data_6CNB
# 
_entry.id   6CNB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CNB         
WWPDB D_1000233022 
EMDB  EMD-7530     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Yeast RNA polymerase III initial transcribing complex' 
_pdbx_database_related.db_id          EMD-7530 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6CNB 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Han, Y.' 1 ? 
'He, Y.'  2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Cell Discov' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2056-5968 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            4 
_citation.language                  ? 
_citation.page_first                40 
_citation.page_last                 40 
_citation.title                     'Structural visualization of RNA polymerase III transcription machineries.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41421-018-0044-z 
_citation.pdbx_database_id_PubMed   30083386 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Han, Y.'      1 0000-0002-1207-7756 
primary 'Yan, C.'      2 ?                   
primary 'Fishbain, S.' 3 ?                   
primary 'Ivanov, I.'   4 0000-0002-5306-1005 
primary 'He, Y.'       5 0000-0002-1455-3963 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase III subunit RPC1' 162517.812 1 2.7.7.6 ?     ? ? 
2  polymer     nat 'DNA-directed RNA polymerase III subunit RPC2' 129629.383 1 2.7.7.6 ?     ? ? 
3  polymer     nat 'DNA-directed RNA polymerases I and III subunit RPAC1' 37732.613  1 ?       ?     ? ? 
4  polymer     nat 'DNA-directed RNA polymerase III subunit RPC9' 18623.123  1 ?       ?     ? ? 
5  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC1' 25117.094  1 ?       ?     ? ? 
6  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC2' 17931.834  1 ?       ?     ? ? 
7  polymer     nat 'DNA-directed RNA polymerase III subunit RPC8' 24349.770  1 ?       ?     ? ? 
8  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC3' 16525.363  1 ?       ?     ? ? 
9  polymer     nat 'DNA-directed RNA polymerase III subunit RPC10' 12525.109  1 ?       ?     ? ? 
10 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC5' 8290.732   1 ?       ?     ? ? 
11 polymer     nat 'DNA-directed RNA polymerases I and III subunit RPAC2' 16167.860  1 ?       ?     ? ? 
12 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC4' 7729.969   1 ?       ?     ? ? 
13 polymer     nat 'DNA-directed RNA polymerase III subunit RPC5' 32178.115  1 ?       ?     ? ? 
14 polymer     nat 'DNA-directed RNA polymerase III subunit RPC4' 46751.469  1 ?       ?     ? ? 
15 polymer     nat 'DNA-directed RNA polymerase III subunit RPC3' 74112.820  1 ?       ?     ? ? 
16 polymer     nat 'DNA-directed RNA polymerase III subunit RPC6' 36174.160  1 ?       C438S ? ? 
17 polymer     nat 
;DNA-directed RNA polymerase III subunit RPC7,DNA-directed RNA polymerase III subunit RPC7,DNA-directed RNA polymerase III subunit RPC7,DNA-directed RNA polymerase III subunit RPC7,DNA-directed RNA polymerase III subunit RPC7
;
27299.682  1 ?       ?     ? ? 
18 polymer     man 'Transcription factor IIIB 70 kDa subunit,TATA-box-binding protein,Transcription factor IIIB 70 kDa subunit' 
82097.867  1 ?       ?     ? ? 
19 polymer     man 
;Transcription factor TFIIIB component B'',Transcription factor TFIIIB component B'',Transcription factor TFIIIB component B'',Transcription factor TFIIIB component B'',Transcription factor TFIIIB component B''
;
66249.742  1 ?       ?     ? ? 
20 polymer     syn 'DNA (71-MER)' 21745.959  1 ?       ?     ? ? 
21 polymer     syn 'DNA (71-MER)' 21894.096  1 ?       ?     ? ? 
22 non-polymer syn 'ZINC ION' 65.409     7 ?       ?     ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'RNA polymerase III subunit C1,DNA-directed RNA polymerase III largest subunit,RNA polymerase III subunit C160' 
2  'RNA polymerase III subunit C2,C128,DNA-directed RNA polymerase III 130 kDa polypeptide' 
3  'RNA polymerases I and III subunit AC1,C37,DNA-directed RNA polymerases I and III 40 kDa polypeptide,C40' 
4  'RNA polymerase III subunit C9,RNA polymerase III subunit C17' 
5  'RNA polymerases I,II,and III subunit ABC1,ABC27,DNA-directed RNA polymerases I,and III 27 kDa polypeptide' 
6  'RNA polymerases I,II,and III subunit ABC2,ABC23,DNA-directed RNA polymerases I,and III 23 kDa polypeptide' 
7  'RNA polymerase III subunit C8,DNA-directed RNA polymerase III 25 kDa polypeptide,RNA polymerase III subunit C25' 
8  'RNA polymerases I,II,and III subunit ABC3,ABC14.4,ABC14.5,DNA-directed RNA polymerases I,and III 14.5 kDa polypeptide' 
9  'RNA polymerase III subunit C10,DNA-directed RNA polymerases III 12.5 kDa polypeptide,RNA polymerase III subunit C11' 
10 'RNA polymerases I,II,and III subunit ABC5,ABC10-beta,ABC8,DNA-directed RNA polymerases I,and III 8.3 kDa polypeptide' 
11 'RNA polymerases I and III subunit AC2,AC19,DNA-directed RNA polymerases I and III 16 kDa polypeptide,RPA19' 
12 'RNA polymerases I,II,and III subunit ABC4,ABC10-alpha' 
13 'RNA polymerase III subunit C5,DNA-directed RNA polymerase III 37 kDa polypeptide,RNA polymerase III subunit C37' 
14 'RNA polymerase III subunit C4,C53,DNA-directed RNA polymerase III 47 kDa polypeptide' 
15 'RNA polymerase III subunit C3,C82,DNA-directed III 74 kDa polypeptide,C74' 
16 'RNA polymerase III subunit C6,C34,DNA-directed RNA polymerase III 36 kDa polypeptide' 
17 
;RNA polymerase III subunit C7,DNA-directed RNA polymerase III 31 kDa polypeptide,C31,RNA polymerase III subunit C7,DNA-directed RNA polymerase III 31 kDa polypeptide,C31,RNA polymerase III subunit C7,DNA-directed RNA polymerase III 31 kDa polypeptide,C31,RNA polymerase III subunit C7,DNA-directed RNA polymerase III 31 kDa polypeptide,C31
;
18 
;TFIIIB,B-related factor 1,BRF-1,TATA sequence-binding protein,TBP,TATA-binding factor,TATA-box factor,Transcription factor D,Transcription initiation factor TFIID TBP subunit,TFIIIB,B-related factor 1,BRF-1
;
19 TFIIIB90,TFIIIB90,TFIIIB90,TFIIIB90 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no 
;MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHGNLASCHGH
FGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGAL
NGVVKKAAAGAGSAALKIIHDTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQ
LTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK
VLTYPEKVTRYNRHKLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL
HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITG
SYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKS
LPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNWNAPLIMATCGSK
GSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTA
ETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM
ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQ
GIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT
LGVPRIKEIINASKVISTPIINAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL
TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLRRALPDVVVKGLPDISR
AVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGD
VMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD
LVPKRCLFESLSNEAALKAN
;
;MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHGNLASCHGH
FGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGAL
NGVVKKAAAGAGSAALKIIHDTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQ
LTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK
VLTYPEKVTRYNRHKLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL
HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITG
SYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKS
LPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNWNAPLIMATCGSK
GSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTA
ETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM
ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQ
GIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT
LGVPRIKEIINASKVISTPIINAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL
TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLRRALPDVVVKGLPDISR
AVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGD
VMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD
LVPKRCLFESLSNEAALKAN
;
A ? 
2  'polypeptide(L)'        no no 
;MVAATKRRKTHIHKHVKDEAFDDLLKPVYKGKKLTDEINTAQDKWHLLPAFLKVKGLVKQHLDSFNYFVDTDLKKIIKAN
QLILSDVDPEFYLKYVDIRVGKKSSSSTKDYLTPPHECRLRDMTYSAPIYVDIEYTRGRNIIMHKDVEIGRMPIMLRSNK
CILYDADESKMAKLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKGIVQASVTSSTHERKSKTYVITKNGKI
YLKHNSIAEEIPIAIVLKACGILSDLEIMQLVCGNDSSYQDIFAVNLEESSKLDIYTQQQALEYIGAKVKTMRRQKLTIL
QEGIEAIATTVIAHLTVEALDFREKALYIAMMTRRVVMAMYNPKMIDDRDYVGNKRLELAGQLISLLFEDLFKKFNNDFK
LSIDKVLKKPNRAMEYDALLSINVHSNNITSGLNRAISTGNWSLKRFKMERAGVTHVLSRLSYISALGMMTRISSQFEKS
RKVSGPRALQPSQFGMLCTADTPEGEACGLVKNLALMTHITTDDEEEPIKKLCYVLGVEDITLIDSASLHLNYGVYLNGT
LIGSIRFPTKFVTQFRHLRRTGKVSEFISIYSNSHQMAVHIATDGGRICRPLIIVSDGQSRVKDIHLRKLLDGELDFDDF
LKLGLVEYLDVNEENDSYIALYEKDIVPSMTHLEIEPFTILGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKR
IDTLLYLMTYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCETRRKTTTVLKRYAN
HTQDIIGGMRVDENGDPIWQHQSLGPDGLGEVGMKVQSGQIYINKSVPTNSADAPNPNNVNVQTQYREAPVIYRGPEPSH
IDQVMMSVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDMPFNDQGIVPDIIMNPHGFPSRMTVGKMIE
LISGKAGVLNGTLEYGTCFGGSKLEDMSKILVDQGFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARAR
GPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCDKCGLMGYSGWCTTCKSAENIIKMT
IPYAAKLLFQELLSMNIAPRLRLEDIFQQ
;
;MVAATKRRKTHIHKHVKDEAFDDLLKPVYKGKKLTDEINTAQDKWHLLPAFLKVKGLVKQHLDSFNYFVDTDLKKIIKAN
QLILSDVDPEFYLKYVDIRVGKKSSSSTKDYLTPPHECRLRDMTYSAPIYVDIEYTRGRNIIMHKDVEIGRMPIMLRSNK
CILYDADESKMAKLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKGIVQASVTSSTHERKSKTYVITKNGKI
YLKHNSIAEEIPIAIVLKACGILSDLEIMQLVCGNDSSYQDIFAVNLEESSKLDIYTQQQALEYIGAKVKTMRRQKLTIL
QEGIEAIATTVIAHLTVEALDFREKALYIAMMTRRVVMAMYNPKMIDDRDYVGNKRLELAGQLISLLFEDLFKKFNNDFK
LSIDKVLKKPNRAMEYDALLSINVHSNNITSGLNRAISTGNWSLKRFKMERAGVTHVLSRLSYISALGMMTRISSQFEKS
RKVSGPRALQPSQFGMLCTADTPEGEACGLVKNLALMTHITTDDEEEPIKKLCYVLGVEDITLIDSASLHLNYGVYLNGT
LIGSIRFPTKFVTQFRHLRRTGKVSEFISIYSNSHQMAVHIATDGGRICRPLIIVSDGQSRVKDIHLRKLLDGELDFDDF
LKLGLVEYLDVNEENDSYIALYEKDIVPSMTHLEIEPFTILGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKR
IDTLLYLMTYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCETRRKTTTVLKRYAN
HTQDIIGGMRVDENGDPIWQHQSLGPDGLGEVGMKVQSGQIYINKSVPTNSADAPNPNNVNVQTQYREAPVIYRGPEPSH
IDQVMMSVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDMPFNDQGIVPDIIMNPHGFPSRMTVGKMIE
LISGKAGVLNGTLEYGTCFGGSKLEDMSKILVDQGFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARAR
GPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCDKCGLMGYSGWCTTCKSAENIIKMT
IPYAAKLLFQELLSMNIAPRLRLEDIFQQ
;
B ? 
3  'polypeptide(L)'        no no 
;MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAA
EYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNA
HVYARDLKFEPQGRQSTTFADCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIK
GESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRI
LKNKAEYLKNCPITQ
;
;MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAA
EYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNA
HVYARDLKFEPQGRQSTTFADCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIK
GESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRI
LKNKAEYLKNCPITQ
;
C ? 
4  'polypeptide(L)'        no no 
;MKVLEERNAFLSDYEVLKFLTDLEKKHLWDQKSLAALKKSRSKGKQNRPYNHPELQGITRNVVNYLSINKNFINQEDEGE
ERESSGAKDAEKSGISKMSDESFAELMTKLNSFKLFKAEKLQIVNQLPANMVHLYSIVEECDARFDEKTIEEMLEIISGY
A
;
;MKVLEERNAFLSDYEVLKFLTDLEKKHLWDQKSLAALKKSRSKGKQNRPYNHPELQGITRNVVNYLSINKNFINQEDEGE
ERESSGAKDAEKSGISKMSDESFAELMTKLNSFKLFKAEKLQIVNQLPANMVHLYSIVEECDARFDEKTIEEMLEIISGY
A
;
D ? 
5  'polypeptide(L)'        no no 
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
6  'polypeptide(L)'        no no 
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
7  'polypeptide(L)'        no no 
;MFILSKIADLVRIPPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQLKPGDGSSYINVTFRAVVFKPF
LGEIVTGWISKCTAEGIKVSLLGIFDDIFIPQNMLFEGCYYTPEESAWIWPMDEETKLYFDVNEKIRFRIEREVFVDVKP
KSPKERELEERAQLENEIEGKNEETPQNEKPPAYALLGSCQTDGMGLVSWWE
;
;MFILSKIADLVRIPPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQLKPGDGSSYINVTFRAVVFKPF
LGEIVTGWISKCTAEGIKVSLLGIFDDIFIPQNMLFEGCYYTPEESAWIWPMDEETKLYFDVNEKIRFRIEREVFVDVKP
KSPKERELEERAQLENEIEGKNEETPQNEKPPAYALLGSCQTDGMGLVSWWE
;
G ? 
8  'polypeptide(L)'        no no 
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
9  'polypeptide(L)'        no no 
;MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWDNVDQTKTQCPNYDTCGGESA
YFFQLQIRSADEPMTTFYKCVNCGHRWKEN
;
;MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWDNVDQTKTQCPNYDTCGGESA
YFFQLQIRSADEPMTTFYKCVNCGHRWKEN
;
I ? 
10 'polypeptide(L)'        no no MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
11 'polypeptide(L)'        no no 
;MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVI
MKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM
;
;MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVI
MKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM
;
K ? 
12 'polypeptide(L)'        no no MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
13 'polypeptide(L)'        no no 
;MSIDNKLFVTEEDEEDRTQDRADVEDESNDIDMIADENGTNSAIANEQEEKSEEVKAEDDTGEEEEDDPVIEEFPLKISG
EEESLHVFQYANRPRLVGRKPAEHPFISAARYKPKSHLWEIDIPLDEQAFYNKDKAESEWNGVNVQTLKGVGVENNGQYA
AFVKDMQVYLVPIERVAQLKPFFKYIDDANVTRKQEDARRNPNPSSQRAQVVTMSVKSVNDPSQNRLTGSLLAHKVADEE
ANIELTWAEGTFEQFKDTIVKEAEDKTLVALEKQEDYIDNLV
;
;MSIDNKLFVTEEDEEDRTQDRADVEDESNDIDMIADENGTNSAIANEQEEKSEEVKAEDDTGEEEEDDPVIEEFPLKISG
EEESLHVFQYANRPRLVGRKPAEHPFISAARYKPKSHLWEIDIPLDEQAFYNKDKAESEWNGVNVQTLKGVGVENNGQYA
AFVKDMQVYLVPIERVAQLKPFFKYIDDANVTRKQEDARRNPNPSSQRAQVVTMSVKSVNDPSQNRLTGSLLAHKVADEE
ANIELTWAEGTFEQFKDTIVKEAEDKTLVALEKQEDYIDNLV
;
M ? 
14 'polypeptide(L)'        no no 
;MSSNKGNGRLPSLKDSSSNGGGSAKPSLKFKPKAVARKSKEEREAAASKVKLEEESKRGNDKKHFNNKNKRVTGAGGQQR
RMAKYLNNTHVISSGPLAAGNFVSEKGDLRRGFIKSEGSGSSLVQKGLETIDNGAESSENEAEDDDNEGVASKSKKKFNM
GKEFEARNLIEDEDDGESEKSSDVDMDDEEWRSKRIEQLFPVRPVRVRHEDVETVKREIQEALSEKPTREPTPSVKTEPV
GTGLQSYLEERERQVNEKLADLGLEKEFQSVDGKEAAAELELLNADHQHILRKLKKMNNKPERFMVFQLPTRLPAFERPA
VKEEKEDMETQASDPSKKKKNIKKKDTKDALSTRELAGKVGSIRVHKSGKLSVKIGNVVMDIGKGAETTFLQDVIALSIA
DDASSAELLGRVDGKIVVTPQI
;
;MSSNKGNGRLPSLKDSSSNGGGSAKPSLKFKPKAVARKSKEEREAAASKVKLEEESKRGNDKKHFNNKNKRVTGAGGQQR
RMAKYLNNTHVISSGPLAAGNFVSEKGDLRRGFIKSEGSGSSLVQKGLETIDNGAESSENEAEDDDNEGVASKSKKKFNM
GKEFEARNLIEDEDDGESEKSSDVDMDDEEWRSKRIEQLFPVRPVRVRHEDVETVKREIQEALSEKPTREPTPSVKTEPV
GTGLQSYLEERERQVNEKLADLGLEKEFQSVDGKEAAAELELLNADHQHILRKLKKMNNKPERFMVFQLPTRLPAFERPA
VKEEKEDMETQASDPSKKKKNIKKKDTKDALSTRELAGKVGSIRVHKSGKLSVKIGNVVMDIGKGAETTFLQDVIALSIA
DDASSAELLGRVDGKIVVTPQI
;
N ? 
