data_6CM1
# 
_entry.id   6CM1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CM1         
WWPDB D_1000232930 
BMRB  30426        
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'MT1-MMP HPX Domain with Blade 2 Loop Bound to Nanodiscs' 
_pdbx_database_related.db_id          30426 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        6CM1 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-02 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Marcink, T.C.'   1 0000-0003-4295-1229 
'Van Doren, S.R.' 2 0000-0003-2838-4598 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           1878-4186 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            27 
_citation.language                  ? 
_citation.page_first                281 
_citation.page_last                 292.e6 
_citation.title                     
'MT1-MMP Binds Membranes by Opposite Tips of Its beta Propeller to Position It for Pericellular Proteolysis.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2018.10.008 
_citation.pdbx_database_id_PubMed   30471921 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Marcink, T.C.'   1 ? 
primary 'Simoncic, J.A.'  2 ? 
primary 'An, B.'          3 ? 
primary 'Knapinska, A.M.' 4 ? 
primary 'Fulcher, Y.G.'   5 ? 
primary 'Akkaladevi, N.'  6 ? 
primary 'Fields, G.B.'    7 ? 
primary 'Van Doren, S.R.' 8 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Matrix metalloproteinase-14'               23131.346 1   3.4.24.80 ? 'residues 316-511' ? 
2 polymer     man 'Apolipoprotein A-I'                        24912.156 2   ?         ? 'residues 79-267'  ? 
3 non-polymer syn 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE 678.940   218 ?         ? ?                  ? 
4 non-polymer syn 'SODIUM ION'                                22.990    1   ?         ? ?                  ? 
5 non-polymer syn 'CHLORIDE ION'                              35.453    1   ?         ? ?                  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'MMP-14,MMP-X1,Membrane-type matrix metalloproteinase 1,MTMMP1,Membrane-type-1 matrix metalloproteinase,MT1MMP' 
2 'ApoA-I,Apolipoprotein A1'                                                                                      
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;PNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASL
EPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFT
YFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSG
;
;PNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASL
EPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFT
YFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSG
;
A   ? 
2 'polypeptide(L)' no no 
;STFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPYLDDFQKKWQEEM
ELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEY
HAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
;
;STFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPYLDDFQKKWQEEM
ELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEY
HAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
;
B,C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ASN n 
1 3   ILE n 
1 4   CYS n 
1 5   ASP n 
1 6   GLY n 
1 7   ASN n 
1 8   PHE n 
1 9   ASP n 
1 10  THR n 
1 11  VAL n 
1 12  ALA n 
1 13  MET n 
1 14  LEU n 
1 15  ARG n 
1 16  GLY n 
1 17  GLU n 
1 18  MET n 
1 19  PHE n 
1 20  VAL n 
1 21  PHE n 
1 22  LYS n 
1 23  GLU n 
1 24  ARG n 
1 25  TRP n 
1 26  PHE n 
1 27  TRP n 
1 28  ARG n 
1 29  VAL n 
1 30  ARG n 
1 31  ASN n 
1 32  ASN n 
1 33  GLN n 
1 34  VAL n 
1 35  MET n 
1 36  ASP n 
1 37  GLY n 
1 38  TYR n 
1 39  PRO n 
1 40  MET n 
1 41  PRO n 
1 42  ILE n 
1 43  GLY n 
1 44  GLN n 
1 45  PHE n 
1 46  TRP n 
1 47  ARG n 
1 48  GLY n 
1 49  LEU n 
1 50  PRO n 
1 51  ALA n 
1 52  SER n 
1 53  ILE n 
1 54  ASN n 
1 55  THR n 
1 56  ALA n 
1 57  TYR n 
1 58  GLU n 
1 59  ARG n 
1 60  LYS n 
1 61  ASP n 
1 62  GLY n 
1 63  LYS n 
1 64  PHE n 
1 65  VAL n 
1 66  PHE n 
1 67  PHE n 
1 68  LYS n 
1 69  GLY n 
1 70  ASP n 
1 71  LYS n 
1 72  HIS n 
1 73  TRP n 
1 74  VAL n 
1 75  PHE n 
1 76  ASP n 
1 77  GLU n 
1 78  ALA n 
1 79  SER n 
1 80  LEU n 
1 81  GLU n 
1 82  PRO n 
1 83  GLY n 
1 84  TYR n 
1 85  PRO n 
1 86  LYS n 
1 87  HIS n 
1 88  ILE n 
1 89  LYS n 
1 90  GLU n 
1 91  LEU n 
1 92  GLY n 
1 93  ARG n 
1 94  GLY n 
1 95  LEU n 
1 96  PRO n 
1 97  THR n 
1 98  ASP n 
1 99  LYS n 
1 100 ILE n 
1 101 ASP n 
1 102 ALA n 
1 103 ALA n 
1 104 LEU n 
1 105 PHE n 
1 106 TRP n 
1 107 MET n 
1 108 PRO n 
1 109 ASN n 
1 110 GLY n 
1 111 LYS n 
1 112 THR n 
1 113 TYR n 
1 114 PHE n 
1 115 PHE n 
1 116 ARG n 
1 117 GLY n 
1 118 ASN n 
1 119 LYS n 
1 120 TYR n 
1 121 TYR n 
1 122 ARG n 
1 123 PHE n 
1 124 ASN n 
1 125 GLU n 
1 126 GLU n 
1 127 LEU n 
1 128 ARG n 
1 129 ALA n 
1 130 VAL n 
1 131 ASP n 
1 132 SER n 
1 133 GLU n 
1 134 TYR n 
1 135 PRO n 
1 136 LYS n 
1 137 ASN n 
1 138 ILE n 
1 139 LYS n 
1 140 VAL n 
1 141 TRP n 
1 142 GLU n 
1 143 GLY n 
1 144 ILE n 
1 145 PRO n 
1 146 GLU n 
1 147 SER n 
1 148 PRO n 
1 149 ARG n 
1 150 GLY n 
1 151 SER n 
1 152 PHE n 
1 153 MET n 
1 154 GLY n 
1 155 SER n 
1 156 ASP n 
1 157 GLU n 
1 158 VAL n 
1 159 PHE n 
1 160 THR n 
1 161 TYR n 
1 162 PHE n 
1 163 TYR n 
1 164 LYS n 
1 165 GLY n 
1 166 ASN n 
1 167 LYS n 
1 168 TYR n 
1 169 TRP n 
1 170 LYS n 
1 171 PHE n 
1 172 ASN n 
1 173 ASN n 
1 174 GLN n 
1 175 LYS n 
1 176 LEU n 
1 177 LYS n 
1 178 VAL n 
1 179 GLU n 
1 180 PRO n 
1 181 GLY n 
1 182 TYR n 
1 183 PRO n 
1 184 LYS n 
1 185 SER n 
1 186 ALA n 
1 187 LEU n 
1 188 ARG n 
1 189 ASP n 
1 190 TRP n 
1 191 MET n 
1 192 GLY n 
1 193 CYS n 
1 194 PRO n 
1 195 SER n 
1 196 GLY n 
2 1   SER n 
2 2   THR n 
2 3   PHE n 
2 4   SER n 
2 5   LYS n 
2 6   LEU n 
2 7   ARG n 
2 8   GLU n 
2 9   GLN n 
2 10  LEU n 
2 11  GLY n 
2 12  PRO n 
2 13  VAL n 
2 14  THR n 
2 15  GLN n 
2 16  GLU n 
2 17  PHE n 
2 18  TRP n 
2 19  ASP n 
2 20  ASN n 
2 21  LEU n 
2 22  GLU n 
2 23  LYS n 
2 24  GLU n 
2 25  THR n 
2 26  GLU n 
2 27  GLY n 
2 28  LEU n 
2 29  ARG n 
2 30  GLN n 
2 31  GLU n 
2 32  MET n 
2 33  SER n 
2 34  LYS n 
2 35  ASP n 
2 36  LEU n 
2 37  GLU n 
2 38  GLU n 
2 39  VAL n 
2 40  LYS n 
2 41  ALA n 
2 42  LYS n 
2 43  VAL n 
2 44  GLN n 
2 45  PRO n 
2 46  TYR n 
2 47  LEU n 
2 48  ASP n 
2 49  ASP n 
2 50  PHE n 
2 51  GLN n 
2 52  LYS n 
2 53  LYS n 
2 54  TRP n 
2 55  GLN n 
2 56  GLU n 
2 57  GLU n 
2 58  MET n 
2 59  GLU n 
2 60  LEU n 
2 61  TYR n 
2 62  ARG n 
2 63  GLN n 
2 64  LYS n 
2 65  VAL n 
2 66  GLU n 
2 67  PRO n 
2 68  TYR n 
2 69  LEU n 
2 70  ASP n 
2 71  ASP n 
2 72  PHE n 
2 73  GLN n 
2 74  LYS n 
2 75  LYS n 
2 76  TRP n 
2 77  GLN n 
2 78  GLU n 
2 79  GLU n 
2 80  MET n 
2 81  GLU n 
2 82  LEU n 
2 83  TYR n 
2 84  ARG n 
2 85  GLN n 
2 86  LYS n 
2 87  VAL n 
2 88  GLU n 
2 89  PRO n 
2 90  LEU n 
2 91  ARG n 
2 92  ALA n 
2 93  GLU n 
2 94  LEU n 
2 95  GLN n 
2 96  GLU n 
2 97  GLY n 
2 98  ALA n 
2 99  ARG n 
2 100 GLN n 
2 101 LYS n 
2 102 LEU n 
2 103 HIS n 
2 104 GLU n 
2 105 LEU n 
2 106 GLN n 
2 107 GLU n 
2 108 LYS n 
2 109 LEU n 
2 110 SER n 
2 111 PRO n 
2 112 LEU n 
2 113 GLY n 
2 114 GLU n 
2 115 GLU n 
2 116 MET n 
2 117 ARG n 
2 118 ASP n 
2 119 ARG n 
2 120 ALA n 
2 121 ARG n 
2 122 ALA n 
2 123 HIS n 
2 124 VAL n 
2 125 ASP n 
2 126 ALA n 
2 127 LEU n 
2 128 ARG n 
2 129 THR n 
2 130 HIS n 
2 131 LEU n 
2 132 ALA n 
2 133 PRO n 
2 134 TYR n 
2 135 SER n 
2 136 ASP n 
2 137 GLU n 
2 138 LEU n 
2 139 ARG n 
2 140 GLN n 
2 141 ARG n 
2 142 LEU n 
2 143 ALA n 
2 144 ALA n 
2 145 ARG n 
2 146 LEU n 
2 147 GLU n 
2 148 ALA n 
2 149 LEU n 
2 150 LYS n 
2 151 GLU n 
2 152 ASN n 
2 153 GLY n 
2 154 GLY n 
2 155 ALA n 
2 156 ARG n 
2 157 LEU n 
2 158 ALA n 
2 159 GLU n 
2 160 TYR n 
2 161 HIS n 
2 162 ALA n 
2 163 LYS n 
2 164 ALA n 
2 165 THR n 
2 166 GLU n 
2 167 HIS n 
2 168 LEU n 
2 169 SER n 
2 170 THR n 
2 171 LEU n 
2 172 SER n 
2 173 GLU n 
2 174 LYS n 
2 175 ALA n 
2 176 LYS n 
2 177 PRO n 
2 178 ALA n 
2 179 LEU n 
2 180 GLU n 
2 181 ASP n 
2 182 LEU n 
2 183 ARG n 
2 184 GLN n 
2 185 GLY n 
2 186 LEU n 
2 187 LEU n 
2 188 PRO n 
2 189 VAL n 
2 190 LEU n 
2 191 GLU n 
2 192 SER n 
2 193 PHE n 
2 194 LYS n 
2 195 VAL n 
2 196 SER n 
2 197 PHE n 
2 198 LEU n 
2 199 SER n 
2 200 ALA n 
2 201 LEU n 
2 202 GLU n 
2 203 GLU n 
2 204 TYR n 
2 205 THR n 
2 206 LYS n 
2 207 LYS n 
2 208 LEU n 
2 209 ASN n 
2 210 THR n 
2 211 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 196 Human ? MMP14 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 211 Human ? APOA1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MMP14_HUMAN P50281 ? 1 
;PNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASL
EPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFT
YFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSG
;
316 
2 UNP APOA1_HUMAN P02647 ? 2 
;STFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKL
HELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDL
RQGLLPVLESFKVSFLSALEEYTKKLNTQ
;
79  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6CM1 A 1 ? 196 ? P50281 316 ? 511 ? 316 511 
2 2 6CM1 B 1 ? 211 ? P02647 79  ? 267 ? 55  265 
3 2 6CM1 C 1 ? 211 ? P02647 79  ? 267 ? 55  265 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 6CM1 PRO B 45 ? UNP P02647 ? ? insertion 99  1  
2 6CM1 TYR B 46 ? UNP P02647 ? ? insertion 100 2  
2 6CM1 LEU B 47 ? UNP P02647 ? ? insertion 101 3  
2 6CM1 ASP B 48 ? UNP P02647 ? ? insertion 102 4  
2 6CM1 ASP B 49 ? UNP P02647 ? ? insertion 103 5  
2 6CM1 PHE B 50 ? UNP P02647 ? ? insertion 104 6  
2 6CM1 GLN B 51 ? UNP P02647 ? ? insertion 105 7  
2 6CM1 LYS B 52 ? UNP P02647 ? ? insertion 106 8  
2 6CM1 LYS B 53 ? UNP P02647 ? ? insertion 107 9  
2 6CM1 TRP B 54 ? UNP P02647 ? ? insertion 108 10 
2 6CM1 GLN B 55 ? UNP P02647 ? ? insertion 109 11 
2 6CM1 GLU B 56 ? UNP P02647 ? ? insertion 110 12 
2 6CM1 GLU B 57 ? UNP P02647 ? ? insertion 111 13 
2 6CM1 MET B 58 ? UNP P02647 ? ? insertion 112 14 
2 6CM1 GLU B 59 ? UNP P02647 ? ? insertion 113 15 
2 6CM1 LEU B 60 ? UNP P02647 ? ? insertion 114 16 
2 6CM1 TYR B 61 ? UNP P02647 ? ? insertion 115 17 
2 6CM1 ARG B 62 ? UNP P02647 ? ? insertion 116 18 
2 6CM1 GLN B 63 ? UNP P02647 ? ? insertion 117 19 
2 6CM1 LYS B 64 ? UNP P02647 ? ? insertion 118 20 
2 6CM1 VAL B 65 ? UNP P02647 ? ? insertion 119 21 
2 6CM1 GLU B 66 ? UNP P02647 ? ? insertion 120 22 
3 6CM1 PRO C 45 ? UNP P02647 ? ? insertion 99  23 
3 6CM1 TYR C 46 ? UNP P02647 ? ? insertion 100 24 
3 6CM1 LEU C 47 ? UNP P02647 ? ? insertion 101 25 
3 6CM1 ASP C 48 ? UNP P02647 ? ? insertion 102 26 
3 6CM1 ASP C 49 ? UNP P02647 ? ? insertion 103 27 
3 6CM1 PHE C 50 ? UNP P02647 ? ? insertion 104 28 
3 6CM1 GLN C 51 ? UNP P02647 ? ? insertion 105 29 
3 6CM1 LYS C 52 ? UNP P02647 ? ? insertion 106 30 
3 6CM1 LYS C 53 ? UNP P02647 ? ? insertion 107 31 
3 6CM1 TRP C 54 ? UNP P02647 ? ? insertion 108 32 
3 6CM1 GLN C 55 ? UNP P02647 ? ? insertion 109 33 
3 6CM1 GLU C 56 ? UNP P02647 ? ? insertion 110 34 
3 6CM1 GLU C 57 ? UNP P02647 ? ? insertion 111 35 
3 6CM1 MET C 58 ? UNP P02647 ? ? insertion 112 36 
3 6CM1 GLU C 59 ? UNP P02647 ? ? insertion 113 37 
3 6CM1 LEU C 60 ? UNP P02647 ? ? insertion 114 38 
3 6CM1 TYR C 61 ? UNP P02647 ? ? insertion 115 39 
3 6CM1 ARG C 62 ? UNP P02647 ? ? insertion 116 40 
3 6CM1 GLN C 63 ? UNP P02647 ? ? insertion 117 41 
3 6CM1 LYS C 64 ? UNP P02647 ? ? insertion 118 42 
3 6CM1 VAL C 65 ? UNP P02647 ? ? insertion 119 43 
3 6CM1 GLU C 66 ? UNP P02647 ? ? insertion 120 44 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                     ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                    ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ? 'C4 H7 N O4'       133.103 
CL  non-polymer         . 'CHLORIDE ION'                              ? 'Cl -1'            35.453  
CYS 'L-peptide linking' y CYSTEINE                                    ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                   ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                     ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ? 'C6 H10 N3 O2 1'   156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                  ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                     ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                      ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                  ? 'C5 H11 N O2 S'    149.211 
NA  non-polymer         . 'SODIUM ION'                                ? 'Na 1'             22.990  
PHE 'L-peptide linking' y PHENYLALANINE                               ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                     ? 'C5 H9 N O2'       115.130 
PX4 non-polymer         . 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE ? 'C36 H73 N O8 P 1' 678.940 
SER 'L-peptide linking' y SERINE                                      ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                   ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                  ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                    ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                      ? 'C5 H11 N O2'      117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1 1 1 HMQC      1 isotropic 
2 1 1 TROSY     1 isotropic 
3 1 1 CPMG-HMQC 1 isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            303 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7.2 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         300 
_pdbx_nmr_exptl_sample_conditions.details                
;MT1-MMP hemopexin-like domain along with the MSP1D1 and PX4 complex were suspended in a buffer containing 300 mM NaCl, 0.02% sodium azide, 93% water, 7% D2O, and 20 mM Tris pH 7.2
;
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  'NMR Buffer' 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;20 mM Tri-HCl, 300 mM NaCl, 0.02 % sodium azide, 93 % H2O, 7 % [U-100% 2H] D2O, 90 uM 2H, 13C, 15N MT1-MMP hemopexin-like domain, 180 uM MSP1D1, 14.4 mM PX4, 93% H2O/7% D2O
;
_pdbx_nmr_sample_details.solvent_system   '93% H2O/7% D2O' 
_pdbx_nmr_sample_details.label            '2H, 13C, 15N' 
_pdbx_nmr_sample_details.type             solution 
_pdbx_nmr_sample_details.details          
'300 mM NaCl was used to reduce affinity of the HPX domain to the nanodisc. NMR shaped tubes were used to obtain a better spectra' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             'AVANCE III' 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.details           ? 
# 
_pdbx_nmr_refine.entry_id           6CM1 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   4 
# 
_pdbx_nmr_ensemble.entry_id                                      6CM1 
_pdbx_nmr_ensemble.conformers_calculated_total_number            15 
_pdbx_nmr_ensemble.conformers_submitted_total_number             15 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'all calculated structures submitted' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             6CM1 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 processing              TopSpin  3.2                                'Bruker Biospin' 
2 'data analysis'         Analysis 2.4                                CCPN 
3 'structure calculation' HADDOCK  HADDOCK2.1                         Bonvin 
4 refinement              NAMD     'NAMD2.1 with CUDA GPU processing' 
;Theoretical and Computational Biophysics Group in the Beckman Institute for Advanced Science and Technology at the University of Illinois at Urbana-Champaign
;
5 'structure calculation' NAMD     'NAMD2.1 with CUDA GPU processing' 
;Theoretical and Computational Biophysics Group in the Beckman Institute for Advanced Science and Technology at the University of Illinois at Urbana-Champaign
;
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CM1 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6CM1 
_struct.title                        'MT1-MMP HPX Domain with Blade 2 Loop Bound to Nanodiscs' 
_struct.pdbx_descriptor              'Matrix metalloproteinase-14 (E.C.3.4.24.80), Apolipoprotein A-I' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CM1 
_struct_keywords.text            
'MT1-MMP, MMP-14, Nanodisc, lipids, peripheral membrane protein, protease domain, LIPID BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'LIPID BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 3 ? 
F  N N 3 ? 
G  N N 3 ? 
H  N N 3 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 3 ? 
L  N N 3 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 3 ? 
KA N N 3 ? 
LA N N 3 ? 
MA N N 3 ? 
NA N N 3 ? 
OA N N 3 ? 
PA N N 3 ? 
QA N N 3 ? 
RA N N 3 ? 
SA N N 3 ? 
TA N N 3 ? 
UA N N 3 ? 
VA N N 3 ? 
WA N N 3 ? 
XA N N 3 ? 
YA N N 3 ? 
ZA N N 3 ? 
AB N N 3 ? 
BB N N 3 ? 
CB N N 3 ? 
DB N N 3 ? 
EB N N 3 ? 
FB N N 4 ? 
GB N N 5 ? 
HB N N 3 ? 
IB N N 3 ? 
JB N N 3 ? 
KB N N 3 ? 
LB N N 3 ? 
MB N N 3 ? 
NB N N 3 ? 
OB N N 3 ? 
PB N N 3 ? 
QB N N 3 ? 
RB N N 3 ? 
SB N N 3 ? 
TB N N 3 ? 
UB N N 3 ? 
VB N N 3 ? 
WB N N 3 ? 
XB N N 3 ? 
YB N N 3 ? 
ZB N N 3 ? 
AC N N 3 ? 
BC N N 3 ? 
CC N N 3 ? 
DC N N 3 ? 
EC N N 3 ? 
FC N N 3 ? 
GC N N 3 ? 
HC N N 3 ? 
IC N N 3 ? 
JC N N 3 ? 
KC N N 3 ? 
LC N N 3 ? 
MC N N 3 ? 
NC N N 3 ? 
OC N N 3 ? 
PC N N 3 ? 
QC N N 3 ? 
RC N N 3 ? 
SC N N 3 ? 
TC N N 3 ? 
UC N N 3 ? 
VC N N 3 ? 
WC N N 3 ? 
XC N N 3 ? 
YC N N 3 ? 
ZC N N 3 ? 
AD N N 3 ? 
BD N N 3 ? 
CD N N 3 ? 
DD N N 3 ? 
ED N N 3 ? 
FD N N 3 ? 
GD N N 3 ? 
HD N N 3 ? 
ID N N 3 ? 
JD N N 3 ? 
KD N N 3 ? 
LD N N 3 ? 
MD N N 3 ? 
ND N N 3 ? 
OD N N 3 ? 
PD N N 3 ? 
QD N N 3 ? 
RD N N 3 ? 
SD N N 3 ? 
TD N N 3 ? 
UD N N 3 ? 
VD N N 3 ? 
WD N N 3 ? 
XD N N 3 ? 
YD N N 3 ? 
ZD N N 3 ? 
AE N N 3 ? 
BE N N 3 ? 
CE N N 3 ? 
DE N N 3 ? 
EE N N 3 ? 
FE N N 3 ? 
GE N N 3 ? 
HE N N 3 ? 
IE N N 3 ? 
JE N N 3 ? 
KE N N 3 ? 
LE N N 3 ? 
ME N N 3 ? 
NE N N 3 ? 
OE N N 3 ? 
PE N N 3 ? 
QE N N 3 ? 
RE N N 3 ? 
SE N N 3 ? 
TE N N 3 ? 
UE N N 3 ? 
VE N N 3 ? 
WE N N 3 ? 
XE N N 3 ? 
YE N N 3 ? 
ZE N N 3 ? 
AF N N 3 ? 
BF N N 3 ? 
CF N N 3 ? 
DF N N 3 ? 
EF N N 3 ? 
FF N N 3 ? 
GF N N 3 ? 
HF N N 3 ? 
IF N N 3 ? 
JF N N 3 ? 
KF N N 3 ? 
LF N N 3 ? 
MF N N 3 ? 
NF N N 3 ? 
OF N N 3 ? 
PF N N 3 ? 
QF N N 3 ? 
RF N N 3 ? 
SF N N 3 ? 
TF N N 3 ? 
UF N N 3 ? 
VF N N 3 ? 
WF N N 3 ? 
XF N N 3 ? 
YF N N 3 ? 
ZF N N 3 ? 
AG N N 3 ? 
BG N N 3 ? 
CG N N 3 ? 
DG N N 3 ? 
EG N N 3 ? 
FG N N 3 ? 
GG N N 3 ? 
HG N N 3 ? 
IG N N 3 ? 
JG N N 3 ? 
KG N N 3 ? 
LG N N 3 ? 
MG N N 3 ? 
NG N N 3 ? 
OG N N 3 ? 
PG N N 3 ? 
QG N N 3 ? 
RG N N 3 ? 
SG N N 3 ? 
TG N N 3 ? 
UG N N 3 ? 
VG N N 3 ? 
WG N N 3 ? 
XG N N 3 ? 
YG N N 3 ? 
ZG N N 3 ? 
AH N N 3 ? 
BH N N 3 ? 
CH N N 3 ? 
DH N N 3 ? 
EH N N 3 ? 
FH N N 3 ? 
GH N N 3 ? 
HH N N 3 ? 
IH N N 3 ? 
JH N N 3 ? 
KH N N 3 ? 
LH N N 3 ? 
MH N N 3 ? 
NH N N 3 ? 
OH N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 2   ? GLY A 6   ? ASN A 317 GLY A 321 5 ? 5   
HELX_P HELX_P2  AA2 ILE A 42  ? TRP A 46  ? ILE A 357 TRP A 361 1 ? 5   
HELX_P HELX_P3  AA3 LYS A 89  ? LEU A 91  ? LYS A 404 LEU A 406 5 ? 3   
HELX_P HELX_P4  AA4 LYS A 139 ? TRP A 141 ? LYS A 454 TRP A 456 5 ? 3   
HELX_P HELX_P5  AA5 ALA A 186 ? TRP A 190 ? ALA A 501 TRP A 505 1 ? 5   
HELX_P HELX_P6  AA6 THR B 2   ? LEU B 10  ? THR B 56  LEU B 64  1 ? 9   
HELX_P HELX_P7  AA7 LEU B 10  ? GLU B 115 ? LEU B 64  GLU B 169 1 ? 106 
HELX_P HELX_P8  AA8 ASP B 118 ? GLN B 211 ? ASP B 172 GLN B 265 1 ? 94  
HELX_P HELX_P9  AA9 THR C 2   ? GLN C 44  ? THR C 56  GLN C 98  1 ? 43  
HELX_P HELX_P10 AB1 TYR C 46  ? GLN C 51  ? TYR C 100 GLN C 105 1 ? 6   
HELX_P HELX_P11 AB2 LYS C 52  ? VAL C 65  ? LYS C 106 VAL C 119 1 ? 14  
HELX_P HELX_P12 AB3 VAL C 65  ? THR C 170 ? VAL C 119 THR C 224 1 ? 106 
HELX_P HELX_P13 AB4 THR C 170 ? ALA C 175 ? THR C 224 ALA C 229 1 ? 6   
HELX_P HELX_P14 AB5 ALA C 175 ? THR C 205 ? ALA C 229 THR C 259 1 ? 31  
HELX_P HELX_P15 AB6 LYS C 207 ? GLN C 211 ? LYS C 261 GLN C 265 5 ? 5   
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A ASN 54  O   ? ? ? 1_555 FB NA . NA ? ? A ASN 369 A NA 655 1_555 ? ? ? ? ? ? ? 2.367 ? 
metalc2 metalc ? ? A THR 55  OG1 ? ? ? 1_555 FB NA . NA ? ? A THR 370 A NA 655 1_555 ? ? ? ? ? ? ? 2.919 ? 
metalc3 metalc ? ? A ASP 101 O   ? ? ? 1_555 FB NA . NA ? ? A ASP 416 A NA 655 1_555 ? ? ? ? ? ? ? 2.551 ? 
metalc4 metalc ? ? A ARG 149 O   ? ? ? 1_555 FB NA . NA ? ? A ARG 464 A NA 655 1_555 ? ? ? ? ? ? ? 2.439 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 1  -3.01  
2  TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 1  -1.18  
3  TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 1  -16.16 
4  TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 1  -17.16 
5  TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 2  -10.32 
6  TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 2  -16.70 
7  TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 2  7.54   
8  TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 2  -15.74 
9  TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 3  4.08   
10 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 3  -9.54  
11 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 3  -3.22  
12 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 3  -0.76  
13 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 4  -13.00 
14 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 4  11.44  
15 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 4  0.13   
16 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 4  -3.11  
17 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 5  12.62  
18 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 5  13.14  
19 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 5  -9.99  
20 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 5  -17.33 
21 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 6  6.89   
22 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 6  -20.25 
23 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 6  -10.09 
24 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 6  -16.69 
25 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 7  -2.81  
26 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 7  -13.20 
27 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 7  -7.09  
28 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 7  14.56  
29 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 8  12.96  
30 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 8  0.29   
31 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 8  -9.06  
32 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 8  -18.08 
33 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 9  -5.19  
34 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 9  -14.93 
35 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 9  5.12   
36 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 9  6.48   
37 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 10 7.88   
38 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 10 6.64   
39 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 10 -6.76  
40 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 10 1.42   
41 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 11 -4.23  
42 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 11 -3.23  
43 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 11 -3.16  
44 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 11 -17.61 
45 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 12 -14.88 
46 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 12 16.75  
47 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 12 -17.64 
48 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 12 -10.25 
49 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 13 0.45   
50 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 13 6.42   
51 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 13 -7.61  
52 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 13 10.98  
53 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 14 -11.15 
54 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 14 -15.35 
55 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 14 7.66   
56 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 14 14.65  
57 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 15 -17.05 
58 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 15 -18.38 
59 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 15 -17.21 
60 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 15 11.62  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 10  ? LEU A 14  ? THR A 325 LEU A 329 
AA1 2 GLU A 17  ? LYS A 22  ? GLU A 332 LYS A 337 
AA1 3 TRP A 25  ? VAL A 29  ? TRP A 340 VAL A 344 
AA1 4 MET A 40  ? PRO A 41  ? MET A 355 PRO A 356 
AA2 1 THR A 55  ? GLU A 58  ? THR A 370 GLU A 373 
AA2 2 PHE A 64  ? LYS A 68  ? PHE A 379 LYS A 383 
AA2 3 LYS A 71  ? PHE A 75  ? LYS A 386 PHE A 390 
AA2 4 LYS A 86  ? HIS A 87  ? LYS A 401 HIS A 402 
AA3 1 ALA A 102 ? PHE A 105 ? ALA A 417 PHE A 420 
AA3 2 THR A 112 ? ARG A 116 ? THR A 427 ARG A 431 
AA3 3 LYS A 119 ? ASN A 124 ? LYS A 434 ASN A 439 
AA3 4 ALA A 129 ? VAL A 130 ? ALA A 444 VAL A 445 
AA4 1 ALA A 102 ? PHE A 105 ? ALA A 417 PHE A 420 
AA4 2 THR A 112 ? ARG A 116 ? THR A 427 ARG A 431 
AA4 3 LYS A 119 ? ASN A 124 ? LYS A 434 ASN A 439 
AA4 4 LYS A 136 ? ASN A 137 ? LYS A 451 ASN A 452 
AA5 1 GLY A 150 ? MET A 153 ? GLY A 465 MET A 468 
AA5 2 PHE A 159 ? LYS A 164 ? PHE A 474 LYS A 479 
AA5 3 LYS A 167 ? ASN A 172 ? LYS A 482 ASN A 487 
AA5 4 LYS A 184 ? SER A 185 ? LYS A 499 SER A 500 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR A 10  ? N THR A 325 O PHE A 21  ? O PHE A 336 
AA1 2 3 N MET A 18  ? N MET A 333 O VAL A 29  ? O VAL A 344 
AA1 3 4 N PHE A 26  ? N PHE A 341 O MET A 40  ? O MET A 355 
AA2 1 2 N TYR A 57  ? N TYR A 372 O VAL A 65  ? O VAL A 380 
AA2 2 3 N PHE A 66  ? N PHE A 381 O TRP A 73  ? O TRP A 388 
AA2 3 4 N HIS A 72  ? N HIS A 387 O LYS A 86  ? O LYS A 401 
AA3 1 2 N LEU A 104 ? N LEU A 419 O TYR A 113 ? O TYR A 428 
AA3 2 3 N THR A 112 ? N THR A 427 O PHE A 123 ? O PHE A 438 
AA3 3 4 N ASN A 124 ? N ASN A 439 O ALA A 129 ? O ALA A 444 
AA4 1 2 N LEU A 104 ? N LEU A 419 O TYR A 113 ? O TYR A 428 
AA4 2 3 N THR A 112 ? N THR A 427 O PHE A 123 ? O PHE A 438 
AA4 3 4 N TYR A 120 ? N TYR A 435 O LYS A 136 ? O LYS A 451 
AA5 1 2 N PHE A 152 ? N PHE A 467 O TYR A 161 ? O TYR A 476 
AA5 2 3 N THR A 160 ? N THR A 475 O PHE A 171 ? O PHE A 486 
AA5 3 4 N TYR A 168 ? N TYR A 483 O LYS A 184 ? O LYS A 499 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PX4 601 ? 3 'binding site for residue PX4 A 601' 
AC2 Software A PX4 602 ? 4 'binding site for residue PX4 A 602' 
AC3 Software A PX4 603 ? 4 'binding site for residue PX4 A 603' 
AC4 Software A PX4 604 ? 5 'binding site for residue PX4 A 604' 
AC5 Software A PX4 605 ? 4 'binding site for residue PX4 A 605' 
AC6 Software A PX4 606 ? 3 'binding site for residue PX4 A 606' 
AC7 Software A PX4 607 ? 4 'binding site for residue PX4 A 607' 
AC8 Software A PX4 608 ? 5 'binding site for residue PX4 A 608' 
AC9 Software A PX4 609 ? 5 'binding site for residue PX4 A 609' 
AD1 Software A PX4 610 ? 7 'binding site for residue PX4 A 610' 
AD2 Software A PX4 611 ? 3 'binding site for residue PX4 A 611' 
AD3 Software A PX4 612 ? 5 'binding site for residue PX4 A 612' 
AD4 Software A PX4 613 ? 6 'binding site for residue PX4 A 613' 
AD5 Software A PX4 614 ? 6 'binding site for residue PX4 A 614' 
AD6 Software A PX4 615 ? 3 'binding site for residue PX4 A 615' 
AD7 Software A PX4 616 ? 5 'binding site for residue PX4 A 616' 
AD8 Software A PX4 617 ? 6 'binding site for residue PX4 A 617' 
AD9 Software A PX4 618 ? 2 'binding site for residue PX4 A 618' 
AE1 Software A PX4 619 ? 4 'binding site for residue PX4 A 619' 
AE2 Software A PX4 620 ? 4 'binding site for residue PX4 A 620' 
AE3 Software A PX4 621 ? 2 'binding site for residue PX4 A 621' 
AE4 Software A PX4 622 ? 3 'binding site for residue PX4 A 622' 
AE5 Software A PX4 623 ? 5 'binding site for residue PX4 A 623' 
AE6 Software A PX4 624 ? 2 'binding site for residue PX4 A 624' 
AE7 Software A PX4 625 ? 4 'binding site for residue PX4 A 625' 
AE8 Software A PX4 626 ? 4 'binding site for residue PX4 A 626' 
AE9 Software A PX4 627 ? 4 'binding site for residue PX4 A 627' 
AF1 Software A PX4 628 ? 6 'binding site for residue PX4 A 628' 
AF2 Software A PX4 629 ? 4 'binding site for residue PX4 A 629' 
AF3 Software A PX4 630 ? 4 'binding site for residue PX4 A 630' 
AF4 Software A PX4 631 ? 7 'binding site for residue PX4 A 631' 
AF5 Software A PX4 632 ? 5 'binding site for residue PX4 A 632' 
AF6 Software A PX4 633 ? 5 'binding site for residue PX4 A 633' 
AF7 Software A PX4 634 ? 5 'binding site for residue PX4 A 634' 
AF8 Software A PX4 635 ? 3 'binding site for residue PX4 A 635' 
AF9 Software A PX4 636 ? 5 'binding site for residue PX4 A 636' 
AG1 Software A PX4 637 ? 7 'binding site for residue PX4 A 637' 
AG2 Software A PX4 638 ? 4 'binding site for residue PX4 A 638' 
AG3 Software A PX4 639 ? 3 'binding site for residue PX4 A 639' 
AG4 Software A PX4 640 ? 5 'binding site for residue PX4 A 640' 
AG5 Software A PX4 641 ? 5 'binding site for residue PX4 A 641' 
AG6 Software A PX4 642 ? 5 'binding site for residue PX4 A 642' 
AG7 Software A PX4 643 ? 4 'binding site for residue PX4 A 643' 
AG8 Software A PX4 644 ? 8 'binding site for residue PX4 A 644' 
AG9 Software A PX4 645 ? 5 'binding site for residue PX4 A 645' 
AH1 Software A PX4 646 ? 5 'binding site for residue PX4 A 646' 
AH2 Software A PX4 647 ? 4 'binding site for residue PX4 A 647' 
AH3 Software A PX4 648 ? 6 'binding site for residue PX4 A 648' 
AH4 Software A PX4 649 ? 6 'binding site for residue PX4 A 649' 
AH5 Software A PX4 650 ? 7 'binding site for residue PX4 A 650' 
AH6 Software A PX4 651 ? 7 'binding site for residue PX4 A 651' 
AH7 Software A PX4 652 ? 9 'binding site for residue PX4 A 652' 
AH8 Software A PX4 653 ? 5 'binding site for residue PX4 A 653' 
AH9 Software A PX4 654 ? 5 'binding site for residue PX4 A 654' 
AI1 Software A NA  655 ? 5 'binding site for residue NA A 655'  
AI2 Software A CL  656 ? 3 'binding site for residue CL A 656'  
AI3 Software B PX4 301 ? 6 'binding site for residue PX4 B 301' 
AI4 Software B PX4 302 ? 3 'binding site for residue PX4 B 302' 
AI5 Software B PX4 303 ? 8 'binding site for residue PX4 B 303' 
AI6 Software B PX4 304 ? 6 'binding site for residue PX4 B 304' 
AI7 Software B PX4 305 ? 7 'binding site for residue PX4 B 305' 
AI8 Software B PX4 306 ? 8 'binding site for residue PX4 B 306' 
AI9 Software B PX4 307 ? 5 'binding site for residue PX4 B 307' 
AJ1 Software B PX4 308 ? 5 'binding site for residue PX4 B 308' 
AJ2 Software B PX4 309 ? 6 'binding site for residue PX4 B 309' 
AJ3 Software B PX4 310 ? 3 'binding site for residue PX4 B 310' 
AJ4 Software B PX4 311 ? 3 'binding site for residue PX4 B 311' 
AJ5 Software B PX4 312 ? 4 'binding site for residue PX4 B 312' 
AJ6 Software B PX4 313 ? 6 'binding site for residue PX4 B 313' 
AJ7 Software B PX4 314 ? 6 'binding site for residue PX4 B 314' 
AJ8 Software B PX4 315 ? 5 'binding site for residue PX4 B 315' 
AJ9 Software B PX4 316 ? 5 'binding site for residue PX4 B 316' 
AK1 Software B PX4 317 ? 4 'binding site for residue PX4 B 317' 
AK2 Software B PX4 318 ? 6 'binding site for residue PX4 B 318' 
AK3 Software B PX4 319 ? 3 'binding site for residue PX4 B 319' 
AK4 Software B PX4 320 ? 3 'binding site for residue PX4 B 320' 
AK5 Software B PX4 321 ? 6 'binding site for residue PX4 B 321' 
AK6 Software B PX4 322 ? 4 'binding site for residue PX4 B 322' 
AK7 Software B PX4 323 ? 7 'binding site for residue PX4 B 323' 
AK8 Software B PX4 324 ? 4 'binding site for residue PX4 B 324' 
AK9 Software B PX4 325 ? 6 'binding site for residue PX4 B 325' 
AL1 Software B PX4 326 ? 5 'binding site for residue PX4 B 326' 
AL2 Software B PX4 327 ? 7 'binding site for residue PX4 B 327' 
AL3 Software B PX4 328 ? 7 'binding site for residue PX4 B 328' 
AL4 Software B PX4 329 ? 3 'binding site for residue PX4 B 329' 
AL5 Software B PX4 330 ? 5 'binding site for residue PX4 B 330' 
AL6 Software B PX4 331 ? 5 'binding site for residue PX4 B 331' 
AL7 Software B PX4 332 ? 8 'binding site for residue PX4 B 332' 
AL8 Software B PX4 333 ? 4 'binding site for residue PX4 B 333' 
AL9 Software B PX4 334 ? 6 'binding site for residue PX4 B 334' 
AM1 Software B PX4 335 ? 3 'binding site for residue PX4 B 335' 
AM2 Software B PX4 336 ? 3 'binding site for residue PX4 B 336' 
AM3 Software B PX4 337 ? 4 'binding site for residue PX4 B 337' 
AM4 Software B PX4 338 ? 2 'binding site for residue PX4 B 338' 
AM5 Software B PX4 339 ? 6 'binding site for residue PX4 B 339' 
AM6 Software B PX4 340 ? 5 'binding site for residue PX4 B 340' 
AM7 Software B PX4 341 ? 5 'binding site for residue PX4 B 341' 
AM8 Software B PX4 342 ? 4 'binding site for residue PX4 B 342' 
AM9 Software B PX4 343 ? 4 'binding site for residue PX4 B 343' 
AN1 Software B PX4 344 ? 5 'binding site for residue PX4 B 344' 
AN2 Software B PX4 345 ? 4 'binding site for residue PX4 B 345' 
AN3 Software B PX4 346 ? 4 'binding site for residue PX4 B 346' 
AN4 Software B PX4 347 ? 4 'binding site for residue PX4 B 347' 
AN5 Software B PX4 348 ? 5 'binding site for residue PX4 B 348' 
AN6 Software B PX4 349 ? 2 'binding site for residue PX4 B 349' 
AN7 Software B PX4 350 ? 6 'binding site for residue PX4 B 350' 
AN8 Software B PX4 351 ? 5 'binding site for residue PX4 B 351' 
AN9 Software B PX4 352 ? 6 'binding site for residue PX4 B 352' 
AO1 Software B PX4 353 ? 6 'binding site for residue PX4 B 353' 
AO2 Software B PX4 354 ? 6 'binding site for residue PX4 B 354' 
AO3 Software B PX4 355 ? 5 'binding site for residue PX4 B 355' 
AO4 Software B PX4 356 ? 3 'binding site for residue PX4 B 356' 
AO5 Software B PX4 357 ? 4 'binding site for residue PX4 B 357' 
AO6 Software B PX4 358 ? 3 'binding site for residue PX4 B 358' 
AO7 Software B PX4 359 ? 4 'binding site for residue PX4 B 359' 
AO8 Software B PX4 360 ? 6 'binding site for residue PX4 B 360' 
AO9 Software B PX4 361 ? 2 'binding site for residue PX4 B 361' 
AP1 Software B PX4 362 ? 8 'binding site for residue PX4 B 362' 
AP2 Software B PX4 363 ? 6 'binding site for residue PX4 B 363' 
AP3 Software B PX4 364 ? 5 'binding site for residue PX4 B 364' 
AP4 Software B PX4 365 ? 6 'binding site for residue PX4 B 365' 
AP5 Software B PX4 366 ? 2 'binding site for residue PX4 B 366' 
AP6 Software B PX4 367 ? 5 'binding site for residue PX4 B 367' 
AP7 Software B PX4 368 ? 5 'binding site for residue PX4 B 368' 
AP8 Software B PX4 369 ? 7 'binding site for residue PX4 B 369' 
AP9 Software B PX4 370 ? 4 'binding site for residue PX4 B 370' 
AQ1 Software B PX4 371 ? 3 'binding site for residue PX4 B 371' 
AQ2 Software B PX4 372 ? 6 'binding site for residue PX4 B 372' 
AQ3 Software B PX4 373 ? 6 'binding site for residue PX4 B 373' 
AQ4 Software B PX4 374 ? 5 'binding site for residue PX4 B 374' 
AQ5 Software B PX4 375 ? 4 'binding site for residue PX4 B 375' 
AQ6 Software B PX4 376 ? 4 'binding site for residue PX4 B 376' 
AQ7 Software B PX4 377 ? 3 'binding site for residue PX4 B 377' 
AQ8 Software B PX4 378 ? 5 'binding site for residue PX4 B 378' 
AQ9 Software B PX4 379 ? 7 'binding site for residue PX4 B 379' 
AR1 Software B PX4 380 ? 4 'binding site for residue PX4 B 380' 
AR2 Software B PX4 381 ? 4 'binding site for residue PX4 B 381' 
AR3 Software B PX4 382 ? 7 'binding site for residue PX4 B 382' 
AR4 Software B PX4 383 ? 4 'binding site for residue PX4 B 383' 
AR5 Software B PX4 384 ? 5 'binding site for residue PX4 B 384' 
AR6 Software B PX4 385 ? 5 'binding site for residue PX4 B 385' 
AR7 Software B PX4 386 ? 3 'binding site for residue PX4 B 386' 
AR8 Software B PX4 387 ? 5 'binding site for residue PX4 B 387' 
AR9 Software B PX4 388 ? 5 'binding site for residue PX4 B 388' 
AS1 Software B PX4 389 ? 5 'binding site for residue PX4 B 389' 
AS2 Software B PX4 390 ? 6 'binding site for residue PX4 B 390' 
AS3 Software B PX4 391 ? 4 'binding site for residue PX4 B 391' 
AS4 Software B PX4 392 ? 5 'binding site for residue PX4 B 392' 
AS5 Software B PX4 393 ? 4 'binding site for residue PX4 B 393' 
AS6 Software B PX4 394 ? 6 'binding site for residue PX4 B 394' 
AS7 Software B PX4 395 ? 2 'binding site for residue PX4 B 395' 
AS8 Software B PX4 396 ? 3 'binding site for residue PX4 B 396' 
AS9 Software B PX4 397 ? 5 'binding site for residue PX4 B 397' 
AT1 Software B PX4 398 ? 6 'binding site for residue PX4 B 398' 
AT2 Software B PX4 399 ? 3 'binding site for residue PX4 B 399' 
AT3 Software B PX4 400 ? 4 'binding site for residue PX4 B 400' 
AT4 Software C PX4 301 ? 4 'binding site for residue PX4 C 301' 
AT5 Software C PX4 302 ? 5 'binding site for residue PX4 C 302' 
AT6 Software C PX4 303 ? 3 'binding site for residue PX4 C 303' 
AT7 Software C PX4 304 ? 3 'binding site for residue PX4 C 304' 
AT8 Software C PX4 305 ? 7 'binding site for residue PX4 C 305' 
AT9 Software C PX4 306 ? 6 'binding site for residue PX4 C 306' 
AU1 Software C PX4 307 ? 7 'binding site for residue PX4 C 307' 
AU2 Software C PX4 308 ? 4 'binding site for residue PX4 C 308' 
AU3 Software C PX4 309 ? 4 'binding site for residue PX4 C 309' 
AU4 Software C PX4 310 ? 8 'binding site for residue PX4 C 310' 
AU5 Software C PX4 311 ? 5 'binding site for residue PX4 C 311' 
AU6 Software C PX4 312 ? 5 'binding site for residue PX4 C 312' 
AU7 Software C PX4 313 ? 6 'binding site for residue PX4 C 313' 
AU8 Software C PX4 314 ? 4 'binding site for residue PX4 C 314' 
AU9 Software C PX4 315 ? 5 'binding site for residue PX4 C 315' 
AV1 Software C PX4 316 ? 6 'binding site for residue PX4 C 316' 
AV2 Software C PX4 317 ? 5 'binding site for residue PX4 C 317' 
AV3 Software C PX4 318 ? 7 'binding site for residue PX4 C 318' 
AV4 Software C PX4 319 ? 7 'binding site for residue PX4 C 319' 
AV5 Software C PX4 320 ? 7 'binding site for residue PX4 C 320' 
AV6 Software C PX4 321 ? 5 'binding site for residue PX4 C 321' 
AV7 Software C PX4 322 ? 5 'binding site for residue PX4 C 322' 
AV8 Software C PX4 323 ? 6 'binding site for residue PX4 C 323' 
AV9 Software C PX4 324 ? 7 'binding site for residue PX4 C 324' 
AW1 Software C PX4 325 ? 6 'binding site for residue PX4 C 325' 
AW2 Software C PX4 326 ? 6 'binding site for residue PX4 C 326' 
AW3 Software C PX4 327 ? 3 'binding site for residue PX4 C 327' 
AW4 Software C PX4 328 ? 5 'binding site for residue PX4 C 328' 
AW5 Software C PX4 329 ? 7 'binding site for residue PX4 C 329' 
AW6 Software C PX4 330 ? 5 'binding site for residue PX4 C 330' 
AW7 Software C PX4 331 ? 6 'binding site for residue PX4 C 331' 
AW8 Software C PX4 332 ? 3 'binding site for residue PX4 C 332' 
AW9 Software C PX4 333 ? 5 'binding site for residue PX4 C 333' 
AX1 Software C PX4 334 ? 8 'binding site for residue PX4 C 334' 
AX2 Software C PX4 335 ? 6 'binding site for residue PX4 C 335' 
AX3 Software C PX4 336 ? 4 'binding site for residue PX4 C 336' 
AX4 Software C PX4 337 ? 6 'binding site for residue PX4 C 337' 
AX5 Software C PX4 338 ? 6 'binding site for residue PX4 C 338' 
AX6 Software C PX4 339 ? 5 'binding site for residue PX4 C 339' 
AX7 Software C PX4 340 ? 6 'binding site for residue PX4 C 340' 
AX8 Software C PX4 341 ? 3 'binding site for residue PX4 C 341' 
AX9 Software C PX4 342 ? 4 'binding site for residue PX4 C 342' 
AY1 Software C PX4 343 ? 6 'binding site for residue PX4 C 343' 
AY2 Software C PX4 344 ? 5 'binding site for residue PX4 C 344' 
AY3 Software C PX4 345 ? 2 'binding site for residue PX4 C 345' 
AY4 Software C PX4 346 ? 7 'binding site for residue PX4 C 346' 
AY5 Software C PX4 347 ? 4 'binding site for residue PX4 C 347' 
AY6 Software C PX4 348 ? 5 'binding site for residue PX4 C 348' 
AY7 Software C PX4 349 ? 4 'binding site for residue PX4 C 349' 
AY8 Software C PX4 350 ? 4 'binding site for residue PX4 C 350' 
AY9 Software C PX4 351 ? 5 'binding site for residue PX4 C 351' 
AZ1 Software C PX4 352 ? 5 'binding site for residue PX4 C 352' 
AZ2 Software C PX4 353 ? 3 'binding site for residue PX4 C 353' 
AZ3 Software C PX4 354 ? 5 'binding site for residue PX4 C 354' 
AZ4 Software C PX4 355 ? 4 'binding site for residue PX4 C 355' 
AZ5 Software C PX4 356 ? 5 'binding site for residue PX4 C 356' 
AZ6 Software C PX4 357 ? 3 'binding site for residue PX4 C 357' 
AZ7 Software C PX4 358 ? 4 'binding site for residue PX4 C 358' 
AZ8 Software C PX4 359 ? 6 'binding site for residue PX4 C 359' 
AZ9 Software C PX4 360 ? 3 'binding site for residue PX4 C 360' 
BC1 Software C PX4 361 ? 3 'binding site for residue PX4 C 361' 
BC2 Software C PX4 362 ? 6 'binding site for residue PX4 C 362' 
BC3 Software C PX4 363 ? 5 'binding site for residue PX4 C 363' 
BC4 Software C PX4 364 ? 3 'binding site for residue PX4 C 364' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 3 PX4 AE .   ? PX4 B 372 . ? 1_555 ? 
2    AC1 3 PX4 FE .   ? PX4 B 377 . ? 1_555 ? 
3    AC1 3 PX4 ME .   ? PX4 B 384 . ? 1_555 ? 
4    AC2 4 PX4 F  .   ? PX4 A 603 . ? 1_555 ? 
5    AC2 4 PX4 G  .   ? PX4 A 604 . ? 1_555 ? 
6    AC2 4 PX4 AE .   ? PX4 B 372 . ? 1_555 ? 
7    AC2 4 PX4 DE .   ? PX4 B 375 . ? 1_555 ? 
8    AC3 4 PX4 E  .   ? PX4 A 602 . ? 1_555 ? 
9    AC3 4 PX4 L  .   ? PX4 A 609 . ? 1_555 ? 
10   AC3 4 PX4 ID .   ? PX4 B 354 . ? 1_555 ? 
11   AC3 4 PX4 ME .   ? PX4 B 384 . ? 1_555 ? 
12   AC4 5 PX4 E  .   ? PX4 A 602 . ? 1_555 ? 
13   AC4 5 PX4 J  .   ? PX4 A 607 . ? 1_555 ? 
14   AC4 5 PX4 EE .   ? PX4 B 376 . ? 1_555 ? 
15   AC4 5 PX4 SE .   ? PX4 B 390 . ? 1_555 ? 
16   AC4 5 PX4 UE .   ? PX4 B 392 . ? 1_555 ? 
17   AC5 4 PX4 L  .   ? PX4 A 609 . ? 1_555 ? 
18   AC5 4 PX4 M  .   ? PX4 A 610 . ? 1_555 ? 
19   AC5 4 PX4 CE .   ? PX4 B 374 . ? 1_555 ? 
20   AC5 4 PX4 HE .   ? PX4 B 379 . ? 1_555 ? 
21   AC6 3 PX4 K  .   ? PX4 A 608 . ? 1_555 ? 
22   AC6 3 PX4 M  .   ? PX4 A 610 . ? 1_555 ? 
23   AC6 3 PX4 EF .   ? PX4 C 302 . ? 1_555 ? 
24   AC7 4 PX4 G  .   ? PX4 A 604 . ? 1_555 ? 
25   AC7 4 PX4 O  .   ? PX4 A 612 . ? 1_555 ? 
26   AC7 4 PX4 UE .   ? PX4 B 392 . ? 1_555 ? 
27   AC7 4 PX4 WE .   ? PX4 B 394 . ? 1_555 ? 
28   AC8 5 PX4 I  .   ? PX4 A 606 . ? 1_555 ? 
29   AC8 5 PX4 N  .   ? PX4 A 611 . ? 1_555 ? 
30   AC8 5 PX4 O  .   ? PX4 A 612 . ? 1_555 ? 
31   AC8 5 PX4 JE .   ? PX4 B 381 . ? 1_555 ? 
32   AC8 5 PX4 RE .   ? PX4 B 389 . ? 1_555 ? 
33   AC9 5 PX4 F  .   ? PX4 A 603 . ? 1_555 ? 
34   AC9 5 PX4 H  .   ? PX4 A 605 . ? 1_555 ? 
35   AC9 5 PX4 M  .   ? PX4 A 610 . ? 1_555 ? 
36   AC9 5 PX4 TA .   ? PX4 A 643 . ? 1_555 ? 
37   AC9 5 PX4 ME .   ? PX4 B 384 . ? 1_555 ? 
38   AD1 7 PX4 H  .   ? PX4 A 605 . ? 1_555 ? 
39   AD1 7 PX4 I  .   ? PX4 A 606 . ? 1_555 ? 
40   AD1 7 PX4 L  .   ? PX4 A 609 . ? 1_555 ? 
41   AD1 7 PX4 O  .   ? PX4 A 612 . ? 1_555 ? 
42   AD1 7 PX4 HE .   ? PX4 B 379 . ? 1_555 ? 
43   AD1 7 PX4 LE .   ? PX4 B 383 . ? 1_555 ? 
44   AD1 7 PX4 RE .   ? PX4 B 389 . ? 1_555 ? 
45   AD2 3 PX4 K  .   ? PX4 A 608 . ? 1_555 ? 
46   AD2 3 PX4 QE .   ? PX4 B 388 . ? 1_555 ? 
47   AD2 3 PX4 WE .   ? PX4 B 394 . ? 1_555 ? 
48   AD3 5 PX4 J  .   ? PX4 A 607 . ? 1_555 ? 
49   AD3 5 PX4 K  .   ? PX4 A 608 . ? 1_555 ? 
50   AD3 5 PX4 M  .   ? PX4 A 610 . ? 1_555 ? 
51   AD3 5 PX4 CB .   ? PX4 A 652 . ? 1_555 ? 
52   AD3 5 PX4 RE .   ? PX4 B 389 . ? 1_555 ? 
53   AD4 6 PX4 Q  .   ? PX4 A 614 . ? 1_555 ? 
54   AD4 6 PX4 R  .   ? PX4 A 615 . ? 1_555 ? 
55   AD4 6 PX4 EA .   ? PX4 A 628 . ? 1_555 ? 
56   AD4 6 PX4 HA .   ? PX4 A 631 . ? 1_555 ? 
57   AD4 6 PX4 OG .   ? PX4 C 338 . ? 1_555 ? 
58   AD4 6 PX4 VG .   ? PX4 C 345 . ? 1_555 ? 
59   AD5 6 PX4 P  .   ? PX4 A 613 . ? 1_555 ? 
60   AD5 6 PX4 EA .   ? PX4 A 628 . ? 1_555 ? 
61   AD5 6 PX4 NE .   ? PX4 B 385 . ? 1_555 ? 
62   AD5 6 PX4 MG .   ? PX4 C 336 . ? 1_555 ? 
63   AD5 6 PX4 AH .   ? PX4 C 350 . ? 1_555 ? 
64   AD5 6 PX4 FH .   ? PX4 C 355 . ? 1_555 ? 
65   AD6 3 PX4 P  .   ? PX4 A 613 . ? 1_555 ? 
66   AD6 3 PX4 FA .   ? PX4 A 629 . ? 1_555 ? 
67   AD6 3 PX4 KH .   ? PX4 C 360 . ? 1_555 ? 
68   AD7 5 PX4 Z  .   ? PX4 A 623 . ? 1_555 ? 
69   AD7 5 PX4 KA .   ? PX4 A 634 . ? 1_555 ? 
70   AD7 5 PX4 NG .   ? PX4 C 337 . ? 1_555 ? 
71   AD7 5 PX4 WG .   ? PX4 C 346 . ? 1_555 ? 
72   AD7 5 PX4 GH .   ? PX4 C 356 . ? 1_555 ? 
73   AD8 6 PX4 BA .   ? PX4 A 625 . ? 1_555 ? 
74   AD8 6 PX4 NA .   ? PX4 A 637 . ? 1_555 ? 
75   AD8 6 PX4 ZA .   ? PX4 A 649 . ? 1_555 ? 
76   AD8 6 PX4 GD .   ? PX4 B 352 . ? 1_555 ? 
77   AD8 6 PX4 PG .   ? PX4 C 339 . ? 1_555 ? 
78   AD8 6 PX4 FH .   ? PX4 C 355 . ? 1_555 ? 
79   AD9 2 PX4 W  .   ? PX4 A 620 . ? 1_555 ? 
80   AD9 2 PX4 JA .   ? PX4 A 633 . ? 1_555 ? 
81   AE1 4 PX4 DA .   ? PX4 A 627 . ? 1_555 ? 
82   AE1 4 PX4 IA .   ? PX4 A 632 . ? 1_555 ? 
83   AE1 4 PX4 YE .   ? PX4 B 396 . ? 1_555 ? 
84   AE1 4 PX4 NH .   ? PX4 C 363 . ? 1_555 ? 
85   AE2 4 PX4 U  .   ? PX4 A 618 . ? 1_555 ? 
86   AE2 4 PX4 MA .   ? PX4 A 636 . ? 1_555 ? 
87   AE2 4 PX4 YG .   ? PX4 C 348 . ? 1_555 ? 
88   AE2 4 PX4 BH .   ? PX4 C 351 . ? 1_555 ? 
89   AE3 2 PX4 FA .   ? PX4 A 629 . ? 1_555 ? 
90   AE3 2 PX4 MA .   ? PX4 A 636 . ? 1_555 ? 
91   AE4 3 PX4 LA .   ? PX4 A 635 . ? 1_555 ? 
92   AE4 3 PX4 PG .   ? PX4 C 339 . ? 1_555 ? 
93   AE4 3 PX4 ZG .   ? PX4 C 349 . ? 1_555 ? 
94   AE5 5 PX4 S  .   ? PX4 A 616 . ? 1_555 ? 
95   AE5 5 PX4 KA .   ? PX4 A 634 . ? 1_555 ? 
96   AE5 5 PX4 AF .   ? PX4 B 398 . ? 1_555 ? 
97   AE5 5 PX4 FG .   ? PX4 C 329 . ? 1_555 ? 
98   AE5 5 PX4 EH .   ? PX4 C 354 . ? 1_555 ? 
99   AE6 2 PX4 PA .   ? PX4 A 639 . ? 1_555 ? 
100  AE6 2 PX4 HH .   ? PX4 C 357 . ? 1_555 ? 
101  AE7 4 PX4 T  .   ? PX4 A 617 . ? 1_555 ? 
102  AE7 4 PX4 NA .   ? PX4 A 637 . ? 1_555 ? 
103  AE7 4 PX4 QD .   ? PX4 B 362 . ? 1_555 ? 
104  AE7 4 PX4 FH .   ? PX4 C 355 . ? 1_555 ? 
105  AE8 4 PX4 OA .   ? PX4 A 638 . ? 1_555 ? 
106  AE8 4 PX4 BE .   ? PX4 B 373 . ? 1_555 ? 
107  AE8 4 PX4 WG .   ? PX4 C 346 . ? 1_555 ? 
108  AE8 4 PX4 MH .   ? PX4 C 362 . ? 1_555 ? 
109  AE9 4 PX4 V  .   ? PX4 A 619 . ? 1_555 ? 
110  AE9 4 PX4 TA .   ? PX4 A 643 . ? 1_555 ? 
111  AE9 4 PX4 IH .   ? PX4 C 358 . ? 1_555 ? 
112  AE9 4 PX4 LH .   ? PX4 C 361 . ? 1_555 ? 
113  AF1 6 PX4 P  .   ? PX4 A 613 . ? 1_555 ? 
114  AF1 6 PX4 Q  .   ? PX4 A 614 . ? 1_555 ? 
115  AF1 6 PX4 HA .   ? PX4 A 631 . ? 1_555 ? 
116  AF1 6 PX4 NA .   ? PX4 A 637 . ? 1_555 ? 
117  AF1 6 PX4 RA .   ? PX4 A 641 . ? 1_555 ? 
118  AF1 6 PX4 SA .   ? PX4 A 642 . ? 1_555 ? 
119  AF2 4 PX4 R  .   ? PX4 A 615 . ? 1_555 ? 
120  AF2 4 PX4 X  .   ? PX4 A 621 . ? 1_555 ? 
121  AF2 4 PX4 HA .   ? PX4 A 631 . ? 1_555 ? 
122  AF2 4 PX4 WA .   ? PX4 A 646 . ? 1_555 ? 
123  AF3 4 PX4 JA .   ? PX4 A 633 . ? 1_555 ? 
124  AF3 4 PX4 MA .   ? PX4 A 636 . ? 1_555 ? 
125  AF3 4 PX4 VA .   ? PX4 A 645 . ? 1_555 ? 
126  AF3 4 PX4 YA .   ? PX4 A 648 . ? 1_555 ? 
127  AF4 7 PX4 P  .   ? PX4 A 613 . ? 1_555 ? 
128  AF4 7 PX4 EA .   ? PX4 A 628 . ? 1_555 ? 
129  AF4 7 PX4 FA .   ? PX4 A 629 . ? 1_555 ? 
130  AF4 7 PX4 SA .   ? PX4 A 642 . ? 1_555 ? 
131  AF4 7 PX4 WA .   ? PX4 A 646 . ? 1_555 ? 
132  AF4 7 PX4 RD .   ? PX4 B 363 . ? 1_555 ? 
133  AF4 7 PX4 EF .   ? PX4 C 302 . ? 1_555 ? 
134  AF5 5 PX4 V  .   ? PX4 A 619 . ? 1_555 ? 
135  AF5 5 PX4 TA .   ? PX4 A 643 . ? 1_555 ? 
136  AF5 5 PX4 XA .   ? PX4 A 647 . ? 1_555 ? 
137  AF5 5 PX4 CF .   ? PX4 B 400 . ? 1_555 ? 
138  AF5 5 PX4 NH .   ? PX4 C 363 . ? 1_555 ? 
139  AF6 5 PX4 U  .   ? PX4 A 618 . ? 1_555 ? 
140  AF6 5 PX4 GA .   ? PX4 A 630 . ? 1_555 ? 
141  AF6 5 PX4 YA .   ? PX4 A 648 . ? 1_555 ? 
142  AF6 5 PX4 MH .   ? PX4 C 362 . ? 1_555 ? 
143  AF6 5 PX4 OH .   ? PX4 C 364 . ? 1_555 ? 
144  AF7 5 PX4 S  .   ? PX4 A 616 . ? 1_555 ? 
145  AF7 5 PX4 Z  .   ? PX4 A 623 . ? 1_555 ? 
146  AF7 5 PX4 QA .   ? PX4 A 640 . ? 1_555 ? 
147  AF7 5 PX4 UA .   ? PX4 A 644 . ? 1_555 ? 
148  AF7 5 PX4 AF .   ? PX4 B 398 . ? 1_555 ? 
149  AF8 3 PX4 Y  .   ? PX4 A 622 . ? 1_555 ? 
150  AF8 3 PX4 NA .   ? PX4 A 637 . ? 1_555 ? 
151  AF8 3 PX4 ZG .   ? PX4 C 349 . ? 1_555 ? 
152  AF9 5 PX4 W  .   ? PX4 A 620 . ? 1_555 ? 
153  AF9 5 PX4 X  .   ? PX4 A 621 . ? 1_555 ? 
154  AF9 5 PX4 GA .   ? PX4 A 630 . ? 1_555 ? 
155  AF9 5 PX4 VA .   ? PX4 A 645 . ? 1_555 ? 
156  AF9 5 PX4 KE .   ? PX4 B 382 . ? 1_555 ? 
157  AG1 7 PX4 T  .   ? PX4 A 617 . ? 1_555 ? 
158  AG1 7 PX4 BA .   ? PX4 A 625 . ? 1_555 ? 
159  AG1 7 PX4 EA .   ? PX4 A 628 . ? 1_555 ? 
160  AG1 7 PX4 LA .   ? PX4 A 635 . ? 1_555 ? 
161  AG1 7 PX4 RA .   ? PX4 A 641 . ? 1_555 ? 
162  AG1 7 PX4 ZA .   ? PX4 A 649 . ? 1_555 ? 
163  AG1 7 PX4 HE .   ? PX4 B 379 . ? 1_555 ? 
164  AG2 4 PX4 CA .   ? PX4 A 626 . ? 1_555 ? 
165  AG2 4 PX4 UA .   ? PX4 A 644 . ? 1_555 ? 
166  AG2 4 PX4 YA .   ? PX4 A 648 . ? 1_555 ? 
167  AG2 4 PX4 MH .   ? PX4 C 362 . ? 1_555 ? 
168  AG3 3 PX4 AA .   ? PX4 A 624 . ? 1_555 ? 
169  AG3 3 PX4 QA .   ? PX4 A 640 . ? 1_555 ? 
170  AG3 3 PX4 JD .   ? PX4 B 355 . ? 1_555 ? 
171  AG4 5 GLN A  44  ? GLN A 359 . ? 1_555 ? 
172  AG4 5 PX4 KA .   ? PX4 A 634 . ? 1_555 ? 
173  AG4 5 PX4 PA .   ? PX4 A 639 . ? 1_555 ? 
174  AG4 5 PX4 AB .   ? PX4 A 650 . ? 1_555 ? 
175  AG4 5 PX4 AE .   ? PX4 B 372 . ? 1_555 ? 
176  AG5 5 GLU A  90  ? GLU A 405 . ? 1_555 ? 
177  AG5 5 ARG A  128 ? ARG A 443 . ? 1_555 ? 
178  AG5 5 PX4 EA .   ? PX4 A 628 . ? 1_555 ? 
179  AG5 5 PX4 NA .   ? PX4 A 637 . ? 1_555 ? 
180  AG5 5 PX4 BB .   ? PX4 A 651 . ? 1_555 ? 
181  AG6 5 PX4 EA .   ? PX4 A 628 . ? 1_555 ? 
182  AG6 5 PX4 HA .   ? PX4 A 631 . ? 1_555 ? 
183  AG6 5 PX4 WA .   ? PX4 A 646 . ? 1_555 ? 
184  AG6 5 PX4 BB .   ? PX4 A 651 . ? 1_555 ? 
185  AG6 5 PX4 DB .   ? PX4 A 653 . ? 1_555 ? 
186  AG7 4 PX4 L  .   ? PX4 A 609 . ? 1_555 ? 
187  AG7 4 PX4 DA .   ? PX4 A 627 . ? 1_555 ? 
188  AG7 4 PX4 IA .   ? PX4 A 632 . ? 1_555 ? 
189  AG7 4 PX4 CB .   ? PX4 A 652 . ? 1_555 ? 
190  AG8 8 PHE A  45  ? PHE A 360 . ? 1_555 ? 
191  AG8 8 GLU A  77  ? GLU A 392 . ? 1_555 ? 
192  AG8 8 ALA A  78  ? ALA A 393 . ? 1_555 ? 
193  AG8 8 PX4 KA .   ? PX4 A 634 . ? 1_555 ? 
194  AG8 8 PX4 OA .   ? PX4 A 638 . ? 1_555 ? 
195  AG8 8 PX4 YA .   ? PX4 A 648 . ? 1_555 ? 
196  AG8 8 PX4 AB .   ? PX4 A 650 . ? 1_555 ? 
197  AG8 8 PX4 EB .   ? PX4 A 654 . ? 1_555 ? 
198  AG9 5 PX4 GA .   ? PX4 A 630 . ? 1_555 ? 
199  AG9 5 PX4 MA .   ? PX4 A 636 . ? 1_555 ? 
200  AG9 5 PX4 WA .   ? PX4 A 646 . ? 1_555 ? 
201  AG9 5 PX4 YA .   ? PX4 A 648 . ? 1_555 ? 
202  AG9 5 PX4 DB .   ? PX4 A 653 . ? 1_555 ? 
203  AH1 5 PX4 FA .   ? PX4 A 629 . ? 1_555 ? 
204  AH1 5 PX4 HA .   ? PX4 A 631 . ? 1_555 ? 
205  AH1 5 PX4 SA .   ? PX4 A 642 . ? 1_555 ? 
206  AH1 5 PX4 VA .   ? PX4 A 645 . ? 1_555 ? 
207  AH1 5 PX4 DB .   ? PX4 A 653 . ? 1_555 ? 
208  AH2 4 PX4 IA .   ? PX4 A 632 . ? 1_555 ? 
209  AH2 4 PX4 AB .   ? PX4 A 650 . ? 1_555 ? 
210  AH2 4 PX4 CB .   ? PX4 A 652 . ? 1_555 ? 
211  AH2 4 PX4 EB .   ? PX4 A 654 . ? 1_555 ? 
212  AH3 6 PX4 GA .   ? PX4 A 630 . ? 1_555 ? 
213  AH3 6 PX4 JA .   ? PX4 A 633 . ? 1_555 ? 
214  AH3 6 PX4 OA .   ? PX4 A 638 . ? 1_555 ? 
215  AH3 6 PX4 UA .   ? PX4 A 644 . ? 1_555 ? 
216  AH3 6 PX4 VA .   ? PX4 A 645 . ? 1_555 ? 
217  AH3 6 PX4 DB .   ? PX4 A 653 . ? 1_555 ? 
218  AH4 6 LYS A  86  ? LYS A 401 . ? 1_555 ? 
219  AH4 6 HIS A  87  ? HIS A 402 . ? 1_555 ? 
220  AH4 6 PX4 T  .   ? PX4 A 617 . ? 1_555 ? 
221  AH4 6 PX4 NA .   ? PX4 A 637 . ? 1_555 ? 
222  AH4 6 PX4 BB .   ? PX4 A 651 . ? 1_555 ? 
223  AH4 6 PX4 CB .   ? PX4 A 652 . ? 1_555 ? 
224  AH5 7 GLN A  44  ? GLN A 359 . ? 1_555 ? 
225  AH5 7 PHE A  45  ? PHE A 360 . ? 1_555 ? 
226  AH5 7 ARG A  47  ? ARG A 362 . ? 1_555 ? 
227  AH5 7 PX4 QA .   ? PX4 A 640 . ? 1_555 ? 
228  AH5 7 PX4 UA .   ? PX4 A 644 . ? 1_555 ? 
229  AH5 7 PX4 XA .   ? PX4 A 647 . ? 1_555 ? 
230  AH5 7 PX4 EB .   ? PX4 A 654 . ? 1_555 ? 
231  AH6 7 TYR A  84  ? TYR A 399 . ? 1_555 ? 
232  AH6 7 LYS A  86  ? LYS A 401 . ? 1_555 ? 
233  AH6 7 ARG A  128 ? ARG A 443 . ? 1_555 ? 
234  AH6 7 PX4 RA .   ? PX4 A 641 . ? 1_555 ? 
235  AH6 7 PX4 SA .   ? PX4 A 642 . ? 1_555 ? 
236  AH6 7 PX4 ZA .   ? PX4 A 649 . ? 1_555 ? 
237  AH6 7 PX4 DB .   ? PX4 A 653 . ? 1_555 ? 
238  AH7 9 PRO A  82  ? PRO A 397 . ? 1_555 ? 
239  AH7 9 GLY A  83  ? GLY A 398 . ? 1_555 ? 
240  AH7 9 TYR A  84  ? TYR A 399 . ? 1_555 ? 
241  AH7 9 PRO A  85  ? PRO A 400 . ? 1_555 ? 
242  AH7 9 PX4 O  .   ? PX4 A 612 . ? 1_555 ? 
243  AH7 9 PX4 TA .   ? PX4 A 643 . ? 1_555 ? 
244  AH7 9 PX4 XA .   ? PX4 A 647 . ? 1_555 ? 
245  AH7 9 PX4 ZA .   ? PX4 A 649 . ? 1_555 ? 
246  AH7 9 PX4 EB .   ? PX4 A 654 . ? 1_555 ? 
247  AH8 5 PX4 SA .   ? PX4 A 642 . ? 1_555 ? 
248  AH8 5 PX4 VA .   ? PX4 A 645 . ? 1_555 ? 
249  AH8 5 PX4 WA .   ? PX4 A 646 . ? 1_555 ? 
250  AH8 5 PX4 YA .   ? PX4 A 648 . ? 1_555 ? 
251  AH8 5 PX4 BB .   ? PX4 A 651 . ? 1_555 ? 
252  AH9 5 SER A  79  ? SER A 394 . ? 1_555 ? 
253  AH9 5 PX4 UA .   ? PX4 A 644 . ? 1_555 ? 
254  AH9 5 PX4 XA .   ? PX4 A 647 . ? 1_555 ? 
255  AH9 5 PX4 AB .   ? PX4 A 650 . ? 1_555 ? 
256  AH9 5 PX4 CB .   ? PX4 A 652 . ? 1_555 ? 
257  AI1 5 ASN A  54  ? ASN A 369 . ? 1_555 ? 
258  AI1 5 THR A  55  ? THR A 370 . ? 1_555 ? 
259  AI1 5 ASP A  101 ? ASP A 416 . ? 1_555 ? 
260  AI1 5 ARG A  149 ? ARG A 464 . ? 1_555 ? 
261  AI1 5 CL  GB .   ? CL  A 656 . ? 1_555 ? 
262  AI2 3 ALA A  56  ? ALA A 371 . ? 1_555 ? 
263  AI2 3 ARG A  149 ? ARG A 464 . ? 1_555 ? 
264  AI2 3 NA  FB .   ? NA  A 655 . ? 1_555 ? 
265  AI3 6 TRP B  54  ? TRP B 108 . ? 1_555 ? 
266  AI3 6 GLN B  55  ? GLN B 109 . ? 1_555 ? 
267  AI3 6 PX4 JB .   ? PX4 B 303 . ? 1_555 ? 
268  AI3 6 PX4 KB .   ? PX4 B 304 . ? 1_555 ? 
269  AI3 6 PX4 BG .   ? PX4 C 325 . ? 1_555 ? 
270  AI3 6 PX4 KG .   ? PX4 C 334 . ? 1_555 ? 
271  AI4 3 SER B  110 ? SER B 164 . ? 1_555 ? 
272  AI4 3 GLY B  113 ? GLY B 167 . ? 1_555 ? 
273  AI4 3 PX4 NB .   ? PX4 B 307 . ? 1_555 ? 
274  AI5 8 GLN B  51  ? GLN B 105 . ? 1_555 ? 
275  AI5 8 PX4 HB .   ? PX4 B 301 . ? 1_555 ? 
276  AI5 8 PX4 PC .   ? PX4 B 335 . ? 1_555 ? 
277  AI5 8 PX4 UC .   ? PX4 B 340 . ? 1_555 ? 
278  AI5 8 PX4 HD .   ? PX4 B 353 . ? 1_555 ? 
279  AI5 8 ARG C  156 ? ARG C 210 . ? 1_555 ? 
280  AI5 8 PX4 DF .   ? PX4 C 301 . ? 1_555 ? 
281  AI5 8 PX4 KG .   ? PX4 C 334 . ? 1_555 ? 
282  AI6 6 GLN B  55  ? GLN B 109 . ? 1_555 ? 
283  AI6 6 MET B  58  ? MET B 112 . ? 1_555 ? 
284  AI6 6 ARG B  62  ? ARG B 116 . ? 1_555 ? 
285  AI6 6 PX4 HB .   ? PX4 B 301 . ? 1_555 ? 
286  AI6 6 PX4 UC .   ? PX4 B 340 . ? 1_555 ? 
287  AI6 6 PX4 ZC .   ? PX4 B 345 . ? 1_555 ? 
288  AI7 7 GLU B  22  ? GLU B 76  . ? 1_555 ? 
289  AI7 7 GLU B  26  ? GLU B 80  . ? 1_555 ? 
290  AI7 7 ARG B  29  ? ARG B 83  . ? 1_555 ? 
291  AI7 7 PX4 SB .   ? PX4 B 312 . ? 1_555 ? 
292  AI7 7 PX4 DC .   ? PX4 B 323 . ? 1_555 ? 
293  AI7 7 PX4 AD .   ? PX4 B 346 . ? 1_555 ? 
294  AI7 7 PX4 KD .   ? PX4 B 356 . ? 1_555 ? 
295  AI8 8 SER B  135 ? SER B 189 . ? 1_555 ? 
296  AI8 8 ARG B  139 ? ARG B 193 . ? 1_555 ? 
297  AI8 8 PX4 TB .   ? PX4 B 313 . ? 1_555 ? 
298  AI8 8 PX4 UB .   ? PX4 B 314 . ? 1_555 ? 
299  AI8 8 PX4 TC .   ? PX4 B 339 . ? 1_555 ? 
300  AI8 8 PX4 CD .   ? PX4 B 348 . ? 1_555 ? 
301  AI8 8 PX4 WF .   ? PX4 C 320 . ? 1_555 ? 
302  AI8 8 PX4 PG .   ? PX4 C 339 . ? 1_555 ? 
303  AI9 5 LEU B  112 ? LEU B 166 . ? 1_555 ? 
304  AI9 5 PX4 IB .   ? PX4 B 302 . ? 1_555 ? 
305  AI9 5 PX4 YB .   ? PX4 B 318 . ? 1_555 ? 
306  AI9 5 PX4 RC .   ? PX4 B 337 . ? 1_555 ? 
307  AI9 5 TYR C  83  ? TYR C 137 . ? 1_555 ? 
308  AJ1 5 LEU B  36  ? LEU B 90  . ? 1_555 ? 
309  AJ1 5 LYS B  40  ? LYS B 94  . ? 1_555 ? 
310  AJ1 5 HIS C  167 ? HIS C 221 . ? 1_555 ? 
311  AJ1 5 PX4 DF .   ? PX4 C 301 . ? 1_555 ? 
312  AJ1 5 PX4 JH .   ? PX4 C 359 . ? 1_555 ? 
313  AJ2 6 ALA B  98  ? ALA B 152 . ? 1_555 ? 
314  AJ2 6 ARG B  99  ? ARG B 153 . ? 1_555 ? 
315  AJ2 6 PX4 VB .   ? PX4 B 315 . ? 1_555 ? 
316  AJ2 6 PX4 NC .   ? PX4 B 333 . ? 1_555 ? 
317  AJ2 6 LEU C  105 ? LEU C 159 . ? 1_555 ? 
318  AJ2 6 PX4 NF .   ? PX4 C 311 . ? 1_555 ? 
319  AJ3 3 ARG B  84  ? ARG B 138 . ? 1_555 ? 
320  AJ3 3 PX4 ZB .   ? PX4 B 319 . ? 1_555 ? 
321  AJ3 3 PX4 IC .   ? PX4 B 328 . ? 1_555 ? 
322  AJ4 3 ARG B  62  ? ARG B 116 . ? 1_555 ? 
323  AJ4 3 PX4 ZC .   ? PX4 B 345 . ? 1_555 ? 
324  AJ4 3 PX4 TG .   ? PX4 C 343 . ? 1_555 ? 
325  AJ5 4 PX4 LB .   ? PX4 B 305 . ? 1_555 ? 
326  AJ5 4 PX4 XB .   ? PX4 B 317 . ? 1_555 ? 
327  AJ5 4 PX4 KD .   ? PX4 B 356 . ? 1_555 ? 
328  AJ5 4 PX4 JG .   ? PX4 C 333 . ? 1_555 ? 
329  AJ6 6 ARG B  139 ? ARG B 193 . ? 1_555 ? 
330  AJ6 6 GLN B  140 ? GLN B 194 . ? 1_555 ? 
331  AJ6 6 PX4 MB .   ? PX4 B 306 . ? 1_555 ? 
332  AJ6 6 PX4 KC .   ? PX4 B 330 . ? 1_555 ? 
333  AJ6 6 PX4 WF .   ? PX4 C 320 . ? 1_555 ? 
334  AJ6 6 PX4 GG .   ? PX4 C 330 . ? 1_555 ? 
335  AJ7 6 ARG B  128 ? ARG B 182 . ? 1_555 ? 
336  AJ7 6 PX4 MB .   ? PX4 B 306 . ? 1_555 ? 
337  AJ7 6 PX4 YB .   ? PX4 B 318 . ? 1_555 ? 
338  AJ7 6 PX4 KF .   ? PX4 C 308 . ? 1_555 ? 
339  AJ7 6 PX4 WF .   ? PX4 C 320 . ? 1_555 ? 
340  AJ7 6 PX4 PG .   ? PX4 C 339 . ? 1_555 ? 
341  AJ8 5 ARG B  91  ? ARG B 145 . ? 1_555 ? 
342  AJ8 5 PX4 PB .   ? PX4 B 309 . ? 1_555 ? 
343  AJ8 5 PX4 IC .   ? PX4 B 328 . ? 1_555 ? 
344  AJ8 5 PX4 QC .   ? PX4 B 336 . ? 1_555 ? 
345  AJ8 5 PX4 NF .   ? PX4 C 311 . ? 1_555 ? 
346  AJ9 5 PX4 BC .   ? PX4 B 321 . ? 1_555 ? 
347  AJ9 5 PX4 CC .   ? PX4 B 322 . ? 1_555 ? 
348  AJ9 5 PX4 YC .   ? PX4 B 344 . ? 1_555 ? 
349  AJ9 5 PX4 ED .   ? PX4 B 350 . ? 1_555 ? 
350  AJ9 5 PX4 IH .   ? PX4 C 358 . ? 1_555 ? 
351  AK1 4 ARG B  7   ? ARG B 61  . ? 1_555 ? 
352  AK1 4 PX4 SB .   ? PX4 B 312 . ? 1_555 ? 
353  AK1 4 PX4 FC .   ? PX4 B 325 . ? 1_555 ? 
354  AK1 4 PX4 LC .   ? PX4 B 331 . ? 1_555 ? 
355  AK2 6 ARG B  121 ? ARG B 175 . ? 1_555 ? 
356  AK2 6 PX4 NB .   ? PX4 B 307 . ? 1_555 ? 
357  AK2 6 PX4 UB .   ? PX4 B 314 . ? 1_555 ? 
358  AK2 6 PX4 CD .   ? PX4 B 348 . ? 1_555 ? 
359  AK2 6 PX4 UF .   ? PX4 C 318 . ? 1_555 ? 
360  AK2 6 PX4 WF .   ? PX4 C 320 . ? 1_555 ? 
361  AK3 3 PX4 QB .   ? PX4 B 310 . ? 1_555 ? 
362  AK3 3 PX4 AC .   ? PX4 B 320 . ? 1_555 ? 
363  AK3 3 PX4 MD .   ? PX4 B 358 . ? 1_555 ? 
364  AK4 3 PX4 ZB .   ? PX4 B 319 . ? 1_555 ? 
365  AK4 3 PX4 UC .   ? PX4 B 340 . ? 1_555 ? 
366  AK4 3 PX4 JF .   ? PX4 C 307 . ? 1_555 ? 
367  AK5 6 LYS B  150 ? LYS B 204 . ? 1_555 ? 
368  AK5 6 GLY B  153 ? GLY B 207 . ? 1_555 ? 
369  AK5 6 GLY B  154 ? GLY B 208 . ? 1_555 ? 
370  AK5 6 LEU B  157 ? LEU B 211 . ? 1_555 ? 
371  AK5 6 PX4 WB .   ? PX4 B 316 . ? 1_555 ? 
372  AK5 6 PX4 SG .   ? PX4 C 342 . ? 1_555 ? 
373  AK6 4 LEU B  157 ? LEU B 211 . ? 1_555 ? 
374  AK6 4 PX4 WB .   ? PX4 B 316 . ? 1_555 ? 
375  AK6 4 PX4 WC .   ? PX4 B 342 . ? 1_555 ? 
376  AK6 4 PX4 ED .   ? PX4 B 350 . ? 1_555 ? 
377  AK7 7 THR B  25  ? THR B 79  . ? 1_555 ? 
378  AK7 7 ARG B  29  ? ARG B 83  . ? 1_555 ? 
379  AK7 7 PX4 LB .   ? PX4 B 305 . ? 1_555 ? 
380  AK7 7 PX4 AD .   ? PX4 B 346 . ? 1_555 ? 
381  AK7 7 HIS C  167 ? HIS C 221 . ? 1_555 ? 
382  AK7 7 LEU C  171 ? LEU C 225 . ? 1_555 ? 
383  AK7 7 PX4 TF .   ? PX4 C 317 . ? 1_555 ? 
384  AK8 4 PX4 BD .   ? PX4 B 347 . ? 1_555 ? 
385  AK8 4 PX4 FD .   ? PX4 B 351 . ? 1_555 ? 
386  AK8 4 PX4 ID .   ? PX4 B 354 . ? 1_555 ? 
387  AK8 4 PX4 VF .   ? PX4 C 319 . ? 1_555 ? 
388  AK9 6 TYR B  204 ? TYR B 258 . ? 1_555 ? 
389  AK9 6 PX4 XB .   ? PX4 B 317 . ? 1_555 ? 
390  AK9 6 PX4 LC .   ? PX4 B 331 . ? 1_555 ? 
391  AK9 6 PX4 LD .   ? PX4 B 357 . ? 1_555 ? 
392  AK9 6 PX4 FG .   ? PX4 C 329 . ? 1_555 ? 
393  AK9 6 PX4 NG .   ? PX4 C 337 . ? 1_555 ? 
394  AL1 5 LEU B  179 ? LEU B 233 . ? 1_555 ? 
395  AL1 5 ARG B  183 ? ARG B 237 . ? 1_555 ? 
396  AL1 5 PX4 FD .   ? PX4 B 351 . ? 1_555 ? 
397  AL1 5 PX4 JD .   ? PX4 B 355 . ? 1_555 ? 
398  AL1 5 PX4 BF .   ? PX4 B 399 . ? 1_555 ? 
399  AL2 7 PHE B  193 ? PHE B 247 . ? 1_555 ? 
400  AL2 7 LYS B  194 ? LYS B 248 . ? 1_555 ? 
401  AL2 7 PHE B  197 ? PHE B 251 . ? 1_555 ? 
402  AL2 7 PX4 FD .   ? PX4 B 351 . ? 1_555 ? 
403  AL2 7 PX4 ID .   ? PX4 B 354 . ? 1_555 ? 
404  AL2 7 PHE C  3   ? PHE C 57  . ? 1_555 ? 
405  AL2 7 PX4 LG .   ? PX4 C 335 . ? 1_555 ? 
406  AL3 7 TRP B  76  ? TRP B 130 . ? 1_555 ? 
407  AL3 7 TYR B  83  ? TYR B 137 . ? 1_555 ? 
408  AL3 7 ARG B  84  ? ARG B 138 . ? 1_555 ? 
409  AL3 7 ARG B  91  ? ARG B 145 . ? 1_555 ? 
410  AL3 7 PX4 QB .   ? PX4 B 310 . ? 1_555 ? 
411  AL3 7 PX4 VB .   ? PX4 B 315 . ? 1_555 ? 
412  AL3 7 MET C  116 ? MET C 170 . ? 1_555 ? 
413  AL4 3 LEU B  179 ? LEU B 233 . ? 1_555 ? 
414  AL4 3 PX4 MC .   ? PX4 B 332 . ? 1_555 ? 
415  AL4 3 PX4 JD .   ? PX4 B 355 . ? 1_555 ? 
416  AL5 5 LEU B  146 ? LEU B 200 . ? 1_555 ? 
417  AL5 5 PX4 TB .   ? PX4 B 313 . ? 1_555 ? 
418  AL5 5 PX4 TC .   ? PX4 B 339 . ? 1_555 ? 
419  AL5 5 PX4 OD .   ? PX4 B 360 . ? 1_555 ? 
420  AL5 5 PX4 GG .   ? PX4 C 330 . ? 1_555 ? 
421  AL6 5 SER B  1   ? SER B 55  . ? 1_555 ? 
422  AL6 5 SER B  4   ? SER B 58  . ? 1_555 ? 
423  AL6 5 PX4 XB .   ? PX4 B 317 . ? 1_555 ? 
424  AL6 5 PX4 FC .   ? PX4 B 325 . ? 1_555 ? 
425  AL6 5 PX4 HG .   ? PX4 C 331 . ? 1_555 ? 
426  AL7 8 LEU B  168 ? LEU B 222 . ? 1_555 ? 
427  AL7 8 SER B  169 ? SER B 223 . ? 1_555 ? 
428  AL7 8 SER B  172 ? SER B 226 . ? 1_555 ? 
429  AL7 8 PX4 JC .   ? PX4 B 329 . ? 1_555 ? 
430  AL7 8 PX4 WC .   ? PX4 B 342 . ? 1_555 ? 
431  AL7 8 PX4 ZE .   ? PX4 B 397 . ? 1_555 ? 
432  AL7 8 GLU C  24  ? GLU C 78  . ? 1_555 ? 
433  AL7 8 PX4 OF .   ? PX4 C 312 . ? 1_555 ? 
434  AL8 4 PX4 PB .   ? PX4 B 309 . ? 1_555 ? 
435  AL8 4 PX4 QC .   ? PX4 B 336 . ? 1_555 ? 
436  AL8 4 PX4 RC .   ? PX4 B 337 . ? 1_555 ? 
437  AL8 4 PX4 WD .   ? PX4 B 368 . ? 1_555 ? 
438  AL9 6 PX4 TC .   ? PX4 B 339 . ? 1_555 ? 
439  AL9 6 PX4 CD .   ? PX4 B 348 . ? 1_555 ? 
440  AL9 6 PX4 GD .   ? PX4 B 352 . ? 1_555 ? 
441  AL9 6 PX4 QD .   ? PX4 B 362 . ? 1_555 ? 
442  AL9 6 PX4 NE .   ? PX4 B 385 . ? 1_555 ? 
443  AL9 6 PX4 UF .   ? PX4 C 318 . ? 1_555 ? 
444  AM1 3 PX4 JB .   ? PX4 B 303 . ? 1_555 ? 
445  AM1 3 PX4 HD .   ? PX4 B 353 . ? 1_555 ? 
446  AM1 3 PX4 SD .   ? PX4 B 364 . ? 1_555 ? 
447  AM2 3 PX4 VB .   ? PX4 B 315 . ? 1_555 ? 
448  AM2 3 PX4 NC .   ? PX4 B 333 . ? 1_555 ? 
449  AM2 3 PX4 XC .   ? PX4 B 343 . ? 1_555 ? 
450  AM3 4 GLN B  106 ? GLN B 160 . ? 1_555 ? 
451  AM3 4 PX4 NB .   ? PX4 B 307 . ? 1_555 ? 
452  AM3 4 PX4 NC .   ? PX4 B 333 . ? 1_555 ? 
453  AM3 4 PX4 GD .   ? PX4 B 352 . ? 1_555 ? 
454  AM4 2 PX4 XC .   ? PX4 B 343 . ? 1_555 ? 
455  AM4 2 PX4 TD .   ? PX4 B 365 . ? 1_555 ? 
456  AM5 6 PX4 MB .   ? PX4 B 306 . ? 1_555 ? 
457  AM5 6 PX4 KC .   ? PX4 B 330 . ? 1_555 ? 
458  AM5 6 PX4 OC .   ? PX4 B 334 . ? 1_555 ? 
459  AM5 6 PX4 OD .   ? PX4 B 360 . ? 1_555 ? 
460  AM5 6 PX4 QD .   ? PX4 B 362 . ? 1_555 ? 
461  AM5 6 PX4 RG .   ? PX4 C 341 . ? 1_555 ? 
462  AM6 5 PX4 JB .   ? PX4 B 303 . ? 1_555 ? 
463  AM6 5 PX4 KB .   ? PX4 B 304 . ? 1_555 ? 
464  AM6 5 PX4 AC .   ? PX4 B 320 . ? 1_555 ? 
465  AM6 5 PX4 MD .   ? PX4 B 358 . ? 1_555 ? 
466  AM6 5 PX4 YD .   ? PX4 B 370 . ? 1_555 ? 
467  AM7 5 PX4 AD .   ? PX4 B 346 . ? 1_555 ? 
468  AM7 5 PX4 ND .   ? PX4 B 359 . ? 1_555 ? 
469  AM7 5 PX4 BE .   ? PX4 B 373 . ? 1_555 ? 
470  AM7 5 PX4 YF .   ? PX4 C 322 . ? 1_555 ? 
471  AM7 5 PX4 CH .   ? PX4 C 352 . ? 1_555 ? 
472  AM8 4 PX4 CC .   ? PX4 B 322 . ? 1_555 ? 
473  AM8 4 PX4 MC .   ? PX4 B 332 . ? 1_555 ? 
474  AM8 4 PX4 ED .   ? PX4 B 350 . ? 1_555 ? 
475  AM8 4 PX4 VD .   ? PX4 B 367 . ? 1_555 ? 
476  AM9 4 PX4 QC .   ? PX4 B 336 . ? 1_555 ? 
477  AM9 4 PX4 SC .   ? PX4 B 338 . ? 1_555 ? 
478  AM9 4 PX4 RD .   ? PX4 B 363 . ? 1_555 ? 
479  AM9 4 PX4 TD .   ? PX4 B 365 . ? 1_555 ? 
480  AN1 5 PX4 WB .   ? PX4 B 316 . ? 1_555 ? 
481  AN1 5 PX4 ED .   ? PX4 B 350 . ? 1_555 ? 
482  AN1 5 PX4 OD .   ? PX4 B 360 . ? 1_555 ? 
483  AN1 5 PX4 CE .   ? PX4 B 374 . ? 1_555 ? 
484  AN1 5 PX4 HE .   ? PX4 B 379 . ? 1_555 ? 
485  AN2 4 PX4 KB .   ? PX4 B 304 . ? 1_555 ? 
486  AN2 4 PX4 RB .   ? PX4 B 311 . ? 1_555 ? 
487  AN2 4 PX4 HD .   ? PX4 B 353 . ? 1_555 ? 
488  AN2 4 PX4 XD .   ? PX4 B 369 . ? 1_555 ? 
489  AN3 4 PX4 LB .   ? PX4 B 305 . ? 1_555 ? 
490  AN3 4 PX4 DC .   ? PX4 B 323 . ? 1_555 ? 
491  AN3 4 PX4 VC .   ? PX4 B 341 . ? 1_555 ? 
492  AN3 4 PX4 DF .   ? PX4 C 301 . ? 1_555 ? 
493  AN4 4 PX4 EC .   ? PX4 B 324 . ? 1_555 ? 
494  AN4 4 PX4 ID .   ? PX4 B 354 . ? 1_555 ? 
495  AN4 4 PX4 LD .   ? PX4 B 357 . ? 1_555 ? 
496  AN4 4 PX4 AE .   ? PX4 B 372 . ? 1_555 ? 
497  AN5 5 PX4 MB .   ? PX4 B 306 . ? 1_555 ? 
498  AN5 5 PX4 YB .   ? PX4 B 318 . ? 1_555 ? 
499  AN5 5 PX4 OC .   ? PX4 B 334 . ? 1_555 ? 
500  AN5 5 PX4 GD .   ? PX4 B 352 . ? 1_555 ? 
501  AN5 5 PX4 QD .   ? PX4 B 362 . ? 1_555 ? 
502  AN6 2 PX4 BE .   ? PX4 B 373 . ? 1_555 ? 
503  AN6 2 PX4 MH .   ? PX4 C 362 . ? 1_555 ? 
504  AN7 6 PX4 WB .   ? PX4 B 316 . ? 1_555 ? 
505  AN7 6 PX4 CC .   ? PX4 B 322 . ? 1_555 ? 
506  AN7 6 PX4 WC .   ? PX4 B 342 . ? 1_555 ? 
507  AN7 6 PX4 YC .   ? PX4 B 344 . ? 1_555 ? 
508  AN7 6 PX4 VD .   ? PX4 B 367 . ? 1_555 ? 
509  AN7 6 PX4 CE .   ? PX4 B 374 . ? 1_555 ? 
510  AN8 5 PX4 EC .   ? PX4 B 324 . ? 1_555 ? 
511  AN8 5 PX4 GC .   ? PX4 B 326 . ? 1_555 ? 
512  AN8 5 PX4 HC .   ? PX4 B 327 . ? 1_555 ? 
513  AN8 5 PX4 ID .   ? PX4 B 354 . ? 1_555 ? 
514  AN8 5 PX4 JD .   ? PX4 B 355 . ? 1_555 ? 
515  AN9 6 PX4 T  .   ? PX4 A 617 . ? 1_555 ? 
516  AN9 6 PX4 OC .   ? PX4 B 334 . ? 1_555 ? 
517  AN9 6 PX4 RC .   ? PX4 B 337 . ? 1_555 ? 
518  AN9 6 PX4 CD .   ? PX4 B 348 . ? 1_555 ? 
519  AN9 6 PX4 WD .   ? PX4 B 368 . ? 1_555 ? 
520  AN9 6 PX4 NE .   ? PX4 B 385 . ? 1_555 ? 
521  AO1 6 PX4 JB .   ? PX4 B 303 . ? 1_555 ? 
522  AO1 6 PX4 PC .   ? PX4 B 335 . ? 1_555 ? 
523  AO1 6 PX4 ZC .   ? PX4 B 345 . ? 1_555 ? 
524  AO1 6 PX4 SD .   ? PX4 B 364 . ? 1_555 ? 
525  AO1 6 PX4 XD .   ? PX4 B 369 . ? 1_555 ? 
526  AO1 6 PX4 KE .   ? PX4 B 382 . ? 1_555 ? 
527  AO2 6 PX4 F  .   ? PX4 A 603 . ? 1_555 ? 
528  AO2 6 PX4 EC .   ? PX4 B 324 . ? 1_555 ? 
529  AO2 6 PX4 HC .   ? PX4 B 327 . ? 1_555 ? 
530  AO2 6 PX4 BD .   ? PX4 B 347 . ? 1_555 ? 
531  AO2 6 PX4 FD .   ? PX4 B 351 . ? 1_555 ? 
532  AO2 6 PX4 AE .   ? PX4 B 372 . ? 1_555 ? 
533  AO3 5 PX4 PA .   ? PX4 A 639 . ? 1_555 ? 
534  AO3 5 PX4 GC .   ? PX4 B 326 . ? 1_555 ? 
535  AO3 5 PX4 JC .   ? PX4 B 329 . ? 1_555 ? 
536  AO3 5 PX4 FD .   ? PX4 B 351 . ? 1_555 ? 
537  AO3 5 PX4 FE .   ? PX4 B 377 . ? 1_555 ? 
538  AO4 3 PX4 LB .   ? PX4 B 305 . ? 1_555 ? 
539  AO4 3 PX4 SB .   ? PX4 B 312 . ? 1_555 ? 
540  AO4 3 PX4 JG .   ? PX4 C 333 . ? 1_555 ? 
541  AO5 4 PX4 FC .   ? PX4 B 325 . ? 1_555 ? 
542  AO5 4 PX4 BD .   ? PX4 B 347 . ? 1_555 ? 
543  AO5 4 PX4 DE .   ? PX4 B 375 . ? 1_555 ? 
544  AO5 4 PX4 AF .   ? PX4 B 398 . ? 1_555 ? 
545  AO6 3 PX4 ZB .   ? PX4 B 319 . ? 1_555 ? 
546  AO6 3 PX4 UC .   ? PX4 B 340 . ? 1_555 ? 
547  AO6 3 PX4 GE .   ? PX4 B 378 . ? 1_555 ? 
548  AO7 4 PX4 VC .   ? PX4 B 341 . ? 1_555 ? 
549  AO7 4 PX4 ZD .   ? PX4 B 371 . ? 1_555 ? 
550  AO7 4 PX4 BE .   ? PX4 B 373 . ? 1_555 ? 
551  AO7 4 PX4 IE .   ? PX4 B 380 . ? 1_555 ? 
552  AO8 6 PX4 KC .   ? PX4 B 330 . ? 1_555 ? 
553  AO8 6 PX4 TC .   ? PX4 B 339 . ? 1_555 ? 
554  AO8 6 PX4 YC .   ? PX4 B 344 . ? 1_555 ? 
555  AO8 6 PX4 QD .   ? PX4 B 362 . ? 1_555 ? 
556  AO8 6 PX4 UD .   ? PX4 B 366 . ? 1_555 ? 
557  AO8 6 PX4 HE .   ? PX4 B 379 . ? 1_555 ? 
558  AO9 2 PX4 RD .   ? PX4 B 363 . ? 1_555 ? 
559  AO9 2 PX4 WD .   ? PX4 B 368 . ? 1_555 ? 
560  AP1 8 PX4 BA .   ? PX4 A 625 . ? 1_555 ? 
561  AP1 8 PX4 OC .   ? PX4 B 334 . ? 1_555 ? 
562  AP1 8 PX4 TC .   ? PX4 B 339 . ? 1_555 ? 
563  AP1 8 PX4 CD .   ? PX4 B 348 . ? 1_555 ? 
564  AP1 8 PX4 OD .   ? PX4 B 360 . ? 1_555 ? 
565  AP1 8 PX4 UD .   ? PX4 B 366 . ? 1_555 ? 
566  AP1 8 PX4 HE .   ? PX4 B 379 . ? 1_555 ? 
567  AP1 8 PX4 NE .   ? PX4 B 385 . ? 1_555 ? 
568  AP2 6 PX4 HA .   ? PX4 A 631 . ? 1_555 ? 
569  AP2 6 PX4 XC .   ? PX4 B 343 . ? 1_555 ? 
570  AP2 6 PX4 PD .   ? PX4 B 361 . ? 1_555 ? 
571  AP2 6 PX4 WD .   ? PX4 B 368 . ? 1_555 ? 
572  AP2 6 PX4 JE .   ? PX4 B 381 . ? 1_555 ? 
573  AP2 6 PX4 EF .   ? PX4 C 302 . ? 1_555 ? 
574  AP3 5 PX4 PC .   ? PX4 B 335 . ? 1_555 ? 
575  AP3 5 PX4 HD .   ? PX4 B 353 . ? 1_555 ? 
576  AP3 5 PX4 KE .   ? PX4 B 382 . ? 1_555 ? 
577  AP3 5 PX4 DF .   ? PX4 C 301 . ? 1_555 ? 
578  AP3 5 PX4 FF .   ? PX4 C 303 . ? 1_555 ? 
579  AP4 6 PX4 SC .   ? PX4 B 338 . ? 1_555 ? 
580  AP4 6 PX4 XC .   ? PX4 B 343 . ? 1_555 ? 
581  AP4 6 PX4 GE .   ? PX4 B 378 . ? 1_555 ? 
582  AP4 6 PX4 EF .   ? PX4 C 302 . ? 1_555 ? 
583  AP4 6 PX4 MF .   ? PX4 C 310 . ? 1_555 ? 
584  AP4 6 PX4 AG .   ? PX4 C 324 . ? 1_555 ? 
585  AP5 2 PX4 OD .   ? PX4 B 360 . ? 1_555 ? 
586  AP5 2 PX4 QD .   ? PX4 B 362 . ? 1_555 ? 
587  AP6 5 PX4 WC .   ? PX4 B 342 . ? 1_555 ? 
588  AP6 5 PX4 ED .   ? PX4 B 350 . ? 1_555 ? 
589  AP6 5 PX4 CE .   ? PX4 B 374 . ? 1_555 ? 
590  AP6 5 PX4 FE .   ? PX4 B 377 . ? 1_555 ? 
591  AP6 5 PX4 ME .   ? PX4 B 384 . ? 1_555 ? 
592  AP7 5 PX4 NC .   ? PX4 B 333 . ? 1_555 ? 
593  AP7 5 PX4 GD .   ? PX4 B 352 . ? 1_555 ? 
594  AP7 5 PX4 PD .   ? PX4 B 361 . ? 1_555 ? 
595  AP7 5 PX4 RD .   ? PX4 B 363 . ? 1_555 ? 
596  AP7 5 PX4 JE .   ? PX4 B 381 . ? 1_555 ? 
597  AP8 7 PX4 ZC .   ? PX4 B 345 . ? 1_555 ? 
598  AP8 7 PX4 HD .   ? PX4 B 353 . ? 1_555 ? 
599  AP8 7 PX4 YD .   ? PX4 B 370 . ? 1_555 ? 
600  AP8 7 PX4 KE .   ? PX4 B 382 . ? 1_555 ? 
601  AP8 7 PX4 OE .   ? PX4 B 386 . ? 1_555 ? 
602  AP8 7 PX4 QE .   ? PX4 B 388 . ? 1_555 ? 
603  AP8 7 PX4 YG .   ? PX4 C 348 . ? 1_555 ? 
604  AP9 4 PX4 UC .   ? PX4 B 340 . ? 1_555 ? 
605  AP9 4 PX4 XD .   ? PX4 B 369 . ? 1_555 ? 
606  AP9 4 PX4 OE .   ? PX4 B 386 . ? 1_555 ? 
607  AP9 4 PX4 QG .   ? PX4 C 340 . ? 1_555 ? 
608  AQ1 3 PX4 ND .   ? PX4 B 359 . ? 1_555 ? 
609  AQ1 3 PX4 IE .   ? PX4 B 380 . ? 1_555 ? 
610  AQ1 3 PX4 FF .   ? PX4 C 303 . ? 1_555 ? 
611  AQ2 6 PX4 D  .   ? PX4 A 601 . ? 1_555 ? 
612  AQ2 6 PX4 E  .   ? PX4 A 602 . ? 1_555 ? 
613  AQ2 6 PX4 QA .   ? PX4 A 640 . ? 1_555 ? 
614  AQ2 6 PX4 BD .   ? PX4 B 347 . ? 1_555 ? 
615  AQ2 6 PX4 ID .   ? PX4 B 354 . ? 1_555 ? 
616  AQ2 6 PX4 DE .   ? PX4 B 375 . ? 1_555 ? 
617  AQ3 6 PX4 CA .   ? PX4 A 626 . ? 1_555 ? 
618  AQ3 6 PX4 VC .   ? PX4 B 341 . ? 1_555 ? 
619  AQ3 6 PX4 DD .   ? PX4 B 349 . ? 1_555 ? 
620  AQ3 6 PX4 ND .   ? PX4 B 359 . ? 1_555 ? 
621  AQ3 6 PX4 IE .   ? PX4 B 380 . ? 1_555 ? 
622  AQ3 6 PX4 PE .   ? PX4 B 387 . ? 1_555 ? 
623  AQ4 5 PX4 H  .   ? PX4 A 605 . ? 1_555 ? 
624  AQ4 5 PX4 YC .   ? PX4 B 344 . ? 1_555 ? 
625  AQ4 5 PX4 ED .   ? PX4 B 350 . ? 1_555 ? 
626  AQ4 5 PX4 VD .   ? PX4 B 367 . ? 1_555 ? 
627  AQ4 5 PX4 ME .   ? PX4 B 384 . ? 1_555 ? 
628  AQ5 4 PX4 E  .   ? PX4 A 602 . ? 1_555 ? 
629  AQ5 4 PX4 LD .   ? PX4 B 357 . ? 1_555 ? 
630  AQ5 4 PX4 AE .   ? PX4 B 372 . ? 1_555 ? 
631  AQ5 4 PX4 EE .   ? PX4 B 376 . ? 1_555 ? 
632  AQ6 4 PX4 G  .   ? PX4 A 604 . ? 1_555 ? 
633  AQ6 4 PX4 DE .   ? PX4 B 375 . ? 1_555 ? 
634  AQ6 4 PX4 PE .   ? PX4 B 387 . ? 1_555 ? 
635  AQ6 4 PX4 SE .   ? PX4 B 390 . ? 1_555 ? 
636  AQ7 3 PX4 D  .   ? PX4 A 601 . ? 1_555 ? 
637  AQ7 3 PX4 JD .   ? PX4 B 355 . ? 1_555 ? 
638  AQ7 3 PX4 VD .   ? PX4 B 367 . ? 1_555 ? 
639  AQ8 5 PX4 MD .   ? PX4 B 358 . ? 1_555 ? 
640  AQ8 5 PX4 TD .   ? PX4 B 365 . ? 1_555 ? 
641  AQ8 5 PX4 OE .   ? PX4 B 386 . ? 1_555 ? 
642  AQ8 5 PX4 QE .   ? PX4 B 388 . ? 1_555 ? 
643  AQ8 5 PX4 EF .   ? PX4 C 302 . ? 1_555 ? 
644  AQ9 7 PX4 H  .   ? PX4 A 605 . ? 1_555 ? 
645  AQ9 7 PX4 M  .   ? PX4 A 610 . ? 1_555 ? 
646  AQ9 7 PX4 NA .   ? PX4 A 637 . ? 1_555 ? 
647  AQ9 7 PX4 YC .   ? PX4 B 344 . ? 1_555 ? 
648  AQ9 7 PX4 OD .   ? PX4 B 360 . ? 1_555 ? 
649  AQ9 7 PX4 QD .   ? PX4 B 362 . ? 1_555 ? 
650  AQ9 7 PX4 RE .   ? PX4 B 389 . ? 1_555 ? 
651  AR1 4 PX4 ND .   ? PX4 B 359 . ? 1_555 ? 
652  AR1 4 PX4 ZD .   ? PX4 B 371 . ? 1_555 ? 
653  AR1 4 PX4 BE .   ? PX4 B 373 . ? 1_555 ? 
654  AR1 4 PX4 PE .   ? PX4 B 387 . ? 1_555 ? 
655  AR2 4 PX4 K  .   ? PX4 A 608 . ? 1_555 ? 
656  AR2 4 PX4 RD .   ? PX4 B 363 . ? 1_555 ? 
657  AR2 4 PX4 WD .   ? PX4 B 368 . ? 1_555 ? 
658  AR2 4 PX4 LE .   ? PX4 B 383 . ? 1_555 ? 
659  AR3 7 PX4 MA .   ? PX4 A 636 . ? 1_555 ? 
660  AR3 7 PX4 HD .   ? PX4 B 353 . ? 1_555 ? 
661  AR3 7 PX4 SD .   ? PX4 B 364 . ? 1_555 ? 
662  AR3 7 PX4 XD .   ? PX4 B 369 . ? 1_555 ? 
663  AR3 7 PX4 QE .   ? PX4 B 388 . ? 1_555 ? 
664  AR3 7 PX4 TE .   ? PX4 B 391 . ? 1_555 ? 
665  AR3 7 PX4 VE .   ? PX4 B 393 . ? 1_555 ? 
666  AR4 4 PX4 M  .   ? PX4 A 610 . ? 1_555 ? 
667  AR4 4 PX4 JE .   ? PX4 B 381 . ? 1_555 ? 
668  AR4 4 PX4 NE .   ? PX4 B 385 . ? 1_555 ? 
669  AR4 4 PX4 RE .   ? PX4 B 389 . ? 1_555 ? 
670  AR5 5 PX4 D  .   ? PX4 A 601 . ? 1_555 ? 
671  AR5 5 PX4 F  .   ? PX4 A 603 . ? 1_555 ? 
672  AR5 5 PX4 L  .   ? PX4 A 609 . ? 1_555 ? 
673  AR5 5 PX4 VD .   ? PX4 B 367 . ? 1_555 ? 
674  AR5 5 PX4 CE .   ? PX4 B 374 . ? 1_555 ? 
675  AR6 5 PX4 Q  .   ? PX4 A 614 . ? 1_555 ? 
676  AR6 5 PX4 OC .   ? PX4 B 334 . ? 1_555 ? 
677  AR6 5 PX4 GD .   ? PX4 B 352 . ? 1_555 ? 
678  AR6 5 PX4 QD .   ? PX4 B 362 . ? 1_555 ? 
679  AR6 5 PX4 LE .   ? PX4 B 383 . ? 1_555 ? 
680  AR7 3 PX4 XD .   ? PX4 B 369 . ? 1_555 ? 
681  AR7 3 PX4 YD .   ? PX4 B 370 . ? 1_555 ? 
682  AR7 3 PX4 GE .   ? PX4 B 378 . ? 1_555 ? 
683  AR8 5 PX4 BE .   ? PX4 B 373 . ? 1_555 ? 
684  AR8 5 PX4 EE .   ? PX4 B 376 . ? 1_555 ? 
685  AR8 5 PX4 IE .   ? PX4 B 380 . ? 1_555 ? 
686  AR8 5 PX4 SE .   ? PX4 B 390 . ? 1_555 ? 
687  AR8 5 PX4 UE .   ? PX4 B 392 . ? 1_555 ? 
688  AR9 5 PX4 N  .   ? PX4 A 611 . ? 1_555 ? 
689  AR9 5 PX4 XD .   ? PX4 B 369 . ? 1_555 ? 
690  AR9 5 PX4 GE .   ? PX4 B 378 . ? 1_555 ? 
691  AR9 5 PX4 KE .   ? PX4 B 382 . ? 1_555 ? 
692  AR9 5 PX4 VE .   ? PX4 B 393 . ? 1_555 ? 
693  AS1 5 PX4 K  .   ? PX4 A 608 . ? 1_555 ? 
694  AS1 5 PX4 M  .   ? PX4 A 610 . ? 1_555 ? 
695  AS1 5 PX4 O  .   ? PX4 A 612 . ? 1_555 ? 
696  AS1 5 PX4 HE .   ? PX4 B 379 . ? 1_555 ? 
697  AS1 5 PX4 LE .   ? PX4 B 383 . ? 1_555 ? 
698  AS2 6 PX4 G  .   ? PX4 A 604 . ? 1_555 ? 
699  AS2 6 PX4 EE .   ? PX4 B 376 . ? 1_555 ? 
700  AS2 6 PX4 PE .   ? PX4 B 387 . ? 1_555 ? 
701  AS2 6 PX4 UE .   ? PX4 B 392 . ? 1_555 ? 
702  AS2 6 PX4 VE .   ? PX4 B 393 . ? 1_555 ? 
703  AS2 6 PX4 WE .   ? PX4 B 394 . ? 1_555 ? 
704  AS3 4 PX4 KE .   ? PX4 B 382 . ? 1_555 ? 
705  AS3 4 PX4 WE .   ? PX4 B 394 . ? 1_555 ? 
706  AS3 4 PX4 FF .   ? PX4 C 303 . ? 1_555 ? 
707  AS3 4 PX4 BH .   ? PX4 C 351 . ? 1_555 ? 
708  AS4 5 PX4 G  .   ? PX4 A 604 . ? 1_555 ? 
709  AS4 5 PX4 J  .   ? PX4 A 607 . ? 1_555 ? 
710  AS4 5 PX4 PE .   ? PX4 B 387 . ? 1_555 ? 
711  AS4 5 PX4 SE .   ? PX4 B 390 . ? 1_555 ? 
712  AS4 5 PX4 WE .   ? PX4 B 394 . ? 1_555 ? 
713  AS5 4 PX4 KE .   ? PX4 B 382 . ? 1_555 ? 
714  AS5 4 PX4 QE .   ? PX4 B 388 . ? 1_555 ? 
715  AS5 4 PX4 SE .   ? PX4 B 390 . ? 1_555 ? 
716  AS5 4 PX4 WE .   ? PX4 B 394 . ? 1_555 ? 
717  AS6 6 PX4 J  .   ? PX4 A 607 . ? 1_555 ? 
718  AS6 6 PX4 N  .   ? PX4 A 611 . ? 1_555 ? 
719  AS6 6 PX4 SE .   ? PX4 B 390 . ? 1_555 ? 
720  AS6 6 PX4 TE .   ? PX4 B 391 . ? 1_555 ? 
721  AS6 6 PX4 UE .   ? PX4 B 392 . ? 1_555 ? 
722  AS6 6 PX4 VE .   ? PX4 B 393 . ? 1_555 ? 
723  AS7 2 PX4 YE .   ? PX4 B 396 . ? 1_555 ? 
724  AS7 2 PX4 IH .   ? PX4 C 358 . ? 1_555 ? 
725  AS8 3 PX4 V  .   ? PX4 A 619 . ? 1_555 ? 
726  AS8 3 PX4 XE .   ? PX4 B 395 . ? 1_555 ? 
727  AS8 3 PX4 ZE .   ? PX4 B 397 . ? 1_555 ? 
728  AS9 5 PX4 MC .   ? PX4 B 332 . ? 1_555 ? 
729  AS9 5 PX4 YE .   ? PX4 B 396 . ? 1_555 ? 
730  AS9 5 PX4 OF .   ? PX4 C 312 . ? 1_555 ? 
731  AS9 5 PX4 XG .   ? PX4 C 347 . ? 1_555 ? 
732  AS9 5 PX4 NH .   ? PX4 C 363 . ? 1_555 ? 
733  AT1 6 PX4 Z  .   ? PX4 A 623 . ? 1_555 ? 
734  AT1 6 PX4 KA .   ? PX4 A 634 . ? 1_555 ? 
735  AT1 6 PX4 LD .   ? PX4 B 357 . ? 1_555 ? 
736  AT1 6 PX4 VF .   ? PX4 C 319 . ? 1_555 ? 
737  AT1 6 PX4 LG .   ? PX4 C 335 . ? 1_555 ? 
738  AT1 6 PX4 EH .   ? PX4 C 354 . ? 1_555 ? 
739  AT2 3 PX4 GC .   ? PX4 B 326 . ? 1_555 ? 
740  AT2 3 PX4 IG .   ? PX4 C 332 . ? 1_555 ? 
741  AT2 3 PX4 HH .   ? PX4 C 357 . ? 1_555 ? 
742  AT3 4 PX4 IA .   ? PX4 A 632 . ? 1_555 ? 
743  AT3 4 PX4 CG .   ? PX4 C 326 . ? 1_555 ? 
744  AT3 4 PX4 XG .   ? PX4 C 347 . ? 1_555 ? 
745  AT3 4 PX4 NH .   ? PX4 C 363 . ? 1_555 ? 
746  AT4 4 PX4 JB .   ? PX4 B 303 . ? 1_555 ? 
747  AT4 4 PX4 OB .   ? PX4 B 308 . ? 1_555 ? 
748  AT4 4 PX4 AD .   ? PX4 B 346 . ? 1_555 ? 
749  AT4 4 PX4 SD .   ? PX4 B 364 . ? 1_555 ? 
750  AT5 5 PX4 I  .   ? PX4 A 606 . ? 1_555 ? 
751  AT5 5 PX4 HA .   ? PX4 A 631 . ? 1_555 ? 
752  AT5 5 PX4 RD .   ? PX4 B 363 . ? 1_555 ? 
753  AT5 5 PX4 TD .   ? PX4 B 365 . ? 1_555 ? 
754  AT5 5 PX4 GE .   ? PX4 B 378 . ? 1_555 ? 
755  AT6 3 PX4 SD .   ? PX4 B 364 . ? 1_555 ? 
756  AT6 3 PX4 ZD .   ? PX4 B 371 . ? 1_555 ? 
757  AT6 3 PX4 TE .   ? PX4 B 391 . ? 1_555 ? 
758  AT7 3 GLU C  22  ? GLU C 76  . ? 1_555 ? 
759  AT7 3 THR C  25  ? THR C 79  . ? 1_555 ? 
760  AT7 3 ARG C  29  ? ARG C 83  . ? 1_555 ? 
761  AT8 7 HIS C  103 ? HIS C 157 . ? 1_555 ? 
762  AT8 7 GLN C  106 ? GLN C 160 . ? 1_555 ? 
763  AT8 7 GLU C  107 ? GLU C 161 . ? 1_555 ? 
764  AT8 7 SER C  110 ? SER C 164 . ? 1_555 ? 
765  AT8 7 PX4 NF .   ? PX4 C 311 . ? 1_555 ? 
766  AT8 7 PX4 AG .   ? PX4 C 324 . ? 1_555 ? 
767  AT8 7 PX4 OG .   ? PX4 C 338 . ? 1_555 ? 
768  AT9 6 LEU B  109 ? LEU B 163 . ? 1_555 ? 
769  AT9 6 GLN C  95  ? GLN C 149 . ? 1_555 ? 
770  AT9 6 PX4 NF .   ? PX4 C 311 . ? 1_555 ? 
771  AT9 6 PX4 XF .   ? PX4 C 321 . ? 1_555 ? 
772  AT9 6 PX4 MG .   ? PX4 C 336 . ? 1_555 ? 
773  AT9 6 PX4 AH .   ? PX4 C 350 . ? 1_555 ? 
774  AU1 7 TYR B  68  ? TYR B 122 . ? 1_555 ? 
775  AU1 7 PHE B  72  ? PHE B 126 . ? 1_555 ? 
776  AU1 7 PX4 AC .   ? PX4 B 320 . ? 1_555 ? 
777  AU1 7 LEU C  127 ? LEU C 181 . ? 1_555 ? 
778  AU1 7 PX4 MF .   ? PX4 C 310 . ? 1_555 ? 
779  AU1 7 PX4 QG .   ? PX4 C 340 . ? 1_555 ? 
780  AU1 7 PX4 TG .   ? PX4 C 343 . ? 1_555 ? 
781  AU2 4 LEU B  131 ? LEU B 185 . ? 1_555 ? 
782  AU2 4 PX4 UB .   ? PX4 B 314 . ? 1_555 ? 
783  AU2 4 ARG C  84  ? ARG C 138 . ? 1_555 ? 
784  AU2 4 PX4 UF .   ? PX4 C 318 . ? 1_555 ? 
785  AU3 4 SER C  135 ? SER C 189 . ? 1_555 ? 
786  AU3 4 PX4 RF .   ? PX4 C 315 . ? 1_555 ? 
787  AU3 4 PX4 DG .   ? PX4 C 327 . ? 1_555 ? 
788  AU3 4 PX4 TG .   ? PX4 C 343 . ? 1_555 ? 
789  AU4 8 PX4 TD .   ? PX4 B 365 . ? 1_555 ? 
790  AU4 8 ARG C  117 ? ARG C 171 . ? 1_555 ? 
791  AU4 8 ALA C  120 ? ALA C 174 . ? 1_555 ? 
792  AU4 8 PX4 JF .   ? PX4 C 307 . ? 1_555 ? 
793  AU4 8 PX4 AG .   ? PX4 C 324 . ? 1_555 ? 
794  AU4 8 PX4 OG .   ? PX4 C 338 . ? 1_555 ? 
795  AU4 8 PX4 QG .   ? PX4 C 340 . ? 1_555 ? 
796  AU4 8 PX4 KH .   ? PX4 C 360 . ? 1_555 ? 
797  AU5 5 PX4 PB .   ? PX4 B 309 . ? 1_555 ? 
798  AU5 5 PX4 VB .   ? PX4 B 315 . ? 1_555 ? 
799  AU5 5 PX4 HF .   ? PX4 C 305 . ? 1_555 ? 
800  AU5 5 PX4 IF .   ? PX4 C 306 . ? 1_555 ? 
801  AU5 5 PX4 MG .   ? PX4 C 336 . ? 1_555 ? 
802  AU6 5 ALA B  164 ? ALA B 218 . ? 1_555 ? 
803  AU6 5 PX4 MC .   ? PX4 B 332 . ? 1_555 ? 
804  AU6 5 PX4 ZE .   ? PX4 B 397 . ? 1_555 ? 
805  AU6 5 LEU C  28  ? LEU C 82  . ? 1_555 ? 
806  AU6 5 PX4 QF .   ? PX4 C 314 . ? 1_555 ? 
807  AU7 6 SER C  196 ? SER C 250 . ? 1_555 ? 
808  AU7 6 PHE C  197 ? PHE C 251 . ? 1_555 ? 
809  AU7 6 LEU C  201 ? LEU C 255 . ? 1_555 ? 
810  AU7 6 PX4 FG .   ? PX4 C 329 . ? 1_555 ? 
811  AU7 6 PX4 NG .   ? PX4 C 337 . ? 1_555 ? 
812  AU7 6 PX4 EH .   ? PX4 C 354 . ? 1_555 ? 
813  AU8 4 TYR B  160 ? TYR B 214 . ? 1_555 ? 
814  AU8 4 LEU C  36  ? LEU C 90  . ? 1_555 ? 
815  AU8 4 LYS C  40  ? LYS C 94  . ? 1_555 ? 
816  AU8 4 PX4 OF .   ? PX4 C 312 . ? 1_555 ? 
817  AU9 5 PX4 LF .   ? PX4 C 309 . ? 1_555 ? 
818  AU9 5 PX4 DG .   ? PX4 C 327 . ? 1_555 ? 
819  AU9 5 PX4 TG .   ? PX4 C 343 . ? 1_555 ? 
820  AU9 5 PX4 YG .   ? PX4 C 348 . ? 1_555 ? 
821  AU9 5 PX4 DH .   ? PX4 C 353 . ? 1_555 ? 
822  AV1 6 LEU B  146 ? LEU B 200 . ? 1_555 ? 
823  AV1 6 LEU B  149 ? LEU B 203 . ? 1_555 ? 
824  AV1 6 GLN C  55  ? GLN C 109 . ? 1_555 ? 
825  AV1 6 PX4 GG .   ? PX4 C 330 . ? 1_555 ? 
826  AV1 6 PX4 SG .   ? PX4 C 342 . ? 1_555 ? 
827  AV1 6 PX4 ZG .   ? PX4 C 349 . ? 1_555 ? 
828  AV2 5 PX4 DC .   ? PX4 B 323 . ? 1_555 ? 
829  AV2 5 LEU C  168 ? LEU C 222 . ? 1_555 ? 
830  AV2 5 SER C  169 ? SER C 223 . ? 1_555 ? 
831  AV2 5 LEU C  171 ? LEU C 225 . ? 1_555 ? 
832  AV2 5 PX4 UG .   ? PX4 C 344 . ? 1_555 ? 
833  AV3 7 PX4 YB .   ? PX4 B 318 . ? 1_555 ? 
834  AV3 7 PX4 OC .   ? PX4 B 334 . ? 1_555 ? 
835  AV3 7 MET C  80  ? MET C 134 . ? 1_555 ? 
836  AV3 7 VAL C  87  ? VAL C 141 . ? 1_555 ? 
837  AV3 7 ARG C  91  ? ARG C 145 . ? 1_555 ? 
838  AV3 7 PX4 KF .   ? PX4 C 308 . ? 1_555 ? 
839  AV3 7 PX4 XF .   ? PX4 C 321 . ? 1_555 ? 
840  AV4 7 GLN B  211 ? GLN B 265 . ? 1_555 ? 
841  AV4 7 PX4 EC .   ? PX4 B 324 . ? 1_555 ? 
842  AV4 7 PX4 AF .   ? PX4 B 398 . ? 1_555 ? 
843  AV4 7 TYR C  204 ? TYR C 258 . ? 1_555 ? 
844  AV4 7 GLN C  211 ? GLN C 265 . ? 1_555 ? 
845  AV4 7 PX4 FG .   ? PX4 C 329 . ? 1_555 ? 
846  AV4 7 PX4 LG .   ? PX4 C 335 . ? 1_555 ? 
847  AV5 7 PX4 MB .   ? PX4 B 306 . ? 1_555 ? 
848  AV5 7 PX4 TB .   ? PX4 B 313 . ? 1_555 ? 
849  AV5 7 PX4 UB .   ? PX4 B 314 . ? 1_555 ? 
850  AV5 7 PX4 YB .   ? PX4 B 318 . ? 1_555 ? 
851  AV5 7 ARG C  62  ? ARG C 116 . ? 1_555 ? 
852  AV5 7 PX4 GG .   ? PX4 C 330 . ? 1_555 ? 
853  AV5 7 PX4 RG .   ? PX4 C 341 . ? 1_555 ? 
854  AV6 5 ARG C  91  ? ARG C 145 . ? 1_555 ? 
855  AV6 5 GLN C  95  ? GLN C 149 . ? 1_555 ? 
856  AV6 5 PX4 IF .   ? PX4 C 306 . ? 1_555 ? 
857  AV6 5 PX4 UF .   ? PX4 C 318 . ? 1_555 ? 
858  AV6 5 PX4 AH .   ? PX4 C 350 . ? 1_555 ? 
859  AV7 5 PX4 VC .   ? PX4 B 341 . ? 1_555 ? 
860  AV7 5 TYR C  160 ? TYR C 214 . ? 1_555 ? 
861  AV7 5 PX4 BG .   ? PX4 C 325 . ? 1_555 ? 
862  AV7 5 PX4 UG .   ? PX4 C 344 . ? 1_555 ? 
863  AV7 5 PX4 BH .   ? PX4 C 351 . ? 1_555 ? 
864  AV8 6 ASN B  152 ? ASN B 206 . ? 1_555 ? 
865  AV8 6 TYR B  160 ? TYR B 214 . ? 1_555 ? 
866  AV8 6 VAL C  43  ? VAL C 97  . ? 1_555 ? 
867  AV8 6 GLN C  44  ? GLN C 98  . ? 1_555 ? 
868  AV8 6 GLN C  51  ? GLN C 105 . ? 1_555 ? 
869  AV8 6 PX4 SG .   ? PX4 C 342 . ? 1_555 ? 
870  AV9 7 PX4 TD .   ? PX4 B 365 . ? 1_555 ? 
871  AV9 7 GLN C  106 ? GLN C 160 . ? 1_555 ? 
872  AV9 7 MET C  116 ? MET C 170 . ? 1_555 ? 
873  AV9 7 ARG C  117 ? ARG C 171 . ? 1_555 ? 
874  AV9 7 PX4 HF .   ? PX4 C 305 . ? 1_555 ? 
875  AV9 7 PX4 MF .   ? PX4 C 310 . ? 1_555 ? 
876  AV9 7 PX4 OG .   ? PX4 C 338 . ? 1_555 ? 
877  AW1 6 PX4 HB .   ? PX4 B 301 . ? 1_555 ? 
878  AW1 6 GLY C  153 ? GLY C 207 . ? 1_555 ? 
879  AW1 6 ARG C  156 ? ARG C 210 . ? 1_555 ? 
880  AW1 6 PX4 YF .   ? PX4 C 322 . ? 1_555 ? 
881  AW1 6 PX4 KG .   ? PX4 C 334 . ? 1_555 ? 
882  AW1 6 PX4 JH .   ? PX4 C 359 . ? 1_555 ? 
883  AW2 6 PHE B  193 ? PHE B 247 . ? 1_555 ? 
884  AW2 6 PX4 CF .   ? PX4 B 400 . ? 1_555 ? 
885  AW2 6 ARG C  7   ? ARG C 61  . ? 1_555 ? 
886  AW2 6 THR C  14  ? THR C 68  . ? 1_555 ? 
887  AW2 6 GLN C  15  ? GLN C 69  . ? 1_555 ? 
888  AW2 6 TRP C  18  ? TRP C 72  . ? 1_555 ? 
889  AW3 3 PX4 LF .   ? PX4 C 309 . ? 1_555 ? 
890  AW3 3 PX4 RF .   ? PX4 C 315 . ? 1_555 ? 
891  AW3 3 PX4 JH .   ? PX4 C 359 . ? 1_555 ? 
892  AW4 5 LEU C  182 ? LEU C 236 . ? 1_555 ? 
893  AW4 5 LEU C  186 ? LEU C 240 . ? 1_555 ? 
894  AW4 5 PX4 HG .   ? PX4 C 331 . ? 1_555 ? 
895  AW4 5 PX4 JG .   ? PX4 C 333 . ? 1_555 ? 
896  AW4 5 PX4 GH .   ? PX4 C 356 . ? 1_555 ? 
897  AW5 7 PX4 Z  .   ? PX4 A 623 . ? 1_555 ? 
898  AW5 7 PX4 FC .   ? PX4 B 325 . ? 1_555 ? 
899  AW5 7 LEU C  201 ? LEU C 255 . ? 1_555 ? 
900  AW5 7 TYR C  204 ? TYR C 258 . ? 1_555 ? 
901  AW5 7 PX4 PF .   ? PX4 C 313 . ? 1_555 ? 
902  AW5 7 PX4 VF .   ? PX4 C 319 . ? 1_555 ? 
903  AW5 7 PX4 EH .   ? PX4 C 354 . ? 1_555 ? 
904  AW6 5 PX4 TB .   ? PX4 B 313 . ? 1_555 ? 
905  AW6 5 PX4 KC .   ? PX4 B 330 . ? 1_555 ? 
906  AW6 5 GLU C  59  ? GLU C 113 . ? 1_555 ? 
907  AW6 5 PX4 SF .   ? PX4 C 316 . ? 1_555 ? 
908  AW6 5 PX4 WF .   ? PX4 C 320 . ? 1_555 ? 
909  AW7 6 PHE B  3   ? PHE B 57  . ? 1_555 ? 
910  AW7 6 PX4 LC .   ? PX4 B 331 . ? 1_555 ? 
911  AW7 6 VAL C  189 ? VAL C 243 . ? 1_555 ? 
912  AW7 6 LEU C  190 ? LEU C 244 . ? 1_555 ? 
913  AW7 6 PX4 EG .   ? PX4 C 328 . ? 1_555 ? 
914  AW7 6 PX4 NG .   ? PX4 C 337 . ? 1_555 ? 
915  AW8 3 PX4 BF .   ? PX4 B 399 . ? 1_555 ? 
916  AW8 3 PX4 LG .   ? PX4 C 335 . ? 1_555 ? 
917  AW8 3 PX4 HH .   ? PX4 C 357 . ? 1_555 ? 
918  AW9 5 PX4 SB .   ? PX4 B 312 . ? 1_555 ? 
919  AW9 5 PX4 KD .   ? PX4 B 356 . ? 1_555 ? 
920  AW9 5 SER C  172 ? SER C 226 . ? 1_555 ? 
921  AW9 5 PX4 EG .   ? PX4 C 328 . ? 1_555 ? 
922  AW9 5 PX4 CH .   ? PX4 C 352 . ? 1_555 ? 
923  AX1 8 TRP B  54  ? TRP B 108 . ? 1_555 ? 
924  AX1 8 PX4 HB .   ? PX4 B 301 . ? 1_555 ? 
925  AX1 8 PX4 JB .   ? PX4 B 303 . ? 1_555 ? 
926  AX1 8 LEU C  146 ? LEU C 200 . ? 1_555 ? 
927  AX1 8 LEU C  149 ? LEU C 203 . ? 1_555 ? 
928  AX1 8 ARG C  156 ? ARG C 210 . ? 1_555 ? 
929  AX1 8 PX4 BG .   ? PX4 C 325 . ? 1_555 ? 
930  AX1 8 PX4 JH .   ? PX4 C 359 . ? 1_555 ? 
931  AX2 6 PX4 HC .   ? PX4 B 327 . ? 1_555 ? 
932  AX2 6 PX4 AF .   ? PX4 B 398 . ? 1_555 ? 
933  AX2 6 SER C  1   ? SER C 55  . ? 1_555 ? 
934  AX2 6 GLN C  211 ? GLN C 265 . ? 1_555 ? 
935  AX2 6 PX4 VF .   ? PX4 C 319 . ? 1_555 ? 
936  AX2 6 PX4 IG .   ? PX4 C 332 . ? 1_555 ? 
937  AX3 4 PX4 Q  .   ? PX4 A 614 . ? 1_555 ? 
938  AX3 4 PX4 IF .   ? PX4 C 306 . ? 1_555 ? 
939  AX3 4 PX4 NF .   ? PX4 C 311 . ? 1_555 ? 
940  AX3 4 PX4 VG .   ? PX4 C 345 . ? 1_555 ? 
941  AX4 6 PX4 S  .   ? PX4 A 616 . ? 1_555 ? 
942  AX4 6 PX4 FC .   ? PX4 B 325 . ? 1_555 ? 
943  AX4 6 PX4 PF .   ? PX4 C 313 . ? 1_555 ? 
944  AX4 6 PX4 HG .   ? PX4 C 331 . ? 1_555 ? 
945  AX4 6 PX4 EH .   ? PX4 C 354 . ? 1_555 ? 
946  AX4 6 PX4 GH .   ? PX4 C 356 . ? 1_555 ? 
947  AX5 6 PX4 P  .   ? PX4 A 613 . ? 1_555 ? 
948  AX5 6 ARG C  117 ? ARG C 171 . ? 1_555 ? 
949  AX5 6 PX4 HF .   ? PX4 C 305 . ? 1_555 ? 
950  AX5 6 PX4 MF .   ? PX4 C 310 . ? 1_555 ? 
951  AX5 6 PX4 AG .   ? PX4 C 324 . ? 1_555 ? 
952  AX5 6 PX4 QG .   ? PX4 C 340 . ? 1_555 ? 
953  AX6 5 PX4 T  .   ? PX4 A 617 . ? 1_555 ? 
954  AX6 5 PX4 Y  .   ? PX4 A 622 . ? 1_555 ? 
955  AX6 5 PX4 MB .   ? PX4 B 306 . ? 1_555 ? 
956  AX6 5 PX4 UB .   ? PX4 B 314 . ? 1_555 ? 
957  AX6 5 PX4 RG .   ? PX4 C 341 . ? 1_555 ? 
958  AX7 6 PX4 YD .   ? PX4 B 370 . ? 1_555 ? 
959  AX7 6 PX4 JF .   ? PX4 C 307 . ? 1_555 ? 
960  AX7 6 PX4 MF .   ? PX4 C 310 . ? 1_555 ? 
961  AX7 6 PX4 OG .   ? PX4 C 338 . ? 1_555 ? 
962  AX7 6 PX4 TG .   ? PX4 C 343 . ? 1_555 ? 
963  AX7 6 PX4 KH .   ? PX4 C 360 . ? 1_555 ? 
964  AX8 3 PX4 TC .   ? PX4 B 339 . ? 1_555 ? 
965  AX8 3 PX4 WF .   ? PX4 C 320 . ? 1_555 ? 
966  AX8 3 PX4 PG .   ? PX4 C 339 . ? 1_555 ? 
967  AX9 4 PX4 BC .   ? PX4 B 321 . ? 1_555 ? 
968  AX9 4 GLN C  51  ? GLN C 105 . ? 1_555 ? 
969  AX9 4 PX4 SF .   ? PX4 C 316 . ? 1_555 ? 
970  AX9 4 PX4 ZF .   ? PX4 C 323 . ? 1_555 ? 
971  AY1 6 PX4 RB .   ? PX4 B 311 . ? 1_555 ? 
972  AY1 6 PX4 JF .   ? PX4 C 307 . ? 1_555 ? 
973  AY1 6 PX4 LF .   ? PX4 C 309 . ? 1_555 ? 
974  AY1 6 PX4 RF .   ? PX4 C 315 . ? 1_555 ? 
975  AY1 6 PX4 QG .   ? PX4 C 340 . ? 1_555 ? 
976  AY1 6 PX4 DH .   ? PX4 C 353 . ? 1_555 ? 
977  AY2 5 PX4 TF .   ? PX4 C 317 . ? 1_555 ? 
978  AY2 5 PX4 YF .   ? PX4 C 322 . ? 1_555 ? 
979  AY2 5 PX4 BH .   ? PX4 C 351 . ? 1_555 ? 
980  AY2 5 PX4 CH .   ? PX4 C 352 . ? 1_555 ? 
981  AY2 5 PX4 OH .   ? PX4 C 364 . ? 1_555 ? 
982  AY3 2 PX4 P  .   ? PX4 A 613 . ? 1_555 ? 
983  AY3 2 PX4 MG .   ? PX4 C 336 . ? 1_555 ? 
984  AY4 7 PX4 S  .   ? PX4 A 616 . ? 1_555 ? 
985  AY4 7 PX4 CA .   ? PX4 A 626 . ? 1_555 ? 
986  AY4 7 LEU C  179 ? LEU C 233 . ? 1_555 ? 
987  AY4 7 LEU C  182 ? LEU C 236 . ? 1_555 ? 
988  AY4 7 PX4 CH .   ? PX4 C 352 . ? 1_555 ? 
989  AY4 7 PX4 GH .   ? PX4 C 356 . ? 1_555 ? 
990  AY4 7 PX4 MH .   ? PX4 C 362 . ? 1_555 ? 
991  AY5 4 PX4 ZE .   ? PX4 B 397 . ? 1_555 ? 
992  AY5 4 PX4 CF .   ? PX4 B 400 . ? 1_555 ? 
993  AY5 4 TRP C  18  ? TRP C 72  . ? 1_555 ? 
994  AY5 4 PX4 NH .   ? PX4 C 363 . ? 1_555 ? 
995  AY6 5 PX4 W  .   ? PX4 A 620 . ? 1_555 ? 
996  AY6 5 PX4 XD .   ? PX4 B 369 . ? 1_555 ? 
997  AY6 5 PX4 RF .   ? PX4 C 315 . ? 1_555 ? 
998  AY6 5 PX4 DH .   ? PX4 C 353 . ? 1_555 ? 
999  AY6 5 PX4 JH .   ? PX4 C 359 . ? 1_555 ? 
1000 AY7 4 PX4 Y  .   ? PX4 A 622 . ? 1_555 ? 
1001 AY7 4 PX4 LA .   ? PX4 A 635 . ? 1_555 ? 
1002 AY7 4 PX4 SF .   ? PX4 C 316 . ? 1_555 ? 
1003 AY7 4 PX4 LH .   ? PX4 C 361 . ? 1_555 ? 
1004 AY8 4 PX4 Q  .   ? PX4 A 614 . ? 1_555 ? 
1005 AY8 4 PX4 IF .   ? PX4 C 306 . ? 1_555 ? 
1006 AY8 4 PX4 XF .   ? PX4 C 321 . ? 1_555 ? 
1007 AY8 4 PX4 FH .   ? PX4 C 355 . ? 1_555 ? 
1008 AY9 5 PX4 W  .   ? PX4 A 620 . ? 1_555 ? 
1009 AY9 5 PX4 TE .   ? PX4 B 391 . ? 1_555 ? 
1010 AY9 5 PX4 YF .   ? PX4 C 322 . ? 1_555 ? 
1011 AY9 5 PX4 UG .   ? PX4 C 344 . ? 1_555 ? 
1012 AY9 5 PX4 JH .   ? PX4 C 359 . ? 1_555 ? 
1013 AZ1 5 PX4 VC .   ? PX4 B 341 . ? 1_555 ? 
1014 AZ1 5 PX4 JG .   ? PX4 C 333 . ? 1_555 ? 
1015 AZ1 5 PX4 UG .   ? PX4 C 344 . ? 1_555 ? 
1016 AZ1 5 PX4 WG .   ? PX4 C 346 . ? 1_555 ? 
1017 AZ1 5 PX4 OH .   ? PX4 C 364 . ? 1_555 ? 
1018 AZ2 3 PX4 RF .   ? PX4 C 315 . ? 1_555 ? 
1019 AZ2 3 PX4 TG .   ? PX4 C 343 . ? 1_555 ? 
1020 AZ2 3 PX4 YG .   ? PX4 C 348 . ? 1_555 ? 
1021 AZ3 5 PX4 Z  .   ? PX4 A 623 . ? 1_555 ? 
1022 AZ3 5 PX4 AF .   ? PX4 B 398 . ? 1_555 ? 
1023 AZ3 5 PX4 PF .   ? PX4 C 313 . ? 1_555 ? 
1024 AZ3 5 PX4 FG .   ? PX4 C 329 . ? 1_555 ? 
1025 AZ3 5 PX4 NG .   ? PX4 C 337 . ? 1_555 ? 
1026 AZ4 4 PX4 Q  .   ? PX4 A 614 . ? 1_555 ? 
1027 AZ4 4 PX4 T  .   ? PX4 A 617 . ? 1_555 ? 
1028 AZ4 4 PX4 BA .   ? PX4 A 625 . ? 1_555 ? 
1029 AZ4 4 PX4 AH .   ? PX4 C 350 . ? 1_555 ? 
1030 AZ5 5 PX4 S  .   ? PX4 A 616 . ? 1_555 ? 
1031 AZ5 5 PX4 EG .   ? PX4 C 328 . ? 1_555 ? 
1032 AZ5 5 PX4 NG .   ? PX4 C 337 . ? 1_555 ? 
1033 AZ5 5 PX4 WG .   ? PX4 C 346 . ? 1_555 ? 
1034 AZ5 5 PX4 MH .   ? PX4 C 362 . ? 1_555 ? 
1035 AZ6 3 PX4 AA .   ? PX4 A 624 . ? 1_555 ? 
1036 AZ6 3 PX4 BF .   ? PX4 B 399 . ? 1_555 ? 
1037 AZ6 3 PX4 IG .   ? PX4 C 332 . ? 1_555 ? 
1038 AZ7 4 PX4 DA .   ? PX4 A 627 . ? 1_555 ? 
1039 AZ7 4 PX4 WB .   ? PX4 B 316 . ? 1_555 ? 
1040 AZ7 4 PX4 XE .   ? PX4 B 395 . ? 1_555 ? 
1041 AZ7 4 PX4 LH .   ? PX4 C 361 . ? 1_555 ? 
1042 AZ8 6 PX4 OB .   ? PX4 B 308 . ? 1_555 ? 
1043 AZ8 6 PX4 BG .   ? PX4 C 325 . ? 1_555 ? 
1044 AZ8 6 PX4 DG .   ? PX4 C 327 . ? 1_555 ? 
1045 AZ8 6 PX4 KG .   ? PX4 C 334 . ? 1_555 ? 
1046 AZ8 6 PX4 YG .   ? PX4 C 348 . ? 1_555 ? 
1047 AZ8 6 PX4 BH .   ? PX4 C 351 . ? 1_555 ? 
1048 AZ9 3 PX4 R  .   ? PX4 A 615 . ? 1_555 ? 
1049 AZ9 3 PX4 MF .   ? PX4 C 310 . ? 1_555 ? 
1050 AZ9 3 PX4 QG .   ? PX4 C 340 . ? 1_555 ? 
1051 BC1 3 PX4 DA .   ? PX4 A 627 . ? 1_555 ? 
1052 BC1 3 PX4 ZG .   ? PX4 C 349 . ? 1_555 ? 
1053 BC1 3 PX4 IH .   ? PX4 C 358 . ? 1_555 ? 
1054 BC2 6 PX4 CA .   ? PX4 A 626 . ? 1_555 ? 
1055 BC2 6 PX4 JA .   ? PX4 A 633 . ? 1_555 ? 
1056 BC2 6 PX4 OA .   ? PX4 A 638 . ? 1_555 ? 
1057 BC2 6 PX4 DD .   ? PX4 B 349 . ? 1_555 ? 
1058 BC2 6 PX4 WG .   ? PX4 C 346 . ? 1_555 ? 
1059 BC2 6 PX4 GH .   ? PX4 C 356 . ? 1_555 ? 
1060 BC3 5 PX4 V  .   ? PX4 A 619 . ? 1_555 ? 
1061 BC3 5 PX4 IA .   ? PX4 A 632 . ? 1_555 ? 
1062 BC3 5 PX4 ZE .   ? PX4 B 397 . ? 1_555 ? 
1063 BC3 5 PX4 CF .   ? PX4 B 400 . ? 1_555 ? 
1064 BC3 5 PX4 XG .   ? PX4 C 347 . ? 1_555 ? 
1065 BC4 3 PX4 JA .   ? PX4 A 633 . ? 1_555 ? 
1066 BC4 3 PX4 UG .   ? PX4 C 344 . ? 1_555 ? 
1067 BC4 3 PX4 CH .   ? PX4 C 352 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6CM1 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N  N    . PRO A  1 1   ? 6.673   -22.457 37.583  1.00 0.00 ?  316 PRO A N    1  
ATOM   2      C  CA   . PRO A  1 1   ? 6.283   -21.614 38.744  1.00 0.00 ?  316 PRO A CA   1  
ATOM   3      C  C    . PRO A  1 1   ? 4.908   -22.088 39.276  1.00 0.00 ?  316 PRO A C    1  
ATOM   4      O  O    . PRO A  1 1   ? 4.032   -22.466 38.459  1.00 0.00 ?  316 PRO A O    1  
ATOM   5      C  CB   . PRO A  1 1   ? 6.316   -20.184 38.134  1.00 0.00 ?  316 PRO A CB   1  
ATOM   6      C  CG   . PRO A  1 1   ? 5.704   -20.489 36.707  1.00 0.00 ?  316 PRO A CG   1  
ATOM   7      C  CD   . PRO A  1 1   ? 6.188   -21.874 36.271  1.00 0.00 ?  316 PRO A CD   1  
ATOM   8      H  H2   . PRO A  1 1   ? 6.239   -23.353 37.731  1.00 0.00 ?  316 PRO A H2   1  
ATOM   9      H  H3   . PRO A  1 1   ? 7.622   -22.778 37.492  1.00 0.00 ?  316 PRO A H3   1  
ATOM   10     H  HA   . PRO A  1 1   ? 7.092   -21.813 39.431  1.00 0.00 ?  316 PRO A HA   1  
ATOM   11     H  HB2  . PRO A  1 1   ? 5.665   -19.525 38.747  1.00 0.00 ?  316 PRO A HB2  1  
ATOM   12     H  HB3  . PRO A  1 1   ? 7.316   -19.728 37.968  1.00 0.00 ?  316 PRO A HB3  1  
ATOM   13     H  HG2  . PRO A  1 1   ? 4.601   -20.560 36.817  1.00 0.00 ?  316 PRO A HG2  1  
ATOM   14     H  HG3  . PRO A  1 1   ? 5.920   -19.610 36.063  1.00 0.00 ?  316 PRO A HG3  1  
ATOM   15     H  HD2  . PRO A  1 1   ? 5.390   -22.524 35.851  1.00 0.00 ?  316 PRO A HD2  1  
ATOM   16     H  HD3  . PRO A  1 1   ? 7.122   -21.841 35.671  1.00 0.00 ?  316 PRO A HD3  1  
ATOM   17     N  N    . ASN A  1 2   ? 4.681   -21.988 40.617  1.00 0.00 ?  317 ASN A N    1  
ATOM   18     C  CA   . ASN A  1 2   ? 3.453   -22.523 41.199  1.00 0.00 ?  317 ASN A CA   1  
ATOM   19     C  C    . ASN A  1 2   ? 2.631   -21.351 41.638  1.00 0.00 ?  317 ASN A C    1  
ATOM   20     O  O    . ASN A  1 2   ? 3.135   -20.436 42.269  1.00 0.00 ?  317 ASN A O    1  
ATOM   21     C  CB   . ASN A  1 2   ? 3.835   -23.551 42.317  1.00 0.00 ?  317 ASN A CB   1  
ATOM   22     C  CG   . ASN A  1 2   ? 2.696   -24.159 43.113  1.00 0.00 ?  317 ASN A CG   1  
ATOM   23     O  OD1  . ASN A  1 2   ? 1.519   -23.650 43.161  1.00 0.00 ?  317 ASN A OD1  1  
ATOM   24     N  ND2  . ASN A  1 2   ? 2.951   -25.295 43.806  1.00 0.00 ?  317 ASN A ND2  1  
ATOM   25     H  H    . ASN A  1 2   ? 5.466   -21.849 41.216  1.00 0.00 ?  317 ASN A H    1  
ATOM   26     H  HA   . ASN A  1 2   ? 2.882   -22.982 40.406  1.00 0.00 ?  317 ASN A HA   1  
ATOM   27     H  HB2  . ASN A  1 2   ? 4.452   -24.317 41.800  1.00 0.00 ?  317 ASN A HB2  1  
ATOM   28     H  HB3  . ASN A  1 2   ? 4.565   -23.040 42.980  1.00 0.00 ?  317 ASN A HB3  1  
ATOM   29     H  HD21 . ASN A  1 2   ? 2.123   -25.821 44.000  1.00 0.00 ?  317 ASN A HD21 1  
ATOM   30     H  HD22 . ASN A  1 2   ? 3.881   -25.594 44.020  1.00 0.00 ?  317 ASN A HD22 1  
ATOM   31     N  N    . ILE A  1 3   ? 1.351   -21.285 41.298  1.00 0.00 ?  318 ILE A N    1  
ATOM   32     C  CA   . ILE A  1 3   ? 0.385   -20.232 41.598  1.00 0.00 ?  318 ILE A CA   1  
ATOM   33     C  C    . ILE A  1 3   ? 0.336   -19.933 43.098  1.00 0.00 ?  318 ILE A C    1  
ATOM   34     O  O    . ILE A  1 3   ? 0.383   -18.726 43.480  1.00 0.00 ?  318 ILE A O    1  
ATOM   35     C  CB   . ILE A  1 3   ? -0.976  -20.539 40.998  1.00 0.00 ?  318 ILE A CB   1  
ATOM   36     C  CG1  . ILE A  1 3   ? -1.945  -19.379 41.085  1.00 0.00 ?  318 ILE A CG1  1  
ATOM   37     C  CG2  . ILE A  1 3   ? -1.646  -21.771 41.665  1.00 0.00 ?  318 ILE A CG2  1  
ATOM   38     C  CD1  . ILE A  1 3   ? -1.632  -18.440 39.987  1.00 0.00 ?  318 ILE A CD1  1  
ATOM   39     H  H    . ILE A  1 3   ? 0.939   -21.998 40.735  1.00 0.00 ?  318 ILE A H    1  
ATOM   40     H  HA   . ILE A  1 3   ? 0.820   -19.382 41.094  1.00 0.00 ?  318 ILE A HA   1  
ATOM   41     H  HB   . ILE A  1 3   ? -0.849  -20.838 39.935  1.00 0.00 ?  318 ILE A HB   1  
ATOM   42     H  HG12 . ILE A  1 3   ? -2.941  -19.849 40.940  1.00 0.00 ?  318 ILE A HG12 1  
ATOM   43     H  HG13 . ILE A  1 3   ? -1.862  -18.989 42.122  1.00 0.00 ?  318 ILE A HG13 1  
ATOM   44     H  HG21 . ILE A  1 3   ? -1.967  -21.690 42.726  1.00 0.00 ?  318 ILE A HG21 1  
ATOM   45     H  HG22 . ILE A  1 3   ? -0.972  -22.653 41.618  1.00 0.00 ?  318 ILE A HG22 1  
ATOM   46     H  HG23 . ILE A  1 3   ? -2.558  -21.968 41.062  1.00 0.00 ?  318 ILE A HG23 1  
ATOM   47     H  HD11 . ILE A  1 3   ? -0.567  -18.121 40.004  1.00 0.00 ?  318 ILE A HD11 1  
ATOM   48     H  HD12 . ILE A  1 3   ? -2.235  -17.507 40.028  1.00 0.00 ?  318 ILE A HD12 1  
ATOM   49     H  HD13 . ILE A  1 3   ? -1.941  -18.854 39.004  1.00 0.00 ?  318 ILE A HD13 1  
ATOM   50     N  N    . CYS A  1 4   ? 0.396   -20.954 43.949  1.00 0.00 ?  319 CYS A N    1  
ATOM   51     C  CA   . CYS A  1 4   ? 0.336   -20.807 45.421  1.00 0.00 ?  319 CYS A CA   1  
ATOM   52     C  C    . CYS A  1 4   ? 1.674   -20.371 45.986  1.00 0.00 ?  319 CYS A C    1  
ATOM   53     O  O    . CYS A  1 4   ? 1.738   -19.696 47.081  1.00 0.00 ?  319 CYS A O    1  
ATOM   54     C  CB   . CYS A  1 4   ? -0.001  -22.259 45.926  1.00 0.00 ?  319 CYS A CB   1  
ATOM   55     S  SG   . CYS A  1 4   ? -0.226  -22.231 47.753  1.00 0.00 ?  319 CYS A SG   1  
ATOM   56     H  H    . CYS A  1 4   ? 0.489   -21.829 43.480  1.00 0.00 ?  319 CYS A H    1  
ATOM   57     H  HA   . CYS A  1 4   ? -0.463  -20.124 45.671  1.00 0.00 ?  319 CYS A HA   1  
ATOM   58     H  HB2  . CYS A  1 4   ? -0.922  -22.661 45.451  1.00 0.00 ?  319 CYS A HB2  1  
ATOM   59     H  HB3  . CYS A  1 4   ? 0.842   -22.912 45.615  1.00 0.00 ?  319 CYS A HB3  1  
ATOM   60     H  HG   . CYS A  1 4   ? 1.035   -21.923 48.017  1.00 0.00 ?  319 CYS A HG   1  
ATOM   61     N  N    . ASP A  1 5   ? 2.770   -20.556 45.263  1.00 0.00 ?  320 ASP A N    1  
ATOM   62     C  CA   . ASP A  1 5   ? 4.075   -19.933 45.598  1.00 0.00 ?  320 ASP A CA   1  
ATOM   63     C  C    . ASP A  1 5   ? 4.187   -18.434 45.363  1.00 0.00 ?  320 ASP A C    1  
ATOM   64     O  O    . ASP A  1 5   ? 5.119   -17.844 45.933  1.00 0.00 ?  320 ASP A O    1  
ATOM   65     C  CB   . ASP A  1 5   ? 5.242   -20.705 44.986  1.00 0.00 ?  320 ASP A CB   1  
ATOM   66     C  CG   . ASP A  1 5   ? 5.389   -22.119 45.590  1.00 0.00 ?  320 ASP A CG   1  
ATOM   67     O  OD1  . ASP A  1 5   ? 4.956   -22.373 46.697  1.00 0.00 ?  320 ASP A OD1  1  
ATOM   68     O  OD2  . ASP A  1 5   ? 6.235   -22.884 44.991  1.00 0.00 -1 320 ASP A OD2  1  
ATOM   69     H  H    . ASP A  1 5   ? 2.694   -21.086 44.421  1.00 0.00 ?  320 ASP A H    1  
ATOM   70     H  HA   . ASP A  1 5   ? 4.219   -20.030 46.664  1.00 0.00 ?  320 ASP A HA   1  
ATOM   71     H  HB2  . ASP A  1 5   ? 5.125   -20.729 43.882  1.00 0.00 ?  320 ASP A HB2  1  
ATOM   72     H  HB3  . ASP A  1 5   ? 6.168   -20.097 45.077  1.00 0.00 ?  320 ASP A HB3  1  
ATOM   73     N  N    . GLY A  1 6   ? 3.252   -17.907 44.644  1.00 0.00 ?  321 GLY A N    1  
ATOM   74     C  CA   . GLY A  1 6   ? 3.062   -16.460 44.507  1.00 0.00 ?  321 GLY A CA   1  
ATOM   75     C  C    . GLY A  1 6   ? 4.226   -15.749 43.935  1.00 0.00 ?  321 GLY A C    1  
ATOM   76     O  O    . GLY A  1 6   ? 4.964   -16.306 43.147  1.00 0.00 ?  321 GLY A O    1  
ATOM   77     H  H    . GLY A  1 6   ? 2.469   -18.453 44.357  1.00 0.00 ?  321 GLY A H    1  
ATOM   78     H  HA2  . GLY A  1 6   ? 2.217   -16.234 43.874  1.00 0.00 ?  321 GLY A HA2  1  
ATOM   79     H  HA3  . GLY A  1 6   ? 2.839   -16.140 45.514  1.00 0.00 ?  321 GLY A HA3  1  
ATOM   80     N  N    . ASN A  1 7   ? 4.414   -14.433 44.208  1.00 0.00 ?  322 ASN A N    1  
ATOM   81     C  CA   . ASN A  1 7   ? 5.478   -13.582 43.757  1.00 0.00 ?  322 ASN A CA   1  
ATOM   82     C  C    . ASN A  1 7   ? 5.411   -13.331 42.246  1.00 0.00 ?  322 ASN A C    1  
ATOM   83     O  O    . ASN A  1 7   ? 6.432   -13.330 41.550  1.00 0.00 ?  322 ASN A O    1  
ATOM   84     C  CB   . ASN A  1 7   ? 6.862   -14.215 44.181  1.00 0.00 ?  322 ASN A CB   1  
ATOM   85     C  CG   . ASN A  1 7   ? 6.868   -14.175 45.689  1.00 0.00 ?  322 ASN A CG   1  
ATOM   86     O  OD1  . ASN A  1 7   ? 6.468   -13.206 46.270  1.00 0.00 ?  322 ASN A OD1  1  
ATOM   87     N  ND2  . ASN A  1 7   ? 7.230   -15.245 46.394  1.00 0.00 ?  322 ASN A ND2  1  
ATOM   88     H  H    . ASN A  1 7   ? 3.866   -14.007 44.924  1.00 0.00 ?  322 ASN A H    1  
ATOM   89     H  HA   . ASN A  1 7   ? 5.374   -12.615 44.227  1.00 0.00 ?  322 ASN A HA   1  
ATOM   90     H  HB2  . ASN A  1 7   ? 6.991   -15.264 43.837  1.00 0.00 ?  322 ASN A HB2  1  
ATOM   91     H  HB3  . ASN A  1 7   ? 7.703   -13.585 43.822  1.00 0.00 ?  322 ASN A HB3  1  
ATOM   92     H  HD21 . ASN A  1 7   ? 7.358   -15.202 47.385  1.00 0.00 ?  322 ASN A HD21 1  
ATOM   93     H  HD22 . ASN A  1 7   ? 7.486   -16.100 45.943  1.00 0.00 ?  322 ASN A HD22 1  
ATOM   94     N  N    . PHE A  1 8   ? 4.195   -13.117 41.767  1.00 0.00 ?  323 PHE A N    1  
ATOM   95     C  CA   . PHE A  1 8   ? 3.917   -12.649 40.402  1.00 0.00 ?  323 PHE A CA   1  
ATOM   96     C  C    . PHE A  1 8   ? 4.614   -11.309 39.951  1.00 0.00 ?  323 PHE A C    1  
ATOM   97     O  O    . PHE A  1 8   ? 4.666   -10.355 40.746  1.00 0.00 ?  323 PHE A O    1  
ATOM   98     C  CB   . PHE A  1 8   ? 2.383   -12.628 40.119  1.00 0.00 ?  323 PHE A CB   1  
ATOM   99     C  CG   . PHE A  1 8   ? 1.714   -13.838 40.697  1.00 0.00 ?  323 PHE A CG   1  
ATOM   100    C  CD1  . PHE A  1 8   ? 2.041   -15.129 40.382  1.00 0.00 ?  323 PHE A CD1  1  
ATOM   101    C  CD2  . PHE A  1 8   ? 0.631   -13.514 41.549  1.00 0.00 ?  323 PHE A CD2  1  
ATOM   102    C  CE1  . PHE A  1 8   ? 1.206   -16.125 40.840  1.00 0.00 ?  323 PHE A CE1  1  
ATOM   103    C  CE2  . PHE A  1 8   ? -0.201  -14.529 42.134  1.00 0.00 ?  323 PHE A CE2  1  
ATOM   104    C  CZ   . PHE A  1 8   ? 0.165   -15.886 41.720  1.00 0.00 ?  323 PHE A CZ   1  
ATOM   105    H  H    . PHE A  1 8   ? 3.426   -13.190 42.397  1.00 0.00 ?  323 PHE A H    1  
ATOM   106    H  HA   . PHE A  1 8   ? 4.288   -13.416 39.739  1.00 0.00 ?  323 PHE A HA   1  
ATOM   107    H  HB2  . PHE A  1 8   ? 1.947   -11.646 40.403  1.00 0.00 ?  323 PHE A HB2  1  
ATOM   108    H  HB3  . PHE A  1 8   ? 2.136   -12.545 39.039  1.00 0.00 ?  323 PHE A HB3  1  
ATOM   109    H  HD1  . PHE A  1 8   ? 2.718   -15.445 39.601  1.00 0.00 ?  323 PHE A HD1  1  
ATOM   110    H  HD2  . PHE A  1 8   ? 0.454   -12.459 41.696  1.00 0.00 ?  323 PHE A HD2  1  
ATOM   111    H  HE1  . PHE A  1 8   ? 1.326   -17.128 40.459  1.00 0.00 ?  323 PHE A HE1  1  
ATOM   112    H  HE2  . PHE A  1 8   ? -1.021  -14.268 42.786  1.00 0.00 ?  323 PHE A HE2  1  
ATOM   113    H  HZ   . PHE A  1 8   ? -0.494  -16.719 41.913  1.00 0.00 ?  323 PHE A HZ   1  
ATOM   114    N  N    . ASP A  1 9   ? 5.135   -11.303 38.669  1.00 0.00 ?  324 ASP A N    1  
ATOM   115    C  CA   . ASP A  1 9   ? 5.686   -10.107 38.099  1.00 0.00 ?  324 ASP A CA   1  
ATOM   116    C  C    . ASP A  1 9   ? 4.579   -9.136  37.606  1.00 0.00 ?  324 ASP A C    1  
ATOM   117    O  O    . ASP A  1 9   ? 4.720   -7.950  37.578  1.00 0.00 ?  324 ASP A O    1  
ATOM   118    C  CB   . ASP A  1 9   ? 6.473   -10.381 36.776  1.00 0.00 ?  324 ASP A CB   1  
ATOM   119    C  CG   . ASP A  1 9   ? 7.781   -10.993 37.136  1.00 0.00 ?  324 ASP A CG   1  
ATOM   120    O  OD1  . ASP A  1 9   ? 8.435   -10.515 38.101  1.00 0.00 ?  324 ASP A OD1  1  
ATOM   121    O  OD2  . ASP A  1 9   ? 8.164   -11.908 36.396  1.00 0.00 -1 324 ASP A OD2  1  
ATOM   122    H  H    . ASP A  1 9   ? 5.076   -12.039 37.999  1.00 0.00 ?  324 ASP A H    1  
ATOM   123    H  HA   . ASP A  1 9   ? 6.109   -9.447  38.843  1.00 0.00 ?  324 ASP A HA   1  
ATOM   124    H  HB2  . ASP A  1 9   ? 5.932   -10.986 36.018  1.00 0.00 ?  324 ASP A HB2  1  
ATOM   125    H  HB3  . ASP A  1 9   ? 6.716   -9.435  36.246  1.00 0.00 ?  324 ASP A HB3  1  
ATOM   126    N  N    . THR A  1 10  ? 3.344   -9.689  37.244  1.00 0.00 ?  325 THR A N    1  
ATOM   127    C  CA   . THR A  1 10  ? 2.209   -8.821  36.881  1.00 0.00 ?  325 THR A CA   1  
ATOM   128    C  C    . THR A  1 10  ? 0.879   -9.542  37.012  1.00 0.00 ?  325 THR A C    1  
ATOM   129    O  O    . THR A  1 10  ? 0.678   -10.611 36.503  1.00 0.00 ?  325 THR A O    1  
ATOM   130    C  CB   . THR A  1 10  ? 2.394   -8.191  35.499  1.00 0.00 ?  325 THR A CB   1  
ATOM   131    O  OG1  . THR A  1 10  ? 3.332   -7.138  35.517  1.00 0.00 ?  325 THR A OG1  1  
ATOM   132    C  CG2  . THR A  1 10  ? 1.114   -7.594  34.949  1.00 0.00 ?  325 THR A CG2  1  
ATOM   133    H  H    . THR A  1 10  ? 3.351   -10.675 37.094  1.00 0.00 ?  325 THR A H    1  
ATOM   134    H  HA   . THR A  1 10  ? 2.146   -7.990  37.568  1.00 0.00 ?  325 THR A HA   1  
ATOM   135    H  HB   . THR A  1 10  ? 2.730   -9.046  34.874  1.00 0.00 ?  325 THR A HB   1  
ATOM   136    H  HG1  . THR A  1 10  ? 3.987   -7.305  36.198  1.00 0.00 ?  325 THR A HG1  1  
ATOM   137    H  HG21 . THR A  1 10  ? 0.799   -6.766  35.620  1.00 0.00 ?  325 THR A HG21 1  
ATOM   138    H  HG22 . THR A  1 10  ? 0.294   -8.329  34.801  1.00 0.00 ?  325 THR A HG22 1  
ATOM   139    H  HG23 . THR A  1 10  ? 1.273   -7.179  33.931  1.00 0.00 ?  325 THR A HG23 1  
ATOM   140    N  N    . VAL A  1 11  ? -0.115  -8.936  37.741  1.00 0.00 ?  326 VAL A N    1  
ATOM   141    C  CA   . VAL A  1 11  ? -1.499  -9.423  37.727  1.00 0.00 ?  326 VAL A CA   1  
ATOM   142    C  C    . VAL A  1 11  ? -2.217  -8.342  36.964  1.00 0.00 ?  326 VAL A C    1  
ATOM   143    O  O    . VAL A  1 11  ? -2.247  -7.194  37.415  1.00 0.00 ?  326 VAL A O    1  
ATOM   144    C  CB   . VAL A  1 11  ? -2.204  -9.548  39.035  1.00 0.00 ?  326 VAL A CB   1  
ATOM   145    C  CG1  . VAL A  1 11  ? -3.750  -9.748  38.940  1.00 0.00 ?  326 VAL A CG1  1  
ATOM   146    C  CG2  . VAL A  1 11  ? -1.558  -10.854 39.792  1.00 0.00 ?  326 VAL A CG2  1  
ATOM   147    H  H    . VAL A  1 11  ? -0.030  -8.020  38.125  1.00 0.00 ?  326 VAL A H    1  
ATOM   148    H  HA   . VAL A  1 11  ? -1.490  -10.384 37.235  1.00 0.00 ?  326 VAL A HA   1  
ATOM   149    H  HB   . VAL A  1 11  ? -1.895  -8.666  39.636  1.00 0.00 ?  326 VAL A HB   1  
ATOM   150    H  HG11 . VAL A  1 11  ? -4.225  -8.897  38.406  1.00 0.00 ?  326 VAL A HG11 1  
ATOM   151    H  HG12 . VAL A  1 11  ? -4.114  -9.980  39.963  1.00 0.00 ?  326 VAL A HG12 1  
ATOM   152    H  HG13 . VAL A  1 11  ? -4.000  -10.628 38.309  1.00 0.00 ?  326 VAL A HG13 1  
ATOM   153    H  HG21 . VAL A  1 11  ? -0.536  -10.673 40.188  1.00 0.00 ?  326 VAL A HG21 1  
ATOM   154    H  HG22 . VAL A  1 11  ? -1.543  -11.824 39.249  1.00 0.00 ?  326 VAL A HG22 1  
ATOM   155    H  HG23 . VAL A  1 11  ? -2.154  -10.994 40.719  1.00 0.00 ?  326 VAL A HG23 1  
ATOM   156    N  N    . ALA A  1 12  ? -2.846  -8.623  35.808  1.00 0.00 ?  327 ALA A N    1  
ATOM   157    C  CA   . ALA A  1 12  ? -3.414  -7.545  34.927  1.00 0.00 ?  327 ALA A CA   1  
ATOM   158    C  C    . ALA A  1 12  ? -4.903  -7.883  34.747  1.00 0.00 ?  327 ALA A C    1  
ATOM   159    O  O    . ALA A  1 12  ? -5.252  -9.066  34.721  1.00 0.00 ?  327 ALA A O    1  
ATOM   160    C  CB   . ALA A  1 12  ? -2.783  -7.525  33.497  1.00 0.00 ?  327 ALA A CB   1  
ATOM   161    H  H    . ALA A  1 12  ? -2.936  -9.577  35.533  1.00 0.00 ?  327 ALA A H    1  
ATOM   162    H  HA   . ALA A  1 12  ? -3.298  -6.571  35.379  1.00 0.00 ?  327 ALA A HA   1  
ATOM   163    H  HB1  . ALA A  1 12  ? -2.975  -8.530  33.064  1.00 0.00 ?  327 ALA A HB1  1  
ATOM   164    H  HB2  . ALA A  1 12  ? -1.676  -7.453  33.560  1.00 0.00 ?  327 ALA A HB2  1  
ATOM   165    H  HB3  . ALA A  1 12  ? -3.175  -6.730  32.827  1.00 0.00 ?  327 ALA A HB3  1  
ATOM   166    N  N    . MET A  1 13  ? -5.824  -6.897  34.625  1.00 0.00 ?  328 MET A N    1  
ATOM   167    C  CA   . MET A  1 13  ? -7.279  -7.134  34.296  1.00 0.00 ?  328 MET A CA   1  
ATOM   168    C  C    . MET A  1 13  ? -7.534  -6.656  32.826  1.00 0.00 ?  328 MET A C    1  
ATOM   169    O  O    . MET A  1 13  ? -7.660  -5.466  32.604  1.00 0.00 ?  328 MET A O    1  
ATOM   170    C  CB   . MET A  1 13  ? -8.135  -6.456  35.308  1.00 0.00 ?  328 MET A CB   1  
ATOM   171    C  CG   . MET A  1 13  ? -9.655  -6.880  35.140  1.00 0.00 ?  328 MET A CG   1  
ATOM   172    S  SD   . MET A  1 13  ? -9.843  -8.666  35.300  1.00 0.00 ?  328 MET A SD   1  
ATOM   173    C  CE   . MET A  1 13  ? -11.593 -8.449  35.865  1.00 0.00 ?  328 MET A CE   1  
ATOM   174    H  H    . MET A  1 13  ? -5.558  -5.949  34.784  1.00 0.00 ?  328 MET A H    1  
ATOM   175    H  HA   . MET A  1 13  ? -7.427  -8.203  34.245  1.00 0.00 ?  328 MET A HA   1  
ATOM   176    H  HB2  . MET A  1 13  ? -7.835  -6.833  36.309  1.00 0.00 ?  328 MET A HB2  1  
ATOM   177    H  HB3  . MET A  1 13  ? -7.904  -5.378  35.169  1.00 0.00 ?  328 MET A HB3  1  
ATOM   178    H  HG2  . MET A  1 13  ? -10.086 -6.363  36.024  1.00 0.00 ?  328 MET A HG2  1  
ATOM   179    H  HG3  . MET A  1 13  ? -10.153 -6.517  34.215  1.00 0.00 ?  328 MET A HG3  1  
ATOM   180    H  HE1  . MET A  1 13  ? -12.204 -8.016  35.045  1.00 0.00 ?  328 MET A HE1  1  
ATOM   181    H  HE2  . MET A  1 13  ? -11.660 -7.890  36.823  1.00 0.00 ?  328 MET A HE2  1  
ATOM   182    H  HE3  . MET A  1 13  ? -12.193 -9.374  36.001  1.00 0.00 ?  328 MET A HE3  1  
ATOM   183    N  N    . LEU A  1 14  ? -7.641  -7.561  31.767  1.00 0.00 ?  329 LEU A N    1  
ATOM   184    C  CA   . LEU A  1 14  ? -7.555  -7.113  30.404  1.00 0.00 ?  329 LEU A CA   1  
ATOM   185    C  C    . LEU A  1 14  ? -8.792  -7.484  29.630  1.00 0.00 ?  329 LEU A C    1  
ATOM   186    O  O    . LEU A  1 14  ? -9.140  -8.622  29.421  1.00 0.00 ?  329 LEU A O    1  
ATOM   187    C  CB   . LEU A  1 14  ? -6.391  -7.900  29.756  1.00 0.00 ?  329 LEU A CB   1  
ATOM   188    C  CG   . LEU A  1 14  ? -4.951  -7.566  30.326  1.00 0.00 ?  329 LEU A CG   1  
ATOM   189    C  CD1  . LEU A  1 14  ? -3.773  -8.293  29.670  1.00 0.00 ?  329 LEU A CD1  1  
ATOM   190    C  CD2  . LEU A  1 14  ? -4.769  -6.017  30.391  1.00 0.00 ?  329 LEU A CD2  1  
ATOM   191    H  H    . LEU A  1 14  ? -7.616  -8.530  31.999  1.00 0.00 ?  329 LEU A H    1  
ATOM   192    H  HA   . LEU A  1 14  ? -7.447  -6.050  30.247  1.00 0.00 ?  329 LEU A HA   1  
ATOM   193    H  HB2  . LEU A  1 14  ? -6.555  -8.988  29.907  1.00 0.00 ?  329 LEU A HB2  1  
ATOM   194    H  HB3  . LEU A  1 14  ? -6.270  -7.669  28.676  1.00 0.00 ?  329 LEU A HB3  1  
ATOM   195    H  HG   . LEU A  1 14  ? -4.947  -7.787  31.415  1.00 0.00 ?  329 LEU A HG   1  
ATOM   196    H  HD11 . LEU A  1 14  ? -3.708  -8.041  28.589  1.00 0.00 ?  329 LEU A HD11 1  
ATOM   197    H  HD12 . LEU A  1 14  ? -3.854  -9.401  29.659  1.00 0.00 ?  329 LEU A HD12 1  
ATOM   198    H  HD13 . LEU A  1 14  ? -2.772  -8.078  30.102  1.00 0.00 ?  329 LEU A HD13 1  
ATOM   199    H  HD21 . LEU A  1 14  ? -3.920  -5.771  31.064  1.00 0.00 ?  329 LEU A HD21 1  
ATOM   200    H  HD22 . LEU A  1 14  ? -5.609  -5.397  30.770  1.00 0.00 ?  329 LEU A HD22 1  
ATOM   201    H  HD23 . LEU A  1 14  ? -4.458  -5.490  29.464  1.00 0.00 ?  329 LEU A HD23 1  
ATOM   202    N  N    . ARG A  1 15  ? -9.641  -6.496  29.260  1.00 0.00 ?  330 ARG A N    1  
ATOM   203    C  CA   . ARG A  1 15  ? -10.997 -6.709  28.715  1.00 0.00 ?  330 ARG A CA   1  
ATOM   204    C  C    . ARG A  1 15  ? -11.991 -7.490  29.654  1.00 0.00 ?  330 ARG A C    1  
ATOM   205    O  O    . ARG A  1 15  ? -12.860 -8.255  29.285  1.00 0.00 ?  330 ARG A O    1  
ATOM   206    C  CB   . ARG A  1 15  ? -10.989 -7.417  27.308  1.00 0.00 ?  330 ARG A CB   1  
ATOM   207    C  CG   . ARG A  1 15  ? -10.723 -6.322  26.256  1.00 0.00 ?  330 ARG A CG   1  
ATOM   208    C  CD   . ARG A  1 15  ? -10.626 -6.918  24.865  1.00 0.00 ?  330 ARG A CD   1  
ATOM   209    N  NE   . ARG A  1 15  ? -9.998  -5.868  23.959  1.00 0.00 ?  330 ARG A NE   1  
ATOM   210    C  CZ   . ARG A  1 15  ? -9.686  -6.081  22.659  1.00 0.00 ?  330 ARG A CZ   1  
ATOM   211    N  NH1  . ARG A  1 15  ? -8.996  -5.214  21.989  1.00 0.00 1  330 ARG A NH1  1  
ATOM   212    N  NH2  . ARG A  1 15  ? -10.134 -7.173  22.040  1.00 0.00 ?  330 ARG A NH2  1  
ATOM   213    H  H    . ARG A  1 15  ? -9.390  -5.535  29.346  1.00 0.00 ?  330 ARG A H    1  
ATOM   214    H  HA   . ARG A  1 15  ? -11.520 -5.772  28.595  1.00 0.00 ?  330 ARG A HA   1  
ATOM   215    H  HB2  . ARG A  1 15  ? -10.220 -8.219  27.280  1.00 0.00 ?  330 ARG A HB2  1  
ATOM   216    H  HB3  . ARG A  1 15  ? -12.001 -7.848  27.154  1.00 0.00 ?  330 ARG A HB3  1  
ATOM   217    H  HG2  . ARG A  1 15  ? -11.554 -5.587  26.316  1.00 0.00 ?  330 ARG A HG2  1  
ATOM   218    H  HG3  . ARG A  1 15  ? -9.835  -5.724  26.554  1.00 0.00 ?  330 ARG A HG3  1  
ATOM   219    H  HD2  . ARG A  1 15  ? -9.875  -7.737  24.895  1.00 0.00 ?  330 ARG A HD2  1  
ATOM   220    H  HD3  . ARG A  1 15  ? -11.624 -7.292  24.551  1.00 0.00 ?  330 ARG A HD3  1  
ATOM   221    H  HE   . ARG A  1 15  ? -9.684  -4.969  24.265  1.00 0.00 ?  330 ARG A HE   1  
ATOM   222    H  HH11 . ARG A  1 15  ? -8.280  -4.875  22.600  1.00 0.00 ?  330 ARG A HH11 1  
ATOM   223    H  HH12 . ARG A  1 15  ? -8.564  -5.496  21.132  1.00 0.00 ?  330 ARG A HH12 1  
ATOM   224    H  HH21 . ARG A  1 15  ? -10.096 -8.000  22.601  1.00 0.00 ?  330 ARG A HH21 1  
ATOM   225    H  HH22 . ARG A  1 15  ? -9.897  -7.232  21.070  1.00 0.00 ?  330 ARG A HH22 1  
ATOM   226    N  N    . GLY A  1 16  ? -11.807 -7.312  31.026  1.00 0.00 ?  331 GLY A N    1  
ATOM   227    C  CA   . GLY A  1 16  ? -12.426 -8.144  32.038  1.00 0.00 ?  331 GLY A CA   1  
ATOM   228    C  C    . GLY A  1 16  ? -11.977 -9.567  32.261  1.00 0.00 ?  331 GLY A C    1  
ATOM   229    O  O    . GLY A  1 16  ? -12.611 -10.325 32.989  1.00 0.00 ?  331 GLY A O    1  
ATOM   230    H  H    . GLY A  1 16  ? -11.183 -6.579  31.285  1.00 0.00 ?  331 GLY A H    1  
ATOM   231    H  HA2  . GLY A  1 16  ? -12.252 -7.604  32.957  1.00 0.00 ?  331 GLY A HA2  1  
ATOM   232    H  HA3  . GLY A  1 16  ? -13.483 -8.213  31.825  1.00 0.00 ?  331 GLY A HA3  1  
ATOM   233    N  N    . GLU A  1 17  ? -10.795 -10.052 31.799  1.00 0.00 ?  332 GLU A N    1  
ATOM   234    C  CA   . GLU A  1 17  ? -10.269 -11.350 32.072  1.00 0.00 ?  332 GLU A CA   1  
ATOM   235    C  C    . GLU A  1 17  ? -8.952  -11.076 32.820  1.00 0.00 ?  332 GLU A C    1  
ATOM   236    O  O    . GLU A  1 17  ? -8.101  -10.270 32.508  1.00 0.00 ?  332 GLU A O    1  
ATOM   237    C  CB   . GLU A  1 17  ? -9.980  -12.058 30.733  1.00 0.00 ?  332 GLU A CB   1  
ATOM   238    C  CG   . GLU A  1 17  ? -11.159 -12.213 29.836  1.00 0.00 ?  332 GLU A CG   1  
ATOM   239    C  CD   . GLU A  1 17  ? -12.272 -13.071 30.404  1.00 0.00 ?  332 GLU A CD   1  
ATOM   240    O  OE1  . GLU A  1 17  ? -11.931 -14.105 31.097  1.00 0.00 ?  332 GLU A OE1  1  
ATOM   241    O  OE2  . GLU A  1 17  ? -13.461 -12.731 30.198  1.00 0.00 -1 332 GLU A OE2  1  
ATOM   242    H  H    . GLU A  1 17  ? -10.254 -9.530  31.144  1.00 0.00 ?  332 GLU A H    1  
ATOM   243    H  HA   . GLU A  1 17  ? -10.872 -11.915 32.768  1.00 0.00 ?  332 GLU A HA   1  
ATOM   244    H  HB2  . GLU A  1 17  ? -9.263  -11.322 30.309  1.00 0.00 ?  332 GLU A HB2  1  
ATOM   245    H  HB3  . GLU A  1 17  ? -9.582  -13.064 30.984  1.00 0.00 ?  332 GLU A HB3  1  
ATOM   246    H  HG2  . GLU A  1 17  ? -11.583 -11.230 29.542  1.00 0.00 ?  332 GLU A HG2  1  
ATOM   247    H  HG3  . GLU A  1 17  ? -10.852 -12.750 28.913  1.00 0.00 ?  332 GLU A HG3  1  
ATOM   248    N  N    . MET A  1 18  ? -8.816  -11.788 34.054  1.00 0.00 ?  333 MET A N    1  
ATOM   249    C  CA   . MET A  1 18  ? -7.727  -11.539 34.953  1.00 0.00 ?  333 MET A CA   1  
ATOM   250    C  C    . MET A  1 18  ? -6.567  -12.466 34.608  1.00 0.00 ?  333 MET A C    1  
ATOM   251    O  O    . MET A  1 18  ? -6.787  -13.719 34.500  1.00 0.00 ?  333 MET A O    1  
ATOM   252    C  CB   . MET A  1 18  ? -8.108  -11.673 36.434  1.00 0.00 ?  333 MET A CB   1  
ATOM   253    C  CG   . MET A  1 18  ? -6.829  -11.836 37.353  1.00 0.00 ?  333 MET A CG   1  
ATOM   254    S  SD   . MET A  1 18  ? -7.280  -12.030 39.131  1.00 0.00 ?  333 MET A SD   1  
ATOM   255    C  CE   . MET A  1 18  ? -7.721  -10.294 39.433  1.00 0.00 ?  333 MET A CE   1  
ATOM   256    H  H    . MET A  1 18  ? -9.616  -12.278 34.392  1.00 0.00 ?  333 MET A H    1  
ATOM   257    H  HA   . MET A  1 18  ? -7.409  -10.509 34.893  1.00 0.00 ?  333 MET A HA   1  
ATOM   258    H  HB2  . MET A  1 18  ? -8.671  -10.745 36.671  1.00 0.00 ?  333 MET A HB2  1  
ATOM   259    H  HB3  . MET A  1 18  ? -8.819  -12.516 36.568  1.00 0.00 ?  333 MET A HB3  1  
ATOM   260    H  HG2  . MET A  1 18  ? -6.359  -12.786 37.020  1.00 0.00 ?  333 MET A HG2  1  
ATOM   261    H  HG3  . MET A  1 18  ? -6.059  -11.041 37.253  1.00 0.00 ?  333 MET A HG3  1  
ATOM   262    H  HE1  . MET A  1 18  ? -7.647  -10.151 40.532  1.00 0.00 ?  333 MET A HE1  1  
ATOM   263    H  HE2  . MET A  1 18  ? -8.685  -9.900  39.048  1.00 0.00 ?  333 MET A HE2  1  
ATOM   264    H  HE3  . MET A  1 18  ? -6.953  -9.610  39.013  1.00 0.00 ?  333 MET A HE3  1  
ATOM   265    N  N    . PHE A  1 19  ? -5.391  -11.917 34.294  1.00 0.00 ?  334 PHE A N    1  
ATOM   266    C  CA   . PHE A  1 19  ? -4.155  -12.572 33.810  1.00 0.00 ?  334 PHE A CA   1  
ATOM   267    C  C    . PHE A  1 19  ? -3.150  -12.474 34.903  1.00 0.00 ?  334 PHE A C    1  
ATOM   268    O  O    . PHE A  1 19  ? -3.220  -11.458 35.671  1.00 0.00 ?  334 PHE A O    1  
ATOM   269    C  CB   . PHE A  1 19  ? -3.611  -11.861 32.508  1.00 0.00 ?  334 PHE A CB   1  
ATOM   270    C  CG   . PHE A  1 19  ? -4.521  -12.205 31.371  1.00 0.00 ?  334 PHE A CG   1  
ATOM   271    C  CD1  . PHE A  1 19  ? -4.182  -13.247 30.518  1.00 0.00 ?  334 PHE A CD1  1  
ATOM   272    C  CD2  . PHE A  1 19  ? -5.729  -11.468 30.992  1.00 0.00 ?  334 PHE A CD2  1  
ATOM   273    C  CE1  . PHE A  1 19  ? -4.892  -13.654 29.409  1.00 0.00 ?  334 PHE A CE1  1  
ATOM   274    C  CE2  . PHE A  1 19  ? -6.422  -11.864 29.792  1.00 0.00 ?  334 PHE A CE2  1  
ATOM   275    C  CZ   . PHE A  1 19  ? -6.069  -12.975 29.043  1.00 0.00 ?  334 PHE A CZ   1  
ATOM   276    H  H    . PHE A  1 19  ? -5.368  -10.922 34.229  1.00 0.00 ?  334 PHE A H    1  
ATOM   277    H  HA   . PHE A  1 19  ? -4.429  -13.602 33.638  1.00 0.00 ?  334 PHE A HA   1  
ATOM   278    H  HB2  . PHE A  1 19  ? -3.502  -10.776 32.721  1.00 0.00 ?  334 PHE A HB2  1  
ATOM   279    H  HB3  . PHE A  1 19  ? -2.636  -12.345 32.288  1.00 0.00 ?  334 PHE A HB3  1  
ATOM   280    H  HD1  . PHE A  1 19  ? -3.346  -13.855 30.833  1.00 0.00 ?  334 PHE A HD1  1  
ATOM   281    H  HD2  . PHE A  1 19  ? -6.011  -10.595 31.562  1.00 0.00 ?  334 PHE A HD2  1  
ATOM   282    H  HE1  . PHE A  1 19  ? -4.663  -14.571 28.887  1.00 0.00 ?  334 PHE A HE1  1  
ATOM   283    H  HE2  . PHE A  1 19  ? -7.242  -11.249 29.454  1.00 0.00 ?  334 PHE A HE2  1  
ATOM   284    H  HZ   . PHE A  1 19  ? -6.587  -13.279 28.145  1.00 0.00 ?  334 PHE A HZ   1  
ATOM   285    N  N    . VAL A  1 20  ? -2.303  -13.466 34.928  1.00 0.00 ?  335 VAL A N    1  
ATOM   286    C  CA   . VAL A  1 20  ? -1.237  -13.574 35.933  1.00 0.00 ?  335 VAL A CA   1  
ATOM   287    C  C    . VAL A  1 20  ? -0.016  -13.762 35.086  1.00 0.00 ?  335 VAL A C    1  
ATOM   288    O  O    . VAL A  1 20  ? -0.066  -14.672 34.199  1.00 0.00 ?  335 VAL A O    1  
ATOM   289    C  CB   . VAL A  1 20  ? -1.478  -14.746 36.862  1.00 0.00 ?  335 VAL A CB   1  
ATOM   290    C  CG1  . VAL A  1 20  ? -0.481  -14.638 38.006  1.00 0.00 ?  335 VAL A CG1  1  
ATOM   291    C  CG2  . VAL A  1 20  ? -2.926  -14.722 37.485  1.00 0.00 ?  335 VAL A CG2  1  
ATOM   292    H  H    . VAL A  1 20  ? -2.489  -14.244 34.333  1.00 0.00 ?  335 VAL A H    1  
ATOM   293    H  HA   . VAL A  1 20  ? -1.263  -12.696 36.561  1.00 0.00 ?  335 VAL A HA   1  
ATOM   294    H  HB   . VAL A  1 20  ? -1.446  -15.731 36.350  1.00 0.00 ?  335 VAL A HB   1  
ATOM   295    H  HG11 . VAL A  1 20  ? -0.614  -13.787 38.708  1.00 0.00 ?  335 VAL A HG11 1  
ATOM   296    H  HG12 . VAL A  1 20  ? 0.572   -14.667 37.652  1.00 0.00 ?  335 VAL A HG12 1  
ATOM   297    H  HG13 . VAL A  1 20  ? -0.699  -15.466 38.713  1.00 0.00 ?  335 VAL A HG13 1  
ATOM   298    H  HG21 . VAL A  1 20  ? -3.712  -14.966 36.738  1.00 0.00 ?  335 VAL A HG21 1  
ATOM   299    H  HG22 . VAL A  1 20  ? -3.198  -13.695 37.812  1.00 0.00 ?  335 VAL A HG22 1  
ATOM   300    H  HG23 . VAL A  1 20  ? -2.900  -15.439 38.333  1.00 0.00 ?  335 VAL A HG23 1  
ATOM   301    N  N    . PHE A  1 21  ? 1.028   -12.877 35.181  1.00 0.00 ?  336 PHE A N    1  
ATOM   302    C  CA   . PHE A  1 21  ? 2.228   -13.127 34.504  1.00 0.00 ?  336 PHE A CA   1  
ATOM   303    C  C    . PHE A  1 21  ? 3.425   -13.285 35.464  1.00 0.00 ?  336 PHE A C    1  
ATOM   304    O  O    . PHE A  1 21  ? 3.495   -12.581 36.481  1.00 0.00 ?  336 PHE A O    1  
ATOM   305    C  CB   . PHE A  1 21  ? 2.521   -11.892 33.494  1.00 0.00 ?  336 PHE A CB   1  
ATOM   306    C  CG   . PHE A  1 21  ? 1.376   -11.673 32.451  1.00 0.00 ?  336 PHE A CG   1  
ATOM   307    C  CD1  . PHE A  1 21  ? 0.244   -10.898 32.690  1.00 0.00 ?  336 PHE A CD1  1  
ATOM   308    C  CD2  . PHE A  1 21  ? 1.764   -11.972 31.131  1.00 0.00 ?  336 PHE A CD2  1  
ATOM   309    C  CE1  . PHE A  1 21  ? -0.507  -10.430 31.585  1.00 0.00 ?  336 PHE A CE1  1  
ATOM   310    C  CE2  . PHE A  1 21  ? 1.019   -11.507 30.010  1.00 0.00 ?  336 PHE A CE2  1  
ATOM   311    C  CZ   . PHE A  1 21  ? -0.149  -10.709 30.247  1.00 0.00 ?  336 PHE A CZ   1  
ATOM   312    H  H    . PHE A  1 21  ? 1.085   -12.081 35.778  1.00 0.00 ?  336 PHE A H    1  
ATOM   313    H  HA   . PHE A  1 21  ? 2.306   -13.979 33.846  1.00 0.00 ?  336 PHE A HA   1  
ATOM   314    H  HB2  . PHE A  1 21  ? 2.577   -11.078 34.247  1.00 0.00 ?  336 PHE A HB2  1  
ATOM   315    H  HB3  . PHE A  1 21  ? 3.515   -12.015 33.015  1.00 0.00 ?  336 PHE A HB3  1  
ATOM   316    H  HD1  . PHE A  1 21  ? -0.122  -10.561 33.649  1.00 0.00 ?  336 PHE A HD1  1  
ATOM   317    H  HD2  . PHE A  1 21  ? 2.680   -12.523 30.972  1.00 0.00 ?  336 PHE A HD2  1  
ATOM   318    H  HE1  . PHE A  1 21  ? -1.369  -9.792  31.712  1.00 0.00 ?  336 PHE A HE1  1  
ATOM   319    H  HE2  . PHE A  1 21  ? 1.295   -11.712 28.986  1.00 0.00 ?  336 PHE A HE2  1  
ATOM   320    H  HZ   . PHE A  1 21  ? -0.670  -10.365 29.366  1.00 0.00 ?  336 PHE A HZ   1  
ATOM   321    N  N    . LYS A  1 22  ? 4.455   -14.062 35.212  1.00 0.00 ?  337 LYS A N    1  
ATOM   322    C  CA   . LYS A  1 22  ? 5.635   -14.128 36.003  1.00 0.00 ?  337 LYS A CA   1  
ATOM   323    C  C    . LYS A  1 22  ? 6.634   -14.843 35.199  1.00 0.00 ?  337 LYS A C    1  
ATOM   324    O  O    . LYS A  1 22  ? 6.369   -15.943 34.665  1.00 0.00 ?  337 LYS A O    1  
ATOM   325    C  CB   . LYS A  1 22  ? 5.461   -14.988 37.226  1.00 0.00 ?  337 LYS A CB   1  
ATOM   326    C  CG   . LYS A  1 22  ? 6.650   -14.880 38.266  1.00 0.00 ?  337 LYS A CG   1  
ATOM   327    C  CD   . LYS A  1 22  ? 6.727   -16.246 39.067  1.00 0.00 ?  337 LYS A CD   1  
ATOM   328    C  CE   . LYS A  1 22  ? 7.680   -16.275 40.285  1.00 0.00 ?  337 LYS A CE   1  
ATOM   329    N  NZ   . LYS A  1 22  ? 9.003   -15.625 40.127  1.00 0.00 1  337 LYS A NZ   1  
ATOM   330    H  H    . LYS A  1 22  ? 4.392   -14.755 34.498  1.00 0.00 ?  337 LYS A H    1  
ATOM   331    H  HA   . LYS A  1 22  ? 6.016   -13.162 36.302  1.00 0.00 ?  337 LYS A HA   1  
ATOM   332    H  HB2  . LYS A  1 22  ? 4.601   -14.647 37.842  1.00 0.00 ?  337 LYS A HB2  1  
ATOM   333    H  HB3  . LYS A  1 22  ? 5.312   -16.069 37.016  1.00 0.00 ?  337 LYS A HB3  1  
ATOM   334    H  HG2  . LYS A  1 22  ? 7.650   -14.638 37.846  1.00 0.00 ?  337 LYS A HG2  1  
ATOM   335    H  HG3  . LYS A  1 22  ? 6.433   -13.984 38.886  1.00 0.00 ?  337 LYS A HG3  1  
ATOM   336    H  HD2  . LYS A  1 22  ? 5.685   -16.415 39.414  1.00 0.00 ?  337 LYS A HD2  1  
ATOM   337    H  HD3  . LYS A  1 22  ? 7.061   -17.068 38.399  1.00 0.00 ?  337 LYS A HD3  1  
ATOM   338    H  HE2  . LYS A  1 22  ? 7.152   -15.750 41.110  1.00 0.00 ?  337 LYS A HE2  1  
ATOM   339    H  HE3  . LYS A  1 22  ? 7.906   -17.305 40.633  1.00 0.00 ?  337 LYS A HE3  1  
ATOM   340    H  HZ1  . LYS A  1 22  ? 9.034   -14.631 39.820  1.00 0.00 ?  337 LYS A HZ1  1  
ATOM   341    H  HZ2  . LYS A  1 22  ? 9.559   -16.179 39.445  1.00 0.00 ?  337 LYS A HZ2  1  
ATOM   342    H  HZ3  . LYS A  1 22  ? 9.522   -15.754 41.019  1.00 0.00 ?  337 LYS A HZ3  1  
ATOM   343    N  N    . GLU A  1 23  ? 7.885   -14.281 35.098  1.00 0.00 ?  338 GLU A N    1  
ATOM   344    C  CA   . GLU A  1 23  ? 9.034   -14.887 34.356  1.00 0.00 ?  338 GLU A CA   1  
ATOM   345    C  C    . GLU A  1 23  ? 8.617   -15.143 32.902  1.00 0.00 ?  338 GLU A C    1  
ATOM   346    O  O    . GLU A  1 23  ? 8.457   -14.172 32.166  1.00 0.00 ?  338 GLU A O    1  
ATOM   347    C  CB   . GLU A  1 23  ? 9.578   -16.097 35.170  1.00 0.00 ?  338 GLU A CB   1  
ATOM   348    C  CG   . GLU A  1 23  ? 10.376  -15.668 36.433  1.00 0.00 ?  338 GLU A CG   1  
ATOM   349    C  CD   . GLU A  1 23  ? 11.105  -16.692 37.324  1.00 0.00 ?  338 GLU A CD   1  
ATOM   350    O  OE1  . GLU A  1 23  ? 11.883  -17.487 36.807  1.00 0.00 ?  338 GLU A OE1  1  
ATOM   351    O  OE2  . GLU A  1 23  ? 10.826  -16.729 38.563  1.00 0.00 -1 338 GLU A OE2  1  
ATOM   352    H  H    . GLU A  1 23  ? 8.049   -13.424 35.581  1.00 0.00 ?  338 GLU A H    1  
ATOM   353    H  HA   . GLU A  1 23  ? 9.889   -14.231 34.286  1.00 0.00 ?  338 GLU A HA   1  
ATOM   354    H  HB2  . GLU A  1 23  ? 8.694   -16.634 35.577  1.00 0.00 ?  338 GLU A HB2  1  
ATOM   355    H  HB3  . GLU A  1 23  ? 10.273  -16.711 34.559  1.00 0.00 ?  338 GLU A HB3  1  
ATOM   356    H  HG2  . GLU A  1 23  ? 11.174  -14.946 36.159  1.00 0.00 ?  338 GLU A HG2  1  
ATOM   357    H  HG3  . GLU A  1 23  ? 9.664   -15.128 37.094  1.00 0.00 ?  338 GLU A HG3  1  
ATOM   358    N  N    . ARG A  1 24  ? 8.473   -16.404 32.465  1.00 0.00 ?  339 ARG A N    1  
ATOM   359    C  CA   . ARG A  1 24  ? 8.327   -16.670 31.058  1.00 0.00 ?  339 ARG A CA   1  
ATOM   360    C  C    . ARG A  1 24  ? 7.000   -17.362 30.719  1.00 0.00 ?  339 ARG A C    1  
ATOM   361    O  O    . ARG A  1 24  ? 6.756   -17.740 29.593  1.00 0.00 ?  339 ARG A O    1  
ATOM   362    C  CB   . ARG A  1 24  ? 9.528   -17.473 30.502  1.00 0.00 ?  339 ARG A CB   1  
ATOM   363    C  CG   . ARG A  1 24  ? 9.725   -18.918 30.964  1.00 0.00 ?  339 ARG A CG   1  
ATOM   364    C  CD   . ARG A  1 24  ? 10.990  -19.621 30.511  1.00 0.00 ?  339 ARG A CD   1  
ATOM   365    N  NE   . ARG A  1 24  ? 11.048  -21.050 30.934  1.00 0.00 ?  339 ARG A NE   1  
ATOM   366    C  CZ   . ARG A  1 24  ? 10.624  -22.012 30.195  1.00 0.00 ?  339 ARG A CZ   1  
ATOM   367    N  NH1  . ARG A  1 24  ? 9.976   -21.733 29.090  1.00 0.00 1  339 ARG A NH1  1  
ATOM   368    N  NH2  . ARG A  1 24  ? 10.919  -23.245 30.520  1.00 0.00 ?  339 ARG A NH2  1  
ATOM   369    H  H    . ARG A  1 24  ? 8.649   -17.081 33.176  1.00 0.00 ?  339 ARG A H    1  
ATOM   370    H  HA   . ARG A  1 24  ? 8.324   -15.676 30.637  1.00 0.00 ?  339 ARG A HA   1  
ATOM   371    H  HB2  . ARG A  1 24  ? 9.600   -17.556 29.396  1.00 0.00 ?  339 ARG A HB2  1  
ATOM   372    H  HB3  . ARG A  1 24  ? 10.408  -16.859 30.792  1.00 0.00 ?  339 ARG A HB3  1  
ATOM   373    H  HG2  . ARG A  1 24  ? 9.664   -18.918 32.073  1.00 0.00 ?  339 ARG A HG2  1  
ATOM   374    H  HG3  . ARG A  1 24  ? 8.808   -19.430 30.603  1.00 0.00 ?  339 ARG A HG3  1  
ATOM   375    H  HD2  . ARG A  1 24  ? 11.222  -19.546 29.427  1.00 0.00 ?  339 ARG A HD2  1  
ATOM   376    H  HD3  . ARG A  1 24  ? 11.814  -19.013 30.941  1.00 0.00 ?  339 ARG A HD3  1  
ATOM   377    H  HE   . ARG A  1 24  ? 11.555  -21.408 31.718  1.00 0.00 ?  339 ARG A HE   1  
ATOM   378    H  HH11 . ARG A  1 24  ? 9.842   -20.822 28.700  1.00 0.00 ?  339 ARG A HH11 1  
ATOM   379    H  HH12 . ARG A  1 24  ? 9.851   -22.537 28.509  1.00 0.00 ?  339 ARG A HH12 1  
ATOM   380    H  HH21 . ARG A  1 24  ? 11.446  -23.319 31.366  1.00 0.00 ?  339 ARG A HH21 1  
ATOM   381    H  HH22 . ARG A  1 24  ? 10.636  -24.038 29.980  1.00 0.00 ?  339 ARG A HH22 1  
ATOM   382    N  N    . TRP A  1 25  ? 6.090   -17.375 31.688  1.00 0.00 ?  340 TRP A N    1  
ATOM   383    C  CA   . TRP A  1 25  ? 4.782   -18.084 31.681  1.00 0.00 ?  340 TRP A CA   1  
ATOM   384    C  C    . TRP A  1 25  ? 3.718   -17.213 32.279  1.00 0.00 ?  340 TRP A C    1  
ATOM   385    O  O    . TRP A  1 25  ? 3.984   -16.368 33.095  1.00 0.00 ?  340 TRP A O    1  
ATOM   386    C  CB   . TRP A  1 25  ? 4.808   -19.405 32.428  1.00 0.00 ?  340 TRP A CB   1  
ATOM   387    C  CG   . TRP A  1 25  ? 5.981   -20.370 32.210  1.00 0.00 ?  340 TRP A CG   1  
ATOM   388    C  CD1  . TRP A  1 25  ? 6.146   -21.475 31.380  1.00 0.00 ?  340 TRP A CD1  1  
ATOM   389    C  CD2  . TRP A  1 25  ? 7.145   -20.343 33.049  1.00 0.00 ?  340 TRP A CD2  1  
ATOM   390    N  NE1  . TRP A  1 25  ? 7.389   -21.996 31.633  1.00 0.00 ?  340 TRP A NE1  1  
ATOM   391    C  CE2  . TRP A  1 25  ? 8.010   -21.408 32.689  1.00 0.00 ?  340 TRP A CE2  1  
ATOM   392    C  CE3  . TRP A  1 25  ? 7.523   -19.471 34.109  1.00 0.00 ?  340 TRP A CE3  1  
ATOM   393    C  CZ2  . TRP A  1 25  ? 9.199   -21.675 33.289  1.00 0.00 ?  340 TRP A CZ2  1  
ATOM   394    C  CZ3  . TRP A  1 25  ? 8.760   -19.680 34.679  1.00 0.00 ?  340 TRP A CZ3  1  
ATOM   395    C  CH2  . TRP A  1 25  ? 9.671   -20.706 34.225  1.00 0.00 ?  340 TRP A CH2  1  
ATOM   396    H  H    . TRP A  1 25  ? 6.288   -16.901 32.542  1.00 0.00 ?  340 TRP A H    1  
ATOM   397    H  HA   . TRP A  1 25  ? 4.369   -18.249 30.697  1.00 0.00 ?  340 TRP A HA   1  
ATOM   398    H  HB2  . TRP A  1 25  ? 4.662   -19.247 33.518  1.00 0.00 ?  340 TRP A HB2  1  
ATOM   399    H  HB3  . TRP A  1 25  ? 3.832   -19.895 32.223  1.00 0.00 ?  340 TRP A HB3  1  
ATOM   400    H  HD1  . TRP A  1 25  ? 5.426   -21.761 30.627  1.00 0.00 ?  340 TRP A HD1  1  
ATOM   401    H  HE1  . TRP A  1 25  ? 7.665   -22.895 31.371  1.00 0.00 ?  340 TRP A HE1  1  
ATOM   402    H  HE3  . TRP A  1 25  ? 6.853   -18.704 34.470  1.00 0.00 ?  340 TRP A HE3  1  
ATOM   403    H  HZ2  . TRP A  1 25  ? 9.812   -22.533 33.060  1.00 0.00 ?  340 TRP A HZ2  1  
ATOM   404    H  HZ3  . TRP A  1 25  ? 9.133   -19.055 35.477  1.00 0.00 ?  340 TRP A HZ3  1  
ATOM   405    H  HH2  . TRP A  1 25  ? 10.635  -20.783 34.705  1.00 0.00 ?  340 TRP A HH2  1  
ATOM   406    N  N    . PHE A  1 26  ? 2.550   -17.478 31.838  1.00 0.00 ?  341 PHE A N    1  
ATOM   407    C  CA   . PHE A  1 26  ? 1.325   -16.704 32.243  1.00 0.00 ?  341 PHE A CA   1  
ATOM   408    C  C    . PHE A  1 26  ? 0.198   -17.764 32.596  1.00 0.00 ?  341 PHE A C    1  
ATOM   409    O  O    . PHE A  1 26  ? 0.248   -18.883 32.131  1.00 0.00 ?  341 PHE A O    1  
ATOM   410    C  CB   . PHE A  1 26  ? 0.876   -15.702 31.097  1.00 0.00 ?  341 PHE A CB   1  
ATOM   411    C  CG   . PHE A  1 26  ? -0.069  -16.366 30.062  1.00 0.00 ?  341 PHE A CG   1  
ATOM   412    C  CD1  . PHE A  1 26  ? -1.472  -16.194 30.102  1.00 0.00 ?  341 PHE A CD1  1  
ATOM   413    C  CD2  . PHE A  1 26  ? 0.479   -17.147 29.037  1.00 0.00 ?  341 PHE A CD2  1  
ATOM   414    C  CE1  . PHE A  1 26  ? -2.303  -16.899 29.220  1.00 0.00 ?  341 PHE A CE1  1  
ATOM   415    C  CE2  . PHE A  1 26  ? -0.342  -17.793 28.132  1.00 0.00 ?  341 PHE A CE2  1  
ATOM   416    C  CZ   . PHE A  1 26  ? -1.737  -17.623 28.198  1.00 0.00 ?  341 PHE A CZ   1  
ATOM   417    H  H    . PHE A  1 26  ? 2.400   -18.129 31.097  1.00 0.00 ?  341 PHE A H    1  
ATOM   418    H  HA   . PHE A  1 26  ? 1.479   -16.188 33.179  1.00 0.00 ?  341 PHE A HA   1  
ATOM   419    H  HB2  . PHE A  1 26  ? 0.404   -14.750 31.421  1.00 0.00 ?  341 PHE A HB2  1  
ATOM   420    H  HB3  . PHE A  1 26  ? 1.781   -15.330 30.570  1.00 0.00 ?  341 PHE A HB3  1  
ATOM   421    H  HD1  . PHE A  1 26  ? -1.960  -15.610 30.868  1.00 0.00 ?  341 PHE A HD1  1  
ATOM   422    H  HD2  . PHE A  1 26  ? 1.529   -17.393 29.087  1.00 0.00 ?  341 PHE A HD2  1  
ATOM   423    H  HE1  . PHE A  1 26  ? -3.376  -16.876 29.340  1.00 0.00 ?  341 PHE A HE1  1  
ATOM   424    H  HE2  . PHE A  1 26  ? 0.048   -18.557 27.476  1.00 0.00 ?  341 PHE A HE2  1  
ATOM   425    H  HZ   . PHE A  1 26  ? -2.345  -18.184 27.503  1.00 0.00 ?  341 PHE A HZ   1  
ATOM   426    N  N    . TRP A  1 27  ? -0.749  -17.324 33.498  1.00 0.00 ?  342 TRP A N    1  
ATOM   427    C  CA   . TRP A  1 27  ? -1.862  -18.187 33.995  1.00 0.00 ?  342 TRP A CA   1  
ATOM   428    C  C    . TRP A  1 27  ? -3.049  -17.315 33.708  1.00 0.00 ?  342 TRP A C    1  
ATOM   429    O  O    . TRP A  1 27  ? -2.976  -16.058 33.653  1.00 0.00 ?  342 TRP A O    1  
ATOM   430    C  CB   . TRP A  1 27  ? -1.986  -18.568 35.493  1.00 0.00 ?  342 TRP A CB   1  
ATOM   431    C  CG   . TRP A  1 27  ? -0.910  -19.390 36.173  1.00 0.00 ?  342 TRP A CG   1  
ATOM   432    C  CD1  . TRP A  1 27  ? -1.051  -20.633 36.706  1.00 0.00 ?  342 TRP A CD1  1  
ATOM   433    C  CD2  . TRP A  1 27  ? 0.334   -18.904 36.723  1.00 0.00 ?  342 TRP A CD2  1  
ATOM   434    N  NE1  . TRP A  1 27  ? 0.083   -21.055 37.388  1.00 0.00 ?  342 TRP A NE1  1  
ATOM   435    C  CE2  . TRP A  1 27  ? 0.861   -19.911 37.534  1.00 0.00 ?  342 TRP A CE2  1  
ATOM   436    C  CE3  . TRP A  1 27  ? 1.009   -17.736 36.560  1.00 0.00 ?  342 TRP A CE3  1  
ATOM   437    C  CZ2  . TRP A  1 27  ? 2.129   -19.695 38.213  1.00 0.00 ?  342 TRP A CZ2  1  
ATOM   438    C  CZ3  . TRP A  1 27  ? 2.274   -17.584 37.178  1.00 0.00 ?  342 TRP A CZ3  1  
ATOM   439    C  CH2  . TRP A  1 27  ? 2.771   -18.480 38.026  1.00 0.00 ?  342 TRP A CH2  1  
ATOM   440    H  H    . TRP A  1 27  ? -0.735  -16.360 33.754  1.00 0.00 ?  342 TRP A H    1  
ATOM   441    H  HA   . TRP A  1 27  ? -1.901  -19.092 33.407  1.00 0.00 ?  342 TRP A HA   1  
ATOM   442    H  HB2  . TRP A  1 27  ? -2.023  -17.607 36.049  1.00 0.00 ?  342 TRP A HB2  1  
ATOM   443    H  HB3  . TRP A  1 27  ? -2.989  -19.032 35.598  1.00 0.00 ?  342 TRP A HB3  1  
ATOM   444    H  HD1  . TRP A  1 27  ? -1.922  -21.216 36.445  1.00 0.00 ?  342 TRP A HD1  1  
ATOM   445    H  HE1  . TRP A  1 27  ? 0.191   -21.929 37.808  1.00 0.00 ?  342 TRP A HE1  1  
ATOM   446    H  HE3  . TRP A  1 27  ? 0.621   -17.031 35.840  1.00 0.00 ?  342 TRP A HE3  1  
ATOM   447    H  HZ2  . TRP A  1 27  ? 2.758   -20.453 38.657  1.00 0.00 ?  342 TRP A HZ2  1  
ATOM   448    H  HZ3  . TRP A  1 27  ? 2.886   -16.694 37.146  1.00 0.00 ?  342 TRP A HZ3  1  
ATOM   449    H  HH2  . TRP A  1 27  ? 3.800   -18.447 38.353  1.00 0.00 ?  342 TRP A HH2  1  
ATOM   450    N  N    . ARG A  1 28  ? -4.262  -17.854 33.542  1.00 0.00 ?  343 ARG A N    1  
ATOM   451    C  CA   . ARG A  1 28  ? -5.447  -17.004 33.529  1.00 0.00 ?  343 ARG A CA   1  
ATOM   452    C  C    . ARG A  1 28  ? -6.405  -17.367 34.711  1.00 0.00 ?  343 ARG A C    1  
ATOM   453    O  O    . ARG A  1 28  ? -6.392  -18.483 35.229  1.00 0.00 ?  343 ARG A O    1  
ATOM   454    C  CB   . ARG A  1 28  ? -6.302  -17.361 32.327  1.00 0.00 ?  343 ARG A CB   1  
ATOM   455    C  CG   . ARG A  1 28  ? -5.737  -16.800 31.039  1.00 0.00 ?  343 ARG A CG   1  
ATOM   456    C  CD   . ARG A  1 28  ? -6.608  -17.006 29.819  1.00 0.00 ?  343 ARG A CD   1  
ATOM   457    N  NE   . ARG A  1 28  ? -7.750  -16.035 30.003  1.00 0.00 ?  343 ARG A NE   1  
ATOM   458    C  CZ   . ARG A  1 28  ? -8.590  -15.785 29.043  1.00 0.00 ?  343 ARG A CZ   1  
ATOM   459    N  NH1  . ARG A  1 28  ? -9.747  -15.185 29.272  1.00 0.00 1  343 ARG A NH1  1  
ATOM   460    N  NH2  . ARG A  1 28  ? -8.466  -15.986 27.800  1.00 0.00 ?  343 ARG A NH2  1  
ATOM   461    H  H    . ARG A  1 28  ? -4.442  -18.835 33.574  1.00 0.00 ?  343 ARG A H    1  
ATOM   462    H  HA   . ARG A  1 28  ? -5.296  -15.934 33.529  1.00 0.00 ?  343 ARG A HA   1  
ATOM   463    H  HB2  . ARG A  1 28  ? -6.302  -18.469 32.251  1.00 0.00 ?  343 ARG A HB2  1  
ATOM   464    H  HB3  . ARG A  1 28  ? -7.313  -16.901 32.291  1.00 0.00 ?  343 ARG A HB3  1  
ATOM   465    H  HG2  . ARG A  1 28  ? -5.540  -15.728 31.257  1.00 0.00 ?  343 ARG A HG2  1  
ATOM   466    H  HG3  . ARG A  1 28  ? -4.672  -17.086 30.905  1.00 0.00 ?  343 ARG A HG3  1  
ATOM   467    H  HD2  . ARG A  1 28  ? -6.121  -16.761 28.851  1.00 0.00 ?  343 ARG A HD2  1  
ATOM   468    H  HD3  . ARG A  1 28  ? -7.017  -18.039 29.806  1.00 0.00 ?  343 ARG A HD3  1  
ATOM   469    H  HE   . ARG A  1 28  ? -8.062  -15.910 30.944  1.00 0.00 ?  343 ARG A HE   1  
ATOM   470    H  HH11 . ARG A  1 28  ? -9.876  -14.951 30.235  1.00 0.00 ?  343 ARG A HH11 1  
ATOM   471    H  HH12 . ARG A  1 28  ? -10.320 -15.016 28.470  1.00 0.00 ?  343 ARG A HH12 1  
ATOM   472    H  HH21 . ARG A  1 28  ? -7.533  -15.771 27.510  1.00 0.00 ?  343 ARG A HH21 1  
ATOM   473    H  HH22 . ARG A  1 28  ? -9.185  -15.660 27.187  1.00 0.00 ?  343 ARG A HH22 1  
ATOM   474    N  N    . VAL A  1 29  ? -7.217  -16.412 35.136  1.00 0.00 ?  344 VAL A N    1  
ATOM   475    C  CA   . VAL A  1 29  ? -8.187  -16.673 36.240  1.00 0.00 ?  344 VAL A CA   1  
ATOM   476    C  C    . VAL A  1 29  ? -9.685  -16.584 35.802  1.00 0.00 ?  344 VAL A C    1  
ATOM   477    O  O    . VAL A  1 29  ? -10.031 -15.626 35.128  1.00 0.00 ?  344 VAL A O    1  
ATOM   478    C  CB   . VAL A  1 29  ? -7.919  -15.604 37.291  1.00 0.00 ?  344 VAL A CB   1  
ATOM   479    C  CG1  . VAL A  1 29  ? -8.849  -15.795 38.469  1.00 0.00 ?  344 VAL A CG1  1  
ATOM   480    C  CG2  . VAL A  1 29  ? -6.497  -15.866 37.836  1.00 0.00 ?  344 VAL A CG2  1  
ATOM   481    H  H    . VAL A  1 29  ? -7.140  -15.482 34.785  1.00 0.00 ?  344 VAL A H    1  
ATOM   482    H  HA   . VAL A  1 29  ? -8.131  -17.628 36.740  1.00 0.00 ?  344 VAL A HA   1  
ATOM   483    H  HB   . VAL A  1 29  ? -8.050  -14.597 36.841  1.00 0.00 ?  344 VAL A HB   1  
ATOM   484    H  HG11 . VAL A  1 29  ? -8.627  -16.820 38.835  1.00 0.00 ?  344 VAL A HG11 1  
ATOM   485    H  HG12 . VAL A  1 29  ? -9.923  -15.640 38.231  1.00 0.00 ?  344 VAL A HG12 1  
ATOM   486    H  HG13 . VAL A  1 29  ? -8.594  -15.081 39.280  1.00 0.00 ?  344 VAL A HG13 1  
ATOM   487    H  HG21 . VAL A  1 29  ? -6.230  -16.919 38.069  1.00 0.00 ?  344 VAL A HG21 1  
ATOM   488    H  HG22 . VAL A  1 29  ? -6.377  -15.263 38.761  1.00 0.00 ?  344 VAL A HG22 1  
ATOM   489    H  HG23 . VAL A  1 29  ? -5.795  -15.533 37.042  1.00 0.00 ?  344 VAL A HG23 1  
ATOM   490    N  N    . ARG A  1 30  ? -10.575 -17.537 36.206  1.00 0.00 ?  345 ARG A N    1  
ATOM   491    C  CA   . ARG A  1 30  ? -11.993 -17.465 36.011  1.00 0.00 ?  345 ARG A CA   1  
ATOM   492    C  C    . ARG A  1 30  ? -12.798 -18.054 37.143  1.00 0.00 ?  345 ARG A C    1  
ATOM   493    O  O    . ARG A  1 30  ? -12.355 -19.071 37.713  1.00 0.00 ?  345 ARG A O    1  
ATOM   494    C  CB   . ARG A  1 30  ? -12.513 -17.896 34.665  1.00 0.00 ?  345 ARG A CB   1  
ATOM   495    C  CG   . ARG A  1 30  ? -12.501 -16.825 33.533  1.00 0.00 ?  345 ARG A CG   1  
ATOM   496    C  CD   . ARG A  1 30  ? -13.749 -16.796 32.544  1.00 0.00 ?  345 ARG A CD   1  
ATOM   497    N  NE   . ARG A  1 30  ? -13.953 -18.213 32.126  1.00 0.00 ?  345 ARG A NE   1  
ATOM   498    C  CZ   . ARG A  1 30  ? -14.425 -18.656 30.987  1.00 0.00 ?  345 ARG A CZ   1  
ATOM   499    N  NH1  . ARG A  1 30  ? -14.823 -19.902 30.824  1.00 0.00 1  345 ARG A NH1  1  
ATOM   500    N  NH2  . ARG A  1 30  ? -14.577 -17.873 29.901  1.00 0.00 ?  345 ARG A NH2  1  
ATOM   501    H  H    . ARG A  1 30  ? -10.278 -18.434 36.526  1.00 0.00 ?  345 ARG A H    1  
ATOM   502    H  HA   . ARG A  1 30  ? -12.253 -16.420 36.094  1.00 0.00 ?  345 ARG A HA   1  
ATOM   503    H  HB2  . ARG A  1 30  ? -11.969 -18.830 34.407  1.00 0.00 ?  345 ARG A HB2  1  
ATOM   504    H  HB3  . ARG A  1 30  ? -13.600 -18.095 34.777  1.00 0.00 ?  345 ARG A HB3  1  
ATOM   505    H  HG2  . ARG A  1 30  ? -12.451 -15.786 33.923  1.00 0.00 ?  345 ARG A HG2  1  
ATOM   506    H  HG3  . ARG A  1 30  ? -11.624 -16.872 32.853  1.00 0.00 ?  345 ARG A HG3  1  
ATOM   507    H  HD2  . ARG A  1 30  ? -14.606 -16.336 33.081  1.00 0.00 ?  345 ARG A HD2  1  
ATOM   508    H  HD3  . ARG A  1 30  ? -13.355 -16.156 31.726  1.00 0.00 ?  345 ARG A HD3  1  
ATOM   509    H  HE   . ARG A  1 30  ? -14.045 -18.940 32.807  1.00 0.00 ?  345 ARG A HE   1  
ATOM   510    H  HH11 . ARG A  1 30  ? -14.633 -20.591 31.523  1.00 0.00 ?  345 ARG A HH11 1  
ATOM   511    H  HH12 . ARG A  1 30  ? -15.231 -20.223 29.970  1.00 0.00 ?  345 ARG A HH12 1  
ATOM   512    H  HH21 . ARG A  1 30  ? -14.404 -16.888 29.934  1.00 0.00 ?  345 ARG A HH21 1  
ATOM   513    H  HH22 . ARG A  1 30  ? -14.960 -18.192 29.034  1.00 0.00 ?  345 ARG A HH22 1  
ATOM   514    N  N    . ASN A  1 31  ? -13.939 -17.473 37.568  1.00 0.00 ?  346 ASN A N    1  
ATOM   515    C  CA   . ASN A  1 31  ? -14.595 -17.836 38.800  1.00 0.00 ?  346 ASN A CA   1  
ATOM   516    C  C    . ASN A  1 31  ? -13.622 -17.822 40.014  1.00 0.00 ?  346 ASN A C    1  
ATOM   517    O  O    . ASN A  1 31  ? -13.753 -18.735 40.791  1.00 0.00 ?  346 ASN A O    1  
ATOM   518    C  CB   . ASN A  1 31  ? -15.286 -19.228 38.603  1.00 0.00 ?  346 ASN A CB   1  
ATOM   519    C  CG   . ASN A  1 31  ? -16.389 -19.013 37.570  1.00 0.00 ?  346 ASN A CG   1  
ATOM   520    O  OD1  . ASN A  1 31  ? -16.599 -17.894 37.080  1.00 0.00 ?  346 ASN A OD1  1  
ATOM   521    N  ND2  . ASN A  1 31  ? -17.147 -20.104 37.291  1.00 0.00 ?  346 ASN A ND2  1  
ATOM   522    H  H    . ASN A  1 31  ? -14.378 -16.784 36.996  1.00 0.00 ?  346 ASN A H    1  
ATOM   523    H  HA   . ASN A  1 31  ? -15.311 -17.074 39.069  1.00 0.00 ?  346 ASN A HA   1  
ATOM   524    H  HB2  . ASN A  1 31  ? -14.648 -20.111 38.387  1.00 0.00 ?  346 ASN A HB2  1  
ATOM   525    H  HB3  . ASN A  1 31  ? -15.952 -19.406 39.475  1.00 0.00 ?  346 ASN A HB3  1  
ATOM   526    H  HD21 . ASN A  1 31  ? -17.497 -19.965 36.365  1.00 0.00 ?  346 ASN A HD21 1  
ATOM   527    H  HD22 . ASN A  1 31  ? -16.992 -21.011 37.684  1.00 0.00 ?  346 ASN A HD22 1  
ATOM   528    N  N    . ASN A  1 32  ? -12.703 -16.886 40.153  1.00 0.00 ?  347 ASN A N    1  
ATOM   529    C  CA   . ASN A  1 32  ? -11.753 -16.802 41.258  1.00 0.00 ?  347 ASN A CA   1  
ATOM   530    C  C    . ASN A  1 32  ? -10.954 -18.139 41.514  1.00 0.00 ?  347 ASN A C    1  
ATOM   531    O  O    . ASN A  1 32  ? -10.916 -18.678 42.621  1.00 0.00 ?  347 ASN A O    1  
ATOM   532    C  CB   . ASN A  1 32  ? -12.344 -16.235 42.572  1.00 0.00 ?  347 ASN A CB   1  
ATOM   533    C  CG   . ASN A  1 32  ? -13.133 -14.937 42.360  1.00 0.00 ?  347 ASN A CG   1  
ATOM   534    O  OD1  . ASN A  1 32  ? -14.337 -14.872 42.150  1.00 0.00 ?  347 ASN A OD1  1  
ATOM   535    N  ND2  . ASN A  1 32  ? -12.415 -13.814 42.363  1.00 0.00 ?  347 ASN A ND2  1  
ATOM   536    H  H    . ASN A  1 32  ? -12.671 -16.148 39.483  1.00 0.00 ?  347 ASN A H    1  
ATOM   537    H  HA   . ASN A  1 32  ? -10.979 -16.091 41.011  1.00 0.00 ?  347 ASN A HA   1  
ATOM   538    H  HB2  . ASN A  1 32  ? -13.034 -16.977 43.029  1.00 0.00 ?  347 ASN A HB2  1  
ATOM   539    H  HB3  . ASN A  1 32  ? -11.510 -16.055 43.284  1.00 0.00 ?  347 ASN A HB3  1  
ATOM   540    H  HD21 . ASN A  1 32  ? -12.912 -12.954 42.474  1.00 0.00 ?  347 ASN A HD21 1  
ATOM   541    H  HD22 . ASN A  1 32  ? -11.495 -13.832 42.756  1.00 0.00 ?  347 ASN A HD22 1  
ATOM   542    N  N    . GLN A  1 33  ? -10.450 -18.778 40.455  1.00 0.00 ?  348 GLN A N    1  
ATOM   543    C  CA   . GLN A  1 33  ? -9.734  -20.000 40.402  1.00 0.00 ?  348 GLN A CA   1  
ATOM   544    C  C    . GLN A  1 33  ? -8.871  -19.990 39.097  1.00 0.00 ?  348 GLN A C    1  
ATOM   545    O  O    . GLN A  1 33  ? -9.374  -19.578 38.107  1.00 0.00 ?  348 GLN A O    1  
ATOM   546    C  CB   . GLN A  1 33  ? -10.590 -21.287 40.268  1.00 0.00 ?  348 GLN A CB   1  
ATOM   547    C  CG   . GLN A  1 33  ? -9.835  -22.604 40.297  1.00 0.00 ?  348 GLN A CG   1  
ATOM   548    C  CD   . GLN A  1 33  ? -8.786  -22.655 41.427  1.00 0.00 ?  348 GLN A CD   1  
ATOM   549    O  OE1  . GLN A  1 33  ? -7.586  -22.706 41.350  1.00 0.00 ?  348 GLN A OE1  1  
ATOM   550    N  NE2  . GLN A  1 33  ? -9.347  -22.650 42.643  1.00 0.00 ?  348 GLN A NE2  1  
ATOM   551    H  H    . GLN A  1 33  ? -10.644 -18.502 39.517  1.00 0.00 ?  348 GLN A H    1  
ATOM   552    H  HA   . GLN A  1 33  ? -9.139  -20.047 41.302  1.00 0.00 ?  348 GLN A HA   1  
ATOM   553    H  HB2  . GLN A  1 33  ? -11.367 -21.159 41.052  1.00 0.00 ?  348 GLN A HB2  1  
ATOM   554    H  HB3  . GLN A  1 33  ? -11.118 -21.341 39.292  1.00 0.00 ?  348 GLN A HB3  1  
ATOM   555    H  HG2  . GLN A  1 33  ? -10.521 -23.475 40.231  1.00 0.00 ?  348 GLN A HG2  1  
ATOM   556    H  HG3  . GLN A  1 33  ? -9.163  -22.632 39.413  1.00 0.00 ?  348 GLN A HG3  1  
ATOM   557    H  HE21 . GLN A  1 33  ? -8.655  -22.479 43.345  1.00 0.00 ?  348 GLN A HE21 1  
ATOM   558    H  HE22 . GLN A  1 33  ? -10.346 -22.682 42.641  1.00 0.00 ?  348 GLN A HE22 1  
ATOM   559    N  N    . VAL A  1 34  ? -7.585  -20.410 39.133  1.00 0.00 ?  349 VAL A N    1  
ATOM   560    C  CA   . VAL A  1 34  ? -6.851  -20.606 37.948  1.00 0.00 ?  349 VAL A CA   1  
ATOM   561    C  C    . VAL A  1 34  ? -7.475  -21.572 36.940  1.00 0.00 ?  349 VAL A C    1  
ATOM   562    O  O    . VAL A  1 34  ? -8.150  -22.532 37.264  1.00 0.00 ?  349 VAL A O    1  
ATOM   563    C  CB   . VAL A  1 34  ? -5.315  -20.848 38.139  1.00 0.00 ?  349 VAL A CB   1  
ATOM   564    C  CG1  . VAL A  1 34  ? -4.687  -19.611 38.862  1.00 0.00 ?  349 VAL A CG1  1  
ATOM   565    C  CG2  . VAL A  1 34  ? -5.137  -22.059 39.027  1.00 0.00 ?  349 VAL A CG2  1  
ATOM   566    H  H    . VAL A  1 34  ? -7.245  -20.664 40.035  1.00 0.00 ?  349 VAL A H    1  
ATOM   567    H  HA   . VAL A  1 34  ? -6.847  -19.694 37.369  1.00 0.00 ?  349 VAL A HA   1  
ATOM   568    H  HB   . VAL A  1 34  ? -4.787  -20.991 37.172  1.00 0.00 ?  349 VAL A HB   1  
ATOM   569    H  HG11 . VAL A  1 34  ? -4.905  -18.716 38.241  1.00 0.00 ?  349 VAL A HG11 1  
ATOM   570    H  HG12 . VAL A  1 34  ? -3.576  -19.620 38.858  1.00 0.00 ?  349 VAL A HG12 1  
ATOM   571    H  HG13 . VAL A  1 34  ? -5.226  -19.555 39.832  1.00 0.00 ?  349 VAL A HG13 1  
ATOM   572    H  HG21 . VAL A  1 34  ? -5.553  -22.952 38.513  1.00 0.00 ?  349 VAL A HG21 1  
ATOM   573    H  HG22 . VAL A  1 34  ? -5.554  -21.897 40.044  1.00 0.00 ?  349 VAL A HG22 1  
ATOM   574    H  HG23 . VAL A  1 34  ? -4.056  -22.286 39.155  1.00 0.00 ?  349 VAL A HG23 1  
ATOM   575    N  N    . MET A  1 35  ? -7.368  -21.269 35.663  1.00 0.00 ?  350 MET A N    1  
ATOM   576    C  CA   . MET A  1 35  ? -8.035  -22.037 34.675  1.00 0.00 ?  350 MET A CA   1  
ATOM   577    C  C    . MET A  1 35  ? -7.230  -23.284 34.368  1.00 0.00 ?  350 MET A C    1  
ATOM   578    O  O    . MET A  1 35  ? -6.116  -23.455 34.819  1.00 0.00 ?  350 MET A O    1  
ATOM   579    C  CB   . MET A  1 35  ? -8.299  -21.239 33.428  1.00 0.00 ?  350 MET A CB   1  
ATOM   580    C  CG   . MET A  1 35  ? -9.230  -20.066 33.717  1.00 0.00 ?  350 MET A CG   1  
ATOM   581    S  SD   . MET A  1 35  ? -9.410  -18.827 32.341  1.00 0.00 ?  350 MET A SD   1  
ATOM   582    C  CE   . MET A  1 35  ? -10.317 -19.903 31.156  1.00 0.00 ?  350 MET A CE   1  
ATOM   583    H  H    . MET A  1 35  ? -6.862  -20.471 35.344  1.00 0.00 ?  350 MET A H    1  
ATOM   584    H  HA   . MET A  1 35  ? -8.991  -22.342 35.074  1.00 0.00 ?  350 MET A HA   1  
ATOM   585    H  HB2  . MET A  1 35  ? -7.362  -21.054 32.860  1.00 0.00 ?  350 MET A HB2  1  
ATOM   586    H  HB3  . MET A  1 35  ? -8.910  -21.729 32.640  1.00 0.00 ?  350 MET A HB3  1  
ATOM   587    H  HG2  . MET A  1 35  ? -10.247 -20.478 33.889  1.00 0.00 ?  350 MET A HG2  1  
ATOM   588    H  HG3  . MET A  1 35  ? -9.027  -19.524 34.666  1.00 0.00 ?  350 MET A HG3  1  
ATOM   589    H  HE1  . MET A  1 35  ? -11.212 -20.355 31.635  1.00 0.00 ?  350 MET A HE1  1  
ATOM   590    H  HE2  . MET A  1 35  ? -9.659  -20.689 30.729  1.00 0.00 ?  350 MET A HE2  1  
ATOM   591    H  HE3  . MET A  1 35  ? -10.718 -19.252 30.350  1.00 0.00 ?  350 MET A HE3  1  
ATOM   592    N  N    . ASP A  1 36  ? -7.884  -24.263 33.662  1.00 0.00 ?  351 ASP A N    1  
ATOM   593    C  CA   . ASP A  1 36  ? -7.376  -25.550 33.266  1.00 0.00 ?  351 ASP A CA   1  
ATOM   594    C  C    . ASP A  1 36  ? -6.206  -25.313 32.310  1.00 0.00 ?  351 ASP A C    1  
ATOM   595    O  O    . ASP A  1 36  ? -6.233  -24.434 31.422  1.00 0.00 ?  351 ASP A O    1  
ATOM   596    C  CB   . ASP A  1 36  ? -8.399  -26.439 32.635  1.00 0.00 ?  351 ASP A CB   1  
ATOM   597    C  CG   . ASP A  1 36  ? -9.698  -26.472 33.356  1.00 0.00 ?  351 ASP A CG   1  
ATOM   598    O  OD1  . ASP A  1 36  ? -10.764 -26.512 32.658  1.00 0.00 ?  351 ASP A OD1  1  
ATOM   599    O  OD2  . ASP A  1 36  ? -9.793  -26.527 34.614  1.00 0.00 -1 351 ASP A OD2  1  
ATOM   600    H  H    . ASP A  1 36  ? -8.843  -24.160 33.409  1.00 0.00 ?  351 ASP A H    1  
ATOM   601    H  HA   . ASP A  1 36  ? -6.875  -25.973 34.124  1.00 0.00 ?  351 ASP A HA   1  
ATOM   602    H  HB2  . ASP A  1 36  ? -8.573  -25.985 31.636  1.00 0.00 ?  351 ASP A HB2  1  
ATOM   603    H  HB3  . ASP A  1 36  ? -7.916  -27.417 32.423  1.00 0.00 ?  351 ASP A HB3  1  
ATOM   604    N  N    . GLY A  1 37  ? -5.151  -26.109 32.340  1.00 0.00 ?  352 GLY A N    1  
ATOM   605    C  CA   . GLY A  1 37  ? -4.051  -26.146 31.375  1.00 0.00 ?  352 GLY A CA   1  
ATOM   606    C  C    . GLY A  1 37  ? -2.965  -25.099 31.539  1.00 0.00 ?  352 GLY A C    1  
ATOM   607    O  O    . GLY A  1 37  ? -2.606  -24.505 30.517  1.00 0.00 ?  352 GLY A O    1  
ATOM   608    H  H    . GLY A  1 37  ? -5.034  -26.675 33.153  1.00 0.00 ?  352 GLY A H    1  
ATOM   609    H  HA2  . GLY A  1 37  ? -3.466  -27.023 31.608  1.00 0.00 ?  352 GLY A HA2  1  
ATOM   610    H  HA3  . GLY A  1 37  ? -4.415  -26.152 30.358  1.00 0.00 ?  352 GLY A HA3  1  
ATOM   611    N  N    . TYR A  1 38  ? -2.478  -24.750 32.681  1.00 0.00 ?  353 TYR A N    1  
ATOM   612    C  CA   . TYR A  1 38  ? -1.404  -23.696 32.844  1.00 0.00 ?  353 TYR A CA   1  
ATOM   613    C  C    . TYR A  1 38  ? -0.423  -24.251 33.770  1.00 0.00 ?  353 TYR A C    1  
ATOM   614    O  O    . TYR A  1 38  ? -0.867  -25.144 34.494  1.00 0.00 ?  353 TYR A O    1  
ATOM   615    C  CB   . TYR A  1 38  ? -1.974  -22.423 33.538  1.00 0.00 ?  353 TYR A CB   1  
ATOM   616    C  CG   . TYR A  1 38  ? -2.836  -21.732 32.490  1.00 0.00 ?  353 TYR A CG   1  
ATOM   617    C  CD1  . TYR A  1 38  ? -4.224  -21.932 32.344  1.00 0.00 ?  353 TYR A CD1  1  
ATOM   618    C  CD2  . TYR A  1 38  ? -2.274  -20.791 31.628  1.00 0.00 ?  353 TYR A CD2  1  
ATOM   619    C  CE1  . TYR A  1 38  ? -4.891  -21.430 31.223  1.00 0.00 ?  353 TYR A CE1  1  
ATOM   620    C  CE2  . TYR A  1 38  ? -2.906  -20.199 30.568  1.00 0.00 ?  353 TYR A CE2  1  
ATOM   621    C  CZ   . TYR A  1 38  ? -4.243  -20.544 30.358  1.00 0.00 ?  353 TYR A CZ   1  
ATOM   622    O  OH   . TYR A  1 38  ? -4.978  -19.930 29.275  1.00 0.00 ?  353 TYR A OH   1  
ATOM   623    H  H    . TYR A  1 38  ? -2.636  -25.209 33.551  1.00 0.00 ?  353 TYR A H    1  
ATOM   624    H  HA   . TYR A  1 38  ? -0.922  -23.516 31.894  1.00 0.00 ?  353 TYR A HA   1  
ATOM   625    H  HB2  . TYR A  1 38  ? -2.651  -22.747 34.357  1.00 0.00 ?  353 TYR A HB2  1  
ATOM   626    H  HB3  . TYR A  1 38  ? -1.217  -21.767 34.019  1.00 0.00 ?  353 TYR A HB3  1  
ATOM   627    H  HD1  . TYR A  1 38  ? -4.804  -22.661 32.889  1.00 0.00 ?  353 TYR A HD1  1  
ATOM   628    H  HD2  . TYR A  1 38  ? -1.217  -20.608 31.753  1.00 0.00 ?  353 TYR A HD2  1  
ATOM   629    H  HE1  . TYR A  1 38  ? -5.921  -21.742 31.137  1.00 0.00 ?  353 TYR A HE1  1  
ATOM   630    H  HE2  . TYR A  1 38  ? -2.421  -19.570 29.835  1.00 0.00 ?  353 TYR A HE2  1  
ATOM   631    H  HH   . TYR A  1 38  ? -5.878  -20.244 29.389  1.00 0.00 ?  353 TYR A HH   1  
ATOM   632    N  N    . PRO A  1 39  ? 0.798   -23.769 33.967  1.00 0.00 ?  354 PRO A N    1  
ATOM   633    C  CA   . PRO A  1 39  ? 1.420   -22.655 33.276  1.00 0.00 ?  354 PRO A CA   1  
ATOM   634    C  C    . PRO A  1 39  ? 1.549   -22.741 31.794  1.00 0.00 ?  354 PRO A C    1  
ATOM   635    O  O    . PRO A  1 39  ? 2.095   -23.718 31.365  1.00 0.00 ?  354 PRO A O    1  
ATOM   636    C  CB   . PRO A  1 39  ? 2.881   -22.553 33.904  1.00 0.00 ?  354 PRO A CB   1  
ATOM   637    C  CG   . PRO A  1 39  ? 2.673   -23.074 35.313  1.00 0.00 ?  354 PRO A CG   1  
ATOM   638    C  CD   . PRO A  1 39  ? 1.589   -24.094 35.111  1.00 0.00 ?  354 PRO A CD   1  
ATOM   639    H  HA   . PRO A  1 39  ? 0.909   -21.742 33.546  1.00 0.00 ?  354 PRO A HA   1  
ATOM   640    H  HB2  . PRO A  1 39  ? 3.627   -23.128 33.314  1.00 0.00 ?  354 PRO A HB2  1  
ATOM   641    H  HB3  . PRO A  1 39  ? 3.291   -21.521 33.937  1.00 0.00 ?  354 PRO A HB3  1  
ATOM   642    H  HG2  . PRO A  1 39  ? 3.580   -23.620 35.652  1.00 0.00 ?  354 PRO A HG2  1  
ATOM   643    H  HG3  . PRO A  1 39  ? 2.436   -22.196 35.950  1.00 0.00 ?  354 PRO A HG3  1  
ATOM   644    H  HD2  . PRO A  1 39  ? 2.072   -25.068 34.882  1.00 0.00 ?  354 PRO A HD2  1  
ATOM   645    H  HD3  . PRO A  1 39  ? 0.910   -24.190 35.985  1.00 0.00 ?  354 PRO A HD3  1  
ATOM   646    N  N    . MET A  1 40  ? 1.164   -21.726 31.042  1.00 0.00 ?  355 MET A N    1  
ATOM   647    C  CA   . MET A  1 40  ? 1.486   -21.653 29.625  1.00 0.00 ?  355 MET A CA   1  
ATOM   648    C  C    . MET A  1 40  ? 2.608   -20.671 29.380  1.00 0.00 ?  355 MET A C    1  
ATOM   649    O  O    . MET A  1 40  ? 2.566   -19.615 29.886  1.00 0.00 ?  355 MET A O    1  
ATOM   650    C  CB   . MET A  1 40  ? 0.236   -21.302 28.868  1.00 0.00 ?  355 MET A CB   1  
ATOM   651    C  CG   . MET A  1 40  ? -0.781  -22.479 28.577  1.00 0.00 ?  355 MET A CG   1  
ATOM   652    S  SD   . MET A  1 40  ? -2.185  -21.845 27.686  1.00 0.00 ?  355 MET A SD   1  
ATOM   653    C  CE   . MET A  1 40  ? -2.742  -23.456 26.987  1.00 0.00 ?  355 MET A CE   1  
ATOM   654    H  H    . MET A  1 40  ? 0.681   -20.930 31.400  1.00 0.00 ?  355 MET A H    1  
ATOM   655    H  HA   . MET A  1 40  ? 1.887   -22.630 29.401  1.00 0.00 ?  355 MET A HA   1  
ATOM   656    H  HB2  . MET A  1 40  ? -0.237  -20.463 29.422  1.00 0.00 ?  355 MET A HB2  1  
ATOM   657    H  HB3  . MET A  1 40  ? 0.498   -20.885 27.872  1.00 0.00 ?  355 MET A HB3  1  
ATOM   658    H  HG2  . MET A  1 40  ? -0.243  -23.266 28.006  1.00 0.00 ?  355 MET A HG2  1  
ATOM   659    H  HG3  . MET A  1 40  ? -1.045  -22.905 29.569  1.00 0.00 ?  355 MET A HG3  1  
ATOM   660    H  HE1  . MET A  1 40  ? -3.820  -23.473 26.717  1.00 0.00 ?  355 MET A HE1  1  
ATOM   661    H  HE2  . MET A  1 40  ? -2.507  -24.281 27.693  1.00 0.00 ?  355 MET A HE2  1  
ATOM   662    H  HE3  . MET A  1 40  ? -2.066  -23.715 26.144  1.00 0.00 ?  355 MET A HE3  1  
ATOM   663    N  N    . PRO A  1 41  ? 3.662   -20.915 28.612  1.00 0.00 ?  356 PRO A N    1  
ATOM   664    C  CA   . PRO A  1 41  ? 4.556   -19.813 28.150  1.00 0.00 ?  356 PRO A CA   1  
ATOM   665    C  C    . PRO A  1 41  ? 3.764   -18.635 27.603  1.00 0.00 ?  356 PRO A C    1  
ATOM   666    O  O    . PRO A  1 41  ? 2.689   -18.812 26.931  1.00 0.00 ?  356 PRO A O    1  
ATOM   667    C  CB   . PRO A  1 41  ? 5.463   -20.492 27.230  1.00 0.00 ?  356 PRO A CB   1  
ATOM   668    C  CG   . PRO A  1 41  ? 5.282   -22.018 27.489  1.00 0.00 ?  356 PRO A CG   1  
ATOM   669    C  CD   . PRO A  1 41  ? 3.836   -22.149 27.842  1.00 0.00 ?  356 PRO A CD   1  
ATOM   670    H  HA   . PRO A  1 41  ? 5.129   -19.561 29.030  1.00 0.00 ?  356 PRO A HA   1  
ATOM   671    H  HB2  . PRO A  1 41  ? 5.048   -20.309 26.216  1.00 0.00 ?  356 PRO A HB2  1  
ATOM   672    H  HB3  . PRO A  1 41  ? 6.520   -20.156 27.284  1.00 0.00 ?  356 PRO A HB3  1  
ATOM   673    H  HG2  . PRO A  1 41  ? 5.549   -22.558 26.555  1.00 0.00 ?  356 PRO A HG2  1  
ATOM   674    H  HG3  . PRO A  1 41  ? 6.027   -22.290 28.267  1.00 0.00 ?  356 PRO A HG3  1  
ATOM   675    H  HD2  . PRO A  1 41  ? 3.155   -21.914 26.996  1.00 0.00 ?  356 PRO A HD2  1  
ATOM   676    H  HD3  . PRO A  1 41  ? 3.605   -23.089 28.388  1.00 0.00 ?  356 PRO A HD3  1  
ATOM   677    N  N    . ILE A  1 42  ? 4.327   -17.355 27.706  1.00 0.00 ?  357 ILE A N    1  
ATOM   678    C  CA   . ILE A  1 42  ? 3.741   -16.139 27.072  1.00 0.00 ?  357 ILE A CA   1  
ATOM   679    C  C    . ILE A  1 42  ? 3.836   -16.324 25.548  1.00 0.00 ?  357 ILE A C    1  
ATOM   680    O  O    . ILE A  1 42  ? 2.821   -15.995 24.922  1.00 0.00 ?  357 ILE A O    1  
ATOM   681    C  CB   . ILE A  1 42  ? 4.608   -14.930 27.547  1.00 0.00 ?  357 ILE A CB   1  
ATOM   682    C  CG1  . ILE A  1 42  ? 4.779   -14.811 29.101  1.00 0.00 ?  357 ILE A CG1  1  
ATOM   683    C  CG2  . ILE A  1 42  ? 4.191   -13.531 26.948  1.00 0.00 ?  357 ILE A CG2  1  
ATOM   684    C  CD1  . ILE A  1 42  ? 5.900   -13.753 29.350  1.00 0.00 ?  357 ILE A CD1  1  
ATOM   685    H  H    . ILE A  1 42  ? 5.137   -17.247 28.278  1.00 0.00 ?  357 ILE A H    1  
ATOM   686    H  HA   . ILE A  1 42  ? 2.673   -16.144 27.234  1.00 0.00 ?  357 ILE A HA   1  
ATOM   687    H  HB   . ILE A  1 42  ? 5.667   -15.082 27.246  1.00 0.00 ?  357 ILE A HB   1  
ATOM   688    H  HG12 . ILE A  1 42  ? 3.856   -14.472 29.619  1.00 0.00 ?  357 ILE A HG12 1  
ATOM   689    H  HG13 . ILE A  1 42  ? 5.104   -15.747 29.604  1.00 0.00 ?  357 ILE A HG13 1  
ATOM   690    H  HG21 . ILE A  1 42  ? 4.804   -12.653 27.243  1.00 0.00 ?  357 ILE A HG21 1  
ATOM   691    H  HG22 . ILE A  1 42  ? 3.106   -13.291 26.961  1.00 0.00 ?  357 ILE A HG22 1  
ATOM   692    H  HG23 . ILE A  1 42  ? 4.302   -13.569 25.843  1.00 0.00 ?  357 ILE A HG23 1  
ATOM   693    H  HD11 . ILE A  1 42  ? 6.735   -13.923 28.638  1.00 0.00 ?  357 ILE A HD11 1  
ATOM   694    H  HD12 . ILE A  1 42  ? 6.342   -13.783 30.369  1.00 0.00 ?  357 ILE A HD12 1  
ATOM   695    H  HD13 . ILE A  1 42  ? 5.468   -12.738 29.222  1.00 0.00 ?  357 ILE A HD13 1  
ATOM   696    N  N    . GLY A  1 43  ? 4.960   -16.875 25.006  1.00 0.00 ?  358 GLY A N    1  
ATOM   697    C  CA   . GLY A  1 43  ? 5.115   -17.038 23.555  1.00 0.00 ?  358 GLY A CA   1  
ATOM   698    C  C    . GLY A  1 43  ? 4.207   -18.005 22.845  1.00 0.00 ?  358 GLY A C    1  
ATOM   699    O  O    . GLY A  1 43  ? 4.096   -18.048 21.624  1.00 0.00 ?  358 GLY A O    1  
ATOM   700    H  H    . GLY A  1 43  ? 5.718   -17.077 25.621  1.00 0.00 ?  358 GLY A H    1  
ATOM   701    H  HA2  . GLY A  1 43  ? 4.969   -16.068 23.104  1.00 0.00 ?  358 GLY A HA2  1  
ATOM   702    H  HA3  . GLY A  1 43  ? 6.099   -17.418 23.323  1.00 0.00 ?  358 GLY A HA3  1  
ATOM   703    N  N    . GLN A  1 44  ? 3.677   -18.979 23.654  1.00 0.00 ?  359 GLN A N    1  
ATOM   704    C  CA   . GLN A  1 44  ? 2.689   -19.953 23.125  1.00 0.00 ?  359 GLN A CA   1  
ATOM   705    C  C    . GLN A  1 44  ? 1.319   -19.290 22.946  1.00 0.00 ?  359 GLN A C    1  
ATOM   706    O  O    . GLN A  1 44  ? 0.434   -19.745 22.191  1.00 0.00 ?  359 GLN A O    1  
ATOM   707    C  CB   . GLN A  1 44  ? 2.621   -21.201 23.966  1.00 0.00 ?  359 GLN A CB   1  
ATOM   708    C  CG   . GLN A  1 44  ? 3.817   -22.214 23.848  1.00 0.00 ?  359 GLN A CG   1  
ATOM   709    C  CD   . GLN A  1 44  ? 4.217   -22.686 22.495  1.00 0.00 ?  359 GLN A CD   1  
ATOM   710    O  OE1  . GLN A  1 44  ? 3.546   -22.532 21.468  1.00 0.00 ?  359 GLN A OE1  1  
ATOM   711    N  NE2  . GLN A  1 44  ? 5.415   -23.287 22.410  1.00 0.00 ?  359 GLN A NE2  1  
ATOM   712    H  H    . GLN A  1 44  ? 4.077   -19.150 24.551  1.00 0.00 ?  359 GLN A H    1  
ATOM   713    H  HA   . GLN A  1 44  ? 3.054   -20.256 22.155  1.00 0.00 ?  359 GLN A HA   1  
ATOM   714    H  HB2  . GLN A  1 44  ? 2.573   -20.804 25.002  1.00 0.00 ?  359 GLN A HB2  1  
ATOM   715    H  HB3  . GLN A  1 44  ? 1.682   -21.699 23.644  1.00 0.00 ?  359 GLN A HB3  1  
ATOM   716    H  HG2  . GLN A  1 44  ? 4.636   -21.732 24.423  1.00 0.00 ?  359 GLN A HG2  1  
ATOM   717    H  HG3  . GLN A  1 44  ? 3.482   -23.118 24.400  1.00 0.00 ?  359 GLN A HG3  1  
ATOM   718    H  HE21 . GLN A  1 44  ? 5.663   -23.665 21.518  1.00 0.00 ?  359 GLN A HE21 1  
ATOM   719    H  HE22 . GLN A  1 44  ? 5.894   -23.445 23.273  1.00 0.00 ?  359 GLN A HE22 1  
ATOM   720    N  N    . PHE A  1 45  ? 1.060   -18.116 23.597  1.00 0.00 ?  360 PHE A N    1  
ATOM   721    C  CA   . PHE A  1 45  ? -0.171  -17.330 23.298  1.00 0.00 ?  360 PHE A CA   1  
ATOM   722    C  C    . PHE A  1 45  ? -0.033  -16.297 22.058  1.00 0.00 ?  360 PHE A C    1  
ATOM   723    O  O    . PHE A  1 45  ? -0.904  -16.175 21.195  1.00 0.00 ?  360 PHE A O    1  
ATOM   724    C  CB   . PHE A  1 45  ? -0.683  -16.521 24.574  1.00 0.00 ?  360 PHE A CB   1  
ATOM   725    C  CG   . PHE A  1 45  ? -1.724  -15.504 24.239  1.00 0.00 ?  360 PHE A CG   1  
ATOM   726    C  CD1  . PHE A  1 45  ? -1.638  -14.263 24.858  1.00 0.00 ?  360 PHE A CD1  1  
ATOM   727    C  CD2  . PHE A  1 45  ? -2.942  -15.813 23.601  1.00 0.00 ?  360 PHE A CD2  1  
ATOM   728    C  CE1  . PHE A  1 45  ? -2.636  -13.291 24.734  1.00 0.00 ?  360 PHE A CE1  1  
ATOM   729    C  CE2  . PHE A  1 45  ? -3.952  -14.824 23.420  1.00 0.00 ?  360 PHE A CE2  1  
ATOM   730    C  CZ   . PHE A  1 45  ? -3.736  -13.525 23.878  1.00 0.00 ?  360 PHE A CZ   1  
ATOM   731    H  H    . PHE A  1 45  ? 1.769   -17.641 24.112  1.00 0.00 ?  360 PHE A H    1  
ATOM   732    H  HA   . PHE A  1 45  ? -0.957  -18.030 23.056  1.00 0.00 ?  360 PHE A HA   1  
ATOM   733    H  HB2  . PHE A  1 45  ? -1.122  -17.223 25.314  1.00 0.00 ?  360 PHE A HB2  1  
ATOM   734    H  HB3  . PHE A  1 45  ? 0.152   -15.972 25.061  1.00 0.00 ?  360 PHE A HB3  1  
ATOM   735    H  HD1  . PHE A  1 45  ? -0.830  -14.186 25.570  1.00 0.00 ?  360 PHE A HD1  1  
ATOM   736    H  HD2  . PHE A  1 45  ? -3.091  -16.800 23.190  1.00 0.00 ?  360 PHE A HD2  1  
ATOM   737    H  HE1  . PHE A  1 45  ? -2.520  -12.367 25.281  1.00 0.00 ?  360 PHE A HE1  1  
ATOM   738    H  HE2  . PHE A  1 45  ? -4.896  -14.999 22.925  1.00 0.00 ?  360 PHE A HE2  1  
ATOM   739    H  HZ   . PHE A  1 45  ? -4.441  -12.748 23.623  1.00 0.00 ?  360 PHE A HZ   1  
ATOM   740    N  N    . TRP A  1 46  ? 1.055   -15.537 21.974  1.00 0.00 ?  361 TRP A N    1  
ATOM   741    C  CA   . TRP A  1 46  ? 1.333   -14.510 21.033  1.00 0.00 ?  361 TRP A CA   1  
ATOM   742    C  C    . TRP A  1 46  ? 2.859   -14.335 20.808  1.00 0.00 ?  361 TRP A C    1  
ATOM   743    O  O    . TRP A  1 46  ? 3.669   -14.714 21.674  1.00 0.00 ?  361 TRP A O    1  
ATOM   744    C  CB   . TRP A  1 46  ? 0.584   -13.176 21.306  1.00 0.00 ?  361 TRP A CB   1  
ATOM   745    C  CG   . TRP A  1 46  ? 0.781   -12.544 22.678  1.00 0.00 ?  361 TRP A CG   1  
ATOM   746    C  CD1  . TRP A  1 46  ? 1.606   -12.917 23.764  1.00 0.00 ?  361 TRP A CD1  1  
ATOM   747    C  CD2  . TRP A  1 46  ? -0.005  -11.515 23.205  1.00 0.00 ?  361 TRP A CD2  1  
ATOM   748    N  NE1  . TRP A  1 46  ? 1.410   -12.159 24.863  1.00 0.00 ?  361 TRP A NE1  1  
ATOM   749    C  CE2  . TRP A  1 46  ? 0.376   -11.234 24.518  1.00 0.00 ?  361 TRP A CE2  1  
ATOM   750    C  CE3  . TRP A  1 46  ? -1.127  -10.842 22.720  1.00 0.00 ?  361 TRP A CE3  1  
ATOM   751    C  CZ2  . TRP A  1 46  ? -0.106  -10.172 25.245  1.00 0.00 ?  361 TRP A CZ2  1  
ATOM   752    C  CZ3  . TRP A  1 46  ? -1.735  -9.865  23.465  1.00 0.00 ?  361 TRP A CZ3  1  
ATOM   753    C  CH2  . TRP A  1 46  ? -1.247  -9.561  24.751  1.00 0.00 ?  361 TRP A CH2  1  
ATOM   754    H  H    . TRP A  1 46  ? 1.729   -15.599 22.706  1.00 0.00 ?  361 TRP A H    1  
ATOM   755    H  HA   . TRP A  1 46  ? 0.999   -14.981 20.121  1.00 0.00 ?  361 TRP A HA   1  
ATOM   756    H  HB2  . TRP A  1 46  ? 0.897   -12.423 20.552  1.00 0.00 ?  361 TRP A HB2  1  
ATOM   757    H  HB3  . TRP A  1 46  ? -0.511  -13.315 21.178  1.00 0.00 ?  361 TRP A HB3  1  
ATOM   758    H  HD1  . TRP A  1 46  ? 2.200   -13.819 23.732  1.00 0.00 ?  361 TRP A HD1  1  
ATOM   759    H  HE1  . TRP A  1 46  ? 2.037   -11.998 25.594  1.00 0.00 ?  361 TRP A HE1  1  
ATOM   760    H  HE3  . TRP A  1 46  ? -1.522  -11.035 21.734  1.00 0.00 ?  361 TRP A HE3  1  
ATOM   761    H  HZ2  . TRP A  1 46  ? 0.263   -9.936  26.232  1.00 0.00 ?  361 TRP A HZ2  1  
ATOM   762    H  HZ3  . TRP A  1 46  ? -2.590  -9.295  23.135  1.00 0.00 ?  361 TRP A HZ3  1  
ATOM   763    H  HH2  . TRP A  1 46  ? -1.793  -8.796  25.283  1.00 0.00 ?  361 TRP A HH2  1  
ATOM   764    N  N    . ARG A  1 47  ? 3.210   -13.725 19.694  1.00 0.00 ?  362 ARG A N    1  
ATOM   765    C  CA   . ARG A  1 47  ? 4.595   -13.751 19.246  1.00 0.00 ?  362 ARG A CA   1  
ATOM   766    C  C    . ARG A  1 47  ? 5.165   -12.348 19.336  1.00 0.00 ?  362 ARG A C    1  
ATOM   767    O  O    . ARG A  1 47  ? 4.830   -11.480 18.543  1.00 0.00 ?  362 ARG A O    1  
ATOM   768    C  CB   . ARG A  1 47  ? 4.621   -14.025 17.741  1.00 0.00 ?  362 ARG A CB   1  
ATOM   769    C  CG   . ARG A  1 47  ? 6.038   -14.160 17.185  1.00 0.00 ?  362 ARG A CG   1  
ATOM   770    C  CD   . ARG A  1 47  ? 6.244   -14.501 15.713  1.00 0.00 ?  362 ARG A CD   1  
ATOM   771    N  NE   . ARG A  1 47  ? 5.374   -15.645 15.293  1.00 0.00 ?  362 ARG A NE   1  
ATOM   772    C  CZ   . ARG A  1 47  ? 5.492   -16.890 15.777  1.00 0.00 ?  362 ARG A CZ   1  
ATOM   773    N  NH1  . ARG A  1 47  ? 6.602   -17.484 15.998  1.00 0.00 1  362 ARG A NH1  1  
ATOM   774    N  NH2  . ARG A  1 47  ? 4.324   -17.556 15.951  1.00 0.00 ?  362 ARG A NH2  1  
ATOM   775    H  H    . ARG A  1 47  ? 2.556   -13.366 19.033  1.00 0.00 ?  362 ARG A H    1  
ATOM   776    H  HA   . ARG A  1 47  ? 5.238   -14.393 19.830  1.00 0.00 ?  362 ARG A HA   1  
ATOM   777    H  HB2  . ARG A  1 47  ? 4.147   -14.995 17.483  1.00 0.00 ?  362 ARG A HB2  1  
ATOM   778    H  HB3  . ARG A  1 47  ? 3.940   -13.284 17.270  1.00 0.00 ?  362 ARG A HB3  1  
ATOM   779    H  HG2  . ARG A  1 47  ? 6.680   -13.291 17.442  1.00 0.00 ?  362 ARG A HG2  1  
ATOM   780    H  HG3  . ARG A  1 47  ? 6.510   -15.004 17.731  1.00 0.00 ?  362 ARG A HG3  1  
ATOM   781    H  HD2  . ARG A  1 47  ? 6.069   -13.606 15.079  1.00 0.00 ?  362 ARG A HD2  1  
ATOM   782    H  HD3  . ARG A  1 47  ? 7.302   -14.776 15.518  1.00 0.00 ?  362 ARG A HD3  1  
ATOM   783    H  HE   . ARG A  1 47  ? 4.431   -15.433 15.037  1.00 0.00 ?  362 ARG A HE   1  
ATOM   784    H  HH11 . ARG A  1 47  ? 7.440   -17.083 15.628  1.00 0.00 ?  362 ARG A HH11 1  
ATOM   785    H  HH12 . ARG A  1 47  ? 6.654   -18.472 16.147  1.00 0.00 ?  362 ARG A HH12 1  
ATOM   786    H  HH21 . ARG A  1 47  ? 3.418   -17.146 15.849  1.00 0.00 ?  362 ARG A HH21 1  
ATOM   787    H  HH22 . ARG A  1 47  ? 4.385   -18.399 16.484  1.00 0.00 ?  362 ARG A HH22 1  
ATOM   788    N  N    . GLY A  1 48  ? 6.093   -12.003 20.244  1.00 0.00 ?  363 GLY A N    1  
ATOM   789    C  CA   . GLY A  1 48  ? 6.841   -10.712 20.268  1.00 0.00 ?  363 GLY A CA   1  
ATOM   790    C  C    . GLY A  1 48  ? 6.896   -9.987  21.632  1.00 0.00 ?  363 GLY A C    1  
ATOM   791    O  O    . GLY A  1 48  ? 7.391   -8.839  21.639  1.00 0.00 ?  363 GLY A O    1  
ATOM   792    H  H    . GLY A  1 48  ? 6.306   -12.618 20.999  1.00 0.00 ?  363 GLY A H    1  
ATOM   793    H  HA2  . GLY A  1 48  ? 7.910   -10.813 20.146  1.00 0.00 ?  363 GLY A HA2  1  
ATOM   794    H  HA3  . GLY A  1 48  ? 6.313   -9.969  19.690  1.00 0.00 ?  363 GLY A HA3  1  
ATOM   795    N  N    . LEU A  1 49  ? 6.475   -10.540 22.733  1.00 0.00 ?  364 LEU A N    1  
ATOM   796    C  CA   . LEU A  1 49  ? 6.431   -9.883  24.014  1.00 0.00 ?  364 LEU A CA   1  
ATOM   797    C  C    . LEU A  1 49  ? 7.391   -10.579 24.974  1.00 0.00 ?  364 LEU A C    1  
ATOM   798    O  O    . LEU A  1 49  ? 7.230   -11.779 25.034  1.00 0.00 ?  364 LEU A O    1  
ATOM   799    C  CB   . LEU A  1 49  ? 5.119   -10.002 24.708  1.00 0.00 ?  364 LEU A CB   1  
ATOM   800    C  CG   . LEU A  1 49  ? 4.854   -9.259  26.055  1.00 0.00 ?  364 LEU A CG   1  
ATOM   801    C  CD1  . LEU A  1 49  ? 4.884   -7.707  25.933  1.00 0.00 ?  364 LEU A CD1  1  
ATOM   802    C  CD2  . LEU A  1 49  ? 3.559   -9.692  26.654  1.00 0.00 ?  364 LEU A CD2  1  
ATOM   803    H  H    . LEU A  1 49  ? 6.235   -11.498 22.596  1.00 0.00 ?  364 LEU A H    1  
ATOM   804    H  HA   . LEU A  1 49  ? 6.581   -8.821  23.887  1.00 0.00 ?  364 LEU A HA   1  
ATOM   805    H  HB2  . LEU A  1 49  ? 4.309   -9.606  24.058  1.00 0.00 ?  364 LEU A HB2  1  
ATOM   806    H  HB3  . LEU A  1 49  ? 4.752   -11.050 24.674  1.00 0.00 ?  364 LEU A HB3  1  
ATOM   807    H  HG   . LEU A  1 49  ? 5.673   -9.428  26.786  1.00 0.00 ?  364 LEU A HG   1  
ATOM   808    H  HD11 . LEU A  1 49  ? 5.895   -7.415  25.578  1.00 0.00 ?  364 LEU A HD11 1  
ATOM   809    H  HD12 . LEU A  1 49  ? 4.822   -7.274  26.954  1.00 0.00 ?  364 LEU A HD12 1  
ATOM   810    H  HD13 . LEU A  1 49  ? 4.121   -7.304  25.233  1.00 0.00 ?  364 LEU A HD13 1  
ATOM   811    H  HD21 . LEU A  1 49  ? 3.648   -10.691 27.132  1.00 0.00 ?  364 LEU A HD21 1  
ATOM   812    H  HD22 . LEU A  1 49  ? 2.737   -9.780  25.911  1.00 0.00 ?  364 LEU A HD22 1  
ATOM   813    H  HD23 . LEU A  1 49  ? 3.249   -8.947  27.417  1.00 0.00 ?  364 LEU A HD23 1  
ATOM   814    N  N    . PRO A  1 50  ? 8.399   -9.792  25.519  1.00 0.00 ?  365 PRO A N    1  
ATOM   815    C  CA   . PRO A  1 50  ? 9.326   -10.260 26.457  1.00 0.00 ?  365 PRO A CA   1  
ATOM   816    C  C    . PRO A  1 50  ? 8.928   -10.919 27.791  1.00 0.00 ?  365 PRO A C    1  
ATOM   817    O  O    . PRO A  1 50  ? 7.896   -10.498 28.413  1.00 0.00 ?  365 PRO A O    1  
ATOM   818    C  CB   . PRO A  1 50  ? 10.011  -8.959  26.834  1.00 0.00 ?  365 PRO A CB   1  
ATOM   819    C  CG   . PRO A  1 50  ? 10.140  -8.192  25.538  1.00 0.00 ?  365 PRO A CG   1  
ATOM   820    C  CD   . PRO A  1 50  ? 8.788   -8.553  24.922  1.00 0.00 ?  365 PRO A CD   1  
ATOM   821    H  HA   . PRO A  1 50  ? 9.997   -10.967 25.992  1.00 0.00 ?  365 PRO A HA   1  
ATOM   822    H  HB2  . PRO A  1 50  ? 9.300   -8.448  27.518  1.00 0.00 ?  365 PRO A HB2  1  
ATOM   823    H  HB3  . PRO A  1 50  ? 10.960  -9.176  27.369  1.00 0.00 ?  365 PRO A HB3  1  
ATOM   824    H  HG2  . PRO A  1 50  ? 10.351  -7.111  25.685  1.00 0.00 ?  365 PRO A HG2  1  
ATOM   825    H  HG3  . PRO A  1 50  ? 10.985  -8.638  24.971  1.00 0.00 ?  365 PRO A HG3  1  
ATOM   826    H  HD2  . PRO A  1 50  ? 8.111   -7.747  25.276  1.00 0.00 ?  365 PRO A HD2  1  
ATOM   827    H  HD3  . PRO A  1 50  ? 8.916   -8.533  23.818  1.00 0.00 ?  365 PRO A HD3  1  
ATOM   828    N  N    . ALA A  1 51  ? 9.731   -11.828 28.409  1.00 0.00 ?  366 ALA A N    1  
ATOM   829    C  CA   . ALA A  1 51  ? 9.639   -12.334 29.773  1.00 0.00 ?  366 ALA A CA   1  
ATOM   830    C  C    . ALA A  1 51  ? 9.754   -11.245 30.902  1.00 0.00 ?  366 ALA A C    1  
ATOM   831    O  O    . ALA A  1 51  ? 10.131  -10.146 30.692  1.00 0.00 ?  366 ALA A O    1  
ATOM   832    C  CB   . ALA A  1 51  ? 10.569  -13.603 29.941  1.00 0.00 ?  366 ALA A CB   1  
ATOM   833    H  H    . ALA A  1 51  ? 10.629  -11.897 27.980  1.00 0.00 ?  366 ALA A H    1  
ATOM   834    H  HA   . ALA A  1 51  ? 8.696   -12.850 29.880  1.00 0.00 ?  366 ALA A HA   1  
ATOM   835    H  HB1  . ALA A  1 51  ? 10.502  -13.936 30.999  1.00 0.00 ?  366 ALA A HB1  1  
ATOM   836    H  HB2  . ALA A  1 51  ? 11.630  -13.512 29.624  1.00 0.00 ?  366 ALA A HB2  1  
ATOM   837    H  HB3  . ALA A  1 51  ? 10.103  -14.423 29.355  1.00 0.00 ?  366 ALA A HB3  1  
ATOM   838    N  N    . SER A  1 52  ? 9.405   -11.554 32.187  1.00 0.00 ?  367 SER A N    1  
ATOM   839    C  CA   . SER A  1 52  ? 9.079   -10.670 33.362  1.00 0.00 ?  367 SER A CA   1  
ATOM   840    C  C    . SER A  1 52  ? 8.759   -9.223  33.037  1.00 0.00 ?  367 SER A C    1  
ATOM   841    O  O    . SER A  1 52  ? 9.560   -8.321  33.150  1.00 0.00 ?  367 SER A O    1  
ATOM   842    C  CB   . SER A  1 52  ? 10.235  -10.728 34.386  1.00 0.00 ?  367 SER A CB   1  
ATOM   843    O  OG   . SER A  1 52  ? 10.373  -11.977 35.046  1.00 0.00 ?  367 SER A OG   1  
ATOM   844    H  H    . SER A  1 52  ? 9.323   -12.518 32.431  1.00 0.00 ?  367 SER A H    1  
ATOM   845    H  HA   . SER A  1 52  ? 8.221   -11.011 33.922  1.00 0.00 ?  367 SER A HA   1  
ATOM   846    H  HB2  . SER A  1 52  ? 11.147  -10.521 33.787  1.00 0.00 ?  367 SER A HB2  1  
ATOM   847    H  HB3  . SER A  1 52  ? 10.030  -9.949  35.152  1.00 0.00 ?  367 SER A HB3  1  
ATOM   848    H  HG   . SER A  1 52  ? 9.595   -11.988 35.608  1.00 0.00 ?  367 SER A HG   1  
ATOM   849    N  N    . ILE A  1 53  ? 7.576   -8.915  32.426  1.00 0.00 ?  368 ILE A N    1  
ATOM   850    C  CA   . ILE A  1 53  ? 7.117   -7.573  32.347  1.00 0.00 ?  368 ILE A CA   1  
ATOM   851    C  C    . ILE A  1 53  ? 6.857   -6.970  33.750  1.00 0.00 ?  368 ILE A C    1  
ATOM   852    O  O    . ILE A  1 53  ? 6.436   -7.654  34.708  1.00 0.00 ?  368 ILE A O    1  
ATOM   853    C  CB   . ILE A  1 53  ? 5.734   -7.521  31.594  1.00 0.00 ?  368 ILE A CB   1  
ATOM   854    C  CG1  . ILE A  1 53  ? 4.809   -8.681  31.968  1.00 0.00 ?  368 ILE A CG1  1  
ATOM   855    C  CG2  . ILE A  1 53  ? 5.943   -7.565  30.031  1.00 0.00 ?  368 ILE A CG2  1  
ATOM   856    C  CD1  . ILE A  1 53  ? 3.374   -8.249  31.780  1.00 0.00 ?  368 ILE A CD1  1  
ATOM   857    H  H    . ILE A  1 53  ? 6.963   -9.652  32.155  1.00 0.00 ?  368 ILE A H    1  
ATOM   858    H  HA   . ILE A  1 53  ? 7.702   -6.868  31.775  1.00 0.00 ?  368 ILE A HA   1  
ATOM   859    H  HB   . ILE A  1 53  ? 5.278   -6.533  31.819  1.00 0.00 ?  368 ILE A HB   1  
ATOM   860    H  HG12 . ILE A  1 53  ? 5.003   -9.621  31.409  1.00 0.00 ?  368 ILE A HG12 1  
ATOM   861    H  HG13 . ILE A  1 53  ? 4.965   -9.002  33.020  1.00 0.00 ?  368 ILE A HG13 1  
ATOM   862    H  HG21 . ILE A  1 53  ? 6.696   -8.350  29.802  1.00 0.00 ?  368 ILE A HG21 1  
ATOM   863    H  HG22 . ILE A  1 53  ? 6.377   -6.652  29.571  1.00 0.00 ?  368 ILE A HG22 1  
ATOM   864    H  HG23 . ILE A  1 53  ? 4.962   -7.727  29.536  1.00 0.00 ?  368 ILE A HG23 1  
ATOM   865    H  HD11 . ILE A  1 53  ? 3.131   -8.052  30.714  1.00 0.00 ?  368 ILE A HD11 1  
ATOM   866    H  HD12 . ILE A  1 53  ? 3.037   -7.406  32.421  1.00 0.00 ?  368 ILE A HD12 1  
ATOM   867    H  HD13 . ILE A  1 53  ? 2.748   -9.126  32.051  1.00 0.00 ?  368 ILE A HD13 1  
ATOM   868    N  N    . ASN A  1 54  ? 7.007   -5.608  33.884  1.00 0.00 ?  369 ASN A N    1  
ATOM   869    C  CA   . ASN A  1 54  ? 6.780   -4.854  35.103  1.00 0.00 ?  369 ASN A CA   1  
ATOM   870    C  C    . ASN A  1 54  ? 5.312   -4.477  35.400  1.00 0.00 ?  369 ASN A C    1  
ATOM   871    O  O    . ASN A  1 54  ? 4.823   -4.568  36.526  1.00 0.00 ?  369 ASN A O    1  
ATOM   872    C  CB   . ASN A  1 54  ? 7.733   -3.632  35.186  1.00 0.00 ?  369 ASN A CB   1  
ATOM   873    C  CG   . ASN A  1 54  ? 9.148   -3.999  34.829  1.00 0.00 ?  369 ASN A CG   1  
ATOM   874    O  OD1  . ASN A  1 54  ? 9.738   -3.398  33.923  1.00 0.00 ?  369 ASN A OD1  1  
ATOM   875    N  ND2  . ASN A  1 54  ? 9.739   -4.954  35.537  1.00 0.00 ?  369 ASN A ND2  1  
ATOM   876    H  H    . ASN A  1 54  ? 7.241   -5.057  33.087  1.00 0.00 ?  369 ASN A H    1  
ATOM   877    H  HA   . ASN A  1 54  ? 7.130   -5.500  35.894  1.00 0.00 ?  369 ASN A HA   1  
ATOM   878    H  HB2  . ASN A  1 54  ? 7.399   -2.928  34.394  1.00 0.00 ?  369 ASN A HB2  1  
ATOM   879    H  HB3  . ASN A  1 54  ? 7.736   -3.293  36.244  1.00 0.00 ?  369 ASN A HB3  1  
ATOM   880    H  HD21 . ASN A  1 54  ? 9.127   -5.583  36.017  1.00 0.00 ?  369 ASN A HD21 1  
ATOM   881    H  HD22 . ASN A  1 54  ? 10.686  -5.229  35.372  1.00 0.00 ?  369 ASN A HD22 1  
ATOM   882    N  N    . THR A  1 55  ? 4.568   -4.039  34.356  1.00 0.00 ?  370 THR A N    1  
ATOM   883    C  CA   . THR A  1 55  ? 3.203   -3.554  34.391  1.00 0.00 ?  370 THR A CA   1  
ATOM   884    C  C    . THR A  1 55  ? 2.400   -3.892  33.152  1.00 0.00 ?  370 THR A C    1  
ATOM   885    O  O    . THR A  1 55  ? 2.870   -3.883  32.013  1.00 0.00 ?  370 THR A O    1  
ATOM   886    C  CB   . THR A  1 55  ? 3.272   -1.972  34.545  1.00 0.00 ?  370 THR A CB   1  
ATOM   887    O  OG1  . THR A  1 55  ? 3.563   -1.677  35.903  1.00 0.00 ?  370 THR A OG1  1  
ATOM   888    C  CG2  . THR A  1 55  ? 1.916   -1.249  34.401  1.00 0.00 ?  370 THR A CG2  1  
ATOM   889    H  H    . THR A  1 55  ? 4.903   -4.241  33.439  1.00 0.00 ?  370 THR A H    1  
ATOM   890    H  HA   . THR A  1 55  ? 2.829   -3.953  35.322  1.00 0.00 ?  370 THR A HA   1  
ATOM   891    H  HB   . THR A  1 55  ? 4.039   -1.560  33.854  1.00 0.00 ?  370 THR A HB   1  
ATOM   892    H  HG1  . THR A  1 55  ? 4.518   -1.643  35.993  1.00 0.00 ?  370 THR A HG1  1  
ATOM   893    H  HG21 . THR A  1 55  ? 1.197   -1.622  35.161  1.00 0.00 ?  370 THR A HG21 1  
ATOM   894    H  HG22 . THR A  1 55  ? 1.464   -1.343  33.390  1.00 0.00 ?  370 THR A HG22 1  
ATOM   895    H  HG23 . THR A  1 55  ? 2.064   -0.175  34.643  1.00 0.00 ?  370 THR A HG23 1  
ATOM   896    N  N    . ALA A  1 56  ? 1.148   -4.358  33.352  1.00 0.00 ?  371 ALA A N    1  
ATOM   897    C  CA   . ALA A  1 56  ? 0.299   -4.330  32.207  1.00 0.00 ?  371 ALA A CA   1  
ATOM   898    C  C    . ALA A  1 56  ? -1.141  -3.766  32.424  1.00 0.00 ?  371 ALA A C    1  
ATOM   899    O  O    . ALA A  1 56  ? -1.767  -3.948  33.477  1.00 0.00 ?  371 ALA A O    1  
ATOM   900    C  CB   . ALA A  1 56  ? 0.300   -5.716  31.608  1.00 0.00 ?  371 ALA A CB   1  
ATOM   901    H  H    . ALA A  1 56  ? 0.819   -4.554  34.273  1.00 0.00 ?  371 ALA A H    1  
ATOM   902    H  HA   . ALA A  1 56  ? 0.720   -3.624  31.507  1.00 0.00 ?  371 ALA A HA   1  
ATOM   903    H  HB1  . ALA A  1 56  ? 0.086   -5.733  30.517  1.00 0.00 ?  371 ALA A HB1  1  
ATOM   904    H  HB2  . ALA A  1 56  ? -0.441  -6.390  32.088  1.00 0.00 ?  371 ALA A HB2  1  
ATOM   905    H  HB3  . ALA A  1 56  ? 1.330   -6.131  31.603  1.00 0.00 ?  371 ALA A HB3  1  
ATOM   906    N  N    . TYR A  1 57  ? -1.778  -3.031  31.435  1.00 0.00 ?  372 TYR A N    1  
ATOM   907    C  CA   . TYR A  1 57  ? -3.126  -2.459  31.670  1.00 0.00 ?  372 TYR A CA   1  
ATOM   908    C  C    . TYR A  1 57  ? -3.832  -2.300  30.269  1.00 0.00 ?  372 TYR A C    1  
ATOM   909    O  O    . TYR A  1 57  ? -3.161  -2.452  29.240  1.00 0.00 ?  372 TYR A O    1  
ATOM   910    C  CB   . TYR A  1 57  ? -3.062  -1.184  32.520  1.00 0.00 ?  372 TYR A CB   1  
ATOM   911    C  CG   . TYR A  1 57  ? -2.689  0.043   31.673  1.00 0.00 ?  372 TYR A CG   1  
ATOM   912    C  CD1  . TYR A  1 57  ? -1.393  0.277   31.287  1.00 0.00 ?  372 TYR A CD1  1  
ATOM   913    C  CD2  . TYR A  1 57  ? -3.719  0.955   31.207  1.00 0.00 ?  372 TYR A CD2  1  
ATOM   914    C  CE1  . TYR A  1 57  ? -1.017  1.365   30.476  1.00 0.00 ?  372 TYR A CE1  1  
ATOM   915    C  CE2  . TYR A  1 57  ? -3.389  2.054   30.442  1.00 0.00 ?  372 TYR A CE2  1  
ATOM   916    C  CZ   . TYR A  1 57  ? -2.057  2.241   30.080  1.00 0.00 ?  372 TYR A CZ   1  
ATOM   917    O  OH   . TYR A  1 57  ? -1.867  3.440   29.286  1.00 0.00 ?  372 TYR A OH   1  
ATOM   918    H  H    . TYR A  1 57  ? -1.331  -2.897  30.554  1.00 0.00 ?  372 TYR A H    1  
ATOM   919    H  HA   . TYR A  1 57  ? -3.744  -3.161  32.210  1.00 0.00 ?  372 TYR A HA   1  
ATOM   920    H  HB2  . TYR A  1 57  ? -4.071  -1.004  32.950  1.00 0.00 ?  372 TYR A HB2  1  
ATOM   921    H  HB3  . TYR A  1 57  ? -2.330  -1.366  33.336  1.00 0.00 ?  372 TYR A HB3  1  
ATOM   922    H  HD1  . TYR A  1 57  ? -0.609  -0.403  31.586  1.00 0.00 ?  372 TYR A HD1  1  
ATOM   923    H  HD2  . TYR A  1 57  ? -4.781  0.816   31.350  1.00 0.00 ?  372 TYR A HD2  1  
ATOM   924    H  HE1  . TYR A  1 57  ? -0.035  1.637   30.119  1.00 0.00 ?  372 TYR A HE1  1  
ATOM   925    H  HE2  . TYR A  1 57  ? -4.149  2.747   30.111  1.00 0.00 ?  372 TYR A HE2  1  
ATOM   926    H  HH   . TYR A  1 57  ? -2.633  4.018   29.298  1.00 0.00 ?  372 TYR A HH   1  
ATOM   927    N  N    . GLU A  1 58  ? -5.201  -2.155  30.267  1.00 0.00 ?  373 GLU A N    1  
ATOM   928    C  CA   . GLU A  1 58  ? -6.060  -1.902  29.133  1.00 0.00 ?  373 GLU A CA   1  
ATOM   929    C  C    . GLU A  1 58  ? -6.263  -0.366  28.963  1.00 0.00 ?  373 GLU A C    1  
ATOM   930    O  O    . GLU A  1 58  ? -6.765  0.337   29.866  1.00 0.00 ?  373 GLU A O    1  
ATOM   931    C  CB   . GLU A  1 58  ? -7.386  -2.675  29.226  1.00 0.00 ?  373 GLU A CB   1  
ATOM   932    C  CG   . GLU A  1 58  ? -8.401  -2.612  28.071  1.00 0.00 ?  373 GLU A CG   1  
ATOM   933    C  CD   . GLU A  1 58  ? -9.792  -3.095  28.387  1.00 0.00 ?  373 GLU A CD   1  
ATOM   934    O  OE1  . GLU A  1 58  ? -10.657 -3.028  27.443  1.00 0.00 ?  373 GLU A OE1  1  
ATOM   935    O  OE2  . GLU A  1 58  ? -10.105 -3.521  29.529  1.00 0.00 -1 373 GLU A OE2  1  
ATOM   936    H  H    . GLU A  1 58  ? -5.696  -2.323  31.116  1.00 0.00 ?  373 GLU A H    1  
ATOM   937    H  HA   . GLU A  1 58  ? -5.488  -2.176  28.258  1.00 0.00 ?  373 GLU A HA   1  
ATOM   938    H  HB2  . GLU A  1 58  ? -7.279  -3.759  29.448  1.00 0.00 ?  373 GLU A HB2  1  
ATOM   939    H  HB3  . GLU A  1 58  ? -7.879  -2.416  30.187  1.00 0.00 ?  373 GLU A HB3  1  
ATOM   940    H  HG2  . GLU A  1 58  ? -8.540  -1.579  27.685  1.00 0.00 ?  373 GLU A HG2  1  
ATOM   941    H  HG3  . GLU A  1 58  ? -7.976  -3.174  27.212  1.00 0.00 ?  373 GLU A HG3  1  
ATOM   942    N  N    . ARG A  1 59  ? -6.006  0.179   27.751  1.00 0.00 ?  374 ARG A N    1  
ATOM   943    C  CA   . ARG A  1 59  ? -6.165  1.575   27.463  1.00 0.00 ?  374 ARG A CA   1  
ATOM   944    C  C    . ARG A  1 59  ? -7.573  1.878   26.850  1.00 0.00 ?  374 ARG A C    1  
ATOM   945    O  O    . ARG A  1 59  ? -8.313  0.926   26.559  1.00 0.00 ?  374 ARG A O    1  
ATOM   946    C  CB   . ARG A  1 59  ? -4.981  2.115   26.671  1.00 0.00 ?  374 ARG A CB   1  
ATOM   947    C  CG   . ARG A  1 59  ? -4.997  1.937   25.199  1.00 0.00 ?  374 ARG A CG   1  
ATOM   948    C  CD   . ARG A  1 59  ? -3.910  2.553   24.339  1.00 0.00 ?  374 ARG A CD   1  
ATOM   949    N  NE   . ARG A  1 59  ? -4.380  2.237   22.942  1.00 0.00 ?  374 ARG A NE   1  
ATOM   950    C  CZ   . ARG A  1 59  ? -3.756  2.695   21.812  1.00 0.00 ?  374 ARG A CZ   1  
ATOM   951    N  NH1  . ARG A  1 59  ? -4.309  2.394   20.660  1.00 0.00 1  374 ARG A NH1  1  
ATOM   952    N  NH2  . ARG A  1 59  ? -2.652  3.342   21.897  1.00 0.00 ?  374 ARG A NH2  1  
ATOM   953    H  H    . ARG A  1 59  ? -6.011  -0.402  26.941  1.00 0.00 ?  374 ARG A H    1  
ATOM   954    H  HA   . ARG A  1 59  ? -6.187  2.154   28.375  1.00 0.00 ?  374 ARG A HA   1  
ATOM   955    H  HB2  . ARG A  1 59  ? -4.892  3.222   26.659  1.00 0.00 ?  374 ARG A HB2  1  
ATOM   956    H  HB3  . ARG A  1 59  ? -4.064  1.626   27.064  1.00 0.00 ?  374 ARG A HB3  1  
ATOM   957    H  HG2  . ARG A  1 59  ? -5.201  0.858   25.030  1.00 0.00 ?  374 ARG A HG2  1  
ATOM   958    H  HG3  . ARG A  1 59  ? -5.916  2.440   24.829  1.00 0.00 ?  374 ARG A HG3  1  
ATOM   959    H  HD2  . ARG A  1 59  ? -3.841  3.662   24.336  1.00 0.00 ?  374 ARG A HD2  1  
ATOM   960    H  HD3  . ARG A  1 59  ? -2.887  2.197   24.586  1.00 0.00 ?  374 ARG A HD3  1  
ATOM   961    H  HE   . ARG A  1 59  ? -5.292  1.857   22.791  1.00 0.00 ?  374 ARG A HE   1  
ATOM   962    H  HH11 . ARG A  1 59  ? -5.194  1.928   20.677  1.00 0.00 ?  374 ARG A HH11 1  
ATOM   963    H  HH12 . ARG A  1 59  ? -3.970  2.761   19.794  1.00 0.00 ?  374 ARG A HH12 1  
ATOM   964    H  HH21 . ARG A  1 59  ? -2.139  3.446   22.749  1.00 0.00 ?  374 ARG A HH21 1  