15 'polypeptide(L)'        no no 
;MDELLGEALSAENQTGESTVESEKLVTPEDVMTISSLEQRTLNPDLFLYKELVKAHLGERAASVIGMLVALGRLSVRELV
EKIDGMDVDSVKTTLVSLTQLRCVKYLQETAISGKKTTYYYYNEEGIHILLYSGLIIDEIITQMRVNDEEEHKQLVAEIV
QNVISLGSLTVEDYLSSVTSDSMKYTISSLFVQLCEMGYLIQISKLHYTPIEDLWQFLYEKHYKNIPRNSPLSDLKKRSQ
AKMNAKTDFAKIINKPNELSQILTVDPKTSLRIVKPTVSLTINLDRFMKGRRSKQLINLAKTRVGSVTAQVYKIALRLTE
QKSPKIRDPLTQTGLLQDLEEAKSFQDEAELVEEKTPGLTFNAIDLARHLPAELDLRGSLLSRKPSDNKKRSGSNAAASL
PSKKLKTEDGFVIPALPAAVSKSLQESGDTQEEDEEEEDLDADTEDPHSASLINSHLKILASSNFPFLNETKPGVYYVPY
SKLMPVLKSSVYEYVIASTLGPSAMRLSRCIRDNKLVSEKIINSTALMKEKDIRSTLASLIRYNSVEIQEVPRTADRSAS
RAVFLFRCKETHSYNFMRQNLEWNMANLLFKKEKLKQENSTLLKKANRDDVKGRENELLLPSELNQLKMVNERELNVFAR
LSRLLSLWEVFQMA
;
;MDELLGEALSAENQTGESTVESEKLVTPEDVMTISSLEQRTLNPDLFLYKELVKAHLGERAASVIGMLVALGRLSVRELV
EKIDGMDVDSVKTTLVSLTQLRCVKYLQETAISGKKTTYYYYNEEGIHILLYSGLIIDEIITQMRVNDEEEHKQLVAEIV
QNVISLGSLTVEDYLSSVTSDSMKYTISSLFVQLCEMGYLIQISKLHYTPIEDLWQFLYEKHYKNIPRNSPLSDLKKRSQ
AKMNAKTDFAKIINKPNELSQILTVDPKTSLRIVKPTVSLTINLDRFMKGRRSKQLINLAKTRVGSVTAQVYKIALRLTE
QKSPKIRDPLTQTGLLQDLEEAKSFQDEAELVEEKTPGLTFNAIDLARHLPAELDLRGSLLSRKPSDNKKRSGSNAAASL
PSKKLKTEDGFVIPALPAAVSKSLQESGDTQEEDEEEEDLDADTEDPHSASLINSHLKILASSNFPFLNETKPGVYYVPY
SKLMPVLKSSVYEYVIASTLGPSAMRLSRCIRDNKLVSEKIINSTALMKEKDIRSTLASLIRYNSVEIQEVPRTADRSAS
RAVFLFRCKETHSYNFMRQNLEWNMANLLFKKEKLKQENSTLLKKANRDDVKGRENELLLPSELNQLKMVNERELNVFAR
LSRLLSLWEVFQMA
;
O ? 
16 'polypeptide(L)'        no no 
;MSGMIENGLQLSDNAKTLHSQMMSKGIGALFTQQELQKQMGIGSLTDLMSIVQELLDKNLIKLVKQNDELKFQGVLESEA
QKKATMSAEEALVYSYIEASGREGIWSKTIKARTNLHQHVVLKCLKSLESQRYVKSVKSVKFPTRKIYMLYSLQPSVDIT
GGPWFTDGELDIEFINSLLTIVWRFISENTFPNGFKNFENGPKKNVFYAPNVKNYSTTQEILEFITAAQVANVELTPSNI
RSLCEVLVYDDKLEKVTHDCYRVTLESILQMNQGEGEPEAGNKALEDEEEFSIFNYFKMFPASKHDKEVVYFDEWTI
;
;MSGMIENGLQLSDNAKTLHSQMMSKGIGALFTQQELQKQMGIGSLTDLMSIVQELLDKNLIKLVKQNDELKFQGVLESEA
QKKATMSAEEALVYSYIEASGREGIWSKTIKARTNLHQHVVLKCLKSLESQRYVKSVKSVKFPTRKIYMLYSLQPSVDIT
GGPWFTDGELDIEFINSLLTIVWRFISENTFPNGFKNFENGPKKNVFYAPNVKNYSTTQEILEFITAAQVANVELTPSNI
RSLCEVLVYDDKLEKVTHDCYRVTLESILQMNQGEGEPEAGNKALEDEEEFSIFNYFKMFPASKHDKEVVYFDEWTI
;
P ? 
17 'polypeptide(L)'        no no 
;MSSYRGGSRGGGSNYMSNLPFGLGYGDVGKNHITEFPSIPLPINGPITNKERSLAVKYINFGKTVKDGPF(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)RKPNIILDEDDTNDGIERYSDKYLKKRKIGISIDDHPYNLNLFPNELYNVMGINKKKLLAISKFNNADDVFTGTG
LQDENIGLSMLAKLKELAEDVDDASTGDGAAKGSKTGEGEDDDLADDDFEEDEDEEDDDDYNAEKYFNNGDDDDYGDEED
PNEEAAF
;
;MSSYRGGSRGGGSNYMSNLPFGLGYGDVGKNHITEFPSIPLPINGPITNKERSLAVKYINFGKTVKDGPFXXXXXXXXXX
XXXXXXXXXRKPNIILDEDDTNDGIERYSDKYLKKRKIGISIDDHPYNLNLFPNELYNVMGINKKKLLAISKFNNADDVF
TGTGLQDENIGLSMLAKLKELAEDVDDASTGDGAAKGSKTGEGEDDDLADDDFEEDEDEEDDDDYNAEKYFNNGDDDDYG
DEEDPNEEAAF
;
Q ? 
18 'polypeptide(L)'        no no 
;MPVCKNCHGTEFERDLSNANNDLVCKACGVVSEDNPIVSEVTFGETSAGAAVVQGSFIGAGQSHAAFGGSSALESREATL
NNARRKLRAVSYALHIPEYITDAAFQWYKLALANNFVQGRRSQNVIASCLYVACRKEKTHHMLIDFSSRLQVSVYSIGAT
FLKMVKKLHITELPLADPSLFIQHFAEKLDLADKKIKVVKDAVKLAQRMSKDWMFEGRRPAGIAGACILLACRMNNLRRT
HTEIVAVSHVAEETLQQRLNEFKNTKAAKLSVQKFRENDVEDGEARPPSFVKNRKKERKIKDSLDKEEMFQTSEEALNKN
PILTQVLGEQELSSKEVLFYLKQFSERRARVVERIKATNGIDGENIYHEGSENETRKRKLSEAMPWSGIVPTLQNIVATV
TLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTD
FKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVL
SEFRKMGSGSGSGSGSGSPRNLHLLPTTDTYLSKVSDDPDNLEDVDDEELNAHLLNEEASKLKERIWIGLNADFLLEQES
KRLKQEADIATGNTSVKKKRTRRRNNTRSDEPTKTVDAAAAIGLMSDLQDKSGLHAALKAAEESGDFTTADSVKNMLQKA
SFSKKINYDAIDGLFR
;
;MPVCKNCHGTEFERDLSNANNDLVCKACGVVSEDNPIVSEVTFGETSAGAAVVQGSFIGAGQSHAAFGGSSALESREATL
NNARRKLRAVSYALHIPEYITDAAFQWYKLALANNFVQGRRSQNVIASCLYVACRKEKTHHMLIDFSSRLQVSVYSIGAT
FLKMVKKLHITELPLADPSLFIQHFAEKLDLADKKIKVVKDAVKLAQRMSKDWMFEGRRPAGIAGACILLACRMNNLRRT
HTEIVAVSHVAEETLQQRLNEFKNTKAAKLSVQKFRENDVEDGEARPPSFVKNRKKERKIKDSLDKEEMFQTSEEALNKN
PILTQVLGEQELSSKEVLFYLKQFSERRARVVERIKATNGIDGENIYHEGSENETRKRKLSEAMPWSGIVPTLQNIVATV
TLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTD
FKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVL
SEFRKMGSGSGSGSGSGSPRNLHLLPTTDTYLSKVSDDPDNLEDVDDEELNAHLLNEEASKLKERIWIGLNADFLLEQES
KRLKQEADIATGNTSVKKKRTRRRNNTRSDEPTKTVDAAAAIGLMSDLQDKSGLHAALKAAEESGDFTTADSVKNMLQKA
SFSKKINYDAIDGLFR
;
R ? 
19 'polypeptide(L)'        no no 
;MSSIVNKSGTRFAPKVRQRRAATGGTPTPKPRTPQLFIPESKEIEEDNSDNDKGVDENETAIVEKPSLVGERSLEGFTLT
GTNGHDNEIGDEGPIDASTQNPKADVIEDNVTLKPAPLQTHRDQKVPRSSRLASLSKDNESRPSFKPSFLDSSSNSNGTA
RRLSTISNKLPKKIRLGSITENDMNLKTFKRHRVLGKPSSAKKPAGAHRISIVSKISPPTAMTDSLDRNEFSSETSTSRE
ADENENYVISKVKDIPKKVRDGESAKYFIDEENFTMAELCKPNFPIGQISENFEKSKMAKKAKLEKRRHLRELRMR
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)TAIQLKLNPDGTMAIDEETMVVDRH
KNASIENEYKEKVDENPFANLYNYGSYGRGSYTDPWTVEEMIKFYKALSMWGTDFNLISQLYPYRSRKQVKAKFVNEEKK
RPILIELALRSKLPPNFDEYCCEIKKNIGTVADFNEKLIELQNEHKHHMKEIEEAKNTAKEEDQTAQRLNDANLNKKGSG
GIMTNDLKVYRKTEVVLGTIDDLKRKKLKERNNDDNEDNEGSEEEPEIDQ
;
;MSSIVNKSGTRFAPKVRQRRAATGGTPTPKPRTPQLFIPESKEIEEDNSDNDKGVDENETAIVEKPSLVGERSLEGFTLT
GTNGHDNEIGDEGPIDASTQNPKADVIEDNVTLKPAPLQTHRDQKVPRSSRLASLSKDNESRPSFKPSFLDSSSNSNGTA
RRLSTISNKLPKKIRLGSITENDMNLKTFKRHRVLGKPSSAKKPAGAHRISIVSKISPPTAMTDSLDRNEFSSETSTSRE
ADENENYVISKVKDIPKKVRDGESAKYFIDEENFTMAELCKPNFPIGQISENFEKSKMAKKAKLEKRRHLRELRMRXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTAIQLKLNPDGTMAIDEETMVVDRHKNASIENEYKEKVDEN
PFANLYNYGSYGRGSYTDPWTVEEMIKFYKALSMWGTDFNLISQLYPYRSRKQVKAKFVNEEKKRPILIELALRSKLPPN
FDEYCCEIKKNIGTVADFNEKLIELQNEHKHHMKEIEEAKNTAKEEDQTAQRLNDANLNKKGSGGIMTNDLKVYRKTEVV
LGTIDDLKRKKLKERNNDDNEDNEGSEEEPEIDQ
;
S ? 
20 polydeoxyribonucleotide no no 
;(DT)(DT)(DT)(DT)(DC)(DA)(DA)(DC)(DA)(DT)(DA)(DT)(DA)(DT)(DT)(DA)(DG)(DT)(DA)(DA)
(DT)(DA)(DC)(DT)(DT)(DT)(DT)(DT)(DC)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DT)(DT)(DT)(DT)
(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DA)(DA)(DA)(DT)(DG)(DA)(DC)(DT)(DC)(DC)(DA)
(DT)(DG)(DG)(DC)(DC)(DA)(DA)(DG)(DT)(DT)(DG)
;
TTTTCAACATATATTAGTAATACTTTTTCTGTATTTTTTTTTTTTTTTTAAATGACTCCATGGCCAAGTTG X ? 
21 polydeoxyribonucleotide no no 
;(DC)(DA)(DA)(DC)(DT)(DT)(DG)(DG)(DC)(DC)(DA)(DT)(DG)(DG)(DA)(DG)(DT)(DC)(DA)(DT)
(DT)(DT)(DT)(DA)(DT)(DC)(DT)(DT)(DG)(DT)(DG)(DT)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DA)
(DC)(DA)(DG)(DA)(DA)(DA)(DA)(DA)(DG)(DT)(DA)(DT)(DT)(DA)(DC)(DT)(DA)(DA)(DT)(DA)
(DT)(DA)(DT)(DG)(DT)(DT)(DG)(DA)(DA)(DA)(DA)
;
CAACTTGGCCATGGAGTCATTTTATCTTGTGTCACTTTTACAGAAAAAGTATTACTAATATATGTTGAAAA Y ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    LYS n 
1  3    GLU n 
1  4    VAL n 
1  5    VAL n 
1  6    VAL n 
1  7    SER n 
1  8    GLU n 
1  9    THR n 
1  10   PRO n 
1  11   LYS n 
1  12   ARG n 
1  13   ILE n 
1  14   LYS n 
1  15   GLY n 
1  16   LEU n 
1  17   GLU n 
1  18   PHE n 
1  19   SER n 
1  20   ALA n 
1  21   LEU n 
1  22   SER n 
1  23   ALA n 
1  24   ALA n 
1  25   ASP n 
1  26   ILE n 
1  27   VAL n 
1  28   ALA n 
1  29   GLN n 
1  30   SER n 
1  31   GLU n 
1  32   VAL n 
1  33   GLU n 
1  34   VAL n 
1  35   SER n 
1  36   THR n 
1  37   ARG n 
1  38   ASP n 
1  39   LEU n 
1  40   PHE n 
1  41   ASP n 
1  42   LEU n 
1  43   GLU n 
1  44   LYS n 
1  45   ASP n 
1  46   ARG n 
1  47   ALA n 
1  48   PRO n 
1  49   LYS n 
1  50   ALA n 
1  51   ASN n 
1  52   GLY n 
1  53   ALA n 
1  54   LEU n 
1  55   ASP n 
1  56   PRO n 
1  57   LYS n 
1  58   MET n 
1  59   GLY n 
1  60   VAL n 
1  61   SER n 
1  62   SER n 
1  63   SER n 
1  64   SER n 
1  65   LEU n 
1  66   GLU n 
1  67   CYS n 
1  68   ALA n 
1  69   THR n 
1  70   CYS n 
1  71   HIS n 
1  72   GLY n 
1  73   ASN n 
1  74   LEU n 
1  75   ALA n 
1  76   SER n 
1  77   CYS n 
1  78   HIS n 
1  79   GLY n 
1  80   HIS n 
1  81   PHE n 
1  82   GLY n 
1  83   HIS n 
1  84   LEU n 
1  85   LYS n 
1  86   LEU n 
1  87   ALA n 
1  88   LEU n 
1  89   PRO n 
1  90   VAL n 
1  91   PHE n 
1  92   HIS n 
1  93   ILE n 
1  94   GLY n 
1  95   TYR n 
1  96   PHE n 
1  97   LYS n 
1  98   ALA n 
1  99   THR n 
1  100  ILE n 
1  101  GLN n 
1  102  ILE n 
1  103  LEU n 
1  104  GLN n 
1  105  GLY n 
1  106  ILE n 
1  107  CYS n 
1  108  LYS n 
1  109  ASN n 
1  110  CYS n 
1  111  SER n 
1  112  ALA n 
1  113  ILE n 
1  114  LEU n 
1  115  LEU n 
1  116  SER n 
1  117  GLU n 
1  118  THR n 
1  119  ASP n 
1  120  LYS n 
1  121  ARG n 
1  122  GLN n 
1  123  PHE n 
1  124  LEU n 
1  125  HIS n 
1  126  GLU n 
1  127  LEU n 
1  128  ARG n 
1  129  ARG n 
1  130  PRO n 
1  131  GLY n 
1  132  VAL n 
1  133  ASP n 
1  134  ASN n 
1  135  LEU n 
1  136  ARG n 
1  137  ARG n 
1  138  MET n 
1  139  GLY n 
1  140  ILE n 
1  141  LEU n 
1  142  LYS n 
1  143  LYS n 
1  144  ILE n 
1  145  LEU n 
1  146  ASP n 
1  147  GLN n 
1  148  CYS n 
1  149  LYS n 
1  150  LYS n 
1  151  GLN n 
1  152  ARG n 
1  153  ARG n 
1  154  CYS n 
1  155  LEU n 
1  156  HIS n 
1  157  CYS n 
1  158  GLY n 
1  159  ALA n 
1  160  LEU n 
1  161  ASN n 
1  162  GLY n 
1  163  VAL n 
1  164  VAL n 
1  165  LYS n 
1  166  LYS n 
1  167  ALA n 
1  168  ALA n 
1  169  ALA n 
1  170  GLY n 
1  171  ALA n 
1  172  GLY n 
1  173  SER n 
1  174  ALA n 
1  175  ALA n 
1  176  LEU n 
1  177  LYS n 
1  178  ILE n 
1  179  ILE n 
1  180  HIS n 
1  181  ASP n 
1  182  THR n 
1  183  PHE n 
1  184  ARG n 
1  185  TRP n 
1  186  VAL n 
1  187  GLY n 
1  188  LYS n 
1  189  LYS n 
1  190  SER n 
1  191  ALA n 
1  192  PRO n 
1  193  GLU n 
1  194  LYS n 
1  195  ASP n 
1  196  ILE n 
1  197  TRP n 
1  198  VAL n 
1  199  GLY n 
1  200  GLU n 
1  201  TRP n 
1  202  LYS n 
1  203  GLU n 
1  204  VAL n 
1  205  LEU n 
1  206  ALA n 
1  207  HIS n 
1  208  ASN n 
1  209  PRO n 
1  210  GLU n 
1  211  LEU n 
1  212  GLU n 
1  213  ARG n 
1  214  TYR n 
1  215  VAL n 
1  216  LYS n 
1  217  ARG n 
1  218  CYS n 
1  219  MET n 
1  220  ASP n 
1  221  ASP n 
1  222  LEU n 
1  223  ASN n 
1  224  PRO n 
1  225  LEU n 
1  226  LYS n 
1  227  THR n 
1  228  LEU n 
1  229  ASN n 
1  230  LEU n 
1  231  PHE n 
1  232  LYS n 
1  233  GLN n 
1  234  ILE n 
1  235  LYS n 
1  236  SER n 
1  237  ALA n 
1  238  ASP n 
1  239  CYS n 
1  240  GLU n 
1  241  LEU n 
1  242  LEU n 
1  243  GLY n 
1  244  ILE n 
1  245  ASP n 
1  246  ALA n 
1  247  THR n 
1  248  VAL n 
1  249  PRO n 
1  250  SER n 
1  251  GLY n 
1  252  ARG n 
1  253  PRO n 
1  254  GLU n 
1  255  THR n 
1  256  TYR n 
1  257  ILE n 
1  258  TRP n 
1  259  ARG n 
1  260  TYR n 
1  261  LEU n 
1  262  PRO n 
1  263  ALA n 
1  264  PRO n 
1  265  PRO n 
1  266  VAL n 
1  267  CYS n 
1  268  ILE n 
1  269  ARG n 
1  270  PRO n 
1  271  SER n 
1  272  VAL n 
1  273  MET n 
1  274  MET n 
1  275  GLN n 
1  276  ASP n 
1  277  SER n 
1  278  PRO n 
1  279  ALA n 
1  280  SER n 
1  281  ASN n 
1  282  GLU n 
1  283  ASP n 
1  284  ASP n 
1  285  LEU n 
1  286  THR n 
1  287  VAL n 
1  288  LYS n 
1  289  LEU n 
1  290  THR n 
1  291  GLU n 
1  292  ILE n 
1  293  VAL n 
1  294  TRP n 
1  295  THR n 
1  296  SER n 
1  297  SER n 
1  298  LEU n 
1  299  ILE n 
1  300  LYS n 
1  301  ALA n 
1  302  GLY n 
1  303  LEU n 
1  304  ASP n 
1  305  LYS n 
1  306  GLY n 
1  307  ILE n 
1  308  SER n 
1  309  ILE n 
1  310  ASN n 
1  311  ASN n 
1  312  MET n 
1  313  MET n 
1  314  GLU n 
1  315  HIS n 
1  316  TRP n 
1  317  ASP n 
1  318  TYR n 
1  319  LEU n 
1  320  GLN n 
1  321  LEU n 
1  322  THR n 
1  323  VAL n 
1  324  ALA n 
1  325  MET n 
1  326  TYR n 
1  327  ILE n 
1  328  ASN n 
1  329  SER n 
1  330  ASP n 
1  331  SER n 
1  332  VAL n 
1  333  ASN n 
1  334  PRO n 
1  335  ALA n 
1  336  MET n 
1  337  LEU n 
1  338  PRO n 
1  339  GLY n 
1  340  SER n 
1  341  SER n 
1  342  ASN n 
1  343  GLY n 
1  344  GLY n 
1  345  GLY n 
1  346  LYS n 
1  347  VAL n 
1  348  LYS n 
1  349  PRO n 
1  350  ILE n 
1  351  ARG n 
1  352  GLY n 
1  353  PHE n 
1  354  CYS n 
1  355  GLN n 
1  356  ARG n 
1  357  LEU n 
1  358  LYS n 
1  359  GLY n 
1  360  LYS n 
1  361  GLN n 
1  362  GLY n 
1  363  ARG n 
1  364  PHE n 
1  365  ARG n 
1  366  GLY n 
1  367  ASN n 
1  368  LEU n 
1  369  SER n 
1  370  GLY n 
1  371  LYS n 
1  372  ARG n 
1  373  VAL n 
1  374  ASP n 
1  375  PHE n 
1  376  SER n 
1  377  GLY n 
1  378  ARG n 
1  379  THR n 
1  380  VAL n 
1  381  ILE n 
1  382  SER n 
1  383  PRO n 
1  384  ASP n 
1  385  PRO n 
1  386  ASN n 
1  387  LEU n 
1  388  SER n 
1  389  ILE n 
1  390  ASP n 
1  391  GLU n 
1  392  VAL n 
1  393  ALA n 
1  394  VAL n 
1  395  PRO n 
1  396  ASP n 
1  397  ARG n 
1  398  VAL n 
1  399  ALA n 
1  400  LYS n 
1  401  VAL n 
1  402  LEU n 
1  403  THR n 
1  404  TYR n 
1  405  PRO n 
1  406  GLU n 
1  407  LYS n 
1  408  VAL n 
1  409  THR n 
1  410  ARG n 
1  411  TYR n 
1  412  ASN n 
1  413  ARG n 
1  414  HIS n 
1  415  LYS n 
1  416  LEU n 
1  417  GLN n 
1  418  GLU n 
1  419  LEU n 
1  420  ILE n 
1  421  VAL n 
1  422  ASN n 
1  423  GLY n 
1  424  PRO n 
1  425  ASN n 
1  426  VAL n 
1  427  HIS n 
1  428  PRO n 
1  429  GLY n 
1  430  ALA n 
1  431  ASN n 
1  432  TYR n 
1  433  LEU n 
1  434  LEU n 
1  435  LYS n 
1  436  ARG n 
1  437  ASN n 
1  438  GLU n 
1  439  ASP n 
1  440  ALA n 
1  441  ARG n 
1  442  ARG n 
1  443  ASN n 
1  444  LEU n 
1  445  ARG n 
1  446  TYR n 
1  447  GLY n 
1  448  ASP n 
1  449  ARG n 
1  450  MET n 
1  451  LYS n 
1  452  LEU n 
1  453  ALA n 
1  454  LYS n 
1  455  ASN n 
1  456  LEU n 
1  457  GLN n 
1  458  ILE n 
1  459  GLY n 
1  460  ASP n 
1  461  VAL n 
1  462  VAL n 
1  463  GLU n 
1  464  ARG n 
1  465  HIS n 
1  466  LEU n 
1  467  GLU n 
1  468  ASP n 
1  469  GLY n 
1  470  ASP n 
1  471  VAL n 
1  472  VAL n 
1  473  LEU n 
1  474  PHE n 
1  475  ASN n 
1  476  ARG n 
1  477  GLN n 
1  478  PRO n 
1  479  SER n 
1  480  LEU n 
1  481  HIS n 
1  482  ARG n 
1  483  LEU n 
1  484  SER n 
1  485  ILE n 
1  486  LEU n 
1  487  SER n 
1  488  HIS n 
1  489  TYR n 
1  490  ALA n 
1  491  LYS n 
1  492  ILE n 
1  493  ARG n 
1  494  PRO n 
1  495  TRP n 
1  496  ARG n 
1  497  THR n 
1  498  PHE n 
1  499  ARG n 
1  500  LEU n 
1  501  ASN n 
1  502  GLU n 
1  503  CYS n 
1  504  VAL n 
1  505  CYS n 
1  506  THR n 
1  507  PRO n 
1  508  TYR n 
1  509  ASN n 
1  510  ALA n 
1  511  ASP n 
1  512  PHE n 
1  513  ASP n 
1  514  GLY n 
1  515  ASP n 
1  516  GLU n 
1  517  MET n 
1  518  ASN n 
1  519  LEU n 
1  520  HIS n 
1  521  VAL n 
1  522  PRO n 
1  523  GLN n 
1  524  THR n 
1  525  GLU n 
1  526  GLU n 
1  527  ALA n 
1  528  ARG n 
1  529  ALA n 
1  530  GLU n 
1  531  ALA n 
1  532  ILE n 
1  533  ASN n 
1  534  LEU n 
1  535  MET n 
1  536  GLY n 
1  537  VAL n 
1  538  LYS n 
1  539  ASN n 
1  540  ASN n 
1  541  LEU n 
1  542  LEU n 
1  543  THR n 
1  544  PRO n 
1  545  LYS n 
1  546  SER n 
1  547  GLY n 
1  548  GLU n 
1  549  PRO n 
1  550  ILE n 
1  551  ILE n 
1  552  ALA n 
1  553  ALA n 
1  554  THR n 
1  555  GLN n 
1  556  ASP n 
1  557  PHE n 
1  558  ILE n 
1  559  THR n 
1  560  GLY n 
1  561  SER n 
1  562  TYR n 
1  563  LEU n 
1  564  ILE n 
1  565  SER n 
1  566  HIS n 
1  567  LYS n 
1  568  ASP n 
1  569  SER n 
1  570  PHE n 
1  571  TYR n 
1  572  ASP n 
1  573  ARG n 
1  574  ALA n 
1  575  THR n 
1  576  LEU n 
1  577  THR n 
1  578  GLN n 
1  579  LEU n 
1  580  LEU n 
1  581  SER n 
1  582  MET n 
1  583  MET n 
1  584  SER n 
1  585  ASP n 
1  586  GLY n 
1  587  ILE n 
1  588  GLU n 
1  589  HIS n 
1  590  PHE n 
1  591  ASP n 
1  592  ILE n 
1  593  PRO n 
1  594  PRO n 
1  595  PRO n 
1  596  ALA n 
1  597  ILE n 
1  598  MET n 
1  599  LYS n 
1  600  PRO n 
1  601  TYR n 
1  602  TYR n 
1  603  LEU n 
1  604  TRP n 
1  605  THR n 
1  606  GLY n 
1  607  LYS n 
1  608  GLN n 
1  609  VAL n 
1  610  PHE n 
1  611  SER n 
1  612  LEU n 
1  613  LEU n 
1  614  ILE n 
1  615  LYS n 
1  616  PRO n 
1  617  ASN n 
1  618  HIS n 
1  619  ASN n 
1  620  SER n 
1  621  PRO n 
1  622  VAL n 
1  623  VAL n 
1  624  ILE n 
1  625  ASN n 
1  626  LEU n 
1  627  ASP n 
1  628  ALA n 
1  629  LYS n 
1  630  ASN n 
1  631  LYS n 
1  632  VAL n 
1  633  PHE n 
1  634  VAL n 
1  635  PRO n 
1  636  PRO n 
1  637  LYS n 
1  638  SER n 
1  639  LYS n 
1  640  SER n 
1  641  LEU n 
1  642  PRO n 
1  643  ASN n 
1  644  GLU n 
1  645  MET n 
1  646  SER n 
1  647  GLN n 
1  648  ASN n 
1  649  ASP n 
1  650  GLY n 
1  651  PHE n 
1  652  VAL n 
1  653  ILE n 
1  654  ILE n 
1  655  ARG n 
1  656  GLY n 
1  657  SER n 
1  658  GLN n 
1  659  ILE n 
1  660  LEU n 
1  661  SER n 
1  662  GLY n 
1  663  VAL n 
1  664  MET n 
1  665  ASP n 
1  666  LYS n 
1  667  SER n 
1  668  VAL n 
1  669  LEU n 
1  670  GLY n 
1  671  ASP n 
1  672  GLY n 
1  673  LYS n 
1  674  LYS n 
1  675  HIS n 
1  676  SER n 
1  677  VAL n 
1  678  PHE n 
1  679  TYR n 
1  680  THR n 
1  681  ILE n 
1  682  LEU n 
1  683  ARG n 
1  684  ASP n 
1  685  TYR n 
1  686  GLY n 
1  687  PRO n 
1  688  GLN n 
1  689  GLU n 
1  690  ALA n 
1  691  ALA n 
1  692  ASN n 
1  693  ALA n 
1  694  MET n 
1  695  ASN n 
1  696  ARG n 
1  697  MET n 
1  698  ALA n 
1  699  LYS n 
1  700  LEU n 
1  701  CYS n 
1  702  ALA n 
1  703  ARG n 
1  704  PHE n 
1  705  LEU n 
1  706  GLY n 
1  707  ASN n 
1  708  ARG n 
1  709  GLY n 
1  710  PHE n 
1  711  SER n 
1  712  ILE n 
1  713  GLY n 
1  714  ILE n 
1  715  ASN n 
1  716  ASP n 
1  717  VAL n 
1  718  THR n 
1  719  PRO n 
1  720  ALA n 
1  721  ASP n 
1  722  ASP n 
1  723  LEU n 
1  724  LYS n 
1  725  GLN n 
1  726  LYS n 
1  727  LYS n 
1  728  GLU n 
1  729  GLU n 
1  730  LEU n 
1  731  VAL n 
1  732  GLU n 
1  733  ILE n 
1  734  ALA n 
1  735  TYR n 
1  736  HIS n 
1  737  LYS n 
1  738  CYS n 
1  739  ASP n 
1  740  GLU n 
1  741  LEU n 
1  742  ILE n 
1  743  THR n 
1  744  LEU n 
1  745  PHE n 
1  746  ASN n 
1  747  LYS n 
1  748  GLY n 
1  749  GLU n 
1  750  LEU n 
1  751  GLU n 
1  752  THR n 
1  753  GLN n 
1  754  PRO n 
1  755  GLY n 
1  756  CYS n 
1  757  ASN n 
1  758  GLU n 
1  759  GLU n 
1  760  GLN n 
1  761  THR n 
1  762  LEU n 
1  763  GLU n 
1  764  ALA n 
1  765  LYS n 
1  766  ILE n 
1  767  GLY n 
1  768  GLY n 
1  769  LEU n 
1  770  LEU n 
1  771  SER n 
1  772  LYS n 
1  773  VAL n 
1  774  ARG n 
1  775  GLU n 
1  776  GLU n 
1  777  VAL n 
1  778  GLY n 
1  779  ASP n 
1  780  VAL n 
1  781  CYS n 
1  782  ILE n 
1  783  ASN n 
1  784  GLU n 
1  785  LEU n 
1  786  ASP n 
1  787  ASN n 
1  788  TRP n 
1  789  ASN n 
1  790  ALA n 
1  791  PRO n 
1  792  LEU n 
1  793  ILE n 
1  794  MET n 
1  795  ALA n 
1  796  THR n 
1  797  CYS n 
1  798  GLY n 
1  799  SER n 
1  800  LYS n 
1  801  GLY n 
1  802  SER n 
1  803  THR n 
1  804  LEU n 
1  805  ASN n 
1  806  VAL n 
1  807  SER n 
1  808  GLN n 
1  809  MET n 
1  810  VAL n 
1  811  ALA n 
1  812  VAL n 
1  813  VAL n 
1  814  GLY n 
1  815  GLN n 
1  816  GLN n 
1  817  ILE n 
1  818  ILE n 
1  819  SER n 
1  820  GLY n 
1  821  ASN n 
1  822  ARG n 
1  823  VAL n 
1  824  PRO n 
1  825  ASP n 
1  826  GLY n 
1  827  PHE n 
1  828  GLN n 
1  829  ASP n 
1  830  ARG n 
1  831  SER n 
1  832  LEU n 
1  833  PRO n 
1  834  HIS n 
1  835  PHE n 
1  836  PRO n 
1  837  LYS n 
1  838  ASN n 
1  839  SER n 
1  840  LYS n 
1  841  THR n 
1  842  PRO n 
1  843  GLN n 
1  844  SER n 
1  845  LYS n 
1  846  GLY n 
1  847  PHE n 
1  848  VAL n 
1  849  ARG n 
1  850  ASN n 
1  851  SER n 
1  852  PHE n 
1  853  PHE n 
1  854  SER n 
1  855  GLY n 
1  856  LEU n 
1  857  SER n 
1  858  PRO n 
1  859  PRO n 
1  860  GLU n 
1  861  PHE n 
1  862  LEU n 
1  863  PHE n 
1  864  HIS n 
1  865  ALA n 
1  866  ILE n 
1  867  SER n 
1  868  GLY n 
1  869  ARG n 
1  870  GLU n 
1  871  GLY n 
1  872  LEU n 
1  873  VAL n 
1  874  ASP n 
1  875  THR n 
1  876  ALA n 
1  877  VAL n 
1  878  LYS n 
1  879  THR n 
1  880  ALA n 
1  881  GLU n 
1  882  THR n 
1  883  GLY n 
1  884  TYR n 
1  885  MET n 
1  886  SER n 
1  887  ARG n 
1  888  ARG n 
1  889  LEU n 
1  890  MET n 
1  891  LYS n 
1  892  SER n 
1  893  LEU n 
1  894  GLU n 
1  895  ASP n 
1  896  LEU n 
1  897  SER n 
1  898  CYS n 
1  899  GLN n 
1  900  TYR n 
1  901  ASP n 
1  902  ASN n 
1  903  THR n 
1  904  VAL n 
1  905  ARG n 
1  906  THR n 
1  907  SER n 
1  908  ALA n 
1  909  ASN n 
1  910  GLY n 
1  911  ILE n 
1  912  VAL n 
1  913  GLN n 
1  914  PHE n 
1  915  THR n 
1  916  TYR n 
1  917  GLY n 
1  918  GLY n 
1  919  ASP n 
1  920  GLY n 
1  921  LEU n 
1  922  ASP n 
1  923  PRO n 
1  924  LEU n 
1  925  GLU n 
1  926  MET n 
1  927  GLU n 
1  928  GLY n 
1  929  ASN n 
1  930  ALA n 
1  931  GLN n 
1  932  PRO n 
1  933  VAL n 
1  934  ASN n 
1  935  PHE n 
1  936  ASN n 
1  937  ARG n 
1  938  SER n 
1  939  TRP n 
1  940  ASP n 
1  941  HIS n 
1  942  ALA n 
1  943  TYR n 
1  944  ASN n 
1  945  ILE n 
1  946  THR n 
1  947  PHE n 
1  948  ASN n 
1  949  ASN n 
1  950  GLN n 
1  951  ASP n 
1  952  LYS n 
1  953  GLY n 
1  954  LEU n 
1  955  LEU n 
1  956  PRO n 
1  957  TYR n 
1  958  ALA n 
1  959  ILE n 
1  960  MET n 
1  961  GLU n 
1  962  THR n 
1  963  ALA n 
1  964  ASN n 
1  965  GLU n 
1  966  ILE n 
1  967  LEU n 
1  968  GLY n 
1  969  PRO n 
1  970  LEU n 
1  971  GLU n 
1  972  GLU n 
1  973  ARG n 
1  974  LEU n 
1  975  VAL n 
1  976  ARG n 
1  977  TYR n 
1  978  ASP n 
1  979  ASN n 
1  980  SER n 
1  981  GLY n 
1  982  CYS n 
1  983  LEU n 
1  984  VAL n 