ATOM   965    H  HH22 . ARG A  1 59  ? -2.306  3.852   21.109  1.00 0.00 ?  374 ARG A HH22 1  
ATOM   966    N  N    . LYS A  1 60  ? -8.005  3.163   26.742  1.00 0.00 ?  375 LYS A N    1  
ATOM   967    C  CA   . LYS A  1 60  ? -9.355  3.673   26.501  1.00 0.00 ?  375 LYS A CA   1  
ATOM   968    C  C    . LYS A  1 60  ? -10.164 3.196   25.251  1.00 0.00 ?  375 LYS A C    1  
ATOM   969    O  O    . LYS A  1 60  ? -11.341 2.939   25.355  1.00 0.00 ?  375 LYS A O    1  
ATOM   970    C  CB   . LYS A  1 60  ? -9.391  5.268   26.508  1.00 0.00 ?  375 LYS A CB   1  
ATOM   971    C  CG   . LYS A  1 60  ? -10.862 5.747   26.601  1.00 0.00 ?  375 LYS A CG   1  
ATOM   972    C  CD   . LYS A  1 60  ? -11.100 7.314   26.629  1.00 0.00 ?  375 LYS A CD   1  
ATOM   973    C  CE   . LYS A  1 60  ? -12.531 7.783   26.249  1.00 0.00 ?  375 LYS A CE   1  
ATOM   974    N  NZ   . LYS A  1 60  ? -12.714 9.201   26.547  1.00 0.00 1  375 LYS A NZ   1  
ATOM   975    H  H    . LYS A  1 60  ? -7.335  3.878   26.928  1.00 0.00 ?  375 LYS A H    1  
ATOM   976    H  HA   . LYS A  1 60  ? -9.930  3.373   27.365  1.00 0.00 ?  375 LYS A HA   1  
ATOM   977    H  HB2  . LYS A  1 60  ? -8.788  5.655   27.358  1.00 0.00 ?  375 LYS A HB2  1  
ATOM   978    H  HB3  . LYS A  1 60  ? -8.919  5.701   25.600  1.00 0.00 ?  375 LYS A HB3  1  
ATOM   979    H  HG2  . LYS A  1 60  ? -11.343 5.513   25.627  1.00 0.00 ?  375 LYS A HG2  1  
ATOM   980    H  HG3  . LYS A  1 60  ? -11.446 5.284   27.425  1.00 0.00 ?  375 LYS A HG3  1  
ATOM   981    H  HD2  . LYS A  1 60  ? -10.747 7.673   27.620  1.00 0.00 ?  375 LYS A HD2  1  
ATOM   982    H  HD3  . LYS A  1 60  ? -10.391 7.865   25.976  1.00 0.00 ?  375 LYS A HD3  1  
ATOM   983    H  HE2  . LYS A  1 60  ? -12.665 7.747   25.146  1.00 0.00 ?  375 LYS A HE2  1  
ATOM   984    H  HE3  . LYS A  1 60  ? -13.339 7.254   26.798  1.00 0.00 ?  375 LYS A HE3  1  
ATOM   985    H  HZ1  . LYS A  1 60  ? -12.504 9.339   27.556  1.00 0.00 ?  375 LYS A HZ1  1  
ATOM   986    H  HZ2  . LYS A  1 60  ? -13.677 9.544   26.355  1.00 0.00 ?  375 LYS A HZ2  1  
ATOM   987    H  HZ3  . LYS A  1 60  ? -12.105 9.841   25.999  1.00 0.00 ?  375 LYS A HZ3  1  
ATOM   988    N  N    . ASP A  1 61  ? -9.460  3.068   24.097  1.00 0.00 ?  376 ASP A N    1  
ATOM   989    C  CA   . ASP A  1 61  ? -9.927  2.430   22.944  1.00 0.00 ?  376 ASP A CA   1  
ATOM   990    C  C    . ASP A  1 61  ? -10.104 0.873   23.224  1.00 0.00 ?  376 ASP A C    1  
ATOM   991    O  O    . ASP A  1 61  ? -11.187 0.379   22.815  1.00 0.00 ?  376 ASP A O    1  
ATOM   992    C  CB   . ASP A  1 61  ? -8.873  2.626   21.845  1.00 0.00 ?  376 ASP A CB   1  
ATOM   993    C  CG   . ASP A  1 61  ? -7.494  1.920   21.806  1.00 0.00 ?  376 ASP A CG   1  
ATOM   994    O  OD1  . ASP A  1 61  ? -7.024  1.476   22.911  1.00 0.00 ?  376 ASP A OD1  1  
ATOM   995    O  OD2  . ASP A  1 61  ? -6.930  1.794   20.688  1.00 0.00 -1 376 ASP A OD2  1  
ATOM   996    H  H    . ASP A  1 61  ? -8.595  3.555   24.001  1.00 0.00 ?  376 ASP A H    1  
ATOM   997    H  HA   . ASP A  1 61  ? -10.842 2.831   22.533  1.00 0.00 ?  376 ASP A HA   1  
ATOM   998    H  HB2  . ASP A  1 61  ? -9.398  2.355   20.904  1.00 0.00 ?  376 ASP A HB2  1  
ATOM   999    H  HB3  . ASP A  1 61  ? -8.517  3.663   21.665  1.00 0.00 ?  376 ASP A HB3  1  
ATOM   1000   N  N    . GLY A  1 62  ? -9.129  0.171   23.904  1.00 0.00 ?  377 GLY A N    1  
ATOM   1001   C  CA   . GLY A  1 62  ? -9.167  -1.244  24.249  1.00 0.00 ?  377 GLY A CA   1  
ATOM   1002   C  C    . GLY A  1 62  ? -7.952  -2.099  24.016  1.00 0.00 ?  377 GLY A C    1  
ATOM   1003   O  O    . GLY A  1 62  ? -7.938  -3.333  24.109  1.00 0.00 ?  377 GLY A O    1  
ATOM   1004   H  H    . GLY A  1 62  ? -8.272  0.651   24.073  1.00 0.00 ?  377 GLY A H    1  
ATOM   1005   H  HA2  . GLY A  1 62  ? -9.290  -1.297  25.321  1.00 0.00 ?  377 GLY A HA2  1  
ATOM   1006   H  HA3  . GLY A  1 62  ? -10.005 -1.664  23.714  1.00 0.00 ?  377 GLY A HA3  1  
ATOM   1007   N  N    . LYS A  1 63  ? -6.826  -1.522  23.600  1.00 0.00 ?  378 LYS A N    1  
ATOM   1008   C  CA   . LYS A  1 63  ? -5.507  -2.079  23.516  1.00 0.00 ?  378 LYS A CA   1  
ATOM   1009   C  C    . LYS A  1 63  ? -5.018  -2.581  24.906  1.00 0.00 ?  378 LYS A C    1  
ATOM   1010   O  O    . LYS A  1 63  ? -5.419  -2.136  25.995  1.00 0.00 ?  378 LYS A O    1  
ATOM   1011   C  CB   . LYS A  1 63  ? -4.373  -1.259  22.980  1.00 0.00 ?  378 LYS A CB   1  
ATOM   1012   C  CG   . LYS A  1 63  ? -4.585  -0.773  21.566  1.00 0.00 ?  378 LYS A CG   1  
ATOM   1013   C  CD   . LYS A  1 63  ? -4.766  -1.858  20.548  1.00 0.00 ?  378 LYS A CD   1  
ATOM   1014   C  CE   . LYS A  1 63  ? -4.926  -1.262  19.152  1.00 0.00 ?  378 LYS A CE   1  
ATOM   1015   N  NZ   . LYS A  1 63  ? -5.035  -2.385  18.284  1.00 0.00 1  378 LYS A NZ   1  
ATOM   1016   H  H    . LYS A  1 63  ? -6.862  -0.534  23.467  1.00 0.00 ?  378 LYS A H    1  
ATOM   1017   H  HA   . LYS A  1 63  ? -5.589  -2.924  22.849  1.00 0.00 ?  378 LYS A HA   1  
ATOM   1018   H  HB2  . LYS A  1 63  ? -4.170  -0.436  23.697  1.00 0.00 ?  378 LYS A HB2  1  
ATOM   1019   H  HB3  . LYS A  1 63  ? -3.440  -1.859  22.914  1.00 0.00 ?  378 LYS A HB3  1  
ATOM   1020   H  HG2  . LYS A  1 63  ? -5.458  -0.086  21.537  1.00 0.00 ?  378 LYS A HG2  1  
ATOM   1021   H  HG3  . LYS A  1 63  ? -3.637  -0.235  21.351  1.00 0.00 ?  378 LYS A HG3  1  
ATOM   1022   H  HD2  . LYS A  1 63  ? -3.896  -2.545  20.626  1.00 0.00 ?  378 LYS A HD2  1  
ATOM   1023   H  HD3  . LYS A  1 63  ? -5.681  -2.466  20.716  1.00 0.00 ?  378 LYS A HD3  1  
ATOM   1024   H  HE2  . LYS A  1 63  ? -5.859  -0.667  19.058  1.00 0.00 ?  378 LYS A HE2  1  
ATOM   1025   H  HE3  . LYS A  1 63  ? -3.981  -0.761  18.851  1.00 0.00 ?  378 LYS A HE3  1  
ATOM   1026   H  HZ1  . LYS A  1 63  ? -5.692  -3.112  18.631  1.00 0.00 ?  378 LYS A HZ1  1  
ATOM   1027   H  HZ2  . LYS A  1 63  ? -4.097  -2.832  18.334  1.00 0.00 ?  378 LYS A HZ2  1  
ATOM   1028   H  HZ3  . LYS A  1 63  ? -5.156  -2.181  17.271  1.00 0.00 ?  378 LYS A HZ3  1  
ATOM   1029   N  N    . PHE A  1 64  ? -3.994  -3.498  24.923  1.00 0.00 ?  379 PHE A N    1  
ATOM   1030   C  CA   . PHE A  1 64  ? -3.290  -3.861  26.103  1.00 0.00 ?  379 PHE A CA   1  
ATOM   1031   C  C    . PHE A  1 64  ? -1.870  -3.291  25.997  1.00 0.00 ?  379 PHE A C    1  
ATOM   1032   O  O    . PHE A  1 64  ? -1.093  -3.456  25.040  1.00 0.00 ?  379 PHE A O    1  
ATOM   1033   C  CB   . PHE A  1 64  ? -3.133  -5.390  26.312  1.00 0.00 ?  379 PHE A CB   1  
ATOM   1034   C  CG   . PHE A  1 64  ? -4.388  -6.058  25.797  1.00 0.00 ?  379 PHE A CG   1  
ATOM   1035   C  CD1  . PHE A  1 64  ? -4.290  -6.960  24.700  1.00 0.00 ?  379 PHE A CD1  1  
ATOM   1036   C  CD2  . PHE A  1 64  ? -5.662  -5.741  26.265  1.00 0.00 ?  379 PHE A CD2  1  
ATOM   1037   C  CE1  . PHE A  1 64  ? -5.399  -7.554  24.152  1.00 0.00 ?  379 PHE A CE1  1  
ATOM   1038   C  CE2  . PHE A  1 64  ? -6.846  -6.289  25.617  1.00 0.00 ?  379 PHE A CE2  1  
ATOM   1039   C  CZ   . PHE A  1 64  ? -6.635  -7.189  24.524  1.00 0.00 ?  379 PHE A CZ   1  
ATOM   1040   H  H    . PHE A  1 64  ? -3.543  -3.717  24.062  1.00 0.00 ?  379 PHE A H    1  
ATOM   1041   H  HA   . PHE A  1 64  ? -3.792  -3.532  27.000  1.00 0.00 ?  379 PHE A HA   1  
ATOM   1042   H  HB2  . PHE A  1 64  ? -2.197  -5.685  25.790  1.00 0.00 ?  379 PHE A HB2  1  
ATOM   1043   H  HB3  . PHE A  1 64  ? -3.062  -5.564  27.407  1.00 0.00 ?  379 PHE A HB3  1  
ATOM   1044   H  HD1  . PHE A  1 64  ? -3.320  -7.187  24.283  1.00 0.00 ?  379 PHE A HD1  1  
ATOM   1045   H  HD2  . PHE A  1 64  ? -5.812  -5.279  27.229  1.00 0.00 ?  379 PHE A HD2  1  
ATOM   1046   H  HE1  . PHE A  1 64  ? -5.146  -8.238  23.356  1.00 0.00 ?  379 PHE A HE1  1  
ATOM   1047   H  HE2  . PHE A  1 64  ? -7.799  -5.888  25.929  1.00 0.00 ?  379 PHE A HE2  1  
ATOM   1048   H  HZ   . PHE A  1 64  ? -7.538  -7.527  24.038  1.00 0.00 ?  379 PHE A HZ   1  
ATOM   1049   N  N    . VAL A  1 65  ? -1.445  -2.475  26.995  1.00 0.00 ?  380 VAL A N    1  
ATOM   1050   C  CA   . VAL A  1 65  ? -0.126  -1.884  27.053  1.00 0.00 ?  380 VAL A CA   1  
ATOM   1051   C  C    . VAL A  1 65  ? 0.639   -2.510  28.227  1.00 0.00 ?  380 VAL A C    1  
ATOM   1052   O  O    . VAL A  1 65  ? 0.156   -2.584  29.353  1.00 0.00 ?  380 VAL A O    1  
ATOM   1053   C  CB   . VAL A  1 65  ? -0.239  -0.361  27.263  1.00 0.00 ?  380 VAL A CB   1  
ATOM   1054   C  CG1  . VAL A  1 65  ? 1.175   0.307   27.425  1.00 0.00 ?  380 VAL A CG1  1  
ATOM   1055   C  CG2  . VAL A  1 65  ? -1.127  0.329   26.133  1.00 0.00 ?  380 VAL A CG2  1  
ATOM   1056   H  H    . VAL A  1 65  ? -2.106  -2.460  27.741  1.00 0.00 ?  380 VAL A H    1  
ATOM   1057   H  HA   . VAL A  1 65  ? 0.389   -2.094  26.127  1.00 0.00 ?  380 VAL A HA   1  
ATOM   1058   H  HB   . VAL A  1 65  ? -0.749  -0.259  28.245  1.00 0.00 ?  380 VAL A HB   1  
ATOM   1059   H  HG11 . VAL A  1 65  ? 1.068   1.413   27.386  1.00 0.00 ?  380 VAL A HG11 1  
ATOM   1060   H  HG12 . VAL A  1 65  ? 1.817   0.049   26.557  1.00 0.00 ?  380 VAL A HG12 1  
ATOM   1061   H  HG13 . VAL A  1 65  ? 1.770   0.083   28.336  1.00 0.00 ?  380 VAL A HG13 1  
ATOM   1062   H  HG21 . VAL A  1 65  ? -0.942  1.423   26.188  1.00 0.00 ?  380 VAL A HG21 1  
ATOM   1063   H  HG22 . VAL A  1 65  ? -2.182  0.017   26.289  1.00 0.00 ?  380 VAL A HG22 1  
ATOM   1064   H  HG23 . VAL A  1 65  ? -0.785  -0.023  25.136  1.00 0.00 ?  380 VAL A HG23 1  
ATOM   1065   N  N    . PHE A  1 66  ? 1.882   -2.915  27.858  1.00 0.00 ?  381 PHE A N    1  
ATOM   1066   C  CA   . PHE A  1 66  ? 2.992   -3.525  28.654  1.00 0.00 ?  381 PHE A CA   1  
ATOM   1067   C  C    . PHE A  1 66  ? 4.229   -2.725  28.888  1.00 0.00 ?  381 PHE A C    1  
ATOM   1068   O  O    . PHE A  1 66  ? 4.890   -2.201  27.941  1.00 0.00 ?  381 PHE A O    1  
ATOM   1069   C  CB   . PHE A  1 66  ? 3.329   -4.823  27.825  1.00 0.00 ?  381 PHE A CB   1  
ATOM   1070   C  CG   . PHE A  1 66  ? 2.225   -5.822  27.871  1.00 0.00 ?  381 PHE A CG   1  
ATOM   1071   C  CD1  . PHE A  1 66  ? 1.414   -5.951  26.686  1.00 0.00 ?  381 PHE A CD1  1  
ATOM   1072   C  CD2  . PHE A  1 66  ? 1.992   -6.667  28.937  1.00 0.00 ?  381 PHE A CD2  1  
ATOM   1073   C  CE1  . PHE A  1 66  ? 0.338   -6.794  26.719  1.00 0.00 ?  381 PHE A CE1  1  
ATOM   1074   C  CE2  . PHE A  1 66  ? 0.924   -7.561  28.948  1.00 0.00 ?  381 PHE A CE2  1  
ATOM   1075   C  CZ   . PHE A  1 66  ? 0.110   -7.610  27.844  1.00 0.00 ?  381 PHE A CZ   1  
ATOM   1076   H  H    . PHE A  1 66  ? 2.119   -2.689  26.917  1.00 0.00 ?  381 PHE A H    1  
ATOM   1077   H  HA   . PHE A  1 66  ? 2.656   -3.840  29.631  1.00 0.00 ?  381 PHE A HA   1  
ATOM   1078   H  HB2  . PHE A  1 66  ? 3.606   -4.702  26.756  1.00 0.00 ?  381 PHE A HB2  1  
ATOM   1079   H  HB3  . PHE A  1 66  ? 4.172   -5.336  28.336  1.00 0.00 ?  381 PHE A HB3  1  
ATOM   1080   H  HD1  . PHE A  1 66  ? 1.624   -5.393  25.785  1.00 0.00 ?  381 PHE A HD1  1  
ATOM   1081   H  HD2  . PHE A  1 66  ? 2.759   -6.527  29.684  1.00 0.00 ?  381 PHE A HD2  1  
ATOM   1082   H  HE1  . PHE A  1 66  ? -0.374  -6.830  25.908  1.00 0.00 ?  381 PHE A HE1  1  
ATOM   1083   H  HE2  . PHE A  1 66  ? 0.812   -8.147  29.848  1.00 0.00 ?  381 PHE A HE2  1  
ATOM   1084   H  HZ   . PHE A  1 66  ? -0.701  -8.319  27.766  1.00 0.00 ?  381 PHE A HZ   1  
ATOM   1085   N  N    . PHE A  1 67  ? 4.617   -2.632  30.181  1.00 0.00 ?  382 PHE A N    1  
ATOM   1086   C  CA   . PHE A  1 67  ? 5.863   -2.033  30.499  1.00 0.00 ?  382 PHE A CA   1  
ATOM   1087   C  C    . PHE A  1 67  ? 6.932   -3.065  30.973  1.00 0.00 ?  382 PHE A C    1  
ATOM   1088   O  O    . PHE A  1 67  ? 6.617   -3.886  31.826  1.00 0.00 ?  382 PHE A O    1  
ATOM   1089   C  CB   . PHE A  1 67  ? 5.840   -0.844  31.576  1.00 0.00 ?  382 PHE A CB   1  
ATOM   1090   C  CG   . PHE A  1 67  ? 4.956   0.287   31.081  1.00 0.00 ?  382 PHE A CG   1  
ATOM   1091   C  CD1  . PHE A  1 67  ? 5.327   1.306   30.185  1.00 0.00 ?  382 PHE A CD1  1  
ATOM   1092   C  CD2  . PHE A  1 67  ? 3.668   0.317   31.612  1.00 0.00 ?  382 PHE A CD2  1  
ATOM   1093   C  CE1  . PHE A  1 67  ? 4.360   2.266   29.824  1.00 0.00 ?  382 PHE A CE1  1  
ATOM   1094   C  CE2  . PHE A  1 67  ? 2.686   1.285   31.259  1.00 0.00 ?  382 PHE A CE2  1  
ATOM   1095   C  CZ   . PHE A  1 67  ? 2.989   2.214   30.251  1.00 0.00 ?  382 PHE A CZ   1  
ATOM   1096   H  H    . PHE A  1 67  ? 4.071   -2.928  30.961  1.00 0.00 ?  382 PHE A H    1  
ATOM   1097   H  HA   . PHE A  1 67  ? 6.220   -1.644  29.556  1.00 0.00 ?  382 PHE A HA   1  
ATOM   1098   H  HB2  . PHE A  1 67  ? 5.607   -1.117  32.628  1.00 0.00 ?  382 PHE A HB2  1  
ATOM   1099   H  HB3  . PHE A  1 67  ? 6.868   -0.425  31.614  1.00 0.00 ?  382 PHE A HB3  1  
ATOM   1100   H  HD1  . PHE A  1 67  ? 6.359   1.360   29.873  1.00 0.00 ?  382 PHE A HD1  1  
ATOM   1101   H  HD2  . PHE A  1 67  ? 3.287   -0.436  32.286  1.00 0.00 ?  382 PHE A HD2  1  
ATOM   1102   H  HE1  . PHE A  1 67  ? 4.571   3.096   29.166  1.00 0.00 ?  382 PHE A HE1  1  
ATOM   1103   H  HE2  . PHE A  1 67  ? 1.690   1.118   31.644  1.00 0.00 ?  382 PHE A HE2  1  
ATOM   1104   H  HZ   . PHE A  1 67  ? 2.237   2.961   30.043  1.00 0.00 ?  382 PHE A HZ   1  
ATOM   1105   N  N    . LYS A  1 68  ? 8.098   -3.055  30.306  1.00 0.00 ?  383 LYS A N    1  
ATOM   1106   C  CA   . LYS A  1 68  ? 9.272   -3.766  30.813  1.00 0.00 ?  383 LYS A CA   1  
ATOM   1107   C  C    . LYS A  1 68  ? 10.483  -2.792  30.673  1.00 0.00 ?  383 LYS A C    1  
ATOM   1108   O  O    . LYS A  1 68  ? 10.746  -2.301  29.596  1.00 0.00 ?  383 LYS A O    1  
ATOM   1109   C  CB   . LYS A  1 68  ? 9.592   -5.030  29.950  1.00 0.00 ?  383 LYS A CB   1  
ATOM   1110   C  CG   . LYS A  1 68  ? 10.611  -5.899  30.676  1.00 0.00 ?  383 LYS A CG   1  
ATOM   1111   C  CD   . LYS A  1 68  ? 11.102  -7.115  29.859  1.00 0.00 ?  383 LYS A CD   1  
ATOM   1112   C  CE   . LYS A  1 68  ? 12.319  -7.920  30.478  1.00 0.00 ?  383 LYS A CE   1  
ATOM   1113   N  NZ   . LYS A  1 68  ? 12.065  -8.430  31.781  1.00 0.00 1  383 LYS A NZ   1  
ATOM   1114   H  H    . LYS A  1 68  ? 8.222   -2.434  29.536  1.00 0.00 ?  383 LYS A H    1  
ATOM   1115   H  HA   . LYS A  1 68  ? 9.095   -4.041  31.843  1.00 0.00 ?  383 LYS A HA   1  
ATOM   1116   H  HB2  . LYS A  1 68  ? 8.667   -5.636  29.842  1.00 0.00 ?  383 LYS A HB2  1  
ATOM   1117   H  HB3  . LYS A  1 68  ? 10.024  -4.798  28.953  1.00 0.00 ?  383 LYS A HB3  1  
ATOM   1118   H  HG2  . LYS A  1 68  ? 11.499  -5.261  30.871  1.00 0.00 ?  383 LYS A HG2  1  
ATOM   1119   H  HG3  . LYS A  1 68  ? 10.224  -6.276  31.647  1.00 0.00 ?  383 LYS A HG3  1  
ATOM   1120   H  HD2  . LYS A  1 68  ? 10.222  -7.759  29.647  1.00 0.00 ?  383 LYS A HD2  1  
ATOM   1121   H  HD3  . LYS A  1 68  ? 11.555  -6.774  28.903  1.00 0.00 ?  383 LYS A HD3  1  
ATOM   1122   H  HE2  . LYS A  1 68  ? 12.518  -8.808  29.840  1.00 0.00 ?  383 LYS A HE2  1  
ATOM   1123   H  HE3  . LYS A  1 68  ? 13.217  -7.270  30.544  1.00 0.00 ?  383 LYS A HE3  1  
ATOM   1124   H  HZ1  . LYS A  1 68  ? 12.574  -9.336  31.826  1.00 0.00 ?  383 LYS A HZ1  1  
ATOM   1125   H  HZ2  . LYS A  1 68  ? 11.043  -8.572  31.916  1.00 0.00 ?  383 LYS A HZ2  1  
ATOM   1126   H  HZ3  . LYS A  1 68  ? 12.347  -7.808  32.566  1.00 0.00 ?  383 LYS A HZ3  1  
ATOM   1127   N  N    . GLY A  1 69  ? 11.248  -2.458  31.705  1.00 0.00 ?  384 GLY A N    1  
ATOM   1128   C  CA   . GLY A  1 69  ? 12.237  -1.390  31.605  1.00 0.00 ?  384 GLY A CA   1  
ATOM   1129   C  C    . GLY A  1 69  ? 11.708  -0.040  31.391  1.00 0.00 ?  384 GLY A C    1  
ATOM   1130   O  O    . GLY A  1 69  ? 10.691  0.251   32.011  1.00 0.00 ?  384 GLY A O    1  
ATOM   1131   H  H    . GLY A  1 69  ? 11.108  -2.851  32.610  1.00 0.00 ?  384 GLY A H    1  
ATOM   1132   H  HA2  . GLY A  1 69  ? 12.708  -1.348  32.576  1.00 0.00 ?  384 GLY A HA2  1  
ATOM   1133   H  HA3  . GLY A  1 69  ? 12.861  -1.537  30.736  1.00 0.00 ?  384 GLY A HA3  1  
ATOM   1134   N  N    . ASP A  1 70  ? 12.296  0.741   30.437  1.00 0.00 ?  385 ASP A N    1  
ATOM   1135   C  CA   . ASP A  1 70  ? 11.922  2.059   29.850  1.00 0.00 ?  385 ASP A CA   1  
ATOM   1136   C  C    . ASP A  1 70  ? 11.279  1.890   28.487  1.00 0.00 ?  385 ASP A C    1  
ATOM   1137   O  O    . ASP A  1 70  ? 11.111  2.885   27.732  1.00 0.00 ?  385 ASP A O    1  
ATOM   1138   C  CB   . ASP A  1 70  ? 13.145  3.015   30.045  1.00 0.00 ?  385 ASP A CB   1  
ATOM   1139   C  CG   . ASP A  1 70  ? 14.378  2.690   29.258  1.00 0.00 ?  385 ASP A CG   1  
ATOM   1140   O  OD1  . ASP A  1 70  ? 15.347  3.487   29.303  1.00 0.00 ?  385 ASP A OD1  1  
ATOM   1141   O  OD2  . ASP A  1 70  ? 14.462  1.598   28.669  1.00 0.00 -1 385 ASP A OD2  1  
ATOM   1142   H  H    . ASP A  1 70  ? 13.152  0.339   30.123  1.00 0.00 ?  385 ASP A H    1  
ATOM   1143   H  HA   . ASP A  1 70  ? 11.128  2.380   30.509  1.00 0.00 ?  385 ASP A HA   1  
ATOM   1144   H  HB2  . ASP A  1 70  ? 12.787  4.053   29.874  1.00 0.00 ?  385 ASP A HB2  1  
ATOM   1145   H  HB3  . ASP A  1 70  ? 13.355  3.114   31.131  1.00 0.00 ?  385 ASP A HB3  1  
ATOM   1146   N  N    . LYS A  1 71  ? 10.839  0.657   28.119  1.00 0.00 ?  386 LYS A N    1  
ATOM   1147   C  CA   . LYS A  1 71  ? 10.219  0.386   26.945  1.00 0.00 ?  386 LYS A CA   1  
ATOM   1148   C  C    . LYS A  1 71  ? 8.757   0.073   27.158  1.00 0.00 ?  386 LYS A C    1  
ATOM   1149   O  O    . LYS A  1 71  ? 8.315   -0.291  28.223  1.00 0.00 ?  386 LYS A O    1  
ATOM   1150   C  CB   . LYS A  1 71  ? 10.883  -0.793  26.217  1.00 0.00 ?  386 LYS A CB   1  
ATOM   1151   C  CG   . LYS A  1 71  ? 12.330  -0.561  25.771  1.00 0.00 ?  386 LYS A CG   1  
ATOM   1152   C  CD   . LYS A  1 71  ? 12.422  0.665   24.796  1.00 0.00 ?  386 LYS A CD   1  
ATOM   1153   C  CE   . LYS A  1 71  ? 13.604  0.480   23.830  1.00 0.00 ?  386 LYS A CE   1  
ATOM   1154   N  NZ   . LYS A  1 71  ? 14.877  0.474   24.555  1.00 0.00 1  386 LYS A NZ   1  
ATOM   1155   H  H    . LYS A  1 71  ? 10.770  -0.069  28.799  1.00 0.00 ?  386 LYS A H    1  
ATOM   1156   H  HA   . LYS A  1 71  ? 10.287  1.180   26.217  1.00 0.00 ?  386 LYS A HA   1  
ATOM   1157   H  HB2  . LYS A  1 71  ? 10.912  -1.592  26.988  1.00 0.00 ?  386 LYS A HB2  1  
ATOM   1158   H  HB3  . LYS A  1 71  ? 10.334  -1.014  25.277  1.00 0.00 ?  386 LYS A HB3  1  
ATOM   1159   H  HG2  . LYS A  1 71  ? 13.048  -0.540  26.619  1.00 0.00 ?  386 LYS A HG2  1  
ATOM   1160   H  HG3  . LYS A  1 71  ? 12.624  -1.439  25.157  1.00 0.00 ?  386 LYS A HG3  1  
ATOM   1161   H  HD2  . LYS A  1 71  ? 11.514  0.685   24.157  1.00 0.00 ?  386 LYS A HD2  1  
ATOM   1162   H  HD3  . LYS A  1 71  ? 12.445  1.641   25.326  1.00 0.00 ?  386 LYS A HD3  1  
ATOM   1163   H  HE2  . LYS A  1 71  ? 13.614  -0.391  23.140  1.00 0.00 ?  386 LYS A HE2  1  
ATOM   1164   H  HE3  . LYS A  1 71  ? 13.621  1.337   23.123  1.00 0.00 ?  386 LYS A HE3  1  
ATOM   1165   H  HZ1  . LYS A  1 71  ? 15.025  -0.469  24.967  1.00 0.00 ?  386 LYS A HZ1  1  
ATOM   1166   H  HZ2  . LYS A  1 71  ? 14.799  1.192   25.304  1.00 0.00 ?  386 LYS A HZ2  1  
ATOM   1167   H  HZ3  . LYS A  1 71  ? 15.662  0.754   23.933  1.00 0.00 ?  386 LYS A HZ3  1  
ATOM   1168   N  N    . HIS A  1 72  ? 7.955   0.268   26.099  1.00 0.00 ?  387 HIS A N    1  
ATOM   1169   C  CA   . HIS A  1 72  ? 6.595   -0.241  26.227  1.00 0.00 ?  387 HIS A CA   1  
ATOM   1170   C  C    . HIS A  1 72  ? 6.008   -0.798  24.902  1.00 0.00 ?  387 HIS A C    1  
ATOM   1171   O  O    . HIS A  1 72  ? 6.391   -0.300  23.867  1.00 0.00 ?  387 HIS A O    1  
ATOM   1172   C  CB   . HIS A  1 72  ? 5.590   0.788   26.747  1.00 0.00 ?  387 HIS A CB   1  
ATOM   1173   C  CG   . HIS A  1 72  ? 5.184   1.927   25.882  1.00 0.00 ?  387 HIS A CG   1  
ATOM   1174   N  ND1  . HIS A  1 72  ? 6.039   2.820   25.285  1.00 0.00 ?  387 HIS A ND1  1  
ATOM   1175   C  CD2  . HIS A  1 72  ? 3.935   2.359   25.458  1.00 0.00 ?  387 HIS A CD2  1  
ATOM   1176   C  CE1  . HIS A  1 72  ? 5.310   3.692   24.523  1.00 0.00 ?  387 HIS A CE1  1  
ATOM   1177   N  NE2  . HIS A  1 72  ? 4.023   3.388   24.511  1.00 0.00 ?  387 HIS A NE2  1  
ATOM   1178   H  H    . HIS A  1 72  ? 8.293   0.608   25.225  1.00 0.00 ?  387 HIS A H    1  
ATOM   1179   H  HA   . HIS A  1 72  ? 6.628   -1.084  26.901  1.00 0.00 ?  387 HIS A HA   1  
ATOM   1180   H  HB2  . HIS A  1 72  ? 4.699   0.220   27.089  1.00 0.00 ?  387 HIS A HB2  1  
ATOM   1181   H  HB3  . HIS A  1 72  ? 6.176   1.242   27.575  1.00 0.00 ?  387 HIS A HB3  1  
ATOM   1182   H  HD1  . HIS A  1 72  ? 7.031   2.754   25.392  1.00 0.00 ?  387 HIS A HD1  1  
ATOM   1183   H  HD2  . HIS A  1 72  ? 2.988   1.972   25.813  1.00 0.00 ?  387 HIS A HD2  1  
ATOM   1184   H  HE1  . HIS A  1 72  ? 5.813   4.401   23.866  1.00 0.00 ?  387 HIS A HE1  1  
ATOM   1185   N  N    . TRP A  1 73  ? 5.204   -1.892  24.971  1.00 0.00 ?  388 TRP A N    1  
ATOM   1186   C  CA   . TRP A  1 73  ? 4.672   -2.683  23.886  1.00 0.00 ?  388 TRP A CA   1  
ATOM   1187   C  C    . TRP A  1 73  ? 3.184   -2.479  23.950  1.00 0.00 ?  388 TRP A C    1  
ATOM   1188   O  O    . TRP A  1 73  ? 2.592   -2.526  25.044  1.00 0.00 ?  388 TRP A O    1  
ATOM   1189   C  CB   . TRP A  1 73  ? 4.954   -4.194  23.935  1.00 0.00 ?  388 TRP A CB   1  
ATOM   1190   C  CG   . TRP A  1 73  ? 6.332   -4.774  23.661  1.00 0.00 ?  388 TRP A CG   1  
ATOM   1191   C  CD1  . TRP A  1 73  ? 6.961   -5.332  22.613  1.00 0.00 ?  388 TRP A CD1  1  
ATOM   1192   C  CD2  . TRP A  1 73  ? 7.276   -4.666  24.697  1.00 0.00 ?  388 TRP A CD2  1  
ATOM   1193   N  NE1  . TRP A  1 73  ? 8.276   -5.591  22.973  1.00 0.00 ?  388 TRP A NE1  1  
ATOM   1194   C  CE2  . TRP A  1 73  ? 8.508   -5.063  24.233  1.00 0.00 ?  388 TRP A CE2  1  
ATOM   1195   C  CE3  . TRP A  1 73  ? 7.212   -4.241  26.044  1.00 0.00 ?  388 TRP A CE3  1  
ATOM   1196   C  CZ2  . TRP A  1 73  ? 9.771   -4.977  24.915  1.00 0.00 ?  388 TRP A CZ2  1  
ATOM   1197   C  CZ3  . TRP A  1 73  ? 8.380   -4.194  26.749  1.00 0.00 ?  388 TRP A CZ3  1  
ATOM   1198   C  CH2  . TRP A  1 73  ? 9.681   -4.406  26.160  1.00 0.00 ?  388 TRP A CH2  1  
ATOM   1199   H  H    . TRP A  1 73  ? 4.890   -2.199  25.866  1.00 0.00 ?  388 TRP A H    1  
ATOM   1200   H  HA   . TRP A  1 73  ? 5.138   -2.277  23.000  1.00 0.00 ?  388 TRP A HA   1  
ATOM   1201   H  HB2  . TRP A  1 73  ? 4.503   -4.727  24.799  1.00 0.00 ?  388 TRP A HB2  1  
ATOM   1202   H  HB3  . TRP A  1 73  ? 4.335   -4.571  23.093  1.00 0.00 ?  388 TRP A HB3  1  
ATOM   1203   H  HD1  . TRP A  1 73  ? 6.632   -5.238  21.588  1.00 0.00 ?  388 TRP A HD1  1  
ATOM   1204   H  HE1  . TRP A  1 73  ? 9.090   -5.659  22.439  1.00 0.00 ?  388 TRP A HE1  1  
ATOM   1205   H  HE3  . TRP A  1 73  ? 6.259   -3.988  26.485  1.00 0.00 ?  388 TRP A HE3  1  
ATOM   1206   H  HZ2  . TRP A  1 73  ? 10.675  -5.303  24.423  1.00 0.00 ?  388 TRP A HZ2  1  
ATOM   1207   H  HZ3  . TRP A  1 73  ? 8.402   -3.862  27.777  1.00 0.00 ?  388 TRP A HZ3  1  
ATOM   1208   H  HH2  . TRP A  1 73  ? 10.550  -4.232  26.777  1.00 0.00 ?  388 TRP A HH2  1  
ATOM   1209   N  N    . VAL A  1 74  ? 2.523   -2.364  22.759  1.00 0.00 ?  389 VAL A N    1  
ATOM   1210   C  CA   . VAL A  1 74  ? 1.089   -2.261  22.709  1.00 0.00 ?  389 VAL A CA   1  
ATOM   1211   C  C    . VAL A  1 74  ? 0.737   -3.404  21.933  1.00 0.00 ?  389 VAL A C    1  
ATOM   1212   O  O    . VAL A  1 74  ? 1.044   -3.552  20.759  1.00 0.00 ?  389 VAL A O    1  
ATOM   1213   C  CB   . VAL A  1 74  ? 0.627   -0.944  22.118  1.00 0.00 ?  389 VAL A CB   1  
ATOM   1214   C  CG1  . VAL A  1 74  ? -0.895  -0.907  22.282  1.00 0.00 ?  389 VAL A CG1  1  
ATOM   1215   C  CG2  . VAL A  1 74  ? 1.238   0.208   22.980  1.00 0.00 ?  389 VAL A CG2  1  
ATOM   1216   H  H    . VAL A  1 74  ? 2.966   -2.261  21.871  1.00 0.00 ?  389 VAL A H    1  
ATOM   1217   H  HA   . VAL A  1 74  ? 0.697   -2.345  23.711  1.00 0.00 ?  389 VAL A HA   1  
ATOM   1218   H  HB   . VAL A  1 74  ? 0.995   -0.838  21.074  1.00 0.00 ?  389 VAL A HB   1  
ATOM   1219   H  HG11 . VAL A  1 74  ? -1.369  0.094   22.197  1.00 0.00 ?  389 VAL A HG11 1  
ATOM   1220   H  HG12 . VAL A  1 74  ? -0.968  -0.929  23.391  1.00 0.00 ?  389 VAL A HG12 1  
ATOM   1221   H  HG13 . VAL A  1 74  ? -1.475  -1.720  21.795  1.00 0.00 ?  389 VAL A HG13 1  
ATOM   1222   H  HG21 . VAL A  1 74  ? 2.331   0.132   23.166  1.00 0.00 ?  389 VAL A HG21 1  
ATOM   1223   H  HG22 . VAL A  1 74  ? 0.718   0.109   23.957  1.00 0.00 ?  389 VAL A HG22 1  
ATOM   1224   H  HG23 . VAL A  1 74  ? 0.981   1.219   22.597  1.00 0.00 ?  389 VAL A HG23 1  
ATOM   1225   N  N    . PHE A  1 75  ? 0.065   -4.351  22.502  1.00 0.00 ?  390 PHE A N    1  
ATOM   1226   C  CA   . PHE A  1 75  ? -0.532  -5.534  21.877  1.00 0.00 ?  390 PHE A CA   1  
ATOM   1227   C  C    . PHE A  1 75  ? -2.050  -5.338  21.713  1.00 0.00 ?  390 PHE A C    1  
ATOM   1228   O  O    . PHE A  1 75  ? -2.623  -4.530  22.468  1.00 0.00 ?  390 PHE A O    1  
ATOM   1229   C  CB   . PHE A  1 75  ? -0.316  -6.753  22.738  1.00 0.00 ?  390 PHE A CB   1  
ATOM   1230   C  CG   . PHE A  1 75  ? 1.001   -7.299  22.452  1.00 0.00 ?  390 PHE A CG   1  
ATOM   1231   C  CD1  . PHE A  1 75  ? 2.232   -6.937  23.031  1.00 0.00 ?  390 PHE A CD1  1  
ATOM   1232   C  CD2  . PHE A  1 75  ? 1.084   -8.380  21.502  1.00 0.00 ?  390 PHE A CD2  1  
ATOM   1233   C  CE1  . PHE A  1 75  ? 3.460   -7.503  22.715  1.00 0.00 ?  390 PHE A CE1  1  
ATOM   1234   C  CE2  . PHE A  1 75  ? 2.303   -8.993  21.198  1.00 0.00 ?  390 PHE A CE2  1  
ATOM   1235   C  CZ   . PHE A  1 75  ? 3.502   -8.628  21.826  1.00 0.00 ?  390 PHE A CZ   1  
ATOM   1236   H  H    . PHE A  1 75  ? -0.194  -4.252  23.459  1.00 0.00 ?  390 PHE A H    1  
ATOM   1237   H  HA   . PHE A  1 75  ? -0.171  -5.697  20.872  1.00 0.00 ?  390 PHE A HA   1  
ATOM   1238   H  HB2  . PHE A  1 75  ? -0.381  -6.438  23.801  1.00 0.00 ?  390 PHE A HB2  1  
ATOM   1239   H  HB3  . PHE A  1 75  ? -1.074  -7.526  22.492  1.00 0.00 ?  390 PHE A HB3  1  
ATOM   1240   H  HD1  . PHE A  1 75  ? 2.168   -6.150  23.768  1.00 0.00 ?  390 PHE A HD1  1  
ATOM   1241   H  HD2  . PHE A  1 75  ? 0.176   -8.728  21.033  1.00 0.00 ?  390 PHE A HD2  1  
ATOM   1242   H  HE1  . PHE A  1 75  ? 4.422   -7.166  23.073  1.00 0.00 ?  390 PHE A HE1  1  
ATOM   1243   H  HE2  . PHE A  1 75  ? 2.472   -9.840  20.551  1.00 0.00 ?  390 PHE A HE2  1  
ATOM   1244   H  HZ   . PHE A  1 75  ? 4.453   -9.107  21.647  1.00 0.00 ?  390 PHE A HZ   1  
ATOM   1245   N  N    . ASP A  1 76  ? -2.701  -5.997  20.722  1.00 0.00 ?  391 ASP A N    1  
ATOM   1246   C  CA   . ASP A  1 76  ? -4.131  -6.267  20.787  1.00 0.00 ?  391 ASP A CA   1  
ATOM   1247   C  C    . ASP A  1 76  ? -4.258  -7.783  20.660  1.00 0.00 ?  391 ASP A C    1  
ATOM   1248   O  O    . ASP A  1 76  ? -3.268  -8.424  20.929  1.00 0.00 ?  391 ASP A O    1  
ATOM   1249   C  CB   . ASP A  1 76  ? -4.846  -5.462  19.613  1.00 0.00 ?  391 ASP A CB   1  
ATOM   1250   C  CG   . ASP A  1 76  ? -6.273  -5.219  19.774  1.00 0.00 ?  391 ASP A CG   1  
ATOM   1251   O  OD1  . ASP A  1 76  ? -7.026  -5.951  20.423  1.00 0.00 ?  391 ASP A OD1  1  
ATOM   1252   O  OD2  . ASP A  1 76  ? -6.771  -4.273  19.074  1.00 0.00 -1 391 ASP A OD2  1  
ATOM   1253   H  H    . ASP A  1 76  ? -2.212  -6.425  19.967  1.00 0.00 ?  391 ASP A H    1  
ATOM   1254   H  HA   . ASP A  1 76  ? -4.502  -6.016  21.770  1.00 0.00 ?  391 ASP A HA   1  
ATOM   1255   H  HB2  . ASP A  1 76  ? -4.282  -4.505  19.600  1.00 0.00 ?  391 ASP A HB2  1  
ATOM   1256   H  HB3  . ASP A  1 76  ? -4.497  -5.937  18.671  1.00 0.00 ?  391 ASP A HB3  1  
ATOM   1257   N  N    . GLU A  1 77  ? -5.435  -8.480  20.404  1.00 0.00 ?  392 GLU A N    1  
ATOM   1258   C  CA   . GLU A  1 77  ? -5.474  -9.932  20.520  1.00 0.00 ?  392 GLU A CA   1  
ATOM   1259   C  C    . GLU A  1 77  ? -4.623  -10.770 19.487  1.00 0.00 ?  392 GLU A C    1  
ATOM   1260   O  O    . GLU A  1 77  ? -4.175  -11.905 19.728  1.00 0.00 ?  392 GLU A O    1  
ATOM   1261   C  CB   . GLU A  1 77  ? -6.941  -10.443 20.658  1.00 0.00 ?  392 GLU A CB   1  
ATOM   1262   C  CG   . GLU A  1 77  ? -7.557  -9.849  21.942  1.00 0.00 ?  392 GLU A CG   1  
ATOM   1263   C  CD   . GLU A  1 77  ? -8.813  -10.517 22.423  1.00 0.00 ?  392 GLU A CD   1  
ATOM   1264   O  OE1  . GLU A  1 77  ? -8.936  -11.687 22.006  1.00 0.00 ?  392 GLU A OE1  1  
ATOM   1265   O  OE2  . GLU A  1 77  ? -9.678  -9.862  23.094  1.00 0.00 -1 392 GLU A OE2  1  
ATOM   1266   H  H    . GLU A  1 77  ? -6.314  -8.026  20.283  1.00 0.00 ?  392 GLU A H    1  
ATOM   1267   H  HA   . GLU A  1 77  ? -5.015  -10.146 21.474  1.00 0.00 ?  392 GLU A HA   1  
ATOM   1268   H  HB2  . GLU A  1 77  ? -7.470  -10.196 19.713  1.00 0.00 ?  392 GLU A HB2  1  
ATOM   1269   H  HB3  . GLU A  1 77  ? -6.873  -11.552 20.667  1.00 0.00 ?  392 GLU A HB3  1  
ATOM   1270   H  HG2  . GLU A  1 77  ? -6.825  -9.888  22.777  1.00 0.00 ?  392 GLU A HG2  1  
ATOM   1271   H  HG3  . GLU A  1 77  ? -7.770  -8.759  21.940  1.00 0.00 ?  392 GLU A HG3  1  
ATOM   1272   N  N    . ALA A  1 78  ? -4.441  -10.149 18.276  1.00 0.00 ?  393 ALA A N    1  
ATOM   1273   C  CA   . ALA A  1 78  ? -3.794  -10.857 17.201  1.00 0.00 ?  393 ALA A CA   1  
ATOM   1274   C  C    . ALA A  1 78  ? -2.312  -10.659 17.252  1.00 0.00 ?  393 ALA A C    1  
ATOM   1275   O  O    . ALA A  1 78  ? -1.524  -11.630 17.208  1.00 0.00 ?  393 ALA A O    1  
ATOM   1276   C  CB   . ALA A  1 78  ? -4.352  -10.416 15.840  1.00 0.00 ?  393 ALA A CB   1  
ATOM   1277   H  H    . ALA A  1 78  ? -4.871  -9.289  18.011  1.00 0.00 ?  393 ALA A H    1  
ATOM   1278   H  HA   . ALA A  1 78  ? -4.084  -11.893 17.299  1.00 0.00 ?  393 ALA A HA   1  
ATOM   1279   H  HB1  . ALA A  1 78  ? -5.453  -10.485 15.972  1.00 0.00 ?  393 ALA A HB1  1  
ATOM   1280   H  HB2  . ALA A  1 78  ? -4.100  -11.082 14.987  1.00 0.00 ?  393 ALA A HB2  1  
ATOM   1281   H  HB3  . ALA A  1 78  ? -4.005  -9.393  15.581  1.00 0.00 ?  393 ALA A HB3  1  
ATOM   1282   N  N    . SER A  1 79  ? -1.876  -9.364  17.443  1.00 0.00 ?  394 SER A N    1  
ATOM   1283   C  CA   . SER A  1 79  ? -0.561  -8.979  17.045  1.00 0.00 ?  394 SER A CA   1  
ATOM   1284   C  C    . SER A  1 79  ? -0.111  -7.740  17.837  1.00 0.00 ?  394 SER A C    1  
ATOM   1285   O  O    . SER A  1 79  ? -0.875  -6.887  18.280  1.00 0.00 ?  394 SER A O    1  
ATOM   1286   C  CB   . SER A  1 79  ? -0.357  -8.544  15.614  1.00 0.00 ?  394 SER A CB   1  
ATOM   1287   O  OG   . SER A  1 79  ? 0.954   -8.912  15.181  1.00 0.00 ?  394 SER A OG   1  
ATOM   1288   H  H    . SER A  1 79  ? -2.431  -8.547  17.580  1.00 0.00 ?  394 SER A H    1  
ATOM   1289   H  HA   . SER A  1 79  ? 0.132   -9.778  17.267  1.00 0.00 ?  394 SER A HA   1  
ATOM   1290   H  HB2  . SER A  1 79  ? -1.048  -9.048  14.905  1.00 0.00 ?  394 SER A HB2  1  
ATOM   1291   H  HB3  . SER A  1 79  ? -0.387  -7.450  15.425  1.00 0.00 ?  394 SER A HB3  1  
ATOM   1292   H  HG   . SER A  1 79  ? 1.169   -8.597  14.300  1.00 0.00 ?  394 SER A HG   1  
ATOM   1293   N  N    . LEU A  1 80  ? 1.224   -7.529  17.935  1.00 0.00 ?  395 LEU A N    1  
ATOM   1294   C  CA   . LEU A  1 80  ? 1.825   -6.253  18.342  1.00 0.00 ?  395 LEU A CA   1  
ATOM   1295   C  C    . LEU A  1 80  ? 1.601   -5.048  17.420  1.00 0.00 ?  395 LEU A C    1  
ATOM   1296   O  O    . LEU A  1 80  ? 1.584   -5.196  16.229  1.00 0.00 ?  395 LEU A O    1  
ATOM   1297   C  CB   . LEU A  1 80  ? 3.309   -6.582  18.603  1.00 0.00 ?  395 LEU A CB   1  
ATOM   1298   C  CG   . LEU A  1 80  ? 4.152   -5.353  19.040  1.00 0.00 ?  395 LEU A CG   1  
ATOM   1299   C  CD1  . LEU A  1 80  ? 3.990   -5.048  20.455  1.00 0.00 ?  395 LEU A CD1  1  
ATOM   1300   C  CD2  . LEU A  1 80  ? 5.607   -5.687  18.689  1.00 0.00 ?  395 LEU A CD2  1  
ATOM   1301   H  H    . LEU A  1 80  ? 1.877   -8.121  17.470  1.00 0.00 ?  395 LEU A H    1  
ATOM   1302   H  HA   . LEU A  1 80  ? 1.396   -6.000  19.301  1.00 0.00 ?  395 LEU A HA   1  
ATOM   1303   H  HB2  . LEU A  1 80  ? 3.383   -7.303  19.445  1.00 0.00 ?  395 LEU A HB2  1  
ATOM   1304   H  HB3  . LEU A  1 80  ? 3.717   -7.180  17.760  1.00 0.00 ?  395 LEU A HB3  1  
ATOM   1305   H  HG   . LEU A  1 80  ? 3.869   -4.444  18.469  1.00 0.00 ?  395 LEU A HG   1  
ATOM   1306   H  HD11 . LEU A  1 80  ? 4.317   -4.083  20.897  1.00 0.00 ?  395 LEU A HD11 1  
ATOM   1307   H  HD12 . LEU A  1 80  ? 4.415   -5.847  21.101  1.00 0.00 ?  395 LEU A HD12 1  
ATOM   1308   H  HD13 . LEU A  1 80  ? 2.911   -5.035  20.716  1.00 0.00 ?  395 LEU A HD13 1  
ATOM   1309   H  HD21 . LEU A  1 80  ? 5.802   -5.681  17.596  1.00 0.00 ?  395 LEU A HD21 1  
ATOM   1310   H  HD22 . LEU A  1 80  ? 5.893   -6.695  19.058  1.00 0.00 ?  395 LEU A HD22 1  
ATOM   1311   H  HD23 . LEU A  1 80  ? 6.370   -5.011  19.133  1.00 0.00 ?  395 LEU A HD23 1  
ATOM   1312   N  N    . GLU A  1 81  ? 1.349   -3.877  18.054  1.00 0.00 ?  396 GLU A N    1  
ATOM   1313   C  CA   . GLU A  1 81  ? 0.976   -2.710  17.316  1.00 0.00 ?  396 GLU A CA   1  
ATOM   1314   C  C    . GLU A  1 81  ? 2.046   -2.315  16.290  1.00 0.00 ?  396 GLU A C    1  
ATOM   1315   O  O    . GLU A  1 81  ? 3.241   -2.428  16.592  1.00 0.00 ?  396 GLU A O    1  
ATOM   1316   C  CB   . GLU A  1 81  ? 0.420   -1.566  18.143  1.00 0.00 ?  396 GLU A CB   1  
ATOM   1317   C  CG   . GLU A  1 81  ? -0.841  -1.975  18.882  1.00 0.00 ?  396 GLU A CG   1  
ATOM   1318   C  CD   . GLU A  1 81  ? -1.869  -2.550  17.957  1.00 0.00 ?  396 GLU A CD   1  
ATOM   1319   O  OE1  . GLU A  1 81  ? -2.012  -2.072  16.793  1.00 0.00 ?  396 GLU A OE1  1  
ATOM   1320   O  OE2  . GLU A  1 81  ? -2.695  -3.377  18.442  1.00 0.00 -1 396 GLU A OE2  1  
ATOM   1321   H  H    . GLU A  1 81  ? 1.360   -3.757  19.044  1.00 0.00 ?  396 GLU A H    1  
ATOM   1322   H  HA   . GLU A  1 81  ? 0.165   -3.075  16.703  1.00 0.00 ?  396 GLU A HA   1  
ATOM   1323   H  HB2  . GLU A  1 81  ? 1.137   -1.341  18.960  1.00 0.00 ?  396 GLU A HB2  1  
ATOM   1324   H  HB3  . GLU A  1 81  ? 0.296   -0.668  17.501  1.00 0.00 ?  396 GLU A HB3  1  
ATOM   1325   H  HG2  . GLU A  1 81  ? -0.669  -2.557  19.813  1.00 0.00 ?  396 GLU A HG2  1  
ATOM   1326   H  HG3  . GLU A  1 81  ? -1.371  -1.056  19.212  1.00 0.00 ?  396 GLU A HG3  1  
ATOM   1327   N  N    . PRO A  1 82  ? 1.682   -1.793  15.063  1.00 0.00 ?  397 PRO A N    1  
ATOM   1328   C  CA   . PRO A  1 82  ? 2.670   -1.376  14.148  1.00 0.00 ?  397 PRO A CA   1  
ATOM   1329   C  C    . PRO A  1 82  ? 3.610   -0.283  14.673  1.00 0.00 ?  397 PRO A C    1  
ATOM   1330   O  O    . PRO A  1 82  ? 3.171   0.855   14.814  1.00 0.00 ?  397 PRO A O    1  
ATOM   1331   C  CB   . PRO A  1 82  ? 1.818   -1.005  12.903  1.00 0.00 ?  397 PRO A CB   1  
ATOM   1332   C  CG   . PRO A  1 82  ? 0.711   -1.970  12.945  1.00 0.00 ?  397 PRO A CG   1  
ATOM   1333   C  CD   . PRO A  1 82  ? 0.384   -2.050  14.450  1.00 0.00 ?  397 PRO A CD   1  
ATOM   1334   H  HA   . PRO A  1 82  ? 3.251   -2.257  13.919  1.00 0.00 ?  397 PRO A HA   1  
ATOM   1335   H  HB2  . PRO A  1 82  ? 1.490   0.057   12.910  1.00 0.00 ?  397 PRO A HB2  1  
ATOM   1336   H  HB3  . PRO A  1 82  ? 2.448   -1.045  11.989  1.00 0.00 ?  397 PRO A HB3  1  
ATOM   1337   H  HG2  . PRO A  1 82  ? -0.112  -1.698  12.249  1.00 0.00 ?  397 PRO A HG2  1  
ATOM   1338   H  HG3  . PRO A  1 82  ? 1.148   -2.966  12.718  1.00 0.00 ?  397 PRO A HG3  1  
ATOM   1339   H  HD2  . PRO A  1 82  ? -0.326  -1.249  14.748  1.00 0.00 ?  397 PRO A HD2  1  
ATOM   1340   H  HD3  . PRO A  1 82  ? 0.154   -3.112  14.679  1.00 0.00 ?  397 PRO A HD3  1  
ATOM   1341   N  N    . GLY A  1 83  ? 4.900   -0.562  14.834  1.00 0.00 ?  398 GLY A N    1  
ATOM   1342   C  CA   . GLY A  1 83  ? 5.966   0.450   15.117  1.00 0.00 ?  398 GLY A CA   1  
ATOM   1343   C  C    . GLY A  1 83  ? 6.282   0.505   16.540  1.00 0.00 ?  398 GLY A C    1  
ATOM   1344   O  O    . GLY A  1 83  ? 6.810   1.550   17.003  1.00 0.00 ?  398 GLY A O    1  
ATOM   1345   H  H    . GLY A  1 83  ? 5.302   -1.473  14.789  1.00 0.00 ?  398 GLY A H    1  
ATOM   1346   H  HA2  . GLY A  1 83  ? 6.847   0.030   14.653  1.00 0.00 ?  398 GLY A HA2  1  
ATOM   1347   H  HA3  . GLY A  1 83  ? 5.664   1.408   14.720  1.00 0.00 ?  398 GLY A HA3  1  
ATOM   1348   N  N    . TYR A  1 84  ? 5.913   -0.602  17.205  1.00 0.00 ?  399 TYR A N    1  
ATOM   1349   C  CA   . TYR A  1 84  ? 6.332   -0.900  18.581  1.00 0.00 ?  399 TYR A CA   1  
ATOM   1350   C  C    . TYR A  1 84  ? 7.298   -1.968  18.585  1.00 0.00 ?  399 TYR A C    1  
ATOM   1351   O  O    . TYR A  1 84  ? 7.395   -2.606  17.561  1.00 0.00 ?  399 TYR A O    1  
ATOM   1352   C  CB   . TYR A  1 84  ? 5.107   -1.271  19.413  1.00 0.00 ?  399 TYR A CB   1  
ATOM   1353   C  CG   . TYR A  1 84  ? 4.285   -0.067  19.788  1.00 0.00 ?  399 TYR A CG   1  
ATOM   1354   C  CD1  . TYR A  1 84  ? 4.652   0.757   20.882  1.00 0.00 ?  399 TYR A CD1  1  
ATOM   1355   C  CD2  . TYR A  1 84  ? 3.216   0.322   18.988  1.00 0.00 ?  399 TYR A CD2  1  
ATOM   1356   C  CE1  . TYR A  1 84  ? 3.888   1.879   21.255  1.00 0.00 ?  399 TYR A CE1  1  
ATOM   1357   C  CE2  . TYR A  1 84  ? 2.569   1.500   19.264  1.00 0.00 ?  399 TYR A CE2  1  
ATOM   1358   C  CZ   . TYR A  1 84  ? 2.901   2.270   20.383  1.00 0.00 ?  399 TYR A CZ   1  
ATOM   1359   O  OH   . TYR A  1 84  ? 2.029   3.354   20.735  1.00 0.00 ?  399 TYR A OH   1  
ATOM   1360   H  H    . TYR A  1 84  ? 5.479   -1.324  16.671  1.00 0.00 ?  399 TYR A H    1  
ATOM   1361   H  HA   . TYR A  1 84  ? 6.738   0.038   18.931  1.00 0.00 ?  399 TYR A HA   1  
ATOM   1362   H  HB2  . TYR A  1 84  ? 4.443   -2.011  18.917  1.00 0.00 ?  399 TYR A HB2  1  
ATOM   1363   H  HB3  . TYR A  1 84  ? 5.466   -1.818  20.311  1.00 0.00 ?  399 TYR A HB3  1  
ATOM   1364   H  HD1  . TYR A  1 84  ? 5.472   0.506   21.538  1.00 0.00 ?  399 TYR A HD1  1  
ATOM   1365   H  HD2  . TYR A  1 84  ? 2.974   -0.297  18.137  1.00 0.00 ?  399 TYR A HD2  1  
ATOM   1366   H  HE1  . TYR A  1 84  ? 4.054   2.442   22.161  1.00 0.00 ?  399 TYR A HE1  1  
ATOM   1367   H  HE2  . TYR A  1 84  ? 1.766   1.847   18.631  1.00 0.00 ?  399 TYR A HE2  1  
ATOM   1368   H  HH   . TYR A  1 84  ? 1.587   3.538   19.903  1.00 0.00 ?  399 TYR A HH   1  
ATOM   1369   N  N    . PRO A  1 85  ? 8.080   -2.144  19.747  1.00 0.00 ?  400 PRO A N    1  
ATOM   1370   C  CA   . PRO A  1 85  ? 8.121   -1.367  21.067  1.00 0.00 ?  400 PRO A CA   1  
ATOM   1371   C  C    . PRO A  1 85  ? 8.494   0.124   20.951  1.00 0.00 ?  400 PRO A C    1  
ATOM   1372   O  O    . PRO A  1 85  ? 8.894   0.602   19.922  1.00 0.00 ?  400 PRO A O    1  
ATOM   1373   C  CB   . PRO A  1 85  ? 9.052   -2.226  21.980  1.00 0.00 ?  400 PRO A CB   1  
ATOM   1374   C  CG   . PRO A  1 85  ? 10.013  -2.821  20.938  1.00 0.00 ?  400 PRO A CG   1  
ATOM   1375   C  CD   . PRO A  1 85  ? 9.146   -3.113  19.743  1.00 0.00 ?  400 PRO A CD   1  
ATOM   1376   H  HA   . PRO A  1 85  ? 7.104   -1.311  21.426  1.00 0.00 ?  400 PRO A HA   1  
ATOM   1377   H  HB2  . PRO A  1 85  ? 9.611   -1.619  22.725  1.00 0.00 ?  400 PRO A HB2  1  
ATOM   1378   H  HB3  . PRO A  1 85  ? 8.426   -2.921  22.580  1.00 0.00 ?  400 PRO A HB3  1  
ATOM   1379   H  HG2  . PRO A  1 85  ? 10.818  -2.138  20.593  1.00 0.00 ?  400 PRO A HG2  1  
ATOM   1380   H  HG3  . PRO A  1 85  ? 10.531  -3.752  21.255  1.00 0.00 ?  400 PRO A HG3  1  
ATOM   1381   H  HD2  . PRO A  1 85  ? 9.666   -2.809  18.810  1.00 0.00 ?  400 PRO A HD2  1  
ATOM   1382   H  HD3  . PRO A  1 85  ? 8.730   -4.142  19.800  1.00 0.00 ?  400 PRO A HD3  1  
ATOM   1383   N  N    . LYS A  1 86  ? 8.297   0.929   21.951  1.00 0.00 ?  401 LYS A N    1  
ATOM   1384   C  CA   . LYS A  1 86  ? 8.714   2.328   22.026  1.00 0.00 ?  401 LYS A CA   1  
ATOM   1385   C  C    . LYS A  1 86  ? 9.259   2.652   23.432  1.00 0.00 ?  401 LYS A C    1  
ATOM   1386   O  O    . LYS A  1 86  ? 8.887   2.032   24.416  1.00 0.00 ?  401 LYS A O    1  
ATOM   1387   C  CB   . LYS A  1 86  ? 7.673   3.365   21.571  1.00 0.00 ?  401 LYS A CB   1  
ATOM   1388   C  CG   . LYS A  1 86  ? 7.280   3.439   20.082  1.00 0.00 ?  401 LYS A CG   1  
ATOM   1389   C  CD   . LYS A  1 86  ? 6.257   4.455   19.692  1.00 0.00 ?  401 LYS A CD   1  
ATOM   1390   C  CE   . LYS A  1 86  ? 5.607   4.227   18.320  1.00 0.00 ?  401 LYS A CE   1  
ATOM   1391   N  NZ   . LYS A  1 86  ? 4.719   5.408   18.087  1.00 0.00 1  401 LYS A NZ   1  
ATOM   1392   H  H    . LYS A  1 86  ? 7.905   0.656   22.826  1.00 0.00 ?  401 LYS A H    1  
ATOM   1393   H  HA   . LYS A  1 86  ? 9.592   2.546   21.436  1.00 0.00 ?  401 LYS A HA   1  
ATOM   1394   H  HB2  . LYS A  1 86  ? 6.844   2.998   22.214  1.00 0.00 ?  401 LYS A HB2  1  
ATOM   1395   H  HB3  . LYS A  1 86  ? 8.153   4.322   21.867  1.00 0.00 ?  401 LYS A HB3  1  
ATOM   1396   H  HG2  . LYS A  1 86  ? 8.218   3.632   19.519  1.00 0.00 ?  401 LYS A HG2  1  
ATOM   1397   H  HG3  . LYS A  1 86  ? 6.966   2.393   19.877  1.00 0.00 ?  401 LYS A HG3  1  
ATOM   1398   H  HD2  . LYS A  1 86  ? 5.453   4.508   20.457  1.00 0.00 ?  401 LYS A HD2  1  
ATOM   1399   H  HD3  . LYS A  1 86  ? 6.724   5.463   19.683  1.00 0.00 ?  401 LYS A HD3  1  
ATOM   1400   H  HE2  . LYS A  1 86  ? 6.330   4.073   17.491  1.00 0.00 ?  401 LYS A HE2  1  
ATOM   1401   H  HE3  . LYS A  1 86  ? 5.000   3.298   18.371  1.00 0.00 ?  401 LYS A HE3  1  
ATOM   1402   H  HZ1  . LYS A  1 86  ? 4.575   5.858   19.014  1.00 0.00 ?  401 LYS A HZ1  1  
ATOM   1403   H  HZ2  . LYS A  1 86  ? 3.843   5.091   17.624  1.00 0.00 ?  401 LYS A HZ2  1  
ATOM   1404   H  HZ3  . LYS A  1 86  ? 5.102   6.086   17.398  1.00 0.00 ?  401 LYS A HZ3  1  
ATOM   1405   N  N    . HIS A  1 87  ? 10.163  3.614   23.593  1.00 0.00 ?  402 HIS A N    1  
ATOM   1406   C  CA   . HIS A  1 87  ? 10.469  4.278   24.886  1.00 0.00 ?  402 HIS A CA   1  
ATOM   1407   C  C    . HIS A  1 87  ? 9.309   4.866   25.645  1.00 0.00 ?  402 HIS A C    1  
ATOM   1408   O  O    . HIS A  1 87  ? 8.343   5.222   25.054  1.00 0.00 ?  402 HIS A O    1  
ATOM   1409   C  CB   . HIS A  1 87  ? 11.734  5.250   24.811  1.00 0.00 ?  402 HIS A CB   1  
ATOM   1410   C  CG   . HIS A  1 87  ? 12.912  4.404   24.610  1.00 0.00 ?  402 HIS A CG   1  
ATOM   1411   N  ND1  . HIS A  1 87  ? 13.593  4.386   23.445  1.00 0.00 ?  402 HIS A ND1  1  
ATOM   1412   C  CD2  . HIS A  1 87  ? 13.760  4.032   25.573  1.00 0.00 ?  402 HIS A CD2  1  
ATOM   1413   C  CE1  . HIS A  1 87  ? 14.829  3.964   23.724  1.00 0.00 ?  402 HIS A CE1  1  
ATOM   1414   N  NE2  . HIS A  1 87  ? 15.027  3.723   25.024  1.00 0.00 ?  402 HIS A NE2  1  
ATOM   1415   H  H    . HIS A  1 87  ? 10.531  4.190   22.866  1.00 0.00 ?  402 HIS A H    1  
ATOM   1416   H  HA   . HIS A  1 87  ? 10.747  3.544   25.629  1.00 0.00 ?  402 HIS A HA   1  
ATOM   1417   H  HB2  . HIS A  1 87  ? 11.432  5.864   23.936  1.00 0.00 ?  402 HIS A HB2  1  
ATOM   1418   H  HB3  . HIS A  1 87  ? 11.801  5.894   25.714  1.00 0.00 ?  402 HIS A HB3  1  
ATOM   1419   H  HD1  . HIS A  1 87  ? 13.195  4.565   22.545  1.00 0.00 ?  402 HIS A HD1  1  
ATOM   1420   H  HD2  . HIS A  1 87  ? 13.627  3.995   26.647  1.00 0.00 ?  402 HIS A HD2  1  
ATOM   1421   H  HE1  . HIS A  1 87  ? 15.564  3.791   22.937  1.00 0.00 ?  402 HIS A HE1  1  
ATOM   1422   N  N    . ILE A  1 88  ? 9.362   4.975   26.979  1.00 0.00 ?  403 ILE A N    1  
ATOM   1423   C  CA   . ILE A  1 88  ? 8.198   5.413   27.877  1.00 0.00 ?  403 ILE A CA   1  
ATOM   1424   C  C    . ILE A  1 88  ? 7.669   6.754   27.477  1.00 0.00 ?  403 ILE A C    1  
ATOM   1425   O  O    . ILE A  1 88  ? 6.470   6.935   27.301  1.00 0.00 ?  403 ILE A O    1  
ATOM   1426   C  CB   . ILE A  1 88  ? 8.455   5.305   29.384  1.00 0.00 ?  403 ILE A CB   1  
ATOM   1427   C  CG1  . ILE A  1 88  ? 8.414   3.796   29.816  1.00 0.00 ?  403 ILE A CG1  1  
ATOM   1428   C  CG2  . ILE A  1 88  ? 7.508   6.217   30.281  1.00 0.00 ?  403 ILE A CG2  1  
ATOM   1429   C  CD1  . ILE A  1 88  ? 9.010   3.602   31.214  1.00 0.00 ?  403 ILE A CD1  1  
ATOM   1430   H  H    . ILE A  1 88  ? 10.224  4.634   27.346  1.00 0.00 ?  403 ILE A H    1  
ATOM   1431   H  HA   . ILE A  1 88  ? 7.365   4.765   27.646  1.00 0.00 ?  403 ILE A HA   1  
ATOM   1432   H  HB   . ILE A  1 88  ? 9.457   5.722   29.619  1.00 0.00 ?  403 ILE A HB   1  
ATOM   1433   H  HG12 . ILE A  1 88  ? 7.305   3.722   29.844  1.00 0.00 ?  403 ILE A HG12 1  
ATOM   1434   H  HG13 . ILE A  1 88  ? 8.977   3.140   29.118  1.00 0.00 ?  403 ILE A HG13 1  
ATOM   1435   H  HG21 . ILE A  1 88  ? 7.799   6.239   31.353  1.00 0.00 ?  403 ILE A HG21 1  
ATOM   1436   H  HG22 . ILE A  1 88  ? 6.499   5.753   30.318  1.00 0.00 ?  403 ILE A HG22 1  
ATOM   1437   H  HG23 . ILE A  1 88  ? 7.515   7.292   30.001  1.00 0.00 ?  403 ILE A HG23 1  
ATOM   1438   H  HD11 . ILE A  1 88  ? 10.038  4.013   31.130  1.00 0.00 ?  403 ILE A HD11 1  
ATOM   1439   H  HD12 . ILE A  1 88  ? 9.174   2.531   31.461  1.00 0.00 ?  403 ILE A HD12 1  
ATOM   1440   H  HD13 . ILE A  1 88  ? 8.506   4.225   31.984  1.00 0.00 ?  403 ILE A HD13 1  
ATOM   1441   N  N    . LYS A  1 89  ? 8.597   7.621   27.047  1.00 0.00 ?  404 LYS A N    1  
ATOM   1442   C  CA   . LYS A  1 89  ? 8.376   9.030   26.551  1.00 0.00 ?  404 LYS A CA   1  
ATOM   1443   C  C    . LYS A  1 89  ? 7.539   9.181   25.277  1.00 0.00 ?  404 LYS A C    1  
ATOM   1444   O  O    . LYS A  1 89  ? 6.975   10.219  25.047  1.00 0.00 ?  404 LYS A O    1  
ATOM   1445   C  CB   . LYS A  1 89  ? 9.781   9.773   26.389  1.00 0.00 ?  404 LYS A CB   1  
ATOM   1446   C  CG   . LYS A  1 89  ? 10.554  9.188   25.128  1.00 0.00 ?  404 LYS A CG   1  
ATOM   1447   C  CD   . LYS A  1 89  ? 12.064  9.543   25.218  1.00 0.00 ?  404 LYS A CD   1  
ATOM   1448   C  CE   . LYS A  1 89  ? 12.429  11.025  25.286  1.00 0.00 ?  404 LYS A CE   1  
ATOM   1449   N  NZ   . LYS A  1 89  ? 13.880  11.316  25.145  1.00 0.00 1  404 LYS A NZ   1  
ATOM   1450   H  H    . LYS A  1 89  ? 9.561   7.425   27.210  1.00 0.00 ?  404 LYS A H    1  
ATOM   1451   H  HA   . LYS A  1 89  ? 7.855   9.581   27.320  1.00 0.00 ?  404 LYS A HA   1  
ATOM   1452   H  HB2  . LYS A  1 89  ? 9.581   10.866  26.378  1.00 0.00 ?  404 LYS A HB2  1  
ATOM   1453   H  HB3  . LYS A  1 89  ? 10.477  9.686   27.250  1.00 0.00 ?  404 LYS A HB3  1  
ATOM   1454   H  HG2  . LYS A  1 89  ? 10.341  8.097   25.102  1.00 0.00 ?  404 LYS A HG2  1  
ATOM   1455   H  HG3  . LYS A  1 89  ? 10.207  9.631   24.171  1.00 0.00 ?  404 LYS A HG3  1  
ATOM   1456   H  HD2  . LYS A  1 89  ? 12.543  9.016   26.070  1.00 0.00 ?  404 LYS A HD2  1  
ATOM   1457   H  HD3  . LYS A  1 89  ? 12.501  9.135   24.281  1.00 0.00 ?  404 LYS A HD3  1  
ATOM   1458   H  HE2  . LYS A  1 89  ? 11.884  11.547  24.470  1.00 0.00 ?  404 LYS A HE2  1  
ATOM   1459   H  HE3  . LYS A  1 89  ? 12.063  11.402  26.265  1.00 0.00 ?  404 LYS A HE3  1  
ATOM   1460   H  HZ1  . LYS A  1 89  ? 14.239  11.098  24.193  1.00 0.00 ?  404 LYS A HZ1  1  
ATOM   1461   H  HZ2  . LYS A  1 89  ? 14.409  10.738  25.829  1.00 0.00 ?  404 LYS A HZ2  1  
ATOM   1462   H  HZ3  . LYS A  1 89  ? 14.082  12.324  25.301  1.00 0.00 ?  404 LYS A HZ3  1  
ATOM   1463   N  N    . GLU A  1 90  ? 7.516   8.064   24.561  1.00 0.00 ?  405 GLU A N    1  
ATOM   1464   C  CA   . GLU A  1 90  ? 6.589   8.005   23.432  1.00 0.00 ?  405 GLU A CA   1  
ATOM   1465   C  C    . GLU A  1 90  ? 5.151   7.620   23.697  1.00 0.00 ?  405 GLU A C    1  
ATOM   1466   O  O    . GLU A  1 90  ? 4.377   7.449   22.736  1.00 0.00 ?  405 GLU A O    1  
ATOM   1467   C  CB   . GLU A  1 90  ? 7.204   7.017   22.389  1.00 0.00 ?  405 GLU A CB   1  
ATOM   1468   C  CG   . GLU A  1 90  ? 8.737   7.364   22.073  1.00 0.00 ?  405 GLU A CG   1  
ATOM   1469   C  CD   . GLU A  1 90  ? 9.012   8.790   21.553  1.00 0.00 ?  405 GLU A CD   1  
ATOM   1470   O  OE1  . GLU A  1 90  ? 10.180  8.966   21.069  1.00 0.00 ?  405 GLU A OE1  1  
ATOM   1471   O  OE2  . GLU A  1 90  ? 8.130   9.679   21.473  1.00 0.00 -1 405 GLU A OE2  1  
ATOM   1472   H  H    . GLU A  1 90  ? 7.957   7.236   24.896  1.00 0.00 ?  405 GLU A H    1  
ATOM   1473   H  HA   . GLU A  1 90  ? 6.555   8.974   22.956  1.00 0.00 ?  405 GLU A HA   1  
ATOM   1474   H  HB2  . GLU A  1 90  ? 7.278   5.977   22.772  1.00 0.00 ?  405 GLU A HB2  1  
ATOM   1475   H  HB3  . GLU A  1 90  ? 6.585   6.950   21.468  1.00 0.00 ?  405 GLU A HB3  1  
ATOM   1476   H  HG2  . GLU A  1 90  ? 9.425   7.232   22.936  1.00 0.00 ?  405 GLU A HG2  1  
ATOM   1477   H  HG3  . GLU A  1 90  ? 9.107   6.676   21.283  1.00 0.00 ?  405 GLU A HG3  1  
ATOM   1478   N  N    . LEU A  1 91  ? 4.673   7.454   24.947  1.00 0.00 ?  406 LEU A N    1  
ATOM   1479   C  CA   . LEU A  1 91  ? 3.228   7.532   25.312  1.00 0.00 ?  406 LEU A CA   1  
ATOM   1480   C  C    . LEU A  1 91  ? 2.863   8.971   25.572  1.00 0.00 ?  406 LEU A C    1  
ATOM   1481   O  O    . LEU A  1 91  ? 1.897   9.387   24.950  1.00 0.00 ?  406 LEU A O    1  
ATOM   1482   C  CB   . LEU A  1 91  ? 3.037   6.532   26.566  1.00 0.00 ?  406 LEU A CB   1  
ATOM   1483   C  CG   . LEU A  1 91  ? 1.715   6.546   27.337  1.00 0.00 ?  406 LEU A CG   1  
ATOM   1484   C  CD1  . LEU A  1 91  ? 0.572   6.406   26.366  1.00 0.00 ?  406 LEU A CD1  1  
ATOM   1485   C  CD2  . LEU A  1 91  ? 1.691   5.349   28.381  1.00 0.00 ?  406 LEU A CD2  1  
ATOM   1486   H  H    . LEU A  1 91  ? 5.327   7.077   25.598  1.00 0.00 ?  406 LEU A H    1  
ATOM   1487   H  HA   . LEU A  1 91  ? 2.640   7.291   24.439  1.00 0.00 ?  406 LEU A HA   1  
ATOM   1488   H  HB2  . LEU A  1 91  ? 3.206   5.498   26.195  1.00 0.00 ?  406 LEU A HB2  1  
ATOM   1489   H  HB3  . LEU A  1 91  ? 3.799   6.853   27.308  1.00 0.00 ?  406 LEU A HB3  1  
ATOM   1490   H  HG   . LEU A  1 91  ? 1.558   7.401   28.028  1.00 0.00 ?  406 LEU A HG   1  
ATOM   1491   H  HD11 . LEU A  1 91  ? -0.350  6.145   26.929  1.00 0.00 ?  406 LEU A HD11 1  
ATOM   1492   H  HD12 . LEU A  1 91  ? 0.800   5.619   25.616  1.00 0.00 ?  406 LEU A HD12 1  
ATOM   1493   H  HD13 . LEU A  1 91  ? 0.401   7.400   25.901  1.00 0.00 ?  406 LEU A HD13 1  
ATOM   1494   H  HD21 . LEU A  1 91  ? 1.475   4.407   27.832  1.00 0.00 ?  406 LEU A HD21 1  
ATOM   1495   H  HD22 . LEU A  1 91  ? 0.846   5.471   29.091  1.00 0.00 ?  406 LEU A HD22 1  
ATOM   1496   H  HD23 . LEU A  1 91  ? 2.599   5.248   29.013  1.00 0.00 ?  406 LEU A HD23 1  
ATOM   1497   N  N    . GLY A  1 92  ? 3.697   9.704   26.292  1.00 0.00 ?  407 GLY A N    1  
ATOM   1498   C  CA   . GLY A  1 92  ? 3.426   11.061  26.510  1.00 0.00 ?  407 GLY A CA   1  
ATOM   1499   C  C    . GLY A  1 92  ? 4.474   11.557  27.494  1.00 0.00 ?  407 GLY A C    1  
ATOM   1500   O  O    . GLY A  1 92  ? 4.711   10.904  28.487  1.00 0.00 ?  407 GLY A O    1  
ATOM   1501   H  H    . GLY A  1 92  ? 4.600   9.346   26.516  1.00 0.00 ?  407 GLY A H    1  
ATOM   1502   H  HA2  . GLY A  1 92  ? 3.512   11.703  25.646  1.00 0.00 ?  407 GLY A HA2  1  
ATOM   1503   H  HA3  . GLY A  1 92  ? 2.476   11.211  27.001  1.00 0.00 ?  407 GLY A HA3  1  
ATOM   1504   N  N    . ARG A  1 93  ? 5.149   12.614  27.082  1.00 0.00 ?  408 ARG A N    1  
ATOM   1505   C  CA   . ARG A  1 93  ? 6.216   13.214  27.895  1.00 0.00 ?  408 ARG A CA   1  
ATOM   1506   C  C    . ARG A  1 93  ? 5.695   13.673  29.191  1.00 0.00 ?  408 ARG A C    1  
ATOM   1507   O  O    . ARG A  1 93  ? 4.598   14.268  29.347  1.00 0.00 ?  408 ARG A O    1  
ATOM   1508   C  CB   . ARG A  1 93  ? 7.065   14.273  27.104  1.00 0.00 ?  408 ARG A CB   1  
ATOM   1509   C  CG   . ARG A  1 93  ? 7.820   13.781  25.855  1.00 0.00 ?  408 ARG A CG   1  
ATOM   1510   C  CD   . ARG A  1 93  ? 8.596   14.882  25.099  1.00 0.00 ?  408 ARG A CD   1  
ATOM   1511   N  NE   . ARG A  1 93  ? 9.250   14.146  23.953  1.00 0.00 ?  408 ARG A NE   1  
ATOM   1512   C  CZ   . ARG A  1 93  ? 10.180  14.640  23.159  1.00 0.00 ?  408 ARG A CZ   1  
ATOM   1513   N  NH1  . ARG A  1 93  ? 10.515  14.003  22.086  1.00 0.00 1  408 ARG A NH1  1  
ATOM   1514   N  NH2  . ARG A  1 93  ? 10.760  15.772  23.358  1.00 0.00 ?  408 ARG A NH2  1  
ATOM   1515   H  H    . ARG A  1 93  ? 5.020   13.051  26.196  1.00 0.00 ?  408 ARG A H    1  
ATOM   1516   H  HA   . ARG A  1 93  ? 6.945   12.446  28.104  1.00 0.00 ?  408 ARG A HA   1  
ATOM   1517   H  HB2  . ARG A  1 93  ? 6.479   15.189  26.873  1.00 0.00 ?  408 ARG A HB2  1  
ATOM   1518   H  HB3  . ARG A  1 93  ? 7.841   14.509  27.864  1.00 0.00 ?  408 ARG A HB3  1  
ATOM   1519   H  HG2  . ARG A  1 93  ? 8.501   12.944  26.119  1.00 0.00 ?  408 ARG A HG2  1  
ATOM   1520   H  HG3  . ARG A  1 93  ? 7.018   13.433  25.169  1.00 0.00 ?  408 ARG A HG3  1  
ATOM   1521   H  HD2  . ARG A  1 93  ? 7.896   15.636  24.679  1.00 0.00 ?  408 ARG A HD2  1  
ATOM   1522   H  HD3  . ARG A  1 93  ? 9.395   15.217  25.795  1.00 0.00 ?  408 ARG A HD3  1  
ATOM   1523   H  HE   . ARG A  1 93  ? 8.899   13.250  23.683  1.00 0.00 ?  408 ARG A HE   1  
ATOM   1524   H  HH11 . ARG A  1 93  ? 9.987   13.225  21.744  1.00 0.00 ?  408 ARG A HH11 1  
ATOM   1525   H  HH12 . ARG A  1 93  ? 11.167  14.468  21.489  1.00 0.00 ?  408 ARG A HH12 1  
ATOM   1526   H  HH21 . ARG A  1 93  ? 10.496  16.357  24.125  1.00 0.00 ?  408 ARG A HH21 1  
ATOM   1527   H  HH22 . ARG A  1 93  ? 11.640  16.018  22.952  1.00 0.00 ?  408 ARG A HH22 1  
ATOM   1528   N  N    . GLY A  1 94  ? 6.464   13.306  30.238  1.00 0.00 ?  409 GLY A N    1  
ATOM   1529   C  CA   . GLY A  1 94  ? 6.325   13.609  31.724  1.00 0.00 ?  409 GLY A CA   1  
ATOM   1530   C  C    . GLY A  1 94  ? 6.291   12.330  32.592  1.00 0.00 ?  409 GLY A C    1  
ATOM   1531   O  O    . GLY A  1 94  ? 6.484   12.388  33.768  1.00 0.00 ?  409 GLY A O    1  
ATOM   1532   H  H    . GLY A  1 94  ? 7.333   12.869  30.020  1.00 0.00 ?  409 GLY A H    1  
ATOM   1533   H  HA2  . GLY A  1 94  ? 6.972   14.386  32.103  1.00 0.00 ?  409 GLY A HA2  1  
ATOM   1534   H  HA3  . GLY A  1 94  ? 5.312   13.978  31.796  1.00 0.00 ?  409 GLY A HA3  1  
ATOM   1535   N  N    . LEU A  1 95  ? 6.074   11.162  31.976  1.00 0.00 ?  410 LEU A N    1  
ATOM   1536   C  CA   . LEU A  1 95  ? 5.938   9.838   32.727  1.00 0.00 ?  410 LEU A CA   1  
ATOM   1537   C  C    . LEU A  1 95  ? 7.249   9.171   33.099  1.00 0.00 ?  410 LEU A C    1  
ATOM   1538   O  O    . LEU A  1 95  ? 8.340   9.544   32.674  1.00 0.00 ?  410 LEU A O    1  
ATOM   1539   C  CB   . LEU A  1 95  ? 5.111   8.873   31.736  1.00 0.00 ?  410 LEU A CB   1  
ATOM   1540   C  CG   . LEU A  1 95  ? 3.630   9.264   31.580  1.00 0.00 ?  410 LEU A CG   1  
ATOM   1541   C  CD1  . LEU A  1 95  ? 2.867   8.201   30.847  1.00 0.00 ?  410 LEU A CD1  1  
ATOM   1542   C  CD2  . LEU A  1 95  ? 2.949   9.559   32.885  1.00 0.00 ?  410 LEU A CD2  1  
ATOM   1543   H  H    . LEU A  1 95  ? 5.785   11.167  31.022  1.00 0.00 ?  410 LEU A H    1  
ATOM   1544   H  HA   . LEU A  1 95  ? 5.506   10.000  33.704  1.00 0.00 ?  410 LEU A HA   1  
ATOM   1545   H  HB2  . LEU A  1 95  ? 5.624   8.886   30.750  1.00 0.00 ?  410 LEU A HB2  1  
ATOM   1546   H  HB3  . LEU A  1 95  ? 5.204   7.822   32.086  1.00 0.00 ?  410 LEU A HB3  1  
ATOM   1547   H  HG   . LEU A  1 95  ? 3.647   10.132  30.887  1.00 0.00 ?  410 LEU A HG   1  
ATOM   1548   H  HD11 . LEU A  1 95  ? 2.826   7.336   31.543  1.00 0.00 ?  410 LEU A HD11 1  
ATOM   1549   H  HD12 . LEU A  1 95  ? 3.360   7.921   29.892  1.00 0.00 ?  410 LEU A HD12 1  
ATOM   1550   H  HD13 . LEU A  1 95  ? 1.827   8.570   30.723  1.00 0.00 ?  410 LEU A HD13 1  
ATOM   1551   H  HD21 . LEU A  1 95  ? 1.841   9.573   32.806  1.00 0.00 ?  410 LEU A HD21 1  
ATOM   1552   H  HD22 . LEU A  1 95  ? 3.200   10.547  33.328  1.00 0.00 ?  410 LEU A HD22 1  
ATOM   1553   H  HD23 . LEU A  1 95  ? 3.127   8.723   33.595  1.00 0.00 ?  410 LEU A HD23 1  
ATOM   1554   N  N    . PRO A  1 96  ? 7.193   8.242   34.085  1.00 0.00 ?  411 PRO A N    1  
ATOM   1555   C  CA   . PRO A  1 96  ? 8.362   7.649   34.758  1.00 0.00 ?  411 PRO A CA   1  
ATOM   1556   C  C    . PRO A  1 96  ? 9.617   7.450   33.977  1.00 0.00 ?  411 PRO A C    1  
ATOM   1557   O  O    . PRO A  1 96  ? 9.589   6.824   32.894  1.00 0.00 ?  411 PRO A O    1  
ATOM   1558   C  CB   . PRO A  1 96  ? 7.885   6.376   35.410  1.00 0.00 ?  411 PRO A CB   1  
ATOM   1559   C  CG   . PRO A  1 96  ? 6.472   6.806   35.826  1.00 0.00 ?  411 PRO A CG   1  
ATOM   1560   C  CD   . PRO A  1 96  ? 5.978   7.762   34.720  1.00 0.00 ?  411 PRO A CD   1  
ATOM   1561   H  HA   . PRO A  1 96  ? 8.672   8.434   35.431  1.00 0.00 ?  411 PRO A HA   1  
ATOM   1562   H  HB2  . PRO A  1 96  ? 7.879   5.623   34.594  1.00 0.00 ?  411 PRO A HB2  1  
ATOM   1563   H  HB3  . PRO A  1 96  ? 8.465   6.075   36.308  1.00 0.00 ?  411 PRO A HB3  1  
ATOM   1564   H  HG2  . PRO A  1 96  ? 5.822   5.907   35.762  1.00 0.00 ?  411 PRO A HG2  1  
ATOM   1565   H  HG3  . PRO A  1 96  ? 6.396   7.417   36.751  1.00 0.00 ?  411 PRO A HG3  1  
ATOM   1566   H  HD2  . PRO A  1 96  ? 5.257   7.330   33.994  1.00 0.00 ?  411 PRO A HD2  1  
ATOM   1567   H  HD3  . PRO A  1 96  ? 5.430   8.629   35.148  1.00 0.00 ?  411 PRO A HD3  1  
ATOM   1568   N  N    . THR A  1 97  ? 10.707  7.835   34.622  1.00 0.00 ?  412 THR A N    1  
ATOM   1569   C  CA   . THR A  1 97  ? 12.067  7.856   34.038  1.00 0.00 ?  412 THR A CA   1  
ATOM   1570   C  C    . THR A  1 97  ? 12.688  6.499   33.681  1.00 0.00 ?  412 THR A C    1  
ATOM   1571   O  O    . THR A  1 97  ? 13.179  6.336   32.589  1.00 0.00 ?  412 THR A O    1  
ATOM   1572   C  CB   . THR A  1 97  ? 13.075  8.704   34.792  1.00 0.00 ?  412 THR A CB   1  
ATOM   1573   O  OG1  . THR A  1 97  ? 12.847  8.598   36.160  1.00 0.00 ?  412 THR A OG1  1  
ATOM   1574   C  CG2  . THR A  1 97  ? 13.033  10.110  34.262  1.00 0.00 ?  412 THR A CG2  1  
ATOM   1575   H  H    . THR A  1 97  ? 10.665  8.189   35.553  1.00 0.00 ?  412 THR A H    1  
ATOM   1576   H  HA   . THR A  1 97  ? 11.864  8.372   33.111  1.00 0.00 ?  412 THR A HA   1  
ATOM   1577   H  HB   . THR A  1 97  ? 14.088  8.266   34.663  1.00 0.00 ?  412 THR A HB   1  
ATOM   1578   H  HG1  . THR A  1 97  ? 12.138  9.238   36.258  1.00 0.00 ?  412 THR A HG1  1  
ATOM   1579   H  HG21 . THR A  1 97  ? 12.045  10.609  34.163  1.00 0.00 ?  412 THR A HG21 1  
ATOM   1580   H  HG22 . THR A  1 97  ? 13.563  10.159  33.287  1.00 0.00 ?  412 THR A HG22 1  
ATOM   1581   H  HG23 . THR A  1 97  ? 13.714  10.770  34.841  1.00 0.00 ?  412 THR A HG23 1  
ATOM   1582   N  N    . ASP A  1 98  ? 12.448  5.594   34.627  1.00 0.00 ?  413 ASP A N    1  
ATOM   1583   C  CA   . ASP A  1 98  ? 13.043  4.304   34.867  1.00 0.00 ?  413 ASP A CA   1  
ATOM   1584   C  C    . ASP A  1 98  ? 12.083  3.114   34.596  1.00 0.00 ?  413 ASP A C    1  
ATOM   1585   O  O    . ASP A  1 98  ? 12.308  2.430   33.572  1.00 0.00 ?  413 ASP A O    1  
ATOM   1586   C  CB   . ASP A  1 98  ? 13.716  4.264   36.278  1.00 0.00 ?  413 ASP A CB   1  
ATOM   1587   C  CG   . ASP A  1 98  ? 12.970  4.617   37.537  1.00 0.00 ?  413 ASP A CG   1  
ATOM   1588   O  OD1  . ASP A  1 98  ? 13.578  4.397   38.688  1.00 0.00 ?  413 ASP A OD1  1  
ATOM   1589   O  OD2  . ASP A  1 98  ? 11.853  5.208   37.588  1.00 0.00 -1 413 ASP A OD2  1  
ATOM   1590   H  H    . ASP A  1 98  ? 11.871  5.949   35.359  1.00 0.00 ?  413 ASP A H    1  
ATOM   1591   H  HA   . ASP A  1 98  ? 13.815  4.103   34.139  1.00 0.00 ?  413 ASP A HA   1  
ATOM   1592   H  HB2  . ASP A  1 98  ? 14.123  3.249   36.472  1.00 0.00 ?  413 ASP A HB2  1  
ATOM   1593   H  HB3  . ASP A  1 98  ? 14.566  4.978   36.304  1.00 0.00 ?  413 ASP A HB3  1  
ATOM   1594   N  N    . LYS A  1 99  ? 11.060  2.956   35.426  1.00 0.00 ?  414 LYS A N    1  
ATOM   1595   C  CA   . LYS A  1 99  ? 10.183  1.752   35.504  1.00 0.00 ?  414 LYS A CA   1  
ATOM   1596   C  C    . LYS A  1 99  ? 8.822   2.207   36.002  1.00 0.00 ?  414 LYS A C    1  
ATOM   1597   O  O    . LYS A  1 99  ? 8.662   3.299   36.505  1.00 0.00 ?  414 LYS A O    1  
ATOM   1598   C  CB   . LYS A  1 99  ? 10.692  0.484   36.239  1.00 0.00 ?  414 LYS A CB   1  
ATOM   1599   C  CG   . LYS A  1 99  ? 12.027  -0.061  35.695  1.00 0.00 ?  414 LYS A CG   1  
ATOM   1600   C  CD   . LYS A  1 99  ? 12.193  -1.475  36.195  1.00 0.00 ?  414 LYS A CD   1  
ATOM   1601   C  CE   . LYS A  1 99  ? 13.370  -2.171  35.609  1.00 0.00 ?  414 LYS A CE   1  
ATOM   1602   N  NZ   . LYS A  1 99  ? 14.661  -1.703  36.253  1.00 0.00 1  414 LYS A NZ   1  
ATOM   1603   H  H    . LYS A  1 99  ? 11.009  3.630   36.158  1.00 0.00 ?  414 LYS A H    1  
ATOM   1604   H  HA   . LYS A  1 99  ? 9.894   1.610   34.473  1.00 0.00 ?  414 LYS A HA   1  
ATOM   1605   H  HB2  . LYS A  1 99  ? 10.897  0.745   37.299  1.00 0.00 ?  414 LYS A HB2  1  
ATOM   1606   H  HB3  . LYS A  1 99  ? 9.953   -0.341  36.325  1.00 0.00 ?  414 LYS A HB3  1  
ATOM   1607   H  HG2  . LYS A  1 99  ? 11.960  -0.119  34.587  1.00 0.00 ?  414 LYS A HG2  1  
ATOM   1608   H  HG3  . LYS A  1 99  ? 12.954  0.522   35.883  1.00 0.00 ?  414 LYS A HG3  1  
ATOM   1609   H  HD2  . LYS A  1 99  ? 12.174  -1.585  37.300  1.00 0.00 ?  414 LYS A HD2  1  
ATOM   1610   H  HD3  . LYS A  1 99  ? 11.336  -2.024  35.748  1.00 0.00 ?  414 LYS A HD3  1  
ATOM   1611   H  HE2  . LYS A  1 99  ? 13.285  -3.273  35.724  1.00 0.00 ?  414 LYS A HE2  1  
ATOM   1612   H  HE3  . LYS A  1 99  ? 13.495  -2.008  34.518  1.00 0.00 ?  414 LYS A HE3  1  
ATOM   1613   H  HZ1  . LYS A  1 99  ? 14.638  -1.958  37.260  1.00 0.00 ?  414 LYS A HZ1  1  
ATOM   1614   H  HZ2  . LYS A  1 99  ? 14.814  -0.674  36.238  1.00 0.00 ?  414 LYS A HZ2  1  
ATOM   1615   H  HZ3  . LYS A  1 99  ? 15.473  -2.237  35.882  1.00 0.00 ?  414 LYS A HZ3  1  
ATOM   1616   N  N    . ILE A  1 100 ? 7.868   1.331   35.673  1.00 0.00 ?  415 ILE A N    1  
ATOM   1617   C  CA   . ILE A  1 100 ? 6.425   1.519   36.019  1.00 0.00 ?  415 ILE A CA   1  
ATOM   1618   C  C    . ILE A  1 100 ? 5.934   0.386   37.032  1.00 0.00 ?  415 ILE A C    1  
ATOM   1619   O  O    . ILE A  1 100 ? 6.050   -0.843  36.800  1.00 0.00 ?  415 ILE A O    1  
ATOM   1620   C  CB   . ILE A  1 100 ? 5.463   1.688   34.889  1.00 0.00 ?  415 ILE A CB   1  
ATOM   1621   C  CG1  . ILE A  1 100 ? 6.038   2.872   34.000  1.00 0.00 ?  415 ILE A CG1  1  
ATOM   1622   C  CG2  . ILE A  1 100 ? 4.047   1.974   35.461  1.00 0.00 ?  415 ILE A CG2  1  
ATOM   1623   C  CD1  . ILE A  1 100 ? 5.118   3.711   33.196  1.00 0.00 ?  415 ILE A CD1  1  
ATOM   1624   H  H    . ILE A  1 100 ? 8.011   0.437   35.256  1.00 0.00 ?  415 ILE A H    1  
ATOM   1625   H  HA   . ILE A  1 100 ? 6.389   2.458   36.552  1.00 0.00 ?  415 ILE A HA   1  
ATOM   1626   H  HB   . ILE A  1 100 ? 5.243   0.792   34.269  1.00 0.00 ?  415 ILE A HB   1  
ATOM   1627   H  HG12 . ILE A  1 100 ? 6.519   3.585   34.702  1.00 0.00 ?  415 ILE A HG12 1  
ATOM   1628   H  HG13 . ILE A  1 100 ? 6.907   2.432   33.466  1.00 0.00 ?  415 ILE A HG13 1  
ATOM   1629   H  HG21 . ILE A  1 100 ? 4.036   2.964   35.965  1.00 0.00 ?  415 ILE A HG21 1  
ATOM   1630   H  HG22 . ILE A  1 100 ? 3.673   1.126   36.074  1.00 0.00 ?  415 ILE A HG22 1  
ATOM   1631   H  HG23 . ILE A  1 100 ? 3.371   2.077   34.585  1.00 0.00 ?  415 ILE A HG23 1  
ATOM   1632   H  HD11 . ILE A  1 100 ? 5.557   4.124   32.263  1.00 0.00 ?  415 ILE A HD11 1  
ATOM   1633   H  HD12 . ILE A  1 100 ? 4.612   4.543   33.731  1.00 0.00 ?  415 ILE A HD12 1  
ATOM   1634   H  HD13 . ILE A  1 100 ? 4.246   3.079   32.923  1.00 0.00 ?  415 ILE A HD13 1  
ATOM   1635   N  N    . ASP A  1 101 ? 5.592   0.867   38.253  1.00 0.00 ?  416 ASP A N    1  
ATOM   1636   C  CA   . ASP A  1 101 ? 5.200   -0.018  39.332  1.00 0.00 ?  416 ASP A CA   1  
ATOM   1637   C  C    . ASP A  1 101 ? 3.824   -0.576  39.063  1.00 0.00 ?  416 ASP A C    1  
ATOM   1638   O  O    . ASP A  1 101 ? 3.509   -1.726  39.182  1.00 0.00 ?  416 ASP A O    1  
ATOM   1639   C  CB   . ASP A  1 101 ? 5.227   0.605   40.739  1.00 0.00 ?  416 ASP A CB   1  
ATOM   1640   C  CG   . ASP A  1 101 ? 6.614   0.758   41.148  1.00 0.00 ?  416 ASP A CG   1  
ATOM   1641   O  OD1  . ASP A  1 101 ? 7.532   0.142   40.550  1.00 0.00 ?  416 ASP A OD1  1  
ATOM   1642   O  OD2  . ASP A  1 101 ? 6.869   1.396   42.203  1.00 0.00 -1 416 ASP A OD2  1  
ATOM   1643   H  H    . ASP A  1 101 ? 5.670   1.838   38.466  1.00 0.00 ?  416 ASP A H    1  
ATOM   1644   H  HA   . ASP A  1 101 ? 5.861   -0.869  39.271  1.00 0.00 ?  416 ASP A HA   1  
ATOM   1645   H  HB2  . ASP A  1 101 ? 4.760   1.613   40.743  1.00 0.00 ?  416 ASP A HB2  1  
ATOM   1646   H  HB3  . ASP A  1 101 ? 4.752   -0.113  41.442  1.00 0.00 ?  416 ASP A HB3  1  
ATOM   1647   N  N    . ALA A  1 102 ? 2.859   0.295   38.679  1.00 0.00 ?  417 ALA A N    1  
ATOM   1648   C  CA   . ALA A  1 102 ? 1.556   -0.123  38.273  1.00 0.00 ?  417 ALA A CA   1  
ATOM   1649   C  C    . ALA A  1 102 ? 0.786   0.966   37.509  1.00 0.00 ?  417 ALA A C    1  
ATOM   1650   O  O    . ALA A  1 102 ? 1.254   2.078   37.231  1.00 0.00 ?  417 ALA A O    1  
ATOM   1651   C  CB   . ALA A  1 102 ? 0.722   -0.482  39.542  1.00 0.00 ?  417 ALA A CB   1  
ATOM   1652   H  H    . ALA A  1 102 ? 3.090   1.233   38.435  1.00 0.00 ?  417 ALA A H    1  
ATOM   1653   H  HA   . ALA A  1 102 ? 1.636   -0.961  37.597  1.00 0.00 ?  417 ALA A HA   1  
ATOM   1654   H  HB1  . ALA A  1 102 ? 0.994   0.294   40.289  1.00 0.00 ?  417 ALA A HB1  1  
ATOM   1655   H  HB2  . ALA A  1 102 ? 1.198   -1.380  39.990  1.00 0.00 ?  417 ALA A HB2  1  
ATOM   1656   H  HB3  . ALA A  1 102 ? -0.374  -0.546  39.368  1.00 0.00 ?  417 ALA A HB3  1  
ATOM   1657   N  N    . ALA A  1 103 ? -0.489  0.705   37.077  1.00 0.00 ?  418 ALA A N    1  
ATOM   1658   C  CA   . ALA A  1 103 ? -1.236  1.576   36.219  1.00 0.00 ?  418 ALA A CA   1  
ATOM   1659   C  C    . ALA A  1 103 ? -2.657  1.275   36.563  1.00 0.00 ?  418 ALA A C    1  
ATOM   1660   O  O    . ALA A  1 103 ? -2.907  0.215   37.228  1.00 0.00 ?  418 ALA A O    1  
ATOM   1661   C  CB   . ALA A  1 103 ? -1.103  1.345   34.741  1.00 0.00 ?  418 ALA A CB   1  
ATOM   1662   H  H    . ALA A  1 103 ? -1.062  -0.033  37.423  1.00 0.00 ?  418 ALA A H    1  
ATOM   1663   H  HA   . ALA A  1 103 ? -0.848  2.561   36.431  1.00 0.00 ?  418 ALA A HA   1  
ATOM   1664   H  HB1  . ALA A  1 103 ? -1.764  1.847   34.003  1.00 0.00 ?  418 ALA A HB1  1  
ATOM   1665   H  HB2  . ALA A  1 103 ? -1.170  0.255   34.542  1.00 0.00 ?  418 ALA A HB2  1  
ATOM   1666   H  HB3  . ALA A  1 103 ? -0.127  1.687   34.334  1.00 0.00 ?  418 ALA A HB3  1  
ATOM   1667   N  N    . LEU A  1 104 ? -3.629  2.163   36.244  1.00 0.00 ?  419 LEU A N    1  
ATOM   1668   C  CA   . LEU A  1 104 ? -4.965  1.967   36.838  1.00 0.00 ?  419 LEU A CA   1  
ATOM   1669   C  C    . LEU A  1 104 ? -5.747  2.876   35.878  1.00 0.00 ?  419 LEU A C    1  
ATOM   1670   O  O    . LEU A  1 104 ? -5.732  4.125   35.954  1.00 0.00 ?  419 LEU A O    1  
ATOM   1671   C  CB   . LEU A  1 104 ? -4.989  2.320   38.346  1.00 0.00 ?  419 LEU A CB   1  
ATOM   1672   C  CG   . LEU A  1 104 ? -6.420  2.665   38.879  1.00 0.00 ?  419 LEU A CG   1  
ATOM   1673   C  CD1  . LEU A  1 104 ? -7.555  1.563   38.673  1.00 0.00 ?  419 LEU A CD1  1  
ATOM   1674   C  CD2  . LEU A  1 104 ? -6.304  3.085   40.386  1.00 0.00 ?  419 LEU A CD2  1  
ATOM   1675   H  H    . LEU A  1 104 ? -3.382  3.001   35.763  1.00 0.00 ?  419 LEU A H    1  
ATOM   1676   H  HA   . LEU A  1 104 ? -5.172  0.910   36.756  1.00 0.00 ?  419 LEU A HA   1  
ATOM   1677   H  HB2  . LEU A  1 104 ? -4.605  1.389   38.817  1.00 0.00 ?  419 LEU A HB2  1  
ATOM   1678   H  HB3  . LEU A  1 104 ? -4.250  3.125   38.546  1.00 0.00 ?  419 LEU A HB3  1  
ATOM   1679   H  HG   . LEU A  1 104 ? -6.774  3.608   38.410  1.00 0.00 ?  419 LEU A HG   1  
ATOM   1680   H  HD11 . LEU A  1 104 ? -7.473  1.124   37.656  1.00 0.00 ?  419 LEU A HD11 1  
ATOM   1681   H  HD12 . LEU A  1 104 ? -8.569  2.015   38.626  1.00 0.00 ?  419 LEU A HD12 1  
ATOM   1682   H  HD13 . LEU A  1 104 ? -7.350  0.749   39.400  1.00 0.00 ?  419 LEU A HD13 1  
ATOM   1683   H  HD21 . LEU A  1 104 ? -5.416  3.730   40.559  1.00 0.00 ?  419 LEU A HD21 1  
ATOM   1684   H  HD22 . LEU A  1 104 ? -6.195  2.184   41.026  1.00 0.00 ?  419 LEU A HD22 1  
ATOM   1685   H  HD23 . LEU A  1 104 ? -7.245  3.641   40.587  1.00 0.00 ?  419 LEU A HD23 1  
ATOM   1686   N  N    . PHE A  1 105 ? -6.386  2.287   34.867  1.00 0.00 ?  420 PHE A N    1  
ATOM   1687   C  CA   . PHE A  1 105 ? -7.392  3.036   34.154  1.00 0.00 ?  420 PHE A CA   1  
ATOM   1688   C  C    . PHE A  1 105 ? -8.634  3.377   34.977  1.00 0.00 ?  420 PHE A C    1  
ATOM   1689   O  O    . PHE A  1 105 ? -9.295  2.494   35.555  1.00 0.00 ?  420 PHE A O    1  
ATOM   1690   C  CB   . PHE A  1 105 ? -7.789  2.222   32.902  1.00 0.00 ?  420 PHE A CB   1  
ATOM   1691   C  CG   . PHE A  1 105 ? -8.937  2.859   32.111  1.00 0.00 ?  420 PHE A CG   1  
ATOM   1692   C  CD1  . PHE A  1 105 ? -8.605  3.736   31.013  1.00 0.00 ?  420 PHE A CD1  1  
ATOM   1693   C  CD2  . PHE A  1 105 ? -10.284 2.419   32.245  1.00 0.00 ?  420 PHE A CD2  1  
ATOM   1694   C  CE1  . PHE A  1 105 ? -9.641  4.232   30.230  1.00 0.00 ?  420 PHE A CE1  1  
ATOM   1695   C  CE2  . PHE A  1 105 ? -11.234 2.806   31.354  1.00 0.00 ?  420 PHE A CE2  1  
ATOM   1696   C  CZ   . PHE A  1 105 ? -10.947 3.741   30.393  1.00 0.00 ?  420 PHE A CZ   1  
ATOM   1697   H  H    . PHE A  1 105 ? -6.250  1.336   34.603  1.00 0.00 ?  420 PHE A H    1  
ATOM   1698   H  HA   . PHE A  1 105 ? -6.921  3.895   33.700  1.00 0.00 ?  420 PHE A HA   1  
ATOM   1699   H  HB2  . PHE A  1 105 ? -6.906  2.092   32.241  1.00 0.00 ?  420 PHE A HB2  1  
ATOM   1700   H  HB3  . PHE A  1 105 ? -8.158  1.212   33.184  1.00 0.00 ?  420 PHE A HB3  1  
ATOM   1701   H  HD1  . PHE A  1 105 ? -7.603  4.110   30.860  1.00 0.00 ?  420 PHE A HD1  1  
ATOM   1702   H  HD2  . PHE A  1 105 ? -10.621 1.732   33.007  1.00 0.00 ?  420 PHE A HD2  1  
ATOM   1703   H  HE1  . PHE A  1 105 ? -9.385  5.088   29.623  1.00 0.00 ?  420 PHE A HE1  1  
ATOM   1704   H  HE2  . PHE A  1 105 ? -12.280 2.551   31.446  1.00 0.00 ?  420 PHE A HE2  1  
ATOM   1705   H  HZ   . PHE A  1 105 ? -11.748 4.118   29.774  1.00 0.00 ?  420 PHE A HZ   1  
ATOM   1706   N  N    . TRP A  1 106 ? -9.035  4.659   35.011  1.00 0.00 ?  421 TRP A N    1  
ATOM   1707   C  CA   . TRP A  1 106 ? -10.115 5.035   35.944  1.00 0.00 ?  421 TRP A CA   1  
ATOM   1708   C  C    . TRP A  1 106 ? -11.501 5.308   35.267  1.00 0.00 ?  421 TRP A C    1  
ATOM   1709   O  O    . TRP A  1 106 ? -11.642 6.185   34.386  1.00 0.00 ?  421 TRP A O    1  
ATOM   1710   C  CB   . TRP A  1 106 ? -9.725  6.418   36.617  1.00 0.00 ?  421 TRP A CB   1  
ATOM   1711   C  CG   . TRP A  1 106 ? -10.581 6.917   37.752  1.00 0.00 ?  421 TRP A CG   1  
ATOM   1712   C  CD1  . TRP A  1 106 ? -11.328 8.016   37.929  1.00 0.00 ?  421 TRP A CD1  1  
ATOM   1713   C  CD2  . TRP A  1 106 ? -10.577 6.248   39.026  1.00 0.00 ?  421 TRP A CD2  1  
ATOM   1714   N  NE1  . TRP A  1 106 ? -11.901 8.004   39.216  1.00 0.00 ?  421 TRP A NE1  1  
ATOM   1715   C  CE2  . TRP A  1 106 ? -11.528 6.872   39.838  1.00 0.00 ?  421 TRP A CE2  1  
ATOM   1716   C  CE3  . TRP A  1 106 ? -10.001 5.087   39.421  1.00 0.00 ?  421 TRP A CE3  1  
ATOM   1717   C  CZ2  . TRP A  1 106 ? -11.856 6.404   41.107  1.00 0.00 ?  421 TRP A CZ2  1  
ATOM   1718   C  CZ3  . TRP A  1 106 ? -10.256 4.632   40.726  1.00 0.00 ?  421 TRP A CZ3  1  
ATOM   1719   C  CH2  . TRP A  1 106 ? -11.136 5.277   41.545  1.00 0.00 ?  421 TRP A CH2  1  
ATOM   1720   H  H    . TRP A  1 106 ? -8.794  5.345   34.329  1.00 0.00 ?  421 TRP A H    1  
ATOM   1721   H  HA   . TRP A  1 106 ? -10.326 4.333   36.737  1.00 0.00 ?  421 TRP A HA   1  
ATOM   1722   H  HB2  . TRP A  1 106 ? -8.646  6.269   36.840  1.00 0.00 ?  421 TRP A HB2  1  
ATOM   1723   H  HB3  . TRP A  1 106 ? -9.757  7.120   35.757  1.00 0.00 ?  421 TRP A HB3  1  
ATOM   1724   H  HD1  . TRP A  1 106 ? -11.650 8.675   37.137  1.00 0.00 ?  421 TRP A HD1  1  
ATOM   1725   H  HE1  . TRP A  1 106 ? -12.338 8.694   39.749  1.00 0.00 ?  421 TRP A HE1  1  
ATOM   1726   H  HE3  . TRP A  1 106 ? -9.277  4.489   38.887  1.00 0.00 ?  421 TRP A HE3  1  
ATOM   1727   H  HZ2  . TRP A  1 106 ? -12.646 6.883   41.666  1.00 0.00 ?  421 TRP A HZ2  1  
ATOM   1728   H  HZ3  . TRP A  1 106 ? -9.754  3.745   41.083  1.00 0.00 ?  421 TRP A HZ3  1  
ATOM   1729   H  HH2  . TRP A  1 106 ? -11.359 4.880   42.524  1.00 0.00 ?  421 TRP A HH2  1  
ATOM   1730   N  N    . MET A  1 107 ? -12.489 4.456   35.519  1.00 0.00 ?  422 MET A N    1  
ATOM   1731   C  CA   . MET A  1 107 ? -13.776 4.552   34.870  1.00 0.00 ?  422 MET A CA   1  
ATOM   1732   C  C    . MET A  1 107 ? -14.489 5.886   34.838  1.00 0.00 ?  422 MET A C    1  
ATOM   1733   O  O    . MET A  1 107 ? -14.871 6.138   33.685  1.00 0.00 ?  422 MET A O    1  
ATOM   1734   C  CB   . MET A  1 107 ? -14.726 3.418   35.309  1.00 0.00 ?  422 MET A CB   1  
ATOM   1735   C  CG   . MET A  1 107 ? -14.524 1.984   34.649  1.00 0.00 ?  422 MET A CG   1  
ATOM   1736   S  SD   . MET A  1 107 ? -13.011 1.058   35.035  1.00 0.00 ?  422 MET A SD   1  
ATOM   1737   C  CE   . MET A  1 107 ? -13.151 0.063   33.514  1.00 0.00 ?  422 MET A CE   1  
ATOM   1738   H  H    . MET A  1 107 ? -12.323 3.591   35.987  1.00 0.00 ?  422 MET A H    1  
ATOM   1739   H  HA   . MET A  1 107 ? -13.579 4.344   33.829  1.00 0.00 ?  422 MET A HA   1  
ATOM   1740   H  HB2  . MET A  1 107 ? -14.808 3.261   36.405  1.00 0.00 ?  422 MET A HB2  1  
ATOM   1741   H  HB3  . MET A  1 107 ? -15.765 3.751   35.101  1.00 0.00 ?  422 MET A HB3  1  
ATOM   1742   H  HG2  . MET A  1 107 ? -15.413 1.346   34.843  1.00 0.00 ?  422 MET A HG2  1  
ATOM   1743   H  HG3  . MET A  1 107 ? -14.680 2.095   33.555  1.00 0.00 ?  422 MET A HG3  1  
ATOM   1744   H  HE1  . MET A  1 107 ? -12.232 -0.542  33.362  1.00 0.00 ?  422 MET A HE1  1  
ATOM   1745   H  HE2  . MET A  1 107 ? -13.230 0.803   32.689  1.00 0.00 ?  422 MET A HE2  1  
ATOM   1746   H  HE3  . MET A  1 107 ? -14.054 -0.580  33.590  1.00 0.00 ?  422 MET A HE3  1  
ATOM   1747   N  N    . PRO A  1 108 ? -14.758 6.699   35.931  1.00 0.00 ?  423 PRO A N    1  
ATOM   1748   C  CA   . PRO A  1 108 ? -15.520 7.935   35.920  1.00 0.00 ?  423 PRO A CA   1  
ATOM   1749   C  C    . PRO A  1 108 ? -15.240 8.877   34.769  1.00 0.00 ?  423 PRO A C    1  
ATOM   1750   O  O    . PRO A  1 108 ? -16.183 9.523   34.267  1.00 0.00 ?  423 PRO A O    1  
ATOM   1751   C  CB   . PRO A  1 108 ? -15.275 8.585   37.243  1.00 0.00 ?  423 PRO A CB   1  
ATOM   1752   C  CG   . PRO A  1 108 ? -15.033 7.314   38.204  1.00 0.00 ?  423 PRO A CG   1  
ATOM   1753   C  CD   . PRO A  1 108 ? -14.379 6.292   37.224  1.00 0.00 ?  423 PRO A CD   1  
ATOM   1754   H  HA   . PRO A  1 108 ? -16.557 7.633   35.891  1.00 0.00 ?  423 PRO A HA   1  
ATOM   1755   H  HB2  . PRO A  1 108 ? -14.343 9.165   37.071  1.00 0.00 ?  423 PRO A HB2  1  
ATOM   1756   H  HB3  . PRO A  1 108 ? -16.131 9.162   37.654  1.00 0.00 ?  423 PRO A HB3  1  
ATOM   1757   H  HG2  . PRO A  1 108 ? -14.480 7.635   39.113  1.00 0.00 ?  423 PRO A HG2  1  
ATOM   1758   H  HG3  . PRO A  1 108 ? -16.009 6.881   38.510  1.00 0.00 ?  423 PRO A HG3  1  
ATOM   1759   H  HD2  . PRO A  1 108 ? -13.294 6.259   37.460  1.00 0.00 ?  423 PRO A HD2  1  
ATOM   1760   H  HD3  . PRO A  1 108 ? -14.726 5.265   37.467  1.00 0.00 ?  423 PRO A HD3  1  
ATOM   1761   N  N    . ASN A  1 109 ? -13.918 9.186   34.516  1.00 0.00 ?  424 ASN A N    1  
ATOM   1762   C  CA   . ASN A  1 109 ? -13.450 10.185  33.622  1.00 0.00 ?  424 ASN A CA   1  
ATOM   1763   C  C    . ASN A  1 109 ? -12.654 9.591   32.438  1.00 0.00 ?  424 ASN A C    1  
ATOM   1764   O  O    . ASN A  1 109 ? -12.434 10.448  31.553  1.00 0.00 ?  424 ASN A O    1  
ATOM   1765   C  CB   . ASN A  1 109 ? -12.755 11.268  34.401  1.00 0.00 ?  424 ASN A CB   1  
ATOM   1766   C  CG   . ASN A  1 109 ? -11.485 10.775  35.115  1.00 0.00 ?  424 ASN A CG   1  
ATOM   1767   O  OD1  . ASN A  1 109 ? -10.868 9.782   34.734  1.00 0.00 ?  424 ASN A OD1  1  
ATOM   1768   N  ND2  . ASN A  1 109 ? -11.101 11.535  36.231  1.00 0.00 ?  424 ASN A ND2  1  
ATOM   1769   H  H    . ASN A  1 109 ? -13.236 8.545   34.860  1.00 0.00 ?  424 ASN A H    1  
ATOM   1770   H  HA   . ASN A  1 109 ? -14.238 10.747  33.143  1.00 0.00 ?  424 ASN A HA   1  
ATOM   1771   H  HB2  . ASN A  1 109 ? -12.394 12.102  33.761  1.00 0.00 ?  424 ASN A HB2  1  
ATOM   1772   H  HB3  . ASN A  1 109 ? -13.341 11.798  35.182  1.00 0.00 ?  424 ASN A HB3  1  
ATOM   1773   H  HD21 . ASN A  1 109 ? -10.214 11.365  36.660  1.00 0.00 ?  424 ASN A HD21 1  
ATOM   1774   H  HD22 . ASN A  1 109 ? -11.615 12.305  36.609  1.00 0.00 ?  424 ASN A HD22 1  
ATOM   1775   N  N    . GLY A  1 110 ? -12.396 8.297   32.338  1.00 0.00 ?  425 GLY A N    1  
ATOM   1776   C  CA   . GLY A  1 110 ? -11.500 7.681   31.346  1.00 0.00 ?  425 GLY A CA   1  
ATOM   1777   C  C    . GLY A  1 110 ? -10.078 8.143   31.273  1.00 0.00 ?  425 GLY A C    1  
ATOM   1778   O  O    . GLY A  1 110 ? -9.375  7.858   30.290  1.00 0.00 ?  425 GLY A O    1  
ATOM   1779   H  H    . GLY A  1 110 ? -12.765 7.726   33.067  1.00 0.00 ?  425 GLY A H    1  
ATOM   1780   H  HA2  . GLY A  1 110 ? -11.462 6.625   31.569  1.00 0.00 ?  425 GLY A HA2  1  
ATOM   1781   H  HA3  . GLY A  1 110 ? -11.947 7.921   30.393  1.00 0.00 ?  425 GLY A HA3  1  
ATOM   1782   N  N    . LYS A  1 111 ? -9.498  8.724   32.348  1.00 0.00 ?  426 LYS A N    1  
ATOM   1783   C  CA   . LYS A  1 111 ? -8.069  8.979   32.390  1.00 0.00 ?  426 LYS A CA   1  
ATOM   1784   C  C    . LYS A  1 111 ? -7.395  7.797   33.028  1.00 0.00 ?  426 LYS A C    1  
ATOM   1785   O  O    . LYS A  1 111 ? -7.967  6.935   33.629  1.00 0.00 ?  426 LYS A O    1  
ATOM   1786   C  CB   . LYS A  1 111 ? -7.728  10.332  33.099  1.00 0.00 ?  426 LYS A CB   1  
ATOM   1787   C  CG   . LYS A  1 111 ? -8.438  11.446  32.365  1.00 0.00 ?  426 LYS A CG   1  
ATOM   1788   C  CD   . LYS A  1 111 ? -7.796  12.725  32.916  1.00 0.00 ?  426 LYS A CD   1  
ATOM   1789   C  CE   . LYS A  1 111 ? -8.390  14.050  32.369  1.00 0.00 ?  426 LYS A CE   1  
ATOM   1790   N  NZ   . LYS A  1 111 ? -7.810  15.164  33.117  1.00 0.00 1  426 LYS A NZ   1  
ATOM   1791   H  H    . LYS A  1 111 ? -10.000 8.823   33.204  1.00 0.00 ?  426 LYS A H    1  
ATOM   1792   H  HA   . LYS A  1 111 ? -7.625  9.124   31.416  1.00 0.00 ?  426 LYS A HA   1  
ATOM   1793   H  HB2  . LYS A  1 111 ? -8.081  10.402  34.150  1.00 0.00 ?  426 LYS A HB2  1  
ATOM   1794   H  HB3  . LYS A  1 111 ? -6.627  10.407  33.227  1.00 0.00 ?  426 LYS A HB3  1  
ATOM   1795   H  HG2  . LYS A  1 111 ? -7.978  11.401  31.355  1.00 0.00 ?  426 LYS A HG2  1  
ATOM   1796   H  HG3  . LYS A  1 111 ? -9.548  11.399  32.356  1.00 0.00 ?  426 LYS A HG3  1  
ATOM   1797   H  HD2  . LYS A  1 111 ? -7.962  12.760  34.014  1.00 0.00 ?  426 LYS A HD2  1  
ATOM   1798   H  HD3  . LYS A  1 111 ? -6.703  12.756  32.719  1.00 0.00 ?  426 LYS A HD3  1  
ATOM   1799   H  HE2  . LYS A  1 111 ? -8.174  14.120  31.281  1.00 0.00 ?  426 LYS A HE2  1  
ATOM   1800   H  HE3  . LYS A  1 111 ? -9.491  14.073  32.516  1.00 0.00 ?  426 LYS A HE3  1  
ATOM   1801   H  HZ1  . LYS A  1 111 ? -6.780  15.103  33.243  1.00 0.00 ?  426 LYS A HZ1  1  
ATOM   1802   H  HZ2  . LYS A  1 111 ? -8.165  15.262  34.090  1.00 0.00 ?  426 LYS A HZ2  1  
ATOM   1803   H  HZ3  . LYS A  1 111 ? -7.886  16.052  32.581  1.00 0.00 ?  426 LYS A HZ3  1  
ATOM   1804   N  N    . THR A  1 112 ? -6.089  7.793   32.927  1.00 0.00 ?  427 THR A N    1  
ATOM   1805   C  CA   . THR A  1 112 ? -5.212  6.647   33.391  1.00 0.00 ?  427 THR A CA   1  
ATOM   1806   C  C    . THR A  1 112 ? -4.332  7.155   34.539  1.00 0.00 ?  427 THR A C    1  
ATOM   1807   O  O    . THR A  1 112 ? -3.696  8.238   34.537  1.00 0.00 ?  427 THR A O    1  
ATOM   1808   C  CB   . THR A  1 112 ? -4.273  6.215   32.310  1.00 0.00 ?  427 THR A CB   1  
ATOM   1809   O  OG1  . THR A  1 112 ? -4.990  5.486   31.280  1.00 0.00 ?  427 THR A OG1  1  
ATOM   1810   C  CG2  . THR A  1 112 ? -3.306  5.140   32.780  1.00 0.00 ?  427 THR A CG2  1  
ATOM   1811   H  H    . THR A  1 112 ? -5.663  8.666   32.705  1.00 0.00 ?  427 THR A H    1  
ATOM   1812   H  HA   . THR A  1 112 ? -5.782  5.832   33.813  1.00 0.00 ?  427 THR A HA   1  
ATOM   1813   H  HB   . THR A  1 112 ? -3.795  7.116   31.871  1.00 0.00 ?  427 THR A HB   1  
ATOM   1814   H  HG1  . THR A  1 112 ? -4.393  5.401   30.533  1.00 0.00 ?  427 THR A HG1  1  
ATOM   1815   H  HG21 . THR A  1 112 ? -3.813  4.453   33.490  1.00 0.00 ?  427 THR A HG21 1  
ATOM   1816   H  HG22 . THR A  1 112 ? -2.378  5.643   33.128  1.00 0.00 ?  427 THR A HG22 1  
ATOM   1817   H  HG23 . THR A  1 112 ? -2.923  4.449   31.999  1.00 0.00 ?  427 THR A HG23 1  
ATOM   1818   N  N    . TYR A  1 113 ? -4.150  6.296   35.541  1.00 0.00 ?  428 TYR A N    1  
ATOM   1819   C  CA   . TYR A  1 113 ? -3.163  6.553   36.647  1.00 0.00 ?  428 TYR A CA   1  
ATOM   1820   C  C    . TYR A  1 113 ? -1.890  5.740   36.522  1.00 0.00 ?  428 TYR A C    1  
ATOM   1821   O  O    . TYR A  1 113 ? -1.976  4.583   36.079  1.00 0.00 ?  428 TYR A O    1  
ATOM   1822   C  CB   . TYR A  1 113 ? -3.780  6.135   38.105  1.00 0.00 ?  428 TYR A CB   1  
ATOM   1823   C  CG   . TYR A  1 113 ? -4.819  7.126   38.466  1.00 0.00 ?  428 TYR A CG   1  
ATOM   1824   C  CD1  . TYR A  1 113 ? -4.518  8.477   38.525  1.00 0.00 ?  428 TYR A CD1  1  
ATOM   1825   C  CD2  . TYR A  1 113 ? -6.085  6.714   38.815  1.00 0.00 ?  428 TYR A CD2  1  
ATOM   1826   C  CE1  . TYR A  1 113 ? -5.398  9.444   38.964  1.00 0.00 ?  428 TYR A CE1  1  
ATOM   1827   C  CE2  . TYR A  1 113 ? -7.016  7.653   39.351  1.00 0.00 ?  428 TYR A CE2  1  
ATOM   1828   C  CZ   . TYR A  1 113 ? -6.679  9.008   39.373  1.00 0.00 ?  428 TYR A CZ   1  
ATOM   1829   O  OH   . TYR A  1 113 ? -7.607  10.020  39.810  1.00 0.00 ?  428 TYR A OH   1  
ATOM   1830   H  H    . TYR A  1 113 ? -4.563  5.402   35.700  1.00 0.00 ?  428 TYR A H    1  
ATOM   1831   H  HA   . TYR A  1 113 ? -2.838  7.581   36.718  1.00 0.00 ?  428 TYR A HA   1  
ATOM   1832   H  HB2  . TYR A  1 113 ? -4.230  5.147   37.871  1.00 0.00 ?  428 TYR A HB2  1  
ATOM   1833   H  HB3  . TYR A  1 113 ? -2.975  6.158   38.871  1.00 0.00 ?  428 TYR A HB3  1  
ATOM   1834   H  HD1  . TYR A  1 113 ? -3.489  8.739   38.330  1.00 0.00 ?  428 TYR A HD1  1  
ATOM   1835   H  HD2  . TYR A  1 113 ? -6.395  5.682   38.754  1.00 0.00 ?  428 TYR A HD2  1  
ATOM   1836   H  HE1  . TYR A  1 113 ? -5.155  10.471  39.192  1.00 0.00 ?  428 TYR A HE1  1  
ATOM   1837   H  HE2  . TYR A  1 113 ? -8.012  7.370   39.662  1.00 0.00 ?  428 TYR A HE2  1  
ATOM   1838   H  HH   . TYR A  1 113 ? -8.267  9.567   40.341  1.00 0.00 ?  428 TYR A HH   1  
ATOM   1839   N  N    . PHE A  1 114 ? -0.773  6.305   36.841  1.00 0.00 ?  429 PHE A N    1  
ATOM   1840   C  CA   . PHE A  1 114 ? 0.560   5.644   36.840  1.00 0.00 ?  429 PHE A CA   1  
ATOM   1841   C  C    . PHE A  1 114 ? 1.231   5.608   38.242  1.00 0.00 ?  429 PHE A C    1  
ATOM   1842   O  O    . PHE A  1 114 ? 1.440   6.629   38.843  1.00 0.00 ?  429 PHE A O    1  
ATOM   1843   C  CB   . PHE A  1 114 ? 1.521   6.241   35.800  1.00 0.00 ?  429 PHE A CB   1  
ATOM   1844   C  CG   . PHE A  1 114 ? 1.126   5.774   34.308  1.00 0.00 ?  429 PHE A CG   1  
ATOM   1845   C  CD1  . PHE A  1 114 ? 1.052   4.419   33.905  1.00 0.00 ?  429 PHE A CD1  1  
ATOM   1846   C  CD2  . PHE A  1 114 ? 0.593   6.722   33.396  1.00 0.00 ?  429 PHE A CD2  1  
ATOM   1847   C  CE1  . PHE A  1 114 ? 0.597   4.005   32.690  1.00 0.00 ?  429 PHE A CE1  1  
ATOM   1848   C  CE2  . PHE A  1 114 ? 0.124   6.361   32.116  1.00 0.00 ?  429 PHE A CE2  1  
ATOM   1849   C  CZ   . PHE A  1 114 ? 0.104   5.019   31.753  1.00 0.00 ?  429 PHE A CZ   1  
ATOM   1850   H  H    . PHE A  1 114 ? -0.831  7.278   37.051  1.00 0.00 ?  429 PHE A H    1  
ATOM   1851   H  HA   . PHE A  1 114 ? 0.361   4.617   36.573  1.00 0.00 ?  429 PHE A HA   1  
ATOM   1852   H  HB2  . PHE A  1 114 ? 1.655   7.340   35.894  1.00 0.00 ?  429 PHE A HB2  1  
ATOM   1853   H  HB3  . PHE A  1 114 ? 2.513   5.761   35.940  1.00 0.00 ?  429 PHE A HB3  1  
ATOM   1854   H  HD1  . PHE A  1 114 ? 1.400   3.628   34.554  1.00 0.00 ?  429 PHE A HD1  1  
ATOM   1855   H  HD2  . PHE A  1 114 ? 0.689   7.789   33.532  1.00 0.00 ?  429 PHE A HD2  1  
ATOM   1856   H  HE1  . PHE A  1 114 ? 0.677   2.950   32.472  1.00 0.00 ?  429 PHE A HE1  1  
ATOM   1857   H  HE2  . PHE A  1 114 ? -0.291  7.076   31.422  1.00 0.00 ?  429 PHE A HE2  1  
ATOM   1858   H  HZ   . PHE A  1 114 ? -0.214  4.633   30.796  1.00 0.00 ?  429 PHE A HZ   1  
ATOM   1859   N  N    . PHE A  1 115 ? 1.643   4.432   38.765  1.00 0.00 ?  430 PHE A N    1  
ATOM   1860   C  CA   . PHE A  1 115 ? 2.422   4.385   40.012  1.00 0.00 ?  430 PHE A CA   1  
ATOM   1861   C  C    . PHE A  1 115 ? 3.932   4.114   39.824  1.00 0.00 ?  430 PHE A C    1  
ATOM   1862   O  O    . PHE A  1 115 ? 4.409   3.422   38.948  1.00 0.00 ?  430 PHE A O    1  
ATOM   1863   C  CB   . PHE A  1 115 ? 1.773   3.414   40.960  1.00 0.00 ?  430 PHE A CB   1  
ATOM   1864   C  CG   . PHE A  1 115 ? 0.332   3.753   41.206  1.00 0.00 ?  430 PHE A CG   1  
ATOM   1865   C  CD1  . PHE A  1 115 ? -0.101  4.646   42.140  1.00 0.00 ?  430 PHE A CD1  1  
ATOM   1866   C  CD2  . PHE A  1 115 ? -0.568  3.029   40.452  1.00 0.00 ?  430 PHE A CD2  1  
ATOM   1867   C  CE1  . PHE A  1 115 ? -1.485  4.939   42.252  1.00 0.00 ?  430 PHE A CE1  1  
ATOM   1868   C  CE2  . PHE A  1 115 ? -1.952  3.284   40.507  1.00 0.00 ?  430 PHE A CE2  1  
ATOM   1869   C  CZ   . PHE A  1 115 ? -2.375  4.329   41.369  1.00 0.00 ?  430 PHE A CZ   1  
ATOM   1870   H  H    . PHE A  1 115 ? 1.467   3.500   38.458  1.00 0.00 ?  430 PHE A H    1  
ATOM   1871   H  HA   . PHE A  1 115 ? 2.328   5.387   40.403  1.00 0.00 ?  430 PHE A HA   1  
ATOM   1872   H  HB2  . PHE A  1 115 ? 1.799   2.332   40.711  1.00 0.00 ?  430 PHE A HB2  1  
ATOM   1873   H  HB3  . PHE A  1 115 ? 2.269   3.436   41.954  1.00 0.00 ?  430 PHE A HB3  1  
ATOM   1874   H  HD1  . PHE A  1 115 ? 0.636   5.225   42.677  1.00 0.00 ?  430 PHE A HD1  1  
ATOM   1875   H  HD2  . PHE A  1 115 ? -0.161  2.275   39.795  1.00 0.00 ?  430 PHE A HD2  1  
ATOM   1876   H  HE1  . PHE A  1 115 ? -1.867  5.645   42.975  1.00 0.00 ?  430 PHE A HE1  1  
ATOM   1877   H  HE2  . PHE A  1 115 ? -2.565  2.688   39.846  1.00 0.00 ?  430 PHE A HE2  1  
ATOM   1878   H  HZ   . PHE A  1 115 ? -3.401  4.666   41.393  1.00 0.00 ?  430 PHE A HZ   1  
ATOM   1879   N  N    . ARG A  1 116 ? 4.795   4.833   40.550  1.00 0.00 ?  431 ARG A N    1  
ATOM   1880   C  CA   . ARG A  1 116 ? 6.191   4.456   40.685  1.00 0.00 ?  431 ARG A CA   1  
ATOM   1881   C  C    . ARG A  1 116 ? 6.581   4.948   42.080  1.00 0.00 ?  431 ARG A C    1  
ATOM   1882   O  O    . ARG A  1 116 ? 6.585   6.124   42.284  1.00 0.00 ?  431 ARG A O    1  
ATOM   1883   C  CB   . ARG A  1 116 ? 7.036   5.109   39.572  1.00 0.00 ?  431 ARG A CB   1  
ATOM   1884   C  CG   . ARG A  1 116 ? 8.532   4.694   39.649  1.00 0.00 ?  431 ARG A CG   1  
ATOM   1885   C  CD   . ARG A  1 116 ? 8.739   3.169   39.770  1.00 0.00 ?  431 ARG A CD   1  
ATOM   1886   N  NE   . ARG A  1 116 ? 10.191  2.982   39.467  1.00 0.00 ?  431 ARG A NE   1  
ATOM   1887   C  CZ   . ARG A  1 116 ? 10.945  1.976   39.586  1.00 0.00 ?  431 ARG A CZ   1  
ATOM   1888   N  NH1  . ARG A  1 116 ? 12.231  2.168   39.318  1.00 0.00 1  431 ARG A NH1  1  
ATOM   1889   N  NH2  . ARG A  1 116 ? 10.583  0.741   39.896  1.00 0.00 ?  431 ARG A NH2  1  
ATOM   1890   H  H    . ARG A  1 116 ? 4.444   5.563   41.130  1.00 0.00 ?  431 ARG A H    1  
ATOM   1891   H  HA   . ARG A  1 116 ? 6.254   3.384   40.798  1.00 0.00 ?  431 ARG A HA   1  
ATOM   1892   H  HB2  . ARG A  1 116 ? 6.741   4.690   38.586  1.00 0.00 ?  431 ARG A HB2  1  
ATOM   1893   H  HB3  . ARG A  1 116 ? 6.913   6.211   39.498  1.00 0.00 ?  431 ARG A HB3  1  
ATOM   1894   H  HG2  . ARG A  1 116 ? 8.911   5.012   38.655  1.00 0.00 ?  431 ARG A HG2  1  
ATOM   1895   H  HG3  . ARG A  1 116 ? 8.925   5.299   40.494  1.00 0.00 ?  431 ARG A HG3  1  
ATOM   1896   H  HD2  . ARG A  1 116 ? 8.562   2.841   40.817  1.00 0.00 ?  431 ARG A HD2  1  
ATOM   1897   H  HD3  . ARG A  1 116 ? 8.167   2.448   39.147  1.00 0.00 ?  431 ARG A HD3  1  
ATOM   1898   H  HE   . ARG A  1 116 ? 10.735  3.805   39.306  1.00 0.00 ?  431 ARG A HE   1  
ATOM   1899   H  HH11 . ARG A  1 116 ? 12.462  3.097   39.028  1.00 0.00 ?  431 ARG A HH11 1  
ATOM   1900   H  HH12 . ARG A  1 116 ? 12.838  1.433   39.018  1.00 0.00 ?  431 ARG A HH12 1  
ATOM   1901   H  HH21 . ARG A  1 116 ? 9.727   0.526   40.366  1.00 0.00 ?  431 ARG A HH21 1  
ATOM   1902   H  HH22 . ARG A  1 116 ? 11.393  0.185   40.079  1.00 0.00 ?  431 ARG A HH22 1  
ATOM   1903   N  N    . GLY A  1 117 ? 6.831   3.944   43.005  1.00 0.00 ?  432 GLY A N    1  
ATOM   1904   C  CA   . GLY A  1 117 ? 7.194   4.228   44.415  1.00 0.00 ?  432 GLY A CA   1  
ATOM   1905   C  C    . GLY A  1 117 ? 6.141   5.022   45.137  1.00 0.00 ?  432 GLY A C    1  
ATOM   1906   O  O    . GLY A  1 117 ? 4.974   4.659   45.354  1.00 0.00 ?  432 GLY A O    1  
ATOM   1907   H  H    . GLY A  1 117 ? 6.683   2.978   42.807  1.00 0.00 ?  432 GLY A H    1  
ATOM   1908   H  HA2  . GLY A  1 117 ? 7.274   3.236   44.834  1.00 0.00 ?  432 GLY A HA2  1  
ATOM   1909   H  HA3  . GLY A  1 117 ? 8.046   4.892   44.398  1.00 0.00 ?  432 GLY A HA3  1  
ATOM   1910   N  N    . ASN A  1 118 ? 6.540   6.183   45.654  1.00 0.00 ?  433 ASN A N    1  
ATOM   1911   C  CA   . ASN A  1 118 ? 5.719   7.014   46.503  1.00 0.00 ?  433 ASN A CA   1  
ATOM   1912   C  C    . ASN A  1 118 ? 5.160   8.152   45.650  1.00 0.00 ?  433 ASN A C    1  
ATOM   1913   O  O    . ASN A  1 118 ? 4.558   9.076   46.206  1.00 0.00 ?  433 ASN A O    1  
ATOM   1914   C  CB   . ASN A  1 118 ? 6.627   7.635   47.664  1.00 0.00 ?  433 ASN A CB   1  
ATOM   1915   C  CG   . ASN A  1 118 ? 7.885   8.481   47.321  1.00 0.00 ?  433 ASN A CG   1  
ATOM   1916   O  OD1  . ASN A  1 118 ? 8.207   8.688   46.113  1.00 0.00 ?  433 ASN A OD1  1  
ATOM   1917   N  ND2  . ASN A  1 118 ? 8.648   8.829   48.351  1.00 0.00 ?  433 ASN A ND2  1  
ATOM   1918   H  H    . ASN A  1 118 ? 7.433   6.627   45.684  1.00 0.00 ?  433 ASN A H    1  
ATOM   1919   H  HA   . ASN A  1 118 ? 4.872   6.538   46.974  1.00 0.00 ?  433 ASN A HA   1  
ATOM   1920   H  HB2  . ASN A  1 118 ? 6.000   8.225   48.367  1.00 0.00 ?  433 ASN A HB2  1  
ATOM   1921   H  HB3  . ASN A  1 118 ? 6.971   6.741   48.227  1.00 0.00 ?  433 ASN A HB3  1  
ATOM   1922   H  HD21 . ASN A  1 118 ? 8.290   8.499   49.224  1.00 0.00 ?  433 ASN A HD21 1  
ATOM   1923   H  HD22 . ASN A  1 118 ? 9.564   9.197   48.184  1.00 0.00 ?  433 ASN A HD22 1  
ATOM   1924   N  N    . LYS A  1 119 ? 5.308   8.074   44.352  1.00 0.00 ?  434 LYS A N    1  
ATOM   1925   C  CA   . LYS A  1 119 ? 4.860   9.152   43.441  1.00 0.00 ?  434 LYS A CA   1  
ATOM   1926   C  C    . LYS A  1 119 ? 3.831   8.472   42.521  1.00 0.00 ?  434 LYS A C    1  
ATOM   1927   O  O    . LYS A  1 119 ? 3.995   7.340   42.079  1.00 0.00 ?  434 LYS A O    1  
ATOM   1928   C  CB   . LYS A  1 119 ? 5.890   9.722   42.430  1.00 0.00 ?  434 LYS A CB   1  
ATOM   1929   C  CG   . LYS A  1 119 ? 7.200   10.218  43.036  1.00 0.00 ?  434 LYS A CG   1  
ATOM   1930   C  CD   . LYS A  1 119 ? 6.969   11.524  43.844  1.00 0.00 ?  434 LYS A CD   1  
ATOM   1931   C  CE   . LYS A  1 119 ? 8.162   11.894  44.776  1.00 0.00 ?  434 LYS A CE   1  
ATOM   1932   N  NZ   . LYS A  1 119 ? 7.786   13.073  45.512  1.00 0.00 1  434 LYS A NZ   1  
ATOM   1933   H  H    . LYS A  1 119 ? 5.891   7.404   43.899  1.00 0.00 ?  434 LYS A H    1  
ATOM   1934   H  HA   . LYS A  1 119 ? 4.465   10.016  43.956  1.00 0.00 ?  434 LYS A HA   1  
ATOM   1935   H  HB2  . LYS A  1 119 ? 6.081   8.924   41.680  1.00 0.00 ?  434 LYS A HB2  1  
ATOM   1936   H  HB3  . LYS A  1 119 ? 5.476   10.585  41.866  1.00 0.00 ?  434 LYS A HB3  1  
ATOM   1937   H  HG2  . LYS A  1 119 ? 7.485   9.401   43.733  1.00 0.00 ?  434 LYS A HG2  1  
ATOM   1938   H  HG3  . LYS A  1 119 ? 8.026   10.231  42.293  1.00 0.00 ?  434 LYS A HG3  1  
ATOM   1939   H  HD2  . LYS A  1 119 ? 6.907   12.265  43.018  1.00 0.00 ?  434 LYS A HD2  1  
ATOM   1940   H  HD3  . LYS A  1 119 ? 5.938   11.519  44.256  1.00 0.00 ?  434 LYS A HD3  1  
ATOM   1941   H  HE2  . LYS A  1 119 ? 8.516   11.113  45.482  1.00 0.00 ?  434 LYS A HE2  1  
ATOM   1942   H  HE3  . LYS A  1 119 ? 8.984   12.140  44.070  1.00 0.00 ?  434 LYS A HE3  1  
ATOM   1943   H  HZ1  . LYS A  1 119 ? 8.518   13.651  45.971  1.00 0.00 ?  434 LYS A HZ1  1  
ATOM   1944   H  HZ2  . LYS A  1 119 ? 7.148   12.709  46.249  1.00 0.00 ?  434 LYS A HZ2  1  
ATOM   1945   H  HZ3  . LYS A  1 119 ? 7.160   13.638  44.904  1.00 0.00 ?  434 LYS A HZ3  1  
ATOM   1946   N  N    . TYR A  1 120 ? 2.715   9.229   42.225  1.00 0.00 ?  435 TYR A N    1  
ATOM   1947   C  CA   . TYR A  1 120 ? 1.684   8.834   41.308  1.00 0.00 ?  435 TYR A CA   1  
ATOM   1948   C  C    . TYR A  1 120 ? 1.438   9.959   40.359  1.00 0.00 ?  435 TYR A C    1  
ATOM   1949   O  O    . TYR A  1 120 ? 1.451   11.144  40.697  1.00 0.00 ?  435 TYR A O    1  
ATOM   1950   C  CB   . TYR A  1 120 ? 0.358   8.275   41.999  1.00 0.00 ?  435 TYR A CB   1  
ATOM   1951   C  CG   . TYR A  1 120 ? -0.628  9.337   42.441  1.00 0.00 ?  435 TYR A CG   1  
ATOM   1952   C  CD1  . TYR A  1 120 ? -0.540  9.938   43.701  1.00 0.00 ?  435 TYR A CD1  1  
ATOM   1953   C  CD2  . TYR A  1 120 ? -1.689  9.701   41.573  1.00 0.00 ?  435 TYR A CD2  1  
ATOM   1954   C  CE1  . TYR A  1 120 ? -1.446  10.959  44.044  1.00 0.00 ?  435 TYR A CE1  1  
ATOM   1955   C  CE2  . TYR A  1 120 ? -2.642  10.655  41.988  1.00 0.00 ?  435 TYR A CE2  1  
ATOM   1956   C  CZ   . TYR A  1 120 ? -2.526  11.325  43.251  1.00 0.00 ?  435 TYR A CZ   1  
ATOM   1957   O  OH   . TYR A  1 120 ? -3.447  12.339  43.703  1.00 0.00 ?  435 TYR A OH   1  
ATOM   1958   H  H    . TYR A  1 120 ? 2.534   10.151  42.560  1.00 0.00 ?  435 TYR A H    1  
ATOM   1959   H  HA   . TYR A  1 120 ? 2.148   8.028   40.757  1.00 0.00 ?  435 TYR A HA   1  
ATOM   1960   H  HB2  . TYR A  1 120 ? -0.149  7.525   41.355  1.00 0.00 ?  435 TYR A HB2  1  
ATOM   1961   H  HB3  . TYR A  1 120 ? 0.624   7.752   42.943  1.00 0.00 ?  435 TYR A HB3  1  
ATOM   1962   H  HD1  . TYR A  1 120 ? 0.276   9.791   44.393  1.00 0.00 ?  435 TYR A HD1  1  
ATOM   1963   H  HD2  . TYR A  1 120 ? -1.843  9.282   40.589  1.00 0.00 ?  435 TYR A HD2  1  
ATOM   1964   H  HE1  . TYR A  1 120 ? -1.370  11.416  45.020  1.00 0.00 ?  435 TYR A HE1  1  
ATOM   1965   H  HE2  . TYR A  1 120 ? -3.543  10.780  41.405  1.00 0.00 ?  435 TYR A HE2  1  
ATOM   1966   H  HH   . TYR A  1 120 ? -4.303  12.304  43.269  1.00 0.00 ?  435 TYR A HH   1  
ATOM   1967   N  N    . TYR A  1 121 ? 1.113   9.572   39.096  1.00 0.00 ?  436 TYR A N    1  
ATOM   1968   C  CA   . TYR A  1 121 ? 0.842   10.527  38.060  1.00 0.00 ?  436 TYR A CA   1  
ATOM   1969   C  C    . TYR A  1 121 ? -0.535  10.351  37.580  1.00 0.00 ?  436 TYR A C    1  
ATOM   1970   O  O    . TYR A  1 121 ? -1.181  9.200   37.720  1.00 0.00 ?  436 TYR A O    1  
ATOM   1971   C  CB   . TYR A  1 121 ? 1.728   10.315  36.753  1.00 0.00 ?  436 TYR A CB   1  
ATOM   1972   C  CG   . TYR A  1 121 ? 3.205   10.185  37.060  1.00 0.00 ?  436 TYR A CG   1  
ATOM   1973   C  CD1  . TYR A  1 121 ? 4.051   11.258  36.590  1.00 0.00 ?  436 TYR A CD1  1  
ATOM   1974   C  CD2  . TYR A  1 121 ? 3.742   9.126   37.776  1.00 0.00 ?  436 TYR A CD2  1  
ATOM   1975   C  CE1  . TYR A  1 121 ? 5.385   11.325  37.118  1.00 0.00 ?  436 TYR A CE1  1  
ATOM   1976   C  CE2  . TYR A  1 121 ? 5.089   9.095   38.090  1.00 0.00 ?  436 TYR A CE2  1  
ATOM   1977   C  CZ   . TYR A  1 121 ? 5.927   10.242  37.793  1.00 0.00 ?  436 TYR A CZ   1  
ATOM   1978   O  OH   . TYR A  1 121 ? 7.264   10.169  38.076  1.00 0.00 ?  436 TYR A OH   1  
ATOM   1979   H  H    . TYR A  1 121 ? 0.908   8.600   39.021  1.00 0.00 ?  436 TYR A H    1  
ATOM   1980   H  HA   . TYR A  1 121 ? 0.931   11.557  38.375  1.00 0.00 ?  436 TYR A HA   1  
ATOM   1981   H  HB2  . TYR A  1 121 ? 1.645   9.417   36.105  1.00 0.00 ?  436 TYR A HB2  1  
ATOM   1982   H  HB3  . TYR A  1 121 ? 1.535   11.160  36.058  1.00 0.00 ?  436 TYR A HB3  1  
ATOM   1983   H  HD1  . TYR A  1 121 ? 3.586   12.035  36.001  1.00 0.00 ?  436 TYR A HD1  1  
ATOM   1984   H  HD2  . TYR A  1 121 ? 3.093   8.283   37.962  1.00 0.00 ?  436 TYR A HD2  1  
ATOM   1985   H  HE1  . TYR A  1 121 ? 5.971   12.180  36.818  1.00 0.00 ?  436 TYR A HE1  1  
ATOM   1986   H  HE2  . TYR A  1 121 ? 5.616   8.277   38.556  1.00 0.00 ?  436 TYR A HE2  1  
ATOM   1987   H  HH   . TYR A  1 121 ? 7.659   11.012  37.844  1.00 0.00 ?  436 TYR A HH   1  
ATOM   1988   N  N    . ARG A  1 122 ? -1.166  11.327  36.902  1.00 0.00 ?  437 ARG A N    1  
ATOM   1989   C  CA   . ARG A  1 122 ? -2.400  11.136  36.192  1.00 0.00 ?  437 ARG A CA   1  
ATOM   1990   C  C    . ARG A  1 122 ? -2.150  11.519  34.733  1.00 0.00 ?  437 ARG A C    1  
ATOM   1991   O  O    . ARG A  1 122 ? -1.534  12.529  34.420  1.00 0.00 ?  437 ARG A O    1  
ATOM   1992   C  CB   . ARG A  1 122 ? -3.570  11.990  36.817  1.00 0.00 ?  437 ARG A CB   1  
ATOM   1993   C  CG   . ARG A  1 122 ? -4.943  11.833  36.029  1.00 0.00 ?  437 ARG A CG   1  
ATOM   1994   C  CD   . ARG A  1 122 ? -6.169  12.478  36.744  1.00 0.00 ?  437 ARG A CD   1  
ATOM   1995   N  NE   . ARG A  1 122 ? -6.075  14.013  36.545  1.00 0.00 ?  437 ARG A NE   1  
ATOM   1996   C  CZ   . ARG A  1 122 ? -6.913  14.844  37.247  1.00 0.00 ?  437 ARG A CZ   1  
ATOM   1997   N  NH1  . ARG A  1 122 ? -7.839  14.372  37.968  1.00 0.00 1  437 ARG A NH1  1  
ATOM   1998   N  NH2  . ARG A  1 122 ? -6.723  16.105  37.144  1.00 0.00 ?  437 ARG A NH2  1  
ATOM   1999   H  H    . ARG A  1 122 ? -0.662  12.147  36.641  1.00 0.00 ?  437 ARG A H    1  
ATOM   2000   H  HA   . ARG A  1 122 ? -2.732  10.110  36.131  1.00 0.00 ?  437 ARG A HA   1  
ATOM   2001   H  HB2  . ARG A  1 122 ? -3.735  11.569  37.832  1.00 0.00 ?  437 ARG A HB2  1  
ATOM   2002   H  HB3  . ARG A  1 122 ? -3.215  13.037  36.930  1.00 0.00 ?  437 ARG A HB3  1  
ATOM   2003   H  HG2  . ARG A  1 122 ? -4.732  12.353  35.071  1.00 0.00 ?  437 ARG A HG2  1  
ATOM   2004   H  HG3  . ARG A  1 122 ? -5.130  10.747  35.886  1.00 0.00 ?  437 ARG A HG3  1  
ATOM   2005   H  HD2  . ARG A  1 122 ? -7.128  12.183  36.266  1.00 0.00 ?  437 ARG A HD2  1  
ATOM   2006   H  HD3  . ARG A  1 122 ? -6.277  12.280  37.832  1.00 0.00 ?  437 ARG A HD3  1  
ATOM   2007   H  HE   . ARG A  1 122 ? -5.549  14.368  35.772  1.00 0.00 ?  437 ARG A HE   1  
ATOM   2008   H  HH11 . ARG A  1 122 ? -8.037  13.397  38.065  1.00 0.00 ?  437 ARG A HH11 1  
ATOM   2009   H  HH12 . ARG A  1 122 ? -8.204  14.876  38.751  1.00 0.00 ?  437 ARG A HH12 1  
ATOM   2010   H  HH21 . ARG A  1 122 ? -6.326  16.467  36.300  1.00 0.00 ?  437 ARG A HH21 1  
ATOM   2011   H  HH22 . ARG A  1 122 ? -7.430  16.768  37.389  1.00 0.00 ?  437 ARG A HH22 1  
ATOM   2012   N  N    . PHE A  1 123 ? -2.619  10.666  33.835  1.00 0.00 ?  438 PHE A N    1  
ATOM   2013   C  CA   . PHE A  1 123 ? -2.389  10.769  32.435  1.00 0.00 ?  438 PHE A CA   1  
ATOM   2014   C  C    . PHE A  1 123 ? -3.680  10.882  31.698  1.00 0.00 ?  438 PHE A C    1  
ATOM   2015   O  O    . PHE A  1 123 ? -4.597  10.066  31.929  1.00 0.00 ?  438 PHE A O    1  
ATOM   2016   C  CB   . PHE A  1 123 ? -1.490  9.554   31.990  1.00 0.00 ?  438 PHE A CB   1  
ATOM   2017   C  CG   . PHE A  1 123 ? -1.239  9.548   30.481  1.00 0.00 ?  438 PHE A CG   1  
ATOM   2018   C  CD1  . PHE A  1 123 ? -0.290  10.445  29.926  1.00 0.00 ?  438 PHE A CD1  1  
ATOM   2019   C  CD2  . PHE A  1 123 ? -1.877  8.598   29.622  1.00 0.00 ?  438 PHE A CD2  1  
ATOM   2020   C  CE1  . PHE A  1 123 ? -0.026  10.463  28.556  1.00 0.00 ?  438 PHE A CE1  1  
ATOM   2021   C  CE2  . PHE A  1 123 ? -1.534  8.673   28.243  1.00 0.00 ?  438 PHE A CE2  1  
ATOM   2022   C  CZ   . PHE A  1 123 ? -0.650  9.546   27.694  1.00 0.00 ?  438 PHE A CZ   1  
ATOM   2023   H  H    . PHE A  1 123 ? -3.070  9.838   34.159  1.00 0.00 ?  438 PHE A H    1  
ATOM   2024   H  HA   . PHE A  1 123 ? -1.831  11.643  32.134  1.00 0.00 ?  438 PHE A HA   1  
ATOM   2025   H  HB2  . PHE A  1 123 ? -0.484  9.509   32.459  1.00 0.00 ?  438 PHE A HB2  1  
ATOM   2026   H  HB3  . PHE A  1 123 ? -2.097  8.658   32.240  1.00 0.00 ?  438 PHE A HB3  1  
ATOM   2027   H  HD1  . PHE A  1 123 ? 0.161   11.178  30.578  1.00 0.00 ?  438 PHE A HD1  1  
ATOM   2028   H  HD2  . PHE A  1 123 ? -2.541  7.835   29.999  1.00 0.00 ?  438 PHE A HD2  1  
ATOM   2029   H  HE1  . PHE A  1 123 ? 0.739   11.184  28.308  1.00 0.00 ?  438 PHE A HE1  1  
ATOM   2030   H  HE2  . PHE A  1 123 ? -2.153  8.069   27.596  1.00 0.00 ?  438 PHE A HE2  1  
ATOM   2031   H  HZ   . PHE A  1 123 ? -0.393  9.484   26.647  1.00 0.00 ?  438 PHE A HZ   1  
ATOM   2032   N  N    . ASN A  1 124 ? -3.756  11.881  30.796  1.00 0.00 ?  439 ASN A N    1  
ATOM   2033   C  CA   . ASN A  1 124 ? -4.898  12.053  29.925  1.00 0.00 ?  439 ASN A CA   1  
ATOM   2034   C  C    . ASN A  1 124 ? -4.771  11.063  28.707  1.00 0.00 ?  439 ASN A C    1  
ATOM   2035   O  O    . ASN A  1 124 ? -4.134  11.291  27.689  1.00 0.00 ?  439 ASN A O    1  
ATOM   2036   C  CB   . ASN A  1 124 ? -5.042  13.597  29.542  1.00 0.00 ?  439 ASN A CB   1  
ATOM   2037   C  CG   . ASN A  1 124 ? -6.330  13.939  28.756  1.00 0.00 ?  439 ASN A CG   1  
ATOM   2038   O  OD1  . ASN A  1 124 ? -6.896  13.018  28.055  1.00 0.00 ?  439 ASN A OD1  1  
ATOM   2039   N  ND2  . ASN A  1 124 ? -6.786  15.193  28.862  1.00 0.00 ?  439 ASN A ND2  1  
ATOM   2040   H  H    . ASN A  1 124 ? -3.027  12.553  30.693  1.00 0.00 ?  439 ASN A H    1  
ATOM   2041   H  HA   . ASN A  1 124 ? -5.810  11.858  30.470  1.00 0.00 ?  439 ASN A HA   1  
ATOM   2042   H  HB2  . ASN A  1 124 ? -5.034  14.203  30.474  1.00 0.00 ?  439 ASN A HB2  1  
ATOM   2043   H  HB3  . ASN A  1 124 ? -4.149  13.909  28.959  1.00 0.00 ?  439 ASN A HB3  1  
ATOM   2044   H  HD21 . ASN A  1 124 ? -7.640  15.325  28.358  1.00 0.00 ?  439 ASN A HD21 1  
ATOM   2045   H  HD22 . ASN A  1 124 ? -6.553  15.831  29.595  1.00 0.00 ?  439 ASN A HD22 1  
ATOM   2046   N  N    . GLU A  1 125 ? -5.466  9.904   28.915  1.00 0.00 ?  440 GLU A N    1  
ATOM   2047   C  CA   . GLU A  1 125 ? -5.326  8.771   28.069  1.00 0.00 ?  440 GLU A CA   1  
ATOM   2048   C  C    . GLU A  1 125 ? -6.068  8.990   26.742  1.00 0.00 ?  440 GLU A C    1  
ATOM   2049   O  O    . GLU A  1 125 ? -5.940  8.300   25.732  1.00 0.00 ?  440 GLU A O    1  
ATOM   2050   C  CB   . GLU A  1 125 ? -5.931  7.494   28.711  1.00 0.00 ?  440 GLU A CB   1  
ATOM   2051   C  CG   . GLU A  1 125 ? -5.646  6.227   27.969  1.00 0.00 ?  440 GLU A CG   1  
ATOM   2052   C  CD   . GLU A  1 125 ? -4.145  5.828   27.985  1.00 0.00 ?  440 GLU A CD   1  
ATOM   2053   O  OE1  . GLU A  1 125 ? -3.511  6.066   26.917  1.00 0.00 ?  440 GLU A OE1  1  
ATOM   2054   O  OE2  . GLU A  1 125 ? -3.605  5.317   28.999  1.00 0.00 -1 440 GLU A OE2  1  
ATOM   2055   H  H    . GLU A  1 125 ? -6.000  9.841   29.754  1.00 0.00 ?  440 GLU A H    1  
ATOM   2056   H  HA   . GLU A  1 125 ? -4.270  8.580   27.942  1.00 0.00 ?  440 GLU A HA   1  
ATOM   2057   H  HB2  . GLU A  1 125 ? -5.502  7.447   29.735  1.00 0.00 ?  440 GLU A HB2  1  
ATOM   2058   H  HB3  . GLU A  1 125 ? -7.020  7.646   28.868  1.00 0.00 ?  440 GLU A HB3  1  
ATOM   2059   H  HG2  . GLU A  1 125 ? -6.146  5.363   28.455  1.00 0.00 ?  440 GLU A HG2  1  
ATOM   2060   H  HG3  . GLU A  1 125 ? -5.995  6.267   26.915  1.00 0.00 ?  440 GLU A HG3  1  
ATOM   2061   N  N    . GLU A  1 126 ? -6.842  10.085  26.622  1.00 0.00 ?  441 GLU A N    1  
ATOM   2062   C  CA   . GLU A  1 126 ? -7.437  10.461  25.376  1.00 0.00 ?  441 GLU A CA   1  
ATOM   2063   C  C    . GLU A  1 126 ? -6.558  11.465  24.626  1.00 0.00 ?  441 GLU A C    1  
ATOM   2064   O  O    . GLU A  1 126 ? -6.037  11.309  23.492  1.00 0.00 ?  441 GLU A O    1  
ATOM   2065   C  CB   . GLU A  1 126 ? -8.868  11.145  25.584  1.00 0.00 ?  441 GLU A CB   1  
ATOM   2066   C  CG   . GLU A  1 126 ? -9.416  11.712  24.249  1.00 0.00 ?  441 GLU A CG   1  
ATOM   2067   C  CD   . GLU A  1 126 ? -10.914 11.723  24.293  1.00 0.00 ?  441 GLU A CD   1  
ATOM   2068   O  OE1  . GLU A  1 126 ? -11.590 12.729  23.953  1.00 0.00 ?  441 GLU A OE1  1  
ATOM   2069   O  OE2  . GLU A  1 126 ? -11.499 10.637  24.686  1.00 0.00 -1 441 GLU A OE2  1  
ATOM   2070   H  H    . GLU A  1 126 ? -7.086  10.580  27.452  1.00 0.00 ?  441 GLU A H    1  
ATOM   2071   H  HA   . GLU A  1 126 ? -7.516  9.566   24.776  1.00 0.00 ?  441 GLU A HA   1  
ATOM   2072   H  HB2  . GLU A  1 126 ? -9.440  10.299  26.022  1.00 0.00 ?  441 GLU A HB2  1  
ATOM   2073   H  HB3  . GLU A  1 126 ? -8.888  11.951  26.349  1.00 0.00 ?  441 GLU A HB3  1  
ATOM   2074   H  HG2  . GLU A  1 126 ? -9.081  12.760  24.094  1.00 0.00 ?  441 GLU A HG2  1  
ATOM   2075   H  HG3  . GLU A  1 126 ? -9.157  11.070  23.379  1.00 0.00 ?  441 GLU A HG3  1  
ATOM   2076   N  N    . LEU A  1 127 ? -6.278  12.687  25.205  1.00 0.00 ?  442 LEU A N    1  
ATOM   2077   C  CA   . LEU A  1 127 ? -5.364  13.646  24.552  1.00 0.00 ?  442 LEU A CA   1  
ATOM   2078   C  C    . LEU A  1 127 ? -3.955  13.250  24.476  1.00 0.00 ?  442 LEU A C    1  
ATOM   2079   O  O    . LEU A  1 127 ? -3.202  13.738  23.616  1.00 0.00 ?  442 LEU A O    1  
ATOM   2080   C  CB   . LEU A  1 127 ? -5.546  15.102  25.127  1.00 0.00 ?  442 LEU A CB   1  
ATOM   2081   C  CG   . LEU A  1 127 ? -7.053  15.606  25.110  1.00 0.00 ?  442 LEU A CG   1  
ATOM   2082   C  CD1  . LEU A  1 127 ? -7.258  16.870  25.906  1.00 0.00 ?  442 LEU A CD1  1  
ATOM   2083   C  CD2  . LEU A  1 127 ? -7.541  15.805  23.630  1.00 0.00 ?  442 LEU A CD2  1  
ATOM   2084   H  H    . LEU A  1 127 ? -6.635  12.888  26.114  1.00 0.00 ?  442 LEU A H    1  
ATOM   2085   H  HA   . LEU A  1 127 ? -5.711  13.630  23.530  1.00 0.00 ?  442 LEU A HA   1  
ATOM   2086   H  HB2  . LEU A  1 127 ? -5.355  15.055  26.221  1.00 0.00 ?  442 LEU A HB2  1  
ATOM   2087   H  HB3  . LEU A  1 127 ? -5.007  15.874  24.538  1.00 0.00 ?  442 LEU A HB3  1  
ATOM   2088   H  HG   . LEU A  1 127 ? -7.720  14.819  25.520  1.00 0.00 ?  442 LEU A HG   1  
ATOM   2089   H  HD11 . LEU A  1 127 ? -6.600  17.696  25.561  1.00 0.00 ?  442 LEU A HD11 1  
ATOM   2090   H  HD12 . LEU A  1 127 ? -6.999  16.592  26.950  1.00 0.00 ?  442 LEU A HD12 1  
ATOM   2091   H  HD13 . LEU A  1 127 ? -8.267  17.332  25.848  1.00 0.00 ?  442 LEU A HD13 1  
ATOM   2092   H  HD21 . LEU A  1 127 ? -7.125  16.623  23.004  1.00 0.00 ?  442 LEU A HD21 1  
ATOM   2093   H  HD22 . LEU A  1 127 ? -8.580  16.176  23.767  1.00 0.00 ?  442 LEU A HD22 1  
ATOM   2094   H  HD23 . LEU A  1 127 ? -7.707  14.813  23.159  1.00 0.00 ?  442 LEU A HD23 1  
ATOM   2095   N  N    . ARG A  1 128 ? -3.520  12.336  25.365  1.00 0.00 ?  443 ARG A N    1  
ATOM   2096   C  CA   . ARG A  1 128 ? -2.109  11.796  25.288  1.00 0.00 ?  443 ARG A CA   1  
ATOM   2097   C  C    . ARG A  1 128 ? -1.017  12.555  26.059  1.00 0.00 ?  443 ARG A C    1  
ATOM   2098   O  O    . ARG A  1 128 ? 0.054   12.814  25.474  1.00 0.00 ?  443 ARG A O    1  
ATOM   2099   C  CB   . ARG A  1 128 ? -1.551  11.187  23.910  1.00 0.00 ?  443 ARG A CB   1  
ATOM   2100   C  CG   . ARG A  1 128 ? -2.388  10.068  23.327  1.00 0.00 ?  443 ARG A CG   1  
ATOM   2101   C  CD   . ARG A  1 128 ? -1.893  9.533   21.931  1.00 0.00 ?  443 ARG A CD   1  
ATOM   2102   N  NE   . ARG A  1 128 ? -0.534  8.874   21.992  1.00 0.00 ?  443 ARG A NE   1  
ATOM   2103   C  CZ   . ARG A  1 128 ? -0.180  7.715   22.539  1.00 0.00 ?  443 ARG A CZ   1  
ATOM   2104   N  NH1  . ARG A  1 128 ? 1.143   7.510   22.468  1.00 0.00 1  443 ARG A NH1  1  
ATOM   2105   N  NH2  . ARG A  1 128 ? -0.908  6.823   23.093  1.00 0.00 ?  443 ARG A NH2  1  
ATOM   2106   H  H    . ARG A  1 128 ? -4.077  11.949  26.095  1.00 0.00 ?  443 ARG A H    1  
ATOM   2107   H  HA   . ARG A  1 128 ? -2.193  10.957  25.962  1.00 0.00 ?  443 ARG A HA   1  
ATOM   2108   H  HB2  . ARG A  1 128 ? -1.529  12.039  23.197  1.00 0.00 ?  443 ARG A HB2  1  
ATOM   2109   H  HB3  . ARG A  1 128 ? -0.541  10.775  24.120  1.00 0.00 ?  443 ARG A HB3  1  
ATOM   2110   H  HG2  . ARG A  1 128 ? -2.419  9.169   23.979  1.00 0.00 ?  443 ARG A HG2  1  
ATOM   2111   H  HG3  . ARG A  1 128 ? -3.382  10.515  23.112  1.00 0.00 ?  443 ARG A HG3  1  
ATOM   2112   H  HD2  . ARG A  1 128 ? -2.697  8.874   21.539  1.00 0.00 ?  443 ARG A HD2  1  
ATOM   2113   H  HD3  . ARG A  1 128 ? -1.769  10.334  21.172  1.00 0.00 ?  443 ARG A HD3  1  
ATOM   2114   H  HE   . ARG A  1 128 ? 0.298   9.378   21.758  1.00 0.00 ?  443 ARG A HE   1  
ATOM   2115   H  HH11 . ARG A  1 128 ? 1.489   6.620   22.763  1.00 0.00 ?  443 ARG A HH11 1  
ATOM   2116   H  HH12 . ARG A  1 128 ? 1.621   8.168   21.886  1.00 0.00 ?  443 ARG A HH12 1  
ATOM   2117   H  HH21 . ARG A  1 128 ? -1.866  7.097   23.180  1.00 0.00 ?  443 ARG A HH21 1  
ATOM   2118   H  HH22 . ARG A  1 128 ? -0.439  6.024   23.468  1.00 0.00 ?  443 ARG A HH22 1  
ATOM   2119   N  N    . ALA A  1 129 ? -1.286  13.043  27.322  1.00 0.00 ?  444 ALA A N    1  
ATOM   2120   C  CA   . ALA A  1 129 ? -0.366  13.947  28.033  1.00 0.00 ?  444 ALA A CA   1  
ATOM   2121   C  C    . ALA A  1 129 ? -0.622  13.909  29.576  1.00 0.00 ?  444 ALA A C    1  
ATOM   2122   O  O    . ALA A  1 129 ? -1.749  13.540  29.979  1.00 0.00 ?  444 ALA A O    1  
ATOM   2123   C  CB   . ALA A  1 129 ? -0.695  15.288  27.407  1.00 0.00 ?  444 ALA A CB   1  
ATOM   2124   H  H    . ALA A  1 129 ? -2.137  12.780  27.769  1.00 0.00 ?  444 ALA A H    1  
ATOM   2125   H  HA   . ALA A  1 129 ? 0.670   13.679  27.890  1.00 0.00 ?  444 ALA A HA   1  
ATOM   2126   H  HB1  . ALA A  1 129 ? -0.406  16.028  28.183  1.00 0.00 ?  444 ALA A HB1  1  
ATOM   2127   H  HB2  . ALA A  1 129 ? -1.789  15.457  27.308  1.00 0.00 ?  444 ALA A HB2  1  
ATOM   2128   H  HB3  . ALA A  1 129 ? -0.217  15.593  26.451  1.00 0.00 ?  444 ALA A HB3  1  
ATOM   2129   N  N    . VAL A  1 130 ? 0.417   14.215  30.403  1.00 0.00 ?  445 VAL A N    1  
ATOM   2130   C  CA   . VAL A  1 130 ? 0.300   14.220  31.826  1.00 0.00 ?  445 VAL A CA   1  
ATOM   2131   C  C    . VAL A  1 130 ? -0.292  15.440  32.430  1.00 0.00 ?  445 VAL A C    1  
ATOM   2132   O  O    . VAL A  1 130 ? 0.050   16.542  32.043  1.00 0.00 ?  445 VAL A O    1  
ATOM   2133   C  CB   . VAL A  1 130 ? 1.644   13.971  32.529  1.00 0.00 ?  445 VAL A CB   1  
ATOM   2134   C  CG1  . VAL A  1 130 ? 1.375   13.393  33.946  1.00 0.00 ?  445 VAL A CG1  1  
ATOM   2135   C  CG2  . VAL A  1 130 ? 2.428   12.923  31.706  1.00 0.00 ?  445 VAL A CG2  1  
ATOM   2136   H  H    . VAL A  1 130 ? 1.254   14.458  29.918  1.00 0.00 ?  445 VAL A H    1  
ATOM   2137   H  HA   . VAL A  1 130 ? -0.280  13.353  32.108  1.00 0.00 ?  445 VAL A HA   1  
ATOM   2138   H  HB   . VAL A  1 130 ? 2.267   14.890  32.511  1.00 0.00 ?  445 VAL A HB   1  
ATOM   2139   H  HG11 . VAL A  1 130 ? 0.835   14.098  34.613  1.00 0.00 ?  445 VAL A HG11 1  
ATOM   2140   H  HG12 . VAL A  1 130 ? 2.262   13.184  34.582  1.00 0.00 ?  445 VAL A HG12 1  
ATOM   2141   H  HG13 . VAL A  1 130 ? 0.848   12.424  33.817  1.00 0.00 ?  445 VAL A HG13 1  
ATOM   2142   H  HG21 . VAL A  1 130 ? 2.859   13.301  30.754  1.00 0.00 ?  445 VAL A HG21 1  
ATOM   2143   H  HG22 . VAL A  1 130 ? 1.794   12.072  31.378  1.00 0.00 ?  445 VAL A HG22 1  
ATOM   2144   H  HG23 . VAL A  1 130 ? 3.353   12.696  32.278  1.00 0.00 ?  445 VAL A HG23 1  
ATOM   2145   N  N    . ASP A  1 131 ? -1.301  15.302  33.278  1.00 0.00 ?  446 ASP A N    1  
ATOM   2146   C  CA   . ASP A  1 131 ? -1.894  16.415  33.898  1.00 0.00 ?  446 ASP A CA   1  
ATOM   2147   C  C    . ASP A  1 131 ? -1.157  17.378  34.894  1.00 0.00 ?  446 ASP A C    1  
ATOM   2148   O  O    . ASP A  1 131 ? -0.113  17.095  35.483  1.00 0.00 ?  446 ASP A O    1  
ATOM   2149   C  CB   . ASP A  1 131 ? -3.113  15.845  34.650  1.00 0.00 ?  446 ASP A CB   1  
ATOM   2150   C  CG   . ASP A  1 131 ? -4.222  15.510  33.600  1.00 0.00 ?  446 ASP A CG   1  
ATOM   2151   O  OD1  . ASP A  1 131 ? -4.154  15.829  32.354  1.00 0.00 ?  446 ASP A OD1  1  
ATOM   2152   O  OD2  . ASP A  1 131 ? -5.253  14.988  34.027  1.00 0.00 -1 446 ASP A OD2  1  
ATOM   2153   H  H    . ASP A  1 131 ? -1.654  14.456  33.671  1.00 0.00 ?  446 ASP A H    1  
ATOM   2154   H  HA   . ASP A  1 131 ? -2.262  17.028  33.088  1.00 0.00 ?  446 ASP A HA   1  
ATOM   2155   H  HB2  . ASP A  1 131 ? -3.062  14.958  35.318  1.00 0.00 ?  446 ASP A HB2  1  
ATOM   2156   H  HB3  . ASP A  1 131 ? -3.532  16.703  35.217  1.00 0.00 ?  446 ASP A HB3  1  
ATOM   2157   N  N    . SER A  1 132 ? -1.790  18.557  35.168  1.00 0.00 ?  447 SER A N    1  
ATOM   2158   C  CA   . SER A  1 132 ? -1.300  19.629  35.957  1.00 0.00 ?  447 SER A CA   1  
ATOM   2159   C  C    . SER A  1 132 ? -1.229  19.253  37.476  1.00 0.00 ?  447 SER A C    1  
ATOM   2160   O  O    . SER A  1 132 ? -2.129  18.551  38.130  1.00 0.00 ?  447 SER A O    1  
ATOM   2161   C  CB   . SER A  1 132 ? -2.106  20.982  35.780  1.00 0.00 ?  447 SER A CB   1  
ATOM   2162   O  OG   . SER A  1 132 ? -2.039  21.364  34.404  1.00 0.00 ?  447 SER A OG   1  
ATOM   2163   H  H    . SER A  1 132 ? -2.534  18.723  34.526  1.00 0.00 ?  447 SER A H    1  
ATOM   2164   H  HA   . SER A  1 132 ? -0.255  19.650  35.684  1.00 0.00 ?  447 SER A HA   1  
ATOM   2165   H  HB2  . SER A  1 132 ? -3.181  20.861  36.032  1.00 0.00 ?  447 SER A HB2  1  
ATOM   2166   H  HB3  . SER A  1 132 ? -1.669  21.793  36.402  1.00 0.00 ?  447 SER A HB3  1  
ATOM   2167   H  HG   . SER A  1 132 ? -2.073  20.622  33.795  1.00 0.00 ?  447 SER A HG   1  
ATOM   2168   N  N    . GLU A  1 133 ? -0.080  19.710  38.175  1.00 0.00 ?  448 GLU A N    1  
ATOM   2169   C  CA   . GLU A  1 133 ? 0.126   19.620  39.608  1.00 0.00 ?  448 GLU A CA   1  
ATOM   2170   C  C    . GLU A  1 133 ? 0.669   18.207  40.026  1.00 0.00 ?  448 GLU A C    1  
ATOM   2171   O  O    . GLU A  1 133 ? 0.950   17.956  41.173  1.00 0.00 ?  448 GLU A O    1  
ATOM   2172   C  CB   . GLU A  1 133 ? -0.925  20.275  40.476  1.00 0.00 ?  448 GLU A CB   1  
ATOM   2173   C  CG   . GLU A  1 133 ? -0.994  21.780  40.367  1.00 0.00 ?  448 GLU A CG   1  
ATOM   2174   C  CD   . GLU A  1 133 ? -1.788  22.450  41.526  1.00 0.00 ?  448 GLU A CD   1  
ATOM   2175   O  OE1  . GLU A  1 133 ? -1.185  22.618  42.655  1.00 0.00 ?  448 GLU A OE1  1  
ATOM   2176   O  OE2  . GLU A  1 133 ? -2.887  23.030  41.297  1.00 0.00 -1 448 GLU A OE2  1  
ATOM   2177   H  H    . GLU A  1 133 ? 0.580   20.205  37.616  1.00 0.00 ?  448 GLU A H    1  
ATOM   2178   H  HA   . GLU A  1 133 ? 0.980   20.280  39.634  1.00 0.00 ?  448 GLU A HA   1  
ATOM   2179   H  HB2  . GLU A  1 133 ? -1.929  19.920  40.161  1.00 0.00 ?  448 GLU A HB2  1  
ATOM   2180   H  HB3  . GLU A  1 133 ? -0.642  20.132  41.541  1.00 0.00 ?  448 GLU A HB3  1  
ATOM   2181   H  HG2  . GLU A  1 133 ? 0.028   22.210  40.293  1.00 0.00 ?  448 GLU A HG2  1  
ATOM   2182   H  HG3  . GLU A  1 133 ? -1.516  22.043  39.422  1.00 0.00 ?  448 GLU A HG3  1  
ATOM   2183   N  N    . TYR A  1 134 ? 0.859   17.299  39.018  1.00 0.00 ?  449 TYR A N    1  
ATOM   2184   C  CA   . TYR A  1 134 ? 1.530   16.070  39.219  1.00 0.00 ?  449 TYR A CA   1  
ATOM   2185   C  C    . TYR A  1 134 ? 3.001   16.066  39.036  1.00 0.00 ?  449 TYR A C    1  
ATOM   2186   O  O    . TYR A  1 134 ? 3.536   17.023  38.466  1.00 0.00 ?  449 TYR A O    1  
ATOM   2187   C  CB   . TYR A  1 134 ? 0.748   14.932  38.473  1.00 0.00 ?  449 TYR A CB   1  
ATOM   2188   C  CG   . TYR A  1 134 ? -0.697  14.737  38.913  1.00 0.00 ?  449 TYR A CG   1  
ATOM   2189   C  CD1  . TYR A  1 134 ? -1.004  13.924  40.015  1.00 0.00 ?  449 TYR A CD1  1  
ATOM   2190   C  CD2  . TYR A  1 134 ? -1.752  15.351  38.232  1.00 0.00 ?  449 TYR A CD2  1  
ATOM   2191   C  CE1  . TYR A  1 134 ? -2.352  13.660  40.395  1.00 0.00 ?  449 TYR A CE1  1  
ATOM   2192   C  CE2  . TYR A  1 134 ? -3.105  15.162  38.682  1.00 0.00 ?  449 TYR A CE2  1  
ATOM   2193   C  CZ   . TYR A  1 134 ? -3.360  14.258  39.704  1.00 0.00 ?  449 TYR A CZ   1  
ATOM   2194   O  OH   . TYR A  1 134 ? -4.736  13.966  40.070  1.00 0.00 ?  449 TYR A OH   1  
ATOM   2195   H  H    . TYR A  1 134 ? 0.792   17.634  38.081  1.00 0.00 ?  449 TYR A H    1  
ATOM   2196   H  HA   . TYR A  1 134 ? 1.307   15.808  40.243  1.00 0.00 ?  449 TYR A HA   1  
ATOM   2197   H  HB2  . TYR A  1 134 ? 0.666   15.125  37.382  1.00 0.00 ?  449 TYR A HB2  1  
ATOM   2198   H  HB3  . TYR A  1 134 ? 1.121   13.929  38.770  1.00 0.00 ?  449 TYR A HB3  1  
ATOM   2199   H  HD1  . TYR A  1 134 ? -0.244  13.628  40.724  1.00 0.00 ?  449 TYR A HD1  1  
ATOM   2200   H  HD2  . TYR A  1 134 ? -1.535  16.074  37.460  1.00 0.00 ?  449 TYR A HD2  1  
ATOM   2201   H  HE1  . TYR A  1 134 ? -2.558  13.097  41.293  1.00 0.00 ?  449 TYR A HE1  1  
ATOM   2202   H  HE2  . TYR A  1 134 ? -3.964  15.570  38.169  1.00 0.00 ?  449 TYR A HE2  1  
ATOM   2203   H  HH   . TYR A  1 134 ? -5.247  14.737  39.816  1.00 0.00 ?  449 TYR A HH   1  
ATOM   2204   N  N    . PRO A  1 135 ? 3.768   14.993  39.411  1.00 0.00 ?  450 PRO A N    1  
ATOM   2205   C  CA   . PRO A  1 135 ? 3.400   13.879  40.301  1.00 0.00 ?  450 PRO A CA   1  
ATOM   2206   C  C    . PRO A  1 135 ? 2.947   14.306  41.630  1.00 0.00 ?  450 PRO A C    1  
ATOM   2207   O  O    . PRO A  1 135 ? 3.510   15.318  42.121  1.00 0.00 ?  450 PRO A O    1  
ATOM   2208   C  CB   . PRO A  1 135 ? 4.640   13.050  40.425  1.00 0.00 ?  450 PRO A CB   1  
ATOM   2209   C  CG   . PRO A  1 135 ? 5.786   13.961  40.053  1.00 0.00 ?  450 PRO A CG   1  
ATOM   2210   C  CD   . PRO A  1 135 ? 5.144   14.882  38.965  1.00 0.00 ?  450 PRO A CD   1  
ATOM   2211   H  HA   . PRO A  1 135 ? 2.582   13.306  39.888  1.00 0.00 ?  450 PRO A HA   1  
ATOM   2212   H  HB2  . PRO A  1 135 ? 4.768   12.519  41.393  1.00 0.00 ?  450 PRO A HB2  1  
ATOM   2213   H  HB3  . PRO A  1 135 ? 4.648   12.285  39.619  1.00 0.00 ?  450 PRO A HB3  1  
ATOM   2214   H  HG2  . PRO A  1 135 ? 6.137   14.594  40.896  1.00 0.00 ?  450 PRO A HG2  1  
ATOM   2215   H  HG3  . PRO A  1 135 ? 6.643   13.332  39.731  1.00 0.00 ?  450 PRO A HG3  1  
ATOM   2216   H  HD2  . PRO A  1 135 ? 5.603   15.894  38.963  1.00 0.00 ?  450 PRO A HD2  1  
ATOM   2217   H  HD3  . PRO A  1 135 ? 5.167   14.534  37.910  1.00 0.00 ?  450 PRO A HD3  1  
ATOM   2218   N  N    . LYS A  1 136 ? 2.038   13.641  42.260  1.00 0.00 ?  451 LYS A N    1  
ATOM   2219   C  CA   . LYS A  1 136 ? 1.575   13.884  43.616  1.00 0.00 ?  451 LYS A CA   1  
ATOM   2220   C  C    . LYS A  1 136 ? 1.997   12.719  44.503  1.00 0.00 ?  451 LYS A C    1  
ATOM   2221   O  O    . LYS A  1 136 ? 2.166   11.601  43.983  1.00 0.00 ?  451 LYS A O    1  
ATOM   2222   C  CB   . LYS A  1 136 ? 0.030   14.192  43.734  1.00 0.00 ?  451 LYS A CB   1  
ATOM   2223   C  CG   . LYS A  1 136 ? -0.296  15.682  43.229  1.00 0.00 ?  451 LYS A CG   1  
ATOM   2224   C  CD   . LYS A  1 136 ? -1.739  16.094  43.264  1.00 0.00 ?  451 LYS A CD   1  
ATOM   2225   C  CE   . LYS A  1 136 ? -2.278  16.207  44.695  1.00 0.00 ?  451 LYS A CE   1  
ATOM   2226   N  NZ   . LYS A  1 136 ? -3.534  16.990  44.600  1.00 0.00 1  451 LYS A NZ   1  
ATOM   2227   H  H    . LYS A  1 136 ? 1.623   12.834  41.847  1.00 0.00 ?  451 LYS A H    1  
ATOM   2228   H  HA   . LYS A  1 136 ? 2.117   14.707  44.056  1.00 0.00 ?  451 LYS A HA   1  
ATOM   2229   H  HB2  . LYS A  1 136 ? -0.574  13.601  43.012  1.00 0.00 ?  451 LYS A HB2  1  
ATOM   2230   H  HB3  . LYS A  1 136 ? -0.423  14.135  44.746  1.00 0.00 ?  451 LYS A HB3  1  
ATOM   2231   H  HG2  . LYS A  1 136 ? 0.356   16.339  43.843  1.00 0.00 ?  451 LYS A HG2  1  
ATOM   2232   H  HG3  . LYS A  1 136 ? 0.065   15.731  42.179  1.00 0.00 ?  451 LYS A HG3  1  
ATOM   2233   H  HD2  . LYS A  1 136 ? -1.770  17.105  42.805  1.00 0.00 ?  451 LYS A HD2  1  
ATOM   2234   H  HD3  . LYS A  1 136 ? -2.374  15.376  42.701  1.00 0.00 ?  451 LYS A HD3  1  
ATOM   2235   H  HE2  . LYS A  1 136 ? -2.527  15.142  44.893  1.00 0.00 ?  451 LYS A HE2  1  
ATOM   2236   H  HE3  . LYS A  1 136 ? -1.581  16.748  45.370  1.00 0.00 ?  451 LYS A HE3  1  
ATOM   2237   H  HZ1  . LYS A  1 136 ? -3.970  17.119  45.535  1.00 0.00 ?  451 LYS A HZ1  1  
ATOM   2238   H  HZ2  . LYS A  1 136 ? -4.241  16.621  43.932  1.00 0.00 ?  451 LYS A HZ2  1  
ATOM   2239   H  HZ3  . LYS A  1 136 ? -3.350  17.954  44.254  1.00 0.00 ?  451 LYS A HZ3  1  
ATOM   2240   N  N    . ASN A  1 137 ? 2.061   12.968  45.853  1.00 0.00 ?  452 ASN A N    1  
ATOM   2241   C  CA   . ASN A  1 137 ? 2.376   11.949  46.858  1.00 0.00 ?  452 ASN A CA   1  
ATOM   2242   C  C    . ASN A  1 137 ? 1.312   10.896  46.954  1.00 0.00 ?  452 ASN A C    1  
ATOM   2243   O  O    . ASN A  1 137 ? 0.082   11.098  46.951  1.00 0.00 ?  452 ASN A O    1  
ATOM   2244   C  CB   . ASN A  1 137 ? 2.856   12.599  48.149  1.00 0.00 ?  452 ASN A CB   1  
ATOM   2245   C  CG   . ASN A  1 137 ? 3.503   11.723  49.186  1.00 0.00 ?  452 ASN A CG   1  
ATOM   2246   O  OD1  . ASN A  1 137 ? 3.706   10.519  48.914  1.00 0.00 ?  452 ASN A OD1  1  
ATOM   2247   N  ND2  . ASN A  1 137 ? 3.992   12.353  50.298  1.00 0.00 ?  452 ASN A ND2  1  
ATOM   2248   H  H    . ASN A  1 137 ? 1.863   13.879  46.205  1.00 0.00 ?  452 ASN A H    1  
ATOM   2249   H  HA   . ASN A  1 137 ? 3.194   11.407  46.407  1.00 0.00 ?  452 ASN A HA   1  
ATOM   2250   H  HB2  . ASN A  1 137 ? 3.600   13.301  47.715  1.00 0.00 ?  452 ASN A HB2  1  
ATOM   2251   H  HB3  . ASN A  1 137 ? 2.116   13.251  48.659  1.00 0.00 ?  452 ASN A HB3  1  
ATOM   2252   H  HD21 . ASN A  1 137 ? 4.488   11.894  51.035  1.00 0.00 ?  452 ASN A HD21 1  
ATOM   2253   H  HD22 . ASN A  1 137 ? 3.672   13.280  50.496  1.00 0.00 ?  452 ASN A HD22 1  
ATOM   2254   N  N    . ILE A  1 138 ? 1.733   9.613   47.101  1.00 0.00 ?  453 ILE A N    1  
ATOM   2255   C  CA   . ILE A  1 138 ? 0.848   8.428   47.274  1.00 0.00 ?  453 ILE A CA   1  
ATOM   2256   C  C    . ILE A  1 138 ? -0.096  8.509   48.429  1.00 0.00 ?  453 ILE A C    1  
ATOM   2257   O  O    . ILE A  1 138 ? -1.199  8.054   48.258  1.00 0.00 ?  453 ILE A O    1  
ATOM   2258   C  CB   . ILE A  1 138 ? 1.609   7.124   47.148  1.00 0.00 ?  453 ILE A CB   1  
ATOM   2259   C  CG1  . ILE A  1 138 ? 0.641   5.946   46.647  1.00 0.00 ?  453 ILE A CG1  1  
ATOM   2260   C  CG2  . ILE A  1 138 ? 2.198   6.729   48.555  1.00 0.00 ?  453 ILE A CG2  1  
ATOM   2261   C  CD1  . ILE A  1 138 ? 1.374   4.737   46.096  1.00 0.00 ?  453 ILE A CD1  1  
ATOM   2262   H  H    . ILE A  1 138 ? 2.693   9.344   47.070  1.00 0.00 ?  453 ILE A H    1  
ATOM   2263   H  HA   . ILE A  1 138 ? 0.172   8.412   46.432  1.00 0.00 ?  453 ILE A HA   1  
ATOM   2264   H  HB   . ILE A  1 138 ? 2.483   7.300   46.485  1.00 0.00 ?  453 ILE A HB   1  
ATOM   2265   H  HG12 . ILE A  1 138 ? -0.218  5.675   47.297  1.00 0.00 ?  453 ILE A HG12 1  
ATOM   2266   H  HG13 . ILE A  1 138 ? 0.150   6.334   45.729  1.00 0.00 ?  453 ILE A HG13 1  
ATOM   2267   H  HG21 . ILE A  1 138 ? 1.431   6.665   49.357  1.00 0.00 ?  453 ILE A HG21 1  
ATOM   2268   H  HG22 . ILE A  1 138 ? 3.002   7.411   48.906  1.00 0.00 ?  453 ILE A HG22 1  
ATOM   2269   H  HG23 . ILE A  1 138 ? 2.571   5.685   48.487  1.00 0.00 ?  453 ILE A HG23 1  
ATOM   2270   H  HD11 . ILE A  1 138 ? 2.204   5.173   45.500  1.00 0.00 ?  453 ILE A HD11 1  
ATOM   2271   H  HD12 . ILE A  1 138 ? 0.727   4.149   45.411  1.00 0.00 ?  453 ILE A HD12 1  
ATOM   2272   H  HD13 . ILE A  1 138 ? 1.883   4.106   46.857  1.00 0.00 ?  453 ILE A HD13 1  
ATOM   2273   N  N    . LYS A  1 139 ? 0.345   9.069   49.542  1.00 0.00 ?  454 LYS A N    1  
ATOM   2274   C  CA   . LYS A  1 139 ? -0.325  9.384   50.830  1.00 0.00 ?  454 LYS A CA   1  
ATOM   2275   C  C    . LYS A  1 139 ? -1.724  10.060  50.550  1.00 0.00 ?  454 LYS A C    1  
ATOM   2276   O  O    . LYS A  1 139 ? -2.677  9.923   51.310  1.00 0.00 ?  454 LYS A O    1  
ATOM   2277   C  CB   . LYS A  1 139 ? 0.599   10.328  51.651  1.00 0.00 ?  454 LYS A CB   1  
ATOM   2278   C  CG   . LYS A  1 139 ? 2.030   9.791   51.810  1.00 0.00 ?  454 LYS A CG   1  
ATOM   2279   C  CD   . LYS A  1 139 ? 2.113   8.443   52.605  1.00 0.00 ?  454 LYS A CD   1  
ATOM   2280   C  CE   . LYS A  1 139 ? 3.569   7.965   52.736  1.00 0.00 ?  454 LYS A CE   1  
ATOM   2281   N  NZ   . LYS A  1 139 ? 3.578   6.668   53.506  1.00 0.00 1  454 LYS A NZ   1  
ATOM   2282   H  H    . LYS A  1 139 ? 1.273   9.417   49.427  1.00 0.00 ?  454 LYS A H    1  
ATOM   2283   H  HA   . LYS A  1 139 ? -0.475  8.459   51.367  1.00 0.00 ?  454 LYS A HA   1  
ATOM   2284   H  HB2  . LYS A  1 139 ? 0.627   11.396  51.345  1.00 0.00 ?  454 LYS A HB2  1  
ATOM   2285   H  HB3  . LYS A  1 139 ? 0.228   10.265  52.696  1.00 0.00 ?  454 LYS A HB3  1  
ATOM   2286   H  HG2  . LYS A  1 139 ? 2.525   9.669   50.822  1.00 0.00 ?  454 LYS A HG2  1  
ATOM   2287   H  HG3  . LYS A  1 139 ? 2.548   10.484  52.507  1.00 0.00 ?  454 LYS A HG3  1  
ATOM   2288   H  HD2  . LYS A  1 139 ? 1.590   8.636   53.566  1.00 0.00 ?  454 LYS A HD2  1  
ATOM   2289   H  HD3  . LYS A  1 139 ? 1.539   7.661   52.064  1.00 0.00 ?  454 LYS A HD3  1  
ATOM   2290   H  HE2  . LYS A  1 139 ? 3.975   7.845   51.709  1.00 0.00 ?  454 LYS A HE2  1  
ATOM   2291   H  HE3  . LYS A  1 139 ? 4.171   8.643   53.378  1.00 0.00 ?  454 LYS A HE3  1  
ATOM   2292   H  HZ1  . LYS A  1 139 ? 4.497   6.247   53.264  1.00 0.00 ?  454 LYS A HZ1  1  
ATOM   2293   H  HZ2  . LYS A  1 139 ? 2.829   6.061   53.117  1.00 0.00 ?  454 LYS A HZ2  1  
ATOM   2294   H  HZ3  . LYS A  1 139 ? 3.399   6.849   54.514  1.00 0.00 ?  454 LYS A HZ3  1  
ATOM   2295   N  N    . VAL A  1 140 ? -1.912  10.762  49.399  1.00 0.00 ?  455 VAL A N    1  
ATOM   2296   C  CA   . VAL A  1 140 ? -3.155  11.284  48.863  1.00 0.00 ?  455 VAL A CA   1  
ATOM   2297   C  C    . VAL A  1 140 ? -4.242  10.319  48.628  1.00 0.00 ?  455 VAL A C    1  
ATOM   2298   O  O    . VAL A  1 140 ? -5.436  10.545  48.786  1.00 0.00 ?  455 VAL A O    1  
ATOM   2299   C  CB   . VAL A  1 140 ? -3.001  12.001  47.495  1.00 0.00 ?  455 VAL A CB   1  
ATOM   2300   C  CG1  . VAL A  1 140 ? -4.304  12.691  47.060  1.00 0.00 ?  455 VAL A CG1  1  
ATOM   2301   C  CG2  . VAL A  1 140 ? -1.976  13.206  47.751  1.00 0.00 ?  455 VAL A CG2  1  
ATOM   2302   H  H    . VAL A  1 140 ? -1.165  10.824  48.741  1.00 0.00 ?  455 VAL A H    1  
ATOM   2303   H  HA   . VAL A  1 140 ? -3.565  11.946  49.611  1.00 0.00 ?  455 VAL A HA   1  
ATOM   2304   H  HB   . VAL A  1 140 ? -2.593  11.392  46.660  1.00 0.00 ?  455 VAL A HB   1  
ATOM   2305   H  HG11 . VAL A  1 140 ? -3.895  13.319  46.240  1.00 0.00 ?  455 VAL A HG11 1  
ATOM   2306   H  HG12 . VAL A  1 140 ? -4.775  13.349  47.822  1.00 0.00 ?  455 VAL A HG12 1  
ATOM   2307   H  HG13 . VAL A  1 140 ? -5.055  11.922  46.779  1.00 0.00 ?  455 VAL A HG13 1  
ATOM   2308   H  HG21 . VAL A  1 140 ? -0.996  12.830  48.116  1.00 0.00 ?  455 VAL A HG21 1  
ATOM   2309   H  HG22 . VAL A  1 140 ? -2.376  13.913  48.508  1.00 0.00 ?  455 VAL A HG22 1  
ATOM   2310   H  HG23 . VAL A  1 140 ? -1.785  13.637  46.745  1.00 0.00 ?  455 VAL A HG23 1  
ATOM   2311   N  N    . TRP A  1 141 ? -3.838  9.119   48.236  1.00 0.00 ?  456 TRP A N    1  
ATOM   2312   C  CA   . TRP A  1 141 ? -4.718  7.988   48.136  1.00 0.00 ?  456 TRP A CA   1  
ATOM   2313   C  C    . TRP A  1 141 ? -4.585  7.354   49.509  1.00 0.00 ?  456 TRP A C    1  
ATOM   2314   O  O    . TRP A  1 141 ? -3.638  6.611   49.830  1.00 0.00 ?  456 TRP A O    1  
ATOM   2315   C  CB   . TRP A  1 141 ? -4.343  6.961   47.008  1.00 0.00 ?  456 TRP A CB   1  
ATOM   2316   C  CG   . TRP A  1 141 ? -4.344  7.409   45.581  1.00 0.00 ?  456 TRP A CG   1  
ATOM   2317   C  CD1  . TRP A  1 141 ? -3.367  7.908   44.848  1.00 0.00 ?  456 TRP A CD1  1  
ATOM   2318   C  CD2  . TRP A  1 141 ? -5.494  7.209   44.753  1.00 0.00 ?  456 TRP A CD2  1  
ATOM   2319   N  NE1  . TRP A  1 141 ? -3.827  8.032   43.551  1.00 0.00 ?  456 TRP A NE1  1  
ATOM   2320   C  CE2  . TRP A  1 141 ? -5.087  7.494   43.492  1.00 0.00 ?  456 TRP A CE2  1  
ATOM   2321   C  CE3  . TRP A  1 141 ? -6.811  6.729   45.042  1.00 0.00 ?  456 TRP A CE3  1  
ATOM   2322   C  CZ2  . TRP A  1 141 ? -6.001  7.467   42.415  1.00 0.00 ?  456 TRP A CZ2  1  
ATOM   2323   C  CZ3  . TRP A  1 141 ? -7.740  6.646   43.946  1.00 0.00 ?  456 TRP A CZ3  1  
ATOM   2324   C  CH2  . TRP A  1 141 ? -7.262  6.900   42.671  1.00 0.00 ?  456 TRP A CH2  1  
ATOM   2325   H  H    . TRP A  1 141 ? -2.850  9.046   48.124  1.00 0.00 ?  456 TRP A H    1  
ATOM   2326   H  HA   . TRP A  1 141 ? -5.710  8.361   47.931  1.00 0.00 ?  456 TRP A HA   1  
ATOM   2327   H  HB2  . TRP A  1 141 ? -3.306  6.633   47.239  1.00 0.00 ?  456 TRP A HB2  1  
ATOM   2328   H  HB3  . TRP A  1 141 ? -5.015  6.077   47.027  1.00 0.00 ?  456 TRP A HB3  1  
ATOM   2329   H  HD1  . TRP A  1 141 ? -2.380  8.171   45.198  1.00 0.00 ?  456 TRP A HD1  1  
ATOM   2330   H  HE1  . TRP A  1 141 ? -3.252  8.296   42.808  1.00 0.00 ?  456 TRP A HE1  1  
ATOM   2331   H  HE3  . TRP A  1 141 ? -7.044  6.385   46.039  1.00 0.00 ?  456 TRP A HE3  1  
ATOM   2332   H  HZ2  . TRP A  1 141 ? -5.593  7.656   41.433  1.00 0.00 ?  456 TRP A HZ2  1  
ATOM   2333   H  HZ3  . TRP A  1 141 ? -8.716  6.184   43.973  1.00 0.00 ?  456 TRP A HZ3  1  
ATOM   2334   H  HH2  . TRP A  1 141 ? -7.924  6.823   41.822  1.00 0.00 ?  456 TRP A HH2  1  
ATOM   2335   N  N    . GLU A  1 142 ? -5.539  7.585   50.378  1.00 0.00 ?  457 GLU A N    1  
ATOM   2336   C  CA   . GLU A  1 142 ? -5.549  7.407   51.788  1.00 0.00 ?  457 GLU A CA   1  
ATOM   2337   C  C    . GLU A  1 142 ? -5.601  5.917   52.229  1.00 0.00 ?  457 GLU A C    1  
ATOM   2338   O  O    . GLU A  1 142 ? -6.629  5.266   52.158  1.00 0.00 ?  457 GLU A O    1  
ATOM   2339   C  CB   . GLU A  1 142 ? -6.607  8.323   52.473  1.00 0.00 ?  457 GLU A CB   1  
ATOM   2340   C  CG   . GLU A  1 142 ? -6.085  9.719   52.668  1.00 0.00 ?  457 GLU A CG   1  
ATOM   2341   C  CD   . GLU A  1 142 ? -7.052  10.530  53.467  1.00 0.00 ?  457 GLU A CD   1  
ATOM   2342   O  OE1  . GLU A  1 142 ? -7.090  10.582  54.724  1.00 0.00 ?  457 GLU A OE1  1  
ATOM   2343   O  OE2  . GLU A  1 142 ? -7.835  11.207  52.775  1.00 0.00 -1 457 GLU A OE2  1  
ATOM   2344   H  H    . GLU A  1 142 ? -6.280  8.115   49.972  1.00 0.00 ?  457 GLU A H    1  
ATOM   2345   H  HA   . GLU A  1 142 ? -4.589  7.821   52.058  1.00 0.00 ?  457 GLU A HA   1  
ATOM   2346   H  HB2  . GLU A  1 142 ? -7.512  8.300   51.829  1.00 0.00 ?  457 GLU A HB2  1  
ATOM   2347   H  HB3  . GLU A  1 142 ? -6.924  7.829   53.416  1.00 0.00 ?  457 GLU A HB3  1  
ATOM   2348   H  HG2  . GLU A  1 142 ? -5.098  9.646   53.174  1.00 0.00 ?  457 GLU A HG2  1  
ATOM   2349   H  HG3  . GLU A  1 142 ? -5.831  10.127  51.667  1.00 0.00 ?  457 GLU A HG3  1  
ATOM   2350   N  N    . GLY A  1 143 ? -4.474  5.492   52.735  1.00 0.00 ?  458 GLY A N    1  
ATOM   2351   C  CA   . GLY A  1 143 ? -4.244  4.171   53.238  1.00 0.00 ?  458 GLY A CA   1  
ATOM   2352   C  C    . GLY A  1 143 ? -3.611  3.215   52.328  1.00 0.00 ?  458 GLY A C    1  
ATOM   2353   O  O    . GLY A  1 143 ? -3.623  2.057   52.615  1.00 0.00 ?  458 GLY A O    1  
ATOM   2354   H  H    . GLY A  1 143 ? -3.735  6.156   52.826  1.00 0.00 ?  458 GLY A H    1  
ATOM   2355   H  HA2  . GLY A  1 143 ? -3.602  4.289   54.098  1.00 0.00 ?  458 GLY A HA2  1  
ATOM   2356   H  HA3  . GLY A  1 143 ? -5.191  3.765   53.560  1.00 0.00 ?  458 GLY A HA3  1  
ATOM   2357   N  N    . ILE A  1 144 ? -2.955  3.634   51.174  1.00 0.00 ?  459 ILE A N    1  
ATOM   2358   C  CA   . ILE A  1 144 ? -2.325  2.654   50.209  1.00 0.00 ?  459 ILE A CA   1  
ATOM   2359   C  C    . ILE A  1 144 ? -0.798  2.433   50.595  1.00 0.00 ?  459 ILE A C    1  
ATOM   2360   O  O    . ILE A  1 144 ? -0.103  3.467   50.813  1.00 0.00 ?  459 ILE A O    1  
ATOM   2361   C  CB   . ILE A  1 144 ? -2.407  3.229   48.670  1.00 0.00 ?  459 ILE A CB   1  
ATOM   2362   C  CG1  . ILE A  1 144 ? -3.831  3.466   48.142  1.00 0.00 ?  459 ILE A CG1  1  
ATOM   2363   C  CG2  . ILE A  1 144 ? -1.563  2.311   47.684  1.00 0.00 ?  459 ILE A CG2  1  
ATOM   2364   C  CD1  . ILE A  1 144 ? -4.706  2.203   48.274  1.00 0.00 ?  459 ILE A CD1  1  
ATOM   2365   H  H    . ILE A  1 144 ? -3.005  4.613   50.994  1.00 0.00 ?  459 ILE A H    1  
ATOM   2366   H  HA   . ILE A  1 144 ? -2.830  1.700   50.250  1.00 0.00 ?  459 ILE A HA   1  
ATOM   2367   H  HB   . ILE A  1 144 ? -1.900  4.217   48.701  1.00 0.00 ?  459 ILE A HB   1  
ATOM   2368   H  HG12 . ILE A  1 144 ? -4.322  4.273   48.727  1.00 0.00 ?  459 ILE A HG12 1  
ATOM   2369   H  HG13 . ILE A  1 144 ? -3.779  3.863   47.106  1.00 0.00 ?  459 ILE A HG13 1  
ATOM   2370   H  HG21 . ILE A  1 144 ? -1.717  2.703   46.655  1.00 0.00 ?  459 ILE A HG21 1  
ATOM   2371   H  HG22 . ILE A  1 144 ? -2.018  1.301   47.607  1.00 0.00 ?  459 ILE A HG22 1  
ATOM   2372   H  HG23 . ILE A  1 144 ? -0.498  2.448   47.967  1.00 0.00 ?  459 ILE A HG23 1  
ATOM   2373   H  HD11 . ILE A  1 144 ? -4.447  1.263   47.741  1.00 0.00 ?  459 ILE A HD11 1  
ATOM   2374   H  HD12 . ILE A  1 144 ? -5.763  2.420   48.010  1.00 0.00 ?  459 ILE A HD12 1  
ATOM   2375   H  HD13 . ILE A  1 144 ? -4.613  1.931   49.347  1.00 0.00 ?  459 ILE A HD13 1  
ATOM   2376   N  N    . PRO A  1 145 ? -0.101  1.261   50.670  1.00 0.00 ?  460 PRO A N    1  
ATOM   2377   C  CA   . PRO A  1 145 ? 1.328   1.103   50.561  1.00 0.00 ?  460 PRO A CA   1  
ATOM   2378   C  C    . PRO A  1 145 ? 2.092   1.777   49.434  1.00 0.00 ?  460 PRO A C    1  
ATOM   2379   O  O    . PRO A  1 145 ? 1.660   1.759   48.281  1.00 0.00 ?  460 PRO A O    1  
ATOM   2380   C  CB   . PRO A  1 145 ? 1.497   -0.438  50.533  1.00 0.00 ?  460 PRO A CB   1  
ATOM   2381   C  CG   . PRO A  1 145 ? 0.158   -0.985  49.921  1.00 0.00 ?  460 PRO A CG   1  
ATOM   2382   C  CD   . PRO A  1 145 ? -0.774  0.012   50.567  1.00 0.00 ?  460 PRO A CD   1  
ATOM   2383   H  HA   . PRO A  1 145 ? 1.664   1.579   51.470  1.00 0.00 ?  460 PRO A HA   1  
ATOM   2384   H  HB2  . PRO A  1 145 ? 2.290   -0.876  49.889  1.00 0.00 ?  460 PRO A HB2  1  
ATOM   2385   H  HB3  . PRO A  1 145 ? 1.518   -0.844  51.566  1.00 0.00 ?  460 PRO A HB3  1  
ATOM   2386   H  HG2  . PRO A  1 145 ? 0.123   -0.904  48.814  1.00 0.00 ?  460 PRO A HG2  1  
ATOM   2387   H  HG3  . PRO A  1 145 ? 0.114   -2.028  50.303  1.00 0.00 ?  460 PRO A HG3  1  
ATOM   2388   H  HD2  . PRO A  1 145 ? -1.620  0.115   49.854  1.00 0.00 ?  460 PRO A HD2  1  
ATOM   2389   H  HD3  . PRO A  1 145 ? -1.084  -0.261  51.598  1.00 0.00 ?  460 PRO A HD3  1  
ATOM   2390   N  N    . GLU A  1 146 ? 3.246   2.306   49.743  1.00 0.00 ?  461 GLU A N    1  
ATOM   2391   C  CA   . GLU A  1 146 ? 4.275   2.747   48.690  1.00 0.00 ?  461 GLU A CA   1  
ATOM   2392   C  C    . GLU A  1 146 ? 4.800   1.705   47.765  1.00 0.00 ?  461 GLU A C    1  
ATOM   2393   O  O    . GLU A  1 146 ? 5.067   0.614   48.291  1.00 0.00 ?  461 GLU A O    1  
ATOM   2394   C  CB   . GLU A  1 146 ? 5.364   3.609   49.324  1.00 0.00 ?  461 GLU A CB   1  
ATOM   2395   C  CG   . GLU A  1 146 ? 4.914   4.996   49.851  1.00 0.00 ?  461 GLU A CG   1  
ATOM   2396   C  CD   . GLU A  1 146 ? 5.794   5.687   50.880  1.00 0.00 ?  461 GLU A CD   1  
ATOM   2397   O  OE1  . GLU A  1 146 ? 6.684   6.533   50.515  1.00 0.00 ?  461 GLU A OE1  1  
ATOM   2398   O  OE2  . GLU A  1 146 ? 5.529   5.410   52.079  1.00 0.00 -1 461 GLU A OE2  1  
ATOM   2399   H  H    . GLU A  1 146 ? 3.418   2.326   50.725  1.00 0.00 ?  461 GLU A H    1  
ATOM   2400   H  HA   . GLU A  1 146 ? 3.827   3.471   48.025  1.00 0.00 ?  461 GLU A HA   1  
ATOM   2401   H  HB2  . GLU A  1 146 ? 5.757   3.013   50.174  1.00 0.00 ?  461 GLU A HB2  1  
ATOM   2402   H  HB3  . GLU A  1 146 ? 6.233   3.788   48.655  1.00 0.00 ?  461 GLU A HB3  1  
ATOM   2403   H  HG2  . GLU A  1 146 ? 4.865   5.749   49.035  1.00 0.00 ?  461 GLU A HG2  1  
ATOM   2404   H  HG3  . GLU A  1 146 ? 3.887   4.907   50.266  1.00 0.00 ?  461 GLU A HG3  1  
ATOM   2405   N  N    . SER A  1 147 ? 5.002   1.980   46.506  1.00 0.00 ?  462 SER A N    1  
ATOM   2406   C  CA   . SER A  1 147 ? 5.024   0.902   45.484  1.00 0.00 ?  462 SER A CA   1  
ATOM   2407   C  C    . SER A  1 147 ? 3.744   -0.066  45.394  1.00 0.00 ?  462 SER A C    1  
ATOM   2408   O  O    . SER A  1 147 ? 3.988   -1.228  45.652  1.00 0.00 ?  462 SER A O    1  
ATOM   2409   C  CB   . SER A  1 147 ? 6.293   0.046   45.454  1.00 0.00 ?  462 SER A CB   1  
ATOM   2410   O  OG   . SER A  1 147 ? 7.527   0.701   45.122  1.00 0.00 ?  462 SER A OG   1  
ATOM   2411   H  H    . SER A  1 147 ? 4.998   2.943   46.248  1.00 0.00 ?  462 SER A H    1  
ATOM   2412   H  HA   . SER A  1 147 ? 5.096   1.460   44.562  1.00 0.00 ?  462 SER A HA   1  
ATOM   2413   H  HB2  . SER A  1 147 ? 6.473   -0.417  46.448  1.00 0.00 ?  462 SER A HB2  1  
ATOM   2414   H  HB3  . SER A  1 147 ? 6.179   -0.819  44.767  1.00 0.00 ?  462 SER A HB3  1  
ATOM   2415   H  HG   . SER A  1 147 ? 7.472   0.800   44.168  1.00 0.00 ?  462 SER A HG   1  
ATOM   2416   N  N    . PRO A  1 148 ? 2.480   0.290   45.104  1.00 0.00 ?  463 PRO A N    1  
ATOM   2417   C  CA   . PRO A  1 148 ? 1.512   -0.639  44.581  1.00 0.00 ?  463 PRO A CA   1  
ATOM   2418   C  C    . PRO A  1 148 ? 2.039   -1.376  43.326  1.00 0.00 ?  463 PRO A C    1  
ATOM   2419   O  O    . PRO A  1 148 ? 2.630   -0.752  42.434  1.00 0.00 ?  463 PRO A O    1  
ATOM   2420   C  CB   . PRO A  1 148 ? 0.287   0.280   44.340  1.00 0.00 ?  463 PRO A CB   1  
ATOM   2421   C  CG   . PRO A  1 148 ? 0.925   1.581   43.839  1.00 0.00 ?  463 PRO A CG   1  
ATOM   2422   C  CD   . PRO A  1 148 ? 2.213   1.674   44.603  1.00 0.00 ?  463 PRO A CD   1  
ATOM   2423   H  HA   . PRO A  1 148 ? 1.433   -1.399  45.344  1.00 0.00 ?  463 PRO A HA   1  
ATOM   2424   H  HB2  . PRO A  1 148 ? -0.433  -0.200  43.643  1.00 0.00 ?  463 PRO A HB2  1  
ATOM   2425   H  HB3  . PRO A  1 148 ? -0.323  0.579   45.220  1.00 0.00 ?  463 PRO A HB3  1  
ATOM   2426   H  HG2  . PRO A  1 148 ? 1.189   1.560   42.760  1.00 0.00 ?  463 PRO A HG2  1  
ATOM   2427   H  HG3  . PRO A  1 148 ? 0.273   2.434   44.124  1.00 0.00 ?  463 PRO A HG3  1  
ATOM   2428   H  HD2  . PRO A  1 148 ? 3.004   2.132   43.971  1.00 0.00 ?  463 PRO A HD2  1  
ATOM   2429   H  HD3  . PRO A  1 148 ? 2.006   2.249   45.531  1.00 0.00 ?  463 PRO A HD3  1  
ATOM   2430   N  N    . ARG A  1 149 ? 1.905   -2.684  43.211  1.00 0.00 ?  464 ARG A N    1  
ATOM   2431   C  CA   . ARG A  1 149 ? 2.478   -3.441  42.191  1.00 0.00 ?  464 ARG A CA   1  
ATOM   2432   C  C    . ARG A  1 149 ? 1.469   -3.764  41.089  1.00 0.00 ?  464 ARG A C    1  
ATOM   2433   O  O    . ARG A  1 149 ? 1.926   -4.153  39.980  1.00 0.00 ?  464 ARG A O    1  
ATOM   2434   C  CB   . ARG A  1 149 ? 2.921   -4.763  42.774  1.00 0.00 ?  464 ARG A CB   1  
ATOM   2435   C  CG   . ARG A  1 149 ? 3.951   -4.671  43.976  1.00 0.00 ?  464 ARG A CG   1  
ATOM   2436   C  CD   . ARG A  1 149 ? 5.305   -4.052  43.587  1.00 0.00 ?  464 ARG A CD   1  
ATOM   2437   N  NE   . ARG A  1 149 ? 6.269   -4.298  44.710  1.00 0.00 ?  464 ARG A NE   1  
ATOM   2438   C  CZ   . ARG A  1 149 ? 7.396   -3.595  44.880  1.00 0.00 ?  464 ARG A CZ   1  
ATOM   2439   N  NH1  . ARG A  1 149 ? 8.216   -3.972  45.854  1.00 0.00 1  464 ARG A NH1  1  
ATOM   2440   N  NH2  . ARG A  1 149 ? 7.861   -2.623  44.123  1.00 0.00 ?  464 ARG A NH2  1  
ATOM   2441   H  H    . ARG A  1 149 ? 1.137   -3.093  43.698  1.00 0.00 ?  464 ARG A H    1  
ATOM   2442   H  HA   . ARG A  1 149 ? 3.280   -2.880  41.734  1.00 0.00 ?  464 ARG A HA   1  
ATOM   2443   H  HB2  . ARG A  1 149 ? 2.034   -5.305  43.166  1.00 0.00 ?  464 ARG A HB2  1  
ATOM   2444   H  HB3  . ARG A  1 149 ? 3.278   -5.435  41.964  1.00 0.00 ?  464 ARG A HB3  1  
ATOM   2445   H  HG2  . ARG A  1 149 ? 3.463   -4.094  44.790  1.00 0.00 ?  464 ARG A HG2  1  
ATOM   2446   H  HG3  . ARG A  1 149 ? 4.238   -5.672  44.362  1.00 0.00 ?  464 ARG A HG3  1  
ATOM   2447   H  HD2  . ARG A  1 149 ? 5.722   -4.556  42.689  1.00 0.00 ?  464 ARG A HD2  1  
ATOM   2448   H  HD3  . ARG A  1 149 ? 5.255   -2.949  43.460  1.00 0.00 ?  464 ARG A HD3  1  
ATOM   2449   H  HE   . ARG A  1 149 ? 6.053   -4.986  45.402  1.00 0.00 ?  464 ARG A HE   1  
ATOM   2450   H  HH11 . ARG A  1 149 ? 8.045   -4.777  46.421  1.00 0.00 ?  464 ARG A HH11 1  
ATOM   2451   H  HH12 . ARG A  1 149 ? 9.171   -3.771  45.638  1.00 0.00 ?  464 ARG A HH12 1  
ATOM   2452   H  HH21 . ARG A  1 149 ? 8.690   -2.161  44.438  1.00 0.00 ?  464 ARG A HH21 1  
ATOM   2453   H  HH22 . ARG A  1 149 ? 7.676   -2.563  43.142  1.00 0.00 ?  464 ARG A HH22 1  
ATOM   2454   N  N    . GLY A  1 150 ? 0.159   -3.624  41.396  1.00 0.00 ?  465 GLY A N    1  
ATOM   2455   C  CA   . GLY A  1 150 ? -0.906  -3.698  40.442  1.00 0.00 ?  465 GLY A CA   1  
ATOM   2456   C  C    . GLY A  1 150 ? -2.063  -2.920  41.007  1.00 0.00 ?  465 GLY A C    1  
ATOM   2457   O  O    . GLY A  1 150 ? -2.076  -2.490  42.177  1.00 0.00 ?  465 GLY A O    1  