1  985  LYS n 
1  986  ARG n 
1  987  GLU n 
1  988  ASP n 
1  989  LEU n 
1  990  ASN n 
1  991  LYS n 
1  992  ALA n 
1  993  GLU n 
1  994  TYR n 
1  995  VAL n 
1  996  ASP n 
1  997  GLN n 
1  998  TYR n 
1  999  ASP n 
1  1000 ALA n 
1  1001 GLU n 
1  1002 ARG n 
1  1003 ASP n 
1  1004 PHE n 
1  1005 TYR n 
1  1006 HIS n 
1  1007 SER n 
1  1008 LEU n 
1  1009 ARG n 
1  1010 GLU n 
1  1011 TYR n 
1  1012 ILE n 
1  1013 ASN n 
1  1014 GLY n 
1  1015 LYS n 
1  1016 ALA n 
1  1017 THR n 
1  1018 ALA n 
1  1019 LEU n 
1  1020 ALA n 
1  1021 ASN n 
1  1022 LEU n 
1  1023 ARG n 
1  1024 LYS n 
1  1025 SER n 
1  1026 ARG n 
1  1027 GLY n 
1  1028 MET n 
1  1029 LEU n 
1  1030 GLY n 
1  1031 LEU n 
1  1032 LEU n 
1  1033 GLU n 
1  1034 PRO n 
1  1035 PRO n 
1  1036 ALA n 
1  1037 LYS n 
1  1038 GLU n 
1  1039 LEU n 
1  1040 GLN n 
1  1041 GLY n 
1  1042 ILE n 
1  1043 ASP n 
1  1044 PRO n 
1  1045 ASP n 
1  1046 GLU n 
1  1047 THR n 
1  1048 VAL n 
1  1049 PRO n 
1  1050 ASP n 
1  1051 ASN n 
1  1052 VAL n 
1  1053 LYS n 
1  1054 THR n 
1  1055 SER n 
1  1056 VAL n 
1  1057 SER n 
1  1058 GLN n 
1  1059 LEU n 
1  1060 TYR n 
1  1061 ARG n 
1  1062 ILE n 
1  1063 SER n 
1  1064 GLU n 
1  1065 LYS n 
1  1066 SER n 
1  1067 VAL n 
1  1068 ARG n 
1  1069 LYS n 
1  1070 PHE n 
1  1071 LEU n 
1  1072 GLU n 
1  1073 ILE n 
1  1074 ALA n 
1  1075 LEU n 
1  1076 PHE n 
1  1077 LYS n 
1  1078 TYR n 
1  1079 ARG n 
1  1080 LYS n 
1  1081 ALA n 
1  1082 ARG n 
1  1083 LEU n 
1  1084 GLU n 
1  1085 PRO n 
1  1086 GLY n 
1  1087 THR n 
1  1088 ALA n 
1  1089 ILE n 
1  1090 GLY n 
1  1091 ALA n 
1  1092 ILE n 
1  1093 GLY n 
1  1094 ALA n 
1  1095 GLN n 
1  1096 SER n 
1  1097 ILE n 
1  1098 GLY n 
1  1099 GLU n 
1  1100 PRO n 
1  1101 GLY n 
1  1102 THR n 
1  1103 GLN n 
1  1104 MET n 
1  1105 THR n 
1  1106 LEU n 
1  1107 LYS n 
1  1108 THR n 
1  1109 PHE n 
1  1110 HIS n 
1  1111 PHE n 
1  1112 ALA n 
1  1113 GLY n 
1  1114 VAL n 
1  1115 ALA n 
1  1116 SER n 
1  1117 MET n 
1  1118 ASN n 
1  1119 VAL n 
1  1120 THR n 
1  1121 LEU n 
1  1122 GLY n 
1  1123 VAL n 
1  1124 PRO n 
1  1125 ARG n 
1  1126 ILE n 
1  1127 LYS n 
1  1128 GLU n 
1  1129 ILE n 
1  1130 ILE n 
1  1131 ASN n 
1  1132 ALA n 
1  1133 SER n 
1  1134 LYS n 
1  1135 VAL n 
1  1136 ILE n 
1  1137 SER n 
1  1138 THR n 
1  1139 PRO n 
1  1140 ILE n 
1  1141 ILE n 
1  1142 ASN n 
1  1143 ALA n 
1  1144 VAL n 
1  1145 LEU n 
1  1146 VAL n 
1  1147 ASN n 
1  1148 ASP n 
1  1149 ASN n 
1  1150 ASP n 
1  1151 GLU n 
1  1152 ARG n 
1  1153 ALA n 
1  1154 ALA n 
1  1155 ARG n 
1  1156 VAL n 
1  1157 VAL n 
1  1158 LYS n 
1  1159 GLY n 
1  1160 ARG n 
1  1161 VAL n 
1  1162 GLU n 
1  1163 LYS n 
1  1164 THR n 
1  1165 LEU n 
1  1166 LEU n 
1  1167 SER n 
1  1168 ASP n 
1  1169 VAL n 
1  1170 ALA n 
1  1171 PHE n 
1  1172 TYR n 
1  1173 VAL n 
1  1174 GLN n 
1  1175 ASP n 
1  1176 VAL n 
1  1177 TYR n 
1  1178 LYS n 
1  1179 ASP n 
1  1180 ASN n 
1  1181 LEU n 
1  1182 SER n 
1  1183 PHE n 
1  1184 ILE n 
1  1185 GLN n 
1  1186 VAL n 
1  1187 ARG n 
1  1188 ILE n 
1  1189 ASP n 
1  1190 LEU n 
1  1191 GLY n 
1  1192 THR n 
1  1193 ILE n 
1  1194 ASP n 
1  1195 LYS n 
1  1196 LEU n 
1  1197 GLN n 
1  1198 LEU n 
1  1199 GLU n 
1  1200 LEU n 
1  1201 THR n 
1  1202 ILE n 
1  1203 GLU n 
1  1204 ASP n 
1  1205 ILE n 
1  1206 ALA n 
1  1207 VAL n 
1  1208 ALA n 
1  1209 ILE n 
1  1210 THR n 
1  1211 ARG n 
1  1212 ALA n 
1  1213 SER n 
1  1214 LYS n 
1  1215 LEU n 
1  1216 LYS n 
1  1217 ILE n 
1  1218 GLN n 
1  1219 ALA n 
1  1220 SER n 
1  1221 ASP n 
1  1222 VAL n 
1  1223 ASN n 
1  1224 ILE n 
1  1225 ILE n 
1  1226 GLY n 
1  1227 LYS n 
1  1228 ASP n 
1  1229 ARG n 
1  1230 ILE n 
1  1231 ALA n 
1  1232 ILE n 
1  1233 ASN n 
1  1234 VAL n 
1  1235 PHE n 
1  1236 PRO n 
1  1237 GLU n 
1  1238 GLY n 
1  1239 TYR n 
1  1240 LYS n 
1  1241 ALA n 
1  1242 LYS n 
1  1243 SER n 
1  1244 ILE n 
1  1245 SER n 
1  1246 THR n 
1  1247 SER n 
1  1248 ALA n 
1  1249 LYS n 
1  1250 GLU n 
1  1251 PRO n 
1  1252 SER n 
1  1253 GLU n 
1  1254 ASN n 
1  1255 ASP n 
1  1256 VAL n 
1  1257 PHE n 
1  1258 TYR n 
1  1259 ARG n 
1  1260 MET n 
1  1261 GLN n 
1  1262 GLN n 
1  1263 LEU n 
1  1264 ARG n 
1  1265 ARG n 
1  1266 ALA n 
1  1267 LEU n 
1  1268 PRO n 
1  1269 ASP n 
1  1270 VAL n 
1  1271 VAL n 
1  1272 VAL n 
1  1273 LYS n 
1  1274 GLY n 
1  1275 LEU n 
1  1276 PRO n 
1  1277 ASP n 
1  1278 ILE n 
1  1279 SER n 
1  1280 ARG n 
1  1281 ALA n 
1  1282 VAL n 
1  1283 ILE n 
1  1284 ASN n 
1  1285 ILE n 
1  1286 ARG n 
1  1287 ASP n 
1  1288 ASP n 
1  1289 GLY n 
1  1290 LYS n 
1  1291 ARG n 
1  1292 GLU n 
1  1293 LEU n 
1  1294 LEU n 
1  1295 VAL n 
1  1296 GLU n 
1  1297 GLY n 
1  1298 TYR n 
1  1299 GLY n 
1  1300 LEU n 
1  1301 ARG n 
1  1302 ASP n 
1  1303 VAL n 
1  1304 MET n 
1  1305 CYS n 
1  1306 THR n 
1  1307 ASP n 
1  1308 GLY n 
1  1309 VAL n 
1  1310 ILE n 
1  1311 GLY n 
1  1312 SER n 
1  1313 ARG n 
1  1314 THR n 
1  1315 THR n 
1  1316 THR n 
1  1317 ASN n 
1  1318 HIS n 
1  1319 VAL n 
1  1320 LEU n 
1  1321 GLU n 
1  1322 VAL n 
1  1323 PHE n 
1  1324 SER n 
1  1325 VAL n 
1  1326 LEU n 
1  1327 GLY n 
1  1328 ILE n 
1  1329 GLU n 
1  1330 ALA n 
1  1331 ALA n 
1  1332 ARG n 
1  1333 TYR n 
1  1334 SER n 
1  1335 ILE n 
1  1336 ILE n 
1  1337 ARG n 
1  1338 GLU n 
1  1339 ILE n 
1  1340 ASN n 
1  1341 TYR n 
1  1342 THR n 
1  1343 MET n 
1  1344 SER n 
1  1345 ASN n 
1  1346 HIS n 
1  1347 GLY n 
1  1348 MET n 
1  1349 SER n 
1  1350 VAL n 
1  1351 ASP n 
1  1352 PRO n 
1  1353 ARG n 
1  1354 HIS n 
1  1355 ILE n 
1  1356 GLN n 
1  1357 LEU n 
1  1358 LEU n 
1  1359 GLY n 
1  1360 ASP n 
1  1361 VAL n 
1  1362 MET n 
1  1363 THR n 
1  1364 TYR n 
1  1365 LYS n 
1  1366 GLY n 
1  1367 GLU n 
1  1368 VAL n 
1  1369 LEU n 
1  1370 GLY n 
1  1371 ILE n 
1  1372 THR n 
1  1373 ARG n 
1  1374 PHE n 
1  1375 GLY n 
1  1376 LEU n 
1  1377 SER n 
1  1378 LYS n 
1  1379 MET n 
1  1380 ARG n 
1  1381 ASP n 
1  1382 SER n 
1  1383 VAL n 
1  1384 LEU n 
1  1385 GLN n 
1  1386 LEU n 
1  1387 ALA n 
1  1388 SER n 
1  1389 PHE n 
1  1390 GLU n 
1  1391 LYS n 
1  1392 THR n 
1  1393 THR n 
1  1394 ASP n 
1  1395 HIS n 
1  1396 LEU n 
1  1397 PHE n 
1  1398 ASP n 
1  1399 ALA n 
1  1400 ALA n 
1  1401 PHE n 
1  1402 TYR n 
1  1403 MET n 
1  1404 LYS n 
1  1405 LYS n 
1  1406 ASP n 
1  1407 ALA n 
1  1408 VAL n 
1  1409 GLU n 
1  1410 GLY n 
1  1411 VAL n 
1  1412 SER n 
1  1413 GLU n 
1  1414 CYS n 
1  1415 ILE n 
1  1416 ILE n 
1  1417 LEU n 
1  1418 GLY n 
1  1419 GLN n 
1  1420 THR n 
1  1421 MET n 
1  1422 SER n 
1  1423 ILE n 
1  1424 GLY n 
1  1425 THR n 
1  1426 GLY n 
1  1427 SER n 
1  1428 PHE n 
1  1429 LYS n 
1  1430 VAL n 
1  1431 VAL n 
1  1432 LYS n 
1  1433 GLY n 
1  1434 THR n 
1  1435 ASN n 
1  1436 ILE n 
1  1437 SER n 
1  1438 GLU n 
1  1439 LYS n 
1  1440 ASP n 
1  1441 LEU n 
1  1442 VAL n 
1  1443 PRO n 
1  1444 LYS n 
1  1445 ARG n 
1  1446 CYS n 
1  1447 LEU n 
1  1448 PHE n 
1  1449 GLU n 
1  1450 SER n 
1  1451 LEU n 
1  1452 SER n 
1  1453 ASN n 
1  1454 GLU n 
1  1455 ALA n 
1  1456 ALA n 
1  1457 LEU n 
1  1458 LYS n 
1  1459 ALA n 
1  1460 ASN n 
2  1    MET n 
2  2    VAL n 
2  3    ALA n 
2  4    ALA n 
2  5    THR n 
2  6    LYS n 
2  7    ARG n 
2  8    ARG n 
2  9    LYS n 
2  10   THR n 
2  11   HIS n 
2  12   ILE n 
2  13   HIS n 
2  14   LYS n 
2  15   HIS n 
2  16   VAL n 
2  17   LYS n 
2  18   ASP n 
2  19   GLU n 
2  20   ALA n 
2  21   PHE n 
2  22   ASP n 
2  23   ASP n 
2  24   LEU n 
2  25   LEU n 
2  26   LYS n 
2  27   PRO n 
2  28   VAL n 
2  29   TYR n 
2  30   LYS n 
2  31   GLY n 
2  32   LYS n 
2  33   LYS n 
2  34   LEU n 
2  35   THR n 
2  36   ASP n 
2  37   GLU n 
2  38   ILE n 
2  39   ASN n 
2  40   THR n 
2  41   ALA n 
2  42   GLN n 
2  43   ASP n 
2  44   LYS n 
2  45   TRP n 
2  46   HIS n 
2  47   LEU n 
2  48   LEU n 
2  49   PRO n 
2  50   ALA n 
2  51   PHE n 
2  52   LEU n 
2  53   LYS n 
2  54   VAL n 
2  55   LYS n 
2  56   GLY n 
2  57   LEU n 
2  58   VAL n 
2  59   LYS n 
2  60   GLN n 
2  61   HIS n 
2  62   LEU n 
2  63   ASP n 
2  64   SER n 
2  65   PHE n 
2  66   ASN n 
2  67   TYR n 
2  68   PHE n 
2  69   VAL n 
2  70   ASP n 
2  71   THR n 
2  72   ASP n 
2  73   LEU n 
2  74   LYS n 
2  75   LYS n 
2  76   ILE n 
2  77   ILE n 
2  78   LYS n 
2  79   ALA n 
2  80   ASN n 
2  81   GLN n 
2  82   LEU n 
2  83   ILE n 
2  84   LEU n 
2  85   SER n 
2  86   ASP n 
2  87   VAL n 
2  88   ASP n 
2  89   PRO n 
2  90   GLU n 
2  91   PHE n 
2  92   TYR n 
2  93   LEU n 
2  94   LYS n 
2  95   TYR n 
2  96   VAL n 
2  97   ASP n 
2  98   ILE n 
2  99   ARG n 
2  100  VAL n 
2  101  GLY n 
2  102  LYS n 
2  103  LYS n 
2  104  SER n 
2  105  SER n 
2  106  SER n 
2  107  SER n 
2  108  THR n 
2  109  LYS n 
2  110  ASP n 
2  111  TYR n 
2  112  LEU n 
2  113  THR n 
2  114  PRO n 
2  115  PRO n 
2  116  HIS n 
2  117  GLU n 
2  118  CYS n 
2  119  ARG n 
2  120  LEU n 
2  121  ARG n 
2  122  ASP n 
2  123  MET n 
2  124  THR n 
2  125  TYR n 
2  126  SER n 
2  127  ALA n 
2  128  PRO n 
2  129  ILE n 
2  130  TYR n 
2  131  VAL n 
2  132  ASP n 
2  133  ILE n 
2  134  GLU n 
2  135  TYR n 
2  136  THR n 
2  137  ARG n 
2  138  GLY n 
2  139  ARG n 
2  140  ASN n 
2  141  ILE n 
2  142  ILE n 
2  143  MET n 
2  144  HIS n 
2  145  LYS n 
2  146  ASP n 
2  147  VAL n 
2  148  GLU n 
2  149  ILE n 
2  150  GLY n 
2  151  ARG n 
2  152  MET n 
2  153  PRO n 
2  154  ILE n 
2  155  MET n 
2  156  LEU n 
2  157  ARG n 
2  158  SER n 
2  159  ASN n 
2  160  LYS n 
2  161  CYS n 
2  162  ILE n 
2  163  LEU n 
2  164  TYR n 
2  165  ASP n 
2  166  ALA n 
2  167  ASP n 
2  168  GLU n 
2  169  SER n 
2  170  LYS n 
2  171  MET n 
2  172  ALA n 
2  173  LYS n 
2  174  LEU n 
2  175  ASN n 
2  176  GLU n 
2  177  CYS n 
2  178  PRO n 
2  179  LEU n 
2  180  ASP n 
2  181  PRO n 
2  182  GLY n 
2  183  GLY n 
2  184  TYR n 
2  185  PHE n 
2  186  ILE n 
2  187  VAL n 
2  188  ASN n 
2  189  GLY n 
2  190  THR n 
2  191  GLU n 
2  192  LYS n 
2  193  VAL n 
2  194  ILE n 
2  195  LEU n 
2  196  VAL n 
2  197  GLN n 
2  198  GLU n 
2  199  GLN n 
2  200  LEU n 
2  201  SER n 
2  202  LYS n 
2  203  ASN n 
2  204  ARG n 
2  205  ILE n 
2  206  ILE n 
2  207  VAL n 
2  208  GLU n 
2  209  ALA n 
2  210  ASP n 
2  211  GLU n 
2  212  LYS n 
2  213  LYS n 
2  214  GLY n 
2  215  ILE n 
2  216  VAL n 
2  217  GLN n 
2  218  ALA n 
2  219  SER n 
2  220  VAL n 
2  221  THR n 
2  222  SER n 
2  223  SER n 
2  224  THR n 
2  225  HIS n 
2  226  GLU n 
2  227  ARG n 
2  228  LYS n 
2  229  SER n 
2  230  LYS n 
2  231  THR n 
2  232  TYR n 
2  233  VAL n 
2  234  ILE n 
2  235  THR n 
2  236  LYS n 
2  237  ASN n 
2  238  GLY n 
2  239  LYS n 
2  240  ILE n 
2  241  TYR n 
2  242  LEU n 
2  243  LYS n 
2  244  HIS n 
2  245  ASN n 
2  246  SER n 
2  247  ILE n 
2  248  ALA n 
2  249  GLU n 
2  250  GLU n 
2  251  ILE n 
2  252  PRO n 
2  253  ILE n 
2  254  ALA n 
2  255  ILE n 
2  256  VAL n 
2  257  LEU n 
2  258  LYS n 
2  259  ALA n 
2  260  CYS n 
2  261  GLY n 
2  262  ILE n 
2  263  LEU n 
2  264  SER n 
2  265  ASP n 
2  266  LEU n 
2  267  GLU n 
2  268  ILE n 
2  269  MET n 
2  270  GLN n 
2  271  LEU n 
2  272  VAL n 
2  273  CYS n 
2  274  GLY n 
2  275  ASN n 
2  276  ASP n 
2  277  SER n 
2  278  SER n 
2  279  TYR n 
2  280  GLN n 
2  281  ASP n 
2  282  ILE n 
2  283  PHE n 
2  284  ALA n 
2  285  VAL n 
2  286  ASN n 
2  287  LEU n 
2  288  GLU n 
2  289  GLU n 
2  290  SER n 
2  291  SER n 
2  292  LYS n 
2  293  LEU n 
2  294  ASP n 
2  295  ILE n 
2  296  TYR n 
2  297  THR n 
2  298  GLN n 
2  299  GLN n 
2  300  GLN n 
2  301  ALA n 
2  302  LEU n 
2  303  GLU n 
2  304  TYR n 
2  305  ILE n 
2  306  GLY n 
2  307  ALA n 
2  308  LYS n 
2  309  VAL n 
2  310  LYS n 
2  311  THR n 
2  312  MET n 
2  313  ARG n 
2  314  ARG n 
2  315  GLN n 
2  316  LYS n 
2  317  LEU n 
2  318  THR n 
2  319  ILE n 
2  320  LEU n 
2  321  GLN n 
2  322  GLU n 
2  323  GLY n 
2  324  ILE n 
2  325  GLU n 
2  326  ALA n 
2  327  ILE n 
2  328  ALA n 
2  329  THR n 
2  330  THR n 
2  331  VAL n 
2  332  ILE n 
2  333  ALA n 
2  334  HIS n 
2  335  LEU n 
2  336  THR n 
2  337  VAL n 
2  338  GLU n 
2  339  ALA n 
2  340  LEU n 
2  341  ASP n 
2  342  PHE n 
2  343  ARG n 
2  344  GLU n 
2  345  LYS n 
2  346  ALA n 
2  347  LEU n 
2  348  TYR n 
2  349  ILE n 
2  350  ALA n 
2  351  MET n 
2  352  MET n 
2  353  THR n 
2  354  ARG n 
2  355  ARG n 
2  356  VAL n 
2  357  VAL n 
2  358  MET n 
2  359  ALA n 
2  360  MET n 
2  361  TYR n 
2  362  ASN n 
2  363  PRO n 
2  364  LYS n 
2  365  MET n 
2  366  ILE n 
2  367  ASP n 
2  368  ASP n 
2  369  ARG n 
2  370  ASP n 
2  371  TYR n 
2  372  VAL n 
2  373  GLY n 
2  374  ASN n 
2  375  LYS n 
2  376  ARG n 
2  377  LEU n 
2  378  GLU n 
2  379  LEU n 
2  380  ALA n 
2  381  GLY n 
2  382  GLN n 
2  383  LEU n 
2  384  ILE n 
2  385  SER n 
2  386  LEU n 
2  387  LEU n 
2  388  PHE n 
2  389  GLU n 
2  390  ASP n 
2  391  LEU n 
2  392  PHE n 
2  393  LYS n 
2  394  LYS n 
2  395  PHE n 
2  396  ASN n 
2  397  ASN n 
2  398  ASP n 
2  399  PHE n 
2  400  LYS n 
2  401  LEU n 
2  402  SER n 
2  403  ILE n 
2  404  ASP n 
2  405  LYS n 
2  406  VAL n 
2  407  LEU n 
2  408  LYS n 
2  409  LYS n 
2  410  PRO n 
2  411  ASN n 
2  412  ARG n 
2  413  ALA n 
2  414  MET n 
2  415  GLU n 
2  416  TYR n 
2  417  ASP n 
2  418  ALA n 
2  419  LEU n 
2  420  LEU n 
2  421  SER n 
2  422  ILE n 
2  423  ASN n 
2  424  VAL n 
2  425  HIS n 
2  426  SER n 
2  427  ASN n 
2  428  ASN n 
2  429  ILE n 
2  430  THR n 
2  431  SER n 
2  432  GLY n 
2  433  LEU n 
2  434  ASN n 
2  435  ARG n 
2  436  ALA n 
2  437  ILE n 
2  438  SER n 
2  439  THR n 
2  440  GLY n 
2  441  ASN n 
2  442  TRP n 
2  443  SER n 
2  444  LEU n 
2  445  LYS n 
2  446  ARG n 
2  447  PHE n 
2  448  LYS n 
2  449  MET n 
2  450  GLU n 
2  451  ARG n 
2  452  ALA n 
2  453  GLY n 
2  454  VAL n 
2  455  THR n 
2  456  HIS n 
2  457  VAL n 
2  458  LEU n 
2  459  SER n 
2  460  ARG n 
2  461  LEU n 
2  462  SER n 
2  463  TYR n 
2  464  ILE n 
2  465  SER n 
2  466  ALA n 
2  467  LEU n 
2  468  GLY n 
2  469  MET n 
2  470  MET n 
2  471  THR n 
2  472  ARG n 
2  473  ILE n 
2  474  SER n 
2  475  SER n 
2  476  GLN n 
2  477  PHE n 
2  478  GLU n 
2  479  LYS n 
2  480  SER n 
2  481  ARG n 
2  482  LYS n 
2  483  VAL n 
2  484  SER n 
2  485  GLY n 
2  486  PRO n 
2  487  ARG n 
2  488  ALA n 
2  489  LEU n 
2  490  GLN n 
2  491  PRO n 
2  492  SER n 
2  493  GLN n 
2  494  PHE n 
2  495  GLY n 
2  496  MET n 
2  497  LEU n 
2  498  CYS n 
2  499  THR n 
2  500  ALA n 
2  501  ASP n 
2  502  THR n 
2  503  PRO n 
2  504  GLU n 
2  505  GLY n 
2  506  GLU n 
2  507  ALA n 
2  508  CYS n 
2  509  GLY n 
2  510  LEU n 
2  511  VAL n 
2  512  LYS n 
2  513  ASN n 
2  514  LEU n 
2  515  ALA n 
2  516  LEU n 
2  517  MET n 
2  518  THR n 
2  519  HIS n 
2  520  ILE n 
2  521  THR n 
2  522  THR n 
2  523  ASP n 
2  524  ASP n 
2  525  GLU n 
2  526  GLU n 
2  527  GLU n 
2  528  PRO n 
2  529  ILE n 
2  530  LYS n 
2  531  LYS n 
2  532  LEU n 
2  533  CYS n 
2  534  TYR n 
2  535  VAL n 
2  536  LEU n 
2  537  GLY n 
2  538  VAL n 
2  539  GLU n 
2  540  ASP n 
2  541  ILE n 
2  542  THR n 
2  543  LEU n 
2  544  ILE n 
2  545  ASP n 
2  546  SER n 
2  547  ALA n 
2  548  SER n 
2  549  LEU n 
2  550  HIS n 
2  551  LEU n 
2  552  ASN n 
2  553  TYR n 
2  554  GLY n 
2  555  VAL n 
2  556  TYR n 
2  557  LEU n 
2  558  ASN n 
2  559  GLY n 
2  560  THR n 
2  561  LEU n 
2  562  ILE n 
2  563  GLY n 
2  564  SER n 
2  565  ILE n 
2  566  ARG n 
2  567  PHE n 
2  568  PRO n 
2  569  THR n 
2  570  LYS n 
2  571  PHE n 
2  572  VAL n 
2  573  THR n 
2  574  GLN n 
2  575  PHE n 
2  576  ARG n 
2  577  HIS n 
2  578  LEU n 
2  579  ARG n 
2  580  ARG n 
2  581  THR n 
2  582  GLY n 
2  583  LYS n 
2  584  VAL n 
2  585  SER n 
2  586  GLU n 
2  587  PHE n 
2  588  ILE n 
2  589  SER n 
2  590  ILE n 
2  591  TYR n 
2  592  SER n 
2  593  ASN n 
2  594  SER n 
2  595  HIS n 
2  596  GLN n 
2  597  MET n 
2  598  ALA n 
2  599  VAL n 
2  600  HIS n 
2  601  ILE n 
2  602  ALA n 
2  603  THR n 
2  604  ASP n 
2  605  GLY n 
2  606  GLY n 
2  607  ARG n 
2  608  ILE n 
2  609  CYS n 
2  610  ARG n 
2  611  PRO n 
2  612  LEU n 
2  613  ILE n 
2  614  ILE n 
2  615  VAL n 
2  616  SER n 
2  617  ASP n 
2  618  GLY n 
2  619  GLN n 
2  620  SER n 
2  621  ARG n 
2  622  VAL n 
2  623  LYS n 
2  624  ASP n 
2  625  ILE n 
2  626  HIS n 
2  627  LEU n 
2  628  ARG n 
2  629  LYS n 
2  630  LEU n 
2  631  LEU n 
2  632  ASP n 
2  633  GLY n 
2  634  GLU n 
2  635  LEU n 
2  636  ASP n 
2  637  PHE n 
2  638  ASP n 
2  639  ASP n 
2  640  PHE n 
2  641  LEU n 
2  642  LYS n 
2  643  LEU n 
2  644  GLY n 
2  645  LEU n 
2  646  VAL n 
2  647  GLU n 
2  648  TYR n 
2  649  LEU n 
2  650  ASP n 
2  651  VAL n 
2  652  ASN n 
2  653  GLU n 
2  654  GLU n 
2  655  ASN n 
2  656  ASP n 
2  657  SER n 
2  658  TYR n 
2  659  ILE n 
2  660  ALA n 
2  661  LEU n 
2  662  TYR n 
2  663  GLU n 
2  664  LYS n 
2  665  ASP n 
2  666  ILE n 
2  667  VAL n 
2  668  PRO n 
2  669  SER n 
2  670  MET n 
2  671  THR n 
2  672  HIS n 
2  673  LEU n 
2  674  GLU n 
2  675  ILE n 
2  676  GLU n 
2  677  PRO n 
2  678  PHE n 
2  679  THR n 
2  680  ILE n 
2  681  LEU n 
2  682  GLY n 
2  683  ALA n 
2  684  VAL n 
2  685  ALA n 
2  686  GLY n 
2  687  LEU n 
2  688  ILE n 
2  689  PRO n 
2  690  TYR n 
2  691  PRO n 
2  692  HIS n 
2  693  HIS n 
2  694  ASN n 
2  695  GLN n 
2  696  SER n 
2  697  PRO n 
2  698  ARG n 
2  699  ASN n 
2  700  THR n 
2  701  TYR n 
2  702  GLN n 
2  703  CYS n 
2  704  ALA n 
2  705  MET n 
2  706  GLY n 
2  707  LYS n 
2  708  GLN n 
2  709  ALA n 
2  710  ILE n 
2  711  GLY n 
2  712  ALA n 
2  713  ILE n 
2  714  ALA n 
2  715  TYR n 
2  716  ASN n 
2  717  GLN n 
2  718  PHE n 
2  719  LYS n 
2  720  ARG n 
2  721  ILE n 
2  722  ASP n 
2  723  THR n 
2  724  LEU n 
2  725  LEU n 
2  726  TYR n 
2  727  LEU n 
2  728  MET n 
2  729  THR n 
2  730  TYR n 
2  731  PRO n 
2  732  GLN n 
2  733  GLN n 
2  734  PRO n 
2  735  MET n 
2  736  VAL n 
2  737  LYS n 
2  738  THR n 
2  739  LYS n 
2  740  THR n 
2  741  ILE n 
2  742  GLU n 
2  743  LEU n 
2  744  ILE n 
2  745  ASP n 
2  746  TYR n 
2  747  ASP n 
2  748  LYS n 
2  749  LEU n 
2  750  PRO n 
2  751  ALA n 
2  752  GLY n 
2  753  GLN n 
2  754  ASN n 
2  755  ALA n 
2  756  THR n 
2  757  VAL n 
2  758  ALA n 
2  759  VAL n 
2  760  MET n 
2  761  SER n 
2  762  TYR n 
2  763  SER n 
2  764  GLY n 
2  765  TYR n 
2  766  ASP n 
2  767  ILE n 
2  768  GLU n 
2  769  ASP n 
2  770  ALA n 
2  771  LEU n 
2  772  VAL n 
2  773  LEU n 
2  774  ASN n 
2  775  LYS n 
2  776  SER n 
2  777  SER n 
2  778  ILE n 
2  779  ASP n 
2  780  ARG n 
2  781  GLY n 
2  782  PHE n 
2  783  GLY n 
2  784  ARG n 
2  785  CYS n 
2  786  GLU n 
2  787  THR n 
2  788  ARG n 
2  789  ARG n 
2  790  LYS n 
2  791  THR n 
2  792  THR n 
2  793  THR n 
2  794  VAL n 
2  795  LEU n 
2  796  LYS n 
2  797  ARG n 
2  798  TYR n 
2  799  ALA n 
2  800  ASN n 
2  801  HIS n 
2  802  THR n 
2  803  GLN n 
2  804  ASP n 
2  805  ILE n 
2  806  ILE n 
2  807  GLY n 
2  808  GLY n 
2  809  MET n 
2  810  ARG n 
2  811  VAL n 
2  812  ASP n 
2  813  GLU n 
2  814  ASN n 
2  815  GLY n 
2  816  ASP n 
2  817  PRO n 
2  818  ILE n 
2  819  TRP n 
2  820  GLN n 
2  821  HIS n 
2  822  GLN n 
2  823  SER n 
2  824  LEU n 
2  825  GLY n 
2  826  PRO n 
2  827  ASP n 
2  828  GLY n 
2  829  LEU n 
2  830  GLY n 
2  831  GLU n 
2  832  VAL n 
2  833  GLY n 
2  834  MET n 
2  835  LYS n 
2  836  VAL n 
2  837  GLN n 
2  838  SER n 
2  839  GLY n 
2  840  GLN n 
2  841  ILE n 
2  842  TYR n 
2  843  ILE n 
2  844  ASN n 
2  845  LYS n 
2  846  SER n 
2  847  VAL n 
2  848  PRO n 
2  849  THR n 
2  850  ASN n 
2  851  SER n 
2  852  ALA n 
2  853  ASP n 
2  854  ALA n 
2  855  PRO n 
2  856  ASN n 
2  857  PRO n 
2  858  ASN n 
2  859  ASN n 
2  860  VAL n 
2  861  ASN n 
2  862  VAL n 
2  863  GLN n 
2  864  THR n 
2  865  GLN n 
2  866  TYR n 
2  867  ARG n 
2  868  GLU n 
2  869  ALA n 
2  870  PRO n 
2  871  VAL n 
2  872  ILE n 
2  873  TYR n 
2  874  ARG n 
2  875  GLY n 
2  876  PRO n 
2  877  GLU n 
2  878  PRO n 
2  879  SER n 
2  880  HIS n 
2  881  ILE n 
2  882  ASP n 
2  883  GLN n 
2  884  VAL n 
2  885  MET n 
2  886  MET n 
2  887  SER n 
2  888  VAL n 
2  889  SER n 
2  890  ASP n 
2  891  ASN n 
2  892  ASP n 
2  893  GLN n 
2  894  ALA n 
2  895  LEU n 
2  896  ILE n 
2  897  LYS n 
2  898  VAL n 
2  899  LEU n 
2  900  LEU n 
2  901  ARG n 
2  902  GLN n 
2  903  ASN n 
2  904  ARG n 
2  905  ARG n 
2  906  PRO n 
2  907  GLU n 
2  908  LEU n 
2  909  GLY n 
2  910  ASP n 
2  911  LYS n 
2  912  PHE n 
2  913  SER n 
2  914  SER n 
2  915  ARG n 
2  916  HIS n 
2  917  GLY n 
2  918  GLN n 
2  919  LYS n 
2  920  GLY n 
2  921  VAL n 
2  922  CYS n 
2  923  GLY n 
2  924  ILE n 
2  925  ILE n 