ATOM   2458   H  H    . GLY A  1 150 ? -0.101  -3.281  42.295  1.00 0.00 ?  465 GLY A H    1  
ATOM   2459   H  HA2  . GLY A  1 150 ? -0.539  -3.193  39.561  1.00 0.00 ?  465 GLY A HA2  1  
ATOM   2460   H  HA3  . GLY A  1 150 ? -1.202  -4.733  40.353  1.00 0.00 ?  465 GLY A HA3  1  
ATOM   2461   N  N    . SER A  1 151 ? -3.157  -2.748  40.215  1.00 0.00 ?  466 SER A N    1  
ATOM   2462   C  CA   . SER A  1 151 ? -4.320  -2.041  40.552  1.00 0.00 ?  466 SER A CA   1  
ATOM   2463   C  C    . SER A  1 151 ? -5.443  -1.967  39.488  1.00 0.00 ?  466 SER A C    1  
ATOM   2464   O  O    . SER A  1 151 ? -5.247  -1.561  38.328  1.00 0.00 ?  466 SER A O    1  
ATOM   2465   C  CB   . SER A  1 151 ? -4.005  -0.563  41.024  1.00 0.00 ?  466 SER A CB   1  
ATOM   2466   O  OG   . SER A  1 151 ? -3.240  0.087   39.996  1.00 0.00 ?  466 SER A OG   1  
ATOM   2467   H  H    . SER A  1 151 ? -3.183  -3.201  39.328  1.00 0.00 ?  466 SER A H    1  
ATOM   2468   H  HA   . SER A  1 151 ? -4.784  -2.567  41.374  1.00 0.00 ?  466 SER A HA   1  
ATOM   2469   H  HB2  . SER A  1 151 ? -4.876  0.095   41.234  1.00 0.00 ?  466 SER A HB2  1  
ATOM   2470   H  HB3  . SER A  1 151 ? -3.461  -0.546  41.992  1.00 0.00 ?  466 SER A HB3  1  
ATOM   2471   H  HG   . SER A  1 151 ? -3.529  -0.156  39.114  1.00 0.00 ?  466 SER A HG   1  
ATOM   2472   N  N    . PHE A  1 152 ? -6.701  -2.261  39.906  1.00 0.00 ?  467 PHE A N    1  
ATOM   2473   C  CA   . PHE A  1 152 ? -7.801  -2.167  38.935  1.00 0.00 ?  467 PHE A CA   1  
ATOM   2474   C  C    . PHE A  1 152 ? -9.046  -1.997  39.768  1.00 0.00 ?  467 PHE A C    1  
ATOM   2475   O  O    . PHE A  1 152 ? -9.022  -2.097  40.960  1.00 0.00 ?  467 PHE A O    1  
ATOM   2476   C  CB   . PHE A  1 152 ? -7.853  -3.398  37.939  1.00 0.00 ?  467 PHE A CB   1  
ATOM   2477   C  CG   . PHE A  1 152 ? -7.863  -4.696  38.691  1.00 0.00 ?  467 PHE A CG   1  
ATOM   2478   C  CD1  . PHE A  1 152 ? -9.060  -5.176  39.237  1.00 0.00 ?  467 PHE A CD1  1  
ATOM   2479   C  CD2  . PHE A  1 152 ? -6.727  -5.493  38.871  1.00 0.00 ?  467 PHE A CD2  1  
ATOM   2480   C  CE1  . PHE A  1 152 ? -9.098  -6.196  40.118  1.00 0.00 ?  467 PHE A CE1  1  
ATOM   2481   C  CE2  . PHE A  1 152 ? -6.788  -6.684  39.655  1.00 0.00 ?  467 PHE A CE2  1  
ATOM   2482   C  CZ   . PHE A  1 152 ? -7.952  -6.952  40.374  1.00 0.00 ?  467 PHE A CZ   1  
ATOM   2483   H  H    . PHE A  1 152 ? -6.846  -2.563  40.846  1.00 0.00 ?  467 PHE A H    1  
ATOM   2484   H  HA   . PHE A  1 152 ? -7.837  -1.224  38.410  1.00 0.00 ?  467 PHE A HA   1  
ATOM   2485   H  HB2  . PHE A  1 152 ? -8.793  -3.356  37.348  1.00 0.00 ?  467 PHE A HB2  1  
ATOM   2486   H  HB3  . PHE A  1 152 ? -6.963  -3.340  37.277  1.00 0.00 ?  467 PHE A HB3  1  
ATOM   2487   H  HD1  . PHE A  1 152 ? -9.924  -4.542  39.103  1.00 0.00 ?  467 PHE A HD1  1  
ATOM   2488   H  HD2  . PHE A  1 152 ? -5.729  -5.308  38.504  1.00 0.00 ?  467 PHE A HD2  1  
ATOM   2489   H  HE1  . PHE A  1 152 ? -9.992  -6.383  40.693  1.00 0.00 ?  467 PHE A HE1  1  
ATOM   2490   H  HE2  . PHE A  1 152 ? -5.877  -7.241  39.817  1.00 0.00 ?  467 PHE A HE2  1  
ATOM   2491   H  HZ   . PHE A  1 152 ? -7.990  -7.761  41.089  1.00 0.00 ?  467 PHE A HZ   1  
ATOM   2492   N  N    . MET A  1 153 ? -10.131 -1.466  39.169  1.00 0.00 ?  468 MET A N    1  
ATOM   2493   C  CA   . MET A  1 153 ? -11.414 -1.267  39.767  1.00 0.00 ?  468 MET A CA   1  
ATOM   2494   C  C    . MET A  1 153 ? -12.281 -2.499  39.751  1.00 0.00 ?  468 MET A C    1  
ATOM   2495   O  O    . MET A  1 153 ? -12.208 -3.374  38.905  1.00 0.00 ?  468 MET A O    1  
ATOM   2496   C  CB   . MET A  1 153 ? -12.226 -0.138  39.128  1.00 0.00 ?  468 MET A CB   1  
ATOM   2497   C  CG   . MET A  1 153 ? -11.554 1.249   39.243  1.00 0.00 ?  468 MET A CG   1  
ATOM   2498   S  SD   . MET A  1 153 ? -12.337 2.624   38.375  1.00 0.00 ?  468 MET A SD   1  
ATOM   2499   C  CE   . MET A  1 153 ? -13.623 3.125   39.590  1.00 0.00 ?  468 MET A CE   1  
ATOM   2500   H  H    . MET A  1 153 ? -10.181 -1.332  38.183  1.00 0.00 ?  468 MET A H    1  
ATOM   2501   H  HA   . MET A  1 153 ? -11.165 -0.963  40.774  1.00 0.00 ?  468 MET A HA   1  
ATOM   2502   H  HB2  . MET A  1 153 ? -12.434 -0.399  38.068  1.00 0.00 ?  468 MET A HB2  1  
ATOM   2503   H  HB3  . MET A  1 153 ? -13.138 0.074   39.725  1.00 0.00 ?  468 MET A HB3  1  
ATOM   2504   H  HG2  . MET A  1 153 ? -11.304 1.522   40.290  1.00 0.00 ?  468 MET A HG2  1  
ATOM   2505   H  HG3  . MET A  1 153 ? -10.678 1.019   38.600  1.00 0.00 ?  468 MET A HG3  1  
ATOM   2506   H  HE1  . MET A  1 153 ? -14.352 3.913   39.304  1.00 0.00 ?  468 MET A HE1  1  
ATOM   2507   H  HE2  . MET A  1 153 ? -13.151 3.430   40.548  1.00 0.00 ?  468 MET A HE2  1  
ATOM   2508   H  HE3  . MET A  1 153 ? -14.330 2.300   39.820  1.00 0.00 ?  468 MET A HE3  1  
ATOM   2509   N  N    . GLY A  1 154 ? -13.288 -2.569  40.658  1.00 0.00 ?  469 GLY A N    1  
ATOM   2510   C  CA   . GLY A  1 154 ? -14.429 -3.495  40.598  1.00 0.00 ?  469 GLY A CA   1  
ATOM   2511   C  C    . GLY A  1 154 ? -15.514 -3.214  39.645  1.00 0.00 ?  469 GLY A C    1  
ATOM   2512   O  O    . GLY A  1 154 ? -15.641 -2.122  39.076  1.00 0.00 ?  469 GLY A O    1  
ATOM   2513   H  H    . GLY A  1 154 ? -13.267 -1.934  41.426  1.00 0.00 ?  469 GLY A H    1  
ATOM   2514   H  HA2  . GLY A  1 154 ? -14.024 -4.480  40.416  1.00 0.00 ?  469 GLY A HA2  1  
ATOM   2515   H  HA3  . GLY A  1 154 ? -14.832 -3.540  41.599  1.00 0.00 ?  469 GLY A HA3  1  
ATOM   2516   N  N    . SER A  1 155 ? -16.442 -4.146  39.327  1.00 0.00 ?  470 SER A N    1  
ATOM   2517   C  CA   . SER A  1 155 ? -17.442 -4.308  38.310  1.00 0.00 ?  470 SER A CA   1  
ATOM   2518   C  C    . SER A  1 155 ? -18.375 -3.129  38.224  1.00 0.00 ?  470 SER A C    1  
ATOM   2519   O  O    . SER A  1 155 ? -18.791 -2.690  37.153  1.00 0.00 ?  470 SER A O    1  
ATOM   2520   C  CB   . SER A  1 155 ? -18.233 -5.628  38.436  1.00 0.00 ?  470 SER A CB   1  
ATOM   2521   O  OG   . SER A  1 155 ? -19.032 -6.019  37.285  1.00 0.00 ?  470 SER A OG   1  
ATOM   2522   H  H    . SER A  1 155 ? -16.519 -5.042  39.756  1.00 0.00 ?  470 SER A H    1  
ATOM   2523   H  HA   . SER A  1 155 ? -16.940 -4.396  37.358  1.00 0.00 ?  470 SER A HA   1  
ATOM   2524   H  HB2  . SER A  1 155 ? -17.438 -6.395  38.551  1.00 0.00 ?  470 SER A HB2  1  
ATOM   2525   H  HB3  . SER A  1 155 ? -18.816 -5.687  39.380  1.00 0.00 ?  470 SER A HB3  1  
ATOM   2526   H  HG   . SER A  1 155 ? -19.765 -5.420  37.443  1.00 0.00 ?  470 SER A HG   1  
ATOM   2527   N  N    . ASP A  1 156 ? -18.707 -2.638  39.358  1.00 0.00 ?  471 ASP A N    1  
ATOM   2528   C  CA   . ASP A  1 156 ? -19.711 -1.644  39.584  1.00 0.00 ?  471 ASP A CA   1  
ATOM   2529   C  C    . ASP A  1 156 ? -19.162 -0.310  39.927  1.00 0.00 ?  471 ASP A C    1  
ATOM   2530   O  O    . ASP A  1 156 ? -19.891 0.585   40.199  1.00 0.00 ?  471 ASP A O    1  
ATOM   2531   C  CB   . ASP A  1 156 ? -20.834 -2.175  40.568  1.00 0.00 ?  471 ASP A CB   1  
ATOM   2532   C  CG   . ASP A  1 156 ? -20.353 -2.527  41.960  1.00 0.00 ?  471 ASP A CG   1  
ATOM   2533   O  OD1  . ASP A  1 156 ? -19.136 -2.656  42.144  1.00 0.00 ?  471 ASP A OD1  1  
ATOM   2534   O  OD2  . ASP A  1 156 ? -21.215 -2.607  42.870  1.00 0.00 -1 471 ASP A OD2  1  
ATOM   2535   H  H    . ASP A  1 156 ? -18.236 -3.020  40.149  1.00 0.00 ?  471 ASP A H    1  
ATOM   2536   H  HA   . ASP A  1 156 ? -20.287 -1.454  38.691  1.00 0.00 ?  471 ASP A HA   1  
ATOM   2537   H  HB2  . ASP A  1 156 ? -21.656 -1.428  40.565  1.00 0.00 ?  471 ASP A HB2  1  
ATOM   2538   H  HB3  . ASP A  1 156 ? -21.260 -3.074  40.074  1.00 0.00 ?  471 ASP A HB3  1  
ATOM   2539   N  N    . GLU A  1 157 ? -17.803 -0.228  39.778  1.00 0.00 ?  472 GLU A N    1  
ATOM   2540   C  CA   . GLU A  1 157 ? -17.096 1.019   39.845  1.00 0.00 ?  472 GLU A CA   1  
ATOM   2541   C  C    . GLU A  1 157 ? -17.015 1.586   41.260  1.00 0.00 ?  472 GLU A C    1  
ATOM   2542   O  O    . GLU A  1 157 ? -16.748 2.787   41.309  1.00 0.00 ?  472 GLU A O    1  
ATOM   2543   C  CB   . GLU A  1 157 ? -17.711 2.054   38.798  1.00 0.00 ?  472 GLU A CB   1  
ATOM   2544   C  CG   . GLU A  1 157 ? -17.834 1.556   37.367  1.00 0.00 ?  472 GLU A CG   1  
ATOM   2545   C  CD   . GLU A  1 157 ? -18.808 2.092   36.321  1.00 0.00 ?  472 GLU A CD   1  
ATOM   2546   O  OE1  . GLU A  1 157 ? -19.054 1.395   35.302  1.00 0.00 ?  472 GLU A OE1  1  
ATOM   2547   O  OE2  . GLU A  1 157 ? -19.381 3.194   36.598  1.00 0.00 -1 472 GLU A OE2  1  
ATOM   2548   H  H    . GLU A  1 157 ? -17.174 -0.990  39.645  1.00 0.00 ?  472 GLU A H    1  
ATOM   2549   H  HA   . GLU A  1 157 ? -16.095 0.799   39.505  1.00 0.00 ?  472 GLU A HA   1  
ATOM   2550   H  HB2  . GLU A  1 157 ? -18.553 2.586   39.290  1.00 0.00 ?  472 GLU A HB2  1  
ATOM   2551   H  HB3  . GLU A  1 157 ? -16.956 2.858   38.662  1.00 0.00 ?  472 GLU A HB3  1  
ATOM   2552   H  HG2  . GLU A  1 157 ? -16.827 1.479   36.904  1.00 0.00 ?  472 GLU A HG2  1  
ATOM   2553   H  HG3  . GLU A  1 157 ? -18.163 0.507   37.526  1.00 0.00 ?  472 GLU A HG3  1  
ATOM   2554   N  N    . VAL A  1 158 ? -17.330 0.858   42.308  1.00 0.00 ?  473 VAL A N    1  
ATOM   2555   C  CA   . VAL A  1 158 ? -17.428 1.437   43.578  1.00 0.00 ?  473 VAL A CA   1  
ATOM   2556   C  C    . VAL A  1 158 ? -16.140 1.216   44.347  1.00 0.00 ?  473 VAL A C    1  
ATOM   2557   O  O    . VAL A  1 158 ? -15.779 2.052   45.150  1.00 0.00 ?  473 VAL A O    1  
ATOM   2558   C  CB   . VAL A  1 158 ? -18.587 0.787   44.354  1.00 0.00 ?  473 VAL A CB   1  
ATOM   2559   C  CG1  . VAL A  1 158 ? -18.642 1.421   45.756  1.00 0.00 ?  473 VAL A CG1  1  
ATOM   2560   C  CG2  . VAL A  1 158 ? -19.959 1.047   43.638  1.00 0.00 ?  473 VAL A CG2  1  
ATOM   2561   H  H    . VAL A  1 158 ? -17.628 -0.074  42.118  1.00 0.00 ?  473 VAL A H    1  
ATOM   2562   H  HA   . VAL A  1 158 ? -17.775 2.458   43.511  1.00 0.00 ?  473 VAL A HA   1  
ATOM   2563   H  HB   . VAL A  1 158 ? -18.447 -0.311  44.457  1.00 0.00 ?  473 VAL A HB   1  
ATOM   2564   H  HG11 . VAL A  1 158 ? -17.699 1.306   46.333  1.00 0.00 ?  473 VAL A HG11 1  
ATOM   2565   H  HG12 . VAL A  1 158 ? -19.504 1.073   46.364  1.00 0.00 ?  473 VAL A HG12 1  
ATOM   2566   H  HG13 . VAL A  1 158 ? -18.770 2.515   45.609  1.00 0.00 ?  473 VAL A HG13 1  
ATOM   2567   H  HG21 . VAL A  1 158 ? -20.284 2.098   43.479  1.00 0.00 ?  473 VAL A HG21 1  
ATOM   2568   H  HG22 . VAL A  1 158 ? -20.708 0.482   44.234  1.00 0.00 ?  473 VAL A HG22 1  
ATOM   2569   H  HG23 . VAL A  1 158 ? -19.960 0.659   42.597  1.00 0.00 ?  473 VAL A HG23 1  
ATOM   2570   N  N    . PHE A  1 159 ? -15.433 0.064   44.165  1.00 0.00 ?  474 PHE A N    1  
ATOM   2571   C  CA   . PHE A  1 159 ? -14.245 -0.294  44.842  1.00 0.00 ?  474 PHE A CA   1  
ATOM   2572   C  C    . PHE A  1 159 ? -13.028 -0.564  43.931  1.00 0.00 ?  474 PHE A C    1  
ATOM   2573   O  O    . PHE A  1 159 ? -13.140 -1.283  42.986  1.00 0.00 ?  474 PHE A O    1  
ATOM   2574   C  CB   . PHE A  1 159 ? -14.389 -1.473  45.902  1.00 0.00 ?  474 PHE A CB   1  
ATOM   2575   C  CG   . PHE A  1 159 ? -15.532 -1.139  46.915  1.00 0.00 ?  474 PHE A CG   1  
ATOM   2576   C  CD1  . PHE A  1 159 ? -16.848 -1.612  46.748  1.00 0.00 ?  474 PHE A CD1  1  
ATOM   2577   C  CD2  . PHE A  1 159 ? -15.225 -0.468  48.070  1.00 0.00 ?  474 PHE A CD2  1  
ATOM   2578   C  CE1  . PHE A  1 159 ? -17.837 -1.285  47.632  1.00 0.00 ?  474 PHE A CE1  1  
ATOM   2579   C  CE2  . PHE A  1 159 ? -16.245 -0.084  48.969  1.00 0.00 ?  474 PHE A CE2  1  
ATOM   2580   C  CZ   . PHE A  1 159 ? -17.534 -0.548  48.777  1.00 0.00 ?  474 PHE A CZ   1  
ATOM   2581   H  H    . PHE A  1 159 ? -15.799 -0.565  43.484  1.00 0.00 ?  474 PHE A H    1  
ATOM   2582   H  HA   . PHE A  1 159 ? -13.961 0.599   45.379  1.00 0.00 ?  474 PHE A HA   1  
ATOM   2583   H  HB2  . PHE A  1 159 ? -14.608 -2.430  45.381  1.00 0.00 ?  474 PHE A HB2  1  
ATOM   2584   H  HB3  . PHE A  1 159 ? -13.491 -1.531  46.552  1.00 0.00 ?  474 PHE A HB3  1  
ATOM   2585   H  HD1  . PHE A  1 159 ? -17.012 -2.153  45.828  1.00 0.00 ?  474 PHE A HD1  1  
ATOM   2586   H  HD2  . PHE A  1 159 ? -14.211 -0.147  48.261  1.00 0.00 ?  474 PHE A HD2  1  
ATOM   2587   H  HE1  . PHE A  1 159 ? -18.875 -1.499  47.425  1.00 0.00 ?  474 PHE A HE1  1  
ATOM   2588   H  HE2  . PHE A  1 159 ? -16.030 0.424   49.898  1.00 0.00 ?  474 PHE A HE2  1  
ATOM   2589   H  HZ   . PHE A  1 159 ? -18.206 -0.196  49.546  1.00 0.00 ?  474 PHE A HZ   1  
ATOM   2590   N  N    . THR A  1 160 ? -11.872 0.072   44.278  1.00 0.00 ?  475 THR A N    1  
ATOM   2591   C  CA   . THR A  1 160 ? -10.621 -0.078  43.679  1.00 0.00 ?  475 THR A CA   1  
ATOM   2592   C  C    . THR A  1 160 ? -9.746  -1.004  44.502  1.00 0.00 ?  475 THR A C    1  
ATOM   2593   O  O    . THR A  1 160 ? -9.754  -0.940  45.749  1.00 0.00 ?  475 THR A O    1  
ATOM   2594   C  CB   . THR A  1 160 ? -9.867  1.222   43.439  1.00 0.00 ?  475 THR A CB   1  
ATOM   2595   O  OG1  . THR A  1 160 ? -10.767 2.112   42.787  1.00 0.00 ?  475 THR A OG1  1  
ATOM   2596   C  CG2  . THR A  1 160 ? -8.669  1.063   42.513  1.00 0.00 ?  475 THR A CG2  1  
ATOM   2597   H  H    . THR A  1 160 ? -11.938 0.814   44.940  1.00 0.00 ?  475 THR A H    1  
ATOM   2598   H  HA   . THR A  1 160 ? -10.751 -0.600  42.742  1.00 0.00 ?  475 THR A HA   1  
ATOM   2599   H  HB   . THR A  1 160 ? -9.395  1.688   44.329  1.00 0.00 ?  475 THR A HB   1  
ATOM   2600   H  HG1  . THR A  1 160 ? -11.311 2.538   43.453  1.00 0.00 ?  475 THR A HG1  1  
ATOM   2601   H  HG21 . THR A  1 160 ? -8.170  2.036   42.316  1.00 0.00 ?  475 THR A HG21 1  
ATOM   2602   H  HG22 . THR A  1 160 ? -8.916  0.651   41.511  1.00 0.00 ?  475 THR A HG22 1  
ATOM   2603   H  HG23 . THR A  1 160 ? -7.998  0.282   42.930  1.00 0.00 ?  475 THR A HG23 1  
ATOM   2604   N  N    . TYR A  1 161 ? -9.013  -1.872  43.868  1.00 0.00 ?  476 TYR A N    1  
ATOM   2605   C  CA   . TYR A  1 161 ? -8.216  -2.905  44.475  1.00 0.00 ?  476 TYR A CA   1  
ATOM   2606   C  C    . TYR A  1 161 ? -6.803  -2.629  44.072  1.00 0.00 ?  476 TYR A C    1  
ATOM   2607   O  O    . TYR A  1 161 ? -6.439  -2.837  42.972  1.00 0.00 ?  476 TYR A O    1  
ATOM   2608   C  CB   . TYR A  1 161 ? -8.606  -4.323  44.033  1.00 0.00 ?  476 TYR A CB   1  
ATOM   2609   C  CG   . TYR A  1 161 ? -10.028 -4.648  44.347  1.00 0.00 ?  476 TYR A CG   1  
ATOM   2610   C  CD1  . TYR A  1 161 ? -10.313 -5.081  45.649  1.00 0.00 ?  476 TYR A CD1  1  
ATOM   2611   C  CD2  . TYR A  1 161 ? -11.098 -4.258  43.460  1.00 0.00 ?  476 TYR A CD2  1  
ATOM   2612   C  CE1  . TYR A  1 161 ? -11.705 -5.376  46.011  1.00 0.00 ?  476 TYR A CE1  1  
ATOM   2613   C  CE2  . TYR A  1 161 ? -12.404 -4.369  43.898  1.00 0.00 ?  476 TYR A CE2  1  
ATOM   2614   C  CZ   . TYR A  1 161 ? -12.663 -5.058  45.097  1.00 0.00 ?  476 TYR A CZ   1  
ATOM   2615   O  OH   . TYR A  1 161 ? -13.942 -5.201  45.575  1.00 0.00 ?  476 TYR A OH   1  
ATOM   2616   H  H    . TYR A  1 161 ? -8.934  -1.899  42.874  1.00 0.00 ?  476 TYR A H    1  
ATOM   2617   H  HA   . TYR A  1 161 ? -8.297  -2.919  45.552  1.00 0.00 ?  476 TYR A HA   1  
ATOM   2618   H  HB2  . TYR A  1 161 ? -8.512  -4.300  42.926  1.00 0.00 ?  476 TYR A HB2  1  
ATOM   2619   H  HB3  . TYR A  1 161 ? -7.891  -5.033  44.501  1.00 0.00 ?  476 TYR A HB3  1  
ATOM   2620   H  HD1  . TYR A  1 161 ? -9.579  -5.369  46.387  1.00 0.00 ?  476 TYR A HD1  1  
ATOM   2621   H  HD2  . TYR A  1 161 ? -10.753 -3.762  42.565  1.00 0.00 ?  476 TYR A HD2  1  
ATOM   2622   H  HE1  . TYR A  1 161 ? -11.682 -5.710  47.038  1.00 0.00 ?  476 TYR A HE1  1  
ATOM   2623   H  HE2  . TYR A  1 161 ? -13.202 -4.189  43.193  1.00 0.00 ?  476 TYR A HE2  1  
ATOM   2624   H  HH   . TYR A  1 161 ? -14.566 -4.733  45.015  1.00 0.00 ?  476 TYR A HH   1  
ATOM   2625   N  N    . PHE A  1 162 ? -6.008  -2.228  45.045  1.00 0.00 ?  477 PHE A N    1  
ATOM   2626   C  CA   . PHE A  1 162 ? -4.611  -1.961  44.885  1.00 0.00 ?  477 PHE A CA   1  
ATOM   2627   C  C    . PHE A  1 162 ? -3.897  -3.202  45.381  1.00 0.00 ?  477 PHE A C    1  
ATOM   2628   O  O    . PHE A  1 162 ? -4.411  -3.919  46.206  1.00 0.00 ?  477 PHE A O    1  
ATOM   2629   C  CB   . PHE A  1 162 ? -4.051  -0.740  45.619  1.00 0.00 ?  477 PHE A CB   1  
ATOM   2630   C  CG   . PHE A  1 162 ? -4.711  0.532   45.120  1.00 0.00 ?  477 PHE A CG   1  
ATOM   2631   C  CD1  . PHE A  1 162 ? -5.939  0.927   45.615  1.00 0.00 ?  477 PHE A CD1  1  
ATOM   2632   C  CD2  . PHE A  1 162 ? -4.138  1.233   44.057  1.00 0.00 ?  477 PHE A CD2  1  
ATOM   2633   C  CE1  . PHE A  1 162 ? -6.522  2.117   45.113  1.00 0.00 ?  477 PHE A CE1  1  
ATOM   2634   C  CE2  . PHE A  1 162 ? -4.655  2.447   43.590  1.00 0.00 ?  477 PHE A CE2  1  
ATOM   2635   C  CZ   . PHE A  1 162 ? -5.907  2.827   44.033  1.00 0.00 ?  477 PHE A CZ   1  
ATOM   2636   H  H    . PHE A  1 162 ? -6.333  -2.262  45.987  1.00 0.00 ?  477 PHE A H    1  
ATOM   2637   H  HA   . PHE A  1 162 ? -4.433  -1.864  43.824  1.00 0.00 ?  477 PHE A HA   1  
ATOM   2638   H  HB2  . PHE A  1 162 ? -4.139  -0.823  46.724  1.00 0.00 ?  477 PHE A HB2  1  
ATOM   2639   H  HB3  . PHE A  1 162 ? -2.965  -0.681  45.396  1.00 0.00 ?  477 PHE A HB3  1  
ATOM   2640   H  HD1  . PHE A  1 162 ? -6.352  0.274   46.369  1.00 0.00 ?  477 PHE A HD1  1  
ATOM   2641   H  HD2  . PHE A  1 162 ? -3.212  0.903   43.610  1.00 0.00 ?  477 PHE A HD2  1  
ATOM   2642   H  HE1  . PHE A  1 162 ? -7.434  2.452   45.584  1.00 0.00 ?  477 PHE A HE1  1  
ATOM   2643   H  HE2  . PHE A  1 162 ? -4.255  3.080   42.812  1.00 0.00 ?  477 PHE A HE2  1  
ATOM   2644   H  HZ   . PHE A  1 162 ? -6.281  3.799   43.747  1.00 0.00 ?  477 PHE A HZ   1  
ATOM   2645   N  N    . TYR A  1 163 ? -2.721  -3.576  44.728  1.00 0.00 ?  478 TYR A N    1  
ATOM   2646   C  CA   . TYR A  1 163 ? -2.116  -4.891  44.822  1.00 0.00 ?  478 TYR A CA   1  
ATOM   2647   C  C    . TYR A  1 163 ? -0.668  -4.616  45.247  1.00 0.00 ?  478 TYR A C    1  
ATOM   2648   O  O    . TYR A  1 163 ? 0.005   -3.750  44.710  1.00 0.00 ?  478 TYR A O    1  
ATOM   2649   C  CB   . TYR A  1 163 ? -2.125  -5.602  43.513  1.00 0.00 ?  478 TYR A CB   1  
ATOM   2650   C  CG   . TYR A  1 163 ? -1.456  -6.963  43.561  1.00 0.00 ?  478 TYR A CG   1  
ATOM   2651   C  CD1  . TYR A  1 163 ? -0.229  -7.112  42.875  1.00 0.00 ?  478 TYR A CD1  1  
ATOM   2652   C  CD2  . TYR A  1 163 ? -2.074  -8.049  44.248  1.00 0.00 ?  478 TYR A CD2  1  
ATOM   2653   C  CE1  . TYR A  1 163 ? 0.430   -8.334  42.844  1.00 0.00 ?  478 TYR A CE1  1  
ATOM   2654   C  CE2  . TYR A  1 163 ? -1.349  -9.256  44.209  1.00 0.00 ?  478 TYR A CE2  1  
ATOM   2655   C  CZ   . TYR A  1 163 ? -0.126  -9.377  43.618  1.00 0.00 ?  478 TYR A CZ   1  
ATOM   2656   O  OH   . TYR A  1 163 ? 0.537   -10.628 43.694  1.00 0.00 ?  478 TYR A OH   1  
ATOM   2657   H  H    . TYR A  1 163 ? -2.380  -3.099  43.922  1.00 0.00 ?  478 TYR A H    1  
ATOM   2658   H  HA   . TYR A  1 163 ? -2.682  -5.381  45.601  1.00 0.00 ?  478 TYR A HA   1  
ATOM   2659   H  HB2  . TYR A  1 163 ? -3.185  -5.711  43.199  1.00 0.00 ?  478 TYR A HB2  1  
ATOM   2660   H  HB3  . TYR A  1 163 ? -1.592  -4.927  42.809  1.00 0.00 ?  478 TYR A HB3  1  
ATOM   2661   H  HD1  . TYR A  1 163 ? 0.146   -6.247  42.348  1.00 0.00 ?  478 TYR A HD1  1  
ATOM   2662   H  HD2  . TYR A  1 163 ? -2.987  -7.879  44.799  1.00 0.00 ?  478 TYR A HD2  1  
ATOM   2663   H  HE1  . TYR A  1 163 ? 1.276   -8.483  42.188  1.00 0.00 ?  478 TYR A HE1  1  
ATOM   2664   H  HE2  . TYR A  1 163 ? -1.724  -10.081 44.797  1.00 0.00 ?  478 TYR A HE2  1  
ATOM   2665   H  HH   . TYR A  1 163 ? 1.442   -10.573 43.378  1.00 0.00 ?  478 TYR A HH   1  
ATOM   2666   N  N    . LYS A  1 164 ? -0.129  -5.297  46.279  1.00 0.00 ?  479 LYS A N    1  
ATOM   2667   C  CA   . LYS A  1 164 ? 1.301   -5.271  46.645  1.00 0.00 ?  479 LYS A CA   1  
ATOM   2668   C  C    . LYS A  1 164 ? 1.641   -6.631  47.257  1.00 0.00 ?  479 LYS A C    1  
ATOM   2669   O  O    . LYS A  1 164 ? 0.869   -7.104  48.099  1.00 0.00 ?  479 LYS A O    1  
ATOM   2670   C  CB   . LYS A  1 164 ? 1.665   -4.073  47.627  1.00 0.00 ?  479 LYS A CB   1  
ATOM   2671   C  CG   . LYS A  1 164 ? 3.160   -4.143  48.164  1.00 0.00 ?  479 LYS A CG   1  
ATOM   2672   C  CD   . LYS A  1 164 ? 3.657   -2.986  49.014  1.00 0.00 ?  479 LYS A CD   1  
ATOM   2673   C  CE   . LYS A  1 164 ? 5.185   -2.856  48.929  1.00 0.00 ?  479 LYS A CE   1  
ATOM   2674   N  NZ   . LYS A  1 164 ? 5.586   -1.639  49.690  1.00 0.00 1  479 LYS A NZ   1  
ATOM   2675   H  H    . LYS A  1 164 ? -0.726  -5.992  46.672  1.00 0.00 ?  479 LYS A H    1  
ATOM   2676   H  HA   . LYS A  1 164 ? 1.991   -5.307  45.815  1.00 0.00 ?  479 LYS A HA   1  
ATOM   2677   H  HB2  . LYS A  1 164 ? 1.517   -3.184  46.978  1.00 0.00 ?  479 LYS A HB2  1  
ATOM   2678   H  HB3  . LYS A  1 164 ? 0.880   -3.959  48.406  1.00 0.00 ?  479 LYS A HB3  1  
ATOM   2679   H  HG2  . LYS A  1 164 ? 3.258   -5.142  48.640  1.00 0.00 ?  479 LYS A HG2  1  
ATOM   2680   H  HG3  . LYS A  1 164 ? 3.795   -4.262  47.260  1.00 0.00 ?  479 LYS A HG3  1  
ATOM   2681   H  HD2  . LYS A  1 164 ? 3.241   -2.056  48.572  1.00 0.00 ?  479 LYS A HD2  1  
ATOM   2682   H  HD3  . LYS A  1 164 ? 3.177   -3.123  50.007  1.00 0.00 ?  479 LYS A HD3  1  
ATOM   2683   H  HE2  . LYS A  1 164 ? 5.714   -3.690  49.437  1.00 0.00 ?  479 LYS A HE2  1  
ATOM   2684   H  HE3  . LYS A  1 164 ? 5.494   -2.736  47.868  1.00 0.00 ?  479 LYS A HE3  1  
ATOM   2685   H  HZ1  . LYS A  1 164 ? 5.265   -1.779  50.669  1.00 0.00 ?  479 LYS A HZ1  1  
ATOM   2686   H  HZ2  . LYS A  1 164 ? 5.194   -0.772  49.270  1.00 0.00 ?  479 LYS A HZ2  1  
ATOM   2687   H  HZ3  . LYS A  1 164 ? 6.623   -1.561  49.725  1.00 0.00 ?  479 LYS A HZ3  1  
ATOM   2688   N  N    . GLY A  1 165 ? 2.780   -7.248  46.938  1.00 0.00 ?  480 GLY A N    1  
ATOM   2689   C  CA   . GLY A  1 165 ? 3.234   -8.533  47.566  1.00 0.00 ?  480 GLY A CA   1  
ATOM   2690   C  C    . GLY A  1 165 ? 2.302   -9.587  47.878  1.00 0.00 ?  480 GLY A C    1  
ATOM   2691   O  O    . GLY A  1 165 ? 2.082   -9.856  49.053  1.00 0.00 ?  480 GLY A O    1  
ATOM   2692   H  H    . GLY A  1 165 ? 3.396   -6.950  46.213  1.00 0.00 ?  480 GLY A H    1  
ATOM   2693   H  HA2  . GLY A  1 165 ? 3.920   -8.966  46.852  1.00 0.00 ?  480 GLY A HA2  1  
ATOM   2694   H  HA3  . GLY A  1 165 ? 3.657   -8.284  48.528  1.00 0.00 ?  480 GLY A HA3  1  
ATOM   2695   N  N    . ASN A  1 166 ? 1.608   -10.138 46.933  1.00 0.00 ?  481 ASN A N    1  
ATOM   2696   C  CA   . ASN A  1 166 ? 0.588   -11.200 46.973  1.00 0.00 ?  481 ASN A CA   1  
ATOM   2697   C  C    . ASN A  1 166 ? -0.690  -10.914 47.726  1.00 0.00 ?  481 ASN A C    1  
ATOM   2698   O  O    . ASN A  1 166 ? -1.483  -11.834 47.991  1.00 0.00 ?  481 ASN A O    1  
ATOM   2699   C  CB   . ASN A  1 166 ? 1.193   -12.525 47.572  1.00 0.00 ?  481 ASN A CB   1  
ATOM   2700   C  CG   . ASN A  1 166 ? 2.514   -12.976 46.894  1.00 0.00 ?  481 ASN A CG   1  
ATOM   2701   O  OD1  . ASN A  1 166 ? 2.478   -13.048 45.690  1.00 0.00 ?  481 ASN A OD1  1  
ATOM   2702   N  ND2  . ASN A  1 166 ? 3.614   -13.313 47.659  1.00 0.00 ?  481 ASN A ND2  1  
ATOM   2703   H  H    . ASN A  1 166 ? 1.765   -9.960  45.964  1.00 0.00 ?  481 ASN A H    1  
ATOM   2704   H  HA   . ASN A  1 166 ? 0.351   -11.276 45.922  1.00 0.00 ?  481 ASN A HA   1  
ATOM   2705   H  HB2  . ASN A  1 166 ? 1.380   -12.369 48.656  1.00 0.00 ?  481 ASN A HB2  1  
ATOM   2706   H  HB3  . ASN A  1 166 ? 0.457   -13.346 47.441  1.00 0.00 ?  481 ASN A HB3  1  
ATOM   2707   H  HD21 . ASN A  1 166 ? 3.627   -13.289 48.659  1.00 0.00 ?  481 ASN A HD21 1  
ATOM   2708   H  HD22 . ASN A  1 166 ? 4.354   -13.658 47.082  1.00 0.00 ?  481 ASN A HD22 1  
ATOM   2709   N  N    . LYS A  1 167 ? -0.989  -9.570  47.952  1.00 0.00 ?  482 LYS A N    1  
ATOM   2710   C  CA   . LYS A  1 167 ? -2.049  -9.053  48.851  1.00 0.00 ?  482 LYS A CA   1  
ATOM   2711   C  C    . LYS A  1 167 ? -2.721  -7.886  48.176  1.00 0.00 ?  482 LYS A C    1  
ATOM   2712   O  O    . LYS A  1 167 ? -2.117  -7.195  47.348  1.00 0.00 ?  482 LYS A O    1  
ATOM   2713   C  CB   . LYS A  1 167 ? -1.575  -8.716  50.270  1.00 0.00 ?  482 LYS A CB   1  
ATOM   2714   C  CG   . LYS A  1 167 ? -0.870  -9.873  51.000  1.00 0.00 ?  482 LYS A CG   1  
ATOM   2715   C  CD   . LYS A  1 167 ? -0.718  -9.680  52.496  1.00 0.00 ?  482 LYS A CD   1  
ATOM   2716   C  CE   . LYS A  1 167 ? -0.564  -10.979 53.316  1.00 0.00 ?  482 LYS A CE   1  
ATOM   2717   N  NZ   . LYS A  1 167 ? 0.522   -11.823 52.891  1.00 0.00 1  482 LYS A NZ   1  
ATOM   2718   H  H    . LYS A  1 167 ? -0.419  -8.818  47.631  1.00 0.00 ?  482 LYS A H    1  
ATOM   2719   H  HA   . LYS A  1 167 ? -2.785  -9.837  48.949  1.00 0.00 ?  482 LYS A HA   1  
ATOM   2720   H  HB2  . LYS A  1 167 ? -0.892  -7.840  50.289  1.00 0.00 ?  482 LYS A HB2  1  
ATOM   2721   H  HB3  . LYS A  1 167 ? -2.452  -8.421  50.885  1.00 0.00 ?  482 LYS A HB3  1  
ATOM   2722   H  HG2  . LYS A  1 167 ? -1.558  -10.735 50.863  1.00 0.00 ?  482 LYS A HG2  1  
ATOM   2723   H  HG3  . LYS A  1 167 ? 0.119   -10.180 50.599  1.00 0.00 ?  482 LYS A HG3  1  
ATOM   2724   H  HD2  . LYS A  1 167 ? 0.137   -8.971  52.531  1.00 0.00 ?  482 LYS A HD2  1  
ATOM   2725   H  HD3  . LYS A  1 167 ? -1.578  -9.079  52.861  1.00 0.00 ?  482 LYS A HD3  1  
ATOM   2726   H  HE2  . LYS A  1 167 ? -0.363  -10.705 54.374  1.00 0.00 ?  482 LYS A HE2  1  
ATOM   2727   H  HE3  . LYS A  1 167 ? -1.463  -11.610 53.147  1.00 0.00 ?  482 LYS A HE3  1  
ATOM   2728   H  HZ1  . LYS A  1 167 ? 0.527   -12.088 51.885  1.00 0.00 ?  482 LYS A HZ1  1  
ATOM   2729   H  HZ2  . LYS A  1 167 ? 0.545   -12.715 53.424  1.00 0.00 ?  482 LYS A HZ2  1  
ATOM   2730   H  HZ3  . LYS A  1 167 ? 1.461   -11.381 52.965  1.00 0.00 ?  482 LYS A HZ3  1  
ATOM   2731   N  N    . TYR A  1 168 ? -4.000  -7.591  48.536  1.00 0.00 ?  483 TYR A N    1  
ATOM   2732   C  CA   . TYR A  1 168 ? -4.750  -6.474  47.968  1.00 0.00 ?  483 TYR A CA   1  
ATOM   2733   C  C    . TYR A  1 168 ? -5.409  -5.746  49.060  1.00 0.00 ?  483 TYR A C    1  
ATOM   2734   O  O    . TYR A  1 168 ? -5.770  -6.427  50.087  1.00 0.00 ?  483 TYR A O    1  
ATOM   2735   C  CB   . TYR A  1 168 ? -5.774  -6.946  46.840  1.00 0.00 ?  483 TYR A CB   1  
ATOM   2736   C  CG   . TYR A  1 168 ? -6.978  -7.752  47.369  1.00 0.00 ?  483 TYR A CG   1  
ATOM   2737   C  CD1  . TYR A  1 168 ? -7.008  -9.134  47.716  1.00 0.00 ?  483 TYR A CD1  1  
ATOM   2738   C  CD2  . TYR A  1 168 ? -8.092  -6.981  47.601  1.00 0.00 ?  483 TYR A CD2  1  
ATOM   2739   C  CE1  . TYR A  1 168 ? -8.190  -9.706  48.204  1.00 0.00 ?  483 TYR A CE1  1  
ATOM   2740   C  CE2  . TYR A  1 168 ? -9.273  -7.497  48.095  1.00 0.00 ?  483 TYR A CE2  1  
ATOM   2741   C  CZ   . TYR A  1 168 ? -9.325  -8.929  48.362  1.00 0.00 ?  483 TYR A CZ   1  
ATOM   2742   O  OH   . TYR A  1 168 ? -10.437 -9.415  49.026  1.00 0.00 ?  483 TYR A OH   1  
ATOM   2743   H  H    . TYR A  1 168 ? -4.438  -8.114  49.264  1.00 0.00 ?  483 TYR A H    1  
ATOM   2744   H  HA   . TYR A  1 168 ? -4.075  -5.827  47.429  1.00 0.00 ?  483 TYR A HA   1  
ATOM   2745   H  HB2  . TYR A  1 168 ? -6.094  -6.097  46.199  1.00 0.00 ?  483 TYR A HB2  1  
ATOM   2746   H  HB3  . TYR A  1 168 ? -5.323  -7.593  46.057  1.00 0.00 ?  483 TYR A HB3  1  
ATOM   2747   H  HD1  . TYR A  1 168 ? -6.072  -9.662  47.608  1.00 0.00 ?  483 TYR A HD1  1  
ATOM   2748   H  HD2  . TYR A  1 168 ? -8.039  -5.912  47.458  1.00 0.00 ?  483 TYR A HD2  1  
ATOM   2749   H  HE1  . TYR A  1 168 ? -8.221  -10.779 48.315  1.00 0.00 ?  483 TYR A HE1  1  
ATOM   2750   H  HE2  . TYR A  1 168 ? -10.152 -6.902  48.293  1.00 0.00 ?  483 TYR A HE2  1  
ATOM   2751   H  HH   . TYR A  1 168 ? -10.485 -10.367 49.140  1.00 0.00 ?  483 TYR A HH   1  
ATOM   2752   N  N    . TRP A  1 169 ? -5.529  -4.408  48.852  1.00 0.00 ?  484 TRP A N    1  
ATOM   2753   C  CA   . TRP A  1 169 ? -6.155  -3.443  49.664  1.00 0.00 ?  484 TRP A CA   1  
ATOM   2754   C  C    . TRP A  1 169 ? -7.362  -2.916  48.833  1.00 0.00 ?  484 TRP A C    1  
ATOM   2755   O  O    . TRP A  1 169 ? -7.306  -2.360  47.760  1.00 0.00 ?  484 TRP A O    1  
ATOM   2756   C  CB   . TRP A  1 169 ? -5.257  -2.180  49.984  1.00 0.00 ?  484 TRP A CB   1  
ATOM   2757   C  CG   . TRP A  1 169 ? -4.077  -2.409  50.888  1.00 0.00 ?  484 TRP A CG   1  
ATOM   2758   C  CD1  . TRP A  1 169 ? -3.923  -1.910  52.178  1.00 0.00 ?  484 TRP A CD1  1  
ATOM   2759   C  CD2  . TRP A  1 169 ? -2.948  -3.287  50.678  1.00 0.00 ?  484 TRP A CD2  1  
ATOM   2760   N  NE1  . TRP A  1 169 ? -2.779  -2.487  52.749  1.00 0.00 ?  484 TRP A NE1  1  
ATOM   2761   C  CE2  . TRP A  1 169 ? -2.136  -3.292  51.840  1.00 0.00 ?  484 TRP A CE2  1  
ATOM   2762   C  CE3  . TRP A  1 169 ? -2.480  -4.004  49.559  1.00 0.00 ?  484 TRP A CE3  1  
ATOM   2763   C  CZ2  . TRP A  1 169 ? -1.074  -4.179  52.043  1.00 0.00 ?  484 TRP A CZ2  1  
ATOM   2764   C  CZ3  . TRP A  1 169 ? -1.404  -4.935  49.699  1.00 0.00 ?  484 TRP A CZ3  1  
ATOM   2765   C  CH2  . TRP A  1 169 ? -0.725  -4.982  50.954  1.00 0.00 ?  484 TRP A CH2  1  
ATOM   2766   H  H    . TRP A  1 169 ? -5.066  -4.123  48.016  1.00 0.00 ?  484 TRP A H    1  
ATOM   2767   H  HA   . TRP A  1 169 ? -6.569  -3.963  50.516  1.00 0.00 ?  484 TRP A HA   1  
ATOM   2768   H  HB2  . TRP A  1 169 ? -4.914  -1.678  49.054  1.00 0.00 ?  484 TRP A HB2  1  
ATOM   2769   H  HB3  . TRP A  1 169 ? -5.904  -1.475  50.549  1.00 0.00 ?  484 TRP A HB3  1  
ATOM   2770   H  HD1  . TRP A  1 169 ? -4.767  -1.423  52.643  1.00 0.00 ?  484 TRP A HD1  1  
ATOM   2771   H  HE1  . TRP A  1 169 ? -2.397  -2.231  53.609  1.00 0.00 ?  484 TRP A HE1  1  
ATOM   2772   H  HE3  . TRP A  1 169 ? -2.974  -3.934  48.601  1.00 0.00 ?  484 TRP A HE3  1  
ATOM   2773   H  HZ2  . TRP A  1 169 ? -0.576  -4.147  53.001  1.00 0.00 ?  484 TRP A HZ2  1  
ATOM   2774   H  HZ3  . TRP A  1 169 ? -0.996  -5.441  48.837  1.00 0.00 ?  484 TRP A HZ3  1  
ATOM   2775   H  HH2  . TRP A  1 169 ? 0.103   -5.666  51.073  1.00 0.00 ?  484 TRP A HH2  1  
ATOM   2776   N  N    . LYS A  1 170 ? -8.525  -2.998  49.459  1.00 0.00 ?  485 LYS A N    1  
ATOM   2777   C  CA   . LYS A  1 170 ? -9.794  -2.665  48.846  1.00 0.00 ?  485 LYS A CA   1  
ATOM   2778   C  C    . LYS A  1 170 ? -10.214 -1.322  49.268  1.00 0.00 ?  485 LYS A C    1  
ATOM   2779   O  O    . LYS A  1 170 ? -10.534 -1.139  50.422  1.00 0.00 ?  485 LYS A O    1  
ATOM   2780   C  CB   . LYS A  1 170 ? -10.884 -3.746  49.144  1.00 0.00 ?  485 LYS A CB   1  
ATOM   2781   C  CG   . LYS A  1 170 ? -12.311 -3.372  48.714  1.00 0.00 ?  485 LYS A CG   1  
ATOM   2782   C  CD   . LYS A  1 170 ? -13.380 -4.190  49.352  1.00 0.00 ?  485 LYS A CD   1  
ATOM   2783   C  CE   . LYS A  1 170 ? -14.796 -3.849  48.828  1.00 0.00 ?  485 LYS A CE   1  
ATOM   2784   N  NZ   . LYS A  1 170 ? -15.859 -4.623  49.478  1.00 0.00 1  485 LYS A NZ   1  
ATOM   2785   H  H    . LYS A  1 170 ? -8.578  -3.420  50.361  1.00 0.00 ?  485 LYS A H    1  
ATOM   2786   H  HA   . LYS A  1 170 ? -9.635  -2.794  47.786  1.00 0.00 ?  485 LYS A HA   1  
ATOM   2787   H  HB2  . LYS A  1 170 ? -10.754 -4.757  48.703  1.00 0.00 ?  485 LYS A HB2  1  
ATOM   2788   H  HB3  . LYS A  1 170 ? -11.026 -3.843  50.242  1.00 0.00 ?  485 LYS A HB3  1  
ATOM   2789   H  HG2  . LYS A  1 170 ? -12.497 -2.314  48.996  1.00 0.00 ?  485 LYS A HG2  1  
ATOM   2790   H  HG3  . LYS A  1 170 ? -12.297 -3.452  47.606  1.00 0.00 ?  485 LYS A HG3  1  
ATOM   2791   H  HD2  . LYS A  1 170 ? -13.315 -5.274  49.113  1.00 0.00 ?  485 LYS A HD2  1  
ATOM   2792   H  HD3  . LYS A  1 170 ? -13.423 -4.180  50.462  1.00 0.00 ?  485 LYS A HD3  1  
ATOM   2793   H  HE2  . LYS A  1 170 ? -15.071 -2.816  49.131  1.00 0.00 ?  485 LYS A HE2  1  
ATOM   2794   H  HE3  . LYS A  1 170 ? -14.804 -3.911  47.719  1.00 0.00 ?  485 LYS A HE3  1  
ATOM   2795   H  HZ1  . LYS A  1 170 ? -15.979 -4.361  50.477  1.00 0.00 ?  485 LYS A HZ1  1  
ATOM   2796   H  HZ2  . LYS A  1 170 ? -15.759 -5.652  49.588  1.00 0.00 ?  485 LYS A HZ2  1  
ATOM   2797   H  HZ3  . LYS A  1 170 ? -16.753 -4.367  49.014  1.00 0.00 ?  485 LYS A HZ3  1  
ATOM   2798   N  N    . PHE A  1 171 ? -10.212 -0.322  48.338  1.00 0.00 ?  486 PHE A N    1  
ATOM   2799   C  CA   . PHE A  1 171 ? -10.398 1.098   48.657  1.00 0.00 ?  486 PHE A CA   1  
ATOM   2800   C  C    . PHE A  1 171 ? -11.742 1.558   48.223  1.00 0.00 ?  486 PHE A C    1  
ATOM   2801   O  O    . PHE A  1 171 ? -12.247 1.161   47.221  1.00 0.00 ?  486 PHE A O    1  
ATOM   2802   C  CB   . PHE A  1 171 ? -9.322  1.851   47.914  1.00 0.00 ?  486 PHE A CB   1  
ATOM   2803   C  CG   . PHE A  1 171 ? -9.406  3.396   47.903  1.00 0.00 ?  486 PHE A CG   1  
ATOM   2804   C  CD1  . PHE A  1 171 ? -8.371  4.100   48.522  1.00 0.00 ?  486 PHE A CD1  1  
ATOM   2805   C  CD2  . PHE A  1 171 ? -10.153 4.102   47.016  1.00 0.00 ?  486 PHE A CD2  1  
ATOM   2806   C  CE1  . PHE A  1 171 ? -8.335  5.485   48.587  1.00 0.00 ?  486 PHE A CE1  1  
ATOM   2807   C  CE2  . PHE A  1 171 ? -10.022 5.479   46.876  1.00 0.00 ?  486 PHE A CE2  1  
ATOM   2808   C  CZ   . PHE A  1 171 ? -9.100  6.210   47.682  1.00 0.00 ?  486 PHE A CZ   1  
ATOM   2809   H  H    . PHE A  1 171 ? -9.877  -0.574  47.434  1.00 0.00 ?  486 PHE A H    1  
ATOM   2810   H  HA   . PHE A  1 171 ? -10.304 1.273   49.719  1.00 0.00 ?  486 PHE A HA   1  
ATOM   2811   H  HB2  . PHE A  1 171 ? -8.312  1.576   48.286  1.00 0.00 ?  486 PHE A HB2  1  
ATOM   2812   H  HB3  . PHE A  1 171 ? -9.367  1.489   46.865  1.00 0.00 ?  486 PHE A HB3  1  
ATOM   2813   H  HD1  . PHE A  1 171 ? -7.686  3.486   49.087  1.00 0.00 ?  486 PHE A HD1  1  
ATOM   2814   H  HD2  . PHE A  1 171 ? -10.799 3.596   46.314  1.00 0.00 ?  486 PHE A HD2  1  
ATOM   2815   H  HE1  . PHE A  1 171 ? -7.521  6.020   49.054  1.00 0.00 ?  486 PHE A HE1  1  
ATOM   2816   H  HE2  . PHE A  1 171 ? -10.771 5.924   46.238  1.00 0.00 ?  486 PHE A HE2  1  
ATOM   2817   H  HZ   . PHE A  1 171 ? -9.076  7.281   47.547  1.00 0.00 ?  486 PHE A HZ   1  
ATOM   2818   N  N    . ASN A  1 172 ? -12.358 2.457   48.994  1.00 0.00 ?  487 ASN A N    1  
ATOM   2819   C  CA   . ASN A  1 172 ? -13.707 2.888   48.764  1.00 0.00 ?  487 ASN A CA   1  
ATOM   2820   C  C    . ASN A  1 172 ? -13.726 4.212   48.031  1.00 0.00 ?  487 ASN A C    1  
ATOM   2821   O  O    . ASN A  1 172 ? -13.136 5.183   48.480  1.00 0.00 ?  487 ASN A O    1  
ATOM   2822   C  CB   . ASN A  1 172 ? -14.332 2.871   50.205  1.00 0.00 ?  487 ASN A CB   1  
ATOM   2823   C  CG   . ASN A  1 172 ? -15.777 3.371   50.270  1.00 0.00 ?  487 ASN A CG   1  
ATOM   2824   O  OD1  . ASN A  1 172 ? -16.394 4.056   49.405  1.00 0.00 ?  487 ASN A OD1  1  
ATOM   2825   N  ND2  . ASN A  1 172 ? -16.425 3.007   51.411  1.00 0.00 ?  487 ASN A ND2  1  
ATOM   2826   H  H    . ASN A  1 172 ? -11.886 2.907   49.748  1.00 0.00 ?  487 ASN A H    1  
ATOM   2827   H  HA   . ASN A  1 172 ? -14.184 2.162   48.122  1.00 0.00 ?  487 ASN A HA   1  
ATOM   2828   H  HB2  . ASN A  1 172 ? -14.332 1.778   50.405  1.00 0.00 ?  487 ASN A HB2  1  
ATOM   2829   H  HB3  . ASN A  1 172 ? -13.723 3.587   50.796  1.00 0.00 ?  487 ASN A HB3  1  
ATOM   2830   H  HD21 . ASN A  1 172 ? -17.402 3.220   51.380  1.00 0.00 ?  487 ASN A HD21 1  
ATOM   2831   H  HD22 . ASN A  1 172 ? -15.977 2.344   52.011  1.00 0.00 ?  487 ASN A HD22 1  
ATOM   2832   N  N    . ASN A  1 173 ? -14.298 4.225   46.812  1.00 0.00 ?  488 ASN A N    1  
ATOM   2833   C  CA   . ASN A  1 173 ? -14.139 5.338   45.914  1.00 0.00 ?  488 ASN A CA   1  
ATOM   2834   C  C    . ASN A  1 173 ? -15.181 6.402   46.375  1.00 0.00 ?  488 ASN A C    1  
ATOM   2835   O  O    . ASN A  1 173 ? -15.099 7.529   45.913  1.00 0.00 ?  488 ASN A O    1  
ATOM   2836   C  CB   . ASN A  1 173 ? -14.415 4.920   44.480  1.00 0.00 ?  488 ASN A CB   1  
ATOM   2837   C  CG   . ASN A  1 173 ? -13.579 3.707   44.002  1.00 0.00 ?  488 ASN A CG   1  
ATOM   2838   O  OD1  . ASN A  1 173 ? -12.624 3.181   44.525  1.00 0.00 ?  488 ASN A OD1  1  
ATOM   2839   N  ND2  . ASN A  1 173 ? -13.977 3.253   42.781  1.00 0.00 ?  488 ASN A ND2  1  
ATOM   2840   H  H    . ASN A  1 173 ? -14.750 3.367   46.580  1.00 0.00 ?  488 ASN A H    1  
ATOM   2841   H  HA   . ASN A  1 173 ? -13.228 5.887   46.100  1.00 0.00 ?  488 ASN A HA   1  
ATOM   2842   H  HB2  . ASN A  1 173 ? -15.479 4.631   44.344  1.00 0.00 ?  488 ASN A HB2  1  
ATOM   2843   H  HB3  . ASN A  1 173 ? -14.088 5.741   43.807  1.00 0.00 ?  488 ASN A HB3  1  
ATOM   2844   H  HD21 . ASN A  1 173 ? -14.792 3.633   42.344  1.00 0.00 ?  488 ASN A HD21 1  
ATOM   2845   H  HD22 . ASN A  1 173 ? -13.663 2.343   42.508  1.00 0.00 ?  488 ASN A HD22 1  
ATOM   2846   N  N    . GLN A  1 174 ? -16.145 6.105   47.164  1.00 0.00 ?  489 GLN A N    1  
ATOM   2847   C  CA   . GLN A  1 174 ? -17.212 6.954   47.733  1.00 0.00 ?  489 GLN A CA   1  
ATOM   2848   C  C    . GLN A  1 174 ? -16.818 7.500   49.085  1.00 0.00 ?  489 GLN A C    1  
ATOM   2849   O  O    . GLN A  1 174 ? -17.376 8.517   49.465  1.00 0.00 ?  489 GLN A O    1  
ATOM   2850   C  CB   . GLN A  1 174 ? -18.627 6.243   47.818  1.00 0.00 ?  489 GLN A CB   1  
ATOM   2851   C  CG   . GLN A  1 174 ? -18.987 5.281   46.535  1.00 0.00 ?  489 GLN A CG   1  
ATOM   2852   C  CD   . GLN A  1 174 ? -18.670 5.921   45.167  1.00 0.00 ?  489 GLN A CD   1  
ATOM   2853   O  OE1  . GLN A  1 174 ? -17.890 5.396   44.344  1.00 0.00 ?  489 GLN A OE1  1  
ATOM   2854   N  NE2  . GLN A  1 174 ? -19.311 7.015   44.896  1.00 0.00 ?  489 GLN A NE2  1  
ATOM   2855   H  H    . GLN A  1 174 ? -16.038 5.163   47.472  1.00 0.00 ?  489 GLN A H    1  
ATOM   2856   H  HA   . GLN A  1 174 ? -17.330 7.828   47.109  1.00 0.00 ?  489 GLN A HA   1  
ATOM   2857   H  HB2  . GLN A  1 174 ? -18.788 5.553   48.673  1.00 0.00 ?  489 GLN A HB2  1  
ATOM   2858   H  HB3  . GLN A  1 174 ? -19.346 7.085   47.910  1.00 0.00 ?  489 GLN A HB3  1  
ATOM   2859   H  HG2  . GLN A  1 174 ? -18.423 4.330   46.641  1.00 0.00 ?  489 GLN A HG2  1  
ATOM   2860   H  HG3  . GLN A  1 174 ? -20.063 5.013   46.599  1.00 0.00 ?  489 GLN A HG3  1  
ATOM   2861   H  HE21 . GLN A  1 174 ? -18.987 7.557   44.121  1.00 0.00 ?  489 GLN A HE21 1  
ATOM   2862   H  HE22 . GLN A  1 174 ? -20.095 7.244   45.474  1.00 0.00 ?  489 GLN A HE22 1  
ATOM   2863   N  N    . LYS A  1 175 ? -15.901 6.848   49.755  1.00 0.00 ?  490 LYS A N    1  
ATOM   2864   C  CA   . LYS A  1 175 ? -15.459 7.272   51.064  1.00 0.00 ?  490 LYS A CA   1  
ATOM   2865   C  C    . LYS A  1 175 ? -13.940 7.711   51.126  1.00 0.00 ?  490 LYS A C    1  
ATOM   2866   O  O    . LYS A  1 175 ? -13.615 8.300   52.100  1.00 0.00 ?  490 LYS A O    1  
ATOM   2867   C  CB   . LYS A  1 175 ? -15.779 6.287   52.279  1.00 0.00 ?  490 LYS A CB   1  
ATOM   2868   C  CG   . LYS A  1 175 ? -17.301 6.256   52.412  1.00 0.00 ?  490 LYS A CG   1  
ATOM   2869   C  CD   . LYS A  1 175 ? -17.708 5.508   53.742  1.00 0.00 ?  490 LYS A CD   1  
ATOM   2870   C  CE   . LYS A  1 175 ? -19.180 5.423   54.071  1.00 0.00 ?  490 LYS A CE   1  
ATOM   2871   N  NZ   . LYS A  1 175 ? -19.933 4.922   52.871  1.00 0.00 1  490 LYS A NZ   1  
ATOM   2872   H  H    . LYS A  1 175 ? -15.560 6.003   49.351  1.00 0.00 ?  490 LYS A H    1  
ATOM   2873   H  HA   . LYS A  1 175 ? -15.908 8.215   51.337  1.00 0.00 ?  490 LYS A HA   1  
ATOM   2874   H  HB2  . LYS A  1 175 ? -15.191 5.369   52.066  1.00 0.00 ?  490 LYS A HB2  1  
ATOM   2875   H  HB3  . LYS A  1 175 ? -15.315 6.790   53.155  1.00 0.00 ?  490 LYS A HB3  1  
ATOM   2876   H  HG2  . LYS A  1 175 ? -17.731 7.281   52.400  1.00 0.00 ?  490 LYS A HG2  1  
ATOM   2877   H  HG3  . LYS A  1 175 ? -17.719 5.744   51.519  1.00 0.00 ?  490 LYS A HG3  1  
ATOM   2878   H  HD2  . LYS A  1 175 ? -17.177 4.533   53.773  1.00 0.00 ?  490 LYS A HD2  1  
ATOM   2879   H  HD3  . LYS A  1 175 ? -17.338 6.084   54.617  1.00 0.00 ?  490 LYS A HD3  1  
ATOM   2880   H  HE2  . LYS A  1 175 ? -19.561 4.877   54.960  1.00 0.00 ?  490 LYS A HE2  1  
ATOM   2881   H  HE3  . LYS A  1 175 ? -19.501 6.462   54.297  1.00 0.00 ?  490 LYS A HE3  1  
ATOM   2882   H  HZ1  . LYS A  1 175 ? -19.727 5.597   52.107  1.00 0.00 ?  490 LYS A HZ1  1  
ATOM   2883   H  HZ2  . LYS A  1 175 ? -20.950 4.957   53.086  1.00 0.00 ?  490 LYS A HZ2  1  
ATOM   2884   H  HZ3  . LYS A  1 175 ? -19.665 3.974   52.537  1.00 0.00 ?  490 LYS A HZ3  1  
ATOM   2885   N  N    . LEU A  1 176 ? -13.243 7.413   50.098  1.00 0.00 ?  491 LEU A N    1  
ATOM   2886   C  CA   . LEU A  1 176 ? -11.861 8.013   49.928  1.00 0.00 ?  491 LEU A CA   1  
ATOM   2887   C  C    . LEU A  1 176 ? -10.758 7.495   50.797  1.00 0.00 ?  491 LEU A C    1  
ATOM   2888   O  O    . LEU A  1 176 ? -9.796  8.262   50.905  1.00 0.00 ?  491 LEU A O    1  
ATOM   2889   C  CB   . LEU A  1 176 ? -11.967 9.524   49.801  1.00 0.00 ?  491 LEU A CB   1  
ATOM   2890   C  CG   . LEU A  1 176 ? -12.953 10.009  48.690  1.00 0.00 ?  491 LEU A CG   1  
ATOM   2891   C  CD1  . LEU A  1 176 ? -12.903 11.595  48.720  1.00 0.00 ?  491 LEU A CD1  1  
ATOM   2892   C  CD2  . LEU A  1 176 ? -12.544 9.475   47.327  1.00 0.00 ?  491 LEU A CD2  1  
ATOM   2893   H  H    . LEU A  1 176 ? -13.712 7.140   49.262  1.00 0.00 ?  491 LEU A H    1  
ATOM   2894   H  HA   . LEU A  1 176 ? -11.545 7.713   48.940  1.00 0.00 ?  491 LEU A HA   1  
ATOM   2895   H  HB2  . LEU A  1 176 ? -12.161 10.025  50.774  1.00 0.00 ?  491 LEU A HB2  1  
ATOM   2896   H  HB3  . LEU A  1 176 ? -10.995 9.992   49.534  1.00 0.00 ?  491 LEU A HB3  1  
ATOM   2897   H  HG   . LEU A  1 176 ? -13.990 9.721   48.964  1.00 0.00 ?  491 LEU A HG   1  
ATOM   2898   H  HD11 . LEU A  1 176 ? -11.933 11.956  48.316  1.00 0.00 ?  491 LEU A HD11 1  
ATOM   2899   H  HD12 . LEU A  1 176 ? -13.074 11.942  49.762  1.00 0.00 ?  491 LEU A HD12 1  
ATOM   2900   H  HD13 . LEU A  1 176 ? -13.739 12.068  48.163  1.00 0.00 ?  491 LEU A HD13 1  
ATOM   2901   H  HD21 . LEU A  1 176 ? -12.961 10.112  46.519  1.00 0.00 ?  491 LEU A HD21 1  
ATOM   2902   H  HD22 . LEU A  1 176 ? -12.944 8.439   47.291  1.00 0.00 ?  491 LEU A HD22 1  
ATOM   2903   H  HD23 . LEU A  1 176 ? -11.446 9.610   47.229  1.00 0.00 ?  491 LEU A HD23 1  
ATOM   2904   N  N    . LYS A  1 177 ? -10.901 6.306   51.372  1.00 0.00 ?  492 LYS A N    1  
ATOM   2905   C  CA   . LYS A  1 177 ? -9.873  5.626   52.127  1.00 0.00 ?  492 LYS A CA   1  
ATOM   2906   C  C    . LYS A  1 177 ? -10.019 4.137   51.991  1.00 0.00 ?  492 LYS A C    1  
ATOM   2907   O  O    . LYS A  1 177 ? -11.076 3.678   51.611  1.00 0.00 ?  492 LYS A O    1  
ATOM   2908   C  CB   . LYS A  1 177 ? -9.629  6.123   53.563  1.00 0.00 ?  492 LYS A CB   1  
ATOM   2909   C  CG   . LYS A  1 177 ? -10.644 5.707   54.661  1.00 0.00 ?  492 LYS A CG   1  
ATOM   2910   C  CD   . LYS A  1 177 ? -12.123 6.176   54.348  1.00 0.00 ?  492 LYS A CD   1  
ATOM   2911   C  CE   . LYS A  1 177 ? -13.221 6.043   55.408  1.00 0.00 ?  492 LYS A CE   1  
ATOM   2912   N  NZ   . LYS A  1 177 ? -13.359 4.629   55.840  1.00 0.00 1  492 LYS A NZ   1  
ATOM   2913   H  H    . LYS A  1 177 ? -11.646 5.725   51.053  1.00 0.00 ?  492 LYS A H    1  
ATOM   2914   H  HA   . LYS A  1 177 ? -8.957  5.865   51.607  1.00 0.00 ?  492 LYS A HA   1  
ATOM   2915   H  HB2  . LYS A  1 177 ? -8.665  5.717   53.937  1.00 0.00 ?  492 LYS A HB2  1  
ATOM   2916   H  HB3  . LYS A  1 177 ? -9.536  7.229   53.523  1.00 0.00 ?  492 LYS A HB3  1  
ATOM   2917   H  HG2  . LYS A  1 177 ? -10.610 4.597   54.653  1.00 0.00 ?  492 LYS A HG2  1  
ATOM   2918   H  HG3  . LYS A  1 177 ? -10.349 6.125   55.647  1.00 0.00 ?  492 LYS A HG3  1  
ATOM   2919   H  HD2  . LYS A  1 177 ? -12.036 7.270   54.171  1.00 0.00 ?  492 LYS A HD2  1  
ATOM   2920   H  HD3  . LYS A  1 177 ? -12.468 5.776   53.371  1.00 0.00 ?  492 LYS A HD3  1  
ATOM   2921   H  HE2  . LYS A  1 177 ? -12.965 6.639   56.310  1.00 0.00 ?  492 LYS A HE2  1  
ATOM   2922   H  HE3  . LYS A  1 177 ? -14.205 6.356   54.997  1.00 0.00 ?  492 LYS A HE3  1  
ATOM   2923   H  HZ1  . LYS A  1 177 ? -12.578 4.325   56.455  1.00 0.00 ?  492 LYS A HZ1  1  
ATOM   2924   H  HZ2  . LYS A  1 177 ? -13.528 3.937   55.082  1.00 0.00 ?  492 LYS A HZ2  1  
ATOM   2925   H  HZ3  . LYS A  1 177 ? -14.094 4.582   56.574  1.00 0.00 ?  492 LYS A HZ3  1  
ATOM   2926   N  N    . VAL A  1 178 ? -8.952  3.392   52.321  1.00 0.00 ?  493 VAL A N    1  
ATOM   2927   C  CA   . VAL A  1 178 ? -8.926  1.950   52.389  1.00 0.00 ?  493 VAL A CA   1  
ATOM   2928   C  C    . VAL A  1 178 ? -9.952  1.362   53.333  1.00 0.00 ?  493 VAL A C    1  
ATOM   2929   O  O    . VAL A  1 178 ? -10.088 1.762   54.506  1.00 0.00 ?  493 VAL A O    1  
ATOM   2930   C  CB   . VAL A  1 178 ? -7.510  1.310   52.561  1.00 0.00 ?  493 VAL A CB   1  
ATOM   2931   C  CG1  . VAL A  1 178 ? -7.577  -0.248  52.667  1.00 0.00 ?  493 VAL A CG1  1  
ATOM   2932   C  CG2  . VAL A  1 178 ? -6.700  1.782   51.377  1.00 0.00 ?  493 VAL A CG2  1  
ATOM   2933   H  H    . VAL A  1 178 ? -8.094  3.866   52.503  1.00 0.00 ?  493 VAL A H    1  
ATOM   2934   H  HA   . VAL A  1 178 ? -9.335  1.648   51.436  1.00 0.00 ?  493 VAL A HA   1  
ATOM   2935   H  HB   . VAL A  1 178 ? -7.061  1.699   53.500  1.00 0.00 ?  493 VAL A HB   1  
ATOM   2936   H  HG11 . VAL A  1 178 ? -8.323  -0.582  53.419  1.00 0.00 ?  493 VAL A HG11 1  
ATOM   2937   H  HG12 . VAL A  1 178 ? -6.624  -0.740  52.954  1.00 0.00 ?  493 VAL A HG12 1  
ATOM   2938   H  HG13 . VAL A  1 178 ? -7.913  -0.668  51.695  1.00 0.00 ?  493 VAL A HG13 1  
ATOM   2939   H  HG21 . VAL A  1 178 ? -7.274  1.607   50.442  1.00 0.00 ?  493 VAL A HG21 1  
ATOM   2940   H  HG22 . VAL A  1 178 ? -5.684  1.337   51.437  1.00 0.00 ?  493 VAL A HG22 1  
ATOM   2941   H  HG23 . VAL A  1 178 ? -6.556  2.883   51.406  1.00 0.00 ?  493 VAL A HG23 1  
ATOM   2942   N  N    . GLU A  1 179 ? -10.723 0.323   52.865  1.00 0.00 ?  494 GLU A N    1  
ATOM   2943   C  CA   . GLU A  1 179 ? -11.692 -0.361  53.634  1.00 0.00 ?  494 GLU A CA   1  
ATOM   2944   C  C    . GLU A  1 179 ? -11.226 -1.097  54.995  1.00 0.00 ?  494 GLU A C    1  
ATOM   2945   O  O    . GLU A  1 179 ? -10.169 -1.672  54.895  1.00 0.00 ?  494 GLU A O    1  
ATOM   2946   C  CB   . GLU A  1 179 ? -12.526 -1.355  52.779  1.00 0.00 ?  494 GLU A CB   1  
ATOM   2947   C  CG   . GLU A  1 179 ? -13.553 -0.592  51.946  1.00 0.00 ?  494 GLU A CG   1  
ATOM   2948   C  CD   . GLU A  1 179 ? -14.673 -0.087  52.835  1.00 0.00 ?  494 GLU A CD   1  
ATOM   2949   O  OE1  . GLU A  1 179 ? -15.604 -0.955  53.129  1.00 0.00 ?  494 GLU A OE1  1  
ATOM   2950   O  OE2  . GLU A  1 179 ? -14.742 1.080   53.223  1.00 0.00 -1 494 GLU A OE2  1  
ATOM   2951   H  H    . GLU A  1 179 ? -10.536 -0.148  52.007  1.00 0.00 ?  494 GLU A H    1  
ATOM   2952   H  HA   . GLU A  1 179 ? -12.353 0.472   53.826  1.00 0.00 ?  494 GLU A HA   1  
ATOM   2953   H  HB2  . GLU A  1 179 ? -11.795 -1.834  52.093  1.00 0.00 ?  494 GLU A HB2  1  
ATOM   2954   H  HB3  . GLU A  1 179 ? -12.980 -2.098  53.468  1.00 0.00 ?  494 GLU A HB3  1  
ATOM   2955   H  HG2  . GLU A  1 179 ? -13.073 0.320   51.532  1.00 0.00 ?  494 GLU A HG2  1  
ATOM   2956   H  HG3  . GLU A  1 179 ? -13.870 -1.230  51.093  1.00 0.00 ?  494 GLU A HG3  1  
ATOM   2957   N  N    . PRO A  1 180 ? -12.017 -1.185  56.056  1.00 0.00 ?  495 PRO A N    1  
ATOM   2958   C  CA   . PRO A  1 180 ? -11.757 -2.050  57.186  1.00 0.00 ?  495 PRO A CA   1  
ATOM   2959   C  C    . PRO A  1 180 ? -11.604 -3.540  56.926  1.00 0.00 ?  495 PRO A C    1  
ATOM   2960   O  O    . PRO A  1 180 ? -12.312 -4.067  56.095  1.00 0.00 ?  495 PRO A O    1  
ATOM   2961   C  CB   . PRO A  1 180 ? -12.935 -1.747  58.120  1.00 0.00 ?  495 PRO A CB   1  
ATOM   2962   C  CG   . PRO A  1 180 ? -13.104 -0.293  57.816  1.00 0.00 ?  495 PRO A CG   1  
ATOM   2963   C  CD   . PRO A  1 180 ? -12.967 -0.166  56.331  1.00 0.00 ?  495 PRO A CD   1  
ATOM   2964   H  HA   . PRO A  1 180 ? -10.817 -1.853  57.682  1.00 0.00 ?  495 PRO A HA   1  
ATOM   2965   H  HB2  . PRO A  1 180 ? -13.716 -2.446  57.752  1.00 0.00 ?  495 PRO A HB2  1  
ATOM   2966   H  HB3  . PRO A  1 180 ? -12.773 -1.906  59.207  1.00 0.00 ?  495 PRO A HB3  1  
ATOM   2967   H  HG2  . PRO A  1 180 ? -14.070 0.189   58.078  1.00 0.00 ?  495 PRO A HG2  1  
ATOM   2968   H  HG3  . PRO A  1 180 ? -12.195 0.283   58.092  1.00 0.00 ?  495 PRO A HG3  1  
ATOM   2969   H  HD2  . PRO A  1 180 ? -13.961 -0.329  55.864  1.00 0.00 ?  495 PRO A HD2  1  
ATOM   2970   H  HD3  . PRO A  1 180 ? -12.644 0.851   56.021  1.00 0.00 ?  495 PRO A HD3  1  
ATOM   2971   N  N    . GLY A  1 181 ? -10.501 -4.080  57.482  1.00 0.00 ?  496 GLY A N    1  
ATOM   2972   C  CA   . GLY A  1 181 ? -10.368 -5.557  57.382  1.00 0.00 ?  496 GLY A CA   1  
ATOM   2973   C  C    . GLY A  1 181 ? -9.379  -6.017  56.399  1.00 0.00 ?  496 GLY A C    1  
ATOM   2974   O  O    . GLY A  1 181 ? -8.918  -7.184  56.416  1.00 0.00 ?  496 GLY A O    1  
ATOM   2975   H  H    . GLY A  1 181 ? -9.851  -3.522  57.993  1.00 0.00 ?  496 GLY A H    1  
ATOM   2976   H  HA2  . GLY A  1 181 ? -10.028 -5.786  58.381  1.00 0.00 ?  496 GLY A HA2  1  
ATOM   2977   H  HA3  . GLY A  1 181 ? -11.371 -5.912  57.203  1.00 0.00 ?  496 GLY A HA3  1  
ATOM   2978   N  N    . TYR A  1 182 ? -9.006  -5.076  55.545  1.00 0.00 ?  497 TYR A N    1  
ATOM   2979   C  CA   . TYR A  1 182 ? -8.021  -5.304  54.571  1.00 0.00 ?  497 TYR A CA   1  
ATOM   2980   C  C    . TYR A  1 182 ? -6.604  -5.073  55.242  1.00 0.00 ?  497 TYR A C    1  
ATOM   2981   O  O    . TYR A  1 182 ? -6.532  -4.610  56.341  1.00 0.00 ?  497 TYR A O    1  
ATOM   2982   C  CB   . TYR A  1 182 ? -8.296  -4.461  53.219  1.00 0.00 ?  497 TYR A CB   1  
ATOM   2983   C  CG   . TYR A  1 182 ? -9.661  -4.851  52.692  1.00 0.00 ?  497 TYR A CG   1  
ATOM   2984   C  CD1  . TYR A  1 182 ? -10.827 -4.392  53.268  1.00 0.00 ?  497 TYR A CD1  1  
ATOM   2985   C  CD2  . TYR A  1 182 ? -9.715  -5.756  51.571  1.00 0.00 ?  497 TYR A CD2  1  
ATOM   2986   C  CE1  . TYR A  1 182 ? -12.056 -4.825  52.790  1.00 0.00 ?  497 TYR A CE1  1  
ATOM   2987   C  CE2  . TYR A  1 182 ? -10.929 -6.262  51.183  1.00 0.00 ?  497 TYR A CE2  1  
ATOM   2988   C  CZ   . TYR A  1 182 ? -12.096 -5.847  51.914  1.00 0.00 ?  497 TYR A CZ   1  
ATOM   2989   O  OH   . TYR A  1 182 ? -13.322 -6.403  51.747  1.00 0.00 ?  497 TYR A OH   1  
ATOM   2990   H  H    . TYR A  1 182 ? -9.382  -4.153  55.553  1.00 0.00 ?  497 TYR A H    1  
ATOM   2991   H  HA   . TYR A  1 182 ? -8.004  -6.328  54.228  1.00 0.00 ?  497 TYR A HA   1  
ATOM   2992   H  HB2  . TYR A  1 182 ? -8.277  -3.392  53.523  1.00 0.00 ?  497 TYR A HB2  1  
ATOM   2993   H  HB3  . TYR A  1 182 ? -7.571  -4.685  52.408  1.00 0.00 ?  497 TYR A HB3  1  
ATOM   2994   H  HD1  . TYR A  1 182 ? -10.736 -3.609  54.006  1.00 0.00 ?  497 TYR A HD1  1  
ATOM   2995   H  HD2  . TYR A  1 182 ? -8.853  -6.128  51.036  1.00 0.00 ?  497 TYR A HD2  1  
ATOM   2996   H  HE1  . TYR A  1 182 ? -12.962 -4.388  53.182  1.00 0.00 ?  497 TYR A HE1  1  
ATOM   2997   H  HE2  . TYR A  1 182 ? -10.958 -7.009  50.404  1.00 0.00 ?  497 TYR A HE2  1  
ATOM   2998   H  HH   . TYR A  1 182 ? -13.199 -7.119  51.120  1.00 0.00 ?  497 TYR A HH   1  
ATOM   2999   N  N    . PRO A  1 183 ? -5.413  -5.354  54.630  1.00 0.00 ?  498 PRO A N    1  
ATOM   3000   C  CA   . PRO A  1 183 ? -5.216  -6.215  53.448  1.00 0.00 ?  498 PRO A CA   1  
ATOM   3001   C  C    . PRO A  1 183 ? -5.824  -7.632  53.549  1.00 0.00 ?  498 PRO A C    1  
ATOM   3002   O  O    . PRO A  1 183 ? -6.062  -8.062  54.671  1.00 0.00 ?  498 PRO A O    1  
ATOM   3003   C  CB   . PRO A  1 183 ? -3.729  -6.321  53.293  1.00 0.00 ?  498 PRO A CB   1  
ATOM   3004   C  CG   . PRO A  1 183 ? -3.214  -5.936  54.698  1.00 0.00 ?  498 PRO A CG   1  
ATOM   3005   C  CD   . PRO A  1 183 ? -4.169  -5.018  55.288  1.00 0.00 ?  498 PRO A CD   1  
ATOM   3006   H  HA   . PRO A  1 183 ? -5.669  -5.785  52.567  1.00 0.00 ?  498 PRO A HA   1  
ATOM   3007   H  HB2  . PRO A  1 183 ? -3.275  -7.302  53.033  1.00 0.00 ?  498 PRO A HB2  1  
ATOM   3008   H  HB3  . PRO A  1 183 ? -3.522  -5.546  52.525  1.00 0.00 ?  498 PRO A HB3  1  
ATOM   3009   H  HG2  . PRO A  1 183 ? -3.169  -6.860  55.312  1.00 0.00 ?  498 PRO A HG2  1  
ATOM   3010   H  HG3  . PRO A  1 183 ? -2.142  -5.646  54.687  1.00 0.00 ?  498 PRO A HG3  1  
ATOM   3011   H  HD2  . PRO A  1 183 ? -4.352  -5.064  56.383  1.00 0.00 ?  498 PRO A HD2  1  
ATOM   3012   H  HD3  . PRO A  1 183 ? -4.131  -3.941  55.018  1.00 0.00 ?  498 PRO A HD3  1  
ATOM   3013   N  N    . LYS A  1 184 ? -6.091  -8.333  52.390  1.00 0.00 ?  499 LYS A N    1  
ATOM   3014   C  CA   . LYS A  1 184 ? -6.413  -9.690  52.405  1.00 0.00 ?  499 LYS A CA   1  
ATOM   3015   C  C    . LYS A  1 184 ? -5.597  -10.301 51.265  1.00 0.00 ?  499 LYS A C    1  
ATOM   3016   O  O    . LYS A  1 184 ? -5.016  -9.614  50.402  1.00 0.00 ?  499 LYS A O    1  
ATOM   3017   C  CB   . LYS A  1 184 ? -7.967  -9.971  52.204  1.00 0.00 ?  499 LYS A CB   1  
ATOM   3018   C  CG   . LYS A  1 184 ? -8.760  -9.137  53.222  1.00 0.00 ?  499 LYS A CG   1  
ATOM   3019   C  CD   . LYS A  1 184 ? -10.290 -9.196  53.016  1.00 0.00 ?  499 LYS A CD   1  
ATOM   3020   C  CE   . LYS A  1 184 ? -11.065 -8.452  54.070  1.00 0.00 ?  499 LYS A CE   1  
ATOM   3021   N  NZ   . LYS A  1 184 ? -10.939 -9.045  55.351  1.00 0.00 1  499 LYS A NZ   1  
ATOM   3022   H  H    . LYS A  1 184 ? -5.937  -7.903  51.504  1.00 0.00 ?  499 LYS A H    1  
ATOM   3023   H  HA   . LYS A  1 184 ? -5.998  -10.179 53.274  1.00 0.00 ?  499 LYS A HA   1  
ATOM   3024   H  HB2  . LYS A  1 184 ? -8.213  -9.595  51.188  1.00 0.00 ?  499 LYS A HB2  1  
ATOM   3025   H  HB3  . LYS A  1 184 ? -8.202  -11.049 52.336  1.00 0.00 ?  499 LYS A HB3  1  
ATOM   3026   H  HG2  . LYS A  1 184 ? -8.347  -9.464  54.200  1.00 0.00 ?  499 LYS A HG2  1  
ATOM   3027   H  HG3  . LYS A  1 184 ? -8.609  -8.037  53.171  1.00 0.00 ?  499 LYS A HG3  1  
ATOM   3028   H  HD2  . LYS A  1 184 ? -10.553 -8.793  52.014  1.00 0.00 ?  499 LYS A HD2  1  
ATOM   3029   H  HD3  . LYS A  1 184 ? -10.663 -10.241 52.963  1.00 0.00 ?  499 LYS A HD3  1  
ATOM   3030   H  HE2  . LYS A  1 184 ? -10.917 -7.351  54.111  1.00 0.00 ?  499 LYS A HE2  1  
ATOM   3031   H  HE3  . LYS A  1 184 ? -12.125 -8.414  53.739  1.00 0.00 ?  499 LYS A HE3  1  
ATOM   3032   H  HZ1  . LYS A  1 184 ? -10.064 -8.665  55.766  1.00 0.00 ?  499 LYS A HZ1  1  
ATOM   3033   H  HZ2  . LYS A  1 184 ? -10.916 -10.085 55.334  1.00 0.00 ?  499 LYS A HZ2  1  
ATOM   3034   H  HZ3  . LYS A  1 184 ? -11.757 -8.746  55.919  1.00 0.00 ?  499 LYS A HZ3  1  
ATOM   3035   N  N    . SER A  1 185 ? -5.531  -11.600 51.282  1.00 0.00 ?  500 SER A N    1  
ATOM   3036   C  CA   . SER A  1 185 ? -4.696  -12.326 50.417  1.00 0.00 ?  500 SER A CA   1  
ATOM   3037   C  C    . SER A  1 185 ? -5.422  -12.666 49.145  1.00 0.00 ?  500 SER A C    1  
ATOM   3038   O  O    . SER A  1 185 ? -6.477  -13.284 49.139  1.00 0.00 ?  500 SER A O    1  
ATOM   3039   C  CB   . SER A  1 185 ? -4.142  -13.679 51.042  1.00 0.00 ?  500 SER A CB   1  
ATOM   3040   O  OG   . SER A  1 185 ? -3.302  -14.332 50.081  1.00 0.00 ?  500 SER A OG   1  
ATOM   3041   H  H    . SER A  1 185 ? -5.827  -12.076 52.107  1.00 0.00 ?  500 SER A H    1  
ATOM   3042   H  HA   . SER A  1 185 ? -3.806  -11.742 50.238  1.00 0.00 ?  500 SER A HA   1  
ATOM   3043   H  HB2  . SER A  1 185 ? -3.589  -13.518 51.992  1.00 0.00 ?  500 SER A HB2  1  
ATOM   3044   H  HB3  . SER A  1 185 ? -5.005  -14.351 51.237  1.00 0.00 ?  500 SER A HB3  1  
ATOM   3045   H  HG   . SER A  1 185 ? -3.420  -15.255 50.315  1.00 0.00 ?  500 SER A HG   1  
ATOM   3046   N  N    . ALA A  1 186 ? -4.819  -12.149 48.045  1.00 0.00 ?  501 ALA A N    1  
ATOM   3047   C  CA   . ALA A  1 186 ? -5.153  -12.299 46.699  1.00 0.00 ?  501 ALA A CA   1  
ATOM   3048   C  C    . ALA A  1 186 ? -5.068  -13.716 46.219  1.00 0.00 ?  501 ALA A C    1  
ATOM   3049   O  O    . ALA A  1 186 ? -5.812  -14.138 45.378  1.00 0.00 ?  501 ALA A O    1  
ATOM   3050   C  CB   . ALA A  1 186 ? -4.240  -11.460 45.807  1.00 0.00 ?  501 ALA A CB   1  
ATOM   3051   H  H    . ALA A  1 186 ? -4.020  -11.559 48.135  1.00 0.00 ?  501 ALA A H    1  
ATOM   3052   H  HA   . ALA A  1 186 ? -6.196  -12.107 46.498  1.00 0.00 ?  501 ALA A HA   1  
ATOM   3053   H  HB1  . ALA A  1 186 ? -4.513  -11.529 44.732  1.00 0.00 ?  501 ALA A HB1  1  
ATOM   3054   H  HB2  . ALA A  1 186 ? -3.205  -11.809 46.007  1.00 0.00 ?  501 ALA A HB2  1  
ATOM   3055   H  HB3  . ALA A  1 186 ? -4.351  -10.409 46.148  1.00 0.00 ?  501 ALA A HB3  1  
ATOM   3056   N  N    . LEU A  1 187 ? -4.111  -14.429 46.869  1.00 0.00 ?  502 LEU A N    1  
ATOM   3057   C  CA   . LEU A  1 187 ? -3.908  -15.816 46.624  1.00 0.00 ?  502 LEU A CA   1  
ATOM   3058   C  C    . LEU A  1 187 ? -5.165  -16.568 47.014  1.00 0.00 ?  502 LEU A C    1  
ATOM   3059   O  O    . LEU A  1 187 ? -5.489  -17.516 46.307  1.00 0.00 ?  502 LEU A O    1  
ATOM   3060   C  CB   . LEU A  1 187 ? -2.604  -16.387 47.230  1.00 0.00 ?  502 LEU A CB   1  
ATOM   3061   C  CG   . LEU A  1 187 ? -1.285  -15.731 46.758  1.00 0.00 ?  502 LEU A CG   1  
ATOM   3062   C  CD1  . LEU A  1 187 ? -0.141  -16.311 47.651  1.00 0.00 ?  502 LEU A CD1  1  
ATOM   3063   C  CD2  . LEU A  1 187 ? -1.067  -16.007 45.257  1.00 0.00 ?  502 LEU A CD2  1  
ATOM   3064   H  H    . LEU A  1 187 ? -3.514  -13.904 47.472  1.00 0.00 ?  502 LEU A H    1  
ATOM   3065   H  HA   . LEU A  1 187 ? -3.764  -15.964 45.564  1.00 0.00 ?  502 LEU A HA   1  
ATOM   3066   H  HB2  . LEU A  1 187 ? -2.506  -16.177 48.317  1.00 0.00 ?  502 LEU A HB2  1  
ATOM   3067   H  HB3  . LEU A  1 187 ? -2.488  -17.468 47.005  1.00 0.00 ?  502 LEU A HB3  1  
ATOM   3068   H  HG   . LEU A  1 187 ? -1.355  -14.643 46.972  1.00 0.00 ?  502 LEU A HG   1  
ATOM   3069   H  HD11 . LEU A  1 187 ? 0.892   -16.007 47.378  1.00 0.00 ?  502 LEU A HD11 1  
ATOM   3070   H  HD12 . LEU A  1 187 ? -0.101  -17.422 47.664  1.00 0.00 ?  502 LEU A HD12 1  
ATOM   3071   H  HD13 . LEU A  1 187 ? -0.369  -15.935 48.671  1.00 0.00 ?  502 LEU A HD13 1  
ATOM   3072   H  HD21 . LEU A  1 187 ? -0.035  -15.665 45.025  1.00 0.00 ?  502 LEU A HD21 1  
ATOM   3073   H  HD22 . LEU A  1 187 ? -1.834  -15.457 44.671  1.00 0.00 ?  502 LEU A HD22 1  
ATOM   3074   H  HD23 . LEU A  1 187 ? -1.070  -17.069 44.929  1.00 0.00 ?  502 LEU A HD23 1  
ATOM   3075   N  N    . ARG A  1 188 ? -5.916  -16.167 48.069  1.00 0.00 ?  503 ARG A N    1  
ATOM   3076   C  CA   . ARG A  1 188 ? -7.169  -16.811 48.424  1.00 0.00 ?  503 ARG A CA   1  
ATOM   3077   C  C    . ARG A  1 188 ? -8.291  -16.217 47.556  1.00 0.00 ?  503 ARG A C    1  
ATOM   3078   O  O    . ARG A  1 188 ? -9.137  -16.953 47.093  1.00 0.00 ?  503 ARG A O    1  
ATOM   3079   C  CB   . ARG A  1 188 ? -7.386  -16.529 49.948  1.00 0.00 ?  503 ARG A CB   1  
ATOM   3080   C  CG   . ARG A  1 188 ? -8.750  -16.906 50.525  1.00 0.00 ?  503 ARG A CG   1  
ATOM   3081   C  CD   . ARG A  1 188 ? -8.914  -16.327 51.890  1.00 0.00 ?  503 ARG A CD   1  
ATOM   3082   N  NE   . ARG A  1 188 ? -9.392  -14.946 51.818  1.00 0.00 ?  503 ARG A NE   1  
ATOM   3083   C  CZ   . ARG A  1 188 ? -9.623  -14.117 52.871  1.00 0.00 ?  503 ARG A CZ   1  
ATOM   3084   N  NH1  . ARG A  1 188 ? -10.410 -13.084 52.646  1.00 0.00 1  503 ARG A NH1  1  
ATOM   3085   N  NH2  . ARG A  1 188 ? -9.198  -14.286 54.069  1.00 0.00 ?  503 ARG A NH2  1  
ATOM   3086   H  H    . ARG A  1 188 ? -5.631  -15.304 48.479  1.00 0.00 ?  503 ARG A H    1  
ATOM   3087   H  HA   . ARG A  1 188 ? -7.096  -17.887 48.366  1.00 0.00 ?  503 ARG A HA   1  
ATOM   3088   H  HB2  . ARG A  1 188 ? -6.624  -17.013 50.595  1.00 0.00 ?  503 ARG A HB2  1  
ATOM   3089   H  HB3  . ARG A  1 188 ? -7.295  -15.428 50.065  1.00 0.00 ?  503 ARG A HB3  1  
ATOM   3090   H  HG2  . ARG A  1 188 ? -9.605  -16.562 49.904  1.00 0.00 ?  503 ARG A HG2  1  
ATOM   3091   H  HG3  . ARG A  1 188 ? -8.925  -18.002 50.564  1.00 0.00 ?  503 ARG A HG3  1  
ATOM   3092   H  HD2  . ARG A  1 188 ? -9.714  -16.865 52.442  1.00 0.00 ?  503 ARG A HD2  1  
ATOM   3093   H  HD3  . ARG A  1 188 ? -8.020  -16.402 52.546  1.00 0.00 ?  503 ARG A HD3  1  
ATOM   3094   H  HE   . ARG A  1 188 ? -9.793  -14.635 50.957  1.00 0.00 ?  503 ARG A HE   1  
ATOM   3095   H  HH11 . ARG A  1 188 ? -10.572 -12.886 51.679  1.00 0.00 ?  503 ARG A HH11 1  
ATOM   3096   H  HH12 . ARG A  1 188 ? -10.581 -12.362 53.317  1.00 0.00 ?  503 ARG A HH12 1  
ATOM   3097   H  HH21 . ARG A  1 188 ? -8.407  -14.855 54.292  1.00 0.00 ?  503 ARG A HH21 1  
ATOM   3098   H  HH22 . ARG A  1 188 ? -9.440  -13.587 54.742  1.00 0.00 ?  503 ARG A HH22 1  
ATOM   3099   N  N    . ASP A  1 189 ? -8.483  -14.883 47.405  1.00 0.00 ?  504 ASP A N    1  
ATOM   3100   C  CA   . ASP A  1 189 ? -9.726  -14.417 46.995  1.00 0.00 ?  504 ASP A CA   1  
ATOM   3101   C  C    . ASP A  1 189 ? -9.831  -14.398 45.477  1.00 0.00 ?  504 ASP A C    1  
ATOM   3102   O  O    . ASP A  1 189 ? -10.902 -14.464 44.861  1.00 0.00 ?  504 ASP A O    1  
ATOM   3103   C  CB   . ASP A  1 189 ? -9.937  -12.982 47.641  1.00 0.00 ?  504 ASP A CB   1  
ATOM   3104   C  CG   . ASP A  1 189 ? -10.323 -13.066 49.112  1.00 0.00 ?  504 ASP A CG   1  
ATOM   3105   O  OD1  . ASP A  1 189 ? -10.351 -12.038 49.803  1.00 0.00 ?  504 ASP A OD1  1  
ATOM   3106   O  OD2  . ASP A  1 189 ? -10.723 -14.169 49.566  1.00 0.00 -1 504 ASP A OD2  1  
ATOM   3107   H  H    . ASP A  1 189 ? -7.892  -14.262 47.913  1.00 0.00 ?  504 ASP A H    1  
ATOM   3108   H  HA   . ASP A  1 189 ? -10.442 -15.033 47.518  1.00 0.00 ?  504 ASP A HA   1  
ATOM   3109   H  HB2  . ASP A  1 189 ? -8.982  -12.447 47.449  1.00 0.00 ?  504 ASP A HB2  1  
ATOM   3110   H  HB3  . ASP A  1 189 ? -10.759 -12.499 47.071  1.00 0.00 ?  504 ASP A HB3  1  
ATOM   3111   N  N    . TRP A  1 190 ? -8.708  -14.353 44.816  1.00 0.00 ?  505 TRP A N    1  
ATOM   3112   C  CA   . TRP A  1 190 ? -8.529  -14.099 43.414  1.00 0.00 ?  505 TRP A CA   1  
ATOM   3113   C  C    . TRP A  1 190 ? -8.053  -15.342 42.712  1.00 0.00 ?  505 TRP A C    1  
ATOM   3114   O  O    . TRP A  1 190 ? -8.775  -15.871 41.826  1.00 0.00 ?  505 TRP A O    1  
ATOM   3115   C  CB   . TRP A  1 190 ? -7.420  -12.991 43.002  1.00 0.00 ?  505 TRP A CB   1  
ATOM   3116   C  CG   . TRP A  1 190 ? -7.648  -11.623 43.561  1.00 0.00 ?  505 TRP A CG   1  
ATOM   3117   C  CD1  . TRP A  1 190 ? -8.774  -11.189 44.233  1.00 0.00 ?  505 TRP A CD1  1  
ATOM   3118   C  CD2  . TRP A  1 190 ? -6.851  -10.376 43.350  1.00 0.00 ?  505 TRP A CD2  1  
ATOM   3119   N  NE1  . TRP A  1 190 ? -8.639  -9.861  44.489  1.00 0.00 ?  505 TRP A NE1  1  
ATOM   3120   C  CE2  . TRP A  1 190 ? -7.575  -9.268  43.916  1.00 0.00 ?  505 TRP A CE2  1  
ATOM   3121   C  CE3  . TRP A  1 190 ? -5.790  -9.989  42.535  1.00 0.00 ?  505 TRP A CE3  1  
ATOM   3122   C  CZ2  . TRP A  1 190 ? -7.123  -7.929  43.983  1.00 0.00 ?  505 TRP A CZ2  1  
ATOM   3123   C  CZ3  . TRP A  1 190 ? -5.290  -8.709  42.579  1.00 0.00 ?  505 TRP A CZ3  1  
ATOM   3124   C  CH2  . TRP A  1 190 ? -5.979  -7.629  43.237  1.00 0.00 ?  505 TRP A CH2  1  
ATOM   3125   H  H    . TRP A  1 190 ? -7.860  -14.410 45.337  1.00 0.00 ?  505 TRP A H    1  
ATOM   3126   H  HA   . TRP A  1 190 ? -9.504  -13.894 42.996  1.00 0.00 ?  505 TRP A HA   1  
ATOM   3127   H  HB2  . TRP A  1 190 ? -6.422  -13.380 43.297  1.00 0.00 ?  505 TRP A HB2  1  
ATOM   3128   H  HB3  . TRP A  1 190 ? -7.381  -12.972 41.892  1.00 0.00 ?  505 TRP A HB3  1  
ATOM   3129   H  HD1  . TRP A  1 190 ? -9.491  -11.793 44.770  1.00 0.00 ?  505 TRP A HD1  1  
ATOM   3130   H  HE1  . TRP A  1 190 ? -9.303  -9.416  45.050  1.00 0.00 ?  505 TRP A HE1  1  
ATOM   3131   H  HE3  . TRP A  1 190 ? -5.187  -10.759 42.077  1.00 0.00 ?  505 TRP A HE3  1  
ATOM   3132   H  HZ2  . TRP A  1 190 ? -7.729  -7.136  44.397  1.00 0.00 ?  505 TRP A HZ2  1  
ATOM   3133   H  HZ3  . TRP A  1 190 ? -4.295  -8.460  42.240  1.00 0.00 ?  505 TRP A HZ3  1  
ATOM   3134   H  HH2  . TRP A  1 190 ? -5.433  -6.698  43.249  1.00 0.00 ?  505 TRP A HH2  1  
ATOM   3135   N  N    . MET A  1 191 ? -6.923  -15.890 43.177  1.00 0.00 ?  506 MET A N    1  
ATOM   3136   C  CA   . MET A  1 191 ? -6.154  -16.969 42.564  1.00 0.00 ?  506 MET A CA   1  
ATOM   3137   C  C    . MET A  1 191 ? -6.709  -18.398 42.967  1.00 0.00 ?  506 MET A C    1  
ATOM   3138   O  O    . MET A  1 191 ? -6.485  -19.374 42.277  1.00 0.00 ?  506 MET A O    1  
ATOM   3139   C  CB   . MET A  1 191 ? -4.567  -16.901 42.799  1.00 0.00 ?  506 MET A CB   1  
ATOM   3140   C  CG   . MET A  1 191 ? -3.882  -15.554 42.566  1.00 0.00 ?  506 MET A CG   1  
ATOM   3141   S  SD   . MET A  1 191 ? -4.190  -14.881 40.847  1.00 0.00 ?  506 MET A SD   1  
ATOM   3142   C  CE   . MET A  1 191 ? -3.723  -13.207 41.335  1.00 0.00 ?  506 MET A CE   1  
ATOM   3143   H  H    . MET A  1 191 ? -6.420  -15.459 43.923  1.00 0.00 ?  506 MET A H    1  
ATOM   3144   H  HA   . MET A  1 191 ? -6.316  -16.981 41.496  1.00 0.00 ?  506 MET A HA   1  
ATOM   3145   H  HB2  . MET A  1 191 ? -4.333  -17.100 43.867  1.00 0.00 ?  506 MET A HB2  1  
ATOM   3146   H  HB3  . MET A  1 191 ? -4.104  -17.725 42.216  1.00 0.00 ?  506 MET A HB3  1  
ATOM   3147   H  HG2  . MET A  1 191 ? -4.275  -14.834 43.316  1.00 0.00 ?  506 MET A HG2  1  
ATOM   3148   H  HG3  . MET A  1 191 ? -2.791  -15.617 42.765  1.00 0.00 ?  506 MET A HG3  1  
ATOM   3149   H  HE1  . MET A  1 191 ? -3.918  -12.392 40.607  1.00 0.00 ?  506 MET A HE1  1  
ATOM   3150   H  HE2  . MET A  1 191 ? -2.613  -13.177 41.335  1.00 0.00 ?  506 MET A HE2  1  
ATOM   3151   H  HE3  . MET A  1 191 ? -4.116  -12.942 42.340  1.00 0.00 ?  506 MET A HE3  1  
ATOM   3152   N  N    . GLY A  1 192 ? -7.678  -18.431 43.942  1.00 0.00 ?  507 GLY A N    1  
ATOM   3153   C  CA   . GLY A  1 192 ? -8.452  -19.517 44.372  1.00 0.00 ?  507 GLY A CA   1  
ATOM   3154   C  C    . GLY A  1 192 ? -7.730  -20.538 45.324  1.00 0.00 ?  507 GLY A C    1  
ATOM   3155   O  O    . GLY A  1 192 ? -8.082  -21.690 45.403  1.00 0.00 ?  507 GLY A O    1  
ATOM   3156   H  H    . GLY A  1 192 ? -7.727  -17.534 44.375  1.00 0.00 ?  507 GLY A H    1  
ATOM   3157   H  HA2  . GLY A  1 192 ? -9.231  -19.096 44.989  1.00 0.00 ?  507 GLY A HA2  1  
ATOM   3158   H  HA3  . GLY A  1 192 ? -8.836  -20.154 43.588  1.00 0.00 ?  507 GLY A HA3  1  
ATOM   3159   N  N    . CYS A  1 193 ? -6.582  -20.120 45.851  1.00 0.00 ?  508 CYS A N    1  
ATOM   3160   C  CA   . CYS A  1 193 ? -5.644  -20.984 46.647  1.00 0.00 ?  508 CYS A CA   1  
ATOM   3161   C  C    . CYS A  1 193 ? -6.108  -21.274 48.018  1.00 0.00 ?  508 CYS A C    1  
ATOM   3162   O  O    . CYS A  1 193 ? -6.903  -20.478 48.584  1.00 0.00 ?  508 CYS A O    1  
ATOM   3163   C  CB   . CYS A  1 193 ? -4.181  -20.342 46.679  1.00 0.00 ?  508 CYS A CB   1  
ATOM   3164   S  SG   . CYS A  1 193 ? -3.410  -20.132 44.971  1.00 0.00 ?  508 CYS A SG   1  
ATOM   3165   H  H    . CYS A  1 193 ? -6.478  -19.134 45.751  1.00 0.00 ?  508 CYS A H    1  
ATOM   3166   H  HA   . CYS A  1 193 ? -5.657  -21.955 46.174  1.00 0.00 ?  508 CYS A HA   1  
ATOM   3167   H  HB2  . CYS A  1 193 ? -4.341  -19.364 47.182  1.00 0.00 ?  508 CYS A HB2  1  
ATOM   3168   H  HB3  . CYS A  1 193 ? -3.483  -20.909 47.331  1.00 0.00 ?  508 CYS A HB3  1  
ATOM   3169   H  HG   . CYS A  1 193 ? -3.246  -21.444 44.876  1.00 0.00 ?  508 CYS A HG   1  
ATOM   3170   N  N    . PRO A  1 194 ? -5.678  -22.350 48.656  1.00 0.00 ?  509 PRO A N    1  
ATOM   3171   C  CA   . PRO A  1 194 ? -6.076  -22.519 50.130  1.00 0.00 ?  509 PRO A CA   1  
ATOM   3172   C  C    . PRO A  1 194 ? -5.319  -21.613 51.076  1.00 0.00 ?  509 PRO A C    1  
ATOM   3173   O  O    . PRO A  1 194 ? -4.148  -21.446 50.840  1.00 0.00 ?  509 PRO A O    1  
ATOM   3174   C  CB   . PRO A  1 194 ? -5.785  -24.014 50.303  1.00 0.00 ?  509 PRO A CB   1  
ATOM   3175   C  CG   . PRO A  1 194 ? -4.660  -24.334 49.294  1.00 0.00 ?  509 PRO A CG   1  
ATOM   3176   C  CD   . PRO A  1 194 ? -5.030  -23.489 48.086  1.00 0.00 ?  509 PRO A CD   1  
ATOM   3177   H  HA   . PRO A  1 194 ? -7.139  -22.356 50.231  1.00 0.00 ?  509 PRO A HA   1  
ATOM   3178   H  HB2  . PRO A  1 194 ? -5.551  -24.294 51.352  1.00 0.00 ?  509 PRO A HB2  1  
ATOM   3179   H  HB3  . PRO A  1 194 ? -6.612  -24.722 50.082  1.00 0.00 ?  509 PRO A HB3  1  
ATOM   3180   H  HG2  . PRO A  1 194 ? -3.743  -24.047 49.851  1.00 0.00 ?  509 PRO A HG2  1  
ATOM   3181   H  HG3  . PRO A  1 194 ? -4.495  -25.421 49.131  1.00 0.00 ?  509 PRO A HG3  1  
ATOM   3182   H  HD2  . PRO A  1 194 ? -4.221  -23.251 47.362  1.00 0.00 ?  509 PRO A HD2  1  
ATOM   3183   H  HD3  . PRO A  1 194 ? -5.852  -24.062 47.608  1.00 0.00 ?  509 PRO A HD3  1  
ATOM   3184   N  N    . SER A  1 195 ? -6.040  -21.082 52.138  1.00 0.00 ?  510 SER A N    1  
ATOM   3185   C  CA   . SER A  1 195 ? -5.438  -20.601 53.445  1.00 0.00 ?  510 SER A CA   1  
ATOM   3186   C  C    . SER A  1 195 ? -4.924  -19.138 53.428  1.00 0.00 ?  510 SER A C    1  
ATOM   3187   O  O    . SER A  1 195 ? -3.841  -18.751 52.910  1.00 0.00 ?  510 SER A O    1  
ATOM   3188   C  CB   . SER A  1 195 ? -4.362  -21.540 53.970  1.00 0.00 ?  510 SER A CB   1  
ATOM   3189   O  OG   . SER A  1 195 ? -3.988  -21.097 55.290  1.00 0.00 ?  510 SER A OG   1  
ATOM   3190   H  H    . SER A  1 195 ? -7.027  -21.010 52.021  1.00 0.00 ?  510 SER A H    1  
ATOM   3191   H  HA   . SER A  1 195 ? -6.202  -20.508 54.203  1.00 0.00 ?  510 SER A HA   1  
ATOM   3192   H  HB2  . SER A  1 195 ? -4.860  -22.533 53.969  1.00 0.00 ?  510 SER A HB2  1  
ATOM   3193   H  HB3  . SER A  1 195 ? -3.430  -21.545 53.366  1.00 0.00 ?  510 SER A HB3  1  
ATOM   3194   H  HG   . SER A  1 195 ? -3.078  -20.793 55.266  1.00 0.00 ?  510 SER A HG   1  
ATOM   3195   N  N    . GLY A  1 196 ? -5.749  -18.140 53.952  1.00 0.00 ?  511 GLY A N    1  
ATOM   3196   C  CA   . GLY A  1 196 ? -5.274  -16.817 54.176  1.00 0.00 ?  511 GLY A CA   1  
ATOM   3197   C  C    . GLY A  1 196 ? -6.406  -16.042 54.925  1.00 0.00 ?  511 GLY A C    1  
ATOM   3198   O  O    . GLY A  1 196 ? -6.302  -14.850 55.202  1.00 0.00 ?  511 GLY A O    1  
ATOM   3199   O  OXT  . GLY A  1 196 ? -7.411  -16.710 55.230  1.00 0.00 ?  511 GLY A OXT  1  
ATOM   3200   H  H    . GLY A  1 196 ? -6.656  -18.294 54.335  1.00 0.00 ?  511 GLY A H    1  
ATOM   3201   H  HA2  . GLY A  1 196 ? -4.407  -16.967 54.803  1.00 0.00 ?  511 GLY A HA2  1  
ATOM   3202   H  HA3  . GLY A  1 196 ? -5.031  -16.452 53.189  1.00 0.00 ?  511 GLY A HA3  1  
ATOM   3203   N  N    . SER B  2 1   ? -9.778  -50.495 -14.504 1.00 0.00 ?  55  SER B N    1  
ATOM   3204   C  CA   . SER B  2 1   ? -9.542  -51.203 -13.245 1.00 0.00 ?  55  SER B CA   1  
ATOM   3205   C  C    . SER B  2 1   ? -10.759 -51.122 -12.289 1.00 0.00 ?  55  SER B C    1  
ATOM   3206   O  O    . SER B  2 1   ? -11.907 -51.037 -12.750 1.00 0.00 ?  55  SER B O    1  
ATOM   3207   C  CB   . SER B  2 1   ? -8.154  -50.808 -12.704 1.00 0.00 ?  55  SER B CB   1  
ATOM   3208   O  OG   . SER B  2 1   ? -7.808  -51.659 -11.590 1.00 0.00 ?  55  SER B OG   1  
ATOM   3209   H  H1   . SER B  2 1   ? -10.735 -50.767 -14.810 1.00 0.00 ?  55  SER B H1   1  
ATOM   3210   H  H2   . SER B  2 1   ? -9.119  -50.532 -15.308 1.00 0.00 ?  55  SER B H2   1  
ATOM   3211   H  H3   . SER B  2 1   ? -9.861  -49.470 -14.349 1.00 0.00 ?  55  SER B H3   1  
ATOM   3212   H  HA   . SER B  2 1   ? -9.575  -52.236 -13.559 1.00 0.00 ?  55  SER B HA   1  
ATOM   3213   H  HB2  . SER B  2 1   ? -7.458  -50.936 -13.560 1.00 0.00 ?  55  SER B HB2  1  
ATOM   3214   H  HB3  . SER B  2 1   ? -8.171  -49.740 -12.399 1.00 0.00 ?  55  SER B HB3  1  
ATOM   3215   H  HG   . SER B  2 1   ? -6.964  -51.356 -11.248 1.00 0.00 ?  55  SER B HG   1  
ATOM   3216   N  N    . THR B  2 2   ? -10.580 -51.164 -10.987 1.00 0.00 ?  56  THR B N    1  
ATOM   3217   C  CA   . THR B  2 2   ? -11.664 -51.235 -10.029 1.00 0.00 ?  56  THR B CA   1  
ATOM   3218   C  C    . THR B  2 2   ? -12.531 -50.054 -10.049 1.00 0.00 ?  56  THR B C    1  
ATOM   3219   O  O    . THR B  2 2   ? -13.736 -50.184 -10.038 1.00 0.00 ?  56  THR B O    1  
ATOM   3220   C  CB   . THR B  2 2   ? -11.177 -51.466 -8.595  1.00 0.00 ?  56  THR B CB   1  
ATOM   3221   O  OG1  . THR B  2 2   ? -9.927  -51.997 -8.682  1.00 0.00 ?  56  THR B OG1  1  
ATOM   3222   C  CG2  . THR B  2 2   ? -12.131 -52.390 -7.835  1.00 0.00 ?  56  THR B CG2  1  
ATOM   3223   H  H    . THR B  2 2   ? -9.719  -51.405 -10.546 1.00 0.00 ?  56  THR B H    1  
ATOM   3224   H  HA   . THR B  2 2   ? -12.339 -52.023 -10.326 1.00 0.00 ?  56  THR B HA   1  
ATOM   3225   H  HB   . THR B  2 2   ? -11.101 -50.461 -8.127  1.00 0.00 ?  56  THR B HB   1  
ATOM   3226   H  HG1  . THR B  2 2   ? -9.270  -51.298 -8.720  1.00 0.00 ?  56  THR B HG1  1  
ATOM   3227   H  HG21 . THR B  2 2   ? -12.083 -53.445 -8.179  1.00 0.00 ?  56  THR B HG21 1  
ATOM   3228   H  HG22 . THR B  2 2   ? -13.184 -52.034 -7.842  1.00 0.00 ?  56  THR B HG22 1  
ATOM   3229   H  HG23 . THR B  2 2   ? -11.786 -52.369 -6.780  1.00 0.00 ?  56  THR B HG23 1  
ATOM   3230   N  N    . PHE B  2 3   ? -12.027 -48.798 -10.075 1.00 0.00 ?  57  PHE B N    1  
ATOM   3231   C  CA   . PHE B  2 3   ? -12.848 -47.574 -10.054 1.00 0.00 ?  57  PHE B CA   1  
ATOM   3232   C  C    . PHE B  2 3   ? -13.611 -47.306 -11.373 1.00 0.00 ?  57  PHE B C    1  
ATOM   3233   O  O    . PHE B  2 3   ? -14.759 -46.896 -11.355 1.00 0.00 ?  57  PHE B O    1  
ATOM   3234   C  CB   . PHE B  2 3   ? -11.932 -46.275 -9.951  1.00 0.00 ?  57  PHE B CB   1  
ATOM   3235   C  CG   . PHE B  2 3   ? -11.399 -46.081 -8.562  1.00 0.00 ?  57  PHE B CG   1  
ATOM   3236   C  CD1  . PHE B  2 3   ? -10.067 -46.449 -8.352  1.00 0.00 ?  57  PHE B CD1  1  
ATOM   3237   C  CD2  . PHE B  2 3   ? -12.135 -45.585 -7.484  1.00 0.00 ?  57  PHE B CD2  1  
ATOM   3238   C  CE1  . PHE B  2 3   ? -9.498  -46.356 -7.065  1.00 0.00 ?  57  PHE B CE1  1  
ATOM   3239   C  CE2  . PHE B  2 3   ? -11.572 -45.452 -6.210  1.00 0.00 ?  57  PHE B CE2  1  
ATOM   3240   C  CZ   . PHE B  2 3   ? -10.279 -45.942 -5.908  1.00 0.00 ?  57  PHE B CZ   1  
ATOM   3241   H  H    . PHE B  2 3   ? -11.043 -48.645 -10.042 1.00 0.00 ?  57  PHE B H    1  
ATOM   3242   H  HA   . PHE B  2 3   ? -13.560 -47.568 -9.242  1.00 0.00 ?  57  PHE B HA   1  
ATOM   3243   H  HB2  . PHE B  2 3   ? -11.020 -46.481 -10.552 1.00 0.00 ?  57  PHE B HB2  1  
ATOM   3244   H  HB3  . PHE B  2 3   ? -12.382 -45.332 -10.329 1.00 0.00 ?  57  PHE B HB3  1  
ATOM   3245   H  HD1  . PHE B  2 3   ? -9.420  -46.885 -9.098  1.00 0.00 ?  57  PHE B HD1  1  
ATOM   3246   H  HD2  . PHE B  2 3   ? -13.143 -45.283 -7.726  1.00 0.00 ?  57  PHE B HD2  1  
ATOM   3247   H  HE1  . PHE B  2 3   ? -8.528  -46.764 -6.822  1.00 0.00 ?  57  PHE B HE1  1  
ATOM   3248   H  HE2  . PHE B  2 3   ? -12.053 -44.823 -5.475  1.00 0.00 ?  57  PHE B HE2  1  
ATOM   3249   H  HZ   . PHE B  2 3   ? -9.762  -45.636 -5.011  1.00 0.00 ?  57  PHE B HZ   1  
ATOM   3250   N  N    . SER B  2 4   ? -13.027 -47.551 -12.614 1.00 0.00 ?  58  SER B N    1  
ATOM   3251   C  CA   . SER B  2 4   ? -13.688 -47.576 -13.869 1.00 0.00 ?  58  SER B CA   1  
ATOM   3252   C  C    . SER B  2 4   ? -14.751 -48.693 -13.920 1.00 0.00 ?  58  SER B C    1  
ATOM   3253   O  O    . SER B  2 4   ? -15.867 -48.469 -14.440 1.00 0.00 ?  58  SER B O    1  
ATOM   3254   C  CB   . SER B  2 4   ? -12.741 -47.733 -15.097 1.00 0.00 ?  58  SER B CB   1  
ATOM   3255   O  OG   . SER B  2 4   ? -12.179 -48.970 -15.216 1.00 0.00 ?  58  SER B OG   1  
ATOM   3256   H  H    . SER B  2 4   ? -12.057 -47.781 -12.625 1.00 0.00 ?  58  SER B H    1  
ATOM   3257   H  HA   . SER B  2 4   ? -14.321 -46.702 -13.920 1.00 0.00 ?  58  SER B HA   1  
ATOM   3258   H  HB2  . SER B  2 4   ? -13.293 -47.713 -16.061 1.00 0.00 ?  58  SER B HB2  1  
ATOM   3259   H  HB3  . SER B  2 4   ? -11.983 -46.922 -15.142 1.00 0.00 ?  58  SER B HB3  1  
ATOM   3260   H  HG   . SER B  2 4   ? -12.645 -49.443 -15.909 1.00 0.00 ?  58  SER B HG   1  
ATOM   3261   N  N    . LYS B  2 5   ? -14.501 -49.785 -13.231 1.00 0.00 ?  59  LYS B N    1  
ATOM   3262   C  CA   . LYS B  2 5   ? -15.569 -50.735 -13.025 1.00 0.00 ?  59  LYS B CA   1  
ATOM   3263   C  C    . LYS B  2 5   ? -16.644 -50.412 -11.913 1.00 0.00 ?  59  LYS B C    1  
ATOM   3264   O  O    . LYS B  2 5   ? -17.794 -50.522 -12.229 1.00 0.00 ?  59  LYS B O    1  
ATOM   3265   C  CB   . LYS B  2 5   ? -14.872 -52.035 -12.669 1.00 0.00 ?  59  LYS B CB   1  
ATOM   3266   C  CG   . LYS B  2 5   ? -15.793 -53.214 -12.985 1.00 0.00 ?  59  LYS B CG   1  
ATOM   3267   C  CD   . LYS B  2 5   ? -16.358 -53.263 -14.414 1.00 0.00 ?  59  LYS B CD   1  
ATOM   3268   C  CE   . LYS B  2 5   ? -15.297 -53.188 -15.558 1.00 0.00 ?  59  LYS B CE   1  
ATOM   3269   N  NZ   . LYS B  2 5   ? -15.882 -53.309 -16.940 1.00 0.00 1  59  LYS B NZ   1  
ATOM   3270   H  H    . LYS B  2 5   ? -13.576 -50.112 -13.053 1.00 0.00 ?  59  LYS B H    1  
ATOM   3271   H  HA   . LYS B  2 5   ? -16.198 -50.784 -13.902 1.00 0.00 ?  59  LYS B HA   1  
ATOM   3272   H  HB2  . LYS B  2 5   ? -13.999 -52.204 -13.335 1.00 0.00 ?  59  LYS B HB2  1  
ATOM   3273   H  HB3  . LYS B  2 5   ? -14.398 -51.981 -11.666 1.00 0.00 ?  59  LYS B HB3  1  
ATOM   3274   H  HG2  . LYS B  2 5   ? -15.290 -54.165 -12.705 1.00 0.00 ?  59  LYS B HG2  1  
ATOM   3275   H  HG3  . LYS B  2 5   ? -16.692 -53.208 -12.331 1.00 0.00 ?  59  LYS B HG3  1  
ATOM   3276   H  HD2  . LYS B  2 5   ? -16.927 -54.214 -14.485 1.00 0.00 ?  59  LYS B HD2  1  
ATOM   3277   H  HD3  . LYS B  2 5   ? -17.161 -52.536 -14.663 1.00 0.00 ?  59  LYS B HD3  1  
ATOM   3278   H  HE2  . LYS B  2 5   ? -14.789 -52.200 -15.563 1.00 0.00 ?  59  LYS B HE2  1  
ATOM   3279   H  HE3  . LYS B  2 5   ? -14.521 -53.977 -15.460 1.00 0.00 ?  59  LYS B HE3  1  
ATOM   3280   H  HZ1  . LYS B  2 5   ? -15.093 -53.120 -17.591 1.00 0.00 ?  59  LYS B HZ1  1  
ATOM   3281   H  HZ2  . LYS B  2 5   ? -16.587 -52.549 -17.031 1.00 0.00 ?  59  LYS B HZ2  1  
ATOM   3282   H  HZ3  . LYS B  2 5   ? -16.316 -54.223 -17.180 1.00 0.00 ?  59  LYS B HZ3  1  
ATOM   3283   N  N    . LEU B  2 6   ? -16.303 -49.798 -10.777 1.00 0.00 ?  60  LEU B N    1  
ATOM   3284   C  CA   . LEU B  2 6   ? -17.210 -49.241 -9.766  1.00 0.00 ?  60  LEU B CA   1  
ATOM   3285   C  C    . LEU B  2 6   ? -18.047 -48.165 -10.301 1.00 0.00 ?  60  LEU B C    1  
ATOM   3286   O  O    . LEU B  2 6   ? -19.262 -48.159 -10.150 1.00 0.00 ?  60  LEU B O    1  
ATOM   3287   C  CB   . LEU B  2 6   ? -16.375 -48.743 -8.521  1.00 0.00 ?  60  LEU B CB   1  
ATOM   3288   C  CG   . LEU B  2 6   ? -17.044 -48.138 -7.307  1.00 0.00 ?  60  LEU B CG   1  
ATOM   3289   C  CD1  . LEU B  2 6   ? -18.357 -48.835 -6.916  1.00 0.00 ?  60  LEU B CD1  1  
ATOM   3290   C  CD2  . LEU B  2 6   ? -16.053 -48.149 -6.152  1.00 0.00 ?  60  LEU B CD2  1  
ATOM   3291   H  H    . LEU B  2 6   ? -15.338 -49.610 -10.608 1.00 0.00 ?  60  LEU B H    1  
ATOM   3292   H  HA   . LEU B  2 6   ? -17.860 -50.031 -9.419  1.00 0.00 ?  60  LEU B HA   1  
ATOM   3293   H  HB2  . LEU B  2 6   ? -15.886 -49.679 -8.178  1.00 0.00 ?  60  LEU B HB2  1  
ATOM   3294   H  HB3  . LEU B  2 6   ? -15.412 -48.267 -8.804  1.00 0.00 ?  60  LEU B HB3  1  
ATOM   3295   H  HG   . LEU B  2 6   ? -17.256 -47.084 -7.587  1.00 0.00 ?  60  LEU B HG   1  
ATOM   3296   H  HD11 . LEU B  2 6   ? -18.265 -49.904 -6.629  1.00 0.00 ?  60  LEU B HD11 1  
ATOM   3297   H  HD12 . LEU B  2 6   ? -19.084 -48.870 -7.756  1.00 0.00 ?  60  LEU B HD12 1  
ATOM   3298   H  HD13 . LEU B  2 6   ? -18.811 -48.306 -6.051  1.00 0.00 ?  60  LEU B HD13 1  
ATOM   3299   H  HD21 . LEU B  2 6   ? -15.884 -49.188 -5.796  1.00 0.00 ?  60  LEU B HD21 1  
ATOM   3300   H  HD22 . LEU B  2 6   ? -16.451 -47.620 -5.259  1.00 0.00 ?  60  LEU B HD22 1  
ATOM   3301   H  HD23 . LEU B  2 6   ? -15.211 -47.532 -6.533  1.00 0.00 ?  60  LEU B HD23 1  
ATOM   3302   N  N    . ARG B  2 7   ? -17.511 -47.225 -11.099 1.00 0.00 ?  61  ARG B N    1  
ATOM   3303   C  CA   . ARG B  2 7   ? -18.343 -46.354 -11.923 1.00 0.00 ?  61  ARG B CA   1  
ATOM   3304   C  C    . ARG B  2 7   ? -19.347 -46.982 -12.832 1.00 0.00 ?  61  ARG B C    1  
ATOM   3305   O  O    . ARG B  2 7   ? -20.398 -46.417 -13.072 1.00 0.00 ?  61  ARG B O    1  
ATOM   3306   C  CB   . ARG B  2 7   ? -17.393 -45.621 -12.899 1.00 0.00 ?  61  ARG B CB   1  
ATOM   3307   C  CG   . ARG B  2 7   ? -17.974 -44.309 -13.557 1.00 0.00 ?  61  ARG B CG   1  
ATOM   3308   C  CD   . ARG B  2 7   ? -16.848 -43.434 -14.243 1.00 0.00 ?  61  ARG B CD   1  
ATOM   3309   N  NE   . ARG B  2 7   ? -16.316 -44.192 -15.448 1.00 0.00 ?  61  ARG B NE   1  
ATOM   3310   C  CZ   . ARG B  2 7   ? -15.111 -43.910 -15.929 1.00 0.00 ?  61  ARG B CZ   1  
ATOM   3311   N  NH1  . ARG B  2 7   ? -14.731 -44.670 -16.893 1.00 0.00 1  61  ARG B NH1  1  
ATOM   3312   N  NH2  . ARG B  2 7   ? -14.433 -42.839 -15.585 1.00 0.00 ?  61  ARG B NH2  1  
ATOM   3313   H  H    . ARG B  2 7   ? -16.546 -47.188 -11.346 1.00 0.00 ?  61  ARG B H    1  
ATOM   3314   H  HA   . ARG B  2 7   ? -18.875 -45.603 -11.357 1.00 0.00 ?  61  ARG B HA   1  
ATOM   3315   H  HB2  . ARG B  2 7   ? -16.570 -45.321 -12.216 1.00 0.00 ?  61  ARG B HB2  1  
ATOM   3316   H  HB3  . ARG B  2 7   ? -16.936 -46.260 -13.684 1.00 0.00 ?  61  ARG B HB3  1  
ATOM   3317   H  HG2  . ARG B  2 7   ? -18.670 -44.538 -14.393 1.00 0.00 ?  61  ARG B HG2  1  
ATOM   3318   H  HG3  . ARG B  2 7   ? -18.366 -43.667 -12.740 1.00 0.00 ?  61  ARG B HG3  1  
ATOM   3319   H  HD2  . ARG B  2 7   ? -17.330 -42.567 -14.745 1.00 0.00 ?  61  ARG B HD2  1  
ATOM   3320   H  HD3  . ARG B  2 7   ? -16.098 -43.299 -13.435 1.00 0.00 ?  61  ARG B HD3  1  
ATOM   3321   H  HE   . ARG B  2 7   ? -16.785 -44.984 -15.840 1.00 0.00 ?  61  ARG B HE   1  
ATOM   3322   H  HH11 . ARG B  2 7   ? -15.377 -45.209 -17.434 1.00 0.00 ?  61  ARG B HH11 1  
ATOM   3323   H  HH12 . ARG B  2 7   ? -14.036 -44.239 -17.469 1.00 0.00 ?  61  ARG B HH12 1  
ATOM   3324   H  HH21 . ARG B  2 7   ? -13.518 -42.651 -15.943 1.00 0.00 ?  61  ARG B HH21 1  
ATOM   3325   H  HH22 . ARG B  2 7   ? -15.064 -42.153 -15.221 1.00 0.00 ?  61  ARG B HH22 1  
ATOM   3326   N  N    . GLU B  2 8   ? -19.108 -48.200 -13.395 1.00 0.00 ?  62  GLU B N    1  
ATOM   3327   C  CA   . GLU B  2 8   ? -20.103 -48.975 -14.135 1.00 0.00 ?  62  GLU B CA   1  
ATOM   3328   C  C    . GLU B  2 8   ? -21.233 -49.654 -13.334 1.00 0.00 ?  62  GLU B C    1  
ATOM   3329   O  O    . GLU B  2 8   ? -22.354 -49.930 -13.783 1.00 0.00 ?  62  GLU B O    1  
ATOM   3330   C  CB   . GLU B  2 8   ? -19.525 -50.004 -15.054 1.00 0.00 ?  62  GLU B CB   1  
ATOM   3331   C  CG   . GLU B  2 8   ? -18.622 -49.519 -16.176 1.00 0.00 ?  62  GLU B CG   1  
ATOM   3332   C  CD   . GLU B  2 8   ? -17.968 -50.682 -16.929 1.00 0.00 ?  62  GLU B CD   1  
ATOM   3333   O  OE1  . GLU B  2 8   ? -16.801 -50.578 -17.268 1.00 0.00 ?  62  GLU B OE1  1  
ATOM   3334   O  OE2  . GLU B  2 8   ? -18.682 -51.722 -17.186 1.00 0.00 -1 62  GLU B OE2  1  
ATOM   3335   H  H    . GLU B  2 8   ? -18.169 -48.525 -13.472 1.00 0.00 ?  62  GLU B H    1  
ATOM   3336   H  HA   . GLU B  2 8   ? -20.588 -48.211 -14.726 1.00 0.00 ?  62  GLU B HA   1  
ATOM   3337   H  HB2  . GLU B  2 8   ? -18.904 -50.736 -14.495 1.00 0.00 ?  62  GLU B HB2  1  
ATOM   3338   H  HB3  . GLU B  2 8   ? -20.368 -50.589 -15.481 1.00 0.00 ?  62  GLU B HB3  1  
ATOM   3339   H  HG2  . GLU B  2 8   ? -19.318 -49.079 -16.922 1.00 0.00 ?  62  GLU B HG2  1  
ATOM   3340   H  HG3  . GLU B  2 8   ? -17.809 -48.845 -15.831 1.00 0.00 ?  62  GLU B HG3  1  
ATOM   3341   N  N    . GLN B  2 9   ? -20.967 -49.946 -12.064 1.00 0.00 ?  63  GLN B N    1  
ATOM   3342   C  CA   . GLN B  2 9   ? -21.936 -50.524 -11.066 1.00 0.00 ?  63  GLN B CA   1  
ATOM   3343   C  C    . GLN B  2 9   ? -22.842 -49.499 -10.396 1.00 0.00 ?  63  GLN B C    1  
ATOM   3344   O  O    . GLN B  2 9   ? -24.032 -49.715 -10.207 1.00 0.00 ?  63  GLN B O    1  
ATOM   3345   C  CB   . GLN B  2 9   ? -21.330 -51.287 -9.817  1.00 0.00 ?  63  GLN B CB   1  
ATOM   3346   C  CG   . GLN B  2 9   ? -20.120 -52.213 -10.282 1.00 0.00 ?  63  GLN B CG   1  
ATOM   3347   C  CD   . GLN B  2 9   ? -20.267 -52.904 -11.605 1.00 0.00 ?  63  GLN B CD   1  
ATOM   3348   O  OE1  . GLN B  2 9   ? -21.256 -53.622 -11.799 1.00 0.00 ?  63  GLN B OE1  1  
ATOM   3349   N  NE2  . GLN B  2 9   ? -19.340 -52.767 -12.594 1.00 0.00 ?  63  GLN B NE2  1  
ATOM   3350   H  H    . GLN B  2 9   ? -20.069 -49.702 -11.709 1.00 0.00 ?  63  GLN B H    1  
ATOM   3351   H  HA   . GLN B  2 9   ? -22.584 -51.167 -11.645 1.00 0.00 ?  63  GLN B HA   1  
ATOM   3352   H  HB2  . GLN B  2 9   ? -20.900 -50.549 -9.106  1.00 0.00 ?  63  GLN B HB2  1  
ATOM   3353   H  HB3  . GLN B  2 9   ? -22.118 -51.819 -9.243  1.00 0.00 ?  63  GLN B HB3  1  
ATOM   3354   H  HG2  . GLN B  2 9   ? -19.200 -51.590 -10.312 1.00 0.00 ?  63  GLN B HG2  1  
ATOM   3355   H  HG3  . GLN B  2 9   ? -20.057 -53.013 -9.513  1.00 0.00 ?  63  GLN B HG3  1  
ATOM   3356   H  HE21 . GLN B  2 9   ? -19.627 -53.178 -13.459 1.00 0.00 ?  63  GLN B HE21 1  
ATOM   3357   H  HE22 . GLN B  2 9   ? -18.672 -52.038 -12.445 1.00 0.00 ?  63  GLN B HE22 1  
ATOM   3358   N  N    . LEU B  2 10  ? -22.287 -48.333 -10.126 1.00 0.00 ?  64  LEU B N    1  
ATOM   3359   C  CA   . LEU B  2 10  ? -23.003 -47.058 -9.817  1.00 0.00 ?  64  LEU B CA   1  
ATOM   3360   C  C    . LEU B  2 10  ? -23.648 -46.424 -11.101 1.00 0.00 ?  64  LEU B C    1  
ATOM   3361   O  O    . LEU B  2 10  ? -24.503 -45.569 -11.049 1.00 0.00 ?  64  LEU B O    1  
ATOM   3362   C  CB   . LEU B  2 10  ? -22.124 -46.028 -9.086  1.00 0.00 ?  64  LEU B CB   1  
ATOM   3363   C  CG   . LEU B  2 10  ? -21.590 -46.454 -7.696  1.00 0.00 ?  64  LEU B CG   1  
ATOM   3364   C  CD1  . LEU B  2 10  ? -20.306 -45.658 -7.468  1.00 0.00 ?  64  LEU B CD1  1  
ATOM   3365   C  CD2  . LEU B  2 10  ? -22.736 -46.338 -6.562  1.00 0.00 ?  64  LEU B CD2  1  
ATOM   3366   H  H    . LEU B  2 10  ? -21.303 -48.194 -10.199 1.00 0.00 ?  64  LEU B H    1  
ATOM   3367   H  HA   . LEU B  2 10  ? -23.844 -47.240 -9.164  1.00 0.00 ?  64  LEU B HA   1  
ATOM   3368   H  HB2  . LEU B  2 10  ? -21.244 -45.889 -9.750  1.00 0.00 ?  64  LEU B HB2  1  
ATOM   3369   H  HB3  . LEU B  2 10  ? -22.585 -45.037 -8.888  1.00 0.00 ?  64  LEU B HB3  1  
ATOM   3370   H  HG   . LEU B  2 10  ? -21.278 -47.513 -7.815  1.00 0.00 ?  64  LEU B HG   1  
ATOM   3371   H  HD11 . LEU B  2 10  ? -19.576 -45.930 -8.260  1.00 0.00 ?  64  LEU B HD11 1  
ATOM   3372   H  HD12 . LEU B  2 10  ? -19.724 -45.841 -6.539  1.00 0.00 ?  64  LEU B HD12 1  
ATOM   3373   H  HD13 . LEU B  2 10  ? -20.503 -44.571 -7.581  1.00 0.00 ?  64  LEU B HD13 1  
ATOM   3374   H  HD21 . LEU B  2 10  ? -23.151 -45.309 -6.492  1.00 0.00 ?  64  LEU B HD21 1  
ATOM   3375   H  HD22 . LEU B  2 10  ? -22.342 -46.723 -5.597  1.00 0.00 ?  64  LEU B HD22 1  
ATOM   3376   H  HD23 . LEU B  2 10  ? -23.566 -47.052 -6.748  1.00 0.00 ?  64  LEU B HD23 1  
ATOM   3377   N  N    . GLY B  2 11  ? -23.174 -46.830 -12.345 1.00 0.00 ?  65  GLY B N    1  
ATOM   3378   C  CA   . GLY B  2 11  ? -23.651 -46.311 -13.644 1.00 0.00 ?  65  GLY B CA   1  
ATOM   3379   C  C    . GLY B  2 11  ? -25.216 -46.386 -13.874 1.00 0.00 ?  65  GLY B C    1  
ATOM   3380   O  O    . GLY B  2 11  ? -25.746 -45.315 -14.250 1.00 0.00 ?  65  GLY B O    1  
ATOM   3381   H  H    . GLY B  2 11  ? -22.412 -47.448 -12.169 1.00 0.00 ?  65  GLY B H    1  
ATOM   3382   H  HA2  . GLY B  2 11  ? -23.415 -45.257 -13.644 1.00 0.00 ?  65  GLY B HA2  1  
ATOM   3383   H  HA3  . GLY B  2 11  ? -23.224 -46.905 -14.438 1.00 0.00 ?  65  GLY B HA3  1  
ATOM   3384   N  N    . PRO B  2 12  ? -26.058 -47.412 -13.604 1.00 0.00 ?  66  PRO B N    1  
ATOM   3385   C  CA   . PRO B  2 12  ? -27.466 -47.252 -13.685 1.00 0.00 ?  66  PRO B CA   1  
ATOM   3386   C  C    . PRO B  2 12  ? -28.007 -46.482 -12.468 1.00 0.00 ?  66  PRO B C    1  
ATOM   3387   O  O    . PRO B  2 12  ? -29.054 -45.771 -12.578 1.00 0.00 ?  66  PRO B O    1  
ATOM   3388   C  CB   . PRO B  2 12  ? -28.044 -48.623 -13.776 1.00 0.00 ?  66  PRO B CB   1  
ATOM   3389   C  CG   . PRO B  2 12  ? -26.850 -49.569 -13.337 1.00 0.00 ?  66  PRO B CG   1  
ATOM   3390   C  CD   . PRO B  2 12  ? -25.592 -48.774 -13.315 1.00 0.00 ?  66  PRO B CD   1  
ATOM   3391   H  HA   . PRO B  2 12  ? -27.735 -46.737 -14.595 1.00 0.00 ?  66  PRO B HA   1  
ATOM   3392   H  HB2  . PRO B  2 12  ? -28.997 -48.992 -13.339 1.00 0.00 ?  66  PRO B HB2  1  
ATOM   3393   H  HB3  . PRO B  2 12  ? -28.218 -48.740 -14.867 1.00 0.00 ?  66  PRO B HB3  1  
ATOM   3394   H  HG2  . PRO B  2 12  ? -27.069 -49.976 -12.327 1.00 0.00 ?  66  PRO B HG2  1  
ATOM   3395   H  HG3  . PRO B  2 12  ? -26.968 -50.301 -14.165 1.00 0.00 ?  66  PRO B HG3  1  
ATOM   3396   H  HD2  . PRO B  2 12  ? -25.126 -48.885 -12.312 1.00 0.00 ?  66  PRO B HD2  1  
ATOM   3397   H  HD3  . PRO B  2 12  ? -24.877 -49.110 -14.096 1.00 0.00 ?  66  PRO B HD3  1  
ATOM   3398   N  N    . VAL B  2 13  ? -27.473 -46.711 -11.286 1.00 0.00 ?  67  VAL B N    1  
ATOM   3399   C  CA   . VAL B  2 13  ? -27.945 -46.030 -10.041 1.00 0.00 ?  67  VAL B CA   1  
ATOM   3400   C  C    . VAL B  2 13  ? -27.813 -44.495 -10.173 1.00 0.00 ?  67  VAL B C    1  
ATOM   3401   O  O    . VAL B  2 13  ? -28.724 -43.754 -9.839  1.00 0.00 ?  67  VAL B O    1  
ATOM   3402   C  CB   . VAL B  2 13  ? -27.108 -46.621 -8.835  1.00 0.00 ?  67  VAL B CB   1  
ATOM   3403   C  CG1  . VAL B  2 13  ? -27.262 -45.838 -7.480  1.00 0.00 ?  67  VAL B CG1  1  
ATOM   3404   C  CG2  . VAL B  2 13  ? -27.438 -48.124 -8.664  1.00 0.00 ?  67  VAL B CG2  1  
ATOM   3405   H  H    . VAL B  2 13  ? -26.893 -47.519 -11.222 1.00 0.00 ?  67  VAL B H    1  
ATOM   3406   H  HA   . VAL B  2 13  ? -29.002 -46.239 -9.975  1.00 0.00 ?  67  VAL B HA   1  
ATOM   3407   H  HB   . VAL B  2 13  ? -26.005 -46.623 -8.968  1.00 0.00 ?  67  VAL B HB   1  
ATOM   3408   H  HG11 . VAL B  2 13  ? -26.709 -46.328 -6.650  1.00 0.00 ?  67  VAL B HG11 1  
ATOM   3409   H  HG12 . VAL B  2 13  ? -28.367 -45.845 -7.357  1.00 0.00 ?  67  VAL B HG12 1  
ATOM   3410   H  HG13 . VAL B  2 13  ? -26.953 -44.779 -7.609  1.00 0.00 ?  67  VAL B HG13 1  
ATOM   3411   H  HG21 . VAL B  2 13  ? -27.286 -48.627 -9.643  1.00 0.00 ?  67  VAL B HG21 1  
ATOM   3412   H  HG22 . VAL B  2 13  ? -28.476 -48.268 -8.295  1.00 0.00 ?  67  VAL B HG22 1  
ATOM   3413   H  HG23 . VAL B  2 13  ? -26.731 -48.682 -8.014  1.00 0.00 ?  67  VAL B HG23 1  
ATOM   3414   N  N    . THR B  2 14  ? -26.676 -43.955 -10.627 1.00 0.00 ?  68  THR B N    1  
ATOM   3415   C  CA   . THR B  2 14  ? -26.515 -42.557 -10.819 1.00 0.00 ?  68  THR B CA   1  
ATOM   3416   C  C    . THR B  2 14  ? -27.467 -41.900 -11.861 1.00 0.00 ?  68  THR B C    1  
ATOM   3417   O  O    . THR B  2 14  ? -28.075 -40.880 -11.612 1.00 0.00 ?  68  THR B O    1  
ATOM   3418   C  CB   . THR B  2 14  ? -25.070 -42.207 -11.131 1.00 0.00 ?  68  THR B CB   1  
ATOM   3419   O  OG1  . THR B  2 14  ? -24.600 -40.915 -10.675 1.00 0.00 ?  68  THR B OG1  1  
ATOM   3420   C  CG2  . THR B  2 14  ? -24.643 -42.315 -12.633 1.00 0.00 ?  68  THR B CG2  1  
ATOM   3421   H  H    . THR B  2 14  ? -25.918 -44.537 -10.910 1.00 0.00 ?  68  THR B H    1  
ATOM   3422   H  HA   . THR B  2 14  ? -26.886 -42.080 -9.924  1.00 0.00 ?  68  THR B HA   1  
ATOM   3423   H  HB   . THR B  2 14  ? -24.450 -42.951 -10.585 1.00 0.00 ?  68  THR B HB   1  
ATOM   3424   H  HG1  . THR B  2 14  ? -24.927 -40.948 -9.773  1.00 0.00 ?  68  THR B HG1  1  
ATOM   3425   H  HG21 . THR B  2 14  ? -23.551 -42.129 -12.720 1.00 0.00 ?  68  THR B HG21 1  
ATOM   3426   H  HG22 . THR B  2 14  ? -25.049 -41.399 -13.114 1.00 0.00 ?  68  THR B HG22 1  
ATOM   3427   H  HG23 . THR B  2 14  ? -25.020 -43.217 -13.161 1.00 0.00 ?  68  THR B HG23 1  
ATOM   3428   N  N    . GLN B  2 15  ? -27.702 -42.606 -12.987 1.00 0.00 ?  69  GLN B N    1  
ATOM   3429   C  CA   . GLN B  2 15  ? -28.648 -42.456 -14.068 1.00 0.00 ?  69  GLN B CA   1  
ATOM   3430   C  C    . GLN B  2 15  ? -30.029 -42.351 -13.500 1.00 0.00 ?  69  GLN B C    1  
ATOM   3431   O  O    . GLN B  2 15  ? -30.777 -41.414 -13.765 1.00 0.00 ?  69  GLN B O    1  
ATOM   3432   C  CB   . GLN B  2 15  ? -28.617 -43.627 -15.088 1.00 0.00 ?  69  GLN B CB   1  
ATOM   3433   C  CG   . GLN B  2 15  ? -29.563 -43.397 -16.261 1.00 0.00 ?  69  GLN B CG   1  
ATOM   3434   C  CD   . GLN B  2 15  ? -29.253 -42.090 -17.080 1.00 0.00 ?  69  GLN B CD   1  
ATOM   3435   O  OE1  . GLN B  2 15  ? -28.069 -41.834 -17.435 1.00 0.00 ?  69  GLN B OE1  1  
ATOM   3436   N  NE2  . GLN B  2 15  ? -30.380 -41.336 -17.476 1.00 0.00 ?  69  GLN B NE2  1  
ATOM   3437   H  H    . GLN B  2 15  ? -27.035 -43.327 -13.158 1.00 0.00 ?  69  GLN B H    1  
ATOM   3438   H  HA   . GLN B  2 15  ? -28.473 -41.526 -14.588 1.00 0.00 ?  69  GLN B HA   1  
ATOM   3439   H  HB2  . GLN B  2 15  ? -27.586 -43.710 -15.493 1.00 0.00 ?  69  GLN B HB2  1  
ATOM   3440   H  HB3  . GLN B  2 15  ? -28.828 -44.591 -14.578 1.00 0.00 ?  69  GLN B HB3  1  
ATOM   3441   H  HG2  . GLN B  2 15  ? -29.697 -44.273 -16.933 1.00 0.00 ?  69  GLN B HG2  1  
ATOM   3442   H  HG3  . GLN B  2 15  ? -30.646 -43.307 -16.031 1.00 0.00 ?  69  GLN B HG3  1  
ATOM   3443   H  HE21 . GLN B  2 15  ? -30.222 -40.654 -18.190 1.00 0.00 ?  69  GLN B HE21 1  
ATOM   3444   H  HE22 . GLN B  2 15  ? -31.307 -41.566 -17.179 1.00 0.00 ?  69  GLN B HE22 1  
ATOM   3445   N  N    . GLU B  2 16  ? -30.413 -43.233 -12.543 1.00 0.00 ?  70  GLU B N    1  
ATOM   3446   C  CA   . GLU B  2 16  ? -31.720 -43.109 -11.914 1.00 0.00 ?  70  GLU B CA   1  
ATOM   3447   C  C    . GLU B  2 16  ? -32.062 -41.774 -11.173 1.00 0.00 ?  70  GLU B C    1  
ATOM   3448   O  O    . GLU B  2 16  ? -33.115 -41.176 -11.381 1.00 0.00 ?  70  GLU B O    1  
ATOM   3449   C  CB   . GLU B  2 16  ? -31.980 -44.340 -10.989 1.00 0.00 ?  70  GLU B CB   1  
ATOM   3450   C  CG   . GLU B  2 16  ? -33.355 -44.404 -10.453 1.00 0.00 ?  70  GLU B CG   1  
ATOM   3451   C  CD   . GLU B  2 16  ? -33.560 -45.796 -9.969  1.00 0.00 ?  70  GLU B CD   1  
ATOM   3452   O  OE1  . GLU B  2 16  ? -33.720 -45.935 -8.737  1.00 0.00 ?  70  GLU B OE1  1  
ATOM   3453   O  OE2  . GLU B  2 16  ? -33.592 -46.802 -10.702 1.00 0.00 -1 70  GLU B OE2  1  
ATOM   3454   H  H    . GLU B  2 16  ? -29.914 -44.024 -12.197 1.00 0.00 ?  70  GLU B H    1  
ATOM   3455   H  HA   . GLU B  2 16  ? -32.448 -43.083 -12.712 1.00 0.00 ?  70  GLU B HA   1  
ATOM   3456   H  HB2  . GLU B  2 16  ? -31.778 -45.281 -11.544 1.00 0.00 ?  70  GLU B HB2  1  
ATOM   3457   H  HB3  . GLU B  2 16  ? -31.220 -44.328 -10.180 1.00 0.00 ?  70  GLU B HB3  1  
ATOM   3458   H  HG2  . GLU B  2 16  ? -33.405 -43.685 -9.607  1.00 0.00 ?  70  GLU B HG2  1  
ATOM   3459   H  HG3  . GLU B  2 16  ? -34.120 -44.089 -11.195 1.00 0.00 ?  70  GLU B HG3  1  
ATOM   3460   N  N    . PHE B  2 17  ? -31.106 -41.314 -10.312 1.00 0.00 ?  71  PHE B N    1  
ATOM   3461   C  CA   . PHE B  2 17  ? -31.211 -39.975 -9.643  1.00 0.00 ?  71  PHE B CA   1  
ATOM   3462   C  C    . PHE B  2 17  ? -31.184 -38.897 -10.601 1.00 0.00 ?  71  PHE B C    1  
ATOM   3463   O  O    . PHE B  2 17  ? -31.889 -37.944 -10.481 1.00 0.00 ?  71  PHE B O    1  
ATOM   3464   C  CB   . PHE B  2 17  ? -30.058 -39.827 -8.635  1.00 0.00 ?  71  PHE B CB   1  
ATOM   3465   C  CG   . PHE B  2 17  ? -30.141 -40.752 -7.464  1.00 0.00 ?  71  PHE B CG   1  
ATOM   3466   C  CD1  . PHE B  2 17  ? -29.033 -41.522 -7.134  1.00 0.00 ?  71  PHE B CD1  1  
ATOM   3467   C  CD2  . PHE B  2 17  ? -31.293 -40.874 -6.604  1.00 0.00 ?  71  PHE B CD2  1  
ATOM   3468   C  CE1  . PHE B  2 17  ? -29.067 -42.354 -6.009  1.00 0.00 ?  71  PHE B CE1  1  
ATOM   3469   C  CE2  . PHE B  2 17  ? -31.314 -41.642 -5.394  1.00 0.00 ?  71  PHE B CE2  1  
ATOM   3470   C  CZ   . PHE B  2 17  ? -30.144 -42.391 -5.114  1.00 0.00 ?  71  PHE B CZ   1  
ATOM   3471   H  H    . PHE B  2 17  ? -30.346 -41.888 -10.015 1.00 0.00 ?  71  PHE B H    1  
ATOM   3472   H  HA   . PHE B  2 17  ? -32.129 -39.986 -9.074  1.00 0.00 ?  71  PHE B HA   1  
ATOM   3473   H  HB2  . PHE B  2 17  ? -29.088 -40.020 -9.141  1.00 0.00 ?  71  PHE B HB2  1  
ATOM   3474   H  HB3  . PHE B  2 17  ? -29.926 -38.778 -8.295  1.00 0.00 ?  71  PHE B HB3  1  
ATOM   3475   H  HD1  . PHE B  2 17  ? -28.196 -41.462 -7.814  1.00 0.00 ?  71  PHE B HD1  1  
ATOM   3476   H  HD2  . PHE B  2 17  ? -32.225 -40.364 -6.799  1.00 0.00 ?  71  PHE B HD2  1  
ATOM   3477   H  HE1  . PHE B  2 17  ? -28.163 -42.834 -5.664  1.00 0.00 ?  71  PHE B HE1  1  
ATOM   3478   H  HE2  . PHE B  2 17  ? -32.188 -41.611 -4.761  1.00 0.00 ?  71  PHE B HE2  1  
ATOM   3479   H  HZ   . PHE B  2 17  ? -30.167 -43.127 -4.323  1.00 0.00 ?  71  PHE B HZ   1  
ATOM   3480   N  N    . TRP B  2 18  ? -30.386 -38.890 -11.587 1.00 0.00 ?  72  TRP B N    1  
ATOM   3481   C  CA   . TRP B  2 18  ? -30.216 -37.878 -12.501 1.00 0.00 ?  72  TRP B CA   1  
ATOM   3482   C  C    . TRP B  2 18  ? -31.486 -37.722 -13.389 1.00 0.00 ?  72  TRP B C    1  
ATOM   3483   O  O    . TRP B  2 18  ? -31.988 -36.622 -13.568 1.00 0.00 ?  72  TRP B O    1  
ATOM   3484   C  CB   . TRP B  2 18  ? -29.006 -38.145 -13.525 1.00 0.00 ?  72  TRP B CB   1  
ATOM   3485   C  CG   . TRP B  2 18  ? -28.680 -37.037 -14.467 1.00 0.00 ?  72  TRP B CG   1  
ATOM   3486   C  CD1  . TRP B  2 18  ? -29.277 -36.669 -15.684 1.00 0.00 ?  72  TRP B CD1  1  
ATOM   3487   C  CD2  . TRP B  2 18  ? -28.135 -35.761 -13.996 1.00 0.00 ?  72  TRP B CD2  1  
ATOM   3488   N  NE1  . TRP B  2 18  ? -29.140 -35.275 -15.937 1.00 0.00 ?  72  TRP B NE1  1  
ATOM   3489   C  CE2  . TRP B  2 18  ? -28.496 -34.752 -14.852 1.00 0.00 ?  72  TRP B CE2  1  
ATOM   3490   C  CE3  . TRP B  2 18  ? -27.369 -35.485 -12.888 1.00 0.00 ?  72  TRP B CE3  1  
ATOM   3491   C  CZ2  . TRP B  2 18  ? -28.201 -33.370 -14.643 1.00 0.00 ?  72  TRP B CZ2  1  
ATOM   3492   C  CZ3  . TRP B  2 18  ? -27.068 -34.147 -12.637 1.00 0.00 ?  72  TRP B CZ3  1  
ATOM   3493   C  CH2  . TRP B  2 18  ? -27.435 -33.127 -13.553 1.00 0.00 ?  72  TRP B CH2  1  
ATOM   3494   H  H    . TRP B  2 18  ? -29.678 -39.591 -11.543 1.00 0.00 ?  72  TRP B H    1  
ATOM   3495   H  HA   . TRP B  2 18  ? -30.225 -36.911 -12.021 1.00 0.00 ?  72  TRP B HA   1  
ATOM   3496   H  HB2  . TRP B  2 18  ? -28.115 -38.421 -12.921 1.00 0.00 ?  72  TRP B HB2  1  
ATOM   3497   H  HB3  . TRP B  2 18  ? -29.169 -39.073 -14.114 1.00 0.00 ?  72  TRP B HB3  1  
ATOM   3498   H  HD1  . TRP B  2 18  ? -29.978 -37.225 -16.289 1.00 0.00 ?  72  TRP B HD1  1  
ATOM   3499   H  HE1  . TRP B  2 18  ? -29.510 -34.815 -16.715 1.00 0.00 ?  72  TRP B HE1  1  
ATOM   3500   H  HE3  . TRP B  2 18  ? -27.132 -36.245 -12.158 1.00 0.00 ?  72  TRP B HE3  1  
ATOM   3501   H  HZ2  . TRP B  2 18  ? -28.408 -32.563 -15.330 1.00 0.00 ?  72  TRP B HZ2  1  
ATOM   3502   H  HZ3  . TRP B  2 18  ? -26.496 -33.937 -11.745 1.00 0.00 ?  72  TRP B HZ3  1  
ATOM   3503   H  HH2  . TRP B  2 18  ? -27.094 -32.111 -13.419 1.00 0.00 ?  72  TRP B HH2  1  
ATOM   3504   N  N    . ASP B  2 19  ? -32.008 -38.877 -13.883 1.00 0.00 ?  73  ASP B N    1  
ATOM   3505   C  CA   . ASP B  2 19  ? -33.137 -38.959 -14.670 1.00 0.00 ?  73  ASP B CA   1  
ATOM   3506   C  C    . ASP B  2 19  ? -34.432 -38.543 -13.863 1.00 0.00 ?  73  ASP B C    1  
ATOM   3507   O  O    . ASP B  2 19  ? -35.212 -37.768 -14.342 1.00 0.00 ?  73  ASP B O    1  
ATOM   3508   C  CB   . ASP B  2 19  ? -33.273 -40.420 -15.146 1.00 0.00 ?  73  ASP B CB   1  
ATOM   3509   C  CG   . ASP B  2 19  ? -34.224 -40.423 -16.290 1.00 0.00 ?  73  ASP B CG   1  
ATOM   3510   O  OD1  . ASP B  2 19  ? -34.321 -39.440 -17.073 1.00 0.00 ?  73  ASP B OD1  1  
ATOM   3511   O  OD2  . ASP B  2 19  ? -34.990 -41.391 -16.540 1.00 0.00 -1 73  ASP B OD2  1  
ATOM   3512   H  H    . ASP B  2 19  ? -31.580 -39.733 -13.605 1.00 0.00 ?  73  ASP B H    1  
ATOM   3513   H  HA   . ASP B  2 19  ? -32.916 -38.291 -15.490 1.00 0.00 ?  73  ASP B HA   1  
ATOM   3514   H  HB2  . ASP B  2 19  ? -32.362 -40.827 -15.635 1.00 0.00 ?  73  ASP B HB2  1  
ATOM   3515   H  HB3  . ASP B  2 19  ? -33.457 -41.075 -14.267 1.00 0.00 ?  73  ASP B HB3  1  
ATOM   3516   N  N    . ASN B  2 20  ? -34.548 -38.991 -12.569 1.00 0.00 ?  74  ASN B N    1  
ATOM   3517   C  CA   . ASN B  2 20  ? -35.568 -38.470 -11.663 1.00 0.00 ?  74  ASN B CA   1  
ATOM   3518   C  C    . ASN B  2 20  ? -35.435 -36.987 -11.462 1.00 0.00 ?  74  ASN B C    1  
ATOM   3519   O  O    . ASN B  2 20  ? -36.427 -36.279 -11.303 1.00 0.00 ?  74  ASN B O    1  
ATOM   3520   C  CB   . ASN B  2 20  ? -35.585 -39.046 -10.164 1.00 0.00 ?  74  ASN B CB   1  
ATOM   3521   C  CG   . ASN B  2 20  ? -36.045 -40.495 -10.177 1.00 0.00 ?  74  ASN B CG   1  
ATOM   3522   O  OD1  . ASN B  2 20  ? -36.663 -41.055 -11.099 1.00 0.00 ?  74  ASN B OD1  1  
ATOM   3523   N  ND2  . ASN B  2 20  ? -35.534 -41.222 -9.178  1.00 0.00 ?  74  ASN B ND2  1  
ATOM   3524   H  H    . ASN B  2 20  ? -33.892 -39.687 -12.286 1.00 0.00 ?  74  ASN B H    1  
ATOM   3525   H  HA   . ASN B  2 20  ? -36.513 -38.670 -12.146 1.00 0.00 ?  74  ASN B HA   1  
ATOM   3526   H  HB2  . ASN B  2 20  ? -34.590 -39.013 -9.671  1.00 0.00 ?  74  ASN B HB2  1  
ATOM   3527   H  HB3  . ASN B  2 20  ? -36.379 -38.499 -9.612  1.00 0.00 ?  74  ASN B HB3  1  
ATOM   3528   H  HD21 . ASN B  2 20  ? -35.644 -42.205 -9.037  1.00 0.00 ?  74  ASN B HD21 1  
ATOM   3529   H  HD22 . ASN B  2 20  ? -35.270 -40.743 -8.340  1.00 0.00 ?  74  ASN B HD22 1  
ATOM   3530   N  N    . LEU B  2 21  ? -34.188 -36.429 -11.435 1.00 0.00 ?  75  LEU B N    1  
ATOM   3531   C  CA   . LEU B  2 21  ? -34.032 -35.104 -10.952 1.00 0.00 ?  75  LEU B CA   1  
ATOM   3532   C  C    . LEU B  2 21  ? -34.287 -34.053 -12.078 1.00 0.00 ?  75  LEU B C    1  
ATOM   3533   O  O    . LEU B  2 21  ? -34.917 -33.049 -11.914 1.00 0.00 ?  75  LEU B O    1  
ATOM   3534   C  CB   . LEU B  2 21  ? -32.564 -34.979 -10.395 1.00 0.00 ?  75  LEU B CB   1  
ATOM   3535   C  CG   . LEU B  2 21  ? -32.004 -33.666 -9.863  1.00 0.00 ?  75  LEU B CG   1  
ATOM   3536   C  CD1  . LEU B  2 21  ? -32.528 -33.238 -8.549  1.00 0.00 ?  75  LEU B CD1  1  
ATOM   3537   C  CD2  . LEU B  2 21  ? -30.416 -33.736 -9.807  1.00 0.00 ?  75  LEU B CD2  1  
ATOM   3538   H  H    . LEU B  2 21  ? -33.383 -37.016 -11.426 1.00 0.00 ?  75  LEU B H    1  
ATOM   3539   H  HA   . LEU B  2 21  ? -34.659 -34.796 -10.128 1.00 0.00 ?  75  LEU B HA   1  
ATOM   3540   H  HB2  . LEU B  2 21  ? -32.441 -35.812 -9.671  1.00 0.00 ?  75  LEU B HB2  1  
ATOM   3541   H  HB3  . LEU B  2 21  ? -31.930 -35.203 -11.279 1.00 0.00 ?  75  LEU B HB3  1  
ATOM   3542   H  HG   . LEU B  2 21  ? -32.275 -32.827 -10.540 1.00 0.00 ?  75  LEU B HG   1  
ATOM   3543   H  HD11 . LEU B  2 21  ? -32.468 -34.126 -7.884  1.00 0.00 ?  75  LEU B HD11 1  
ATOM   3544   H  HD12 . LEU B  2 21  ? -33.611 -32.990 -8.553  1.00 0.00 ?  75  LEU B HD12 1  
ATOM   3545   H  HD13 . LEU B  2 21  ? -32.040 -32.392 -8.019  1.00 0.00 ?  75  LEU B HD13 1  
ATOM   3546   H  HD21 . LEU B  2 21  ? -29.993 -32.821 -9.339  1.00 0.00 ?  75  LEU B HD21 1  
ATOM   3547   H  HD22 . LEU B  2 21  ? -29.972 -33.992 -10.793 1.00 0.00 ?  75  LEU B HD22 1  
ATOM   3548   H  HD23 . LEU B  2 21  ? -30.093 -34.520 -9.090  1.00 0.00 ?  75  LEU B HD23 1  
ATOM   3549   N  N    . GLU B  2 22  ? -34.006 -34.480 -13.340 1.00 0.00 ?  76  GLU B N    1  
ATOM   3550   C  CA   . GLU B  2 22  ? -34.557 -33.820 -14.427 1.00 0.00 ?  76  GLU B CA   1  
ATOM   3551   C  C    . GLU B  2 22  ? -36.145 -33.965 -14.517 1.00 0.00 ?  76  GLU B C    1  
ATOM   3552   O  O    . GLU B  2 22  ? -36.798 -33.041 -14.859 1.00 0.00 ?  76  GLU B O    1  
ATOM   3553   C  CB   . GLU B  2 22  ? -33.898 -34.459 -15.707 1.00 0.00 ?  76  GLU B CB   1  
ATOM   3554   C  CG   . GLU B  2 22  ? -32.351 -34.220 -15.929 1.00 0.00 ?  76  GLU B CG   1  
ATOM   3555   C  CD   . GLU B  2 22  ? -31.952 -34.442 -17.358 1.00 0.00 ?  76  GLU B CD   1  
ATOM   3556   O  OE1  . GLU B  2 22  ? -31.035 -33.814 -17.848 1.00 0.00 ?  76  GLU B OE1  1  
ATOM   3557   O  OE2  . GLU B  2 22  ? -32.544 -35.391 -18.024 1.00 0.00 -1 76  GLU B OE2  1  
ATOM   3558   H  H    . GLU B  2 22  ? -33.335 -35.212 -13.432 1.00 0.00 ?  76  GLU B H    1  
ATOM   3559   H  HA   . GLU B  2 22  ? -34.262 -32.781 -14.418 1.00 0.00 ?  76  GLU B HA   1  
ATOM   3560   H  HB2  . GLU B  2 22  ? -34.063 -35.553 -15.604 1.00 0.00 ?  76  GLU B HB2  1  
ATOM   3561   H  HB3  . GLU B  2 22  ? -34.530 -34.134 -16.560 1.00 0.00 ?  76  GLU B HB3  1  
ATOM   3562   H  HG2  . GLU B  2 22  ? -32.163 -33.164 -15.638 1.00 0.00 ?  76  GLU B HG2  1  
ATOM   3563   H  HG3  . GLU B  2 22  ? -31.778 -34.875 -15.240 1.00 0.00 ?  76  GLU B HG3  1  
ATOM   3564   N  N    . LYS B  2 23  ? -36.676 -35.162 -14.176 1.00 0.00 ?  77  LYS B N    1  
ATOM   3565   C  CA   . LYS B  2 23  ? -38.144 -35.425 -14.244 1.00 0.00 ?  77  LYS B CA   1  
ATOM   3566   C  C    . LYS B  2 23  ? -38.976 -34.600 -13.234 1.00 0.00 ?  77  LYS B C    1  
ATOM   3567   O  O    . LYS B  2 23  ? -39.882 -33.860 -13.627 1.00 0.00 ?  77  LYS B O    1  
ATOM   3568   C  CB   . LYS B  2 23  ? -38.579 -36.890 -14.217 1.00 0.00 ?  77  LYS B CB   1  
ATOM   3569   C  CG   . LYS B  2 23  ? -38.221 -37.548 -15.544 1.00 0.00 ?  77  LYS B CG   1  
ATOM   3570   C  CD   . LYS B  2 23  ? -38.579 -39.076 -15.366 1.00 0.00 ?  77  LYS B CD   1  
ATOM   3571   C  CE   . LYS B  2 23  ? -38.565 -39.830 -16.693 1.00 0.00 ?  77  LYS B CE   1  
ATOM   3572   N  NZ   . LYS B  2 23  ? -37.221 -39.930 -17.259 1.00 0.00 1  77  LYS B NZ   1  
ATOM   3573   H  H    . LYS B  2 23  ? -36.110 -35.876 -13.771 1.00 0.00 ?  77  LYS B H    1  
ATOM   3574   H  HA   . LYS B  2 23  ? -38.539 -35.073 -15.186 1.00 0.00 ?  77  LYS B HA   1  
ATOM   3575   H  HB2  . LYS B  2 23  ? -38.069 -37.328 -13.333 1.00 0.00 ?  77  LYS B HB2  1  
ATOM   3576   H  HB3  . LYS B  2 23  ? -39.682 -36.963 -14.100 1.00 0.00 ?  77  LYS B HB3  1  
ATOM   3577   H  HG2  . LYS B  2 23  ? -38.705 -37.000 -16.380 1.00 0.00 ?  77  LYS B HG2  1  
ATOM   3578   H  HG3  . LYS B  2 23  ? -37.127 -37.479 -15.725 1.00 0.00 ?  77  LYS B HG3  1  
ATOM   3579   H  HD2  . LYS B  2 23  ? -37.988 -39.667 -14.634 1.00 0.00 ?  77  LYS B HD2  1  
ATOM   3580   H  HD3  . LYS B  2 23  ? -39.637 -39.083 -15.028 1.00 0.00 ?  77  LYS B HD3  1  
ATOM   3581   H  HE2  . LYS B  2 23  ? -38.984 -40.833 -16.462 1.00 0.00 ?  77  LYS B HE2  1  
ATOM   3582   H  HE3  . LYS B  2 23  ? -39.277 -39.431 -17.446 1.00 0.00 ?  77  LYS B HE3  1  
ATOM   3583   H  HZ1  . LYS B  2 23  ? -36.426 -39.569 -16.694 1.00 0.00 ?  77  LYS B HZ1  1  
ATOM   3584   H  HZ2  . LYS B  2 23  ? -37.184 -39.382 -18.142 1.00 0.00 ?  77  LYS B HZ2  1  
ATOM   3585   H  HZ3  . LYS B  2 23  ? -37.126 -40.947 -17.458 1.00 0.00 ?  77  LYS B HZ3  1  
ATOM   3586   N  N    . GLU B  2 24  ? -38.559 -34.596 -11.939 1.00 0.00 ?  78  GLU B N    1  
ATOM   3587   C  CA   . GLU B  2 24  ? -39.132 -33.683 -10.972 1.00 0.00 ?  78  GLU B CA   1  
ATOM   3588   C  C    . GLU B  2 24  ? -39.060 -32.173 -11.353 1.00 0.00 ?  78  GLU B C    1  
ATOM   3589   O  O    . GLU B  2 24  ? -40.044 -31.454 -11.239 1.00 0.00 ?  78  GLU B O    1  
ATOM   3590   C  CB   . GLU B  2 24  ? -38.514 -33.891 -9.539  1.00 0.00 ?  78  GLU B CB   1  
ATOM   3591   C  CG   . GLU B  2 24  ? -38.779 -35.248 -8.798  1.00 0.00 ?  78  GLU B CG   1  
ATOM   3592   C  CD   . GLU B  2 24  ? -38.604 -35.077 -7.277  1.00 0.00 ?  78  GLU B CD   1  
ATOM   3593   O  OE1  . GLU B  2 24  ? -39.587 -35.284 -6.500  1.00 0.00 ?  78  GLU B OE1  1  
ATOM   3594   O  OE2  . GLU B  2 24  ? -37.500 -34.689 -6.825  1.00 0.00 -1 78  GLU B OE2  1  
ATOM   3595   H  H    . GLU B  2 24  ? -37.806 -35.197 -11.683 1.00 0.00 ?  78  GLU B H    1  
ATOM   3596   H  HA   . GLU B  2 24  ? -40.174 -33.937 -10.841 1.00 0.00 ?  78  GLU B HA   1  
ATOM   3597   H  HB2  . GLU B  2 24  ? -37.429 -33.654 -9.491  1.00 0.00 ?  78  GLU B HB2  1  
ATOM   3598   H  HB3  . GLU B  2 24  ? -38.948 -33.034 -8.981  1.00 0.00 ?  78  GLU B HB3  1  
ATOM   3599   H  HG2  . GLU B  2 24  ? -39.874 -35.423 -8.867  1.00 0.00 ?  78  GLU B HG2  1  
ATOM   3600   H  HG3  . GLU B  2 24  ? -38.123 -36.092 -9.103  1.00 0.00 ?  78  GLU B HG3  1  
ATOM   3601   N  N    . THR B  2 25  ? -37.830 -31.712 -11.732 1.00 0.00 ?  79  THR B N    1  
ATOM   3602   C  CA   . THR B  2 25  ? -37.543 -30.299 -11.963 1.00 0.00 ?  79  THR B CA   1  
ATOM   3603   C  C    . THR B  2 25  ? -38.262 -29.720 -13.148 1.00 0.00 ?  79  THR B C    1  
ATOM   3604   O  O    . THR B  2 25  ? -38.739 -28.634 -13.160 1.00 0.00 ?  79  THR B O    1  
ATOM   3605   C  CB   . THR B  2 25  ? -36.167 -30.123 -12.107 1.00 0.00 ?  79  THR B CB   1  
ATOM   3606   O  OG1  . THR B  2 25  ? -35.477 -30.438 -10.933 1.00 0.00 ?  79  THR B OG1  1  
ATOM   3607   C  CG2  . THR B  2 25  ? -35.670 -28.668 -12.365 1.00 0.00 ?  79  THR B CG2  1  
ATOM   3608   H  H    . THR B  2 25  ? -37.087 -32.355 -11.565 1.00 0.00 ?  79  THR B H    1  
ATOM   3609   H  HA   . THR B  2 25  ? -37.905 -29.833 -11.058 1.00 0.00 ?  79  THR B HA   1  
ATOM   3610   H  HB   . THR B  2 25  ? -35.846 -30.903 -12.830 1.00 0.00 ?  79  THR B HB   1  
ATOM   3611   H  HG1  . THR B  2 25  ? -35.057 -31.290 -11.072 1.00 0.00 ?  79  THR B HG1  1  
ATOM   3612   H  HG21 . THR B  2 25  ? -36.318 -28.131 -11.639 1.00 0.00 ?  79  THR B HG21 1  
ATOM   3613   H  HG22 . THR B  2 25  ? -35.950 -28.355 -13.394 1.00 0.00 ?  79  THR B HG22 1  
ATOM   3614   H  HG23 . THR B  2 25  ? -34.576 -28.476 -12.333 1.00 0.00 ?  79  THR B HG23 1  
ATOM   3615   N  N    . GLU B  2 26  ? -38.288 -30.418 -14.294 1.00 0.00 ?  80  GLU B N    1  
ATOM   3616   C  CA   . GLU B  2 26  ? -39.325 -30.147 -15.358 1.00 0.00 ?  80  GLU B CA   1  
ATOM   3617   C  C    . GLU B  2 26  ? -40.747 -30.352 -14.874 1.00 0.00 ?  80  GLU B C    1  
ATOM   3618   O  O    . GLU B  2 26  ? -41.576 -29.467 -14.928 1.00 0.00 ?  80  GLU B O    1  
ATOM   3619   C  CB   . GLU B  2 26  ? -38.999 -30.824 -16.694 1.00 0.00 ?  80  GLU B CB   1  
ATOM   3620   C  CG   . GLU B  2 26  ? -40.262 -31.104 -17.556 1.00 0.00 ?  80  GLU B CG   1  
ATOM   3621   C  CD   . GLU B  2 26  ? -40.029 -31.744 -18.941 1.00 0.00 ?  80  GLU B CD   1  
ATOM   3622   O  OE1  . GLU B  2 26  ? -40.566 -32.833 -19.215 1.00 0.00 ?  80  GLU B OE1  1  
ATOM   3623   O  OE2  . GLU B  2 26  ? -39.331 -31.077 -19.763 1.00 0.00 -1 80  GLU B OE2  1  
ATOM   3624   H  H    . GLU B  2 26  ? -37.775 -31.256 -14.463 1.00 0.00 ?  80  GLU B H    1  
ATOM   3625   H  HA   . GLU B  2 26  ? -39.240 -29.081 -15.505 1.00 0.00 ?  80  GLU B HA   1  
ATOM   3626   H  HB2  . GLU B  2 26  ? -38.244 -30.214 -17.234 1.00 0.00 ?  80  GLU B HB2  1  
ATOM   3627   H  HB3  . GLU B  2 26  ? -38.556 -31.817 -16.468 1.00 0.00 ?  80  GLU B HB3  1  
ATOM   3628   H  HG2  . GLU B  2 26  ? -40.981 -31.763 -17.023 1.00 0.00 ?  80  GLU B HG2  1  
ATOM   3629   H  HG3  . GLU B  2 26  ? -40.794 -30.147 -17.739 1.00 0.00 ?  80  GLU B HG3  1  
ATOM   3630   N  N    . GLY B  2 27  ? -41.085 -31.425 -14.198 1.00 0.00 ?  81  GLY B N    1  
ATOM   3631   C  CA   . GLY B  2 27  ? -42.432 -31.745 -13.629 1.00 0.00 ?  81  GLY B CA   1  
ATOM   3632   C  C    . GLY B  2 27  ? -43.264 -30.721 -12.875 1.00 0.00 ?  81  GLY B C    1  
ATOM   3633   O  O    . GLY B  2 27  ? -44.421 -30.329 -13.164 1.00 0.00 ?  81  GLY B O    1  
ATOM   3634   H  H    . GLY B  2 27  ? -40.473 -32.174 -13.957 1.00 0.00 ?  81  GLY B H    1  
ATOM   3635   H  HA2  . GLY B  2 27  ? -43.088 -32.134 -14.394 1.00 0.00 ?  81  GLY B HA2  1  
ATOM   3636   H  HA3  . GLY B  2 27  ? -42.076 -32.521 -12.968 1.00 0.00 ?  81  GLY B HA3  1  
ATOM   3637   N  N    . LEU B  2 28  ? -42.696 -30.225 -11.746 1.00 0.00 ?  82  LEU B N    1  
ATOM   3638   C  CA   . LEU B  2 28  ? -43.245 -29.137 -10.911 1.00 0.00 ?  82  LEU B CA   1  
ATOM   3639   C  C    . LEU B  2 28  ? -43.365 -27.852 -11.675 1.00 0.00 ?  82  LEU B C    1  
ATOM   3640   O  O    . LEU B  2 28  ? -44.457 -27.237 -11.601 1.00 0.00 ?  82  LEU B O    1  
ATOM   3641   C  CB   . LEU B  2 28  ? -42.403 -29.044 -9.620  1.00 0.00 ?  82  LEU B CB   1  
ATOM   3642   C  CG   . LEU B  2 28  ? -42.157 -30.336 -8.762  1.00 0.00 ?  82  LEU B CG   1  
ATOM   3643   C  CD1  . LEU B  2 28  ? -41.200 -30.115 -7.588  1.00 0.00 ?  82  LEU B CD1  1  
ATOM   3644   C  CD2  . LEU B  2 28  ? -43.516 -30.916 -8.181  1.00 0.00 ?  82  LEU B CD2  1  
ATOM   3645   H  H    . LEU B  2 28  ? -41.796 -30.557 -11.476 1.00 0.00 ?  82  LEU B H    1  
ATOM   3646   H  HA   . LEU B  2 28  ? -44.221 -29.370 -10.512 1.00 0.00 ?  82  LEU B HA   1  
ATOM   3647   H  HB2  . LEU B  2 28  ? -41.357 -28.722 -9.813  1.00 0.00 ?  82  LEU B HB2  1  
ATOM   3648   H  HB3  . LEU B  2 28  ? -42.860 -28.264 -8.974  1.00 0.00 ?  82  LEU B HB3  1  
ATOM   3649   H  HG   . LEU B  2 28  ? -41.687 -31.147 -9.357  1.00 0.00 ?  82  LEU B HG   1  
ATOM   3650   H  HD11 . LEU B  2 28  ? -41.312 -29.216 -6.945  1.00 0.00 ?  82  LEU B HD11 1  
ATOM   3651   H  HD12 . LEU B  2 28  ? -40.234 -29.999 -8.124  1.00 0.00 ?  82  LEU B HD12 1  
ATOM   3652   H  HD13 . LEU B  2 28  ? -41.220 -31.015 -6.937  1.00 0.00 ?  82  LEU B HD13 1  
ATOM   3653   H  HD21 . LEU B  2 28  ? -44.191 -31.213 -9.012  1.00 0.00 ?  82  LEU B HD21 1  
ATOM   3654   H  HD22 . LEU B  2 28  ? -43.964 -30.027 -7.689  1.00 0.00 ?  82  LEU B HD22 1  
ATOM   3655   H  HD23 . LEU B  2 28  ? -43.316 -31.742 -7.464  1.00 0.00 ?  82  LEU B HD23 1  
ATOM   3656   N  N    . ARG B  2 29  ? -42.410 -27.443 -12.559 1.00 0.00 ?  83  ARG B N    1  
ATOM   3657   C  CA   . ARG B  2 29  ? -42.591 -26.172 -13.305 1.00 0.00 ?  83  ARG B CA   1  
ATOM   3658   C  C    . ARG B  2 29  ? -43.816 -26.076 -14.286 1.00 0.00 ?  83  ARG B C    1  
ATOM   3659   O  O    . ARG B  2 29  ? -44.311 -24.958 -14.396 1.00 0.00 ?  83  ARG B O    1  
ATOM   3660   C  CB   . ARG B  2 29  ? -41.271 -25.580 -14.019 1.00 0.00 ?  83  ARG B CB   1  
ATOM   3661   C  CG   . ARG B  2 29  ? -40.630 -26.227 -15.189 1.00 0.00 ?  83  ARG B CG   1  
ATOM   3662   C  CD   . ARG B  2 29  ? -39.263 -25.610 -15.426 1.00 0.00 ?  83  ARG B CD   1  
ATOM   3663   N  NE   . ARG B  2 29  ? -38.893 -26.161 -16.762 1.00 0.00 ?  83  ARG B NE   1  
ATOM   3664   C  CZ   . ARG B  2 29  ? -37.917 -26.974 -16.987 1.00 0.00 ?  83  ARG B CZ   1  
ATOM   3665   N  NH1  . ARG B  2 29  ? -37.986 -27.607 -18.128 1.00 0.00 1  83  ARG B NH1  1  
ATOM   3666   N  NH2  . ARG B  2 29  ? -36.875 -27.193 -16.211 1.00 0.00 ?  83  ARG B NH2  1  
ATOM   3667   H  H    . ARG B  2 29  ? -41.803 -28.152 -12.910 1.00 0.00 ?  83  ARG B H    1  
ATOM   3668   H  HA   . ARG B  2 29  ? -42.837 -25.427 -12.563 1.00 0.00 ?  83  ARG B HA   1  
ATOM   3669   H  HB2  . ARG B  2 29  ? -41.481 -24.578 -14.451 1.00 0.00 ?  83  ARG B HB2  1  
ATOM   3670   H  HB3  . ARG B  2 29  ? -40.522 -25.445 -13.210 1.00 0.00 ?  83  ARG B HB3  1  
ATOM   3671   H  HG2  . ARG B  2 29  ? -40.566 -27.330 -15.069 1.00 0.00 ?  83  ARG B HG2  1  
ATOM   3672   H  HG3  . ARG B  2 29  ? -41.299 -25.935 -16.026 1.00 0.00 ?  83  ARG B HG3  1  
ATOM   3673   H  HD2  . ARG B  2 29  ? -39.330 -24.508 -15.547 1.00 0.00 ?  83  ARG B HD2  1  
ATOM   3674   H  HD3  . ARG B  2 29  ? -38.472 -25.872 -14.692 1.00 0.00 ?  83  ARG B HD3  1  
ATOM   3675   H  HE   . ARG B  2 29  ? -39.553 -26.103 -17.511 1.00 0.00 ?  83  ARG B HE   1  
ATOM   3676   H  HH11 . ARG B  2 29  ? -38.527 -27.288 -18.906 1.00 0.00 ?  83  ARG B HH11 1  
ATOM   3677   H  HH12 . ARG B  2 29  ? -37.132 -28.064 -18.378 1.00 0.00 ?  83  ARG B HH12 1  
ATOM   3678   H  HH21 . ARG B  2 29  ? -36.851 -26.707 -15.337 1.00 0.00 ?  83  ARG B HH21 1  
ATOM   3679   H  HH22 . ARG B  2 29  ? -36.189 -27.910 -16.340 1.00 0.00 ?  83  ARG B HH22 1  
ATOM   3680   N  N    . GLN B  2 30  ? -44.243 -27.267 -14.904 1.00 0.00 ?  84  GLN B N    1  
ATOM   3681   C  CA   . GLN B  2 30  ? -45.418 -27.233 -15.701 1.00 0.00 ?  84  GLN B CA   1  
ATOM   3682   C  C    . GLN B  2 30  ? -46.695 -26.942 -14.937 1.00 0.00 ?  84  GLN B C    1  
ATOM   3683   O  O    . GLN B  2 30  ? -47.613 -26.276 -15.448 1.00 0.00 ?  84  GLN B O    1  
ATOM   3684   C  CB   . GLN B  2 30  ? -45.591 -28.589 -16.500 1.00 0.00 ?  84  GLN B CB   1  
ATOM   3685   C  CG   . GLN B  2 30  ? -44.433 -29.161 -17.277 1.00 0.00 ?  84  GLN B CG   1  
ATOM   3686   C  CD   . GLN B  2 30  ? -43.601 -28.172 -18.031 1.00 0.00 ?  84  GLN B CD   1  
ATOM   3687   O  OE1  . GLN B  2 30  ? -44.005 -27.718 -19.120 1.00 0.00 ?  84  GLN B OE1  1  
ATOM   3688   N  NE2  . GLN B  2 30  ? -42.439 -27.850 -17.496 1.00 0.00 ?  84  GLN B NE2  1  
ATOM   3689   H  H    . GLN B  2 30  ? -43.647 -28.064 -14.853 1.00 0.00 ?  84  GLN B H    1  
ATOM   3690   H  HA   . GLN B  2 30  ? -45.167 -26.408 -16.351 1.00 0.00 ?  84  GLN B HA   1  
ATOM   3691   H  HB2  . GLN B  2 30  ? -46.072 -29.395 -15.905 1.00 0.00 ?  84  GLN B HB2  1  
ATOM   3692   H  HB3  . GLN B  2 30  ? -46.305 -28.420 -17.334 1.00 0.00 ?  84  GLN B HB3  1  
ATOM   3693   H  HG2  . GLN B  2 30  ? -43.910 -29.597 -16.399 1.00 0.00 ?  84  GLN B HG2  1  
ATOM   3694   H  HG3  . GLN B  2 30  ? -44.832 -29.867 -18.036 1.00 0.00 ?  84  GLN B HG3  1  
ATOM   3695   H  HE21 . GLN B  2 30  ? -41.869 -27.109 -17.852 1.00 0.00 ?  84  GLN B HE21 1  
ATOM   3696   H  HE22 . GLN B  2 30  ? -42.292 -28.299 -16.615 1.00 0.00 ?  84  GLN B HE22 1  
ATOM   3697   N  N    . GLU B  2 31  ? -46.892 -27.521 -13.742 1.00 0.00 ?  85  GLU B N    1  
ATOM   3698   C  CA   . GLU B  2 31  ? -48.076 -27.315 -12.918 1.00 0.00 ?  85  GLU B CA   1  
ATOM   3699   C  C    . GLU B  2 31  ? -48.080 -25.915 -12.427 1.00 0.00 ?  85  GLU B C    1  
ATOM   3700   O  O    . GLU B  2 31  ? -49.122 -25.238 -12.525 1.00 0.00 ?  85  GLU B O    1  
ATOM   3701   C  CB   . GLU B  2 31  ? -48.100 -28.381 -11.745 1.00 0.00 ?  85  GLU B CB   1  
ATOM   3702   C  CG   . GLU B  2 31  ? -48.060 -29.818 -12.331 1.00 0.00 ?  85  GLU B CG   1  
ATOM   3703   C  CD   . GLU B  2 31  ? -49.116 -30.192 -13.431 1.00 0.00 ?  85  GLU B CD   1  
ATOM   3704   O  OE1  . GLU B  2 31  ? -48.811 -30.315 -14.599 1.00 0.00 ?  85  GLU B OE1  1  
ATOM   3705   O  OE2  . GLU B  2 31  ? -50.308 -30.223 -13.122 1.00 0.00 -1 85  GLU B OE2  1  
ATOM   3706   H  H    . GLU B  2 31  ? -46.118 -28.084 -13.463 1.00 0.00 ?  85  GLU B H    1  
ATOM   3707   H  HA   . GLU B  2 31  ? -48.881 -27.466 -13.621 1.00 0.00 ?  85  GLU B HA   1  
ATOM   3708   H  HB2  . GLU B  2 31  ? -47.256 -28.232 -11.038 1.00 0.00 ?  85  GLU B HB2  1  
ATOM   3709   H  HB3  . GLU B  2 31  ? -49.032 -28.299 -11.145 1.00 0.00 ?  85  GLU B HB3  1  
ATOM   3710   H  HG2  . GLU B  2 31  ? -47.053 -29.986 -12.770 1.00 0.00 ?  85  GLU B HG2  1  
ATOM   3711   H  HG3  . GLU B  2 31  ? -48.242 -30.511 -11.482 1.00 0.00 ?  85  GLU B HG3  1  
ATOM   3712   N  N    . MET B  2 32  ? -46.867 -25.441 -12.035 1.00 0.00 ?  86  MET B N    1  
ATOM   3713   C  CA   . MET B  2 32  ? -46.624 -24.082 -11.761 1.00 0.00 ?  86  MET B CA   1  
ATOM   3714   C  C    . MET B  2 32  ? -46.975 -23.040 -12.855 1.00 0.00 ?  86  MET B C    1  
ATOM   3715   O  O    . MET B  2 32  ? -47.716 -22.050 -12.650 1.00 0.00 ?  86  MET B O    1  
ATOM   3716   C  CB   . MET B  2 32  ? -45.129 -23.956 -11.231 1.00 0.00 ?  86  MET B CB   1  
ATOM   3717   C  CG   . MET B  2 32  ? -44.684 -22.560 -10.828 1.00 0.00 ?  86  MET B CG   1  
ATOM   3718   S  SD   . MET B  2 32  ? -45.744 -21.674 -9.712  1.00 0.00 ?  86  MET B SD   1  
ATOM   3719   C  CE   . MET B  2 32  ? -44.422 -20.401 -9.552  1.00 0.00 ?  86  MET B CE   1  
ATOM   3720   H  H    . MET B  2 32  ? -46.083 -26.051 -11.948 1.00 0.00 ?  86  MET B H    1  
ATOM   3721   H  HA   . MET B  2 32  ? -47.274 -23.765 -10.959 1.00 0.00 ?  86  MET B HA   1  
ATOM   3722   H  HB2  . MET B  2 32  ? -45.067 -24.657 -10.371 1.00 0.00 ?  86  MET B HB2  1  
ATOM   3723   H  HB3  . MET B  2 32  ? -44.452 -24.295 -12.044 1.00 0.00 ?  86  MET B HB3  1  
ATOM   3724   H  HG2  . MET B  2 32  ? -43.701 -22.749 -10.346 1.00 0.00 ?  86  MET B HG2  1  
ATOM   3725   H  HG3  . MET B  2 32  ? -44.602 -21.908 -11.724 1.00 0.00 ?  86  MET B HG3  1  
ATOM   3726   H  HE1  . MET B  2 32  ? -44.133 -20.100 -10.581 1.00 0.00 ?  86  MET B HE1  1  
ATOM   3727   H  HE2  . MET B  2 32  ? -43.481 -20.868 -9.191  1.00 0.00 ?  86  MET B HE2  1  
ATOM   3728   H  HE3  . MET B  2 32  ? -44.689 -19.501 -8.957  1.00 0.00 ?  86  MET B HE3  1  
ATOM   3729   N  N    . SER B  2 33  ? -46.528 -23.270 -14.100 1.00 0.00 ?  87  SER B N    1  
ATOM   3730   C  CA   . SER B  2 33  ? -46.933 -22.551 -15.289 1.00 0.00 ?  87  SER B CA   1  
ATOM   3731   C  C    . SER B  2 33  ? -48.432 -22.400 -15.522 1.00 0.00 ?  87  SER B C    1  
ATOM   3732   O  O    . SER B  2 33  ? -48.947 -21.324 -15.746 1.00 0.00 ?  87  SER B O    1  
ATOM   3733   C  CB   . SER B  2 33  ? -46.237 -23.091 -16.550 1.00 0.00 ?  87  SER B CB   1  
ATOM   3734   O  OG   . SER B  2 33  ? -46.490 -22.284 -17.708 1.00 0.00 ?  87  SER B OG   1  
ATOM   3735   H  H    . SER B  2 33  ? -46.000 -24.101 -14.257 1.00 0.00 ?  87  SER B H    1  
ATOM   3736   H  HA   . SER B  2 33  ? -46.553 -21.554 -15.118 1.00 0.00 ?  87  SER B HA   1  
ATOM   3737   H  HB2  . SER B  2 33  ? -45.152 -23.206 -16.341 1.00 0.00 ?  87  SER B HB2  1  
ATOM   3738   H  HB3  . SER B  2 33  ? -46.652 -24.095 -16.782 1.00 0.00 ?  87  SER B HB3  1  
ATOM   3739   H  HG   . SER B  2 33  ? -47.301 -22.621 -18.096 1.00 0.00 ?  87  SER B HG   1  
ATOM   3740   N  N    . LYS B  2 34  ? -49.192 -23.542 -15.364 1.00 0.00 ?  88  LYS B N    1  
ATOM   3741   C  CA   . LYS B  2 34  ? -50.605 -23.499 -15.433 1.00 0.00 ?  88  LYS B CA   1  
ATOM   3742   C  C    . LYS B  2 34  ? -51.320 -22.691 -14.259 1.00 0.00 ?  88  LYS B C    1  
ATOM   3743   O  O    . LYS B  2 34  ? -52.282 -21.966 -14.569 1.00 0.00 ?  88  LYS B O    1  
ATOM   3744   C  CB   . LYS B  2 34  ? -51.099 -25.011 -15.429 1.00 0.00 ?  88  LYS B CB   1  
ATOM   3745   C  CG   . LYS B  2 34  ? -51.215 -25.729 -16.820 1.00 0.00 ?  88  LYS B CG   1  
ATOM   3746   C  CD   . LYS B  2 34  ? -51.717 -27.196 -16.627 1.00 0.00 ?  88  LYS B CD   1  
ATOM   3747   C  CE   . LYS B  2 34  ? -51.038 -27.967 -15.495 1.00 0.00 ?  88  LYS B CE   1  
ATOM   3748   N  NZ   . LYS B  2 34  ? -51.223 -29.337 -15.626 1.00 0.00 1  88  LYS B NZ   1  
ATOM   3749   H  H    . LYS B  2 34  ? -48.710 -24.415 -15.382 1.00 0.00 ?  88  LYS B H    1  
ATOM   3750   H  HA   . LYS B  2 34  ? -50.791 -23.099 -16.418 1.00 0.00 ?  88  LYS B HA   1  
ATOM   3751   H  HB2  . LYS B  2 34  ? -50.488 -25.562 -14.683 1.00 0.00 ?  88  LYS B HB2  1  
ATOM   3752   H  HB3  . LYS B  2 34  ? -52.151 -24.980 -15.075 1.00 0.00 ?  88  LYS B HB3  1  
ATOM   3753   H  HG2  . LYS B  2 34  ? -51.780 -25.039 -17.482 1.00 0.00 ?  88  LYS B HG2  1  
ATOM   3754   H  HG3  . LYS B  2 34  ? -50.150 -25.666 -17.131 1.00 0.00 ?  88  LYS B HG3  1  
ATOM   3755   H  HD2  . LYS B  2 34  ? -52.794 -27.157 -16.355 1.00 0.00 ?  88  LYS B HD2  1  
ATOM   3756   H  HD3  . LYS B  2 34  ? -51.639 -27.633 -17.646 1.00 0.00 ?  88  LYS B HD3  1  
ATOM   3757   H  HE2  . LYS B  2 34  ? -49.972 -27.699 -15.659 1.00 0.00 ?  88  LYS B HE2  1  
ATOM   3758   H  HE3  . LYS B  2 34  ? -51.097 -27.531 -14.475 1.00 0.00 ?  88  LYS B HE3  1  
ATOM   3759   H  HZ1  . LYS B  2 34  ? -51.261 -29.636 -16.622 1.00 0.00 ?  88  LYS B HZ1  1  
ATOM   3760   H  HZ2  . LYS B  2 34  ? -52.062 -29.555 -15.051 1.00 0.00 ?  88  LYS B HZ2  1  
ATOM   3761   H  HZ3  . LYS B  2 34  ? -50.435 -29.754 -15.091 1.00 0.00 ?  88  LYS B HZ3  1  
ATOM   3762   N  N    . ASP B  2 35  ? -50.912 -22.802 -12.968 1.00 0.00 ?  89  ASP B N    1  
ATOM   3763   C  CA   . ASP B  2 35  ? -51.434 -22.039 -11.873 1.00 0.00 ?  89  ASP B CA   1  
ATOM   3764   C  C    . ASP B  2 35  ? -50.997 -20.566 -11.947 1.00 0.00 ?  89  ASP B C    1  
ATOM   3765   O  O    . ASP B  2 35  ? -51.707 -19.670 -11.532 1.00 0.00 ?  89  ASP B O    1  
ATOM   3766   C  CB   . ASP B  2 35  ? -51.096 -22.617 -10.486 1.00 0.00 ?  89  ASP B CB   1  
ATOM   3767   C  CG   . ASP B  2 35  ? -51.768 -23.962 -10.352 1.00 0.00 ?  89  ASP B CG   1  
ATOM   3768   O  OD1  . ASP B  2 35  ? -52.926 -24.189 -10.719 1.00 0.00 ?  89  ASP B OD1  1  
ATOM   3769   O  OD2  . ASP B  2 35  ? -51.066 -24.789 -9.791  1.00 0.00 -1 89  ASP B OD2  1  
ATOM   3770   H  H    . ASP B  2 35  ? -50.224 -23.480 -12.721 1.00 0.00 ?  89  ASP B H    1  
ATOM   3771   H  HA   . ASP B  2 35  ? -52.504 -22.048 -12.018 1.00 0.00 ?  89  ASP B HA   1  
ATOM   3772   H  HB2  . ASP B  2 35  ? -49.990 -22.723 -10.496 1.00 0.00 ?  89  ASP B HB2  1  
ATOM   3773   H  HB3  . ASP B  2 35  ? -51.488 -21.890 -9.743  1.00 0.00 ?  89  ASP B HB3  1  
ATOM   3774   N  N    . LEU B  2 36  ? -49.809 -20.286 -12.480 1.00 0.00 ?  90  LEU B N    1  
ATOM   3775   C  CA   . LEU B  2 36  ? -49.336 -18.940 -12.653 1.00 0.00 ?  90  LEU B CA   1  
ATOM   3776   C  C    . LEU B  2 36  ? -50.131 -18.137 -13.703 1.00 0.00 ?  90  LEU B C    1  
ATOM   3777   O  O    . LEU B  2 36  ? -50.460 -16.963 -13.502 1.00 0.00 ?  90  LEU B O    1  
ATOM   3778   C  CB   . LEU B  2 36  ? -47.808 -18.980 -13.052 1.00 0.00 ?  90  LEU B CB   1  
ATOM   3779   C  CG   . LEU B  2 36  ? -47.173 -17.656 -13.204 1.00 0.00 ?  90  LEU B CG   1  
ATOM   3780   C  CD1  . LEU B  2 36  ? -47.288 -16.772 -11.930 1.00 0.00 ?  90  LEU B CD1  1  
ATOM   3781   C  CD2  . LEU B  2 36  ? -45.680 -17.819 -13.496 1.00 0.00 ?  90  LEU B CD2  1  
ATOM   3782   H  H    . LEU B  2 36  ? -49.061 -20.932 -12.609 1.00 0.00 ?  90  LEU B H    1  
ATOM   3783   H  HA   . LEU B  2 36  ? -49.617 -18.477 -11.718 1.00 0.00 ?  90  LEU B HA   1  
ATOM   3784   H  HB2  . LEU B  2 36  ? -47.348 -19.471 -12.168 1.00 0.00 ?  90  LEU B HB2  1  
ATOM   3785   H  HB3  . LEU B  2 36  ? -47.468 -19.674 -13.850 1.00 0.00 ?  90  LEU B HB3  1  
ATOM   3786   H  HG   . LEU B  2 36  ? -47.711 -17.090 -13.994 1.00 0.00 ?  90  LEU B HG   1  
ATOM   3787   H  HD11 . LEU B  2 36  ? -48.357 -16.653 -11.652 1.00 0.00 ?  90  LEU B HD11 1  
ATOM   3788   H  HD12 . LEU B  2 36  ? -46.702 -15.828 -11.907 1.00 0.00 ?  90  LEU B HD12 1  
ATOM   3789   H  HD13 . LEU B  2 36  ? -46.791 -17.334 -11.110 1.00 0.00 ?  90  LEU B HD13 1  
ATOM   3790   H  HD21 . LEU B  2 36  ? -45.409 -18.569 -14.269 1.00 0.00 ?  90  LEU B HD21 1  
ATOM   3791   H  HD22 . LEU B  2 36  ? -45.060 -18.065 -12.608 1.00 0.00 ?  90  LEU B HD22 1  
ATOM   3792   H  HD23 . LEU B  2 36  ? -45.222 -16.858 -13.814 1.00 0.00 ?  90  LEU B HD23 1  
ATOM   3793   N  N    . GLU B  2 37  ? -50.601 -18.865 -14.808 1.00 0.00 ?  91  GLU B N    1  
ATOM   3794   C  CA   . GLU B  2 37  ? -51.434 -18.279 -15.815 1.00 0.00 ?  91  GLU B CA   1  
ATOM   3795   C  C    . GLU B  2 37  ? -52.772 -17.713 -15.272 1.00 0.00 ?  91  GLU B C    1  
ATOM   3796   O  O    . GLU B  2 37  ? -53.131 -16.506 -15.421 1.00 0.00 ?  91  GLU B O    1  
ATOM   3797   C  CB   . GLU B  2 37  ? -51.860 -19.230 -16.966 1.00 0.00 ?  91  GLU B CB   1  
ATOM   3798   C  CG   . GLU B  2 37  ? -52.996 -18.755 -17.887 1.00 0.00 ?  91  GLU B CG   1  
ATOM   3799   C  CD   . GLU B  2 37  ? -53.317 -19.787 -18.967 1.00 0.00 ?  91  GLU B CD   1  
ATOM   3800   O  OE1  . GLU B  2 37  ? -54.505 -20.198 -19.015 1.00 0.00 ?  91  GLU B OE1  1  
ATOM   3801   O  OE2  . GLU B  2 37  ? -52.413 -20.117 -19.822 1.00 0.00 -1 91  GLU B OE2  1  
ATOM   3802   H  H    . GLU B  2 37  ? -50.374 -19.820 -14.981 1.00 0.00 ?  91  GLU B H    1  
ATOM   3803   H  HA   . GLU B  2 37  ? -50.818 -17.517 -16.270 1.00 0.00 ?  91  GLU B HA   1  
ATOM   3804   H  HB2  . GLU B  2 37  ? -50.985 -19.540 -17.576 1.00 0.00 ?  91  GLU B HB2  1  
ATOM   3805   H  HB3  . GLU B  2 37  ? -52.171 -20.224 -16.578 1.00 0.00 ?  91  GLU B HB3  1  
ATOM   3806   H  HG2  . GLU B  2 37  ? -53.934 -18.557 -17.326 1.00 0.00 ?  91  GLU B HG2  1  
ATOM   3807   H  HG3  . GLU B  2 37  ? -52.806 -17.788 -18.402 1.00 0.00 ?  91  GLU B HG3  1  
ATOM   3808   N  N    . GLU B  2 38  ? -53.409 -18.580 -14.460 1.00 0.00 ?  92  GLU B N    1  
ATOM   3809   C  CA   . GLU B  2 38  ? -54.562 -18.346 -13.681 1.00 0.00 ?  92  GLU B CA   1  
ATOM   3810   C  C    . GLU B  2 38  ? -54.472 -17.241 -12.608 1.00 0.00 ?  92  GLU B C    1  
ATOM   3811   O  O    . GLU B  2 38  ? -55.428 -16.485 -12.312 1.00 0.00 ?  92  GLU B O    1  
ATOM   3812   C  CB   . GLU B  2 38  ? -55.225 -19.670 -13.147 1.00 0.00 ?  92  GLU B CB   1  
ATOM   3813   C  CG   . GLU B  2 38  ? -55.660 -20.719 -14.145 1.00 0.00 ?  92  GLU B CG   1  
ATOM   3814   C  CD   . GLU B  2 38  ? -56.556 -21.768 -13.618 1.00 0.00 ?  92  GLU B CD   1  
ATOM   3815   O  OE1  . GLU B  2 38  ? -57.558 -21.419 -12.994 1.00 0.00 ?  92  GLU B OE1  1  
ATOM   3816   O  OE2  . GLU B  2 38  ? -56.172 -22.945 -13.806 1.00 0.00 -1 92  GLU B OE2  1  
ATOM   3817   H  H    . GLU B  2 38  ? -53.016 -19.480 -14.290 1.00 0.00 ?  92  GLU B H    1  
ATOM   3818   H  HA   . GLU B  2 38  ? -55.281 -18.047 -14.430 1.00 0.00 ?  92  GLU B HA   1  
ATOM   3819   H  HB2  . GLU B  2 38  ? -54.535 -20.243 -12.492 1.00 0.00 ?  92  GLU B HB2  1  
ATOM   3820   H  HB3  . GLU B  2 38  ? -56.112 -19.326 -12.574 1.00 0.00 ?  92  GLU B HB3  1  
ATOM   3821   H  HG2  . GLU B  2 38  ? -56.120 -20.179 -15.000 1.00 0.00 ?  92  GLU B HG2  1  
ATOM   3822   H  HG3  . GLU B  2 38  ? -54.731 -21.186 -14.538 1.00 0.00 ?  92  GLU B HG3  1  
ATOM   3823   N  N    . VAL B  2 39  ? -53.369 -17.169 -11.827 1.00 0.00 ?  93  VAL B N    1  
ATOM   3824   C  CA   . VAL B  2 39  ? -53.276 -16.100 -10.786 1.00 0.00 ?  93  VAL B CA   1  
ATOM   3825   C  C    . VAL B  2 39  ? -52.851 -14.749 -11.444 1.00 0.00 ?  93  VAL B C    1  
ATOM   3826   O  O    . VAL B  2 39  ? -53.143 -13.689 -10.895 1.00 0.00 ?  93  VAL B O    1  
ATOM   3827   C  CB   . VAL B  2 39  ? -52.306 -16.490 -9.704  1.00 0.00 ?  93  VAL B CB   1  
ATOM   3828   C  CG1  . VAL B  2 39  ? -50.799 -16.484 -10.122 1.00 0.00 ?  93  VAL B CG1  1  
ATOM   3829   C  CG2  . VAL B  2 39  ? -52.481 -15.626 -8.364  1.00 0.00 ?  93  VAL B CG2  1  
ATOM   3830   H  H    . VAL B  2 39  ? -52.696 -17.905 -11.816 1.00 0.00 ?  93  VAL B H    1  
ATOM   3831   H  HA   . VAL B  2 39  ? -54.234 -16.093 -10.287 1.00 0.00 ?  93  VAL B HA   1  
ATOM   3832   H  HB   . VAL B  2 39  ? -52.542 -17.527 -9.384  1.00 0.00 ?  93  VAL B HB   1  
ATOM   3833   H  HG11 . VAL B  2 39  ? -50.407 -15.448 -10.198 1.00 0.00 ?  93  VAL B HG11 1  
ATOM   3834   H  HG12 . VAL B  2 39  ? -50.821 -16.994 -11.109 1.00 0.00 ?  93  VAL B HG12 1  
ATOM   3835   H  HG13 . VAL B  2 39  ? -50.240 -17.014 -9.321  1.00 0.00 ?  93  VAL B HG13 1  
ATOM   3836   H  HG21 . VAL B  2 39  ? -53.564 -15.550 -8.128  1.00 0.00 ?  93  VAL B HG21 1  
ATOM   3837   H  HG22 . VAL B  2 39  ? -52.053 -14.629 -8.604  1.00 0.00 ?  93  VAL B HG22 1  
ATOM   3838   H  HG23 . VAL B  2 39  ? -51.942 -16.183 -7.568  1.00 0.00 ?  93  VAL B HG23 1  
ATOM   3839   N  N    . LYS B  2 40  ? -52.090 -14.692 -12.554 1.00 0.00 ?  94  LYS B N    1  
ATOM   3840   C  CA   . LYS B  2 40  ? -51.754 -13.380 -13.039 1.00 0.00 ?  94  LYS B CA   1  
ATOM   3841   C  C    . LYS B  2 40  ? -52.987 -12.802 -13.670 1.00 0.00 ?  94  LYS B C    1  
ATOM   3842   O  O    . LYS B  2 40  ? -53.300 -11.623 -13.549 1.00 0.00 ?  94  LYS B O    1  
ATOM   3843   C  CB   . LYS B  2 40  ? -50.600 -13.509 -14.041 1.00 0.00 ?  94  LYS B CB   1  
ATOM   3844   C  CG   . LYS B  2 40  ? -49.201 -13.916 -13.366 1.00 0.00 ?  94  LYS B CG   1  
ATOM   3845   C  CD   . LYS B  2 40  ? -48.282 -14.301 -14.514 1.00 0.00 ?  94  LYS B CD   1  
ATOM   3846   C  CE   . LYS B  2 40  ? -48.038 -13.085 -15.406 1.00 0.00 ?  94  LYS B CE   1  
ATOM   3847   N  NZ   . LYS B  2 40  ? -47.004 -13.568 -16.400 1.00 0.00 1  94  LYS B NZ   1  
ATOM   3848   H  H    . LYS B  2 40  ? -51.623 -15.460 -12.985 1.00 0.00 ?  94  LYS B H    1  
ATOM   3849   H  HA   . LYS B  2 40  ? -51.540 -12.738 -12.198 1.00 0.00 ?  94  LYS B HA   1  
ATOM   3850   H  HB2  . LYS B  2 40  ? -50.804 -14.341 -14.749 1.00 0.00 ?  94  LYS B HB2  1  
ATOM   3851   H  HB3  . LYS B  2 40  ? -50.522 -12.507 -14.516 1.00 0.00 ?  94  LYS B HB3  1  
ATOM   3852   H  HG2  . LYS B  2 40  ? -48.757 -13.059 -12.816 1.00 0.00 ?  94  LYS B HG2  1  
ATOM   3853   H  HG3  . LYS B  2 40  ? -49.286 -14.752 -12.639 1.00 0.00 ?  94  LYS B HG3  1  
ATOM   3854   H  HD2  . LYS B  2 40  ? -47.354 -14.642 -14.007 1.00 0.00 ?  94  LYS B HD2  1  
ATOM   3855   H  HD3  . LYS B  2 40  ? -48.673 -15.206 -15.026 1.00 0.00 ?  94  LYS B HD3  1  
ATOM   3856   H  HE2  . LYS B  2 40  ? -48.885 -12.673 -15.993 1.00 0.00 ?  94  LYS B HE2  1  
ATOM   3857   H  HE3  . LYS B  2 40  ? -47.538 -12.226 -14.909 1.00 0.00 ?  94  LYS B HE3  1  
ATOM   3858   H  HZ1  . LYS B  2 40  ? -47.386 -14.416 -16.866 1.00 0.00 ?  94  LYS B HZ1  1  
ATOM   3859   H  HZ2  . LYS B  2 40  ? -46.141 -13.773 -15.857 1.00 0.00 ?  94  LYS B HZ2  1  
ATOM   3860   H  HZ3  . LYS B  2 40  ? -46.805 -12.834 -17.109 1.00 0.00 ?  94  LYS B HZ3  1  
ATOM   3861   N  N    . ALA B  2 41  ? -53.850 -13.729 -14.264 1.00 0.00 ?  95  ALA B N    1  
ATOM   3862   C  CA   . ALA B  2 41  ? -55.225 -13.465 -14.763 1.00 0.00 ?  95  ALA B CA   1  
ATOM   3863   C  C    . ALA B  2 41  ? -56.081 -12.987 -13.672 1.00 0.00 ?  95  ALA B C    1  
ATOM   3864   O  O    . ALA B  2 41  ? -56.895 -12.090 -13.871 1.00 0.00 ?  95  ALA B O    1  
ATOM   3865   C  CB   . ALA B  2 41  ? -55.869 -14.621 -15.580 1.00 0.00 ?  95  ALA B CB   1  
ATOM   3866   H  H    . ALA B  2 41  ? -53.519 -14.662 -14.384 1.00 0.00 ?  95  ALA B H    1  
ATOM   3867   H  HA   . ALA B  2 41  ? -55.104 -12.558 -15.337 1.00 0.00 ?  95  ALA B HA   1  
ATOM   3868   H  HB1  . ALA B  2 41  ? -55.041 -14.940 -16.248 1.00 0.00 ?  95  ALA B HB1  1  
ATOM   3869   H  HB2  . ALA B  2 41  ? -56.687 -14.310 -16.265 1.00 0.00 ?  95  ALA B HB2  1  
ATOM   3870   H  HB3  . ALA B  2 41  ? -56.287 -15.511 -15.064 1.00 0.00 ?  95  ALA B HB3  1  
ATOM   3871   N  N    . LYS B  2 42  ? -55.998 -13.581 -12.481 1.00 0.00 ?  96  LYS B N    1  
ATOM   3872   C  CA   . LYS B  2 42  ? -56.698 -13.091 -11.248 1.00 0.00 ?  96  LYS B CA   1  
ATOM   3873   C  C    . LYS B  2 42  ? -56.304 -11.699 -10.777 1.00 0.00 ?  96  LYS B C    1  
ATOM   3874   O  O    . LYS B  2 42  ? -57.125 -10.792 -10.469 1.00 0.00 ?  96  LYS B O    1  
ATOM   3875   C  CB   . LYS B  2 42  ? -56.553 -14.162 -10.167 1.00 0.00 ?  96  LYS B CB   1  
ATOM   3876   C  CG   . LYS B  2 42  ? -57.251 -13.969 -8.850  1.00 0.00 ?  96  LYS B CG   1  
ATOM   3877   C  CD   . LYS B  2 42  ? -58.752 -14.222 -8.965  1.00 0.00 ?  96  LYS B CD   1  
ATOM   3878   C  CE   . LYS B  2 42  ? -59.160 -15.586 -9.529  1.00 0.00 ?  96  LYS B CE   1  
ATOM   3879   N  NZ   . LYS B  2 42  ? -58.349 -16.737 -8.914  1.00 0.00 1  96  LYS B NZ   1  
ATOM   3880   H  H    . LYS B  2 42  ? -55.393 -14.366 -12.370 1.00 0.00 ?  96  LYS B H    1  
ATOM   3881   H  HA   . LYS B  2 42  ? -57.737 -12.895 -11.472 1.00 0.00 ?  96  LYS B HA   1  
ATOM   3882   H  HB2  . LYS B  2 42  ? -56.718 -15.165 -10.616 1.00 0.00 ?  96  LYS B HB2  1  
ATOM   3883   H  HB3  . LYS B  2 42  ? -55.452 -14.120 -10.021 1.00 0.00 ?  96  LYS B HB3  1  
ATOM   3884   H  HG2  . LYS B  2 42  ? -56.740 -14.672 -8.158  1.00 0.00 ?  96  LYS B HG2  1  
ATOM   3885   H  HG3  . LYS B  2 42  ? -57.019 -12.993 -8.373  1.00 0.00 ?  96  LYS B HG3  1  
ATOM   3886   H  HD2  . LYS B  2 42  ? -59.209 -14.063 -7.965  1.00 0.00 ?  96  LYS B HD2  1  
ATOM   3887   H  HD3  . LYS B  2 42  ? -59.056 -13.448 -9.702  1.00 0.00 ?  96  LYS B HD3  1  
ATOM   3888   H  HE2  . LYS B  2 42  ? -60.239 -15.733 -9.309  1.00 0.00 ?  96  LYS B HE2  1  
ATOM   3889   H  HE3  . LYS B  2 42  ? -58.995 -15.683 -10.623 1.00 0.00 ?  96  LYS B HE3  1  
ATOM   3890   H  HZ1  . LYS B  2 42  ? -58.264 -16.581 -7.890  1.00 0.00 ?  96  LYS B HZ1  1  
ATOM   3891   H  HZ2  . LYS B  2 42  ? -57.363 -16.800 -9.240  1.00 0.00 ?  96  LYS B HZ2  1  
ATOM   3892   H  HZ3  . LYS B  2 42  ? -58.775 -17.662 -9.124  1.00 0.00 ?  96  LYS B HZ3  1  
ATOM   3893   N  N    . VAL B  2 43  ? -54.969 -11.429 -10.762 1.00 0.00 ?  97  VAL B N    1  
ATOM   3894   C  CA   . VAL B  2 43  ? -54.403 -10.115 -10.361 1.00 0.00 ?  97  VAL B CA   1  
ATOM   3895   C  C    . VAL B  2 43  ? -54.673 -8.937  -11.318 1.00 0.00 ?  97  VAL B C    1  
ATOM   3896   O  O    . VAL B  2 43  ? -54.968 -7.836  -10.865 1.00 0.00 ?  97  VAL B O    1  
ATOM   3897   C  CB   . VAL B  2 43  ? -52.928 -10.327 -10.134 1.00 0.00 ?  97  VAL B CB   1  
ATOM   3898   C  CG1  . VAL B  2 43  ? -52.082 -8.998  -10.057 1.00 0.00 ?  97  VAL B CG1  1  
ATOM   3899   C  CG2  . VAL B  2 43  ? -52.684 -11.112 -8.772  1.00 0.00 ?  97  VAL B CG2  1  
ATOM   3900   H  H    . VAL B  2 43  ? -54.288 -12.098 -11.049 1.00 0.00 ?  97  VAL B H    1  
ATOM   3901   H  HA   . VAL B  2 43  ? -54.971 -9.701  -9.541  1.00 0.00 ?  97  VAL B HA   1  
ATOM   3902   H  HB   . VAL B  2 43  ? -52.511 -10.805 -11.046 1.00 0.00 ?  97  VAL B HB   1  
ATOM   3903   H  HG11 . VAL B  2 43  ? -52.275 -8.459  -11.009 1.00 0.00 ?  97  VAL B HG11 1  
ATOM   3904   H  HG12 . VAL B  2 43  ? -50.971 -8.985  -10.081 1.00 0.00 ?  97  VAL B HG12 1  
ATOM   3905   H  HG13 . VAL B  2 43  ? -52.505 -8.413  -9.212  1.00 0.00 ?  97  VAL B HG13 1  
ATOM   3906   H  HG21 . VAL B  2 43  ? -52.957 -12.185 -8.866  1.00 0.00 ?  97  VAL B HG21 1  
ATOM   3907   H  HG22 . VAL B  2 43  ? -53.281 -10.498 -8.065  1.00 0.00 ?  97  VAL B HG22 1  
ATOM   3908   H  HG23 . VAL B  2 43  ? -51.628 -10.945 -8.469  1.00 0.00 ?  97  VAL B HG23 1  
ATOM   3909   N  N    . GLN B  2 44  ? -54.678 -9.195  -12.647 1.00 0.00 ?  98  GLN B N    1  
ATOM   3910   C  CA   . GLN B  2 44  ? -54.778 -8.229  -13.735 1.00 0.00 ?  98  GLN B CA   1  
ATOM   3911   C  C    . GLN B  2 44  ? -55.711 -7.008  -13.537 1.00 0.00 ?  98  GLN B C    1  
ATOM   3912   O  O    . GLN B  2 44  ? -55.177 -5.867  -13.624 1.00 0.00 ?  98  GLN B O    1  
ATOM   3913   C  CB   . GLN B  2 44  ? -55.065 -8.960  -15.050 1.00 0.00 ?  98  GLN B CB   1  
ATOM   3914   C  CG   . GLN B  2 44  ? -55.455 -8.099  -16.319 1.00 0.00 ?  98  GLN B CG   1  
ATOM   3915   C  CD   . GLN B  2 44  ? -54.205 -7.378  -16.859 1.00 0.00 ?  98  GLN B CD   1  
ATOM   3916   O  OE1  . GLN B  2 44  ? -53.077 -7.934  -16.968 1.00 0.00 ?  98  GLN B OE1  1  
ATOM   3917   N  NE2  . GLN B  2 44  ? -54.387 -6.039  -17.057 1.00 0.00 ?  98  GLN B NE2  1  
ATOM   3918   H  H    . GLN B  2 44  ? -54.445 -10.153 -12.793 1.00 0.00 ?  98  GLN B H    1  
ATOM   3919   H  HA   . GLN B  2 44  ? -53.789 -7.836  -13.921 1.00 0.00 ?  98  GLN B HA   1  
ATOM   3920   H  HB2  . GLN B  2 44  ? -54.182 -9.586  -15.299 1.00 0.00 ?  98  GLN B HB2  1  
ATOM   3921   H  HB3  . GLN B  2 44  ? -55.818 -9.757  -14.876 1.00 0.00 ?  98  GLN B HB3  1  
ATOM   3922   H  HG2  . GLN B  2 44  ? -55.720 -8.767  -17.167 1.00 0.00 ?  98  GLN B HG2  1  
ATOM   3923   H  HG3  . GLN B  2 44  ? -56.292 -7.415  -16.060 1.00 0.00 ?  98  GLN B HG3  1  
ATOM   3924   H  HE21 . GLN B  2 44  ? -53.570 -5.527  -17.324 1.00 0.00 ?  98  GLN B HE21 1  
ATOM   3925   H  HE22 . GLN B  2 44  ? -55.335 -5.748  -17.185 1.00 0.00 ?  98  GLN B HE22 1  
ATOM   3926   N  N    . PRO B  2 45  ? -57.043 -6.981  -13.279 1.00 0.00 ?  99  PRO B N    1  
ATOM   3927   C  CA   . PRO B  2 45  ? -57.928 -5.834  -13.322 1.00 0.00 ?  99  PRO B CA   1  
ATOM   3928   C  C    . PRO B  2 45  ? -57.668 -4.974  -12.152 1.00 0.00 ?  99  PRO B C    1  
ATOM   3929   O  O    . PRO B  2 45  ? -57.764 -3.774  -12.281 1.00 0.00 ?  99  PRO B O    1  
ATOM   3930   C  CB   . PRO B  2 45  ? -59.326 -6.458  -13.345 1.00 0.00 ?  99  PRO B CB   1  
ATOM   3931   C  CG   . PRO B  2 45  ? -59.243 -7.887  -12.830 1.00 0.00 ?  99  PRO B CG   1  
ATOM   3932   C  CD   . PRO B  2 45  ? -57.858 -8.214  -13.263 1.00 0.00 ?  99  PRO B CD   1  
ATOM   3933   H  HA   . PRO B  2 45  ? -57.774 -5.243  -14.213 1.00 0.00 ?  99  PRO B HA   1  
ATOM   3934   H  HB2  . PRO B  2 45  ? -60.081 -5.829  -12.827 1.00 0.00 ?  99  PRO B HB2  1  
ATOM   3935   H  HB3  . PRO B  2 45  ? -59.665 -6.522  -14.401 1.00 0.00 ?  99  PRO B HB3  1  
ATOM   3936   H  HG2  . PRO B  2 45  ? -59.324 -7.847  -11.723 1.00 0.00 ?  99  PRO B HG2  1  
ATOM   3937   H  HG3  . PRO B  2 45  ? -60.072 -8.542  -13.175 1.00 0.00 ?  99  PRO B HG3  1  
ATOM   3938   H  HD2  . PRO B  2 45  ? -57.485 -8.969  -12.537 1.00 0.00 ?  99  PRO B HD2  1  
ATOM   3939   H  HD3  . PRO B  2 45  ? -57.810 -8.555  -14.319 1.00 0.00 ?  99  PRO B HD3  1  
ATOM   3940   N  N    . TYR B  2 46  ? -57.365 -5.517  -10.975 1.00 0.00 ?  100 TYR B N    1  
ATOM   3941   C  CA   . TYR B  2 46  ? -57.085 -4.860  -9.740  1.00 0.00 ?  100 TYR B CA   1  
ATOM   3942   C  C    . TYR B  2 46  ? -55.831 -3.961  -9.830  1.00 0.00 ?  100 TYR B C    1  
ATOM   3943   O  O    . TYR B  2 46  ? -55.775 -2.785  -9.423  1.00 0.00 ?  100 TYR B O    1  
ATOM   3944   C  CB   . TYR B  2 46  ? -56.683 -5.924  -8.739  1.00 0.00 ?  100 TYR B CB   1  
ATOM   3945   C  CG   . TYR B  2 46  ? -57.858 -6.824  -8.359  1.00 0.00 ?  100 TYR B CG   1  
ATOM   3946   C  CD1  . TYR B  2 46  ? -58.076 -8.111  -9.030  1.00 0.00 ?  100 TYR B CD1  1  
ATOM   3947   C  CD2  . TYR B  2 46  ? -58.747 -6.476  -7.333  1.00 0.00 ?  100 TYR B CD2  1  
ATOM   3948   C  CE1  . TYR B  2 46  ? -59.034 -9.027  -8.565  1.00 0.00 ?  100 TYR B CE1  1  
ATOM   3949   C  CE2  . TYR B  2 46  ? -59.713 -7.398  -6.871  1.00 0.00 ?  100 TYR B CE2  1  
ATOM   3950   C  CZ   . TYR B  2 46  ? -59.797 -8.703  -7.435  1.00 0.00 ?  100 TYR B CZ   1  