2  926  VAL n 
2  927  LYS n 
2  928  GLN n 
2  929  GLU n 
2  930  ASP n 
2  931  MET n 
2  932  PRO n 
2  933  PHE n 
2  934  ASN n 
2  935  ASP n 
2  936  GLN n 
2  937  GLY n 
2  938  ILE n 
2  939  VAL n 
2  940  PRO n 
2  941  ASP n 
2  942  ILE n 
2  943  ILE n 
2  944  MET n 
2  945  ASN n 
2  946  PRO n 
2  947  HIS n 
2  948  GLY n 
2  949  PHE n 
2  950  PRO n 
2  951  SER n 
2  952  ARG n 
2  953  MET n 
2  954  THR n 
2  955  VAL n 
2  956  GLY n 
2  957  LYS n 
2  958  MET n 
2  959  ILE n 
2  960  GLU n 
2  961  LEU n 
2  962  ILE n 
2  963  SER n 
2  964  GLY n 
2  965  LYS n 
2  966  ALA n 
2  967  GLY n 
2  968  VAL n 
2  969  LEU n 
2  970  ASN n 
2  971  GLY n 
2  972  THR n 
2  973  LEU n 
2  974  GLU n 
2  975  TYR n 
2  976  GLY n 
2  977  THR n 
2  978  CYS n 
2  979  PHE n 
2  980  GLY n 
2  981  GLY n 
2  982  SER n 
2  983  LYS n 
2  984  LEU n 
2  985  GLU n 
2  986  ASP n 
2  987  MET n 
2  988  SER n 
2  989  LYS n 
2  990  ILE n 
2  991  LEU n 
2  992  VAL n 
2  993  ASP n 
2  994  GLN n 
2  995  GLY n 
2  996  PHE n 
2  997  ASN n 
2  998  TYR n 
2  999  SER n 
2  1000 GLY n 
2  1001 LYS n 
2  1002 ASP n 
2  1003 MET n 
2  1004 LEU n 
2  1005 TYR n 
2  1006 SER n 
2  1007 GLY n 
2  1008 ILE n 
2  1009 THR n 
2  1010 GLY n 
2  1011 GLU n 
2  1012 CYS n 
2  1013 LEU n 
2  1014 GLN n 
2  1015 ALA n 
2  1016 TYR n 
2  1017 ILE n 
2  1018 PHE n 
2  1019 PHE n 
2  1020 GLY n 
2  1021 PRO n 
2  1022 ILE n 
2  1023 TYR n 
2  1024 TYR n 
2  1025 GLN n 
2  1026 LYS n 
2  1027 LEU n 
2  1028 LYS n 
2  1029 HIS n 
2  1030 MET n 
2  1031 VAL n 
2  1032 LEU n 
2  1033 ASP n 
2  1034 LYS n 
2  1035 MET n 
2  1036 HIS n 
2  1037 ALA n 
2  1038 ARG n 
2  1039 ALA n 
2  1040 ARG n 
2  1041 GLY n 
2  1042 PRO n 
2  1043 ARG n 
2  1044 ALA n 
2  1045 VAL n 
2  1046 LEU n 
2  1047 THR n 
2  1048 ARG n 
2  1049 GLN n 
2  1050 PRO n 
2  1051 THR n 
2  1052 GLU n 
2  1053 GLY n 
2  1054 ARG n 
2  1055 SER n 
2  1056 ARG n 
2  1057 ASP n 
2  1058 GLY n 
2  1059 GLY n 
2  1060 LEU n 
2  1061 ARG n 
2  1062 LEU n 
2  1063 GLY n 
2  1064 GLU n 
2  1065 MET n 
2  1066 GLU n 
2  1067 ARG n 
2  1068 ASP n 
2  1069 CYS n 
2  1070 VAL n 
2  1071 ILE n 
2  1072 ALA n 
2  1073 TYR n 
2  1074 GLY n 
2  1075 ALA n 
2  1076 SER n 
2  1077 GLN n 
2  1078 LEU n 
2  1079 LEU n 
2  1080 LEU n 
2  1081 GLU n 
2  1082 ARG n 
2  1083 LEU n 
2  1084 MET n 
2  1085 ILE n 
2  1086 SER n 
2  1087 SER n 
2  1088 ASP n 
2  1089 ALA n 
2  1090 PHE n 
2  1091 GLU n 
2  1092 VAL n 
2  1093 ASP n 
2  1094 VAL n 
2  1095 CYS n 
2  1096 ASP n 
2  1097 LYS n 
2  1098 CYS n 
2  1099 GLY n 
2  1100 LEU n 
2  1101 MET n 
2  1102 GLY n 
2  1103 TYR n 
2  1104 SER n 
2  1105 GLY n 
2  1106 TRP n 
2  1107 CYS n 
2  1108 THR n 
2  1109 THR n 
2  1110 CYS n 
2  1111 LYS n 
2  1112 SER n 
2  1113 ALA n 
2  1114 GLU n 
2  1115 ASN n 
2  1116 ILE n 
2  1117 ILE n 
2  1118 LYS n 
2  1119 MET n 
2  1120 THR n 
2  1121 ILE n 
2  1122 PRO n 
2  1123 TYR n 
2  1124 ALA n 
2  1125 ALA n 
2  1126 LYS n 
2  1127 LEU n 
2  1128 LEU n 
2  1129 PHE n 
2  1130 GLN n 
2  1131 GLU n 
2  1132 LEU n 
2  1133 LEU n 
2  1134 SER n 
2  1135 MET n 
2  1136 ASN n 
2  1137 ILE n 
2  1138 ALA n 
2  1139 PRO n 
2  1140 ARG n 
2  1141 LEU n 
2  1142 ARG n 
2  1143 LEU n 
2  1144 GLU n 
2  1145 ASP n 
2  1146 ILE n 
2  1147 PHE n 
2  1148 GLN n 
2  1149 GLN n 
3  1    MET n 
3  2    SER n 
3  3    ASN n 
3  4    ILE n 
3  5    VAL n 
3  6    GLY n 
3  7    ILE n 
3  8    GLU n 
3  9    TYR n 
3  10   ASN n 
3  11   ARG n 
3  12   VAL n 
3  13   THR n 
3  14   ASN n 
3  15   THR n 
3  16   THR n 
3  17   SER n 
3  18   THR n 
3  19   ASP n 
3  20   PHE n 
3  21   PRO n 
3  22   GLY n 
3  23   PHE n 
3  24   SER n 
3  25   LYS n 
3  26   ASP n 
3  27   ALA n 
3  28   GLU n 
3  29   ASN n 
3  30   GLU n 
3  31   TRP n 
3  32   ASN n 
3  33   VAL n 
3  34   GLU n 
3  35   LYS n 
3  36   PHE n 
3  37   LYS n 
3  38   LYS n 
3  39   ASP n 
3  40   PHE n 
3  41   GLU n 
3  42   VAL n 
3  43   ASN n 
3  44   ILE n 
3  45   SER n 
3  46   SER n 
3  47   LEU n 
3  48   ASP n 
3  49   ALA n 
3  50   ARG n 
3  51   GLU n 
3  52   ALA n 
3  53   ASN n 
3  54   PHE n 
3  55   ASP n 
3  56   LEU n 
3  57   ILE n 
3  58   ASN n 
3  59   ILE n 
3  60   ASP n 
3  61   THR n 
3  62   SER n 
3  63   ILE n 
3  64   ALA n 
3  65   ASN n 
3  66   ALA n 
3  67   PHE n 
3  68   ARG n 
3  69   ARG n 
3  70   ILE n 
3  71   MET n 
3  72   ILE n 
3  73   SER n 
3  74   GLU n 
3  75   VAL n 
3  76   PRO n 
3  77   SER n 
3  78   VAL n 
3  79   ALA n 
3  80   ALA n 
3  81   GLU n 
3  82   TYR n 
3  83   VAL n 
3  84   TYR n 
3  85   PHE n 
3  86   PHE n 
3  87   ASN n 
3  88   ASN n 
3  89   THR n 
3  90   SER n 
3  91   VAL n 
3  92   ILE n 
3  93   GLN n 
3  94   ASP n 
3  95   GLU n 
3  96   VAL n 
3  97   LEU n 
3  98   ALA n 
3  99   HIS n 
3  100  ARG n 
3  101  ILE n 
3  102  GLY n 
3  103  LEU n 
3  104  VAL n 
3  105  PRO n 
3  106  LEU n 
3  107  LYS n 
3  108  VAL n 
3  109  ASP n 
3  110  PRO n 
3  111  ASP n 
3  112  MET n 
3  113  LEU n 
3  114  THR n 
3  115  TRP n 
3  116  VAL n 
3  117  ASP n 
3  118  SER n 
3  119  ASN n 
3  120  LEU n 
3  121  PRO n 
3  122  ASP n 
3  123  ASP n 
3  124  GLU n 
3  125  LYS n 
3  126  PHE n 
3  127  THR n 
3  128  ASP n 
3  129  GLU n 
3  130  ASN n 
3  131  THR n 
3  132  ILE n 
3  133  VAL n 
3  134  LEU n 
3  135  SER n 
3  136  LEU n 
3  137  ASN n 
3  138  VAL n 
3  139  LYS n 
3  140  CYS n 
3  141  THR n 
3  142  ARG n 
3  143  ASN n 
3  144  PRO n 
3  145  ASP n 
3  146  ALA n 
3  147  PRO n 
3  148  LYS n 
3  149  GLY n 
3  150  SER n 
3  151  THR n 
3  152  ASP n 
3  153  PRO n 
3  154  LYS n 
3  155  GLU n 
3  156  LEU n 
3  157  TYR n 
3  158  ASN n 
3  159  ASN n 
3  160  ALA n 
3  161  HIS n 
3  162  VAL n 
3  163  TYR n 
3  164  ALA n 
3  165  ARG n 
3  166  ASP n 
3  167  LEU n 
3  168  LYS n 
3  169  PHE n 
3  170  GLU n 
3  171  PRO n 
3  172  GLN n 
3  173  GLY n 
3  174  ARG n 
3  175  GLN n 
3  176  SER n 
3  177  THR n 
3  178  THR n 
3  179  PHE n 
3  180  ALA n 
3  181  ASP n 
3  182  CYS n 
3  183  PRO n 
3  184  VAL n 
3  185  VAL n 
3  186  PRO n 
3  187  ALA n 
3  188  ASP n 
3  189  PRO n 
3  190  ASP n 
3  191  ILE n 
3  192  LEU n 
3  193  LEU n 
3  194  ALA n 
3  195  LYS n 
3  196  LEU n 
3  197  ARG n 
3  198  PRO n 
3  199  GLY n 
3  200  GLN n 
3  201  GLU n 
3  202  ILE n 
3  203  SER n 
3  204  LEU n 
3  205  LYS n 
3  206  ALA n 
3  207  HIS n 
3  208  CYS n 
3  209  ILE n 
3  210  LEU n 
3  211  GLY n 
3  212  ILE n 
3  213  GLY n 
3  214  GLY n 
3  215  ASP n 
3  216  HIS n 
3  217  ALA n 
3  218  LYS n 
3  219  PHE n 
3  220  SER n 
3  221  PRO n 
3  222  VAL n 
3  223  SER n 
3  224  THR n 
3  225  ALA n 
3  226  SER n 
3  227  TYR n 
3  228  ARG n 
3  229  LEU n 
3  230  LEU n 
3  231  PRO n 
3  232  GLN n 
3  233  ILE n 
3  234  ASN n 
3  235  ILE n 
3  236  LEU n 
3  237  GLN n 
3  238  PRO n 
3  239  ILE n 
3  240  LYS n 
3  241  GLY n 
3  242  GLU n 
3  243  SER n 
3  244  ALA n 
3  245  ARG n 
3  246  ARG n 
3  247  PHE n 
3  248  GLN n 
3  249  LYS n 
3  250  CYS n 
3  251  PHE n 
3  252  PRO n 
3  253  PRO n 
3  254  GLY n 
3  255  VAL n 
3  256  ILE n 
3  257  GLY n 
3  258  ILE n 
3  259  ASP n 
3  260  GLU n 
3  261  GLY n 
3  262  SER n 
3  263  ASP n 
3  264  GLU n 
3  265  ALA n 
3  266  TYR n 
3  267  VAL n 
3  268  LYS n 
3  269  ASP n 
3  270  ALA n 
3  271  ARG n 
3  272  LYS n 
3  273  ASP n 
3  274  THR n 
3  275  VAL n 
3  276  SER n 
3  277  ARG n 
3  278  GLU n 
3  279  VAL n 
3  280  LEU n 
3  281  ARG n 
3  282  TYR n 
3  283  GLU n 
3  284  GLU n 
3  285  PHE n 
3  286  ALA n 
3  287  ASP n 
3  288  LYS n 
3  289  VAL n 
3  290  LYS n 
3  291  LEU n 
3  292  GLY n 
3  293  ARG n 
3  294  VAL n 
3  295  ARG n 
3  296  ASN n 
3  297  HIS n 
3  298  PHE n 
3  299  ILE n 
3  300  PHE n 
3  301  ASN n 
3  302  VAL n 
3  303  GLU n 
3  304  SER n 
3  305  ALA n 
3  306  GLY n 
3  307  ALA n 
3  308  MET n 
3  309  THR n 
3  310  PRO n 
3  311  GLU n 
3  312  GLU n 
3  313  ILE n 
3  314  PHE n 
3  315  PHE n 
3  316  LYS n 
3  317  SER n 
3  318  VAL n 
3  319  ARG n 
3  320  ILE n 
3  321  LEU n 
3  322  LYS n 
3  323  ASN n 
3  324  LYS n 
3  325  ALA n 
3  326  GLU n 
3  327  TYR n 
3  328  LEU n 
3  329  LYS n 
3  330  ASN n 
3  331  CYS n 
3  332  PRO n 
3  333  ILE n 
3  334  THR n 
3  335  GLN n 
4  1    MET n 
4  2    LYS n 
4  3    VAL n 
4  4    LEU n 
4  5    GLU n 
4  6    GLU n 
4  7    ARG n 
4  8    ASN n 
4  9    ALA n 
4  10   PHE n 
4  11   LEU n 
4  12   SER n 
4  13   ASP n 
4  14   TYR n 
4  15   GLU n 
4  16   VAL n 
4  17   LEU n 
4  18   LYS n 
4  19   PHE n 
4  20   LEU n 
4  21   THR n 
4  22   ASP n 
4  23   LEU n 
4  24   GLU n 
4  25   LYS n 
4  26   LYS n 
4  27   HIS n 
4  28   LEU n 
4  29   TRP n 
4  30   ASP n 
4  31   GLN n 
4  32   LYS n 
4  33   SER n 
4  34   LEU n 
4  35   ALA n 
4  36   ALA n 
4  37   LEU n 
4  38   LYS n 
4  39   LYS n 
4  40   SER n 
4  41   ARG n 
4  42   SER n 
4  43   LYS n 
4  44   GLY n 
4  45   LYS n 
4  46   GLN n 
4  47   ASN n 
4  48   ARG n 
4  49   PRO n 
4  50   TYR n 
4  51   ASN n 
4  52   HIS n 
4  53   PRO n 
4  54   GLU n 
4  55   LEU n 
4  56   GLN n 
4  57   GLY n 
4  58   ILE n 
4  59   THR n 
4  60   ARG n 
4  61   ASN n 
4  62   VAL n 
4  63   VAL n 
4  64   ASN n 
4  65   TYR n 
4  66   LEU n 
4  67   SER n 
4  68   ILE n 
4  69   ASN n 
4  70   LYS n 
4  71   ASN n 
4  72   PHE n 
4  73   ILE n 
4  74   ASN n 
4  75   GLN n 
4  76   GLU n 
4  77   ASP n 
4  78   GLU n 
4  79   GLY n 
4  80   GLU n 
4  81   GLU n 
4  82   ARG n 
4  83   GLU n 
4  84   SER n 
4  85   SER n 
4  86   GLY n 
4  87   ALA n 
4  88   LYS n 
4  89   ASP n 
4  90   ALA n 
4  91   GLU n 
4  92   LYS n 
4  93   SER n 
4  94   GLY n 
4  95   ILE n 
4  96   SER n 
4  97   LYS n 
4  98   MET n 
4  99   SER n 
4  100  ASP n 
4  101  GLU n 
4  102  SER n 
4  103  PHE n 
4  104  ALA n 
4  105  GLU n 
4  106  LEU n 
4  107  MET n 
4  108  THR n 
4  109  LYS n 
4  110  LEU n 
4  111  ASN n 
4  112  SER n 
4  113  PHE n 
4  114  LYS n 
4  115  LEU n 
4  116  PHE n 
4  117  LYS n 
4  118  ALA n 
4  119  GLU n 
4  120  LYS n 
4  121  LEU n 
4  122  GLN n 
4  123  ILE n 
4  124  VAL n 
4  125  ASN n 
4  126  GLN n 
4  127  LEU n 
4  128  PRO n 
4  129  ALA n 
4  130  ASN n 
4  131  MET n 
4  132  VAL n 
4  133  HIS n 
4  134  LEU n 
4  135  TYR n 
4  136  SER n 
4  137  ILE n 
4  138  VAL n 
4  139  GLU n 
4  140  GLU n 
4  141  CYS n 