ATOM   3951   O  OH   . TYR B  2 46  ? -60.936 -9.541  -7.158  1.00 0.00 ?  100 TYR B OH   1  
ATOM   3952   H  H    . TYR B  2 46  ? -57.428 -6.510  -10.927 1.00 0.00 ?  100 TYR B H    1  
ATOM   3953   H  HA   . TYR B  2 46  ? -57.958 -4.327  -9.392  1.00 0.00 ?  100 TYR B HA   1  
ATOM   3954   H  HB2  . TYR B  2 46  ? -55.837 -6.498  -9.174  1.00 0.00 ?  100 TYR B HB2  1  
ATOM   3955   H  HB3  . TYR B  2 46  ? -56.281 -5.502  -7.793  1.00 0.00 ?  100 TYR B HB3  1  
ATOM   3956   H  HD1  . TYR B  2 46  ? -57.398 -8.472  -9.790  1.00 0.00 ?  100 TYR B HD1  1  
ATOM   3957   H  HD2  . TYR B  2 46  ? -58.515 -5.561  -6.809  1.00 0.00 ?  100 TYR B HD2  1  
ATOM   3958   H  HE1  . TYR B  2 46  ? -59.210 -9.962  -9.077  1.00 0.00 ?  100 TYR B HE1  1  
ATOM   3959   H  HE2  . TYR B  2 46  ? -60.266 -7.196  -5.966  1.00 0.00 ?  100 TYR B HE2  1  
ATOM   3960   H  HH   . TYR B  2 46  ? -61.234 -9.996  -7.948  1.00 0.00 ?  100 TYR B HH   1  
ATOM   3961   N  N    . LEU B  2 47  ? -54.781 -4.542  -10.410 1.00 0.00 ?  101 LEU B N    1  
ATOM   3962   C  CA   . LEU B  2 47  ? -53.477 -4.061  -10.666 1.00 0.00 ?  101 LEU B CA   1  
ATOM   3963   C  C    . LEU B  2 47  ? -53.517 -2.911  -11.655 1.00 0.00 ?  101 LEU B C    1  
ATOM   3964   O  O    . LEU B  2 47  ? -52.853 -1.889  -11.581 1.00 0.00 ?  101 LEU B O    1  
ATOM   3965   C  CB   . LEU B  2 47  ? -52.544 -5.258  -11.215 1.00 0.00 ?  101 LEU B CB   1  
ATOM   3966   C  CG   . LEU B  2 47  ? -51.202 -4.949  -11.803 1.00 0.00 ?  101 LEU B CG   1  
ATOM   3967   C  CD1  . LEU B  2 47  ? -50.274 -4.053  -10.985 1.00 0.00 ?  101 LEU B CD1  1  
ATOM   3968   C  CD2  . LEU B  2 47  ? -50.500 -6.270  -12.112 1.00 0.00 ?  101 LEU B CD2  1  
ATOM   3969   H  H    . LEU B  2 47  ? -54.956 -5.489  -10.669 1.00 0.00 ?  101 LEU B H    1  
ATOM   3970   H  HA   . LEU B  2 47  ? -53.078 -3.562  -9.794  1.00 0.00 ?  101 LEU B HA   1  
ATOM   3971   H  HB2  . LEU B  2 47  ? -52.481 -5.942  -10.341 1.00 0.00 ?  101 LEU B HB2  1  
ATOM   3972   H  HB3  . LEU B  2 47  ? -53.201 -5.822  -11.910 1.00 0.00 ?  101 LEU B HB3  1  
ATOM   3973   H  HG   . LEU B  2 47  ? -51.372 -4.471  -12.792 1.00 0.00 ?  101 LEU B HG   1  
ATOM   3974   H  HD11 . LEU B  2 47  ? -49.281 -3.849  -11.440 1.00 0.00 ?  101 LEU B HD11 1  
ATOM   3975   H  HD12 . LEU B  2 47  ? -50.079 -4.381  -9.941  1.00 0.00 ?  101 LEU B HD12 1  
ATOM   3976   H  HD13 . LEU B  2 47  ? -50.732 -3.042  -10.999 1.00 0.00 ?  101 LEU B HD13 1  
ATOM   3977   H  HD21 . LEU B  2 47  ? -49.451 -6.078  -12.424 1.00 0.00 ?  101 LEU B HD21 1  
ATOM   3978   H  HD22 . LEU B  2 47  ? -51.103 -6.875  -12.822 1.00 0.00 ?  101 LEU B HD22 1  
ATOM   3979   H  HD23 . LEU B  2 47  ? -50.319 -6.812  -11.159 1.00 0.00 ?  101 LEU B HD23 1  
ATOM   3980   N  N    . ASP B  2 48  ? -54.407 -2.963  -12.693 1.00 0.00 ?  102 ASP B N    1  
ATOM   3981   C  CA   . ASP B  2 48  ? -54.539 -1.927  -13.673 1.00 0.00 ?  102 ASP B CA   1  
ATOM   3982   C  C    . ASP B  2 48  ? -55.093 -0.590  -13.025 1.00 0.00 ?  102 ASP B C    1  
ATOM   3983   O  O    . ASP B  2 48  ? -54.678 0.525   -13.377 1.00 0.00 ?  102 ASP B O    1  
ATOM   3984   C  CB   . ASP B  2 48  ? -55.413 -2.320  -14.836 1.00 0.00 ?  102 ASP B CB   1  
ATOM   3985   C  CG   . ASP B  2 48  ? -55.476 -1.362  -15.999 1.00 0.00 ?  102 ASP B CG   1  
ATOM   3986   O  OD1  . ASP B  2 48  ? -56.635 -1.218  -16.502 1.00 0.00 ?  102 ASP B OD1  1  
ATOM   3987   O  OD2  . ASP B  2 48  ? -54.392 -0.899  -16.443 1.00 0.00 -1 102 ASP B OD2  1  
ATOM   3988   H  H    . ASP B  2 48  ? -55.052 -3.694  -12.901 1.00 0.00 ?  102 ASP B H    1  
ATOM   3989   H  HA   . ASP B  2 48  ? -53.599 -1.694  -14.151 1.00 0.00 ?  102 ASP B HA   1  
ATOM   3990   H  HB2  . ASP B  2 48  ? -55.000 -3.244  -15.293 1.00 0.00 ?  102 ASP B HB2  1  
ATOM   3991   H  HB3  . ASP B  2 48  ? -56.447 -2.560  -14.509 1.00 0.00 ?  102 ASP B HB3  1  
ATOM   3992   N  N    . ASP B  2 49  ? -56.088 -0.749  -12.100 1.00 0.00 ?  103 ASP B N    1  
ATOM   3993   C  CA   . ASP B  2 49  ? -56.789 0.351   -11.412 1.00 0.00 ?  103 ASP B CA   1  
ATOM   3994   C  C    . ASP B  2 49  ? -55.819 1.042   -10.446 1.00 0.00 ?  103 ASP B C    1  
ATOM   3995   O  O    . ASP B  2 49  ? -55.879 2.242   -10.374 1.00 0.00 ?  103 ASP B O    1  
ATOM   3996   C  CB   . ASP B  2 49  ? -58.136 -0.062  -10.769 1.00 0.00 ?  103 ASP B CB   1  
ATOM   3997   C  CG   . ASP B  2 49  ? -59.173 -0.313  -11.769 1.00 0.00 ?  103 ASP B CG   1  
ATOM   3998   O  OD1  . ASP B  2 49  ? -58.949 -0.259  -12.971 1.00 0.00 ?  103 ASP B OD1  1  
ATOM   3999   O  OD2  . ASP B  2 49  ? -60.274 -0.561  -11.322 1.00 0.00 -1 103 ASP B OD2  1  
ATOM   4000   H  H    . ASP B  2 49  ? -56.492 -1.658  -12.033 1.00 0.00 ?  103 ASP B H    1  
ATOM   4001   H  HA   . ASP B  2 49  ? -57.053 1.040   -12.200 1.00 0.00 ?  103 ASP B HA   1  
ATOM   4002   H  HB2  . ASP B  2 49  ? -57.925 -1.005  -10.221 1.00 0.00 ?  103 ASP B HB2  1  
ATOM   4003   H  HB3  . ASP B  2 49  ? -58.378 0.654   -9.955  1.00 0.00 ?  103 ASP B HB3  1  
ATOM   4004   N  N    . PHE B  2 50  ? -54.946 0.253   -9.639  1.00 0.00 ?  104 PHE B N    1  
ATOM   4005   C  CA   . PHE B  2 50  ? -53.916 0.802   -8.725  1.00 0.00 ?  104 PHE B CA   1  
ATOM   4006   C  C    . PHE B  2 50  ? -52.864 1.759   -9.426  1.00 0.00 ?  104 PHE B C    1  
ATOM   4007   O  O    . PHE B  2 50  ? -52.679 2.893   -8.975  1.00 0.00 ?  104 PHE B O    1  
ATOM   4008   C  CB   . PHE B  2 50  ? -53.195 -0.384  -7.906  1.00 0.00 ?  104 PHE B CB   1  
ATOM   4009   C  CG   . PHE B  2 50  ? -52.083 0.105   -6.980  1.00 0.00 ?  104 PHE B CG   1  
ATOM   4010   C  CD1  . PHE B  2 50  ? -50.742 -0.094  -7.326  1.00 0.00 ?  104 PHE B CD1  1  
ATOM   4011   C  CD2  . PHE B  2 50  ? -52.424 0.747   -5.810  1.00 0.00 ?  104 PHE B CD2  1  
ATOM   4012   C  CE1  . PHE B  2 50  ? -49.721 0.459   -6.570  1.00 0.00 ?  104 PHE B CE1  1  
ATOM   4013   C  CE2  . PHE B  2 50  ? -51.385 1.115   -4.921  1.00 0.00 ?  104 PHE B CE2  1  
ATOM   4014   C  CZ   . PHE B  2 50  ? -50.053 0.967   -5.305  1.00 0.00 ?  104 PHE B CZ   1  
ATOM   4015   H  H    . PHE B  2 50  ? -55.020 -0.713  -9.872  1.00 0.00 ?  104 PHE B H    1  
ATOM   4016   H  HA   . PHE B  2 50  ? -54.362 1.341   -7.902  1.00 0.00 ?  104 PHE B HA   1  
ATOM   4017   H  HB2  . PHE B  2 50  ? -54.009 -0.796  -7.273  1.00 0.00 ?  104 PHE B HB2  1  
ATOM   4018   H  HB3  . PHE B  2 50  ? -52.802 -1.097  -8.663  1.00 0.00 ?  104 PHE B HB3  1  
ATOM   4019   H  HD1  . PHE B  2 50  ? -50.560 -0.567  -8.280  1.00 0.00 ?  104 PHE B HD1  1  
ATOM   4020   H  HD2  . PHE B  2 50  ? -53.472 0.970   -5.674  1.00 0.00 ?  104 PHE B HD2  1  
ATOM   4021   H  HE1  . PHE B  2 50  ? -48.678 0.253   -6.761  1.00 0.00 ?  104 PHE B HE1  1  
ATOM   4022   H  HE2  . PHE B  2 50  ? -51.792 1.533   -4.012  1.00 0.00 ?  104 PHE B HE2  1  
ATOM   4023   H  HZ   . PHE B  2 50  ? -49.238 1.276   -4.667  1.00 0.00 ?  104 PHE B HZ   1  
ATOM   4024   N  N    . GLN B  2 51  ? -52.318 1.338   -10.556 1.00 0.00 ?  105 GLN B N    1  
ATOM   4025   C  CA   . GLN B  2 51  ? -51.526 2.133   -11.497 1.00 0.00 ?  105 GLN B CA   1  
ATOM   4026   C  C    . GLN B  2 51  ? -52.254 3.356   -12.139 1.00 0.00 ?  105 GLN B C    1  
ATOM   4027   O  O    . GLN B  2 51  ? -51.732 4.452   -12.037 1.00 0.00 ?  105 GLN B O    1  
ATOM   4028   C  CB   . GLN B  2 51  ? -50.967 1.196   -12.648 1.00 0.00 ?  105 GLN B CB   1  
ATOM   4029   C  CG   . GLN B  2 51  ? -49.896 0.226   -12.064 1.00 0.00 ?  105 GLN B CG   1  
ATOM   4030   C  CD   . GLN B  2 51  ? -49.289 -0.788  -13.055 1.00 0.00 ?  105 GLN B CD   1  
ATOM   4031   O  OE1  . GLN B  2 51  ? -48.163 -0.765  -13.494 1.00 0.00 ?  105 GLN B OE1  1  
ATOM   4032   N  NE2  . GLN B  2 51  ? -50.045 -1.804  -13.379 1.00 0.00 ?  105 GLN B NE2  1  
ATOM   4033   H  H    . GLN B  2 51  ? -52.429 0.397   -10.865 1.00 0.00 ?  105 GLN B H    1  
ATOM   4034   H  HA   . GLN B  2 51  ? -50.805 2.590   -10.836 1.00 0.00 ?  105 GLN B HA   1  
ATOM   4035   H  HB2  . GLN B  2 51  ? -51.787 0.677   -13.189 1.00 0.00 ?  105 GLN B HB2  1  
ATOM   4036   H  HB3  . GLN B  2 51  ? -50.449 1.924   -13.308 1.00 0.00 ?  105 GLN B HB3  1  
ATOM   4037   H  HG2  . GLN B  2 51  ? -49.104 0.888   -11.653 1.00 0.00 ?  105 GLN B HG2  1  
ATOM   4038   H  HG3  . GLN B  2 51  ? -50.175 -0.412  -11.198 1.00 0.00 ?  105 GLN B HG3  1  
ATOM   4039   H  HE21 . GLN B  2 51  ? -50.987 -1.791  -13.042 1.00 0.00 ?  105 GLN B HE21 1  
ATOM   4040   H  HE22 . GLN B  2 51  ? -49.505 -2.518  -13.825 1.00 0.00 ?  105 GLN B HE22 1  
ATOM   4041   N  N    . LYS B  2 52  ? -53.513 3.229   -12.596 1.00 0.00 ?  106 LYS B N    1  
ATOM   4042   C  CA   . LYS B  2 52  ? -54.168 4.394   -13.105 1.00 0.00 ?  106 LYS B CA   1  
ATOM   4043   C  C    . LYS B  2 52  ? -54.395 5.516   -12.055 1.00 0.00 ?  106 LYS B C    1  
ATOM   4044   O  O    . LYS B  2 52  ? -54.048 6.656   -12.266 1.00 0.00 ?  106 LYS B O    1  
ATOM   4045   C  CB   . LYS B  2 52  ? -55.504 3.987   -13.836 1.00 0.00 ?  106 LYS B CB   1  
ATOM   4046   C  CG   . LYS B  2 52  ? -56.390 5.247   -14.277 1.00 0.00 ?  106 LYS B CG   1  
ATOM   4047   C  CD   . LYS B  2 52  ? -57.363 4.667   -15.319 1.00 0.00 ?  106 LYS B CD   1  
ATOM   4048   C  CE   . LYS B  2 52  ? -58.456 5.720   -15.599 1.00 0.00 ?  106 LYS B CE   1  
ATOM   4049   N  NZ   . LYS B  2 52  ? -57.884 7.062   -15.967 1.00 0.00 1  106 LYS B NZ   1  
ATOM   4050   H  H    . LYS B  2 52  ? -53.974 2.346   -12.624 1.00 0.00 ?  106 LYS B H    1  
ATOM   4051   H  HA   . LYS B  2 52  ? -53.504 4.852   -13.823 1.00 0.00 ?  106 LYS B HA   1  
ATOM   4052   H  HB2  . LYS B  2 52  ? -55.168 3.458   -14.753 1.00 0.00 ?  106 LYS B HB2  1  
ATOM   4053   H  HB3  . LYS B  2 52  ? -56.116 3.274   -13.244 1.00 0.00 ?  106 LYS B HB3  1  
ATOM   4054   H  HG2  . LYS B  2 52  ? -56.965 5.531   -13.369 1.00 0.00 ?  106 LYS B HG2  1  
ATOM   4055   H  HG3  . LYS B  2 52  ? -55.718 5.974   -14.781 1.00 0.00 ?  106 LYS B HG3  1  
ATOM   4056   H  HD2  . LYS B  2 52  ? -56.820 4.407   -16.253 1.00 0.00 ?  106 LYS B HD2  1  
ATOM   4057   H  HD3  . LYS B  2 52  ? -57.885 3.762   -14.940 1.00 0.00 ?  106 LYS B HD3  1  
ATOM   4058   H  HE2  . LYS B  2 52  ? -59.202 5.467   -16.383 1.00 0.00 ?  106 LYS B HE2  1  
ATOM   4059   H  HE3  . LYS B  2 52  ? -59.126 5.849   -14.722 1.00 0.00 ?  106 LYS B HE3  1  
ATOM   4060   H  HZ1  . LYS B  2 52  ? -58.475 7.532   -16.683 1.00 0.00 ?  106 LYS B HZ1  1  
ATOM   4061   H  HZ2  . LYS B  2 52  ? -56.877 7.182   -16.199 1.00 0.00 ?  106 LYS B HZ2  1  
ATOM   4062   H  HZ3  . LYS B  2 52  ? -57.984 7.647   -15.113 1.00 0.00 ?  106 LYS B HZ3  1  
ATOM   4063   N  N    . LYS B  2 53  ? -54.899 5.219   -10.854 1.00 0.00 ?  107 LYS B N    1  
ATOM   4064   C  CA   . LYS B  2 53  ? -55.187 6.195   -9.783  1.00 0.00 ?  107 LYS B CA   1  
ATOM   4065   C  C    . LYS B  2 53  ? -53.980 6.812   -9.226  1.00 0.00 ?  107 LYS B C    1  
ATOM   4066   O  O    . LYS B  2 53  ? -53.925 8.022   -8.964  1.00 0.00 ?  107 LYS B O    1  
ATOM   4067   C  CB   . LYS B  2 53  ? -56.040 5.583   -8.640  1.00 0.00 ?  107 LYS B CB   1  
ATOM   4068   C  CG   . LYS B  2 53  ? -55.417 4.437   -7.875  1.00 0.00 ?  107 LYS B CG   1  
ATOM   4069   C  CD   . LYS B  2 53  ? -56.380 3.942   -6.747  1.00 0.00 ?  107 LYS B CD   1  
ATOM   4070   C  CE   . LYS B  2 53  ? -57.751 3.598   -7.186  1.00 0.00 ?  107 LYS B CE   1  
ATOM   4071   N  NZ   . LYS B  2 53  ? -58.562 2.953   -6.042  1.00 0.00 1  107 LYS B NZ   1  
ATOM   4072   H  H    . LYS B  2 53  ? -55.287 4.329   -10.627 1.00 0.00 ?  107 LYS B H    1  
ATOM   4073   H  HA   . LYS B  2 53  ? -55.738 7.053   -10.140 1.00 0.00 ?  107 LYS B HA   1  
ATOM   4074   H  HB2  . LYS B  2 53  ? -56.225 6.417   -7.929  1.00 0.00 ?  107 LYS B HB2  1  
ATOM   4075   H  HB3  . LYS B  2 53  ? -57.020 5.301   -9.080  1.00 0.00 ?  107 LYS B HB3  1  
ATOM   4076   H  HG2  . LYS B  2 53  ? -55.310 3.522   -8.496  1.00 0.00 ?  107 LYS B HG2  1  
ATOM   4077   H  HG3  . LYS B  2 53  ? -54.533 4.840   -7.336  1.00 0.00 ?  107 LYS B HG3  1  
ATOM   4078   H  HD2  . LYS B  2 53  ? -55.989 3.126   -6.103  1.00 0.00 ?  107 LYS B HD2  1  
ATOM   4079   H  HD3  . LYS B  2 53  ? -56.569 4.845   -6.128  1.00 0.00 ?  107 LYS B HD3  1  
ATOM   4080   H  HE2  . LYS B  2 53  ? -58.380 4.438   -7.551  1.00 0.00 ?  107 LYS B HE2  1  
ATOM   4081   H  HE3  . LYS B  2 53  ? -57.665 3.000   -8.119  1.00 0.00 ?  107 LYS B HE3  1  
ATOM   4082   H  HZ1  . LYS B  2 53  ? -59.366 2.518   -6.539  1.00 0.00 ?  107 LYS B HZ1  1  
ATOM   4083   H  HZ2  . LYS B  2 53  ? -59.003 3.710   -5.480  1.00 0.00 ?  107 LYS B HZ2  1  
ATOM   4084   H  HZ3  . LYS B  2 53  ? -58.108 2.224   -5.456  1.00 0.00 ?  107 LYS B HZ3  1  
ATOM   4085   N  N    . TRP B  2 54  ? -52.937 6.049   -9.087  1.00 0.00 ?  108 TRP B N    1  
ATOM   4086   C  CA   . TRP B  2 54  ? -51.657 6.535   -8.655  1.00 0.00 ?  108 TRP B CA   1  
ATOM   4087   C  C    . TRP B  2 54  ? -51.033 7.409   -9.683  1.00 0.00 ?  108 TRP B C    1  
ATOM   4088   O  O    . TRP B  2 54  ? -50.367 8.408   -9.417  1.00 0.00 ?  108 TRP B O    1  
ATOM   4089   C  CB   . TRP B  2 54  ? -50.698 5.365   -8.300  1.00 0.00 ?  108 TRP B CB   1  
ATOM   4090   C  CG   . TRP B  2 54  ? -49.448 5.728   -7.532  1.00 0.00 ?  108 TRP B CG   1  
ATOM   4091   C  CD1  . TRP B  2 54  ? -48.313 6.435   -7.970  1.00 0.00 ?  108 TRP B CD1  1  
ATOM   4092   C  CD2  . TRP B  2 54  ? -49.210 5.495   -6.126  1.00 0.00 ?  108 TRP B CD2  1  
ATOM   4093   N  NE1  . TRP B  2 54  ? -47.275 6.381   -6.955  1.00 0.00 ?  108 TRP B NE1  1  
ATOM   4094   C  CE2  . TRP B  2 54  ? -47.837 5.854   -5.799  1.00 0.00 ?  108 TRP B CE2  1  
ATOM   4095   C  CE3  . TRP B  2 54  ? -50.006 4.863   -5.131  1.00 0.00 ?  108 TRP B CE3  1  
ATOM   4096   C  CZ2  . TRP B  2 54  ? -47.352 5.674   -4.533  1.00 0.00 ?  108 TRP B CZ2  1  
ATOM   4097   C  CZ3  . TRP B  2 54  ? -49.509 4.710   -3.868  1.00 0.00 ?  108 TRP B CZ3  1  
ATOM   4098   C  CH2  . TRP B  2 54  ? -48.232 5.136   -3.583  1.00 0.00 ?  108 TRP B CH2  1  
ATOM   4099   H  H    . TRP B  2 54  ? -53.136 5.090   -9.273  1.00 0.00 ?  108 TRP B H    1  
ATOM   4100   H  HA   . TRP B  2 54  ? -51.782 7.097   -7.741  1.00 0.00 ?  108 TRP B HA   1  
ATOM   4101   H  HB2  . TRP B  2 54  ? -51.409 4.899   -7.584  1.00 0.00 ?  108 TRP B HB2  1  
ATOM   4102   H  HB3  . TRP B  2 54  ? -50.481 4.725   -9.182  1.00 0.00 ?  108 TRP B HB3  1  
ATOM   4103   H  HD1  . TRP B  2 54  ? -48.313 6.777   -8.994  1.00 0.00 ?  108 TRP B HD1  1  
ATOM   4104   H  HE1  . TRP B  2 54  ? -46.328 6.363   -7.187  1.00 0.00 ?  108 TRP B HE1  1  
ATOM   4105   H  HE3  . TRP B  2 54  ? -50.979 4.423   -5.290  1.00 0.00 ?  108 TRP B HE3  1  
ATOM   4106   H  HZ2  . TRP B  2 54  ? -46.347 5.880   -4.194  1.00 0.00 ?  108 TRP B HZ2  1  
ATOM   4107   H  HZ3  . TRP B  2 54  ? -50.054 4.104   -3.159  1.00 0.00 ?  108 TRP B HZ3  1  
ATOM   4108   H  HH2  . TRP B  2 54  ? -47.857 4.908   -2.596  1.00 0.00 ?  108 TRP B HH2  1  
ATOM   4109   N  N    . GLN B  2 55  ? -51.198 7.126   -10.988 1.00 0.00 ?  109 GLN B N    1  
ATOM   4110   C  CA   . GLN B  2 55  ? -50.708 7.893   -12.099 1.00 0.00 ?  109 GLN B CA   1  
ATOM   4111   C  C    . GLN B  2 55  ? -51.511 9.146   -12.382 1.00 0.00 ?  109 GLN B C    1  
ATOM   4112   O  O    . GLN B  2 55  ? -50.988 10.215  -12.692 1.00 0.00 ?  109 GLN B O    1  
ATOM   4113   C  CB   . GLN B  2 55  ? -50.671 7.092   -13.416 1.00 0.00 ?  109 GLN B CB   1  
ATOM   4114   C  CG   . GLN B  2 55  ? -49.812 7.822   -14.447 1.00 0.00 ?  109 GLN B CG   1  
ATOM   4115   C  CD   . GLN B  2 55  ? -49.533 7.022   -15.759 1.00 0.00 ?  109 GLN B CD   1  
ATOM   4116   O  OE1  . GLN B  2 55  ? -49.886 5.819   -15.858 1.00 0.00 ?  109 GLN B OE1  1  
ATOM   4117   N  NE2  . GLN B  2 55  ? -48.698 7.553   -16.663 1.00 0.00 ?  109 GLN B NE2  1  
ATOM   4118   H  H    . GLN B  2 55  ? -51.681 6.306   -11.285 1.00 0.00 ?  109 GLN B H    1  
ATOM   4119   H  HA   . GLN B  2 55  ? -49.675 8.182   -11.977 1.00 0.00 ?  109 GLN B HA   1  
ATOM   4120   H  HB2  . GLN B  2 55  ? -50.253 6.066   -13.335 1.00 0.00 ?  109 GLN B HB2  1  
ATOM   4121   H  HB3  . GLN B  2 55  ? -51.699 6.884   -13.781 1.00 0.00 ?  109 GLN B HB3  1  
ATOM   4122   H  HG2  . GLN B  2 55  ? -50.132 8.856   -14.700 1.00 0.00 ?  109 GLN B HG2  1  
ATOM   4123   H  HG3  . GLN B  2 55  ? -48.782 7.921   -14.042 1.00 0.00 ?  109 GLN B HG3  1  
ATOM   4124   H  HE21 . GLN B  2 55  ? -48.298 8.462   -16.548 1.00 0.00 ?  109 GLN B HE21 1  
ATOM   4125   H  HE22 . GLN B  2 55  ? -48.604 7.026   -17.507 1.00 0.00 ?  109 GLN B HE22 1  
ATOM   4126   N  N    . GLU B  2 56  ? -52.846 9.050   -12.247 1.00 0.00 ?  110 GLU B N    1  
ATOM   4127   C  CA   . GLU B  2 56  ? -53.691 10.220  -12.259 1.00 0.00 ?  110 GLU B CA   1  
ATOM   4128   C  C    . GLU B  2 56  ? -53.454 11.217  -11.175 1.00 0.00 ?  110 GLU B C    1  
ATOM   4129   O  O    . GLU B  2 56  ? -53.266 12.440  -11.398 1.00 0.00 ?  110 GLU B O    1  
ATOM   4130   C  CB   . GLU B  2 56  ? -55.181 9.871   -12.085 1.00 0.00 ?  110 GLU B CB   1  
ATOM   4131   C  CG   . GLU B  2 56  ? -55.849 9.167   -13.304 1.00 0.00 ?  110 GLU B CG   1  
ATOM   4132   C  CD   . GLU B  2 56  ? -57.341 8.849   -13.152 1.00 0.00 ?  110 GLU B CD   1  
ATOM   4133   O  OE1  . GLU B  2 56  ? -58.077 9.000   -14.184 1.00 0.00 ?  110 GLU B OE1  1  
ATOM   4134   O  OE2  . GLU B  2 56  ? -57.801 8.556   -12.033 1.00 0.00 -1 110 GLU B OE2  1  
ATOM   4135   H  H    . GLU B  2 56  ? -53.324 8.187   -12.102 1.00 0.00 ?  110 GLU B H    1  
ATOM   4136   H  HA   . GLU B  2 56  ? -53.674 10.717  -13.217 1.00 0.00 ?  110 GLU B HA   1  
ATOM   4137   H  HB2  . GLU B  2 56  ? -55.349 9.144   -11.262 1.00 0.00 ?  110 GLU B HB2  1  
ATOM   4138   H  HB3  . GLU B  2 56  ? -55.712 10.805  -11.800 1.00 0.00 ?  110 GLU B HB3  1  
ATOM   4139   H  HG2  . GLU B  2 56  ? -55.811 9.899   -14.138 1.00 0.00 ?  110 GLU B HG2  1  
ATOM   4140   H  HG3  . GLU B  2 56  ? -55.324 8.241   -13.625 1.00 0.00 ?  110 GLU B HG3  1  
ATOM   4141   N  N    . GLU B  2 57  ? -53.299 10.743  -9.965  1.00 0.00 ?  111 GLU B N    1  
ATOM   4142   C  CA   . GLU B  2 57  ? -52.787 11.548  -8.838  1.00 0.00 ?  111 GLU B CA   1  
ATOM   4143   C  C    . GLU B  2 57  ? -51.406 12.175  -9.100  1.00 0.00 ?  111 GLU B C    1  
ATOM   4144   O  O    . GLU B  2 57  ? -51.209 13.380  -9.009  1.00 0.00 ?  111 GLU B O    1  
ATOM   4145   C  CB   . GLU B  2 57  ? -52.761 10.655  -7.543  1.00 0.00 ?  111 GLU B CB   1  
ATOM   4146   C  CG   . GLU B  2 57  ? -54.172 10.608  -6.806  1.00 0.00 ?  111 GLU B CG   1  
ATOM   4147   C  CD   . GLU B  2 57  ? -54.694 11.980  -6.226  1.00 0.00 ?  111 GLU B CD   1  
ATOM   4148   O  OE1  . GLU B  2 57  ? -55.920 12.064  -6.095  1.00 0.00 ?  111 GLU B OE1  1  
ATOM   4149   O  OE2  . GLU B  2 57  ? -53.844 12.785  -5.761  1.00 0.00 -1 111 GLU B OE2  1  
ATOM   4150   H  H    . GLU B  2 57  ? -53.383 9.765   -9.791  1.00 0.00 ?  111 GLU B H    1  
ATOM   4151   H  HA   . GLU B  2 57  ? -53.421 12.415  -8.729  1.00 0.00 ?  111 GLU B HA   1  
ATOM   4152   H  HB2  . GLU B  2 57  ? -52.337 9.643   -7.720  1.00 0.00 ?  111 GLU B HB2  1  
ATOM   4153   H  HB3  . GLU B  2 57  ? -52.119 11.091  -6.748  1.00 0.00 ?  111 GLU B HB3  1  
ATOM   4154   H  HG2  . GLU B  2 57  ? -54.904 10.183  -7.526  1.00 0.00 ?  111 GLU B HG2  1  
ATOM   4155   H  HG3  . GLU B  2 57  ? -54.274 9.966   -5.905  1.00 0.00 ?  111 GLU B HG3  1  
ATOM   4156   N  N    . MET B  2 58  ? -50.376 11.419  -9.622  1.00 0.00 ?  112 MET B N    1  
ATOM   4157   C  CA   . MET B  2 58  ? -49.170 12.010  -10.121 1.00 0.00 ?  112 MET B CA   1  
ATOM   4158   C  C    . MET B  2 58  ? -49.342 13.012  -11.268 1.00 0.00 ?  112 MET B C    1  
ATOM   4159   O  O    . MET B  2 58  ? -48.652 13.999  -11.259 1.00 0.00 ?  112 MET B O    1  
ATOM   4160   C  CB   . MET B  2 58  ? -48.172 10.816  -10.545 1.00 0.00 ?  112 MET B CB   1  
ATOM   4161   C  CG   . MET B  2 58  ? -47.666 10.115  -9.272  1.00 0.00 ?  112 MET B CG   1  
ATOM   4162   S  SD   . MET B  2 58  ? -46.757 11.298  -8.256  1.00 0.00 ?  112 MET B SD   1  
ATOM   4163   C  CE   . MET B  2 58  ? -47.946 11.386  -6.913  1.00 0.00 ?  112 MET B CE   1  
ATOM   4164   H  H    . MET B  2 58  ? -50.481 10.428  -9.640  1.00 0.00 ?  112 MET B H    1  
ATOM   4165   H  HA   . MET B  2 58  ? -48.726 12.616  -9.345  1.00 0.00 ?  112 MET B HA   1  
ATOM   4166   H  HB2  . MET B  2 58  ? -48.713 10.093  -11.192 1.00 0.00 ?  112 MET B HB2  1  
ATOM   4167   H  HB3  . MET B  2 58  ? -47.256 11.149  -11.078 1.00 0.00 ?  112 MET B HB3  1  
ATOM   4168   H  HG2  . MET B  2 58  ? -48.542 9.699   -8.729  1.00 0.00 ?  112 MET B HG2  1  
ATOM   4169   H  HG3  . MET B  2 58  ? -47.051 9.224   -9.524  1.00 0.00 ?  112 MET B HG3  1  
ATOM   4170   H  HE1  . MET B  2 58  ? -47.487 12.031  -6.133  1.00 0.00 ?  112 MET B HE1  1  
ATOM   4171   H  HE2  . MET B  2 58  ? -48.087 10.348  -6.542  1.00 0.00 ?  112 MET B HE2  1  
ATOM   4172   H  HE3  . MET B  2 58  ? -48.954 11.711  -7.248  1.00 0.00 ?  112 MET B HE3  1  
ATOM   4173   N  N    . GLU B  2 59  ? -50.250 12.777  -12.205 1.00 0.00 ?  113 GLU B N    1  
ATOM   4174   C  CA   . GLU B  2 59  ? -50.557 13.746  -13.298 1.00 0.00 ?  113 GLU B CA   1  
ATOM   4175   C  C    . GLU B  2 59  ? -51.040 15.124  -12.791 1.00 0.00 ?  113 GLU B C    1  
ATOM   4176   O  O    . GLU B  2 59  ? -50.592 16.171  -13.189 1.00 0.00 ?  113 GLU B O    1  
ATOM   4177   C  CB   . GLU B  2 59  ? -51.431 13.227  -14.422 1.00 0.00 ?  113 GLU B CB   1  
ATOM   4178   C  CG   . GLU B  2 59  ? -52.257 14.214  -15.248 1.00 0.00 ?  113 GLU B CG   1  
ATOM   4179   C  CD   . GLU B  2 59  ? -53.187 13.390  -16.079 1.00 0.00 ?  113 GLU B CD   1  
ATOM   4180   O  OE1  . GLU B  2 59  ? -53.156 13.498  -17.315 1.00 0.00 ?  113 GLU B OE1  1  
ATOM   4181   O  OE2  . GLU B  2 59  ? -54.082 12.717  -15.452 1.00 0.00 -1 113 GLU B OE2  1  
ATOM   4182   H  H    . GLU B  2 59  ? -50.647 11.863  -12.206 1.00 0.00 ?  113 GLU B H    1  
ATOM   4183   H  HA   . GLU B  2 59  ? -49.649 14.054  -13.795 1.00 0.00 ?  113 GLU B HA   1  
ATOM   4184   H  HB2  . GLU B  2 59  ? -50.648 12.737  -15.040 1.00 0.00 ?  113 GLU B HB2  1  
ATOM   4185   H  HB3  . GLU B  2 59  ? -52.097 12.541  -13.856 1.00 0.00 ?  113 GLU B HB3  1  
ATOM   4186   H  HG2  . GLU B  2 59  ? -52.866 14.835  -14.556 1.00 0.00 ?  113 GLU B HG2  1  
ATOM   4187   H  HG3  . GLU B  2 59  ? -51.637 14.856  -15.910 1.00 0.00 ?  113 GLU B HG3  1  
ATOM   4188   N  N    . LEU B  2 60  ? -51.987 15.092  -11.816 1.00 0.00 ?  114 LEU B N    1  
ATOM   4189   C  CA   . LEU B  2 60  ? -52.441 16.213  -10.900 1.00 0.00 ?  114 LEU B CA   1  
ATOM   4190   C  C    . LEU B  2 60  ? -51.436 16.781  -9.966  1.00 0.00 ?  114 LEU B C    1  
ATOM   4191   O  O    . LEU B  2 60  ? -51.370 17.960  -9.830  1.00 0.00 ?  114 LEU B O    1  
ATOM   4192   C  CB   . LEU B  2 60  ? -53.692 15.757  -10.084 1.00 0.00 ?  114 LEU B CB   1  
ATOM   4193   C  CG   . LEU B  2 60  ? -54.307 16.736  -9.094  1.00 0.00 ?  114 LEU B CG   1  
ATOM   4194   C  CD1  . LEU B  2 60  ? -54.743 17.999  -9.802  1.00 0.00 ?  114 LEU B CD1  1  
ATOM   4195   C  CD2  . LEU B  2 60  ? -55.592 16.181  -8.399  1.00 0.00 ?  114 LEU B CD2  1  
ATOM   4196   H  H    . LEU B  2 60  ? -52.502 14.255  -11.644 1.00 0.00 ?  114 LEU B H    1  
ATOM   4197   H  HA   . LEU B  2 60  ? -52.632 17.050  -11.554 1.00 0.00 ?  114 LEU B HA   1  
ATOM   4198   H  HB2  . LEU B  2 60  ? -54.458 15.553  -10.862 1.00 0.00 ?  114 LEU B HB2  1  
ATOM   4199   H  HB3  . LEU B  2 60  ? -53.602 14.781  -9.561  1.00 0.00 ?  114 LEU B HB3  1  
ATOM   4200   H  HG   . LEU B  2 60  ? -53.607 17.036  -8.285  1.00 0.00 ?  114 LEU B HG   1  
ATOM   4201   H  HD11 . LEU B  2 60  ? -55.144 18.699  -9.039  1.00 0.00 ?  114 LEU B HD11 1  
ATOM   4202   H  HD12 . LEU B  2 60  ? -55.395 17.883  -10.694 1.00 0.00 ?  114 LEU B HD12 1  
ATOM   4203   H  HD13 . LEU B  2 60  ? -53.783 18.423  -10.169 1.00 0.00 ?  114 LEU B HD13 1  
ATOM   4204   H  HD21 . LEU B  2 60  ? -55.285 15.265  -7.851  1.00 0.00 ?  114 LEU B HD21 1  
ATOM   4205   H  HD22 . LEU B  2 60  ? -56.222 15.705  -9.181  1.00 0.00 ?  114 LEU B HD22 1  
ATOM   4206   H  HD23 . LEU B  2 60  ? -56.059 16.925  -7.718  1.00 0.00 ?  114 LEU B HD23 1  
ATOM   4207   N  N    . TYR B  2 61  ? -50.551 16.028  -9.330  1.00 0.00 ?  115 TYR B N    1  
ATOM   4208   C  CA   . TYR B  2 61  ? -49.528 16.612  -8.450  1.00 0.00 ?  115 TYR B CA   1  
ATOM   4209   C  C    . TYR B  2 61  ? -48.577 17.548  -9.315  1.00 0.00 ?  115 TYR B C    1  
ATOM   4210   O  O    . TYR B  2 61  ? -48.232 18.694  -8.960  1.00 0.00 ?  115 TYR B O    1  
ATOM   4211   C  CB   . TYR B  2 61  ? -48.825 15.465  -7.827  1.00 0.00 ?  115 TYR B CB   1  
ATOM   4212   C  CG   . TYR B  2 61  ? -47.693 15.752  -6.915  1.00 0.00 ?  115 TYR B CG   1  
ATOM   4213   C  CD1  . TYR B  2 61  ? -46.413 15.168  -7.170  1.00 0.00 ?  115 TYR B CD1  1  
ATOM   4214   C  CD2  . TYR B  2 61  ? -47.830 16.525  -5.784  1.00 0.00 ?  115 TYR B CD2  1  
ATOM   4215   C  CE1  . TYR B  2 61  ? -45.312 15.453  -6.332  1.00 0.00 ?  115 TYR B CE1  1  
ATOM   4216   C  CE2  . TYR B  2 61  ? -46.779 16.762  -4.849  1.00 0.00 ?  115 TYR B CE2  1  
ATOM   4217   C  CZ   . TYR B  2 61  ? -45.518 16.216  -5.166  1.00 0.00 ?  115 TYR B CZ   1  
ATOM   4218   O  OH   . TYR B  2 61  ? -44.402 16.565  -4.351  1.00 0.00 ?  115 TYR B OH   1  
ATOM   4219   H  H    . TYR B  2 61  ? -50.548 15.034  -9.265  1.00 0.00 ?  115 TYR B H    1  
ATOM   4220   H  HA   . TYR B  2 61  ? -49.898 17.317  -7.720  1.00 0.00 ?  115 TYR B HA   1  
ATOM   4221   H  HB2  . TYR B  2 61  ? -49.463 15.026  -7.031  1.00 0.00 ?  115 TYR B HB2  1  
ATOM   4222   H  HB3  . TYR B  2 61  ? -48.498 14.691  -8.553  1.00 0.00 ?  115 TYR B HB3  1  
ATOM   4223   H  HD1  . TYR B  2 61  ? -46.222 14.591  -8.063  1.00 0.00 ?  115 TYR B HD1  1  
ATOM   4224   H  HD2  . TYR B  2 61  ? -48.768 17.034  -5.622  1.00 0.00 ?  115 TYR B HD2  1  
ATOM   4225   H  HE1  . TYR B  2 61  ? -44.322 15.096  -6.574  1.00 0.00 ?  115 TYR B HE1  1  
ATOM   4226   H  HE2  . TYR B  2 61  ? -46.939 17.398  -3.990  1.00 0.00 ?  115 TYR B HE2  1  
ATOM   4227   H  HH   . TYR B  2 61  ? -44.704 17.195  -3.693  1.00 0.00 ?  115 TYR B HH   1  
ATOM   4228   N  N    . ARG B  2 62  ? -48.065 17.027  -10.491 1.00 0.00 ?  116 ARG B N    1  
ATOM   4229   C  CA   . ARG B  2 62  ? -47.352 17.909  -11.425 1.00 0.00 ?  116 ARG B CA   1  
ATOM   4230   C  C    . ARG B  2 62  ? -48.099 19.147  -11.980 1.00 0.00 ?  116 ARG B C    1  
ATOM   4231   O  O    . ARG B  2 62  ? -47.536 20.204  -12.186 1.00 0.00 ?  116 ARG B O    1  
ATOM   4232   C  CB   . ARG B  2 62  ? -46.575 17.143  -12.539 1.00 0.00 ?  116 ARG B CB   1  
ATOM   4233   C  CG   . ARG B  2 62  ? -47.233 16.296  -13.621 1.00 0.00 ?  116 ARG B CG   1  
ATOM   4234   C  CD   . ARG B  2 62  ? -47.673 17.184  -14.820 1.00 0.00 ?  116 ARG B CD   1  
ATOM   4235   N  NE   . ARG B  2 62  ? -48.203 16.409  -15.996 1.00 0.00 ?  116 ARG B NE   1  
ATOM   4236   C  CZ   . ARG B  2 62  ? -47.349 15.666  -16.653 1.00 0.00 ?  116 ARG B CZ   1  
ATOM   4237   N  NH1  . ARG B  2 62  ? -48.010 14.788  -17.427 1.00 0.00 1  116 ARG B NH1  1  
ATOM   4238   N  NH2  . ARG B  2 62  ? -46.045 15.709  -16.604 1.00 0.00 ?  116 ARG B NH2  1  
ATOM   4239   H  H    . ARG B  2 62  ? -48.371 16.132  -10.803 1.00 0.00 ?  116 ARG B H    1  
ATOM   4240   H  HA   . ARG B  2 62  ? -46.488 18.270  -10.886 1.00 0.00 ?  116 ARG B HA   1  
ATOM   4241   H  HB2  . ARG B  2 62  ? -45.926 17.929  -12.982 1.00 0.00 ?  116 ARG B HB2  1  
ATOM   4242   H  HB3  . ARG B  2 62  ? -45.909 16.444  -11.989 1.00 0.00 ?  116 ARG B HB3  1  
ATOM   4243   H  HG2  . ARG B  2 62  ? -46.416 15.664  -14.032 1.00 0.00 ?  116 ARG B HG2  1  
ATOM   4244   H  HG3  . ARG B  2 62  ? -48.034 15.614  -13.263 1.00 0.00 ?  116 ARG B HG3  1  
ATOM   4245   H  HD2  . ARG B  2 62  ? -48.513 17.759  -14.374 1.00 0.00 ?  116 ARG B HD2  1  
ATOM   4246   H  HD3  . ARG B  2 62  ? -46.923 17.934  -15.150 1.00 0.00 ?  116 ARG B HD3  1  
ATOM   4247   H  HE   . ARG B  2 62  ? -49.161 16.412  -16.284 1.00 0.00 ?  116 ARG B HE   1  
ATOM   4248   H  HH11 . ARG B  2 62  ? -49.002 14.677  -17.477 1.00 0.00 ?  116 ARG B HH11 1  
ATOM   4249   H  HH12 . ARG B  2 62  ? -47.506 14.242  -18.096 1.00 0.00 ?  116 ARG B HH12 1  
ATOM   4250   H  HH21 . ARG B  2 62  ? -45.572 16.378  -16.031 1.00 0.00 ?  116 ARG B HH21 1  
ATOM   4251   H  HH22 . ARG B  2 62  ? -45.432 15.129  -17.140 1.00 0.00 ?  116 ARG B HH22 1  
ATOM   4252   N  N    . GLN B  2 63  ? -49.461 19.082  -12.177 1.00 0.00 ?  117 GLN B N    1  
ATOM   4253   C  CA   . GLN B  2 63  ? -50.275 20.265  -12.493 1.00 0.00 ?  117 GLN B CA   1  
ATOM   4254   C  C    . GLN B  2 63  ? -50.552 21.193  -11.313 1.00 0.00 ?  117 GLN B C    1  
ATOM   4255   O  O    . GLN B  2 63  ? -50.500 22.411  -11.432 1.00 0.00 ?  117 GLN B O    1  
ATOM   4256   C  CB   . GLN B  2 63  ? -51.589 19.868  -13.033 1.00 0.00 ?  117 GLN B CB   1  
ATOM   4257   C  CG   . GLN B  2 63  ? -51.414 19.450  -14.591 1.00 0.00 ?  117 GLN B CG   1  
ATOM   4258   C  CD   . GLN B  2 63  ? -52.555 18.673  -15.256 1.00 0.00 ?  117 GLN B CD   1  
ATOM   4259   O  OE1  . GLN B  2 63  ? -53.218 19.178  -16.151 1.00 0.00 ?  117 GLN B OE1  1  
ATOM   4260   N  NE2  . GLN B  2 63  ? -52.871 17.557  -14.666 1.00 0.00 ?  117 GLN B NE2  1  
ATOM   4261   H  H    . GLN B  2 63  ? -49.896 18.207  -11.980 1.00 0.00 ?  117 GLN B H    1  
ATOM   4262   H  HA   . GLN B  2 63  ? -49.731 20.869  -13.205 1.00 0.00 ?  117 GLN B HA   1  
ATOM   4263   H  HB2  . GLN B  2 63  ? -52.084 19.071  -12.439 1.00 0.00 ?  117 GLN B HB2  1  
ATOM   4264   H  HB3  . GLN B  2 63  ? -52.277 20.740  -12.996 1.00 0.00 ?  117 GLN B HB3  1  
ATOM   4265   H  HG2  . GLN B  2 63  ? -51.191 20.351  -15.201 1.00 0.00 ?  117 GLN B HG2  1  
ATOM   4266   H  HG3  . GLN B  2 63  ? -50.526 18.803  -14.749 1.00 0.00 ?  117 GLN B HG3  1  
ATOM   4267   H  HE21 . GLN B  2 63  ? -53.699 17.088  -14.973 1.00 0.00 ?  117 GLN B HE21 1  
ATOM   4268   H  HE22 . GLN B  2 63  ? -52.224 17.027  -14.116 1.00 0.00 ?  117 GLN B HE22 1  
ATOM   4269   N  N    . LYS B  2 64  ? -50.714 20.653  -10.105 1.00 0.00 ?  118 LYS B N    1  
ATOM   4270   C  CA   . LYS B  2 64  ? -50.619 21.357  -8.867  1.00 0.00 ?  118 LYS B CA   1  
ATOM   4271   C  C    . LYS B  2 64  ? -49.308 22.149  -8.743  1.00 0.00 ?  118 LYS B C    1  
ATOM   4272   O  O    . LYS B  2 64  ? -49.298 23.330  -8.383  1.00 0.00 ?  118 LYS B O    1  
ATOM   4273   C  CB   . LYS B  2 64  ? -50.967 20.381  -7.689  1.00 0.00 ?  118 LYS B CB   1  
ATOM   4274   C  CG   . LYS B  2 64  ? -51.170 21.146  -6.438  1.00 0.00 ?  118 LYS B CG   1  
ATOM   4275   C  CD   . LYS B  2 64  ? -52.265 22.222  -6.469  1.00 0.00 ?  118 LYS B CD   1  
ATOM   4276   C  CE   . LYS B  2 64  ? -52.711 22.658  -5.069  1.00 0.00 ?  118 LYS B CE   1  
ATOM   4277   N  NZ   . LYS B  2 64  ? -51.854 23.616  -4.436  1.00 0.00 1  118 LYS B NZ   1  
ATOM   4278   H  H    . LYS B  2 64  ? -50.706 19.665  -9.972  1.00 0.00 ?  118 LYS B H    1  
ATOM   4279   H  HA   . LYS B  2 64  ? -51.336 22.163  -8.912  1.00 0.00 ?  118 LYS B HA   1  
ATOM   4280   H  HB2  . LYS B  2 64  ? -51.847 19.743  -7.919  1.00 0.00 ?  118 LYS B HB2  1  
ATOM   4281   H  HB3  . LYS B  2 64  ? -50.111 19.705  -7.476  1.00 0.00 ?  118 LYS B HB3  1  
ATOM   4282   H  HG2  . LYS B  2 64  ? -51.580 20.412  -5.711  1.00 0.00 ?  118 LYS B HG2  1  
ATOM   4283   H  HG3  . LYS B  2 64  ? -50.192 21.555  -6.106  1.00 0.00 ?  118 LYS B HG3  1  
ATOM   4284   H  HD2  . LYS B  2 64  ? -51.968 23.012  -7.191  1.00 0.00 ?  118 LYS B HD2  1  
ATOM   4285   H  HD3  . LYS B  2 64  ? -53.216 21.804  -6.865  1.00 0.00 ?  118 LYS B HD3  1  
ATOM   4286   H  HE2  . LYS B  2 64  ? -53.675 23.200  -5.175  1.00 0.00 ?  118 LYS B HE2  1  
ATOM   4287   H  HE3  . LYS B  2 64  ? -52.969 21.799  -4.413  1.00 0.00 ?  118 LYS B HE3  1  
ATOM   4288   H  HZ1  . LYS B  2 64  ? -50.906 23.616  -4.863  1.00 0.00 ?  118 LYS B HZ1  1  
ATOM   4289   H  HZ2  . LYS B  2 64  ? -51.828 23.351  -3.431  1.00 0.00 ?  118 LYS B HZ2  1  
ATOM   4290   H  HZ3  . LYS B  2 64  ? -52.245 24.579  -4.471  1.00 0.00 ?  118 LYS B HZ3  1  
ATOM   4291   N  N    . VAL B  2 65  ? -48.244 21.545  -9.077  1.00 0.00 ?  119 VAL B N    1  
ATOM   4292   C  CA   . VAL B  2 65  ? -46.954 22.117  -8.959  1.00 0.00 ?  119 VAL B CA   1  
ATOM   4293   C  C    . VAL B  2 65  ? -46.379 23.070  -10.070 1.00 0.00 ?  119 VAL B C    1  
ATOM   4294   O  O    . VAL B  2 65  ? -45.814 24.106  -9.795  1.00 0.00 ?  119 VAL B O    1  
ATOM   4295   C  CB   . VAL B  2 65  ? -45.914 21.004  -8.713  1.00 0.00 ?  119 VAL B CB   1  
ATOM   4296   C  CG1  . VAL B  2 65  ? -44.479 21.540  -8.768  1.00 0.00 ?  119 VAL B CG1  1  
ATOM   4297   C  CG2  . VAL B  2 65  ? -46.200 20.364  -7.325  1.00 0.00 ?  119 VAL B CG2  1  
ATOM   4298   H  H    . VAL B  2 65  ? -48.299 20.568  -9.266  1.00 0.00 ?  119 VAL B H    1  
ATOM   4299   H  HA   . VAL B  2 65  ? -47.006 22.716  -8.062  1.00 0.00 ?  119 VAL B HA   1  
ATOM   4300   H  HB   . VAL B  2 65  ? -46.059 20.307  -9.566  1.00 0.00 ?  119 VAL B HB   1  
ATOM   4301   H  HG11 . VAL B  2 65  ? -44.245 21.650  -9.849  1.00 0.00 ?  119 VAL B HG11 1  
ATOM   4302   H  HG12 . VAL B  2 65  ? -43.797 20.819  -8.269  1.00 0.00 ?  119 VAL B HG12 1  
ATOM   4303   H  HG13 . VAL B  2 65  ? -44.332 22.573  -8.388  1.00 0.00 ?  119 VAL B HG13 1  
ATOM   4304   H  HG21 . VAL B  2 65  ? -47.267 20.140  -7.113  1.00 0.00 ?  119 VAL B HG21 1  
ATOM   4305   H  HG22 . VAL B  2 65  ? -45.781 21.030  -6.541  1.00 0.00 ?  119 VAL B HG22 1  
ATOM   4306   H  HG23 . VAL B  2 65  ? -45.642 19.404  -7.323  1.00 0.00 ?  119 VAL B HG23 1  
ATOM   4307   N  N    . GLU B  2 66  ? -46.450 22.695  -11.410 1.00 0.00 ?  120 GLU B N    1  
ATOM   4308   C  CA   . GLU B  2 66  ? -45.643 23.387  -12.347 1.00 0.00 ?  120 GLU B CA   1  
ATOM   4309   C  C    . GLU B  2 66  ? -46.031 24.891  -12.486 1.00 0.00 ?  120 GLU B C    1  
ATOM   4310   O  O    . GLU B  2 66  ? -45.094 25.741  -12.613 1.00 0.00 ?  120 GLU B O    1  
ATOM   4311   C  CB   . GLU B  2 66  ? -45.627 22.637  -13.636 1.00 0.00 ?  120 GLU B CB   1  
ATOM   4312   C  CG   . GLU B  2 66  ? -44.620 21.453  -13.527 1.00 0.00 ?  120 GLU B CG   1  
ATOM   4313   C  CD   . GLU B  2 66  ? -44.593 20.774  -14.893 1.00 0.00 ?  120 GLU B CD   1  
ATOM   4314   O  OE1  . GLU B  2 66  ? -43.613 21.072  -15.618 1.00 0.00 ?  120 GLU B OE1  1  
ATOM   4315   O  OE2  . GLU B  2 66  ? -45.463 20.024  -15.326 1.00 0.00 -1 120 GLU B OE2  1  
ATOM   4316   H  H    . GLU B  2 66  ? -46.968 21.956  -11.833 1.00 0.00 ?  120 GLU B H    1  
ATOM   4317   H  HA   . GLU B  2 66  ? -44.614 23.344  -12.022 1.00 0.00 ?  120 GLU B HA   1  
ATOM   4318   H  HB2  . GLU B  2 66  ? -46.641 22.358  -13.994 1.00 0.00 ?  120 GLU B HB2  1  
ATOM   4319   H  HB3  . GLU B  2 66  ? -45.291 23.305  -14.457 1.00 0.00 ?  120 GLU B HB3  1  
ATOM   4320   H  HG2  . GLU B  2 66  ? -43.605 21.841  -13.294 1.00 0.00 ?  120 GLU B HG2  1  
ATOM   4321   H  HG3  . GLU B  2 66  ? -44.903 20.784  -12.687 1.00 0.00 ?  120 GLU B HG3  1  
ATOM   4322   N  N    . PRO B  2 67  ? -47.244 25.482  -12.477 1.00 0.00 ?  121 PRO B N    1  
ATOM   4323   C  CA   . PRO B  2 67  ? -47.447 26.911  -12.599 1.00 0.00 ?  121 PRO B CA   1  
ATOM   4324   C  C    . PRO B  2 67  ? -46.875 27.749  -11.512 1.00 0.00 ?  121 PRO B C    1  
ATOM   4325   O  O    . PRO B  2 67  ? -46.488 28.908  -11.799 1.00 0.00 ?  121 PRO B O    1  
ATOM   4326   C  CB   . PRO B  2 67  ? -48.982 27.093  -12.610 1.00 0.00 ?  121 PRO B CB   1  
ATOM   4327   C  CG   . PRO B  2 67  ? -49.391 25.787  -13.317 1.00 0.00 ?  121 PRO B CG   1  
ATOM   4328   C  CD   . PRO B  2 67  ? -48.475 24.746  -12.797 1.00 0.00 ?  121 PRO B CD   1  
ATOM   4329   H  HA   . PRO B  2 67  ? -46.947 27.234  -13.500 1.00 0.00 ?  121 PRO B HA   1  
ATOM   4330   H  HB2  . PRO B  2 67  ? -49.545 27.196  -11.658 1.00 0.00 ?  121 PRO B HB2  1  
ATOM   4331   H  HB3  . PRO B  2 67  ? -49.318 27.973  -13.199 1.00 0.00 ?  121 PRO B HB3  1  
ATOM   4332   H  HG2  . PRO B  2 67  ? -50.468 25.519  -13.269 1.00 0.00 ?  121 PRO B HG2  1  
ATOM   4333   H  HG3  . PRO B  2 67  ? -49.260 25.832  -14.420 1.00 0.00 ?  121 PRO B HG3  1  
ATOM   4334   H  HD2  . PRO B  2 67  ? -48.909 24.149  -11.967 1.00 0.00 ?  121 PRO B HD2  1  
ATOM   4335   H  HD3  . PRO B  2 67  ? -48.353 23.998  -13.610 1.00 0.00 ?  121 PRO B HD3  1  
ATOM   4336   N  N    . TYR B  2 68  ? -46.817 27.107  -10.288 1.00 0.00 ?  122 TYR B N    1  
ATOM   4337   C  CA   . TYR B  2 68  ? -46.278 27.621  -9.039  1.00 0.00 ?  122 TYR B CA   1  
ATOM   4338   C  C    . TYR B  2 68  ? -44.785 27.767  -9.064  1.00 0.00 ?  122 TYR B C    1  
ATOM   4339   O  O    . TYR B  2 68  ? -44.261 28.762  -8.581  1.00 0.00 ?  122 TYR B O    1  
ATOM   4340   C  CB   . TYR B  2 68  ? -46.726 26.683  -7.885  1.00 0.00 ?  122 TYR B CB   1  
ATOM   4341   C  CG   . TYR B  2 68  ? -46.539 27.205  -6.451  1.00 0.00 ?  122 TYR B CG   1  
ATOM   4342   C  CD1  . TYR B  2 68  ? -46.035 26.329  -5.472  1.00 0.00 ?  122 TYR B CD1  1  
ATOM   4343   C  CD2  . TYR B  2 68  ? -46.706 28.545  -6.174  1.00 0.00 ?  122 TYR B CD2  1  
ATOM   4344   C  CE1  . TYR B  2 68  ? -45.775 26.787  -4.172  1.00 0.00 ?  122 TYR B CE1  1  
ATOM   4345   C  CE2  . TYR B  2 68  ? -46.574 28.921  -4.817  1.00 0.00 ?  122 TYR B CE2  1  
ATOM   4346   C  CZ   . TYR B  2 68  ? -46.088 28.073  -3.815  1.00 0.00 ?  122 TYR B CZ   1  
ATOM   4347   O  OH   . TYR B  2 68  ? -46.054 28.429  -2.487  1.00 0.00 ?  122 TYR B OH   1  
ATOM   4348   H  H    . TYR B  2 68  ? -47.164 26.191  -10.101 1.00 0.00 ?  122 TYR B H    1  
ATOM   4349   H  HA   . TYR B  2 68  ? -46.712 28.594  -8.862  1.00 0.00 ?  122 TYR B HA   1  
ATOM   4350   H  HB2  . TYR B  2 68  ? -47.776 26.349  -8.028  1.00 0.00 ?  122 TYR B HB2  1  
ATOM   4351   H  HB3  . TYR B  2 68  ? -46.191 25.712  -7.946  1.00 0.00 ?  122 TYR B HB3  1  
ATOM   4352   H  HD1  . TYR B  2 68  ? -45.904 25.296  -5.759  1.00 0.00 ?  122 TYR B HD1  1  
ATOM   4353   H  HD2  . TYR B  2 68  ? -47.074 29.242  -6.912  1.00 0.00 ?  122 TYR B HD2  1  
ATOM   4354   H  HE1  . TYR B  2 68  ? -45.378 26.067  -3.473  1.00 0.00 ?  122 TYR B HE1  1  
ATOM   4355   H  HE2  . TYR B  2 68  ? -46.839 29.954  -4.643  1.00 0.00 ?  122 TYR B HE2  1  
ATOM   4356   H  HH   . TYR B  2 68  ? -46.495 29.280  -2.543  1.00 0.00 ?  122 TYR B HH   1  
ATOM   4357   N  N    . LEU B  2 69  ? -44.054 26.771  -9.712  1.00 0.00 ?  123 LEU B N    1  
ATOM   4358   C  CA   . LEU B  2 69  ? -42.583 26.707  -9.887  1.00 0.00 ?  123 LEU B CA   1  
ATOM   4359   C  C    . LEU B  2 69  ? -42.188 27.915  -10.749 1.00 0.00 ?  123 LEU B C    1  
ATOM   4360   O  O    . LEU B  2 69  ? -41.384 28.773  -10.390 1.00 0.00 ?  123 LEU B O    1  
ATOM   4361   C  CB   . LEU B  2 69  ? -42.115 25.387  -10.600 1.00 0.00 ?  123 LEU B CB   1  
ATOM   4362   C  CG   . LEU B  2 69  ? -42.462 24.089  -9.853  1.00 0.00 ?  123 LEU B CG   1  
ATOM   4363   C  CD1  . LEU B  2 69  ? -41.880 22.840  -10.522 1.00 0.00 ?  123 LEU B CD1  1  
ATOM   4364   C  CD2  . LEU B  2 69  ? -41.993 24.119  -8.360  1.00 0.00 ?  123 LEU B CD2  1  
ATOM   4365   H  H    . LEU B  2 69  ? -44.628 25.991  -9.950  1.00 0.00 ?  123 LEU B H    1  
ATOM   4366   H  HA   . LEU B  2 69  ? -42.164 26.972  -8.928  1.00 0.00 ?  123 LEU B HA   1  
ATOM   4367   H  HB2  . LEU B  2 69  ? -42.548 25.256  -11.614 1.00 0.00 ?  123 LEU B HB2  1  
ATOM   4368   H  HB3  . LEU B  2 69  ? -41.005 25.436  -10.611 1.00 0.00 ?  123 LEU B HB3  1  
ATOM   4369   H  HG   . LEU B  2 69  ? -43.567 23.994  -9.790  1.00 0.00 ?  123 LEU B HG   1  
ATOM   4370   H  HD11 . LEU B  2 69  ? -42.025 21.941  -9.885  1.00 0.00 ?  123 LEU B HD11 1  
ATOM   4371   H  HD12 . LEU B  2 69  ? -40.797 22.937  -10.749 1.00 0.00 ?  123 LEU B HD12 1  
ATOM   4372   H  HD13 . LEU B  2 69  ? -42.347 22.655  -11.513 1.00 0.00 ?  123 LEU B HD13 1  
ATOM   4373   H  HD21 . LEU B  2 69  ? -40.967 24.530  -8.245  1.00 0.00 ?  123 LEU B HD21 1  
ATOM   4374   H  HD22 . LEU B  2 69  ? -42.056 23.096  -7.931  1.00 0.00 ?  123 LEU B HD22 1  
ATOM   4375   H  HD23 . LEU B  2 69  ? -42.642 24.824  -7.798  1.00 0.00 ?  123 LEU B HD23 1  
ATOM   4376   N  N    . ASP B  2 70  ? -42.950 28.098  -11.883 1.00 0.00 ?  124 ASP B N    1  
ATOM   4377   C  CA   . ASP B  2 70  ? -42.818 29.352  -12.667 1.00 0.00 ?  124 ASP B CA   1  
ATOM   4378   C  C    . ASP B  2 70  ? -43.162 30.670  -11.953 1.00 0.00 ?  124 ASP B C    1  
ATOM   4379   O  O    . ASP B  2 70  ? -42.418 31.657  -12.094 1.00 0.00 ?  124 ASP B O    1  
ATOM   4380   C  CB   . ASP B  2 70  ? -43.650 29.177  -13.979 1.00 0.00 ?  124 ASP B CB   1  
ATOM   4381   C  CG   . ASP B  2 70  ? -42.986 28.101  -14.824 1.00 0.00 ?  124 ASP B CG   1  
ATOM   4382   O  OD1  . ASP B  2 70  ? -41.765 28.010  -14.744 1.00 0.00 ?  124 ASP B OD1  1  
ATOM   4383   O  OD2  . ASP B  2 70  ? -43.645 27.480  -15.678 1.00 0.00 -1 124 ASP B OD2  1  
ATOM   4384   H  H    . ASP B  2 70  ? -43.666 27.431  -12.074 1.00 0.00 ?  124 ASP B H    1  
ATOM   4385   H  HA   . ASP B  2 70  ? -41.741 29.416  -12.728 1.00 0.00 ?  124 ASP B HA   1  
ATOM   4386   H  HB2  . ASP B  2 70  ? -44.681 28.843  -13.734 1.00 0.00 ?  124 ASP B HB2  1  
ATOM   4387   H  HB3  . ASP B  2 70  ? -43.759 30.084  -14.611 1.00 0.00 ?  124 ASP B HB3  1  
ATOM   4388   N  N    . ASP B  2 71  ? -44.293 30.756  -11.153 1.00 0.00 ?  125 ASP B N    1  
ATOM   4389   C  CA   . ASP B  2 71  ? -44.698 31.915  -10.440 1.00 0.00 ?  125 ASP B CA   1  
ATOM   4390   C  C    . ASP B  2 71  ? -43.753 32.392  -9.339  1.00 0.00 ?  125 ASP B C    1  
ATOM   4391   O  O    . ASP B  2 71  ? -43.535 33.591  -9.185  1.00 0.00 ?  125 ASP B O    1  
ATOM   4392   C  CB   . ASP B  2 71  ? -46.083 31.585  -9.817  1.00 0.00 ?  125 ASP B CB   1  
ATOM   4393   C  CG   . ASP B  2 71  ? -46.854 32.837  -9.319  1.00 0.00 ?  125 ASP B CG   1  
ATOM   4394   O  OD1  . ASP B  2 71  ? -47.318 32.848  -8.218  1.00 0.00 ?  125 ASP B OD1  1  
ATOM   4395   O  OD2  . ASP B  2 71  ? -46.974 33.897  -10.062 1.00 0.00 -1 125 ASP B OD2  1  
ATOM   4396   H  H    . ASP B  2 71  ? -44.810 29.905  -11.103 1.00 0.00 ?  125 ASP B H    1  
ATOM   4397   H  HA   . ASP B  2 71  ? -44.730 32.770  -11.100 1.00 0.00 ?  125 ASP B HA   1  
ATOM   4398   H  HB2  . ASP B  2 71  ? -46.751 31.147  -10.590 1.00 0.00 ?  125 ASP B HB2  1  
ATOM   4399   H  HB3  . ASP B  2 71  ? -45.993 30.931  -8.924  1.00 0.00 ?  125 ASP B HB3  1  
ATOM   4400   N  N    . PHE B  2 72  ? -43.233 31.391  -8.585  1.00 0.00 ?  126 PHE B N    1  
ATOM   4401   C  CA   . PHE B  2 72  ? -42.143 31.533  -7.589  1.00 0.00 ?  126 PHE B CA   1  
ATOM   4402   C  C    . PHE B  2 72  ? -40.842 31.979  -8.202  1.00 0.00 ?  126 PHE B C    1  
ATOM   4403   O  O    . PHE B  2 72  ? -40.175 32.866  -7.701  1.00 0.00 ?  126 PHE B O    1  
ATOM   4404   C  CB   . PHE B  2 72  ? -42.043 30.214  -6.778  1.00 0.00 ?  126 PHE B CB   1  
ATOM   4405   C  CG   . PHE B  2 72  ? -40.889 30.330  -5.809  1.00 0.00 ?  126 PHE B CG   1  
ATOM   4406   C  CD1  . PHE B  2 72  ? -39.630 29.870  -6.209  1.00 0.00 ?  126 PHE B CD1  1  
ATOM   4407   C  CD2  . PHE B  2 72  ? -41.030 30.769  -4.470  1.00 0.00 ?  126 PHE B CD2  1  
ATOM   4408   C  CE1  . PHE B  2 72  ? -38.543 29.834  -5.345  1.00 0.00 ?  126 PHE B CE1  1  
ATOM   4409   C  CE2  . PHE B  2 72  ? -39.930 30.665  -3.586  1.00 0.00 ?  126 PHE B CE2  1  
ATOM   4410   C  CZ   . PHE B  2 72  ? -38.697 30.241  -4.053  1.00 0.00 ?  126 PHE B CZ   1  
ATOM   4411   H  H    . PHE B  2 72  ? -43.775 30.563  -8.706  1.00 0.00 ?  126 PHE B H    1  
ATOM   4412   H  HA   . PHE B  2 72  ? -42.443 32.380  -6.990  1.00 0.00 ?  126 PHE B HA   1  
ATOM   4413   H  HB2  . PHE B  2 72  ? -43.015 30.028  -6.273  1.00 0.00 ?  126 PHE B HB2  1  
ATOM   4414   H  HB3  . PHE B  2 72  ? -41.911 29.266  -7.343  1.00 0.00 ?  126 PHE B HB3  1  
ATOM   4415   H  HD1  . PHE B  2 72  ? -39.535 29.511  -7.223  1.00 0.00 ?  126 PHE B HD1  1  
ATOM   4416   H  HD2  . PHE B  2 72  ? -41.968 31.051  -4.015  1.00 0.00 ?  126 PHE B HD2  1  
ATOM   4417   H  HE1  . PHE B  2 72  ? -37.583 29.570  -5.764  1.00 0.00 ?  126 PHE B HE1  1  
ATOM   4418   H  HE2  . PHE B  2 72  ? -40.192 31.010  -2.597  1.00 0.00 ?  126 PHE B HE2  1  
ATOM   4419   H  HZ   . PHE B  2 72  ? -37.935 30.132  -3.294  1.00 0.00 ?  126 PHE B HZ   1  
ATOM   4420   N  N    . GLN B  2 73  ? -40.421 31.383  -9.371  1.00 0.00 ?  127 GLN B N    1  
ATOM   4421   C  CA   . GLN B  2 73  ? -39.203 31.819  -9.993  1.00 0.00 ?  127 GLN B CA   1  
ATOM   4422   C  C    . GLN B  2 73  ? -39.315 33.228  -10.531 1.00 0.00 ?  127 GLN B C    1  
ATOM   4423   O  O    . GLN B  2 73  ? -38.353 33.985  -10.502 1.00 0.00 ?  127 GLN B O    1  
ATOM   4424   C  CB   . GLN B  2 73  ? -38.867 30.830  -11.126 1.00 0.00 ?  127 GLN B CB   1  
ATOM   4425   C  CG   . GLN B  2 73  ? -37.491 31.173  -11.796 1.00 0.00 ?  127 GLN B CG   1  
ATOM   4426   C  CD   . GLN B  2 73  ? -37.291 30.298  -13.023 1.00 0.00 ?  127 GLN B CD   1  
ATOM   4427   O  OE1  . GLN B  2 73  ? -38.133 29.374  -13.190 1.00 0.00 ?  127 GLN B OE1  1  
ATOM   4428   N  NE2  . GLN B  2 73  ? -36.225 30.443  -13.773 1.00 0.00 ?  127 GLN B NE2  1  
ATOM   4429   H  H    . GLN B  2 73  ? -40.854 30.564  -9.740  1.00 0.00 ?  127 GLN B H    1  
ATOM   4430   H  HA   . GLN B  2 73  ? -38.415 31.824  -9.255  1.00 0.00 ?  127 GLN B HA   1  
ATOM   4431   H  HB2  . GLN B  2 73  ? -38.671 29.839  -10.665 1.00 0.00 ?  127 GLN B HB2  1  
ATOM   4432   H  HB3  . GLN B  2 73  ? -39.713 30.788  -11.846 1.00 0.00 ?  127 GLN B HB3  1  
ATOM   4433   H  HG2  . GLN B  2 73  ? -37.347 32.216  -12.151 1.00 0.00 ?  127 GLN B HG2  1  
ATOM   4434   H  HG3  . GLN B  2 73  ? -36.719 31.078  -11.004 1.00 0.00 ?  127 GLN B HG3  1  
ATOM   4435   H  HE21 . GLN B  2 73  ? -36.116 29.759  -14.494 1.00 0.00 ?  127 GLN B HE21 1  
ATOM   4436   H  HE22 . GLN B  2 73  ? -35.551 31.176  -13.681 1.00 0.00 ?  127 GLN B HE22 1  
ATOM   4437   N  N    . LYS B  2 74  ? -40.442 33.687  -11.108 1.00 0.00 ?  128 LYS B N    1  
ATOM   4438   C  CA   . LYS B  2 74  ? -40.632 35.091  -11.623 1.00 0.00 ?  128 LYS B CA   1  
ATOM   4439   C  C    . LYS B  2 74  ? -40.564 36.164  -10.550 1.00 0.00 ?  128 LYS B C    1  
ATOM   4440   O  O    . LYS B  2 74  ? -40.019 37.292  -10.748 1.00 0.00 ?  128 LYS B O    1  
ATOM   4441   C  CB   . LYS B  2 74  ? -42.028 35.044  -12.436 1.00 0.00 ?  128 LYS B CB   1  
ATOM   4442   C  CG   . LYS B  2 74  ? -42.600 36.331  -12.914 1.00 0.00 ?  128 LYS B CG   1  
ATOM   4443   C  CD   . LYS B  2 74  ? -41.662 37.010  -13.909 1.00 0.00 ?  128 LYS B CD   1  
ATOM   4444   C  CE   . LYS B  2 74  ? -42.137 38.384  -14.281 1.00 0.00 ?  128 LYS B CE   1  
ATOM   4445   N  NZ   . LYS B  2 74  ? -41.269 39.033  -15.269 1.00 0.00 1  128 LYS B NZ   1  
ATOM   4446   H  H    . LYS B  2 74  ? -41.092 32.935  -11.186 1.00 0.00 ?  128 LYS B H    1  
ATOM   4447   H  HA   . LYS B  2 74  ? -39.784 35.318  -12.251 1.00 0.00 ?  128 LYS B HA   1  
ATOM   4448   H  HB2  . LYS B  2 74  ? -41.843 34.338  -13.274 1.00 0.00 ?  128 LYS B HB2  1  
ATOM   4449   H  HB3  . LYS B  2 74  ? -42.726 34.572  -11.712 1.00 0.00 ?  128 LYS B HB3  1  
ATOM   4450   H  HG2  . LYS B  2 74  ? -43.589 36.110  -13.369 1.00 0.00 ?  128 LYS B HG2  1  
ATOM   4451   H  HG3  . LYS B  2 74  ? -42.834 37.057  -12.106 1.00 0.00 ?  128 LYS B HG3  1  
ATOM   4452   H  HD2  . LYS B  2 74  ? -40.656 37.099  -13.445 1.00 0.00 ?  128 LYS B HD2  1  
ATOM   4453   H  HD3  . LYS B  2 74  ? -41.516 36.352  -14.791 1.00 0.00 ?  128 LYS B HD3  1  
ATOM   4454   H  HE2  . LYS B  2 74  ? -43.182 38.346  -14.656 1.00 0.00 ?  128 LYS B HE2  1  
ATOM   4455   H  HE3  . LYS B  2 74  ? -42.073 38.988  -13.350 1.00 0.00 ?  128 LYS B HE3  1  
ATOM   4456   H  HZ1  . LYS B  2 74  ? -40.553 39.661  -14.851 1.00 0.00 ?  128 LYS B HZ1  1  
ATOM   4457   H  HZ2  . LYS B  2 74  ? -41.680 39.648  -16.000 1.00 0.00 ?  128 LYS B HZ2  1  
ATOM   4458   H  HZ3  . LYS B  2 74  ? -40.823 38.250  -15.787 1.00 0.00 ?  128 LYS B HZ3  1  
ATOM   4459   N  N    . LYS B  2 75  ? -41.080 35.814  -9.340  1.00 0.00 ?  129 LYS B N    1  
ATOM   4460   C  CA   . LYS B  2 75  ? -40.926 36.672  -8.207  1.00 0.00 ?  129 LYS B CA   1  
ATOM   4461   C  C    . LYS B  2 75  ? -39.496 36.927  -7.745  1.00 0.00 ?  129 LYS B C    1  
ATOM   4462   O  O    . LYS B  2 75  ? -39.069 38.008  -7.598  1.00 0.00 ?  129 LYS B O    1  
ATOM   4463   C  CB   . LYS B  2 75  ? -41.815 36.188  -7.030  1.00 0.00 ?  129 LYS B CB   1  
ATOM   4464   C  CG   . LYS B  2 75  ? -41.604 36.936  -5.733  1.00 0.00 ?  129 LYS B CG   1  
ATOM   4465   C  CD   . LYS B  2 75  ? -41.960 38.411  -5.825  1.00 0.00 ?  129 LYS B CD   1  
ATOM   4466   C  CE   . LYS B  2 75  ? -42.200 39.027  -4.507  1.00 0.00 ?  129 LYS B CE   1  
ATOM   4467   N  NZ   . LYS B  2 75  ? -42.759 40.410  -4.557  1.00 0.00 1  129 LYS B NZ   1  
ATOM   4468   H  H    . LYS B  2 75  ? -41.480 34.920  -9.150  1.00 0.00 ?  129 LYS B H    1  
ATOM   4469   H  HA   . LYS B  2 75  ? -41.335 37.665  -8.322  1.00 0.00 ?  129 LYS B HA   1  
ATOM   4470   H  HB2  . LYS B  2 75  ? -42.886 36.155  -7.324  1.00 0.00 ?  129 LYS B HB2  1  
ATOM   4471   H  HB3  . LYS B  2 75  ? -41.553 35.128  -6.820  1.00 0.00 ?  129 LYS B HB3  1  
ATOM   4472   H  HG2  . LYS B  2 75  ? -42.153 36.345  -4.969  1.00 0.00 ?  129 LYS B HG2  1  
ATOM   4473   H  HG3  . LYS B  2 75  ? -40.560 36.762  -5.397  1.00 0.00 ?  129 LYS B HG3  1  
ATOM   4474   H  HD2  . LYS B  2 75  ? -41.086 38.969  -6.226  1.00 0.00 ?  129 LYS B HD2  1  
ATOM   4475   H  HD3  . LYS B  2 75  ? -42.893 38.650  -6.377  1.00 0.00 ?  129 LYS B HD3  1  
ATOM   4476   H  HE2  . LYS B  2 75  ? -43.030 38.448  -4.049  1.00 0.00 ?  129 LYS B HE2  1  
ATOM   4477   H  HE3  . LYS B  2 75  ? -41.343 38.968  -3.804  1.00 0.00 ?  129 LYS B HE3  1  
ATOM   4478   H  HZ1  . LYS B  2 75  ? -42.922 40.688  -3.569  1.00 0.00 ?  129 LYS B HZ1  1  
ATOM   4479   H  HZ2  . LYS B  2 75  ? -43.612 40.516  -5.142  1.00 0.00 ?  129 LYS B HZ2  1  
ATOM   4480   H  HZ3  . LYS B  2 75  ? -42.078 41.042  -5.026  1.00 0.00 ?  129 LYS B HZ3  1  
ATOM   4481   N  N    . TRP B  2 76  ? -38.747 35.786  -7.528  1.00 0.00 ?  130 TRP B N    1  
ATOM   4482   C  CA   . TRP B  2 76  ? -37.305 35.872  -7.272  1.00 0.00 ?  130 TRP B CA   1  
ATOM   4483   C  C    . TRP B  2 76  ? -36.574 36.616  -8.383  1.00 0.00 ?  130 TRP B C    1  
ATOM   4484   O  O    . TRP B  2 76  ? -35.728 37.432  -8.097  1.00 0.00 ?  130 TRP B O    1  
ATOM   4485   C  CB   . TRP B  2 76  ? -36.743 34.461  -6.915  1.00 0.00 ?  130 TRP B CB   1  
ATOM   4486   C  CG   . TRP B  2 76  ? -35.324 34.420  -6.531  1.00 0.00 ?  130 TRP B CG   1  
ATOM   4487   C  CD1  . TRP B  2 76  ? -34.870 34.460  -5.244  1.00 0.00 ?  130 TRP B CD1  1  
ATOM   4488   C  CD2  . TRP B  2 76  ? -34.117 34.425  -7.367  1.00 0.00 ?  130 TRP B CD2  1  
ATOM   4489   N  NE1  . TRP B  2 76  ? -33.458 34.485  -5.195  1.00 0.00 ?  130 TRP B NE1  1  
ATOM   4490   C  CE2  . TRP B  2 76  ? -32.982 34.557  -6.503  1.00 0.00 ?  130 TRP B CE2  1  
ATOM   4491   C  CE3  . TRP B  2 76  ? -33.820 34.354  -8.746  1.00 0.00 ?  130 TRP B CE3  1  
ATOM   4492   C  CZ2  . TRP B  2 76  ? -31.711 34.588  -6.973  1.00 0.00 ?  130 TRP B CZ2  1  
ATOM   4493   C  CZ3  . TRP B  2 76  ? -32.529 34.520  -9.208  1.00 0.00 ?  130 TRP B CZ3  1  
ATOM   4494   C  CH2  . TRP B  2 76  ? -31.455 34.563  -8.324  1.00 0.00 ?  130 TRP B CH2  1  
ATOM   4495   H  H    . TRP B  2 76  ? -39.136 34.882  -7.685  1.00 0.00 ?  130 TRP B H    1  
ATOM   4496   H  HA   . TRP B  2 76  ? -37.187 36.536  -6.428  1.00 0.00 ?  130 TRP B HA   1  
ATOM   4497   H  HB2  . TRP B  2 76  ? -37.261 34.011  -6.042  1.00 0.00 ?  130 TRP B HB2  1  
ATOM   4498   H  HB3  . TRP B  2 76  ? -36.866 33.669  -7.684  1.00 0.00 ?  130 TRP B HB3  1  
ATOM   4499   H  HD1  . TRP B  2 76  ? -35.565 34.601  -4.430  1.00 0.00 ?  130 TRP B HD1  1  
ATOM   4500   H  HE1  . TRP B  2 76  ? -32.923 34.649  -4.395  1.00 0.00 ?  130 TRP B HE1  1  
ATOM   4501   H  HE3  . TRP B  2 76  ? -34.638 34.337  -9.451  1.00 0.00 ?  130 TRP B HE3  1  
ATOM   4502   H  HZ2  . TRP B  2 76  ? -30.893 34.619  -6.268  1.00 0.00 ?  130 TRP B HZ2  1  
ATOM   4503   H  HZ3  . TRP B  2 76  ? -32.437 34.430  -10.280 1.00 0.00 ?  130 TRP B HZ3  1  
ATOM   4504   H  HH2  . TRP B  2 76  ? -30.462 34.658  -8.736  1.00 0.00 ?  130 TRP B HH2  1  
ATOM   4505   N  N    . GLN B  2 77  ? -36.944 36.359  -9.660  1.00 0.00 ?  131 GLN B N    1  
ATOM   4506   C  CA   . GLN B  2 77  ? -36.398 37.009  -10.808 1.00 0.00 ?  131 GLN B CA   1  
ATOM   4507   C  C    . GLN B  2 77  ? -36.656 38.519  -10.900 1.00 0.00 ?  131 GLN B C    1  
ATOM   4508   O  O    . GLN B  2 77  ? -35.675 39.258  -10.967 1.00 0.00 ?  131 GLN B O    1  
ATOM   4509   C  CB   . GLN B  2 77  ? -36.952 36.231  -12.019 1.00 0.00 ?  131 GLN B CB   1  
ATOM   4510   C  CG   . GLN B  2 77  ? -36.512 36.664  -13.425 1.00 0.00 ?  131 GLN B CG   1  
ATOM   4511   C  CD   . GLN B  2 77  ? -35.017 36.771  -13.563 1.00 0.00 ?  131 GLN B CD   1  
ATOM   4512   O  OE1  . GLN B  2 77  ? -34.333 35.787  -13.322 1.00 0.00 ?  131 GLN B OE1  1  
ATOM   4513   N  NE2  . GLN B  2 77  ? -34.460 37.948  -13.879 1.00 0.00 ?  131 GLN B NE2  1  
ATOM   4514   H  H    . GLN B  2 77  ? -37.564 35.632  -9.945  1.00 0.00 ?  131 GLN B H    1  
ATOM   4515   H  HA   . GLN B  2 77  ? -35.325 36.886  -10.818 1.00 0.00 ?  131 GLN B HA   1  
ATOM   4516   H  HB2  . GLN B  2 77  ? -36.616 35.177  -11.914 1.00 0.00 ?  131 GLN B HB2  1  
ATOM   4517   H  HB3  . GLN B  2 77  ? -38.060 36.315  -11.990 1.00 0.00 ?  131 GLN B HB3  1  
ATOM   4518   H  HG2  . GLN B  2 77  ? -36.905 36.081  -14.285 1.00 0.00 ?  131 GLN B HG2  1  
ATOM   4519   H  HG3  . GLN B  2 77  ? -36.990 37.662  -13.513 1.00 0.00 ?  131 GLN B HG3  1  
ATOM   4520   H  HE21 . GLN B  2 77  ? -34.989 38.710  -14.252 1.00 0.00 ?  131 GLN B HE21 1  
ATOM   4521   H  HE22 . GLN B  2 77  ? -33.477 37.922  -14.062 1.00 0.00 ?  131 GLN B HE22 1  
ATOM   4522   N  N    . GLU B  2 78  ? -37.896 39.082  -10.845 1.00 0.00 ?  132 GLU B N    1  
ATOM   4523   C  CA   . GLU B  2 78  ? -38.243 40.487  -10.808 1.00 0.00 ?  132 GLU B CA   1  
ATOM   4524   C  C    . GLU B  2 78  ? -37.473 41.080  -9.670  1.00 0.00 ?  132 GLU B C    1  
ATOM   4525   O  O    . GLU B  2 78  ? -36.798 42.074  -9.799  1.00 0.00 ?  132 GLU B O    1  
ATOM   4526   C  CB   . GLU B  2 78  ? -39.761 40.745  -10.721 1.00 0.00 ?  132 GLU B CB   1  
ATOM   4527   C  CG   . GLU B  2 78  ? -40.222 42.212  -10.523 1.00 0.00 ?  132 GLU B CG   1  
ATOM   4528   C  CD   . GLU B  2 78  ? -41.735 42.267  -10.514 1.00 0.00 ?  132 GLU B CD   1  
ATOM   4529   O  OE1  . GLU B  2 78  ? -42.328 41.995  -11.628 1.00 0.00 ?  132 GLU B OE1  1  
ATOM   4530   O  OE2  . GLU B  2 78  ? -42.329 42.406  -9.412  1.00 0.00 -1 132 GLU B OE2  1  
ATOM   4531   H  H    . GLU B  2 78  ? -38.640 38.419  -10.882 1.00 0.00 ?  132 GLU B H    1  
ATOM   4532   H  HA   . GLU B  2 78  ? -37.847 40.907  -11.720 1.00 0.00 ?  132 GLU B HA   1  
ATOM   4533   H  HB2  . GLU B  2 78  ? -40.204 40.332  -11.653 1.00 0.00 ?  132 GLU B HB2  1  
ATOM   4534   H  HB3  . GLU B  2 78  ? -40.152 40.139  -9.876  1.00 0.00 ?  132 GLU B HB3  1  
ATOM   4535   H  HG2  . GLU B  2 78  ? -39.850 42.640  -9.568  1.00 0.00 ?  132 GLU B HG2  1  
ATOM   4536   H  HG3  . GLU B  2 78  ? -39.880 42.836  -11.377 1.00 0.00 ?  132 GLU B HG3  1  
ATOM   4537   N  N    . GLU B  2 79  ? -37.398 40.448  -8.476  1.00 0.00 ?  133 GLU B N    1  
ATOM   4538   C  CA   . GLU B  2 79  ? -36.789 41.062  -7.257  1.00 0.00 ?  133 GLU B CA   1  
ATOM   4539   C  C    . GLU B  2 79  ? -35.261 40.914  -7.304  1.00 0.00 ?  133 GLU B C    1  
ATOM   4540   O  O    . GLU B  2 79  ? -34.556 41.682  -6.628  1.00 0.00 ?  133 GLU B O    1  
ATOM   4541   C  CB   . GLU B  2 79  ? -37.116 40.249  -6.029  1.00 0.00 ?  133 GLU B CB   1  
ATOM   4542   C  CG   . GLU B  2 79  ? -38.521 40.377  -5.403  1.00 0.00 ?  133 GLU B CG   1  
ATOM   4543   C  CD   . GLU B  2 79  ? -38.702 41.869  -5.048  1.00 0.00 ?  133 GLU B CD   1  
ATOM   4544   O  OE1  . GLU B  2 79  ? -39.469 42.564  -5.697  1.00 0.00 ?  133 GLU B OE1  1  
ATOM   4545   O  OE2  . GLU B  2 79  ? -37.999 42.326  -4.094  1.00 0.00 -1 133 GLU B OE2  1  
ATOM   4546   H  H    . GLU B  2 79  ? -37.927 39.618  -8.314  1.00 0.00 ?  133 GLU B H    1  
ATOM   4547   H  HA   . GLU B  2 79  ? -36.926 42.133  -7.256  1.00 0.00 ?  133 GLU B HA   1  
ATOM   4548   H  HB2  . GLU B  2 79  ? -36.933 39.214  -6.388  1.00 0.00 ?  133 GLU B HB2  1  
ATOM   4549   H  HB3  . GLU B  2 79  ? -36.423 40.455  -5.185  1.00 0.00 ?  133 GLU B HB3  1  
ATOM   4550   H  HG2  . GLU B  2 79  ? -39.292 40.200  -6.183  1.00 0.00 ?  133 GLU B HG2  1  
ATOM   4551   H  HG3  . GLU B  2 79  ? -38.693 39.733  -4.514  1.00 0.00 ?  133 GLU B HG3  1  
ATOM   4552   N  N    . MET B  2 80  ? -34.628 39.964  -7.993  1.00 0.00 ?  134 MET B N    1  
ATOM   4553   C  CA   . MET B  2 80  ? -33.177 39.918  -8.342  1.00 0.00 ?  134 MET B CA   1  
ATOM   4554   C  C    . MET B  2 80  ? -32.708 40.985  -9.259  1.00 0.00 ?  134 MET B C    1  
ATOM   4555   O  O    . MET B  2 80  ? -31.641 41.551  -9.137  1.00 0.00 ?  134 MET B O    1  
ATOM   4556   C  CB   . MET B  2 80  ? -32.821 38.527  -9.002  1.00 0.00 ?  134 MET B CB   1  
ATOM   4557   C  CG   . MET B  2 80  ? -31.340 38.345  -9.433  1.00 0.00 ?  134 MET B CG   1  
ATOM   4558   S  SD   . MET B  2 80  ? -30.255 38.232  -7.991  1.00 0.00 ?  134 MET B SD   1  
ATOM   4559   C  CE   . MET B  2 80  ? -28.694 38.450  -8.840  1.00 0.00 ?  134 MET B CE   1  
ATOM   4560   H  H    . MET B  2 80  ? -35.116 39.257  -8.499  1.00 0.00 ?  134 MET B H    1  
ATOM   4561   H  HA   . MET B  2 80  ? -32.669 39.987  -7.391  1.00 0.00 ?  134 MET B HA   1  
ATOM   4562   H  HB2  . MET B  2 80  ? -33.100 37.662  -8.363  1.00 0.00 ?  134 MET B HB2  1  
ATOM   4563   H  HB3  . MET B  2 80  ? -33.387 38.343  -9.941  1.00 0.00 ?  134 MET B HB3  1  
ATOM   4564   H  HG2  . MET B  2 80  ? -31.226 37.401  -10.008 1.00 0.00 ?  134 MET B HG2  1  
ATOM   4565   H  HG3  . MET B  2 80  ? -30.918 39.211  -9.987  1.00 0.00 ?  134 MET B HG3  1  
ATOM   4566   H  HE1  . MET B  2 80  ? -28.577 37.981  -9.841  1.00 0.00 ?  134 MET B HE1  1  
ATOM   4567   H  HE2  . MET B  2 80  ? -27.841 38.103  -8.218  1.00 0.00 ?  134 MET B HE2  1  
ATOM   4568   H  HE3  . MET B  2 80  ? -28.506 39.541  -8.930  1.00 0.00 ?  134 MET B HE3  1  
ATOM   4569   N  N    . GLU B  2 81  ? -33.530 41.361  -10.206 1.00 0.00 ?  135 GLU B N    1  
ATOM   4570   C  CA   . GLU B  2 81  ? -33.351 42.398  -11.136 1.00 0.00 ?  135 GLU B CA   1  
ATOM   4571   C  C    . GLU B  2 81  ? -33.294 43.818  -10.527 1.00 0.00 ?  135 GLU B C    1  
ATOM   4572   O  O    . GLU B  2 81  ? -32.570 44.725  -11.010 1.00 0.00 ?  135 GLU B O    1  
ATOM   4573   C  CB   . GLU B  2 81  ? -34.432 42.330  -12.202 1.00 0.00 ?  135 GLU B CB   1  
ATOM   4574   C  CG   . GLU B  2 81  ? -34.169 41.230  -13.254 1.00 0.00 ?  135 GLU B CG   1  
ATOM   4575   C  CD   . GLU B  2 81  ? -35.418 41.181  -14.190 1.00 0.00 ?  135 GLU B CD   1  
ATOM   4576   O  OE1  . GLU B  2 81  ? -36.514 40.974  -13.658 1.00 0.00 ?  135 GLU B OE1  1  
ATOM   4577   O  OE2  . GLU B  2 81  ? -35.309 41.409  -15.385 1.00 0.00 -1 135 GLU B OE2  1  
ATOM   4578   H  H    . GLU B  2 81  ? -34.374 40.835  -10.277 1.00 0.00 ?  135 GLU B H    1  
ATOM   4579   H  HA   . GLU B  2 81  ? -32.383 42.233  -11.586 1.00 0.00 ?  135 GLU B HA   1  
ATOM   4580   H  HB2  . GLU B  2 81  ? -35.344 42.051  -11.632 1.00 0.00 ?  135 GLU B HB2  1  
ATOM   4581   H  HB3  . GLU B  2 81  ? -34.660 43.183  -12.877 1.00 0.00 ?  135 GLU B HB3  1  
ATOM   4582   H  HG2  . GLU B  2 81  ? -33.278 41.403  -13.895 1.00 0.00 ?  135 GLU B HG2  1  
ATOM   4583   H  HG3  . GLU B  2 81  ? -34.003 40.244  -12.771 1.00 0.00 ?  135 GLU B HG3  1  
ATOM   4584   N  N    . LEU B  2 82  ? -34.078 44.074  -9.448  1.00 0.00 ?  136 LEU B N    1  
ATOM   4585   C  CA   . LEU B  2 82  ? -34.015 45.192  -8.511  1.00 0.00 ?  136 LEU B CA   1  
ATOM   4586   C  C    . LEU B  2 82  ? -32.622 45.202  -7.824  1.00 0.00 ?  136 LEU B C    1  
ATOM   4587   O  O    . LEU B  2 82  ? -31.933 46.202  -7.726  1.00 0.00 ?  136 LEU B O    1  
ATOM   4588   C  CB   . LEU B  2 82  ? -35.128 45.145  -7.489  1.00 0.00 ?  136 LEU B CB   1  
ATOM   4589   C  CG   . LEU B  2 82  ? -36.474 45.698  -8.027  1.00 0.00 ?  136 LEU B CG   1  
ATOM   4590   C  CD1  . LEU B  2 82  ? -37.614 44.996  -7.348  1.00 0.00 ?  136 LEU B CD1  1  
ATOM   4591   C  CD2  . LEU B  2 82  ? -36.513 47.171  -7.845  1.00 0.00 ?  136 LEU B CD2  1  
ATOM   4592   H  H    . LEU B  2 82  ? -34.726 43.340  -9.257  1.00 0.00 ?  136 LEU B H    1  
ATOM   4593   H  HA   . LEU B  2 82  ? -34.064 46.104  -9.087  1.00 0.00 ?  136 LEU B HA   1  
ATOM   4594   H  HB2  . LEU B  2 82  ? -35.311 44.103  -7.148  1.00 0.00 ?  136 LEU B HB2  1  
ATOM   4595   H  HB3  . LEU B  2 82  ? -34.924 45.737  -6.571  1.00 0.00 ?  136 LEU B HB3  1  
ATOM   4596   H  HG   . LEU B  2 82  ? -36.575 45.463  -9.108  1.00 0.00 ?  136 LEU B HG   1  
ATOM   4597   H  HD11 . LEU B  2 82  ? -38.541 45.596  -7.473  1.00 0.00 ?  136 LEU B HD11 1  
ATOM   4598   H  HD12 . LEU B  2 82  ? -37.300 44.836  -6.295  1.00 0.00 ?  136 LEU B HD12 1  
ATOM   4599   H  HD13 . LEU B  2 82  ? -37.826 43.988  -7.765  1.00 0.00 ?  136 LEU B HD13 1  
ATOM   4600   H  HD21 . LEU B  2 82  ? -35.616 47.662  -8.280  1.00 0.00 ?  136 LEU B HD21 1  
ATOM   4601   H  HD22 . LEU B  2 82  ? -36.576 47.560  -6.806  1.00 0.00 ?  136 LEU B HD22 1  
ATOM   4602   H  HD23 . LEU B  2 82  ? -37.425 47.533  -8.367  1.00 0.00 ?  136 LEU B HD23 1  
ATOM   4603   N  N    . TYR B  2 83  ? -32.137 43.964  -7.437  1.00 0.00 ?  137 TYR B N    1  
ATOM   4604   C  CA   . TYR B  2 83  ? -30.837 43.758  -6.857  1.00 0.00 ?  137 TYR B CA   1  
ATOM   4605   C  C    . TYR B  2 83  ? -29.592 44.136  -7.682  1.00 0.00 ?  137 TYR B C    1  
ATOM   4606   O  O    . TYR B  2 83  ? -28.695 44.770  -7.171  1.00 0.00 ?  137 TYR B O    1  
ATOM   4607   C  CB   . TYR B  2 83  ? -30.738 42.409  -6.069  1.00 0.00 ?  137 TYR B CB   1  
ATOM   4608   C  CG   . TYR B  2 83  ? -29.388 42.087  -5.443  1.00 0.00 ?  137 TYR B CG   1  
ATOM   4609   C  CD1  . TYR B  2 83  ? -29.077 42.428  -4.125  1.00 0.00 ?  137 TYR B CD1  1  
ATOM   4610   C  CD2  . TYR B  2 83  ? -28.554 41.275  -6.188  1.00 0.00 ?  137 TYR B CD2  1  
ATOM   4611   C  CE1  . TYR B  2 83  ? -27.916 41.961  -3.545  1.00 0.00 ?  137 TYR B CE1  1  
ATOM   4612   C  CE2  . TYR B  2 83  ? -27.320 40.848  -5.630  1.00 0.00 ?  137 TYR B CE2  1  
ATOM   4613   C  CZ   . TYR B  2 83  ? -27.040 41.220  -4.303  1.00 0.00 ?  137 TYR B CZ   1  
ATOM   4614   O  OH   . TYR B  2 83  ? -25.752 40.786  -3.904  1.00 0.00 ?  137 TYR B OH   1  
ATOM   4615   H  H    . TYR B  2 83  ? -32.736 43.178  -7.567  1.00 0.00 ?  137 TYR B H    1  
ATOM   4616   H  HA   . TYR B  2 83  ? -30.833 44.504  -6.076  1.00 0.00 ?  137 TYR B HA   1  
ATOM   4617   H  HB2  . TYR B  2 83  ? -31.558 42.505  -5.324  1.00 0.00 ?  137 TYR B HB2  1  
ATOM   4618   H  HB3  . TYR B  2 83  ? -31.043 41.601  -6.768  1.00 0.00 ?  137 TYR B HB3  1  
ATOM   4619   H  HD1  . TYR B  2 83  ? -29.832 42.982  -3.587  1.00 0.00 ?  137 TYR B HD1  1  
ATOM   4620   H  HD2  . TYR B  2 83  ? -28.852 41.022  -7.195  1.00 0.00 ?  137 TYR B HD2  1  
ATOM   4621   H  HE1  . TYR B  2 83  ? -27.608 42.244  -2.549  1.00 0.00 ?  137 TYR B HE1  1  
ATOM   4622   H  HE2  . TYR B  2 83  ? -26.537 40.421  -6.238  1.00 0.00 ?  137 TYR B HE2  1  
ATOM   4623   H  HH   . TYR B  2 83  ? -25.287 40.558  -4.712  1.00 0.00 ?  137 TYR B HH   1  
ATOM   4624   N  N    . ARG B  2 84  ? -29.693 43.844  -8.992  1.00 0.00 ?  138 ARG B N    1  
ATOM   4625   C  CA   . ARG B  2 84  ? -28.759 44.264  -9.998  1.00 0.00 ?  138 ARG B CA   1  
ATOM   4626   C  C    . ARG B  2 84  ? -28.474 45.765  -10.031 1.00 0.00 ?  138 ARG B C    1  
ATOM   4627   O  O    . ARG B  2 84  ? -27.347 46.136  -10.400 1.00 0.00 ?  138 ARG B O    1  
ATOM   4628   C  CB   . ARG B  2 84  ? -29.185 43.767  -11.423 1.00 0.00 ?  138 ARG B CB   1  
ATOM   4629   C  CG   . ARG B  2 84  ? -29.022 42.232  -11.717 1.00 0.00 ?  138 ARG B CG   1  
ATOM   4630   C  CD   . ARG B  2 84  ? -29.445 41.834  -13.069 1.00 0.00 ?  138 ARG B CD   1  
ATOM   4631   N  NE   . ARG B  2 84  ? -29.250 40.360  -13.094 1.00 0.00 ?  138 ARG B NE   1  
ATOM   4632   C  CZ   . ARG B  2 84  ? -30.012 39.526  -13.807 1.00 0.00 ?  138 ARG B CZ   1  
ATOM   4633   N  NH1  . ARG B  2 84  ? -29.867 38.206  -13.639 1.00 0.00 1  138 ARG B NH1  1  
ATOM   4634   N  NH2  . ARG B  2 84  ? -30.810 39.803  -14.820 1.00 0.00 ?  138 ARG B NH2  1  
ATOM   4635   H  H    . ARG B  2 84  ? -30.450 43.253  -9.260  1.00 0.00 ?  138 ARG B H    1  
ATOM   4636   H  HA   . ARG B  2 84  ? -27.809 43.784  -9.816  1.00 0.00 ?  138 ARG B HA   1  
ATOM   4637   H  HB2  . ARG B  2 84  ? -30.200 44.124  -11.699 1.00 0.00 ?  138 ARG B HB2  1  
ATOM   4638   H  HB3  . ARG B  2 84  ? -28.379 44.201  -12.052 1.00 0.00 ?  138 ARG B HB3  1  
ATOM   4639   H  HG2  . ARG B  2 84  ? -27.998 41.884  -11.464 1.00 0.00 ?  138 ARG B HG2  1  
ATOM   4640   H  HG3  . ARG B  2 84  ? -29.710 41.807  -10.955 1.00 0.00 ?  138 ARG B HG3  1  
ATOM   4641   H  HD2  . ARG B  2 84  ? -30.526 42.041  -13.220 1.00 0.00 ?  138 ARG B HD2  1  
ATOM   4642   H  HD3  . ARG B  2 84  ? -28.903 42.261  -13.941 1.00 0.00 ?  138 ARG B HD3  1  
ATOM   4643   H  HE   . ARG B  2 84  ? -28.578 39.936  -12.487 1.00 0.00 ?  138 ARG B HE   1  
ATOM   4644   H  HH11 . ARG B  2 84  ? -29.487 37.839  -12.791 1.00 0.00 ?  138 ARG B HH11 1  
ATOM   4645   H  HH12 . ARG B  2 84  ? -30.504 37.589  -14.101 1.00 0.00 ?  138 ARG B HH12 1  
ATOM   4646   H  HH21 . ARG B  2 84  ? -30.928 40.738  -15.156 1.00 0.00 ?  138 ARG B HH21 1  
ATOM   4647   H  HH22 . ARG B  2 84  ? -31.251 39.040  -15.293 1.00 0.00 ?  138 ARG B HH22 1  
ATOM   4648   N  N    . GLN B  2 85  ? -29.525 46.577  -9.795  1.00 0.00 ?  139 GLN B N    1  
ATOM   4649   C  CA   . GLN B  2 85  ? -29.383 48.049  -9.934  1.00 0.00 ?  139 GLN B CA   1  
ATOM   4650   C  C    . GLN B  2 85  ? -29.078 48.686  -8.620  1.00 0.00 ?  139 GLN B C    1  
ATOM   4651   O  O    . GLN B  2 85  ? -28.557 49.743  -8.511  1.00 0.00 ?  139 GLN B O    1  
ATOM   4652   C  CB   . GLN B  2 85  ? -30.777 48.551  -10.400 1.00 0.00 ?  139 GLN B CB   1  
ATOM   4653   C  CG   . GLN B  2 85  ? -31.286 48.139  -11.730 1.00 0.00 ?  139 GLN B CG   1  
ATOM   4654   C  CD   . GLN B  2 85  ? -30.240 47.829  -12.721 1.00 0.00 ?  139 GLN B CD   1  
ATOM   4655   O  OE1  . GLN B  2 85  ? -30.276 46.772  -13.331 1.00 0.00 ?  139 GLN B OE1  1  
ATOM   4656   N  NE2  . GLN B  2 85  ? -29.228 48.697  -12.957 1.00 0.00 ?  139 GLN B NE2  1  
ATOM   4657   H  H    . GLN B  2 85  ? -30.435 46.205  -9.627  1.00 0.00 ?  139 GLN B H    1  
ATOM   4658   H  HA   . GLN B  2 85  ? -28.588 48.302  -10.619 1.00 0.00 ?  139 GLN B HA   1  
ATOM   4659   H  HB2  . GLN B  2 85  ? -31.561 48.281  -9.661  1.00 0.00 ?  139 GLN B HB2  1  
ATOM   4660   H  HB3  . GLN B  2 85  ? -30.722 49.658  -10.479 1.00 0.00 ?  139 GLN B HB3  1  
ATOM   4661   H  HG2  . GLN B  2 85  ? -31.962 47.261  -11.647 1.00 0.00 ?  139 GLN B HG2  1  
ATOM   4662   H  HG3  . GLN B  2 85  ? -31.879 48.972  -12.164 1.00 0.00 ?  139 GLN B HG3  1  
ATOM   4663   H  HE21 . GLN B  2 85  ? -28.577 48.456  -13.678 1.00 0.00 ?  139 GLN B HE21 1  
ATOM   4664   H  HE22 . GLN B  2 85  ? -29.345 49.618  -12.586 1.00 0.00 ?  139 GLN B HE22 1  
ATOM   4665   N  N    . LYS B  2 86  ? -29.380 47.988  -7.487  1.00 0.00 ?  140 LYS B N    1  
ATOM   4666   C  CA   . LYS B  2 86  ? -28.894 48.331  -6.194  1.00 0.00 ?  140 LYS B CA   1  
ATOM   4667   C  C    . LYS B  2 86  ? -27.376 48.129  -6.015  1.00 0.00 ?  140 LYS B C    1  
ATOM   4668   O  O    . LYS B  2 86  ? -26.721 49.009  -5.397  1.00 0.00 ?  140 LYS B O    1  
ATOM   4669   C  CB   . LYS B  2 86  ? -29.684 47.517  -5.112  1.00 0.00 ?  140 LYS B CB   1  
ATOM   4670   C  CG   . LYS B  2 86  ? -28.995 47.689  -3.731  1.00 0.00 ?  140 LYS B CG   1  
ATOM   4671   C  CD   . LYS B  2 86  ? -29.799 47.198  -2.499  1.00 0.00 ?  140 LYS B CD   1  
ATOM   4672   C  CE   . LYS B  2 86  ? -29.301 47.679  -1.140  1.00 0.00 ?  140 LYS B CE   1  
ATOM   4673   N  NZ   . LYS B  2 86  ? -30.216 47.318  -0.028  1.00 0.00 1  140 LYS B NZ   1  
ATOM   4674   H  H    . LYS B  2 86  ? -29.903 47.141  -7.555  1.00 0.00 ?  140 LYS B H    1  
ATOM   4675   H  HA   . LYS B  2 86  ? -29.111 49.379  -6.048  1.00 0.00 ?  140 LYS B HA   1  
ATOM   4676   H  HB2  . LYS B  2 86  ? -30.760 47.757  -4.979  1.00 0.00 ?  140 LYS B HB2  1  
ATOM   4677   H  HB3  . LYS B  2 86  ? -29.704 46.437  -5.374  1.00 0.00 ?  140 LYS B HB3  1  
ATOM   4678   H  HG2  . LYS B  2 86  ? -28.005 47.191  -3.647  1.00 0.00 ?  140 LYS B HG2  1  
ATOM   4679   H  HG3  . LYS B  2 86  ? -28.925 48.789  -3.596  1.00 0.00 ?  140 LYS B HG3  1  
ATOM   4680   H  HD2  . LYS B  2 86  ? -30.837 47.592  -2.473  1.00 0.00 ?  140 LYS B HD2  1  
ATOM   4681   H  HD3  . LYS B  2 86  ? -29.816 46.088  -2.539  1.00 0.00 ?  140 LYS B HD3  1  
ATOM   4682   H  HE2  . LYS B  2 86  ? -28.219 47.499  -0.964  1.00 0.00 ?  140 LYS B HE2  1  
ATOM   4683   H  HE3  . LYS B  2 86  ? -29.335 48.789  -1.186  1.00 0.00 ?  140 LYS B HE3  1  
ATOM   4684   H  HZ1  . LYS B  2 86  ? -31.182 47.690  -0.124  1.00 0.00 ?  140 LYS B HZ1  1  
ATOM   4685   H  HZ2  . LYS B  2 86  ? -29.931 47.860  0.812   1.00 0.00 ?  140 LYS B HZ2  1  
ATOM   4686   H  HZ3  . LYS B  2 86  ? -30.204 46.305  0.209   1.00 0.00 ?  140 LYS B HZ3  1  
ATOM   4687   N  N    . VAL B  2 87  ? -26.812 47.017  -6.449  1.00 0.00 ?  141 VAL B N    1  
ATOM   4688   C  CA   . VAL B  2 87  ? -25.377 46.869  -6.295  1.00 0.00 ?  141 VAL B CA   1  
ATOM   4689   C  C    . VAL B  2 87  ? -24.538 47.652  -7.270  1.00 0.00 ?  141 VAL B C    1  
ATOM   4690   O  O    . VAL B  2 87  ? -23.322 47.848  -7.124  1.00 0.00 ?  141 VAL B O    1  
ATOM   4691   C  CB   . VAL B  2 87  ? -25.031 45.356  -6.509  1.00 0.00 ?  141 VAL B CB   1  
ATOM   4692   C  CG1  . VAL B  2 87  ? -23.527 45.017  -6.418  1.00 0.00 ?  141 VAL B CG1  1  
ATOM   4693   C  CG2  . VAL B  2 87  ? -25.809 44.626  -5.369  1.00 0.00 ?  141 VAL B CG2  1  
ATOM   4694   H  H    . VAL B  2 87  ? -27.393 46.280  -6.786  1.00 0.00 ?  141 VAL B H    1  
ATOM   4695   H  HA   . VAL B  2 87  ? -25.082 47.020  -5.267  1.00 0.00 ?  141 VAL B HA   1  
ATOM   4696   H  HB   . VAL B  2 87  ? -25.433 45.031  -7.493  1.00 0.00 ?  141 VAL B HB   1  
ATOM   4697   H  HG11 . VAL B  2 87  ? -23.134 45.327  -5.426  1.00 0.00 ?  141 VAL B HG11 1  
ATOM   4698   H  HG12 . VAL B  2 87  ? -22.888 45.419  -7.233  1.00 0.00 ?  141 VAL B HG12 1  
ATOM   4699   H  HG13 . VAL B  2 87  ? -23.375 43.918  -6.485  1.00 0.00 ?  141 VAL B HG13 1  
ATOM   4700   H  HG21 . VAL B  2 87  ? -25.619 45.167  -4.418  1.00 0.00 ?  141 VAL B HG21 1  
ATOM   4701   H  HG22 . VAL B  2 87  ? -25.454 43.574  -5.336  1.00 0.00 ?  141 VAL B HG22 1  
ATOM   4702   H  HG23 . VAL B  2 87  ? -26.869 44.611  -5.702  1.00 0.00 ?  141 VAL B HG23 1  
ATOM   4703   N  N    . GLU B  2 88  ? -25.149 48.085  -8.440  1.00 0.00 ?  142 GLU B N    1  
ATOM   4704   C  CA   . GLU B  2 88  ? -24.538 48.903  -9.458  1.00 0.00 ?  142 GLU B CA   1  
ATOM   4705   C  C    . GLU B  2 88  ? -23.647 50.072  -9.070  1.00 0.00 ?  142 GLU B C    1  
ATOM   4706   O  O    . GLU B  2 88  ? -22.517 50.019  -9.546  1.00 0.00 ?  142 GLU B O    1  
ATOM   4707   C  CB   . GLU B  2 88  ? -25.470 49.311  -10.626 1.00 0.00 ?  142 GLU B CB   1  
ATOM   4708   C  CG   . GLU B  2 88  ? -24.836 50.219  -11.734 1.00 0.00 ?  142 GLU B CG   1  
ATOM   4709   C  CD   . GLU B  2 88  ? -25.500 50.111  -13.077 1.00 0.00 ?  142 GLU B CD   1  
ATOM   4710   O  OE1  . GLU B  2 88  ? -25.990 51.107  -13.667 1.00 0.00 ?  142 GLU B OE1  1  
ATOM   4711   O  OE2  . GLU B  2 88  ? -25.447 48.927  -13.613 1.00 0.00 -1 142 GLU B OE2  1  
ATOM   4712   H  H    . GLU B  2 88  ? -26.103 47.835  -8.584  1.00 0.00 ?  142 GLU B H    1  
ATOM   4713   H  HA   . GLU B  2 88  ? -23.822 48.199  -9.856  1.00 0.00 ?  142 GLU B HA   1  
ATOM   4714   H  HB2  . GLU B  2 88  ? -25.746 48.305  -11.010 1.00 0.00 ?  142 GLU B HB2  1  
ATOM   4715   H  HB3  . GLU B  2 88  ? -26.339 49.726  -10.071 1.00 0.00 ?  142 GLU B HB3  1  
ATOM   4716   H  HG2  . GLU B  2 88  ? -24.911 51.236  -11.293 1.00 0.00 ?  142 GLU B HG2  1  
ATOM   4717   H  HG3  . GLU B  2 88  ? -23.755 49.995  -11.858 1.00 0.00 ?  142 GLU B HG3  1  
ATOM   4718   N  N    . PRO B  2 89  ? -23.947 51.133  -8.328  1.00 0.00 ?  143 PRO B N    1  
ATOM   4719   C  CA   . PRO B  2 89  ? -22.970 52.069  -7.831  1.00 0.00 ?  143 PRO B CA   1  
ATOM   4720   C  C    . PRO B  2 89  ? -22.031 51.350  -6.873  1.00 0.00 ?  143 PRO B C    1  
ATOM   4721   O  O    . PRO B  2 89  ? -20.859 51.605  -6.892  1.00 0.00 ?  143 PRO B O    1  
ATOM   4722   C  CB   . PRO B  2 89  ? -23.815 53.044  -7.096  1.00 0.00 ?  143 PRO B CB   1  
ATOM   4723   C  CG   . PRO B  2 89  ? -25.203 52.492  -6.837  1.00 0.00 ?  143 PRO B CG   1  
ATOM   4724   C  CD   . PRO B  2 89  ? -25.275 51.462  -7.928  1.00 0.00 ?  143 PRO B CD   1  
ATOM   4725   H  HA   . PRO B  2 89  ? -22.317 52.381  -8.632  1.00 0.00 ?  143 PRO B HA   1  
ATOM   4726   H  HB2  . PRO B  2 89  ? -23.329 53.396  -6.161  1.00 0.00 ?  143 PRO B HB2  1  
ATOM   4727   H  HB3  . PRO B  2 89  ? -24.024 53.838  -7.844  1.00 0.00 ?  143 PRO B HB3  1  
ATOM   4728   H  HG2  . PRO B  2 89  ? -25.219 51.928  -5.880  1.00 0.00 ?  143 PRO B HG2  1  
ATOM   4729   H  HG3  . PRO B  2 89  ? -25.924 53.330  -6.738  1.00 0.00 ?  143 PRO B HG3  1  
ATOM   4730   H  HD2  . PRO B  2 89  ? -25.921 50.626  -7.585  1.00 0.00 ?  143 PRO B HD2  1  
ATOM   4731   H  HD3  . PRO B  2 89  ? -25.752 51.981  -8.787  1.00 0.00 ?  143 PRO B HD3  1  
ATOM   4732   N  N    . LEU B  2 90  ? -22.512 50.443  -6.100  1.00 0.00 ?  144 LEU B N    1  
ATOM   4733   C  CA   . LEU B  2 90  ? -21.722 49.794  -5.015  1.00 0.00 ?  144 LEU B CA   1  
ATOM   4734   C  C    . LEU B  2 90  ? -20.527 49.033  -5.449  1.00 0.00 ?  144 LEU B C    1  
ATOM   4735   O  O    . LEU B  2 90  ? -19.468 49.059  -4.738  1.00 0.00 ?  144 LEU B O    1  
ATOM   4736   C  CB   . LEU B  2 90  ? -22.607 48.907  -4.059  1.00 0.00 ?  144 LEU B CB   1  
ATOM   4737   C  CG   . LEU B  2 90  ? -23.837 49.644  -3.533  1.00 0.00 ?  144 LEU B CG   1  
ATOM   4738   C  CD1  . LEU B  2 90  ? -24.393 48.690  -2.468  1.00 0.00 ?  144 LEU B CD1  1  
ATOM   4739   C  CD2  . LEU B  2 90  ? -23.580 50.990  -2.914  1.00 0.00 ?  144 LEU B CD2  1  
ATOM   4740   H  H    . LEU B  2 90  ? -23.445 50.119  -6.231  1.00 0.00 ?  144 LEU B H    1  
ATOM   4741   H  HA   . LEU B  2 90  ? -21.298 50.583  -4.411  1.00 0.00 ?  144 LEU B HA   1  
ATOM   4742   H  HB2  . LEU B  2 90  ? -23.005 48.038  -4.625  1.00 0.00 ?  144 LEU B HB2  1  
ATOM   4743   H  HB3  . LEU B  2 90  ? -21.977 48.533  -3.224  1.00 0.00 ?  144 LEU B HB3  1  
ATOM   4744   H  HG   . LEU B  2 90  ? -24.596 49.782  -4.333  1.00 0.00 ?  144 LEU B HG   1  
ATOM   4745   H  HD11 . LEU B  2 90  ? -24.635 47.698  -2.906  1.00 0.00 ?  144 LEU B HD11 1  
ATOM   4746   H  HD12 . LEU B  2 90  ? -25.353 49.138  -2.134  1.00 0.00 ?  144 LEU B HD12 1  
ATOM   4747   H  HD13 . LEU B  2 90  ? -23.674 48.480  -1.647  1.00 0.00 ?  144 LEU B HD13 1  
ATOM   4748   H  HD21 . LEU B  2 90  ? -24.565 51.204  -2.448  1.00 0.00 ?  144 LEU B HD21 1  
ATOM   4749   H  HD22 . LEU B  2 90  ? -23.465 51.815  -3.650  1.00 0.00 ?  144 LEU B HD22 1  
ATOM   4750   H  HD23 . LEU B  2 90  ? -22.741 50.915  -2.190  1.00 0.00 ?  144 LEU B HD23 1  
ATOM   4751   N  N    . ARG B  2 91  ? -20.648 48.355  -6.534  1.00 0.00 ?  145 ARG B N    1  
ATOM   4752   C  CA   . ARG B  2 91  ? -19.627 47.649  -7.187  1.00 0.00 ?  145 ARG B CA   1  
ATOM   4753   C  C    . ARG B  2 91  ? -18.689 48.537  -7.991  1.00 0.00 ?  145 ARG B C    1  
ATOM   4754   O  O    . ARG B  2 91  ? -17.526 48.299  -8.030  1.00 0.00 ?  145 ARG B O    1  
ATOM   4755   C  CB   . ARG B  2 91  ? -20.028 46.415  -8.024  1.00 0.00 ?  145 ARG B CB   1  
ATOM   4756   C  CG   . ARG B  2 91  ? -21.209 46.660  -9.055  1.00 0.00 ?  145 ARG B CG   1  
ATOM   4757   C  CD   . ARG B  2 91  ? -20.739 47.007  -10.474 1.00 0.00 ?  145 ARG B CD   1  
ATOM   4758   N  NE   . ARG B  2 91  ? -20.388 45.696  -11.091 1.00 0.00 ?  145 ARG B NE   1  
ATOM   4759   C  CZ   . ARG B  2 91  ? -20.271 45.448  -12.399 1.00 0.00 ?  145 ARG B CZ   1  
ATOM   4760   N  NH1  . ARG B  2 91  ? -19.880 44.207  -12.811 1.00 0.00 1  145 ARG B NH1  1  
ATOM   4761   N  NH2  . ARG B  2 91  ? -20.772 46.237  -13.284 1.00 0.00 ?  145 ARG B NH2  1  
ATOM   4762   H  H    . ARG B  2 91  ? -21.587 48.431  -6.859  1.00 0.00 ?  145 ARG B H    1  
ATOM   4763   H  HA   . ARG B  2 91  ? -18.987 47.199  -6.442  1.00 0.00 ?  145 ARG B HA   1  
ATOM   4764   H  HB2  . ARG B  2 91  ? -19.086 45.993  -8.437  1.00 0.00 ?  145 ARG B HB2  1  
ATOM   4765   H  HB3  . ARG B  2 91  ? -20.330 45.657  -7.270  1.00 0.00 ?  145 ARG B HB3  1  
ATOM   4766   H  HG2  . ARG B  2 91  ? -21.942 45.825  -9.072  1.00 0.00 ?  145 ARG B HG2  1  
ATOM   4767   H  HG3  . ARG B  2 91  ? -21.840 47.512  -8.722  1.00 0.00 ?  145 ARG B HG3  1  
ATOM   4768   H  HD2  . ARG B  2 91  ? -21.548 47.489  -11.065 1.00 0.00 ?  145 ARG B HD2  1  
ATOM   4769   H  HD3  . ARG B  2 91  ? -19.842 47.661  -10.431 1.00 0.00 ?  145 ARG B HD3  1  
ATOM   4770   H  HE   . ARG B  2 91  ? -20.013 44.960  -10.527 1.00 0.00 ?  145 ARG B HE   1  
ATOM   4771   H  HH11 . ARG B  2 91  ? -20.067 43.904  -13.745 1.00 0.00 ?  145 ARG B HH11 1  
ATOM   4772   H  HH12 . ARG B  2 91  ? -19.530 43.555  -12.138 1.00 0.00 ?  145 ARG B HH12 1  
ATOM   4773   H  HH21 . ARG B  2 91  ? -21.372 47.023  -13.132 1.00 0.00 ?  145 ARG B HH21 1  
ATOM   4774   H  HH22 . ARG B  2 91  ? -20.872 45.877  -14.212 1.00 0.00 ?  145 ARG B HH22 1  
ATOM   4775   N  N    . ALA B  2 92  ? -19.236 49.655  -8.603  1.00 0.00 ?  146 ALA B N    1  
ATOM   4776   C  CA   . ALA B  2 92  ? -18.472 50.696  -9.213  1.00 0.00 ?  146 ALA B CA   1  
ATOM   4777   C  C    . ALA B  2 92  ? -17.564 51.273  -8.118  1.00 0.00 ?  146 ALA B C    1  
ATOM   4778   O  O    . ALA B  2 92  ? -16.328 51.472  -8.303  1.00 0.00 ?  146 ALA B O    1  
ATOM   4779   C  CB   . ALA B  2 92  ? -19.236 51.787  -9.873  1.00 0.00 ?  146 ALA B CB   1  
ATOM   4780   H  H    . ALA B  2 92  ? -20.227 49.762  -8.579  1.00 0.00 ?  146 ALA B H    1  
ATOM   4781   H  HA   . ALA B  2 92  ? -17.851 50.194  -9.940  1.00 0.00 ?  146 ALA B HA   1  
ATOM   4782   H  HB1  . ALA B  2 92  ? -18.541 52.506  -10.358 1.00 0.00 ?  146 ALA B HB1  1  
ATOM   4783   H  HB2  . ALA B  2 92  ? -19.830 52.286  -9.077  1.00 0.00 ?  146 ALA B HB2  1  
ATOM   4784   H  HB3  . ALA B  2 92  ? -19.910 51.445  -10.687 1.00 0.00 ?  146 ALA B HB3  1  
ATOM   4785   N  N    . GLU B  2 93  ? -18.025 51.560  -6.832  1.00 0.00 ?  147 GLU B N    1  
ATOM   4786   C  CA   . GLU B  2 93  ? -17.114 52.056  -5.777  1.00 0.00 ?  147 GLU B CA   1  
ATOM   4787   C  C    . GLU B  2 93  ? -16.022 51.204  -5.323  1.00 0.00 ?  147 GLU B C    1  
ATOM   4788   O  O    . GLU B  2 93  ? -14.851 51.614  -5.145  1.00 0.00 ?  147 GLU B O    1  
ATOM   4789   C  CB   . GLU B  2 93  ? -17.911 52.465  -4.555  1.00 0.00 ?  147 GLU B CB   1  
ATOM   4790   C  CG   . GLU B  2 93  ? -18.899 53.695  -4.836  1.00 0.00 ?  147 GLU B CG   1  
ATOM   4791   C  CD   . GLU B  2 93  ? -19.600 54.203  -3.588  1.00 0.00 ?  147 GLU B CD   1  
ATOM   4792   O  OE1  . GLU B  2 93  ? -18.994 55.120  -2.954  1.00 0.00 ?  147 GLU B OE1  1  
ATOM   4793   O  OE2  . GLU B  2 93  ? -20.658 53.702  -3.200  1.00 0.00 -1 147 GLU B OE2  1  
ATOM   4794   H  H    . GLU B  2 93  ? -19.005 51.607  -6.658  1.00 0.00 ?  147 GLU B H    1  
ATOM   4795   H  HA   . GLU B  2 93  ? -16.685 52.999  -6.082  1.00 0.00 ?  147 GLU B HA   1  
ATOM   4796   H  HB2  . GLU B  2 93  ? -18.572 51.630  -4.238  1.00 0.00 ?  147 GLU B HB2  1  
ATOM   4797   H  HB3  . GLU B  2 93  ? -17.373 52.810  -3.647  1.00 0.00 ?  147 GLU B HB3  1  
ATOM   4798   H  HG2  . GLU B  2 93  ? -18.326 54.569  -5.214  1.00 0.00 ?  147 GLU B HG2  1  
ATOM   4799   H  HG3  . GLU B  2 93  ? -19.747 53.350  -5.464  1.00 0.00 ?  147 GLU B HG3  1  
ATOM   4800   N  N    . LEU B  2 94  ? -16.414 49.919  -5.197  1.00 0.00 ?  148 LEU B N    1  
ATOM   4801   C  CA   . LEU B  2 94  ? -15.436 48.799  -4.998  1.00 0.00 ?  148 LEU B CA   1  
ATOM   4802   C  C    . LEU B  2 94  ? -14.374 48.707  -6.025  1.00 0.00 ?  148 LEU B C    1  
ATOM   4803   O  O    . LEU B  2 94  ? -13.168 48.518  -5.767  1.00 0.00 ?  148 LEU B O    1  
ATOM   4804   C  CB   . LEU B  2 94  ? -16.358 47.606  -4.737  1.00 0.00 ?  148 LEU B CB   1  
ATOM   4805   C  CG   . LEU B  2 94  ? -15.657 46.320  -4.372  1.00 0.00 ?  148 LEU B CG   1  
ATOM   4806   C  CD1  . LEU B  2 94  ? -14.721 46.649  -3.179  1.00 0.00 ?  148 LEU B CD1  1  
ATOM   4807   C  CD2  . LEU B  2 94  ? -16.769 45.289  -4.107  1.00 0.00 ?  148 LEU B CD2  1  
ATOM   4808   H  H    . LEU B  2 94  ? -17.372 49.663  -5.303  1.00 0.00 ?  148 LEU B H    1  
ATOM   4809   H  HA   . LEU B  2 94  ? -14.982 48.938  -4.028  1.00 0.00 ?  148 LEU B HA   1  
ATOM   4810   H  HB2  . LEU B  2 94  ? -17.009 47.905  -3.888  1.00 0.00 ?  148 LEU B HB2  1  
ATOM   4811   H  HB3  . LEU B  2 94  ? -17.029 47.460  -5.611  1.00 0.00 ?  148 LEU B HB3  1  
ATOM   4812   H  HG   . LEU B  2 94  ? -14.963 45.843  -5.096  1.00 0.00 ?  148 LEU B HG   1  
ATOM   4813   H  HD11 . LEU B  2 94  ? -13.760 47.006  -3.608  1.00 0.00 ?  148 LEU B HD11 1  
ATOM   4814   H  HD12 . LEU B  2 94  ? -14.390 45.736  -2.639  1.00 0.00 ?  148 LEU B HD12 1  
ATOM   4815   H  HD13 . LEU B  2 94  ? -15.162 47.454  -2.553  1.00 0.00 ?  148 LEU B HD13 1  
ATOM   4816   H  HD21 . LEU B  2 94  ? -17.624 45.699  -3.528  1.00 0.00 ?  148 LEU B HD21 1  
ATOM   4817   H  HD22 . LEU B  2 94  ? -16.380 44.295  -3.798  1.00 0.00 ?  148 LEU B HD22 1  
ATOM   4818   H  HD23 . LEU B  2 94  ? -17.296 45.065  -5.060  1.00 0.00 ?  148 LEU B HD23 1  
ATOM   4819   N  N    . GLN B  2 95  ? -14.679 48.878  -7.321  1.00 0.00 ?  149 GLN B N    1  
ATOM   4820   C  CA   . GLN B  2 95  ? -13.716 48.896  -8.321  1.00 0.00 ?  149 GLN B CA   1  
ATOM   4821   C  C    . GLN B  2 95  ? -12.586 49.952  -8.246  1.00 0.00 ?  149 GLN B C    1  
ATOM   4822   O  O    . GLN B  2 95  ? -11.436 49.558  -8.333  1.00 0.00 ?  149 GLN B O    1  
ATOM   4823   C  CB   . GLN B  2 95  ? -14.591 48.945  -9.652  1.00 0.00 ?  149 GLN B CB   1  
ATOM   4824   C  CG   . GLN B  2 95  ? -13.920 48.876  -11.009 1.00 0.00 ?  149 GLN B CG   1  
ATOM   4825   C  CD   . GLN B  2 95  ? -12.960 47.694  -11.352 1.00 0.00 ?  149 GLN B CD   1  
ATOM   4826   O  OE1  . GLN B  2 95  ? -13.264 46.750  -12.098 1.00 0.00 ?  149 GLN B OE1  1  
ATOM   4827   N  NE2  . GLN B  2 95  ? -11.845 47.592  -10.578 1.00 0.00 ?  149 GLN B NE2  1  
ATOM   4828   H  H    . GLN B  2 95  ? -15.611 48.801  -7.667  1.00 0.00 ?  149 GLN B H    1  
ATOM   4829   H  HA   . GLN B  2 95  ? -13.241 47.926  -8.328  1.00 0.00 ?  149 GLN B HA   1  
ATOM   4830   H  HB2  . GLN B  2 95  ? -15.216 48.052  -9.439  1.00 0.00 ?  149 GLN B HB2  1  
ATOM   4831   H  HB3  . GLN B  2 95  ? -15.295 49.803  -9.622  1.00 0.00 ?  149 GLN B HB3  1  
ATOM   4832   H  HG2  . GLN B  2 95  ? -14.712 49.074  -11.763 1.00 0.00 ?  149 GLN B HG2  1  
ATOM   4833   H  HG3  . GLN B  2 95  ? -13.267 49.775  -11.020 1.00 0.00 ?  149 GLN B HG3  1  
ATOM   4834   H  HE21 . GLN B  2 95  ? -11.481 48.243  -9.912  1.00 0.00 ?  149 GLN B HE21 1  
ATOM   4835   H  HE22 . GLN B  2 95  ? -11.248 46.834  -10.842 1.00 0.00 ?  149 GLN B HE22 1  
ATOM   4836   N  N    . GLU B  2 96  ? -13.070 51.210  -8.084  1.00 0.00 ?  150 GLU B N    1  
ATOM   4837   C  CA   . GLU B  2 96  ? -12.246 52.399  -8.060  1.00 0.00 ?  150 GLU B CA   1  
ATOM   4838   C  C    . GLU B  2 96  ? -11.473 52.392  -6.772  1.00 0.00 ?  150 GLU B C    1  
ATOM   4839   O  O    . GLU B  2 96  ? -10.323 52.752  -6.823  1.00 0.00 ?  150 GLU B O    1  
ATOM   4840   C  CB   . GLU B  2 96  ? -13.143 53.575  -8.204  1.00 0.00 ?  150 GLU B CB   1  
ATOM   4841   C  CG   . GLU B  2 96  ? -13.942 53.720  -9.590  1.00 0.00 ?  150 GLU B CG   1  
ATOM   4842   C  CD   . GLU B  2 96  ? -14.224 55.130  -10.019 1.00 0.00 ?  150 GLU B CD   1  
ATOM   4843   O  OE1  . GLU B  2 96  ? -14.838 55.798  -9.157  1.00 0.00 ?  150 GLU B OE1  1  
ATOM   4844   O  OE2  . GLU B  2 96  ? -13.913 55.640  -11.108 1.00 0.00 -1 150 GLU B OE2  1  
ATOM   4845   H  H    . GLU B  2 96  ? -14.051 51.335  -7.958  1.00 0.00 ?  150 GLU B H    1  
ATOM   4846   H  HA   . GLU B  2 96  ? -11.533 52.256  -8.858  1.00 0.00 ?  150 GLU B HA   1  
ATOM   4847   H  HB2  . GLU B  2 96  ? -13.881 53.460  -7.382  1.00 0.00 ?  150 GLU B HB2  1  
ATOM   4848   H  HB3  . GLU B  2 96  ? -12.599 54.539  -8.106  1.00 0.00 ?  150 GLU B HB3  1  
ATOM   4849   H  HG2  . GLU B  2 96  ? -13.191 53.309  -10.297 1.00 0.00 ?  150 GLU B HG2  1  
ATOM   4850   H  HG3  . GLU B  2 96  ? -14.832 53.055  -9.595  1.00 0.00 ?  150 GLU B HG3  1  
ATOM   4851   N  N    . GLY B  2 97  ? -11.992 51.817  -5.673  1.00 0.00 ?  151 GLY B N    1  
ATOM   4852   C  CA   . GLY B  2 97  ? -11.322 51.716  -4.378  1.00 0.00 ?  151 GLY B CA   1  
ATOM   4853   C  C    . GLY B  2 97  ? -10.244 50.613  -4.329  1.00 0.00 ?  151 GLY B C    1  
ATOM   4854   O  O    . GLY B  2 97  ? -9.172  50.887  -3.791  1.00 0.00 ?  151 GLY B O    1  
ATOM   4855   H  H    . GLY B  2 97  ? -12.987 51.763  -5.652  1.00 0.00 ?  151 GLY B H    1  
ATOM   4856   H  HA2  . GLY B  2 97  ? -10.889 52.703  -4.312  1.00 0.00 ?  151 GLY B HA2  1  
ATOM   4857   H  HA3  . GLY B  2 97  ? -12.027 51.541  -3.579  1.00 0.00 ?  151 GLY B HA3  1  
ATOM   4858   N  N    . ALA B  2 98  ? -10.481 49.498  -4.990  1.00 0.00 ?  152 ALA B N    1  
ATOM   4859   C  CA   . ALA B  2 98  ? -9.575  48.497  -5.258  1.00 0.00 ?  152 ALA B CA   1  
ATOM   4860   C  C    . ALA B  2 98  ? -8.434  48.953  -6.162  1.00 0.00 ?  152 ALA B C    1  
ATOM   4861   O  O    . ALA B  2 98  ? -7.260  48.611  -5.984  1.00 0.00 ?  152 ALA B O    1  
ATOM   4862   C  CB   . ALA B  2 98  ? -10.273 47.297  -5.924  1.00 0.00 ?  152 ALA B CB   1  
ATOM   4863   H  H    . ALA B  2 98  ? -11.389 49.410  -5.392  1.00 0.00 ?  152 ALA B H    1  
ATOM   4864   H  HA   . ALA B  2 98  ? -9.101  48.294  -4.309  1.00 0.00 ?  152 ALA B HA   1  
ATOM   4865   H  HB1  . ALA B  2 98  ? -9.559  46.457  -6.058  1.00 0.00 ?  152 ALA B HB1  1  
ATOM   4866   H  HB2  . ALA B  2 98  ? -10.742 47.562  -6.895  1.00 0.00 ?  152 ALA B HB2  1  
ATOM   4867   H  HB3  . ALA B  2 98  ? -11.077 46.947  -5.242  1.00 0.00 ?  152 ALA B HB3  1  
ATOM   4868   N  N    . ARG B  2 99  ? -8.801  49.702  -7.226  1.00 0.00 ?  153 ARG B N    1  
ATOM   4869   C  CA   . ARG B  2 99  ? -7.818  50.308  -8.077  1.00 0.00 ?  153 ARG B CA   1  
ATOM   4870   C  C    . ARG B  2 99  ? -6.854  51.380  -7.413  1.00 0.00 ?  153 ARG B C    1  
ATOM   4871   O  O    . ARG B  2 99  ? -5.657  51.230  -7.480  1.00 0.00 ?  153 ARG B O    1  
ATOM   4872   C  CB   . ARG B  2 99  ? -8.491  50.872  -9.288  1.00 0.00 ?  153 ARG B CB   1  
ATOM   4873   C  CG   . ARG B  2 99  ? -8.696  49.769  -10.355 1.00 0.00 ?  153 ARG B CG   1  
ATOM   4874   C  CD   . ARG B  2 99  ? -7.790  49.855  -11.604 1.00 0.00 ?  153 ARG B CD   1  
ATOM   4875   N  NE   . ARG B  2 99  ? -8.207  48.751  -12.481 1.00 0.00 ?  153 ARG B NE   1  
ATOM   4876   C  CZ   . ARG B  2 99  ? -9.321  48.794  -13.144 1.00 0.00 ?  153 ARG B CZ   1  
ATOM   4877   N  NH1  . ARG B  2 99  ? -9.570  47.740  -13.929 1.00 0.00 1  153 ARG B NH1  1  
ATOM   4878   N  NH2  . ARG B  2 99  ? -10.272 49.759  -13.304 1.00 0.00 ?  153 ARG B NH2  1  
ATOM   4879   H  H    . ARG B  2 99  ? -9.752  49.787  -7.512  1.00 0.00 ?  153 ARG B H    1  
ATOM   4880   H  HA   . ARG B  2 99  ? -7.192  49.497  -8.418  1.00 0.00 ?  153 ARG B HA   1  
ATOM   4881   H  HB2  . ARG B  2 99  ? -9.483  51.264  -8.979  1.00 0.00 ?  153 ARG B HB2  1  
ATOM   4882   H  HB3  . ARG B  2 99  ? -8.015  51.759  -9.757  1.00 0.00 ?  153 ARG B HB3  1  
ATOM   4883   H  HG2  . ARG B  2 99  ? -8.564  48.787  -9.853  1.00 0.00 ?  153 ARG B HG2  1  
ATOM   4884   H  HG3  . ARG B  2 99  ? -9.757  49.718  -10.681 1.00 0.00 ?  153 ARG B HG3  1  
ATOM   4885   H  HD2  . ARG B  2 99  ? -7.692  50.829  -12.129 1.00 0.00 ?  153 ARG B HD2  1  
ATOM   4886   H  HD3  . ARG B  2 99  ? -6.754  49.703  -11.232 1.00 0.00 ?  153 ARG B HD3  1  
ATOM   4887   H  HE   . ARG B  2 99  ? -7.698  47.931  -12.742 1.00 0.00 ?  153 ARG B HE   1  
ATOM   4888   H  HH11 . ARG B  2 99  ? -10.482 47.411  -14.176 1.00 0.00 ?  153 ARG B HH11 1  
ATOM   4889   H  HH12 . ARG B  2 99  ? -8.984  46.930  -13.908 1.00 0.00 ?  153 ARG B HH12 1  
ATOM   4890   H  HH21 . ARG B  2 99  ? -10.166 50.615  -12.798 1.00 0.00 ?  153 ARG B HH21 1  
ATOM   4891   H  HH22 . ARG B  2 99  ? -11.075 49.603  -13.880 1.00 0.00 ?  153 ARG B HH22 1  
ATOM   4892   N  N    . GLN B  2 100 ? -7.482  52.243  -6.592  1.00 0.00 ?  154 GLN B N    1  
ATOM   4893   C  CA   . GLN B  2 100 ? -6.835  53.166  -5.689  1.00 0.00 ?  154 GLN B CA   1  
ATOM   4894   C  C    . GLN B  2 100 ? -5.918  52.484  -4.629  1.00 0.00 ?  154 GLN B C    1  
ATOM   4895   O  O    . GLN B  2 100 ? -4.766  52.922  -4.520  1.00 0.00 ?  154 GLN B O    1  
ATOM   4896   C  CB   . GLN B  2 100 ? -7.878  54.222  -5.253  1.00 0.00 ?  154 GLN B CB   1  
ATOM   4897   C  CG   . GLN B  2 100 ? -8.280  55.150  -6.412  1.00 0.00 ?  154 GLN B CG   1  
ATOM   4898   C  CD   . GLN B  2 100 ? -9.700  55.699  -6.258  1.00 0.00 ?  154 GLN B CD   1  
ATOM   4899   O  OE1  . GLN B  2 100 ? -10.433 55.622  -5.261  1.00 0.00 ?  154 GLN B OE1  1  
ATOM   4900   N  NE2  . GLN B  2 100 ? -10.156 56.441  -7.302  1.00 0.00 ?  154 GLN B NE2  1  
ATOM   4901   H  H    . GLN B  2 100 ? -8.466  52.393  -6.649  1.00 0.00 ?  154 GLN B H    1  
ATOM   4902   H  HA   . GLN B  2 100 ? -6.153  53.760  -6.279  1.00 0.00 ?  154 GLN B HA   1  
ATOM   4903   H  HB2  . GLN B  2 100 ? -8.784  53.751  -4.817  1.00 0.00 ?  154 GLN B HB2  1  
ATOM   4904   H  HB3  . GLN B  2 100 ? -7.404  54.846  -4.464  1.00 0.00 ?  154 GLN B HB3  1  
ATOM   4905   H  HG2  . GLN B  2 100 ? -7.470  55.910  -6.412  1.00 0.00 ?  154 GLN B HG2  1  
ATOM   4906   H  HG3  . GLN B  2 100 ? -8.260  54.583  -7.367  1.00 0.00 ?  154 GLN B HG3  1  
ATOM   4907   H  HE21 . GLN B  2 100 ? -11.092 56.795  -7.296  1.00 0.00 ?  154 GLN B HE21 1  
ATOM   4908   H  HE22 . GLN B  2 100 ? -9.589  56.671  -8.093  1.00 0.00 ?  154 GLN B HE22 1  
ATOM   4909   N  N    . LYS B  2 101 ? -6.333  51.451  -3.975  1.00 0.00 ?  155 LYS B N    1  
ATOM   4910   C  CA   . LYS B  2 101 ? -5.363  50.712  -3.079  1.00 0.00 ?  155 LYS B CA   1  
ATOM   4911   C  C    . LYS B  2 101 ? -4.174  50.141  -3.818  1.00 0.00 ?  155 LYS B C    1  
ATOM   4912   O  O    . LYS B  2 101 ? -3.098  50.108  -3.233  1.00 0.00 ?  155 LYS B O    1  
ATOM   4913   C  CB   . LYS B  2 101 ? -5.998  49.675  -2.172  1.00 0.00 ?  155 LYS B CB   1  
ATOM   4914   C  CG   . LYS B  2 101 ? -6.971  50.136  -1.174  1.00 0.00 ?  155 LYS B CG   1  
ATOM   4915   C  CD   . LYS B  2 101 ? -6.681  51.418  -0.335  1.00 0.00 ?  155 LYS B CD   1  
ATOM   4916   C  CE   . LYS B  2 101 ? -7.808  52.558  -0.629  1.00 0.00 ?  155 LYS B CE   1  
ATOM   4917   N  NZ   . LYS B  2 101 ? -7.438  53.850  -0.078  1.00 0.00 1  155 LYS B NZ   1  
ATOM   4918   H  H    . LYS B  2 101 ? -7.191  50.956  -4.092  1.00 0.00 ?  155 LYS B H    1  
ATOM   4919   H  HA   . LYS B  2 101 ? -4.985  51.495  -2.438  1.00 0.00 ?  155 LYS B HA   1  
ATOM   4920   H  HB2  . LYS B  2 101 ? -6.482  48.886  -2.787  1.00 0.00 ?  155 LYS B HB2  1  
ATOM   4921   H  HB3  . LYS B  2 101 ? -5.182  49.140  -1.641  1.00 0.00 ?  155 LYS B HB3  1  
ATOM   4922   H  HG2  . LYS B  2 101 ? -8.005  50.171  -1.579  1.00 0.00 ?  155 LYS B HG2  1  
ATOM   4923   H  HG3  . LYS B  2 101 ? -7.091  49.369  -0.379  1.00 0.00 ?  155 LYS B HG3  1  
ATOM   4924   H  HD2  . LYS B  2 101 ? -6.856  51.185  0.738   1.00 0.00 ?  155 LYS B HD2  1  
ATOM   4925   H  HD3  . LYS B  2 101 ? -5.644  51.768  -0.522  1.00 0.00 ?  155 LYS B HD3  1  
ATOM   4926   H  HE2  . LYS B  2 101 ? -7.932  52.540  -1.733  1.00 0.00 ?  155 LYS B HE2  1  
ATOM   4927   H  HE3  . LYS B  2 101 ? -8.759  52.255  -0.141  1.00 0.00 ?  155 LYS B HE3  1  
ATOM   4928   H  HZ1  . LYS B  2 101 ? -6.478  54.092  -0.395  1.00 0.00 ?  155 LYS B HZ1  1  
ATOM   4929   H  HZ2  . LYS B  2 101 ? -7.374  53.779  0.957   1.00 0.00 ?  155 LYS B HZ2  1  
ATOM   4930   H  HZ3  . LYS B  2 101 ? -8.024  54.650  -0.392  1.00 0.00 ?  155 LYS B HZ3  1  
ATOM   4931   N  N    . LEU B  2 102 ? -4.330  49.623  -5.050  1.00 0.00 ?  156 LEU B N    1  
ATOM   4932   C  CA   . LEU B  2 102 ? -3.330  48.896  -5.855  1.00 0.00 ?  156 LEU B CA   1  
ATOM   4933   C  C    . LEU B  2 102 ? -2.168  49.835  -6.118  1.00 0.00 ?  156 LEU B C    1  
ATOM   4934   O  O    . LEU B  2 102 ? -1.031  49.541  -5.826  1.00 0.00 ?  156 LEU B O    1  
ATOM   4935   C  CB   . LEU B  2 102 ? -4.041  48.392  -7.168  1.00 0.00 ?  156 LEU B CB   1  
ATOM   4936   C  CG   . LEU B  2 102 ? -3.297  47.372  -8.091  1.00 0.00 ?  156 LEU B CG   1  
ATOM   4937   C  CD1  . LEU B  2 102 ? -2.211  48.058  -8.932  1.00 0.00 ?  156 LEU B CD1  1  
ATOM   4938   C  CD2  . LEU B  2 102 ? -2.743  46.116  -7.307  1.00 0.00 ?  156 LEU B CD2  1  
ATOM   4939   H  H    . LEU B  2 102 ? -5.205  49.689  -5.523  1.00 0.00 ?  156 LEU B H    1  
ATOM   4940   H  HA   . LEU B  2 102 ? -3.025  48.092  -5.202  1.00 0.00 ?  156 LEU B HA   1  
ATOM   4941   H  HB2  . LEU B  2 102 ? -4.993  47.955  -6.798  1.00 0.00 ?  156 LEU B HB2  1  
ATOM   4942   H  HB3  . LEU B  2 102 ? -4.303  49.264  -7.805  1.00 0.00 ?  156 LEU B HB3  1  
ATOM   4943   H  HG   . LEU B  2 102 ? -4.092  46.941  -8.736  1.00 0.00 ?  156 LEU B HG   1  
ATOM   4944   H  HD11 . LEU B  2 102 ? -2.534  48.723  -9.762  1.00 0.00 ?  156 LEU B HD11 1  
ATOM   4945   H  HD12 . LEU B  2 102 ? -1.697  47.279  -9.533  1.00 0.00 ?  156 LEU B HD12 1  
ATOM   4946   H  HD13 . LEU B  2 102 ? -1.489  48.500  -8.213  1.00 0.00 ?  156 LEU B HD13 1  
ATOM   4947   H  HD21 . LEU B  2 102 ? -3.573  45.557  -6.825  1.00 0.00 ?  156 LEU B HD21 1  
ATOM   4948   H  HD22 . LEU B  2 102 ? -2.165  46.500  -6.440  1.00 0.00 ?  156 LEU B HD22 1  
ATOM   4949   H  HD23 . LEU B  2 102 ? -2.031  45.455  -7.847  1.00 0.00 ?  156 LEU B HD23 1  
ATOM   4950   N  N    . HIS B  2 103 ? -2.489  51.103  -6.526  1.00 0.00 ?  157 HIS B N    1  
ATOM   4951   C  CA   . HIS B  2 103 ? -1.459  52.192  -6.705  1.00 0.00 ?  157 HIS B CA   1  
ATOM   4952   C  C    . HIS B  2 103 ? -0.824  52.656  -5.396  1.00 0.00 ?  157 HIS B C    1  
ATOM   4953   O  O    . HIS B  2 103 ? 0.406   52.704  -5.197  1.00 0.00 ?  157 HIS B O    1  
ATOM   4954   C  CB   . HIS B  2 103 ? -2.187  53.382  -7.318  1.00 0.00 ?  157 HIS B CB   1  
ATOM   4955   C  CG   . HIS B  2 103 ? -2.659  53.286  -8.672  1.00 0.00 ?  157 HIS B CG   1  
ATOM   4956   N  ND1  . HIS B  2 103 ? -1.887  52.904  -9.844  1.00 0.00 ?  157 HIS B ND1  1  
ATOM   4957   C  CD2  . HIS B  2 103 ? -3.912  53.521  -9.184  1.00 0.00 ?  157 HIS B CD2  1  
ATOM   4958   C  CE1  . HIS B  2 103 ? -2.714  52.901  -10.875 1.00 0.00 ?  157 HIS B CE1  1  
ATOM   4959   N  NE2  . HIS B  2 103 ? -3.948  53.258  -10.534 1.00 0.00 ?  157 HIS B NE2  1  
ATOM   4960   H  H    . HIS B  2 103 ? -3.464  51.290  -6.615  1.00 0.00 ?  157 HIS B H    1  
ATOM   4961   H  HA   . HIS B  2 103 ? -0.669  51.748  -7.291  1.00 0.00 ?  157 HIS B HA   1  
ATOM   4962   H  HB2  . HIS B  2 103 ? -3.079  53.686  -6.730  1.00 0.00 ?  157 HIS B HB2  1  
ATOM   4963   H  HB3  . HIS B  2 103 ? -1.386  54.149  -7.398  1.00 0.00 ?  157 HIS B HB3  1  
ATOM   4964   H  HD1  . HIS B  2 103 ? -0.889  52.879  -9.906  1.00 0.00 ?  157 HIS B HD1  1  
ATOM   4965   H  HD2  . HIS B  2 103 ? -4.781  53.780  -8.591  1.00 0.00 ?  157 HIS B HD2  1  
ATOM   4966   H  HE1  . HIS B  2 103 ? -2.316  52.615  -11.849 1.00 0.00 ?  157 HIS B HE1  1  
ATOM   4967   N  N    . GLU B  2 104 ? -1.685  52.874  -4.304  1.00 0.00 ?  158 GLU B N    1  
ATOM   4968   C  CA   . GLU B  2 104 ? -1.259  53.154  -2.938  1.00 0.00 ?  158 GLU B CA   1  
ATOM   4969   C  C    . GLU B  2 104 ? -0.301  52.163  -2.387  1.00 0.00 ?  158 GLU B C    1  
ATOM   4970   O  O    . GLU B  2 104 ? 0.644   52.572  -1.670  1.00 0.00 ?  158 GLU B O    1  
ATOM   4971   C  CB   . GLU B  2 104 ? -2.391  53.524  -1.997  1.00 0.00 ?  158 GLU B CB   1  
ATOM   4972   C  CG   . GLU B  2 104 ? -3.180  54.839  -2.153  1.00 0.00 ?  158 GLU B CG   1  
ATOM   4973   C  CD   . GLU B  2 104 ? -4.441  54.893  -1.258  1.00 0.00 ?  158 GLU B CD   1  
ATOM   4974   O  OE1  . GLU B  2 104 ? -4.563  54.193  -0.227  1.00 0.00 ?  158 GLU B OE1  1  
ATOM   4975   O  OE2  . GLU B  2 104 ? -5.251  55.800  -1.489  1.00 0.00 -1 158 GLU B OE2  1  
ATOM   4976   H  H    . GLU B  2 104 ? -2.664  52.770  -4.465  1.00 0.00 ?  158 GLU B H    1  
ATOM   4977   H  HA   . GLU B  2 104 ? -0.730  54.094  -2.992  1.00 0.00 ?  158 GLU B HA   1  
ATOM   4978   H  HB2  . GLU B  2 104 ? -3.152  52.716  -2.042  1.00 0.00 ?  158 GLU B HB2  1  
ATOM   4979   H  HB3  . GLU B  2 104 ? -1.895  53.575  -1.004  1.00 0.00 ?  158 GLU B HB3  1  
ATOM   4980   H  HG2  . GLU B  2 104 ? -2.530  55.675  -1.816  1.00 0.00 ?  158 GLU B HG2  1  
ATOM   4981   H  HG3  . GLU B  2 104 ? -3.504  55.094  -3.184  1.00 0.00 ?  158 GLU B HG3  1  
ATOM   4982   N  N    . LEU B  2 105 ? -0.500  50.863  -2.700  1.00 0.00 ?  159 LEU B N    1  
ATOM   4983   C  CA   . LEU B  2 105 ? 0.429   49.805  -2.390  1.00 0.00 ?  159 LEU B CA   1  
ATOM   4984   C  C    . LEU B  2 105 ? 1.765   49.934  -2.983  1.00 0.00 ?  159 LEU B C    1  
ATOM   4985   O  O    . LEU B  2 105 ? 2.742   49.659  -2.324  1.00 0.00 ?  159 LEU B O    1  
ATOM   4986   C  CB   . LEU B  2 105 ? -0.267  48.435  -2.677  1.00 0.00 ?  159 LEU B CB   1  
ATOM   4987   C  CG   . LEU B  2 105 ? 0.620   47.135  -2.332  1.00 0.00 ?  159 LEU B CG   1  
ATOM   4988   C  CD1  . LEU B  2 105 ? 1.049   47.106  -0.859  1.00 0.00 ?  159 LEU B CD1  1  
ATOM   4989   C  CD2  . LEU B  2 105 ? -0.046  45.799  -2.787  1.00 0.00 ?  159 LEU B CD2  1  
ATOM   4990   H  H    . LEU B  2 105 ? -1.368  50.633  -3.135  1.00 0.00 ?  159 LEU B H    1  
ATOM   4991   H  HA   . LEU B  2 105 ? 0.556   49.845  -1.319  1.00 0.00 ?  159 LEU B HA   1  
ATOM   4992   H  HB2  . LEU B  2 105 ? -1.228  48.370  -2.124  1.00 0.00 ?  159 LEU B HB2  1  
ATOM   4993   H  HB3  . LEU B  2 105 ? -0.501  48.334  -3.759  1.00 0.00 ?  159 LEU B HB3  1  
ATOM   4994   H  HG   . LEU B  2 105 ? 1.507   47.248  -2.992  1.00 0.00 ?  159 LEU B HG   1  
ATOM   4995   H  HD11 . LEU B  2 105 ? 0.226   47.464  -0.205  1.00 0.00 ?  159 LEU B HD11 1  
ATOM   4996   H  HD12 . LEU B  2 105 ? 1.871   47.825  -0.655  1.00 0.00 ?  159 LEU B HD12 1  
ATOM   4997   H  HD13 . LEU B  2 105 ? 1.464   46.106  -0.607  1.00 0.00 ?  159 LEU B HD13 1  
ATOM   4998   H  HD21 . LEU B  2 105 ? -0.524  45.916  -3.783  1.00 0.00 ?  159 LEU B HD21 1  
ATOM   4999   H  HD22 . LEU B  2 105 ? -0.806  45.426  -2.067  1.00 0.00 ?  159 LEU B HD22 1  
ATOM   5000   H  HD23 . LEU B  2 105 ? 0.710   44.989  -2.861  1.00 0.00 ?  159 LEU B HD23 1  
ATOM   5001   N  N    . GLN B  2 106 ? 1.743   50.216  -4.250  1.00 0.00 ?  160 GLN B N    1  
ATOM   5002   C  CA   . GLN B  2 106 ? 2.906   50.320  -5.154  1.00 0.00 ?  160 GLN B CA   1  
ATOM   5003   C  C    . GLN B  2 106 ? 3.809   51.486  -4.608  1.00 0.00 ?  160 GLN B C    1  
ATOM   5004   O  O    . GLN B  2 106 ? 4.998   51.255  -4.418  1.00 0.00 ?  160 GLN B O    1  
ATOM   5005   C  CB   . GLN B  2 106 ? 2.548   50.570  -6.627  1.00 0.00 ?  160 GLN B CB   1  
ATOM   5006   C  CG   . GLN B  2 106 ? 1.785   49.430  -7.401  1.00 0.00 ?  160 GLN B CG   1  
ATOM   5007   C  CD   . GLN B  2 106 ? 2.077   47.937  -6.973  1.00 0.00 ?  160 GLN B CD   1  
ATOM   5008   O  OE1  . GLN B  2 106 ? 3.064   47.333  -7.411  1.00 0.00 ?  160 GLN B OE1  1  
ATOM   5009   N  NE2  . GLN B  2 106 ? 1.163   47.388  -6.092  1.00 0.00 ?  160 GLN B NE2  1  
ATOM   5010   H  H    . GLN B  2 106 ? 0.830   50.388  -4.609  1.00 0.00 ?  160 GLN B H    1  
ATOM   5011   H  HA   . GLN B  2 106 ? 3.440   49.383  -5.088  1.00 0.00 ?  160 GLN B HA   1  
ATOM   5012   H  HB2  . GLN B  2 106 ? 2.050   51.537  -6.852  1.00 0.00 ?  160 GLN B HB2  1  
ATOM   5013   H  HB3  . GLN B  2 106 ? 3.551   50.586  -7.104  1.00 0.00 ?  160 GLN B HB3  1  
ATOM   5014   H  HG2  . GLN B  2 106 ? 0.698   49.642  -7.317  1.00 0.00 ?  160 GLN B HG2  1  
ATOM   5015   H  HG3  . GLN B  2 106 ? 1.952   49.350  -8.496  1.00 0.00 ?  160 GLN B HG3  1  
ATOM   5016   H  HE21 . GLN B  2 106 ? 1.462   46.514  -5.708  1.00 0.00 ?  160 GLN B HE21 1  
ATOM   5017   H  HE22 . GLN B  2 106 ? 0.269   47.801  -5.921  1.00 0.00 ?  160 GLN B HE22 1  
ATOM   5018   N  N    . GLU B  2 107 ? 3.145   52.581  -4.222  1.00 0.00 ?  161 GLU B N    1  
ATOM   5019   C  CA   . GLU B  2 107 ? 3.888   53.756  -3.752  1.00 0.00 ?  161 GLU B CA   1  
ATOM   5020   C  C    . GLU B  2 107 ? 4.808   53.473  -2.504  1.00 0.00 ?  161 GLU B C    1  
ATOM   5021   O  O    . GLU B  2 107 ? 5.888   54.046  -2.358  1.00 0.00 ?  161 GLU B O    1  
ATOM   5022   C  CB   . GLU B  2 107 ? 2.927   54.919  -3.406  1.00 0.00 ?  161 GLU B CB   1  
ATOM   5023   C  CG   . GLU B  2 107 ? 3.719   56.121  -2.829  1.00 0.00 ?  161 GLU B CG   1  
ATOM   5024   C  CD   . GLU B  2 107 ? 3.037   57.452  -2.691  1.00 0.00 ?  161 GLU B CD   1  
ATOM   5025   O  OE1  . GLU B  2 107 ? 2.700   57.772  -1.495  1.00 0.00 ?  161 GLU B OE1  1  
ATOM   5026   O  OE2  . GLU B  2 107 ? 2.761   58.103  -3.748  1.00 0.00 -1 161 GLU B OE2  1  
ATOM   5027   H  H    . GLU B  2 107 ? 2.185   52.545  -4.486  1.00 0.00 ?  161 GLU B H    1  
ATOM   5028   H  HA   . GLU B  2 107 ? 4.528   54.098  -4.552  1.00 0.00 ?  161 GLU B HA   1  
ATOM   5029   H  HB2  . GLU B  2 107 ? 2.328   55.209  -4.296  1.00 0.00 ?  161 GLU B HB2  1  
ATOM   5030   H  HB3  . GLU B  2 107 ? 2.180   54.551  -2.671  1.00 0.00 ?  161 GLU B HB3  1  
ATOM   5031   H  HG2  . GLU B  2 107 ? 3.913   55.793  -1.785  1.00 0.00 ?  161 GLU B HG2  1  
ATOM   5032   H  HG3  . GLU B  2 107 ? 4.691   56.298  -3.339  1.00 0.00 ?  161 GLU B HG3  1  
ATOM   5033   N  N    . LYS B  2 108 ? 4.299   52.600  -1.598  1.00 0.00 ?  162 LYS B N    1  
ATOM   5034   C  CA   . LYS B  2 108 ? 5.086   52.058  -0.506  1.00 0.00 ?  162 LYS B CA   1  
ATOM   5035   C  C    . LYS B  2 108 ? 6.149   51.120  -0.962  1.00 0.00 ?  162 LYS B C    1  
ATOM   5036   O  O    . LYS B  2 108 ? 7.201   51.117  -0.267  1.00 0.00 ?  162 LYS B O    1  
ATOM   5037   C  CB   . LYS B  2 108 ? 4.244   51.494  0.593   1.00 0.00 ?  162 LYS B CB   1  
ATOM   5038   C  CG   . LYS B  2 108 ? 3.301   52.381  1.389   1.00 0.00 ?  162 LYS B CG   1  
ATOM   5039   C  CD   . LYS B  2 108 ? 3.976   53.502  2.146   1.00 0.00 ?  162 LYS B CD   1  
ATOM   5040   C  CE   . LYS B  2 108 ? 2.945   54.485  2.720   1.00 0.00 ?  162 LYS B CE   1  
ATOM   5041   N  NZ   . LYS B  2 108 ? 3.774   55.652  3.008   1.00 0.00 1  162 LYS B NZ   1  
ATOM   5042   H  H    . LYS B  2 108 ? 3.350   52.315  -1.708  1.00 0.00 ?  162 LYS B H    1  
ATOM   5043   H  HA   . LYS B  2 108 ? 5.668   52.893  -0.143  1.00 0.00 ?  162 LYS B HA   1  
ATOM   5044   H  HB2  . LYS B  2 108 ? 3.528   50.816  0.082   1.00 0.00 ?  162 LYS B HB2  1  
ATOM   5045   H  HB3  . LYS B  2 108 ? 4.906   50.909  1.266   1.00 0.00 ?  162 LYS B HB3  1  
ATOM   5046   H  HG2  . LYS B  2 108 ? 2.457   52.764  0.776   1.00 0.00 ?  162 LYS B HG2  1  
ATOM   5047   H  HG3  . LYS B  2 108 ? 2.727   51.787  2.133   1.00 0.00 ?  162 LYS B HG3  1  
ATOM   5048   H  HD2  . LYS B  2 108 ? 4.586   53.157  3.009   1.00 0.00 ?  162 LYS B HD2  1  
ATOM   5049   H  HD3  . LYS B  2 108 ? 4.638   54.018  1.418   1.00 0.00 ?  162 LYS B HD3  1  
ATOM   5050   H  HE2  . LYS B  2 108 ? 2.074   54.712  2.069   1.00 0.00 ?  162 LYS B HE2  1  
ATOM   5051   H  HE3  . LYS B  2 108 ? 2.526   54.069  3.661   1.00 0.00 ?  162 LYS B HE3  1  
ATOM   5052   H  HZ1  . LYS B  2 108 ? 4.630   55.292  3.476   1.00 0.00 ?  162 LYS B HZ1  1  
ATOM   5053   H  HZ2  . LYS B  2 108 ? 3.311   56.361  3.611   1.00 0.00 ?  162 LYS B HZ2  1  
ATOM   5054   H  HZ3  . LYS B  2 108 ? 4.081   56.181  2.166   1.00 0.00 ?  162 LYS B HZ3  1  
ATOM   5055   N  N    . LEU B  2 109 ? 6.089   50.376  -2.044  1.00 0.00 ?  163 LEU B N    1  
ATOM   5056   C  CA   . LEU B  2 109 ? 7.100   49.509  -2.536  1.00 0.00 ?  163 LEU B CA   1  
ATOM   5057   C  C    . LEU B  2 109 ? 8.226   50.300  -3.280  1.00 0.00 ?  163 LEU B C    1  
ATOM   5058   O  O    . LEU B  2 109 ? 9.394   49.836  -3.361  1.00 0.00 ?  163 LEU B O    1  
ATOM   5059   C  CB   . LEU B  2 109 ? 6.440   48.518  -3.515  1.00 0.00 ?  163 LEU B CB   1  
ATOM   5060   C  CG   . LEU B  2 109 ? 5.637   47.402  -2.889  1.00 0.00 ?  163 LEU B CG   1  
ATOM   5061   C  CD1  . LEU B  2 109 ? 4.823   46.753  -4.028  1.00 0.00 ?  163 LEU B CD1  1  
ATOM   5062   C  CD2  . LEU B  2 109 ? 6.317   46.286  -2.181  1.00 0.00 ?  163 LEU B CD2  1  
ATOM   5063   H  H    . LEU B  2 109 ? 5.213   50.388  -2.519  1.00 0.00 ?  163 LEU B H    1  
ATOM   5064   H  HA   . LEU B  2 109 ? 7.564   48.875  -1.795  1.00 0.00 ?  163 LEU B HA   1  
ATOM   5065   H  HB2  . LEU B  2 109 ? 5.733   48.976  -4.240  1.00 0.00 ?  163 LEU B HB2  1  
ATOM   5066   H  HB3  . LEU B  2 109 ? 7.240   48.032  -4.113  1.00 0.00 ?  163 LEU B HB3  1  
ATOM   5067   H  HG   . LEU B  2 109 ? 4.951   47.700  -2.068  1.00 0.00 ?  163 LEU B HG   1  
ATOM   5068   H  HD11 . LEU B  2 109 ? 4.096   46.013  -3.630  1.00 0.00 ?  163 LEU B HD11 1  
ATOM   5069   H  HD12 . LEU B  2 109 ? 5.425   46.281  -4.834  1.00 0.00 ?  163 LEU B HD12 1  
ATOM   5070   H  HD13 . LEU B  2 109 ? 4.156   47.526  -4.466  1.00 0.00 ?  163 LEU B HD13 1  
ATOM   5071   H  HD21 . LEU B  2 109 ? 5.560   45.624  -1.710  1.00 0.00 ?  163 LEU B HD21 1  
ATOM   5072   H  HD22 . LEU B  2 109 ? 7.087   46.561  -1.429  1.00 0.00 ?  163 LEU B HD22 1  
ATOM   5073   H  HD23 . LEU B  2 109 ? 6.705   45.546  -2.913  1.00 0.00 ?  163 LEU B HD23 1  
ATOM   5074   N  N    . SER B  2 110 ? 7.995   51.549  -3.734  1.00 0.00 ?  164 SER B N    1  
ATOM   5075   C  CA   . SER B  2 110 ? 8.821   52.441  -4.419  1.00 0.00 ?  164 SER B CA   1  
ATOM   5076   C  C    . SER B  2 110 ? 10.174  52.713  -3.697  1.00 0.00 ?  164 SER B C    1  
ATOM   5077   O  O    . SER B  2 110 ? 11.271  52.607  -4.347  1.00 0.00 ?  164 SER B O    1  
ATOM   5078   C  CB   . SER B  2 110 ? 8.123   53.837  -4.751  1.00 0.00 ?  164 SER B CB   1  
ATOM   5079   O  OG   . SER B  2 110 ? 8.843   54.767  -5.471  1.00 0.00 ?  164 SER B OG   1  
ATOM   5080   H  H    . SER B  2 110 ? 7.040   51.834  -3.711  1.00 0.00 ?  164 SER B H    1  
ATOM   5081   H  HA   . SER B  2 110 ? 9.051   51.863  -5.302  1.00 0.00 ?  164 SER B HA   1  
ATOM   5082   H  HB2  . SER B  2 110 ? 7.260   53.604  -5.411  1.00 0.00 ?  164 SER B HB2  1  
ATOM   5083   H  HB3  . SER B  2 110 ? 7.714   54.537  -3.992  1.00 0.00 ?  164 SER B HB3  1  
ATOM   5084   H  HG   . SER B  2 110 ? 9.502   55.130  -4.875  1.00 0.00 ?  164 SER B HG   1  
ATOM   5085   N  N    . PRO B  2 111 ? 10.265  53.027  -2.362  1.00 0.00 ?  165 PRO B N    1  
ATOM   5086   C  CA   . PRO B  2 111 ? 11.576  53.446  -1.823  1.00 0.00 ?  165 PRO B CA   1  
ATOM   5087   C  C    . PRO B  2 111 ? 12.451  52.276  -1.621  1.00 0.00 ?  165 PRO B C    1  
ATOM   5088   O  O    . PRO B  2 111 ? 13.624  52.477  -1.324  1.00 0.00 ?  165 PRO B O    1  
ATOM   5089   C  CB   . PRO B  2 111 ? 11.239  54.036  -0.460  1.00 0.00 ?  165 PRO B CB   1  
ATOM   5090   C  CG   . PRO B  2 111 ? 9.887   53.369  -0.074  1.00 0.00 ?  165 PRO B CG   1  
ATOM   5091   C  CD   . PRO B  2 111 ? 9.175   53.412  -1.443  1.00 0.00 ?  165 PRO B CD   1  
ATOM   5092   H  HA   . PRO B  2 111 ? 12.080  54.177  -2.438  1.00 0.00 ?  165 PRO B HA   1  
ATOM   5093   H  HB2  . PRO B  2 111 ? 11.988  53.922  0.351   1.00 0.00 ?  165 PRO B HB2  1  
ATOM   5094   H  HB3  . PRO B  2 111 ? 11.017  55.102  -0.682  1.00 0.00 ?  165 PRO B HB3  1  
ATOM   5095   H  HG2  . PRO B  2 111 ? 10.056  52.373  0.389   1.00 0.00 ?  165 PRO B HG2  1  
ATOM   5096   H  HG3  . PRO B  2 111 ? 9.319   54.025  0.620   1.00 0.00 ?  165 PRO B HG3  1  
ATOM   5097   H  HD2  . PRO B  2 111 ? 8.304   52.755  -1.657  1.00 0.00 ?  165 PRO B HD2  1  
ATOM   5098   H  HD3  . PRO B  2 111 ? 8.916   54.460  -1.704  1.00 0.00 ?  165 PRO B HD3  1  
ATOM   5099   N  N    . LEU B  2 112 ? 11.855  51.040  -1.681  1.00 0.00 ?  166 LEU B N    1  
ATOM   5100   C  CA   . LEU B  2 112 ? 12.700  49.855  -1.627  1.00 0.00 ?  166 LEU B CA   1  
ATOM   5101   C  C    . LEU B  2 112 ? 13.379  49.648  -2.979  1.00 0.00 ?  166 LEU B C    1  
ATOM   5102   O  O    . LEU B  2 112 ? 14.532  49.305  -3.050  1.00 0.00 ?  166 LEU B O    1  
ATOM   5103   C  CB   . LEU B  2 112 ? 11.762  48.684  -1.317  1.00 0.00 ?  166 LEU B CB   1  
ATOM   5104   C  CG   . LEU B  2 112 ? 10.749  48.878  -0.134  1.00 0.00 ?  166 LEU B CG   1  
ATOM   5105   C  CD1  . LEU B  2 112 ? 10.057  47.610  0.244   1.00 0.00 ?  166 LEU B CD1  1  
ATOM   5106   C  CD2  . LEU B  2 112 ? 11.354  49.530  1.116   1.00 0.00 ?  166 LEU B CD2  1  
ATOM   5107   H  H    . LEU B  2 112 ? 10.876  50.900  -1.804  1.00 0.00 ?  166 LEU B H    1  
ATOM   5108   H  HA   . LEU B  2 112 ? 13.378  49.942  -0.791  1.00 0.00 ?  166 LEU B HA   1  
ATOM   5109   H  HB2  . LEU B  2 112 ? 11.056  48.408  -2.129  1.00 0.00 ?  166 LEU B HB2  1  
ATOM   5110   H  HB3  . LEU B  2 112 ? 12.415  47.805  -1.127  1.00 0.00 ?  166 LEU B HB3  1  
ATOM   5111   H  HG   . LEU B  2 112 ? 9.991   49.583  -0.538  1.00 0.00 ?  166 LEU B HG   1  
ATOM   5112   H  HD11 . LEU B  2 112 ? 9.383   47.926  1.069   1.00 0.00 ?  166 LEU B HD11 1  
ATOM   5113   H  HD12 . LEU B  2 112 ? 10.744  46.929  0.791   1.00 0.00 ?  166 LEU B HD12 1  
ATOM   5114   H  HD13 . LEU B  2 112 ? 9.520   47.252  -0.660  1.00 0.00 ?  166 LEU B HD13 1  
ATOM   5115   H  HD21 . LEU B  2 112 ? 11.790  50.543  0.980   1.00 0.00 ?  166 LEU B HD21 1  
ATOM   5116   H  HD22 . LEU B  2 112 ? 12.243  48.928  1.401   1.00 0.00 ?  166 LEU B HD22 1  
ATOM   5117   H  HD23 . LEU B  2 112 ? 10.642  49.495  1.967   1.00 0.00 ?  166 LEU B HD23 1  
ATOM   5118   N  N    . GLY B  2 113 ? 12.577  49.861  -4.039  1.00 0.00 ?  167 GLY B N    1  
ATOM   5119   C  CA   . GLY B  2 113 ? 13.041  49.695  -5.463  1.00 0.00 ?  167 GLY B CA   1  
ATOM   5120   C  C    . GLY B  2 113 ? 13.986  50.778  -5.856  1.00 0.00 ?  167 GLY B C    1  
ATOM   5121   O  O    . GLY B  2 113 ? 14.931  50.535  -6.627  1.00 0.00 ?  167 GLY B O    1  
ATOM   5122   H  H    . GLY B  2 113 ? 11.593  50.007  -3.976  1.00 0.00 ?  167 GLY B H    1  
ATOM   5123   H  HA2  . GLY B  2 113 ? 13.661  48.827  -5.630  1.00 0.00 ?  167 GLY B HA2  1  
ATOM   5124   H  HA3  . GLY B  2 113 ? 12.320  49.839  -6.254  1.00 0.00 ?  167 GLY B HA3  1  
ATOM   5125   N  N    . GLU B  2 114 ? 13.721  51.975  -5.464  1.00 0.00 ?  168 GLU B N    1  
ATOM   5126   C  CA   . GLU B  2 114 ? 14.449  53.204  -5.805  1.00 0.00 ?  168 GLU B CA   1  
ATOM   5127   C  C    . GLU B  2 114 ? 15.887  53.164  -5.435  1.00 0.00 ?  168 GLU B C    1  
ATOM   5128   O  O    . GLU B  2 114 ? 16.731  53.539  -6.218  1.00 0.00 ?  168 GLU B O    1  
ATOM   5129   C  CB   . GLU B  2 114 ? 13.715  54.443  -5.297  1.00 0.00 ?  168 GLU B CB   1  
ATOM   5130   C  CG   . GLU B  2 114 ? 14.513  55.699  -5.416  1.00 0.00 ?  168 GLU B CG   1  
ATOM   5131   C  CD   . GLU B  2 114 ? 13.665  56.971  -5.014  1.00 0.00 ?  168 GLU B CD   1  
ATOM   5132   O  OE1  . GLU B  2 114 ? 12.614  56.723  -4.379  1.00 0.00 ?  168 GLU B OE1  1  
ATOM   5133   O  OE2  . GLU B  2 114 ? 14.117  58.060  -5.225  1.00 0.00 -1 168 GLU B OE2  1  
ATOM   5134   H  H    . GLU B  2 114 ? 13.107  52.106  -4.690  1.00 0.00 ?  168 GLU B H    1  
ATOM   5135   H  HA   . GLU B  2 114 ? 14.625  53.381  -6.856  1.00 0.00 ?  168 GLU B HA   1  
ATOM   5136   H  HB2  . GLU B  2 114 ? 12.693  54.436  -5.733  1.00 0.00 ?  168 GLU B HB2  1  
ATOM   5137   H  HB3  . GLU B  2 114 ? 13.526  54.324  -4.209  1.00 0.00 ?  168 GLU B HB3  1  
ATOM   5138   H  HG2  . GLU B  2 114 ? 15.434  55.626  -4.799  1.00 0.00 ?  168 GLU B HG2  1  
ATOM   5139   H  HG3  . GLU B  2 114 ? 14.793  55.916  -6.469  1.00 0.00 ?  168 GLU B HG3  1  
ATOM   5140   N  N    . GLU B  2 115 ? 16.207  52.708  -4.206  1.00 0.00 ?  169 GLU B N    1  
ATOM   5141   C  CA   . GLU B  2 115 ? 17.579  52.521  -3.810  1.00 0.00 ?  169 GLU B CA   1  
ATOM   5142   C  C    . GLU B  2 115 ? 18.312  51.366  -4.371  1.00 0.00 ?  169 GLU B C    1  
ATOM   5143   O  O    . GLU B  2 115 ? 19.481  51.061  -4.110  1.00 0.00 ?  169 GLU B O    1  
ATOM   5144   C  CB   . GLU B  2 115 ? 17.700  52.580  -2.296  1.00 0.00 ?  169 GLU B CB   1  
ATOM   5145   C  CG   . GLU B  2 115 ? 17.339  54.011  -1.763  1.00 0.00 ?  169 GLU B CG   1  
ATOM   5146   C  CD   . GLU B  2 115 ? 17.470  53.996  -0.226  1.00 0.00 ?  169 GLU B CD   1  
ATOM   5147   O  OE1  . GLU B  2 115 ? 16.856  53.146  0.450   1.00 0.00 ?  169 GLU B OE1  1  
ATOM   5148   O  OE2  . GLU B  2 115 ? 18.210  54.819  0.378   1.00 0.00 -1 169 GLU B OE2  1  
ATOM   5149   H  H    . GLU B  2 115 ? 15.495  52.415  -3.573  1.00 0.00 ?  169 GLU B H    1  
ATOM   5150   H  HA   . GLU B  2 115 ? 18.157  53.379  -4.121  1.00 0.00 ?  169 GLU B HA   1  
ATOM   5151   H  HB2  . GLU B  2 115 ? 17.072  51.783  -1.843  1.00 0.00 ?  169 GLU B HB2  1  
ATOM   5152   H  HB3  . GLU B  2 115 ? 18.766  52.571  -1.986  1.00 0.00 ?  169 GLU B HB3  1  
ATOM   5153   H  HG2  . GLU B  2 115 ? 18.012  54.767  -2.221  1.00 0.00 ?  169 GLU B HG2  1  
ATOM   5154   H  HG3  . GLU B  2 115 ? 16.290  54.277  -2.014  1.00 0.00 ?  169 GLU B HG3  1  
ATOM   5155   N  N    . MET B  2 116 ? 17.572  50.434  -5.080  1.00 0.00 ?  170 MET B N    1  
ATOM   5156   C  CA   . MET B  2 116 ? 18.096  49.163  -5.416  1.00 0.00 ?  170 MET B CA   1  
ATOM   5157   C  C    . MET B  2 116 ? 18.215  49.064  -7.007  1.00 0.00 ?  170 MET B C    1  
ATOM   5158   O  O    . MET B  2 116 ? 18.502  47.982  -7.560  1.00 0.00 ?  170 MET B O    1  
ATOM   5159   C  CB   . MET B  2 116 ? 17.296  47.950  -4.841  1.00 0.00 ?  170 MET B CB   1  
ATOM   5160   C  CG   . MET B  2 116 ? 17.643  47.869  -3.328  1.00 0.00 ?  170 MET B CG   1  
ATOM   5161   S  SD   . MET B  2 116 ? 19.265  47.089  -3.056  1.00 0.00 ?  170 MET B SD   1  
ATOM   5162   C  CE   . MET B  2 116 ? 19.297  47.172  -1.232  1.00 0.00 ?  170 MET B CE   1  
ATOM   5163   H  H    . MET B  2 116 ? 16.618  50.650  -5.268  1.00 0.00 ?  170 MET B H    1  
ATOM   5164   H  HA   . MET B  2 116 ? 19.095  49.044  -5.024  1.00 0.00 ?  170 MET B HA   1  
ATOM   5165   H  HB2  . MET B  2 116 ? 16.201  48.136  -4.871  1.00 0.00 ?  170 MET B HB2  1  
ATOM   5166   H  HB3  . MET B  2 116 ? 17.620  47.037  -5.386  1.00 0.00 ?  170 MET B HB3  1  
ATOM   5167   H  HG2  . MET B  2 116 ? 17.584  48.814  -2.747  1.00 0.00 ?  170 MET B HG2  1  
ATOM   5168   H  HG3  . MET B  2 116 ? 16.741  47.397  -2.883  1.00 0.00 ?  170 MET B HG3  1  
ATOM   5169   H  HE1  . MET B  2 116 ? 20.212  46.758  -0.757  1.00 0.00 ?  170 MET B HE1  1  
ATOM   5170   H  HE2  . MET B  2 116 ? 18.497  46.514  -0.830  1.00 0.00 ?  170 MET B HE2  1  
ATOM   5171   H  HE3  . MET B  2 116 ? 19.073  48.214  -0.919  1.00 0.00 ?  170 MET B HE3  1  
ATOM   5172   N  N    . ARG B  2 117 ? 18.037  50.235  -7.746  1.00 0.00 ?  171 ARG B N    1  
ATOM   5173   C  CA   . ARG B  2 117 ? 18.016  50.355  -9.195  1.00 0.00 ?  171 ARG B CA   1  
ATOM   5174   C  C    . ARG B  2 117 ? 19.427  49.874  -9.870  1.00 0.00 ?  171 ARG B C    1  
ATOM   5175   O  O    . ARG B  2 117 ? 19.418  49.282  -10.939 1.00 0.00 ?  171 ARG B O    1  
ATOM   5176   C  CB   . ARG B  2 117 ? 17.662  51.696  -9.694  1.00 0.00 ?  171 ARG B CB   1  
ATOM   5177   C  CG   . ARG B  2 117 ? 16.148  52.095  -9.452  1.00 0.00 ?  171 ARG B CG   1  
ATOM   5178   C  CD   . ARG B  2 117 ? 15.738  53.399  -10.212 1.00 0.00 ?  171 ARG B CD   1  
ATOM   5179   N  NE   . ARG B  2 117 ? 14.371  53.795  -9.622  1.00 0.00 ?  171 ARG B NE   1  
ATOM   5180   C  CZ   . ARG B  2 117 ? 13.871  54.999  -9.533  1.00 0.00 ?  171 ARG B CZ   1  
ATOM   5181   N  NH1  . ARG B  2 117 ? 12.604  55.199  -9.301  1.00 0.00 1  171 ARG B NH1  1  
ATOM   5182   N  NH2  . ARG B  2 117 ? 14.503  56.093  -9.843  1.00 0.00 ?  171 ARG B NH2  1  
ATOM   5183   H  H    . ARG B  2 117 ? 17.954  51.139  -7.334  1.00 0.00 ?  171 ARG B H    1  
ATOM   5184   H  HA   . ARG B  2 117 ? 17.287  49.648  -9.565  1.00 0.00 ?  171 ARG B HA   1  
ATOM   5185   H  HB2  . ARG B  2 117 ? 18.280  52.437  -9.144  1.00 0.00 ?  171 ARG B HB2  1  
ATOM   5186   H  HB3  . ARG B  2 117 ? 17.840  51.779  -10.787 1.00 0.00 ?  171 ARG B HB3  1  
ATOM   5187   H  HG2  . ARG B  2 117 ? 15.545  51.253  -9.855  1.00 0.00 ?  171 ARG B HG2  1  
ATOM   5188   H  HG3  . ARG B  2 117 ? 16.032  52.258  -8.359  1.00 0.00 ?  171 ARG B HG3  1  
ATOM   5189   H  HD2  . ARG B  2 117 ? 16.510  54.034  -9.727  1.00 0.00 ?  171 ARG B HD2  1  
ATOM   5190   H  HD3  . ARG B  2 117 ? 15.755  53.356  -11.322 1.00 0.00 ?  171 ARG B HD3  1  
ATOM   5191   H  HE   . ARG B  2 117 ? 13.635  53.132  -9.486  1.00 0.00 ?  171 ARG B HE   1  
ATOM   5192   H  HH11 . ARG B  2 117 ? 11.998  54.440  -9.539  1.00 0.00 ?  171 ARG B HH11 1  
ATOM   5193   H  HH12 . ARG B  2 117 ? 12.313  56.123  -9.545  1.00 0.00 ?  171 ARG B HH12 1  
ATOM   5194   H  HH21 . ARG B  2 117 ? 15.380  55.925  -10.294 1.00 0.00 ?  171 ARG B HH21 1  
ATOM   5195   H  HH22 . ARG B  2 117 ? 14.153  57.001  -9.614  1.00 0.00 ?  171 ARG B HH22 1  
ATOM   5196   N  N    . ASP B  2 118 ? 20.559  50.165  -9.181  1.00 0.00 ?  172 ASP B N    1  
ATOM   5197   C  CA   . ASP B  2 118 ? 21.863  49.528  -9.477  1.00 0.00 ?  172 ASP B CA   1  
ATOM   5198   C  C    . ASP B  2 118 ? 22.602  48.804  -8.314  1.00 0.00 ?  172 ASP B C    1  
ATOM   5199   O  O    . ASP B  2 118 ? 23.388  47.912  -8.540  1.00 0.00 ?  172 ASP B O    1  
ATOM   5200   C  CB   . ASP B  2 118 ? 22.937  50.667  -9.914  1.00 0.00 ?  172 ASP B CB   1  
ATOM   5201   C  CG   . ASP B  2 118 ? 22.433  51.283  -11.195 1.00 0.00 ?  172 ASP B CG   1  
ATOM   5202   O  OD1  . ASP B  2 118 ? 22.187  52.490  -11.191 1.00 0.00 ?  172 ASP B OD1  1  
ATOM   5203   O  OD2  . ASP B  2 118 ? 22.513  50.650  -12.245 1.00 0.00 -1 172 ASP B OD2  1  
ATOM   5204   H  H    . ASP B  2 118 ? 20.583  50.802  -8.414  1.00 0.00 ?  172 ASP B H    1  
ATOM   5205   H  HA   . ASP B  2 118 ? 21.797  48.809  -10.280 1.00 0.00 ?  172 ASP B HA   1  
ATOM   5206   H  HB2  . ASP B  2 118 ? 23.087  51.388  -9.082  1.00 0.00 ?  172 ASP B HB2  1  
ATOM   5207   H  HB3  . ASP B  2 118 ? 23.931  50.208  -10.100 1.00 0.00 ?  172 ASP B HB3  1  
ATOM   5208   N  N    . ARG B  2 119 ? 22.199  49.115  -7.057  1.00 0.00 ?  173 ARG B N    1  
ATOM   5209   C  CA   . ARG B  2 119 ? 22.843  48.656  -5.845  1.00 0.00 ?  173 ARG B CA   1  
ATOM   5210   C  C    . ARG B  2 119 ? 22.832  47.137  -5.561  1.00 0.00 ?  173 ARG B C    1  
ATOM   5211   O  O    . ARG B  2 119 ? 23.820  46.614  -5.100  1.00 0.00 ?  173 ARG B O    1  
ATOM   5212   C  CB   . ARG B  2 119 ? 22.202  49.431  -4.604  1.00 0.00 ?  173 ARG B CB   1  
ATOM   5213   C  CG   . ARG B  2 119 ? 22.502  48.838  -3.201  1.00 0.00 ?  173 ARG B CG   1  
ATOM   5214   C  CD   . ARG B  2 119 ? 21.923  49.572  -2.007  1.00 0.00 ?  173 ARG B CD   1  
ATOM   5215   N  NE   . ARG B  2 119 ? 22.646  50.872  -1.990  1.00 0.00 ?  173 ARG B NE   1  
ATOM   5216   C  CZ   . ARG B  2 119 ? 23.777  51.211  -1.281  1.00 0.00 ?  173 ARG B CZ   1  
ATOM   5217   N  NH1  . ARG B  2 119 ? 24.024  52.467  -0.994  1.00 0.00 1  173 ARG B NH1  1  
ATOM   5218   N  NH2  . ARG B  2 119 ? 24.472  50.264  -0.695  1.00 0.00 ?  173 ARG B NH2  1  
ATOM   5219   H  H    . ARG B  2 119 ? 21.495  49.811  -6.943  1.00 0.00 ?  173 ARG B H    1  
ATOM   5220   H  HA   . ARG B  2 119 ? 23.877  48.909  -6.029  1.00 0.00 ?  173 ARG B HA   1  
ATOM   5221   H  HB2  . ARG B  2 119 ? 22.537  50.490  -4.597  1.00 0.00 ?  173 ARG B HB2  1  
ATOM   5222   H  HB3  . ARG B  2 119 ? 21.108  49.505  -4.782  1.00 0.00 ?  173 ARG B HB3  1  
ATOM   5223   H  HG2  . ARG B  2 119 ? 22.079  47.811  -3.216  1.00 0.00 ?  173 ARG B HG2  1  
ATOM   5224   H  HG3  . ARG B  2 119 ? 23.606  48.735  -3.135  1.00 0.00 ?  173 ARG B HG3  1  
ATOM   5225   H  HD2  . ARG B  2 119 ? 20.846  49.794  -2.164  1.00 0.00 ?  173 ARG B HD2  1  
ATOM   5226   H  HD3  . ARG B  2 119 ? 21.991  49.069  -1.019  1.00 0.00 ?  173 ARG B HD3  1  
ATOM   5227   H  HE   . ARG B  2 119 ? 22.202  51.681  -2.373  1.00 0.00 ?  173 ARG B HE   1  
ATOM   5228   H  HH11 . ARG B  2 119 ? 23.644  53.180  -1.583  1.00 0.00 ?  173 ARG B HH11 1  
ATOM   5229   H  HH12 . ARG B  2 119 ? 24.658  52.788  -0.291  1.00 0.00 ?  173 ARG B HH12 1  
ATOM   5230   H  HH21 . ARG B  2 119 ? 25.330  50.467  -0.224  1.00 0.00 ?  173 ARG B HH21 1  
ATOM   5231   H  HH22 . ARG B  2 119 ? 24.464  49.401  -1.201  1.00 0.00 ?  173 ARG B HH22 1  
ATOM   5232   N  N    . ALA B  2 120 ? 21.605  46.543  -5.818  1.00 0.00 ?  174 ALA B N    1  
ATOM   5233   C  CA   . ALA B  2 120 ? 21.412  45.070  -5.718  1.00 0.00 ?  174 ALA B CA   1  
ATOM   5234   C  C    . ALA B  2 120 ? 22.301  44.336  -6.657  1.00 0.00 ?  174 ALA B C    1  
ATOM   5235   O  O    . ALA B  2 120 ? 22.880  43.315  -6.267  1.00 0.00 ?  174 ALA B O    1  
ATOM   5236   C  CB   . ALA B  2 120 ? 19.935  44.759  -5.959  1.00 0.00 ?  174 ALA B CB   1  
ATOM   5237   H  H    . ALA B  2 120 ? 20.815  47.052  -6.148  1.00 0.00 ?  174 ALA B H    1  
ATOM   5238   H  HA   . ALA B  2 120 ? 21.783  44.704  -4.772  1.00 0.00 ?  174 ALA B HA   1  
ATOM   5239   H  HB1  . ALA B  2 120 ? 19.787  43.679  -5.745  1.00 0.00 ?  174 ALA B HB1  1  
ATOM   5240   H  HB2  . ALA B  2 120 ? 19.706  45.071  -7.001  1.00 0.00 ?  174 ALA B HB2  1  
ATOM   5241   H  HB3  . ALA B  2 120 ? 19.300  45.237  -5.183  1.00 0.00 ?  174 ALA B HB3  1  
ATOM   5242   N  N    . ARG B  2 121 ? 22.393  44.780  -7.882  1.00 0.00 ?  175 ARG B N    1  
ATOM   5243   C  CA   . ARG B  2 121 ? 23.300  44.230  -8.881  1.00 0.00 ?  175 ARG B CA   1  
ATOM   5244   C  C    . ARG B  2 121 ? 24.764  44.412  -8.396  1.00 0.00 ?  175 ARG B C    1  
ATOM   5245   O  O    . ARG B  2 121 ? 25.548  43.528  -8.387  1.00 0.00 ?  175 ARG B O    1  
ATOM   5246   C  CB   . ARG B  2 121 ? 23.005  44.936  -10.196 1.00 0.00 ?  175 ARG B CB   1  
ATOM   5247   C  CG   . ARG B  2 121 ? 23.802  44.414  -11.473 1.00 0.00 ?  175 ARG B CG   1  
ATOM   5248   C  CD   . ARG B  2 121 ? 25.306  44.740  -11.752 1.00 0.00 ?  175 ARG B CD   1  
ATOM   5249   N  NE   . ARG B  2 121 ? 25.421  46.189  -11.481 1.00 0.00 ?  175 ARG B NE   1  
ATOM   5250   C  CZ   . ARG B  2 121 ? 26.534  46.811  -11.094 1.00 0.00 ?  175 ARG B CZ   1  
ATOM   5251   N  NH1  . ARG B  2 121 ? 26.562  48.105  -10.981 1.00 0.00 1  175 ARG B NH1  1  
ATOM   5252   N  NH2  . ARG B  2 121 ? 27.688  46.143  -10.945 1.00 0.00 ?  175 ARG B NH2  1  
ATOM   5253   H  H    . ARG B  2 121 ? 21.960  45.609  -8.227  1.00 0.00 ?  175 ARG B H    1  
ATOM   5254   H  HA   . ARG B  2 121 ? 23.079  43.180  -9.004  1.00 0.00 ?  175 ARG B HA   1  
ATOM   5255   H  HB2  . ARG B  2 121 ? 22.016  44.556  -10.531 1.00 0.00 ?  175 ARG B HB2  1  
ATOM   5256   H  HB3  . ARG B  2 121 ? 22.964  46.037  -10.053 1.00 0.00 ?  175 ARG B HB3  1  
ATOM   5257   H  HG2  . ARG B  2 121 ? 23.566  43.360  -11.734 1.00 0.00 ?  175 ARG B HG2  1  
ATOM   5258   H  HG3  . ARG B  2 121 ? 23.331  45.026  -12.272 1.00 0.00 ?  175 ARG B HG3  1  
ATOM   5259   H  HD2  . ARG B  2 121 ? 25.907  44.118  -11.055 1.00 0.00 ?  175 ARG B HD2  1  
ATOM   5260   H  HD3  . ARG B  2 121 ? 25.486  44.579  -12.837 1.00 0.00 ?  175 ARG B HD3  1  
ATOM   5261   H  HE   . ARG B  2 121 ? 24.732  46.807  -11.858 1.00 0.00 ?  175 ARG B HE   1  
ATOM   5262   H  HH11 . ARG B  2 121 ? 25.796  48.645  -11.330 1.00 0.00 ?  175 ARG B HH11 1  
ATOM   5263   H  HH12 . ARG B  2 121 ? 27.483  48.483  -11.078 1.00 0.00 ?  175 ARG B HH12 1  
ATOM   5264   H  HH21 . ARG B  2 121 ? 28.335  46.576  -10.318 1.00 0.00 ?  175 ARG B HH21 1  
ATOM   5265   H  HH22 . ARG B  2 121 ? 27.818  45.209  -11.277 1.00 0.00 ?  175 ARG B HH22 1  
ATOM   5266   N  N    . ALA B  2 122 ? 25.113  45.616  -7.893  1.00 0.00 ?  176 ALA B N    1  
ATOM   5267   C  CA   . ALA B  2 122 ? 26.483  45.947  -7.558  1.00 0.00 ?  176 ALA B CA   1  
ATOM   5268   C  C    . ALA B  2 122 ? 27.020  45.111  -6.422  1.00 0.00 ?  176 ALA B C    1  
ATOM   5269   O  O    . ALA B  2 122 ? 28.136  44.601  -6.514  1.00 0.00 ?  176 ALA B O    1  
ATOM   5270   C  CB   . ALA B  2 122 ? 26.665  47.420  -7.336  1.00 0.00 ?  176 ALA B CB   1  
ATOM   5271   H  H    . ALA B  2 122 ? 24.519  46.413  -7.975  1.00 0.00 ?  176 ALA B H    1  
ATOM   5272   H  HA   . ALA B  2 122 ? 27.069  45.588  -8.391  1.00 0.00 ?  176 ALA B HA   1  
ATOM   5273   H  HB1  . ALA B  2 122 ? 26.168  48.103  -8.058  1.00 0.00 ?  176 ALA B HB1  1  
ATOM   5274   H  HB2  . ALA B  2 122 ? 27.746  47.678  -7.352  1.00 0.00 ?  176 ALA B HB2  1  
ATOM   5275   H  HB3  . ALA B  2 122 ? 26.143  47.733  -6.407  1.00 0.00 ?  176 ALA B HB3  1  
ATOM   5276   N  N    . HIS B  2 123 ? 26.263  44.904  -5.370  1.00 0.00 ?  177 HIS B N    1  
ATOM   5277   C  CA   . HIS B  2 123 ? 26.590  43.978  -4.207  1.00 0.00 ?  177 HIS B CA   1  
ATOM   5278   C  C    . HIS B  2 123 ? 26.756  42.558  -4.596  1.00 0.00 ?  177 HIS B C    1  
ATOM   5279   O  O    . HIS B  2 123 ? 27.627  41.799  -4.123  1.00 0.00 ?  177 HIS B O    1  
ATOM   5280   C  CB   . HIS B  2 123 ? 25.599  44.063  -2.964  1.00 0.00 ?  177 HIS B CB   1  
ATOM   5281   C  CG   . HIS B  2 123 ? 25.598  45.431  -2.330  1.00 0.00 ?  177 HIS B CG   1  
ATOM   5282   N  ND1  . HIS B  2 123 ? 26.718  46.060  -1.871  1.00 0.00 ?  177 HIS B ND1  1  
ATOM   5283   C  CD2  . HIS B  2 123 ? 24.622  46.342  -2.141  1.00 0.00 ?  177 HIS B CD2  1  
ATOM   5284   C  CE1  . HIS B  2 123 ? 26.308  47.219  -1.194  1.00 0.00 ?  177 HIS B CE1  1  
ATOM   5285   N  NE2  . HIS B  2 123 ? 25.059  47.455  -1.436  1.00 0.00 ?  177 HIS B NE2  1  
ATOM   5286   H  H    . HIS B  2 123 ? 25.400  45.374  -5.201  1.00 0.00 ?  177 HIS B H    1  
ATOM   5287   H  HA   . HIS B  2 123 ? 27.598  44.303  -3.996  1.00 0.00 ?  177 HIS B HA   1  
ATOM   5288   H  HB2  . HIS B  2 123 ? 24.543  43.912  -3.272  1.00 0.00 ?  177 HIS B HB2  1  
ATOM   5289   H  HB3  . HIS B  2 123 ? 25.946  43.306  -2.227  1.00 0.00 ?  177 HIS B HB3  1  
ATOM   5290   H  HD1  . HIS B  2 123 ? 27.641  45.679  -1.823  1.00 0.00 ?  177 HIS B HD1  1  
ATOM   5291   H  HD2  . HIS B  2 123 ? 23.557  46.233  -2.304  1.00 0.00 ?  177 HIS B HD2  1  
ATOM   5292   H  HE1  . HIS B  2 123 ? 26.820  47.817  -0.440  1.00 0.00 ?  177 HIS B HE1  1  
ATOM   5293   N  N    . VAL B  2 124 ? 26.012  42.047  -5.534  1.00 0.00 ?  178 VAL B N    1  
ATOM   5294   C  CA   . VAL B  2 124 ? 26.234  40.710  -6.175  1.00 0.00 ?  178 VAL B CA   1  
ATOM   5295   C  C    . VAL B  2 124 ? 27.523  40.664  -6.903  1.00 0.00 ?  178 VAL B C    1  
ATOM   5296   O  O    . VAL B  2 124 ? 28.359  39.779  -6.611  1.00 0.00 ?  178 VAL B O    1  
ATOM   5297   C  CB   . VAL B  2 124 ? 24.976  40.262  -6.959  1.00 0.00 ?  178 VAL B CB   1  
ATOM   5298   C  CG1  . VAL B  2 124 ? 25.160  39.389  -8.208  1.00 0.00 ?  178 VAL B CG1  1  
ATOM   5299   C  CG2  . VAL B  2 124 ? 24.034  39.489  -5.990  1.00 0.00 ?  178 VAL B CG2  1  
ATOM   5300   H  H    . VAL B  2 124 ? 25.407  42.703  -5.979  1.00 0.00 ?  178 VAL B H    1  
ATOM   5301   H  HA   . VAL B  2 124 ? 26.400  40.068  -5.323  1.00 0.00 ?  178 VAL B HA   1  
ATOM   5302   H  HB   . VAL B  2 124 ? 24.530  41.184  -7.391  1.00 0.00 ?  178 VAL B HB   1  
ATOM   5303   H  HG11 . VAL B  2 124 ? 25.616  38.424  -7.897  1.00 0.00 ?  178 VAL B HG11 1  
ATOM   5304   H  HG12 . VAL B  2 124 ? 25.795  39.896  -8.966  1.00 0.00 ?  178 VAL B HG12 1  
ATOM   5305   H  HG13 . VAL B  2 124 ? 24.207  39.100  -8.700  1.00 0.00 ?  178 VAL B HG13 1  
ATOM   5306   H  HG21 . VAL B  2 124 ? 23.105  39.173  -6.511  1.00 0.00 ?  178 VAL B HG21 1  
ATOM   5307   H  HG22 . VAL B  2 124 ? 23.887  40.079  -5.060  1.00 0.00 ?  178 VAL B HG22 1  
ATOM   5308   H  HG23 . VAL B  2 124 ? 24.560  38.585  -5.615  1.00 0.00 ?  178 VAL B HG23 1  
ATOM   5309   N  N    . ASP B  2 125 ? 27.793  41.685  -7.812  1.00 0.00 ?  179 ASP B N    1  
ATOM   5310   C  CA   . ASP B  2 125 ? 28.993  41.798  -8.550  1.00 0.00 ?  179 ASP B CA   1  
ATOM   5311   C  C    . ASP B  2 125 ? 30.281  41.888  -7.707  1.00 0.00 ?  179 ASP B C    1  
ATOM   5312   O  O    . ASP B  2 125 ? 31.366  41.365  -8.041  1.00 0.00 ?  179 ASP B O    1  
ATOM   5313   C  CB   . ASP B  2 125 ? 28.831  42.934  -9.623  1.00 0.00 ?  179 ASP B CB   1  
ATOM   5314   C  CG   . ASP B  2 125 ? 28.082  42.454  -10.804 1.00 0.00 ?  179 ASP B CG   1  
ATOM   5315   O  OD1  . ASP B  2 125 ? 27.356  41.476  -10.746 1.00 0.00 ?  179 ASP B OD1  1  
ATOM   5316   O  OD2  . ASP B  2 125 ? 28.084  43.236  -11.771 1.00 0.00 -1 179 ASP B OD2  1  
ATOM   5317   H  H    . ASP B  2 125 ? 27.043  42.199  -8.220  1.00 0.00 ?  179 ASP B H    1  
ATOM   5318   H  HA   . ASP B  2 125 ? 29.256  40.896  -9.082  1.00 0.00 ?  179 ASP B HA   1  
ATOM   5319   H  HB2  . ASP B  2 125 ? 28.327  43.827  -9.195  1.00 0.00 ?  179 ASP B HB2  1  
ATOM   5320   H  HB3  . ASP B  2 125 ? 29.894  43.146  -9.866  1.00 0.00 ?  179 ASP B HB3  1  
ATOM   5321   N  N    . ALA B  2 126 ? 30.157  42.642  -6.631  1.00 0.00 ?  180 ALA B N    1  
ATOM   5322   C  CA   . ALA B  2 126 ? 31.248  42.775  -5.671  1.00 0.00 ?  180 ALA B CA   1  
ATOM   5323   C  C    . ALA B  2 126 ? 31.497  41.489  -4.896  1.00 0.00 ?  180 ALA B C    1  
ATOM   5324   O  O    . ALA B  2 126 ? 32.652  41.130  -4.638  1.00 0.00 ?  180 ALA B O    1  
ATOM   5325   C  CB   . ALA B  2 126 ? 31.024  43.919  -4.624  1.00 0.00 ?  180 ALA B CB   1  
ATOM   5326   H  H    . ALA B  2 126 ? 29.324  43.172  -6.492  1.00 0.00 ?  180 ALA B H    1  
ATOM   5327   H  HA   . ALA B  2 126 ? 32.148  42.978  -6.231  1.00 0.00 ?  180 ALA B HA   1  
ATOM   5328   H  HB1  . ALA B  2 126 ? 32.025  44.282  -4.307  1.00 0.00 ?  180 ALA B HB1  1  
ATOM   5329   H  HB2  . ALA B  2 126 ? 30.446  43.617  -3.724  1.00 0.00 ?  180 ALA B HB2  1  
ATOM   5330   H  HB3  . ALA B  2 126 ? 30.577  44.804  -5.124  1.00 0.00 ?  180 ALA B HB3  1  
ATOM   5331   N  N    . LEU B  2 127 ? 30.505  40.731  -4.557  1.00 0.00 ?  181 LEU B N    1  
ATOM   5332   C  CA   . LEU B  2 127 ? 30.618  39.358  -4.043  1.00 0.00 ?  181 LEU B CA   1  
ATOM   5333   C  C    . LEU B  2 127 ? 31.383  38.440  -4.965  1.00 0.00 ?  181 LEU B C    1  
ATOM   5334   O  O    . LEU B  2 127 ? 32.268  37.701  -4.545  1.00 0.00 ?  181 LEU B O    1  
ATOM   5335   C  CB   . LEU B  2 127 ? 29.162  38.725  -3.802  1.00 0.00 ?  181 LEU B CB   1  
ATOM   5336   C  CG   . LEU B  2 127 ? 29.099  37.498  -2.998  1.00 0.00 ?  181 LEU B CG   1  
ATOM   5337   C  CD1  . LEU B  2 127 ? 29.820  37.593  -1.701  1.00 0.00 ?  181 LEU B CD1  1  
ATOM   5338   C  CD2  . LEU B  2 127 ? 27.620  37.111  -2.754  1.00 0.00 ?  181 LEU B CD2  1  
ATOM   5339   H  H    . LEU B  2 127 ? 29.564  41.027  -4.696  1.00 0.00 ?  181 LEU B H    1  
ATOM   5340   H  HA   . LEU B  2 127 ? 31.190  39.382  -3.127  1.00 0.00 ?  181 LEU B HA   1  
ATOM   5341   H  HB2  . LEU B  2 127 ? 28.510  39.527  -3.395  1.00 0.00 ?  181 LEU B HB2  1  
ATOM   5342   H  HB3  . LEU B  2 127 ? 28.769  38.511  -4.818  1.00 0.00 ?  181 LEU B HB3  1  
ATOM   5343   H  HG   . LEU B  2 127 ? 29.682  36.758  -3.587  1.00 0.00 ?  181 LEU B HG   1  
ATOM   5344   H  HD11 . LEU B  2 127 ? 29.712  36.727  -1.013  1.00 0.00 ?  181 LEU B HD11 1  
ATOM   5345   H  HD12 . LEU B  2 127 ? 29.433  38.516  -1.220  1.00 0.00 ?  181 LEU B HD12 1  
ATOM   5346   H  HD13 . LEU B  2 127 ? 30.904  37.810  -1.810  1.00 0.00 ?  181 LEU B HD13 1  
ATOM   5347   H  HD21 . LEU B  2 127 ? 27.087  37.986  -2.325  1.00 0.00 ?  181 LEU B HD21 1  
ATOM   5348   H  HD22 . LEU B  2 127 ? 27.551  36.282  -2.017  1.00 0.00 ?  181 LEU B HD22 1  
ATOM   5349   H  HD23 . LEU B  2 127 ? 27.054  36.881  -3.682  1.00 0.00 ?  181 LEU B HD23 1  
ATOM   5350   N  N    . ARG B  2 128 ? 30.921  38.446  -6.235  1.00 0.00 ?  182 ARG B N    1  
ATOM   5351   C  CA   . ARG B  2 128 ? 31.457  37.593  -7.281  1.00 0.00 ?  182 ARG B CA   1  
ATOM   5352   C  C    . ARG B  2 128 ? 32.802  38.018  -7.695  1.00 0.00 ?  182 ARG B C    1  
ATOM   5353   O  O    . ARG B  2 128 ? 33.739  37.189  -7.895  1.00 0.00 ?  182 ARG B O    1  
ATOM   5354   C  CB   . ARG B  2 128 ? 30.401  37.643  -8.439  1.00 0.00 ?  182 ARG B CB   1  
ATOM   5355   C  CG   . ARG B  2 128 ? 30.796  36.947  -9.756  1.00 0.00 ?  182 ARG B CG   1  
ATOM   5356   C  CD   . ARG B  2 128 ? 29.648  36.577  -10.714 1.00 0.00 ?  182 ARG B CD   1  
ATOM   5357   N  NE   . ARG B  2 128 ? 28.850  37.821  -11.030 1.00 0.00 ?  182 ARG B NE   1  
ATOM   5358   C  CZ   . ARG B  2 128 ? 27.620  37.785  -11.444 1.00 0.00 ?  182 ARG B CZ   1  
ATOM   5359   N  NH1  . ARG B  2 128 ? 26.978  38.854  -11.654 1.00 0.00 1  182 ARG B NH1  1  
ATOM   5360   N  NH2  . ARG B  2 128 ? 27.030  36.609  -11.609 1.00 0.00 ?  182 ARG B NH2  1  
ATOM   5361   H  H    . ARG B  2 128 ? 30.044  38.884  -6.417  1.00 0.00 ?  182 ARG B H    1  
ATOM   5362   H  HA   . ARG B  2 128 ? 31.651  36.589  -6.933  1.00 0.00 ?  182 ARG B HA   1  
ATOM   5363   H  HB2  . ARG B  2 128 ? 29.413  37.250  -8.117  1.00 0.00 ?  182 ARG B HB2  1  
ATOM   5364   H  HB3  . ARG B  2 128 ? 30.214  38.698  -8.733  1.00 0.00 ?  182 ARG B HB3  1  
ATOM   5365   H  HG2  . ARG B  2 128 ? 31.515  37.581  -10.318 1.00 0.00 ?  182 ARG B HG2  1  
ATOM   5366   H  HG3  . ARG B  2 128 ? 31.287  36.005  -9.430  1.00 0.00 ?  182 ARG B HG3  1  
ATOM   5367   H  HD2  . ARG B  2 128 ? 30.094  36.206  -11.662 1.00 0.00 ?  182 ARG B HD2  1  
ATOM   5368   H  HD3  . ARG B  2 128 ? 28.982  35.817  -10.252 1.00 0.00 ?  182 ARG B HD3  1  
ATOM   5369   H  HE   . ARG B  2 128 ? 29.326  38.697  -10.951 1.00 0.00 ?  182 ARG B HE   1  
ATOM   5370   H  HH11 . ARG B  2 128 ? 27.482  39.716  -11.589 1.00 0.00 ?  182 ARG B HH11 1  
ATOM   5371   H  HH12 . ARG B  2 128 ? 26.148  38.910  -12.208 1.00 0.00 ?  182 ARG B HH12 1  
ATOM   5372   H  HH21 . ARG B  2 128 ? 26.103  36.726  -11.964 1.00 0.00 ?  182 ARG B HH21 1  
ATOM   5373   H  HH22 . ARG B  2 128 ? 27.584  35.781  -11.522 1.00 0.00 ?  182 ARG B HH22 1  
ATOM   5374   N  N    . THR B  2 129 ? 33.071  39.334  -7.878  1.00 0.00 ?  183 THR B N    1  
ATOM   5375   C  CA   . THR B  2 129 ? 34.378  39.949  -8.161  1.00 0.00 ?  183 THR B CA   1  
ATOM   5376   C  C    . THR B  2 129 ? 35.453  39.599  -7.157  1.00 0.00 ?  183 THR B C    1  
ATOM   5377   O  O    . THR B  2 129 ? 36.555  39.164  -7.513  1.00 0.00 ?  183 THR B O    1  
ATOM   5378   C  CB   . THR B  2 129 ? 34.345  41.443  -8.157  1.00 0.00 ?  183 THR B CB   1  
ATOM   5379   O  OG1  . THR B  2 129 ? 33.539  42.017  -9.177  1.00 0.00 ?  183 THR B OG1  1  
ATOM   5380   C  CG2  . THR B  2 129 ? 35.822  41.922  -8.567  1.00 0.00 ?  183 THR B CG2  1  
ATOM   5381   H  H    . THR B  2 129 ? 32.219  39.835  -7.745  1.00 0.00 ?  183 THR B H    1  
ATOM   5382   H  HA   . THR B  2 129 ? 34.664  39.603  -9.143  1.00 0.00 ?  183 THR B HA   1  
ATOM   5383   H  HB   . THR B  2 129 ? 33.872  41.957  -7.293  1.00 0.00 ?  183 THR B HB   1  
ATOM   5384   H  HG1  . THR B  2 129 ? 32.624  41.785  -9.005  1.00 0.00 ?  183 THR B HG1  1  
ATOM   5385   H  HG21 . THR B  2 129 ? 36.573  41.700  -7.779  1.00 0.00 ?  183 THR B HG21 1  
ATOM   5386   H  HG22 . THR B  2 129 ? 35.925  42.957  -8.959  1.00 0.00 ?  183 THR B HG22 1  
ATOM   5387   H  HG23 . THR B  2 129 ? 36.179  41.276  -9.397  1.00 0.00 ?  183 THR B HG23 1  
ATOM   5388   N  N    . HIS B  2 130 ? 35.147  39.651  -5.886  1.00 0.00 ?  184 HIS B N    1  
ATOM   5389   C  CA   . HIS B  2 130 ? 35.967  39.227  -4.820  1.00 0.00 ?  184 HIS B CA   1  
ATOM   5390   C  C    . HIS B  2 130 ? 36.350  37.728  -4.811  1.00 0.00 ?  184 HIS B C    1  
ATOM   5391   O  O    . HIS B  2 130 ? 37.404  37.247  -4.385  1.00 0.00 ?  184 HIS B O    1  
ATOM   5392   C  CB   . HIS B  2 130 ? 35.253  39.620  -3.415  1.00 0.00 ?  184 HIS B CB   1  
ATOM   5393   C  CG   . HIS B  2 130 ? 35.973  39.231  -2.138  1.00 0.00 ?  184 HIS B CG   1  
ATOM   5394   N  ND1  . HIS B  2 130 ? 37.045  39.876  -1.714  1.00 0.00 ?  184 HIS B ND1  1  
ATOM   5395   C  CD2  . HIS B  2 130 ? 35.775  38.179  -1.296  1.00 0.00 ?  184 HIS B CD2  1  
ATOM   5396   C  CE1  . HIS B  2 130 ? 37.516  39.198  -0.607  1.00 0.00 ?  184 HIS B CE1  1  
ATOM   5397   N  NE2  . HIS B  2 130 ? 36.765  38.115  -0.321  1.00 0.00 ?  184 HIS B NE2  1  
ATOM   5398   H  H    . HIS B  2 130 ? 34.289  39.984  -5.502  1.00 0.00 ?  184 HIS B H    1  
ATOM   5399   H  HA   . HIS B  2 130 ? 36.922  39.731  -4.832  1.00 0.00 ?  184 HIS B HA   1  
ATOM   5400   H  HB2  . HIS B  2 130 ? 34.939  40.676  -3.560  1.00 0.00 ?  184 HIS B HB2  1  
ATOM   5401   H  HB3  . HIS B  2 130 ? 34.307  39.040  -3.389  1.00 0.00 ?  184 HIS B HB3  1  
ATOM   5402   H  HD1  . HIS B  2 130 ? 37.416  40.694  -2.153  1.00 0.00 ?  184 HIS B HD1  1  
ATOM   5403   H  HD2  . HIS B  2 130 ? 34.958  37.468  -1.268  1.00 0.00 ?  184 HIS B HD2  1  
ATOM   5404   H  HE1  . HIS B  2 130 ? 38.467  39.441  -0.132  1.00 0.00 ?  184 HIS B HE1  1  
ATOM   5405   N  N    . LEU B  2 131 ? 35.286  36.876  -5.057  1.00 0.00 ?  185 LEU B N    1  
ATOM   5406   C  CA   . LEU B  2 131 ? 35.495  35.471  -4.962  1.00 0.00 ?  185 LEU B CA   1  
ATOM   5407   C  C    . LEU B  2 131 ? 35.873  34.756  -6.305  1.00 0.00 ?  185 LEU B C    1  
ATOM   5408   O  O    . LEU B  2 131 ? 36.328  33.604  -6.268  1.00 0.00 ?  185 LEU B O    1  
ATOM   5409   C  CB   . LEU B  2 131 ? 34.106  34.813  -4.378  1.00 0.00 ?  185 LEU B CB   1  
ATOM   5410   C  CG   . LEU B  2 131 ? 33.747  35.105  -2.930  1.00 0.00 ?  185 LEU B CG   1  
ATOM   5411   C  CD1  . LEU B  2 131 ? 32.329  34.606  -2.655  1.00 0.00 ?  185 LEU B CD1  1  
ATOM   5412   C  CD2  . LEU B  2 131 ? 34.630  34.579  -1.849  1.00 0.00 ?  185 LEU B CD2  1  
ATOM   5413   H  H    . LEU B  2 131 ? 34.380  37.211  -5.301  1.00 0.00 ?  185 LEU B H    1  
ATOM   5414   H  HA   . LEU B  2 131 ? 36.303  35.232  -4.288  1.00 0.00 ?  185 LEU B HA   1  
ATOM   5415   H  HB2  . LEU B  2 131 ? 33.243  34.967  -5.061  1.00 0.00 ?  185 LEU B HB2  1  
ATOM   5416   H  HB3  . LEU B  2 131 ? 34.263  33.713  -4.340  1.00 0.00 ?  185 LEU B HB3  1  
ATOM   5417   H  HG   . LEU B  2 131 ? 33.835  36.205  -2.801  1.00 0.00 ?  185 LEU B HG   1  
ATOM   5418   H  HD11 . LEU B  2 131 ? 31.569  35.183  -3.223  1.00 0.00 ?  185 LEU B HD11 1  
ATOM   5419   H  HD12 . LEU B  2 131 ? 32.064  34.703  -1.581  1.00 0.00 ?  185 LEU B HD12 1  
ATOM   5420   H  HD13 . LEU B  2 131 ? 32.235  33.525  -2.895  1.00 0.00 ?  185 LEU B HD13 1  
ATOM   5421   H  HD21 . LEU B  2 131 ? 34.349  34.970  -0.847  1.00 0.00 ?  185 LEU B HD21 1  
ATOM   5422   H  HD22 . LEU B  2 131 ? 34.528  33.473  -1.817  1.00 0.00 ?  185 LEU B HD22 1  
ATOM   5423   H  HD23 . LEU B  2 131 ? 35.678  34.829  -2.119  1.00 0.00 ?  185 LEU B HD23 1  
ATOM   5424   N  N    . ALA B  2 132 ? 35.758  35.333  -7.503  1.00 0.00 ?  186 ALA B N    1  
ATOM   5425   C  CA   . ALA B  2 132 ? 36.266  34.808  -8.816  1.00 0.00 ?  186 ALA B CA   1  
ATOM   5426   C  C    . ALA B  2 132 ? 37.716  34.376  -8.922  1.00 0.00 ?  186 ALA B C    1  
ATOM   5427   O  O    . ALA B  2 132 ? 37.889  33.276  -9.386  1.00 0.00 ?  186 ALA B O    1  
ATOM   5428   C  CB   . ALA B  2 132 ? 35.833  35.721  -9.984  1.00 0.00 ?  186 ALA B CB   1  
ATOM   5429   H  H    . ALA B  2 132 ? 35.114  36.073  -7.683  1.00 0.00 ?  186 ALA B H    1  
ATOM   5430   H  HA   . ALA B  2 132 ? 35.768  33.879  -9.050  1.00 0.00 ?  186 ALA B HA   1  
ATOM   5431   H  HB1  . ALA B  2 132 ? 36.169  36.776  -9.886  1.00 0.00 ?  186 ALA B HB1  1  
ATOM   5432   H  HB2  . ALA B  2 132 ? 34.725  35.700  -9.902  1.00 0.00 ?  186 ALA B HB2  1  
ATOM   5433   H  HB3  . ALA B  2 132 ? 36.125  35.334  -10.983 1.00 0.00 ?  186 ALA B HB3  1  
ATOM   5434   N  N    . PRO B  2 133 ? 38.753  35.090  -8.508  1.00 0.00 ?  187 PRO B N    1  
ATOM   5435   C  CA   . PRO B  2 133 ? 40.136  34.591  -8.616  1.00 0.00 ?  187 PRO B CA   1  
ATOM   5436   C  C    . PRO B  2 133 ? 40.459  33.568  -7.584  1.00 0.00 ?  187 PRO B C    1  
ATOM   5437   O  O    . PRO B  2 133 ? 41.363  32.760  -7.799  1.00 0.00 ?  187 PRO B O    1  
ATOM   5438   C  CB   . PRO B  2 133 ? 41.036  35.877  -8.549  1.00 0.00 ?  187 PRO B CB   1  
ATOM   5439   C  CG   . PRO B  2 133 ? 40.230  36.831  -7.734  1.00 0.00 ?  187 PRO B CG   1  
ATOM   5440   C  CD   . PRO B  2 133 ? 38.799  36.528  -8.249  1.00 0.00 ?  187 PRO B CD   1  
ATOM   5441   H  HA   . PRO B  2 133 ? 40.305  34.172  -9.597  1.00 0.00 ?  187 PRO B HA   1  
ATOM   5442   H  HB2  . PRO B  2 133 ? 42.090  35.700  -8.247  1.00 0.00 ?  187 PRO B HB2  1  
ATOM   5443   H  HB3  . PRO B  2 133 ? 41.062  36.403  -9.528  1.00 0.00 ?  187 PRO B HB3  1  
ATOM   5444   H  HG2  . PRO B  2 133 ? 40.349  36.745  -6.632  1.00 0.00 ?  187 PRO B HG2  1  
ATOM   5445   H  HG3  . PRO B  2 133 ? 40.434  37.874  -8.056  1.00 0.00 ?  187 PRO B HG3  1  
ATOM   5446   H  HD2  . PRO B  2 133 ? 38.019  36.893  -7.546  1.00 0.00 ?  187 PRO B HD2  1  
ATOM   5447   H  HD3  . PRO B  2 133 ? 38.487  36.988  -9.211  1.00 0.00 ?  187 PRO B HD3  1  
ATOM   5448   N  N    . TYR B  2 134 ? 39.863  33.631  -6.407  1.00 0.00 ?  188 TYR B N    1  
ATOM   5449   C  CA   . TYR B  2 134 ? 40.062  32.750  -5.189  1.00 0.00 ?  188 TYR B CA   1  
ATOM   5450   C  C    . TYR B  2 134 ? 39.399  31.402  -5.457  1.00 0.00 ?  188 TYR B C    1  
ATOM   5451   O  O    . TYR B  2 134 ? 39.906  30.344  -5.087  1.00 0.00 ?  188 TYR B O    1  
ATOM   5452   C  CB   . TYR B  2 134 ? 39.522  33.430  -3.862  1.00 0.00 ?  188 TYR B CB   1  
ATOM   5453   C  CG   . TYR B  2 134 ? 39.468  32.579  -2.622  1.00 0.00 ?  188 TYR B CG   1  
ATOM   5454   C  CD1  . TYR B  2 134 ? 38.313  31.910  -2.274  1.00 0.00 ?  188 TYR B CD1  1  
ATOM   5455   C  CD2  . TYR B  2 134 ? 40.565  32.485  -1.771  1.00 0.00 ?  188 TYR B CD2  1  
ATOM   5456   C  CE1  . TYR B  2 134 ? 38.205  31.112  -1.147  1.00 0.00 ?  188 TYR B CE1  1  
ATOM   5457   C  CE2  . TYR B  2 134 ? 40.537  31.663  -0.659  1.00 0.00 ?  188 TYR B CE2  1  
ATOM   5458   C  CZ   . TYR B  2 134 ? 39.338  30.964  -0.345  1.00 0.00 ?  188 TYR B CZ   1  
ATOM   5459   O  OH   . TYR B  2 134 ? 39.260  30.165  0.770   1.00 0.00 ?  188 TYR B OH   1  
ATOM   5460   H  H    . TYR B  2 134 ? 39.337  34.453  -6.204  1.00 0.00 ?  188 TYR B H    1  
ATOM   5461   H  HA   . TYR B  2 134 ? 41.134  32.643  -5.114  1.00 0.00 ?  188 TYR B HA   1  
ATOM   5462   H  HB2  . TYR B  2 134 ? 40.226  34.267  -3.669  1.00 0.00 ?  188 TYR B HB2  1  
ATOM   5463   H  HB3  . TYR B  2 134 ? 38.524  33.915  -3.916  1.00 0.00 ?  188 TYR B HB3  1  
ATOM   5464   H  HD1  . TYR B  2 134 ? 37.443  32.031  -2.902  1.00 0.00 ?  188 TYR B HD1  1  
ATOM   5465   H  HD2  . TYR B  2 134 ? 41.435  33.071  -2.030  1.00 0.00 ?  188 TYR B HD2  1  
ATOM   5466   H  HE1  . TYR B  2 134 ? 37.263  30.688  -0.831  1.00 0.00 ?  188 TYR B HE1  1  
ATOM   5467   H  HE2  . TYR B  2 134 ? 41.290  31.375  0.060   1.00 0.00 ?  188 TYR B HE2  1  
ATOM   5468   H  HH   . TYR B  2 134 ? 38.326  29.957  0.852   1.00 0.00 ?  188 TYR B HH   1  
ATOM   5469   N  N    . SER B  2 135 ? 38.319  31.452  -6.235  1.00 0.00 ?  189 SER B N    1  
ATOM   5470   C  CA   . SER B  2 135 ? 37.563  30.282  -6.594  1.00 0.00 ?  189 SER B CA   1  
ATOM   5471   C  C    . SER B  2 135 ? 38.154  29.384  -7.644  1.00 0.00 ?  189 SER B C    1  
ATOM   5472   O  O    . SER B  2 135 ? 38.062  28.198  -7.450  1.00 0.00 ?  189 SER B O    1  
ATOM   5473   C  CB   . SER B  2 135 ? 36.075  30.640  -6.955  1.00 0.00 ?  189 SER B CB   1  
ATOM   5474   O  OG   . SER B  2 135 ? 35.369  29.537  -7.513  1.00 0.00 ?  189 SER B OG   1  
ATOM   5475   H  H    . SER B  2 135 ? 38.109  32.332  -6.655  1.00 0.00 ?  189 SER B H    1  
ATOM   5476   H  HA   . SER B  2 135 ? 37.594  29.690  -5.691  1.00 0.00 ?  189 SER B HA   1  
ATOM   5477   H  HB2  . SER B  2 135 ? 35.522  31.111  -6.115  1.00 0.00 ?  189 SER B HB2  1  
ATOM   5478   H  HB3  . SER B  2 135 ? 36.075  31.480  -7.681  1.00 0.00 ?  189 SER B HB3  1  
ATOM   5479   H  HG   . SER B  2 135 ? 35.455  29.592  -8.468  1.00 0.00 ?  189 SER B HG   1  
ATOM   5480   N  N    . ASP B  2 136 ? 38.747  29.935  -8.754  1.00 0.00 ?  190 ASP B N    1  
ATOM   5481   C  CA   . ASP B  2 136 ? 39.422  29.089  -9.624  1.00 0.00 ?  190 ASP B CA   1  
ATOM   5482   C  C    . ASP B  2 136 ? 40.599  28.345  -9.086  1.00 0.00 ?  190 ASP B C    1  
ATOM   5483   O  O    . ASP B  2 136 ? 40.666  27.093  -9.110  1.00 0.00 ?  190 ASP B O    1  
ATOM   5484   C  CB   . ASP B  2 136 ? 39.896  29.936  -10.805 1.00 0.00 ?  190 ASP B CB   1  
ATOM   5485   C  CG   . ASP B  2 136 ? 38.836  30.653  -11.581 1.00 0.00 ?  190 ASP B CG   1  
ATOM   5486   O  OD1  . ASP B  2 136 ? 39.206  31.572  -12.351 1.00 0.00 ?  190 ASP B OD1  1  
ATOM   5487   O  OD2  . ASP B  2 136 ? 37.659  30.171  -11.570 1.00 0.00 -1 190 ASP B OD2  1  
ATOM   5488   H  H    . ASP B  2 136 ? 38.668  30.899  -8.997  1.00 0.00 ?  190 ASP B H    1  
ATOM   5489   H  HA   . ASP B  2 136 ? 38.642  28.428  -9.969  1.00 0.00 ?  190 ASP B HA   1  
ATOM   5490   H  HB2  . ASP B  2 136 ? 40.579  30.731  -10.438 1.00 0.00 ?  190 ASP B HB2  1  
ATOM   5491   H  HB3  . ASP B  2 136 ? 40.411  29.316  -11.569 1.00 0.00 ?  190 ASP B HB3  1  
ATOM   5492   N  N    . GLU B  2 137 ? 41.581  29.019  -8.394  1.00 0.00 ?  191 GLU B N    1  
ATOM   5493   C  CA   . GLU B  2 137 ? 42.662  28.327  -7.625  1.00 0.00 ?  191 GLU B CA   1  
ATOM   5494   C  C    . GLU B  2 137 ? 42.204  27.325  -6.557  1.00 0.00 ?  191 GLU B C    1  
ATOM   5495   O  O    . GLU B  2 137 ? 42.864  26.271  -6.501  1.00 0.00 ?  191 GLU B O    1  
ATOM   5496   C  CB   . GLU B  2 137 ? 43.636  29.293  -7.052  1.00 0.00 ?  191 GLU B CB   1  
ATOM   5497   C  CG   . GLU B  2 137 ? 44.440  30.185  -8.067  1.00 0.00 ?  191 GLU B CG   1  
ATOM   5498   C  CD   . GLU B  2 137 ? 45.565  30.984  -7.442  1.00 0.00 ?  191 GLU B CD   1  
ATOM   5499   O  OE1  . GLU B  2 137 ? 45.291  32.182  -7.035  1.00 0.00 ?  191 GLU B OE1  1  
ATOM   5500   O  OE2  . GLU B  2 137 ? 46.717  30.617  -7.432  1.00 0.00 -1 191 GLU B OE2  1  
ATOM   5501   H  H    . GLU B  2 137 ? 41.520  29.999  -8.221  1.00 0.00 ?  191 GLU B H    1  
ATOM   5502   H  HA   . GLU B  2 137 ? 43.218  27.846  -8.416  1.00 0.00 ?  191 GLU B HA   1  
ATOM   5503   H  HB2  . GLU B  2 137 ? 43.089  29.902  -6.301  1.00 0.00 ?  191 GLU B HB2  1  
ATOM   5504   H  HB3  . GLU B  2 137 ? 44.442  28.680  -6.595  1.00 0.00 ?  191 GLU B HB3  1  
ATOM   5505   H  HG2  . GLU B  2 137 ? 44.789  29.473  -8.844  1.00 0.00 ?  191 GLU B HG2  1  
ATOM   5506   H  HG3  . GLU B  2 137 ? 43.730  30.859  -8.593  1.00 0.00 ?  191 GLU B HG3  1  
ATOM   5507   N  N    . LEU B  2 138 ? 41.148  27.521  -5.695  1.00 0.00 ?  192 LEU B N    1  
ATOM   5508   C  CA   . LEU B  2 138 ? 40.511  26.536  -4.903  1.00 0.00 ?  192 LEU B CA   1  
ATOM   5509   C  C    . LEU B  2 138 ? 39.989  25.308  -5.666  1.00 0.00 ?  192 LEU B C    1  
ATOM   5510   O  O    . LEU B  2 138 ? 40.203  24.174  -5.260  1.00 0.00 ?  192 LEU B O    1  
ATOM   5511   C  CB   . LEU B  2 138 ? 39.319  27.247  -4.212  1.00 0.00 ?  192 LEU B CB   1  
ATOM   5512   C  CG   . LEU B  2 138 ? 38.540  26.525  -3.109  1.00 0.00 ?  192 LEU B CG   1  
ATOM   5513   C  CD1  . LEU B  2 138 ? 39.502  26.102  -2.050  1.00 0.00 ?  192 LEU B CD1  1  
ATOM   5514   C  CD2  . LEU B  2 138 ? 37.520  27.474  -2.511  1.00 0.00 ?  192 LEU B CD2  1  
ATOM   5515   H  H    . LEU B  2 138 ? 40.856  28.458  -5.519  1.00 0.00 ?  192 LEU B H    1  
ATOM   5516   H  HA   . LEU B  2 138 ? 41.198  26.166  -4.157  1.00 0.00 ?  192 LEU B HA   1  
ATOM   5517   H  HB2  . LEU B  2 138 ? 39.725  28.112  -3.644  1.00 0.00 ?  192 LEU B HB2  1  
ATOM   5518   H  HB3  . LEU B  2 138 ? 38.620  27.682  -4.958  1.00 0.00 ?  192 LEU B HB3  1  
ATOM   5519   H  HG   . LEU B  2 138 ? 38.074  25.631  -3.575  1.00 0.00 ?  192 LEU B HG   1  
ATOM   5520   H  HD11 . LEU B  2 138 ? 40.188  26.898  -1.689  1.00 0.00 ?  192 LEU B HD11 1  
ATOM   5521   H  HD12 . LEU B  2 138 ? 40.181  25.240  -2.224  1.00 0.00 ?  192 LEU B HD12 1  
ATOM   5522   H  HD13 . LEU B  2 138 ? 39.016  25.996  -1.057  1.00 0.00 ?  192 LEU B HD13 1  
ATOM   5523   H  HD21 . LEU B  2 138 ? 36.890  27.849  -3.346  1.00 0.00 ?  192 LEU B HD21 1  
ATOM   5524   H  HD22 . LEU B  2 138 ? 37.927  28.371  -1.998  1.00 0.00 ?  192 LEU B HD22 1  
ATOM   5525   H  HD23 . LEU B  2 138 ? 36.880  26.932  -1.783  1.00 0.00 ?  192 LEU B HD23 1  
ATOM   5526   N  N    . ARG B  2 139 ? 39.361  25.532  -6.817  1.00 0.00 ?  193 ARG B N    1  
ATOM   5527   C  CA   . ARG B  2 139 ? 38.937  24.381  -7.650  1.00 0.00 ?  193 ARG B CA   1  
ATOM   5528   C  C    . ARG B  2 139 ? 40.064  23.579  -8.265  1.00 0.00 ?  193 ARG B C    1  
ATOM   5529   O  O    . ARG B  2 139 ? 40.124  22.318  -8.129  1.00 0.00 ?  193 ARG B O    1  
ATOM   5530   C  CB   . ARG B  2 139 ? 37.979  24.864  -8.713  1.00 0.00 ?  193 ARG B CB   1  
ATOM   5531   C  CG   . ARG B  2 139 ? 37.548  23.737  -9.746  1.00 0.00 ?  193 ARG B CG   1  
ATOM   5532   C  CD   . ARG B  2 139 ? 36.611  24.181  -10.888 1.00 0.00 ?  193 ARG B CD   1  
ATOM   5533   N  NE   . ARG B  2 139 ? 37.321  25.323  -11.567 1.00 0.00 ?  193 ARG B NE   1  
ATOM   5534   C  CZ   . ARG B  2 139 ? 36.999  26.595  -11.358 1.00 0.00 ?  193 ARG B CZ   1  
ATOM   5535   N  NH1  . ARG B  2 139 ? 37.555  27.413  -12.312 1.00 0.00 1  193 ARG B NH1  1  
ATOM   5536   N  NH2  . ARG B  2 139 ? 36.214  27.122  -10.502 1.00 0.00 ?  193 ARG B NH2  1  
ATOM   5537   H  H    . ARG B  2 139 ? 39.425  26.490  -7.087  1.00 0.00 ?  193 ARG B H    1  
ATOM   5538   H  HA   . ARG B  2 139 ? 38.358  23.719  -7.023  1.00 0.00 ?  193 ARG B HA   1  
ATOM   5539   H  HB2  . ARG B  2 139 ? 37.070  25.367  -8.321  1.00 0.00 ?  193 ARG B HB2  1  
ATOM   5540   H  HB3  . ARG B  2 139 ? 38.587  25.615  -9.260  1.00 0.00 ?  193 ARG B HB3  1  
ATOM   5541   H  HG2  . ARG B  2 139 ? 38.479  23.326  -10.192 1.00 0.00 ?  193 ARG B HG2  1  
ATOM   5542   H  HG3  . ARG B  2 139 ? 37.008  22.896  -9.260  1.00 0.00 ?  193 ARG B HG3  1  
ATOM   5543   H  HD2  . ARG B  2 139 ? 36.455  23.351  -11.611 1.00 0.00 ?  193 ARG B HD2  1  
ATOM   5544   H  HD3  . ARG B  2 139 ? 35.704  24.504  -10.333 1.00 0.00 ?  193 ARG B HD3  1  
ATOM   5545   H  HE   . ARG B  2 139 ? 37.766  25.103  -12.435 1.00 0.00 ?  193 ARG B HE   1  
ATOM   5546   H  HH11 . ARG B  2 139 ? 38.164  27.017  -12.999 1.00 0.00 ?  193 ARG B HH11 1  
ATOM   5547   H  HH12 . ARG B  2 139 ? 37.507  28.410  -12.250 1.00 0.00 ?  193 ARG B HH12 1  
ATOM   5548   H  HH21 . ARG B  2 139 ? 35.863  26.545  -9.764  1.00 0.00 ?  193 ARG B HH21 1  
ATOM   5549   H  HH22 . ARG B  2 139 ? 36.067  28.107  -10.408 1.00 0.00 ?  193 ARG B HH22 1  
ATOM   5550   N  N    . GLN B  2 140 ? 41.111  24.240  -8.895  1.00 0.00 ?  194 GLN B N    1  
ATOM   5551   C  CA   . GLN B  2 140 ? 42.327  23.607  -9.387  1.00 0.00 ?  194 GLN B CA   1  
ATOM   5552   C  C    . GLN B  2 140 ? 43.143  22.834  -8.310  1.00 0.00 ?  194 GLN B C    1  
ATOM   5553   O  O    . GLN B  2 140 ? 43.623  21.772  -8.611  1.00 0.00 ?  194 GLN B O    1  
ATOM   5554   C  CB   . GLN B  2 140 ? 43.186  24.600  -10.226 1.00 0.00 ?  194 GLN B CB   1  
ATOM   5555   C  CG   . GLN B  2 140 ? 42.645  25.272  -11.516 1.00 0.00 ?  194 GLN B CG   1  
ATOM   5556   C  CD   . GLN B  2 140 ? 42.152  24.069  -12.404 1.00 0.00 ?  194 GLN B CD   1  
ATOM   5557   O  OE1  . GLN B  2 140 ? 42.861  23.575  -13.273 1.00 0.00 ?  194 GLN B OE1  1  
ATOM   5558   N  NE2  . GLN B  2 140 ? 40.892  23.640  -12.127 1.00 0.00 ?  194 GLN B NE2  1  
ATOM   5559   H  H    . GLN B  2 140 ? 41.102  25.237  -8.882  1.00 0.00 ?  194 GLN B H    1  
ATOM   5560   H  HA   . GLN B  2 140 ? 42.038  22.830  -10.079 1.00 0.00 ?  194 GLN B HA   1  
ATOM   5561   H  HB2  . GLN B  2 140 ? 43.487  25.371  -9.485  1.00 0.00 ?  194 GLN B HB2  1  
ATOM   5562   H  HB3  . GLN B  2 140 ? 44.084  24.076  -10.617 1.00 0.00 ?  194 GLN B HB3  1  
ATOM   5563   H  HG2  . GLN B  2 140 ? 41.907  26.090  -11.370 1.00 0.00 ?  194 GLN B HG2  1  
ATOM   5564   H  HG3  . GLN B  2 140 ? 43.470  25.772  -12.067 1.00 0.00 ?  194 GLN B HG3  1  
ATOM   5565   H  HE21 . GLN B  2 140 ? 40.346  23.165  -12.817 1.00 0.00 ?  194 GLN B HE21 1  
ATOM   5566   H  HE22 . GLN B  2 140 ? 40.419  24.239  -11.481 1.00 0.00 ?  194 GLN B HE22 1  
ATOM   5567   N  N    . ARG B  2 141 ? 43.221  23.280  -6.964  1.00 0.00 ?  195 ARG B N    1  
ATOM   5568   C  CA   . ARG B  2 141 ? 43.814  22.615  -5.876  1.00 0.00 ?  195 ARG B CA   1  
ATOM   5569   C  C    . ARG B  2 141 ? 43.127  21.329  -5.579  1.00 0.00 ?  195 ARG B C    1  
ATOM   5570   O  O    . ARG B  2 141 ? 43.828  20.313  -5.318  1.00 0.00 ?  195 ARG B O    1  
ATOM   5571   C  CB   . ARG B  2 141 ? 43.717  23.547  -4.637  1.00 0.00 ?  195 ARG B CB   1  
ATOM   5572   C  CG   . ARG B  2 141 ? 44.892  24.548  -4.397  1.00 0.00 ?  195 ARG B CG   1  
ATOM   5573   C  CD   . ARG B  2 141 ? 44.783  25.627  -3.249  1.00 0.00 ?  195 ARG B CD   1  
ATOM   5574   N  NE   . ARG B  2 141 ? 45.884  26.661  -3.425  1.00 0.00 ?  195 ARG B NE   1  
ATOM   5575   C  CZ   . ARG B  2 141 ? 47.126  26.414  -3.094  1.00 0.00 ?  195 ARG B CZ   1  
ATOM   5576   N  NH1  . ARG B  2 141 ? 47.997  27.246  -3.556  1.00 0.00 1  195 ARG B NH1  1  
ATOM   5577   N  NH2  . ARG B  2 141 ? 47.522  25.342  -2.522  1.00 0.00 ?  195 ARG B NH2  1  
ATOM   5578   H  H    . ARG B  2 141 ? 42.788  24.152  -6.747  1.00 0.00 ?  195 ARG B H    1  
ATOM   5579   H  HA   . ARG B  2 141 ? 44.801  22.264  -6.140  1.00 0.00 ?  195 ARG B HA   1  
ATOM   5580   H  HB2  . ARG B  2 141 ? 42.856  24.228  -4.809  1.00 0.00 ?  195 ARG B HB2  1  
ATOM   5581   H  HB3  . ARG B  2 141 ? 43.788  22.941  -3.708  1.00 0.00 ?  195 ARG B HB3  1  
ATOM   5582   H  HG2  . ARG B  2 141 ? 45.775  23.906  -4.192  1.00 0.00 ?  195 ARG B HG2  1  
ATOM   5583   H  HG3  . ARG B  2 141 ? 45.046  24.950  -5.421  1.00 0.00 ?  195 ARG B HG3  1  
ATOM   5584   H  HD2  . ARG B  2 141 ? 43.857  26.238  -3.307  1.00 0.00 ?  195 ARG B HD2  1  
ATOM   5585   H  HD3  . ARG B  2 141 ? 44.655  25.295  -2.196  1.00 0.00 ?  195 ARG B HD3  1  
ATOM   5586   H  HE   . ARG B  2 141 ? 45.796  27.307  -4.183  1.00 0.00 ?  195 ARG B HE   1  
ATOM   5587   H  HH11 . ARG B  2 141 ? 47.635  27.912  -4.208  1.00 0.00 ?  195 ARG B HH11 1  
ATOM   5588   H  HH12 . ARG B  2 141 ? 48.866  27.182  -3.064  1.00 0.00 ?  195 ARG B HH12 1  
ATOM   5589   H  HH21 . ARG B  2 141 ? 46.803  24.699  -2.259  1.00 0.00 ?  195 ARG B HH21 1  
ATOM   5590   H  HH22 . ARG B  2 141 ? 48.473  25.090  -2.700  1.00 0.00 ?  195 ARG B HH22 1  
ATOM   5591   N  N    . LEU B  2 142 ? 41.764  21.275  -5.556  1.00 0.00 ?  196 LEU B N    1  
ATOM   5592   C  CA   . LEU B  2 142 ? 41.079  20.021  -5.255  1.00 0.00 ?  196 LEU B CA   1  
ATOM   5593   C  C    . LEU B  2 142 ? 41.415  19.111  -6.350  1.00 0.00 ?  196 LEU B C    1  
ATOM   5594   O  O    . LEU B  2 142 ? 41.572  17.883  -6.224  1.00 0.00 ?  196 LEU B O    1  
ATOM   5595   C  CB   . LEU B  2 142 ? 39.559  20.165  -5.134  1.00 0.00 ?  196 LEU B CB   1  
ATOM   5596   C  CG   . LEU B  2 142 ? 39.076  20.940  -3.983  1.00 0.00 ?  196 LEU B CG   1  
ATOM   5597   C  CD1  . LEU B  2 142 ? 37.693  21.355  -4.247  1.00 0.00 ?  196 LEU B CD1  1  
ATOM   5598   C  CD2  . LEU B  2 142 ? 39.225  19.988  -2.749  1.00 0.00 ?  196 LEU B CD2  1  
ATOM   5599   H  H    . LEU B  2 142 ? 41.215  22.064  -5.818  1.00 0.00 ?  196 LEU B H    1  
ATOM   5600   H  HA   . LEU B  2 142 ? 41.541  19.613  -4.368  1.00 0.00 ?  196 LEU B HA   1  
ATOM   5601   H  HB2  . LEU B  2 142 ? 39.311  20.655  -6.100  1.00 0.00 ?  196 LEU B HB2  1  
ATOM   5602   H  HB3  . LEU B  2 142 ? 39.061  19.173  -5.106  1.00 0.00 ?  196 LEU B HB3  1  
ATOM   5603   H  HG   . LEU B  2 142 ? 39.643  21.882  -3.828  1.00 0.00 ?  196 LEU B HG   1  
ATOM   5604   H  HD11 . LEU B  2 142 ? 37.027  20.493  -4.032  1.00 0.00 ?  196 LEU B HD11 1  
ATOM   5605   H  HD12 . LEU B  2 142 ? 37.558  21.565  -5.329  1.00 0.00 ?  196 LEU B HD12 1  
ATOM   5606   H  HD13 . LEU B  2 142 ? 37.341  22.200  -3.618  1.00 0.00 ?  196 LEU B HD13 1  
ATOM   5607   H  HD21 . LEU B  2 142 ? 38.510  19.147  -2.877  1.00 0.00 ?  196 LEU B HD21 1  
ATOM   5608   H  HD22 . LEU B  2 142 ? 38.978  20.547  -1.822  1.00 0.00 ?  196 LEU B HD22 1  
ATOM   5609   H  HD23 . LEU B  2 142 ? 40.210  19.495  -2.608  1.00 0.00 ?  196 LEU B HD23 1  
ATOM   5610   N  N    . ALA B  2 143 ? 41.353  19.631  -7.608  1.00 0.00 ?  197 ALA B N    1  
ATOM   5611   C  CA   . ALA B  2 143 ? 41.672  18.754  -8.790  1.00 0.00 ?  197 ALA B CA   1  
ATOM   5612   C  C    . ALA B  2 143 ? 42.987  18.073  -8.752  1.00 0.00 ?  197 ALA B C    1  
ATOM   5613   O  O    . ALA B  2 143 ? 43.076  16.892  -9.135  1.00 0.00 ?  197 ALA B O    1  
ATOM   5614   C  CB   . ALA B  2 143 ? 41.503  19.507  -10.133 1.00 0.00 ?  197 ALA B CB   1  
ATOM   5615   H  H    . ALA B  2 143 ? 41.081  20.579  -7.753  1.00 0.00 ?  197 ALA B H    1  
ATOM   5616   H  HA   . ALA B  2 143 ? 41.018  17.894  -8.780  1.00 0.00 ?  197 ALA B HA   1  
ATOM   5617   H  HB1  . ALA B  2 143 ? 42.177  20.382  -10.246 1.00 0.00 ?  197 ALA B HB1  1  
ATOM   5618   H  HB2  . ALA B  2 143 ? 40.485  19.940  -10.235 1.00 0.00 ?  197 ALA B HB2  1  
ATOM   5619   H  HB3  . ALA B  2 143 ? 41.723  18.813  -10.973 1.00 0.00 ?  197 ALA B HB3  1  
ATOM   5620   N  N    . ALA B  2 144 ? 44.053  18.722  -8.337  1.00 0.00 ?  198 ALA B N    1  
ATOM   5621   C  CA   . ALA B  2 144 ? 45.352  18.152  -8.033  1.00 0.00 ?  198 ALA B CA   1  
ATOM   5622   C  C    . ALA B  2 144 ? 45.389  17.133  -6.938  1.00 0.00 ?  198 ALA B C    1  
ATOM   5623   O  O    . ALA B  2 144 ? 45.933  16.085  -7.142  1.00 0.00 ?  198 ALA B O    1  
ATOM   5624   C  CB   . ALA B  2 144 ? 46.327  19.375  -7.813  1.00 0.00 ?  198 ALA B CB   1  
ATOM   5625   H  H    . ALA B  2 144 ? 44.065  19.644  -7.959  1.00 0.00 ?  198 ALA B H    1  
ATOM   5626   H  HA   . ALA B  2 144 ? 45.654  17.669  -8.950  1.00 0.00 ?  198 ALA B HA   1  
ATOM   5627   H  HB1  . ALA B  2 144 ? 47.370  18.997  -7.759  1.00 0.00 ?  198 ALA B HB1  1  
ATOM   5628   H  HB2  . ALA B  2 144 ? 46.063  19.895  -6.867  1.00 0.00 ?  198 ALA B HB2  1  
ATOM   5629   H  HB3  . ALA B  2 144 ? 46.146  20.111  -8.625  1.00 0.00 ?  198 ALA B HB3  1  
ATOM   5630   N  N    . ARG B  2 145 ? 44.645  17.341  -5.884  1.00 0.00 ?  199 ARG B N    1  
ATOM   5631   C  CA   . ARG B  2 145 ? 44.390  16.376  -4.806  1.00 0.00 ?  199 ARG B CA   1  
ATOM   5632   C  C    . ARG B  2 145 ? 43.635  15.150  -5.310  1.00 0.00 ?  199 ARG B C    1  
ATOM   5633   O  O    . ARG B  2 145 ? 44.058  14.036  -5.038  1.00 0.00 ?  199 ARG B O    1  
ATOM   5634   C  CB   . ARG B  2 145 ? 43.713  17.140  -3.606  1.00 0.00 ?  199 ARG B CB   1  
ATOM   5635   C  CG   . ARG B  2 145 ? 43.734  16.453  -2.249  1.00 0.00 ?  199 ARG B CG   1  
ATOM   5636   C  CD   . ARG B  2 145 ? 45.234  16.173  -1.662  1.00 0.00 ?  199 ARG B CD   1  
ATOM   5637   N  NE   . ARG B  2 145 ? 45.177  15.705  -0.236  1.00 0.00 ?  199 ARG B NE   1  
ATOM   5638   C  CZ   . ARG B  2 145 ? 46.247  15.385  0.421   1.00 0.00 ?  199 ARG B CZ   1  
ATOM   5639   N  NH1  . ARG B  2 145 ? 46.122  14.957  1.653   1.00 0.00 1  199 ARG B NH1  1  
ATOM   5640   N  NH2  . ARG B  2 145 ? 47.458  15.408  -0.172  1.00 0.00 ?  199 ARG B NH2  1  
ATOM   5641   H  H    . ARG B  2 145 ? 44.315  18.271  -5.737  1.00 0.00 ?  199 ARG B H    1  
ATOM   5642   H  HA   . ARG B  2 145 ? 45.405  16.065  -4.605  1.00 0.00 ?  199 ARG B HA   1  
ATOM   5643   H  HB2  . ARG B  2 145 ? 44.336  18.059  -3.560  1.00 0.00 ?  199 ARG B HB2  1  
ATOM   5644   H  HB3  . ARG B  2 145 ? 42.684  17.447  -3.892  1.00 0.00 ?  199 ARG B HB3  1  
ATOM   5645   H  HG2  . ARG B  2 145 ? 43.256  17.135  -1.513  1.00 0.00 ?  199 ARG B HG2  1  
ATOM   5646   H  HG3  . ARG B  2 145 ? 43.125  15.528  -2.338  1.00 0.00 ?  199 ARG B HG3  1  
ATOM   5647   H  HD2  . ARG B  2 145 ? 45.591  15.324  -2.283  1.00 0.00 ?  199 ARG B HD2  1  
ATOM   5648   H  HD3  . ARG B  2 145 ? 45.988  16.970  -1.840  1.00 0.00 ?  199 ARG B HD3  1  
ATOM   5649   H  HE   . ARG B  2 145 ? 44.377  15.866  0.342   1.00 0.00 ?  199 ARG B HE   1  
ATOM   5650   H  HH11 . ARG B  2 145 ? 45.164  15.004  1.935   1.00 0.00 ?  199 ARG B HH11 1  
ATOM   5651   H  HH12 . ARG B  2 145 ? 46.920  14.414  1.915   1.00 0.00 ?  199 ARG B HH12 1  
ATOM   5652   H  HH21 . ARG B  2 145 ? 47.487  15.664  -1.138  1.00 0.00 ?  199 ARG B HH21 1  
ATOM   5653   H  HH22 . ARG B  2 145 ? 48.309  15.417  0.353   1.00 0.00 ?  199 ARG B HH22 1  
ATOM   5654   N  N    . LEU B  2 146 ? 42.667  15.341  -6.186  1.00 0.00 ?  200 LEU B N    1  
ATOM   5655   C  CA   . LEU B  2 146 ? 42.164  14.209  -6.923  1.00 0.00 ?  200 LEU B CA   1  
ATOM   5656   C  C    . LEU B  2 146 ? 43.143  13.500  -7.863  1.00 0.00 ?  200 LEU B C    1  
ATOM   5657   O  O    . LEU B  2 146 ? 43.166  12.284  -7.882  1.00 0.00 ?  200 LEU B O    1  
ATOM   5658   C  CB   . LEU B  2 146 ? 40.875  14.486  -7.647  1.00 0.00 ?  200 LEU B CB   1  
ATOM   5659   C  CG   . LEU B  2 146 ? 39.745  15.115  -6.783  1.00 0.00 ?  200 LEU B CG   1  
ATOM   5660   C  CD1  . LEU B  2 146 ? 38.657  15.715  -7.702  1.00 0.00 ?  200 LEU B CD1  1  
ATOM   5661   C  CD2  . LEU B  2 146 ? 38.996  14.013  -5.942  1.00 0.00 ?  200 LEU B CD2  1  
ATOM   5662   H  H    . LEU B  2 146 ? 42.336  16.266  -6.358  1.00 0.00 ?  200 LEU B H    1  
ATOM   5663   H  HA   . LEU B  2 146 ? 41.887  13.443  -6.214  1.00 0.00 ?  200 LEU B HA   1  
ATOM   5664   H  HB2  . LEU B  2 146 ? 40.942  15.293  -8.407  1.00 0.00 ?  200 LEU B HB2  1  
ATOM   5665   H  HB3  . LEU B  2 146 ? 40.454  13.600  -8.169  1.00 0.00 ?  200 LEU B HB3  1  
ATOM   5666   H  HG   . LEU B  2 146 ? 40.090  15.865  -6.040  1.00 0.00 ?  200 LEU B HG   1  
ATOM   5667   H  HD11 . LEU B  2 146 ? 37.936  16.241  -7.041  1.00 0.00 ?  200 LEU B HD11 1  
ATOM   5668   H  HD12 . LEU B  2 146 ? 38.204  14.851  -8.234  1.00 0.00 ?  200 LEU B HD12 1  
ATOM   5669   H  HD13 . LEU B  2 146 ? 39.130  16.413  -8.426  1.00 0.00 ?  200 LEU B HD13 1  
ATOM   5670   H  HD21 . LEU B  2 146 ? 38.570  13.236  -6.612  1.00 0.00 ?  200 LEU B HD21 1  
ATOM   5671   H  HD22 . LEU B  2 146 ? 38.161  14.454  -5.356  1.00 0.00 ?  200 LEU B HD22 1  
ATOM   5672   H  HD23 . LEU B  2 146 ? 39.833  13.571  -5.359  1.00 0.00 ?  200 LEU B HD23 1  
ATOM   5673   N  N    . GLU B  2 147 ? 44.009  14.263  -8.616  1.00 0.00 ?  201 GLU B N    1  
ATOM   5674   C  CA   . GLU B  2 147 ? 45.037  13.685  -9.424  1.00 0.00 ?  201 GLU B CA   1  
ATOM   5675   C  C    . GLU B  2 147 ? 46.020  12.946  -8.547  1.00 0.00 ?  201 GLU B C    1  
ATOM   5676   O  O    . GLU B  2 147 ? 46.362  11.802  -8.893  1.00 0.00 ?  201 GLU B O    1  
ATOM   5677   C  CB   . GLU B  2 147 ? 45.798  14.796  -10.211 1.00 0.00 ?  201 GLU B CB   1  
ATOM   5678   C  CG   . GLU B  2 147 ? 46.838  14.229  -11.244 1.00 0.00 ?  201 GLU B CG   1  
ATOM   5679   C  CD   . GLU B  2 147 ? 47.344  15.206  -12.237 1.00 0.00 ?  201 GLU B CD   1  
ATOM   5680   O  OE1  . GLU B  2 147 ? 46.597  15.832  -12.976 1.00 0.00 ?  201 GLU B OE1  1  
ATOM   5681   O  OE2  . GLU B  2 147 ? 48.607  15.490  -12.127 1.00 0.00 -1 201 GLU B OE2  1  
ATOM   5682   H  H    . GLU B  2 147 ? 43.762  15.229  -8.642  1.00 0.00 ?  201 GLU B H    1  
ATOM   5683   H  HA   . GLU B  2 147 ? 44.574  12.913  -10.020 1.00 0.00 ?  201 GLU B HA   1  
ATOM   5684   H  HB2  . GLU B  2 147 ? 45.111  15.485  -10.747 1.00 0.00 ?  201 GLU B HB2  1  
ATOM   5685   H  HB3  . GLU B  2 147 ? 46.329  15.349  -9.407  1.00 0.00 ?  201 GLU B HB3  1  
ATOM   5686   H  HG2  . GLU B  2 147 ? 47.655  13.731  -10.679 1.00 0.00 ?  201 GLU B HG2  1  
ATOM   5687   H  HG3  . GLU B  2 147 ? 46.411  13.447  -11.908 1.00 0.00 ?  201 GLU B HG3  1  
ATOM   5688   N  N    . ALA B  2 148 ? 46.425  13.497  -7.351  1.00 0.00 ?  202 ALA B N    1  
ATOM   5689   C  CA   . ALA B  2 148 ? 47.385  12.776  -6.540  1.00 0.00 ?  202 ALA B CA   1  
ATOM   5690   C  C    . ALA B  2 148 ? 46.891  11.538  -5.835  1.00 0.00 ?  202 ALA B C    1  
ATOM   5691   O  O    . ALA B  2 148 ? 47.615  10.538  -5.811  1.00 0.00 ?  202 ALA B O    1  
ATOM   5692   C  CB   . ALA B  2 148 ? 47.875  13.661  -5.393  1.00 0.00 ?  202 ALA B CB   1  
ATOM   5693   H  H    . ALA B  2 148 ? 46.184  14.434  -7.108  1.00 0.00 ?  202 ALA B H    1  
ATOM   5694   H  HA   . ALA B  2 148 ? 48.209  12.500  -7.180  1.00 0.00 ?  202 ALA B HA   1  
ATOM   5695   H  HB1  . ALA B  2 148 ? 48.686  13.287  -4.732  1.00 0.00 ?  202 ALA B HB1  1  
ATOM   5696   H  HB2  . ALA B  2 148 ? 46.978  13.920  -4.791  1.00 0.00 ?  202 ALA B HB2  1  
ATOM   5697   H  HB3  . ALA B  2 148 ? 48.332  14.522  -5.927  1.00 0.00 ?  202 ALA B HB3  1  
ATOM   5698   N  N    . LEU B  2 149 ? 45.626  11.594  -5.369  1.00 0.00 ?  203 LEU B N    1  
ATOM   5699   C  CA   . LEU B  2 149 ? 45.008  10.455  -4.732  1.00 0.00 ?  203 LEU B CA   1  
ATOM   5700   C  C    . LEU B  2 149 ? 44.748  9.319   -5.621  1.00 0.00 ?  203 LEU B C    1  
ATOM   5701   O  O    . LEU B  2 149 ? 44.898  8.170   -5.218  1.00 0.00 ?  203 LEU B O    1  
ATOM   5702   C  CB   . LEU B  2 149 ? 43.603  10.861  -4.252  1.00 0.00 ?  203 LEU B CB   1  
ATOM   5703   C  CG   . LEU B  2 149 ? 43.625  11.778  -2.989  1.00 0.00 ?  203 LEU B CG   1  
ATOM   5704   C  CD1  . LEU B  2 149 ? 42.200  12.217  -2.869  1.00 0.00 ?  203 LEU B CD1  1  
ATOM   5705   C  CD2  . LEU B  2 149 ? 44.023  11.132  -1.679  1.00 0.00 ?  203 LEU B CD2  1  
ATOM   5706   H  H    . LEU B  2 149 ? 45.132  12.456  -5.454  1.00 0.00 ?  203 LEU B H    1  
ATOM   5707   H  HA   . LEU B  2 149 ? 45.612  10.073  -3.922  1.00 0.00 ?  203 LEU B HA   1  
ATOM   5708   H  HB2  . LEU B  2 149 ? 42.973  11.275  -5.067  1.00 0.00 ?  203 LEU B HB2  1  
ATOM   5709   H  HB3  . LEU B  2 149 ? 43.029  9.981   -3.890  1.00 0.00 ?  203 LEU B HB3  1  
ATOM   5710   H  HG   . LEU B  2 149 ? 44.308  12.633  -3.180  1.00 0.00 ?  203 LEU B HG   1  
ATOM   5711   H  HD11 . LEU B  2 149 ? 42.021  13.067  -2.176  1.00 0.00 ?  203 LEU B HD11 1  
ATOM   5712   H  HD12 . LEU B  2 149 ? 41.563  11.442  -2.393  1.00 0.00 ?  203 LEU B HD12 1  
ATOM   5713   H  HD13 . LEU B  2 149 ? 41.847  12.649  -3.830  1.00 0.00 ?  203 LEU B HD13 1  
ATOM   5714   H  HD21 . LEU B  2 149 ? 45.119  10.948  -1.659  1.00 0.00 ?  203 LEU B HD21 1  
ATOM   5715   H  HD22 . LEU B  2 149 ? 43.559  10.142  -1.479  1.00 0.00 ?  203 LEU B HD22 1  
ATOM   5716   H  HD23 . LEU B  2 149 ? 43.739  11.737  -0.792  1.00 0.00 ?  203 LEU B HD23 1  
ATOM   5717   N  N    . LYS B  2 150 ? 44.431  9.646   -6.889  1.00 0.00 ?  204 LYS B N    1  
ATOM   5718   C  CA   . LYS B  2 150 ? 44.304  8.651   -7.998  1.00 0.00 ?  204 LYS B CA   1  
ATOM   5719   C  C    . LYS B  2 150 ? 45.668  7.982   -8.473  1.00 0.00 ?  204 LYS B C    1  
ATOM   5720   O  O    . LYS B  2 150 ? 45.778  6.744   -8.606  1.00 0.00 ?  204 LYS B O    1  
ATOM   5721   C  CB   . LYS B  2 150 ? 43.472  9.276   -9.208  1.00 0.00 ?  204 LYS B CB   1  
ATOM   5722   C  CG   . LYS B  2 150 ? 43.411  8.411   -10.495 1.00 0.00 ?  204 LYS B CG   1  
ATOM   5723   C  CD   . LYS B  2 150 ? 42.415  8.821   -11.573 1.00 0.00 ?  204 LYS B CD   1  
ATOM   5724   C  CE   . LYS B  2 150 ? 42.797  10.016  -12.444 1.00 0.00 ?  204 LYS B CE   1  
ATOM   5725   N  NZ   . LYS B  2 150 ? 41.658  10.393  -13.300 1.00 0.00 1  204 LYS B NZ   1  
ATOM   5726   H  H    . LYS B  2 150 ? 44.442  10.599  -7.183  1.00 0.00 ?  204 LYS B H    1  
ATOM   5727   H  HA   . LYS B  2 150 ? 43.758  7.844   -7.533  1.00 0.00 ?  204 LYS B HA   1  
ATOM   5728   H  HB2  . LYS B  2 150 ? 42.490  9.604   -8.805  1.00 0.00 ?  204 LYS B HB2  1  
ATOM   5729   H  HB3  . LYS B  2 150 ? 43.932  10.227  -9.551  1.00 0.00 ?  204 LYS B HB3  1  
ATOM   5730   H  HG2  . LYS B  2 150 ? 44.365  8.354   -11.061 1.00 0.00 ?  204 LYS B HG2  1  
ATOM   5731   H  HG3  . LYS B  2 150 ? 43.071  7.401   -10.183 1.00 0.00 ?  204 LYS B HG3  1  
ATOM   5732   H  HD2  . LYS B  2 150 ? 42.150  7.895   -12.125 1.00 0.00 ?  204 LYS B HD2  1  
ATOM   5733   H  HD3  . LYS B  2 150 ? 41.484  9.071   -11.020 1.00 0.00 ?  204 LYS B HD3  1  
ATOM   5734   H  HE2  . LYS B  2 150 ? 42.984  10.833  -11.714 1.00 0.00 ?  204 LYS B HE2  1  
ATOM   5735   H  HE3  . LYS B  2 150 ? 43.646  9.677   -13.075 1.00 0.00 ?  204 LYS B HE3  1  
ATOM   5736   H  HZ1  . LYS B  2 150 ? 40.786  10.619  -12.780 1.00 0.00 ?  204 LYS B HZ1  1  
ATOM   5737   H  HZ2  . LYS B  2 150 ? 41.295  9.591   -13.853 1.00 0.00 ?  204 LYS B HZ2  1  
ATOM   5738   H  HZ3  . LYS B  2 150 ? 41.851  11.171  -13.962 1.00 0.00 ?  204 LYS B HZ3  1  
ATOM   5739   N  N    . GLU B  2 151 ? 46.776  8.760   -8.680  1.00 0.00 ?  205 GLU B N    1  
ATOM   5740   C  CA   . GLU B  2 151 ? 48.129  8.341   -9.021  1.00 0.00 ?  205 GLU B CA   1  
ATOM   5741   C  C    . GLU B  2 151 ? 48.646  7.427   -7.881  1.00 0.00 ?  205 GLU B C    1  
ATOM   5742   O  O    . GLU B  2 151 ? 49.290  6.386   -8.045  1.00 0.00 ?  205 GLU B O    1  
ATOM   5743   C  CB   . GLU B  2 151 ? 49.057  9.457   -9.363  1.00 0.00 ?  205 GLU B CB   1  
ATOM   5744   C  CG   . GLU B  2 151 ? 48.553  10.169  -10.724 1.00 0.00 ?  205 GLU B CG   1  
ATOM   5745   C  CD   . GLU B  2 151 ? 49.737  10.461  -11.585 1.00 0.00 ?  205 GLU B CD   1  
ATOM   5746   O  OE1  . GLU B  2 151 ? 50.019  9.701   -12.556 1.00 0.00 ?  205 GLU B OE1  1  
ATOM   5747   O  OE2  . GLU B  2 151 ? 50.423  11.468  -11.357 1.00 0.00 -1 205 GLU B OE2  1  
ATOM   5748   H  H    . GLU B  2 151 ? 46.700  9.740   -8.513  1.00 0.00 ?  205 GLU B H    1  
ATOM   5749   H  HA   . GLU B  2 151 ? 48.084  7.686   -9.878  1.00 0.00 ?  205 GLU B HA   1  
ATOM   5750   H  HB2  . GLU B  2 151 ? 48.981  10.320  -8.667  1.00 0.00 ?  205 GLU B HB2  1  
ATOM   5751   H  HB3  . GLU B  2 151 ? 50.111  9.139   -9.511  1.00 0.00 ?  205 GLU B HB3  1  
ATOM   5752   H  HG2  . GLU B  2 151 ? 48.034  9.386   -11.317 1.00 0.00 ?  205 GLU B HG2  1  
ATOM   5753   H  HG3  . GLU B  2 151 ? 47.792  10.974  -10.642 1.00 0.00 ?  205 GLU B HG3  1  
ATOM   5754   N  N    . ASN B  2 152 ? 48.446  7.901   -6.656  1.00 0.00 ?  206 ASN B N    1  
ATOM   5755   C  CA   . ASN B  2 152 ? 48.937  7.212   -5.501  1.00 0.00 ?  206 ASN B CA   1  
ATOM   5756   C  C    . ASN B  2 152 ? 48.101  5.978   -5.213  1.00 0.00 ?  206 ASN B C    1  
ATOM   5757   O  O    . ASN B  2 152 ? 48.631  4.922   -4.878  1.00 0.00 ?  206 ASN B O    1  
ATOM   5758   C  CB   . ASN B  2 152 ? 48.912  8.243   -4.330  1.00 0.00 ?  206 ASN B CB   1  
ATOM   5759   C  CG   . ASN B  2 152 ? 49.311  7.724   -2.939  1.00 0.00 ?  206 ASN B CG   1  
ATOM   5760   O  OD1  . ASN B  2 152 ? 49.456  6.534   -2.703  1.00 0.00 ?  206 ASN B OD1  1  
ATOM   5761   N  ND2  . ASN B  2 152 ? 49.703  8.660   -2.046  1.00 0.00 ?  206 ASN B ND2  1  
ATOM   5762   H  H    . ASN B  2 152 ? 47.993  8.781   -6.535  1.00 0.00 ?  206 ASN B H    1  
ATOM   5763   H  HA   . ASN B  2 152 ? 49.933  6.900   -5.779  1.00 0.00 ?  206 ASN B HA   1  
ATOM   5764   H  HB2  . ASN B  2 152 ? 49.615  9.064   -4.590  1.00 0.00 ?  206 ASN B HB2  1  
ATOM   5765   H  HB3  . ASN B  2 152 ? 47.889  8.665   -4.234  1.00 0.00 ?  206 ASN B HB3  1  
ATOM   5766   H  HD21 . ASN B  2 152 ? 50.234  8.279   -1.290  1.00 0.00 ?  206 ASN B HD21 1  
ATOM   5767   H  HD22 . ASN B  2 152 ? 49.354  9.590   -2.170  1.00 0.00 ?  206 ASN B HD22 1  
ATOM   5768   N  N    . GLY B  2 153 ? 46.716  6.098   -5.285  1.00 0.00 ?  207 GLY B N    1  
ATOM   5769   C  CA   . GLY B  2 153 ? 45.776  4.955   -5.032  1.00 0.00 ?  207 GLY B CA   1  
ATOM   5770   C  C    . GLY B  2 153 ? 46.034  3.936   -6.061  1.00 0.00 ?  207 GLY B C    1  
ATOM   5771   O  O    . GLY B  2 153 ? 46.106  2.759   -5.751  1.00 0.00 ?  207 GLY B O    1  
ATOM   5772   H  H    . GLY B  2 153 ? 46.268  6.982   -5.177  1.00 0.00 ?  207 GLY B H    1  
ATOM   5773   H  HA2  . GLY B  2 153 ? 45.998  4.545   -4.058  1.00 0.00 ?  207 GLY B HA2  1  
ATOM   5774   H  HA3  . GLY B  2 153 ? 44.771  5.275   -5.263  1.00 0.00 ?  207 GLY B HA3  1  
ATOM   5775   N  N    . GLY B  2 154 ? 46.378  4.336   -7.311  1.00 0.00 ?  208 GLY B N    1  
ATOM   5776   C  CA   . GLY B  2 154 ? 46.973  3.509   -8.361  1.00 0.00 ?  208 GLY B CA   1  
ATOM   5777   C  C    . GLY B  2 154 ? 48.174  2.700   -8.063  1.00 0.00 ?  208 GLY B C    1  
ATOM   5778   O  O    . GLY B  2 154 ? 48.231  1.490   -8.096  1.00 0.00 ?  208 GLY B O    1  
ATOM   5779   H  H    . GLY B  2 154 ? 46.189  5.286   -7.547  1.00 0.00 ?  208 GLY B H    1  
ATOM   5780   H  HA2  . GLY B  2 154 ? 46.225  2.804   -8.691  1.00 0.00 ?  208 GLY B HA2  1  
ATOM   5781   H  HA3  . GLY B  2 154 ? 47.371  4.214   -9.077  1.00 0.00 ?  208 GLY B HA3  1  
ATOM   5782   N  N    . ALA B  2 155 ? 49.245  3.430   -7.726  1.00 0.00 ?  209 ALA B N    1  
ATOM   5783   C  CA   . ALA B  2 155 ? 50.472  2.745   -7.293  1.00 0.00 ?  209 ALA B CA   1  
ATOM   5784   C  C    . ALA B  2 155 ? 50.295  1.798   -6.135  1.00 0.00 ?  209 ALA B C    1  
ATOM   5785   O  O    . ALA B  2 155 ? 50.777  0.679   -6.136  1.00 0.00 ?  209 ALA B O    1  
ATOM   5786   C  CB   . ALA B  2 155 ? 51.469  3.904   -7.129  1.00 0.00 ?  209 ALA B CB   1  
ATOM   5787   H  H    . ALA B  2 155 ? 49.152  4.416   -7.611  1.00 0.00 ?  209 ALA B H    1  
ATOM   5788   H  HA   . ALA B  2 155 ? 50.696  2.198   -8.197  1.00 0.00 ?  209 ALA B HA   1  
ATOM   5789   H  HB1  . ALA B  2 155 ? 51.530  4.426   -8.108  1.00 0.00 ?  209 ALA B HB1  1  
ATOM   5790   H  HB2  . ALA B  2 155 ? 52.505  3.578   -6.896  1.00 0.00 ?  209 ALA B HB2  1  
ATOM   5791   H  HB3  . ALA B  2 155 ? 51.103  4.670   -6.411  1.00 0.00 ?  209 ALA B HB3  1  
ATOM   5792   N  N    . ARG B  2 156 ? 49.418  2.138   -5.120  1.00 0.00 ?  210 ARG B N    1  
ATOM   5793   C  CA   . ARG B  2 156 ? 48.943  1.179   -4.093  1.00 0.00 ?  210 ARG B CA   1  
ATOM   5794   C  C    . ARG B  2 156 ? 48.227  -0.002  -4.601  1.00 0.00 ?  210 ARG B C    1  
ATOM   5795   O  O    . ARG B  2 156 ? 48.478  -1.142  -4.246  1.00 0.00 ?  210 ARG B O    1  
ATOM   5796   C  CB   . ARG B  2 156 ? 48.086  1.855   -2.964  1.00 0.00 ?  210 ARG B CB   1  
ATOM   5797   C  CG   . ARG B  2 156 ? 48.884  2.450   -1.799  1.00 0.00 ?  210 ARG B CG   1  
ATOM   5798   C  CD   . ARG B  2 156 ? 49.886  3.596   -2.107  1.00 0.00 ?  210 ARG B CD   1  
ATOM   5799   N  NE   . ARG B  2 156 ? 51.166  2.979   -2.668  1.00 0.00 ?  210 ARG B NE   1  
ATOM   5800   C  CZ   . ARG B  2 156 ? 51.970  3.783   -3.420  1.00 0.00 ?  210 ARG B CZ   1  
ATOM   5801   N  NH1  . ARG B  2 156 ? 53.031  3.286   -4.008  1.00 0.00 1  210 ARG B NH1  1  
ATOM   5802   N  NH2  . ARG B  2 156 ? 51.738  5.059   -3.650  1.00 0.00 ?  210 ARG B NH2  1  
ATOM   5803   H  H    . ARG B  2 156 ? 49.014  3.048   -5.165  1.00 0.00 ?  210 ARG B H    1  
ATOM   5804   H  HA   . ARG B  2 156 ? 49.857  0.769   -3.688  1.00 0.00 ?  210 ARG B HA   1  
ATOM   5805   H  HB2  . ARG B  2 156 ? 47.496  2.642   -3.479  1.00 0.00 ?  210 ARG B HB2  1  
ATOM   5806   H  HB3  . ARG B  2 156 ? 47.329  1.134   -2.590  1.00 0.00 ?  210 ARG B HB3  1  
ATOM   5807   H  HG2  . ARG B  2 156 ? 48.151  2.873   -1.079  1.00 0.00 ?  210 ARG B HG2  1  
ATOM   5808   H  HG3  . ARG B  2 156 ? 49.372  1.626   -1.236  1.00 0.00 ?  210 ARG B HG3  1  
ATOM   5809   H  HD2  . ARG B  2 156 ? 49.430  4.317   -2.818  1.00 0.00 ?  210 ARG B HD2  1  
ATOM   5810   H  HD3  . ARG B  2 156 ? 50.178  4.170   -1.201  1.00 0.00 ?  210 ARG B HD3  1  
ATOM   5811   H  HE   . ARG B  2 156 ? 51.341  1.995   -2.702  1.00 0.00 ?  210 ARG B HE   1  
ATOM   5812   H  HH11 . ARG B  2 156 ? 53.271  2.352   -3.744  1.00 0.00 ?  210 ARG B HH11 1  
ATOM   5813   H  HH12 . ARG B  2 156 ? 53.786  3.942   -3.988  1.00 0.00 ?  210 ARG B HH12 1  
ATOM   5814   H  HH21 . ARG B  2 156 ? 50.887  5.364   -3.222  1.00 0.00 ?  210 ARG B HH21 1  
ATOM   5815   H  HH22 . ARG B  2 156 ? 52.367  5.553   -4.250  1.00 0.00 ?  210 ARG B HH22 1  
ATOM   5816   N  N    . LEU B  2 157 ? 47.268  0.176   -5.500  1.00 0.00 ?  211 LEU B N    1  
ATOM   5817   C  CA   . LEU B  2 157 ? 46.369  -0.811  -6.010  1.00 0.00 ?  211 LEU B CA   1  
ATOM   5818   C  C    . LEU B  2 157 ? 47.147  -1.784  -6.812  1.00 0.00 ?  211 LEU B C    1  
ATOM   5819   O  O    . LEU B  2 157 ? 46.784  -2.917  -6.771  1.00 0.00 ?  211 LEU B O    1  
ATOM   5820   C  CB   . LEU B  2 157 ? 45.256  -0.086  -6.772  1.00 0.00 ?  211 LEU B CB   1  
ATOM   5821   C  CG   . LEU B  2 157 ? 44.260  -1.086  -7.411  1.00 0.00 ?  211 LEU B CG   1  
ATOM   5822   C  CD1  . LEU B  2 157 ? 43.527  -1.949  -6.395  1.00 0.00 ?  211 LEU B CD1  1  
ATOM   5823   C  CD2  . LEU B  2 157 ? 43.385  -0.325  -8.403  1.00 0.00 ?  211 LEU B CD2  1  
ATOM   5824   H  H    . LEU B  2 157 ? 47.187  1.043   -5.984  1.00 0.00 ?  211 LEU B H    1  
ATOM   5825   H  HA   . LEU B  2 157 ? 45.974  -1.370  -5.174  1.00 0.00 ?  211 LEU B HA   1  
ATOM   5826   H  HB2  . LEU B  2 157 ? 44.687  0.424   -5.966  1.00 0.00 ?  211 LEU B HB2  1  
ATOM   5827   H  HB3  . LEU B  2 157 ? 45.756  0.489   -7.581  1.00 0.00 ?  211 LEU B HB3  1  
ATOM   5828   H  HG   . LEU B  2 157 ? 44.898  -1.661  -8.116  1.00 0.00 ?  211 LEU B HG   1  
ATOM   5829   H  HD11 . LEU B  2 157 ? 43.005  -1.304  -5.657  1.00 0.00 ?  211 LEU B HD11 1  
ATOM   5830   H  HD12 . LEU B  2 157 ? 44.285  -2.464  -5.766  1.00 0.00 ?  211 LEU B HD12 1  
ATOM   5831   H  HD13 . LEU B  2 157 ? 42.695  -2.566  -6.795  1.00 0.00 ?  211 LEU B HD13 1  
ATOM   5832   H  HD21 . LEU B  2 157 ? 42.733  -0.958  -9.043  1.00 0.00 ?  211 LEU B HD21 1  
ATOM   5833   H  HD22 . LEU B  2 157 ? 44.052  0.149   -9.155  1.00 0.00 ?  211 LEU B HD22 1  
ATOM   5834   H  HD23 . LEU B  2 157 ? 42.837  0.538   -7.970  1.00 0.00 ?  211 LEU B HD23 1  
ATOM   5835   N  N    . ALA B  2 158 ? 48.163  -1.363  -7.546  1.00 0.00 ?  212 ALA B N    1  
ATOM   5836   C  CA   . ALA B  2 158 ? 49.141  -2.170  -8.209  1.00 0.00 ?  212 ALA B CA   1  
ATOM   5837   C  C    . ALA B  2 158 ? 50.021  -2.997  -7.331  1.00 0.00 ?  212 ALA B C    1  
ATOM   5838   O  O    . ALA B  2 158 ? 50.194  -4.167  -7.532  1.00 0.00 ?  212 ALA B O    1  
ATOM   5839   C  CB   . ALA B  2 158 ? 50.009  -1.330  -9.208  1.00 0.00 ?  212 ALA B CB   1  
ATOM   5840   H  H    . ALA B  2 158 ? 48.393  -0.404  -7.697  1.00 0.00 ?  212 ALA B H    1  
ATOM   5841   H  HA   . ALA B  2 158 ? 48.692  -2.852  -8.916  1.00 0.00 ?  212 ALA B HA   1  
ATOM   5842   H  HB1  . ALA B  2 158 ? 50.781  -0.691  -8.727  1.00 0.00 ?  212 ALA B HB1  1  
ATOM   5843   H  HB2  . ALA B  2 158 ? 49.392  -0.607  -9.782  1.00 0.00 ?  212 ALA B HB2  1  
ATOM   5844   H  HB3  . ALA B  2 158 ? 50.461  -1.988  -9.982  1.00 0.00 ?  212 ALA B HB3  1  
ATOM   5845   N  N    . GLU B  2 159 ? 50.551  -2.383  -6.240  1.00 0.00 ?  213 GLU B N    1  
ATOM   5846   C  CA   . GLU B  2 159 ? 51.376  -3.061  -5.213  1.00 0.00 ?  213 GLU B CA   1  
ATOM   5847   C  C    . GLU B  2 159 ? 50.785  -4.394  -4.643  1.00 0.00 ?  213 GLU B C    1  
ATOM   5848   O  O    . GLU B  2 159 ? 51.351  -5.438  -4.648  1.00 0.00 ?  213 GLU B O    1  
ATOM   5849   C  CB   . GLU B  2 159 ? 51.692  -2.115  -4.012  1.00 0.00 ?  213 GLU B CB   1  
ATOM   5850   C  CG   . GLU B  2 159 ? 52.990  -2.501  -3.298  1.00 0.00 ?  213 GLU B CG   1  
ATOM   5851   C  CD   . GLU B  2 159 ? 54.302  -2.575  -4.087  1.00 0.00 ?  213 GLU B CD   1  
ATOM   5852   O  OE1  . GLU B  2 159 ? 54.837  -3.696  -4.270  1.00 0.00 ?  213 GLU B OE1  1  
ATOM   5853   O  OE2  . GLU B  2 159 ? 54.651  -1.476  -4.665  1.00 0.00 -1 213 GLU B OE2  1  
ATOM   5854   H  H    . GLU B  2 159 ? 50.241  -1.460  -6.024  1.00 0.00 ?  213 GLU B H    1  
ATOM   5855   H  HA   . GLU B  2 159 ? 52.257  -3.365  -5.757  1.00 0.00 ?  213 GLU B HA   1  
ATOM   5856   H  HB2  . GLU B  2 159 ? 51.835  -1.100  -4.441  1.00 0.00 ?  213 GLU B HB2  1  
ATOM   5857   H  HB3  . GLU B  2 159 ? 50.841  -2.068  -3.300  1.00 0.00 ?  213 GLU B HB3  1  
ATOM   5858   H  HG2  . GLU B  2 159 ? 53.134  -1.707  -2.534  1.00 0.00 ?  213 GLU B HG2  1  
ATOM   5859   H  HG3  . GLU B  2 159 ? 52.897  -3.500  -2.822  1.00 0.00 ?  213 GLU B HG3  1  
ATOM   5860   N  N    . TYR B  2 160 ? 49.529  -4.319  -4.087  1.00 0.00 ?  214 TYR B N    1  
ATOM   5861   C  CA   . TYR B  2 160 ? 48.678  -5.428  -3.948  1.00 0.00 ?  214 TYR B CA   1  
ATOM   5862   C  C    . TYR B  2 160 ? 48.365  -6.291  -5.127  1.00 0.00 ?  214 TYR B C    1  
ATOM   5863   O  O    . TYR B  2 160 ? 48.578  -7.458  -4.971  1.00 0.00 ?  214 TYR B O    1  
ATOM   5864   C  CB   . TYR B  2 160 ? 47.356  -4.733  -3.394  1.00 0.00 ?  214 TYR B CB   1  
ATOM   5865   C  CG   . TYR B  2 160 ? 47.426  -4.247  -1.968  1.00 0.00 ?  214 TYR B CG   1  
ATOM   5866   C  CD1  . TYR B  2 160 ? 47.804  -5.129  -0.964  1.00 0.00 ?  214 TYR B CD1  1  
ATOM   5867   C  CD2  . TYR B  2 160 ? 47.315  -2.848  -1.663  1.00 0.00 ?  214 TYR B CD2  1  
ATOM   5868   C  CE1  . TYR B  2 160 ? 47.968  -4.705  0.360   1.00 0.00 ?  214 TYR B CE1  1  
ATOM   5869   C  CE2  . TYR B  2 160 ? 47.444  -2.440  -0.326  1.00 0.00 ?  214 TYR B CE2  1  
ATOM   5870   C  CZ   . TYR B  2 160 ? 47.810  -3.390  0.691   1.00 0.00 ?  214 TYR B CZ   1  
ATOM   5871   O  OH   . TYR B  2 160 ? 48.209  -2.912  1.968   1.00 0.00 ?  214 TYR B OH   1  
ATOM   5872   H  H    . TYR B  2 160 ? 49.191  -3.383  -4.023  1.00 0.00 ?  214 TYR B H    1  
ATOM   5873   H  HA   . TYR B  2 160 ? 49.054  -6.176  -3.266  1.00 0.00 ?  214 TYR B HA   1  
ATOM   5874   H  HB2  . TYR B  2 160 ? 46.836  -3.958  -3.996  1.00 0.00 ?  214 TYR B HB2  1  
ATOM   5875   H  HB3  . TYR B  2 160 ? 46.514  -5.437  -3.220  1.00 0.00 ?  214 TYR B HB3  1  
ATOM   5876   H  HD1  . TYR B  2 160 ? 47.902  -6.167  -1.246  1.00 0.00 ?  214 TYR B HD1  1  
ATOM   5877   H  HD2  . TYR B  2 160 ? 47.038  -2.154  -2.443  1.00 0.00 ?  214 TYR B HD2  1  
ATOM   5878   H  HE1  . TYR B  2 160 ? 48.411  -5.362  1.094   1.00 0.00 ?  214 TYR B HE1  1  
ATOM   5879   H  HE2  . TYR B  2 160 ? 47.288  -1.385  -0.158  1.00 0.00 ?  214 TYR B HE2  1  
ATOM   5880   H  HH   . TYR B  2 160 ? 48.163  -3.598  2.638   1.00 0.00 ?  214 TYR B HH   1  
ATOM   5881   N  N    . HIS B  2 161 ? 47.989  -5.754  -6.289  1.00 0.00 ?  215 HIS B N    1  
ATOM   5882   C  CA   . HIS B  2 161 ? 47.719  -6.458  -7.568  1.00 0.00 ?  215 HIS B CA   1  
ATOM   5883   C  C    . HIS B  2 161 ? 48.740  -7.458  -7.991  1.00 0.00 ?  215 HIS B C    1  
ATOM   5884   O  O    . HIS B  2 161 ? 48.378  -8.611  -8.253  1.00 0.00 ?  215 HIS B O    1  
ATOM   5885   C  CB   . HIS B  2 161 ? 47.268  -5.450  -8.718  1.00 0.00 ?  215 HIS B CB   1  
ATOM   5886   C  CG   . HIS B  2 161 ? 46.808  -6.081  -10.063 1.00 0.00 ?  215 HIS B CG   1  
ATOM   5887   N  ND1  . HIS B  2 161 ? 47.657  -6.590  -10.987 1.00 0.00 ?  215 HIS B ND1  1  
ATOM   5888   C  CD2  . HIS B  2 161 ? 45.569  -6.218  -10.587 1.00 0.00 ?  215 HIS B CD2  1  
ATOM   5889   C  CE1  . HIS B  2 161 ? 46.963  -6.981  -12.042 1.00 0.00 ?  215 HIS B CE1  1  
ATOM   5890   N  NE2  . HIS B  2 161 ? 45.666  -6.780  -11.829 1.00 0.00 ?  215 HIS B NE2  1  
ATOM   5891   H  H    . HIS B  2 161 ? 48.010  -4.758  -6.338  1.00 0.00 ?  215 HIS B H    1  
ATOM   5892   H  HA   . HIS B  2 161 ? 46.772  -6.929  -7.347  1.00 0.00 ?  215 HIS B HA   1  
ATOM   5893   H  HB2  . HIS B  2 161 ? 46.361  -4.946  -8.321  1.00 0.00 ?  215 HIS B HB2  1  
ATOM   5894   H  HB3  . HIS B  2 161 ? 48.051  -4.692  -8.933  1.00 0.00 ?  215 HIS B HB3  1  
ATOM   5895   H  HD1  . HIS B  2 161 ? 48.599  -6.893  -10.846 1.00 0.00 ?  215 HIS B HD1  1  
ATOM   5896   H  HD2  . HIS B  2 161 ? 44.636  -5.982  -10.090 1.00 0.00 ?  215 HIS B HD2  1  
ATOM   5897   H  HE1  . HIS B  2 161 ? 47.418  -7.362  -12.956 1.00 0.00 ?  215 HIS B HE1  1  
ATOM   5898   N  N    . ALA B  2 162 ? 50.071  -7.175  -8.017  1.00 0.00 ?  216 ALA B N    1  
ATOM   5899   C  CA   . ALA B  2 162 ? 51.101  -8.226  -8.313  1.00 0.00 ?  216 ALA B CA   1  
ATOM   5900   C  C    . ALA B  2 162 ? 51.330  -9.279  -7.269  1.00 0.00 ?  216 ALA B C    1  
ATOM   5901   O  O    . ALA B  2 162 ? 51.571  -10.443 -7.579  1.00 0.00 ?  216 ALA B O    1  
ATOM   5902   C  CB   . ALA B  2 162 ? 52.391  -7.428  -8.724  1.00 0.00 ?  216 ALA B CB   1  
ATOM   5903   H  H    . ALA B  2 162 ? 50.416  -6.249  -7.889  1.00 0.00 ?  216 ALA B H    1  
ATOM   5904   H  HA   . ALA B  2 162 ? 50.717  -8.716  -9.196  1.00 0.00 ?  216 ALA B HA   1  
ATOM   5905   H  HB1  . ALA B  2 162 ? 52.201  -6.812  -9.629  1.00 0.00 ?  216 ALA B HB1  1  
ATOM   5906   H  HB2  . ALA B  2 162 ? 53.249  -8.117  -8.878  1.00 0.00 ?  216 ALA B HB2  1  
ATOM   5907   H  HB3  . ALA B  2 162 ? 52.629  -6.705  -7.915  1.00 0.00 ?  216 ALA B HB3  1  
ATOM   5908   N  N    . LYS B  2 163 ? 51.168  -8.945  -5.974  1.00 0.00 ?  217 LYS B N    1  
ATOM   5909   C  CA   . LYS B  2 163 ? 51.123  -10.032 -4.973  1.00 0.00 ?  217 LYS B CA   1  
ATOM   5910   C  C    . LYS B  2 163 ? 49.859  -10.872 -5.020  1.00 0.00 ?  217 LYS B C    1  
ATOM   5911   O  O    . LYS B  2 163 ? 49.914  -12.073 -4.942  1.00 0.00 ?  217 LYS B O    1  
ATOM   5912   C  CB   . LYS B  2 163 ? 51.282  -9.637  -3.489  1.00 0.00 ?  217 LYS B CB   1  
ATOM   5913   C  CG   . LYS B  2 163 ? 52.499  -8.831  -3.116  1.00 0.00 ?  217 LYS B CG   1  
ATOM   5914   C  CD   . LYS B  2 163 ? 53.828  -9.588  -3.484  1.00 0.00 ?  217 LYS B CD   1  
ATOM   5915   C  CE   . LYS B  2 163 ? 55.119  -8.867  -3.038  1.00 0.00 ?  217 LYS B CE   1  
ATOM   5916   N  NZ   . LYS B  2 163 ? 56.301  -9.695  -3.146  1.00 0.00 1  217 LYS B NZ   1  
ATOM   5917   H  H    . LYS B  2 163 ? 50.930  -8.030  -5.656  1.00 0.00 ?  217 LYS B H    1  
ATOM   5918   H  HA   . LYS B  2 163 ? 51.967  -10.706 -4.995  1.00 0.00 ?  217 LYS B HA   1  
ATOM   5919   H  HB2  . LYS B  2 163 ? 50.326  -9.148  -3.202  1.00 0.00 ?  217 LYS B HB2  1  
ATOM   5920   H  HB3  . LYS B  2 163 ? 51.325  -10.573 -2.892  1.00 0.00 ?  217 LYS B HB3  1  
ATOM   5921   H  HG2  . LYS B  2 163 ? 52.561  -7.813  -3.555  1.00 0.00 ?  217 LYS B HG2  1  
ATOM   5922   H  HG3  . LYS B  2 163 ? 52.418  -8.649  -2.023  1.00 0.00 ?  217 LYS B HG3  1  
ATOM   5923   H  HD2  . LYS B  2 163 ? 53.761  -10.529 -2.897  1.00 0.00 ?  217 LYS B HD2  1  
ATOM   5924   H  HD3  . LYS B  2 163 ? 53.977  -9.820  -4.561  1.00 0.00 ?  217 LYS B HD3  1  
ATOM   5925   H  HE2  . LYS B  2 163 ? 55.309  -7.911  -3.570  1.00 0.00 ?  217 LYS B HE2  1  
ATOM   5926   H  HE3  . LYS B  2 163 ? 54.927  -8.703  -1.956  1.00 0.00 ?  217 LYS B HE3  1  
ATOM   5927   H  HZ1  . LYS B  2 163 ? 56.708  -9.776  -2.193  1.00 0.00 ?  217 LYS B HZ1  1  
ATOM   5928   H  HZ2  . LYS B  2 163 ? 56.959  -9.096  -3.686  1.00 0.00 ?  217 LYS B HZ2  1  
ATOM   5929   H  HZ3  . LYS B  2 163 ? 56.108  -10.592 -3.637  1.00 0.00 ?  217 LYS B HZ3  1  
ATOM   5930   N  N    . ALA B  2 164 ? 48.654  -10.248 -5.180  1.00 0.00 ?  218 ALA B N    1  
ATOM   5931   C  CA   . ALA B  2 164 ? 47.349  -10.906 -5.340  1.00 0.00 ?  218 ALA B CA   1  
ATOM   5932   C  C    . ALA B  2 164 ? 47.131  -11.741 -6.552  1.00 0.00 ?  218 ALA B C    1  
ATOM   5933   O  O    . ALA B  2 164 ? 46.520  -12.805 -6.570  1.00 0.00 ?  218 ALA B O    1  
ATOM   5934   C  CB   . ALA B  2 164 ? 46.215  -9.841  -5.268  1.00 0.00 ?  218 ALA B CB   1  
ATOM   5935   H  H    . ALA B  2 164 ? 48.646  -9.253  -5.126  1.00 0.00 ?  218 ALA B H    1  
ATOM   5936   H  HA   . ALA B  2 164 ? 47.208  -11.635 -4.557  1.00 0.00 ?  218 ALA B HA   1  
ATOM   5937   H  HB1  . ALA B  2 164 ? 46.534  -9.036  -5.964  1.00 0.00 ?  218 ALA B HB1  1  
ATOM   5938   H  HB2  . ALA B  2 164 ? 46.213  -9.418  -4.240  1.00 0.00 ?  218 ALA B HB2  1  
ATOM   5939   H  HB3  . ALA B  2 164 ? 45.193  -10.196 -5.520  1.00 0.00 ?  218 ALA B HB3  1  
ATOM   5940   N  N    . THR B  2 165 ? 47.819  -11.383 -7.700  1.00 0.00 ?  219 THR B N    1  
ATOM   5941   C  CA   . THR B  2 165 ? 48.004  -12.267 -8.900  1.00 0.00 ?  219 THR B CA   1  
ATOM   5942   C  C    . THR B  2 165 ? 48.778  -13.517 -8.648  1.00 0.00 ?  219 THR B C    1  
ATOM   5943   O  O    . THR B  2 165 ? 48.329  -14.643 -8.922  1.00 0.00 ?  219 THR B O    1  
ATOM   5944   C  CB   . THR B  2 165 ? 48.636  -11.536 -10.054 1.00 0.00 ?  219 THR B CB   1  
ATOM   5945   O  OG1  . THR B  2 165 ? 47.915  -10.372 -10.319 1.00 0.00 ?  219 THR B OG1  1  
ATOM   5946   C  CG2  . THR B  2 165 ? 48.565  -12.318 -11.345 1.00 0.00 ?  219 THR B CG2  1  
ATOM   5947   H  H    . THR B  2 165 ? 48.302  -10.511 -7.685  1.00 0.00 ?  219 THR B H    1  
ATOM   5948   H  HA   . THR B  2 165 ? 46.984  -12.528 -9.144  1.00 0.00 ?  219 THR B HA   1  
ATOM   5949   H  HB   . THR B  2 165 ? 49.664  -11.164 -9.854  1.00 0.00 ?  219 THR B HB   1  
ATOM   5950   H  HG1  . THR B  2 165 ? 47.975  -9.796  -9.553  1.00 0.00 ?  219 THR B HG1  1  
ATOM   5951   H  HG21 . THR B  2 165 ? 47.505  -12.538 -11.596 1.00 0.00 ?  219 THR B HG21 1  
ATOM   5952   H  HG22 . THR B  2 165 ? 49.059  -13.305 -11.218 1.00 0.00 ?  219 THR B HG22 1  
ATOM   5953   H  HG23 . THR B  2 165 ? 49.042  -11.726 -12.155 1.00 0.00 ?  219 THR B HG23 1  
ATOM   5954   N  N    . GLU B  2 166 ? 49.929  -13.434 -7.942  1.00 0.00 ?  220 GLU B N    1  
ATOM   5955   C  CA   . GLU B  2 166 ? 50.681  -14.602 -7.418  1.00 0.00 ?  220 GLU B CA   1  
ATOM   5956   C  C    . GLU B  2 166 ? 49.866  -15.479 -6.469  1.00 0.00 ?  220 GLU B C    1  
ATOM   5957   O  O    . GLU B  2 166 ? 49.884  -16.689 -6.461  1.00 0.00 ?  220 GLU B O    1  
ATOM   5958   C  CB   . GLU B  2 166 ? 51.957  -14.118 -6.721  1.00 0.00 ?  220 GLU B CB   1  
ATOM   5959   C  CG   . GLU B  2 166 ? 53.076  -13.605 -7.745  1.00 0.00 ?  220 GLU B CG   1  
ATOM   5960   C  CD   . GLU B  2 166 ? 54.505  -13.587 -7.208  1.00 0.00 ?  220 GLU B CD   1  
ATOM   5961   O  OE1  . GLU B  2 166 ? 55.013  -14.578 -6.623  1.00 0.00 ?  220 GLU B OE1  1  
ATOM   5962   O  OE2  . GLU B  2 166 ? 55.189  -12.613 -7.550  1.00 0.00 -1 220 GLU B OE2  1  
ATOM   5963   H  H    . GLU B  2 166 ? 50.373  -12.549 -7.822  1.00 0.00 ?  220 GLU B H    1  
ATOM   5964   H  HA   . GLU B  2 166 ? 50.835  -15.227 -8.285  1.00 0.00 ?  220 GLU B HA   1  
ATOM   5965   H  HB2  . GLU B  2 166 ? 51.748  -13.230 -6.087  1.00 0.00 ?  220 GLU B HB2  1  
ATOM   5966   H  HB3  . GLU B  2 166 ? 52.363  -15.023 -6.221  1.00 0.00 ?  220 GLU B HB3  1  
ATOM   5967   H  HG2  . GLU B  2 166 ? 53.000  -14.168 -8.700  1.00 0.00 ?  220 GLU B HG2  1  
ATOM   5968   H  HG3  . GLU B  2 166 ? 52.839  -12.553 -8.015  1.00 0.00 ?  220 GLU B HG3  1  
ATOM   5969   N  N    . HIS B  2 167 ? 49.147  -14.817 -5.533  1.00 0.00 ?  221 HIS B N    1  
ATOM   5970   C  CA   . HIS B  2 167 ? 48.207  -15.480 -4.739  1.00 0.00 ?  221 HIS B CA   1  
ATOM   5971   C  C    . HIS B  2 167 ? 47.025  -16.175 -5.450  1.00 0.00 ?  221 HIS B C    1  
ATOM   5972   O  O    . HIS B  2 167 ? 46.661  -17.239 -5.051  1.00 0.00 ?  221 HIS B O    1  
ATOM   5973   C  CB   . HIS B  2 167 ? 47.639  -14.541 -3.639  1.00 0.00 ?  221 HIS B CB   1  
ATOM   5974   C  CG   . HIS B  2 167 ? 48.692  -13.889 -2.745  1.00 0.00 ?  221 HIS B CG   1  
ATOM   5975   N  ND1  . HIS B  2 167 ? 49.672  -14.595 -2.109  1.00 0.00 ?  221 HIS B ND1  1  
ATOM   5976   C  CD2  . HIS B  2 167 ? 48.833  -12.616 -2.302  1.00 0.00 ?  221 HIS B CD2  1  
ATOM   5977   C  CE1  . HIS B  2 167 ? 50.441  -13.729 -1.404  1.00 0.00 ?  221 HIS B CE1  1  
ATOM   5978   N  NE2  . HIS B  2 167 ? 49.977  -12.494 -1.544  1.00 0.00 ?  221 HIS B NE2  1  
ATOM   5979   H  H    . HIS B  2 167 ? 49.294  -13.839 -5.406  1.00 0.00 ?  221 HIS B H    1  
ATOM   5980   H  HA   . HIS B  2 167 ? 48.693  -16.301 -4.233  1.00 0.00 ?  221 HIS B HA   1  
ATOM   5981   H  HB2  . HIS B  2 167 ? 46.837  -13.846 -3.967  1.00 0.00 ?  221 HIS B HB2  1  
ATOM   5982   H  HB3  . HIS B  2 167 ? 47.176  -15.230 -2.900  1.00 0.00 ?  221 HIS B HB3  1  
ATOM   5983   H  HD1  . HIS B  2 167 ? 49.844  -15.553 -2.337  1.00 0.00 ?  221 HIS B HD1  1  
ATOM   5984   H  HD2  . HIS B  2 167 ? 48.309  -11.722 -2.618  1.00 0.00 ?  221 HIS B HD2  1  
ATOM   5985   H  HE1  . HIS B  2 167 ? 51.308  -14.091 -0.851  1.00 0.00 ?  221 HIS B HE1  1  
ATOM   5986   N  N    . LEU B  2 168 ? 46.302  -15.441 -6.352  1.00 0.00 ?  222 LEU B N    1  
ATOM   5987   C  CA   . LEU B  2 168 ? 45.223  -16.106 -7.150  1.00 0.00 ?  222 LEU B CA   1  
ATOM   5988   C  C    . LEU B  2 168 ? 45.554  -17.273 -7.964  1.00 0.00 ?  222 LEU B C    1  
ATOM   5989   O  O    . LEU B  2 168 ? 44.817  -18.264 -7.871  1.00 0.00 ?  222 LEU B O    1  
ATOM   5990   C  CB   . LEU B  2 168 ? 44.480  -15.110 -8.012  1.00 0.00 ?  222 LEU B CB   1  
ATOM   5991   C  CG   . LEU B  2 168 ? 43.527  -14.164 -7.233  1.00 0.00 ?  222 LEU B CG   1  
ATOM   5992   C  CD1  . LEU B  2 168 ? 43.108  -12.901 -8.020  1.00 0.00 ?  222 LEU B CD1  1  
ATOM   5993   C  CD2  . LEU B  2 168 ? 42.273  -14.961 -6.840  1.00 0.00 ?  222 LEU B CD2  1  
ATOM   5994   H  H    . LEU B  2 168 ? 46.472  -14.480 -6.554  1.00 0.00 ?  222 LEU B H    1  
ATOM   5995   H  HA   . LEU B  2 168 ? 44.454  -16.446 -6.472  1.00 0.00 ?  222 LEU B HA   1  
ATOM   5996   H  HB2  . LEU B  2 168 ? 45.274  -14.493 -8.484  1.00 0.00 ?  222 LEU B HB2  1  
ATOM   5997   H  HB3  . LEU B  2 168 ? 43.887  -15.588 -8.821  1.00 0.00 ?  222 LEU B HB3  1  
ATOM   5998   H  HG   . LEU B  2 168 ? 44.048  -13.784 -6.327  1.00 0.00 ?  222 LEU B HG   1  
ATOM   5999   H  HD11 . LEU B  2 168 ? 43.975  -12.463 -8.558  1.00 0.00 ?  222 LEU B HD11 1  
ATOM   6000   H  HD12 . LEU B  2 168 ? 42.772  -12.132 -7.292  1.00 0.00 ?  222 LEU B HD12 1  
ATOM   6001   H  HD13 . LEU B  2 168 ? 42.309  -13.099 -8.766  1.00 0.00 ?  222 LEU B HD13 1  
ATOM   6002   H  HD21 . LEU B  2 168 ? 41.610  -15.055 -7.726  1.00 0.00 ?  222 LEU B HD21 1  
ATOM   6003   H  HD22 . LEU B  2 168 ? 41.691  -14.540 -5.993  1.00 0.00 ?  222 LEU B HD22 1  
ATOM   6004   H  HD23 . LEU B  2 168 ? 42.412  -15.985 -6.433  1.00 0.00 ?  222 LEU B HD23 1  
ATOM   6005   N  N    . SER B  2 169 ? 46.665  -17.239 -8.708  1.00 0.00 ?  223 SER B N    1  
ATOM   6006   C  CA   . SER B  2 169 ? 47.275  -18.461 -9.367  1.00 0.00 ?  223 SER B CA   1  
ATOM   6007   C  C    . SER B  2 169 ? 47.426  -19.624 -8.413  1.00 0.00 ?  223 SER B C    1  
ATOM   6008   O  O    . SER B  2 169 ? 47.039  -20.777 -8.686  1.00 0.00 ?  223 SER B O    1  
ATOM   6009   C  CB   . SER B  2 169 ? 48.631  -18.053 -9.962  1.00 0.00 ?  223 SER B CB   1  
ATOM   6010   O  OG   . SER B  2 169 ? 48.606  -16.880 -10.754 1.00 0.00 ?  223 SER B OG   1  
ATOM   6011   H  H    . SER B  2 169 ? 47.193  -16.394 -8.739  1.00 0.00 ?  223 SER B H    1  
ATOM   6012   H  HA   . SER B  2 169 ? 46.669  -18.724 -10.221 1.00 0.00 ?  223 SER B HA   1  
ATOM   6013   H  HB2  . SER B  2 169 ? 49.314  -17.817 -9.119  1.00 0.00 ?  223 SER B HB2  1  
ATOM   6014   H  HB3  . SER B  2 169 ? 48.964  -18.910 -10.586 1.00 0.00 ?  223 SER B HB3  1  
ATOM   6015   H  HG   . SER B  2 169 ? 48.983  -16.195 -10.197 1.00 0.00 ?  223 SER B HG   1  
ATOM   6016   N  N    . THR B  2 170 ? 48.059  -19.337 -7.277  1.00 0.00 ?  224 THR B N    1  
ATOM   6017   C  CA   . THR B  2 170 ? 48.213  -20.338 -6.187  1.00 0.00 ?  224 THR B CA   1  
ATOM   6018   C  C    . THR B  2 170 ? 46.878  -20.810 -5.525  1.00 0.00 ?  224 THR B C    1  
ATOM   6019   O  O    . THR B  2 170 ? 46.675  -21.977 -5.284  1.00 0.00 ?  224 THR B O    1  
ATOM   6020   C  CB   . THR B  2 170 ? 49.096  -19.907 -5.026  1.00 0.00 ?  224 THR B CB   1  
ATOM   6021   O  OG1  . THR B  2 170 ? 50.266  -19.138 -5.442  1.00 0.00 ?  224 THR B OG1  1  
ATOM   6022   C  CG2  . THR B  2 170 ? 49.625  -21.072 -4.176  1.00 0.00 ?  224 THR B CG2  1  
ATOM   6023   H  H    . THR B  2 170 ? 48.276  -18.366 -7.222  1.00 0.00 ?  224 THR B H    1  
ATOM   6024   H  HA   . THR B  2 170 ? 48.637  -21.202 -6.677  1.00 0.00 ?  224 THR B HA   1  
ATOM   6025   H  HB   . THR B  2 170 ? 48.576  -19.187 -4.360  1.00 0.00 ?  224 THR B HB   1  
ATOM   6026   H  HG1  . THR B  2 170 ? 49.954  -18.256 -5.656  1.00 0.00 ?  224 THR B HG1  1  
ATOM   6027   H  HG21 . THR B  2 170 ? 50.102  -21.808 -4.857  1.00 0.00 ?  224 THR B HG21 1  
ATOM   6028   H  HG22 . THR B  2 170 ? 48.775  -21.599 -3.692  1.00 0.00 ?  224 THR B HG22 1  
ATOM   6029   H  HG23 . THR B  2 170 ? 50.365  -20.646 -3.466  1.00 0.00 ?  224 THR B HG23 1  
ATOM   6030   N  N    . LEU B  2 171 ? 45.878  -19.927 -5.304  1.00 0.00 ?  225 LEU B N    1  
ATOM   6031   C  CA   . LEU B  2 171 ? 44.576  -20.287 -4.799  1.00 0.00 ?  225 LEU B CA   1  
ATOM   6032   C  C    . LEU B  2 171 ? 43.933  -21.257 -5.702  1.00 0.00 ?  225 LEU B C    1  
ATOM   6033   O  O    . LEU B  2 171 ? 43.552  -22.325 -5.299  1.00 0.00 ?  225 LEU B O    1  
ATOM   6034   C  CB   . LEU B  2 171 ? 43.743  -19.020 -4.699  1.00 0.00 ?  225 LEU B CB   1  
ATOM   6035   C  CG   . LEU B  2 171 ? 43.998  -18.157 -3.458  1.00 0.00 ?  225 LEU B CG   1  
ATOM   6036   C  CD1  . LEU B  2 171 ? 43.222  -16.832 -3.607  1.00 0.00 ?  225 LEU B CD1  1  
ATOM   6037   C  CD2  . LEU B  2 171 ? 43.506  -18.830 -2.112  1.00 0.00 ?  225 LEU B CD2  1  
ATOM   6038   H  H    . LEU B  2 171 ? 46.063  -18.956 -5.436  1.00 0.00 ?  225 LEU B H    1  
ATOM   6039   H  HA   . LEU B  2 171 ? 44.593  -20.749 -3.823  1.00 0.00 ?  225 LEU B HA   1  
ATOM   6040   H  HB2  . LEU B  2 171 ? 43.733  -18.437 -5.645  1.00 0.00 ?  225 LEU B HB2  1  
ATOM   6041   H  HB3  . LEU B  2 171 ? 42.702  -19.373 -4.543  1.00 0.00 ?  225 LEU B HB3  1  
ATOM   6042   H  HG   . LEU B  2 171 ? 45.074  -17.927 -3.304  1.00 0.00 ?  225 LEU B HG   1  
ATOM   6043   H  HD11 . LEU B  2 171 ? 42.144  -17.082 -3.702  1.00 0.00 ?  225 LEU B HD11 1  
ATOM   6044   H  HD12 . LEU B  2 171 ? 43.589  -16.223 -4.460  1.00 0.00 ?  225 LEU B HD12 1  
ATOM   6045   H  HD13 . LEU B  2 171 ? 43.305  -16.162 -2.725  1.00 0.00 ?  225 LEU B HD13 1  
ATOM   6046   H  HD21 . LEU B  2 171 ? 44.018  -19.804 -1.957  1.00 0.00 ?  225 LEU B HD21 1  
ATOM   6047   H  HD22 . LEU B  2 171 ? 42.412  -19.022 -2.102  1.00 0.00 ?  225 LEU B HD22 1  
ATOM   6048   H  HD23 . LEU B  2 171 ? 43.708  -18.107 -1.292  1.00 0.00 ?  225 LEU B HD23 1  
ATOM   6049   N  N    . SER B  2 172 ? 43.984  -20.956 -6.961  1.00 0.00 ?  226 SER B N    1  
ATOM   6050   C  CA   . SER B  2 172 ? 43.640  -21.898 -8.059  1.00 0.00 ?  226 SER B CA   1  
ATOM   6051   C  C    . SER B  2 172 ? 44.302  -23.231 -8.051  1.00 0.00 ?  226 SER B C    1  
ATOM   6052   O  O    . SER B  2 172 ? 43.596  -24.225 -8.215  1.00 0.00 ?  226 SER B O    1  
ATOM   6053   C  CB   . SER B  2 172 ? 43.695  -21.194 -9.456  1.00 0.00 ?  226 SER B CB   1  
ATOM   6054   O  OG   . SER B  2 172 ? 43.646  -22.137 -10.485 1.00 0.00 ?  226 SER B OG   1  
ATOM   6055   H  H    . SER B  2 172 ? 44.367  -20.068 -7.200  1.00 0.00 ?  226 SER B H    1  
ATOM   6056   H  HA   . SER B  2 172 ? 42.589  -22.073 -7.879  1.00 0.00 ?  226 SER B HA   1  
ATOM   6057   H  HB2  . SER B  2 172 ? 42.715  -20.673 -9.508  1.00 0.00 ?  226 SER B HB2  1  
ATOM   6058   H  HB3  . SER B  2 172 ? 44.580  -20.525 -9.512  1.00 0.00 ?  226 SER B HB3  1  
ATOM   6059   H  HG   . SER B  2 172 ? 42.725  -22.331 -10.673 1.00 0.00 ?  226 SER B HG   1  
ATOM   6060   N  N    . GLU B  2 173 ? 45.644  -23.241 -8.035  1.00 0.00 ?  227 GLU B N    1  
ATOM   6061   C  CA   . GLU B  2 173 ? 46.464  -24.437 -8.076  1.00 0.00 ?  227 GLU B CA   1  
ATOM   6062   C  C    . GLU B  2 173 ? 46.094  -25.403 -6.859  1.00 0.00 ?  227 GLU B C    1  
ATOM   6063   O  O    . GLU B  2 173 ? 46.130  -26.619 -7.020  1.00 0.00 ?  227 GLU B O    1  
ATOM   6064   C  CB   . GLU B  2 173 ? 47.971  -24.164 -7.788  1.00 0.00 ?  227 GLU B CB   1  
ATOM   6065   C  CG   . GLU B  2 173 ? 48.750  -23.554 -9.028  1.00 0.00 ?  227 GLU B CG   1  
ATOM   6066   C  CD   . GLU B  2 173 ? 50.247  -23.482 -8.985  1.00 0.00 ?  227 GLU B CD   1  
ATOM   6067   O  OE1  . GLU B  2 173 ? 50.908  -24.400 -8.474  1.00 0.00 ?  227 GLU B OE1  1  
ATOM   6068   O  OE2  . GLU B  2 173 ? 50.770  -22.496 -9.567  1.00 0.00 -1 227 GLU B OE2  1  
ATOM   6069   H  H    . GLU B  2 173 ? 46.250  -22.451 -7.993  1.00 0.00 ?  227 GLU B H    1  
ATOM   6070   H  HA   . GLU B  2 173 ? 46.268  -25.028 -8.958  1.00 0.00 ?  227 GLU B HA   1  
ATOM   6071   H  HB2  . GLU B  2 173 ? 48.046  -23.525 -6.882  1.00 0.00 ?  227 GLU B HB2  1  
ATOM   6072   H  HB3  . GLU B  2 173 ? 48.530  -25.115 -7.651  1.00 0.00 ?  227 GLU B HB3  1  
ATOM   6073   H  HG2  . GLU B  2 173 ? 48.526  -24.180 -9.918  1.00 0.00 ?  227 GLU B HG2  1  
ATOM   6074   H  HG3  . GLU B  2 173 ? 48.371  -22.541 -9.281  1.00 0.00 ?  227 GLU B HG3  1  
ATOM   6075   N  N    . LYS B  2 174 ? 45.681  -24.801 -5.693  1.00 0.00 ?  228 LYS B N    1  
ATOM   6076   C  CA   . LYS B  2 174 ? 45.224  -25.537 -4.503  1.00 0.00 ?  228 LYS B CA   1  
ATOM   6077   C  C    . LYS B  2 174 ? 43.752  -25.905 -4.596  1.00 0.00 ?  228 LYS B C    1  
ATOM   6078   O  O    . LYS B  2 174 ? 43.326  -27.018 -4.298  1.00 0.00 ?  228 LYS B O    1  
ATOM   6079   C  CB   . LYS B  2 174 ? 45.516  -24.705 -3.164  1.00 0.00 ?  228 LYS B CB   1  
ATOM   6080   C  CG   . LYS B  2 174 ? 47.015  -24.450 -2.855  1.00 0.00 ?  228 LYS B CG   1  
ATOM   6081   C  CD   . LYS B  2 174 ? 47.926  -25.679 -2.750  1.00 0.00 ?  228 LYS B CD   1  
ATOM   6082   C  CE   . LYS B  2 174 ? 49.470  -25.443 -2.679  1.00 0.00 ?  228 LYS B CE   1  
ATOM   6083   N  NZ   . LYS B  2 174 ? 49.959  -25.043 -1.383  1.00 0.00 1  228 LYS B NZ   1  
ATOM   6084   H  H    . LYS B  2 174 ? 45.709  -23.807 -5.623  1.00 0.00 ?  228 LYS B H    1  
ATOM   6085   H  HA   . LYS B  2 174 ? 45.676  -26.514 -4.420  1.00 0.00 ?  228 LYS B HA   1  
ATOM   6086   H  HB2  . LYS B  2 174 ? 44.925  -23.764 -3.174  1.00 0.00 ?  228 LYS B HB2  1  
ATOM   6087   H  HB3  . LYS B  2 174 ? 45.150  -25.301 -2.301  1.00 0.00 ?  228 LYS B HB3  1  
ATOM   6088   H  HG2  . LYS B  2 174 ? 47.472  -23.762 -3.598  1.00 0.00 ?  228 LYS B HG2  1  
ATOM   6089   H  HG3  . LYS B  2 174 ? 47.077  -23.810 -1.949  1.00 0.00 ?  228 LYS B HG3  1  
ATOM   6090   H  HD2  . LYS B  2 174 ? 47.591  -26.415 -1.988  1.00 0.00 ?  228 LYS B HD2  1  
ATOM   6091   H  HD3  . LYS B  2 174 ? 47.796  -26.234 -3.703  1.00 0.00 ?  228 LYS B HD3  1  
ATOM   6092   H  HE2  . LYS B  2 174 ? 50.035  -26.365 -2.935  1.00 0.00 ?  228 LYS B HE2  1  
ATOM   6093   H  HE3  . LYS B  2 174 ? 49.730  -24.695 -3.459  1.00 0.00 ?  228 LYS B HE3  1  
ATOM   6094   H  HZ1  . LYS B  2 174 ? 50.967  -25.278 -1.282  1.00 0.00 ?  228 LYS B HZ1  1  
ATOM   6095   H  HZ2  . LYS B  2 174 ? 49.474  -25.627 -0.671  1.00 0.00 ?  228 LYS B HZ2  1  
ATOM   6096   H  HZ3  . LYS B  2 174 ? 49.729  -24.035 -1.271  1.00 0.00 ?  228 LYS B HZ3  1  
ATOM   6097   N  N    . ALA B  2 175 ? 42.862  -24.995 -5.034  1.00 0.00 ?  229 ALA B N    1  
ATOM   6098   C  CA   . ALA B  2 175 ? 41.431  -25.332 -5.201  1.00 0.00 ?  229 ALA B CA   1  
ATOM   6099   C  C    . ALA B  2 175 ? 41.092  -26.449 -6.222  1.00 0.00 ?  229 ALA B C    1  
ATOM   6100   O  O    . ALA B  2 175 ? 40.246  -27.273 -5.859  1.00 0.00 ?  229 ALA B O    1  
ATOM   6101   C  CB   . ALA B  2 175 ? 40.801  -24.038 -5.601  1.00 0.00 ?  229 ALA B CB   1  
ATOM   6102   H  H    . ALA B  2 175 ? 43.239  -24.073 -5.067  1.00 0.00 ?  229 ALA B H    1  
ATOM   6103   H  HA   . ALA B  2 175 ? 41.082  -25.465 -4.187  1.00 0.00 ?  229 ALA B HA   1  
ATOM   6104   H  HB1  . ALA B  2 175 ? 39.694  -23.996 -5.520  1.00 0.00 ?  229 ALA B HB1  1  
ATOM   6105   H  HB2  . ALA B  2 175 ? 41.211  -23.828 -6.612  1.00 0.00 ?  229 ALA B HB2  1  
ATOM   6106   H  HB3  . ALA B  2 175 ? 41.161  -23.125 -5.081  1.00 0.00 ?  229 ALA B HB3  1  
ATOM   6107   N  N    . LYS B  2 176 ? 41.659  -26.421 -7.425  1.00 0.00 ?  230 LYS B N    1  
ATOM   6108   C  CA   . LYS B  2 176 ? 41.434  -27.461 -8.460  1.00 0.00 ?  230 LYS B CA   1  
ATOM   6109   C  C    . LYS B  2 176 ? 41.392  -28.918 -8.005  1.00 0.00 ?  230 LYS B C    1  
ATOM   6110   O  O    . LYS B  2 176 ? 40.437  -29.585 -8.350  1.00 0.00 ?  230 LYS B O    1  
ATOM   6111   C  CB   . LYS B  2 176 ? 42.453  -27.216 -9.653  1.00 0.00 ?  230 LYS B CB   1  
ATOM   6112   C  CG   . LYS B  2 176 ? 42.570  -28.382 -10.655 1.00 0.00 ?  230 LYS B CG   1  
ATOM   6113   C  CD   . LYS B  2 176 ? 41.314  -28.576 -11.593 1.00 0.00 ?  230 LYS B CD   1  
ATOM   6114   C  CE   . LYS B  2 176 ? 41.437  -29.655 -12.704 1.00 0.00 ?  230 LYS B CE   1  
ATOM   6115   N  NZ   . LYS B  2 176 ? 41.858  -31.023 -12.258 1.00 0.00 1  230 LYS B NZ   1  
ATOM   6116   H  H    . LYS B  2 176 ? 42.229  -25.624 -7.609  1.00 0.00 ?  230 LYS B H    1  
ATOM   6117   H  HA   . LYS B  2 176 ? 40.416  -27.351 -8.804  1.00 0.00 ?  230 LYS B HA   1  
ATOM   6118   H  HB2  . LYS B  2 176 ? 41.970  -26.406 -10.241 1.00 0.00 ?  230 LYS B HB2  1  
ATOM   6119   H  HB3  . LYS B  2 176 ? 43.495  -26.916 -9.412  1.00 0.00 ?  230 LYS B HB3  1  
ATOM   6120   H  HG2  . LYS B  2 176 ? 43.532  -28.189 -11.178 1.00 0.00 ?  230 LYS B HG2  1  
ATOM   6121   H  HG3  . LYS B  2 176 ? 42.785  -29.286 -10.045 1.00 0.00 ?  230 LYS B HG3  1  
ATOM   6122   H  HD2  . LYS B  2 176 ? 40.403  -28.723 -10.975 1.00 0.00 ?  230 LYS B HD2  1  
ATOM   6123   H  HD3  . LYS B  2 176 ? 41.159  -27.568 -12.032 1.00 0.00 ?  230 LYS B HD3  1  
ATOM   6124   H  HE2  . LYS B  2 176 ? 40.505  -29.736 -13.303 1.00 0.00 ?  230 LYS B HE2  1  
ATOM   6125   H  HE3  . LYS B  2 176 ? 42.235  -29.293 -13.387 1.00 0.00 ?  230 LYS B HE3  1  
ATOM   6126   H  HZ1  . LYS B  2 176 ? 41.147  -31.559 -11.721 1.00 0.00 ?  230 LYS B HZ1  1  
ATOM   6127   H  HZ2  . LYS B  2 176 ? 42.737  -30.900 -11.716 1.00 0.00 ?  230 LYS B HZ2  1  
ATOM   6128   H  HZ3  . LYS B  2 176 ? 42.130  -31.568 -13.101 1.00 0.00 ?  230 LYS B HZ3  1  
ATOM   6129   N  N    . PRO B  2 177 ? 42.324  -29.501 -7.289  1.00 0.00 ?  231 PRO B N    1  
ATOM   6130   C  CA   . PRO B  2 177 ? 42.258  -30.810 -6.669  1.00 0.00 ?  231 PRO B CA   1  
ATOM   6131   C  C    . PRO B  2 177 ? 41.402  -30.826 -5.398  1.00 0.00 ?  231 PRO B C    1  
ATOM   6132   O  O    . PRO B  2 177 ? 40.805  -31.821 -5.174  1.00 0.00 ?  231 PRO B O    1  
ATOM   6133   C  CB   . PRO B  2 177 ? 43.743  -31.205 -6.573  1.00 0.00 ?  231 PRO B CB   1  
ATOM   6134   C  CG   . PRO B  2 177 ? 44.486  -29.850 -6.422  1.00 0.00 ?  231 PRO B CG   1  
ATOM   6135   C  CD   . PRO B  2 177 ? 43.704  -28.925 -7.316  1.00 0.00 ?  231 PRO B CD   1  
ATOM   6136   H  HA   . PRO B  2 177 ? 41.818  -31.508 -7.366  1.00 0.00 ?  231 PRO B HA   1  
ATOM   6137   H  HB2  . PRO B  2 177 ? 43.987  -31.893 -5.736  1.00 0.00 ?  231 PRO B HB2  1  
ATOM   6138   H  HB3  . PRO B  2 177 ? 44.203  -31.672 -7.470  1.00 0.00 ?  231 PRO B HB3  1  
ATOM   6139   H  HG2  . PRO B  2 177 ? 44.325  -29.447 -5.400  1.00 0.00 ?  231 PRO B HG2  1  
ATOM   6140   H  HG3  . PRO B  2 177 ? 45.574  -29.889 -6.644  1.00 0.00 ?  231 PRO B HG3  1  
ATOM   6141   H  HD2  . PRO B  2 177 ? 43.552  -27.905 -6.903  1.00 0.00 ?  231 PRO B HD2  1  
ATOM   6142   H  HD3  . PRO B  2 177 ? 44.069  -28.869 -8.364  1.00 0.00 ?  231 PRO B HD3  1  
ATOM   6143   N  N    . ALA B  2 178 ? 41.315  -29.858 -4.547  1.00 0.00 ?  232 ALA B N    1  
ATOM   6144   C  CA   . ALA B  2 178 ? 40.396  -29.725 -3.406  1.00 0.00 ?  232 ALA B CA   1  
ATOM   6145   C  C    . ALA B  2 178 ? 38.937  -29.949 -3.728  1.00 0.00 ?  232 ALA B C    1  
ATOM   6146   O  O    . ALA B  2 178 ? 38.152  -30.601 -3.064  1.00 0.00 ?  232 ALA B O    1  
ATOM   6147   C  CB   . ALA B  2 178 ? 40.637  -28.431 -2.604  1.00 0.00 ?  232 ALA B CB   1  
ATOM   6148   H  H    . ALA B  2 178 ? 41.807  -29.032 -4.812  1.00 0.00 ?  232 ALA B H    1  
ATOM   6149   H  HA   . ALA B  2 178 ? 40.584  -30.580 -2.773  1.00 0.00 ?  232 ALA B HA   1  
ATOM   6150   H  HB1  . ALA B  2 178 ? 41.682  -28.177 -2.324  1.00 0.00 ?  232 ALA B HB1  1  
ATOM   6151   H  HB2  . ALA B  2 178 ? 40.234  -28.547 -1.575  1.00 0.00 ?  232 ALA B HB2  1  
ATOM   6152   H  HB3  . ALA B  2 178 ? 40.192  -27.501 -3.017  1.00 0.00 ?  232 ALA B HB3  1  
ATOM   6153   N  N    . LEU B  2 179 ? 38.523  -29.351 -4.807  1.00 0.00 ?  233 LEU B N    1  
ATOM   6154   C  CA   . LEU B  2 179 ? 37.259  -29.413 -5.457  1.00 0.00 ?  233 LEU B CA   1  
ATOM   6155   C  C    . LEU B  2 179 ? 36.914  -30.735 -5.943  1.00 0.00 ?  233 LEU B C    1  
ATOM   6156   O  O    . LEU B  2 179 ? 35.851  -31.225 -5.666  1.00 0.00 ?  233 LEU B O    1  
ATOM   6157   C  CB   . LEU B  2 179 ? 37.250  -28.299 -6.602  1.00 0.00 ?  233 LEU B CB   1  
ATOM   6158   C  CG   . LEU B  2 179 ? 35.819  -28.008 -7.126  1.00 0.00 ?  233 LEU B CG   1  
ATOM   6159   C  CD1  . LEU B  2 179 ? 35.194  -27.082 -6.141  1.00 0.00 ?  233 LEU B CD1  1  
ATOM   6160   C  CD2  . LEU B  2 179 ? 35.910  -27.445 -8.577  1.00 0.00 ?  233 LEU B CD2  1  
ATOM   6161   H  H    . LEU B  2 179 ? 39.154  -28.701 -5.225  1.00 0.00 ?  233 LEU B H    1  
ATOM   6162   H  HA   . LEU B  2 179 ? 36.514  -29.047 -4.767  1.00 0.00 ?  233 LEU B HA   1  
ATOM   6163   H  HB2  . LEU B  2 179 ? 37.701  -27.404 -6.123  1.00 0.00 ?  233 LEU B HB2  1  
ATOM   6164   H  HB3  . LEU B  2 179 ? 37.988  -28.516 -7.403  1.00 0.00 ?  233 LEU B HB3  1  
ATOM   6165   H  HG   . LEU B  2 179 ? 35.217  -28.941 -7.078  1.00 0.00 ?  233 LEU B HG   1  
ATOM   6166   H  HD11 . LEU B  2 179 ? 34.086  -27.104 -6.218  1.00 0.00 ?  233 LEU B HD11 1  
ATOM   6167   H  HD12 . LEU B  2 179 ? 35.736  -26.126 -5.981  1.00 0.00 ?  233 LEU B HD12 1  
ATOM   6168   H  HD13 . LEU B  2 179 ? 35.269  -27.547 -5.134  1.00 0.00 ?  233 LEU B HD13 1  
ATOM   6169   H  HD21 . LEU B  2 179 ? 34.946  -27.001 -8.905  1.00 0.00 ?  233 LEU B HD21 1  
ATOM   6170   H  HD22 . LEU B  2 179 ? 36.188  -28.263 -9.276  1.00 0.00 ?  233 LEU B HD22 1  
ATOM   6171   H  HD23 . LEU B  2 179 ? 36.650  -26.617 -8.566  1.00 0.00 ?  233 LEU B HD23 1  
ATOM   6172   N  N    . GLU B  2 180 ? 37.908  -31.449 -6.554  1.00 0.00 ?  234 GLU B N    1  
ATOM   6173   C  CA   . GLU B  2 180 ? 37.795  -32.845 -6.927  1.00 0.00 ?  234 GLU B CA   1  
ATOM   6174   C  C    . GLU B  2 180 ? 37.501  -33.812 -5.716  1.00 0.00 ?  234 GLU B C    1  
ATOM   6175   O  O    . GLU B  2 180 ? 36.592  -34.681 -5.805  1.00 0.00 ?  234 GLU B O    1  
ATOM   6176   C  CB   . GLU B  2 180 ? 38.932  -33.434 -7.727  1.00 0.00 ?  234 GLU B CB   1  
ATOM   6177   C  CG   . GLU B  2 180 ? 38.990  -32.806 -9.118  1.00 0.00 ?  234 GLU B CG   1  
ATOM   6178   C  CD   . GLU B  2 180 ? 39.885  -33.482 -10.109 1.00 0.00 ?  234 GLU B CD   1  
ATOM   6179   O  OE1  . GLU B  2 180 ? 40.661  -32.768 -10.802 1.00 0.00 ?  234 GLU B OE1  1  
ATOM   6180   O  OE2  . GLU B  2 180 ? 39.859  -34.800 -10.148 1.00 0.00 -1 234 GLU B OE2  1  
ATOM   6181   H  H    . GLU B  2 180 ? 38.800  -31.025 -6.685  1.00 0.00 ?  234 GLU B H    1  
ATOM   6182   H  HA   . GLU B  2 180 ? 36.959  -32.919 -7.606  1.00 0.00 ?  234 GLU B HA   1  
ATOM   6183   H  HB2  . GLU B  2 180 ? 39.830  -33.119 -7.155  1.00 0.00 ?  234 GLU B HB2  1  
ATOM   6184   H  HB3  . GLU B  2 180 ? 38.761  -34.527 -7.836  1.00 0.00 ?  234 GLU B HB3  1  
ATOM   6185   H  HG2  . GLU B  2 180 ? 37.968  -32.839 -9.553  1.00 0.00 ?  234 GLU B HG2  1  
ATOM   6186   H  HG3  . GLU B  2 180 ? 39.297  -31.739 -9.090  1.00 0.00 ?  234 GLU B HG3  1  
ATOM   6187   N  N    . ASP B  2 181 ? 38.178  -33.631 -4.580  1.00 0.00 ?  235 ASP B N    1  
ATOM   6188   C  CA   . ASP B  2 181 ? 37.948  -34.399 -3.391  1.00 0.00 ?  235 ASP B CA   1  
ATOM   6189   C  C    . ASP B  2 181 ? 36.556  -34.220 -2.834  1.00 0.00 ?  235 ASP B C    1  
ATOM   6190   O  O    . ASP B  2 181 ? 35.895  -35.220 -2.587  1.00 0.00 ?  235 ASP B O    1  
ATOM   6191   C  CB   . ASP B  2 181 ? 39.034  -34.017 -2.300  1.00 0.00 ?  235 ASP B CB   1  
ATOM   6192   C  CG   . ASP B  2 181 ? 40.368  -34.652 -2.531  1.00 0.00 ?  235 ASP B CG   1  
ATOM   6193   O  OD1  . ASP B  2 181 ? 40.458  -35.745 -3.091  1.00 0.00 ?  235 ASP B OD1  1  
ATOM   6194   O  OD2  . ASP B  2 181 ? 41.319  -34.056 -1.969  1.00 0.00 -1 235 ASP B OD2  1  
ATOM   6195   H  H    . ASP B  2 181 ? 39.086  -33.218 -4.584  1.00 0.00 ?  235 ASP B H    1  
ATOM   6196   H  HA   . ASP B  2 181 ? 37.999  -35.449 -3.639  1.00 0.00 ?  235 ASP B HA   1  
ATOM   6197   H  HB2  . ASP B  2 181 ? 39.103  -32.910 -2.230  1.00 0.00 ?  235 ASP B HB2  1  
ATOM   6198   H  HB3  . ASP B  2 181 ? 38.736  -34.441 -1.317  1.00 0.00 ?  235 ASP B HB3  1  
ATOM   6199   N  N    . LEU B  2 182 ? 36.035  -33.000 -2.848  1.00 0.00 ?  236 LEU B N    1  
ATOM   6200   C  CA   . LEU B  2 182 ? 34.680  -32.707 -2.487  1.00 0.00 ?  236 LEU B CA   1  
ATOM   6201   C  C    . LEU B  2 182 ? 33.608  -33.338 -3.409  1.00 0.00 ?  236 LEU B C    1  
ATOM   6202   O  O    . LEU B  2 182 ? 32.672  -33.996 -2.998  1.00 0.00 ?  236 LEU B O    1  
ATOM   6203   C  CB   . LEU B  2 182 ? 34.583  -31.113 -2.338  1.00 0.00 ?  236 LEU B CB   1  
ATOM   6204   C  CG   . LEU B  2 182 ? 33.195  -30.623 -1.786  1.00 0.00 ?  236 LEU B CG   1  
ATOM   6205   C  CD1  . LEU B  2 182 ? 33.279  -30.703 -0.279  1.00 0.00 ?  236 LEU B CD1  1  
ATOM   6206   C  CD2  . LEU B  2 182 ? 32.952  -29.178 -2.230  1.00 0.00 ?  236 LEU B CD2  1  
ATOM   6207   H  H    . LEU B  2 182 ? 36.637  -32.248 -3.103  1.00 0.00 ?  236 LEU B H    1  
ATOM   6208   H  HA   . LEU B  2 182 ? 34.423  -33.192 -1.557  1.00 0.00 ?  236 LEU B HA   1  
ATOM   6209   H  HB2  . LEU B  2 182 ? 35.389  -30.917 -1.599  1.00 0.00 ?  236 LEU B HB2  1  
ATOM   6210   H  HB3  . LEU B  2 182 ? 34.857  -30.663 -3.316  1.00 0.00 ?  236 LEU B HB3  1  
ATOM   6211   H  HG   . LEU B  2 182 ? 32.401  -31.294 -2.179  1.00 0.00 ?  236 LEU B HG   1  
ATOM   6212   H  HD11 . LEU B  2 182 ? 32.349  -30.310 0.185   1.00 0.00 ?  236 LEU B HD11 1  
ATOM   6213   H  HD12 . LEU B  2 182 ? 34.155  -30.078 -0.002  1.00 0.00 ?  236 LEU B HD12 1  
ATOM   6214   H  HD13 . LEU B  2 182 ? 33.495  -31.737 0.067   1.00 0.00 ?  236 LEU B HD13 1  
ATOM   6215   H  HD21 . LEU B  2 182 ? 32.796  -29.166 -3.330  1.00 0.00 ?  236 LEU B HD21 1  
ATOM   6216   H  HD22 . LEU B  2 182 ? 33.865  -28.560 -2.092  1.00 0.00 ?  236 LEU B HD22 1  
ATOM   6217   H  HD23 . LEU B  2 182 ? 32.124  -28.638 -1.722  1.00 0.00 ?  236 LEU B HD23 1  
ATOM   6218   N  N    . ARG B  2 183 ? 33.805  -33.112 -4.684  1.00 0.00 ?  237 ARG B N    1  
ATOM   6219   C  CA   . ARG B  2 183 ? 32.883  -33.523 -5.739  1.00 0.00 ?  237 ARG B CA   1  
ATOM   6220   C  C    . ARG B  2 183 ? 32.712  -35.042 -5.688  1.00 0.00 ?  237 ARG B C    1  
ATOM   6221   O  O    . ARG B  2 183 ? 31.570  -35.481 -5.743  1.00 0.00 ?  237 ARG B O    1  
ATOM   6222   C  CB   . ARG B  2 183 ? 33.315  -33.024 -7.095  1.00 0.00 ?  237 ARG B CB   1  
ATOM   6223   C  CG   . ARG B  2 183 ? 32.515  -33.391 -8.335  1.00 0.00 ?  237 ARG B CG   1  
ATOM   6224   C  CD   . ARG B  2 183 ? 33.288  -33.035 -9.573  1.00 0.00 ?  237 ARG B CD   1  
ATOM   6225   N  NE   . ARG B  2 183 ? 32.560  -33.416 -10.847 1.00 0.00 ?  237 ARG B NE   1  
ATOM   6226   C  CZ   . ARG B  2 183 ? 32.805  -32.964 -12.026 1.00 0.00 ?  237 ARG B CZ   1  
ATOM   6227   N  NH1  . ARG B  2 183 ? 32.441  -33.612 -13.158 1.00 0.00 1  237 ARG B NH1  1  
ATOM   6228   N  NH2  . ARG B  2 183 ? 33.333  -31.755 -12.114 1.00 0.00 ?  237 ARG B NH2  1  
ATOM   6229   H  H    . ARG B  2 183 ? 34.551  -32.454 -4.754  1.00 0.00 ?  237 ARG B H    1  
ATOM   6230   H  HA   . ARG B  2 183 ? 31.908  -33.156 -5.454  1.00 0.00 ?  237 ARG B HA   1  
ATOM   6231   H  HB2  . ARG B  2 183 ? 33.309  -31.923 -6.943  1.00 0.00 ?  237 ARG B HB2  1  
ATOM   6232   H  HB3  . ARG B  2 183 ? 34.399  -33.254 -7.176  1.00 0.00 ?  237 ARG B HB3  1  
ATOM   6233   H  HG2  . ARG B  2 183 ? 32.326  -34.484 -8.392  1.00 0.00 ?  237 ARG B HG2  1  
ATOM   6234   H  HG3  . ARG B  2 183 ? 31.464  -33.033 -8.355  1.00 0.00 ?  237 ARG B HG3  1  
ATOM   6235   H  HD2  . ARG B  2 183 ? 33.368  -31.930 -9.489  1.00 0.00 ?  237 ARG B HD2  1  
ATOM   6236   H  HD3  . ARG B  2 183 ? 34.293  -33.509 -9.576  1.00 0.00 ?  237 ARG B HD3  1  
ATOM   6237   H  HE   . ARG B  2 183 ? 31.972  -34.213 -10.981 1.00 0.00 ?  237 ARG B HE   1  
ATOM   6238   H  HH11 . ARG B  2 183 ? 32.067  -34.538 -13.097 1.00 0.00 ?  237 ARG B HH11 1  
ATOM   6239   H  HH12 . ARG B  2 183 ? 32.445  -33.016 -13.960 1.00 0.00 ?  237 ARG B HH12 1  
ATOM   6240   H  HH21 . ARG B  2 183 ? 33.889  -31.486 -11.328 1.00 0.00 ?  237 ARG B HH21 1  
ATOM   6241   H  HH22 . ARG B  2 183 ? 33.816  -31.575 -12.971 1.00 0.00 ?  237 ARG B HH22 1  
ATOM   6242   N  N    . GLN B  2 184 ? 33.840  -35.762 -5.499  1.00 0.00 ?  238 GLN B N    1  
ATOM   6243   C  CA   . GLN B  2 184 ? 33.953  -37.174 -5.641  1.00 0.00 ?  238 GLN B CA   1  
ATOM   6244   C  C    . GLN B  2 184 ? 33.421  -38.005 -4.516  1.00 0.00 ?  238 GLN B C    1  
ATOM   6245   O  O    . GLN B  2 184 ? 33.103  -39.178 -4.680  1.00 0.00 ?  238 GLN B O    1  
ATOM   6246   C  CB   . GLN B  2 184 ? 35.410  -37.489 -6.128  1.00 0.00 ?  238 GLN B CB   1  
ATOM   6247   C  CG   . GLN B  2 184 ? 35.706  -37.087 -7.525  1.00 0.00 ?  238 GLN B CG   1  
ATOM   6248   C  CD   . GLN B  2 184 ? 34.765  -37.646 -8.563  1.00 0.00 ?  238 GLN B CD   1  
ATOM   6249   O  OE1  . GLN B  2 184 ? 33.718  -37.036 -8.745  1.00 0.00 ?  238 GLN B OE1  1  
ATOM   6250   N  NE2  . GLN B  2 184 ? 34.939  -38.861 -9.136  1.00 0.00 ?  238 GLN B NE2  1  
ATOM   6251   H  H    . GLN B  2 184 ? 34.675  -35.221 -5.451  1.00 0.00 ?  238 GLN B H    1  
ATOM   6252   H  HA   . GLN B  2 184 ? 33.386  -37.555 -6.478  1.00 0.00 ?  238 GLN B HA   1  
ATOM   6253   H  HB2  . GLN B  2 184 ? 36.132  -36.889 -5.534  1.00 0.00 ?  238 GLN B HB2  1  
ATOM   6254   H  HB3  . GLN B  2 184 ? 35.632  -38.559 -5.932  1.00 0.00 ?  238 GLN B HB3  1  
ATOM   6255   H  HG2  . GLN B  2 184 ? 35.715  -35.979 -7.606  1.00 0.00 ?  238 GLN B HG2  1  
ATOM   6256   H  HG3  . GLN B  2 184 ? 36.741  -37.346 -7.832  1.00 0.00 ?  238 GLN B HG3  1  
ATOM   6257   H  HE21 . GLN B  2 184 ? 34.212  -39.186 -9.741  1.00 0.00 ?  238 GLN B HE21 1  
ATOM   6258   H  HE22 . GLN B  2 184 ? 35.764  -39.422 -9.062  1.00 0.00 ?  238 GLN B HE22 1  
ATOM   6259   N  N    . GLY B  2 185 ? 33.215  -37.260 -3.483  1.00 0.00 ?  239 GLY B N    1  
ATOM   6260   C  CA   . GLY B  2 185 ? 32.512  -37.780 -2.314  1.00 0.00 ?  239 GLY B CA   1  
ATOM   6261   C  C    . GLY B  2 185 ? 31.046  -37.477 -2.172  1.00 0.00 ?  239 GLY B C    1  
ATOM   6262   O  O    . GLY B  2 185 ? 30.306  -38.224 -1.576  1.00 0.00 ?  239 GLY B O    1  
ATOM   6263   H  H    . GLY B  2 185 ? 33.639  -36.360 -3.533  1.00 0.00 ?  239 GLY B H    1  
ATOM   6264   H  HA2  . GLY B  2 185 ? 32.602  -38.854 -2.252  1.00 0.00 ?  239 GLY B HA2  1  
ATOM   6265   H  HA3  . GLY B  2 185 ? 32.951  -37.330 -1.436  1.00 0.00 ?  239 GLY B HA3  1  
ATOM   6266   N  N    . LEU B  2 186 ? 30.543  -36.370 -2.778  1.00 0.00 ?  240 LEU B N    1  
ATOM   6267   C  CA   . LEU B  2 186 ? 29.127  -36.059 -2.876  1.00 0.00 ?  240 LEU B CA   1  
ATOM   6268   C  C    . LEU B  2 186 ? 28.494  -36.872 -3.921  1.00 0.00 ?  240 LEU B C    1  
ATOM   6269   O  O    . LEU B  2 186 ? 27.342  -37.351 -3.815  1.00 0.00 ?  240 LEU B O    1  
ATOM   6270   C  CB   . LEU B  2 186 ? 29.039  -34.545 -2.980  1.00 0.00 ?  240 LEU B CB   1  
ATOM   6271   C  CG   . LEU B  2 186 ? 29.345  -33.673 -1.741  1.00 0.00 ?  240 LEU B CG   1  
ATOM   6272   C  CD1  . LEU B  2 186 ? 29.196  -32.130 -2.060  1.00 0.00 ?  240 LEU B CD1  1  
ATOM   6273   C  CD2  . LEU B  2 186 ? 28.382  -34.084 -0.579  1.00 0.00 ?  240 LEU B CD2  1  
ATOM   6274   H  H    . LEU B  2 186 ? 31.174  -35.676 -3.116  1.00 0.00 ?  240 LEU B H    1  
ATOM   6275   H  HA   . LEU B  2 186 ? 28.623  -36.367 -1.972  1.00 0.00 ?  240 LEU B HA   1  
ATOM   6276   H  HB2  . LEU B  2 186 ? 29.584  -34.215 -3.890  1.00 0.00 ?  240 LEU B HB2  1  
ATOM   6277   H  HB3  . LEU B  2 186 ? 27.977  -34.308 -3.207  1.00 0.00 ?  240 LEU B HB3  1  
ATOM   6278   H  HG   . LEU B  2 186 ? 30.410  -33.750 -1.436  1.00 0.00 ?  240 LEU B HG   1  
ATOM   6279   H  HD11 . LEU B  2 186 ? 29.553  -31.780 -3.053  1.00 0.00 ?  240 LEU B HD11 1  
ATOM   6280   H  HD12 . LEU B  2 186 ? 29.587  -31.535 -1.208  1.00 0.00 ?  240 LEU B HD12 1  
ATOM   6281   H  HD13 . LEU B  2 186 ? 28.112  -31.937 -1.911  1.00 0.00 ?  240 LEU B HD13 1  
ATOM   6282   H  HD21 . LEU B  2 186 ? 28.284  -33.363 0.260   1.00 0.00 ?  240 LEU B HD21 1  
ATOM   6283   H  HD22 . LEU B  2 186 ? 28.648  -35.072 -0.146  1.00 0.00 ?  240 LEU B HD22 1  
ATOM   6284   H  HD23 . LEU B  2 186 ? 27.413  -34.056 -1.122  1.00 0.00 ?  240 LEU B HD23 1  
ATOM   6285   N  N    . LEU B  2 187 ? 29.163  -37.081 -5.078  1.00 0.00 ?  241 LEU B N    1  
ATOM   6286   C  CA   . LEU B  2 187 ? 28.702  -37.771 -6.221  1.00 0.00 ?  241 LEU B CA   1  
ATOM   6287   C  C    . LEU B  2 187 ? 28.198  -39.265 -6.002  1.00 0.00 ?  241 LEU B C    1  
ATOM   6288   O  O    . LEU B  2 187 ? 27.169  -39.584 -6.571  1.00 0.00 ?  241 LEU B O    1  
ATOM   6289   C  CB   . LEU B  2 187 ? 29.675  -37.731 -7.384  1.00 0.00 ?  241 LEU B CB   1  
ATOM   6290   C  CG   . LEU B  2 187 ? 29.251  -38.529 -8.663  1.00 0.00 ?  241 LEU B CG   1  
ATOM   6291   C  CD1  . LEU B  2 187 ? 28.457  -37.648 -9.607  1.00 0.00 ?  241 LEU B CD1  1  
ATOM   6292   C  CD2  . LEU B  2 187 ? 30.522  -38.952 -9.360  1.00 0.00 ?  241 LEU B CD2  1  
ATOM   6293   H  H    . LEU B  2 187 ? 30.089  -36.712 -5.083  1.00 0.00 ?  241 LEU B H    1  
ATOM   6294   H  HA   . LEU B  2 187 ? 27.824  -37.252 -6.575  1.00 0.00 ?  241 LEU B HA   1  
ATOM   6295   H  HB2  . LEU B  2 187 ? 29.887  -36.654 -7.558  1.00 0.00 ?  241 LEU B HB2  1  
ATOM   6296   H  HB3  . LEU B  2 187 ? 30.635  -38.228 -7.125  1.00 0.00 ?  241 LEU B HB3  1  
ATOM   6297   H  HG   . LEU B  2 187 ? 28.725  -39.465 -8.378  1.00 0.00 ?  241 LEU B HG   1  
ATOM   6298   H  HD11 . LEU B  2 187 ? 27.987  -38.271 -10.397 1.00 0.00 ?  241 LEU B HD11 1  
ATOM   6299   H  HD12 . LEU B  2 187 ? 28.971  -36.778 -10.068 1.00 0.00 ?  241 LEU B HD12 1  
ATOM   6300   H  HD13 . LEU B  2 187 ? 27.594  -37.199 -9.070  1.00 0.00 ?  241 LEU B HD13 1  
ATOM   6301   H  HD21 . LEU B  2 187 ? 30.409  -39.177 -10.442 1.00 0.00 ?  241 LEU B HD21 1  
ATOM   6302   H  HD22 . LEU B  2 187 ? 30.951  -39.853 -8.873  1.00 0.00 ?  241 LEU B HD22 1  
ATOM   6303   H  HD23 . LEU B  2 187 ? 31.349  -38.213 -9.291  1.00 0.00 ?  241 LEU B HD23 1  
ATOM   6304   N  N    . PRO B  2 188 ? 28.795  -40.206 -5.304  1.00 0.00 ?  242 PRO B N    1  
ATOM   6305   C  CA   . PRO B  2 188 ? 28.162  -41.447 -4.924  1.00 0.00 ?  242 PRO B CA   1  
ATOM   6306   C  C    . PRO B  2 188 ? 26.854  -41.203 -4.204  1.00 0.00 ?  242 PRO B C    1  
ATOM   6307   O  O    . PRO B  2 188 ? 25.946  -42.059 -4.231  1.00 0.00 ?  242 PRO B O    1  
ATOM   6308   C  CB   . PRO B  2 188 ? 29.192  -42.261 -4.134  1.00 0.00 ?  242 PRO B CB   1  
ATOM   6309   C  CG   . PRO B  2 188 ? 30.177  -41.184 -3.628  1.00 0.00 ?  242 PRO B CG   1  
ATOM   6310   C  CD   . PRO B  2 188 ? 30.139  -40.119 -4.744  1.00 0.00 ?  242 PRO B CD   1  
ATOM   6311   H  HA   . PRO B  2 188 ? 27.840  -41.941 -5.829  1.00 0.00 ?  242 PRO B HA   1  
ATOM   6312   H  HB2  . PRO B  2 188 ? 28.809  -42.924 -3.329  1.00 0.00 ?  242 PRO B HB2  1  
ATOM   6313   H  HB3  . PRO B  2 188 ? 29.775  -42.899 -4.833  1.00 0.00 ?  242 PRO B HB3  1  
ATOM   6314   H  HG2  . PRO B  2 188 ? 29.884  -40.717 -2.664  1.00 0.00 ?  242 PRO B HG2  1  
ATOM   6315   H  HG3  . PRO B  2 188 ? 31.200  -41.594 -3.487  1.00 0.00 ?  242 PRO B HG3  1  
ATOM   6316   H  HD2  . PRO B  2 188 ? 30.439  -39.142 -4.309  1.00 0.00 ?  242 PRO B HD2  1  
ATOM   6317   H  HD3  . PRO B  2 188 ? 30.843  -40.409 -5.553  1.00 0.00 ?  242 PRO B HD3  1  
ATOM   6318   N  N    . VAL B  2 189 ? 26.754  -40.199 -3.312  1.00 0.00 ?  243 VAL B N    1  
ATOM   6319   C  CA   . VAL B  2 189 ? 25.502  -40.072 -2.610  1.00 0.00 ?  243 VAL B CA   1  
ATOM   6320   C  C    . VAL B  2 189 ? 24.379  -39.809 -3.583  1.00 0.00 ?  243 VAL B C    1  
ATOM   6321   O  O    . VAL B  2 189 ? 23.301  -40.466 -3.582  1.00 0.00 ?  243 VAL B O    1  
ATOM   6322   C  CB   . VAL B  2 189 ? 25.531  -38.904 -1.629  1.00 0.00 ?  243 VAL B CB   1  
ATOM   6323   C  CG1  . VAL B  2 189 ? 24.199  -38.755 -0.768  1.00 0.00 ?  243 VAL B CG1  1  
ATOM   6324   C  CG2  . VAL B  2 189 ? 26.657  -39.020 -0.600  1.00 0.00 ?  243 VAL B CG2  1  
ATOM   6325   H  H    . VAL B  2 189 ? 27.486  -39.539 -3.157  1.00 0.00 ?  243 VAL B H    1  
ATOM   6326   H  HA   . VAL B  2 189 ? 25.266  -41.041 -2.198  1.00 0.00 ?  243 VAL B HA   1  
ATOM   6327   H  HB   . VAL B  2 189 ? 25.699  -37.949 -2.171  1.00 0.00 ?  243 VAL B HB   1  
ATOM   6328   H  HG11 . VAL B  2 189 ? 24.288  -38.163 0.168   1.00 0.00 ?  243 VAL B HG11 1  
ATOM   6329   H  HG12 . VAL B  2 189 ? 23.762  -39.741 -0.501  1.00 0.00 ?  243 VAL B HG12 1  
ATOM   6330   H  HG13 . VAL B  2 189 ? 23.395  -38.221 -1.318  1.00 0.00 ?  243 VAL B HG13 1  
ATOM   6331   H  HG21 . VAL B  2 189 ? 26.635  -40.004 -0.084  1.00 0.00 ?  243 VAL B HG21 1  
ATOM   6332   H  HG22 . VAL B  2 189 ? 26.513  -38.169 0.099   1.00 0.00 ?  243 VAL B HG22 1  
ATOM   6333   H  HG23 . VAL B  2 189 ? 27.673  -39.044 -1.048  1.00 0.00 ?  243 VAL B HG23 1  
ATOM   6334   N  N    . LEU B  2 190 ? 24.627  -38.908 -4.518  1.00 0.00 ?  244 LEU B N    1  
ATOM   6335   C  CA   . LEU B  2 190 ? 23.746  -38.500 -5.592  1.00 0.00 ?  244 LEU B CA   1  
ATOM   6336   C  C    . LEU B  2 190 ? 23.290  -39.633 -6.525  1.00 0.00 ?  244 LEU B C    1  
ATOM   6337   O  O    . LEU B  2 190 ? 22.163  -39.981 -6.576  1.00 0.00 ?  244 LEU B O    1  
ATOM   6338   C  CB   . LEU B  2 190 ? 24.346  -37.300 -6.421  1.00 0.00 ?  244 LEU B CB   1  
ATOM   6339   C  CG   . LEU B  2 190 ? 23.549  -36.863 -7.655  1.00 0.00 ?  244 LEU B CG   1  
ATOM   6340   C  CD1  . LEU B  2 190 ? 22.323  -36.061 -7.266  1.00 0.00 ?  244 LEU B CD1  1  
ATOM   6341   C  CD2  . LEU B  2 190 ? 24.466  -36.154 -8.636  1.00 0.00 ?  244 LEU B CD2  1  
ATOM   6342   H  H    . LEU B  2 190 ? 25.577  -38.609 -4.575  1.00 0.00 ?  244 LEU B H    1  
ATOM   6343   H  HA   . LEU B  2 190 ? 22.834  -38.160 -5.124  1.00 0.00 ?  244 LEU B HA   1  
ATOM   6344   H  HB2  . LEU B  2 190 ? 24.477  -36.333 -5.891  1.00 0.00 ?  244 LEU B HB2  1  
ATOM   6345   H  HB3  . LEU B  2 190 ? 25.384  -37.579 -6.703  1.00 0.00 ?  244 LEU B HB3  1  
ATOM   6346   H  HG   . LEU B  2 190 ? 23.309  -37.774 -8.243  1.00 0.00 ?  244 LEU B HG   1  
ATOM   6347   H  HD11 . LEU B  2 190 ? 22.663  -35.148 -6.732  1.00 0.00 ?  244 LEU B HD11 1  
ATOM   6348   H  HD12 . LEU B  2 190 ? 21.634  -36.513 -6.522  1.00 0.00 ?  244 LEU B HD12 1  
ATOM   6349   H  HD13 . LEU B  2 190 ? 21.666  -35.719 -8.094  1.00 0.00 ?  244 LEU B HD13 1  
ATOM   6350   H  HD21 . LEU B  2 190 ? 25.323  -36.822 -8.867  1.00 0.00 ?  244 LEU B HD21 1  
ATOM   6351   H  HD22 . LEU B  2 190 ? 24.881  -35.234 -8.172  1.00 0.00 ?  244 LEU B HD22 1  
ATOM   6352   H  HD23 . LEU B  2 190 ? 23.973  -35.912 -9.601  1.00 0.00 ?  244 LEU B HD23 1  
ATOM   6353   N  N    . GLU B  2 191 ? 24.372  -40.372 -6.968  1.00 0.00 ?  245 GLU B N    1  
ATOM   6354   C  CA   . GLU B  2 191 ? 24.273  -41.603 -7.636  1.00 0.00 ?  245 GLU B CA   1  
ATOM   6355   C  C    . GLU B  2 191 ? 23.332  -42.641 -6.926  1.00 0.00 ?  245 GLU B C    1  
ATOM   6356   O  O    . GLU B  2 191 ? 22.428  -43.160 -7.554  1.00 0.00 ?  245 GLU B O    1  
ATOM   6357   C  CB   . GLU B  2 191 ? 25.649  -42.231 -7.934  1.00 0.00 ?  245 GLU B CB   1  
ATOM   6358   C  CG   . GLU B  2 191 ? 26.323  -41.496 -9.155  1.00 0.00 ?  245 GLU B CG   1  
ATOM   6359   C  CD   . GLU B  2 191 ? 25.770  -41.799 -10.589 1.00 0.00 ?  245 GLU B CD   1  
ATOM   6360   O  OE1  . GLU B  2 191 ? 25.162  -40.852 -11.117 1.00 0.00 ?  245 GLU B OE1  1  
ATOM   6361   O  OE2  . GLU B  2 191 ? 25.888  -42.975 -11.059 1.00 0.00 -1 245 GLU B OE2  1  
ATOM   6362   H  H    . GLU B  2 191 ? 25.325  -40.098 -6.866  1.00 0.00 ?  245 GLU B H    1  
ATOM   6363   H  HA   . GLU B  2 191 ? 23.817  -41.478 -8.607  1.00 0.00 ?  245 GLU B HA   1  
ATOM   6364   H  HB2  . GLU B  2 191 ? 26.330  -42.094 -7.067  1.00 0.00 ?  245 GLU B HB2  1  
ATOM   6365   H  HB3  . GLU B  2 191 ? 25.702  -43.293 -8.255  1.00 0.00 ?  245 GLU B HB3  1  
ATOM   6366   H  HG2  . GLU B  2 191 ? 26.209  -40.424 -8.887  1.00 0.00 ?  245 GLU B HG2  1  
ATOM   6367   H  HG3  . GLU B  2 191 ? 27.351  -41.917 -9.187  1.00 0.00 ?  245 GLU B HG3  1  
ATOM   6368   N  N    . SER B  2 192 ? 23.486  -42.927 -5.587  1.00 0.00 ?  246 SER B N    1  
ATOM   6369   C  CA   . SER B  2 192 ? 22.500  -43.737 -4.812  1.00 0.00 ?  246 SER B CA   1  
ATOM   6370   C  C    . SER B  2 192 ? 21.117  -43.185 -4.868  1.00 0.00 ?  246 SER B C    1  
ATOM   6371   O  O    . SER B  2 192 ? 20.201  -43.944 -5.167  1.00 0.00 ?  246 SER B O    1  
ATOM   6372   C  CB   . SER B  2 192 ? 22.986  -44.036 -3.347  1.00 0.00 ?  246 SER B CB   1  
ATOM   6373   O  OG   . SER B  2 192 ? 24.202  -44.773 -3.343  1.00 0.00 ?  246 SER B OG   1  
ATOM   6374   H  H    . SER B  2 192 ? 24.323  -42.605 -5.153  1.00 0.00 ?  246 SER B H    1  
ATOM   6375   H  HA   . SER B  2 192 ? 22.356  -44.644 -5.379  1.00 0.00 ?  246 SER B HA   1  
ATOM   6376   H  HB2  . SER B  2 192 ? 23.104  -43.003 -2.954  1.00 0.00 ?  246 SER B HB2  1  
ATOM   6377   H  HB3  . SER B  2 192 ? 22.206  -44.628 -2.822  1.00 0.00 ?  246 SER B HB3  1  
ATOM   6378   H  HG   . SER B  2 192 ? 23.942  -45.661 -3.598  1.00 0.00 ?  246 SER B HG   1  
ATOM   6379   N  N    . PHE B  2 193 ? 20.908  -41.838 -4.614  1.00 0.00 ?  247 PHE B N    1  
ATOM   6380   C  CA   . PHE B  2 193 ? 19.684  -41.121 -4.801  1.00 0.00 ?  247 PHE B CA   1  
ATOM   6381   C  C    . PHE B  2 193 ? 19.102  -41.381 -6.139  1.00 0.00 ?  247 PHE B C    1  
ATOM   6382   O  O    . PHE B  2 193 ? 17.924  -41.691 -6.144  1.00 0.00 ?  247 PHE B O    1  
ATOM   6383   C  CB   . PHE B  2 193 ? 19.761  -39.641 -4.474  1.00 0.00 ?  247 PHE B CB   1  
ATOM   6384   C  CG   . PHE B  2 193 ? 18.526  -38.837 -4.573  1.00 0.00 ?  247 PHE B CG   1  
ATOM   6385   C  CD1  . PHE B  2 193 ? 17.463  -38.954 -3.706  1.00 0.00 ?  247 PHE B CD1  1  
ATOM   6386   C  CD2  . PHE B  2 193 ? 18.435  -38.048 -5.718  1.00 0.00 ?  247 PHE B CD2  1  
ATOM   6387   C  CE1  . PHE B  2 193 ? 16.309  -38.208 -3.945  1.00 0.00 ?  247 PHE B CE1  1  
ATOM   6388   C  CE2  . PHE B  2 193 ? 17.373  -37.230 -5.869  1.00 0.00 ?  247 PHE B CE2  1  
ATOM   6389   C  CZ   . PHE B  2 193 ? 16.265  -37.236 -4.951  1.00 0.00 ?  247 PHE B CZ   1  
ATOM   6390   H  H    . PHE B  2 193 ? 21.717  -41.270 -4.479  1.00 0.00 ?  247 PHE B H    1  
ATOM   6391   H  HA   . PHE B  2 193 ? 18.975  -41.384 -4.030  1.00 0.00 ?  247 PHE B HA   1  
ATOM   6392   H  HB2  . PHE B  2 193 ? 20.018  -39.648 -3.393  1.00 0.00 ?  247 PHE B HB2  1  
ATOM   6393   H  HB3  . PHE B  2 193 ? 20.529  -39.163 -5.119  1.00 0.00 ?  247 PHE B HB3  1  
ATOM   6394   H  HD1  . PHE B  2 193 ? 17.571  -39.650 -2.888  1.00 0.00 ?  247 PHE B HD1  1  
ATOM   6395   H  HD2  . PHE B  2 193 ? 19.264  -37.915 -6.399  1.00 0.00 ?  247 PHE B HD2  1  
ATOM   6396   H  HE1  . PHE B  2 193 ? 15.497  -38.523 -3.307  1.00 0.00 ?  247 PHE B HE1  1  
ATOM   6397   H  HE2  . PHE B  2 193 ? 17.335  -36.494 -6.659  1.00 0.00 ?  247 PHE B HE2  1  
ATOM   6398   H  HZ   . PHE B  2 193 ? 15.327  -36.772 -5.217  1.00 0.00 ?  247 PHE B HZ   1  
ATOM   6399   N  N    . LYS B  2 194 ? 19.814  -41.382 -7.278  1.00 0.00 ?  248 LYS B N    1  
ATOM   6400   C  CA   . LYS B  2 194 ? 19.397  -41.638 -8.681  1.00 0.00 ?  248 LYS B CA   1  
ATOM   6401   C  C    . LYS B  2 194 ? 18.862  -43.006 -8.857  1.00 0.00 ?  248 LYS B C    1  
ATOM   6402   O  O    . LYS B  2 194 ? 17.794  -43.192 -9.402  1.00 0.00 ?  248 LYS B O    1  
ATOM   6403   C  CB   . LYS B  2 194 ? 20.534  -41.422 -9.705  1.00 0.00 ?  248 LYS B CB   1  
ATOM   6404   C  CG   . LYS B  2 194 ? 21.069  -40.012 -9.928  1.00 0.00 ?  248 LYS B CG   1  
ATOM   6405   C  CD   . LYS B  2 194 ? 19.893  -39.069 -10.348 1.00 0.00 ?  248 LYS B CD   1  
ATOM   6406   C  CE   . LYS B  2 194 ? 20.418  -37.650 -10.627 1.00 0.00 ?  248 LYS B CE   1  
ATOM   6407   N  NZ   . LYS B  2 194 ? 21.441  -37.577 -11.713 1.00 0.00 1  248 LYS B NZ   1  
ATOM   6408   H  H    . LYS B  2 194 ? 20.790  -41.178 -7.247  1.00 0.00 ?  248 LYS B H    1  
ATOM   6409   H  HA   . LYS B  2 194 ? 18.551  -41.015 -8.934  1.00 0.00 ?  248 LYS B HA   1  
ATOM   6410   H  HB2  . LYS B  2 194 ? 21.330  -42.125 -9.377  1.00 0.00 ?  248 LYS B HB2  1  
ATOM   6411   H  HB3  . LYS B  2 194 ? 20.190  -41.747 -10.710 1.00 0.00 ?  248 LYS B HB3  1  
ATOM   6412   H  HG2  . LYS B  2 194 ? 21.708  -39.649 -9.094  1.00 0.00 ?  248 LYS B HG2  1  
ATOM   6413   H  HG3  . LYS B  2 194 ? 21.630  -40.075 -10.885 1.00 0.00 ?  248 LYS B HG3  1  
ATOM   6414   H  HD2  . LYS B  2 194 ? 19.358  -39.556 -11.191 1.00 0.00 ?  248 LYS B HD2  1  
ATOM   6415   H  HD3  . LYS B  2 194 ? 19.177  -39.050 -9.498  1.00 0.00 ?  248 LYS B HD3  1  
ATOM   6416   H  HE2  . LYS B  2 194 ? 19.583  -36.973 -10.910 1.00 0.00 ?  248 LYS B HE2  1  
ATOM   6417   H  HE3  . LYS B  2 194 ? 20.929  -37.243 -9.728  1.00 0.00 ?  248 LYS B HE3  1  
ATOM   6418   H  HZ1  . LYS B  2 194 ? 21.113  -38.196 -12.481 1.00 0.00 ?  248 LYS B HZ1  1  
ATOM   6419   H  HZ2  . LYS B  2 194 ? 22.337  -37.958 -11.347 1.00 0.00 ?  248 LYS B HZ2  1  
ATOM   6420   H  HZ3  . LYS B  2 194 ? 21.652  -36.634 -12.098 1.00 0.00 ?  248 LYS B HZ3  1  
ATOM   6421   N  N    . VAL B  2 195 ? 19.595  -43.976 -8.292  1.00 0.00 ?  249 VAL B N    1  
ATOM   6422   C  CA   . VAL B  2 195 ? 19.129  -45.347 -8.266  1.00 0.00 ?  249 VAL B CA   1  
ATOM   6423   C  C    . VAL B  2 195 ? 17.837  -45.481 -7.441  1.00 0.00 ?  249 VAL B C    1  
ATOM   6424   O  O    . VAL B  2 195 ? 16.933  -46.144 -7.925  1.00 0.00 ?  249 VAL B O    1  
ATOM   6425   C  CB   . VAL B  2 195 ? 20.281  -46.258 -7.793  1.00 0.00 ?  249 VAL B CB   1  
ATOM   6426   C  CG1  . VAL B  2 195 ? 19.739  -47.652 -7.427  1.00 0.00 ?  249 VAL B CG1  1  
ATOM   6427   C  CG2  . VAL B  2 195 ? 21.257  -46.268 -9.033  1.00 0.00 ?  249 VAL B CG2  1  
ATOM   6428   H  H    . VAL B  2 195 ? 20.522  -43.879 -7.938  1.00 0.00 ?  249 VAL B H    1  
ATOM   6429   H  HA   . VAL B  2 195 ? 18.852  -45.603 -9.278  1.00 0.00 ?  249 VAL B HA   1  
ATOM   6430   H  HB   . VAL B  2 195 ? 20.845  -45.681 -7.029  1.00 0.00 ?  249 VAL B HB   1  
ATOM   6431   H  HG11 . VAL B  2 195 ? 19.239  -47.686 -6.435  1.00 0.00 ?  249 VAL B HG11 1  
ATOM   6432   H  HG12 . VAL B  2 195 ? 20.600  -48.347 -7.327  1.00 0.00 ?  249 VAL B HG12 1  
ATOM   6433   H  HG13 . VAL B  2 195 ? 18.992  -48.036 -8.153  1.00 0.00 ?  249 VAL B HG13 1  
ATOM   6434   H  HG21 . VAL B  2 195 ? 21.699  -45.257 -9.161  1.00 0.00 ?  249 VAL B HG21 1  
ATOM   6435   H  HG22 . VAL B  2 195 ? 20.660  -46.495 -9.942  1.00 0.00 ?  249 VAL B HG22 1  
ATOM   6436   H  HG23 . VAL B  2 195 ? 22.076  -46.981 -8.797  1.00 0.00 ?  249 VAL B HG23 1  
ATOM   6437   N  N    . SER B  2 196 ? 17.671  -44.839 -6.235  1.00 0.00 ?  250 SER B N    1  
ATOM   6438   C  CA   . SER B  2 196 ? 16.450  -44.755 -5.517  1.00 0.00 ?  250 SER B CA   1  
ATOM   6439   C  C    . SER B  2 196 ? 15.270  -44.101 -6.312  1.00 0.00 ?  250 SER B C    1  
ATOM   6440   O  O    . SER B  2 196 ? 14.070  -44.453 -6.196  1.00 0.00 ?  250 SER B O    1  
ATOM   6441   C  CB   . SER B  2 196 ? 16.591  -44.027 -4.164  1.00 0.00 ?  250 SER B CB   1  
ATOM   6442   O  OG   . SER B  2 196 ? 17.462  -44.727 -3.266  1.00 0.00 ?  250 SER B OG   1  
ATOM   6443   H  H    . SER B  2 196 ? 18.428  -44.261 -5.939  1.00 0.00 ?  250 SER B H    1  
ATOM   6444   H  HA   . SER B  2 196 ? 16.168  -45.779 -5.321  1.00 0.00 ?  250 SER B HA   1  
ATOM   6445   H  HB2  . SER B  2 196 ? 16.746  -42.929 -4.225  1.00 0.00 ?  250 SER B HB2  1  
ATOM   6446   H  HB3  . SER B  2 196 ? 15.581  -44.078 -3.704  1.00 0.00 ?  250 SER B HB3  1  
ATOM   6447   H  HG   . SER B  2 196 ? 16.823  -45.325 -2.872  1.00 0.00 ?  250 SER B HG   1  
ATOM   6448   N  N    . PHE B  2 197 ? 15.595  -43.056 -7.048  1.00 0.00 ?  251 PHE B N    1  
ATOM   6449   C  CA   . PHE B  2 197 ? 14.709  -42.313 -7.873  1.00 0.00 ?  251 PHE B CA   1  
ATOM   6450   C  C    . PHE B  2 197 ? 14.137  -43.200 -8.974  1.00 0.00 ?  251 PHE B C    1  
ATOM   6451   O  O    . PHE B  2 197 ? 12.933  -43.369 -9.145  1.00 0.00 ?  251 PHE B O    1  
ATOM   6452   C  CB   . PHE B  2 197 ? 15.533  -41.055 -8.394  1.00 0.00 ?  251 PHE B CB   1  
ATOM   6453   C  CG   . PHE B  2 197 ? 14.904  -40.511 -9.769  1.00 0.00 ?  251 PHE B CG   1  
ATOM   6454   C  CD1  . PHE B  2 197 ? 13.565  -40.117 -9.901  1.00 0.00 ?  251 PHE B CD1  1  
ATOM   6455   C  CD2  . PHE B  2 197 ? 15.863  -40.304 -10.790 1.00 0.00 ?  251 PHE B CD2  1  
ATOM   6456   C  CE1  . PHE B  2 197 ? 13.199  -39.503 -11.092 1.00 0.00 ?  251 PHE B CE1  1  
ATOM   6457   C  CE2  . PHE B  2 197 ? 15.387  -39.738 -11.995 1.00 0.00 ?  251 PHE B CE2  1  
ATOM   6458   C  CZ   . PHE B  2 197 ? 14.070  -39.402 -12.193 1.00 0.00 ?  251 PHE B CZ   1  
ATOM   6459   H  H    . PHE B  2 197 ? 16.545  -42.758 -7.001  1.00 0.00 ?  251 PHE B H    1  
ATOM   6460   H  HA   . PHE B  2 197 ? 13.862  -41.930 -7.324  1.00 0.00 ?  251 PHE B HA   1  
ATOM   6461   H  HB2  . PHE B  2 197 ? 15.566  -40.232 -7.648  1.00 0.00 ?  251 PHE B HB2  1  
ATOM   6462   H  HB3  . PHE B  2 197 ? 16.538  -41.479 -8.606  1.00 0.00 ?  251 PHE B HB3  1  
ATOM   6463   H  HD1  . PHE B  2 197 ? 12.850  -40.169 -9.093  1.00 0.00 ?  251 PHE B HD1  1  
ATOM   6464   H  HD2  . PHE B  2 197 ? 16.874  -40.629 -10.592 1.00 0.00 ?  251 PHE B HD2  1  
ATOM   6465   H  HE1  . PHE B  2 197 ? 12.213  -39.072 -11.185 1.00 0.00 ?  251 PHE B HE1  1  
ATOM   6466   H  HE2  . PHE B  2 197 ? 15.974  -39.650 -12.898 1.00 0.00 ?  251 PHE B HE2  1  
ATOM   6467   H  HZ   . PHE B  2 197 ? 13.769  -38.814 -13.048 1.00 0.00 ?  251 PHE B HZ   1  
ATOM   6468   N  N    . LEU B  2 198 ? 14.997  -43.818 -9.745  1.00 0.00 ?  252 LEU B N    1  
ATOM   6469   C  CA   . LEU B  2 198 ? 14.626  -44.832 -10.762 1.00 0.00 ?  252 LEU B CA   1  
ATOM   6470   C  C    . LEU B  2 198 ? 13.795  -45.943 -10.323 1.00 0.00 ?  252 LEU B C    1  
ATOM   6471   O  O    . LEU B  2 198 ? 12.867  -46.469 -10.967 1.00 0.00 ?  252 LEU B O    1  
ATOM   6472   C  CB   . LEU B  2 198 ? 15.919  -45.455 -11.431 1.00 0.00 ?  252 LEU B CB   1  
ATOM   6473   C  CG   . LEU B  2 198 ? 16.674  -44.437 -12.374 1.00 0.00 ?  252 LEU B CG   1  
ATOM   6474   C  CD1  . LEU B  2 198 ? 18.112  -44.827 -12.526 1.00 0.00 ?  252 LEU B CD1  1  
ATOM   6475   C  CD2  . LEU B  2 198 ? 15.960  -44.332 -13.755 1.00 0.00 ?  252 LEU B CD2  1  
ATOM   6476   H  H    . LEU B  2 198 ? 15.962  -43.582 -9.654  1.00 0.00 ?  252 LEU B H    1  
ATOM   6477   H  HA   . LEU B  2 198 ? 14.062  -44.307 -11.519 1.00 0.00 ?  252 LEU B HA   1  
ATOM   6478   H  HB2  . LEU B  2 198 ? 16.620  -45.784 -10.635 1.00 0.00 ?  252 LEU B HB2  1  
ATOM   6479   H  HB3  . LEU B  2 198 ? 15.588  -46.360 -11.985 1.00 0.00 ?  252 LEU B HB3  1  
ATOM   6480   H  HG   . LEU B  2 198 ? 16.680  -43.440 -11.882 1.00 0.00 ?  252 LEU B HG   1  
ATOM   6481   H  HD11 . LEU B  2 198 ? 18.559  -44.175 -13.307 1.00 0.00 ?  252 LEU B HD11 1  
ATOM   6482   H  HD12 . LEU B  2 198 ? 18.171  -45.837 -12.983 1.00 0.00 ?  252 LEU B HD12 1  
ATOM   6483   H  HD13 . LEU B  2 198 ? 18.733  -44.870 -11.606 1.00 0.00 ?  252 LEU B HD13 1  
ATOM   6484   H  HD21 . LEU B  2 198 ? 14.926  -44.069 -13.445 1.00 0.00 ?  252 LEU B HD21 1  
ATOM   6485   H  HD22 . LEU B  2 198 ? 15.741  -45.332 -14.188 1.00 0.00 ?  252 LEU B HD22 1  
ATOM   6486   H  HD23 . LEU B  2 198 ? 16.343  -43.524 -14.414 1.00 0.00 ?  252 LEU B HD23 1  
ATOM   6487   N  N    . SER B  2 199 ? 14.127  -46.428 -9.092  1.00 0.00 ?  253 SER B N    1  
ATOM   6488   C  CA   . SER B  2 199 ? 13.436  -47.501 -8.441  1.00 0.00 ?  253 SER B CA   1  
ATOM   6489   C  C    . SER B  2 199 ? 11.965  -47.081 -8.063  1.00 0.00 ?  253 SER B C    1  
ATOM   6490   O  O    . SER B  2 199 ? 11.041  -47.859 -8.331  1.00 0.00 ?  253 SER B O    1  
ATOM   6491   C  CB   . SER B  2 199 ? 14.224  -47.843 -7.109  1.00 0.00 ?  253 SER B CB   1  
ATOM   6492   O  OG   . SER B  2 199 ? 15.568  -48.308 -7.460  1.00 0.00 ?  253 SER B OG   1  
ATOM   6493   H  H    . SER B  2 199 ? 14.907  -46.150 -8.536  1.00 0.00 ?  253 SER B H    1  
ATOM   6494   H  HA   . SER B  2 199 ? 13.375  -48.396 -9.042  1.00 0.00 ?  253 SER B HA   1  
ATOM   6495   H  HB2  . SER B  2 199 ? 14.445  -46.907 -6.552  1.00 0.00 ?  253 SER B HB2  1  
ATOM   6496   H  HB3  . SER B  2 199 ? 13.776  -48.682 -6.534  1.00 0.00 ?  253 SER B HB3  1  
ATOM   6497   H  HG   . SER B  2 199 ? 16.177  -47.578 -7.596  1.00 0.00 ?  253 SER B HG   1  
ATOM   6498   N  N    . ALA B  2 200 ? 11.677  -45.838 -7.611  1.00 0.00 ?  254 ALA B N    1  
ATOM   6499   C  CA   . ALA B  2 200 ? 10.363  -45.394 -7.355  1.00 0.00 ?  254 ALA B CA   1  
ATOM   6500   C  C    . ALA B  2 200 ? 9.481   -45.406 -8.549  1.00 0.00 ?  254 ALA B C    1  
ATOM   6501   O  O    . ALA B  2 200 ? 8.357   -45.877 -8.465  1.00 0.00 ?  254 ALA B O    1  
ATOM   6502   C  CB   . ALA B  2 200 ? 10.336  -44.015 -6.709  1.00 0.00 ?  254 ALA B CB   1  
ATOM   6503   H  H    . ALA B  2 200 ? 12.364  -45.119 -7.543  1.00 0.00 ?  254 ALA B H    1  
ATOM   6504   H  HA   . ALA B  2 200 ? 9.817   -46.068 -6.712  1.00 0.00 ?  254 ALA B HA   1  
ATOM   6505   H  HB1  . ALA B  2 200 ? 10.325  -43.171 -7.431  1.00 0.00 ?  254 ALA B HB1  1  
ATOM   6506   H  HB2  . ALA B  2 200 ? 11.068  -43.704 -5.933  1.00 0.00 ?  254 ALA B HB2  1  
ATOM   6507   H  HB3  . ALA B  2 200 ? 9.353   -43.885 -6.209  1.00 0.00 ?  254 ALA B HB3  1  
ATOM   6508   N  N    . LEU B  2 201 ? 10.011  -45.001 -9.818  1.00 0.00 ?  255 LEU B N    1  
ATOM   6509   C  CA   . LEU B  2 201 ? 9.228   -45.192 -11.010 1.00 0.00 ?  255 LEU B CA   1  
ATOM   6510   C  C    . LEU B  2 201 ? 8.994   -46.613 -11.288 1.00 0.00 ?  255 LEU B C    1  
ATOM   6511   O  O    . LEU B  2 201 ? 7.895   -47.006 -11.671 1.00 0.00 ?  255 LEU B O    1  
ATOM   6512   C  CB   . LEU B  2 201 ? 9.852   -44.430 -12.213 1.00 0.00 ?  255 LEU B CB   1  
ATOM   6513   C  CG   . LEU B  2 201 ? 9.846   -42.870 -12.052 1.00 0.00 ?  255 LEU B CG   1  
ATOM   6514   C  CD1  . LEU B  2 201 ? 10.809  -42.238 -13.068 1.00 0.00 ?  255 LEU B CD1  1  
ATOM   6515   C  CD2  . LEU B  2 201 ? 8.450   -42.311 -12.273 1.00 0.00 ?  255 LEU B CD2  1  
ATOM   6516   H  H    . LEU B  2 201 ? 10.878  -44.512 -9.863  1.00 0.00 ?  255 LEU B H    1  
ATOM   6517   H  HA   . LEU B  2 201 ? 8.338   -44.588 -10.912 1.00 0.00 ?  255 LEU B HA   1  
ATOM   6518   H  HB2  . LEU B  2 201 ? 10.938  -44.650 -12.132 1.00 0.00 ?  255 LEU B HB2  1  
ATOM   6519   H  HB3  . LEU B  2 201 ? 9.502   -44.640 -13.246 1.00 0.00 ?  255 LEU B HB3  1  
ATOM   6520   H  HG   . LEU B  2 201 ? 10.139  -42.565 -11.025 1.00 0.00 ?  255 LEU B HG   1  
ATOM   6521   H  HD11 . LEU B  2 201 ? 11.829  -42.675 -13.023 1.00 0.00 ?  255 LEU B HD11 1  
ATOM   6522   H  HD12 . LEU B  2 201 ? 10.848  -41.129 -13.003 1.00 0.00 ?  255 LEU B HD12 1  
ATOM   6523   H  HD13 . LEU B  2 201 ? 10.529  -42.336 -14.138 1.00 0.00 ?  255 LEU B HD13 1  
ATOM   6524   H  HD21 . LEU B  2 201 ? 7.697   -42.858 -11.665 1.00 0.00 ?  255 LEU B HD21 1  
ATOM   6525   H  HD22 . LEU B  2 201 ? 8.118   -42.341 -13.333 1.00 0.00 ?  255 LEU B HD22 1  
ATOM   6526   H  HD23 . LEU B  2 201 ? 8.406   -41.226 -12.037 1.00 0.00 ?  255 LEU B HD23 1  
ATOM   6527   N  N    . GLU B  2 202 ? 9.990   -47.522 -11.184 1.00 0.00 ?  256 GLU B N    1  
ATOM   6528   C  CA   . GLU B  2 202 ? 9.799   -48.899 -11.556 1.00 0.00 ?  256 GLU B CA   1  
ATOM   6529   C  C    . GLU B  2 202 ? 8.668   -49.606 -10.823 1.00 0.00 ?  256 GLU B C    1  
ATOM   6530   O  O    . GLU B  2 202 ? 7.832   -50.275 -11.355 1.00 0.00 ?  256 GLU B O    1  
ATOM   6531   C  CB   . GLU B  2 202 ? 11.094  -49.595 -11.247 1.00 0.00 ?  256 GLU B CB   1  
ATOM   6532   C  CG   . GLU B  2 202 ? 11.088  -51.123 -11.569 1.00 0.00 ?  256 GLU B CG   1  
ATOM   6533   C  CD   . GLU B  2 202 ? 12.536  -51.670 -11.748 1.00 0.00 ?  256 GLU B CD   1  
ATOM   6534   O  OE1  . GLU B  2 202 ? 13.200  -51.423 -12.791 1.00 0.00 ?  256 GLU B OE1  1  
ATOM   6535   O  OE2  . GLU B  2 202 ? 12.913  -52.486 -10.850 1.00 0.00 -1 256 GLU B OE2  1  
ATOM   6536   H  H    . GLU B  2 202 ? 10.915  -47.221 -10.966 1.00 0.00 ?  256 GLU B H    1  
ATOM   6537   H  HA   . GLU B  2 202 ? 9.441   -48.978 -12.572 1.00 0.00 ?  256 GLU B HA   1  
ATOM   6538   H  HB2  . GLU B  2 202 ? 11.796  -49.109 -11.958 1.00 0.00 ?  256 GLU B HB2  1  
ATOM   6539   H  HB3  . GLU B  2 202 ? 11.443  -49.432 -10.205 1.00 0.00 ?  256 GLU B HB3  1  
ATOM   6540   H  HG2  . GLU B  2 202 ? 10.728  -51.494 -10.585 1.00 0.00 ?  256 GLU B HG2  1  
ATOM   6541   H  HG3  . GLU B  2 202 ? 10.396  -51.555 -12.323 1.00 0.00 ?  256 GLU B HG3  1  
ATOM   6542   N  N    . GLU B  2 203 ? 8.661   -49.342 -9.478  1.00 0.00 ?  257 GLU B N    1  
ATOM   6543   C  CA   . GLU B  2 203 ? 7.577   -49.726 -8.625  1.00 0.00 ?  257 GLU B CA   1  
ATOM   6544   C  C    . GLU B  2 203 ? 6.232   -49.141 -8.973  1.00 0.00 ?  257 GLU B C    1  
ATOM   6545   O  O    . GLU B  2 203 ? 5.276   -49.925 -9.178  1.00 0.00 ?  257 GLU B O    1  
ATOM   6546   C  CB   . GLU B  2 203 ? 7.991   -49.339 -7.203  1.00 0.00 ?  257 GLU B CB   1  
ATOM   6547   C  CG   . GLU B  2 203 ? 7.318   -50.282 -6.056  1.00 0.00 ?  257 GLU B CG   1  
ATOM   6548   C  CD   . GLU B  2 203 ? 7.712   -51.750 -6.105  1.00 0.00 ?  257 GLU B CD   1  
ATOM   6549   O  OE1  . GLU B  2 203 ? 6.806   -52.540 -5.980  1.00 0.00 ?  257 GLU B OE1  1  
ATOM   6550   O  OE2  . GLU B  2 203 ? 8.907   -52.095 -6.142  1.00 0.00 -1 257 GLU B OE2  1  
ATOM   6551   H  H    . GLU B  2 203 ? 9.443   -48.877 -9.071  1.00 0.00 ?  257 GLU B H    1  
ATOM   6552   H  HA   . GLU B  2 203 ? 7.382   -50.787 -8.672  1.00 0.00 ?  257 GLU B HA   1  
ATOM   6553   H  HB2  . GLU B  2 203 ? 9.090   -49.421 -7.065  1.00 0.00 ?  257 GLU B HB2  1  
ATOM   6554   H  HB3  . GLU B  2 203 ? 7.761   -48.287 -6.929  1.00 0.00 ?  257 GLU B HB3  1  
ATOM   6555   H  HG2  . GLU B  2 203 ? 7.596   -49.880 -5.059  1.00 0.00 ?  257 GLU B HG2  1  
ATOM   6556   H  HG3  . GLU B  2 203 ? 6.217   -50.201 -6.182  1.00 0.00 ?  257 GLU B HG3  1  
ATOM   6557   N  N    . TYR B  2 204 ? 6.104   -47.832 -9.162  1.00 0.00 ?  258 TYR B N    1  
ATOM   6558   C  CA   . TYR B  2 204 ? 4.890   -47.198 -9.713  1.00 0.00 ?  258 TYR B CA   1  
ATOM   6559   C  C    . TYR B  2 204 ? 4.359   -47.782 -11.023 1.00 0.00 ?  258 TYR B C    1  
ATOM   6560   O  O    . TYR B  2 204 ? 3.159   -47.935 -11.157 1.00 0.00 ?  258 TYR B O    1  
ATOM   6561   C  CB   . TYR B  2 204 ? 5.226   -45.762 -9.761  1.00 0.00 ?  258 TYR B CB   1  
ATOM   6562   C  CG   . TYR B  2 204 ? 4.250   -44.849 -10.499 1.00 0.00 ?  258 TYR B CG   1  
ATOM   6563   C  CD1  . TYR B  2 204 ? 4.734   -43.998 -11.479 1.00 0.00 ?  258 TYR B CD1  1  
ATOM   6564   C  CD2  . TYR B  2 204 ? 2.847   -44.794 -10.229 1.00 0.00 ?  258 TYR B CD2  1  
ATOM   6565   C  CE1  . TYR B  2 204 ? 3.885   -43.067 -12.114 1.00 0.00 ?  258 TYR B CE1  1  
ATOM   6566   C  CE2  . TYR B  2 204 ? 1.944   -43.981 -10.923 1.00 0.00 ?  258 TYR B CE2  1  
ATOM   6567   C  CZ   . TYR B  2 204 ? 2.483   -43.042 -11.822 1.00 0.00 ?  258 TYR B CZ   1  
ATOM   6568   O  OH   . TYR B  2 204 ? 1.593   -42.276 -12.620 1.00 0.00 ?  258 TYR B OH   1  
ATOM   6569   H  H    . TYR B  2 204 ? 6.858   -47.196 -9.013  1.00 0.00 ?  258 TYR B H    1  
ATOM   6570   H  HA   . TYR B  2 204 ? 4.139   -47.356 -8.953  1.00 0.00 ?  258 TYR B HA   1  
ATOM   6571   H  HB2  . TYR B  2 204 ? 5.482   -45.204 -8.836  1.00 0.00 ?  258 TYR B HB2  1  
ATOM   6572   H  HB3  . TYR B  2 204 ? 6.099   -45.753 -10.449 1.00 0.00 ?  258 TYR B HB3  1  
ATOM   6573   H  HD1  . TYR B  2 204 ? 5.801   -43.994 -11.646 1.00 0.00 ?  258 TYR B HD1  1  
ATOM   6574   H  HD2  . TYR B  2 204 ? 2.462   -45.498 -9.507  1.00 0.00 ?  258 TYR B HD2  1  
ATOM   6575   H  HE1  . TYR B  2 204 ? 4.377   -42.470 -12.866 1.00 0.00 ?  258 TYR B HE1  1  
ATOM   6576   H  HE2  . TYR B  2 204 ? 0.876   -43.916 -10.781 1.00 0.00 ?  258 TYR B HE2  1  
ATOM   6577   H  HH   . TYR B  2 204 ? 0.682   -42.332 -12.323 1.00 0.00 ?  258 TYR B HH   1  
ATOM   6578   N  N    . THR B  2 205 ? 5.240   -48.120 -12.004 1.00 0.00 ?  259 THR B N    1  
ATOM   6579   C  CA   . THR B  2 205 ? 4.844   -48.823 -13.210 1.00 0.00 ?  259 THR B CA   1  
ATOM   6580   C  C    . THR B  2 205 ? 4.133   -50.130 -12.988 1.00 0.00 ?  259 THR B C    1  
ATOM   6581   O  O    . THR B  2 205 ? 2.999   -50.357 -13.408 1.00 0.00 ?  259 THR B O    1  
ATOM   6582   C  CB   . THR B  2 205 ? 6.093   -49.047 -14.157 1.00 0.00 ?  259 THR B CB   1  
ATOM   6583   O  OG1  . THR B  2 205 ? 7.002   -47.952 -14.213 1.00 0.00 ?  259 THR B OG1  1  
ATOM   6584   C  CG2  . THR B  2 205 ? 5.628   -49.419 -15.626 1.00 0.00 ?  259 THR B CG2  1  
ATOM   6585   H  H    . THR B  2 205 ? 6.209   -47.963 -11.827 1.00 0.00 ?  259 THR B H    1  
ATOM   6586   H  HA   . THR B  2 205 ? 4.235   -48.094 -13.724 1.00 0.00 ?  259 THR B HA   1  
ATOM   6587   H  HB   . THR B  2 205 ? 6.646   -49.956 -13.839 1.00 0.00 ?  259 THR B HB   1  
ATOM   6588   H  HG1  . THR B  2 205 ? 7.490   -47.952 -13.387 1.00 0.00 ?  259 THR B HG1  1  
ATOM   6589   H  HG21 . THR B  2 205 ? 6.390   -50.020 -16.166 1.00 0.00 ?  259 THR B HG21 1  
ATOM   6590   H  HG22 . THR B  2 205 ? 5.368   -48.604 -16.334 1.00 0.00 ?  259 THR B HG22 1  
ATOM   6591   H  HG23 . THR B  2 205 ? 4.732   -50.065 -15.502 1.00 0.00 ?  259 THR B HG23 1  
ATOM   6592   N  N    . LYS B  2 206 ? 4.736   -51.034 -12.099 1.00 0.00 ?  260 LYS B N    1  
ATOM   6593   C  CA   . LYS B  2 206 ? 4.171   -52.212 -11.569 1.00 0.00 ?  260 LYS B CA   1  
ATOM   6594   C  C    . LYS B  2 206 ? 2.955   -51.976 -10.768 1.00 0.00 ?  260 LYS B C    1  
ATOM   6595   O  O    . LYS B  2 206 ? 1.989   -52.612 -10.976 1.00 0.00 ?  260 LYS B O    1  
ATOM   6596   C  CB   . LYS B  2 206 ? 5.168   -53.182 -10.810 1.00 0.00 ?  260 LYS B CB   1  
ATOM   6597   C  CG   . LYS B  2 206 ? 6.488   -53.592 -11.586 1.00 0.00 ?  260 LYS B CG   1  
ATOM   6598   C  CD   . LYS B  2 206 ? 7.321   -54.388 -10.529 1.00 0.00 ?  260 LYS B CD   1  
ATOM   6599   C  CE   . LYS B  2 206 ? 8.792   -54.661 -10.904 1.00 0.00 ?  260 LYS B CE   1  
ATOM   6600   N  NZ   . LYS B  2 206 ? 9.482   -55.266 -9.659  1.00 0.00 1  260 LYS B NZ   1  
ATOM   6601   H  H    . LYS B  2 206 ? 5.670   -50.892 -11.780 1.00 0.00 ?  260 LYS B H    1  
ATOM   6602   H  HA   . LYS B  2 206 ? 3.747   -52.737 -12.412 1.00 0.00 ?  260 LYS B HA   1  
ATOM   6603   H  HB2  . LYS B  2 206 ? 5.467   -52.606 -9.909  1.00 0.00 ?  260 LYS B HB2  1  
ATOM   6604   H  HB3  . LYS B  2 206 ? 4.615   -54.020 -10.333 1.00 0.00 ?  260 LYS B HB3  1  
ATOM   6605   H  HG2  . LYS B  2 206 ? 6.156   -54.300 -12.375 1.00 0.00 ?  260 LYS B HG2  1  
ATOM   6606   H  HG3  . LYS B  2 206 ? 7.119   -52.751 -11.946 1.00 0.00 ?  260 LYS B HG3  1  
ATOM   6607   H  HD2  . LYS B  2 206 ? 7.368   -53.821 -9.575  1.00 0.00 ?  260 LYS B HD2  1  
ATOM   6608   H  HD3  . LYS B  2 206 ? 6.761   -55.309 -10.259 1.00 0.00 ?  260 LYS B HD3  1  
ATOM   6609   H  HE2  . LYS B  2 206 ? 8.960   -55.381 -11.734 1.00 0.00 ?  260 LYS B HE2  1  
ATOM   6610   H  HE3  . LYS B  2 206 ? 9.306   -53.727 -11.213 1.00 0.00 ?  260 LYS B HE3  1  
ATOM   6611   H  HZ1  . LYS B  2 206 ? 9.007   -56.169 -9.456  1.00 0.00 ?  260 LYS B HZ1  1  
ATOM   6612   H  HZ2  . LYS B  2 206 ? 9.335   -54.560 -8.910  1.00 0.00 ?  260 LYS B HZ2  1  
ATOM   6613   H  HZ3  . LYS B  2 206 ? 10.467  -55.409 -9.959  1.00 0.00 ?  260 LYS B HZ3  1  
ATOM   6614   N  N    . LYS B  2 207 ? 2.928   -50.890 -9.912  1.00 0.00 ?  261 LYS B N    1  
ATOM   6615   C  CA   . LYS B  2 207 ? 1.743   -50.537 -9.186  1.00 0.00 ?  261 LYS B CA   1  
ATOM   6616   C  C    . LYS B  2 207 ? 0.521   -50.174 -10.005 1.00 0.00 ?  261 LYS B C    1  
ATOM   6617   O  O    . LYS B  2 207 ? -0.595  -50.597 -9.698  1.00 0.00 ?  261 LYS B O    1  
ATOM   6618   C  CB   . LYS B  2 207 ? 2.068   -49.459 -8.151  1.00 0.00 ?  261 LYS B CB   1  
ATOM   6619   C  CG   . LYS B  2 207 ? 1.005   -48.792 -7.303  1.00 0.00 ?  261 LYS B CG   1  
ATOM   6620   C  CD   . LYS B  2 207 ? 0.379   -49.684 -6.284  1.00 0.00 ?  261 LYS B CD   1  
ATOM   6621   C  CE   . LYS B  2 207 ? 1.204   -50.830 -5.618  1.00 0.00 ?  261 LYS B CE   1  
ATOM   6622   N  NZ   . LYS B  2 207 ? 0.446   -51.625 -4.707  1.00 0.00 1  261 LYS B NZ   1  
ATOM   6623   H  H    . LYS B  2 207 ? 3.794   -50.419 -9.764  1.00 0.00 ?  261 LYS B H    1  
ATOM   6624   H  HA   . LYS B  2 207 ? 1.451   -51.452 -8.693  1.00 0.00 ?  261 LYS B HA   1  
ATOM   6625   H  HB2  . LYS B  2 207 ? 2.877   -49.906 -7.535  1.00 0.00 ?  261 LYS B HB2  1  
ATOM   6626   H  HB3  . LYS B  2 207 ? 2.509   -48.644 -8.764  1.00 0.00 ?  261 LYS B HB3  1  
ATOM   6627   H  HG2  . LYS B  2 207 ? 1.536   -47.883 -6.949  1.00 0.00 ?  261 LYS B HG2  1  
ATOM   6628   H  HG3  . LYS B  2 207 ? 0.200   -48.519 -8.018  1.00 0.00 ?  261 LYS B HG3  1  
ATOM   6629   H  HD2  . LYS B  2 207 ? -0.041  -49.018 -5.500  1.00 0.00 ?  261 LYS B HD2  1  
ATOM   6630   H  HD3  . LYS B  2 207 ? -0.449  -50.290 -6.709  1.00 0.00 ?  261 LYS B HD3  1  
ATOM   6631   H  HE2  . LYS B  2 207 ? 1.537   -51.516 -6.426  1.00 0.00 ?  261 LYS B HE2  1  
ATOM   6632   H  HE3  . LYS B  2 207 ? 2.099   -50.437 -5.089  1.00 0.00 ?  261 LYS B HE3  1  
ATOM   6633   H  HZ1  . LYS B  2 207 ? 1.050   -52.365 -4.295  1.00 0.00 ?  261 LYS B HZ1  1  
ATOM   6634   H  HZ2  . LYS B  2 207 ? -0.325  -52.134 -5.184  1.00 0.00 ?  261 LYS B HZ2  1  
ATOM   6635   H  HZ3  . LYS B  2 207 ? 0.094   -50.985 -3.966  1.00 0.00 ?  261 LYS B HZ3  1  
ATOM   6636   N  N    . LEU B  2 208 ? 0.659   -49.391 -11.080 1.00 0.00 ?  262 LEU B N    1  
ATOM   6637   C  CA   . LEU B  2 208 ? -0.399  -49.100 -11.985 1.00 0.00 ?  262 LEU B CA   1  
ATOM   6638   C  C    . LEU B  2 208 ? -0.953  -50.367 -12.724 1.00 0.00 ?  262 LEU B C    1  
ATOM   6639   O  O    . LEU B  2 208 ? -2.198  -50.456 -12.881 1.00 0.00 ?  262 LEU B O    1  
ATOM   6640   C  CB   . LEU B  2 208 ? 0.069   -48.093 -13.093 1.00 0.00 ?  262 LEU B CB   1  
ATOM   6641   C  CG   . LEU B  2 208 ? 0.398   -46.672 -12.592 1.00 0.00 ?  262 LEU B CG   1  
ATOM   6642   C  CD1  . LEU B  2 208 ? 1.060   -45.871 -13.703 1.00 0.00 ?  262 LEU B CD1  1  
ATOM   6643   C  CD2  . LEU B  2 208 ? -0.888  -45.983 -12.197 1.00 0.00 ?  262 LEU B CD2  1  
ATOM   6644   H  H    . LEU B  2 208 ? 1.587   -49.239 -11.412 1.00 0.00 ?  262 LEU B H    1  
ATOM   6645   H  HA   . LEU B  2 208 ? -1.265  -48.744 -11.447 1.00 0.00 ?  262 LEU B HA   1  
ATOM   6646   H  HB2  . LEU B  2 208 ? 0.995   -48.383 -13.635 1.00 0.00 ?  262 LEU B HB2  1  
ATOM   6647   H  HB3  . LEU B  2 208 ? -0.746  -47.963 -13.836 1.00 0.00 ?  262 LEU B HB3  1  
ATOM   6648   H  HG   . LEU B  2 208 ? 1.059   -46.826 -11.712 1.00 0.00 ?  262 LEU B HG   1  
ATOM   6649   H  HD11 . LEU B  2 208 ? 2.084   -46.181 -14.003 1.00 0.00 ?  262 LEU B HD11 1  
ATOM   6650   H  HD12 . LEU B  2 208 ? 1.024   -44.770 -13.564 1.00 0.00 ?  262 LEU B HD12 1  
ATOM   6651   H  HD13 . LEU B  2 208 ? 0.393   -46.099 -14.562 1.00 0.00 ?  262 LEU B HD13 1  
ATOM   6652   H  HD21 . LEU B  2 208 ? -1.313  -46.562 -11.350 1.00 0.00 ?  262 LEU B HD21 1  
ATOM   6653   H  HD22 . LEU B  2 208 ? -1.478  -45.952 -13.138 1.00 0.00 ?  262 LEU B HD22 1  
ATOM   6654   H  HD23 . LEU B  2 208 ? -0.675  -44.954 -11.836 1.00 0.00 ?  262 LEU B HD23 1  
ATOM   6655   N  N    . ASN B  2 209 ? 0.016   -51.343 -13.010 1.00 0.00 ?  263 ASN B N    1  
ATOM   6656   C  CA   . ASN B  2 209 ? -0.434  -52.646 -13.558 1.00 0.00 ?  263 ASN B CA   1  
ATOM   6657   C  C    . ASN B  2 209 ? -1.124  -53.505 -12.594 1.00 0.00 ?  263 ASN B C    1  
ATOM   6658   O  O    . ASN B  2 209 ? -2.012  -54.315 -12.868 1.00 0.00 ?  263 ASN B O    1  
ATOM   6659   C  CB   . ASN B  2 209 ? 0.708   -53.461 -14.106 1.00 0.00 ?  263 ASN B CB   1  
ATOM   6660   C  CG   . ASN B  2 209 ? 1.427   -52.734 -15.206 1.00 0.00 ?  263 ASN B CG   1  
ATOM   6661   O  OD1  . ASN B  2 209 ? 0.951   -51.769 -15.833 1.00 0.00 ?  263 ASN B OD1  1  
ATOM   6662   N  ND2  . ASN B  2 209 ? 2.661   -53.180 -15.515 1.00 0.00 ?  263 ASN B ND2  1  
ATOM   6663   H  H    . ASN B  2 209 ? 0.988   -51.153 -12.899 1.00 0.00 ?  263 ASN B H    1  
ATOM   6664   H  HA   . ASN B  2 209 ? -1.177  -52.485 -14.325 1.00 0.00 ?  263 ASN B HA   1  
ATOM   6665   H  HB2  . ASN B  2 209 ? 1.503   -53.518 -13.332 1.00 0.00 ?  263 ASN B HB2  1  
ATOM   6666   H  HB3  . ASN B  2 209 ? 0.338   -54.467 -14.400 1.00 0.00 ?  263 ASN B HB3  1  
ATOM   6667   H  HD21 . ASN B  2 209 ? 3.248   -52.571 -16.048 1.00 0.00 ?  263 ASN B HD21 1  
ATOM   6668   H  HD22 . ASN B  2 209 ? 2.930   -54.076 -15.160 1.00 0.00 ?  263 ASN B HD22 1  
ATOM   6669   N  N    . THR B  2 210 ? -0.821  -53.350 -11.288 1.00 0.00 ?  264 THR B N    1  
ATOM   6670   C  CA   . THR B  2 210 ? -1.319  -54.161 -10.161 1.00 0.00 ?  264 THR B CA   1  
ATOM   6671   C  C    . THR B  2 210 ? -2.425  -53.557 -9.210  1.00 0.00 ?  264 THR B C    1  
ATOM   6672   O  O    . THR B  2 210 ? -2.973  -54.202 -8.304  1.00 0.00 ?  264 THR B O    1  
ATOM   6673   C  CB   . THR B  2 210 ? -0.168  -54.685 -9.357  1.00 0.00 ?  264 THR B CB   1  
ATOM   6674   O  OG1  . THR B  2 210 ? 0.662   -53.703 -8.930  1.00 0.00 ?  264 THR B OG1  1  
ATOM   6675   C  CG2  . THR B  2 210 ? 0.730   -55.532 -10.201 1.00 0.00 ?  264 THR B CG2  1  
ATOM   6676   H  H    . THR B  2 210 ? -0.231  -52.587 -11.038 1.00 0.00 ?  264 THR B H    1  
ATOM   6677   H  HA   . THR B  2 210 ? -1.843  -54.973 -10.645 1.00 0.00 ?  264 THR B HA   1  
ATOM   6678   H  HB   . THR B  2 210 ? -0.547  -55.122 -8.409  1.00 0.00 ?  264 THR B HB   1  
ATOM   6679   H  HG1  . THR B  2 210 ? 1.184   -53.462 -9.699  1.00 0.00 ?  264 THR B HG1  1  
ATOM   6680   H  HG21 . THR B  2 210 ? 0.210   -56.261 -10.859 1.00 0.00 ?  264 THR B HG21 1  
ATOM   6681   H  HG22 . THR B  2 210 ? 1.541   -56.024 -9.622  1.00 0.00 ?  264 THR B HG22 1  
ATOM   6682   H  HG23 . THR B  2 210 ? 1.188   -54.886 -10.981 1.00 0.00 ?  264 THR B HG23 1  
ATOM   6683   N  N    . GLN B  2 211 ? -2.796  -52.302 -9.413  1.00 0.00 ?  265 GLN B N    1  
ATOM   6684   C  CA   . GLN B  2 211 ? -3.960  -51.711 -8.705  1.00 0.00 ?  265 GLN B CA   1  
ATOM   6685   C  C    . GLN B  2 211 ? -5.241  -51.782 -9.545  1.00 0.00 ?  265 GLN B C    1  
ATOM   6686   O  O    . GLN B  2 211 ? -5.308  -51.325 -10.677 1.00 0.00 ?  265 GLN B O    1  
ATOM   6687   C  CB   . GLN B  2 211 ? -3.597  -50.265 -8.365  1.00 0.00 ?  265 GLN B CB   1  
ATOM   6688   C  CG   . GLN B  2 211 ? -4.690  -49.537 -7.580  1.00 0.00 ?  265 GLN B CG   1  
ATOM   6689   C  CD   . GLN B  2 211 ? -4.499  -47.999 -7.532  1.00 0.00 ?  265 GLN B CD   1  
ATOM   6690   O  OE1  . GLN B  2 211 ? -4.478  -47.410 -6.442  1.00 0.00 ?  265 GLN B OE1  1  
ATOM   6691   N  NE2  . GLN B  2 211 ? -4.620  -47.379 -8.729  1.00 0.00 ?  265 GLN B NE2  1  
ATOM   6692   O  OXT  . GLN B  2 211 ? -6.285  -52.395 -9.134  1.00 0.00 ?  265 GLN B OXT  1  
ATOM   6693   H  H    . GLN B  2 211 ? -2.289  -51.669 -9.993  1.00 0.00 ?  265 GLN B H    1  
ATOM   6694   H  HA   . GLN B  2 211 ? -4.094  -52.214 -7.758  1.00 0.00 ?  265 GLN B HA   1  
ATOM   6695   H  HB2  . GLN B  2 211 ? -2.603  -50.193 -7.873  1.00 0.00 ?  265 GLN B HB2  1  
ATOM   6696   H  HB3  . GLN B  2 211 ? -3.456  -49.677 -9.298  1.00 0.00 ?  265 GLN B HB3  1  
ATOM   6697   H  HG2  . GLN B  2 211 ? -5.685  -49.723 -8.037  1.00 0.00 ?  265 GLN B HG2  1  
ATOM   6698   H  HG3  . GLN B  2 211 ? -4.761  -49.975 -6.562  1.00 0.00 ?  265 GLN B HG3  1  
ATOM   6699   H  HE21 . GLN B  2 211 ? -4.587  -48.006 -9.508  1.00 0.00 ?  265 GLN B HE21 1  
ATOM   6700   H  HE22 . GLN B  2 211 ? -4.648  -46.380 -8.689  1.00 0.00 ?  265 GLN B HE22 1  
ATOM   6701   N  N    . SER C  2 1   ? 17.436  -48.427 2.878   1.00 0.00 ?  55  SER C N    1  
ATOM   6702   C  CA   . SER C  2 1   ? 18.348  -47.509 2.100   1.00 0.00 ?  55  SER C CA   1  
ATOM   6703   C  C    . SER C  2 1   ? 19.795  -47.657 2.433   1.00 0.00 ?  55  SER C C    1  
ATOM   6704   O  O    . SER C  2 1   ? 20.228  -48.291 3.406   1.00 0.00 ?  55  SER C O    1  
ATOM   6705   C  CB   . SER C  2 1   ? 17.926  -45.984 2.299   1.00 0.00 ?  55  SER C CB   1  
ATOM   6706   O  OG   . SER C  2 1   ? 18.430  -45.319 3.494   1.00 0.00 ?  55  SER C OG   1  
ATOM   6707   H  H1   . SER C  2 1   ? 17.692  -49.412 2.664   1.00 0.00 ?  55  SER C H1   1  
ATOM   6708   H  H2   . SER C  2 1   ? 16.424  -48.286 2.683   1.00 0.00 ?  55  SER C H2   1  
ATOM   6709   H  H3   . SER C  2 1   ? 17.600  -48.212 3.882   1.00 0.00 ?  55  SER C H3   1  
ATOM   6710   H  HA   . SER C  2 1   ? 18.171  -47.876 1.100   1.00 0.00 ?  55  SER C HA   1  
ATOM   6711   H  HB2  . SER C  2 1   ? 18.051  -45.359 1.388   1.00 0.00 ?  55  SER C HB2  1  
ATOM   6712   H  HB3  . SER C  2 1   ? 16.821  -46.082 2.349   1.00 0.00 ?  55  SER C HB3  1  
ATOM   6713   H  HG   . SER C  2 1   ? 17.717  -45.264 4.135   1.00 0.00 ?  55  SER C HG   1  
ATOM   6714   N  N    . THR C  2 2   ? 20.725  -47.060 1.623   1.00 0.00 ?  56  THR C N    1  
ATOM   6715   C  CA   . THR C  2 2   ? 22.120  -47.267 1.812   1.00 0.00 ?  56  THR C CA   1  
ATOM   6716   C  C    . THR C  2 2   ? 22.888  -46.013 2.196   1.00 0.00 ?  56  THR C C    1  
ATOM   6717   O  O    . THR C  2 2   ? 24.048  -46.142 2.528   1.00 0.00 ?  56  THR C O    1  
ATOM   6718   C  CB   . THR C  2 2   ? 22.768  -47.839 0.444   1.00 0.00 ?  56  THR C CB   1  
ATOM   6719   O  OG1  . THR C  2 2   ? 22.097  -47.352 -0.629  1.00 0.00 ?  56  THR C OG1  1  
ATOM   6720   C  CG2  . THR C  2 2   ? 22.575  -49.303 0.357   1.00 0.00 ?  56  THR C CG2  1  
ATOM   6721   H  H    . THR C  2 2   ? 20.486  -46.662 0.740   1.00 0.00 ?  56  THR C H    1  
ATOM   6722   H  HA   . THR C  2 2   ? 22.319  -48.004 2.576   1.00 0.00 ?  56  THR C HA   1  
ATOM   6723   H  HB   . THR C  2 2   ? 23.848  -47.578 0.463   1.00 0.00 ?  56  THR C HB   1  
ATOM   6724   H  HG1  . THR C  2 2   ? 22.235  -46.401 -0.618  1.00 0.00 ?  56  THR C HG1  1  
ATOM   6725   H  HG21 . THR C  2 2   ? 22.848  -49.579 -0.684  1.00 0.00 ?  56  THR C HG21 1  
ATOM   6726   H  HG22 . THR C  2 2   ? 21.549  -49.616 0.645   1.00 0.00 ?  56  THR C HG22 1  
ATOM   6727   H  HG23 . THR C  2 2   ? 23.369  -49.829 0.929   1.00 0.00 ?  56  THR C HG23 1  
ATOM   6728   N  N    . PHE C  2 3   ? 22.287  -44.881 2.275   1.00 0.00 ?  57  PHE C N    1  
ATOM   6729   C  CA   . PHE C  2 3   ? 22.934  -43.588 2.701   1.00 0.00 ?  57  PHE C CA   1  
ATOM   6730   C  C    . PHE C  2 3   ? 23.772  -43.618 3.960   1.00 0.00 ?  57  PHE C C    1  
ATOM   6731   O  O    . PHE C  2 3   ? 24.794  -42.972 3.998   1.00 0.00 ?  57  PHE C O    1  
ATOM   6732   C  CB   . PHE C  2 3   ? 21.796  -42.480 2.849   1.00 0.00 ?  57  PHE C CB   1  
ATOM   6733   C  CG   . PHE C  2 3   ? 21.034  -42.243 1.644   1.00 0.00 ?  57  PHE C CG   1  
ATOM   6734   C  CD1  . PHE C  2 3   ? 19.575  -42.559 1.547   1.00 0.00 ?  57  PHE C CD1  1  
ATOM   6735   C  CD2  . PHE C  2 3   ? 21.630  -41.734 0.506   1.00 0.00 ?  57  PHE C CD2  1  
ATOM   6736   C  CE1  . PHE C  2 3   ? 18.916  -42.539 0.293   1.00 0.00 ?  57  PHE C CE1  1  
ATOM   6737   C  CE2  . PHE C  2 3   ? 20.900  -41.594 -0.721  1.00 0.00 ?  57  PHE C CE2  1  
ATOM   6738   C  CZ   . PHE C  2 3   ? 19.570  -42.009 -0.849  1.00 0.00 ?  57  PHE C CZ   1  
ATOM   6739   H  H    . PHE C  2 3   ? 21.352  -44.792 1.940   1.00 0.00 ?  57  PHE C H    1  
ATOM   6740   H  HA   . PHE C  2 3   ? 23.478  -43.142 1.882   1.00 0.00 ?  57  PHE C HA   1  
ATOM   6741   H  HB2  . PHE C  2 3   ? 21.136  -42.757 3.698   1.00 0.00 ?  57  PHE C HB2  1  
ATOM   6742   H  HB3  . PHE C  2 3   ? 22.393  -41.574 3.087   1.00 0.00 ?  57  PHE C HB3  1  
ATOM   6743   H  HD1  . PHE C  2 3   ? 19.119  -42.988 2.427   1.00 0.00 ?  57  PHE C HD1  1  
ATOM   6744   H  HD2  . PHE C  2 3   ? 22.685  -41.528 0.616   1.00 0.00 ?  57  PHE C HD2  1  
ATOM   6745   H  HE1  . PHE C  2 3   ? 17.912  -42.924 0.196   1.00 0.00 ?  57  PHE C HE1  1  
ATOM   6746   H  HE2  . PHE C  2 3   ? 21.414  -41.157 -1.564  1.00 0.00 ?  57  PHE C HE2  1  
ATOM   6747   H  HZ   . PHE C  2 3   ? 19.181  -41.957 -1.855  1.00 0.00 ?  57  PHE C HZ   1  
ATOM   6748   N  N    . SER C  2 4   ? 23.378  -44.285 5.055   1.00 0.00 ?  58  SER C N    1  
ATOM   6749   C  CA   . SER C  2 4   ? 24.205  -44.444 6.232   1.00 0.00 ?  58  SER C CA   1  
ATOM   6750   C  C    . SER C  2 4   ? 25.359  -45.410 6.123   1.00 0.00 ?  58  SER C C    1  
ATOM   6751   O  O    . SER C  2 4   ? 26.461  -45.149 6.596   1.00 0.00 ?  58  SER C O    1  
ATOM   6752   C  CB   . SER C  2 4   ? 23.316  -44.757 7.451   1.00 0.00 ?  58  SER C CB   1  
ATOM   6753   O  OG   . SER C  2 4   ? 24.057  -44.898 8.684   1.00 0.00 ?  58  SER C OG   1  
ATOM   6754   H  H    . SER C  2 4   ? 22.520  -44.793 5.040   1.00 0.00 ?  58  SER C H    1  
ATOM   6755   H  HA   . SER C  2 4   ? 24.729  -43.551 6.540   1.00 0.00 ?  58  SER C HA   1  
ATOM   6756   H  HB2  . SER C  2 4   ? 22.504  -44.021 7.632   1.00 0.00 ?  58  SER C HB2  1  
ATOM   6757   H  HB3  . SER C  2 4   ? 22.875  -45.769 7.323   1.00 0.00 ?  58  SER C HB3  1  
ATOM   6758   H  HG   . SER C  2 4   ? 24.619  -44.128 8.797   1.00 0.00 ?  58  SER C HG   1  
ATOM   6759   N  N    . LYS C  2 5   ? 25.253  -46.591 5.408   1.00 0.00 ?  59  LYS C N    1  
ATOM   6760   C  CA   . LYS C  2 5   ? 26.316  -47.489 5.117   1.00 0.00 ?  59  LYS C CA   1  
ATOM   6761   C  C    . LYS C  2 5   ? 27.369  -46.830 4.379   1.00 0.00 ?  59  LYS C C    1  
ATOM   6762   O  O    . LYS C  2 5   ? 28.521  -46.630 4.689   1.00 0.00 ?  59  LYS C O    1  
ATOM   6763   C  CB   . LYS C  2 5   ? 25.826  -48.680 4.244   1.00 0.00 ?  59  LYS C CB   1  
ATOM   6764   C  CG   . LYS C  2 5   ? 24.639  -49.358 4.809   1.00 0.00 ?  59  LYS C CG   1  
ATOM   6765   C  CD   . LYS C  2 5   ? 24.564  -49.742 6.270   1.00 0.00 ?  59  LYS C CD   1  
ATOM   6766   C  CE   . LYS C  2 5   ? 23.249  -50.333 6.774   1.00 0.00 ?  59  LYS C CE   1  
ATOM   6767   N  NZ   . LYS C  2 5   ? 23.343  -51.023 8.109   1.00 0.00 1  59  LYS C NZ   1  
ATOM   6768   H  H    . LYS C  2 5   ? 24.384  -46.694 4.931   1.00 0.00 ?  59  LYS C H    1  
ATOM   6769   H  HA   . LYS C  2 5   ? 26.752  -47.820 6.048   1.00 0.00 ?  59  LYS C HA   1  
ATOM   6770   H  HB2  . LYS C  2 5   ? 25.501  -48.269 3.264   1.00 0.00 ?  59  LYS C HB2  1  
ATOM   6771   H  HB3  . LYS C  2 5   ? 26.713  -49.322 4.054   1.00 0.00 ?  59  LYS C HB3  1  
ATOM   6772   H  HG2  . LYS C  2 5   ? 23.744  -48.792 4.474   1.00 0.00 ?  59  LYS C HG2  1  
ATOM   6773   H  HG3  . LYS C  2 5   ? 24.512  -50.348 4.321   1.00 0.00 ?  59  LYS C HG3  1  
ATOM   6774   H  HD2  . LYS C  2 5   ? 25.386  -50.455 6.494   1.00 0.00 ?  59  LYS C HD2  1  
ATOM   6775   H  HD3  . LYS C  2 5   ? 24.891  -48.936 6.962   1.00 0.00 ?  59  LYS C HD3  1  
ATOM   6776   H  HE2  . LYS C  2 5   ? 22.531  -49.506 6.960   1.00 0.00 ?  59  LYS C HE2  1  
ATOM   6777   H  HE3  . LYS C  2 5   ? 22.715  -51.082 6.150   1.00 0.00 ?  59  LYS C HE3  1  
ATOM   6778   H  HZ1  . LYS C  2 5   ? 22.403  -51.012 8.553   1.00 0.00 ?  59  LYS C HZ1  1  
ATOM   6779   H  HZ2  . LYS C  2 5   ? 23.949  -50.401 8.682   1.00 0.00 ?  59  LYS C HZ2  1  
ATOM   6780   H  HZ3  . LYS C  2 5   ? 23.707  -51.997 8.077   1.00 0.00 ?  59  LYS C HZ3  1  
ATOM   6781   N  N    . LEU C  2 6   ? 26.922  -46.087 3.373   1.00 0.00 ?  60  LEU C N    1  
ATOM   6782   C  CA   . LEU C  2 6   ? 27.704  -45.208 2.575   1.00 0.00 ?  60  LEU C CA   1  
ATOM   6783   C  C    . LEU C  2 6   ? 28.367  -44.035 3.271   1.00 0.00 ?  60  LEU C C    1  
ATOM   6784   O  O    . LEU C  2 6   ? 29.544  -43.731 3.025   1.00 0.00 ?  60  LEU C O    1  
ATOM   6785   C  CB   . LEU C  2 6   ? 26.748  -44.676 1.411   1.00 0.00 ?  60  LEU C CB   1  
ATOM   6786   C  CG   . LEU C  2 6   ? 27.383  -43.746 0.337   1.00 0.00 ?  60  LEU C CG   1  
ATOM   6787   C  CD1  . LEU C  2 6   ? 28.673  -44.274 -0.322  1.00 0.00 ?  60  LEU C CD1  1  
ATOM   6788   C  CD2  . LEU C  2 6   ? 26.391  -43.312 -0.738  1.00 0.00 ?  60  LEU C CD2  1  
ATOM   6789   H  H    . LEU C  2 6   ? 25.937  -46.093 3.215   1.00 0.00 ?  60  LEU C H    1  
ATOM   6790   H  HA   . LEU C  2 6   ? 28.489  -45.795 2.121   1.00 0.00 ?  60  LEU C HA   1  
ATOM   6791   H  HB2  . LEU C  2 6   ? 26.258  -45.564 0.957   1.00 0.00 ?  60  LEU C HB2  1  
ATOM   6792   H  HB3  . LEU C  2 6   ? 25.929  -44.074 1.861   1.00 0.00 ?  60  LEU C HB3  1  
ATOM   6793   H  HG   . LEU C  2 6   ? 27.735  -42.792 0.784   1.00 0.00 ?  60  LEU C HG   1  
ATOM   6794   H  HD11 . LEU C  2 6   ? 28.441  -44.678 -1.330  1.00 0.00 ?  60  LEU C HD11 1  
ATOM   6795   H  HD12 . LEU C  2 6   ? 29.101  -45.056 0.341   1.00 0.00 ?  60  LEU C HD12 1  
ATOM   6796   H  HD13 . LEU C  2 6   ? 29.364  -43.411 -0.440  1.00 0.00 ?  60  LEU C HD13 1  
ATOM   6797   H  HD21 . LEU C  2 6   ? 25.892  -44.168 -1.241  1.00 0.00 ?  60  LEU C HD21 1  
ATOM   6798   H  HD22 . LEU C  2 6   ? 26.793  -42.763 -1.616  1.00 0.00 ?  60  LEU C HD22 1  
ATOM   6799   H  HD23 . LEU C  2 6   ? 25.625  -42.615 -0.334  1.00 0.00 ?  60  LEU C HD23 1  
ATOM   6800   N  N    . ARG C  2 7   ? 27.665  -43.398 4.232   1.00 0.00 ?  61  ARG C N    1  
ATOM   6801   C  CA   . ARG C  2 7   ? 28.305  -42.460 5.167   1.00 0.00 ?  61  ARG C CA   1  
ATOM   6802   C  C    . ARG C  2 7   ? 29.453  -43.086 5.844   1.00 0.00 ?  61  ARG C C    1  
ATOM   6803   O  O    . ARG C  2 7   ? 30.552  -42.541 5.863   1.00 0.00 ?  61  ARG C O    1  
ATOM   6804   C  CB   . ARG C  2 7   ? 27.406  -41.985 6.187   1.00 0.00 ?  61  ARG C CB   1  
ATOM   6805   C  CG   . ARG C  2 7   ? 27.914  -40.847 7.141   1.00 0.00 ?  61  ARG C CG   1  
ATOM   6806   C  CD   . ARG C  2 7   ? 28.723  -39.630 6.561   1.00 0.00 ?  61  ARG C CD   1  
ATOM   6807   N  NE   . ARG C  2 7   ? 28.026  -39.213 5.267   1.00 0.00 ?  61  ARG C NE   1  
ATOM   6808   C  CZ   . ARG C  2 7   ? 28.620  -38.643 4.259   1.00 0.00 ?  61  ARG C CZ   1  
ATOM   6809   N  NH1  . ARG C  2 7   ? 28.116  -38.515 3.041   1.00 0.00 1  61  ARG C NH1  1  
ATOM   6810   N  NH2  . ARG C  2 7   ? 29.883  -38.302 4.369   1.00 0.00 ?  61  ARG C NH2  1  
ATOM   6811   H  H    . ARG C  2 7   ? 26.695  -43.567 4.389   1.00 0.00 ?  61  ARG C H    1  
ATOM   6812   H  HA   . ARG C  2 7   ? 28.549  -41.538 4.661   1.00 0.00 ?  61  ARG C HA   1  
ATOM   6813   H  HB2  . ARG C  2 7   ? 26.431  -41.681 5.748   1.00 0.00 ?  61  ARG C HB2  1  
ATOM   6814   H  HB3  . ARG C  2 7   ? 27.074  -42.894 6.733   1.00 0.00 ?  61  ARG C HB3  1  
ATOM   6815   H  HG2  . ARG C  2 7   ? 27.032  -40.477 7.707   1.00 0.00 ?  61  ARG C HG2  1  
ATOM   6816   H  HG3  . ARG C  2 7   ? 28.552  -41.313 7.922   1.00 0.00 ?  61  ARG C HG3  1  
ATOM   6817   H  HD2  . ARG C  2 7   ? 28.740  -38.818 7.319   1.00 0.00 ?  61  ARG C HD2  1  
ATOM   6818   H  HD3  . ARG C  2 7   ? 29.782  -39.942 6.433   1.00 0.00 ?  61  ARG C HD3  1  
ATOM   6819   H  HE   . ARG C  2 7   ? 27.029  -39.288 5.240   1.00 0.00 ?  61  ARG C HE   1  
ATOM   6820   H  HH11 . ARG C  2 7   ? 27.320  -39.081 2.826   1.00 0.00 ?  61  ARG C HH11 1  
ATOM   6821   H  HH12 . ARG C  2 7   ? 28.750  -38.334 2.289   1.00 0.00 ?  61  ARG C HH12 1  
ATOM   6822   H  HH21 . ARG C  2 7   ? 30.384  -37.710 3.737   1.00 0.00 ?  61  ARG C HH21 1  
ATOM   6823   H  HH22 . ARG C  2 7   ? 30.289  -38.520 5.256   1.00 0.00 ?  61  ARG C HH22 1  
ATOM   6824   N  N    . GLU C  2 8   ? 29.266  -44.326 6.420   1.00 0.00 ?  62  GLU C N    1  
ATOM   6825   C  CA   . GLU C  2 8   ? 30.418  -45.118 7.030   1.00 0.00 ?  62  GLU C CA   1  
ATOM   6826   C  C    . GLU C  2 8   ? 31.532  -45.192 6.061   1.00 0.00 ?  62  GLU C C    1  
ATOM   6827   O  O    . GLU C  2 8   ? 32.637  -44.847 6.406   1.00 0.00 ?  62  GLU C O    1  
ATOM   6828   C  CB   . GLU C  2 8   ? 30.060  -46.549 7.527   1.00 0.00 ?  62  GLU C CB   1  
ATOM   6829   C  CG   . GLU C  2 8   ? 29.038  -46.621 8.692   1.00 0.00 ?  62  GLU C CG   1  
ATOM   6830   C  CD   . GLU C  2 8   ? 29.559  -45.932 9.911   1.00 0.00 ?  62  GLU C CD   1  
ATOM   6831   O  OE1  . GLU C  2 8   ? 30.694  -46.258 10.359  1.00 0.00 ?  62  GLU C OE1  1  
ATOM   6832   O  OE2  . GLU C  2 8   ? 28.824  -45.046 10.496  1.00 0.00 -1 62  GLU C OE2  1  
ATOM   6833   H  H    . GLU C  2 8   ? 28.342  -44.700 6.407   1.00 0.00 ?  62  GLU C H    1  
ATOM   6834   H  HA   . GLU C  2 8   ? 30.752  -44.501 7.851   1.00 0.00 ?  62  GLU C HA   1  
ATOM   6835   H  HB2  . GLU C  2 8   ? 29.627  -47.188 6.728   1.00 0.00 ?  62  GLU C HB2  1  
ATOM   6836   H  HB3  . GLU C  2 8   ? 30.943  -47.127 7.877   1.00 0.00 ?  62  GLU C HB3  1  
ATOM   6837   H  HG2  . GLU C  2 8   ? 28.074  -46.167 8.377   1.00 0.00 ?  62  GLU C HG2  1  
ATOM   6838   H  HG3  . GLU C  2 8   ? 28.909  -47.712 8.857   1.00 0.00 ?  62  GLU C HG3  1  
ATOM   6839   N  N    . GLN C  2 9   ? 31.224  -45.520 4.772   1.00 0.00 ?  63  GLN C N    1  
ATOM   6840   C  CA   . GLN C  2 9   ? 32.227  -45.721 3.724   1.00 0.00 ?  63  GLN C CA   1  
ATOM   6841   C  C    . GLN C  2 9   ? 33.007  -44.482 3.229   1.00 0.00 ?  63  GLN C C    1  
ATOM   6842   O  O    . GLN C  2 9   ? 34.104  -44.475 2.692   1.00 0.00 ?  63  GLN C O    1  
ATOM   6843   C  CB   . GLN C  2 9   ? 31.617  -46.396 2.490   1.00 0.00 ?  63  GLN C CB   1  
ATOM   6844   C  CG   . GLN C  2 9   ? 30.999  -47.799 2.794   1.00 0.00 ?  63  GLN C CG   1  
ATOM   6845   C  CD   . GLN C  2 9   ? 31.643  -48.605 3.912   1.00 0.00 ?  63  GLN C CD   1  
ATOM   6846   O  OE1  . GLN C  2 9   ? 32.856  -48.903 3.889   1.00 0.00 ?  63  GLN C OE1  1  
ATOM   6847   N  NE2  . GLN C  2 9   ? 30.833  -48.935 4.971   1.00 0.00 ?  63  GLN C NE2  1  
ATOM   6848   H  H    . GLN C  2 9   ? 30.243  -45.630 4.631   1.00 0.00 ?  63  GLN C H    1  
ATOM   6849   H  HA   . GLN C  2 9   ? 32.995  -46.352 4.147   1.00 0.00 ?  63  GLN C HA   1  
ATOM   6850   H  HB2  . GLN C  2 9   ? 30.829  -45.792 1.991   1.00 0.00 ?  63  GLN C HB2  1  
ATOM   6851   H  HB3  . GLN C  2 9   ? 32.342  -46.489 1.654   1.00 0.00 ?  63  GLN C HB3  1  
ATOM   6852   H  HG2  . GLN C  2 9   ? 29.926  -47.580 2.983   1.00 0.00 ?  63  GLN C HG2  1  
ATOM   6853   H  HG3  . GLN C  2 9   ? 31.070  -48.246 1.780   1.00 0.00 ?  63  GLN C HG3  1  
ATOM   6854   H  HE21 . GLN C  2 9   ? 31.155  -49.385 5.804   1.00 0.00 ?  63  GLN C HE21 1  
ATOM   6855   H  HE22 . GLN C  2 9   ? 29.839  -48.857 4.895   1.00 0.00 ?  63  GLN C HE22 1  
ATOM   6856   N  N    . LEU C  2 10  ? 32.361  -43.326 3.365   1.00 0.00 ?  64  LEU C N    1  
ATOM   6857   C  CA   . LEU C  2 10  ? 32.910  -42.019 3.008   1.00 0.00 ?  64  LEU C CA   1  
ATOM   6858   C  C    . LEU C  2 10  ? 33.696  -41.339 4.022   1.00 0.00 ?  64  LEU C C    1  
ATOM   6859   O  O    . LEU C  2 10  ? 34.493  -40.486 3.670   1.00 0.00 ?  64  LEU C O    1  
ATOM   6860   C  CB   . LEU C  2 10  ? 31.747  -41.088 2.474   1.00 0.00 ?  64  LEU C CB   1  
ATOM   6861   C  CG   . LEU C  2 10  ? 31.291  -41.403 1.030   1.00 0.00 ?  64  LEU C CG   1  
ATOM   6862   C  CD1  . LEU C  2 10  ? 29.961  -40.754 0.790   1.00 0.00 ?  64  LEU C CD1  1  
ATOM   6863   C  CD2  . LEU C  2 10  ? 32.373  -40.994 0.004   1.00 0.00 ?  64  LEU C CD2  1  
ATOM   6864   H  H    . LEU C  2 10  ? 31.397  -43.297 3.619   1.00 0.00 ?  64  LEU C H    1  
ATOM   6865   H  HA   . LEU C  2 10  ? 33.530  -42.133 2.132   1.00 0.00 ?  64  LEU C HA   1  
ATOM   6866   H  HB2  . LEU C  2 10  ? 30.917  -41.215 3.200   1.00 0.00 ?  64  LEU C HB2  1  
ATOM   6867   H  HB3  . LEU C  2 10  ? 32.040  -40.018 2.411   1.00 0.00 ?  64  LEU C HB3  1  
ATOM   6868   H  HG   . LEU C  2 10  ? 31.070  -42.491 0.998   1.00 0.00 ?  64  LEU C HG   1  
ATOM   6869   H  HD11 . LEU C  2 10  ? 29.886  -40.579 -0.305  1.00 0.00 ?  64  LEU C HD11 1  
ATOM   6870   H  HD12 . LEU C  2 10  ? 30.019  -39.738 1.235   1.00 0.00 ?  64  LEU C HD12 1  
ATOM   6871   H  HD13 . LEU C  2 10  ? 29.083  -41.220 1.285   1.00 0.00 ?  64  LEU C HD13 1  
ATOM   6872   H  HD21 . LEU C  2 10  ? 32.739  -39.988 0.302   1.00 0.00 ?  64  LEU C HD21 1  
ATOM   6873   H  HD22 . LEU C  2 10  ? 31.942  -40.781 -0.998  1.00 0.00 ?  64  LEU C HD22 1  
ATOM   6874   H  HD23 . LEU C  2 10  ? 33.283  -41.633 0.000   1.00 0.00 ?  64  LEU C HD23 1  
ATOM   6875   N  N    . GLY C  2 11  ? 33.364  -41.550 5.346   1.00 0.00 ?  65  GLY C N    1  
ATOM   6876   C  CA   . GLY C  2 11  ? 34.050  -41.001 6.438   1.00 0.00 ?  65  GLY C CA   1  
ATOM   6877   C  C    . GLY C  2 11  ? 35.538  -41.021 6.453   1.00 0.00 ?  65  GLY C C    1  
ATOM   6878   O  O    . GLY C  2 11  ? 36.119  -39.998 6.689   1.00 0.00 ?  65  GLY C O    1  
ATOM   6879   H  H    . GLY C  2 11  ? 32.564  -42.129 5.482   1.00 0.00 ?  65  GLY C H    1  
ATOM   6880   H  HA2  . GLY C  2 11  ? 33.865  -39.938 6.392   1.00 0.00 ?  65  GLY C HA2  1  
ATOM   6881   H  HA3  . GLY C  2 11  ? 33.616  -41.386 7.349   1.00 0.00 ?  65  GLY C HA3  1  
ATOM   6882   N  N    . PRO C  2 12  ? 36.208  -42.174 6.213   1.00 0.00 ?  66  PRO C N    1  
ATOM   6883   C  CA   . PRO C  2 12  ? 37.658  -42.282 6.124   1.00 0.00 ?  66  PRO C CA   1  
ATOM   6884   C  C    . PRO C  2 12  ? 38.249  -41.351 5.037   1.00 0.00 ?  66  PRO C C    1  
ATOM   6885   O  O    . PRO C  2 12  ? 39.237  -40.628 5.239   1.00 0.00 ?  66  PRO C O    1  
ATOM   6886   C  CB   . PRO C  2 12  ? 37.932  -43.714 5.902   1.00 0.00 ?  66  PRO C CB   1  
ATOM   6887   C  CG   . PRO C  2 12  ? 36.815  -44.451 6.561   1.00 0.00 ?  66  PRO C CG   1  
ATOM   6888   C  CD   . PRO C  2 12  ? 35.624  -43.507 6.403   1.00 0.00 ?  66  PRO C CD   1  
ATOM   6889   H  HA   . PRO C  2 12  ? 38.139  -41.982 7.043   1.00 0.00 ?  66  PRO C HA   1  
ATOM   6890   H  HB2  . PRO C  2 12  ? 37.969  -44.000 4.829   1.00 0.00 ?  66  PRO C HB2  1  
ATOM   6891   H  HB3  . PRO C  2 12  ? 38.891  -44.045 6.355   1.00 0.00 ?  66  PRO C HB3  1  
ATOM   6892   H  HG2  . PRO C  2 12  ? 36.582  -45.418 6.068   1.00 0.00 ?  66  PRO C HG2  1  
ATOM   6893   H  HG3  . PRO C  2 12  ? 37.148  -44.697 7.592   1.00 0.00 ?  66  PRO C HG3  1  
ATOM   6894   H  HD2  . PRO C  2 12  ? 35.154  -43.760 5.429   1.00 0.00 ?  66  PRO C HD2  1  
ATOM   6895   H  HD3  . PRO C  2 12  ? 34.932  -43.552 7.271   1.00 0.00 ?  66  PRO C HD3  1  
ATOM   6896   N  N    . VAL C  2 13  ? 37.517  -41.369 3.915   1.00 0.00 ?  67  VAL C N    1  
ATOM   6897   C  CA   . VAL C  2 13  ? 37.793  -40.624 2.650   1.00 0.00 ?  67  VAL C CA   1  
ATOM   6898   C  C    . VAL C  2 13  ? 37.642  -39.064 2.992   1.00 0.00 ?  67  VAL C C    1  
ATOM   6899   O  O    . VAL C  2 13  ? 38.471  -38.261 2.578   1.00 0.00 ?  67  VAL C O    1  
ATOM   6900   C  CB   . VAL C  2 13  ? 36.862  -41.056 1.508   1.00 0.00 ?  67  VAL C CB   1  
ATOM   6901   C  CG1  . VAL C  2 13  ? 37.106  -40.235 0.263   1.00 0.00 ?  67  VAL C CG1  1  
ATOM   6902   C  CG2  . VAL C  2 13  ? 37.136  -42.515 1.208   1.00 0.00 ?  67  VAL C CG2  1  
ATOM   6903   H  H    . VAL C  2 13  ? 36.743  -41.983 3.776   1.00 0.00 ?  67  VAL C H    1  
ATOM   6904   H  HA   . VAL C  2 13  ? 38.833  -40.742 2.380   1.00 0.00 ?  67  VAL C HA   1  
ATOM   6905   H  HB   . VAL C  2 13  ? 35.811  -40.777 1.736   1.00 0.00 ?  67  VAL C HB   1  
ATOM   6906   H  HG11 . VAL C  2 13  ? 38.163  -40.223 -0.079  1.00 0.00 ?  67  VAL C HG11 1  
ATOM   6907   H  HG12 . VAL C  2 13  ? 36.750  -39.191 0.392   1.00 0.00 ?  67  VAL C HG12 1  
ATOM   6908   H  HG13 . VAL C  2 13  ? 36.615  -40.620 -0.656  1.00 0.00 ?  67  VAL C HG13 1  
ATOM   6909   H  HG21 . VAL C  2 13  ? 36.438  -43.082 1.861   1.00 0.00 ?  67  VAL C HG21 1  
ATOM   6910   H  HG22 . VAL C  2 13  ? 38.169  -42.733 1.552   1.00 0.00 ?  67  VAL C HG22 1  
ATOM   6911   H  HG23 . VAL C  2 13  ? 36.945  -42.646 0.122   1.00 0.00 ?  67  VAL C HG23 1  
ATOM   6912   N  N    . THR C  2 14  ? 36.651  -38.735 3.802   1.00 0.00 ?  68  THR C N    1  
ATOM   6913   C  CA   . THR C  2 14  ? 36.446  -37.405 4.340   1.00 0.00 ?  68  THR C CA   1  
ATOM   6914   C  C    . THR C  2 14  ? 37.502  -36.909 5.295   1.00 0.00 ?  68  THR C C    1  
ATOM   6915   O  O    . THR C  2 14  ? 37.869  -35.716 5.249   1.00 0.00 ?  68  THR C O    1  
ATOM   6916   C  CB   . THR C  2 14  ? 34.997  -37.241 5.033   1.00 0.00 ?  68  THR C CB   1  
ATOM   6917   O  OG1  . THR C  2 14  ? 34.030  -37.733 4.187   1.00 0.00 ?  68  THR C OG1  1  
ATOM   6918   C  CG2  . THR C  2 14  ? 34.611  -35.783 5.252   1.00 0.00 ?  68  THR C CG2  1  
ATOM   6919   H  H    . THR C  2 14  ? 35.902  -39.357 4.017   1.00 0.00 ?  68  THR C H    1  
ATOM   6920   H  HA   . THR C  2 14  ? 36.426  -36.600 3.621   1.00 0.00 ?  68  THR C HA   1  
ATOM   6921   H  HB   . THR C  2 14  ? 34.930  -37.707 6.040   1.00 0.00 ?  68  THR C HB   1  
ATOM   6922   H  HG1  . THR C  2 14  ? 34.365  -38.566 3.847   1.00 0.00 ?  68  THR C HG1  1  
ATOM   6923   H  HG21 . THR C  2 14  ? 33.630  -35.800 5.774   1.00 0.00 ?  68  THR C HG21 1  
ATOM   6924   H  HG22 . THR C  2 14  ? 34.543  -35.051 4.419   1.00 0.00 ?  68  THR C HG22 1  
ATOM   6925   H  HG23 . THR C  2 14  ? 35.277  -35.211 5.934   1.00 0.00 ?  68  THR C HG23 1  
ATOM   6926   N  N    . GLN C  2 15  ? 38.018  -37.816 6.125   1.00 0.00 ?  69  GLN C N    1  
ATOM   6927   C  CA   . GLN C  2 15  ? 39.082  -37.447 6.982   1.00 0.00 ?  69  GLN C CA   1  
ATOM   6928   C  C    . GLN C  2 15  ? 40.381  -37.026 6.374   1.00 0.00 ?  69  GLN C C    1  
ATOM   6929   O  O    . GLN C  2 15  ? 40.976  -36.111 6.854   1.00 0.00 ?  69  GLN C O    1  
ATOM   6930   C  CB   . GLN C  2 15  ? 39.452  -38.577 8.093   1.00 0.00 ?  69  GLN C CB   1  
ATOM   6931   C  CG   . GLN C  2 15  ? 38.274  -39.033 8.993   1.00 0.00 ?  69  GLN C CG   1  
ATOM   6932   C  CD   . GLN C  2 15  ? 37.486  -37.996 9.710   1.00 0.00 ?  69  GLN C CD   1  
ATOM   6933   O  OE1  . GLN C  2 15  ? 37.598  -37.805 10.921  1.00 0.00 ?  69  GLN C OE1  1  
ATOM   6934   N  NE2  . GLN C  2 15  ? 36.456  -37.504 9.043   1.00 0.00 ?  69  GLN C NE2  1  
ATOM   6935   H  H    . GLN C  2 15  ? 37.623  -38.708 6.328   1.00 0.00 ?  69  GLN C H    1  