4  142  ASP n 
4  143  ALA n 
4  144  ARG n 
4  145  PHE n 
4  146  ASP n 
4  147  GLU n 
4  148  LYS n 
4  149  THR n 
4  150  ILE n 
4  151  GLU n 
4  152  GLU n 
4  153  MET n 
4  154  LEU n 
4  155  GLU n 
4  156  ILE n 
4  157  ILE n 
4  158  SER n 
4  159  GLY n 
4  160  TYR n 
4  161  ALA n 
5  1    MET n 
5  2    ASP n 
5  3    GLN n 
5  4    GLU n 
5  5    ASN n 
5  6    GLU n 
5  7    ARG n 
5  8    ASN n 
5  9    ILE n 
5  10   SER n 
5  11   ARG n 
5  12   LEU n 
5  13   TRP n 
5  14   ARG n 
5  15   ALA n 
5  16   PHE n 
5  17   ARG n 
5  18   THR n 
5  19   VAL n 
5  20   LYS n 
5  21   GLU n 
5  22   MET n 
5  23   VAL n 
5  24   LYS n 
5  25   ASP n 
5  26   ARG n 
5  27   GLY n 
5  28   TYR n 
5  29   PHE n 
5  30   ILE n 
5  31   THR n 
5  32   GLN n 
5  33   GLU n 
5  34   GLU n 
5  35   VAL n 
5  36   GLU n 
5  37   LEU n 
5  38   PRO n 
5  39   LEU n 
5  40   GLU n 
5  41   ASP n 
5  42   PHE n 
5  43   LYS n 
5  44   ALA n 
5  45   LYS n 
5  46   TYR n 
5  47   CYS n 
5  48   ASP n 
5  49   SER n 
5  50   MET n 
5  51   GLY n 
5  52   ARG n 
5  53   PRO n 
5  54   GLN n 
5  55   ARG n 
5  56   LYS n 
5  57   MET n 
5  58   MET n 
5  59   SER n 
5  60   PHE n 
5  61   GLN n 
5  62   ALA n 
5  63   ASN n 
5  64   PRO n 
5  65   THR n 
5  66   GLU n 
5  67   GLU n 
5  68   SER n 
5  69   ILE n 
5  70   SER n 
5  71   LYS n 
5  72   PHE n 
5  73   PRO n 
5  74   ASP n 
5  75   MET n 
5  76   GLY n 
5  77   SER n 
5  78   LEU n 
5  79   TRP n 
5  80   VAL n 
5  81   GLU n 
5  82   PHE n 
5  83   CYS n 
5  84   ASP n 
5  85   GLU n 
5  86   PRO n 
5  87   SER n 
5  88   VAL n 
5  89   GLY n 
5  90   VAL n 
5  91   LYS n 
5  92   THR n 
5  93   MET n 
5  94   LYS n 
5  95   THR n 
5  96   PHE n 
5  97   VAL n 
5  98   ILE n 
5  99   HIS n 
5  100  ILE n 
5  101  GLN n 
5  102  GLU n 
5  103  LYS n 
5  104  ASN n 
5  105  PHE n 
5  106  GLN n 
5  107  THR n 
5  108  GLY n 
5  109  ILE n 
5  110  PHE n 
5  111  VAL n 
5  112  TYR n 
5  113  GLN n 
5  114  ASN n 
5  115  ASN n 
5  116  ILE n 
5  117  THR n 
5  118  PRO n 
5  119  SER n 
5  120  ALA n 
5  121  MET n 
5  122  LYS n 
5  123  LEU n 
5  124  VAL n 
5  125  PRO n 
5  126  SER n 
5  127  ILE n 
5  128  PRO n 
5  129  PRO n 
5  130  ALA n 
5  131  THR n 
5  132  ILE n 
5  133  GLU n 
5  134  THR n 
5  135  PHE n 
5  136  ASN n 
5  137  GLU n 
5  138  ALA n 
5  139  ALA n 
5  140  LEU n 
5  141  VAL n 
5  142  VAL n 
5  143  ASN n 
5  144  ILE n 
5  145  THR n 
5  146  HIS n 
5  147  HIS n 
5  148  GLU n 
5  149  LEU n 
5  150  VAL n 
5  151  PRO n 
5  152  LYS n 
5  153  HIS n 
5  154  ILE n 
5  155  ARG n 
5  156  LEU n 
5  157  SER n 
5  158  SER n 
5  159  ASP n 
5  160  GLU n 
5  161  LYS n 
5  162  ARG n 
5  163  GLU n 
5  164  LEU n 
5  165  LEU n 
5  166  LYS n 
5  167  ARG n 
5  168  TYR n 
5  169  ARG n 
5  170  LEU n 
5  171  LYS n 
5  172  GLU n 
5  173  SER n 
5  174  GLN n 
5  175  LEU n 
5  176  PRO n 
5  177  ARG n 
5  178  ILE n 
5  179  GLN n 
5  180  ARG n 
5  181  ALA n 
5  182  ASP n 
5  183  PRO n 
5  184  VAL n 
5  185  ALA n 
5  186  LEU n 
5  187  TYR n 
5  188  LEU n 
5  189  GLY n 
5  190  LEU n 
5  191  LYS n 
5  192  ARG n 
5  193  GLY n 
5  194  GLU n 
5  195  VAL n 
5  196  VAL n 
5  197  LYS n 
5  198  ILE n 
5  199  ILE n 
5  200  ARG n 
5  201  LYS n 
5  202  SER n 
5  203  GLU n 
5  204  THR n 
5  205  SER n 
5  206  GLY n 
5  207  ARG n 
5  208  TYR n 
5  209  ALA n 
5  210  SER n 
5  211  TYR n 
5  212  ARG n 
5  213  ILE n 
5  214  CYS n 
5  215  MET n 
6  1    MET n 
6  2    SER n 
6  3    ASP n 
6  4    TYR n 
6  5    GLU n 
6  6    GLU n 
6  7    ALA n 
6  8    PHE n 
6  9    ASN n 
6  10   ASP n 
6  11   GLY n 
6  12   ASN n 
6  13   GLU n 
6  14   ASN n 
6  15   PHE n 
6  16   GLU n 
6  17   ASP n 
6  18   PHE n 
6  19   ASP n 
6  20   VAL n 
6  21   GLU n 
6  22   HIS n 
6  23   PHE n 
6  24   SER n 
6  25   ASP n 
6  26   GLU n 
6  27   GLU n 
6  28   THR n 
6  29   TYR n 
6  30   GLU n 
6  31   GLU n 
6  32   LYS n 
6  33   PRO n 
6  34   GLN n 
6  35   PHE n 
6  36   LYS n 
6  37   ASP n 
6  38   GLY n 
6  39   GLU n 
6  40   THR n 
6  41   THR n 
6  42   ASP n 
6  43   ALA n 
6  44   ASN n 
6  45   GLY n 
6  46   LYS n 
6  47   THR n 
6  48   ILE n 
6  49   VAL n 
6  50   THR n 
6  51   GLY n 
6  52   GLY n 
6  53   ASN n 
6  54   GLY n 
6  55   PRO n 
6  56   GLU n 
6  57   ASP n 
6  58   PHE n 
6  59   GLN n 
6  60   GLN n 
6  61   HIS n 
6  62   GLU n 
6  63   GLN n 
6  64   ILE n 
6  65   ARG n 
6  66   ARG n 
6  67   LYS n 
6  68   THR n 
6  69   LEU n 
6  70   LYS n 
6  71   GLU n 
6  72   LYS n 
6  73   ALA n 
6  74   ILE n 
6  75   PRO n 
6  76   LYS n 
6  77   ASP n 
6  78   GLN n 
6  79   ARG n 
6  80   ALA n 
6  81   THR n 
6  82   THR n 
6  83   PRO n 
6  84   TYR n 
6  85   MET n 
6  86   THR n 
6  87   LYS n 
6  88   TYR n 
6  89   GLU n 
6  90   ARG n 
6  91   ALA n 
6  92   ARG n 
6  93   ILE n 
6  94   LEU n 
6  95   GLY n 
6  96   THR n 
6  97   ARG n 
6  98   ALA n 
6  99   LEU n 
6  100  GLN n 
6  101  ILE n 
6  102  SER n 
6  103  MET n 
6  104  ASN n 
6  105  ALA n 
6  106  PRO n 
6  107  VAL n 
6  108  PHE n 
6  109  VAL n 
6  110  ASP n 
6  111  LEU n 
6  112  GLU n 
6  113  GLY n 
6  114  GLU n 
6  115  THR n 
6  116  ASP n 
6  117  PRO n 
6  118  LEU n 
6  119  ARG n 
6  120  ILE n 
6  121  ALA n 
6  122  MET n 
6  123  LYS n 
6  124  GLU n 
6  125  LEU n 
6  126  ALA n 
6  127  GLU n 
6  128  LYS n 
6  129  LYS n 
6  130  ILE n 
6  131  PRO n 
6  132  LEU n 
6  133  VAL n 
6  134  ILE n 
6  135  ARG n 
6  136  ARG n 
6  137  TYR n 
6  138  LEU n 
6  139  PRO n 
6  140  ASP n 
6  141  GLY n 
6  142  SER n 
6  143  PHE n 
6  144  GLU n 
6  145  ASP n 
6  146  TRP n 
6  147  SER n 
6  148  VAL n 
6  149  GLU n 
6  150  GLU n 
6  151  LEU n 
6  152  ILE n 
6  153  VAL n 
6  154  ASP n 
6  155  LEU n 
7  1    MET n 
7  2    PHE n 
7  3    ILE n 
7  4    LEU n 
7  5    SER n 
7  6    LYS n 
7  7    ILE n 
7  8    ALA n 
7  9    ASP n 
7  10   LEU n 
7  11   VAL n 
7  12   ARG n 
7  13   ILE n 
7  14   PRO n 
7  15   PRO n 
7  16   ASP n 
7  17   GLN n 
7  18   PHE n 
7  19   HIS n 
7  20   ARG n 
7  21   ASP n 
7  22   THR n 
7  23   ILE n 
7  24   SER n 
7  25   ALA n 
7  26   ILE n 
7  27   THR n 
7  28   HIS n 
7  29   GLN n 
7  30   LEU n 
7  31   ASN n 
7  32   ASN n 
7  33   LYS n 
7  34   PHE n 
7  35   ALA n 
7  36   ASN n 
7  37   LYS n 
7  38   ILE n 
7  39   ILE n 
7  40   PRO n 
7  41   ASN n 
7  42   VAL n 
7  43   GLY n 
7  44   LEU n 
7  45   CYS n 
7  46   ILE n 
7  47   THR n 
7  48   ILE n 
7  49   TYR n 
7  50   ASP n 
7  51   LEU n 
7  52   LEU n 
7  53   THR n 
7  54   VAL n 
7  55   GLU n 
7  56   GLU n 
7  57   GLY n 
7  58   GLN n 
7  59   LEU n 
7  60   LYS n 
7  61   PRO n 
7  62   GLY n 
7  63   ASP n 
7  64   GLY n 
7  65   SER n 
7  66   SER n 
7  67   TYR n 
7  68   ILE n 
7  69   ASN n 
7  70   VAL n 
7  71   THR n 
7  72   PHE n 
7  73   ARG n 
7  74   ALA n 
7  75   VAL n 
7  76   VAL n 
7  77   PHE n 
7  78   LYS n 
7  79   PRO n 
7  80   PHE n 
7  81   LEU n 
7  82   GLY n 
7  83   GLU n 
7  84   ILE n 
7  85   VAL n 
7  86   THR n 
7  87   GLY n 
7  88   TRP n 
7  89   ILE n 
7  90   SER n 
7  91   LYS n 
7  92   CYS n 
7  93   THR n 
7  94   ALA n 
7  95   GLU n 
7  96   GLY n 
7  97   ILE n 
7  98   LYS n 
7  99   VAL n 
7  100  SER n 
7  101  LEU n 
7  102  LEU n 
7  103  GLY n 
7  104  ILE n 
7  105  PHE n 
7  106  ASP n 
7  107  ASP n 
7  108  ILE n 
7  109  PHE n 
7  110  ILE n 
7  111  PRO n 
7  112  GLN n 
7  113  ASN n 
7  114  MET n 
7  115  LEU n 
7  116  PHE n 
7  117  GLU n 
7  118  GLY n 
7  119  CYS n 
7  120  TYR n 
7  121  TYR n 
7  122  THR n 
7  123  PRO n 
7  124  GLU n 
7  125  GLU n 
7  126  SER n 
7  127  ALA n 
7  128  TRP n 
7  129  ILE n 
7  130  TRP n 
7  131  PRO n 
7  132  MET n 
7  133  ASP n 
7  134  GLU n 
7  135  GLU n 
7  136  THR n 
7  137  LYS n 
7  138  LEU n 
7  139  TYR n 
7  140  PHE n 
7  141  ASP n 
7  142  VAL n 
7  143  ASN n 
7  144  GLU n 
7  145  LYS n 
7  146  ILE n 
7  147  ARG n 
7  148  PHE n 
7  149  ARG n 
7  150  ILE n 
7  151  GLU n 
7  152  ARG n 
7  153  GLU n 
7  154  VAL n 
7  155  PHE n 
7  156  VAL n 
7  157  ASP n 
7  158  VAL n 
7  159  LYS n 
7  160  PRO n 
7  161  LYS n 
7  162  SER n 
7  163  PRO n 
7  164  LYS n 
7  165  GLU n 
7  166  ARG n 
7  167  GLU n 
7  168  LEU n 
7  169  GLU n 
7  170  GLU n 
7  171  ARG n 
7  172  ALA n 
7  173  GLN n 
7  174  LEU n 
7  175  GLU n 
7  176  ASN n 
7  177  GLU n 
7  178  ILE n 
7  179  GLU n 
7  180  GLY n 
7  181  LYS n 
7  182  ASN n 
7  183  GLU n 
7  184  GLU n 
7  185  THR n 
7  186  PRO n 
7  187  GLN n 
7  188  ASN n 
7  189  GLU n 
7  190  LYS n 
7  191  PRO n 
7  192  PRO n 
7  193  ALA n 
7  194  TYR n 
7  195  ALA n 
7  196  LEU n 
7  197  LEU n 
7  198  GLY n 
7  199  SER n 
7  200  CYS n 
7  201  GLN n 
7  202  THR n 
7  203  ASP n 
7  204  GLY n 
7  205  MET n 
7  206  GLY n 
7  207  LEU n 
7  208  VAL n 
7  209  SER n 
7  210  TRP n 
7  211  TRP n 
7  212  GLU n 
8  1    MET n 
8  2    SER n 
8  3    ASN n 
8  4    THR n 
8  5    LEU n 
8  6    PHE n 
8  7    ASP n 
8  8    ASP n 
8  9    ILE n 
8  10   PHE n 
8  11   GLN n 
8  12   VAL n 
8  13   SER n 
8  14   GLU n 
8  15   VAL n 
8  16   ASP n 
8  17   PRO n 
8  18   GLY n 
8  19   ARG n 
8  20   TYR n 
8  21   ASN n 
8  22   LYS n 
8  23   VAL n 
8  24   CYS n 
8  25   ARG n 
8  26   ILE n 
8  27   GLU n 
8  28   ALA n 
8  29   ALA n 
8  30   SER n 
8  31   THR n 
8  32   THR n 
8  33   GLN n 
8  34   ASP n 
8  35   GLN n 
8  36   CYS n 
8  37   LYS n 
8  38   LEU n 
8  39   THR n 
8  40   LEU n 
8  41   ASP n 
8  42   ILE n 
8  43   ASN n 
8  44   VAL n 
8  45   GLU n 
8  46   LEU n 
8  47   PHE n 
8  48   PRO n 
8  49   VAL n 
8  50   ALA n 
8  51   ALA n 
8  52   GLN n 
8  53   ASP n 
8  54   SER n 
8  55   LEU n 
8  56   THR n 
8  57   VAL n 
8  58   THR n 
8  59   ILE n 
8  60   ALA n 
8  61   SER n 
8  62   SER n 
8  63   LEU n 
8  64   ASN n 
8  65   LEU n 
8  66   GLU n 
8  67   ASP n 
8  68   THR n 
8  69   PRO n 
8  70   ALA n 
8  71   ASN n 
8  72   ASP n 
8  73   SER n 
8  74   SER n 
8  75   ALA n 
8  76   THR n 
8  77   ARG n 
8  78   SER n 
8  79   TRP n 
8  80   ARG n 
8  81   PRO n 
8  82   PRO n 
8  83   GLN n 
8  84   ALA n 
8  85   GLY n 
8  86   ASP n 
8  87   ARG n 
8  88   SER n 
8  89   LEU n 
8  90   ALA n 
8  91   ASP n 
8  92   ASP n 
8  93   TYR n 
8  94   ASP n 
8  95   TYR n 
8  96   VAL n 
8  97   MET n 
8  98   TYR n 
8  99   GLY n 