ATOM   6936   H  HA   . GLN C  2 15  ? 38.739  -36.573 7.516   1.00 0.00 ?  69  GLN C HA   1  
ATOM   6937   H  HB2  . GLN C  2 15  ? 39.797  -39.364 7.389   1.00 0.00 ?  69  GLN C HB2  1  
ATOM   6938   H  HB3  . GLN C  2 15  ? 40.302  -38.282 8.744   1.00 0.00 ?  69  GLN C HB3  1  
ATOM   6939   H  HG2  . GLN C  2 15  ? 37.684  -39.693 8.322   1.00 0.00 ?  69  GLN C HG2  1  
ATOM   6940   H  HG3  . GLN C  2 15  ? 38.618  -39.721 9.795   1.00 0.00 ?  69  GLN C HG3  1  
ATOM   6941   H  HE21 . GLN C  2 15  ? 35.889  -36.841 9.532   1.00 0.00 ?  69  GLN C HE21 1  
ATOM   6942   H  HE22 . GLN C  2 15  ? 36.126  -37.893 8.183   1.00 0.00 ?  69  GLN C HE22 1  
ATOM   6943   N  N    . GLU C  2 16  ? 40.878  -37.745 5.324   1.00 0.00 ?  70  GLU C N    1  
ATOM   6944   C  CA   . GLU C  2 16  ? 42.062  -37.408 4.577   1.00 0.00 ?  70  GLU C CA   1  
ATOM   6945   C  C    . GLU C  2 16  ? 41.899  -36.016 3.920   1.00 0.00 ?  70  GLU C C    1  
ATOM   6946   O  O    . GLU C  2 16  ? 42.811  -35.246 3.981   1.00 0.00 ?  70  GLU C O    1  
ATOM   6947   C  CB   . GLU C  2 16  ? 42.343  -38.584 3.488   1.00 0.00 ?  70  GLU C CB   1  
ATOM   6948   C  CG   . GLU C  2 16  ? 42.956  -39.953 4.033   1.00 0.00 ?  70  GLU C CG   1  
ATOM   6949   C  CD   . GLU C  2 16  ? 43.306  -40.836 2.878   1.00 0.00 ?  70  GLU C CD   1  
ATOM   6950   O  OE1  . GLU C  2 16  ? 44.299  -40.551 2.218   1.00 0.00 ?  70  GLU C OE1  1  
ATOM   6951   O  OE2  . GLU C  2 16  ? 42.496  -41.762 2.574   1.00 0.00 -1 70  GLU C OE2  1  
ATOM   6952   H  H    . GLU C  2 16  ? 40.441  -38.618 5.120   1.00 0.00 ?  70  GLU C H    1  
ATOM   6953   H  HA   . GLU C  2 16  ? 42.863  -37.341 5.297   1.00 0.00 ?  70  GLU C HA   1  
ATOM   6954   H  HB2  . GLU C  2 16  ? 41.371  -38.718 2.966   1.00 0.00 ?  70  GLU C HB2  1  
ATOM   6955   H  HB3  . GLU C  2 16  ? 43.130  -38.262 2.773   1.00 0.00 ?  70  GLU C HB3  1  
ATOM   6956   H  HG2  . GLU C  2 16  ? 43.786  -39.633 4.700   1.00 0.00 ?  70  GLU C HG2  1  
ATOM   6957   H  HG3  . GLU C  2 16  ? 42.108  -40.390 4.601   1.00 0.00 ?  70  GLU C HG3  1  
ATOM   6958   N  N    . PHE C  2 17  ? 40.735  -35.764 3.413   1.00 0.00 ?  71  PHE C N    1  
ATOM   6959   C  CA   . PHE C  2 17  ? 40.455  -34.550 2.680   1.00 0.00 ?  71  PHE C CA   1  
ATOM   6960   C  C    . PHE C  2 17  ? 40.407  -33.360 3.638   1.00 0.00 ?  71  PHE C C    1  
ATOM   6961   O  O    . PHE C  2 17  ? 40.892  -32.274 3.282   1.00 0.00 ?  71  PHE C O    1  
ATOM   6962   C  CB   . PHE C  2 17  ? 39.202  -34.811 1.754   1.00 0.00 ?  71  PHE C CB   1  
ATOM   6963   C  CG   . PHE C  2 17  ? 38.230  -33.723 1.693   1.00 0.00 ?  71  PHE C CG   1  
ATOM   6964   C  CD1  . PHE C  2 17  ? 38.659  -32.602 0.993   1.00 0.00 ?  71  PHE C CD1  1  
ATOM   6965   C  CD2  . PHE C  2 17  ? 36.877  -33.777 2.102   1.00 0.00 ?  71  PHE C CD2  1  
ATOM   6966   C  CE1  . PHE C  2 17  ? 37.784  -31.587 0.643   1.00 0.00 ?  71  PHE C CE1  1  
ATOM   6967   C  CE2  . PHE C  2 17  ? 35.979  -32.705 1.937   1.00 0.00 ?  71  PHE C CE2  1  
ATOM   6968   C  CZ   . PHE C  2 17  ? 36.457  -31.596 1.190   1.00 0.00 ?  71  PHE C CZ   1  
ATOM   6969   H  H    . PHE C  2 17  ? 39.997  -36.394 3.644   1.00 0.00 ?  71  PHE C H    1  
ATOM   6970   H  HA   . PHE C  2 17  ? 41.281  -34.304 2.029   1.00 0.00 ?  71  PHE C HA   1  
ATOM   6971   H  HB2  . PHE C  2 17  ? 39.443  -35.091 0.707   1.00 0.00 ?  71  PHE C HB2  1  
ATOM   6972   H  HB3  . PHE C  2 17  ? 38.586  -35.640 2.163   1.00 0.00 ?  71  PHE C HB3  1  
ATOM   6973   H  HD1  . PHE C  2 17  ? 39.685  -32.658 0.661   1.00 0.00 ?  71  PHE C HD1  1  
ATOM   6974   H  HD2  . PHE C  2 17  ? 36.550  -34.638 2.667   1.00 0.00 ?  71  PHE C HD2  1  
ATOM   6975   H  HE1  . PHE C  2 17  ? 38.064  -30.763 0.004   1.00 0.00 ?  71  PHE C HE1  1  
ATOM   6976   H  HE2  . PHE C  2 17  ? 34.949  -32.693 2.261   1.00 0.00 ?  71  PHE C HE2  1  
ATOM   6977   H  HZ   . PHE C  2 17  ? 35.751  -30.830 0.906   1.00 0.00 ?  71  PHE C HZ   1  
ATOM   6978   N  N    . TRP C  2 18  ? 39.813  -33.593 4.846   1.00 0.00 ?  72  TRP C N    1  
ATOM   6979   C  CA   . TRP C  2 18  ? 39.620  -32.559 5.896   1.00 0.00 ?  72  TRP C CA   1  
ATOM   6980   C  C    . TRP C  2 18  ? 40.996  -32.142 6.461   1.00 0.00 ?  72  TRP C C    1  
ATOM   6981   O  O    . TRP C  2 18  ? 41.294  -31.018 6.820   1.00 0.00 ?  72  TRP C O    1  
ATOM   6982   C  CB   . TRP C  2 18  ? 38.559  -32.957 6.980   1.00 0.00 ?  72  TRP C CB   1  
ATOM   6983   C  CG   . TRP C  2 18  ? 38.184  -31.912 7.951   1.00 0.00 ?  72  TRP C CG   1  
ATOM   6984   C  CD1  . TRP C  2 18  ? 38.025  -30.568 7.682   1.00 0.00 ?  72  TRP C CD1  1  
ATOM   6985   C  CD2  . TRP C  2 18  ? 37.466  -32.152 9.191   1.00 0.00 ?  72  TRP C CD2  1  
ATOM   6986   N  NE1  . TRP C  2 18  ? 37.438  -29.932 8.746   1.00 0.00 ?  72  TRP C NE1  1  
ATOM   6987   C  CE2  . TRP C  2 18  ? 37.053  -30.912 9.698   1.00 0.00 ?  72  TRP C CE2  1  
ATOM   6988   C  CE3  . TRP C  2 18  ? 37.179  -33.315 9.931   1.00 0.00 ?  72  TRP C CE3  1  
ATOM   6989   C  CZ2  . TRP C  2 18  ? 36.328  -30.756 10.903  1.00 0.00 ?  72  TRP C CZ2  1  
ATOM   6990   C  CZ3  . TRP C  2 18  ? 36.451  -33.179 11.150  1.00 0.00 ?  72  TRP C CZ3  1  
ATOM   6991   C  CH2  . TRP C  2 18  ? 35.899  -31.975 11.498  1.00 0.00 ?  72  TRP C CH2  1  
ATOM   6992   H  H    . TRP C  2 18  ? 39.401  -34.468 5.088   1.00 0.00 ?  72  TRP C H    1  
ATOM   6993   H  HA   . TRP C  2 18  ? 39.190  -31.719 5.371   1.00 0.00 ?  72  TRP C HA   1  
ATOM   6994   H  HB2  . TRP C  2 18  ? 37.666  -33.179 6.358   1.00 0.00 ?  72  TRP C HB2  1  
ATOM   6995   H  HB3  . TRP C  2 18  ? 38.881  -33.890 7.490   1.00 0.00 ?  72  TRP C HB3  1  
ATOM   6996   H  HD1  . TRP C  2 18  ? 38.321  -30.072 6.769   1.00 0.00 ?  72  TRP C HD1  1  
ATOM   6997   H  HE1  . TRP C  2 18  ? 37.505  -28.978 8.940   1.00 0.00 ?  72  TRP C HE1  1  
ATOM   6998   H  HE3  . TRP C  2 18  ? 37.477  -34.288 9.569   1.00 0.00 ?  72  TRP C HE3  1  
ATOM   6999   H  HZ2  . TRP C  2 18  ? 35.919  -29.824 11.265  1.00 0.00 ?  72  TRP C HZ2  1  
ATOM   7000   H  HZ3  . TRP C  2 18  ? 36.122  -34.118 11.569  1.00 0.00 ?  72  TRP C HZ3  1  
ATOM   7001   H  HH2  . TRP C  2 18  ? 35.263  -31.834 12.359  1.00 0.00 ?  72  TRP C HH2  1  
ATOM   7002   N  N    . ASP C  2 19  ? 41.830  -33.191 6.657   1.00 0.00 ?  73  ASP C N    1  
ATOM   7003   C  CA   . ASP C  2 19  ? 43.183  -33.008 7.097   1.00 0.00 ?  73  ASP C CA   1  
ATOM   7004   C  C    . ASP C  2 19  ? 44.058  -32.075 6.164   1.00 0.00 ?  73  ASP C C    1  
ATOM   7005   O  O    . ASP C  2 19  ? 44.532  -31.030 6.587   1.00 0.00 ?  73  ASP C O    1  
ATOM   7006   C  CB   . ASP C  2 19  ? 43.824  -34.399 7.106   1.00 0.00 ?  73  ASP C CB   1  
ATOM   7007   C  CG   . ASP C  2 19  ? 45.186  -34.472 7.863   1.00 0.00 ?  73  ASP C CG   1  
ATOM   7008   O  OD1  . ASP C  2 19  ? 45.861  -35.542 7.968   1.00 0.00 ?  73  ASP C OD1  1  
ATOM   7009   O  OD2  . ASP C  2 19  ? 45.498  -33.446 8.494   1.00 0.00 -1 73  ASP C OD2  1  
ATOM   7010   H  H    . ASP C  2 19  ? 41.487  -34.097 6.423   1.00 0.00 ?  73  ASP C H    1  
ATOM   7011   H  HA   . ASP C  2 19  ? 43.103  -32.606 8.096   1.00 0.00 ?  73  ASP C HA   1  
ATOM   7012   H  HB2  . ASP C  2 19  ? 43.256  -35.216 7.599   1.00 0.00 ?  73  ASP C HB2  1  
ATOM   7013   H  HB3  . ASP C  2 19  ? 43.957  -34.858 6.103   1.00 0.00 ?  73  ASP C HB3  1  
ATOM   7014   N  N    . ASN C  2 20  ? 44.170  -32.507 4.883   1.00 0.00 ?  74  ASN C N    1  
ATOM   7015   C  CA   . ASN C  2 20  ? 44.904  -31.765 3.888   1.00 0.00 ?  74  ASN C CA   1  
ATOM   7016   C  C    . ASN C  2 20  ? 44.295  -30.369 3.575   1.00 0.00 ?  74  ASN C C    1  
ATOM   7017   O  O    . ASN C  2 20  ? 45.075  -29.404 3.317   1.00 0.00 ?  74  ASN C O    1  
ATOM   7018   C  CB   . ASN C  2 20  ? 44.880  -32.574 2.528   1.00 0.00 ?  74  ASN C CB   1  
ATOM   7019   C  CG   . ASN C  2 20  ? 45.426  -33.977 2.674   1.00 0.00 ?  74  ASN C CG   1  
ATOM   7020   O  OD1  . ASN C  2 20  ? 46.211  -34.268 3.550   1.00 0.00 ?  74  ASN C OD1  1  
ATOM   7021   N  ND2  . ASN C  2 20  ? 45.115  -34.850 1.713   1.00 0.00 ?  74  ASN C ND2  1  
ATOM   7022   H  H    . ASN C  2 20  ? 43.819  -33.428 4.733   1.00 0.00 ?  74  ASN C H    1  
ATOM   7023   H  HA   . ASN C  2 20  ? 45.884  -31.588 4.308   1.00 0.00 ?  74  ASN C HA   1  
ATOM   7024   H  HB2  . ASN C  2 20  ? 43.811  -32.647 2.236   1.00 0.00 ?  74  ASN C HB2  1  
ATOM   7025   H  HB3  . ASN C  2 20  ? 45.386  -31.988 1.730   1.00 0.00 ?  74  ASN C HB3  1  
ATOM   7026   H  HD21 . ASN C  2 20  ? 45.498  -35.761 1.865   1.00 0.00 ?  74  ASN C HD21 1  
ATOM   7027   H  HD22 . ASN C  2 20  ? 44.527  -34.486 0.990   1.00 0.00 ?  74  ASN C HD22 1  
ATOM   7028   N  N    . LEU C  2 21  ? 42.922  -30.146 3.615   1.00 0.00 ?  75  LEU C N    1  
ATOM   7029   C  CA   . LEU C  2 21  ? 42.239  -28.871 3.578   1.00 0.00 ?  75  LEU C CA   1  
ATOM   7030   C  C    . LEU C  2 21  ? 42.710  -27.933 4.656   1.00 0.00 ?  75  LEU C C    1  
ATOM   7031   O  O    . LEU C  2 21  ? 42.944  -26.681 4.405   1.00 0.00 ?  75  LEU C O    1  
ATOM   7032   C  CB   . LEU C  2 21  ? 40.659  -28.948 3.580   1.00 0.00 ?  75  LEU C CB   1  
ATOM   7033   C  CG   . LEU C  2 21  ? 39.801  -27.620 3.564   1.00 0.00 ?  75  LEU C CG   1  
ATOM   7034   C  CD1  . LEU C  2 21  ? 39.674  -26.971 2.143   1.00 0.00 ?  75  LEU C CD1  1  
ATOM   7035   C  CD2  . LEU C  2 21  ? 38.330  -28.056 4.058   1.00 0.00 ?  75  LEU C CD2  1  
ATOM   7036   H  H    . LEU C  2 21  ? 42.328  -30.932 3.767   1.00 0.00 ?  75  LEU C H    1  
ATOM   7037   H  HA   . LEU C  2 21  ? 42.701  -28.501 2.675   1.00 0.00 ?  75  LEU C HA   1  
ATOM   7038   H  HB2  . LEU C  2 21  ? 40.355  -29.714 2.835   1.00 0.00 ?  75  LEU C HB2  1  
ATOM   7039   H  HB3  . LEU C  2 21  ? 40.322  -29.533 4.463   1.00 0.00 ?  75  LEU C HB3  1  
ATOM   7040   H  HG   . LEU C  2 21  ? 40.238  -26.956 4.340   1.00 0.00 ?  75  LEU C HG   1  
ATOM   7041   H  HD11 . LEU C  2 21  ? 39.037  -27.606 1.492   1.00 0.00 ?  75  LEU C HD11 1  
ATOM   7042   H  HD12 . LEU C  2 21  ? 40.611  -26.786 1.576   1.00 0.00 ?  75  LEU C HD12 1  
ATOM   7043   H  HD13 . LEU C  2 21  ? 39.262  -25.941 2.201   1.00 0.00 ?  75  LEU C HD13 1  
ATOM   7044   H  HD21 . LEU C  2 21  ? 38.397  -28.432 5.101   1.00 0.00 ?  75  LEU C HD21 1  
ATOM   7045   H  HD22 . LEU C  2 21  ? 37.882  -28.904 3.497   1.00 0.00 ?  75  LEU C HD22 1  
ATOM   7046   H  HD23 . LEU C  2 21  ? 37.705  -27.138 4.076   1.00 0.00 ?  75  LEU C HD23 1  
ATOM   7047   N  N    . GLU C  2 22  ? 42.766  -28.299 5.969   1.00 0.00 ?  76  GLU C N    1  
ATOM   7048   C  CA   . GLU C  2 22  ? 43.294  -27.480 7.072   1.00 0.00 ?  76  GLU C CA   1  
ATOM   7049   C  C    . GLU C  2 22  ? 44.782  -27.042 6.996   1.00 0.00 ?  76  GLU C C    1  
ATOM   7050   O  O    . GLU C  2 22  ? 45.150  -25.949 7.299   1.00 0.00 ?  76  GLU C O    1  
ATOM   7051   C  CB   . GLU C  2 22  ? 43.042  -28.154 8.425   1.00 0.00 ?  76  GLU C CB   1  
ATOM   7052   C  CG   . GLU C  2 22  ? 43.764  -27.677 9.680   1.00 0.00 ?  76  GLU C CG   1  
ATOM   7053   C  CD   . GLU C  2 22  ? 43.111  -28.232 11.000  1.00 0.00 ?  76  GLU C CD   1  
ATOM   7054   O  OE1  . GLU C  2 22  ? 43.672  -27.981 12.069  1.00 0.00 ?  76  GLU C OE1  1  
ATOM   7055   O  OE2  . GLU C  2 22  ? 41.981  -28.808 10.971  1.00 0.00 -1 76  GLU C OE2  1  
ATOM   7056   H  H    . GLU C  2 22  ? 42.502  -29.235 6.190   1.00 0.00 ?  76  GLU C H    1  
ATOM   7057   H  HA   . GLU C  2 22  ? 42.776  -26.538 6.973   1.00 0.00 ?  76  GLU C HA   1  
ATOM   7058   H  HB2  . GLU C  2 22  ? 41.958  -28.168 8.669   1.00 0.00 ?  76  GLU C HB2  1  
ATOM   7059   H  HB3  . GLU C  2 22  ? 43.168  -29.252 8.318   1.00 0.00 ?  76  GLU C HB3  1  
ATOM   7060   H  HG2  . GLU C  2 22  ? 44.841  -27.915 9.548   1.00 0.00 ?  76  GLU C HG2  1  
ATOM   7061   H  HG3  . GLU C  2 22  ? 43.511  -26.599 9.771   1.00 0.00 ?  76  GLU C HG3  1  
ATOM   7062   N  N    . LYS C  2 23  ? 45.616  -28.115 6.673   1.00 0.00 ?  77  LYS C N    1  
ATOM   7063   C  CA   . LYS C  2 23  ? 47.070  -28.005 6.590   1.00 0.00 ?  77  LYS C CA   1  
ATOM   7064   C  C    . LYS C  2 23  ? 47.430  -27.007 5.529   1.00 0.00 ?  77  LYS C C    1  
ATOM   7065   O  O    . LYS C  2 23  ? 48.275  -26.112 5.577   1.00 0.00 ?  77  LYS C O    1  
ATOM   7066   C  CB   . LYS C  2 23  ? 47.695  -29.397 6.163   1.00 0.00 ?  77  LYS C CB   1  
ATOM   7067   C  CG   . LYS C  2 23  ? 47.845  -30.365 7.349   1.00 0.00 ?  77  LYS C CG   1  
ATOM   7068   C  CD   . LYS C  2 23  ? 48.254  -31.765 6.957   1.00 0.00 ?  77  LYS C CD   1  
ATOM   7069   C  CE   . LYS C  2 23  ? 48.934  -32.520 8.165   1.00 0.00 ?  77  LYS C CE   1  
ATOM   7070   N  NZ   . LYS C  2 23  ? 48.036  -32.489 9.348   1.00 0.00 1  77  LYS C NZ   1  
ATOM   7071   H  H    . LYS C  2 23  ? 45.134  -28.937 6.380   1.00 0.00 ?  77  LYS C H    1  
ATOM   7072   H  HA   . LYS C  2 23  ? 47.383  -27.755 7.593   1.00 0.00 ?  77  LYS C HA   1  
ATOM   7073   H  HB2  . LYS C  2 23  ? 46.995  -29.918 5.475   1.00 0.00 ?  77  LYS C HB2  1  
ATOM   7074   H  HB3  . LYS C  2 23  ? 48.711  -29.369 5.714   1.00 0.00 ?  77  LYS C HB3  1  
ATOM   7075   H  HG2  . LYS C  2 23  ? 48.610  -29.871 7.985   1.00 0.00 ?  77  LYS C HG2  1  
ATOM   7076   H  HG3  . LYS C  2 23  ? 46.887  -30.455 7.904   1.00 0.00 ?  77  LYS C HG3  1  
ATOM   7077   H  HD2  . LYS C  2 23  ? 47.371  -32.370 6.658   1.00 0.00 ?  77  LYS C HD2  1  
ATOM   7078   H  HD3  . LYS C  2 23  ? 48.929  -31.742 6.075   1.00 0.00 ?  77  LYS C HD3  1  
ATOM   7079   H  HE2  . LYS C  2 23  ? 49.157  -33.557 7.835   1.00 0.00 ?  77  LYS C HE2  1  
ATOM   7080   H  HE3  . LYS C  2 23  ? 49.876  -31.957 8.336   1.00 0.00 ?  77  LYS C HE3  1  
ATOM   7081   H  HZ1  . LYS C  2 23  ? 47.100  -32.911 9.181   1.00 0.00 ?  77  LYS C HZ1  1  
ATOM   7082   H  HZ2  . LYS C  2 23  ? 47.866  -31.479 9.527   1.00 0.00 ?  77  LYS C HZ2  1  
ATOM   7083   H  HZ3  . LYS C  2 23  ? 48.349  -32.992 10.203  1.00 0.00 ?  77  LYS C HZ3  1  
ATOM   7084   N  N    . GLU C  2 24  ? 46.722  -27.134 4.408   1.00 0.00 ?  78  GLU C N    1  
ATOM   7085   C  CA   . GLU C  2 24  ? 46.993  -26.130 3.308   1.00 0.00 ?  78  GLU C CA   1  
ATOM   7086   C  C    . GLU C  2 24  ? 46.448  -24.738 3.653   1.00 0.00 ?  78  GLU C C    1  
ATOM   7087   O  O    . GLU C  2 24  ? 47.109  -23.717 3.363   1.00 0.00 ?  78  GLU C O    1  
ATOM   7088   C  CB   . GLU C  2 24  ? 46.532  -26.521 1.885   1.00 0.00 ?  78  GLU C CB   1  
ATOM   7089   C  CG   . GLU C  2 24  ? 47.243  -27.771 1.295   1.00 0.00 ?  78  GLU C CG   1  
ATOM   7090   C  CD   . GLU C  2 24  ? 48.750  -27.644 1.005   1.00 0.00 ?  78  GLU C CD   1  
ATOM   7091   O  OE1  . GLU C  2 24  ? 49.116  -27.341 -0.195  1.00 0.00 ?  78  GLU C OE1  1  
ATOM   7092   O  OE2  . GLU C  2 24  ? 49.542  -27.989 1.881   1.00 0.00 -1 78  GLU C OE2  1  
ATOM   7093   H  H    . GLU C  2 24  ? 45.954  -27.764 4.321   1.00 0.00 ?  78  GLU C H    1  
ATOM   7094   H  HA   . GLU C  2 24  ? 48.050  -25.920 3.234   1.00 0.00 ?  78  GLU C HA   1  
ATOM   7095   H  HB2  . GLU C  2 24  ? 45.469  -26.833 1.971   1.00 0.00 ?  78  GLU C HB2  1  
ATOM   7096   H  HB3  . GLU C  2 24  ? 46.651  -25.644 1.214   1.00 0.00 ?  78  GLU C HB3  1  
ATOM   7097   H  HG2  . GLU C  2 24  ? 47.095  -28.738 1.822   1.00 0.00 ?  78  GLU C HG2  1  
ATOM   7098   H  HG3  . GLU C  2 24  ? 46.676  -27.780 0.339   1.00 0.00 ?  78  GLU C HG3  1  
ATOM   7099   N  N    . THR C  2 25  ? 45.351  -24.710 4.439   1.00 0.00 ?  79  THR C N    1  
ATOM   7100   C  CA   . THR C  2 25  ? 44.859  -23.376 4.831   1.00 0.00 ?  79  THR C CA   1  
ATOM   7101   C  C    . THR C  2 25  ? 45.815  -22.625 5.718   1.00 0.00 ?  79  THR C C    1  
ATOM   7102   O  O    . THR C  2 25  ? 46.155  -21.498 5.357   1.00 0.00 ?  79  THR C O    1  
ATOM   7103   C  CB   . THR C  2 25  ? 43.532  -23.356 5.530   1.00 0.00 ?  79  THR C CB   1  
ATOM   7104   O  OG1  . THR C  2 25  ? 42.545  -23.902 4.700   1.00 0.00 ?  79  THR C OG1  1  
ATOM   7105   C  CG2  . THR C  2 25  ? 43.066  -21.920 5.899   1.00 0.00 ?  79  THR C CG2  1  
ATOM   7106   H  H    . THR C  2 25  ? 44.842  -25.559 4.561   1.00 0.00 ?  79  THR C H    1  
ATOM   7107   H  HA   . THR C  2 25  ? 44.697  -22.846 3.904   1.00 0.00 ?  79  THR C HA   1  
ATOM   7108   H  HB   . THR C  2 25  ? 43.536  -24.069 6.382   1.00 0.00 ?  79  THR C HB   1  
ATOM   7109   H  HG1  . THR C  2 25  ? 42.754  -24.812 4.480   1.00 0.00 ?  79  THR C HG1  1  
ATOM   7110   H  HG21 . THR C  2 25  ? 43.785  -21.517 6.644   1.00 0.00 ?  79  THR C HG21 1  
ATOM   7111   H  HG22 . THR C  2 25  ? 41.996  -21.859 6.189   1.00 0.00 ?  79  THR C HG22 1  
ATOM   7112   H  HG23 . THR C  2 25  ? 43.201  -21.223 5.044   1.00 0.00 ?  79  THR C HG23 1  
ATOM   7113   N  N    . GLU C  2 26  ? 46.372  -23.287 6.779   1.00 0.00 ?  80  GLU C N    1  
ATOM   7114   C  CA   . GLU C  2 26  ? 47.391  -22.670 7.621   1.00 0.00 ?  80  GLU C CA   1  
ATOM   7115   C  C    . GLU C  2 26  ? 48.653  -22.316 6.893   1.00 0.00 ?  80  GLU C C    1  
ATOM   7116   O  O    . GLU C  2 26  ? 49.191  -21.239 7.062   1.00 0.00 ?  80  GLU C O    1  
ATOM   7117   C  CB   . GLU C  2 26  ? 47.814  -23.673 8.829   1.00 0.00 ?  80  GLU C CB   1  
ATOM   7118   C  CG   . GLU C  2 26  ? 46.729  -23.889 9.886   1.00 0.00 ?  80  GLU C CG   1  
ATOM   7119   C  CD   . GLU C  2 26  ? 47.300  -24.110 11.321  1.00 0.00 ?  80  GLU C CD   1  
ATOM   7120   O  OE1  . GLU C  2 26  ? 48.078  -23.143 11.772  1.00 0.00 ?  80  GLU C OE1  1  
ATOM   7121   O  OE2  . GLU C  2 26  ? 47.019  -25.172 11.928  1.00 0.00 -1 80  GLU C OE2  1  
ATOM   7122   H  H    . GLU C  2 26  ? 46.145  -24.216 7.062   1.00 0.00 ?  80  GLU C H    1  
ATOM   7123   H  HA   . GLU C  2 26  ? 46.982  -21.757 8.027   1.00 0.00 ?  80  GLU C HA   1  
ATOM   7124   H  HB2  . GLU C  2 26  ? 48.187  -24.577 8.302   1.00 0.00 ?  80  GLU C HB2  1  
ATOM   7125   H  HB3  . GLU C  2 26  ? 48.699  -23.206 9.311   1.00 0.00 ?  80  GLU C HB3  1  
ATOM   7126   H  HG2  . GLU C  2 26  ? 46.102  -22.972 9.913   1.00 0.00 ?  80  GLU C HG2  1  
ATOM   7127   H  HG3  . GLU C  2 26  ? 46.129  -24.806 9.702   1.00 0.00 ?  80  GLU C HG3  1  
ATOM   7128   N  N    . GLY C  2 27  ? 49.119  -23.112 5.862   1.00 0.00 ?  81  GLY C N    1  
ATOM   7129   C  CA   . GLY C  2 27  ? 50.213  -22.765 4.952   1.00 0.00 ?  81  GLY C CA   1  
ATOM   7130   C  C    . GLY C  2 27  ? 49.889  -21.473 4.247   1.00 0.00 ?  81  GLY C C    1  
ATOM   7131   O  O    . GLY C  2 27  ? 50.731  -20.590 4.191   1.00 0.00 ?  81  GLY C O    1  
ATOM   7132   H  H    . GLY C  2 27  ? 48.639  -23.955 5.634   1.00 0.00 ?  81  GLY C H    1  
ATOM   7133   H  HA2  . GLY C  2 27  ? 51.125  -22.595 5.506   1.00 0.00 ?  81  GLY C HA2  1  
ATOM   7134   H  HA3  . GLY C  2 27  ? 50.279  -23.512 4.174   1.00 0.00 ?  81  GLY C HA3  1  
ATOM   7135   N  N    . LEU C  2 28  ? 48.703  -21.416 3.687   1.00 0.00 ?  82  LEU C N    1  
ATOM   7136   C  CA   . LEU C  2 28  ? 48.146  -20.302 3.018   1.00 0.00 ?  82  LEU C CA   1  
ATOM   7137   C  C    . LEU C  2 28  ? 47.977  -18.996 3.749   1.00 0.00 ?  82  LEU C C    1  
ATOM   7138   O  O    . LEU C  2 28  ? 48.471  -18.009 3.230   1.00 0.00 ?  82  LEU C O    1  
ATOM   7139   C  CB   . LEU C  2 28  ? 46.750  -20.756 2.293   1.00 0.00 ?  82  LEU C CB   1  
ATOM   7140   C  CG   . LEU C  2 28  ? 46.112  -19.642 1.456   1.00 0.00 ?  82  LEU C CG   1  
ATOM   7141   C  CD1  . LEU C  2 28  ? 46.984  -19.112 0.309   1.00 0.00 ?  82  LEU C CD1  1  
ATOM   7142   C  CD2  . LEU C  2 28  ? 44.775  -20.070 0.957   1.00 0.00 ?  82  LEU C CD2  1  
ATOM   7143   H  H    . LEU C  2 28  ? 48.113  -22.217 3.740   1.00 0.00 ?  82  LEU C H    1  
ATOM   7144   H  HA   . LEU C  2 28  ? 48.717  -20.104 2.123   1.00 0.00 ?  82  LEU C HA   1  
ATOM   7145   H  HB2  . LEU C  2 28  ? 46.882  -21.740 1.794   1.00 0.00 ?  82  LEU C HB2  1  
ATOM   7146   H  HB3  . LEU C  2 28  ? 46.119  -20.959 3.185   1.00 0.00 ?  82  LEU C HB3  1  
ATOM   7147   H  HG   . LEU C  2 28  ? 45.878  -18.768 2.102   1.00 0.00 ?  82  LEU C HG   1  
ATOM   7148   H  HD11 . LEU C  2 28  ? 47.377  -19.950 -0.306  1.00 0.00 ?  82  LEU C HD11 1  
ATOM   7149   H  HD12 . LEU C  2 28  ? 47.817  -18.551 0.784   1.00 0.00 ?  82  LEU C HD12 1  
ATOM   7150   H  HD13 . LEU C  2 28  ? 46.322  -18.515 -0.355  1.00 0.00 ?  82  LEU C HD13 1  
ATOM   7151   H  HD21 . LEU C  2 28  ? 44.044  -19.288 0.660   1.00 0.00 ?  82  LEU C HD21 1  
ATOM   7152   H  HD22 . LEU C  2 28  ? 44.266  -20.715 1.705   1.00 0.00 ?  82  LEU C HD22 1  
ATOM   7153   H  HD23 . LEU C  2 28  ? 44.844  -20.614 -0.009  1.00 0.00 ?  82  LEU C HD23 1  
ATOM   7154   N  N    . ARG C  2 29  ? 47.517  -19.005 5.037   1.00 0.00 ?  83  ARG C N    1  
ATOM   7155   C  CA   . ARG C  2 29  ? 47.430  -17.892 5.954   1.00 0.00 ?  83  ARG C CA   1  
ATOM   7156   C  C    . ARG C  2 29  ? 48.706  -17.213 6.231   1.00 0.00 ?  83  ARG C C    1  
ATOM   7157   O  O    . ARG C  2 29  ? 48.860  -15.958 6.080   1.00 0.00 ?  83  ARG C O    1  
ATOM   7158   C  CB   . ARG C  2 29  ? 46.761  -18.410 7.228   1.00 0.00 ?  83  ARG C CB   1  
ATOM   7159   C  CG   . ARG C  2 29  ? 46.471  -17.211 8.277   1.00 0.00 ?  83  ARG C CG   1  
ATOM   7160   C  CD   . ARG C  2 29  ? 45.910  -17.797 9.574   1.00 0.00 ?  83  ARG C CD   1  
ATOM   7161   N  NE   . ARG C  2 29  ? 47.016  -18.553 10.183  1.00 0.00 ?  83  ARG C NE   1  
ATOM   7162   C  CZ   . ARG C  2 29  ? 46.893  -19.710 10.769  1.00 0.00 ?  83  ARG C CZ   1  
ATOM   7163   N  NH1  . ARG C  2 29  ? 48.006  -20.409 11.044  1.00 0.00 1  83  ARG C NH1  1  
ATOM   7164   N  NH2  . ARG C  2 29  ? 45.718  -20.229 11.073  1.00 0.00 ?  83  ARG C NH2  1  
ATOM   7165   H  H    . ARG C  2 29  ? 47.292  -19.910 5.392   1.00 0.00 ?  83  ARG C H    1  
ATOM   7166   H  HA   . ARG C  2 29  ? 46.717  -17.278 5.424   1.00 0.00 ?  83  ARG C HA   1  
ATOM   7167   H  HB2  . ARG C  2 29  ? 45.770  -18.872 7.033   1.00 0.00 ?  83  ARG C HB2  1  
ATOM   7168   H  HB3  . ARG C  2 29  ? 47.357  -19.189 7.750   1.00 0.00 ?  83  ARG C HB3  1  
ATOM   7169   H  HG2  . ARG C  2 29  ? 47.348  -16.534 8.355   1.00 0.00 ?  83  ARG C HG2  1  
ATOM   7170   H  HG3  . ARG C  2 29  ? 45.679  -16.575 7.826   1.00 0.00 ?  83  ARG C HG3  1  
ATOM   7171   H  HD2  . ARG C  2 29  ? 45.625  -16.962 10.249  1.00 0.00 ?  83  ARG C HD2  1  
ATOM   7172   H  HD3  . ARG C  2 29  ? 44.961  -18.314 9.313   1.00 0.00 ?  83  ARG C HD3  1  
ATOM   7173   H  HE   . ARG C  2 29  ? 47.959  -18.228 10.115  1.00 0.00 ?  83  ARG C HE   1  
ATOM   7174   H  HH11 . ARG C  2 29  ? 48.872  -19.976 10.790  1.00 0.00 ?  83  ARG C HH11 1  
ATOM   7175   H  HH12 . ARG C  2 29  ? 47.931  -21.248 11.583  1.00 0.00 ?  83  ARG C HH12 1  
ATOM   7176   H  HH21 . ARG C  2 29  ? 44.889  -19.824 10.686  1.00 0.00 ?  83  ARG C HH21 1  
ATOM   7177   H  HH22 . ARG C  2 29  ? 45.677  -21.086 11.586  1.00 0.00 ?  83  ARG C HH22 1  
ATOM   7178   N  N    . GLN C  2 30  ? 49.732  -18.013 6.590   1.00 0.00 ?  84  GLN C N    1  
ATOM   7179   C  CA   . GLN C  2 30  ? 51.068  -17.510 6.821   1.00 0.00 ?  84  GLN C CA   1  
ATOM   7180   C  C    . GLN C  2 30  ? 51.674  -16.900 5.575   1.00 0.00 ?  84  GLN C C    1  
ATOM   7181   O  O    . GLN C  2 30  ? 52.198  -15.794 5.521   1.00 0.00 ?  84  GLN C O    1  
ATOM   7182   C  CB   . GLN C  2 30  ? 51.950  -18.656 7.405   1.00 0.00 ?  84  GLN C CB   1  
ATOM   7183   C  CG   . GLN C  2 30  ? 51.639  -19.230 8.833   1.00 0.00 ?  84  GLN C CG   1  
ATOM   7184   C  CD   . GLN C  2 30  ? 50.947  -18.168 9.739   1.00 0.00 ?  84  GLN C CD   1  
ATOM   7185   O  OE1  . GLN C  2 30  ? 49.756  -18.334 10.017  1.00 0.00 ?  84  GLN C OE1  1  
ATOM   7186   N  NE2  . GLN C  2 30  ? 51.685  -17.207 10.262  1.00 0.00 ?  84  GLN C NE2  1  
ATOM   7187   H  H    . GLN C  2 30  ? 49.586  -18.980 6.783   1.00 0.00 ?  84  GLN C H    1  
ATOM   7188   H  HA   . GLN C  2 30  ? 51.150  -16.726 7.559   1.00 0.00 ?  84  GLN C HA   1  
ATOM   7189   H  HB2  . GLN C  2 30  ? 52.009  -19.456 6.637   1.00 0.00 ?  84  GLN C HB2  1  
ATOM   7190   H  HB3  . GLN C  2 30  ? 53.033  -18.408 7.389   1.00 0.00 ?  84  GLN C HB3  1  
ATOM   7191   H  HG2  . GLN C  2 30  ? 50.882  -20.035 8.720   1.00 0.00 ?  84  GLN C HG2  1  
ATOM   7192   H  HG3  . GLN C  2 30  ? 52.574  -19.454 9.389   1.00 0.00 ?  84  GLN C HG3  1  
ATOM   7193   H  HE21 . GLN C  2 30  ? 51.176  -16.690 10.950  1.00 0.00 ?  84  GLN C HE21 1  
ATOM   7194   H  HE22 . GLN C  2 30  ? 52.565  -16.963 9.855   1.00 0.00 ?  84  GLN C HE22 1  
ATOM   7195   N  N    . GLU C  2 31  ? 51.476  -17.563 4.376   1.00 0.00 ?  85  GLU C N    1  
ATOM   7196   C  CA   . GLU C  2 31  ? 51.990  -17.002 3.140   1.00 0.00 ?  85  GLU C CA   1  
ATOM   7197   C  C    . GLU C  2 31  ? 51.421  -15.750 2.573   1.00 0.00 ?  85  GLU C C    1  
ATOM   7198   O  O    . GLU C  2 31  ? 52.129  -14.941 1.972   1.00 0.00 ?  85  GLU C O    1  
ATOM   7199   C  CB   . GLU C  2 31  ? 51.950  -18.072 2.073   1.00 0.00 ?  85  GLU C CB   1  
ATOM   7200   C  CG   . GLU C  2 31  ? 53.050  -19.190 2.291   1.00 0.00 ?  85  GLU C CG   1  
ATOM   7201   C  CD   . GLU C  2 31  ? 54.469  -18.749 2.434   1.00 0.00 ?  85  GLU C CD   1  
ATOM   7202   O  OE1  . GLU C  2 31  ? 54.997  -18.902 3.533   1.00 0.00 ?  85  GLU C OE1  1  
ATOM   7203   O  OE2  . GLU C  2 31  ? 55.006  -18.101 1.476   1.00 0.00 -1 85  GLU C OE2  1  
ATOM   7204   H  H    . GLU C  2 31  ? 51.280  -18.540 4.373   1.00 0.00 ?  85  GLU C H    1  
ATOM   7205   H  HA   . GLU C  2 31  ? 53.005  -16.679 3.316   1.00 0.00 ?  85  GLU C HA   1  
ATOM   7206   H  HB2  . GLU C  2 31  ? 50.914  -18.447 1.934   1.00 0.00 ?  85  GLU C HB2  1  
ATOM   7207   H  HB3  . GLU C  2 31  ? 52.128  -17.663 1.055   1.00 0.00 ?  85  GLU C HB3  1  
ATOM   7208   H  HG2  . GLU C  2 31  ? 52.760  -19.698 3.236   1.00 0.00 ?  85  GLU C HG2  1  
ATOM   7209   H  HG3  . GLU C  2 31  ? 53.060  -19.988 1.519   1.00 0.00 ?  85  GLU C HG3  1  
ATOM   7210   N  N    . MET C  2 32  ? 50.108  -15.540 2.787   1.00 0.00 ?  86  MET C N    1  
ATOM   7211   C  CA   . MET C  2 32  ? 49.381  -14.321 2.629   1.00 0.00 ?  86  MET C CA   1  
ATOM   7212   C  C    . MET C  2 32  ? 49.883  -13.320 3.639   1.00 0.00 ?  86  MET C C    1  
ATOM   7213   O  O    . MET C  2 32  ? 50.068  -12.179 3.323   1.00 0.00 ?  86  MET C O    1  
ATOM   7214   C  CB   . MET C  2 32  ? 47.903  -14.599 2.841   1.00 0.00 ?  86  MET C CB   1  
ATOM   7215   C  CG   . MET C  2 32  ? 47.274  -15.408 1.659   1.00 0.00 ?  86  MET C CG   1  
ATOM   7216   S  SD   . MET C  2 32  ? 46.619  -14.413 0.357   1.00 0.00 ?  86  MET C SD   1  
ATOM   7217   C  CE   . MET C  2 32  ? 45.254  -15.518 -0.111  1.00 0.00 ?  86  MET C CE   1  
ATOM   7218   H  H    . MET C  2 32  ? 49.555  -16.331 3.036   1.00 0.00 ?  86  MET C H    1  
ATOM   7219   H  HA   . MET C  2 32  ? 49.538  -14.155 1.573   1.00 0.00 ?  86  MET C HA   1  
ATOM   7220   H  HB2  . MET C  2 32  ? 47.769  -15.081 3.833   1.00 0.00 ?  86  MET C HB2  1  
ATOM   7221   H  HB3  . MET C  2 32  ? 47.346  -13.649 2.983   1.00 0.00 ?  86  MET C HB3  1  
ATOM   7222   H  HG2  . MET C  2 32  ? 47.792  -16.320 1.292   1.00 0.00 ?  86  MET C HG2  1  
ATOM   7223   H  HG3  . MET C  2 32  ? 46.331  -15.854 2.042   1.00 0.00 ?  86  MET C HG3  1  
ATOM   7224   H  HE1  . MET C  2 32  ? 44.672  -15.818 0.787   1.00 0.00 ?  86  MET C HE1  1  
ATOM   7225   H  HE2  . MET C  2 32  ? 45.654  -16.439 -0.586  1.00 0.00 ?  86  MET C HE2  1  
ATOM   7226   H  HE3  . MET C  2 32  ? 44.530  -14.987 -0.765  1.00 0.00 ?  86  MET C HE3  1  
ATOM   7227   N  N    . SER C  2 33  ? 50.114  -13.697 4.865   1.00 0.00 ?  87  SER C N    1  
ATOM   7228   C  CA   . SER C  2 33  ? 50.440  -12.695 5.903   1.00 0.00 ?  87  SER C CA   1  
ATOM   7229   C  C    . SER C  2 33  ? 51.843  -12.108 5.836   1.00 0.00 ?  87  SER C C    1  
ATOM   7230   O  O    . SER C  2 33  ? 52.099  -10.894 6.051   1.00 0.00 ?  87  SER C O    1  
ATOM   7231   C  CB   . SER C  2 33  ? 50.412  -13.325 7.256   1.00 0.00 ?  87  SER C CB   1  
ATOM   7232   O  OG   . SER C  2 33  ? 50.538  -12.479 8.340   1.00 0.00 ?  87  SER C OG   1  
ATOM   7233   H  H    . SER C  2 33  ? 49.939  -14.602 5.244   1.00 0.00 ?  87  SER C H    1  
ATOM   7234   H  HA   . SER C  2 33  ? 49.712  -11.899 5.955   1.00 0.00 ?  87  SER C HA   1  
ATOM   7235   H  HB2  . SER C  2 33  ? 49.449  -13.861 7.398   1.00 0.00 ?  87  SER C HB2  1  
ATOM   7236   H  HB3  . SER C  2 33  ? 51.088  -14.203 7.342   1.00 0.00 ?  87  SER C HB3  1  
ATOM   7237   H  HG   . SER C  2 33  ? 50.161  -12.967 9.076   1.00 0.00 ?  87  SER C HG   1  
ATOM   7238   N  N    . LYS C  2 34  ? 52.787  -12.895 5.372   1.00 0.00 ?  88  LYS C N    1  
ATOM   7239   C  CA   . LYS C  2 34  ? 54.075  -12.497 4.933   1.00 0.00 ?  88  LYS C CA   1  
ATOM   7240   C  C    . LYS C  2 34  ? 54.073  -11.415 3.795   1.00 0.00 ?  88  LYS C C    1  
ATOM   7241   O  O    . LYS C  2 34  ? 54.755  -10.425 3.934   1.00 0.00 ?  88  LYS C O    1  
ATOM   7242   C  CB   . LYS C  2 34  ? 54.750  -13.769 4.480   1.00 0.00 ?  88  LYS C CB   1  
ATOM   7243   C  CG   . LYS C  2 34  ? 55.385  -14.622 5.582   1.00 0.00 ?  88  LYS C CG   1  
ATOM   7244   C  CD   . LYS C  2 34  ? 55.820  -15.979 5.078   1.00 0.00 ?  88  LYS C CD   1  
ATOM   7245   C  CE   . LYS C  2 34  ? 56.817  -15.994 3.903   1.00 0.00 ?  88  LYS C CE   1  
ATOM   7246   N  NZ   . LYS C  2 34  ? 57.196  -17.379 3.499   1.00 0.00 1  88  LYS C NZ   1  
ATOM   7247   H  H    . LYS C  2 34  ? 52.587  -13.855 5.195   1.00 0.00 ?  88  LYS C H    1  
ATOM   7248   H  HA   . LYS C  2 34  ? 54.572  -12.121 5.815   1.00 0.00 ?  88  LYS C HA   1  
ATOM   7249   H  HB2  . LYS C  2 34  ? 54.121  -14.410 3.825   1.00 0.00 ?  88  LYS C HB2  1  
ATOM   7250   H  HB3  . LYS C  2 34  ? 55.652  -13.564 3.864   1.00 0.00 ?  88  LYS C HB3  1  
ATOM   7251   H  HG2  . LYS C  2 34  ? 56.246  -14.119 6.072   1.00 0.00 ?  88  LYS C HG2  1  
ATOM   7252   H  HG3  . LYS C  2 34  ? 54.651  -14.845 6.386   1.00 0.00 ?  88  LYS C HG3  1  
ATOM   7253   H  HD2  . LYS C  2 34  ? 56.339  -16.541 5.884   1.00 0.00 ?  88  LYS C HD2  1  
ATOM   7254   H  HD3  . LYS C  2 34  ? 54.895  -16.556 4.860   1.00 0.00 ?  88  LYS C HD3  1  
ATOM   7255   H  HE2  . LYS C  2 34  ? 56.313  -15.519 3.035   1.00 0.00 ?  88  LYS C HE2  1  
ATOM   7256   H  HE3  . LYS C  2 34  ? 57.741  -15.439 4.172   1.00 0.00 ?  88  LYS C HE3  1  
ATOM   7257   H  HZ1  . LYS C  2 34  ? 57.989  -17.757 4.056   1.00 0.00 ?  88  LYS C HZ1  1  
ATOM   7258   H  HZ2  . LYS C  2 34  ? 57.511  -17.316 2.510   1.00 0.00 ?  88  LYS C HZ2  1  
ATOM   7259   H  HZ3  . LYS C  2 34  ? 56.349  -17.983 3.501   1.00 0.00 ?  88  LYS C HZ3  1  
ATOM   7260   N  N    . ASP C  2 35  ? 53.237  -11.523 2.787   1.00 0.00 ?  89  ASP C N    1  
ATOM   7261   C  CA   . ASP C  2 35  ? 53.066  -10.554 1.653   1.00 0.00 ?  89  ASP C CA   1  
ATOM   7262   C  C    . ASP C  2 35  ? 52.093  -9.408  2.034   1.00 0.00 ?  89  ASP C C    1  
ATOM   7263   O  O    . ASP C  2 35  ? 52.305  -8.304  1.531   1.00 0.00 ?  89  ASP C O    1  
ATOM   7264   C  CB   . ASP C  2 35  ? 52.629  -11.330 0.395   1.00 0.00 ?  89  ASP C CB   1  
ATOM   7265   C  CG   . ASP C  2 35  ? 53.766  -12.145 -0.208  1.00 0.00 ?  89  ASP C CG   1  
ATOM   7266   O  OD1  . ASP C  2 35  ? 54.941  -11.949 0.189   1.00 0.00 ?  89  ASP C OD1  1  
ATOM   7267   O  OD2  . ASP C  2 35  ? 53.564  -12.931 -1.198  1.00 0.00 -1 89  ASP C OD2  1  
ATOM   7268   H  H    . ASP C  2 35  ? 52.647  -12.325 2.746   1.00 0.00 ?  89  ASP C H    1  
ATOM   7269   H  HA   . ASP C  2 35  ? 53.951  -9.961  1.479   1.00 0.00 ?  89  ASP C HA   1  
ATOM   7270   H  HB2  . ASP C  2 35  ? 51.878  -12.122 0.600   1.00 0.00 ?  89  ASP C HB2  1  
ATOM   7271   H  HB3  . ASP C  2 35  ? 52.244  -10.625 -0.373  1.00 0.00 ?  89  ASP C HB3  1  
ATOM   7272   N  N    . LEU C  2 36  ? 51.136  -9.540  2.981   1.00 0.00 ?  90  LEU C N    1  
ATOM   7273   C  CA   . LEU C  2 36  ? 50.411  -8.383  3.504   1.00 0.00 ?  90  LEU C CA   1  
ATOM   7274   C  C    . LEU C  2 36  ? 51.317  -7.606  4.394   1.00 0.00 ?  90  LEU C C    1  
ATOM   7275   O  O    . LEU C  2 36  ? 51.230  -6.345  4.290   1.00 0.00 ?  90  LEU C O    1  
ATOM   7276   C  CB   . LEU C  2 36  ? 49.144  -8.751  4.235   1.00 0.00 ?  90  LEU C CB   1  
ATOM   7277   C  CG   . LEU C  2 36  ? 48.058  -9.380  3.316   1.00 0.00 ?  90  LEU C CG   1  
ATOM   7278   C  CD1  . LEU C  2 36  ? 47.058  -10.244 4.108   1.00 0.00 ?  90  LEU C CD1  1  
ATOM   7279   C  CD2  . LEU C  2 36  ? 47.307  -8.377  2.425   1.00 0.00 ?  90  LEU C CD2  1  
ATOM   7280   H  H    . LEU C  2 36  ? 50.914  -10.470 3.264   1.00 0.00 ?  90  LEU C H    1  
ATOM   7281   H  HA   . LEU C  2 36  ? 50.255  -7.672  2.706   1.00 0.00 ?  90  LEU C HA   1  
ATOM   7282   H  HB2  . LEU C  2 36  ? 49.353  -9.450  5.073   1.00 0.00 ?  90  LEU C HB2  1  
ATOM   7283   H  HB3  . LEU C  2 36  ? 48.808  -7.876  4.832   1.00 0.00 ?  90  LEU C HB3  1  
ATOM   7284   H  HG   . LEU C  2 36  ? 48.577  -10.135 2.688   1.00 0.00 ?  90  LEU C HG   1  
ATOM   7285   H  HD11 . LEU C  2 36  ? 46.361  -9.674  4.758   1.00 0.00 ?  90  LEU C HD11 1  
ATOM   7286   H  HD12 . LEU C  2 36  ? 47.669  -10.903 4.761   1.00 0.00 ?  90  LEU C HD12 1  
ATOM   7287   H  HD13 . LEU C  2 36  ? 46.376  -10.791 3.421   1.00 0.00 ?  90  LEU C HD13 1  
ATOM   7288   H  HD21 . LEU C  2 36  ? 47.108  -7.460  3.018   1.00 0.00 ?  90  LEU C HD21 1  
ATOM   7289   H  HD22 . LEU C  2 36  ? 46.407  -8.751  1.892   1.00 0.00 ?  90  LEU C HD22 1  
ATOM   7290   H  HD23 . LEU C  2 36  ? 47.917  -8.154  1.524   1.00 0.00 ?  90  LEU C HD23 1  
ATOM   7291   N  N    . GLU C  2 37  ? 52.195  -8.163  5.212   1.00 0.00 ?  91  GLU C N    1  
ATOM   7292   C  CA   . GLU C  2 37  ? 53.227  -7.393  5.951   1.00 0.00 ?  91  GLU C CA   1  
ATOM   7293   C  C    . GLU C  2 37  ? 54.192  -6.631  5.102   1.00 0.00 ?  91  GLU C C    1  
ATOM   7294   O  O    . GLU C  2 37  ? 54.584  -5.502  5.378   1.00 0.00 ?  91  GLU C O    1  
ATOM   7295   C  CB   . GLU C  2 37  ? 54.049  -8.296  6.863   1.00 0.00 ?  91  GLU C CB   1  
ATOM   7296   C  CG   . GLU C  2 37  ? 55.256  -7.665  7.590   1.00 0.00 ?  91  GLU C CG   1  
ATOM   7297   C  CD   . GLU C  2 37  ? 56.051  -8.745  8.266   1.00 0.00 ?  91  GLU C CD   1  
ATOM   7298   O  OE1  . GLU C  2 37  ? 56.197  -8.791  9.509   1.00 0.00 ?  91  GLU C OE1  1  
ATOM   7299   O  OE2  . GLU C  2 37  ? 56.718  -9.459  7.466   1.00 0.00 -1 91  GLU C OE2  1  
ATOM   7300   H  H    . GLU C  2 37  ? 52.225  -9.160  5.220   1.00 0.00 ?  91  GLU C H    1  
ATOM   7301   H  HA   . GLU C  2 37  ? 52.736  -6.611  6.511   1.00 0.00 ?  91  GLU C HA   1  
ATOM   7302   H  HB2  . GLU C  2 37  ? 53.361  -8.654  7.659   1.00 0.00 ?  91  GLU C HB2  1  
ATOM   7303   H  HB3  . GLU C  2 37  ? 54.435  -9.131  6.241   1.00 0.00 ?  91  GLU C HB3  1  
ATOM   7304   H  HG2  . GLU C  2 37  ? 56.026  -7.197  6.940   1.00 0.00 ?  91  GLU C HG2  1  
ATOM   7305   H  HG3  . GLU C  2 37  ? 54.893  -6.972  8.379   1.00 0.00 ?  91  GLU C HG3  1  
ATOM   7306   N  N    . GLU C  2 38  ? 54.678  -7.214  4.014   1.00 0.00 ?  92  GLU C N    1  
ATOM   7307   C  CA   . GLU C  2 38  ? 55.577  -6.659  3.100   1.00 0.00 ?  92  GLU C CA   1  
ATOM   7308   C  C    . GLU C  2 38  ? 55.106  -5.402  2.328   1.00 0.00 ?  92  GLU C C    1  
ATOM   7309   O  O    . GLU C  2 38  ? 55.751  -4.326  2.238   1.00 0.00 ?  92  GLU C O    1  
ATOM   7310   C  CB   . GLU C  2 38  ? 55.963  -7.707  2.003   1.00 0.00 ?  92  GLU C CB   1  
ATOM   7311   C  CG   . GLU C  2 38  ? 57.088  -7.234  1.088   1.00 0.00 ?  92  GLU C CG   1  
ATOM   7312   C  CD   . GLU C  2 38  ? 57.783  -8.394  0.498   1.00 0.00 ?  92  GLU C CD   1  
ATOM   7313   O  OE1  . GLU C  2 38  ? 57.895  -8.563  -0.761  1.00 0.00 ?  92  GLU C OE1  1  
ATOM   7314   O  OE2  . GLU C  2 38  ? 58.309  -9.221  1.247   1.00 0.00 -1 92  GLU C OE2  1  
ATOM   7315   H  H    . GLU C  2 38  ? 54.450  -8.184  3.967   1.00 0.00 ?  92  GLU C H    1  
ATOM   7316   H  HA   . GLU C  2 38  ? 56.490  -6.430  3.631   1.00 0.00 ?  92  GLU C HA   1  
ATOM   7317   H  HB2  . GLU C  2 38  ? 56.379  -8.581  2.549   1.00 0.00 ?  92  GLU C HB2  1  
ATOM   7318   H  HB3  . GLU C  2 38  ? 55.051  -7.988  1.433   1.00 0.00 ?  92  GLU C HB3  1  
ATOM   7319   H  HG2  . GLU C  2 38  ? 56.708  -6.463  0.383   1.00 0.00 ?  92  GLU C HG2  1  
ATOM   7320   H  HG3  . GLU C  2 38  ? 57.873  -6.734  1.694   1.00 0.00 ?  92  GLU C HG3  1  
ATOM   7321   N  N    . VAL C  2 39  ? 53.814  -5.421  1.834   1.00 0.00 ?  93  VAL C N    1  
ATOM   7322   C  CA   . VAL C  2 39  ? 53.160  -4.234  1.248   1.00 0.00 ?  93  VAL C CA   1  
ATOM   7323   C  C    . VAL C  2 39  ? 52.740  -3.207  2.228   1.00 0.00 ?  93  VAL C C    1  
ATOM   7324   O  O    . VAL C  2 39  ? 52.675  -2.037  1.968   1.00 0.00 ?  93  VAL C O    1  
ATOM   7325   C  CB   . VAL C  2 39  ? 51.972  -4.675  0.338   1.00 0.00 ?  93  VAL C CB   1  
ATOM   7326   C  CG1  . VAL C  2 39  ? 51.224  -3.521  -0.392  1.00 0.00 ?  93  VAL C CG1  1  
ATOM   7327   C  CG2  . VAL C  2 39  ? 52.490  -5.565  -0.791  1.00 0.00 ?  93  VAL C CG2  1  
ATOM   7328   H  H    . VAL C  2 39  ? 53.343  -6.297  1.906   1.00 0.00 ?  93  VAL C H    1  
ATOM   7329   H  HA   . VAL C  2 39  ? 53.922  -3.814  0.607   1.00 0.00 ?  93  VAL C HA   1  
ATOM   7330   H  HB   . VAL C  2 39  ? 51.229  -5.256  0.925   1.00 0.00 ?  93  VAL C HB   1  
ATOM   7331   H  HG11 . VAL C  2 39  ? 50.552  -3.851  -1.213  1.00 0.00 ?  93  VAL C HG11 1  
ATOM   7332   H  HG12 . VAL C  2 39  ? 51.918  -2.728  -0.745  1.00 0.00 ?  93  VAL C HG12 1  
ATOM   7333   H  HG13 . VAL C  2 39  ? 50.587  -3.017  0.365   1.00 0.00 ?  93  VAL C HG13 1  
ATOM   7334   H  HG21 . VAL C  2 39  ? 52.857  -6.576  -0.513  1.00 0.00 ?  93  VAL C HG21 1  
ATOM   7335   H  HG22 . VAL C  2 39  ? 53.291  -5.100  -1.404  1.00 0.00 ?  93  VAL C HG22 1  
ATOM   7336   H  HG23 . VAL C  2 39  ? 51.644  -5.732  -1.491  1.00 0.00 ?  93  VAL C HG23 1  
ATOM   7337   N  N    . LYS C  2 40  ? 52.433  -3.595  3.509   1.00 0.00 ?  94  LYS C N    1  
ATOM   7338   C  CA   . LYS C  2 40  ? 52.232  -2.632  4.554   1.00 0.00 ?  94  LYS C CA   1  
ATOM   7339   C  C    . LYS C  2 40  ? 53.535  -1.898  4.867   1.00 0.00 ?  94  LYS C C    1  
ATOM   7340   O  O    . LYS C  2 40  ? 53.541  -0.681  5.087   1.00 0.00 ?  94  LYS C O    1  
ATOM   7341   C  CB   . LYS C  2 40  ? 51.662  -3.244  5.833   1.00 0.00 ?  94  LYS C CB   1  
ATOM   7342   C  CG   . LYS C  2 40  ? 51.535  -2.234  7.027   1.00 0.00 ?  94  LYS C CG   1  
ATOM   7343   C  CD   . LYS C  2 40  ? 50.455  -2.824  7.981   1.00 0.00 ?  94  LYS C CD   1  
ATOM   7344   C  CE   . LYS C  2 40  ? 50.765  -4.246  8.498   1.00 0.00 ?  94  LYS C CE   1  
ATOM   7345   N  NZ   . LYS C  2 40  ? 49.957  -4.695  9.597   1.00 0.00 1  94  LYS C NZ   1  
ATOM   7346   H  H    . LYS C  2 40  ? 52.603  -4.478  3.939   1.00 0.00 ?  94  LYS C H    1  
ATOM   7347   H  HA   . LYS C  2 40  ? 51.582  -1.876  4.138   1.00 0.00 ?  94  LYS C HA   1  
ATOM   7348   H  HB2  . LYS C  2 40  ? 50.683  -3.737  5.648   1.00 0.00 ?  94  LYS C HB2  1  
ATOM   7349   H  HB3  . LYS C  2 40  ? 52.408  -4.006  6.143   1.00 0.00 ?  94  LYS C HB3  1  
ATOM   7350   H  HG2  . LYS C  2 40  ? 52.479  -1.978  7.552   1.00 0.00 ?  94  LYS C HG2  1  
ATOM   7351   H  HG3  . LYS C  2 40  ? 51.182  -1.286  6.569   1.00 0.00 ?  94  LYS C HG3  1  
ATOM   7352   H  HD2  . LYS C  2 40  ? 50.420  -2.108  8.830   1.00 0.00 ?  94  LYS C HD2  1  
ATOM   7353   H  HD3  . LYS C  2 40  ? 49.450  -2.824  7.508   1.00 0.00 ?  94  LYS C HD3  1  
ATOM   7354   H  HE2  . LYS C  2 40  ? 50.708  -5.052  7.736   1.00 0.00 ?  94  LYS C HE2  1  
ATOM   7355   H  HE3  . LYS C  2 40  ? 51.827  -4.272  8.826   1.00 0.00 ?  94  LYS C HE3  1  
ATOM   7356   H  HZ1  . LYS C  2 40  ? 50.468  -4.335  10.428  1.00 0.00 ?  94  LYS C HZ1  1  
ATOM   7357   H  HZ2  . LYS C  2 40  ? 49.833  -5.713  9.770   1.00 0.00 ?  94  LYS C HZ2  1  
ATOM   7358   H  HZ3  . LYS C  2 40  ? 49.028  -4.251  9.743   1.00 0.00 ?  94  LYS C HZ3  1  
ATOM   7359   N  N    . ALA C  2 41  ? 54.644  -2.617  4.819   1.00 0.00 ?  95  ALA C N    1  
ATOM   7360   C  CA   . ALA C  2 41  ? 55.934  -1.979  4.975   1.00 0.00 ?  95  ALA C CA   1  
ATOM   7361   C  C    . ALA C  2 41  ? 56.332  -1.047  3.874   1.00 0.00 ?  95  ALA C C    1  
ATOM   7362   O  O    . ALA C  2 41  ? 56.829  0.066   4.067   1.00 0.00 ?  95  ALA C O    1  
ATOM   7363   C  CB   . ALA C  2 41  ? 57.029  -3.030  5.060   1.00 0.00 ?  95  ALA C CB   1  
ATOM   7364   H  H    . ALA C  2 41  ? 54.614  -3.606  4.698   1.00 0.00 ?  95  ALA C H    1  
ATOM   7365   H  HA   . ALA C  2 41  ? 55.962  -1.472  5.928   1.00 0.00 ?  95  ALA C HA   1  
ATOM   7366   H  HB1  . ALA C  2 41  ? 58.047  -2.586  5.104   1.00 0.00 ?  95  ALA C HB1  1  
ATOM   7367   H  HB2  . ALA C  2 41  ? 57.089  -3.842  4.304   1.00 0.00 ?  95  ALA C HB2  1  
ATOM   7368   H  HB3  . ALA C  2 41  ? 56.934  -3.710  5.933   1.00 0.00 ?  95  ALA C HB3  1  
ATOM   7369   N  N    . LYS C  2 42  ? 56.010  -1.321  2.621   1.00 0.00 ?  96  LYS C N    1  
ATOM   7370   C  CA   . LYS C  2 42  ? 56.240  -0.384  1.499   1.00 0.00 ?  96  LYS C CA   1  
ATOM   7371   C  C    . LYS C  2 42  ? 55.344  0.954   1.483   1.00 0.00 ?  96  LYS C C    1  
ATOM   7372   O  O    . LYS C  2 42  ? 55.693  2.020   0.978   1.00 0.00 ?  96  LYS C O    1  
ATOM   7373   C  CB   . LYS C  2 42  ? 55.988  -1.073  0.118   1.00 0.00 ?  96  LYS C CB   1  
ATOM   7374   C  CG   . LYS C  2 42  ? 57.082  -2.096  -0.341  1.00 0.00 ?  96  LYS C CG   1  
ATOM   7375   C  CD   . LYS C  2 42  ? 57.009  -2.571  -1.821  1.00 0.00 ?  96  LYS C CD   1  
ATOM   7376   C  CE   . LYS C  2 42  ? 57.435  -1.438  -2.759  1.00 0.00 ?  96  LYS C CE   1  
ATOM   7377   N  NZ   . LYS C  2 42  ? 57.483  -1.796  -4.189  1.00 0.00 1  96  LYS C NZ   1  
ATOM   7378   H  H    . LYS C  2 42  ? 55.616  -2.211  2.406   1.00 0.00 ?  96  LYS C H    1  
ATOM   7379   H  HA   . LYS C  2 42  ? 57.260  -0.031  1.470   1.00 0.00 ?  96  LYS C HA   1  
ATOM   7380   H  HB2  . LYS C  2 42  ? 54.948  -1.423  -0.055  1.00 0.00 ?  96  LYS C HB2  1  
ATOM   7381   H  HB3  . LYS C  2 42  ? 56.189  -0.378  -0.725  1.00 0.00 ?  96  LYS C HB3  1  
ATOM   7382   H  HG2  . LYS C  2 42  ? 58.090  -1.648  -0.204  1.00 0.00 ?  96  LYS C HG2  1  
ATOM   7383   H  HG3  . LYS C  2 42  ? 57.023  -2.957  0.358   1.00 0.00 ?  96  LYS C HG3  1  
ATOM   7384   H  HD2  . LYS C  2 42  ? 57.792  -3.348  -1.944  1.00 0.00 ?  96  LYS C HD2  1  
ATOM   7385   H  HD3  . LYS C  2 42  ? 55.987  -3.001  -1.887  1.00 0.00 ?  96  LYS C HD3  1  
ATOM   7386   H  HE2  . LYS C  2 42  ? 56.710  -0.602  -2.663  1.00 0.00 ?  96  LYS C HE2  1  
ATOM   7387   H  HE3  . LYS C  2 42  ? 58.448  -1.045  -2.524  1.00 0.00 ?  96  LYS C HE3  1  
ATOM   7388   H  HZ1  . LYS C  2 42  ? 57.772  -2.785  -4.327  1.00 0.00 ?  96  LYS C HZ1  1  
ATOM   7389   H  HZ2  . LYS C  2 42  ? 58.251  -1.205  -4.566  1.00 0.00 ?  96  LYS C HZ2  1  
ATOM   7390   H  HZ3  . LYS C  2 42  ? 56.601  -1.496  -4.652  1.00 0.00 ?  96  LYS C HZ3  1  
ATOM   7391   N  N    . VAL C  2 43  ? 54.113  0.744   1.846   1.00 0.00 ?  97  VAL C N    1  
ATOM   7392   C  CA   . VAL C  2 43  ? 53.097  1.796   1.736   1.00 0.00 ?  97  VAL C CA   1  
ATOM   7393   C  C    . VAL C  2 43  ? 53.325  2.818   2.886   1.00 0.00 ?  97  VAL C C    1  
ATOM   7394   O  O    . VAL C  2 43  ? 53.110  4.016   2.617   1.00 0.00 ?  97  VAL C O    1  
ATOM   7395   C  CB   . VAL C  2 43  ? 51.654  1.184   1.709   1.00 0.00 ?  97  VAL C CB   1  
ATOM   7396   C  CG1  . VAL C  2 43  ? 50.445  2.155   1.838   1.00 0.00 ?  97  VAL C CG1  1  
ATOM   7397   C  CG2  . VAL C  2 43  ? 51.551  0.457   0.365   1.00 0.00 ?  97  VAL C CG2  1  
ATOM   7398   H  H    . VAL C  2 43  ? 53.893  -0.193  2.107   1.00 0.00 ?  97  VAL C H    1  
ATOM   7399   H  HA   . VAL C  2 43  ? 53.232  2.345   0.816   1.00 0.00 ?  97  VAL C HA   1  
ATOM   7400   H  HB   . VAL C  2 43  ? 51.753  0.515   2.590   1.00 0.00 ?  97  VAL C HB   1  
ATOM   7401   H  HG11 . VAL C  2 43  ? 49.569  1.610   1.426   1.00 0.00 ?  97  VAL C HG11 1  
ATOM   7402   H  HG12 . VAL C  2 43  ? 50.569  3.076   1.229   1.00 0.00 ?  97  VAL C HG12 1  
ATOM   7403   H  HG13 . VAL C  2 43  ? 50.229  2.450   2.887   1.00 0.00 ?  97  VAL C HG13 1  
ATOM   7404   H  HG21 . VAL C  2 43  ? 51.516  1.153   -0.500  1.00 0.00 ?  97  VAL C HG21 1  
ATOM   7405   H  HG22 . VAL C  2 43  ? 50.548  -0.020  0.357   1.00 0.00 ?  97  VAL C HG22 1  
ATOM   7406   H  HG23 . VAL C  2 43  ? 52.380  -0.278  0.289   1.00 0.00 ?  97  VAL C HG23 1  
ATOM   7407   N  N    . GLN C  2 44  ? 53.721  2.541   4.145   1.00 0.00 ?  98  GLN C N    1  
ATOM   7408   C  CA   . GLN C  2 44  ? 53.725  3.501   5.157   1.00 0.00 ?  98  GLN C CA   1  
ATOM   7409   C  C    . GLN C  2 44  ? 54.618  4.774   5.055   1.00 0.00 ?  98  GLN C C    1  
ATOM   7410   O  O    . GLN C  2 44  ? 54.162  5.818   5.544   1.00 0.00 ?  98  GLN C O    1  
ATOM   7411   C  CB   . GLN C  2 44  ? 53.995  2.684   6.441   1.00 0.00 ?  98  GLN C CB   1  
ATOM   7412   C  CG   . GLN C  2 44  ? 52.712  1.900   6.888   1.00 0.00 ?  98  GLN C CG   1  
ATOM   7413   C  CD   . GLN C  2 44  ? 52.843  0.975   8.080   1.00 0.00 ?  98  GLN C CD   1  
ATOM   7414   O  OE1  . GLN C  2 44  ? 51.820  0.479   8.540   1.00 0.00 ?  98  GLN C OE1  1  
ATOM   7415   N  NE2  . GLN C  2 44  ? 54.041  0.712   8.697   1.00 0.00 ?  98  GLN C NE2  1  
ATOM   7416   H  H    . GLN C  2 44  ? 53.877  1.578   4.348   1.00 0.00 ?  98  GLN C H    1  
ATOM   7417   H  HA   . GLN C  2 44  ? 52.698  3.819   5.263   1.00 0.00 ?  98  GLN C HA   1  
ATOM   7418   H  HB2  . GLN C  2 44  ? 54.842  1.966   6.397   1.00 0.00 ?  98  GLN C HB2  1  
ATOM   7419   H  HB3  . GLN C  2 44  ? 54.090  3.437   7.253   1.00 0.00 ?  98  GLN C HB3  1  
ATOM   7420   H  HG2  . GLN C  2 44  ? 51.939  2.637   7.193   1.00 0.00 ?  98  GLN C HG2  1  
ATOM   7421   H  HG3  . GLN C  2 44  ? 52.278  1.313   6.050   1.00 0.00 ?  98  GLN C HG3  1  
ATOM   7422   H  HE21 . GLN C  2 44  ? 54.873  1.174   8.390   1.00 0.00 ?  98  GLN C HE21 1  
ATOM   7423   H  HE22 . GLN C  2 44  ? 53.975  0.047   9.441   1.00 0.00 ?  98  GLN C HE22 1  
ATOM   7424   N  N    . PRO C  2 45  ? 55.827  4.830   4.575   1.00 0.00 ?  99  PRO C N    1  
ATOM   7425   C  CA   . PRO C  2 45  ? 56.564  6.049   4.434   1.00 0.00 ?  99  PRO C CA   1  
ATOM   7426   C  C    . PRO C  2 45  ? 56.005  7.043   3.530   1.00 0.00 ?  99  PRO C C    1  
ATOM   7427   O  O    . PRO C  2 45  ? 55.437  6.706   2.554   1.00 0.00 ?  99  PRO C O    1  
ATOM   7428   C  CB   . PRO C  2 45  ? 57.964  5.609   3.971   1.00 0.00 ?  99  PRO C CB   1  
ATOM   7429   C  CG   . PRO C  2 45  ? 58.109  4.278   4.621   1.00 0.00 ?  99  PRO C CG   1  
ATOM   7430   C  CD   . PRO C  2 45  ? 56.685  3.650   4.547   1.00 0.00 ?  99  PRO C CD   1  
ATOM   7431   H  HA   . PRO C  2 45  ? 56.595  6.592   5.367   1.00 0.00 ?  99  PRO C HA   1  
ATOM   7432   H  HB2  . PRO C  2 45  ? 57.999  5.705   2.864   1.00 0.00 ?  99  PRO C HB2  1  
ATOM   7433   H  HB3  . PRO C  2 45  ? 58.832  6.174   4.374   1.00 0.00 ?  99  PRO C HB3  1  
ATOM   7434   H  HG2  . PRO C  2 45  ? 58.872  3.631   4.137   1.00 0.00 ?  99  PRO C HG2  1  
ATOM   7435   H  HG3  . PRO C  2 45  ? 58.431  4.374   5.680   1.00 0.00 ?  99  PRO C HG3  1  
ATOM   7436   H  HD2  . PRO C  2 45  ? 56.432  3.143   3.591   1.00 0.00 ?  99  PRO C HD2  1  
ATOM   7437   H  HD3  . PRO C  2 45  ? 56.551  3.034   5.462   1.00 0.00 ?  99  PRO C HD3  1  
ATOM   7438   N  N    . TYR C  2 46  ? 56.193  8.323   3.940   1.00 0.00 ?  100 TYR C N    1  
ATOM   7439   C  CA   . TYR C  2 46  ? 55.587  9.551   3.270   1.00 0.00 ?  100 TYR C CA   1  
ATOM   7440   C  C    . TYR C  2 46  ? 54.086  9.685   3.614   1.00 0.00 ?  100 TYR C C    1  
ATOM   7441   O  O    . TYR C  2 46  ? 53.688  10.867  3.672   1.00 0.00 ?  100 TYR C O    1  
ATOM   7442   C  CB   . TYR C  2 46  ? 55.866  9.579   1.707   1.00 0.00 ?  100 TYR C CB   1  
ATOM   7443   C  CG   . TYR C  2 46  ? 55.163  10.636  0.918   1.00 0.00 ?  100 TYR C CG   1  
ATOM   7444   C  CD1  . TYR C  2 46  ? 53.953  10.542  0.152   1.00 0.00 ?  100 TYR C CD1  1  
ATOM   7445   C  CD2  . TYR C  2 46  ? 55.741  11.903  1.073   1.00 0.00 ?  100 TYR C CD2  1  
ATOM   7446   C  CE1  . TYR C  2 46  ? 53.302  11.713  -0.307  1.00 0.00 ?  100 TYR C CE1  1  
ATOM   7447   C  CE2  . TYR C  2 46  ? 55.213  13.054  0.504   1.00 0.00 ?  100 TYR C CE2  1  
ATOM   7448   C  CZ   . TYR C  2 46  ? 53.923  12.970  -0.199  1.00 0.00 ?  100 TYR C CZ   1  
ATOM   7449   O  OH   . TYR C  2 46  ? 53.230  14.128  -0.631  1.00 0.00 ?  100 TYR C OH   1  
ATOM   7450   H  H    . TYR C  2 46  ? 56.689  8.535   4.778   1.00 0.00 ?  100 TYR C H    1  
ATOM   7451   H  HA   . TYR C  2 46  ? 55.999  10.433  3.739   1.00 0.00 ?  100 TYR C HA   1  
ATOM   7452   H  HB2  . TYR C  2 46  ? 56.936  9.795   1.504   1.00 0.00 ?  100 TYR C HB2  1  
ATOM   7453   H  HB3  . TYR C  2 46  ? 55.530  8.613   1.272   1.00 0.00 ?  100 TYR C HB3  1  
ATOM   7454   H  HD1  . TYR C  2 46  ? 53.476  9.596   -0.055  1.00 0.00 ?  100 TYR C HD1  1  
ATOM   7455   H  HD2  . TYR C  2 46  ? 56.687  12.033  1.577   1.00 0.00 ?  100 TYR C HD2  1  
ATOM   7456   H  HE1  . TYR C  2 46  ? 52.371  11.667  -0.853  1.00 0.00 ?  100 TYR C HE1  1  
ATOM   7457   H  HE2  . TYR C  2 46  ? 55.741  13.990  0.617   1.00 0.00 ?  100 TYR C HE2  1  
ATOM   7458   H  HH   . TYR C  2 46  ? 53.640  14.889  -0.215  1.00 0.00 ?  100 TYR C HH   1  
ATOM   7459   N  N    . LEU C  2 47  ? 53.334  8.614   3.863   1.00 0.00 ?  101 LEU C N    1  
ATOM   7460   C  CA   . LEU C  2 47  ? 51.926  8.556   4.139   1.00 0.00 ?  101 LEU C CA   1  
ATOM   7461   C  C    . LEU C  2 47  ? 51.464  9.495   5.282   1.00 0.00 ?  101 LEU C C    1  
ATOM   7462   O  O    . LEU C  2 47  ? 50.381  10.114  5.367   1.00 0.00 ?  101 LEU C O    1  
ATOM   7463   C  CB   . LEU C  2 47  ? 51.571  7.081   4.469   1.00 0.00 ?  101 LEU C CB   1  
ATOM   7464   C  CG   . LEU C  2 47  ? 50.057  6.621   4.411   1.00 0.00 ?  101 LEU C CG   1  
ATOM   7465   C  CD1  . LEU C  2 47  ? 49.482  6.686   3.050   1.00 0.00 ?  101 LEU C CD1  1  
ATOM   7466   C  CD2  . LEU C  2 47  ? 49.914  5.100   4.836   1.00 0.00 ?  101 LEU C CD2  1  
ATOM   7467   H  H    . LEU C  2 47  ? 53.728  7.699   3.813   1.00 0.00 ?  101 LEU C H    1  
ATOM   7468   H  HA   . LEU C  2 47  ? 51.458  8.729   3.181   1.00 0.00 ?  101 LEU C HA   1  
ATOM   7469   H  HB2  . LEU C  2 47  ? 52.021  6.444   3.679   1.00 0.00 ?  101 LEU C HB2  1  
ATOM   7470   H  HB3  . LEU C  2 47  ? 52.022  6.709   5.414   1.00 0.00 ?  101 LEU C HB3  1  
ATOM   7471   H  HG   . LEU C  2 47  ? 49.456  7.197   5.147   1.00 0.00 ?  101 LEU C HG   1  
ATOM   7472   H  HD11 . LEU C  2 47  ? 49.248  7.749   2.828   1.00 0.00 ?  101 LEU C HD11 1  
ATOM   7473   H  HD12 . LEU C  2 47  ? 48.450  6.276   3.100   1.00 0.00 ?  101 LEU C HD12 1  
ATOM   7474   H  HD13 . LEU C  2 47  ? 50.064  6.189   2.244   1.00 0.00 ?  101 LEU C HD13 1  
ATOM   7475   H  HD21 . LEU C  2 47  ? 50.493  4.979   5.777   1.00 0.00 ?  101 LEU C HD21 1  
ATOM   7476   H  HD22 . LEU C  2 47  ? 50.447  4.530   4.045   1.00 0.00 ?  101 LEU C HD22 1  
ATOM   7477   H  HD23 . LEU C  2 47  ? 48.852  4.789   4.933   1.00 0.00 ?  101 LEU C HD23 1  
ATOM   7478   N  N    . ASP C  2 48  ? 52.370  9.753   6.204   1.00 0.00 ?  102 ASP C N    1  
ATOM   7479   C  CA   . ASP C  2 48  ? 52.092  10.497  7.376   1.00 0.00 ?  102 ASP C CA   1  
ATOM   7480   C  C    . ASP C  2 48  ? 52.317  11.998  7.192   1.00 0.00 ?  102 ASP C C    1  
ATOM   7481   O  O    . ASP C  2 48  ? 51.645  12.826  7.817   1.00 0.00 ?  102 ASP C O    1  
ATOM   7482   C  CB   . ASP C  2 48  ? 53.035  9.856   8.502   1.00 0.00 ?  102 ASP C CB   1  
ATOM   7483   C  CG   . ASP C  2 48  ? 54.498  10.055  8.244   1.00 0.00 ?  102 ASP C CG   1  
ATOM   7484   O  OD1  . ASP C  2 48  ? 55.005  9.766   7.120   1.00 0.00 ?  102 ASP C OD1  1  
ATOM   7485   O  OD2  . ASP C  2 48  ? 55.234  10.418  9.233   1.00 0.00 -1 102 ASP C OD2  1  
ATOM   7486   H  H    . ASP C  2 48  ? 53.288  9.364   6.171   1.00 0.00 ?  102 ASP C H    1  
ATOM   7487   H  HA   . ASP C  2 48  ? 51.071  10.480  7.728   1.00 0.00 ?  102 ASP C HA   1  
ATOM   7488   H  HB2  . ASP C  2 48  ? 52.827  10.262  9.515   1.00 0.00 ?  102 ASP C HB2  1  
ATOM   7489   H  HB3  . ASP C  2 48  ? 52.837  8.766   8.586   1.00 0.00 ?  102 ASP C HB3  1  
ATOM   7490   N  N    . ASP C  2 49  ? 53.096  12.328  6.109   1.00 0.00 ?  103 ASP C N    1  
ATOM   7491   C  CA   . ASP C  2 49  ? 53.117  13.720  5.693   1.00 0.00 ?  103 ASP C CA   1  
ATOM   7492   C  C    . ASP C  2 49  ? 51.923  13.865  4.680   1.00 0.00 ?  103 ASP C C    1  
ATOM   7493   O  O    . ASP C  2 49  ? 51.294  14.964  4.603   1.00 0.00 ?  103 ASP C O    1  
ATOM   7494   C  CB   . ASP C  2 49  ? 54.502  13.968  4.962   1.00 0.00 ?  103 ASP C CB   1  
ATOM   7495   C  CG   . ASP C  2 49  ? 55.597  14.187  5.962   1.00 0.00 ?  103 ASP C CG   1  
ATOM   7496   O  OD1  . ASP C  2 49  ? 56.763  14.346  5.507   1.00 0.00 ?  103 ASP C OD1  1  
ATOM   7497   O  OD2  . ASP C  2 49  ? 55.444  14.236  7.177   1.00 0.00 -1 103 ASP C OD2  1  
ATOM   7498   H  H    . ASP C  2 49  ? 53.694  11.732  5.578   1.00 0.00 ?  103 ASP C H    1  
ATOM   7499   H  HA   . ASP C  2 49  ? 52.909  14.470  6.442   1.00 0.00 ?  103 ASP C HA   1  
ATOM   7500   H  HB2  . ASP C  2 49  ? 54.770  13.198  4.207   1.00 0.00 ?  103 ASP C HB2  1  
ATOM   7501   H  HB3  . ASP C  2 49  ? 54.372  14.908  4.385   1.00 0.00 ?  103 ASP C HB3  1  
ATOM   7502   N  N    . PHE C  2 50  ? 51.467  12.800  3.900   1.00 0.00 ?  104 PHE C N    1  
ATOM   7503   C  CA   . PHE C  2 50  ? 50.393  12.869  2.857   1.00 0.00 ?  104 PHE C CA   1  
ATOM   7504   C  C    . PHE C  2 50  ? 48.939  13.240  3.401   1.00 0.00 ?  104 PHE C C    1  
ATOM   7505   O  O    . PHE C  2 50  ? 48.225  14.028  2.757   1.00 0.00 ?  104 PHE C O    1  
ATOM   7506   C  CB   . PHE C  2 50  ? 50.434  11.497  2.151   1.00 0.00 ?  104 PHE C CB   1  
ATOM   7507   C  CG   . PHE C  2 50  ? 49.504  11.434  0.974   1.00 0.00 ?  104 PHE C CG   1  
ATOM   7508   C  CD1  . PHE C  2 50  ? 49.829  12.281  -0.087  1.00 0.00 ?  104 PHE C CD1  1  
ATOM   7509   C  CD2  . PHE C  2 50  ? 48.438  10.519  0.837   1.00 0.00 ?  104 PHE C CD2  1  
ATOM   7510   C  CE1  . PHE C  2 50  ? 48.999  12.345  -1.260  1.00 0.00 ?  104 PHE C CE1  1  
ATOM   7511   C  CE2  . PHE C  2 50  ? 47.666  10.499  -0.341  1.00 0.00 ?  104 PHE C CE2  1  
ATOM   7512   C  CZ   . PHE C  2 50  ? 47.901  11.428  -1.382  1.00 0.00 ?  104 PHE C CZ   1  
ATOM   7513   H  H    . PHE C  2 50  ? 51.958  11.935  3.832   1.00 0.00 ?  104 PHE C H    1  
ATOM   7514   H  HA   . PHE C  2 50  ? 50.621  13.678  2.179   1.00 0.00 ?  104 PHE C HA   1  
ATOM   7515   H  HB2  . PHE C  2 50  ? 51.459  11.411  1.732   1.00 0.00 ?  104 PHE C HB2  1  
ATOM   7516   H  HB3  . PHE C  2 50  ? 50.164  10.686  2.860   1.00 0.00 ?  104 PHE C HB3  1  
ATOM   7517   H  HD1  . PHE C  2 50  ? 50.630  13.000  0.009   1.00 0.00 ?  104 PHE C HD1  1  
ATOM   7518   H  HD2  . PHE C  2 50  ? 48.139  9.861   1.639   1.00 0.00 ?  104 PHE C HD2  1  
ATOM   7519   H  HE1  . PHE C  2 50  ? 49.175  13.077  -2.034  1.00 0.00 ?  104 PHE C HE1  1  
ATOM   7520   H  HE2  . PHE C  2 50  ? 46.796  9.861   -0.395  1.00 0.00 ?  104 PHE C HE2  1  
ATOM   7521   H  HZ   . PHE C  2 50  ? 47.395  11.408  -2.336  1.00 0.00 ?  104 PHE C HZ   1  
ATOM   7522   N  N    . GLN C  2 51  ? 48.604  12.749  4.586   1.00 0.00 ?  105 GLN C N    1  
ATOM   7523   C  CA   . GLN C  2 51  ? 47.399  13.217  5.349   1.00 0.00 ?  105 GLN C CA   1  
ATOM   7524   C  C    . GLN C  2 51  ? 47.436  14.778  5.603   1.00 0.00 ?  105 GLN C C    1  
ATOM   7525   O  O    . GLN C  2 51  ? 46.336  15.260  5.635   1.00 0.00 ?  105 GLN C O    1  
ATOM   7526   C  CB   . GLN C  2 51  ? 47.033  12.336  6.668   1.00 0.00 ?  105 GLN C CB   1  
ATOM   7527   C  CG   . GLN C  2 51  ? 48.206  11.705  7.494   1.00 0.00 ?  105 GLN C CG   1  
ATOM   7528   C  CD   . GLN C  2 51  ? 47.841  10.544  8.371   1.00 0.00 ?  105 GLN C CD   1  
ATOM   7529   O  OE1  . GLN C  2 51  ? 48.650  9.646   8.590   1.00 0.00 ?  105 GLN C OE1  1  
ATOM   7530   N  NE2  . GLN C  2 51  ? 46.649  10.571  9.048   1.00 0.00 ?  105 GLN C NE2  1  
ATOM   7531   H  H    . GLN C  2 51  ? 49.284  12.103  4.924   1.00 0.00 ?  105 GLN C H    1  
ATOM   7532   H  HA   . GLN C  2 51  ? 46.510  13.063  4.756   1.00 0.00 ?  105 GLN C HA   1  
ATOM   7533   H  HB2  . GLN C  2 51  ? 46.212  12.872  7.191   1.00 0.00 ?  105 GLN C HB2  1  
ATOM   7534   H  HB3  . GLN C  2 51  ? 46.510  11.462  6.224   1.00 0.00 ?  105 GLN C HB3  1  
ATOM   7535   H  HG2  . GLN C  2 51  ? 49.046  11.322  6.877   1.00 0.00 ?  105 GLN C HG2  1  
ATOM   7536   H  HG3  . GLN C  2 51  ? 48.717  12.524  8.044   1.00 0.00 ?  105 GLN C HG3  1  
ATOM   7537   H  HE21 . GLN C  2 51  ? 46.640  9.957   9.837   1.00 0.00 ?  105 GLN C HE21 1  
ATOM   7538   H  HE22 . GLN C  2 51  ? 46.023  11.348  8.988   1.00 0.00 ?  105 GLN C HE22 1  
ATOM   7539   N  N    . LYS C  2 52  ? 48.577  15.483  5.744   1.00 0.00 ?  106 LYS C N    1  
ATOM   7540   C  CA   . LYS C  2 52  ? 48.631  16.869  6.254   1.00 0.00 ?  106 LYS C CA   1  
ATOM   7541   C  C    . LYS C  2 52  ? 49.128  17.847  5.235   1.00 0.00 ?  106 LYS C C    1  
ATOM   7542   O  O    . LYS C  2 52  ? 48.565  18.934  5.085   1.00 0.00 ?  106 LYS C O    1  
ATOM   7543   C  CB   . LYS C  2 52  ? 49.656  17.009  7.422   1.00 0.00 ?  106 LYS C CB   1  
ATOM   7544   C  CG   . LYS C  2 52  ? 50.988  16.231  7.291   1.00 0.00 ?  106 LYS C CG   1  
ATOM   7545   C  CD   . LYS C  2 52  ? 52.029  16.431  8.394   1.00 0.00 ?  106 LYS C CD   1  
ATOM   7546   C  CE   . LYS C  2 52  ? 51.636  15.967  9.821   1.00 0.00 ?  106 LYS C CE   1  
ATOM   7547   N  NZ   . LYS C  2 52  ? 51.770  14.487  9.963   1.00 0.00 1  106 LYS C NZ   1  
ATOM   7548   H  H    . LYS C  2 52  ? 49.430  14.968  5.705   1.00 0.00 ?  106 LYS C H    1  
ATOM   7549   H  HA   . LYS C  2 52  ? 47.665  17.159  6.641   1.00 0.00 ?  106 LYS C HA   1  
ATOM   7550   H  HB2  . LYS C  2 52  ? 49.801  18.110  7.462   1.00 0.00 ?  106 LYS C HB2  1  
ATOM   7551   H  HB3  . LYS C  2 52  ? 49.247  16.691  8.405   1.00 0.00 ?  106 LYS C HB3  1  
ATOM   7552   H  HG2  . LYS C  2 52  ? 50.674  15.167  7.239   1.00 0.00 ?  106 LYS C HG2  1  
ATOM   7553   H  HG3  . LYS C  2 52  ? 51.416  16.593  6.332   1.00 0.00 ?  106 LYS C HG3  1  
ATOM   7554   H  HD2  . LYS C  2 52  ? 52.970  15.928  8.083   1.00 0.00 ?  106 LYS C HD2  1  
ATOM   7555   H  HD3  . LYS C  2 52  ? 52.205  17.518  8.536   1.00 0.00 ?  106 LYS C HD3  1  
ATOM   7556   H  HE2  . LYS C  2 52  ? 52.360  16.444  10.516  1.00 0.00 ?  106 LYS C HE2  1  
ATOM   7557   H  HE3  . LYS C  2 52  ? 50.633  16.322  10.141  1.00 0.00 ?  106 LYS C HE3  1  
ATOM   7558   H  HZ1  . LYS C  2 52  ? 51.464  14.126  10.889  1.00 0.00 ?  106 LYS C HZ1  1  
ATOM   7559   H  HZ2  . LYS C  2 52  ? 52.770  14.207  9.914   1.00 0.00 ?  106 LYS C HZ2  1  
ATOM   7560   H  HZ3  . LYS C  2 52  ? 51.277  13.986  9.197   1.00 0.00 ?  106 LYS C HZ3  1  
ATOM   7561   N  N    . LYS C  2 53  ? 50.197  17.651  4.483   1.00 0.00 ?  107 LYS C N    1  
ATOM   7562   C  CA   . LYS C  2 53  ? 50.871  18.692  3.736   1.00 0.00 ?  107 LYS C CA   1  
ATOM   7563   C  C    . LYS C  2 53  ? 50.000  19.562  2.698   1.00 0.00 ?  107 LYS C C    1  
ATOM   7564   O  O    . LYS C  2 53  ? 50.283  20.768  2.597   1.00 0.00 ?  107 LYS C O    1  
ATOM   7565   C  CB   . LYS C  2 53  ? 52.162  18.044  3.101   1.00 0.00 ?  107 LYS C CB   1  
ATOM   7566   C  CG   . LYS C  2 53  ? 53.266  17.642  4.054   1.00 0.00 ?  107 LYS C CG   1  
ATOM   7567   C  CD   . LYS C  2 53  ? 54.086  18.761  4.564   1.00 0.00 ?  107 LYS C CD   1  
ATOM   7568   C  CE   . LYS C  2 53  ? 55.501  18.243  4.993   1.00 0.00 ?  107 LYS C CE   1  
ATOM   7569   N  NZ   . LYS C  2 53  ? 56.148  19.361  5.700   1.00 0.00 1  107 LYS C NZ   1  
ATOM   7570   H  H    . LYS C  2 53  ? 50.624  16.751  4.492   1.00 0.00 ?  107 LYS C H    1  
ATOM   7571   H  HA   . LYS C  2 53  ? 51.286  19.453  4.380   1.00 0.00 ?  107 LYS C HA   1  
ATOM   7572   H  HB2  . LYS C  2 53  ? 51.749  17.113  2.657   1.00 0.00 ?  107 LYS C HB2  1  
ATOM   7573   H  HB3  . LYS C  2 53  ? 52.614  18.706  2.331   1.00 0.00 ?  107 LYS C HB3  1  
ATOM   7574   H  HG2  . LYS C  2 53  ? 52.917  17.030  4.913   1.00 0.00 ?  107 LYS C HG2  1  
ATOM   7575   H  HG3  . LYS C  2 53  ? 53.961  16.992  3.481   1.00 0.00 ?  107 LYS C HG3  1  
ATOM   7576   H  HD2  . LYS C  2 53  ? 54.300  19.415  3.692   1.00 0.00 ?  107 LYS C HD2  1  
ATOM   7577   H  HD3  . LYS C  2 53  ? 53.451  19.300  5.299   1.00 0.00 ?  107 LYS C HD3  1  
ATOM   7578   H  HE2  . LYS C  2 53  ? 55.547  17.287  5.557   1.00 0.00 ?  107 LYS C HE2  1  
ATOM   7579   H  HE3  . LYS C  2 53  ? 56.173  18.117  4.117   1.00 0.00 ?  107 LYS C HE3  1  
ATOM   7580   H  HZ1  . LYS C  2 53  ? 55.790  19.450  6.673   1.00 0.00 ?  107 LYS C HZ1  1  
ATOM   7581   H  HZ2  . LYS C  2 53  ? 55.920  20.281  5.270   1.00 0.00 ?  107 LYS C HZ2  1  
ATOM   7582   H  HZ3  . LYS C  2 53  ? 57.185  19.325  5.759   1.00 0.00 ?  107 LYS C HZ3  1  
ATOM   7583   N  N    . TRP C  2 54  ? 49.019  18.934  1.978   1.00 0.00 ?  108 TRP C N    1  
ATOM   7584   C  CA   . TRP C  2 54  ? 48.079  19.754  1.196   1.00 0.00 ?  108 TRP C CA   1  
ATOM   7585   C  C    . TRP C  2 54  ? 47.047  20.609  1.986   1.00 0.00 ?  108 TRP C C    1  
ATOM   7586   O  O    . TRP C  2 54  ? 46.737  21.710  1.525   1.00 0.00 ?  108 TRP C O    1  
ATOM   7587   C  CB   . TRP C  2 54  ? 47.377  18.872  0.170   1.00 0.00 ?  108 TRP C CB   1  
ATOM   7588   C  CG   . TRP C  2 54  ? 46.408  19.563  -0.763  1.00 0.00 ?  108 TRP C CG   1  
ATOM   7589   C  CD1  . TRP C  2 54  ? 46.609  19.859  -2.112  1.00 0.00 ?  108 TRP C CD1  1  
ATOM   7590   C  CD2  . TRP C  2 54  ? 45.043  19.878  -0.511  1.00 0.00 ?  108 TRP C CD2  1  
ATOM   7591   N  NE1  . TRP C  2 54  ? 45.486  20.234  -2.691  1.00 0.00 ?  108 TRP C NE1  1  
ATOM   7592   C  CE2  . TRP C  2 54  ? 44.516  20.397  -1.728  1.00 0.00 ?  108 TRP C CE2  1  
ATOM   7593   C  CE3  . TRP C  2 54  ? 44.174  19.619  0.573   1.00 0.00 ?  108 TRP C CE3  1  
ATOM   7594   C  CZ2  . TRP C  2 54  ? 43.139  20.760  -1.795  1.00 0.00 ?  108 TRP C CZ2  1  
ATOM   7595   C  CZ3  . TRP C  2 54  ? 42.892  20.040  0.502   1.00 0.00 ?  108 TRP C CZ3  1  
ATOM   7596   C  CH2  . TRP C  2 54  ? 42.335  20.654  -0.647  1.00 0.00 ?  108 TRP C CH2  1  
ATOM   7597   H  H    . TRP C  2 54  ? 48.876  17.949  2.024   1.00 0.00 ?  108 TRP C H    1  
ATOM   7598   H  HA   . TRP C  2 54  ? 48.577  20.583  0.715   1.00 0.00 ?  108 TRP C HA   1  
ATOM   7599   H  HB2  . TRP C  2 54  ? 48.133  18.422  -0.509  1.00 0.00 ?  108 TRP C HB2  1  
ATOM   7600   H  HB3  . TRP C  2 54  ? 46.861  18.130  0.815   1.00 0.00 ?  108 TRP C HB3  1  
ATOM   7601   H  HD1  . TRP C  2 54  ? 47.568  19.675  -2.574  1.00 0.00 ?  108 TRP C HD1  1  
ATOM   7602   H  HE1  . TRP C  2 54  ? 45.456  20.530  -3.621  1.00 0.00 ?  108 TRP C HE1  1  
ATOM   7603   H  HE3  . TRP C  2 54  ? 44.519  19.187  1.501   1.00 0.00 ?  108 TRP C HE3  1  
ATOM   7604   H  HZ2  . TRP C  2 54  ? 42.671  21.283  -2.615  1.00 0.00 ?  108 TRP C HZ2  1  
ATOM   7605   H  HZ3  . TRP C  2 54  ? 42.266  19.993  1.381   1.00 0.00 ?  108 TRP C HZ3  1  
ATOM   7606   H  HH2  . TRP C  2 54  ? 41.289  20.921  -0.616  1.00 0.00 ?  108 TRP C HH2  1  
ATOM   7607   N  N    . GLN C  2 55  ? 46.587  20.073  3.176   1.00 0.00 ?  109 GLN C N    1  
ATOM   7608   C  CA   . GLN C  2 55  ? 45.728  20.851  4.141   1.00 0.00 ?  109 GLN C CA   1  
ATOM   7609   C  C    . GLN C  2 55  ? 46.458  22.025  4.743   1.00 0.00 ?  109 GLN C C    1  
ATOM   7610   O  O    . GLN C  2 55  ? 45.820  23.032  4.880   1.00 0.00 ?  109 GLN C O    1  
ATOM   7611   C  CB   . GLN C  2 55  ? 45.292  20.017  5.386   1.00 0.00 ?  109 GLN C CB   1  
ATOM   7612   C  CG   . GLN C  2 55  ? 44.359  18.814  5.009   1.00 0.00 ?  109 GLN C CG   1  
ATOM   7613   C  CD   . GLN C  2 55  ? 43.000  19.156  4.525   1.00 0.00 ?  109 GLN C CD   1  
ATOM   7614   O  OE1  . GLN C  2 55  ? 42.500  18.610  3.525   1.00 0.00 ?  109 GLN C OE1  1  
ATOM   7615   N  NE2  . GLN C  2 55  ? 42.256  20.110  5.177   1.00 0.00 ?  109 GLN C NE2  1  
ATOM   7616   H  H    . GLN C  2 55  ? 46.968  19.177  3.391   1.00 0.00 ?  109 GLN C H    1  
ATOM   7617   H  HA   . GLN C  2 55  ? 44.893  21.103  3.503   1.00 0.00 ?  109 GLN C HA   1  
ATOM   7618   H  HB2  . GLN C  2 55  ? 46.232  19.501  5.676   1.00 0.00 ?  109 GLN C HB2  1  
ATOM   7619   H  HB3  . GLN C  2 55  ? 44.848  20.617  6.209   1.00 0.00 ?  109 GLN C HB3  1  
ATOM   7620   H  HG2  . GLN C  2 55  ? 44.872  18.166  4.267   1.00 0.00 ?  109 GLN C HG2  1  
ATOM   7621   H  HG3  . GLN C  2 55  ? 44.153  18.246  5.942   1.00 0.00 ?  109 GLN C HG3  1  
ATOM   7622   H  HE21 . GLN C  2 55  ? 41.411  20.511  4.823   1.00 0.00 ?  109 GLN C HE21 1  
ATOM   7623   H  HE22 . GLN C  2 55  ? 42.579  20.475  6.050   1.00 0.00 ?  109 GLN C HE22 1  
ATOM   7624   N  N    . GLU C  2 56  ? 47.746  21.838  5.077   1.00 0.00 ?  110 GLU C N    1  
ATOM   7625   C  CA   . GLU C  2 56  ? 48.616  22.968  5.356   1.00 0.00 ?  110 GLU C CA   1  
ATOM   7626   C  C    . GLU C  2 56  ? 48.695  24.075  4.279   1.00 0.00 ?  110 GLU C C    1  
ATOM   7627   O  O    . GLU C  2 56  ? 48.621  25.289  4.534   1.00 0.00 ?  110 GLU C O    1  
ATOM   7628   C  CB   . GLU C  2 56  ? 50.087  22.475  5.778   1.00 0.00 ?  110 GLU C CB   1  
ATOM   7629   C  CG   . GLU C  2 56  ? 51.166  23.533  6.077   1.00 0.00 ?  110 GLU C CG   1  
ATOM   7630   C  CD   . GLU C  2 56  ? 52.593  22.995  6.044   1.00 0.00 ?  110 GLU C CD   1  
ATOM   7631   O  OE1  . GLU C  2 56  ? 53.454  23.405  5.167   1.00 0.00 ?  110 GLU C OE1  1  
ATOM   7632   O  OE2  . GLU C  2 56  ? 52.916  22.143  6.878   1.00 0.00 -1 110 GLU C OE2  1  
ATOM   7633   H  H    . GLU C  2 56  ? 48.167  20.936  5.029   1.00 0.00 ?  110 GLU C H    1  
ATOM   7634   H  HA   . GLU C  2 56  ? 48.106  23.361  6.223   1.00 0.00 ?  110 GLU C HA   1  
ATOM   7635   H  HB2  . GLU C  2 56  ? 49.959  21.842  6.682   1.00 0.00 ?  110 GLU C HB2  1  
ATOM   7636   H  HB3  . GLU C  2 56  ? 50.473  21.736  5.043   1.00 0.00 ?  110 GLU C HB3  1  
ATOM   7637   H  HG2  . GLU C  2 56  ? 51.180  24.316  5.290   1.00 0.00 ?  110 GLU C HG2  1  
ATOM   7638   H  HG3  . GLU C  2 56  ? 51.109  24.079  7.043   1.00 0.00 ?  110 GLU C HG3  1  
ATOM   7639   N  N    . GLU C  2 57  ? 48.850  23.648  2.968   1.00 0.00 ?  111 GLU C N    1  
ATOM   7640   C  CA   . GLU C  2 57  ? 48.746  24.585  1.922   1.00 0.00 ?  111 GLU C CA   1  
ATOM   7641   C  C    . GLU C  2 57  ? 47.372  25.161  1.712   1.00 0.00 ?  111 GLU C C    1  
ATOM   7642   O  O    . GLU C  2 57  ? 47.263  26.337  1.276   1.00 0.00 ?  111 GLU C O    1  
ATOM   7643   C  CB   . GLU C  2 57  ? 49.345  23.888  0.614   1.00 0.00 ?  111 GLU C CB   1  
ATOM   7644   C  CG   . GLU C  2 57  ? 50.830  23.450  0.656   1.00 0.00 ?  111 GLU C CG   1  
ATOM   7645   C  CD   . GLU C  2 57  ? 51.441  23.118  -0.662  1.00 0.00 ?  111 GLU C CD   1  
ATOM   7646   O  OE1  . GLU C  2 57  ? 52.649  23.087  -0.751  1.00 0.00 ?  111 GLU C OE1  1  
ATOM   7647   O  OE2  . GLU C  2 57  ? 50.681  22.989  -1.694  1.00 0.00 -1 111 GLU C OE2  1  
ATOM   7648   H  H    . GLU C  2 57  ? 48.846  22.696  2.673   1.00 0.00 ?  111 GLU C H    1  
ATOM   7649   H  HA   . GLU C  2 57  ? 49.478  25.364  2.079   1.00 0.00 ?  111 GLU C HA   1  
ATOM   7650   H  HB2  . GLU C  2 57  ? 48.801  22.962  0.330   1.00 0.00 ?  111 GLU C HB2  1  
ATOM   7651   H  HB3  . GLU C  2 57  ? 49.243  24.583  -0.247  1.00 0.00 ?  111 GLU C HB3  1  
ATOM   7652   H  HG2  . GLU C  2 57  ? 51.465  24.229  1.129   1.00 0.00 ?  111 GLU C HG2  1  
ATOM   7653   H  HG3  . GLU C  2 57  ? 51.123  22.608  1.319   1.00 0.00 ?  111 GLU C HG3  1  
ATOM   7654   N  N    . MET C  2 58  ? 46.324  24.455  1.921   1.00 0.00 ?  112 MET C N    1  
ATOM   7655   C  CA   . MET C  2 58  ? 44.959  25.041  1.977   1.00 0.00 ?  112 MET C CA   1  
ATOM   7656   C  C    . MET C  2 58  ? 44.858  26.199  2.978   1.00 0.00 ?  112 MET C C    1  
ATOM   7657   O  O    . MET C  2 58  ? 44.322  27.223  2.643   1.00 0.00 ?  112 MET C O    1  
ATOM   7658   C  CB   . MET C  2 58  ? 43.784  24.045  2.095   1.00 0.00 ?  112 MET C CB   1  
ATOM   7659   C  CG   . MET C  2 58  ? 42.447  24.736  1.948   1.00 0.00 ?  112 MET C CG   1  
ATOM   7660   S  SD   . MET C  2 58  ? 42.184  25.712  0.494   1.00 0.00 ?  112 MET C SD   1  
ATOM   7661   C  CE   . MET C  2 58  ? 42.551  24.476  -0.746  1.00 0.00 ?  112 MET C CE   1  
ATOM   7662   H  H    . MET C  2 58  ? 46.518  23.479  1.985   1.00 0.00 ?  112 MET C H    1  
ATOM   7663   H  HA   . MET C  2 58  ? 45.002  25.515  1.007   1.00 0.00 ?  112 MET C HA   1  
ATOM   7664   H  HB2  . MET C  2 58  ? 43.982  23.218  1.380   1.00 0.00 ?  112 MET C HB2  1  
ATOM   7665   H  HB3  . MET C  2 58  ? 43.803  23.563  3.096   1.00 0.00 ?  112 MET C HB3  1  
ATOM   7666   H  HG2  . MET C  2 58  ? 41.711  23.913  1.827   1.00 0.00 ?  112 MET C HG2  1  
ATOM   7667   H  HG3  . MET C  2 58  ? 42.135  25.289  2.860   1.00 0.00 ?  112 MET C HG3  1  
ATOM   7668   H  HE1  . MET C  2 58  ? 42.324  24.728  -1.805  1.00 0.00 ?  112 MET C HE1  1  
ATOM   7669   H  HE2  . MET C  2 58  ? 41.996  23.530  -0.572  1.00 0.00 ?  112 MET C HE2  1  
ATOM   7670   H  HE3  . MET C  2 58  ? 43.638  24.256  -0.680  1.00 0.00 ?  112 MET C HE3  1  
ATOM   7671   N  N    . GLU C  2 59  ? 45.444  25.989  4.180   1.00 0.00 ?  113 GLU C N    1  
ATOM   7672   C  CA   . GLU C  2 59  ? 45.634  26.933  5.181   1.00 0.00 ?  113 GLU C CA   1  
ATOM   7673   C  C    . GLU C  2 59  ? 46.463  28.124  4.689   1.00 0.00 ?  113 GLU C C    1  
ATOM   7674   O  O    . GLU C  2 59  ? 46.069  29.297  4.807   1.00 0.00 ?  113 GLU C O    1  
ATOM   7675   C  CB   . GLU C  2 59  ? 46.169  26.232  6.463   1.00 0.00 ?  113 GLU C CB   1  
ATOM   7676   C  CG   . GLU C  2 59  ? 45.144  25.579  7.416   1.00 0.00 ?  113 GLU C CG   1  
ATOM   7677   C  CD   . GLU C  2 59  ? 45.636  24.883  8.600   1.00 0.00 ?  113 GLU C CD   1  
ATOM   7678   O  OE1  . GLU C  2 59  ? 45.087  23.814  8.934   1.00 0.00 ?  113 GLU C OE1  1  
ATOM   7679   O  OE2  . GLU C  2 59  ? 46.570  25.380  9.257   1.00 0.00 -1 113 GLU C OE2  1  
ATOM   7680   H  H    . GLU C  2 59  ? 45.866  25.094  4.302   1.00 0.00 ?  113 GLU C H    1  
ATOM   7681   H  HA   . GLU C  2 59  ? 44.649  27.339  5.357   1.00 0.00 ?  113 GLU C HA   1  
ATOM   7682   H  HB2  . GLU C  2 59  ? 46.886  25.438  6.164   1.00 0.00 ?  113 GLU C HB2  1  
ATOM   7683   H  HB3  . GLU C  2 59  ? 46.750  26.903  7.131   1.00 0.00 ?  113 GLU C HB3  1  
ATOM   7684   H  HG2  . GLU C  2 59  ? 44.518  26.431  7.758   1.00 0.00 ?  113 GLU C HG2  1  
ATOM   7685   H  HG3  . GLU C  2 59  ? 44.447  24.908  6.871   1.00 0.00 ?  113 GLU C HG3  1  
ATOM   7686   N  N    . LEU C  2 60  ? 47.619  27.913  3.997   1.00 0.00 ?  114 LEU C N    1  
ATOM   7687   C  CA   . LEU C  2 60  ? 48.445  28.916  3.394   1.00 0.00 ?  114 LEU C CA   1  
ATOM   7688   C  C    . LEU C  2 60  ? 47.694  29.743  2.357   1.00 0.00 ?  114 LEU C C    1  
ATOM   7689   O  O    . LEU C  2 60  ? 47.570  30.922  2.461   1.00 0.00 ?  114 LEU C O    1  
ATOM   7690   C  CB   . LEU C  2 60  ? 49.754  28.214  2.771   1.00 0.00 ?  114 LEU C CB   1  
ATOM   7691   C  CG   . LEU C  2 60  ? 50.576  28.904  1.612   1.00 0.00 ?  114 LEU C CG   1  
ATOM   7692   C  CD1  . LEU C  2 60  ? 51.062  30.218  2.173   1.00 0.00 ?  114 LEU C CD1  1  
ATOM   7693   C  CD2  . LEU C  2 60  ? 51.733  28.051  1.218   1.00 0.00 ?  114 LEU C CD2  1  
ATOM   7694   H  H    . LEU C  2 60  ? 47.879  26.952  4.049   1.00 0.00 ?  114 LEU C H    1  
ATOM   7695   H  HA   . LEU C  2 60  ? 48.608  29.584  4.226   1.00 0.00 ?  114 LEU C HA   1  
ATOM   7696   H  HB2  . LEU C  2 60  ? 50.389  27.827  3.596   1.00 0.00 ?  114 LEU C HB2  1  
ATOM   7697   H  HB3  . LEU C  2 60  ? 49.346  27.317  2.258   1.00 0.00 ?  114 LEU C HB3  1  
ATOM   7698   H  HG   . LEU C  2 60  ? 49.892  29.064  0.752   1.00 0.00 ?  114 LEU C HG   1  
ATOM   7699   H  HD11 . LEU C  2 60  ? 51.683  30.260  3.093   1.00 0.00 ?  114 LEU C HD11 1  
ATOM   7700   H  HD12 . LEU C  2 60  ? 50.150  30.828  2.344   1.00 0.00 ?  114 LEU C HD12 1  
ATOM   7701   H  HD13 . LEU C  2 60  ? 51.666  30.787  1.434   1.00 0.00 ?  114 LEU C HD13 1  
ATOM   7702   H  HD21 . LEU C  2 60  ? 52.459  28.087  2.059   1.00 0.00 ?  114 LEU C HD21 1  
ATOM   7703   H  HD22 . LEU C  2 60  ? 52.216  28.577  0.367   1.00 0.00 ?  114 LEU C HD22 1  
ATOM   7704   H  HD23 . LEU C  2 60  ? 51.357  27.036  0.968   1.00 0.00 ?  114 LEU C HD23 1  
ATOM   7705   N  N    . TYR C  2 61  ? 46.979  29.105  1.386   1.00 0.00 ?  115 TYR C N    1  
ATOM   7706   C  CA   . TYR C  2 61  ? 46.101  29.745  0.487   1.00 0.00 ?  115 TYR C CA   1  
ATOM   7707   C  C    . TYR C  2 61  ? 45.126  30.632  1.176   1.00 0.00 ?  115 TYR C C    1  
ATOM   7708   O  O    . TYR C  2 61  ? 45.038  31.836  0.918   1.00 0.00 ?  115 TYR C O    1  
ATOM   7709   C  CB   . TYR C  2 61  ? 45.381  28.725  -0.516  1.00 0.00 ?  115 TYR C CB   1  
ATOM   7710   C  CG   . TYR C  2 61  ? 44.937  29.490  -1.848  1.00 0.00 ?  115 TYR C CG   1  
ATOM   7711   C  CD1  . TYR C  2 61  ? 45.877  30.041  -2.697  1.00 0.00 ?  115 TYR C CD1  1  
ATOM   7712   C  CD2  . TYR C  2 61  ? 43.569  29.758  -2.206  1.00 0.00 ?  115 TYR C CD2  1  
ATOM   7713   C  CE1  . TYR C  2 61  ? 45.550  30.943  -3.725  1.00 0.00 ?  115 TYR C CE1  1  
ATOM   7714   C  CE2  . TYR C  2 61  ? 43.185  30.663  -3.214  1.00 0.00 ?  115 TYR C CE2  1  
ATOM   7715   C  CZ   . TYR C  2 61  ? 44.215  31.219  -3.995  1.00 0.00 ?  115 TYR C CZ   1  
ATOM   7716   O  OH   . TYR C  2 61  ? 43.794  32.125  -5.011  1.00 0.00 ?  115 TYR C OH   1  
ATOM   7717   H  H    . TYR C  2 61  ? 47.122  28.130  1.231   1.00 0.00 ?  115 TYR C H    1  
ATOM   7718   H  HA   . TYR C  2 61  ? 46.695  30.406  -0.125  1.00 0.00 ?  115 TYR C HA   1  
ATOM   7719   H  HB2  . TYR C  2 61  ? 46.110  27.957  -0.853  1.00 0.00 ?  115 TYR C HB2  1  
ATOM   7720   H  HB3  . TYR C  2 61  ? 44.466  28.283  -0.068  1.00 0.00 ?  115 TYR C HB3  1  
ATOM   7721   H  HD1  . TYR C  2 61  ? 46.929  29.858  -2.534  1.00 0.00 ?  115 TYR C HD1  1  
ATOM   7722   H  HD2  . TYR C  2 61  ? 42.751  29.299  -1.670  1.00 0.00 ?  115 TYR C HD2  1  
ATOM   7723   H  HE1  . TYR C  2 61  ? 46.390  31.417  -4.211  1.00 0.00 ?  115 TYR C HE1  1  
ATOM   7724   H  HE2  . TYR C  2 61  ? 42.140  30.869  -3.392  1.00 0.00 ?  115 TYR C HE2  1  
ATOM   7725   H  HH   . TYR C  2 61  ? 44.412  32.166  -5.745  1.00 0.00 ?  115 TYR C HH   1  
ATOM   7726   N  N    . ARG C  2 62  ? 44.437  30.091  2.252   1.00 0.00 ?  116 ARG C N    1  
ATOM   7727   C  CA   . ARG C  2 62  ? 43.430  30.686  3.112   1.00 0.00 ?  116 ARG C CA   1  
ATOM   7728   C  C    . ARG C  2 62  ? 43.845  31.873  3.966   1.00 0.00 ?  116 ARG C C    1  
ATOM   7729   O  O    . ARG C  2 62  ? 43.128  32.833  4.033   1.00 0.00 ?  116 ARG C O    1  
ATOM   7730   C  CB   . ARG C  2 62  ? 42.633  29.650  3.976   1.00 0.00 ?  116 ARG C CB   1  
ATOM   7731   C  CG   . ARG C  2 62  ? 41.373  30.170  4.739   1.00 0.00 ?  116 ARG C CG   1  
ATOM   7732   C  CD   . ARG C  2 62  ? 40.414  30.901  3.911   1.00 0.00 ?  116 ARG C CD   1  
ATOM   7733   N  NE   . ARG C  2 62  ? 39.430  31.448  4.832   1.00 0.00 ?  116 ARG C NE   1  
ATOM   7734   C  CZ   . ARG C  2 62  ? 39.671  32.527  5.565   1.00 0.00 ?  116 ARG C CZ   1  
ATOM   7735   N  NH1  . ARG C  2 62  ? 38.711  32.865  6.350   1.00 0.00 1  116 ARG C NH1  1  
ATOM   7736   N  NH2  . ARG C  2 62  ? 40.687  33.365  5.459   1.00 0.00 ?  116 ARG C NH2  1  
ATOM   7737   H  H    . ARG C  2 62  ? 44.585  29.143  2.522   1.00 0.00 ?  116 ARG C H    1  
ATOM   7738   H  HA   . ARG C  2 62  ? 42.748  31.064  2.365   1.00 0.00 ?  116 ARG C HA   1  
ATOM   7739   H  HB2  . ARG C  2 62  ? 42.279  28.884  3.253   1.00 0.00 ?  116 ARG C HB2  1  
ATOM   7740   H  HB3  . ARG C  2 62  ? 43.334  29.292  4.760   1.00 0.00 ?  116 ARG C HB3  1  
ATOM   7741   H  HG2  . ARG C  2 62  ? 40.819  29.284  5.116   1.00 0.00 ?  116 ARG C HG2  1  
ATOM   7742   H  HG3  . ARG C  2 62  ? 41.707  30.775  5.609   1.00 0.00 ?  116 ARG C HG3  1  
ATOM   7743   H  HD2  . ARG C  2 62  ? 40.782  31.752  3.299   1.00 0.00 ?  116 ARG C HD2  1  
ATOM   7744   H  HD3  . ARG C  2 62  ? 39.814  30.264  3.226   1.00 0.00 ?  116 ARG C HD3  1  
ATOM   7745   H  HE   . ARG C  2 62  ? 38.624  30.924  5.109   1.00 0.00 ?  116 ARG C HE   1  
ATOM   7746   H  HH11 . ARG C  2 62  ? 38.996  33.611  6.951   1.00 0.00 ?  116 ARG C HH11 1  
ATOM   7747   H  HH12 . ARG C  2 62  ? 37.904  32.276  6.399   1.00 0.00 ?  116 ARG C HH12 1  
ATOM   7748   H  HH21 . ARG C  2 62  ? 40.666  34.208  5.997   1.00 0.00 ?  116 ARG C HH21 1  
ATOM   7749   H  HH22 . ARG C  2 62  ? 41.476  33.112  4.900   1.00 0.00 ?  116 ARG C HH22 1  
ATOM   7750   N  N    . GLN C  2 63  ? 45.063  31.899  4.529   1.00 0.00 ?  117 GLN C N    1  
ATOM   7751   C  CA   . GLN C  2 63  ? 45.826  32.896  5.303   1.00 0.00 ?  117 GLN C CA   1  
ATOM   7752   C  C    . GLN C  2 63  ? 46.022  34.190  4.421   1.00 0.00 ?  117 GLN C C    1  
ATOM   7753   O  O    . GLN C  2 63  ? 46.031  35.316  4.991   1.00 0.00 ?  117 GLN C O    1  
ATOM   7754   C  CB   . GLN C  2 63  ? 47.123  32.246  5.750   1.00 0.00 ?  117 GLN C CB   1  
ATOM   7755   C  CG   . GLN C  2 63  ? 47.998  33.149  6.577   1.00 0.00 ?  117 GLN C CG   1  
ATOM   7756   C  CD   . GLN C  2 63  ? 47.399  33.488  7.986   1.00 0.00 ?  117 GLN C CD   1  
ATOM   7757   O  OE1  . GLN C  2 63  ? 47.351  32.590  8.817   1.00 0.00 ?  117 GLN C OE1  1  
ATOM   7758   N  NE2  . GLN C  2 63  ? 46.971  34.750  8.143   1.00 0.00 ?  117 GLN C NE2  1  
ATOM   7759   H  H    . GLN C  2 63  ? 45.567  31.069  4.303   1.00 0.00 ?  117 GLN C H    1  
ATOM   7760   H  HA   . GLN C  2 63  ? 45.202  33.282  6.095   1.00 0.00 ?  117 GLN C HA   1  
ATOM   7761   H  HB2  . GLN C  2 63  ? 46.836  31.347  6.336   1.00 0.00 ?  117 GLN C HB2  1  
ATOM   7762   H  HB3  . GLN C  2 63  ? 47.632  31.825  4.856   1.00 0.00 ?  117 GLN C HB3  1  
ATOM   7763   H  HG2  . GLN C  2 63  ? 48.934  32.574  6.737   1.00 0.00 ?  117 GLN C HG2  1  
ATOM   7764   H  HG3  . GLN C  2 63  ? 48.207  34.088  6.020   1.00 0.00 ?  117 GLN C HG3  1  
ATOM   7765   H  HE21 . GLN C  2 63  ? 46.715  35.025  9.070   1.00 0.00 ?  117 GLN C HE21 1  
ATOM   7766   H  HE22 . GLN C  2 63  ? 47.207  35.433  7.451   1.00 0.00 ?  117 GLN C HE22 1  
ATOM   7767   N  N    . LYS C  2 64  ? 46.268  34.132  3.117   1.00 0.00 ?  118 LYS C N    1  
ATOM   7768   C  CA   . LYS C  2 64  ? 46.709  35.151  2.284   1.00 0.00 ?  118 LYS C CA   1  
ATOM   7769   C  C    . LYS C  2 64  ? 45.593  35.983  1.650   1.00 0.00 ?  118 LYS C C    1  
ATOM   7770   O  O    . LYS C  2 64  ? 45.769  37.083  1.236   1.00 0.00 ?  118 LYS C O    1  
ATOM   7771   C  CB   . LYS C  2 64  ? 47.574  34.562  1.180   1.00 0.00 ?  118 LYS C CB   1  
ATOM   7772   C  CG   . LYS C  2 64  ? 48.922  33.903  1.567   1.00 0.00 ?  118 LYS C CG   1  
ATOM   7773   C  CD   . LYS C  2 64  ? 49.906  34.852  2.138   1.00 0.00 ?  118 LYS C CD   1  
ATOM   7774   C  CE   . LYS C  2 64  ? 51.186  34.270  2.750   1.00 0.00 ?  118 LYS C CE   1  
ATOM   7775   N  NZ   . LYS C  2 64  ? 51.801  35.435  3.476   1.00 0.00 1  118 LYS C NZ   1  
ATOM   7776   H  H    . LYS C  2 64  ? 46.363  33.238  2.686   1.00 0.00 ?  118 LYS C H    1  
ATOM   7777   H  HA   . LYS C  2 64  ? 47.195  35.844  2.956   1.00 0.00 ?  118 LYS C HA   1  
ATOM   7778   H  HB2  . LYS C  2 64  ? 46.936  33.806  0.675   1.00 0.00 ?  118 LYS C HB2  1  
ATOM   7779   H  HB3  . LYS C  2 64  ? 47.818  35.448  0.556   1.00 0.00 ?  118 LYS C HB3  1  
ATOM   7780   H  HG2  . LYS C  2 64  ? 48.656  33.139  2.328   1.00 0.00 ?  118 LYS C HG2  1  
ATOM   7781   H  HG3  . LYS C  2 64  ? 49.295  33.360  0.673   1.00 0.00 ?  118 LYS C HG3  1  
ATOM   7782   H  HD2  . LYS C  2 64  ? 50.193  35.644  1.414   1.00 0.00 ?  118 LYS C HD2  1  
ATOM   7783   H  HD3  . LYS C  2 64  ? 49.376  35.416  2.935   1.00 0.00 ?  118 LYS C HD3  1  
ATOM   7784   H  HE2  . LYS C  2 64  ? 50.915  33.465  3.465   1.00 0.00 ?  118 LYS C HE2  1  
ATOM   7785   H  HE3  . LYS C  2 64  ? 51.893  33.966  1.948   1.00 0.00 ?  118 LYS C HE3  1  
ATOM   7786   H  HZ1  . LYS C  2 64  ? 52.036  36.176  2.785   1.00 0.00 ?  118 LYS C HZ1  1  
ATOM   7787   H  HZ2  . LYS C  2 64  ? 52.747  35.124  3.777   1.00 0.00 ?  118 LYS C HZ2  1  
ATOM   7788   H  HZ3  . LYS C  2 64  ? 51.225  35.798  4.262   1.00 0.00 ?  118 LYS C HZ3  1  
ATOM   7789   N  N    . VAL C  2 65  ? 44.446  35.413  1.573   1.00 0.00 ?  119 VAL C N    1  
ATOM   7790   C  CA   . VAL C  2 65  ? 43.208  36.162  1.189   1.00 0.00 ?  119 VAL C CA   1  
ATOM   7791   C  C    . VAL C  2 65  ? 42.759  36.990  2.404   1.00 0.00 ?  119 VAL C C    1  
ATOM   7792   O  O    . VAL C  2 65  ? 42.005  37.980  2.184   1.00 0.00 ?  119 VAL C O    1  
ATOM   7793   C  CB   . VAL C  2 65  ? 42.133  35.238  0.652   1.00 0.00 ?  119 VAL C CB   1  
ATOM   7794   C  CG1  . VAL C  2 65  ? 41.369  34.441  1.814   1.00 0.00 ?  119 VAL C CG1  1  
ATOM   7795   C  CG2  . VAL C  2 65  ? 41.099  36.108  -0.214  1.00 0.00 ?  119 VAL C CG2  1  
ATOM   7796   H  H    . VAL C  2 65  ? 44.434  34.418  1.631   1.00 0.00 ?  119 VAL C H    1  
ATOM   7797   H  HA   . VAL C  2 65  ? 43.457  36.813  0.363   1.00 0.00 ?  119 VAL C HA   1  
ATOM   7798   H  HB   . VAL C  2 65  ? 42.633  34.474  0.019   1.00 0.00 ?  119 VAL C HB   1  
ATOM   7799   H  HG11 . VAL C  2 65  ? 41.167  35.039  2.729   1.00 0.00 ?  119 VAL C HG11 1  
ATOM   7800   H  HG12 . VAL C  2 65  ? 41.962  33.547  2.105   1.00 0.00 ?  119 VAL C HG12 1  
ATOM   7801   H  HG13 . VAL C  2 65  ? 40.401  34.142  1.359   1.00 0.00 ?  119 VAL C HG13 1  
ATOM   7802   H  HG21 . VAL C  2 65  ? 40.623  35.432  -0.956  1.00 0.00 ?  119 VAL C HG21 1  
ATOM   7803   H  HG22 . VAL C  2 65  ? 41.664  36.853  -0.814  1.00 0.00 ?  119 VAL C HG22 1  
ATOM   7804   H  HG23 . VAL C  2 65  ? 40.242  36.458  0.401   1.00 0.00 ?  119 VAL C HG23 1  
ATOM   7805   N  N    . GLU C  2 66  ? 43.184  36.746  3.660   1.00 0.00 ?  120 GLU C N    1  
ATOM   7806   C  CA   . GLU C  2 66  ? 42.678  37.487  4.783   1.00 0.00 ?  120 GLU C CA   1  
ATOM   7807   C  C    . GLU C  2 66  ? 42.663  39.014  4.801   1.00 0.00 ?  120 GLU C C    1  
ATOM   7808   O  O    . GLU C  2 66  ? 41.626  39.531  5.249   1.00 0.00 ?  120 GLU C O    1  
ATOM   7809   C  CB   . GLU C  2 66  ? 43.507  37.002  5.969   1.00 0.00 ?  120 GLU C CB   1  
ATOM   7810   C  CG   . GLU C  2 66  ? 43.376  35.589  6.543   1.00 0.00 ?  120 GLU C CG   1  
ATOM   7811   C  CD   . GLU C  2 66  ? 42.214  35.315  7.450   1.00 0.00 ?  120 GLU C CD   1  
ATOM   7812   O  OE1  . GLU C  2 66  ? 41.002  35.558  7.045   1.00 0.00 ?  120 GLU C OE1  1  
ATOM   7813   O  OE2  . GLU C  2 66  ? 42.402  34.769  8.583   1.00 0.00 -1 120 GLU C OE2  1  
ATOM   7814   H  H    . GLU C  2 66  ? 43.644  35.901  3.920   1.00 0.00 ?  120 GLU C H    1  
ATOM   7815   H  HA   . GLU C  2 66  ? 41.671  37.186  5.030   1.00 0.00 ?  120 GLU C HA   1  
ATOM   7816   H  HB2  . GLU C  2 66  ? 44.544  37.239  5.647   1.00 0.00 ?  120 GLU C HB2  1  
ATOM   7817   H  HB3  . GLU C  2 66  ? 43.332  37.691  6.823   1.00 0.00 ?  120 GLU C HB3  1  
ATOM   7818   H  HG2  . GLU C  2 66  ? 43.396  34.764  5.800   1.00 0.00 ?  120 GLU C HG2  1  
ATOM   7819   H  HG3  . GLU C  2 66  ? 44.326  35.332  7.059   1.00 0.00 ?  120 GLU C HG3  1  
ATOM   7820   N  N    . PRO C  2 67  ? 43.519  39.927  4.366   1.00 0.00 ?  121 PRO C N    1  
ATOM   7821   C  CA   . PRO C  2 67  ? 43.289  41.329  4.616   1.00 0.00 ?  121 PRO C CA   1  
ATOM   7822   C  C    . PRO C  2 67  ? 42.465  41.891  3.385   1.00 0.00 ?  121 PRO C C    1  
ATOM   7823   O  O    . PRO C  2 67  ? 41.864  42.944  3.496   1.00 0.00 ?  121 PRO C O    1  
ATOM   7824   C  CB   . PRO C  2 67  ? 44.708  41.880  4.639   1.00 0.00 ?  121 PRO C CB   1  
ATOM   7825   C  CG   . PRO C  2 67  ? 45.622  40.901  3.889   1.00 0.00 ?  121 PRO C CG   1  
ATOM   7826   C  CD   . PRO C  2 67  ? 44.886  39.598  4.098   1.00 0.00 ?  121 PRO C CD   1  
ATOM   7827   H  HA   . PRO C  2 67  ? 42.896  41.537  5.600   1.00 0.00 ?  121 PRO C HA   1  
ATOM   7828   H  HB2  . PRO C  2 67  ? 44.821  42.889  4.188   1.00 0.00 ?  121 PRO C HB2  1  
ATOM   7829   H  HB3  . PRO C  2 67  ? 45.010  41.885  5.708   1.00 0.00 ?  121 PRO C HB3  1  
ATOM   7830   H  HG2  . PRO C  2 67  ? 45.694  41.064  2.792   1.00 0.00 ?  121 PRO C HG2  1  
ATOM   7831   H  HG3  . PRO C  2 67  ? 46.654  40.719  4.258   1.00 0.00 ?  121 PRO C HG3  1  
ATOM   7832   H  HD2  . PRO C  2 67  ? 44.914  38.957  3.191   1.00 0.00 ?  121 PRO C HD2  1  
ATOM   7833   H  HD3  . PRO C  2 67  ? 45.258  39.031  4.978   1.00 0.00 ?  121 PRO C HD3  1  
ATOM   7834   N  N    . TYR C  2 68  ? 42.552  41.178  2.208   1.00 0.00 ?  122 TYR C N    1  
ATOM   7835   C  CA   . TYR C  2 68  ? 41.629  41.423  1.091   1.00 0.00 ?  122 TYR C CA   1  
ATOM   7836   C  C    . TYR C  2 68  ? 40.172  41.047  1.488   1.00 0.00 ?  122 TYR C C    1  
ATOM   7837   O  O    . TYR C  2 68  ? 39.208  41.677  1.178   1.00 0.00 ?  122 TYR C O    1  
ATOM   7838   C  CB   . TYR C  2 68  ? 42.123  40.547  -0.106  1.00 0.00 ?  122 TYR C CB   1  
ATOM   7839   C  CG   . TYR C  2 68  ? 41.473  40.915  -1.375  1.00 0.00 ?  122 TYR C CG   1  
ATOM   7840   C  CD1  . TYR C  2 68  ? 40.593  40.015  -1.993  1.00 0.00 ?  122 TYR C CD1  1  
ATOM   7841   C  CD2  . TYR C  2 68  ? 41.646  42.222  -1.908  1.00 0.00 ?  122 TYR C CD2  1  
ATOM   7842   C  CE1  . TYR C  2 68  ? 39.989  40.437  -3.199  1.00 0.00 ?  122 TYR C CE1  1  
ATOM   7843   C  CE2  . TYR C  2 68  ? 40.896  42.672  -3.046  1.00 0.00 ?  122 TYR C CE2  1  
ATOM   7844   C  CZ   . TYR C  2 68  ? 40.114  41.765  -3.700  1.00 0.00 ?  122 TYR C CZ   1  
ATOM   7845   O  OH   . TYR C  2 68  ? 39.330  42.165  -4.743  1.00 0.00 ?  122 TYR C OH   1  
ATOM   7846   H  H    . TYR C  2 68  ? 43.026  40.301  2.218   1.00 0.00 ?  122 TYR C H    1  
ATOM   7847   H  HA   . TYR C  2 68  ? 41.703  42.483  0.900   1.00 0.00 ?  122 TYR C HA   1  
ATOM   7848   H  HB2  . TYR C  2 68  ? 43.217  40.734  -0.168  1.00 0.00 ?  122 TYR C HB2  1  
ATOM   7849   H  HB3  . TYR C  2 68  ? 41.818  39.486  0.022   1.00 0.00 ?  122 TYR C HB3  1  
ATOM   7850   H  HD1  . TYR C  2 68  ? 40.498  38.994  -1.654  1.00 0.00 ?  122 TYR C HD1  1  
ATOM   7851   H  HD2  . TYR C  2 68  ? 42.262  42.927  -1.370  1.00 0.00 ?  122 TYR C HD2  1  
ATOM   7852   H  HE1  . TYR C  2 68  ? 39.400  39.706  -3.734  1.00 0.00 ?  122 TYR C HE1  1  
ATOM   7853   H  HE2  . TYR C  2 68  ? 40.902  43.698  -3.384  1.00 0.00 ?  122 TYR C HE2  1  
ATOM   7854   H  HH   . TYR C  2 68  ? 39.461  43.098  -4.929  1.00 0.00 ?  122 TYR C HH   1  
ATOM   7855   N  N    . LEU C  2 69  ? 40.036  39.980  2.220   1.00 0.00 ?  123 LEU C N    1  
ATOM   7856   C  CA   . LEU C  2 69  ? 38.758  39.587  2.726   1.00 0.00 ?  123 LEU C CA   1  
ATOM   7857   C  C    . LEU C  2 69  ? 38.283  40.569  3.779   1.00 0.00 ?  123 LEU C C    1  
ATOM   7858   O  O    . LEU C  2 69  ? 37.138  40.960  3.661   1.00 0.00 ?  123 LEU C O    1  
ATOM   7859   C  CB   . LEU C  2 69  ? 38.928  38.176  3.389   1.00 0.00 ?  123 LEU C CB   1  
ATOM   7860   C  CG   . LEU C  2 69  ? 37.675  37.636  4.106   1.00 0.00 ?  123 LEU C CG   1  
ATOM   7861   C  CD1  . LEU C  2 69  ? 36.497  37.484  3.199   1.00 0.00 ?  123 LEU C CD1  1  
ATOM   7862   C  CD2  . LEU C  2 69  ? 38.035  36.193  4.531   1.00 0.00 ?  123 LEU C CD2  1  
ATOM   7863   H  H    . LEU C  2 69  ? 40.772  39.339  2.426   1.00 0.00 ?  123 LEU C H    1  
ATOM   7864   H  HA   . LEU C  2 69  ? 38.037  39.582  1.922   1.00 0.00 ?  123 LEU C HA   1  
ATOM   7865   H  HB2  . LEU C  2 69  ? 39.241  37.469  2.591   1.00 0.00 ?  123 LEU C HB2  1  
ATOM   7866   H  HB3  . LEU C  2 69  ? 39.797  38.189  4.081   1.00 0.00 ?  123 LEU C HB3  1  
ATOM   7867   H  HG   . LEU C  2 69  ? 37.490  38.249  5.014   1.00 0.00 ?  123 LEU C HG   1  
ATOM   7868   H  HD11 . LEU C  2 69  ? 36.124  38.476  2.866   1.00 0.00 ?  123 LEU C HD11 1  
ATOM   7869   H  HD12 . LEU C  2 69  ? 35.671  37.071  3.816   1.00 0.00 ?  123 LEU C HD12 1  
ATOM   7870   H  HD13 . LEU C  2 69  ? 36.605  36.785  2.343   1.00 0.00 ?  123 LEU C HD13 1  
ATOM   7871   H  HD21 . LEU C  2 69  ? 38.987  36.236  5.103   1.00 0.00 ?  123 LEU C HD21 1  
ATOM   7872   H  HD22 . LEU C  2 69  ? 38.126  35.514  3.657   1.00 0.00 ?  123 LEU C HD22 1  
ATOM   7873   H  HD23 . LEU C  2 69  ? 37.279  35.918  5.297   1.00 0.00 ?  123 LEU C HD23 1  
ATOM   7874   N  N    . ASP C  2 70  ? 39.144  40.892  4.741   1.00 0.00 ?  124 ASP C N    1  
ATOM   7875   C  CA   . ASP C  2 70  ? 38.800  41.845  5.866   1.00 0.00 ?  124 ASP C CA   1  
ATOM   7876   C  C    . ASP C  2 70  ? 38.160  43.123  5.380   1.00 0.00 ?  124 ASP C C    1  
ATOM   7877   O  O    . ASP C  2 70  ? 37.186  43.563  5.977   1.00 0.00 ?  124 ASP C O    1  
ATOM   7878   C  CB   . ASP C  2 70  ? 40.028  42.053  6.778   1.00 0.00 ?  124 ASP C CB   1  
ATOM   7879   C  CG   . ASP C  2 70  ? 39.896  42.882  8.060   1.00 0.00 ?  124 ASP C CG   1  
ATOM   7880   O  OD1  . ASP C  2 70  ? 38.811  42.871  8.657   1.00 0.00 ?  124 ASP C OD1  1  
ATOM   7881   O  OD2  . ASP C  2 70  ? 40.860  43.384  8.563   1.00 0.00 -1 124 ASP C OD2  1  
ATOM   7882   H  H    . ASP C  2 70  ? 40.007  40.392  4.724   1.00 0.00 ?  124 ASP C H    1  
ATOM   7883   H  HA   . ASP C  2 70  ? 38.063  41.322  6.458   1.00 0.00 ?  124 ASP C HA   1  
ATOM   7884   H  HB2  . ASP C  2 70  ? 40.305  41.040  7.139   1.00 0.00 ?  124 ASP C HB2  1  
ATOM   7885   H  HB3  . ASP C  2 70  ? 40.917  42.434  6.232   1.00 0.00 ?  124 ASP C HB3  1  
ATOM   7886   N  N    . ASP C  2 71  ? 38.833  43.798  4.432   1.00 0.00 ?  125 ASP C N    1  
ATOM   7887   C  CA   . ASP C  2 71  ? 38.379  45.074  3.854   1.00 0.00 ?  125 ASP C CA   1  
ATOM   7888   C  C    . ASP C  2 71  ? 36.919  45.013  3.212   1.00 0.00 ?  125 ASP C C    1  
ATOM   7889   O  O    . ASP C  2 71  ? 36.017  45.853  3.408   1.00 0.00 ?  125 ASP C O    1  
ATOM   7890   C  CB   . ASP C  2 71  ? 39.379  45.503  2.736   1.00 0.00 ?  125 ASP C CB   1  
ATOM   7891   C  CG   . ASP C  2 71  ? 40.599  46.289  3.270   1.00 0.00 ?  125 ASP C CG   1  
ATOM   7892   O  OD1  . ASP C  2 71  ? 41.652  46.251  2.565   1.00 0.00 ?  125 ASP C OD1  1  
ATOM   7893   O  OD2  . ASP C  2 71  ? 40.572  46.890  4.391   1.00 0.00 -1 125 ASP C OD2  1  
ATOM   7894   H  H    . ASP C  2 71  ? 39.655  43.386  4.046   1.00 0.00 ?  125 ASP C H    1  
ATOM   7895   H  HA   . ASP C  2 71  ? 38.361  45.777  4.673   1.00 0.00 ?  125 ASP C HA   1  
ATOM   7896   H  HB2  . ASP C  2 71  ? 39.784  44.638  2.170   1.00 0.00 ?  125 ASP C HB2  1  
ATOM   7897   H  HB3  . ASP C  2 71  ? 38.906  46.065  1.903   1.00 0.00 ?  125 ASP C HB3  1  
ATOM   7898   N  N    . PHE C  2 72  ? 36.648  43.885  2.555   1.00 0.00 ?  126 PHE C N    1  
ATOM   7899   C  CA   . PHE C  2 72  ? 35.365  43.517  1.961   1.00 0.00 ?  126 PHE C CA   1  
ATOM   7900   C  C    . PHE C  2 72  ? 34.379  43.099  3.008   1.00 0.00 ?  126 PHE C C    1  
ATOM   7901   O  O    . PHE C  2 72  ? 33.213  43.497  2.918   1.00 0.00 ?  126 PHE C O    1  
ATOM   7902   C  CB   . PHE C  2 72  ? 35.663  42.479  0.820   1.00 0.00 ?  126 PHE C CB   1  
ATOM   7903   C  CG   . PHE C  2 72  ? 34.330  41.993  0.175   1.00 0.00 ?  126 PHE C CG   1  
ATOM   7904   C  CD1  . PHE C  2 72  ? 33.317  42.859  -0.395  1.00 0.00 ?  126 PHE C CD1  1  
ATOM   7905   C  CD2  . PHE C  2 72  ? 34.073  40.618  0.124   1.00 0.00 ?  126 PHE C CD2  1  
ATOM   7906   C  CE1  . PHE C  2 72  ? 32.112  42.300  -0.903  1.00 0.00 ?  126 PHE C CE1  1  
ATOM   7907   C  CE2  . PHE C  2 72  ? 32.931  40.096  -0.387  1.00 0.00 ?  126 PHE C CE2  1  
ATOM   7908   C  CZ   . PHE C  2 72  ? 31.913  40.904  -0.924  1.00 0.00 ?  126 PHE C CZ   1  
ATOM   7909   H  H    . PHE C  2 72  ? 37.415  43.260  2.429   1.00 0.00 ?  126 PHE C H    1  
ATOM   7910   H  HA   . PHE C  2 72  ? 35.002  44.372  1.410   1.00 0.00 ?  126 PHE C HA   1  
ATOM   7911   H  HB2  . PHE C  2 72  ? 36.380  42.995  0.146   1.00 0.00 ?  126 PHE C HB2  1  
ATOM   7912   H  HB3  . PHE C  2 72  ? 36.134  41.579  1.269   1.00 0.00 ?  126 PHE C HB3  1  
ATOM   7913   H  HD1  . PHE C  2 72  ? 33.470  43.927  -0.438  1.00 0.00 ?  126 PHE C HD1  1  
ATOM   7914   H  HD2  . PHE C  2 72  ? 34.771  39.917  0.557   1.00 0.00 ?  126 PHE C HD2  1  
ATOM   7915   H  HE1  . PHE C  2 72  ? 31.469  42.973  -1.450  1.00 0.00 ?  126 PHE C HE1  1  
ATOM   7916   H  HE2  . PHE C  2 72  ? 32.764  39.029  -0.412  1.00 0.00 ?  126 PHE C HE2  1  
ATOM   7917   H  HZ   . PHE C  2 72  ? 31.032  40.371  -1.248  1.00 0.00 ?  126 PHE C HZ   1  
ATOM   7918   N  N    . GLN C  2 73  ? 34.737  42.390  4.089   1.00 0.00 ?  127 GLN C N    1  
ATOM   7919   C  CA   . GLN C  2 73  ? 33.925  42.133  5.308   1.00 0.00 ?  127 GLN C CA   1  
ATOM   7920   C  C    . GLN C  2 73  ? 33.411  43.393  5.890   1.00 0.00 ?  127 GLN C C    1  
ATOM   7921   O  O    . GLN C  2 73  ? 32.245  43.485  6.061   1.00 0.00 ?  127 GLN C O    1  
ATOM   7922   C  CB   . GLN C  2 73  ? 34.612  41.206  6.382   1.00 0.00 ?  127 GLN C CB   1  
ATOM   7923   C  CG   . GLN C  2 73  ? 34.923  39.669  6.140   1.00 0.00 ?  127 GLN C CG   1  
ATOM   7924   C  CD   . GLN C  2 73  ? 33.659  38.932  5.702   1.00 0.00 ?  127 GLN C CD   1  
ATOM   7925   O  OE1  . GLN C  2 73  ? 32.799  38.643  6.549   1.00 0.00 ?  127 GLN C OE1  1  
ATOM   7926   N  NE2  . GLN C  2 73  ? 33.525  38.645  4.414   1.00 0.00 ?  127 GLN C NE2  1  
ATOM   7927   H  H    . GLN C  2 73  ? 35.601  41.929  3.901   1.00 0.00 ?  127 GLN C H    1  
ATOM   7928   H  HA   . GLN C  2 73  ? 33.005  41.639  5.032   1.00 0.00 ?  127 GLN C HA   1  
ATOM   7929   H  HB2  . GLN C  2 73  ? 35.535  41.683  6.774   1.00 0.00 ?  127 GLN C HB2  1  
ATOM   7930   H  HB3  . GLN C  2 73  ? 33.818  41.087  7.150   1.00 0.00 ?  127 GLN C HB3  1  
ATOM   7931   H  HG2  . GLN C  2 73  ? 35.710  39.660  5.357   1.00 0.00 ?  127 GLN C HG2  1  
ATOM   7932   H  HG3  . GLN C  2 73  ? 35.229  39.260  7.127   1.00 0.00 ?  127 GLN C HG3  1  
ATOM   7933   H  HE21 . GLN C  2 73  ? 32.719  38.089  4.210   1.00 0.00 ?  127 GLN C HE21 1  
ATOM   7934   H  HE22 . GLN C  2 73  ? 34.307  38.817  3.815   1.00 0.00 ?  127 GLN C HE22 1  
ATOM   7935   N  N    . LYS C  2 74  ? 34.298  44.362  6.213   1.00 0.00 ?  128 LYS C N    1  
ATOM   7936   C  CA   . LYS C  2 74  ? 33.872  45.545  6.931   1.00 0.00 ?  128 LYS C CA   1  
ATOM   7937   C  C    . LYS C  2 74  ? 32.840  46.362  6.167   1.00 0.00 ?  128 LYS C C    1  
ATOM   7938   O  O    . LYS C  2 74  ? 31.919  46.847  6.731   1.00 0.00 ?  128 LYS C O    1  
ATOM   7939   C  CB   . LYS C  2 74  ? 35.056  46.471  7.373   1.00 0.00 ?  128 LYS C CB   1  
ATOM   7940   C  CG   . LYS C  2 74  ? 35.803  46.148  8.661   1.00 0.00 ?  128 LYS C CG   1  
ATOM   7941   C  CD   . LYS C  2 74  ? 37.335  46.299  8.686   1.00 0.00 ?  128 LYS C CD   1  
ATOM   7942   C  CE   . LYS C  2 74  ? 38.107  45.999  9.953   1.00 0.00 ?  128 LYS C CE   1  
ATOM   7943   N  NZ   . LYS C  2 74  ? 37.690  44.646  10.510  1.00 0.00 1  128 LYS C NZ   1  
ATOM   7944   H  H    . LYS C  2 74  ? 35.255  44.269  5.950   1.00 0.00 ?  128 LYS C H    1  
ATOM   7945   H  HA   . LYS C  2 74  ? 33.383  45.135  7.803   1.00 0.00 ?  128 LYS C HA   1  
ATOM   7946   H  HB2  . LYS C  2 74  ? 35.831  46.377  6.583   1.00 0.00 ?  128 LYS C HB2  1  
ATOM   7947   H  HB3  . LYS C  2 74  ? 34.789  47.549  7.392   1.00 0.00 ?  128 LYS C HB3  1  
ATOM   7948   H  HG2  . LYS C  2 74  ? 35.274  46.713  9.458   1.00 0.00 ?  128 LYS C HG2  1  
ATOM   7949   H  HG3  . LYS C  2 74  ? 35.559  45.088  8.885   1.00 0.00 ?  128 LYS C HG3  1  
ATOM   7950   H  HD2  . LYS C  2 74  ? 37.609  45.742  7.764   1.00 0.00 ?  128 LYS C HD2  1  
ATOM   7951   H  HD3  . LYS C  2 74  ? 37.554  47.352  8.406   1.00 0.00 ?  128 LYS C HD3  1  
ATOM   7952   H  HE2  . LYS C  2 74  ? 39.196  46.005  9.736   1.00 0.00 ?  128 LYS C HE2  1  
ATOM   7953   H  HE3  . LYS C  2 74  ? 37.787  46.768  10.689  1.00 0.00 ?  128 LYS C HE3  1  
ATOM   7954   H  HZ1  . LYS C  2 74  ? 37.704  44.038  9.667   1.00 0.00 ?  128 LYS C HZ1  1  
ATOM   7955   H  HZ2  . LYS C  2 74  ? 36.729  44.610  10.907  1.00 0.00 ?  128 LYS C HZ2  1  
ATOM   7956   H  HZ3  . LYS C  2 74  ? 38.319  44.259  11.242  1.00 0.00 ?  128 LYS C HZ3  1  
ATOM   7957   N  N    . LYS C  2 75  ? 33.103  46.508  4.865   1.00 0.00 ?  129 LYS C N    1  
ATOM   7958   C  CA   . LYS C  2 75  ? 32.387  47.326  3.896   1.00 0.00 ?  129 LYS C CA   1  
ATOM   7959   C  C    . LYS C  2 75  ? 30.943  46.812  3.642   1.00 0.00 ?  129 LYS C C    1  
ATOM   7960   O  O    . LYS C  2 75  ? 29.901  47.462  3.708   1.00 0.00 ?  129 LYS C O    1  
ATOM   7961   C  CB   . LYS C  2 75  ? 33.183  47.418  2.562   1.00 0.00 ?  129 LYS C CB   1  
ATOM   7962   C  CG   . LYS C  2 75  ? 32.476  47.958  1.274   1.00 0.00 ?  129 LYS C CG   1  
ATOM   7963   C  CD   . LYS C  2 75  ? 33.355  47.899  -0.071  1.00 0.00 ?  129 LYS C CD   1  
ATOM   7964   C  CE   . LYS C  2 75  ? 34.515  48.903  -0.083  1.00 0.00 ?  129 LYS C CE   1  
ATOM   7965   N  NZ   . LYS C  2 75  ? 34.098  50.235  -0.444  1.00 0.00 1  129 LYS C NZ   1  
ATOM   7966   H  H    . LYS C  2 75  ? 34.090  46.421  4.749   1.00 0.00 ?  129 LYS C H    1  
ATOM   7967   H  HA   . LYS C  2 75  ? 32.314  48.327  4.293   1.00 0.00 ?  129 LYS C HA   1  
ATOM   7968   H  HB2  . LYS C  2 75  ? 34.170  47.921  2.644   1.00 0.00 ?  129 LYS C HB2  1  
ATOM   7969   H  HB3  . LYS C  2 75  ? 33.504  46.363  2.426   1.00 0.00 ?  129 LYS C HB3  1  
ATOM   7970   H  HG2  . LYS C  2 75  ? 31.578  47.337  1.071   1.00 0.00 ?  129 LYS C HG2  1  
ATOM   7971   H  HG3  . LYS C  2 75  ? 32.113  48.993  1.455   1.00 0.00 ?  129 LYS C HG3  1  
ATOM   7972   H  HD2  . LYS C  2 75  ? 33.876  46.918  -0.090  1.00 0.00 ?  129 LYS C HD2  1  
ATOM   7973   H  HD3  . LYS C  2 75  ? 32.702  47.986  -0.966  1.00 0.00 ?  129 LYS C HD3  1  
ATOM   7974   H  HE2  . LYS C  2 75  ? 34.990  49.079  0.906   1.00 0.00 ?  129 LYS C HE2  1  
ATOM   7975   H  HE3  . LYS C  2 75  ? 35.312  48.628  -0.807  1.00 0.00 ?  129 LYS C HE3  1  
ATOM   7976   H  HZ1  . LYS C  2 75  ? 34.882  50.913  -0.359  1.00 0.00 ?  129 LYS C HZ1  1  
ATOM   7977   H  HZ2  . LYS C  2 75  ? 33.335  50.622  0.146   1.00 0.00 ?  129 LYS C HZ2  1  
ATOM   7978   H  HZ3  . LYS C  2 75  ? 33.888  50.289  -1.461  1.00 0.00 ?  129 LYS C HZ3  1  
ATOM   7979   N  N    . TRP C  2 76  ? 30.851  45.471  3.465   1.00 0.00 ?  130 TRP C N    1  
ATOM   7980   C  CA   . TRP C  2 76  ? 29.673  44.610  3.507   1.00 0.00 ?  130 TRP C CA   1  
ATOM   7981   C  C    . TRP C  2 76  ? 28.792  44.782  4.789   1.00 0.00 ?  130 TRP C C    1  
ATOM   7982   O  O    . TRP C  2 76  ? 27.610  45.073  4.715   1.00 0.00 ?  130 TRP C O    1  
ATOM   7983   C  CB   . TRP C  2 76  ? 30.157  43.138  3.182   1.00 0.00 ?  130 TRP C CB   1  
ATOM   7984   C  CG   . TRP C  2 76  ? 29.040  42.174  3.216   1.00 0.00 ?  130 TRP C CG   1  
ATOM   7985   C  CD1  . TRP C  2 76  ? 28.506  41.666  4.333   1.00 0.00 ?  130 TRP C CD1  1  
ATOM   7986   C  CD2  . TRP C  2 76  ? 28.343  41.527  2.163   1.00 0.00 ?  130 TRP C CD2  1  
ATOM   7987   N  NE1  . TRP C  2 76  ? 27.388  40.887  4.053   1.00 0.00 ?  130 TRP C NE1  1  
ATOM   7988   C  CE2  . TRP C  2 76  ? 27.352  40.686  2.665   1.00 0.00 ?  130 TRP C CE2  1  
ATOM   7989   C  CE3  . TRP C  2 76  ? 28.503  41.671  0.798   1.00 0.00 ?  130 TRP C CE3  1  
ATOM   7990   C  CZ2  . TRP C  2 76  ? 26.527  39.932  1.822   1.00 0.00 ?  130 TRP C CZ2  1  
ATOM   7991   C  CZ3  . TRP C  2 76  ? 27.639  41.006  -0.041  1.00 0.00 ?  130 TRP C CZ3  1  
ATOM   7992   C  CH2  . TRP C  2 76  ? 26.682  40.133  0.425   1.00 0.00 ?  130 TRP C CH2  1  
ATOM   7993   H  H    . TRP C  2 76  ? 31.714  45.005  3.288   1.00 0.00 ?  130 TRP C H    1  
ATOM   7994   H  HA   . TRP C  2 76  ? 28.972  44.993  2.779   1.00 0.00 ?  130 TRP C HA   1  
ATOM   7995   H  HB2  . TRP C  2 76  ? 30.656  43.116  2.190   1.00 0.00 ?  130 TRP C HB2  1  
ATOM   7996   H  HB3  . TRP C  2 76  ? 31.003  42.797  3.815   1.00 0.00 ?  130 TRP C HB3  1  
ATOM   7997   H  HD1  . TRP C  2 76  ? 28.783  41.901  5.351   1.00 0.00 ?  130 TRP C HD1  1  
ATOM   7998   H  HE1  . TRP C  2 76  ? 26.848  40.341  4.655   1.00 0.00 ?  130 TRP C HE1  1  
ATOM   7999   H  HE3  . TRP C  2 76  ? 29.201  42.390  0.394   1.00 0.00 ?  130 TRP C HE3  1  
ATOM   8000   H  HZ2  . TRP C  2 76  ? 25.870  39.156  2.186   1.00 0.00 ?  130 TRP C HZ2  1  
ATOM   8001   H  HZ3  . TRP C  2 76  ? 27.703  41.117  -1.113  1.00 0.00 ?  130 TRP C HZ3  1  
ATOM   8002   H  HH2  . TRP C  2 76  ? 26.025  39.592  -0.241  1.00 0.00 ?  130 TRP C HH2  1  
ATOM   8003   N  N    . GLN C  2 77  ? 29.448  44.664  5.929   1.00 0.00 ?  131 GLN C N    1  
ATOM   8004   C  CA   . GLN C  2 77  ? 28.724  44.798  7.185   1.00 0.00 ?  131 GLN C CA   1  
ATOM   8005   C  C    . GLN C  2 77  ? 28.227  46.227  7.556   1.00 0.00 ?  131 GLN C C    1  
ATOM   8006   O  O    . GLN C  2 77  ? 27.280  46.452  8.203   1.00 0.00 ?  131 GLN C O    1  
ATOM   8007   C  CB   . GLN C  2 77  ? 29.464  44.338  8.437   1.00 0.00 ?  131 GLN C CB   1  
ATOM   8008   C  CG   . GLN C  2 77  ? 29.712  42.804  8.544   1.00 0.00 ?  131 GLN C CG   1  
ATOM   8009   C  CD   . GLN C  2 77  ? 28.549  41.888  8.170   1.00 0.00 ?  131 GLN C CD   1  
ATOM   8010   O  OE1  . GLN C  2 77  ? 27.487  42.194  7.586   1.00 0.00 ?  131 GLN C OE1  1  
ATOM   8011   N  NE2  . GLN C  2 77  ? 28.771  40.565  8.386   1.00 0.00 ?  131 GLN C NE2  1  
ATOM   8012   H  H    . GLN C  2 77  ? 30.431  44.542  6.047   1.00 0.00 ?  131 GLN C H    1  
ATOM   8013   H  HA   . GLN C  2 77  ? 27.792  44.264  7.072   1.00 0.00 ?  131 GLN C HA   1  
ATOM   8014   H  HB2  . GLN C  2 77  ? 30.488  44.764  8.364   1.00 0.00 ?  131 GLN C HB2  1  
ATOM   8015   H  HB3  . GLN C  2 77  ? 28.965  44.620  9.389   1.00 0.00 ?  131 GLN C HB3  1  
ATOM   8016   H  HG2  . GLN C  2 77  ? 30.549  42.653  7.828   1.00 0.00 ?  131 GLN C HG2  1  
ATOM   8017   H  HG3  . GLN C  2 77  ? 30.061  42.526  9.561   1.00 0.00 ?  131 GLN C HG3  1  
ATOM   8018   H  HE21 . GLN C  2 77  ? 27.998  40.066  7.993   1.00 0.00 ?  131 GLN C HE21 1  
ATOM   8019   H  HE22 . GLN C  2 77  ? 29.578  40.229  8.871   1.00 0.00 ?  131 GLN C HE22 1  
ATOM   8020   N  N    . GLU C  2 78  ? 28.927  47.192  7.037   1.00 0.00 ?  132 GLU C N    1  
ATOM   8021   C  CA   . GLU C  2 78  ? 28.580  48.609  7.324   1.00 0.00 ?  132 GLU C CA   1  
ATOM   8022   C  C    . GLU C  2 78  ? 27.427  49.033  6.489   1.00 0.00 ?  132 GLU C C    1  
ATOM   8023   O  O    . GLU C  2 78  ? 26.600  49.724  7.044   1.00 0.00 ?  132 GLU C O    1  
ATOM   8024   C  CB   . GLU C  2 78  ? 29.819  49.552  6.970   1.00 0.00 ?  132 GLU C CB   1  
ATOM   8025   C  CG   . GLU C  2 78  ? 29.502  51.041  7.115   1.00 0.00 ?  132 GLU C CG   1  
ATOM   8026   C  CD   . GLU C  2 78  ? 30.752  52.000  7.075   1.00 0.00 ?  132 GLU C CD   1  
ATOM   8027   O  OE1  . GLU C  2 78  ? 31.842  51.409  6.831   1.00 0.00 ?  132 GLU C OE1  1  
ATOM   8028   O  OE2  . GLU C  2 78  ? 30.613  53.217  7.404   1.00 0.00 -1 132 GLU C OE2  1  
ATOM   8029   H  H    . GLU C  2 78  ? 29.709  46.985  6.453   1.00 0.00 ?  132 GLU C H    1  
ATOM   8030   H  HA   . GLU C  2 78  ? 28.222  48.649  8.342   1.00 0.00 ?  132 GLU C HA   1  
ATOM   8031   H  HB2  . GLU C  2 78  ? 30.676  49.234  7.601   1.00 0.00 ?  132 GLU C HB2  1  
ATOM   8032   H  HB3  . GLU C  2 78  ? 30.181  49.392  5.931   1.00 0.00 ?  132 GLU C HB3  1  
ATOM   8033   H  HG2  . GLU C  2 78  ? 28.881  51.507  6.320   1.00 0.00 ?  132 GLU C HG2  1  
ATOM   8034   H  HG3  . GLU C  2 78  ? 29.030  51.327  8.079   1.00 0.00 ?  132 GLU C HG3  1  
ATOM   8035   N  N    . GLU C  2 79  ? 27.268  48.477  5.222   1.00 0.00 ?  133 GLU C N    1  
ATOM   8036   C  CA   . GLU C  2 79  ? 26.129  48.893  4.442   1.00 0.00 ?  133 GLU C CA   1  
ATOM   8037   C  C    . GLU C  2 79  ? 24.970  47.914  4.667   1.00 0.00 ?  133 GLU C C    1  
ATOM   8038   O  O    . GLU C  2 79  ? 23.832  48.296  4.504   1.00 0.00 ?  133 GLU C O    1  
ATOM   8039   C  CB   . GLU C  2 79  ? 26.494  48.936  2.881   1.00 0.00 ?  133 GLU C CB   1  
ATOM   8040   C  CG   . GLU C  2 79  ? 27.241  50.215  2.573   1.00 0.00 ?  133 GLU C CG   1  
ATOM   8041   C  CD   . GLU C  2 79  ? 27.198  50.399  1.077   1.00 0.00 ?  133 GLU C CD   1  
ATOM   8042   O  OE1  . GLU C  2 79  ? 27.779  49.560  0.367   1.00 0.00 ?  133 GLU C OE1  1  
ATOM   8043   O  OE2  . GLU C  2 79  ? 26.732  51.426  0.569   1.00 0.00 -1 133 GLU C OE2  1  
ATOM   8044   H  H    . GLU C  2 79  ? 27.970  47.859  4.876   1.00 0.00 ?  133 GLU C H    1  
ATOM   8045   H  HA   . GLU C  2 79  ? 25.756  49.864  4.730   1.00 0.00 ?  133 GLU C HA   1  
ATOM   8046   H  HB2  . GLU C  2 79  ? 27.055  47.998  2.681   1.00 0.00 ?  133 GLU C HB2  1  
ATOM   8047   H  HB3  . GLU C  2 79  ? 25.542  48.889  2.310   1.00 0.00 ?  133 GLU C HB3  1  
ATOM   8048   H  HG2  . GLU C  2 79  ? 26.774  51.075  3.100   1.00 0.00 ?  133 GLU C HG2  1  
ATOM   8049   H  HG3  . GLU C  2 79  ? 28.309  50.094  2.854   1.00 0.00 ?  133 GLU C HG3  1  
ATOM   8050   N  N    . MET C  2 80  ? 25.181  46.678  5.149   1.00 0.00 ?  134 MET C N    1  
ATOM   8051   C  CA   . MET C  2 80  ? 24.127  45.862  5.680   1.00 0.00 ?  134 MET C CA   1  
ATOM   8052   C  C    . MET C  2 80  ? 23.514  46.432  6.873   1.00 0.00 ?  134 MET C C    1  
ATOM   8053   O  O    . MET C  2 80  ? 22.266  46.443  7.058   1.00 0.00 ?  134 MET C O    1  
ATOM   8054   C  CB   . MET C  2 80  ? 24.487  44.337  5.920   1.00 0.00 ?  134 MET C CB   1  
ATOM   8055   C  CG   . MET C  2 80  ? 24.598  43.423  4.665   1.00 0.00 ?  134 MET C CG   1  
ATOM   8056   S  SD   . MET C  2 80  ? 22.896  43.018  3.988   1.00 0.00 ?  134 MET C SD   1  
ATOM   8057   C  CE   . MET C  2 80  ? 23.697  42.026  2.701   1.00 0.00 ?  134 MET C CE   1  
ATOM   8058   H  H    . MET C  2 80  ? 26.133  46.390  5.214   1.00 0.00 ?  134 MET C H    1  
ATOM   8059   H  HA   . MET C  2 80  ? 23.332  45.768  4.954   1.00 0.00 ?  134 MET C HA   1  
ATOM   8060   H  HB2  . MET C  2 80  ? 25.545  44.352  6.260   1.00 0.00 ?  134 MET C HB2  1  
ATOM   8061   H  HB3  . MET C  2 80  ? 23.760  43.851  6.605   1.00 0.00 ?  134 MET C HB3  1  
ATOM   8062   H  HG2  . MET C  2 80  ? 25.289  43.944  3.969   1.00 0.00 ?  134 MET C HG2  1  
ATOM   8063   H  HG3  . MET C  2 80  ? 25.023  42.416  4.866   1.00 0.00 ?  134 MET C HG3  1  
ATOM   8064   H  HE1  . MET C  2 80  ? 24.566  42.646  2.393   1.00 0.00 ?  134 MET C HE1  1  
ATOM   8065   H  HE2  . MET C  2 80  ? 23.065  41.804  1.815   1.00 0.00 ?  134 MET C HE2  1  
ATOM   8066   H  HE3  . MET C  2 80  ? 24.171  41.071  3.012   1.00 0.00 ?  134 MET C HE3  1  
ATOM   8067   N  N    . GLU C  2 81  ? 24.330  46.912  7.794   1.00 0.00 ?  135 GLU C N    1  
ATOM   8068   C  CA   . GLU C  2 81  ? 23.877  47.590  8.979   1.00 0.00 ?  135 GLU C CA   1  
ATOM   8069   C  C    . GLU C  2 81  ? 23.284  48.935  8.724   1.00 0.00 ?  135 GLU C C    1  
ATOM   8070   O  O    . GLU C  2 81  ? 22.238  49.244  9.312   1.00 0.00 ?  135 GLU C O    1  
ATOM   8071   C  CB   . GLU C  2 81  ? 24.978  47.678  10.091  1.00 0.00 ?  135 GLU C CB   1  
ATOM   8072   C  CG   . GLU C  2 81  ? 25.510  46.300  10.690  1.00 0.00 ?  135 GLU C CG   1  
ATOM   8073   C  CD   . GLU C  2 81  ? 24.659  45.876  11.875  1.00 0.00 ?  135 GLU C CD   1  
ATOM   8074   O  OE1  . GLU C  2 81  ? 24.896  44.791  12.471  1.00 0.00 ?  135 GLU C OE1  1  
ATOM   8075   O  OE2  . GLU C  2 81  ? 23.634  46.603  12.183  1.00 0.00 -1 135 GLU C OE2  1  
ATOM   8076   H  H    . GLU C  2 81  ? 25.326  46.892  7.753   1.00 0.00 ?  135 GLU C H    1  
ATOM   8077   H  HA   . GLU C  2 81  ? 23.083  47.077  9.503   1.00 0.00 ?  135 GLU C HA   1  
ATOM   8078   H  HB2  . GLU C  2 81  ? 25.900  48.142  9.681   1.00 0.00 ?  135 GLU C HB2  1  
ATOM   8079   H  HB3  . GLU C  2 81  ? 24.754  48.407  10.899  1.00 0.00 ?  135 GLU C HB3  1  
ATOM   8080   H  HG2  . GLU C  2 81  ? 25.390  45.447  9.990   1.00 0.00 ?  135 GLU C HG2  1  
ATOM   8081   H  HG3  . GLU C  2 81  ? 26.560  46.457  11.018  1.00 0.00 ?  135 GLU C HG3  1  
ATOM   8082   N  N    . LEU C  2 82  ? 23.758  49.800  7.805   1.00 0.00 ?  136 LEU C N    1  
ATOM   8083   C  CA   . LEU C  2 82  ? 23.073  51.044  7.456   1.00 0.00 ?  136 LEU C CA   1  
ATOM   8084   C  C    . LEU C  2 82  ? 21.644  50.772  6.890   1.00 0.00 ?  136 LEU C C    1  
ATOM   8085   O  O    . LEU C  2 82  ? 20.677  51.436  7.169   1.00 0.00 ?  136 LEU C O    1  
ATOM   8086   C  CB   . LEU C  2 82  ? 23.970  51.812  6.487   1.00 0.00 ?  136 LEU C CB   1  
ATOM   8087   C  CG   . LEU C  2 82  ? 23.352  53.088  5.911   1.00 0.00 ?  136 LEU C CG   1  
ATOM   8088   C  CD1  . LEU C  2 82  ? 23.228  54.015  7.074   1.00 0.00 ?  136 LEU C CD1  1  
ATOM   8089   C  CD2  . LEU C  2 82  ? 24.282  53.845  4.966   1.00 0.00 ?  136 LEU C CD2  1  
ATOM   8090   H  H    . LEU C  2 82  ? 24.741  49.709  7.665   1.00 0.00 ?  136 LEU C H    1  
ATOM   8091   H  HA   . LEU C  2 82  ? 22.904  51.643  8.339   1.00 0.00 ?  136 LEU C HA   1  
ATOM   8092   H  HB2  . LEU C  2 82  ? 24.926  52.098  6.975   1.00 0.00 ?  136 LEU C HB2  1  
ATOM   8093   H  HB3  . LEU C  2 82  ? 24.390  51.175  5.679   1.00 0.00 ?  136 LEU C HB3  1  
ATOM   8094   H  HG   . LEU C  2 82  ? 22.368  52.855  5.450   1.00 0.00 ?  136 LEU C HG   1  
ATOM   8095   H  HD11 . LEU C  2 82  ? 22.407  53.643  7.723   1.00 0.00 ?  136 LEU C HD11 1  
ATOM   8096   H  HD12 . LEU C  2 82  ? 23.049  55.042  6.690   1.00 0.00 ?  136 LEU C HD12 1  
ATOM   8097   H  HD13 . LEU C  2 82  ? 24.072  54.082  7.793   1.00 0.00 ?  136 LEU C HD13 1  
ATOM   8098   H  HD21 . LEU C  2 82  ? 24.524  53.213  4.085   1.00 0.00 ?  136 LEU C HD21 1  
ATOM   8099   H  HD22 . LEU C  2 82  ? 25.225  54.112  5.490   1.00 0.00 ?  136 LEU C HD22 1  
ATOM   8100   H  HD23 . LEU C  2 82  ? 23.765  54.741  4.562   1.00 0.00 ?  136 LEU C HD23 1  
ATOM   8101   N  N    . TYR C  2 83  ? 21.568  49.652  6.123   1.00 0.00 ?  137 TYR C N    1  
ATOM   8102   C  CA   . TYR C  2 83  ? 20.301  49.115  5.621   1.00 0.00 ?  137 TYR C CA   1  
ATOM   8103   C  C    . TYR C  2 83  ? 19.302  48.640  6.621   1.00 0.00 ?  137 TYR C C    1  
ATOM   8104   O  O    . TYR C  2 83  ? 18.134  49.031  6.590   1.00 0.00 ?  137 TYR C O    1  
ATOM   8105   C  CB   . TYR C  2 83  ? 20.491  48.069  4.501   1.00 0.00 ?  137 TYR C CB   1  
ATOM   8106   C  CG   . TYR C  2 83  ? 19.210  47.458  3.919   1.00 0.00 ?  137 TYR C CG   1  
ATOM   8107   C  CD1  . TYR C  2 83  ? 18.348  48.325  3.209   1.00 0.00 ?  137 TYR C CD1  1  
ATOM   8108   C  CD2  . TYR C  2 83  ? 19.213  46.098  3.509   1.00 0.00 ?  137 TYR C CD2  1  
ATOM   8109   C  CE1  . TYR C  2 83  ? 17.305  47.825  2.393   1.00 0.00 ?  137 TYR C CE1  1  
ATOM   8110   C  CE2  . TYR C  2 83  ? 18.184  45.489  2.807   1.00 0.00 ?  137 TYR C CE2  1  
ATOM   8111   C  CZ   . TYR C  2 83  ? 17.249  46.435  2.278   1.00 0.00 ?  137 TYR C CZ   1  
ATOM   8112   O  OH   . TYR C  2 83  ? 16.276  45.861  1.458   1.00 0.00 ?  137 TYR C OH   1  
ATOM   8113   H  H    . TYR C  2 83  ? 22.416  49.136  6.030   1.00 0.00 ?  137 TYR C H    1  
ATOM   8114   H  HA   . TYR C  2 83  ? 19.727  49.941  5.227   1.00 0.00 ?  137 TYR C HA   1  
ATOM   8115   H  HB2  . TYR C  2 83  ? 21.159  48.492  3.721   1.00 0.00 ?  137 TYR C HB2  1  
ATOM   8116   H  HB3  . TYR C  2 83  ? 20.963  47.176  4.963   1.00 0.00 ?  137 TYR C HB3  1  
ATOM   8117   H  HD1  . TYR C  2 83  ? 18.499  49.394  3.187   1.00 0.00 ?  137 TYR C HD1  1  
ATOM   8118   H  HD2  . TYR C  2 83  ? 20.048  45.507  3.855   1.00 0.00 ?  137 TYR C HD2  1  
ATOM   8119   H  HE1  . TYR C  2 83  ? 16.572  48.545  2.060   1.00 0.00 ?  137 TYR C HE1  1  
ATOM   8120   H  HE2  . TYR C  2 83  ? 17.964  44.439  2.682   1.00 0.00 ?  137 TYR C HE2  1  
ATOM   8121   H  HH   . TYR C  2 83  ? 15.861  46.596  1.001   1.00 0.00 ?  137 TYR C HH   1  
ATOM   8122   N  N    . ARG C  2 84  ? 19.785  47.879  7.640   1.00 0.00 ?  138 ARG C N    1  
ATOM   8123   C  CA   . ARG C  2 84  ? 18.935  47.382  8.760   1.00 0.00 ?  138 ARG C CA   1  
ATOM   8124   C  C    . ARG C  2 84  ? 18.353  48.574  9.431   1.00 0.00 ?  138 ARG C C    1  
ATOM   8125   O  O    . ARG C  2 84  ? 17.212  48.485  9.831   1.00 0.00 ?  138 ARG C O    1  
ATOM   8126   C  CB   . ARG C  2 84  ? 19.706  46.547  9.773   1.00 0.00 ?  138 ARG C CB   1  
ATOM   8127   C  CG   . ARG C  2 84  ? 19.905  45.101  9.233   1.00 0.00 ?  138 ARG C CG   1  
ATOM   8128   C  CD   . ARG C  2 84  ? 20.733  44.268  10.064  1.00 0.00 ?  138 ARG C CD   1  
ATOM   8129   N  NE   . ARG C  2 84  ? 20.763  42.866  9.515   1.00 0.00 ?  138 ARG C NE   1  
ATOM   8130   C  CZ   . ARG C  2 84  ? 20.238  41.780  10.050  1.00 0.00 ?  138 ARG C CZ   1  
ATOM   8131   N  NH1  . ARG C  2 84  ? 20.494  40.655  9.342   1.00 0.00 1  138 ARG C NH1  1  
ATOM   8132   N  NH2  . ARG C  2 84  ? 19.526  41.741  11.174  1.00 0.00 ?  138 ARG C NH2  1  
ATOM   8133   H  H    . ARG C  2 84  ? 20.731  47.564  7.661   1.00 0.00 ?  138 ARG C H    1  
ATOM   8134   H  HA   . ARG C  2 84  ? 18.144  46.812  8.296   1.00 0.00 ?  138 ARG C HA   1  
ATOM   8135   H  HB2  . ARG C  2 84  ? 20.748  46.928  9.824   1.00 0.00 ?  138 ARG C HB2  1  
ATOM   8136   H  HB3  . ARG C  2 84  ? 19.231  46.495  10.775  1.00 0.00 ?  138 ARG C HB3  1  
ATOM   8137   H  HG2  . ARG C  2 84  ? 18.876  44.685  9.278   1.00 0.00 ?  138 ARG C HG2  1  
ATOM   8138   H  HG3  . ARG C  2 84  ? 20.309  45.118  8.198   1.00 0.00 ?  138 ARG C HG3  1  
ATOM   8139   H  HD2  . ARG C  2 84  ? 21.751  44.707  10.146  1.00 0.00 ?  138 ARG C HD2  1  
ATOM   8140   H  HD3  . ARG C  2 84  ? 20.378  44.111  11.105  1.00 0.00 ?  138 ARG C HD3  1  
ATOM   8141   H  HE   . ARG C  2 84  ? 21.330  42.713  8.706   1.00 0.00 ?  138 ARG C HE   1  
ATOM   8142   H  HH11 . ARG C  2 84  ? 21.002  40.702  8.482   1.00 0.00 ?  138 ARG C HH11 1  
ATOM   8143   H  HH12 . ARG C  2 84  ? 20.294  39.765  9.750   1.00 0.00 ?  138 ARG C HH12 1  
ATOM   8144   H  HH21 . ARG C  2 84  ? 19.137  42.591  11.530  1.00 0.00 ?  138 ARG C HH21 1  
ATOM   8145   H  HH22 . ARG C  2 84  ? 19.139  40.864  11.459  1.00 0.00 ?  138 ARG C HH22 1  
ATOM   8146   N  N    . GLN C  2 85  ? 19.120  49.695  9.585   1.00 0.00 ?  139 GLN C N    1  
ATOM   8147   C  CA   . GLN C  2 85  ? 18.648  50.801  10.319  1.00 0.00 ?  139 GLN C CA   1  
ATOM   8148   C  C    . GLN C  2 85  ? 17.647  51.601  9.460   1.00 0.00 ?  139 GLN C C    1  
ATOM   8149   O  O    . GLN C  2 85  ? 16.565  52.032  9.885   1.00 0.00 ?  139 GLN C O    1  
ATOM   8150   C  CB   . GLN C  2 85  ? 19.772  51.797  10.740  1.00 0.00 ?  139 GLN C CB   1  
ATOM   8151   C  CG   . GLN C  2 85  ? 20.824  51.274  11.760  1.00 0.00 ?  139 GLN C CG   1  
ATOM   8152   C  CD   . GLN C  2 85  ? 20.290  50.349  12.914  1.00 0.00 ?  139 GLN C CD   1  
ATOM   8153   O  OE1  . GLN C  2 85  ? 19.844  50.841  13.938  1.00 0.00 ?  139 GLN C OE1  1  
ATOM   8154   N  NE2  . GLN C  2 85  ? 20.420  48.979  12.762  1.00 0.00 ?  139 GLN C NE2  1  
ATOM   8155   H  H    . GLN C  2 85  ? 20.049  49.778  9.234   1.00 0.00 ?  139 GLN C H    1  
ATOM   8156   H  HA   . GLN C  2 85  ? 18.170  50.491  11.237  1.00 0.00 ?  139 GLN C HA   1  
ATOM   8157   H  HB2  . GLN C  2 85  ? 20.272  52.127  9.805   1.00 0.00 ?  139 GLN C HB2  1  
ATOM   8158   H  HB3  . GLN C  2 85  ? 19.347  52.721  11.186  1.00 0.00 ?  139 GLN C HB3  1  
ATOM   8159   H  HG2  . GLN C  2 85  ? 21.677  50.780  11.248  1.00 0.00 ?  139 GLN C HG2  1  
ATOM   8160   H  HG3  . GLN C  2 85  ? 21.101  52.177  12.345  1.00 0.00 ?  139 GLN C HG3  1  
ATOM   8161   H  HE21 . GLN C  2 85  ? 20.128  48.388  13.515  1.00 0.00 ?  139 GLN C HE21 1  
ATOM   8162   H  HE22 . GLN C  2 85  ? 21.060  48.729  12.036  1.00 0.00 ?  139 GLN C HE22 1  
ATOM   8163   N  N    . LYS C  2 86  ? 17.972  51.846  8.175   1.00 0.00 ?  140 LYS C N    1  
ATOM   8164   C  CA   . LYS C  2 86  ? 17.182  52.607  7.210   1.00 0.00 ?  140 LYS C CA   1  
ATOM   8165   C  C    . LYS C  2 86  ? 15.829  52.031  6.838   1.00 0.00 ?  140 LYS C C    1  
ATOM   8166   O  O    . LYS C  2 86  ? 14.848  52.734  6.613   1.00 0.00 ?  140 LYS C O    1  
ATOM   8167   C  CB   . LYS C  2 86  ? 17.956  52.627  5.846   1.00 0.00 ?  140 LYS C CB   1  
ATOM   8168   C  CG   . LYS C  2 86  ? 18.978  53.881  5.849   1.00 0.00 ?  140 LYS C CG   1  
ATOM   8169   C  CD   . LYS C  2 86  ? 18.457  55.137  5.077   1.00 0.00 ?  140 LYS C CD   1  
ATOM   8170   C  CE   . LYS C  2 86  ? 18.084  55.059  3.546   1.00 0.00 ?  140 LYS C CE   1  
ATOM   8171   N  NZ   . LYS C  2 86  ? 19.344  54.579  2.776   1.00 0.00 1  140 LYS C NZ   1  
ATOM   8172   H  H    . LYS C  2 86  ? 18.830  51.501  7.800   1.00 0.00 ?  140 LYS C H    1  
ATOM   8173   H  HA   . LYS C  2 86  ? 17.003  53.600  7.596   1.00 0.00 ?  140 LYS C HA   1  
ATOM   8174   H  HB2  . LYS C  2 86  ? 18.559  51.696  5.786   1.00 0.00 ?  140 LYS C HB2  1  
ATOM   8175   H  HB3  . LYS C  2 86  ? 17.238  52.834  5.024   1.00 0.00 ?  140 LYS C HB3  1  
ATOM   8176   H  HG2  . LYS C  2 86  ? 19.236  54.188  6.885   1.00 0.00 ?  140 LYS C HG2  1  
ATOM   8177   H  HG3  . LYS C  2 86  ? 19.871  53.552  5.276   1.00 0.00 ?  140 LYS C HG3  1  
ATOM   8178   H  HD2  . LYS C  2 86  ? 17.512  55.423  5.586   1.00 0.00 ?  140 LYS C HD2  1  
ATOM   8179   H  HD3  . LYS C  2 86  ? 19.167  55.959  5.313   1.00 0.00 ?  140 LYS C HD3  1  
ATOM   8180   H  HE2  . LYS C  2 86  ? 17.308  54.269  3.451   1.00 0.00 ?  140 LYS C HE2  1  
ATOM   8181   H  HE3  . LYS C  2 86  ? 17.786  56.045  3.130   1.00 0.00 ?  140 LYS C HE3  1  
ATOM   8182   H  HZ1  . LYS C  2 86  ? 19.577  53.609  3.071   1.00 0.00 ?  140 LYS C HZ1  1  
ATOM   8183   H  HZ2  . LYS C  2 86  ? 20.146  55.213  2.962   1.00 0.00 ?  140 LYS C HZ2  1  
ATOM   8184   H  HZ3  . LYS C  2 86  ? 19.113  54.525  1.763   1.00 0.00 ?  140 LYS C HZ3  1  
ATOM   8185   N  N    . VAL C  2 87  ? 15.824  50.676  6.733   1.00 0.00 ?  141 VAL C N    1  
ATOM   8186   C  CA   . VAL C  2 87  ? 14.574  50.008  6.388   1.00 0.00 ?  141 VAL C CA   1  
ATOM   8187   C  C    . VAL C  2 87  ? 13.553  49.938  7.484   1.00 0.00 ?  141 VAL C C    1  
ATOM   8188   O  O    . VAL C  2 87  ? 12.401  49.755  7.222   1.00 0.00 ?  141 VAL C O    1  
ATOM   8189   C  CB   . VAL C  2 87  ? 14.846  48.521  5.877   1.00 0.00 ?  141 VAL C CB   1  
ATOM   8190   C  CG1  . VAL C  2 87  ? 15.021  47.549  7.048   1.00 0.00 ?  141 VAL C CG1  1  
ATOM   8191   C  CG2  . VAL C  2 87  ? 13.863  48.077  4.796   1.00 0.00 ?  141 VAL C CG2  1  
ATOM   8192   H  H    . VAL C  2 87  ? 16.681  50.187  6.872   1.00 0.00 ?  141 VAL C H    1  
ATOM   8193   H  HA   . VAL C  2 87  ? 14.016  50.522  5.619   1.00 0.00 ?  141 VAL C HA   1  
ATOM   8194   H  HB   . VAL C  2 87  ? 15.860  48.722  5.469   1.00 0.00 ?  141 VAL C HB   1  
ATOM   8195   H  HG11 . VAL C  2 87  ? 15.303  46.519  6.741   1.00 0.00 ?  141 VAL C HG11 1  
ATOM   8196   H  HG12 . VAL C  2 87  ? 14.108  47.438  7.670   1.00 0.00 ?  141 VAL C HG12 1  
ATOM   8197   H  HG13 . VAL C  2 87  ? 15.877  47.893  7.667   1.00 0.00 ?  141 VAL C HG13 1  
ATOM   8198   H  HG21 . VAL C  2 87  ? 12.794  48.143  5.092   1.00 0.00 ?  141 VAL C HG21 1  
ATOM   8199   H  HG22 . VAL C  2 87  ? 14.084  47.042  4.456   1.00 0.00 ?  141 VAL C HG22 1  
ATOM   8200   H  HG23 . VAL C  2 87  ? 13.990  48.783  3.948   1.00 0.00 ?  141 VAL C HG23 1  
ATOM   8201   N  N    . GLU C  2 88  ? 13.951  50.198  8.748   1.00 0.00 ?  142 GLU C N    1  
ATOM   8202   C  CA   . GLU C  2 88  ? 13.120  49.936  9.898   1.00 0.00 ?  142 GLU C CA   1  
ATOM   8203   C  C    . GLU C  2 88  ? 11.756  50.635  10.119  1.00 0.00 ?  142 GLU C C    1  
ATOM   8204   O  O    . GLU C  2 88  ? 10.860  49.834  10.481  1.00 0.00 ?  142 GLU C O    1  
ATOM   8205   C  CB   . GLU C  2 88  ? 13.949  50.143  11.205  1.00 0.00 ?  142 GLU C CB   1  
ATOM   8206   C  CG   . GLU C  2 88  ? 13.240  50.327  12.645  1.00 0.00 ?  142 GLU C CG   1  
ATOM   8207   C  CD   . GLU C  2 88  ? 14.228  50.227  13.809  1.00 0.00 ?  142 GLU C CD   1  
ATOM   8208   O  OE1  . GLU C  2 88  ? 15.309  49.670  13.604  1.00 0.00 ?  142 GLU C OE1  1  
ATOM   8209   O  OE2  . GLU C  2 88  ? 13.938  50.796  14.924  1.00 0.00 -1 142 GLU C OE2  1  
ATOM   8210   H  H    . GLU C  2 88  ? 14.894  50.492  8.883   1.00 0.00 ?  142 GLU C H    1  
ATOM   8211   H  HA   . GLU C  2 88  ? 12.964  48.867  9.915   1.00 0.00 ?  142 GLU C HA   1  
ATOM   8212   H  HB2  . GLU C  2 88  ? 14.812  49.445  11.150  1.00 0.00 ?  142 GLU C HB2  1  
ATOM   8213   H  HB3  . GLU C  2 88  ? 14.487  51.104  11.058  1.00 0.00 ?  142 GLU C HB3  1  
ATOM   8214   H  HG2  . GLU C  2 88  ? 12.771  51.334  12.673  1.00 0.00 ?  142 GLU C HG2  1  
ATOM   8215   H  HG3  . GLU C  2 88  ? 12.530  49.477  12.729  1.00 0.00 ?  142 GLU C HG3  1  
ATOM   8216   N  N    . PRO C  2 89  ? 11.574  51.950  9.894   1.00 0.00 ?  143 PRO C N    1  
ATOM   8217   C  CA   . PRO C  2 89  ? 10.302  52.518  9.900   1.00 0.00 ?  143 PRO C CA   1  
ATOM   8218   C  C    . PRO C  2 89  ? 9.420   52.092  8.777   1.00 0.00 ?  143 PRO C C    1  
ATOM   8219   O  O    . PRO C  2 89  ? 8.201   52.173  8.865   1.00 0.00 ?  143 PRO C O    1  
ATOM   8220   C  CB   . PRO C  2 89  ? 10.601  54.043  9.871   1.00 0.00 ?  143 PRO C CB   1  
ATOM   8221   C  CG   . PRO C  2 89  ? 12.033  54.161  9.263   1.00 0.00 ?  143 PRO C CG   1  
ATOM   8222   C  CD   . PRO C  2 89  ? 12.687  52.897  9.776   1.00 0.00 ?  143 PRO C CD   1  
ATOM   8223   H  HA   . PRO C  2 89  ? 9.792   52.225  10.805  1.00 0.00 ?  143 PRO C HA   1  
ATOM   8224   H  HB2  . PRO C  2 89  ? 9.789   54.619  9.380   1.00 0.00 ?  143 PRO C HB2  1  
ATOM   8225   H  HB3  . PRO C  2 89  ? 10.583  54.442  10.908  1.00 0.00 ?  143 PRO C HB3  1  
ATOM   8226   H  HG2  . PRO C  2 89  ? 11.776  54.227  8.185   1.00 0.00 ?  143 PRO C HG2  1  
ATOM   8227   H  HG3  . PRO C  2 89  ? 12.435  55.169  9.504   1.00 0.00 ?  143 PRO C HG3  1  
ATOM   8228   H  HD2  . PRO C  2 89  ? 13.525  52.558  9.130   1.00 0.00 ?  143 PRO C HD2  1  
ATOM   8229   H  HD3  . PRO C  2 89  ? 13.109  53.005  10.798  1.00 0.00 ?  143 PRO C HD3  1  
ATOM   8230   N  N    . LEU C  2 90  ? 10.024  51.729  7.584   1.00 0.00 ?  144 LEU C N    1  
ATOM   8231   C  CA   . LEU C  2 90  ? 9.349   51.267  6.383   1.00 0.00 ?  144 LEU C CA   1  
ATOM   8232   C  C    . LEU C  2 90  ? 8.689   49.842  6.572   1.00 0.00 ?  144 LEU C C    1  
ATOM   8233   O  O    . LEU C  2 90  ? 7.550   49.572  6.261   1.00 0.00 ?  144 LEU C O    1  
ATOM   8234   C  CB   . LEU C  2 90  ? 10.385  51.185  5.188   1.00 0.00 ?  144 LEU C CB   1  
ATOM   8235   C  CG   . LEU C  2 90  ? 11.127  52.427  4.878   1.00 0.00 ?  144 LEU C CG   1  
ATOM   8236   C  CD1  . LEU C  2 90  ? 12.064  52.189  3.659   1.00 0.00 ?  144 LEU C CD1  1  
ATOM   8237   C  CD2  . LEU C  2 90  ? 10.280  53.729  4.564   1.00 0.00 ?  144 LEU C CD2  1  
ATOM   8238   H  H    . LEU C  2 90  ? 11.013  51.642  7.492   1.00 0.00 ?  144 LEU C H    1  
ATOM   8239   H  HA   . LEU C  2 90  ? 8.690   52.068  6.083   1.00 0.00 ?  144 LEU C HA   1  
ATOM   8240   H  HB2  . LEU C  2 90  ? 11.116  50.375  5.400   1.00 0.00 ?  144 LEU C HB2  1  
ATOM   8241   H  HB3  . LEU C  2 90  ? 9.841   50.984  4.241   1.00 0.00 ?  144 LEU C HB3  1  
ATOM   8242   H  HG   . LEU C  2 90  ? 11.781  52.741  5.719   1.00 0.00 ?  144 LEU C HG   1  
ATOM   8243   H  HD11 . LEU C  2 90  ? 11.434  51.681  2.898   1.00 0.00 ?  144 LEU C HD11 1  
ATOM   8244   H  HD12 . LEU C  2 90  ? 12.852  51.447  3.910   1.00 0.00 ?  144 LEU C HD12 1  
ATOM   8245   H  HD13 . LEU C  2 90  ? 12.619  53.082  3.300   1.00 0.00 ?  144 LEU C HD13 1  
ATOM   8246   H  HD21 . LEU C  2 90  ? 9.760   53.460  3.620   1.00 0.00 ?  144 LEU C HD21 1  
ATOM   8247   H  HD22 . LEU C  2 90  ? 10.934  54.608  4.382   1.00 0.00 ?  144 LEU C HD22 1  
ATOM   8248   H  HD23 . LEU C  2 90  ? 9.594   53.883  5.425   1.00 0.00 ?  144 LEU C HD23 1  
ATOM   8249   N  N    . ARG C  2 91  ? 9.381   48.878  7.250   1.00 0.00 ?  145 ARG C N    1  
ATOM   8250   C  CA   . ARG C  2 91  ? 8.954   47.551  7.611   1.00 0.00 ?  145 ARG C CA   1  
ATOM   8251   C  C    . ARG C  2 91  ? 7.616   47.530  8.220   1.00 0.00 ?  145 ARG C C    1  
ATOM   8252   O  O    . ARG C  2 91  ? 6.700   46.875  7.758   1.00 0.00 ?  145 ARG C O    1  
ATOM   8253   C  CB   . ARG C  2 91  ? 9.908   46.776  8.404   1.00 0.00 ?  145 ARG C CB   1  
ATOM   8254   C  CG   . ARG C  2 91  ? 11.290  46.371  7.841   1.00 0.00 ?  145 ARG C CG   1  
ATOM   8255   C  CD   . ARG C  2 91  ? 11.258  45.711  6.452   1.00 0.00 ?  145 ARG C CD   1  
ATOM   8256   N  NE   . ARG C  2 91  ? 12.458  44.831  6.436   1.00 0.00 ?  145 ARG C NE   1  
ATOM   8257   C  CZ   . ARG C  2 91  ? 13.041  44.425  5.266   1.00 0.00 ?  145 ARG C CZ   1  
ATOM   8258   N  NH1  . ARG C  2 91  ? 14.283  43.955  5.348   1.00 0.00 1  145 ARG C NH1  1  
ATOM   8259   N  NH2  . ARG C  2 91  ? 12.568  44.645  4.065   1.00 0.00 ?  145 ARG C NH2  1  
ATOM   8260   H  H    . ARG C  2 91  ? 10.286  49.171  7.551   1.00 0.00 ?  145 ARG C H    1  
ATOM   8261   H  HA   . ARG C  2 91  ? 8.904   47.038  6.662   1.00 0.00 ?  145 ARG C HA   1  
ATOM   8262   H  HB2  . ARG C  2 91  ? 10.051  47.044  9.473   1.00 0.00 ?  145 ARG C HB2  1  
ATOM   8263   H  HB3  . ARG C  2 91  ? 9.359   45.824  8.565   1.00 0.00 ?  145 ARG C HB3  1  
ATOM   8264   H  HG2  . ARG C  2 91  ? 11.983  47.237  7.776   1.00 0.00 ?  145 ARG C HG2  1  
ATOM   8265   H  HG3  . ARG C  2 91  ? 11.681  45.707  8.641   1.00 0.00 ?  145 ARG C HG3  1  
ATOM   8266   H  HD2  . ARG C  2 91  ? 10.343  45.113  6.252   1.00 0.00 ?  145 ARG C HD2  1  
ATOM   8267   H  HD3  . ARG C  2 91  ? 11.337  46.460  5.636   1.00 0.00 ?  145 ARG C HD3  1  
ATOM   8268   H  HE   . ARG C  2 91  ? 13.019  44.704  7.254   1.00 0.00 ?  145 ARG C HE   1  
ATOM   8269   H  HH11 . ARG C  2 91  ? 14.740  43.962  6.237   1.00 0.00 ?  145 ARG C HH11 1  
ATOM   8270   H  HH12 . ARG C  2 91  ? 14.776  43.818  4.488   1.00 0.00 ?  145 ARG C HH12 1  
ATOM   8271   H  HH21 . ARG C  2 91  ? 13.131  44.453  3.261   1.00 0.00 ?  145 ARG C HH21 1  
ATOM   8272   H  HH22 . ARG C  2 91  ? 11.607  44.916  4.013   1.00 0.00 ?  145 ARG C HH22 1  
ATOM   8273   N  N    . ALA C  2 92  ? 7.502   48.237  9.357   1.00 0.00 ?  146 ALA C N    1  
ATOM   8274   C  CA   . ALA C  2 92  ? 6.303   48.404  10.165  1.00 0.00 ?  146 ALA C CA   1  
ATOM   8275   C  C    . ALA C  2 92  ? 5.270   49.145  9.334   1.00 0.00 ?  146 ALA C C    1  
ATOM   8276   O  O    . ALA C  2 92  ? 4.091   48.777  9.340   1.00 0.00 ?  146 ALA C O    1  
ATOM   8277   C  CB   . ALA C  2 92  ? 6.576   49.173  11.483  1.00 0.00 ?  146 ALA C CB   1  
ATOM   8278   H  H    . ALA C  2 92  ? 8.338   48.505  9.830   1.00 0.00 ?  146 ALA C H    1  
ATOM   8279   H  HA   . ALA C  2 92  ? 5.926   47.401  10.304  1.00 0.00 ?  146 ALA C HA   1  
ATOM   8280   H  HB1  . ALA C  2 92  ? 5.624   49.514  11.945  1.00 0.00 ?  146 ALA C HB1  1  
ATOM   8281   H  HB2  . ALA C  2 92  ? 7.220   50.075  11.401  1.00 0.00 ?  146 ALA C HB2  1  
ATOM   8282   H  HB3  . ALA C  2 92  ? 7.003   48.472  12.231  1.00 0.00 ?  146 ALA C HB3  1  
ATOM   8283   N  N    . GLU C  2 93  ? 5.654   50.167  8.616   1.00 0.00 ?  147 GLU C N    1  
ATOM   8284   C  CA   . GLU C  2 93  ? 4.761   50.899  7.808   1.00 0.00 ?  147 GLU C CA   1  
ATOM   8285   C  C    . GLU C  2 93  ? 4.079   50.171  6.657   1.00 0.00 ?  147 GLU C C    1  
ATOM   8286   O  O    . GLU C  2 93  ? 2.903   50.406  6.432   1.00 0.00 ?  147 GLU C O    1  
ATOM   8287   C  CB   . GLU C  2 93  ? 5.462   52.218  7.225   1.00 0.00 ?  147 GLU C CB   1  
ATOM   8288   C  CG   . GLU C  2 93  ? 4.744   53.031  6.035   1.00 0.00 ?  147 GLU C CG   1  
ATOM   8289   C  CD   . GLU C  2 93  ? 5.160   54.476  5.963   1.00 0.00 ?  147 GLU C CD   1  
ATOM   8290   O  OE1  . GLU C  2 93  ? 5.595   54.879  4.811   1.00 0.00 ?  147 GLU C OE1  1  
ATOM   8291   O  OE2  . GLU C  2 93  ? 5.092   55.222  6.987   1.00 0.00 -1 147 GLU C OE2  1  
ATOM   8292   H  H    . GLU C  2 93  ? 6.571   50.547  8.712   1.00 0.00 ?  147 GLU C H    1  
ATOM   8293   H  HA   . GLU C  2 93  ? 3.972   51.246  8.459   1.00 0.00 ?  147 GLU C HA   1  
ATOM   8294   H  HB2  . GLU C  2 93  ? 5.652   52.868  8.107   1.00 0.00 ?  147 GLU C HB2  1  
ATOM   8295   H  HB3  . GLU C  2 93  ? 6.486   52.049  6.827   1.00 0.00 ?  147 GLU C HB3  1  
ATOM   8296   H  HG2  . GLU C  2 93  ? 5.085   52.421  5.171   1.00 0.00 ?  147 GLU C HG2  1  
ATOM   8297   H  HG3  . GLU C  2 93  ? 3.637   52.943  6.076   1.00 0.00 ?  147 GLU C HG3  1  
ATOM   8298   N  N    . LEU C  2 94  ? 4.762   49.317  5.948   1.00 0.00 ?  148 LEU C N    1  
ATOM   8299   C  CA   . LEU C  2 94  ? 4.257   48.583  4.825   1.00 0.00 ?  148 LEU C CA   1  
ATOM   8300   C  C    . LEU C  2 94  ? 3.295   47.519  5.337   1.00 0.00 ?  148 LEU C C    1  
ATOM   8301   O  O    . LEU C  2 94  ? 2.255   47.189  4.787   1.00 0.00 ?  148 LEU C O    1  
ATOM   8302   C  CB   . LEU C  2 94  ? 5.463   47.854  4.118   1.00 0.00 ?  148 LEU C CB   1  
ATOM   8303   C  CG   . LEU C  2 94  ? 5.196   46.784  3.063   1.00 0.00 ?  148 LEU C CG   1  
ATOM   8304   C  CD1  . LEU C  2 94  ? 4.534   47.317  1.768   1.00 0.00 ?  148 LEU C CD1  1  
ATOM   8305   C  CD2  . LEU C  2 94  ? 6.535   46.022  2.825   1.00 0.00 ?  148 LEU C CD2  1  
ATOM   8306   H  H    . LEU C  2 94  ? 5.743   49.416  6.098   1.00 0.00 ?  148 LEU C H    1  
ATOM   8307   H  HA   . LEU C  2 94  ? 3.786   49.219  4.089   1.00 0.00 ?  148 LEU C HA   1  
ATOM   8308   H  HB2  . LEU C  2 94  ? 6.060   48.661  3.641   1.00 0.00 ?  148 LEU C HB2  1  
ATOM   8309   H  HB3  . LEU C  2 94  ? 5.967   47.334  4.960   1.00 0.00 ?  148 LEU C HB3  1  
ATOM   8310   H  HG   . LEU C  2 94  ? 4.524   46.024  3.515   1.00 0.00 ?  148 LEU C HG   1  
ATOM   8311   H  HD11 . LEU C  2 94  ? 3.572   47.828  1.986   1.00 0.00 ?  148 LEU C HD11 1  
ATOM   8312   H  HD12 . LEU C  2 94  ? 4.245   46.479  1.100   1.00 0.00 ?  148 LEU C HD12 1  
ATOM   8313   H  HD13 . LEU C  2 94  ? 5.253   48.037  1.321   1.00 0.00 ?  148 LEU C HD13 1  
ATOM   8314   H  HD21 . LEU C  2 94  ? 6.993   45.862  3.825   1.00 0.00 ?  148 LEU C HD21 1  
ATOM   8315   H  HD22 . LEU C  2 94  ? 7.326   46.599  2.300   1.00 0.00 ?  148 LEU C HD22 1  
ATOM   8316   H  HD23 . LEU C  2 94  ? 6.338   45.035  2.355   1.00 0.00 ?  148 LEU C HD23 1  
ATOM   8317   N  N    . GLN C  2 95  ? 3.627   46.953  6.517   1.00 0.00 ?  149 GLN C N    1  
ATOM   8318   C  CA   . GLN C  2 95  ? 2.749   46.038  7.180   1.00 0.00 ?  149 GLN C CA   1  
ATOM   8319   C  C    . GLN C  2 95  ? 1.443   46.693  7.608   1.00 0.00 ?  149 GLN C C    1  
ATOM   8320   O  O    . GLN C  2 95  ? 0.402   46.059  7.497   1.00 0.00 ?  149 GLN C O    1  
ATOM   8321   C  CB   . GLN C  2 95  ? 3.421   45.332  8.425   1.00 0.00 ?  149 GLN C CB   1  
ATOM   8322   C  CG   . GLN C  2 95  ? 4.465   44.267  8.171   1.00 0.00 ?  149 GLN C CG   1  
ATOM   8323   C  CD   . GLN C  2 95  ? 4.322   43.318  7.025   1.00 0.00 ?  149 GLN C CD   1  
ATOM   8324   O  OE1  . GLN C  2 95  ? 5.236   43.272  6.169   1.00 0.00 ?  149 GLN C OE1  1  
ATOM   8325   N  NE2  . GLN C  2 95  ? 3.181   42.685  6.915   1.00 0.00 ?  149 GLN C NE2  1  
ATOM   8326   H  H    . GLN C  2 95  ? 4.385   47.260  7.088   1.00 0.00 ?  149 GLN C H    1  
ATOM   8327   H  HA   . GLN C  2 95  ? 2.494   45.295  6.438   1.00 0.00 ?  149 GLN C HA   1  
ATOM   8328   H  HB2  . GLN C  2 95  ? 3.836   46.214  8.958   1.00 0.00 ?  149 GLN C HB2  1  
ATOM   8329   H  HB3  . GLN C  2 95  ? 2.712   44.924  9.177   1.00 0.00 ?  149 GLN C HB3  1  
ATOM   8330   H  HG2  . GLN C  2 95  ? 5.453   44.773  8.139   1.00 0.00 ?  149 GLN C HG2  1  
ATOM   8331   H  HG3  . GLN C  2 95  ? 4.439   43.657  9.099   1.00 0.00 ?  149 GLN C HG3  1  
ATOM   8332   H  HE21 . GLN C  2 95  ? 3.022   42.148  6.087   1.00 0.00 ?  149 GLN C HE21 1  
ATOM   8333   H  HE22 . GLN C  2 95  ? 2.394   42.850  7.509   1.00 0.00 ?  149 GLN C HE22 1  
ATOM   8334   N  N    . GLU C  2 96  ? 1.470   47.937  8.186   1.00 0.00 ?  150 GLU C N    1  
ATOM   8335   C  CA   . GLU C  2 96  ? 0.291   48.699  8.505   1.00 0.00 ?  150 GLU C CA   1  
ATOM   8336   C  C    . GLU C  2 96  ? -0.523  49.055  7.205   1.00 0.00 ?  150 GLU C C    1  
ATOM   8337   O  O    . GLU C  2 96  ? -1.762  48.898  7.137   1.00 0.00 ?  150 GLU C O    1  
ATOM   8338   C  CB   . GLU C  2 96  ? 0.712   50.029  9.120   1.00 0.00 ?  150 GLU C CB   1  
ATOM   8339   C  CG   . GLU C  2 96  ? 0.995   49.902  10.639  1.00 0.00 ?  150 GLU C CG   1  
ATOM   8340   C  CD   . GLU C  2 96  ? 1.303   51.193  11.314  1.00 0.00 ?  150 GLU C CD   1  
ATOM   8341   O  OE1  . GLU C  2 96  ? 2.240   51.253  12.164  1.00 0.00 ?  150 GLU C OE1  1  
ATOM   8342   O  OE2  . GLU C  2 96  ? 0.534   52.142  11.099  1.00 0.00 -1 150 GLU C OE2  1  
ATOM   8343   H  H    . GLU C  2 96  ? 2.335   48.381  8.405   1.00 0.00 ?  150 GLU C H    1  
ATOM   8344   H  HA   . GLU C  2 96  ? -0.420  48.321  9.224   1.00 0.00 ?  150 GLU C HA   1  
ATOM   8345   H  HB2  . GLU C  2 96  ? 1.628   50.495  8.697   1.00 0.00 ?  150 GLU C HB2  1  
ATOM   8346   H  HB3  . GLU C  2 96  ? -0.161  50.696  8.960   1.00 0.00 ?  150 GLU C HB3  1  
ATOM   8347   H  HG2  . GLU C  2 96  ? 0.059   49.500  11.083  1.00 0.00 ?  150 GLU C HG2  1  
ATOM   8348   H  HG3  . GLU C  2 96  ? 1.866   49.326  11.020  1.00 0.00 ?  150 GLU C HG3  1  
ATOM   8349   N  N    . GLY C  2 97  ? 0.262   49.340  6.159   1.00 0.00 ?  151 GLY C N    1  
ATOM   8350   C  CA   . GLY C  2 97  ? -0.219  49.725  4.882   1.00 0.00 ?  151 GLY C CA   1  
ATOM   8351   C  C    . GLY C  2 97  ? -1.017  48.652  4.225   1.00 0.00 ?  151 GLY C C    1  
ATOM   8352   O  O    . GLY C  2 97  ? -2.087  48.941  3.639   1.00 0.00 ?  151 GLY C O    1  
ATOM   8353   H  H    . GLY C  2 97  ? 1.247   49.381  6.306   1.00 0.00 ?  151 GLY C H    1  
ATOM   8354   H  HA2  . GLY C  2 97  ? -0.751  50.661  4.963   1.00 0.00 ?  151 GLY C HA2  1  
ATOM   8355   H  HA3  . GLY C  2 97  ? 0.677   49.836  4.290   1.00 0.00 ?  151 GLY C HA3  1  
ATOM   8356   N  N    . ALA C  2 98  ? -0.595  47.377  4.366   1.00 0.00 ?  152 ALA C N    1  
ATOM   8357   C  CA   . ALA C  2 98  ? -1.400  46.227  3.921   1.00 0.00 ?  152 ALA C CA   1  
ATOM   8358   C  C    . ALA C  2 98  ? -2.584  45.907  4.806   1.00 0.00 ?  152 ALA C C    1  
ATOM   8359   O  O    . ALA C  2 98  ? -3.614  45.459  4.334   1.00 0.00 ?  152 ALA C O    1  
ATOM   8360   C  CB   . ALA C  2 98  ? -0.467  45.016  4.056   1.00 0.00 ?  152 ALA C CB   1  
ATOM   8361   H  H    . ALA C  2 98  ? 0.266   47.218  4.843   1.00 0.00 ?  152 ALA C H    1  
ATOM   8362   H  HA   . ALA C  2 98  ? -1.751  46.302  2.902   1.00 0.00 ?  152 ALA C HA   1  
ATOM   8363   H  HB1  . ALA C  2 98  ? 0.144   45.007  4.984   1.00 0.00 ?  152 ALA C HB1  1  
ATOM   8364   H  HB2  . ALA C  2 98  ? 0.189   45.084  3.162   1.00 0.00 ?  152 ALA C HB2  1  
ATOM   8365   H  HB3  . ALA C  2 98  ? -0.958  44.023  4.135   1.00 0.00 ?  152 ALA C HB3  1  
ATOM   8366   N  N    . ARG C  2 99  ? -2.595  46.067  6.161   1.00 0.00 ?  153 ARG C N    1  
ATOM   8367   C  CA   . ARG C  2 99  ? -3.797  45.827  7.023   1.00 0.00 ?  153 ARG C CA   1  
ATOM   8368   C  C    . ARG C  2 99  ? -4.855  46.879  6.714   1.00 0.00 ?  153 ARG C C    1  
ATOM   8369   O  O    . ARG C  2 99  ? -6.020  46.642  6.485   1.00 0.00 ?  153 ARG C O    1  
ATOM   8370   C  CB   . ARG C  2 99  ? -3.595  45.920  8.580   1.00 0.00 ?  153 ARG C CB   1  
ATOM   8371   C  CG   . ARG C  2 99  ? -2.495  44.941  9.030   1.00 0.00 ?  153 ARG C CG   1  
ATOM   8372   C  CD   . ARG C  2 99  ? -2.219  44.817  10.602  1.00 0.00 ?  153 ARG C CD   1  
ATOM   8373   N  NE   . ARG C  2 99  ? -3.550  44.390  11.249  1.00 0.00 ?  153 ARG C NE   1  
ATOM   8374   C  CZ   . ARG C  2 99  ? -4.499  45.158  11.789  1.00 0.00 ?  153 ARG C CZ   1  
ATOM   8375   N  NH1  . ARG C  2 99  ? -5.594  44.581  12.189  1.00 0.00 1  153 ARG C NH1  1  
ATOM   8376   N  NH2  . ARG C  2 99  ? -4.451  46.470  11.852  1.00 0.00 ?  153 ARG C NH2  1  
ATOM   8377   H  H    . ARG C  2 99  ? -1.796  46.563  6.491   1.00 0.00 ?  153 ARG C H    1  
ATOM   8378   H  HA   . ARG C  2 99  ? -4.126  44.825  6.791   1.00 0.00 ?  153 ARG C HA   1  
ATOM   8379   H  HB2  . ARG C  2 99  ? -3.329  46.980  8.785   1.00 0.00 ?  153 ARG C HB2  1  
ATOM   8380   H  HB3  . ARG C  2 99  ? -4.568  45.800  9.102   1.00 0.00 ?  153 ARG C HB3  1  
ATOM   8381   H  HG2  . ARG C  2 99  ? -2.846  43.952  8.664   1.00 0.00 ?  153 ARG C HG2  1  
ATOM   8382   H  HG3  . ARG C  2 99  ? -1.538  45.058  8.478   1.00 0.00 ?  153 ARG C HG3  1  
ATOM   8383   H  HD2  . ARG C  2 99  ? -1.434  44.088  10.896  1.00 0.00 ?  153 ARG C HD2  1  
ATOM   8384   H  HD3  . ARG C  2 99  ? -1.911  45.761  11.101  1.00 0.00 ?  153 ARG C HD3  1  
ATOM   8385   H  HE   . ARG C  2 99  ? -3.783  43.421  11.170  1.00 0.00 ?  153 ARG C HE   1  
ATOM   8386   H  HH11 . ARG C  2 99  ? -5.778  43.641  11.900  1.00 0.00 ?  153 ARG C HH11 1  
ATOM   8387   H  HH12 . ARG C  2 99  ? -6.394  45.097  12.495  1.00 0.00 ?  153 ARG C HH12 1  
ATOM   8388   H  HH21 . ARG C  2 99  ? -3.640  46.855  11.412  1.00 0.00 ?  153 ARG C HH21 1  
ATOM   8389   H  HH22 . ARG C  2 99  ? -5.246  47.021  12.106  1.00 0.00 ?  153 ARG C HH22 1  
ATOM   8390   N  N    . GLN C  2 100 ? -4.443  48.170  6.845   1.00 0.00 ?  154 GLN C N    1  
ATOM   8391   C  CA   . GLN C  2 100 ? -5.249  49.380  6.686   1.00 0.00 ?  154 GLN C CA   1  
ATOM   8392   C  C    . GLN C  2 100 ? -5.988  49.439  5.398   1.00 0.00 ?  154 GLN C C    1  
ATOM   8393   O  O    . GLN C  2 100 ? -7.215  49.624  5.453   1.00 0.00 ?  154 GLN C O    1  
ATOM   8394   C  CB   . GLN C  2 100 ? -4.452  50.665  6.931   1.00 0.00 ?  154 GLN C CB   1  
ATOM   8395   C  CG   . GLN C  2 100 ? -4.164  50.998  8.460   1.00 0.00 ?  154 GLN C CG   1  
ATOM   8396   C  CD   . GLN C  2 100 ? -5.289  50.521  9.344   1.00 0.00 ?  154 GLN C CD   1  
ATOM   8397   O  OE1  . GLN C  2 100 ? -6.370  51.080  9.434   1.00 0.00 ?  154 GLN C OE1  1  
ATOM   8398   N  NE2  . GLN C  2 100 ? -5.108  49.228  9.899   1.00 0.00 ?  154 GLN C NE2  1  
ATOM   8399   H  H    . GLN C  2 100 ? -3.472  48.340  6.997   1.00 0.00 ?  154 GLN C H    1  
ATOM   8400   H  HA   . GLN C  2 100 ? -6.021  49.252  7.430   1.00 0.00 ?  154 GLN C HA   1  
ATOM   8401   H  HB2  . GLN C  2 100 ? -3.486  50.623  6.384   1.00 0.00 ?  154 GLN C HB2  1  
ATOM   8402   H  HB3  . GLN C  2 100 ? -4.994  51.546  6.526   1.00 0.00 ?  154 GLN C HB3  1  
ATOM   8403   H  HG2  . GLN C  2 100 ? -3.220  50.541  8.826   1.00 0.00 ?  154 GLN C HG2  1  
ATOM   8404   H  HG3  . GLN C  2 100 ? -3.928  52.081  8.538   1.00 0.00 ?  154 GLN C HG3  1  
ATOM   8405   H  HE21 . GLN C  2 100 ? -5.874  48.925  10.466  1.00 0.00 ?  154 GLN C HE21 1  
ATOM   8406   H  HE22 . GLN C  2 100 ? -4.259  48.701  9.853   1.00 0.00 ?  154 GLN C HE22 1  
ATOM   8407   N  N    . LYS C  2 101 ? -5.291  49.119  4.241   1.00 0.00 ?  155 LYS C N    1  
ATOM   8408   C  CA   . LYS C  2 101 ? -5.812  49.172  2.870   1.00 0.00 ?  155 LYS C CA   1  
ATOM   8409   C  C    . LYS C  2 101 ? -6.770  48.029  2.650   1.00 0.00 ?  155 LYS C C    1  
ATOM   8410   O  O    . LYS C  2 101 ? -7.843  48.253  2.037   1.00 0.00 ?  155 LYS C O    1  
ATOM   8411   C  CB   . LYS C  2 101 ? -4.748  49.339  1.795   1.00 0.00 ?  155 LYS C CB   1  
ATOM   8412   C  CG   . LYS C  2 101 ? -3.947  50.678  2.026   1.00 0.00 ?  155 LYS C CG   1  
ATOM   8413   C  CD   . LYS C  2 101 ? -2.703  50.797  1.011   1.00 0.00 ?  155 LYS C CD   1  
ATOM   8414   C  CE   . LYS C  2 101 ? -1.887  52.101  1.288   1.00 0.00 ?  155 LYS C CE   1  
ATOM   8415   N  NZ   . LYS C  2 101 ? -2.681  53.297  1.445   1.00 0.00 1  155 LYS C NZ   1  
ATOM   8416   H  H    . LYS C  2 101 ? -4.314  48.936  4.324   1.00 0.00 ?  155 LYS C H    1  
ATOM   8417   H  HA   . LYS C  2 101 ? -6.307  50.130  2.807   1.00 0.00 ?  155 LYS C HA   1  
ATOM   8418   H  HB2  . LYS C  2 101 ? -4.049  48.475  1.805   1.00 0.00 ?  155 LYS C HB2  1  
ATOM   8419   H  HB3  . LYS C  2 101 ? -5.043  49.360  0.724   1.00 0.00 ?  155 LYS C HB3  1  
ATOM   8420   H  HG2  . LYS C  2 101 ? -4.619  51.549  1.872   1.00 0.00 ?  155 LYS C HG2  1  
ATOM   8421   H  HG3  . LYS C  2 101 ? -3.604  50.605  3.080   1.00 0.00 ?  155 LYS C HG3  1  
ATOM   8422   H  HD2  . LYS C  2 101 ? -2.052  49.896  1.042   1.00 0.00 ?  155 LYS C HD2  1  
ATOM   8423   H  HD3  . LYS C  2 101 ? -3.198  50.813  0.016   1.00 0.00 ?  155 LYS C HD3  1  
ATOM   8424   H  HE2  . LYS C  2 101 ? -1.430  51.972  2.293   1.00 0.00 ?  155 LYS C HE2  1  
ATOM   8425   H  HE3  . LYS C  2 101 ? -1.098  52.269  0.523   1.00 0.00 ?  155 LYS C HE3  1  
ATOM   8426   H  HZ1  . LYS C  2 101 ? -3.147  53.185  2.368   1.00 0.00 ?  155 LYS C HZ1  1  
ATOM   8427   H  HZ2  . LYS C  2 101 ? -3.473  53.404  0.780   1.00 0.00 ?  155 LYS C HZ2  1  
ATOM   8428   H  HZ3  . LYS C  2 101 ? -2.089  54.149  1.511   1.00 0.00 ?  155 LYS C HZ3  1  
ATOM   8429   N  N    . LEU C  2 102 ? -6.551  46.786  3.254   1.00 0.00 ?  156 LEU C N    1  
ATOM   8430   C  CA   . LEU C  2 102 ? -7.666  45.708  3.303   1.00 0.00 ?  156 LEU C CA   1  
ATOM   8431   C  C    . LEU C  2 102 ? -8.898  46.120  4.043   1.00 0.00 ?  156 LEU C C    1  
ATOM   8432   O  O    . LEU C  2 102 ? -9.962  46.008  3.451   1.00 0.00 ?  156 LEU C O    1  
ATOM   8433   C  CB   . LEU C  2 102 ? -7.119  44.347  3.976   1.00 0.00 ?  156 LEU C CB   1  
ATOM   8434   C  CG   . LEU C  2 102 ? -6.439  43.449  2.880   1.00 0.00 ?  156 LEU C CG   1  
ATOM   8435   C  CD1  . LEU C  2 102 ? -5.506  42.427  3.464   1.00 0.00 ?  156 LEU C CD1  1  
ATOM   8436   C  CD2  . LEU C  2 102 ? -7.550  42.771  1.964   1.00 0.00 ?  156 LEU C CD2  1  
ATOM   8437   H  H    . LEU C  2 102 ? -5.814  46.366  3.778   1.00 0.00 ?  156 LEU C H    1  
ATOM   8438   H  HA   . LEU C  2 102 ? -7.892  45.555  2.258   1.00 0.00 ?  156 LEU C HA   1  
ATOM   8439   H  HB2  . LEU C  2 102 ? -6.392  44.514  4.798   1.00 0.00 ?  156 LEU C HB2  1  
ATOM   8440   H  HB3  . LEU C  2 102 ? -8.019  43.824  4.364   1.00 0.00 ?  156 LEU C HB3  1  
ATOM   8441   H  HG   . LEU C  2 102 ? -5.778  44.030  2.201   1.00 0.00 ?  156 LEU C HG   1  
ATOM   8442   H  HD11 . LEU C  2 102 ? -5.262  41.770  2.601   1.00 0.00 ?  156 LEU C HD11 1  
ATOM   8443   H  HD12 . LEU C  2 102 ? -6.013  41.634  4.054   1.00 0.00 ?  156 LEU C HD12 1  
ATOM   8444   H  HD13 . LEU C  2 102 ? -4.601  42.837  3.961   1.00 0.00 ?  156 LEU C HD13 1  
ATOM   8445   H  HD21 . LEU C  2 102 ? -8.161  42.131  2.636   1.00 0.00 ?  156 LEU C HD21 1  
ATOM   8446   H  HD22 . LEU C  2 102 ? -7.138  42.179  1.120   1.00 0.00 ?  156 LEU C HD22 1  
ATOM   8447   H  HD23 . LEU C  2 102 ? -8.140  43.618  1.552   1.00 0.00 ?  156 LEU C HD23 1  
ATOM   8448   N  N    . HIS C  2 103 ? -8.791  46.859  5.214   1.00 0.00 ?  157 HIS C N    1  
ATOM   8449   C  CA   . HIS C  2 103 ? -9.839  47.377  5.961   1.00 0.00 ?  157 HIS C CA   1  
ATOM   8450   C  C    . HIS C  2 103 ? -10.627 48.466  5.284   1.00 0.00 ?  157 HIS C C    1  
ATOM   8451   O  O    . HIS C  2 103 ? -11.872 48.481  5.322   1.00 0.00 ?  157 HIS C O    1  
ATOM   8452   C  CB   . HIS C  2 103 ? -9.245  47.964  7.306   1.00 0.00 ?  157 HIS C CB   1  
ATOM   8453   C  CG   . HIS C  2 103 ? -8.997  47.016  8.357   1.00 0.00 ?  157 HIS C CG   1  
ATOM   8454   N  ND1  . HIS C  2 103 ? -7.936  46.156  8.376   1.00 0.00 ?  157 HIS C ND1  1  
ATOM   8455   C  CD2  . HIS C  2 103 ? -9.573  46.835  9.615   1.00 0.00 ?  157 HIS C CD2  1  
ATOM   8456   C  CE1  . HIS C  2 103 ? -7.775  45.562  9.613   1.00 0.00 ?  157 HIS C CE1  1  
ATOM   8457   N  NE2  . HIS C  2 103 ? -8.773  45.967  10.389  1.00 0.00 ?  157 HIS C NE2  1  
ATOM   8458   H  H    . HIS C  2 103 ? -7.876  47.090  5.535   1.00 0.00 ?  157 HIS C H    1  
ATOM   8459   H  HA   . HIS C  2 103 ? -10.513 46.556  6.152   1.00 0.00 ?  157 HIS C HA   1  
ATOM   8460   H  HB2  . HIS C  2 103 ? -8.336  48.583  7.147   1.00 0.00 ?  157 HIS C HB2  1  
ATOM   8461   H  HB3  . HIS C  2 103 ? -10.005 48.588  7.823   1.00 0.00 ?  157 HIS C HB3  1  
ATOM   8462   H  HD1  . HIS C  2 103 ? -7.451  45.944  7.527   1.00 0.00 ?  157 HIS C HD1  1  
ATOM   8463   H  HD2  . HIS C  2 103 ? -10.387 47.315  10.144  1.00 0.00 ?  157 HIS C HD2  1  
ATOM   8464   H  HE1  . HIS C  2 103 ? -7.034  44.802  9.862   1.00 0.00 ?  157 HIS C HE1  1  
ATOM   8465   N  N    . GLU C  2 104 ? -9.930  49.301  4.465   1.00 0.00 ?  158 GLU C N    1  
ATOM   8466   C  CA   . GLU C  2 104 ? -10.513 50.203  3.464   1.00 0.00 ?  158 GLU C CA   1  
ATOM   8467   C  C    . GLU C  2 104 ? -11.444 49.571  2.343   1.00 0.00 ?  158 GLU C C    1  
ATOM   8468   O  O    . GLU C  2 104 ? -12.547 49.996  2.157   1.00 0.00 ?  158 GLU C O    1  
ATOM   8469   C  CB   . GLU C  2 104 ? -9.493  51.221  2.805   1.00 0.00 ?  158 GLU C CB   1  
ATOM   8470   C  CG   . GLU C  2 104 ? -9.001  52.279  3.820   1.00 0.00 ?  158 GLU C CG   1  
ATOM   8471   C  CD   . GLU C  2 104 ? -8.189  53.334  3.044   1.00 0.00 ?  158 GLU C CD   1  
ATOM   8472   O  OE1  . GLU C  2 104 ? -7.115  53.041  2.501   1.00 0.00 ?  158 GLU C OE1  1  
ATOM   8473   O  OE2  . GLU C  2 104 ? -8.729  54.421  2.823   1.00 0.00 -1 158 GLU C OE2  1  
ATOM   8474   H  H    . GLU C  2 104 ? -8.945  49.295  4.620   1.00 0.00 ?  158 GLU C H    1  
ATOM   8475   H  HA   . GLU C  2 104 ? -11.161 50.880  4.001   1.00 0.00 ?  158 GLU C HA   1  
ATOM   8476   H  HB2  . GLU C  2 104 ? -8.620  50.606  2.499   1.00 0.00 ?  158 GLU C HB2  1  
ATOM   8477   H  HB3  . GLU C  2 104 ? -10.022 51.708  1.958   1.00 0.00 ?  158 GLU C HB3  1  
ATOM   8478   H  HG2  . GLU C  2 104 ? -9.911  52.823  4.152   1.00 0.00 ?  158 GLU C HG2  1  
ATOM   8479   H  HG3  . GLU C  2 104 ? -8.446  51.899  4.704   1.00 0.00 ?  158 GLU C HG3  1  
ATOM   8480   N  N    . LEU C  2 105 ? -11.030 48.434  1.774   1.00 0.00 ?  159 LEU C N    1  
ATOM   8481   C  CA   . LEU C  2 105 ? -11.787 47.562  0.913   1.00 0.00 ?  159 LEU C CA   1  
ATOM   8482   C  C    . LEU C  2 105 ? -12.855 46.843  1.598   1.00 0.00 ?  159 LEU C C    1  
ATOM   8483   O  O    . LEU C  2 105 ? -13.925 46.582  1.004   1.00 0.00 ?  159 LEU C O    1  
ATOM   8484   C  CB   . LEU C  2 105 ? -10.942 46.549  0.138   1.00 0.00 ?  159 LEU C CB   1  
ATOM   8485   C  CG   . LEU C  2 105 ? -9.778  47.079  -0.680  1.00 0.00 ?  159 LEU C CG   1  
ATOM   8486   C  CD1  . LEU C  2 105 ? -9.117  46.045  -1.616  1.00 0.00 ?  159 LEU C CD1  1  
ATOM   8487   C  CD2  . LEU C  2 105 ? -10.084 48.304  -1.422  1.00 0.00 ?  159 LEU C CD2  1  
ATOM   8488   H  H    . LEU C  2 105 ? -10.102 48.101  1.920   1.00 0.00 ?  159 LEU C H    1  
ATOM   8489   H  HA   . LEU C  2 105 ? -12.279 48.188  0.183   1.00 0.00 ?  159 LEU C HA   1  
ATOM   8490   H  HB2  . LEU C  2 105 ? -10.479 45.845  0.863   1.00 0.00 ?  159 LEU C HB2  1  
ATOM   8491   H  HB3  . LEU C  2 105 ? -11.506 45.894  -0.560  1.00 0.00 ?  159 LEU C HB3  1  
ATOM   8492   H  HG   . LEU C  2 105 ? -8.961  47.285  0.044   1.00 0.00 ?  159 LEU C HG   1  
ATOM   8493   H  HD11 . LEU C  2 105 ? -8.626  45.267  -0.993  1.00 0.00 ?  159 LEU C HD11 1  
ATOM   8494   H  HD12 . LEU C  2 105 ? -8.250  46.523  -2.121  1.00 0.00 ?  159 LEU C HD12 1  
ATOM   8495   H  HD13 . LEU C  2 105 ? -9.786  45.506  -2.320  1.00 0.00 ?  159 LEU C HD13 1  
ATOM   8496   H  HD21 . LEU C  2 105 ? -9.470  48.442  -2.337  1.00 0.00 ?  159 LEU C HD21 1  
ATOM   8497   H  HD22 . LEU C  2 105 ? -9.908  49.268  -0.900  1.00 0.00 ?  159 LEU C HD22 1  
ATOM   8498   H  HD23 . LEU C  2 105 ? -11.127 48.307  -1.807  1.00 0.00 ?  159 LEU C HD23 1  
ATOM   8499   N  N    . GLN C  2 106 ? -12.698 46.429  2.879   1.00 0.00 ?  160 GLN C N    1  
ATOM   8500   C  CA   . GLN C  2 106 ? -13.870 45.806  3.520   1.00 0.00 ?  160 GLN C CA   1  
ATOM   8501   C  C    . GLN C  2 106 ? -15.012 46.740  3.838   1.00 0.00 ?  160 GLN C C    1  
ATOM   8502   O  O    . GLN C  2 106 ? -16.159 46.347  3.985   1.00 0.00 ?  160 GLN C O    1  
ATOM   8503   C  CB   . GLN C  2 106 ? -13.357 45.210  4.917   1.00 0.00 ?  160 GLN C CB   1  
ATOM   8504   C  CG   . GLN C  2 106 ? -12.449 43.960  4.711   1.00 0.00 ?  160 GLN C CG   1  
ATOM   8505   C  CD   . GLN C  2 106 ? -13.040 42.989  3.743   1.00 0.00 ?  160 GLN C CD   1  
ATOM   8506   O  OE1  . GLN C  2 106 ? -12.493 42.778  2.694   1.00 0.00 ?  160 GLN C OE1  1  
ATOM   8507   N  NE2  . GLN C  2 106 ? -14.208 42.436  4.002   1.00 0.00 ?  160 GLN C NE2  1  
ATOM   8508   H  H    . GLN C  2 106 ? -11.865 46.414  3.427   1.00 0.00 ?  160 GLN C H    1  
ATOM   8509   H  HA   . GLN C  2 106 ? -14.301 45.080  2.847   1.00 0.00 ?  160 GLN C HA   1  
ATOM   8510   H  HB2  . GLN C  2 106 ? -12.831 45.998  5.497   1.00 0.00 ?  160 GLN C HB2  1  
ATOM   8511   H  HB3  . GLN C  2 106 ? -14.282 44.936  5.467   1.00 0.00 ?  160 GLN C HB3  1  
ATOM   8512   H  HG2  . GLN C  2 106 ? -11.427 44.187  4.341   1.00 0.00 ?  160 GLN C HG2  1  
ATOM   8513   H  HG3  . GLN C  2 106 ? -12.213 43.456  5.673   1.00 0.00 ?  160 GLN C HG3  1  
ATOM   8514   H  HE21 . GLN C  2 106 ? -14.513 41.744  3.349   1.00 0.00 ?  160 GLN C HE21 1  
ATOM   8515   H  HE22 . GLN C  2 106 ? -14.447 42.420  4.973   1.00 0.00 ?  160 GLN C HE22 1  
ATOM   8516   N  N    . GLU C  2 107 ? -14.695 48.066  4.002   1.00 0.00 ?  161 GLU C N    1  
ATOM   8517   C  CA   . GLU C  2 107 ? -15.599 49.167  4.115   1.00 0.00 ?  161 GLU C CA   1  
ATOM   8518   C  C    . GLU C  2 107 ? -16.426 49.225  2.843   1.00 0.00 ?  161 GLU C C    1  
ATOM   8519   O  O    . GLU C  2 107 ? -17.641 49.389  2.885   1.00 0.00 ?  161 GLU C O    1  
ATOM   8520   C  CB   . GLU C  2 107 ? -14.860 50.581  4.513   1.00 0.00 ?  161 GLU C CB   1  
ATOM   8521   C  CG   . GLU C  2 107 ? -14.536 50.597  6.018   1.00 0.00 ?  161 GLU C CG   1  
ATOM   8522   C  CD   . GLU C  2 107 ? -14.302 52.037  6.457   1.00 0.00 ?  161 GLU C CD   1  
ATOM   8523   O  OE1  . GLU C  2 107 ? -14.774 52.550  7.514   1.00 0.00 ?  161 GLU C OE1  1  
ATOM   8524   O  OE2  . GLU C  2 107 ? -13.659 52.757  5.656   1.00 0.00 -1 161 GLU C OE2  1  
ATOM   8525   H  H    . GLU C  2 107 ? -13.779 48.412  3.816   1.00 0.00 ?  161 GLU C H    1  
ATOM   8526   H  HA   . GLU C  2 107 ? -16.304 48.971  4.909   1.00 0.00 ?  161 GLU C HA   1  
ATOM   8527   H  HB2  . GLU C  2 107 ? -13.931 50.595  3.904   1.00 0.00 ?  161 GLU C HB2  1  
ATOM   8528   H  HB3  . GLU C  2 107 ? -15.494 51.428  4.175   1.00 0.00 ?  161 GLU C HB3  1  
ATOM   8529   H  HG2  . GLU C  2 107 ? -15.376 50.234  6.648   1.00 0.00 ?  161 GLU C HG2  1  
ATOM   8530   H  HG3  . GLU C  2 107 ? -13.709 49.907  6.291   1.00 0.00 ?  161 GLU C HG3  1  
ATOM   8531   N  N    . LYS C  2 108 ? -15.801 49.073  1.705   1.00 0.00 ?  162 LYS C N    1  
ATOM   8532   C  CA   . LYS C  2 108 ? -16.473 49.076  0.426   1.00 0.00 ?  162 LYS C CA   1  
ATOM   8533   C  C    . LYS C  2 108 ? -17.264 47.840  0.187   1.00 0.00 ?  162 LYS C C    1  
ATOM   8534   O  O    . LYS C  2 108 ? -18.276 47.895  -0.587  1.00 0.00 ?  162 LYS C O    1  
ATOM   8535   C  CB   . LYS C  2 108 ? -15.446 49.339  -0.701  1.00 0.00 ?  162 LYS C CB   1  
ATOM   8536   C  CG   . LYS C  2 108 ? -14.543 50.660  -0.629  1.00 0.00 ?  162 LYS C CG   1  
ATOM   8537   C  CD   . LYS C  2 108 ? -15.422 51.865  -0.450  1.00 0.00 ?  162 LYS C CD   1  
ATOM   8538   C  CE   . LYS C  2 108 ? -14.506 53.109  -0.531  1.00 0.00 ?  162 LYS C CE   1  
ATOM   8539   N  NZ   . LYS C  2 108 ? -15.198 54.340  -0.100  1.00 0.00 1  162 LYS C NZ   1  
ATOM   8540   H  H    . LYS C  2 108 ? -14.897 48.690  1.533   1.00 0.00 ?  162 LYS C H    1  
ATOM   8541   H  HA   . LYS C  2 108 ? -17.161 49.904  0.521   1.00 0.00 ?  162 LYS C HA   1  
ATOM   8542   H  HB2  . LYS C  2 108 ? -14.848 48.405  -0.770  1.00 0.00 ?  162 LYS C HB2  1  
ATOM   8543   H  HB3  . LYS C  2 108 ? -15.986 49.430  -1.668  1.00 0.00 ?  162 LYS C HB3  1  
ATOM   8544   H  HG2  . LYS C  2 108 ? -13.876 50.629  0.259   1.00 0.00 ?  162 LYS C HG2  1  
ATOM   8545   H  HG3  . LYS C  2 108 ? -13.951 50.696  -1.569  1.00 0.00 ?  162 LYS C HG3  1  
ATOM   8546   H  HD2  . LYS C  2 108 ? -16.211 51.954  -1.227  1.00 0.00 ?  162 LYS C HD2  1  
ATOM   8547   H  HD3  . LYS C  2 108 ? -15.904 51.752  0.545   1.00 0.00 ?  162 LYS C HD3  1  
ATOM   8548   H  HE2  . LYS C  2 108 ? -13.580 53.055  0.081   1.00 0.00 ?  162 LYS C HE2  1  
ATOM   8549   H  HE3  . LYS C  2 108 ? -14.115 53.196  -1.567  1.00 0.00 ?  162 LYS C HE3  1  
ATOM   8550   H  HZ1  . LYS C  2 108 ? -15.545 54.293  0.879   1.00 0.00 ?  162 LYS C HZ1  1  
ATOM   8551   H  HZ2  . LYS C  2 108 ? -16.074 54.355  -0.661  1.00 0.00 ?  162 LYS C HZ2  1  
ATOM   8552   H  HZ3  . LYS C  2 108 ? -14.672 55.201  -0.352  1.00 0.00 ?  162 LYS C HZ3  1  
ATOM   8553   N  N    . LEU C  2 109 ? -16.861 46.665  0.751   1.00 0.00 ?  163 LEU C N    1  
ATOM   8554   C  CA   . LEU C  2 109 ? -17.619 45.429  0.702   1.00 0.00 ?  163 LEU C CA   1  
ATOM   8555   C  C    . LEU C  2 109 ? -18.661 45.235  1.750   1.00 0.00 ?  163 LEU C C    1  
ATOM   8556   O  O    . LEU C  2 109 ? -19.516 44.417  1.694   1.00 0.00 ?  163 LEU C O    1  
ATOM   8557   C  CB   . LEU C  2 109 ? -16.655 44.203  0.906   1.00 0.00 ?  163 LEU C CB   1  
ATOM   8558   C  CG   . LEU C  2 109 ? -15.822 43.889  -0.310  1.00 0.00 ?  163 LEU C CG   1  
ATOM   8559   C  CD1  . LEU C  2 109 ? -14.627 42.942  0.080   1.00 0.00 ?  163 LEU C CD1  1  
ATOM   8560   C  CD2  . LEU C  2 109 ? -16.667 43.226  -1.385  1.00 0.00 ?  163 LEU C CD2  1  
ATOM   8561   H  H    . LEU C  2 109 ? -15.954 46.602  1.161   1.00 0.00 ?  163 LEU C H    1  
ATOM   8562   H  HA   . LEU C  2 109 ? -18.046 45.321  -0.284  1.00 0.00 ?  163 LEU C HA   1  
ATOM   8563   H  HB2  . LEU C  2 109 ? -15.968 44.512  1.722   1.00 0.00 ?  163 LEU C HB2  1  
ATOM   8564   H  HB3  . LEU C  2 109 ? -17.205 43.291  1.225   1.00 0.00 ?  163 LEU C HB3  1  
ATOM   8565   H  HG   . LEU C  2 109 ? -15.371 44.862  -0.600  1.00 0.00 ?  163 LEU C HG   1  
ATOM   8566   H  HD11 . LEU C  2 109 ? -14.970 41.926  0.368   1.00 0.00 ?  163 LEU C HD11 1  
ATOM   8567   H  HD12 . LEU C  2 109 ? -14.032 43.282  0.954   1.00 0.00 ?  163 LEU C HD12 1  
ATOM   8568   H  HD13 . LEU C  2 109 ? -13.804 42.824  -0.656  1.00 0.00 ?  163 LEU C HD13 1  
ATOM   8569   H  HD21 . LEU C  2 109 ? -16.021 42.887  -2.223  1.00 0.00 ?  163 LEU C HD21 1  
ATOM   8570   H  HD22 . LEU C  2 109 ? -17.433 43.922  -1.789  1.00 0.00 ?  163 LEU C HD22 1  
ATOM   8571   H  HD23 . LEU C  2 109 ? -17.142 42.330  -0.931  1.00 0.00 ?  163 LEU C HD23 1  
ATOM   8572   N  N    . SER C  2 110 ? -18.650 46.061  2.796   1.00 0.00 ?  164 SER C N    1  
ATOM   8573   C  CA   . SER C  2 110 ? -19.564 46.020  3.928   1.00 0.00 ?  164 SER C CA   1  
ATOM   8574   C  C    . SER C  2 110 ? -21.068 46.229  3.519   1.00 0.00 ?  164 SER C C    1  
ATOM   8575   O  O    . SER C  2 110 ? -21.921 45.473  3.958   1.00 0.00 ?  164 SER C O    1  
ATOM   8576   C  CB   . SER C  2 110 ? -19.212 46.963  5.058   1.00 0.00 ?  164 SER C CB   1  
ATOM   8577   O  OG   . SER C  2 110 ? -18.179 46.332  5.833   1.00 0.00 ?  164 SER C OG   1  
ATOM   8578   H  H    . SER C  2 110 ? -17.842 46.645  2.832   1.00 0.00 ?  164 SER C H    1  
ATOM   8579   H  HA   . SER C  2 110 ? -19.687 45.034  4.351   1.00 0.00 ?  164 SER C HA   1  
ATOM   8580   H  HB2  . SER C  2 110 ? -18.658 47.857  4.700   1.00 0.00 ?  164 SER C HB2  1  
ATOM   8581   H  HB3  . SER C  2 110 ? -20.059 47.213  5.732   1.00 0.00 ?  164 SER C HB3  1  
ATOM   8582   H  HG   . SER C  2 110 ? -17.480 46.113  5.213   1.00 0.00 ?  164 SER C HG   1  
ATOM   8583   N  N    . PRO C  2 111 ? -21.408 47.136  2.649   1.00 0.00 ?  165 PRO C N    1  
ATOM   8584   C  CA   . PRO C  2 111 ? -22.866 47.171  2.298   1.00 0.00 ?  165 PRO C CA   1  
ATOM   8585   C  C    . PRO C  2 111 ? -23.493 46.031  1.471   1.00 0.00 ?  165 PRO C C    1  
ATOM   8586   O  O    . PRO C  2 111 ? -24.672 45.777  1.553   1.00 0.00 ?  165 PRO C O    1  
ATOM   8587   C  CB   . PRO C  2 111 ? -22.877 48.384  1.448   1.00 0.00 ?  165 PRO C CB   1  
ATOM   8588   C  CG   . PRO C  2 111 ? -21.727 49.304  1.955   1.00 0.00 ?  165 PRO C CG   1  
ATOM   8589   C  CD   . PRO C  2 111 ? -20.630 48.280  2.140   1.00 0.00 ?  165 PRO C CD   1  
ATOM   8590   H  HA   . PRO C  2 111 ? -23.409 47.369  3.210   1.00 0.00 ?  165 PRO C HA   1  
ATOM   8591   H  HB2  . PRO C  2 111 ? -22.638 48.183  0.382   1.00 0.00 ?  165 PRO C HB2  1  
ATOM   8592   H  HB3  . PRO C  2 111 ? -23.803 48.993  1.524   1.00 0.00 ?  165 PRO C HB3  1  
ATOM   8593   H  HG2  . PRO C  2 111 ? -21.433 50.137  1.281   1.00 0.00 ?  165 PRO C HG2  1  
ATOM   8594   H  HG3  . PRO C  2 111 ? -22.045 49.672  2.954   1.00 0.00 ?  165 PRO C HG3  1  
ATOM   8595   H  HD2  . PRO C  2 111 ? -20.038 48.034  1.232   1.00 0.00 ?  165 PRO C HD2  1  
ATOM   8596   H  HD3  . PRO C  2 111 ? -19.917 48.668  2.899   1.00 0.00 ?  165 PRO C HD3  1  
ATOM   8597   N  N    . LEU C  2 112 ? -22.707 45.328  0.607   1.00 0.00 ?  166 LEU C N    1  
ATOM   8598   C  CA   . LEU C  2 112 ? -22.907 44.079  -0.124  1.00 0.00 ?  166 LEU C CA   1  
ATOM   8599   C  C    . LEU C  2 112 ? -23.210 43.019  0.822   1.00 0.00 ?  166 LEU C C    1  
ATOM   8600   O  O    . LEU C  2 112 ? -24.261 42.363  0.800   1.00 0.00 ?  166 LEU C O    1  
ATOM   8601   C  CB   . LEU C  2 112 ? -21.683 43.826  -0.973  1.00 0.00 ?  166 LEU C CB   1  
ATOM   8602   C  CG   . LEU C  2 112 ? -21.214 44.887  -1.962  1.00 0.00 ?  166 LEU C CG   1  
ATOM   8603   C  CD1  . LEU C  2 112 ? -20.246 44.306  -2.950  1.00 0.00 ?  166 LEU C CD1  1  
ATOM   8604   C  CD2  . LEU C  2 112 ? -22.340 45.654  -2.640  1.00 0.00 ?  166 LEU C CD2  1  
ATOM   8605   H  H    . LEU C  2 112 ? -21.779 45.654  0.443   1.00 0.00 ?  166 LEU C H    1  
ATOM   8606   H  HA   . LEU C  2 112 ? -23.780 44.191  -0.751  1.00 0.00 ?  166 LEU C HA   1  
ATOM   8607   H  HB2  . LEU C  2 112 ? -20.842 43.657  -0.268  1.00 0.00 ?  166 LEU C HB2  1  
ATOM   8608   H  HB3  . LEU C  2 112 ? -21.929 42.867  -1.477  1.00 0.00 ?  166 LEU C HB3  1  
ATOM   8609   H  HG   . LEU C  2 112 ? -20.676 45.710  -1.445  1.00 0.00 ?  166 LEU C HG   1  
ATOM   8610   H  HD11 . LEU C  2 112 ? -19.836 45.083  -3.629  1.00 0.00 ?  166 LEU C HD11 1  
ATOM   8611   H  HD12 . LEU C  2 112 ? -20.670 43.571  -3.666  1.00 0.00 ?  166 LEU C HD12 1  
ATOM   8612   H  HD13 . LEU C  2 112 ? -19.305 43.919  -2.503  1.00 0.00 ?  166 LEU C HD13 1  
ATOM   8613   H  HD21 . LEU C  2 112 ? -21.949 46.324  -3.435  1.00 0.00 ?  166 LEU C HD21 1  
ATOM   8614   H  HD22 . LEU C  2 112 ? -23.020 46.241  -1.985  1.00 0.00 ?  166 LEU C HD22 1  
ATOM   8615   H  HD23 . LEU C  2 112 ? -23.109 44.993  -3.094  1.00 0.00 ?  166 LEU C HD23 1  
ATOM   8616   N  N    . GLY C  2 113 ? -22.344 42.896  1.864   1.00 0.00 ?  167 GLY C N    1  
ATOM   8617   C  CA   . GLY C  2 113 ? -22.393 41.899  2.935   1.00 0.00 ?  167 GLY C CA   1  
ATOM   8618   C  C    . GLY C  2 113 ? -23.718 42.009  3.852   1.00 0.00 ?  167 GLY C C    1  
ATOM   8619   O  O    . GLY C  2 113 ? -24.344 41.020  4.208   1.00 0.00 ?  167 GLY C O    1  
ATOM   8620   H  H    . GLY C  2 113 ? -21.501 43.421  1.777   1.00 0.00 ?  167 GLY C H    1  
ATOM   8621   H  HA2  . GLY C  2 113 ? -22.419 40.954  2.413   1.00 0.00 ?  167 GLY C HA2  1  
ATOM   8622   H  HA3  . GLY C  2 113 ? -21.575 42.112  3.608   1.00 0.00 ?  167 GLY C HA3  1  
ATOM   8623   N  N    . GLU C  2 114 ? -24.084 43.256  4.213   1.00 0.00 ?  168 GLU C N    1  
ATOM   8624   C  CA   . GLU C  2 114 ? -25.321 43.552  4.960   1.00 0.00 ?  168 GLU C CA   1  
ATOM   8625   C  C    . GLU C  2 114 ? -26.536 43.141  4.131   1.00 0.00 ?  168 GLU C C    1  
ATOM   8626   O  O    . GLU C  2 114 ? -27.493 42.559  4.640   1.00 0.00 ?  168 GLU C O    1  
ATOM   8627   C  CB   . GLU C  2 114 ? -25.356 45.042  5.441   1.00 0.00 ?  168 GLU C CB   1  
ATOM   8628   C  CG   . GLU C  2 114 ? -26.761 45.684  5.705   1.00 0.00 ?  168 GLU C CG   1  
ATOM   8629   C  CD   . GLU C  2 114 ? -26.614 46.956  6.605   1.00 0.00 ?  168 GLU C CD   1  
ATOM   8630   O  OE1  . GLU C  2 114 ? -27.075 46.850  7.772   1.00 0.00 ?  168 GLU C OE1  1  
ATOM   8631   O  OE2  . GLU C  2 114 ? -26.140 47.973  6.034   1.00 0.00 -1 168 GLU C OE2  1  
ATOM   8632   H  H    . GLU C  2 114 ? -23.598 44.089  3.960   1.00 0.00 ?  168 GLU C H    1  
ATOM   8633   H  HA   . GLU C  2 114 ? -25.282 42.924  5.838   1.00 0.00 ?  168 GLU C HA   1  
ATOM   8634   H  HB2  . GLU C  2 114 ? -24.683 45.052  6.325   1.00 0.00 ?  168 GLU C HB2  1  
ATOM   8635   H  HB3  . GLU C  2 114 ? -24.830 45.707  4.723   1.00 0.00 ?  168 GLU C HB3  1  
ATOM   8636   H  HG2  . GLU C  2 114 ? -27.231 46.085  4.782   1.00 0.00 ?  168 GLU C HG2  1  
ATOM   8637   H  HG3  . GLU C  2 114 ? -27.536 45.008  6.127   1.00 0.00 ?  168 GLU C HG3  1  
ATOM   8638   N  N    . GLU C  2 115 ? -26.600 43.535  2.846   1.00 0.00 ?  169 GLU C N    1  
ATOM   8639   C  CA   . GLU C  2 115 ? -27.682 43.206  1.882   1.00 0.00 ?  169 GLU C CA   1  
ATOM   8640   C  C    . GLU C  2 115 ? -27.777 41.682  1.622   1.00 0.00 ?  169 GLU C C    1  
ATOM   8641   O  O    . GLU C  2 115 ? -28.878 41.121  1.595   1.00 0.00 ?  169 GLU C O    1  
ATOM   8642   C  CB   . GLU C  2 115 ? -27.551 44.107  0.573   1.00 0.00 ?  169 GLU C CB   1  
ATOM   8643   C  CG   . GLU C  2 115 ? -28.484 43.827  -0.591  1.00 0.00 ?  169 GLU C CG   1  
ATOM   8644   C  CD   . GLU C  2 115 ? -29.898 44.079  -0.372  1.00 0.00 ?  169 GLU C CD   1  
ATOM   8645   O  OE1  . GLU C  2 115 ? -30.770 43.605  -1.124  1.00 0.00 ?  169 GLU C OE1  1  
ATOM   8646   O  OE2  . GLU C  2 115 ? -30.230 44.822  0.623   1.00 0.00 -1 169 GLU C OE2  1  
ATOM   8647   H  H    . GLU C  2 115 ? -25.855 44.104  2.506   1.00 0.00 ?  169 GLU C H    1  
ATOM   8648   H  HA   . GLU C  2 115 ? -28.609 43.419  2.394   1.00 0.00 ?  169 GLU C HA   1  
ATOM   8649   H  HB2  . GLU C  2 115 ? -27.629 45.129  1.003   1.00 0.00 ?  169 GLU C HB2  1  
ATOM   8650   H  HB3  . GLU C  2 115 ? -26.480 43.963  0.316   1.00 0.00 ?  169 GLU C HB3  1  
ATOM   8651   H  HG2  . GLU C  2 115 ? -28.165 44.281  -1.554  1.00 0.00 ?  169 GLU C HG2  1  
ATOM   8652   H  HG3  . GLU C  2 115 ? -28.544 42.722  -0.685  1.00 0.00 ?  169 GLU C HG3  1  
ATOM   8653   N  N    . MET C  2 116 ? -26.657 40.937  1.517   1.00 0.00 ?  170 MET C N    1  
ATOM   8654   C  CA   . MET C  2 116 ? -26.745 39.475  1.389   1.00 0.00 ?  170 MET C CA   1  
ATOM   8655   C  C    . MET C  2 116 ? -27.341 38.735  2.562   1.00 0.00 ?  170 MET C C    1  
ATOM   8656   O  O    . MET C  2 116 ? -28.149 37.818  2.420   1.00 0.00 ?  170 MET C O    1  
ATOM   8657   C  CB   . MET C  2 116 ? -25.333 38.920  1.004   1.00 0.00 ?  170 MET C CB   1  
ATOM   8658   C  CG   . MET C  2 116 ? -25.016 39.061  -0.513  1.00 0.00 ?  170 MET C CG   1  
ATOM   8659   S  SD   . MET C  2 116 ? -23.392 38.422  -1.034  1.00 0.00 ?  170 MET C SD   1  
ATOM   8660   C  CE   . MET C  2 116 ? -23.721 38.379  -2.802  1.00 0.00 ?  170 MET C CE   1  
ATOM   8661   H  H    . MET C  2 116 ? -25.765 41.359  1.382   1.00 0.00 ?  170 MET C H    1  
ATOM   8662   H  HA   . MET C  2 116 ? -27.429 39.283  0.575   1.00 0.00 ?  170 MET C HA   1  
ATOM   8663   H  HB2  . MET C  2 116 ? -24.536 39.482  1.536   1.00 0.00 ?  170 MET C HB2  1  
ATOM   8664   H  HB3  . MET C  2 116 ? -25.299 37.819  1.149   1.00 0.00 ?  170 MET C HB3  1  
ATOM   8665   H  HG2  . MET C  2 116 ? -25.781 38.590  -1.166  1.00 0.00 ?  170 MET C HG2  1  
ATOM   8666   H  HG3  . MET C  2 116 ? -24.998 40.137  -0.790  1.00 0.00 ?  170 MET C HG3  1  
ATOM   8667   H  HE1  . MET C  2 116 ? -22.840 38.018  -3.375  1.00 0.00 ?  170 MET C HE1  1  
ATOM   8668   H  HE2  . MET C  2 116 ? -23.914 39.417  -3.148  1.00 0.00 ?  170 MET C HE2  1  
ATOM   8669   H  HE3  . MET C  2 116 ? -24.592 37.737  -3.053  1.00 0.00 ?  170 MET C HE3  1  
ATOM   8670   N  N    . ARG C  2 117 ? -26.891 39.129  3.762   1.00 0.00 ?  171 ARG C N    1  
ATOM   8671   C  CA   . ARG C  2 117 ? -27.371 38.559  5.015   1.00 0.00 ?  171 ARG C CA   1  
ATOM   8672   C  C    . ARG C  2 117 ? -28.945 38.857  5.121   1.00 0.00 ?  171 ARG C C    1  
ATOM   8673   O  O    . ARG C  2 117 ? -29.752 38.078  5.552   1.00 0.00 ?  171 ARG C O    1  
ATOM   8674   C  CB   . ARG C  2 117 ? -26.487 38.841  6.309   1.00 0.00 ?  171 ARG C CB   1  
ATOM   8675   C  CG   . ARG C  2 117 ? -25.362 37.820  6.393   1.00 0.00 ?  171 ARG C CG   1  
ATOM   8676   C  CD   . ARG C  2 117 ? -24.281 38.321  7.426   1.00 0.00 ?  171 ARG C CD   1  
ATOM   8677   N  NE   . ARG C  2 117 ? -23.254 37.260  7.623   1.00 0.00 ?  171 ARG C NE   1  
ATOM   8678   C  CZ   . ARG C  2 117 ? -22.109 37.421  8.179   1.00 0.00 ?  171 ARG C CZ   1  
ATOM   8679   N  NH1  . ARG C  2 117 ? -21.254 36.438  8.044   1.00 0.00 1  171 ARG C NH1  1  
ATOM   8680   N  NH2  . ARG C  2 117 ? -21.687 38.550  8.684   1.00 0.00 ?  171 ARG C NH2  1  
ATOM   8681   H  H    . ARG C  2 117 ? -26.116 39.749  3.857   1.00 0.00 ?  171 ARG C H    1  
ATOM   8682   H  HA   . ARG C  2 117 ? -27.313 37.488  4.896   1.00 0.00 ?  171 ARG C HA   1  
ATOM   8683   H  HB2  . ARG C  2 117 ? -26.104 39.874  6.166   1.00 0.00 ?  171 ARG C HB2  1  
ATOM   8684   H  HB3  . ARG C  2 117 ? -27.206 38.696  7.143   1.00 0.00 ?  171 ARG C HB3  1  
ATOM   8685   H  HG2  . ARG C  2 117 ? -25.892 36.882  6.668   1.00 0.00 ?  171 ARG C HG2  1  
ATOM   8686   H  HG3  . ARG C  2 117 ? -24.826 37.669  5.432   1.00 0.00 ?  171 ARG C HG3  1  
ATOM   8687   H  HD2  . ARG C  2 117 ? -23.789 39.270  7.126   1.00 0.00 ?  171 ARG C HD2  1  
ATOM   8688   H  HD3  . ARG C  2 117 ? -24.786 38.340  8.416   1.00 0.00 ?  171 ARG C HD3  1  
ATOM   8689   H  HE   . ARG C  2 117 ? -23.466 36.296  7.461   1.00 0.00 ?  171 ARG C HE   1  
ATOM   8690   H  HH11 . ARG C  2 117 ? -20.284 36.592  8.233   1.00 0.00 ?  171 ARG C HH11 1  
ATOM   8691   H  HH12 . ARG C  2 117 ? -21.602 35.600  7.624   1.00 0.00 ?  171 ARG C HH12 1  
ATOM   8692   H  HH21 . ARG C  2 117 ? -22.245 39.379  8.687   1.00 0.00 ?  171 ARG C HH21 1  
ATOM   8693   H  HH22 . ARG C  2 117 ? -20.720 38.533  8.941   1.00 0.00 ?  171 ARG C HH22 1  
ATOM   8694   N  N    . ASP C  2 118 ? -29.339 40.021  4.617   1.00 0.00 ?  172 ASP C N    1  
ATOM   8695   C  CA   . ASP C  2 118 ? -30.689 40.475  4.475   1.00 0.00 ?  172 ASP C CA   1  
ATOM   8696   C  C    . ASP C  2 118 ? -31.503 39.734  3.454   1.00 0.00 ?  172 ASP C C    1  
ATOM   8697   O  O    . ASP C  2 118 ? -32.728 39.643  3.543   1.00 0.00 ?  172 ASP C O    1  
ATOM   8698   C  CB   . ASP C  2 118 ? -30.779 41.966  4.110   1.00 0.00 ?  172 ASP C CB   1  
ATOM   8699   C  CG   . ASP C  2 118 ? -30.658 42.762  5.400   1.00 0.00 ?  172 ASP C CG   1  
ATOM   8700   O  OD1  . ASP C  2 118 ? -30.556 44.022  5.270   1.00 0.00 ?  172 ASP C OD1  1  
ATOM   8701   O  OD2  . ASP C  2 118 ? -30.623 42.120  6.486   1.00 0.00 -1 172 ASP C OD2  1  
ATOM   8702   H  H    . ASP C  2 118 ? -28.715 40.798  4.594   1.00 0.00 ?  172 ASP C H    1  
ATOM   8703   H  HA   . ASP C  2 118 ? -31.072 40.186  5.443   1.00 0.00 ?  172 ASP C HA   1  
ATOM   8704   H  HB2  . ASP C  2 118 ? -30.001 42.066  3.323   1.00 0.00 ?  172 ASP C HB2  1  
ATOM   8705   H  HB3  . ASP C  2 118 ? -31.797 42.143  3.702   1.00 0.00 ?  172 ASP C HB3  1  
ATOM   8706   N  N    . ARG C  2 119 ? -30.797 39.124  2.422   1.00 0.00 ?  173 ARG C N    1  
ATOM   8707   C  CA   . ARG C  2 119 ? -31.477 38.221  1.513   1.00 0.00 ?  173 ARG C CA   1  
ATOM   8708   C  C    . ARG C  2 119 ? -31.625 36.822  2.060   1.00 0.00 ?  173 ARG C C    1  
ATOM   8709   O  O    . ARG C  2 119 ? -32.571 36.104  1.860   1.00 0.00 ?  173 ARG C O    1  
ATOM   8710   C  CB   . ARG C  2 119 ? -30.722 38.127  0.157   1.00 0.00 ?  173 ARG C CB   1  
ATOM   8711   C  CG   . ARG C  2 119 ? -31.013 39.355  -0.753  1.00 0.00 ?  173 ARG C CG   1  
ATOM   8712   C  CD   . ARG C  2 119 ? -30.156 39.594  -2.104  1.00 0.00 ?  173 ARG C CD   1  
ATOM   8713   N  NE   . ARG C  2 119 ? -30.517 38.551  -3.119  1.00 0.00 ?  173 ARG C NE   1  
ATOM   8714   C  CZ   . ARG C  2 119 ? -31.545 38.530  -3.952  1.00 0.00 ?  173 ARG C CZ   1  
ATOM   8715   N  NH1  . ARG C  2 119 ? -31.759 37.461  -4.645  1.00 0.00 1  173 ARG C NH1  1  
ATOM   8716   N  NH2  . ARG C  2 119 ? -32.339 39.577  -4.141  1.00 0.00 ?  173 ARG C NH2  1  
ATOM   8717   H  H    . ARG C  2 119 ? -29.865 39.373  2.173   1.00 0.00 ?  173 ARG C H    1  
ATOM   8718   H  HA   . ARG C  2 119 ? -32.503 38.514  1.345   1.00 0.00 ?  173 ARG C HA   1  
ATOM   8719   H  HB2  . ARG C  2 119 ? -29.630 38.166  0.357   1.00 0.00 ?  173 ARG C HB2  1  
ATOM   8720   H  HB3  . ARG C  2 119 ? -30.903 37.147  -0.335  1.00 0.00 ?  173 ARG C HB3  1  
ATOM   8721   H  HG2  . ARG C  2 119 ? -32.102 39.414  -0.969  1.00 0.00 ?  173 ARG C HG2  1  
ATOM   8722   H  HG3  . ARG C  2 119 ? -30.826 40.224  -0.086  1.00 0.00 ?  173 ARG C HG3  1  
ATOM   8723   H  HD2  . ARG C  2 119 ? -30.372 40.625  -2.456  1.00 0.00 ?  173 ARG C HD2  1  
ATOM   8724   H  HD3  . ARG C  2 119 ? -29.098 39.440  -1.800  1.00 0.00 ?  173 ARG C HD3  1  
ATOM   8725   H  HE   . ARG C  2 119 ? -30.043 37.670  -3.129  1.00 0.00 ?  173 ARG C HE   1  
ATOM   8726   H  HH11 . ARG C  2 119 ? -31.063 36.753  -4.523  1.00 0.00 ?  173 ARG C HH11 1  
ATOM   8727   H  HH12 . ARG C  2 119 ? -32.479 37.433  -5.338  1.00 0.00 ?  173 ARG C HH12 1  
ATOM   8728   H  HH21 . ARG C  2 119 ? -33.085 39.374  -4.775  1.00 0.00 ?  173 ARG C HH21 1  
ATOM   8729   H  HH22 . ARG C  2 119 ? -32.262 40.371  -3.538  1.00 0.00 ?  173 ARG C HH22 1  
ATOM   8730   N  N    . ALA C  2 120 ? -30.583 36.375  2.792   1.00 0.00 ?  174 ALA C N    1  
ATOM   8731   C  CA   . ALA C  2 120 ? -30.631 35.035  3.296   1.00 0.00 ?  174 ALA C CA   1  
ATOM   8732   C  C    . ALA C  2 120 ? -31.725 34.723  4.320   1.00 0.00 ?  174 ALA C C    1  
ATOM   8733   O  O    . ALA C  2 120 ? -32.440 33.705  4.163   1.00 0.00 ?  174 ALA C O    1  
ATOM   8734   C  CB   . ALA C  2 120 ? -29.283 34.754  3.994   1.00 0.00 ?  174 ALA C CB   1  
ATOM   8735   H  H    . ALA C  2 120 ? -29.781 36.947  2.947   1.00 0.00 ?  174 ALA C H    1  
ATOM   8736   H  HA   . ALA C  2 120 ? -30.594 34.411  2.416   1.00 0.00 ?  174 ALA C HA   1  
ATOM   8737   H  HB1  . ALA C  2 120 ? -29.222 35.301  4.959   1.00 0.00 ?  174 ALA C HB1  1  
ATOM   8738   H  HB2  . ALA C  2 120 ? -28.547 35.132  3.253   1.00 0.00 ?  174 ALA C HB2  1  
ATOM   8739   H  HB3  . ALA C  2 120 ? -29.119 33.663  4.128   1.00 0.00 ?  174 ALA C HB3  1  
ATOM   8740   N  N    . ARG C  2 121 ? -31.972 35.701  5.226   1.00 0.00 ?  175 ARG C N    1  
ATOM   8741   C  CA   . ARG C  2 121 ? -33.040 35.656  6.167   1.00 0.00 ?  175 ARG C CA   1  
ATOM   8742   C  C    . ARG C  2 121 ? -34.417 35.609  5.592   1.00 0.00 ?  175 ARG C C    1  
ATOM   8743   O  O    . ARG C  2 121 ? -35.290 34.871  6.030   1.00 0.00 ?  175 ARG C O    1  
ATOM   8744   C  CB   . ARG C  2 121 ? -32.825 36.800  7.160   1.00 0.00 ?  175 ARG C CB   1  
ATOM   8745   C  CG   . ARG C  2 121 ? -34.112 37.112  7.971   1.00 0.00 ?  175 ARG C CG   1  
ATOM   8746   C  CD   . ARG C  2 121 ? -34.007 38.305  8.913   1.00 0.00 ?  175 ARG C CD   1  
ATOM   8747   N  NE   . ARG C  2 121 ? -33.445 39.442  8.185   1.00 0.00 ?  175 ARG C NE   1  
ATOM   8748   C  CZ   . ARG C  2 121 ? -34.043 40.131  7.249   1.00 0.00 ?  175 ARG C CZ   1  
ATOM   8749   N  NH1  . ARG C  2 121 ? -33.412 41.000  6.484   1.00 0.00 1  175 ARG C NH1  1  
ATOM   8750   N  NH2  . ARG C  2 121 ? -35.262 40.023  6.829   1.00 0.00 ?  175 ARG C NH2  1  
ATOM   8751   H  H    . ARG C  2 121 ? -31.262 36.399  5.280   1.00 0.00 ?  175 ARG C H    1  
ATOM   8752   H  HA   . ARG C  2 121 ? -32.976 34.700  6.666   1.00 0.00 ?  175 ARG C HA   1  
ATOM   8753   H  HB2  . ARG C  2 121 ? -32.164 36.440  7.978   1.00 0.00 ?  175 ARG C HB2  1  
ATOM   8754   H  HB3  . ARG C  2 121 ? -32.336 37.694  6.718   1.00 0.00 ?  175 ARG C HB3  1  
ATOM   8755   H  HG2  . ARG C  2 121 ? -35.017 37.275  7.346   1.00 0.00 ?  175 ARG C HG2  1  
ATOM   8756   H  HG3  . ARG C  2 121 ? -34.284 36.268  8.672   1.00 0.00 ?  175 ARG C HG3  1  
ATOM   8757   H  HD2  . ARG C  2 121 ? -35.014 38.645  9.235   1.00 0.00 ?  175 ARG C HD2  1  
ATOM   8758   H  HD3  . ARG C  2 121 ? -33.331 38.134  9.777   1.00 0.00 ?  175 ARG C HD3  1  
ATOM   8759   H  HE   . ARG C  2 121 ? -32.494 39.699  8.359   1.00 0.00 ?  175 ARG C HE   1  
ATOM   8760   H  HH11 . ARG C  2 121 ? -32.424 41.117  6.583   1.00 0.00 ?  175 ARG C HH11 1  
ATOM   8761   H  HH12 . ARG C  2 121 ? -33.857 41.512  5.749   1.00 0.00 ?  175 ARG C HH12 1  
ATOM   8762   H  HH21 . ARG C  2 121 ? -35.433 40.654  6.072   1.00 0.00 ?  175 ARG C HH21 1  
ATOM   8763   H  HH22 . ARG C  2 121 ? -35.885 39.341  7.212   1.00 0.00 ?  175 ARG C HH22 1  
ATOM   8764   N  N    . ALA C  2 122 ? -34.583 36.546  4.629   1.00 0.00 ?  176 ALA C N    1  
ATOM   8765   C  CA   . ALA C  2 122 ? -35.764 36.640  3.766   1.00 0.00 ?  176 ALA C CA   1  
ATOM   8766   C  C    . ALA C  2 122 ? -36.134 35.424  2.876   1.00 0.00 ?  176 ALA C C    1  
ATOM   8767   O  O    . ALA C  2 122 ? -37.307 35.017  2.768   1.00 0.00 ?  176 ALA C O    1  
ATOM   8768   C  CB   . ALA C  2 122 ? -35.766 37.929  2.897   1.00 0.00 ?  176 ALA C CB   1  
ATOM   8769   H  H    . ALA C  2 122 ? -33.795 37.107  4.388   1.00 0.00 ?  176 ALA C H    1  
ATOM   8770   H  HA   . ALA C  2 122 ? -36.572 36.896  4.436   1.00 0.00 ?  176 ALA C HA   1  
ATOM   8771   H  HB1  . ALA C  2 122 ? -35.733 38.807  3.577   1.00 0.00 ?  176 ALA C HB1  1  
ATOM   8772   H  HB2  . ALA C  2 122 ? -36.729 37.974  2.344   1.00 0.00 ?  176 ALA C HB2  1  
ATOM   8773   H  HB3  . ALA C  2 122 ? -34.880 37.969  2.228   1.00 0.00 ?  176 ALA C HB3  1  
ATOM   8774   N  N    . HIS C  2 123 ? -35.123 34.785  2.155   1.00 0.00 ?  177 HIS C N    1  
ATOM   8775   C  CA   . HIS C  2 123 ? -35.423 33.530  1.502   1.00 0.00 ?  177 HIS C CA   1  
ATOM   8776   C  C    . HIS C  2 123 ? -35.941 32.372  2.289   1.00 0.00 ?  177 HIS C C    1  
ATOM   8777   O  O    . HIS C  2 123 ? -36.719 31.584  1.731   1.00 0.00 ?  177 HIS C O    1  
ATOM   8778   C  CB   . HIS C  2 123 ? -34.166 33.001  0.745   1.00 0.00 ?  177 HIS C CB   1  
ATOM   8779   C  CG   . HIS C  2 123 ? -33.717 33.939  -0.344  1.00 0.00 ?  177 HIS C CG   1  
ATOM   8780   N  ND1  . HIS C  2 123 ? -34.578 34.598  -1.242  1.00 0.00 ?  177 HIS C ND1  1  
ATOM   8781   C  CD2  . HIS C  2 123 ? -32.482 34.338  -0.692  1.00 0.00 ?  177 HIS C CD2  1  
ATOM   8782   C  CE1  . HIS C  2 123 ? -33.799 35.236  -2.093  1.00 0.00 ?  177 HIS C CE1  1  
ATOM   8783   N  NE2  . HIS C  2 123 ? -32.495 35.205  -1.773  1.00 0.00 ?  177 HIS C NE2  1  
ATOM   8784   H  H    . HIS C  2 123 ? -34.186 35.099  2.024   1.00 0.00 ?  177 HIS C H    1  
ATOM   8785   H  HA   . HIS C  2 123 ? -36.175 33.766  0.764   1.00 0.00 ?  177 HIS C HA   1  
ATOM   8786   H  HB2  . HIS C  2 123 ? -33.426 32.998  1.573   1.00 0.00 ?  177 HIS C HB2  1  
ATOM   8787   H  HB3  . HIS C  2 123 ? -34.310 31.963  0.376   1.00 0.00 ?  177 HIS C HB3  1  
ATOM   8788   H  HD1  . HIS C  2 123 ? -35.537 34.432  -1.470  1.00 0.00 ?  177 HIS C HD1  1  
ATOM   8789   H  HD2  . HIS C  2 123 ? -31.616 33.864  -0.247  1.00 0.00 ?  177 HIS C HD2  1  
ATOM   8790   H  HE1  . HIS C  2 123 ? -34.177 35.572  -3.059  1.00 0.00 ?  177 HIS C HE1  1  
ATOM   8791   N  N    . VAL C  2 124 ? -35.459 32.160  3.559   1.00 0.00 ?  178 VAL C N    1  
ATOM   8792   C  CA   . VAL C  2 124 ? -36.018 31.326  4.590   1.00 0.00 ?  178 VAL C CA   1  
ATOM   8793   C  C    . VAL C  2 124 ? -37.453 31.673  5.008   1.00 0.00 ?  178 VAL C C    1  
ATOM   8794   O  O    . VAL C  2 124 ? -38.384 30.848  5.039   1.00 0.00 ?  178 VAL C O    1  
ATOM   8795   C  CB   . VAL C  2 124 ? -35.122 31.241  5.800   1.00 0.00 ?  178 VAL C CB   1  
ATOM   8796   C  CG1  . VAL C  2 124 ? -35.727 30.397  6.890   1.00 0.00 ?  178 VAL C CG1  1  
ATOM   8797   C  CG2  . VAL C  2 124 ? -33.703 30.719  5.392   1.00 0.00 ?  178 VAL C CG2  1  
ATOM   8798   H  H    . VAL C  2 124 ? -34.678 32.690  3.879   1.00 0.00 ?  178 VAL C H    1  
ATOM   8799   H  HA   . VAL C  2 124 ? -36.054 30.331  4.171   1.00 0.00 ?  178 VAL C HA   1  
ATOM   8800   H  HB   . VAL C  2 124 ? -34.972 32.283  6.155   1.00 0.00 ?  178 VAL C HB   1  
ATOM   8801   H  HG11 . VAL C  2 124 ? -36.590 30.772  7.481   1.00 0.00 ?  178 VAL C HG11 1  
ATOM   8802   H  HG12 . VAL C  2 124 ? -34.893 30.434  7.624   1.00 0.00 ?  178 VAL C HG12 1  
ATOM   8803   H  HG13 . VAL C  2 124 ? -35.705 29.334  6.568   1.00 0.00 ?  178 VAL C HG13 1  
ATOM   8804   H  HG21 . VAL C  2 124 ? -33.873 29.632  5.239   1.00 0.00 ?  178 VAL C HG21 1  
ATOM   8805   H  HG22 . VAL C  2 124 ? -33.072 30.976  6.270   1.00 0.00 ?  178 VAL C HG22 1  
ATOM   8806   H  HG23 . VAL C  2 124 ? -33.306 31.220  4.483   1.00 0.00 ?  178 VAL C HG23 1  
ATOM   8807   N  N    . ASP C  2 125 ? -37.674 32.989  5.227   1.00 0.00 ?  179 ASP C N    1  
ATOM   8808   C  CA   . ASP C  2 125 ? -38.980 33.507  5.501   1.00 0.00 ?  179 ASP C CA   1  
ATOM   8809   C  C    . ASP C  2 125 ? -40.067 33.196  4.416   1.00 0.00 ?  179 ASP C C    1  
ATOM   8810   O  O    . ASP C  2 125 ? -41.191 32.823  4.702   1.00 0.00 ?  179 ASP C O    1  
ATOM   8811   C  CB   . ASP C  2 125 ? -38.890 35.073  5.702   1.00 0.00 ?  179 ASP C CB   1  
ATOM   8812   C  CG   . ASP C  2 125 ? -39.856 35.583  6.717   1.00 0.00 ?  179 ASP C CG   1  
ATOM   8813   O  OD1  . ASP C  2 125 ? -40.141 36.810  6.794   1.00 0.00 ?  179 ASP C OD1  1  
ATOM   8814   O  OD2  . ASP C  2 125 ? -40.299 34.766  7.614   1.00 0.00 -1 179 ASP C OD2  1  
ATOM   8815   H  H    . ASP C  2 125 ? -36.900 33.615  5.173   1.00 0.00 ?  179 ASP C H    1  
ATOM   8816   H  HA   . ASP C  2 125 ? -39.199 32.993  6.425   1.00 0.00 ?  179 ASP C HA   1  
ATOM   8817   H  HB2  . ASP C  2 125 ? -37.879 35.415  6.009   1.00 0.00 ?  179 ASP C HB2  1  
ATOM   8818   H  HB3  . ASP C  2 125 ? -39.282 35.605  4.809   1.00 0.00 ?  179 ASP C HB3  1  
ATOM   8819   N  N    . ALA C  2 126 ? -39.675 33.325  3.151   1.00 0.00 ?  180 ALA C N    1  
ATOM   8820   C  CA   . ALA C  2 126 ? -40.501 33.010  2.042   1.00 0.00 ?  180 ALA C CA   1  
ATOM   8821   C  C    . ALA C  2 126 ? -40.815 31.502  1.978   1.00 0.00 ?  180 ALA C C    1  
ATOM   8822   O  O    . ALA C  2 126 ? -41.962 31.020  1.841   1.00 0.00 ?  180 ALA C O    1  
ATOM   8823   C  CB   . ALA C  2 126 ? -39.641 33.455  0.768   1.00 0.00 ?  180 ALA C CB   1  
ATOM   8824   H  H    . ALA C  2 126 ? -38.715 33.542  2.993   1.00 0.00 ?  180 ALA C H    1  
ATOM   8825   H  HA   . ALA C  2 126 ? -41.480 33.440  2.196   1.00 0.00 ?  180 ALA C HA   1  
ATOM   8826   H  HB1  . ALA C  2 126 ? -38.620 33.024  0.842   1.00 0.00 ?  180 ALA C HB1  1  
ATOM   8827   H  HB2  . ALA C  2 126 ? -39.453 34.541  0.907   1.00 0.00 ?  180 ALA C HB2  1  
ATOM   8828   H  HB3  . ALA C  2 126 ? -40.218 33.209  -0.149  1.00 0.00 ?  180 ALA C HB3  1  
ATOM   8829   N  N    . LEU C  2 127 ? -39.730 30.652  2.095   1.00 0.00 ?  181 LEU C N    1  
ATOM   8830   C  CA   . LEU C  2 127 ? -39.714 29.229  2.120   1.00 0.00 ?  181 LEU C CA   1  
ATOM   8831   C  C    . LEU C  2 127 ? -40.639 28.660  3.122   1.00 0.00 ?  181 LEU C C    1  
ATOM   8832   O  O    . LEU C  2 127 ? -41.560 27.898  2.749   1.00 0.00 ?  181 LEU C O    1  
ATOM   8833   C  CB   . LEU C  2 127 ? -38.234 28.664  2.344   1.00 0.00 ?  181 LEU C CB   1  
ATOM   8834   C  CG   . LEU C  2 127 ? -38.050 27.124  2.351   1.00 0.00 ?  181 LEU C CG   1  
ATOM   8835   C  CD1  . LEU C  2 127 ? -38.782 26.502  1.155   1.00 0.00 ?  181 LEU C CD1  1  
ATOM   8836   C  CD2  . LEU C  2 127 ? -36.609 26.754  2.513   1.00 0.00 ?  181 LEU C CD2  1  
ATOM   8837   H  H    . LEU C  2 127 ? -38.859 31.033  2.394   1.00 0.00 ?  181 LEU C H    1  
ATOM   8838   H  HA   . LEU C  2 127 ? -40.072 28.908  1.153   1.00 0.00 ?  181 LEU C HA   1  
ATOM   8839   H  HB2  . LEU C  2 127 ? -37.590 29.122  1.562   1.00 0.00 ?  181 LEU C HB2  1  
ATOM   8840   H  HB3  . LEU C  2 127 ? -37.962 29.074  3.340   1.00 0.00 ?  181 LEU C HB3  1  
ATOM   8841   H  HG   . LEU C  2 127 ? -38.646 26.701  3.187   1.00 0.00 ?  181 LEU C HG   1  
ATOM   8842   H  HD11 . LEU C  2 127 ? -38.692 27.002  0.167   1.00 0.00 ?  181 LEU C HD11 1  
ATOM   8843   H  HD12 . LEU C  2 127 ? -39.868 26.565  1.382   1.00 0.00 ?  181 LEU C HD12 1  
ATOM   8844   H  HD13 . LEU C  2 127 ? -38.438 25.451  1.053   1.00 0.00 ?  181 LEU C HD13 1  
ATOM   8845   H  HD21 . LEU C  2 127 ? -36.320 27.241  3.469   1.00 0.00 ?  181 LEU C HD21 1  
ATOM   8846   H  HD22 . LEU C  2 127 ? -35.944 27.173  1.729   1.00 0.00 ?  181 LEU C HD22 1  
ATOM   8847   H  HD23 . LEU C  2 127 ? -36.461 25.657  2.615   1.00 0.00 ?  181 LEU C HD23 1  
ATOM   8848   N  N    . ARG C  2 128 ? -40.576 29.091  4.373   1.00 0.00 ?  182 ARG C N    1  
ATOM   8849   C  CA   . ARG C  2 128 ? -41.611 28.824  5.396   1.00 0.00 ?  182 ARG C CA   1  
ATOM   8850   C  C    . ARG C  2 128 ? -43.061 29.313  5.228   1.00 0.00 ?  182 ARG C C    1  
ATOM   8851   O  O    . ARG C  2 128 ? -44.041 28.727  5.729   1.00 0.00 ?  182 ARG C O    1  
ATOM   8852   C  CB   . ARG C  2 128 ? -40.936 29.413  6.722   1.00 0.00 ?  182 ARG C CB   1  
ATOM   8853   C  CG   . ARG C  2 128 ? -39.723 28.555  7.119   1.00 0.00 ?  182 ARG C CG   1  
ATOM   8854   C  CD   . ARG C  2 128 ? -40.157 27.188  7.751   1.00 0.00 ?  182 ARG C CD   1  
ATOM   8855   N  NE   . ARG C  2 128 ? -39.072 26.177  7.541   1.00 0.00 ?  182 ARG C NE   1  
ATOM   8856   C  CZ   . ARG C  2 128 ? -39.232 24.864  7.709   1.00 0.00 ?  182 ARG C CZ   1  
ATOM   8857   N  NH1  . ARG C  2 128 ? -40.364 24.268  7.892   1.00 0.00 1  182 ARG C NH1  1  
ATOM   8858   N  NH2  . ARG C  2 128 ? -38.115 24.149  7.689   1.00 0.00 ?  182 ARG C NH2  1  
ATOM   8859   H  H    . ARG C  2 128 ? -39.950 29.831  4.605   1.00 0.00 ?  182 ARG C H    1  
ATOM   8860   H  HA   . ARG C  2 128 ? -41.747 27.757  5.495   1.00 0.00 ?  182 ARG C HA   1  
ATOM   8861   H  HB2  . ARG C  2 128 ? -40.584 30.444  6.504   1.00 0.00 ?  182 ARG C HB2  1  
ATOM   8862   H  HB3  . ARG C  2 128 ? -41.709 29.445  7.520   1.00 0.00 ?  182 ARG C HB3  1  
ATOM   8863   H  HG2  . ARG C  2 128 ? -38.943 28.518  6.328   1.00 0.00 ?  182 ARG C HG2  1  
ATOM   8864   H  HG3  . ARG C  2 128 ? -39.169 29.036  7.954   1.00 0.00 ?  182 ARG C HG3  1  
ATOM   8865   H  HD2  . ARG C  2 128 ? -40.281 27.378  8.839   1.00 0.00 ?  182 ARG C HD2  1  
ATOM   8866   H  HD3  . ARG C  2 128 ? -41.073 26.803  7.254   1.00 0.00 ?  182 ARG C HD3  1  
ATOM   8867   H  HE   . ARG C  2 128 ? -38.125 26.465  7.400   1.00 0.00 ?  182 ARG C HE   1  
ATOM   8868   H  HH11 . ARG C  2 128 ? -41.136 24.875  8.082   1.00 0.00 ?  182 ARG C HH11 1  
ATOM   8869   H  HH12 . ARG C  2 128 ? -40.407 23.345  8.275   1.00 0.00 ?  182 ARG C HH12 1  
ATOM   8870   H  HH21 . ARG C  2 128 ? -37.223 24.597  7.620   1.00 0.00 ?  182 ARG C HH21 1  
ATOM   8871   H  HH22 . ARG C  2 128 ? -38.116 23.271  8.168   1.00 0.00 ?  182 ARG C HH22 1  
ATOM   8872   N  N    . THR C  2 129 ? -43.223 30.425  4.541   1.00 0.00 ?  183 THR C N    1  
ATOM   8873   C  CA   . THR C  2 129 ? -44.495 30.974  4.128   1.00 0.00 ?  183 THR C CA   1  
ATOM   8874   C  C    . THR C  2 129 ? -45.150 30.041  3.157   1.00 0.00 ?  183 THR C C    1  
ATOM   8875   O  O    . THR C  2 129 ? -46.372 29.862  3.086   1.00 0.00 ?  183 THR C O    1  
ATOM   8876   C  CB   . THR C  2 129 ? -44.375 32.409  3.686   1.00 0.00 ?  183 THR C CB   1  
ATOM   8877   O  OG1  . THR C  2 129 ? -43.974 33.177  4.801   1.00 0.00 ?  183 THR C OG1  1  
ATOM   8878   C  CG2  . THR C  2 129 ? -45.693 33.012  3.218   1.00 0.00 ?  183 THR C CG2  1  
ATOM   8879   H  H    . THR C  2 129 ? -42.450 30.912  4.142   1.00 0.00 ?  183 THR C H    1  
ATOM   8880   H  HA   . THR C  2 129 ? -45.187 30.908  4.955   1.00 0.00 ?  183 THR C HA   1  
ATOM   8881   H  HB   . THR C  2 129 ? -43.622 32.450  2.870   1.00 0.00 ?  183 THR C HB   1  
ATOM   8882   H  HG1  . THR C  2 129 ? -43.020 33.147  4.900   1.00 0.00 ?  183 THR C HG1  1  
ATOM   8883   H  HG21 . THR C  2 129 ? -46.528 32.819  3.924   1.00 0.00 ?  183 THR C HG21 1  
ATOM   8884   H  HG22 . THR C  2 129 ? -45.900 32.533  2.237   1.00 0.00 ?  183 THR C HG22 1  
ATOM   8885   H  HG23 . THR C  2 129 ? -45.606 34.098  2.997   1.00 0.00 ?  183 THR C HG23 1  
ATOM   8886   N  N    . HIS C  2 130 ? -44.289 29.471  2.303   1.00 0.00 ?  184 HIS C N    1  
ATOM   8887   C  CA   . HIS C  2 130 ? -44.757 28.669  1.179   1.00 0.00 ?  184 HIS C CA   1  
ATOM   8888   C  C    . HIS C  2 130 ? -44.992 27.187  1.560   1.00 0.00 ?  184 HIS C C    1  
ATOM   8889   O  O    . HIS C  2 130 ? -45.764 26.466  0.829   1.00 0.00 ?  184 HIS C O    1  
ATOM   8890   C  CB   . HIS C  2 130 ? -43.691 28.706  0.039   1.00 0.00 ?  184 HIS C CB   1  
ATOM   8891   C  CG   . HIS C  2 130 ? -43.576 30.002  -0.658  1.00 0.00 ?  184 HIS C CG   1  
ATOM   8892   N  ND1  . HIS C  2 130 ? -44.637 30.856  -0.964  1.00 0.00 ?  184 HIS C ND1  1  
ATOM   8893   C  CD2  . HIS C  2 130 ? -42.464 30.615  -1.001  1.00 0.00 ?  184 HIS C CD2  1  
ATOM   8894   C  CE1  . HIS C  2 130 ? -44.103 31.920  -1.520  1.00 0.00 ?  184 HIS C CE1  1  
ATOM   8895   N  NE2  . HIS C  2 130 ? -42.806 31.883  -1.571  1.00 0.00 ?  184 HIS C NE2  1  
ATOM   8896   H  H    . HIS C  2 130 ? -43.324 29.712  2.379   1.00 0.00 ?  184 HIS C H    1  
ATOM   8897   H  HA   . HIS C  2 130 ? -45.600 29.110  0.667   1.00 0.00 ?  184 HIS C HA   1  
ATOM   8898   H  HB2  . HIS C  2 130 ? -42.660 28.354  0.260   1.00 0.00 ?  184 HIS C HB2  1  
ATOM   8899   H  HB3  . HIS C  2 130 ? -44.104 27.986  -0.698  1.00 0.00 ?  184 HIS C HB3  1  
ATOM   8900   H  HD1  . HIS C  2 130 ? -45.574 30.548  -0.796  1.00 0.00 ?  184 HIS C HD1  1  
ATOM   8901   H  HD2  . HIS C  2 130 ? -41.448 30.240  -0.955  1.00 0.00 ?  184 HIS C HD2  1  
ATOM   8902   H  HE1  . HIS C  2 130 ? -44.724 32.786  -1.750  1.00 0.00 ?  184 HIS C HE1  1  
ATOM   8903   N  N    . LEU C  2 131 ? -44.383 26.691  2.668   1.00 0.00 ?  185 LEU C N    1  
ATOM   8904   C  CA   . LEU C  2 131 ? -44.561 25.387  3.152   1.00 0.00 ?  185 LEU C CA   1  
ATOM   8905   C  C    . LEU C  2 131 ? -45.855 25.284  4.027   1.00 0.00 ?  185 LEU C C    1  
ATOM   8906   O  O    . LEU C  2 131 ? -46.392 24.247  4.289   1.00 0.00 ?  185 LEU C O    1  
ATOM   8907   C  CB   . LEU C  2 131 ? -43.440 25.075  4.085   1.00 0.00 ?  185 LEU C CB   1  
ATOM   8908   C  CG   . LEU C  2 131 ? -42.174 24.758  3.240   1.00 0.00 ?  185 LEU C CG   1  
ATOM   8909   C  CD1  . LEU C  2 131 ? -41.000 25.005  4.198   1.00 0.00 ?  185 LEU C CD1  1  
ATOM   8910   C  CD2  . LEU C  2 131 ? -42.226 23.316  2.741   1.00 0.00 ?  185 LEU C CD2  1  
ATOM   8911   H  H    . LEU C  2 131 ? -43.658 27.268  3.037   1.00 0.00 ?  185 LEU C H    1  
ATOM   8912   H  HA   . LEU C  2 131 ? -44.620 24.586  2.430   1.00 0.00 ?  185 LEU C HA   1  
ATOM   8913   H  HB2  . LEU C  2 131 ? -43.249 25.999  4.673   1.00 0.00 ?  185 LEU C HB2  1  
ATOM   8914   H  HB3  . LEU C  2 131 ? -43.600 24.274  4.838   1.00 0.00 ?  185 LEU C HB3  1  
ATOM   8915   H  HG   . LEU C  2 131 ? -42.095 25.390  2.329   1.00 0.00 ?  185 LEU C HG   1  
ATOM   8916   H  HD11 . LEU C  2 131 ? -40.043 24.957  3.636   1.00 0.00 ?  185 LEU C HD11 1  
ATOM   8917   H  HD12 . LEU C  2 131 ? -40.677 24.188  4.877   1.00 0.00 ?  185 LEU C HD12 1  
ATOM   8918   H  HD13 . LEU C  2 131 ? -41.022 25.981  4.729   1.00 0.00 ?  185 LEU C HD13 1  
ATOM   8919   H  HD21 . LEU C  2 131 ? -42.352 22.722  3.671   1.00 0.00 ?  185 LEU C HD21 1  
ATOM   8920   H  HD22 . LEU C  2 131 ? -41.290 22.931  2.282   1.00 0.00 ?  185 LEU C HD22 1  
ATOM   8921   H  HD23 . LEU C  2 131 ? -43.042 23.044  2.037   1.00 0.00 ?  185 LEU C HD23 1  
ATOM   8922   N  N    . ALA C  2 132 ? -46.373 26.329  4.548   1.00 0.00 ?  186 ALA C N    1  
ATOM   8923   C  CA   . ALA C  2 132 ? -47.510 26.411  5.359   1.00 0.00 ?  186 ALA C CA   1  
ATOM   8924   C  C    . ALA C  2 132 ? -48.757 25.933  4.602   1.00 0.00 ?  186 ALA C C    1  
ATOM   8925   O  O    . ALA C  2 132 ? -49.423 25.005  5.074   1.00 0.00 ?  186 ALA C O    1  
ATOM   8926   C  CB   . ALA C  2 132 ? -47.651 27.802  5.961   1.00 0.00 ?  186 ALA C CB   1  
ATOM   8927   H  H    . ALA C  2 132 ? -45.920 27.195  4.346   1.00 0.00 ?  186 ALA C H    1  
ATOM   8928   H  HA   . ALA C  2 132 ? -47.328 25.739  6.185   1.00 0.00 ?  186 ALA C HA   1  
ATOM   8929   H  HB1  . ALA C  2 132 ? -47.648 28.548  5.138   1.00 0.00 ?  186 ALA C HB1  1  
ATOM   8930   H  HB2  . ALA C  2 132 ? -46.855 27.943  6.723   1.00 0.00 ?  186 ALA C HB2  1  
ATOM   8931   H  HB3  . ALA C  2 132 ? -48.623 27.881  6.492   1.00 0.00 ?  186 ALA C HB3  1  
ATOM   8932   N  N    . PRO C  2 133 ? -49.129 26.253  3.401   1.00 0.00 ?  187 PRO C N    1  
ATOM   8933   C  CA   . PRO C  2 133 ? -50.157 25.545  2.670   1.00 0.00 ?  187 PRO C CA   1  
ATOM   8934   C  C    . PRO C  2 133 ? -49.784 24.160  2.182   1.00 0.00 ?  187 PRO C C    1  
ATOM   8935   O  O    . PRO C  2 133 ? -50.644 23.264  2.300   1.00 0.00 ?  187 PRO C O    1  
ATOM   8936   C  CB   . PRO C  2 133 ? -50.503 26.424  1.485   1.00 0.00 ?  187 PRO C CB   1  
ATOM   8937   C  CG   . PRO C  2 133 ? -49.173 27.244  1.336   1.00 0.00 ?  187 PRO C CG   1  
ATOM   8938   C  CD   . PRO C  2 133 ? -48.815 27.528  2.719   1.00 0.00 ?  187 PRO C CD   1  
ATOM   8939   H  HA   . PRO C  2 133 ? -50.973 25.273  3.323   1.00 0.00 ?  187 PRO C HA   1  
ATOM   8940   H  HB2  . PRO C  2 133 ? -50.807 25.830  0.597   1.00 0.00 ?  187 PRO C HB2  1  
ATOM   8941   H  HB3  . PRO C  2 133 ? -51.347 27.119  1.683   1.00 0.00 ?  187 PRO C HB3  1  
ATOM   8942   H  HG2  . PRO C  2 133 ? -48.404 26.583  0.882   1.00 0.00 ?  187 PRO C HG2  1  
ATOM   8943   H  HG3  . PRO C  2 133 ? -49.440 28.128  0.718   1.00 0.00 ?  187 PRO C HG3  1  
ATOM   8944   H  HD2  . PRO C  2 133 ? -47.735 27.757  2.838   1.00 0.00 ?  187 PRO C HD2  1  
ATOM   8945   H  HD3  . PRO C  2 133 ? -49.402 28.348  3.184   1.00 0.00 ?  187 PRO C HD3  1  
ATOM   8946   N  N    . TYR C  2 134 ? -48.530 23.912  1.718   1.00 0.00 ?  188 TYR C N    1  
ATOM   8947   C  CA   . TYR C  2 134 ? -48.024 22.676  1.215   1.00 0.00 ?  188 TYR C CA   1  
ATOM   8948   C  C    . TYR C  2 134 ? -48.133 21.588  2.243   1.00 0.00 ?  188 TYR C C    1  
ATOM   8949   O  O    . TYR C  2 134 ? -48.661 20.545  1.888   1.00 0.00 ?  188 TYR C O    1  
ATOM   8950   C  CB   . TYR C  2 134 ? -46.554 22.753  0.677   1.00 0.00 ?  188 TYR C CB   1  
ATOM   8951   C  CG   . TYR C  2 134 ? -45.974 21.555  -0.134  1.00 0.00 ?  188 TYR C CG   1  
ATOM   8952   C  CD1  . TYR C  2 134 ? -46.391 21.296  -1.438  1.00 0.00 ?  188 TYR C CD1  1  
ATOM   8953   C  CD2  . TYR C  2 134 ? -45.063 20.630  0.518   1.00 0.00 ?  188 TYR C CD2  1  
ATOM   8954   C  CE1  . TYR C  2 134 ? -45.942 20.122  -2.157  1.00 0.00 ?  188 TYR C CE1  1  
ATOM   8955   C  CE2  . TYR C  2 134 ? -44.715 19.489  -0.175  1.00 0.00 ?  188 TYR C CE2  1  
ATOM   8956   C  CZ   . TYR C  2 134 ? -45.116 19.225  -1.484  1.00 0.00 ?  188 TYR C CZ   1  
ATOM   8957   O  OH   . TYR C  2 134 ? -44.797 18.057  -2.176  1.00 0.00 ?  188 TYR C OH   1  
ATOM   8958   H  H    . TYR C  2 134 ? -47.834 24.619  1.816   1.00 0.00 ?  188 TYR C H    1  
ATOM   8959   H  HA   . TYR C  2 134 ? -48.601 22.347  0.363   1.00 0.00 ?  188 TYR C HA   1  
ATOM   8960   H  HB2  . TYR C  2 134 ? -46.509 23.571  -0.073  1.00 0.00 ?  188 TYR C HB2  1  
ATOM   8961   H  HB3  . TYR C  2 134 ? -45.818 22.890  1.498   1.00 0.00 ?  188 TYR C HB3  1  
ATOM   8962   H  HD1  . TYR C  2 134 ? -47.197 21.945  -1.748  1.00 0.00 ?  188 TYR C HD1  1  
ATOM   8963   H  HD2  . TYR C  2 134 ? -44.682 20.816  1.511   1.00 0.00 ?  188 TYR C HD2  1  
ATOM   8964   H  HE1  . TYR C  2 134 ? -46.305 19.856  -3.139  1.00 0.00 ?  188 TYR C HE1  1  
ATOM   8965   H  HE2  . TYR C  2 134 ? -44.048 18.751  0.244   1.00 0.00 ?  188 TYR C HE2  1  
ATOM   8966   H  HH   . TYR C  2 134 ? -44.522 17.453  -1.483  1.00 0.00 ?  188 TYR C HH   1  
ATOM   8967   N  N    . SER C  2 135 ? -47.666 21.734  3.531   1.00 0.00 ?  189 SER C N    1  
ATOM   8968   C  CA   . SER C  2 135 ? -47.609 20.744  4.600   1.00 0.00 ?  189 SER C CA   1  
ATOM   8969   C  C    . SER C  2 135 ? -48.965 20.213  5.018   1.00 0.00 ?  189 SER C C    1  
ATOM   8970   O  O    . SER C  2 135 ? -49.078 19.023  5.312   1.00 0.00 ?  189 SER C O    1  
ATOM   8971   C  CB   . SER C  2 135 ? -46.984 21.360  5.834   1.00 0.00 ?  189 SER C CB   1  
ATOM   8972   O  OG   . SER C  2 135 ? -46.851 20.398  6.887   1.00 0.00 ?  189 SER C OG   1  
ATOM   8973   H  H    . SER C  2 135 ? -47.298 22.630  3.767   1.00 0.00 ?  189 SER C H    1  
ATOM   8974   H  HA   . SER C  2 135 ? -47.073 19.872  4.254   1.00 0.00 ?  189 SER C HA   1  
ATOM   8975   H  HB2  . SER C  2 135 ? -46.043 21.831  5.478   1.00 0.00 ?  189 SER C HB2  1  
ATOM   8976   H  HB3  . SER C  2 135 ? -47.624 22.193  6.196   1.00 0.00 ?  189 SER C HB3  1  
ATOM   8977   H  HG   . SER C  2 135 ? -46.204 19.702  6.746   1.00 0.00 ?  189 SER C HG   1  
ATOM   8978   N  N    . ASP C  2 136 ? -50.077 20.963  4.990   1.00 0.00 ?  190 ASP C N    1  
ATOM   8979   C  CA   . ASP C  2 136 ? -51.358 20.381  5.269   1.00 0.00 ?  190 ASP C CA   1  
ATOM   8980   C  C    . ASP C  2 136 ? -51.871 19.478  4.121   1.00 0.00 ?  190 ASP C C    1  
ATOM   8981   O  O    . ASP C  2 136 ? -52.260 18.320  4.253   1.00 0.00 ?  190 ASP C O    1  
ATOM   8982   C  CB   . ASP C  2 136 ? -52.437 21.542  5.501   1.00 0.00 ?  190 ASP C CB   1  
ATOM   8983   C  CG   . ASP C  2 136 ? -52.347 21.975  6.883   1.00 0.00 ?  190 ASP C CG   1  
ATOM   8984   O  OD1  . ASP C  2 136 ? -51.580 21.472  7.733   1.00 0.00 ?  190 ASP C OD1  1  
ATOM   8985   O  OD2  . ASP C  2 136 ? -52.966 23.043  7.254   1.00 0.00 -1 190 ASP C OD2  1  
ATOM   8986   H  H    . ASP C  2 136 ? -49.994 21.893  4.642   1.00 0.00 ?  190 ASP C H    1  
ATOM   8987   H  HA   . ASP C  2 136 ? -51.291 19.690  6.096   1.00 0.00 ?  190 ASP C HA   1  
ATOM   8988   H  HB2  . ASP C  2 136 ? -52.233 22.398  4.821   1.00 0.00 ?  190 ASP C HB2  1  
ATOM   8989   H  HB3  . ASP C  2 136 ? -53.482 21.193  5.362   1.00 0.00 ?  190 ASP C HB3  1  
ATOM   8990   N  N    . GLU C  2 137 ? -51.720 19.976  2.929   1.00 0.00 ?  191 GLU C N    1  
ATOM   8991   C  CA   . GLU C  2 137 ? -52.159 19.198  1.751   1.00 0.00 ?  191 GLU C CA   1  
ATOM   8992   C  C    . GLU C  2 137 ? -51.399 17.901  1.631   1.00 0.00 ?  191 GLU C C    1  
ATOM   8993   O  O    . GLU C  2 137 ? -51.927 16.877  1.234   1.00 0.00 ?  191 GLU C O    1  
ATOM   8994   C  CB   . GLU C  2 137 ? -51.929 20.042  0.451   1.00 0.00 ?  191 GLU C CB   1  
ATOM   8995   C  CG   . GLU C  2 137 ? -52.811 21.336  0.384   1.00 0.00 ?  191 GLU C CG   1  
ATOM   8996   C  CD   . GLU C  2 137 ? -52.424 22.262  -0.829  1.00 0.00 ?  191 GLU C CD   1  
ATOM   8997   O  OE1  . GLU C  2 137 ? -53.295 23.056  -1.180  1.00 0.00 ?  191 GLU C OE1  1  
ATOM   8998   O  OE2  . GLU C  2 137 ? -51.387 22.084  -1.478  1.00 0.00 -1 191 GLU C OE2  1  
ATOM   8999   H  H    . GLU C  2 137 ? -51.553 20.934  2.710   1.00 0.00 ?  191 GLU C H    1  
ATOM   9000   H  HA   . GLU C  2 137 ? -53.197 18.925  1.873   1.00 0.00 ?  191 GLU C HA   1  
ATOM   9001   H  HB2  . GLU C  2 137 ? -50.903 20.465  0.394   1.00 0.00 ?  191 GLU C HB2  1  
ATOM   9002   H  HB3  . GLU C  2 137 ? -52.160 19.348  -0.385  1.00 0.00 ?  191 GLU C HB3  1  
ATOM   9003   H  HG2  . GLU C  2 137 ? -53.850 20.943  0.363   1.00 0.00 ?  191 GLU C HG2  1  
ATOM   9004   H  HG3  . GLU C  2 137 ? -52.644 21.972  1.279   1.00 0.00 ?  191 GLU C HG3  1  
ATOM   9005   N  N    . LEU C  2 138 ? -50.084 17.981  1.934   1.00 0.00 ?  192 LEU C N    1  
ATOM   9006   C  CA   . LEU C  2 138 ? -49.116 16.847  1.845   1.00 0.00 ?  192 LEU C CA   1  
ATOM   9007   C  C    . LEU C  2 138 ? -49.513 15.689  2.743   1.00 0.00 ?  192 LEU C C    1  
ATOM   9008   O  O    . LEU C  2 138 ? -49.489 14.492  2.376   1.00 0.00 ?  192 LEU C O    1  
ATOM   9009   C  CB   . LEU C  2 138 ? -47.636 17.303  2.187   1.00 0.00 ?  192 LEU C CB   1  
ATOM   9010   C  CG   . LEU C  2 138 ? -46.537 16.334  1.736   1.00 0.00 ?  192 LEU C CG   1  
ATOM   9011   C  CD1  . LEU C  2 138 ? -46.542 16.100  0.239   1.00 0.00 ?  192 LEU C CD1  1  
ATOM   9012   C  CD2  . LEU C  2 138 ? -45.240 16.874  2.337   1.00 0.00 ?  192 LEU C CD2  1  
ATOM   9013   H  H    . LEU C  2 138 ? -49.675 18.831  2.259   1.00 0.00 ?  192 LEU C H    1  
ATOM   9014   H  HA   . LEU C  2 138 ? -49.270 16.463  0.848   1.00 0.00 ?  192 LEU C HA   1  
ATOM   9015   H  HB2  . LEU C  2 138 ? -47.442 18.269  1.673   1.00 0.00 ?  192 LEU C HB2  1  
ATOM   9016   H  HB3  . LEU C  2 138 ? -47.479 17.473  3.274   1.00 0.00 ?  192 LEU C HB3  1  
ATOM   9017   H  HG   . LEU C  2 138 ? -46.702 15.363  2.251   1.00 0.00 ?  192 LEU C HG   1  
ATOM   9018   H  HD11 . LEU C  2 138 ? -47.388 15.433  -0.032  1.00 0.00 ?  192 LEU C HD11 1  
ATOM   9019   H  HD12 . LEU C  2 138 ? -45.596 15.521  0.168   1.00 0.00 ?  192 LEU C HD12 1  
ATOM   9020   H  HD13 . LEU C  2 138 ? -46.551 17.070  -0.303  1.00 0.00 ?  192 LEU C HD13 1  
ATOM   9021   H  HD21 . LEU C  2 138 ? -44.983 17.847  1.865   1.00 0.00 ?  192 LEU C HD21 1  
ATOM   9022   H  HD22 . LEU C  2 138 ? -44.526 16.029  2.240   1.00 0.00 ?  192 LEU C HD22 1  
ATOM   9023   H  HD23 . LEU C  2 138 ? -45.403 16.959  3.432   1.00 0.00 ?  192 LEU C HD23 1  
ATOM   9024   N  N    . ARG C  2 139 ? -49.861 16.072  3.999   1.00 0.00 ?  193 ARG C N    1  
ATOM   9025   C  CA   . ARG C  2 139 ? -50.487 15.210  4.981   1.00 0.00 ?  193 ARG C CA   1  
ATOM   9026   C  C    . ARG C  2 139 ? -51.869 14.670  4.719   1.00 0.00 ?  193 ARG C C    1  
ATOM   9027   O  O    . ARG C  2 139 ? -52.135 13.524  4.943   1.00 0.00 ?  193 ARG C O    1  
ATOM   9028   C  CB   . ARG C  2 139 ? -50.305 15.844  6.363   1.00 0.00 ?  193 ARG C CB   1  
ATOM   9029   C  CG   . ARG C  2 139 ? -48.874 15.928  6.774   1.00 0.00 ?  193 ARG C CG   1  
ATOM   9030   C  CD   . ARG C  2 139 ? -48.568 16.489  8.183   1.00 0.00 ?  193 ARG C CD   1  
ATOM   9031   N  NE   . ARG C  2 139 ? -48.788 17.983  8.119   1.00 0.00 ?  193 ARG C NE   1  
ATOM   9032   C  CZ   . ARG C  2 139 ? -48.828 18.704  9.216   1.00 0.00 ?  193 ARG C CZ   1  
ATOM   9033   N  NH1  . ARG C  2 139 ? -48.935 19.989  9.211   1.00 0.00 1  193 ARG C NH1  1  
ATOM   9034   N  NH2  . ARG C  2 139 ? -48.613 18.256  10.439  1.00 0.00 ?  193 ARG C NH2  1  
ATOM   9035   H  H    . ARG C  2 139 ? -49.824 17.054  4.169   1.00 0.00 ?  193 ARG C H    1  
ATOM   9036   H  HA   . ARG C  2 139 ? -49.808 14.370  4.995   1.00 0.00 ?  193 ARG C HA   1  
ATOM   9037   H  HB2  . ARG C  2 139 ? -50.616 16.910  6.331   1.00 0.00 ?  193 ARG C HB2  1  
ATOM   9038   H  HB3  . ARG C  2 139 ? -50.964 15.261  7.042   1.00 0.00 ?  193 ARG C HB3  1  
ATOM   9039   H  HG2  . ARG C  2 139 ? -48.479 14.890  6.821   1.00 0.00 ?  193 ARG C HG2  1  
ATOM   9040   H  HG3  . ARG C  2 139 ? -48.194 16.329  5.992   1.00 0.00 ?  193 ARG C HG3  1  
ATOM   9041   H  HD2  . ARG C  2 139 ? -49.282 16.019  8.891   1.00 0.00 ?  193 ARG C HD2  1  
ATOM   9042   H  HD3  . ARG C  2 139 ? -47.549 16.270  8.568   1.00 0.00 ?  193 ARG C HD3  1  
ATOM   9043   H  HE   . ARG C  2 139 ? -48.723 18.364  7.197   1.00 0.00 ?  193 ARG C HE   1  
ATOM   9044   H  HH11 . ARG C  2 139 ? -48.919 20.497  10.072  1.00 0.00 ?  193 ARG C HH11 1  
ATOM   9045   H  HH12 . ARG C  2 139 ? -48.963 20.491  8.346   1.00 0.00 ?  193 ARG C HH12 1  
ATOM   9046   H  HH21 . ARG C  2 139 ? -48.356 17.312  10.644  1.00 0.00 ?  193 ARG C HH21 1  
ATOM   9047   H  HH22 . ARG C  2 139 ? -48.581 18.981  11.128  1.00 0.00 ?  193 ARG C HH22 1  
ATOM   9048   N  N    . GLN C  2 140 ? -52.763 15.524  4.220   1.00 0.00 ?  194 GLN C N    1  
ATOM   9049   C  CA   . GLN C  2 140 ? -54.059 15.188  3.592   1.00 0.00 ?  194 GLN C CA   1  
ATOM   9050   C  C    . GLN C  2 140 ? -54.034 14.209  2.408   1.00 0.00 ?  194 GLN C C    1  
ATOM   9051   O  O    . GLN C  2 140 ? -54.697 13.154  2.322   1.00 0.00 ?  194 GLN C O    1  
ATOM   9052   C  CB   . GLN C  2 140 ? -54.893 16.478  3.248   1.00 0.00 ?  194 GLN C CB   1  
ATOM   9053   C  CG   . GLN C  2 140 ? -55.500 17.060  4.533   1.00 0.00 ?  194 GLN C CG   1  
ATOM   9054   C  CD   . GLN C  2 140 ? -56.228 18.380  4.210   1.00 0.00 ?  194 GLN C CD   1  
ATOM   9055   O  OE1  . GLN C  2 140 ? -55.846 19.498  4.558   1.00 0.00 ?  194 GLN C OE1  1  
ATOM   9056   N  NE2  . GLN C  2 140 ? -57.306 18.236  3.460   1.00 0.00 ?  194 GLN C NE2  1  
ATOM   9057   H  H    . GLN C  2 140 ? -52.513 16.489  4.212   1.00 0.00 ?  194 GLN C H    1  
ATOM   9058   H  HA   . GLN C  2 140 ? -54.531 14.607  4.371   1.00 0.00 ?  194 GLN C HA   1  
ATOM   9059   H  HB2  . GLN C  2 140 ? -54.176 17.092  2.662   1.00 0.00 ?  194 GLN C HB2  1  
ATOM   9060   H  HB3  . GLN C  2 140 ? -55.708 16.323  2.508   1.00 0.00 ?  194 GLN C HB3  1  
ATOM   9061   H  HG2  . GLN C  2 140 ? -56.140 16.335  5.080   1.00 0.00 ?  194 GLN C HG2  1  
ATOM   9062   H  HG3  . GLN C  2 140 ? -54.728 17.366  5.270   1.00 0.00 ?  194 GLN C HG3  1  
ATOM   9063   H  HE21 . GLN C  2 140 ? -58.008 18.923  3.270   1.00 0.00 ?  194 GLN C HE21 1  
ATOM   9064   H  HE22 . GLN C  2 140 ? -57.551 17.345  3.078   1.00 0.00 ?  194 GLN C HE22 1  
ATOM   9065   N  N    . ARG C  2 141 ? -53.173 14.486  1.445   1.00 0.00 ?  195 ARG C N    1  
ATOM   9066   C  CA   . ARG C  2 141 ? -52.890 13.512  0.354   1.00 0.00 ?  195 ARG C CA   1  
ATOM   9067   C  C    . ARG C  2 141 ? -52.295 12.122  0.733   1.00 0.00 ?  195 ARG C C    1  
ATOM   9068   O  O    . ARG C  2 141 ? -52.641 11.093  0.194   1.00 0.00 ?  195 ARG C O    1  
ATOM   9069   C  CB   . ARG C  2 141 ? -51.987 14.242  -0.662  1.00 0.00 ?  195 ARG C CB   1  
ATOM   9070   C  CG   . ARG C  2 141 ? -52.813 15.282  -1.481  1.00 0.00 ?  195 ARG C CG   1  
ATOM   9071   C  CD   . ARG C  2 141 ? -51.977 16.107  -2.444  1.00 0.00 ?  195 ARG C CD   1  
ATOM   9072   N  NE   . ARG C  2 141 ? -51.110 15.160  -3.280  1.00 0.00 ?  195 ARG C NE   1  
ATOM   9073   C  CZ   . ARG C  2 141 ? -49.797 14.881  -3.076  1.00 0.00 ?  195 ARG C CZ   1  
ATOM   9074   N  NH1  . ARG C  2 141 ? -49.098 14.029  -3.855  1.00 0.00 1  195 ARG C NH1  1  
ATOM   9075   N  NH2  . ARG C  2 141 ? -49.072 15.582  -2.270  1.00 0.00 ?  195 ARG C NH2  1  
ATOM   9076   H  H    . ARG C  2 141 ? -52.696 15.362  1.445   1.00 0.00 ?  195 ARG C H    1  
ATOM   9077   H  HA   . ARG C  2 141 ? -53.822 13.309  -0.152  1.00 0.00 ?  195 ARG C HA   1  
ATOM   9078   H  HB2  . ARG C  2 141 ? -51.055 14.624  -0.194  1.00 0.00 ?  195 ARG C HB2  1  
ATOM   9079   H  HB3  . ARG C  2 141 ? -51.596 13.485  -1.375  1.00 0.00 ?  195 ARG C HB3  1  
ATOM   9080   H  HG2  . ARG C  2 141 ? -53.587 14.660  -1.979  1.00 0.00 ?  195 ARG C HG2  1  
ATOM   9081   H  HG3  . ARG C  2 141 ? -53.218 15.906  -0.656  1.00 0.00 ?  195 ARG C HG3  1  
ATOM   9082   H  HD2  . ARG C  2 141 ? -52.698 16.638  -3.103  1.00 0.00 ?  195 ARG C HD2  1  
ATOM   9083   H  HD3  . ARG C  2 141 ? -51.343 16.868  -1.942  1.00 0.00 ?  195 ARG C HD3  1  
ATOM   9084   H  HE   . ARG C  2 141 ? -51.487 14.559  -3.985  1.00 0.00 ?  195 ARG C HE   1  
ATOM   9085   H  HH11 . ARG C  2 141 ? -49.553 13.583  -4.625  1.00 0.00 ?  195 ARG C HH11 1  
ATOM   9086   H  HH12 . ARG C  2 141 ? -48.111 14.057  -3.700  1.00 0.00 ?  195 ARG C HH12 1  
ATOM   9087   H  HH21 . ARG C  2 141 ? -49.449 16.483  -2.056  1.00 0.00 ?  195 ARG C HH21 1  
ATOM   9088   H  HH22 . ARG C  2 141 ? -48.090 15.409  -2.190  1.00 0.00 ?  195 ARG C HH22 1  
ATOM   9089   N  N    . LEU C  2 142 ? -51.416 12.144  1.734   1.00 0.00 ?  196 LEU C N    1  
ATOM   9090   C  CA   . LEU C  2 142 ? -50.818 10.966  2.359   1.00 0.00 ?  196 LEU C CA   1  
ATOM   9091   C  C    . LEU C  2 142 ? -51.859 10.028  2.959   1.00 0.00 ?  196 LEU C C    1  
ATOM   9092   O  O    . LEU C  2 142 ? -51.836 8.830   2.723   1.00 0.00 ?  196 LEU C O    1  
ATOM   9093   C  CB   . LEU C  2 142 ? -49.708 11.345  3.411   1.00 0.00 ?  196 LEU C CB   1  
ATOM   9094   C  CG   . LEU C  2 142 ? -49.090 10.202  4.228   1.00 0.00 ?  196 LEU C CG   1  
ATOM   9095   C  CD1  . LEU C  2 142 ? -48.206 9.430   3.190   1.00 0.00 ?  196 LEU C CD1  1  
ATOM   9096   C  CD2  . LEU C  2 142 ? -48.122 10.745  5.299   1.00 0.00 ?  196 LEU C CD2  1  
ATOM   9097   H  H    . LEU C  2 142 ? -51.232 13.049  2.110   1.00 0.00 ?  196 LEU C H    1  
ATOM   9098   H  HA   . LEU C  2 142 ? -50.309 10.395  1.596   1.00 0.00 ?  196 LEU C HA   1  
ATOM   9099   H  HB2  . LEU C  2 142 ? -48.939 11.846  2.785   1.00 0.00 ?  196 LEU C HB2  1  
ATOM   9100   H  HB3  . LEU C  2 142 ? -50.234 12.057  4.083   1.00 0.00 ?  196 LEU C HB3  1  
ATOM   9101   H  HG   . LEU C  2 142 ? -49.822 9.475   4.639   1.00 0.00 ?  196 LEU C HG   1  
ATOM   9102   H  HD11 . LEU C  2 142 ? -48.843 9.044   2.365   1.00 0.00 ?  196 LEU C HD11 1  
ATOM   9103   H  HD12 . LEU C  2 142 ? -47.690 8.554   3.637   1.00 0.00 ?  196 LEU C HD12 1  
ATOM   9104   H  HD13 . LEU C  2 142 ? -47.366 10.104  2.919   1.00 0.00 ?  196 LEU C HD13 1  
ATOM   9105   H  HD21 . LEU C  2 142 ? -48.743 11.253  6.067   1.00 0.00 ?  196 LEU C HD21 1  
ATOM   9106   H  HD22 . LEU C  2 142 ? -47.475 11.501  4.805   1.00 0.00 ?  196 LEU C HD22 1  
ATOM   9107   H  HD23 . LEU C  2 142 ? -47.480 9.892   5.609   1.00 0.00 ?  196 LEU C HD23 1  
ATOM   9108   N  N    . ALA C  2 143 ? -52.842 10.590  3.662   1.00 0.00 ?  197 ALA C N    1  
ATOM   9109   C  CA   . ALA C  2 143 ? -53.849 9.764   4.337   1.00 0.00 ?  197 ALA C CA   1  
ATOM   9110   C  C    . ALA C  2 143 ? -54.861 9.114   3.334   1.00 0.00 ?  197 ALA C C    1  
ATOM   9111   O  O    . ALA C  2 143 ? -55.487 8.137   3.667   1.00 0.00 ?  197 ALA C O    1  
ATOM   9112   C  CB   . ALA C  2 143 ? -54.620 10.542  5.424   1.00 0.00 ?  197 ALA C CB   1  
ATOM   9113   H  H    . ALA C  2 143 ? -52.924 11.578  3.766   1.00 0.00 ?  197 ALA C H    1  
ATOM   9114   H  HA   . ALA C  2 143 ? -53.353 8.905   4.765   1.00 0.00 ?  197 ALA C HA   1  
ATOM   9115   H  HB1  . ALA C  2 143 ? -55.225 11.344  4.950   1.00 0.00 ?  197 ALA C HB1  1  
ATOM   9116   H  HB2  . ALA C  2 143 ? -53.913 10.988  6.156   1.00 0.00 ?  197 ALA C HB2  1  
ATOM   9117   H  HB3  . ALA C  2 143 ? -55.250 9.863   6.038   1.00 0.00 ?  197 ALA C HB3  1  
ATOM   9118   N  N    . ALA C  2 144 ? -55.007 9.603   2.084   1.00 0.00 ?  198 ALA C N    1  
ATOM   9119   C  CA   . ALA C  2 144 ? -55.803 8.899   1.040   1.00 0.00 ?  198 ALA C CA   1  
ATOM   9120   C  C    . ALA C  2 144 ? -54.942 7.703   0.490   1.00 0.00 ?  198 ALA C C    1  
ATOM   9121   O  O    . ALA C  2 144 ? -55.347 6.538   0.412   1.00 0.00 ?  198 ALA C O    1  
ATOM   9122   C  CB   . ALA C  2 144 ? -56.062 9.947   -0.049  1.00 0.00 ?  198 ALA C CB   1  
ATOM   9123   H  H    . ALA C  2 144 ? -54.584 10.478  1.859   1.00 0.00 ?  198 ALA C H    1  
ATOM   9124   H  HA   . ALA C  2 144 ? -56.612 8.402   1.554   1.00 0.00 ?  198 ALA C HA   1  
ATOM   9125   H  HB1  . ALA C  2 144 ? -56.484 9.460   -0.954  1.00 0.00 ?  198 ALA C HB1  1  
ATOM   9126   H  HB2  . ALA C  2 144 ? -55.149 10.567  -0.179  1.00 0.00 ?  198 ALA C HB2  1  
ATOM   9127   H  HB3  . ALA C  2 144 ? -56.776 10.666  0.408   1.00 0.00 ?  198 ALA C HB3  1  
ATOM   9128   N  N    . ARG C  2 145 ? -53.640 7.981   0.173   1.00 0.00 ?  199 ARG C N    1  
ATOM   9129   C  CA   . ARG C  2 145 ? -52.761 7.062   -0.452  1.00 0.00 ?  199 ARG C CA   1  
ATOM   9130   C  C    . ARG C  2 145 ? -52.529 5.813   0.398   1.00 0.00 ?  199 ARG C C    1  
ATOM   9131   O  O    . ARG C  2 145 ? -52.367 4.716   -0.133  1.00 0.00 ?  199 ARG C O    1  
ATOM   9132   C  CB   . ARG C  2 145 ? -51.432 7.820   -0.610  1.00 0.00 ?  199 ARG C CB   1  
ATOM   9133   C  CG   . ARG C  2 145 ? -50.243 7.016   -1.247  1.00 0.00 ?  199 ARG C CG   1  
ATOM   9134   C  CD   . ARG C  2 145 ? -48.978 7.836   -1.079  1.00 0.00 ?  199 ARG C CD   1  
ATOM   9135   N  NE   . ARG C  2 145 ? -49.140 9.224   -1.654  1.00 0.00 ?  199 ARG C NE   1  
ATOM   9136   C  CZ   . ARG C  2 145 ? -48.551 10.305  -1.166  1.00 0.00 ?  199 ARG C CZ   1  
ATOM   9137   N  NH1  . ARG C  2 145 ? -49.130 11.429  -1.536  1.00 0.00 1  199 ARG C NH1  1  
ATOM   9138   N  NH2  . ARG C  2 145 ? -47.541 10.301  -0.343  1.00 0.00 ?  199 ARG C NH2  1  
ATOM   9139   H  H    . ARG C  2 145 ? -53.370 8.939   0.104   1.00 0.00 ?  199 ARG C H    1  
ATOM   9140   H  HA   . ARG C  2 145 ? -53.236 6.814   -1.390  1.00 0.00 ?  199 ARG C HA   1  
ATOM   9141   H  HB2  . ARG C  2 145 ? -51.544 8.774   -1.168  1.00 0.00 ?  199 ARG C HB2  1  
ATOM   9142   H  HB3  . ARG C  2 145 ? -51.110 8.046   0.429   1.00 0.00 ?  199 ARG C HB3  1  
ATOM   9143   H  HG2  . ARG C  2 145 ? -50.134 6.050   -0.709  1.00 0.00 ?  199 ARG C HG2  1  
ATOM   9144   H  HG3  . ARG C  2 145 ? -50.588 6.820   -2.285  1.00 0.00 ?  199 ARG C HG3  1  
ATOM   9145   H  HD2  . ARG C  2 145 ? -48.778 7.920   0.010   1.00 0.00 ?  199 ARG C HD2  1  
ATOM   9146   H  HD3  . ARG C  2 145 ? -48.158 7.282   -1.585  1.00 0.00 ?  199 ARG C HD3  1  
ATOM   9147   H  HE   . ARG C  2 145 ? -49.893 9.407   -2.286  1.00 0.00 ?  199 ARG C HE   1  
ATOM   9148   H  HH11 . ARG C  2 145 ? -49.993 11.274  -2.017  1.00 0.00 ?  199 ARG C HH11 1  
ATOM   9149   H  HH12 . ARG C  2 145 ? -48.820 12.173  -0.943  1.00 0.00 ?  199 ARG C HH12 1  
ATOM   9150   H  HH21 . ARG C  2 145 ? -47.040 9.457   -0.147  1.00 0.00 ?  199 ARG C HH21 1  
ATOM   9151   H  HH22 . ARG C  2 145 ? -47.017 11.129  -0.144  1.00 0.00 ?  199 ARG C HH22 1  
ATOM   9152   N  N    . LEU C  2 146 ? -52.431 5.902   1.694   1.00 0.00 ?  200 LEU C N    1  
ATOM   9153   C  CA   . LEU C  2 146 ? -52.253 4.696   2.510   1.00 0.00 ?  200 LEU C CA   1  
ATOM   9154   C  C    . LEU C  2 146 ? -53.484 3.811   2.663   1.00 0.00 ?  200 LEU C C    1  
ATOM   9155   O  O    . LEU C  2 146 ? -53.406 2.607   2.676   1.00 0.00 ?  200 LEU C O    1  
ATOM   9156   C  CB   . LEU C  2 146 ? -51.740 5.209   3.856   1.00 0.00 ?  200 LEU C CB   1  
ATOM   9157   C  CG   . LEU C  2 146 ? -50.369 5.968   3.668   1.00 0.00 ?  200 LEU C CG   1  
ATOM   9158   C  CD1  . LEU C  2 146 ? -49.741 6.369   4.956   1.00 0.00 ?  200 LEU C CD1  1  
ATOM   9159   C  CD2  . LEU C  2 146 ? -49.314 5.156   2.973   1.00 0.00 ?  200 LEU C CD2  1  
ATOM   9160   H  H    . LEU C  2 146 ? -52.456 6.789   2.148   1.00 0.00 ?  200 LEU C H    1  
ATOM   9161   H  HA   . LEU C  2 146 ? -51.498 4.031   2.117   1.00 0.00 ?  200 LEU C HA   1  
ATOM   9162   H  HB2  . LEU C  2 146 ? -52.509 5.887   4.285   1.00 0.00 ?  200 LEU C HB2  1  
ATOM   9163   H  HB3  . LEU C  2 146 ? -51.479 4.374   4.540   1.00 0.00 ?  200 LEU C HB3  1  
ATOM   9164   H  HG   . LEU C  2 146 ? -50.447 6.911   3.085   1.00 0.00 ?  200 LEU C HG   1  
ATOM   9165   H  HD11 . LEU C  2 146 ? -50.324 7.073   5.588   1.00 0.00 ?  200 LEU C HD11 1  
ATOM   9166   H  HD12 . LEU C  2 146 ? -48.781 6.908   4.802   1.00 0.00 ?  200 LEU C HD12 1  
ATOM   9167   H  HD13 . LEU C  2 146 ? -49.524 5.442   5.528   1.00 0.00 ?  200 LEU C HD13 1  
ATOM   9168   H  HD21 . LEU C  2 146 ? -49.401 4.937   1.887   1.00 0.00 ?  200 LEU C HD21 1  
ATOM   9169   H  HD22 . LEU C  2 146 ? -49.376 4.162   3.464   1.00 0.00 ?  200 LEU C HD22 1  
ATOM   9170   H  HD23 . LEU C  2 146 ? -48.334 5.662   3.106   1.00 0.00 ?  200 LEU C HD23 1  
ATOM   9171   N  N    . GLU C  2 147 ? -54.699 4.435   2.547   1.00 0.00 ?  201 GLU C N    1  
ATOM   9172   C  CA   . GLU C  2 147 ? -55.872 3.619   2.333   1.00 0.00 ?  201 GLU C CA   1  
ATOM   9173   C  C    . GLU C  2 147 ? -55.871 2.895   1.015   1.00 0.00 ?  201 GLU C C    1  
ATOM   9174   O  O    . GLU C  2 147 ? -56.048 1.683   0.966   1.00 0.00 ?  201 GLU C O    1  
ATOM   9175   C  CB   . GLU C  2 147 ? -57.213 4.312   2.709   1.00 0.00 ?  201 GLU C CB   1  
ATOM   9176   C  CG   . GLU C  2 147 ? -57.251 4.929   4.116   1.00 0.00 ?  201 GLU C CG   1  
ATOM   9177   C  CD   . GLU C  2 147 ? -57.656 3.884   5.047   1.00 0.00 ?  201 GLU C CD   1  
ATOM   9178   O  OE1  . GLU C  2 147 ? -58.818 3.435   5.023   1.00 0.00 ?  201 GLU C OE1  1  
ATOM   9179   O  OE2  . GLU C  2 147 ? -56.834 3.455   5.952   1.00 0.00 -1 201 GLU C OE2  1  
ATOM   9180   H  H    . GLU C  2 147 ? -54.703 5.417   2.375   1.00 0.00 ?  201 GLU C H    1  
ATOM   9181   H  HA   . GLU C  2 147 ? -55.765 2.772   2.995   1.00 0.00 ?  201 GLU C HA   1  
ATOM   9182   H  HB2  . GLU C  2 147 ? -57.325 5.177   2.021   1.00 0.00 ?  201 GLU C HB2  1  
ATOM   9183   H  HB3  . GLU C  2 147 ? -58.001 3.537   2.596   1.00 0.00 ?  201 GLU C HB3  1  
ATOM   9184   H  HG2  . GLU C  2 147 ? -56.277 5.390   4.384   1.00 0.00 ?  201 GLU C HG2  1  
ATOM   9185   H  HG3  . GLU C  2 147 ? -58.079 5.651   4.285   1.00 0.00 ?  201 GLU C HG3  1  
ATOM   9186   N  N    . ALA C  2 148 ? -55.607 3.624   -0.096  1.00 0.00 ?  202 ALA C N    1  
ATOM   9187   C  CA   . ALA C  2 148 ? -55.554 3.052   -1.460  1.00 0.00 ?  202 ALA C CA   1  
ATOM   9188   C  C    . ALA C  2 148 ? -54.334 2.064   -1.578  1.00 0.00 ?  202 ALA C C    1  
ATOM   9189   O  O    . ALA C  2 148 ? -54.383 1.075   -2.305  1.00 0.00 ?  202 ALA C O    1  
ATOM   9190   C  CB   . ALA C  2 148 ? -55.400 4.247   -2.426  1.00 0.00 ?  202 ALA C CB   1  
ATOM   9191   H  H    . ALA C  2 148 ? -55.548 4.618   -0.033  1.00 0.00 ?  202 ALA C H    1  
ATOM   9192   H  HA   . ALA C  2 148 ? -56.500 2.533   -1.499  1.00 0.00 ?  202 ALA C HA   1  
ATOM   9193   H  HB1  . ALA C  2 148 ? -54.540 4.869   -2.097  1.00 0.00 ?  202 ALA C HB1  1  
ATOM   9194   H  HB2  . ALA C  2 148 ? -56.255 4.954   -2.376  1.00 0.00 ?  202 ALA C HB2  1  
ATOM   9195   H  HB3  . ALA C  2 148 ? -55.343 4.012   -3.510  1.00 0.00 ?  202 ALA C HB3  1  
ATOM   9196   N  N    . LEU C  2 149 ? -53.210 2.210   -0.764  1.00 0.00 ?  203 LEU C N    1  
ATOM   9197   C  CA   . LEU C  2 149 ? -52.101 1.251   -0.781  1.00 0.00 ?  203 LEU C CA   1  
ATOM   9198   C  C    . LEU C  2 149 ? -52.488 -0.080  -0.154  1.00 0.00 ?  203 LEU C C    1  
ATOM   9199   O  O    . LEU C  2 149 ? -52.020 -1.115  -0.623  1.00 0.00 ?  203 LEU C O    1  
ATOM   9200   C  CB   . LEU C  2 149 ? -50.955 1.857   -0.063  1.00 0.00 ?  203 LEU C CB   1  
ATOM   9201   C  CG   . LEU C  2 149 ? -49.659 0.984   -0.107  1.00 0.00 ?  203 LEU C CG   1  
ATOM   9202   C  CD1  . LEU C  2 149 ? -49.221 0.620   -1.487  1.00 0.00 ?  203 LEU C CD1  1  
ATOM   9203   C  CD2  . LEU C  2 149 ? -48.529 1.794   0.591   1.00 0.00 ?  203 LEU C CD2  1  
ATOM   9204   H  H    . LEU C  2 149 ? -53.095 3.075   -0.281  1.00 0.00 ?  203 LEU C H    1  
ATOM   9205   H  HA   . LEU C  2 149 ? -51.932 0.982   -1.813  1.00 0.00 ?  203 LEU C HA   1  
ATOM   9206   H  HB2  . LEU C  2 149 ? -50.776 2.720   -0.739  1.00 0.00 ?  203 LEU C HB2  1  
ATOM   9207   H  HB3  . LEU C  2 149 ? -51.273 2.122   0.968   1.00 0.00 ?  203 LEU C HB3  1  
ATOM   9208   H  HG   . LEU C  2 149 ? -49.760 0.048   0.483   1.00 0.00 ?  203 LEU C HG   1  
ATOM   9209   H  HD11 . LEU C  2 149 ? -49.909 0.015   -2.115  1.00 0.00 ?  203 LEU C HD11 1  
ATOM   9210   H  HD12 . LEU C  2 149 ? -48.324 -0.035  -1.475  1.00 0.00 ?  203 LEU C HD12 1  
ATOM   9211   H  HD13 . LEU C  2 149 ? -49.098 1.499   -2.156  1.00 0.00 ?  203 LEU C HD13 1  
ATOM   9212   H  HD21 . LEU C  2 149 ? -48.877 2.054   1.613   1.00 0.00 ?  203 LEU C HD21 1  
ATOM   9213   H  HD22 . LEU C  2 149 ? -48.409 2.810   0.158   1.00 0.00 ?  203 LEU C HD22 1  
ATOM   9214   H  HD23 . LEU C  2 149 ? -47.553 1.267   0.534   1.00 0.00 ?  203 LEU C HD23 1  
ATOM   9215   N  N    . LYS C  2 150 ? -53.288 -0.157  0.925   1.00 0.00 ?  204 LYS C N    1  
ATOM   9216   C  CA   . LYS C  2 150 ? -53.611 -1.399  1.650   1.00 0.00 ?  204 LYS C CA   1  
ATOM   9217   C  C    . LYS C  2 150 ? -54.213 -2.484  0.775   1.00 0.00 ?  204 LYS C C    1  
ATOM   9218   O  O    . LYS C  2 150 ? -54.023 -3.656  1.032   1.00 0.00 ?  204 LYS C O    1  
ATOM   9219   C  CB   . LYS C  2 150 ? -54.608 -1.141  2.807   1.00 0.00 ?  204 LYS C CB   1  
ATOM   9220   C  CG   . LYS C  2 150 ? -53.786 -0.533  3.947   1.00 0.00 ?  204 LYS C CG   1  
ATOM   9221   C  CD   . LYS C  2 150 ? -54.637 0.208   5.078   1.00 0.00 ?  204 LYS C CD   1  
ATOM   9222   C  CE   . LYS C  2 150 ? -53.947 1.237   5.966   1.00 0.00 ?  204 LYS C CE   1  
ATOM   9223   N  NZ   . LYS C  2 150 ? -54.863 1.842   6.903   1.00 0.00 1  204 LYS C NZ   1  
ATOM   9224   H  H    . LYS C  2 150 ? -53.651 0.694   1.296   1.00 0.00 ?  204 LYS C H    1  
ATOM   9225   H  HA   . LYS C  2 150 ? -52.661 -1.838  1.918   1.00 0.00 ?  204 LYS C HA   1  
ATOM   9226   H  HB2  . LYS C  2 150 ? -55.472 -0.473  2.602   1.00 0.00 ?  204 LYS C HB2  1  
ATOM   9227   H  HB3  . LYS C  2 150 ? -55.130 -2.055  3.162   1.00 0.00 ?  204 LYS C HB3  1  
ATOM   9228   H  HG2  . LYS C  2 150 ? -53.074 -1.231  4.437   1.00 0.00 ?  204 LYS C HG2  1  
ATOM   9229   H  HG3  . LYS C  2 150 ? -53.147 0.319   3.630   1.00 0.00 ?  204 LYS C HG3  1  
ATOM   9230   H  HD2  . LYS C  2 150 ? -55.553 0.594   4.582   1.00 0.00 ?  204 LYS C HD2  1  
ATOM   9231   H  HD3  . LYS C  2 150 ? -55.057 -0.623  5.684   1.00 0.00 ?  204 LYS C HD3  1  
ATOM   9232   H  HE2  . LYS C  2 150 ? -53.213 0.695   6.600   1.00 0.00 ?  204 LYS C HE2  1  
ATOM   9233   H  HE3  . LYS C  2 150 ? -53.493 2.007   5.307   1.00 0.00 ?  204 LYS C HE3  1  
ATOM   9234   H  HZ1  . LYS C  2 150 ? -55.593 2.440   6.465   1.00 0.00 ?  204 LYS C HZ1  1  
ATOM   9235   H  HZ2  . LYS C  2 150 ? -54.335 2.338   7.649   1.00 0.00 ?  204 LYS C HZ2  1  
ATOM   9236   H  HZ3  . LYS C  2 150 ? -55.352 1.033   7.336   1.00 0.00 ?  204 LYS C HZ3  1  
ATOM   9237   N  N    . GLU C  2 151 ? -54.994 -2.139  -0.303  1.00 0.00 ?  205 GLU C N    1  
ATOM   9238   C  CA   . GLU C  2 151 ? -55.556 -3.027  -1.329  1.00 0.00 ?  205 GLU C CA   1  
ATOM   9239   C  C    . GLU C  2 151 ? -54.513 -3.722  -2.109  1.00 0.00 ?  205 GLU C C    1  
ATOM   9240   O  O    . GLU C  2 151 ? -54.713 -4.862  -2.475  1.00 0.00 ?  205 GLU C O    1  
ATOM   9241   C  CB   . GLU C  2 151 ? -56.552 -2.286  -2.268  1.00 0.00 ?  205 GLU C CB   1  
ATOM   9242   C  CG   . GLU C  2 151 ? -57.711 -1.678  -1.539  1.00 0.00 ?  205 GLU C CG   1  
ATOM   9243   C  CD   . GLU C  2 151 ? -58.601 -0.749  -2.315  1.00 0.00 ?  205 GLU C CD   1  
ATOM   9244   O  OE1  . GLU C  2 151 ? -58.471 0.479   -2.302  1.00 0.00 ?  205 GLU C OE1  1  
ATOM   9245   O  OE2  . GLU C  2 151 ? -59.651 -1.290  -2.818  1.00 0.00 -1 205 GLU C OE2  1  
ATOM   9246   H  H    . GLU C  2 151 ? -54.950 -1.161  -0.493  1.00 0.00 ?  205 GLU C H    1  
ATOM   9247   H  HA   . GLU C  2 151 ? -56.043 -3.807  -0.762  1.00 0.00 ?  205 GLU C HA   1  
ATOM   9248   H  HB2  . GLU C  2 151 ? -55.969 -1.453  -2.717  1.00 0.00 ?  205 GLU C HB2  1  
ATOM   9249   H  HB3  . GLU C  2 151 ? -56.948 -2.888  -3.114  1.00 0.00 ?  205 GLU C HB3  1  
ATOM   9250   H  HG2  . GLU C  2 151 ? -58.318 -2.498  -1.098  1.00 0.00 ?  205 GLU C HG2  1  
ATOM   9251   H  HG3  . GLU C  2 151 ? -57.306 -1.098  -0.682  1.00 0.00 ?  205 GLU C HG3  1  
ATOM   9252   N  N    . ASN C  2 152 ? -53.379 -3.066  -2.402  1.00 0.00 ?  206 ASN C N    1  
ATOM   9253   C  CA   . ASN C  2 152 ? -52.197 -3.623  -3.038  1.00 0.00 ?  206 ASN C CA   1  
ATOM   9254   C  C    . ASN C  2 152 ? -51.178 -4.331  -2.067  1.00 0.00 ?  206 ASN C C    1  
ATOM   9255   O  O    . ASN C  2 152 ? -50.650 -5.468  -2.308  1.00 0.00 ?  206 ASN C O    1  
ATOM   9256   C  CB   . ASN C  2 152 ? -51.388 -2.491  -3.697  1.00 0.00 ?  206 ASN C CB   1  
ATOM   9257   C  CG   . ASN C  2 152 ? -50.074 -2.828  -4.388  1.00 0.00 ?  206 ASN C CG   1  
ATOM   9258   O  OD1  . ASN C  2 152 ? -49.061 -2.418  -3.834  1.00 0.00 ?  206 ASN C OD1  1  
ATOM   9259   N  ND2  . ASN C  2 152 ? -50.095 -3.592  -5.457  1.00 0.00 ?  206 ASN C ND2  1  
ATOM   9260   H  H    . ASN C  2 152 ? -53.278 -2.137  -2.055  1.00 0.00 ?  206 ASN C H    1  
ATOM   9261   H  HA   . ASN C  2 152 ? -52.357 -4.420  -3.749  1.00 0.00 ?  206 ASN C HA   1  
ATOM   9262   H  HB2  . ASN C  2 152 ? -51.987 -2.017  -4.504  1.00 0.00 ?  206 ASN C HB2  1  
ATOM   9263   H  HB3  . ASN C  2 152 ? -51.250 -1.643  -2.992  1.00 0.00 ?  206 ASN C HB3  1  
ATOM   9264   H  HD21 . ASN C  2 152 ? -49.200 -3.811  -5.844  1.00 0.00 ?  206 ASN C HD21 1  
ATOM   9265   H  HD22 . ASN C  2 152 ? -50.953 -3.970  -5.808  1.00 0.00 ?  206 ASN C HD22 1  
ATOM   9266   N  N    . GLY C  2 153 ? -50.924 -3.627  -0.903  1.00 0.00 ?  207 GLY C N    1  
ATOM   9267   C  CA   . GLY C  2 153 ? -49.951 -4.001  0.106   1.00 0.00 ?  207 GLY C CA   1  
ATOM   9268   C  C    . GLY C  2 153 ? -50.157 -5.395  0.579   1.00 0.00 ?  207 GLY C C    1  
ATOM   9269   O  O    . GLY C  2 153 ? -49.263 -6.203  0.772   1.00 0.00 ?  207 GLY C O    1  
ATOM   9270   H  H    . GLY C  2 153 ? -51.243 -2.709  -0.682  1.00 0.00 ?  207 GLY C H    1  
ATOM   9271   H  HA2  . GLY C  2 153 ? -49.021 -3.898  -0.435  1.00 0.00 ?  207 GLY C HA2  1  
ATOM   9272   H  HA3  . GLY C  2 153 ? -50.136 -3.379  0.969   1.00 0.00 ?  207 GLY C HA3  1  
ATOM   9273   N  N    . GLY C  2 154 ? -51.435 -5.805  0.929   1.00 0.00 ?  208 GLY C N    1  
ATOM   9274   C  CA   . GLY C  2 154 ? -51.888 -7.053  1.449   1.00 0.00 ?  208 GLY C CA   1  
ATOM   9275   C  C    . GLY C  2 154 ? -51.828 -8.216  0.565   1.00 0.00 ?  208 GLY C C    1  
ATOM   9276   O  O    . GLY C  2 154 ? -51.222 -9.248  0.883   1.00 0.00 ?  208 GLY C O    1  
ATOM   9277   H  H    . GLY C  2 154 ? -52.125 -5.095  0.820   1.00 0.00 ?  208 GLY C H    1  
ATOM   9278   H  HA2  . GLY C  2 154 ? -51.289 -7.201  2.336   1.00 0.00 ?  208 GLY C HA2  1  
ATOM   9279   H  HA3  . GLY C  2 154 ? -52.931 -7.064  1.729   1.00 0.00 ?  208 GLY C HA3  1  
ATOM   9280   N  N    . ALA C  2 155 ? -52.276 -8.047  -0.681  1.00 0.00 ?  209 ALA C N    1  
ATOM   9281   C  CA   . ALA C  2 155 ? -52.145 -9.044  -1.700  1.00 0.00 ?  209 ALA C CA   1  
ATOM   9282   C  C    . ALA C  2 155 ? -50.712 -9.313  -2.261  1.00 0.00 ?  209 ALA C C    1  
ATOM   9283   O  O    . ALA C  2 155 ? -50.289 -10.436 -2.573  1.00 0.00 ?  209 ALA C O    1  
ATOM   9284   C  CB   . ALA C  2 155 ? -52.934 -8.637  -2.947  1.00 0.00 ?  209 ALA C CB   1  
ATOM   9285   H  H    . ALA C  2 155 ? -52.756 -7.212  -0.934  1.00 0.00 ?  209 ALA C H    1  
ATOM   9286   H  HA   . ALA C  2 155 ? -52.491 -9.983  -1.295  1.00 0.00 ?  209 ALA C HA   1  
ATOM   9287   H  HB1  . ALA C  2 155 ? -53.009 -9.510  -3.630  1.00 0.00 ?  209 ALA C HB1  1  
ATOM   9288   H  HB2  . ALA C  2 155 ? -52.409 -7.769  -3.400  1.00 0.00 ?  209 ALA C HB2  1  
ATOM   9289   H  HB3  . ALA C  2 155 ? -53.974 -8.327  -2.710  1.00 0.00 ?  209 ALA C HB3  1  
ATOM   9290   N  N    . ARG C  2 156 ? -49.919 -8.222  -2.302  1.00 0.00 ?  210 ARG C N    1  
ATOM   9291   C  CA   . ARG C  2 156 ? -48.455 -8.209  -2.561  1.00 0.00 ?  210 ARG C CA   1  
ATOM   9292   C  C    . ARG C  2 156 ? -47.674 -8.935  -1.494  1.00 0.00 ?  210 ARG C C    1  
ATOM   9293   O  O    . ARG C  2 156 ? -46.797 -9.764  -1.802  1.00 0.00 ?  210 ARG C O    1  
ATOM   9294   C  CB   . ARG C  2 156 ? -47.931 -6.735  -2.553  1.00 0.00 ?  210 ARG C CB   1  
ATOM   9295   C  CG   . ARG C  2 156 ? -46.444 -6.574  -2.765  1.00 0.00 ?  210 ARG C CG   1  
ATOM   9296   C  CD   . ARG C  2 156 ? -46.045 -5.062  -2.856  1.00 0.00 ?  210 ARG C CD   1  
ATOM   9297   N  NE   . ARG C  2 156 ? -45.852 -4.525  -1.500  1.00 0.00 ?  210 ARG C NE   1  
ATOM   9298   C  CZ   . ARG C  2 156 ? -45.502 -3.329  -1.068  1.00 0.00 ?  210 ARG C CZ   1  
ATOM   9299   N  NH1  . ARG C  2 156 ? -45.356 -3.022  0.205   1.00 0.00 1  210 ARG C NH1  1  
ATOM   9300   N  NH2  . ARG C  2 156 ? -45.397 -2.244  -1.866  1.00 0.00 ?  210 ARG C NH2  1  
ATOM   9301   H  H    . ARG C  2 156 ? -50.217 -7.324  -1.987  1.00 0.00 ?  210 ARG C H    1  
ATOM   9302   H  HA   . ARG C  2 156 ? -48.202 -8.862  -3.384  1.00 0.00 ?  210 ARG C HA   1  
ATOM   9303   H  HB2  . ARG C  2 156 ? -48.477 -6.128  -3.306  1.00 0.00 ?  210 ARG C HB2  1  
ATOM   9304   H  HB3  . ARG C  2 156 ? -48.102 -6.241  -1.572  1.00 0.00 ?  210 ARG C HB3  1  
ATOM   9305   H  HG2  . ARG C  2 156 ? -45.818 -6.985  -1.944  1.00 0.00 ?  210 ARG C HG2  1  
ATOM   9306   H  HG3  . ARG C  2 156 ? -46.108 -7.106  -3.680  1.00 0.00 ?  210 ARG C HG3  1  
ATOM   9307   H  HD2  . ARG C  2 156 ? -45.051 -5.012  -3.350  1.00 0.00 ?  210 ARG C HD2  1  
ATOM   9308   H  HD3  . ARG C  2 156 ? -46.892 -4.419  -3.175  1.00 0.00 ?  210 ARG C HD3  1  
ATOM   9309   H  HE   . ARG C  2 156 ? -46.197 -5.234  -0.886  1.00 0.00 ?  210 ARG C HE   1  
ATOM   9310   H  HH11 . ARG C  2 156 ? -45.745 -3.604  0.920   1.00 0.00 ?  210 ARG C HH11 1  
ATOM   9311   H  HH12 . ARG C  2 156 ? -45.131 -2.071  0.416   1.00 0.00 ?  210 ARG C HH12 1  
ATOM   9312   H  HH21 . ARG C  2 156 ? -45.357 -1.372  -1.378  1.00 0.00 ?  210 ARG C HH21 1  
ATOM   9313   H  HH22 . ARG C  2 156 ? -45.545 -2.388  -2.844  1.00 0.00 ?  210 ARG C HH22 1  
ATOM   9314   N  N    . LEU C  2 157 ? -48.049 -8.810  -0.138  1.00 0.00 ?  211 LEU C N    1  
ATOM   9315   C  CA   . LEU C  2 157 ? -47.393 -9.567  0.917   1.00 0.00 ?  211 LEU C CA   1  
ATOM   9316   C  C    . LEU C  2 157 ? -47.656 -11.084 0.749   1.00 0.00 ?  211 LEU C C    1  
ATOM   9317   O  O    . LEU C  2 157 ? -46.763 -11.949 0.711   1.00 0.00 ?  211 LEU C O    1  
ATOM   9318   C  CB   . LEU C  2 157 ? -47.899 -9.036  2.236   1.00 0.00 ?  211 LEU C CB   1  
ATOM   9319   C  CG   . LEU C  2 157 ? -47.691 -9.896  3.492   1.00 0.00 ?  211 LEU C CG   1  
ATOM   9320   C  CD1  . LEU C  2 157 ? -46.086 -10.046 3.774   1.00 0.00 ?  211 LEU C CD1  1  
ATOM   9321   C  CD2  . LEU C  2 157 ? -48.269 -9.147  4.729   1.00 0.00 ?  211 LEU C CD2  1  
ATOM   9322   H  H    . LEU C  2 157 ? -48.843 -8.281  0.151   1.00 0.00 ?  211 LEU C H    1  
ATOM   9323   H  HA   . LEU C  2 157 ? -46.331 -9.427  0.778   1.00 0.00 ?  211 LEU C HA   1  
ATOM   9324   H  HB2  . LEU C  2 157 ? -47.439 -8.027  2.302   1.00 0.00 ?  211 LEU C HB2  1  
ATOM   9325   H  HB3  . LEU C  2 157 ? -48.983 -8.809  2.152   1.00 0.00 ?  211 LEU C HB3  1  
ATOM   9326   H  HG   . LEU C  2 157 ? -48.136 -10.910 3.400   1.00 0.00 ?  211 LEU C HG   1  
ATOM   9327   H  HD11 . LEU C  2 157 ? -45.677 -10.720 2.992   1.00 0.00 ?  211 LEU C HD11 1  
ATOM   9328   H  HD12 . LEU C  2 157 ? -45.849 -10.424 4.792   1.00 0.00 ?  211 LEU C HD12 1  
ATOM   9329   H  HD13 . LEU C  2 157 ? -45.669 -9.017  3.746   1.00 0.00 ?  211 LEU C HD13 1  
ATOM   9330   H  HD21 . LEU C  2 157 ? -49.358 -8.934  4.672   1.00 0.00 ?  211 LEU C HD21 1  
ATOM   9331   H  HD22 . LEU C  2 157 ? -47.724 -8.220  5.007   1.00 0.00 ?  211 LEU C HD22 1  
ATOM   9332   H  HD23 . LEU C  2 157 ? -48.093 -9.726  5.662   1.00 0.00 ?  211 LEU C HD23 1  
ATOM   9333   N  N    . ALA C  2 158 ? -48.887 -11.442 0.533   1.00 0.00 ?  212 ALA C N    1  
ATOM   9334   C  CA   . ALA C  2 158 ? -49.406 -12.824 0.532   1.00 0.00 ?  212 ALA C CA   1  
ATOM   9335   C  C    . ALA C  2 158 ? -48.957 -13.697 -0.689  1.00 0.00 ?  212 ALA C C    1  
ATOM   9336   O  O    . ALA C  2 158 ? -48.739 -14.909 -0.634  1.00 0.00 ?  212 ALA C O    1  
ATOM   9337   C  CB   . ALA C  2 158 ? -50.973 -12.690 0.484   1.00 0.00 ?  212 ALA C CB   1  
ATOM   9338   H  H    . ALA C  2 158 ? -49.560 -10.707 0.497   1.00 0.00 ?  212 ALA C H    1  
ATOM   9339   H  HA   . ALA C  2 158 ? -49.168 -13.164 1.528   1.00 0.00 ?  212 ALA C HA   1  
ATOM   9340   H  HB1  . ALA C  2 158 ? -51.364 -12.040 1.296   1.00 0.00 ?  212 ALA C HB1  1  
ATOM   9341   H  HB2  . ALA C  2 158 ? -51.546 -13.634 0.609   1.00 0.00 ?  212 ALA C HB2  1  
ATOM   9342   H  HB3  . ALA C  2 158 ? -51.288 -12.154 -0.437  1.00 0.00 ?  212 ALA C HB3  1  
ATOM   9343   N  N    . GLU C  2 159 ? -48.744 -13.071 -1.865  1.00 0.00 ?  213 GLU C N    1  
ATOM   9344   C  CA   . GLU C  2 159 ? -48.184 -13.724 -3.017  1.00 0.00 ?  213 GLU C CA   1  
ATOM   9345   C  C    . GLU C  2 159 ? -46.704 -13.789 -2.863  1.00 0.00 ?  213 GLU C C    1  
ATOM   9346   O  O    . GLU C  2 159 ? -46.053 -14.786 -3.048  1.00 0.00 ?  213 GLU C O    1  
ATOM   9347   C  CB   . GLU C  2 159 ? -48.453 -12.954 -4.336  1.00 0.00 ?  213 GLU C CB   1  
ATOM   9348   C  CG   . GLU C  2 159 ? -47.937 -13.692 -5.573  1.00 0.00 ?  213 GLU C CG   1  
ATOM   9349   C  CD   . GLU C  2 159 ? -48.334 -12.964 -6.868  1.00 0.00 ?  213 GLU C CD   1  
ATOM   9350   O  OE1  . GLU C  2 159 ? -49.548 -12.674 -6.999  1.00 0.00 ?  213 GLU C OE1  1  
ATOM   9351   O  OE2  . GLU C  2 159 ? -47.446 -12.793 -7.747  1.00 0.00 -1 213 GLU C OE2  1  
ATOM   9352   H  H    . GLU C  2 159 ? -48.903 -12.090 -1.945  1.00 0.00 ?  213 GLU C H    1  
ATOM   9353   H  HA   . GLU C  2 159 ? -48.504 -14.756 -3.043  1.00 0.00 ?  213 GLU C HA   1  
ATOM   9354   H  HB2  . GLU C  2 159 ? -49.541 -12.729 -4.366  1.00 0.00 ?  213 GLU C HB2  1  
ATOM   9355   H  HB3  . GLU C  2 159 ? -48.029 -11.930 -4.272  1.00 0.00 ?  213 GLU C HB3  1  
ATOM   9356   H  HG2  . GLU C  2 159 ? -46.832 -13.778 -5.497  1.00 0.00 ?  213 GLU C HG2  1  
ATOM   9357   H  HG3  . GLU C  2 159 ? -48.272 -14.742 -5.718  1.00 0.00 ?  213 GLU C HG3  1  
ATOM   9358   N  N    . TYR C  2 160 ? -46.036 -12.748 -2.433  1.00 0.00 ?  214 TYR C N    1  
ATOM   9359   C  CA   . TYR C  2 160 ? -44.587 -12.792 -2.137  1.00 0.00 ?  214 TYR C CA   1  
ATOM   9360   C  C    . TYR C  2 160 ? -44.177 -13.849 -1.086  1.00 0.00 ?  214 TYR C C    1  
ATOM   9361   O  O    . TYR C  2 160 ? -43.287 -14.671 -1.243  1.00 0.00 ?  214 TYR C O    1  
ATOM   9362   C  CB   . TYR C  2 160 ? -44.038 -11.413 -1.743  1.00 0.00 ?  214 TYR C CB   1  
ATOM   9363   C  CG   . TYR C  2 160 ? -42.557 -11.413 -1.438  1.00 0.00 ?  214 TYR C CG   1  
ATOM   9364   C  CD1  . TYR C  2 160 ? -42.166 -10.691 -0.272  1.00 0.00 ?  214 TYR C CD1  1  
ATOM   9365   C  CD2  . TYR C  2 160 ? -41.550 -11.891 -2.337  1.00 0.00 ?  214 TYR C CD2  1  
ATOM   9366   C  CE1  . TYR C  2 160 ? -40.830 -10.576 -0.035  1.00 0.00 ?  214 TYR C CE1  1  
ATOM   9367   C  CE2  . TYR C  2 160 ? -40.218 -11.926 -1.889  1.00 0.00 ?  214 TYR C CE2  1  
ATOM   9368   C  CZ   . TYR C  2 160 ? -39.835 -11.163 -0.819  1.00 0.00 ?  214 TYR C CZ   1  
ATOM   9369   O  OH   . TYR C  2 160 ? -38.419 -11.068 -0.566  1.00 0.00 ?  214 TYR C OH   1  
ATOM   9370   H  H    . TYR C  2 160 ? -46.523 -11.882 -2.353  1.00 0.00 ?  214 TYR C H    1  
ATOM   9371   H  HA   . TYR C  2 160 ? -44.078 -13.152 -3.020  1.00 0.00 ?  214 TYR C HA   1  
ATOM   9372   H  HB2  . TYR C  2 160 ? -44.248 -10.799 -2.645  1.00 0.00 ?  214 TYR C HB2  1  
ATOM   9373   H  HB3  . TYR C  2 160 ? -44.607 -11.054 -0.859  1.00 0.00 ?  214 TYR C HB3  1  
ATOM   9374   H  HD1  . TYR C  2 160 ? -42.907 -10.210 0.350   1.00 0.00 ?  214 TYR C HD1  1  
ATOM   9375   H  HD2  . TYR C  2 160 ? -41.796 -12.399 -3.258  1.00 0.00 ?  214 TYR C HD2  1  
ATOM   9376   H  HE1  . TYR C  2 160 ? -40.561 -10.057 0.873   1.00 0.00 ?  214 TYR C HE1  1  
ATOM   9377   H  HE2  . TYR C  2 160 ? -39.538 -12.404 -2.578  1.00 0.00 ?  214 TYR C HE2  1  
ATOM   9378   H  HH   . TYR C  2 160 ? -38.315 -10.657 0.295   1.00 0.00 ?  214 TYR C HH   1  
ATOM   9379   N  N    . HIS C  2 161 ? -45.012 -13.965 -0.048  1.00 0.00 ?  215 HIS C N    1  
ATOM   9380   C  CA   . HIS C  2 161 ? -44.974 -14.964 1.042   1.00 0.00 ?  215 HIS C CA   1  
ATOM   9381   C  C    . HIS C  2 161 ? -45.093 -16.455 0.613   1.00 0.00 ?  215 HIS C C    1  
ATOM   9382   O  O    . HIS C  2 161 ? -44.270 -17.309 1.021   1.00 0.00 ?  215 HIS C O    1  
ATOM   9383   C  CB   . HIS C  2 161 ? -45.915 -14.644 2.223   1.00 0.00 ?  215 HIS C CB   1  
ATOM   9384   C  CG   . HIS C  2 161 ? -46.219 -15.661 3.336   1.00 0.00 ?  215 HIS C CG   1  
ATOM   9385   N  ND1  . HIS C  2 161 ? -45.171 -16.235 4.098   1.00 0.00 ?  215 HIS C ND1  1  
ATOM   9386   C  CD2  . HIS C  2 161 ? -47.361 -16.082 3.892   1.00 0.00 ?  215 HIS C CD2  1  
ATOM   9387   C  CE1  . HIS C  2 161 ? -45.840 -16.996 5.041   1.00 0.00 ?  215 HIS C CE1  1  
ATOM   9388   N  NE2  . HIS C  2 161 ? -47.159 -16.979 4.943   1.00 0.00 ?  215 HIS C NE2  1  
ATOM   9389   H  H    . HIS C  2 161 ? -45.813 -13.372 -0.078  1.00 0.00 ?  215 HIS C H    1  
ATOM   9390   H  HA   . HIS C  2 161 ? -44.000 -14.808 1.482   1.00 0.00 ?  215 HIS C HA   1  
ATOM   9391   H  HB2  . HIS C  2 161 ? -45.689 -13.620 2.589   1.00 0.00 ?  215 HIS C HB2  1  
ATOM   9392   H  HB3  . HIS C  2 161 ? -46.880 -14.548 1.680   1.00 0.00 ?  215 HIS C HB3  1  
ATOM   9393   H  HD1  . HIS C  2 161 ? -44.182 -16.126 3.996   1.00 0.00 ?  215 HIS C HD1  1  
ATOM   9394   H  HD2  . HIS C  2 161 ? -48.351 -15.675 3.726   1.00 0.00 ?  215 HIS C HD2  1  
ATOM   9395   H  HE1  . HIS C  2 161 ? -45.271 -17.276 5.928   1.00 0.00 ?  215 HIS C HE1  1  
ATOM   9396   N  N    . ALA C  2 162 ? -46.133 -16.843 -0.145  1.00 0.00 ?  216 ALA C N    1  
ATOM   9397   C  CA   . ALA C  2 162 ? -46.389 -18.155 -0.611  1.00 0.00 ?  216 ALA C CA   1  
ATOM   9398   C  C    . ALA C  2 162 ? -45.355 -18.694 -1.537  1.00 0.00 ?  216 ALA C C    1  
ATOM   9399   O  O    . ALA C  2 162 ? -44.989 -19.886 -1.611  1.00 0.00 ?  216 ALA C O    1  
ATOM   9400   C  CB   . ALA C  2 162 ? -47.800 -18.146 -1.245  1.00 0.00 ?  216 ALA C CB   1  
ATOM   9401   H  H    . ALA C  2 162 ? -46.789 -16.146 -0.425  1.00 0.00 ?  216 ALA C H    1  
ATOM   9402   H  HA   . ALA C  2 162 ? -46.377 -18.784 0.266   1.00 0.00 ?  216 ALA C HA   1  
ATOM   9403   H  HB1  . ALA C  2 162 ? -48.501 -17.541 -0.631  1.00 0.00 ?  216 ALA C HB1  1  
ATOM   9404   H  HB2  . ALA C  2 162 ? -48.304 -19.129 -1.360  1.00 0.00 ?  216 ALA C HB2  1  
ATOM   9405   H  HB3  . ALA C  2 162 ? -47.730 -17.831 -2.308  1.00 0.00 ?  216 ALA C HB3  1  
ATOM   9406   N  N    . LYS C  2 163 ? -44.795 -17.853 -2.444  1.00 0.00 ?  217 LYS C N    1  
ATOM   9407   C  CA   . LYS C  2 163 ? -43.633 -18.235 -3.227  1.00 0.00 ?  217 LYS C CA   1  
ATOM   9408   C  C    . LYS C  2 163 ? -42.405 -18.365 -2.366  1.00 0.00 ?  217 LYS C C    1  
ATOM   9409   O  O    . LYS C  2 163 ? -41.653 -19.325 -2.526  1.00 0.00 ?  217 LYS C O    1  
ATOM   9410   C  CB   . LYS C  2 163 ? -43.328 -17.122 -4.284  1.00 0.00 ?  217 LYS C CB   1  
ATOM   9411   C  CG   . LYS C  2 163 ? -44.475 -17.011 -5.338  1.00 0.00 ?  217 LYS C CG   1  
ATOM   9412   C  CD   . LYS C  2 163 ? -44.268 -15.929 -6.285  1.00 0.00 ?  217 LYS C CD   1  
ATOM   9413   C  CE   . LYS C  2 163 ? -45.286 -15.908 -7.365  1.00 0.00 ?  217 LYS C CE   1  
ATOM   9414   N  NZ   . LYS C  2 163 ? -44.964 -14.979 -8.425  1.00 0.00 1  217 LYS C NZ   1  
ATOM   9415   H  H    . LYS C  2 163 ? -45.022 -16.884 -2.375  1.00 0.00 ?  217 LYS C H    1  
ATOM   9416   H  HA   . LYS C  2 163 ? -43.774 -19.223 -3.641  1.00 0.00 ?  217 LYS C HA   1  
ATOM   9417   H  HB2  . LYS C  2 163 ? -43.117 -16.161 -3.768  1.00 0.00 ?  217 LYS C HB2  1  
ATOM   9418   H  HB3  . LYS C  2 163 ? -42.345 -17.310 -4.766  1.00 0.00 ?  217 LYS C HB3  1  
ATOM   9419   H  HG2  . LYS C  2 163 ? -44.417 -17.990 -5.860  1.00 0.00 ?  217 LYS C HG2  1  
ATOM   9420   H  HG3  . LYS C  2 163 ? -45.457 -16.896 -4.830  1.00 0.00 ?  217 LYS C HG3  1  
ATOM   9421   H  HD2  . LYS C  2 163 ? -44.383 -14.944 -5.784  1.00 0.00 ?  217 LYS C HD2  1  
ATOM   9422   H  HD3  . LYS C  2 163 ? -43.250 -15.907 -6.730  1.00 0.00 ?  217 LYS C HD3  1  
ATOM   9423   H  HE2  . LYS C  2 163 ? -45.192 -16.893 -7.870  1.00 0.00 ?  217 LYS C HE2  1  
ATOM   9424   H  HE3  . LYS C  2 163 ? -46.309 -15.792 -6.946  1.00 0.00 ?  217 LYS C HE3  1  
ATOM   9425   H  HZ1  . LYS C  2 163 ? -44.674 -14.041 -8.081  1.00 0.00 ?  217 LYS C HZ1  1  
ATOM   9426   H  HZ2  . LYS C  2 163 ? -45.834 -14.953 -8.993  1.00 0.00 ?  217 LYS C HZ2  1  
ATOM   9427   H  HZ3  . LYS C  2 163 ? -44.180 -15.324 -9.014  1.00 0.00 ?  217 LYS C HZ3  1  
ATOM   9428   N  N    . ALA C  2 164 ? -42.152 -17.388 -1.425  1.00 0.00 ?  218 ALA C N    1  
ATOM   9429   C  CA   . ALA C  2 164 ? -40.952 -17.417 -0.573  1.00 0.00 ?  218 ALA C CA   1  
ATOM   9430   C  C    . ALA C  2 164 ? -40.850 -18.566 0.437   1.00 0.00 ?  218 ALA C C    1  
ATOM   9431   O  O    . ALA C  2 164 ? -39.792 -19.192 0.683   1.00 0.00 ?  218 ALA C O    1  
ATOM   9432   C  CB   . ALA C  2 164 ? -40.839 -16.140 0.255   1.00 0.00 ?  218 ALA C CB   1  
ATOM   9433   H  H    . ALA C  2 164 ? -42.747 -16.588 -1.438  1.00 0.00 ?  218 ALA C H    1  
ATOM   9434   H  HA   . ALA C  2 164 ? -40.119 -17.559 -1.247  1.00 0.00 ?  218 ALA C HA   1  
ATOM   9435   H  HB1  . ALA C  2 164 ? -40.768 -15.215 -0.355  1.00 0.00 ?  218 ALA C HB1  1  
ATOM   9436   H  HB2  . ALA C  2 164 ? -39.926 -16.259 0.877   1.00 0.00 ?  218 ALA C HB2  1  
ATOM   9437   H  HB3  . ALA C  2 164 ? -41.695 -16.015 0.953   1.00 0.00 ?  218 ALA C HB3  1  
ATOM   9438   N  N    . THR C  2 165 ? -41.995 -18.888 1.045   1.00 0.00 ?  219 THR C N    1  
ATOM   9439   C  CA   . THR C  2 165 ? -42.252 -20.052 1.828   1.00 0.00 ?  219 THR C CA   1  
ATOM   9440   C  C    . THR C  2 165 ? -42.197 -21.394 1.140   1.00 0.00 ?  219 THR C C    1  
ATOM   9441   O  O    . THR C  2 165 ? -41.598 -22.331 1.759   1.00 0.00 ?  219 THR C O    1  
ATOM   9442   C  CB   . THR C  2 165 ? -43.603 -20.058 2.606   1.00 0.00 ?  219 THR C CB   1  
ATOM   9443   O  OG1  . THR C  2 165 ? -44.835 -19.687 1.955   1.00 0.00 ?  219 THR C OG1  1  
ATOM   9444   C  CG2  . THR C  2 165 ? -43.475 -18.986 3.650   1.00 0.00 ?  219 THR C CG2  1  
ATOM   9445   H  H    . THR C  2 165 ? -42.708 -18.218 0.857   1.00 0.00 ?  219 THR C H    1  
ATOM   9446   H  HA   . THR C  2 165 ? -41.525 -20.003 2.625   1.00 0.00 ?  219 THR C HA   1  
ATOM   9447   H  HB   . THR C  2 165 ? -43.819 -21.018 3.121   1.00 0.00 ?  219 THR C HB   1  
ATOM   9448   H  HG1  . THR C  2 165 ? -44.737 -18.761 1.724   1.00 0.00 ?  219 THR C HG1  1  
ATOM   9449   H  HG21 . THR C  2 165 ? -42.575 -19.122 4.287   1.00 0.00 ?  219 THR C HG21 1  
ATOM   9450   H  HG22 . THR C  2 165 ? -44.323 -19.003 4.368   1.00 0.00 ?  219 THR C HG22 1  
ATOM   9451   H  HG23 . THR C  2 165 ? -43.258 -17.982 3.226   1.00 0.00 ?  219 THR C HG23 1  
ATOM   9452   N  N    . GLU C  2 166 ? -42.611 -21.511 -0.202  1.00 0.00 ?  220 GLU C N    1  
ATOM   9453   C  CA   . GLU C  2 166 ? -42.493 -22.731 -0.991  1.00 0.00 ?  220 GLU C CA   1  
ATOM   9454   C  C    . GLU C  2 166 ? -41.095 -23.256 -1.235  1.00 0.00 ?  220 GLU C C    1  
ATOM   9455   O  O    . GLU C  2 166 ? -40.765 -24.424 -1.026  1.00 0.00 ?  220 GLU C O    1  
ATOM   9456   C  CB   . GLU C  2 166 ? -43.178 -22.607 -2.442  1.00 0.00 ?  220 GLU C CB   1  
ATOM   9457   C  CG   . GLU C  2 166 ? -42.933 -23.715 -3.442  1.00 0.00 ?  220 GLU C CG   1  
ATOM   9458   C  CD   . GLU C  2 166 ? -43.715 -23.745 -4.655  1.00 0.00 ?  220 GLU C CD   1  
ATOM   9459   O  OE1  . GLU C  2 166 ? -44.689 -22.934 -4.832  1.00 0.00 ?  220 GLU C OE1  1  
ATOM   9460   O  OE2  . GLU C  2 166 ? -43.453 -24.672 -5.489  1.00 0.00 -1 220 GLU C OE2  1  
ATOM   9461   H  H    . GLU C  2 166 ? -42.981 -20.745 -0.723  1.00 0.00 ?  220 GLU C H    1  
ATOM   9462   H  HA   . GLU C  2 166 ? -43.057 -23.497 -0.480  1.00 0.00 ?  220 GLU C HA   1  
ATOM   9463   H  HB2  . GLU C  2 166 ? -44.244 -22.765 -2.171  1.00 0.00 ?  220 GLU C HB2  1  
ATOM   9464   H  HB3  . GLU C  2 166 ? -43.060 -21.558 -2.788  1.00 0.00 ?  220 GLU C HB3  1  
ATOM   9465   H  HG2  . GLU C  2 166 ? -41.863 -23.766 -3.736  1.00 0.00 ?  220 GLU C HG2  1  
ATOM   9466   H  HG3  . GLU C  2 166 ? -43.274 -24.612 -2.883  1.00 0.00 ?  220 GLU C HG3  1  
ATOM   9467   N  N    . HIS C  2 167 ? -40.251 -22.278 -1.512  1.00 0.00 ?  221 HIS C N    1  
ATOM   9468   C  CA   . HIS C  2 167 ? -38.824 -22.461 -1.810  1.00 0.00 ?  221 HIS C CA   1  
ATOM   9469   C  C    . HIS C  2 167 ? -37.984 -22.689 -0.524  1.00 0.00 ?  221 HIS C C    1  
ATOM   9470   O  O    . HIS C  2 167 ? -37.129 -23.569 -0.573  1.00 0.00 ?  221 HIS C O    1  
ATOM   9471   C  CB   . HIS C  2 167 ? -38.352 -21.179 -2.594  1.00 0.00 ?  221 HIS C CB   1  
ATOM   9472   C  CG   . HIS C  2 167 ? -38.879 -21.235 -4.048  1.00 0.00 ?  221 HIS C CG   1  
ATOM   9473   N  ND1  . HIS C  2 167 ? -40.161 -20.822 -4.329  1.00 0.00 ?  221 HIS C ND1  1  
ATOM   9474   C  CD2  . HIS C  2 167 ? -38.250 -21.322 -5.348  1.00 0.00 ?  221 HIS C CD2  1  
ATOM   9475   C  CE1  . HIS C  2 167 ? -40.260 -20.719 -5.655  1.00 0.00 ?  221 HIS C CE1  1  
ATOM   9476   N  NE2  . HIS C  2 167 ? -39.185 -21.043 -6.278  1.00 0.00 ?  221 HIS C NE2  1  
ATOM   9477   H  H    . HIS C  2 167 ? -40.587 -21.341 -1.467  1.00 0.00 ?  221 HIS C H    1  
ATOM   9478   H  HA   . HIS C  2 167 ? -38.734 -23.376 -2.378  1.00 0.00 ?  221 HIS C HA   1  
ATOM   9479   H  HB2  . HIS C  2 167 ? -38.564 -20.189 -2.136  1.00 0.00 ?  221 HIS C HB2  1  
ATOM   9480   H  HB3  . HIS C  2 167 ? -37.263 -21.203 -2.810  1.00 0.00 ?  221 HIS C HB3  1  
ATOM   9481   H  HD1  . HIS C  2 167 ? -40.771 -20.463 -3.622  1.00 0.00 ?  221 HIS C HD1  1  
ATOM   9482   H  HD2  . HIS C  2 167 ? -37.313 -21.777 -5.644  1.00 0.00 ?  221 HIS C HD2  1  
ATOM   9483   H  HE1  . HIS C  2 167 ? -41.239 -20.823 -6.123  1.00 0.00 ?  221 HIS C HE1  1  
ATOM   9484   N  N    . LEU C  2 168 ? -38.309 -22.017 0.605   1.00 0.00 ?  222 LEU C N    1  
ATOM   9485   C  CA   . LEU C  2 168 ? -37.747 -22.358 1.924   1.00 0.00 ?  222 LEU C CA   1  
ATOM   9486   C  C    . LEU C  2 168 ? -38.160 -23.722 2.435   1.00 0.00 ?  222 LEU C C    1  
ATOM   9487   O  O    . LEU C  2 168 ? -37.342 -24.562 2.843   1.00 0.00 ?  222 LEU C O    1  
ATOM   9488   C  CB   . LEU C  2 168 ? -38.178 -21.440 3.054   1.00 0.00 ?  222 LEU C CB   1  
ATOM   9489   C  CG   . LEU C  2 168 ? -37.673 -20.015 3.070   1.00 0.00 ?  222 LEU C CG   1  
ATOM   9490   C  CD1  . LEU C  2 168 ? -38.390 -19.249 4.156   1.00 0.00 ?  222 LEU C CD1  1  
ATOM   9491   C  CD2  . LEU C  2 168 ? -36.174 -19.915 3.352   1.00 0.00 ?  222 LEU C CD2  1  
ATOM   9492   H  H    . LEU C  2 168 ? -38.952 -21.260 0.520   1.00 0.00 ?  222 LEU C H    1  
ATOM   9493   H  HA   . LEU C  2 168 ? -36.676 -22.433 1.812   1.00 0.00 ?  222 LEU C HA   1  
ATOM   9494   H  HB2  . LEU C  2 168 ? -39.276 -21.301 3.143   1.00 0.00 ?  222 LEU C HB2  1  
ATOM   9495   H  HB3  . LEU C  2 168 ? -37.778 -21.789 4.031   1.00 0.00 ?  222 LEU C HB3  1  
ATOM   9496   H  HG   . LEU C  2 168 ? -37.901 -19.538 2.093   1.00 0.00 ?  222 LEU C HG   1  
ATOM   9497   H  HD11 . LEU C  2 168 ? -39.462 -19.105 3.899   1.00 0.00 ?  222 LEU C HD11 1  
ATOM   9498   H  HD12 . LEU C  2 168 ? -37.990 -18.227 4.326   1.00 0.00 ?  222 LEU C HD12 1  
ATOM   9499   H  HD13 . LEU C  2 168 ? -38.291 -19.831 5.097   1.00 0.00 ?  222 LEU C HD13 1  
ATOM   9500   H  HD21 . LEU C  2 168 ? -35.883 -20.034 4.417   1.00 0.00 ?  222 LEU C HD21 1  
ATOM   9501   H  HD22 . LEU C  2 168 ? -35.775 -18.947 2.980   1.00 0.00 ?  222 LEU C HD22 1  
ATOM   9502   H  HD23 . LEU C  2 168 ? -35.659 -20.615 2.659   1.00 0.00 ?  222 LEU C HD23 1  
ATOM   9503   N  N    . SER C  2 169 ? -39.437 -24.051 2.391   1.00 0.00 ?  223 SER C N    1  
ATOM   9504   C  CA   . SER C  2 169 ? -40.058 -25.293 2.916   1.00 0.00 ?  223 SER C CA   1  
ATOM   9505   C  C    . SER C  2 169 ? -39.492 -26.583 2.220   1.00 0.00 ?  223 SER C C    1  
ATOM   9506   O  O    . SER C  2 169 ? -39.266 -27.548 2.929   1.00 0.00 ?  223 SER C O    1  
ATOM   9507   C  CB   . SER C  2 169 ? -41.633 -25.327 2.770   1.00 0.00 ?  223 SER C CB   1  
ATOM   9508   O  OG   . SER C  2 169 ? -42.066 -26.603 3.126   1.00 0.00 ?  223 SER C OG   1  
ATOM   9509   H  H    . SER C  2 169 ? -40.152 -23.429 2.081   1.00 0.00 ?  223 SER C H    1  
ATOM   9510   H  HA   . SER C  2 169 ? -39.847 -25.450 3.963   1.00 0.00 ?  223 SER C HA   1  
ATOM   9511   H  HB2  . SER C  2 169 ? -42.175 -24.541 3.338   1.00 0.00 ?  223 SER C HB2  1  
ATOM   9512   H  HB3  . SER C  2 169 ? -41.810 -25.180 1.683   1.00 0.00 ?  223 SER C HB3  1  
ATOM   9513   H  HG   . SER C  2 169 ? -42.799 -26.788 2.535   1.00 0.00 ?  223 SER C HG   1  
ATOM   9514   N  N    . THR C  2 170 ? -39.231 -26.489 0.920   1.00 0.00 ?  224 THR C N    1  
ATOM   9515   C  CA   . THR C  2 170 ? -38.786 -27.630 0.155   1.00 0.00 ?  224 THR C CA   1  
ATOM   9516   C  C    . THR C  2 170 ? -37.314 -27.688 -0.292  1.00 0.00 ?  224 THR C C    1  
ATOM   9517   O  O    . THR C  2 170 ? -36.886 -28.544 -1.092  1.00 0.00 ?  224 THR C O    1  
ATOM   9518   C  CB   . THR C  2 170 ? -39.652 -27.738 -1.128  1.00 0.00 ?  224 THR C CB   1  
ATOM   9519   O  OG1  . THR C  2 170 ? -39.574 -26.622 -1.948  1.00 0.00 ?  224 THR C OG1  1  
ATOM   9520   C  CG2  . THR C  2 170 ? -41.103 -27.816 -0.666  1.00 0.00 ?  224 THR C CG2  1  
ATOM   9521   H  H    . THR C  2 170 ? -39.431 -25.698 0.348   1.00 0.00 ?  224 THR C H    1  
ATOM   9522   H  HA   . THR C  2 170 ? -39.008 -28.533 0.705   1.00 0.00 ?  224 THR C HA   1  
ATOM   9523   H  HB   . THR C  2 170 ? -39.406 -28.646 -1.720  1.00 0.00 ?  224 THR C HB   1  
ATOM   9524   H  HG1  . THR C  2 170 ? -40.245 -26.059 -1.557  1.00 0.00 ?  224 THR C HG1  1  
ATOM   9525   H  HG21 . THR C  2 170 ? -41.827 -28.160 -1.436  1.00 0.00 ?  224 THR C HG21 1  
ATOM   9526   H  HG22 . THR C  2 170 ? -41.565 -26.918 -0.202  1.00 0.00 ?  224 THR C HG22 1  
ATOM   9527   H  HG23 . THR C  2 170 ? -41.128 -28.573 0.146   1.00 0.00 ?  224 THR C HG23 1  
ATOM   9528   N  N    . LEU C  2 171 ? -36.488 -26.809 0.227   1.00 0.00 ?  225 LEU C N    1  
ATOM   9529   C  CA   . LEU C  2 171 ? -35.048 -26.744 -0.150  1.00 0.00 ?  225 LEU C CA   1  
ATOM   9530   C  C    . LEU C  2 171 ? -34.254 -28.031 0.100   1.00 0.00 ?  225 LEU C C    1  
ATOM   9531   O  O    . LEU C  2 171 ? -33.357 -28.351 -0.742  1.00 0.00 ?  225 LEU C O    1  
ATOM   9532   C  CB   . LEU C  2 171 ? -34.465 -25.589 0.718   1.00 0.00 ?  225 LEU C CB   1  
ATOM   9533   C  CG   . LEU C  2 171 ? -33.041 -25.190 0.303   1.00 0.00 ?  225 LEU C CG   1  
ATOM   9534   C  CD1  . LEU C  2 171 ? -33.126 -24.232 -0.879  1.00 0.00 ?  225 LEU C CD1  1  
ATOM   9535   C  CD2  . LEU C  2 171 ? -32.241 -24.477 1.379   1.00 0.00 ?  225 LEU C CD2  1  
ATOM   9536   H  H    . LEU C  2 171 ? -36.889 -26.179 0.888   1.00 0.00 ?  225 LEU C H    1  
ATOM   9537   H  HA   . LEU C  2 171 ? -35.038 -26.405 -1.176  1.00 0.00 ?  225 LEU C HA   1  
ATOM   9538   H  HB2  . LEU C  2 171 ? -35.048 -24.666 0.509   1.00 0.00 ?  225 LEU C HB2  1  
ATOM   9539   H  HB3  . LEU C  2 171 ? -34.487 -25.854 1.796   1.00 0.00 ?  225 LEU C HB3  1  
ATOM   9540   H  HG   . LEU C  2 171 ? -32.417 -26.091 0.120   1.00 0.00 ?  225 LEU C HG   1  
ATOM   9541   H  HD11 . LEU C  2 171 ? -33.680 -24.780 -1.671  1.00 0.00 ?  225 LEU C HD11 1  
ATOM   9542   H  HD12 . LEU C  2 171 ? -32.140 -23.844 -1.212  1.00 0.00 ?  225 LEU C HD12 1  
ATOM   9543   H  HD13 . LEU C  2 171 ? -33.659 -23.310 -0.564  1.00 0.00 ?  225 LEU C HD13 1  
ATOM   9544   H  HD21 . LEU C  2 171 ? -31.435 -24.059 0.739   1.00 0.00 ?  225 LEU C HD21 1  
ATOM   9545   H  HD22 . LEU C  2 171 ? -31.877 -25.115 2.212   1.00 0.00 ?  225 LEU C HD22 1  
ATOM   9546   H  HD23 . LEU C  2 171 ? -32.801 -23.620 1.812   1.00 0.00 ?  225 LEU C HD23 1  
ATOM   9547   N  N    . SER C  2 172 ? -34.496 -28.826 1.227   1.00 0.00 ?  226 SER C N    1  
ATOM   9548   C  CA   . SER C  2 172 ? -33.861 -30.065 1.393   1.00 0.00 ?  226 SER C CA   1  
ATOM   9549   C  C    . SER C  2 172 ? -34.236 -31.130 0.304   1.00 0.00 ?  226 SER C C    1  
ATOM   9550   O  O    . SER C  2 172 ? -33.353 -31.835 -0.171  1.00 0.00 ?  226 SER C O    1  
ATOM   9551   C  CB   . SER C  2 172 ? -34.182 -30.690 2.817   1.00 0.00 ?  226 SER C CB   1  
ATOM   9552   O  OG   . SER C  2 172 ? -33.429 -30.093 3.843   1.00 0.00 ?  226 SER C OG   1  
ATOM   9553   H  H    . SER C  2 172 ? -35.209 -28.495 1.840   1.00 0.00 ?  226 SER C H    1  
ATOM   9554   H  HA   . SER C  2 172 ? -32.789 -29.951 1.325   1.00 0.00 ?  226 SER C HA   1  
ATOM   9555   H  HB2  . SER C  2 172 ? -35.251 -30.511 3.064   1.00 0.00 ?  226 SER C HB2  1  
ATOM   9556   H  HB3  . SER C  2 172 ? -33.999 -31.786 2.842   1.00 0.00 ?  226 SER C HB3  1  
ATOM   9557   H  HG   . SER C  2 172 ? -32.562 -30.504 3.882   1.00 0.00 ?  226 SER C HG   1  
ATOM   9558   N  N    . GLU C  2 173 ? -35.527 -31.233 -0.119  1.00 0.00 ?  227 GLU C N    1  
ATOM   9559   C  CA   . GLU C  2 173 ? -36.009 -32.366 -0.917  1.00 0.00 ?  227 GLU C CA   1  
ATOM   9560   C  C    . GLU C  2 173 ? -35.666 -32.178 -2.353  1.00 0.00 ?  227 GLU C C    1  
ATOM   9561   O  O    . GLU C  2 173 ? -35.677 -33.120 -3.189  1.00 0.00 ?  227 GLU C O    1  
ATOM   9562   C  CB   . GLU C  2 173 ? -37.494 -32.669 -0.606  1.00 0.00 ?  227 GLU C CB   1  
ATOM   9563   C  CG   . GLU C  2 173 ? -38.251 -33.756 -1.396  1.00 0.00 ?  227 GLU C CG   1  
ATOM   9564   C  CD   . GLU C  2 173 ? -39.629 -33.980 -0.855  1.00 0.00 ?  227 GLU C CD   1  
ATOM   9565   O  OE1  . GLU C  2 173 ? -39.914 -34.651 0.181   1.00 0.00 ?  227 GLU C OE1  1  
ATOM   9566   O  OE2  . GLU C  2 173 ? -40.586 -33.580 -1.589  1.00 0.00 -1 227 GLU C OE2  1  
ATOM   9567   H  H    . GLU C  2 173 ? -36.206 -30.594 0.234   1.00 0.00 ?  227 GLU C H    1  
ATOM   9568   H  HA   . GLU C  2 173 ? -35.466 -33.264 -0.663  1.00 0.00 ?  227 GLU C HA   1  
ATOM   9569   H  HB2  . GLU C  2 173 ? -37.498 -33.001 0.454   1.00 0.00 ?  227 GLU C HB2  1  
ATOM   9570   H  HB3  . GLU C  2 173 ? -38.110 -31.753 -0.733  1.00 0.00 ?  227 GLU C HB3  1  
ATOM   9571   H  HG2  . GLU C  2 173 ? -38.397 -33.380 -2.431  1.00 0.00 ?  227 GLU C HG2  1  
ATOM   9572   H  HG3  . GLU C  2 173 ? -37.681 -34.708 -1.443  1.00 0.00 ?  227 GLU C HG3  1  
ATOM   9573   N  N    . LYS C  2 174 ? -35.400 -30.876 -2.745  1.00 0.00 ?  228 LYS C N    1  
ATOM   9574   C  CA   . LYS C  2 174 ? -34.767 -30.545 -4.037  1.00 0.00 ?  228 LYS C CA   1  
ATOM   9575   C  C    . LYS C  2 174 ? -33.412 -31.213 -4.150  1.00 0.00 ?  228 LYS C C    1  
ATOM   9576   O  O    . LYS C  2 174 ? -33.071 -31.804 -5.200  1.00 0.00 ?  228 LYS C O    1  
ATOM   9577   C  CB   . LYS C  2 174 ? -34.670 -29.047 -4.277  1.00 0.00 ?  228 LYS C CB   1  
ATOM   9578   C  CG   . LYS C  2 174 ? -36.069 -28.296 -4.430  1.00 0.00 ?  228 LYS C CG   1  
ATOM   9579   C  CD   . LYS C  2 174 ? -36.914 -28.833 -5.551  1.00 0.00 ?  228 LYS C CD   1  
ATOM   9580   C  CE   . LYS C  2 174 ? -38.138 -28.101 -5.962  1.00 0.00 ?  228 LYS C CE   1  
ATOM   9581   N  NZ   . LYS C  2 174 ? -38.986 -27.857 -4.831  1.00 0.00 1  228 LYS C NZ   1  
ATOM   9582   H  H    . LYS C  2 174 ? -35.570 -30.120 -2.118  1.00 0.00 ?  228 LYS C H    1  
ATOM   9583   H  HA   . LYS C  2 174 ? -35.396 -30.900 -4.841  1.00 0.00 ?  228 LYS C HA   1  
ATOM   9584   H  HB2  . LYS C  2 174 ? -34.200 -28.415 -3.494  1.00 0.00 ?  228 LYS C HB2  1  
ATOM   9585   H  HB3  . LYS C  2 174 ? -34.096 -28.770 -5.188  1.00 0.00 ?  228 LYS C HB3  1  
ATOM   9586   H  HG2  . LYS C  2 174 ? -36.655 -28.176 -3.493  1.00 0.00 ?  228 LYS C HG2  1  
ATOM   9587   H  HG3  . LYS C  2 174 ? -35.794 -27.246 -4.670  1.00 0.00 ?  228 LYS C HG3  1  
ATOM   9588   H  HD2  . LYS C  2 174 ? -36.266 -29.018 -6.435  1.00 0.00 ?  228 LYS C HD2  1  
ATOM   9589   H  HD3  . LYS C  2 174 ? -37.322 -29.791 -5.165  1.00 0.00 ?  228 LYS C HD3  1  
ATOM   9590   H  HE2  . LYS C  2 174 ? -37.772 -27.130 -6.357  1.00 0.00 ?  228 LYS C HE2  1  
ATOM   9591   H  HE3  . LYS C  2 174 ? -38.725 -28.479 -6.826  1.00 0.00 ?  228 LYS C HE3  1  
ATOM   9592   H  HZ1  . LYS C  2 174 ? -38.444 -27.175 -4.262  1.00 0.00 ?  228 LYS C HZ1  1  
ATOM   9593   H  HZ2  . LYS C  2 174 ? -39.125 -28.734 -4.289  1.00 0.00 ?  228 LYS C HZ2  1  
ATOM   9594   H  HZ3  . LYS C  2 174 ? -39.813 -27.330 -5.178  1.00 0.00 ?  228 LYS C HZ3  1  
ATOM   9595   N  N    . ALA C  2 175 ? -32.587 -31.153 -3.082  1.00 0.00 ?  229 ALA C N    1  
ATOM   9596   C  CA   . ALA C  2 175 ? -31.275 -31.684 -3.258  1.00 0.00 ?  229 ALA C CA   1  
ATOM   9597   C  C    . ALA C  2 175 ? -31.109 -33.129 -2.824  1.00 0.00 ?  229 ALA C C    1  
ATOM   9598   O  O    . ALA C  2 175 ? -29.962 -33.574 -2.910  1.00 0.00 ?  229 ALA C O    1  
ATOM   9599   C  CB   . ALA C  2 175 ? -30.300 -30.646 -2.717  1.00 0.00 ?  229 ALA C CB   1  
ATOM   9600   H  H    . ALA C  2 175 ? -32.871 -30.944 -2.150  1.00 0.00 ?  229 ALA C H    1  
ATOM   9601   H  HA   . ALA C  2 175 ? -31.033 -31.750 -4.308  1.00 0.00 ?  229 ALA C HA   1  
ATOM   9602   H  HB1  . ALA C  2 175 ? -30.359 -30.522 -1.615  1.00 0.00 ?  229 ALA C HB1  1  
ATOM   9603   H  HB2  . ALA C  2 175 ? -30.643 -29.702 -3.192  1.00 0.00 ?  229 ALA C HB2  1  
ATOM   9604   H  HB3  . ALA C  2 175 ? -29.254 -30.819 -3.050  1.00 0.00 ?  229 ALA C HB3  1  
ATOM   9605   N  N    . LYS C  2 176 ? -32.185 -33.892 -2.473  1.00 0.00 ?  230 LYS C N    1  
ATOM   9606   C  CA   . LYS C  2 176 ? -32.013 -35.324 -2.181  1.00 0.00 ?  230 LYS C CA   1  
ATOM   9607   C  C    . LYS C  2 176 ? -31.385 -36.248 -3.292  1.00 0.00 ?  230 LYS C C    1  
ATOM   9608   O  O    . LYS C  2 176 ? -30.617 -37.120 -2.847  1.00 0.00 ?  230 LYS C O    1  
ATOM   9609   C  CB   . LYS C  2 176 ? -33.379 -35.915 -1.626  1.00 0.00 ?  230 LYS C CB   1  
ATOM   9610   C  CG   . LYS C  2 176 ? -33.694 -35.330 -0.223  1.00 0.00 ?  230 LYS C CG   1  
ATOM   9611   C  CD   . LYS C  2 176 ? -35.039 -35.723 0.375   1.00 0.00 ?  230 LYS C CD   1  
ATOM   9612   C  CE   . LYS C  2 176 ? -34.978 -37.202 0.706   1.00 0.00 ?  230 LYS C CE   1  
ATOM   9613   N  NZ   . LYS C  2 176 ? -35.773 -38.006 -0.396  1.00 0.00 1  230 LYS C NZ   1  
ATOM   9614   H  H    . LYS C  2 176 ? -33.065 -33.459 -2.293  1.00 0.00 ?  230 LYS C H    1  
ATOM   9615   H  HA   . LYS C  2 176 ? -31.309 -35.375 -1.363  1.00 0.00 ?  230 LYS C HA   1  
ATOM   9616   H  HB2  . LYS C  2 176 ? -34.222 -35.856 -2.348  1.00 0.00 ?  230 LYS C HB2  1  
ATOM   9617   H  HB3  . LYS C  2 176 ? -33.226 -36.987 -1.377  1.00 0.00 ?  230 LYS C HB3  1  
ATOM   9618   H  HG2  . LYS C  2 176 ? -32.969 -35.669 0.548   1.00 0.00 ?  230 LYS C HG2  1  
ATOM   9619   H  HG3  . LYS C  2 176 ? -33.575 -34.226 -0.220  1.00 0.00 ?  230 LYS C HG3  1  
ATOM   9620   H  HD2  . LYS C  2 176 ? -35.266 -35.102 1.268   1.00 0.00 ?  230 LYS C HD2  1  
ATOM   9621   H  HD3  . LYS C  2 176 ? -35.832 -35.513 -0.375  1.00 0.00 ?  230 LYS C HD3  1  
ATOM   9622   H  HE2  . LYS C  2 176 ? -33.975 -37.661 0.570   1.00 0.00 ?  230 LYS C HE2  1  
ATOM   9623   H  HE3  . LYS C  2 176 ? -35.506 -37.542 1.622   1.00 0.00 ?  230 LYS C HE3  1  
ATOM   9624   H  HZ1  . LYS C  2 176 ? -35.305 -37.949 -1.322  1.00 0.00 ?  230 LYS C HZ1  1  
ATOM   9625   H  HZ2  . LYS C  2 176 ? -36.736 -37.662 -0.585  1.00 0.00 ?  230 LYS C HZ2  1  
ATOM   9626   H  HZ3  . LYS C  2 176 ? -35.813 -39.015 -0.148  1.00 0.00 ?  230 LYS C HZ3  1  
ATOM   9627   N  N    . PRO C  2 177 ? -31.699 -36.196 -4.586  1.00 0.00 ?  231 PRO C N    1  
ATOM   9628   C  CA   . PRO C  2 177 ? -31.257 -37.267 -5.523  1.00 0.00 ?  231 PRO C CA   1  
ATOM   9629   C  C    . PRO C  2 177 ? -29.747 -37.205 -5.786  1.00 0.00 ?  231 PRO C C    1  
ATOM   9630   O  O    . PRO C  2 177 ? -29.176 -38.291 -5.699  1.00 0.00 ?  231 PRO C O    1  
ATOM   9631   C  CB   . PRO C  2 177 ? -32.055 -36.963 -6.811  1.00 0.00 ?  231 PRO C CB   1  
ATOM   9632   C  CG   . PRO C  2 177 ? -33.406 -36.586 -6.218  1.00 0.00 ?  231 PRO C CG   1  
ATOM   9633   C  CD   . PRO C  2 177 ? -32.893 -35.548 -5.101  1.00 0.00 ?  231 PRO C CD   1  
ATOM   9634   H  HA   . PRO C  2 177 ? -31.676 -38.221 -5.239  1.00 0.00 ?  231 PRO C HA   1  
ATOM   9635   H  HB2  . PRO C  2 177 ? -31.822 -36.007 -7.325  1.00 0.00 ?  231 PRO C HB2  1  
ATOM   9636   H  HB3  . PRO C  2 177 ? -32.116 -37.802 -7.537  1.00 0.00 ?  231 PRO C HB3  1  
ATOM   9637   H  HG2  . PRO C  2 177 ? -34.215 -36.172 -6.858  1.00 0.00 ?  231 PRO C HG2  1  
ATOM   9638   H  HG3  . PRO C  2 177 ? -33.774 -37.552 -5.812  1.00 0.00 ?  231 PRO C HG3  1  
ATOM   9639   H  HD2  . PRO C  2 177 ? -32.559 -34.567 -5.502  1.00 0.00 ?  231 PRO C HD2  1  
ATOM   9640   H  HD3  . PRO C  2 177 ? -33.693 -35.586 -4.331  1.00 0.00 ?  231 PRO C HD3  1  
ATOM   9641   N  N    . ALA C  2 178 ? -29.208 -36.004 -6.014  1.00 0.00 ?  232 ALA C N    1  
ATOM   9642   C  CA   . ALA C  2 178 ? -27.747 -35.747 -6.145  1.00 0.00 ?  232 ALA C CA   1  
ATOM   9643   C  C    . ALA C  2 178 ? -27.012 -35.961 -4.898  1.00 0.00 ?  232 ALA C C    1  
ATOM   9644   O  O    . ALA C  2 178 ? -25.826 -36.192 -4.799  1.00 0.00 ?  232 ALA C O    1  
ATOM   9645   C  CB   . ALA C  2 178 ? -27.551 -34.367 -6.679  1.00 0.00 ?  232 ALA C CB   1  
ATOM   9646   H  H    . ALA C  2 178 ? -29.838 -35.236 -6.100  1.00 0.00 ?  232 ALA C H    1  
ATOM   9647   H  HA   . ALA C  2 178 ? -27.321 -36.457 -6.838  1.00 0.00 ?  232 ALA C HA   1  
ATOM   9648   H  HB1  . ALA C  2 178 ? -26.481 -34.099 -6.811  1.00 0.00 ?  232 ALA C HB1  1  
ATOM   9649   H  HB2  . ALA C  2 178 ? -28.059 -33.510 -6.187  1.00 0.00 ?  232 ALA C HB2  1  
ATOM   9650   H  HB3  . ALA C  2 178 ? -27.729 -34.424 -7.774  1.00 0.00 ?  232 ALA C HB3  1  
ATOM   9651   N  N    . LEU C  2 179 ? -27.707 -35.767 -3.719  1.00 0.00 ?  233 LEU C N    1  
ATOM   9652   C  CA   . LEU C  2 179 ? -27.105 -36.167 -2.381  1.00 0.00 ?  233 LEU C CA   1  
ATOM   9653   C  C    . LEU C  2 179 ? -27.019 -37.672 -2.223  1.00 0.00 ?  233 LEU C C    1  
ATOM   9654   O  O    . LEU C  2 179 ? -26.018 -38.220 -1.740  1.00 0.00 ?  233 LEU C O    1  
ATOM   9655   C  CB   . LEU C  2 179 ? -28.035 -35.650 -1.314  1.00 0.00 ?  233 LEU C CB   1  
ATOM   9656   C  CG   . LEU C  2 179 ? -27.859 -36.056 0.173   1.00 0.00 ?  233 LEU C CG   1  
ATOM   9657   C  CD1  . LEU C  2 179 ? -26.438 -35.722 0.828   1.00 0.00 ?  233 LEU C CD1  1  
ATOM   9658   C  CD2  . LEU C  2 179 ? -29.051 -35.529 0.998   1.00 0.00 ?  233 LEU C CD2  1  
ATOM   9659   H  H    . LEU C  2 179 ? -28.620 -35.368 -3.698  1.00 0.00 ?  233 LEU C H    1  
ATOM   9660   H  HA   . LEU C  2 179 ? -26.167 -35.684 -2.146  1.00 0.00 ?  233 LEU C HA   1  
ATOM   9661   H  HB2  . LEU C  2 179 ? -27.952 -34.543 -1.368  1.00 0.00 ?  233 LEU C HB2  1  
ATOM   9662   H  HB3  . LEU C  2 179 ? -29.093 -35.882 -1.558  1.00 0.00 ?  233 LEU C HB3  1  
ATOM   9663   H  HG   . LEU C  2 179 ? -27.943 -37.158 0.280   1.00 0.00 ?  233 LEU C HG   1  
ATOM   9664   H  HD11 . LEU C  2 179 ? -26.624 -35.734 1.923   1.00 0.00 ?  233 LEU C HD11 1  
ATOM   9665   H  HD12 . LEU C  2 179 ? -25.989 -34.739 0.568   1.00 0.00 ?  233 LEU C HD12 1  
ATOM   9666   H  HD13 . LEU C  2 179 ? -25.748 -36.572 0.638   1.00 0.00 ?  233 LEU C HD13 1  
ATOM   9667   H  HD21 . LEU C  2 179 ? -29.966 -36.075 0.681   1.00 0.00 ?  233 LEU C HD21 1  
ATOM   9668   H  HD22 . LEU C  2 179 ? -29.334 -34.466 0.841   1.00 0.00 ?  233 LEU C HD22 1  
ATOM   9669   H  HD23 . LEU C  2 179 ? -28.941 -35.603 2.101   1.00 0.00 ?  233 LEU C HD23 1  
ATOM   9670   N  N    . GLU C  2 180 ? -28.114 -38.316 -2.682  1.00 0.00 ?  234 GLU C N    1  
ATOM   9671   C  CA   . GLU C  2 180 ? -28.319 -39.737 -2.422  1.00 0.00 ?  234 GLU C CA   1  
ATOM   9672   C  C    . GLU C  2 180 ? -27.556 -40.610 -3.392  1.00 0.00 ?  234 GLU C C    1  
ATOM   9673   O  O    . GLU C  2 180 ? -27.021 -41.666 -3.015  1.00 0.00 ?  234 GLU C O    1  
ATOM   9674   C  CB   . GLU C  2 180 ? -29.823 -40.060 -2.587  1.00 0.00 ?  234 GLU C CB   1  
ATOM   9675   C  CG   . GLU C  2 180 ? -30.262 -41.342 -1.847  1.00 0.00 ?  234 GLU C CG   1  
ATOM   9676   C  CD   . GLU C  2 180 ? -30.292 -41.286 -0.310  1.00 0.00 ?  234 GLU C CD   1  
ATOM   9677   O  OE1  . GLU C  2 180 ? -29.172 -41.384 0.307   1.00 0.00 ?  234 GLU C OE1  1  
ATOM   9678   O  OE2  . GLU C  2 180 ? -31.426 -41.144 0.238   1.00 0.00 -1 234 GLU C OE2  1  
ATOM   9679   H  H    . GLU C  2 180 ? -28.901 -37.812 -3.031  1.00 0.00 ?  234 GLU C H    1  
ATOM   9680   H  HA   . GLU C  2 180 ? -27.835 -40.019 -1.499  1.00 0.00 ?  234 GLU C HA   1  
ATOM   9681   H  HB2  . GLU C  2 180 ? -30.379 -39.225 -2.109  1.00 0.00 ?  234 GLU C HB2  1  
ATOM   9682   H  HB3  . GLU C  2 180 ? -30.068 -40.057 -3.670  1.00 0.00 ?  234 GLU C HB3  1  
ATOM   9683   H  HG2  . GLU C  2 180 ? -31.282 -41.613 -2.193  1.00 0.00 ?  234 GLU C HG2  1  
ATOM   9684   H  HG3  . GLU C  2 180 ? -29.645 -42.234 -2.088  1.00 0.00 ?  234 GLU C HG3  1  
ATOM   9685   N  N    . ASP C  2 181 ? -27.226 -40.110 -4.506  1.00 0.00 ?  235 ASP C N    1  
ATOM   9686   C  CA   . ASP C  2 181 ? -26.206 -40.615 -5.393  1.00 0.00 ?  235 ASP C CA   1  
ATOM   9687   C  C    . ASP C  2 181 ? -24.799 -40.590 -4.775  1.00 0.00 ?  235 ASP C C    1  
ATOM   9688   O  O    . ASP C  2 181 ? -24.065 -41.553 -4.981  1.00 0.00 ?  235 ASP C O    1  
ATOM   9689   C  CB   . ASP C  2 181 ? -26.265 -39.545 -6.524  1.00 0.00 ?  235 ASP C CB   1  
ATOM   9690   C  CG   . ASP C  2 181 ? -25.579 -39.884 -7.785  1.00 0.00 ?  235 ASP C CG   1  
ATOM   9691   O  OD1  . ASP C  2 181 ? -25.278 -38.870 -8.487  1.00 0.00 ?  235 ASP C OD1  1  
ATOM   9692   O  OD2  . ASP C  2 181 ? -25.430 -41.022 -8.178  1.00 0.00 -1 235 ASP C OD2  1  
ATOM   9693   H  H    . ASP C  2 181 ? -27.622 -39.302 -4.935  1.00 0.00 ?  235 ASP C H    1  
ATOM   9694   H  HA   . ASP C  2 181 ? -26.464 -41.644 -5.593  1.00 0.00 ?  235 ASP C HA   1  
ATOM   9695   H  HB2  . ASP C  2 181 ? -27.331 -39.418 -6.811  1.00 0.00 ?  235 ASP C HB2  1  
ATOM   9696   H  HB3  . ASP C  2 181 ? -25.803 -38.624 -6.109  1.00 0.00 ?  235 ASP C HB3  1  
ATOM   9697   N  N    . LEU C  2 182 ? -24.439 -39.535 -3.940  1.00 0.00 ?  236 LEU C N    1  
ATOM   9698   C  CA   . LEU C  2 182 ? -23.144 -39.559 -3.386  1.00 0.00 ?  236 LEU C CA   1  
ATOM   9699   C  C    . LEU C  2 182 ? -23.099 -40.505 -2.219  1.00 0.00 ?  236 LEU C C    1  
ATOM   9700   O  O    . LEU C  2 182 ? -22.031 -41.118 -2.035  1.00 0.00 ?  236 LEU C O    1  
ATOM   9701   C  CB   . LEU C  2 182 ? -22.948 -38.144 -2.971  1.00 0.00 ?  236 LEU C CB   1  
ATOM   9702   C  CG   . LEU C  2 182 ? -22.890 -37.094 -4.050  1.00 0.00 ?  236 LEU C CG   1  
ATOM   9703   C  CD1  . LEU C  2 182 ? -23.092 -35.745 -3.377  1.00 0.00 ?  236 LEU C CD1  1  
ATOM   9704   C  CD2  . LEU C  2 182 ? -21.613 -37.113 -4.966  1.00 0.00 ?  236 LEU C CD2  1  
ATOM   9705   H  H    . LEU C  2 182 ? -25.126 -38.853 -3.700  1.00 0.00 ?  236 LEU C H    1  
ATOM   9706   H  HA   . LEU C  2 182 ? -22.365 -39.813 -4.090  1.00 0.00 ?  236 LEU C HA   1  
ATOM   9707   H  HB2  . LEU C  2 182 ? -23.755 -37.978 -2.226  1.00 0.00 ?  236 LEU C HB2  1  
ATOM   9708   H  HB3  . LEU C  2 182 ? -22.026 -38.085 -2.353  1.00 0.00 ?  236 LEU C HB3  1  
ATOM   9709   H  HG   . LEU C  2 182 ? -23.703 -37.255 -4.790  1.00 0.00 ?  236 LEU C HG   1  
ATOM   9710   H  HD11 . LEU C  2 182 ? -22.246 -35.360 -2.768  1.00 0.00 ?  236 LEU C HD11 1  
ATOM   9711   H  HD12 . LEU C  2 182 ? -24.000 -35.728 -2.737  1.00 0.00 ?  236 LEU C HD12 1  
ATOM   9712   H  HD13 . LEU C  2 182 ? -23.193 -35.033 -4.223  1.00 0.00 ?  236 LEU C HD13 1  
ATOM   9713   H  HD21 . LEU C  2 182 ? -21.541 -38.119 -5.434  1.00 0.00 ?  236 LEU C HD21 1  
ATOM   9714   H  HD22 . LEU C  2 182 ? -20.736 -36.721 -4.409  1.00 0.00 ?  236 LEU C HD22 1  
ATOM   9715   H  HD23 . LEU C  2 182 ? -21.755 -36.426 -5.828  1.00 0.00 ?  236 LEU C HD23 1  
ATOM   9716   N  N    . ARG C  2 183 ? -24.171 -40.645 -1.441  1.00 0.00 ?  237 ARG C N    1  
ATOM   9717   C  CA   . ARG C  2 183 ? -24.346 -41.621 -0.402  1.00 0.00 ?  237 ARG C CA   1  
ATOM   9718   C  C    . ARG C  2 183 ? -24.325 -43.058 -0.913  1.00 0.00 ?  237 ARG C C    1  
ATOM   9719   O  O    . ARG C  2 183 ? -23.583 -43.876 -0.319  1.00 0.00 ?  237 ARG C O    1  
ATOM   9720   C  CB   . ARG C  2 183 ? -25.637 -41.247 0.478   1.00 0.00 ?  237 ARG C CB   1  
ATOM   9721   C  CG   . ARG C  2 183 ? -25.396 -39.941 1.323   1.00 0.00 ?  237 ARG C CG   1  
ATOM   9722   C  CD   . ARG C  2 183 ? -26.295 -39.789 2.578   1.00 0.00 ?  237 ARG C CD   1  
ATOM   9723   N  NE   . ARG C  2 183 ? -27.671 -39.752 2.023   1.00 0.00 ?  237 ARG C NE   1  
ATOM   9724   C  CZ   . ARG C  2 183 ? -28.567 -38.894 2.481   1.00 0.00 ?  237 ARG C CZ   1  
ATOM   9725   N  NH1  . ARG C  2 183 ? -29.776 -39.146 2.103   1.00 0.00 1  237 ARG C NH1  1  
ATOM   9726   N  NH2  . ARG C  2 183 ? -28.482 -38.171 3.588   1.00 0.00 ?  237 ARG C NH2  1  
ATOM   9727   H  H    . ARG C  2 183 ? -24.937 -40.033 -1.623  1.00 0.00 ?  237 ARG C H    1  
ATOM   9728   H  HA   . ARG C  2 183 ? -23.522 -41.595 0.295   1.00 0.00 ?  237 ARG C HA   1  
ATOM   9729   H  HB2  . ARG C  2 183 ? -26.549 -41.228 -0.156  1.00 0.00 ?  237 ARG C HB2  1  
ATOM   9730   H  HB3  . ARG C  2 183 ? -25.825 -42.094 1.172   1.00 0.00 ?  237 ARG C HB3  1  
ATOM   9731   H  HG2  . ARG C  2 183 ? -24.322 -40.027 1.594   1.00 0.00 ?  237 ARG C HG2  1  
ATOM   9732   H  HG3  . ARG C  2 183 ? -25.465 -38.999 0.737   1.00 0.00 ?  237 ARG C HG3  1  
ATOM   9733   H  HD2  . ARG C  2 183 ? -26.204 -40.677 3.239   1.00 0.00 ?  237 ARG C HD2  1  
ATOM   9734   H  HD3  . ARG C  2 183 ? -26.094 -38.865 3.161   1.00 0.00 ?  237 ARG C HD3  1  
ATOM   9735   H  HE   . ARG C  2 183 ? -27.987 -40.466 1.398   1.00 0.00 ?  237 ARG C HE   1  
ATOM   9736   H  HH11 . ARG C  2 183 ? -29.773 -39.851 1.393   1.00 0.00 ?  237 ARG C HH11 1  
ATOM   9737   H  HH12 . ARG C  2 183 ? -30.629 -38.828 2.517   1.00 0.00 ?  237 ARG C HH12 1  
ATOM   9738   H  HH21 . ARG C  2 183 ? -27.648 -38.229 4.137   1.00 0.00 ?  237 ARG C HH21 1  
ATOM   9739   H  HH22 . ARG C  2 183 ? -29.352 -37.860 3.971   1.00 0.00 ?  237 ARG C HH22 1  
ATOM   9740   N  N    . GLN C  2 184 ? -25.018 -43.331 -2.032  1.00 0.00 ?  238 GLN C N    1  
ATOM   9741   C  CA   . GLN C  2 184 ? -25.028 -44.620 -2.617  1.00 0.00 ?  238 GLN C CA   1  
ATOM   9742   C  C    . GLN C  2 184 ? -23.715 -45.080 -3.178  1.00 0.00 ?  238 GLN C C    1  
ATOM   9743   O  O    . GLN C  2 184 ? -23.358 -46.229 -3.009  1.00 0.00 ?  238 GLN C O    1  
ATOM   9744   C  CB   . GLN C  2 184 ? -26.092 -44.851 -3.733  1.00 0.00 ?  238 GLN C CB   1  
ATOM   9745   C  CG   . GLN C  2 184 ? -27.622 -44.909 -3.294  1.00 0.00 ?  238 GLN C CG   1  
ATOM   9746   C  CD   . GLN C  2 184 ? -27.867 -45.646 -1.850  1.00 0.00 ?  238 GLN C CD   1  
ATOM   9747   O  OE1  . GLN C  2 184 ? -28.732 -45.172 -1.036  1.00 0.00 ?  238 GLN C OE1  1  
ATOM   9748   N  NE2  . GLN C  2 184 ? -27.292 -46.778 -1.628  1.00 0.00 ?  238 GLN C NE2  1  
ATOM   9749   H  H    . GLN C  2 184 ? -25.645 -42.636 -2.375  1.00 0.00 ?  238 GLN C H    1  
ATOM   9750   H  HA   . GLN C  2 184 ? -25.261 -45.377 -1.882  1.00 0.00 ?  238 GLN C HA   1  
ATOM   9751   H  HB2  . GLN C  2 184 ? -25.893 -44.002 -4.420  1.00 0.00 ?  238 GLN C HB2  1  
ATOM   9752   H  HB3  . GLN C  2 184 ? -25.965 -45.812 -4.276  1.00 0.00 ?  238 GLN C HB3  1  
ATOM   9753   H  HG2  . GLN C  2 184 ? -28.178 -43.957 -3.155  1.00 0.00 ?  238 GLN C HG2  1  
ATOM   9754   H  HG3  . GLN C  2 184 ? -28.313 -45.378 -4.026  1.00 0.00 ?  238 GLN C HG3  1  
ATOM   9755   H  HE21 . GLN C  2 184 ? -27.548 -47.281 -0.803  1.00 0.00 ?  238 GLN C HE21 1  
ATOM   9756   H  HE22 . GLN C  2 184 ? -26.593 -47.092 -2.271  1.00 0.00 ?  238 GLN C HE22 1  
ATOM   9757   N  N    . GLY C  2 185 ? -22.899 -44.082 -3.693  1.00 0.00 ?  239 GLY C N    1  
ATOM   9758   C  CA   . GLY C  2 185 ? -21.458 -44.207 -4.003  1.00 0.00 ?  239 GLY C CA   1  
ATOM   9759   C  C    . GLY C  2 185 ? -20.497 -44.288 -2.930  1.00 0.00 ?  239 GLY C C    1  
ATOM   9760   O  O    . GLY C  2 185 ? -19.582 -45.079 -2.969  1.00 0.00 ?  239 GLY C O    1  
ATOM   9761   H  H    . GLY C  2 185 ? -23.250 -43.152 -3.766  1.00 0.00 ?  239 GLY C H    1  
ATOM   9762   H  HA2  . GLY C  2 185 ? -21.217 -45.057 -4.624  1.00 0.00 ?  239 GLY C HA2  1  
ATOM   9763   H  HA3  . GLY C  2 185 ? -21.216 -43.288 -4.517  1.00 0.00 ?  239 GLY C HA3  1  
ATOM   9764   N  N    . LEU C  2 186 ? -20.617 -43.551 -1.798  1.00 0.00 ?  240 LEU C N    1  
ATOM   9765   C  CA   . LEU C  2 186 ? -19.871 -43.601 -0.659  1.00 0.00 ?  240 LEU C CA   1  
ATOM   9766   C  C    . LEU C  2 186 ? -19.807 -45.001 0.005   1.00 0.00 ?  240 LEU C C    1  
ATOM   9767   O  O    . LEU C  2 186 ? -18.709 -45.390 0.441   1.00 0.00 ?  240 LEU C O    1  
ATOM   9768   C  CB   . LEU C  2 186 ? -20.373 -42.599 0.396   1.00 0.00 ?  240 LEU C CB   1  
ATOM   9769   C  CG   . LEU C  2 186 ? -19.592 -42.473 1.744   1.00 0.00 ?  240 LEU C CG   1  
ATOM   9770   C  CD1  . LEU C  2 186 ? -18.083 -42.075 1.549   1.00 0.00 ?  240 LEU C CD1  1  
ATOM   9771   C  CD2  . LEU C  2 186 ? -20.216 -41.393 2.584   1.00 0.00 ?  240 LEU C CD2  1  
ATOM   9772   H  H    . LEU C  2 186 ? -21.276 -42.812 -1.913  1.00 0.00 ?  240 LEU C H    1  
ATOM   9773   H  HA   . LEU C  2 186 ? -18.825 -43.537 -0.922  1.00 0.00 ?  240 LEU C HA   1  
ATOM   9774   H  HB2  . LEU C  2 186 ? -20.313 -41.626 -0.136  1.00 0.00 ?  240 LEU C HB2  1  
ATOM   9775   H  HB3  . LEU C  2 186 ? -21.399 -42.903 0.697   1.00 0.00 ?  240 LEU C HB3  1  
ATOM   9776   H  HG   . LEU C  2 186 ? -19.676 -43.451 2.263   1.00 0.00 ?  240 LEU C HG   1  
ATOM   9777   H  HD11 . LEU C  2 186 ? -17.447 -42.734 0.920   1.00 0.00 ?  240 LEU C HD11 1  
ATOM   9778   H  HD12 . LEU C  2 186 ? -17.618 -41.935 2.548   1.00 0.00 ?  240 LEU C HD12 1  
ATOM   9779   H  HD13 . LEU C  2 186 ? -18.074 -41.113 0.994   1.00 0.00 ?  240 LEU C HD13 1  
ATOM   9780   H  HD21 . LEU C  2 186 ? -21.293 -41.590 2.773   1.00 0.00 ?  240 LEU C HD21 1  
ATOM   9781   H  HD22 . LEU C  2 186 ? -20.071 -40.366 2.186   1.00 0.00 ?  240 LEU C HD22 1  
ATOM   9782   H  HD23 . LEU C  2 186 ? -19.646 -41.338 3.536   1.00 0.00 ?  240 LEU C HD23 1  
ATOM   9783   N  N    . LEU C  2 187 ? -20.919 -45.744 0.088   1.00 0.00 ?  241 LEU C N    1  
ATOM   9784   C  CA   . LEU C  2 187 ? -21.087 -47.036 0.738   1.00 0.00 ?  241 LEU C CA   1  
ATOM   9785   C  C    . LEU C  2 187 ? -20.104 -48.188 0.224   1.00 0.00 ?  241 LEU C C    1  
ATOM   9786   O  O    . LEU C  2 187 ? -19.400 -48.752 1.097   1.00 0.00 ?  241 LEU C O    1  
ATOM   9787   C  CB   . LEU C  2 187 ? -22.566 -47.503 0.783   1.00 0.00 ?  241 LEU C CB   1  
ATOM   9788   C  CG   . LEU C  2 187 ? -23.515 -46.687 1.696   1.00 0.00 ?  241 LEU C CG   1  
ATOM   9789   C  CD1  . LEU C  2 187 ? -25.006 -46.841 1.420   1.00 0.00 ?  241 LEU C CD1  1  
ATOM   9790   C  CD2  . LEU C  2 187 ? -23.388 -47.088 3.191   1.00 0.00 ?  241 LEU C CD2  1  
ATOM   9791   H  H    . LEU C  2 187 ? -21.790 -45.402 -0.255  1.00 0.00 ?  241 LEU C H    1  
ATOM   9792   H  HA   . LEU C  2 187 ? -20.808 -46.876 1.769   1.00 0.00 ?  241 LEU C HA   1  
ATOM   9793   H  HB2  . LEU C  2 187 ? -22.948 -47.435 -0.258  1.00 0.00 ?  241 LEU C HB2  1  
ATOM   9794   H  HB3  . LEU C  2 187 ? -22.524 -48.571 1.085   1.00 0.00 ?  241 LEU C HB3  1  
ATOM   9795   H  HG   . LEU C  2 187 ? -23.155 -45.643 1.572   1.00 0.00 ?  241 LEU C HG   1  
ATOM   9796   H  HD11 . LEU C  2 187 ? -25.548 -46.153 2.103   1.00 0.00 ?  241 LEU C HD11 1  
ATOM   9797   H  HD12 . LEU C  2 187 ? -25.278 -47.918 1.408   1.00 0.00 ?  241 LEU C HD12 1  
ATOM   9798   H  HD13 . LEU C  2 187 ? -25.195 -46.389 0.422   1.00 0.00 ?  241 LEU C HD13 1  
ATOM   9799   H  HD21 . LEU C  2 187 ? -24.210 -47.760 3.516   1.00 0.00 ?  241 LEU C HD21 1  
ATOM   9800   H  HD22 . LEU C  2 187 ? -23.578 -46.129 3.719   1.00 0.00 ?  241 LEU C HD22 1  
ATOM   9801   H  HD23 . LEU C  2 187 ? -22.371 -47.394 3.519   1.00 0.00 ?  241 LEU C HD23 1  
ATOM   9802   N  N    . PRO C  2 188 ? -19.979 -48.426 -1.100  1.00 0.00 ?  242 PRO C N    1  
ATOM   9803   C  CA   . PRO C  2 188 ? -19.045 -49.357 -1.589  1.00 0.00 ?  242 PRO C CA   1  
ATOM   9804   C  C    . PRO C  2 188 ? -17.674 -48.769 -1.604  1.00 0.00 ?  242 PRO C C    1  
ATOM   9805   O  O    . PRO C  2 188 ? -16.710 -49.487 -1.645  1.00 0.00 ?  242 PRO C O    1  
ATOM   9806   C  CB   . PRO C  2 188 ? -19.614 -49.856 -2.964  1.00 0.00 ?  242 PRO C CB   1  
ATOM   9807   C  CG   . PRO C  2 188 ? -20.365 -48.630 -3.508  1.00 0.00 ?  242 PRO C CG   1  
ATOM   9808   C  CD   . PRO C  2 188 ? -20.990 -48.101 -2.151  1.00 0.00 ?  242 PRO C CD   1  
ATOM   9809   H  HA   . PRO C  2 188 ? -18.975 -50.163 -0.873  1.00 0.00 ?  242 PRO C HA   1  
ATOM   9810   H  HB2  . PRO C  2 188 ? -18.819 -50.196 -3.662  1.00 0.00 ?  242 PRO C HB2  1  
ATOM   9811   H  HB3  . PRO C  2 188 ? -20.275 -50.746 -2.885  1.00 0.00 ?  242 PRO C HB3  1  
ATOM   9812   H  HG2  . PRO C  2 188 ? -19.593 -47.901 -3.835  1.00 0.00 ?  242 PRO C HG2  1  
ATOM   9813   H  HG3  . PRO C  2 188 ? -21.057 -48.785 -4.364  1.00 0.00 ?  242 PRO C HG3  1  
ATOM   9814   H  HD2  . PRO C  2 188 ? -21.051 -46.992 -2.123  1.00 0.00 ?  242 PRO C HD2  1  
ATOM   9815   H  HD3  . PRO C  2 188 ? -21.986 -48.586 -2.062  1.00 0.00 ?  242 PRO C HD3  1  
ATOM   9816   N  N    . VAL C  2 189 ? -17.597 -47.423 -1.518  1.00 0.00 ?  243 VAL C N    1  
ATOM   9817   C  CA   . VAL C  2 189 ? -16.317 -46.678 -1.477  1.00 0.00 ?  243 VAL C CA   1  
ATOM   9818   C  C    . VAL C  2 189 ? -15.624 -46.850 -0.175  1.00 0.00 ?  243 VAL C C    1  
ATOM   9819   O  O    . VAL C  2 189 ? -14.439 -47.078 -0.173  1.00 0.00 ?  243 VAL C O    1  
ATOM   9820   C  CB   . VAL C  2 189 ? -16.475 -45.272 -2.079  1.00 0.00 ?  243 VAL C CB   1  
ATOM   9821   C  CG1  . VAL C  2 189 ? -15.463 -44.191 -1.621  1.00 0.00 ?  243 VAL C CG1  1  
ATOM   9822   C  CG2  . VAL C  2 189 ? -16.515 -45.460 -3.653  1.00 0.00 ?  243 VAL C CG2  1  
ATOM   9823   H  H    . VAL C  2 189 ? -18.418 -46.873 -1.384  1.00 0.00 ?  243 VAL C H    1  
ATOM   9824   H  HA   . VAL C  2 189 ? -15.571 -47.219 -2.041  1.00 0.00 ?  243 VAL C HA   1  
ATOM   9825   H  HB   . VAL C  2 189 ? -17.504 -44.976 -1.781  1.00 0.00 ?  243 VAL C HB   1  
ATOM   9826   H  HG11 . VAL C  2 189 ? -15.554 -44.027 -0.526  1.00 0.00 ?  243 VAL C HG11 1  
ATOM   9827   H  HG12 . VAL C  2 189 ? -15.588 -43.249 -2.197  1.00 0.00 ?  243 VAL C HG12 1  
ATOM   9828   H  HG13 . VAL C  2 189 ? -14.416 -44.515 -1.804  1.00 0.00 ?  243 VAL C HG13 1  
ATOM   9829   H  HG21 . VAL C  2 189 ? -15.676 -45.999 -4.143  1.00 0.00 ?  243 VAL C HG21 1  
ATOM   9830   H  HG22 . VAL C  2 189 ? -16.655 -44.506 -4.206  1.00 0.00 ?  243 VAL C HG22 1  
ATOM   9831   H  HG23 . VAL C  2 189 ? -17.356 -46.157 -3.854  1.00 0.00 ?  243 VAL C HG23 1  
ATOM   9832   N  N    . LEU C  2 190 ? -16.453 -47.029 0.860   1.00 0.00 ?  244 LEU C N    1  
ATOM   9833   C  CA   . LEU C  2 190 ? -16.000 -47.540 2.177   1.00 0.00 ?  244 LEU C CA   1  
ATOM   9834   C  C    . LEU C  2 190 ? -15.355 -48.904 2.091   1.00 0.00 ?  244 LEU C C    1  
ATOM   9835   O  O    . LEU C  2 190 ? -14.205 -49.030 2.594   1.00 0.00 ?  244 LEU C O    1  
ATOM   9836   C  CB   . LEU C  2 190 ? -17.037 -47.663 3.225   1.00 0.00 ?  244 LEU C CB   1  
ATOM   9837   C  CG   . LEU C  2 190 ? -17.526 -46.257 3.590   1.00 0.00 ?  244 LEU C CG   1  
ATOM   9838   C  CD1  . LEU C  2 190 ? -18.938 -46.385 4.254   1.00 0.00 ?  244 LEU C CD1  1  
ATOM   9839   C  CD2  . LEU C  2 190 ? -16.532 -45.548 4.531   1.00 0.00 ?  244 LEU C CD2  1  
ATOM   9840   H  H    . LEU C  2 190 ? -17.357 -46.654 0.672   1.00 0.00 ?  244 LEU C H    1  
ATOM   9841   H  HA   . LEU C  2 190 ? -15.307 -46.786 2.519   1.00 0.00 ?  244 LEU C HA   1  
ATOM   9842   H  HB2  . LEU C  2 190 ? -17.860 -48.256 2.771   1.00 0.00 ?  244 LEU C HB2  1  
ATOM   9843   H  HB3  . LEU C  2 190 ? -16.693 -48.138 4.168   1.00 0.00 ?  244 LEU C HB3  1  
ATOM   9844   H  HG   . LEU C  2 190 ? -17.609 -45.675 2.647   1.00 0.00 ?  244 LEU C HG   1  
ATOM   9845   H  HD11 . LEU C  2 190 ? -19.027 -47.263 4.929   1.00 0.00 ?  244 LEU C HD11 1  
ATOM   9846   H  HD12 . LEU C  2 190 ? -19.649 -46.421 3.401   1.00 0.00 ?  244 LEU C HD12 1  
ATOM   9847   H  HD13 . LEU C  2 190 ? -19.091 -45.499 4.907   1.00 0.00 ?  244 LEU C HD13 1  
ATOM   9848   H  HD21 . LEU C  2 190 ? -16.100 -46.289 5.236   1.00 0.00 ?  244 LEU C HD21 1  
ATOM   9849   H  HD22 . LEU C  2 190 ? -16.864 -44.658 5.107   1.00 0.00 ?  244 LEU C HD22 1  
ATOM   9850   H  HD23 . LEU C  2 190 ? -15.691 -45.148 3.924   1.00 0.00 ?  244 LEU C HD23 1  
ATOM   9851   N  N    . GLU C  2 191 ? -15.967 -49.917 1.442   1.00 0.00 ?  245 GLU C N    1  
ATOM   9852   C  CA   . GLU C  2 191 ? -15.413 -51.201 1.331   1.00 0.00 ?  245 GLU C CA   1  
ATOM   9853   C  C    . GLU C  2 191 ? -14.125 -51.169 0.529   1.00 0.00 ?  245 GLU C C    1  
ATOM   9854   O  O    . GLU C  2 191 ? -13.085 -51.650 0.857   1.00 0.00 ?  245 GLU C O    1  
ATOM   9855   C  CB   . GLU C  2 191 ? -16.359 -52.230 0.584   1.00 0.00 ?  245 GLU C CB   1  
ATOM   9856   C  CG   . GLU C  2 191 ? -17.794 -52.441 1.218   1.00 0.00 ?  245 GLU C CG   1  
ATOM   9857   C  CD   . GLU C  2 191 ? -18.506 -53.613 0.635   1.00 0.00 ?  245 GLU C CD   1  
ATOM   9858   O  OE1  . GLU C  2 191 ? -18.094 -54.114 -0.416  1.00 0.00 ?  245 GLU C OE1  1  
ATOM   9859   O  OE2  . GLU C  2 191 ? -19.471 -54.026 1.258   1.00 0.00 -1 245 GLU C OE2  1  
ATOM   9860   H  H    . GLU C  2 191 ? -16.933 -49.756 1.255   1.00 0.00 ?  245 GLU C H    1  
ATOM   9861   H  HA   . GLU C  2 191 ? -15.205 -51.594 2.316   1.00 0.00 ?  245 GLU C HA   1  
ATOM   9862   H  HB2  . GLU C  2 191 ? -16.560 -51.913 -0.461  1.00 0.00 ?  245 GLU C HB2  1  
ATOM   9863   H  HB3  . GLU C  2 191 ? -15.834 -53.209 0.538   1.00 0.00 ?  245 GLU C HB3  1  
ATOM   9864   H  HG2  . GLU C  2 191 ? -17.621 -52.527 2.312   1.00 0.00 ?  245 GLU C HG2  1  
ATOM   9865   H  HG3  . GLU C  2 191 ? -18.393 -51.557 0.912   1.00 0.00 ?  245 GLU C HG3  1  
ATOM   9866   N  N    . SER C  2 192 ? -14.149 -50.432 -0.647  1.00 0.00 ?  246 SER C N    1  
ATOM   9867   C  CA   . SER C  2 192 ? -12.968 -50.206 -1.448  1.00 0.00 ?  246 SER C CA   1  
ATOM   9868   C  C    . SER C  2 192 ? -11.884 -49.468 -0.710  1.00 0.00 ?  246 SER C C    1  
ATOM   9869   O  O    . SER C  2 192 ? -10.685 -49.828 -0.636  1.00 0.00 ?  246 SER C O    1  
ATOM   9870   C  CB   . SER C  2 192 ? -13.228 -49.463 -2.783  1.00 0.00 ?  246 SER C CB   1  
ATOM   9871   O  OG   . SER C  2 192 ? -12.057 -49.447 -3.683  1.00 0.00 ?  246 SER C OG   1  
ATOM   9872   H  H    . SER C  2 192 ? -14.959 -49.950 -0.971  1.00 0.00 ?  246 SER C H    1  
ATOM   9873   H  HA   . SER C  2 192 ? -12.627 -51.196 -1.711  1.00 0.00 ?  246 SER C HA   1  
ATOM   9874   H  HB2  . SER C  2 192 ? -14.170 -49.928 -3.143  1.00 0.00 ?  246 SER C HB2  1  
ATOM   9875   H  HB3  . SER C  2 192 ? -13.416 -48.381 -2.615  1.00 0.00 ?  246 SER C HB3  1  
ATOM   9876   H  HG   . SER C  2 192 ? -12.048 -50.333 -4.051  1.00 0.00 ?  246 SER C HG   1  
ATOM   9877   N  N    . PHE C  2 193 ? -12.159 -48.425 0.053   1.00 0.00 ?  247 PHE C N    1  
ATOM   9878   C  CA   . PHE C  2 193 ? -11.178 -47.705 0.845   1.00 0.00 ?  247 PHE C CA   1  
ATOM   9879   C  C    . PHE C  2 193 ? -10.526 -48.574 1.994   1.00 0.00 ?  247 PHE C C    1  
ATOM   9880   O  O    . PHE C  2 193 ? -9.318  -48.671 2.128   1.00 0.00 ?  247 PHE C O    1  
ATOM   9881   C  CB   . PHE C  2 193 ? -11.618 -46.312 1.389   1.00 0.00 ?  247 PHE C CB   1  
ATOM   9882   C  CG   . PHE C  2 193 ? -10.584 -45.556 2.241   1.00 0.00 ?  247 PHE C CG   1  
ATOM   9883   C  CD1  . PHE C  2 193 ? -9.508  -44.984 1.506   1.00 0.00 ?  247 PHE C CD1  1  
ATOM   9884   C  CD2  . PHE C  2 193 ? -10.663 -45.392 3.690   1.00 0.00 ?  247 PHE C CD2  1  
ATOM   9885   C  CE1  . PHE C  2 193 ? -8.563  -44.207 2.208   1.00 0.00 ?  247 PHE C CE1  1  
ATOM   9886   C  CE2  . PHE C  2 193 ? -9.664  -44.689 4.291   1.00 0.00 ?  247 PHE C CE2  1  
ATOM   9887   C  CZ   . PHE C  2 193 ? -8.601  -44.072 3.587   1.00 0.00 ?  247 PHE C CZ   1  
ATOM   9888   H  H    . PHE C  2 193 ? -13.072 -48.032 0.127   1.00 0.00 ?  247 PHE C H    1  
ATOM   9889   H  HA   . PHE C  2 193 ? -10.370 -47.659 0.129   1.00 0.00 ?  247 PHE C HA   1  
ATOM   9890   H  HB2  . PHE C  2 193 ? -12.057 -45.560 0.699   1.00 0.00 ?  247 PHE C HB2  1  
ATOM   9891   H  HB3  . PHE C  2 193 ? -12.547 -46.495 1.971   1.00 0.00 ?  247 PHE C HB3  1  
ATOM   9892   H  HD1  . PHE C  2 193 ? -9.459  -45.025 0.428   1.00 0.00 ?  247 PHE C HD1  1  
ATOM   9893   H  HD2  . PHE C  2 193 ? -11.376 -45.894 4.326   1.00 0.00 ?  247 PHE C HD2  1  
ATOM   9894   H  HE1  . PHE C  2 193 ? -7.821  -43.673 1.633   1.00 0.00 ?  247 PHE C HE1  1  
ATOM   9895   H  HE2  . PHE C  2 193 ? -9.642  -44.598 5.367   1.00 0.00 ?  247 PHE C HE2  1  
ATOM   9896   H  HZ   . PHE C  2 193 ? -7.802  -43.518 4.057   1.00 0.00 ?  247 PHE C HZ   1  
ATOM   9897   N  N    . LYS C  2 194 ? -11.393 -49.293 2.719   1.00 0.00 ?  248 LYS C N    1  
ATOM   9898   C  CA   . LYS C  2 194 ? -10.948 -50.185 3.775   1.00 0.00 ?  248 LYS C CA   1  
ATOM   9899   C  C    . LYS C  2 194 ? -10.196 -51.397 3.214   1.00 0.00 ?  248 LYS C C    1  
ATOM   9900   O  O    . LYS C  2 194 ? -9.203  -51.757 3.760   1.00 0.00 ?  248 LYS C O    1  
ATOM   9901   C  CB   . LYS C  2 194 ? -12.206 -50.708 4.480   1.00 0.00 ?  248 LYS C CB   1  
ATOM   9902   C  CG   . LYS C  2 194 ? -11.927 -51.758 5.490   1.00 0.00 ?  248 LYS C CG   1  
ATOM   9903   C  CD   . LYS C  2 194 ? -11.196 -51.380 6.786   1.00 0.00 ?  248 LYS C CD   1  
ATOM   9904   C  CE   . LYS C  2 194 ? -11.984 -50.427 7.687   1.00 0.00 ?  248 LYS C CE   1  
ATOM   9905   N  NZ   . LYS C  2 194 ? -11.031 -49.892 8.706   1.00 0.00 1  248 LYS C NZ   1  
ATOM   9906   H  H    . LYS C  2 194 ? -12.386 -49.235 2.651   1.00 0.00 ?  248 LYS C H    1  
ATOM   9907   H  HA   . LYS C  2 194 ? -10.306 -49.669 4.473   1.00 0.00 ?  248 LYS C HA   1  
ATOM   9908   H  HB2  . LYS C  2 194 ? -12.717 -49.852 4.970   1.00 0.00 ?  248 LYS C HB2  1  
ATOM   9909   H  HB3  . LYS C  2 194 ? -12.929 -51.021 3.697   1.00 0.00 ?  248 LYS C HB3  1  
ATOM   9910   H  HG2  . LYS C  2 194 ? -12.927 -52.134 5.794   1.00 0.00 ?  248 LYS C HG2  1  
ATOM   9911   H  HG3  . LYS C  2 194 ? -11.518 -52.690 5.045   1.00 0.00 ?  248 LYS C HG3  1  
ATOM   9912   H  HD2  . LYS C  2 194 ? -11.074 -52.312 7.378   1.00 0.00 ?  248 LYS C HD2  1  
ATOM   9913   H  HD3  . LYS C  2 194 ? -10.151 -51.007 6.817   1.00 0.00 ?  248 LYS C HD3  1  
ATOM   9914   H  HE2  . LYS C  2 194 ? -12.441 -49.620 7.074   1.00 0.00 ?  248 LYS C HE2  1  
ATOM   9915   H  HE3  . LYS C  2 194 ? -12.822 -50.928 8.216   1.00 0.00 ?  248 LYS C HE3  1  
ATOM   9916   H  HZ1  . LYS C  2 194 ? -10.536 -49.039 8.376   1.00 0.00 ?  248 LYS C HZ1  1  
ATOM   9917   H  HZ2  . LYS C  2 194 ? -10.243 -50.563 8.812   1.00 0.00 ?  248 LYS C HZ2  1  
ATOM   9918   H  HZ3  . LYS C  2 194 ? -11.381 -49.623 9.648   1.00 0.00 ?  248 LYS C HZ3  1  
ATOM   9919   N  N    . VAL C  2 195 ? -10.628 -52.017 2.073   1.00 0.00 ?  249 VAL C N    1  
ATOM   9920   C  CA   . VAL C  2 195 ? -9.822  -53.123 1.521   1.00 0.00 ?  249 VAL C CA   1  
A