8  100  THR n 
8  101  ALA n 
8  102  TYR n 
8  103  LYS n 
8  104  PHE n 
8  105  GLU n 
8  106  GLU n 
8  107  VAL n 
8  108  SER n 
8  109  LYS n 
8  110  ASP n 
8  111  LEU n 
8  112  ILE n 
8  113  ALA n 
8  114  VAL n 
8  115  TYR n 
8  116  TYR n 
8  117  SER n 
8  118  PHE n 
8  119  GLY n 
8  120  GLY n 
8  121  LEU n 
8  122  LEU n 
8  123  MET n 
8  124  ARG n 
8  125  LEU n 
8  126  GLU n 
8  127  GLY n 
8  128  ASN n 
8  129  TYR n 
8  130  ARG n 
8  131  ASN n 
8  132  LEU n 
8  133  ASN n 
8  134  ASN n 
8  135  LEU n 
8  136  LYS n 
8  137  GLN n 
8  138  GLU n 
8  139  ASN n 
8  140  ALA n 
8  141  TYR n 
8  142  LEU n 
8  143  LEU n 
8  144  ILE n 
8  145  ARG n 
8  146  ARG n 
9  1    MET n 
9  2    LEU n 
9  3    SER n 
9  4    PHE n 
9  5    CYS n 
9  6    PRO n 
9  7    SER n 
9  8    CYS n 
9  9    ASN n 
9  10   ASN n 
9  11   MET n 
9  12   LEU n 
9  13   LEU n 
9  14   ILE n 
9  15   THR n 
9  16   SER n 
9  17   GLY n 
9  18   ASP n 
9  19   SER n 
9  20   GLY n 
9  21   VAL n 
9  22   TYR n 
9  23   THR n 
9  24   LEU n 
9  25   ALA n 
9  26   CYS n 
9  27   ARG n 
9  28   SER n 
9  29   CYS n 
9  30   PRO n 
9  31   TYR n 
9  32   GLU n 
9  33   PHE n 
9  34   PRO n 
9  35   ILE n 
9  36   GLU n 
9  37   GLY n 
9  38   ILE n 
9  39   GLU n 
9  40   ILE n 
9  41   TYR n 
9  42   ASP n 
9  43   ARG n 
9  44   LYS n 
9  45   LYS n 
9  46   LEU n 
9  47   PRO n 
9  48   ARG n 
9  49   LYS n 
9  50   GLU n 
9  51   VAL n 
9  52   ASP n 
9  53   ASP n 
9  54   VAL n 
9  55   LEU n 
9  56   GLY n 
9  57   GLY n 
9  58   GLY n 
9  59   TRP n 
9  60   ASP n 
9  61   ASN n 
9  62   VAL n 
9  63   ASP n 
9  64   GLN n 
9  65   THR n 
9  66   LYS n 
9  67   THR n 
9  68   GLN n 
9  69   CYS n 
9  70   PRO n 
9  71   ASN n 
9  72   TYR n 
9  73   ASP n 
9  74   THR n 
9  75   CYS n 
9  76   GLY n 
9  77   GLY n 
9  78   GLU n 
9  79   SER n 
9  80   ALA n 
9  81   TYR n 
9  82   PHE n 
9  83   PHE n 
9  84   GLN n 
9  85   LEU n 
9  86   GLN n 
9  87   ILE n 
9  88   ARG n 
9  89   SER n 
9  90   ALA n 
9  91   ASP n 
9  92   GLU n 
9  93   PRO n 
9  94   MET n 
9  95   THR n 
9  96   THR n 
9  97   PHE n 
9  98   TYR n 
9  99   LYS n 
9  100  CYS n 
9  101  VAL n 
9  102  ASN n 
9  103  CYS n 
9  104  GLY n 
9  105  HIS n 
9  106  ARG n 
9  107  TRP n 
9  108  LYS n 
9  109  GLU n 
9  110  ASN n 
10 1    MET n 
10 2    ILE n 
10 3    VAL n 
10 4    PRO n 
10 5    VAL n 
10 6    ARG n 
10 7    CYS n 
10 8    PHE n 
10 9    SER n 
10 10   CYS n 
10 11   GLY n 
10 12   LYS n 
10 13   VAL n 
10 14   VAL n 
10 15   GLY n 
10 16   ASP n 
10 17   LYS n 
10 18   TRP n 
10 19   GLU n 
10 20   SER n 
10 21   TYR n 
10 22   LEU n 
10 23   ASN n 
10 24   LEU n 
10 25   LEU n 
10 26   GLN n 
10 27   GLU n 
10 28   ASP n 
10 29   GLU n 
10 30   LEU n 
10 31   ASP n 
10 32   GLU n 
10 33   GLY n 
10 34   THR n 
10 35   ALA n 
10 36   LEU n 
10 37   SER n 
10 38   ARG n 
10 39   LEU n 
10 40   GLY n 
10 41   LEU n 
10 42   LYS n 
10 43   ARG n 
10 44   TYR n 
10 45   CYS n 
10 46   CYS n 
10 47   ARG n 
10 48   ARG n 
10 49   MET n 
10 50   ILE n 
10 51   LEU n 
10 52   THR n 
10 53   HIS n 
10 54   VAL n 
10 55   ASP n 
10 56   LEU n 
10 57   ILE n 
10 58   GLU n 
10 59   LYS n 
10 60   PHE n 
10 61   LEU n 
10 62   ARG n 
10 63   TYR n 
10 64   ASN n 
10 65   PRO n 
10 66   LEU n 
10 67   GLU n 
10 68   LYS n 
10 69   ARG n 
10 70   ASP n 
11 1    MET n 
11 2    THR n 
11 3    GLU n 
11 4    ASP n 
11 5    ILE n 
11 6    GLU n 
11 7    GLN n 
11 8    LYS n 
11 9    LYS n 
11 10   THR n 
11 11   ALA n 
11 12   THR n 
11 13   GLU n 
11 14   VAL n 
11 15   THR n 
11 16   PRO n 
11 17   GLN n 
11 18   GLU n 
11 19   PRO n 
11 20   LYS n 
11 21   HIS n 
11 22   ILE n 
11 23   GLN n 
11 24   GLU n 
11 25   GLU n 
11 26   GLU n 
11 27   GLU n 
11 28   GLN n 
11 29   ASP n 
11 30   VAL n 
11 31   ASP n 
11 32   MET n 
11 33   THR n 
11 34   GLY n 
11 35   ASP n 
11 36   GLU n 
11 37   GLU n 
11 38   GLN n 
11 39   GLU n 
11 40   GLU n 
11 41   GLU n 
11 42   PRO n 
11 43   ASP n 
11 44   ARG n 
11 45   GLU n 
11 46   LYS n 
11 47   ILE n 
11 48   LYS n 
11 49   LEU n 
11 50   LEU n 
11 51   THR n 
11 52   GLN n 
11 53   ALA n 
11 54   THR n 
11 55   SER n 
11 56   GLU n 
11 57   ASP n 
11 58   GLY n 
11 59   THR n 
11 60   SER n 
11 61   ALA n 
11 62   SER n 
11 63   PHE n 
11 64   GLN n 
11 65   ILE n 
11 66   VAL n 
11 67   GLU n 
11 68   GLU n 
11 69   ASP n 
11 70   HIS n 
11 71   THR n 
11 72   LEU n 
11 73   GLY n 
11 74   ASN n 
11 75   ALA n 
11 76   LEU n 
11 77   ARG n 
11 78   TYR n 
11 79   VAL n 
11 80   ILE n 
11 81   MET n 
11 82   LYS n 
11 83   ASN n 
11 84   PRO n 
11 85   ASP n 
11 86   VAL n 
11 87   GLU n 
11 88   PHE n 
11 89   CYS n 
11 90   GLY n 
11 91   TYR n 
11 92   SER n 
11 93   ILE n 
11 94   PRO n 
11 95   HIS n 
11 96   PRO n 
11 97   SER n 
11 98   GLU n 
11 99   ASN n 
11 100  LEU n 
11 101  LEU n 
11 102  ASN n 
11 103  ILE n 
11 104  ARG n 
11 105  ILE n 
11 106  GLN n 
11 107  THR n 
11 108  TYR n 
11 109  GLY n 
11 110  GLU n 
11 111  THR n 
11 112  THR n 
11 113  ALA n 
11 114  VAL n 
11 115  ASP n 
11 116  ALA n 
11 117  LEU n 
11 118  GLN n 
11 119  LYS n 
11 120  GLY n 
11 121  LEU n 
11 122  LYS n 
11 123  ASP n 
11 124  LEU n 
11 125  MET n 
11 126  ASP n 
11 127  LEU n 
11 128  CYS n 
11 129  ASP n 
11 130  VAL n 
11 131  VAL n 
11 132  GLU n 
11 133  SER n 
11 134  LYS n 
11 135  PHE n 
11 136  THR n 
11 137  GLU n 
11 138  LYS n 
11 139  ILE n 
11 140  LYS n 
11 141  SER n 
11 142  MET n 
12 1    MET n 
12 2    SER n 
12 3    ARG n 
12 4    GLU n 
12 5    GLY n 
12 6    PHE n 
12 7    GLN n 
12 8    ILE n 
12 9    PRO n 
12 10   THR n 
12 11   ASN n 
12 12   LEU n 
12 13   ASP n 
12 14   ALA n 
12 15   ALA n 
12 16   ALA n 
12 17   ALA n 
12 18   GLY n 
12 19   THR n 
12 20   SER n 
12 21   GLN n 
12 22   ALA n 
12 23   ARG n 
12 24   THR n 
12 25   ALA n 
12 26   THR n 
12 27   LEU n 
12 28   LYS n 
12 29   TYR n 
12 30   ILE n 
12 31   CYS n 
12 32   ALA n 
12 33   GLU n 
12 34   CYS n 
12 35   SER n 
12 36   SER n 
12 37   LYS n 
12 38   LEU n 
12 39   SER n 
12 40   LEU n 
12 41   SER n 
12 42   ARG n 
12 43   THR n 
12 44   ASP n 
12 45   ALA n 
12 46   VAL n 
12 47   ARG n 
12 48   CYS n 
12 49   LYS n 
12 50   ASP n 
12 51   CYS n 
12 52   GLY n 
12 53   HIS n 
12 54   ARG n 
12 55   ILE n 
12 56   LEU n 
12 57   LEU n 
12 58   LYS n 
12 59   ALA n 
12 60   ARG n 
12 61   THR n 
12 62   LYS n 
12 63   ARG n 
12 64   LEU n 
12 65   VAL n 
12 66   GLN n 
12 67   PHE n 
12 68   GLU n 
12 69   ALA n 
12 70   ARG n 
13 1    MET n 
13 2    SER n 
13 3    ILE n 
13 4    ASP n 
13 5    ASN n 
13 6    LYS n 
13 7    LEU n 
13 8    PHE n 
13 9    VAL n 
13 10   THR n 
13 11   GLU n 
13 12   GLU n 
13 13   ASP n 
13 14   GLU n 
13 15   GLU n 
13 16   ASP n 
13 17   ARG n 
13 18   THR n 
13 19   GLN n 
13 20   ASP n 
13 21   ARG n 
13 22   ALA n 
13 23   ASP n 
13 24   VAL n 
13 25   GLU n 
13 26   ASP n 
13 27   GLU n 
13 28   SER n 
13 29   ASN n 
13 30   ASP n 
13 31   ILE n 
13 32   ASP n 
13 33   MET n 
13 34   ILE n 
13 35   ALA n 
13 36   ASP n 
13 37   GLU n 
13 38   ASN n 
13 39   GLY n 
13 40   THR n 
13 41   ASN n 
13 42   SER n 
13 43   ALA n 
13 44   ILE n 
13 45   ALA n 
13 46   ASN n 
13 47   GLU n 
13 48   GLN n 
13 49   GLU n 
13 50   GLU n 
13 51   LYS n 
13 52   SER n 
13 53   GLU n 
13 54   GLU n 
13 55   VAL n 
13 56   LYS n 
13 57   ALA n 
13 58   GLU n 
13 59   ASP n 
13 60   ASP n 
13 61   THR n 
13 62   GLY n 
13 63   GLU n 
13 64   GLU n 
13 65   GLU n 
13 66   GLU n 
13 67   ASP n 
13 68   ASP n 
13 69   PRO n 
13 70   VAL n 
13 71   ILE n 
13 72   GLU n 
13 73   GLU n 
13 74   PHE n 
13 75   PRO n 
13 76   LEU n 
13 77   LYS n 
13 78   ILE n 
13 79   SER n 
13 80   GLY n 
13 81   GLU n 
13 82   GLU n 
13 83   GLU n 
13 84   SER n 
13 85   LEU n 
13 86   HIS n 
13 87   VAL n 
13 88   PHE n 
13 89   GLN n 
13 90   TYR n 
13 91   ALA n 
13 92   ASN n 
13 93   ARG n 
13 94   PRO n 
13 95   ARG n 
13 96   LEU n 
13 97   VAL n 
13 98   GLY n 
13 99   ARG n 
13 100  LYS n 
13 101  PRO n 
13 102  ALA n 
13 103  GLU n 
13 104  HIS n 
13 105  PRO n 
13 106  PHE n 
13 107  ILE n 
13 108  SER n 
13 109  ALA n 
13 110  ALA n 
13 111  ARG n 
13 112  TYR n 
13 113  LYS n 
13 114  PRO n 
13 115  LYS n 
13 116  SER n 
13 117  HIS n 
13 118  LEU n 
13 119  TRP n 
13 120  GLU n 
13 121  ILE n 
13 122  ASP n 
13 123  ILE n 
13 124  PRO n 
13 125  LEU n 
13 126  ASP n 
13 127  GLU n 
13 128  GLN n 
13 129  ALA n 
13 130  PHE n 
13 131  TYR n 
13 132  ASN n 
13 133  LYS n 
13 134  ASP n 
13 135  LYS n 
13 136  ALA n 
13 137  GLU n 
13 138  SER n 
13 139  GLU n 
13 140  TRP n 
13 141  ASN n 
13 142  GLY n 
13 143  VAL n 
13 144  ASN n 
13 145  VAL n 
13 146  GLN n 
13 147  THR n 
13 148  LEU n 
13 149  LYS n 
13 150  GLY n 
13 151  VAL n 
13 152  GLY n 
13 153  VAL n 
13 154  GLU n 
13 155  ASN n 
13 156  ASN n 
13 157  GLY n 
13 158  GLN n 
13 159  TYR n 
13 160  ALA n 
13 161  ALA n 
13 162  PHE n 
13 163  VAL n 
13 164  LYS n 
13 165  ASP n 
13 166  MET n 
13 167  GLN n 
13 168  VAL n 
13 169  TYR n 
13 170  LEU n 
13 171  VAL n 
13 172  PRO n 
13 173  ILE n 
13 174  GLU n 
13 175  ARG n 
13 176  VAL n 
13 177  ALA n 
13 178  GLN n 
13 179  LEU n 
13 180  LYS n 
13 181  PRO n 
13 182  PHE n 
13 183  PHE n 
13 184  LYS n 
13 185  TYR n 
13 186  ILE n 
13 187  ASP n 
13 188  ASP n 
13 189  ALA n 
13 190  ASN n 
13 191  VAL n 
13 192  THR n 
13 193  ARG n 
13 194  LYS n 
13 195  GLN n 
13 196  GLU n 
13 197  ASP n 
13 198  ALA n 
13 199  ARG n 
13 200  ARG n 
13 201  ASN n 
13 202  PRO n 
13 203  ASN n 
13 204  PRO n 
13 205  SER n 
13 206  SER n 
13 207  GLN n 
13 208  ARG n 
13 209  ALA n 
13 210  GLN n 
13 211  VAL n 
13 212  VAL n 
13 213  THR n 
13 214  MET n 
13 215  SER n 
13 216  VAL n 
13 217  LYS n 
13 218  SER n 
13 219  VAL n 
13 220  ASN n 
13 221  ASP n 
13 222  PRO n 
13 223  SER n 
13 224  GLN n 
13 225  ASN n 
13 226  ARG n 
13 227  LEU n 
13 228  THR n 
13 229  GLY n 
13 230  SER n 
13 231  LEU n 
13 232  LEU n 
13 233  ALA n 
13 234  HIS n 
13 235  LYS n 
13 236  VAL n 
13 237  ALA n 
13 238  ASP n 
13 239  GLU n 
13 240  GLU n 
13 241  ALA n 
13 242  ASN n 
13 243  ILE n 
13 244  GLU n 
13 245  LEU n 
13 246  THR n 
13 247  TRP n 
13 248  ALA n 
13 249  GLU n 
13 250  GLY n 
13 251  THR n 
13 252  PHE n 
13 253  GLU n 
13 254  GLN n 
13 255  PHE n 
13 256  LYS n 
13 257  ASP n 
13 258  THR n 
13 259  ILE n 
13 260  VAL n 
13 261  LYS n 
13 262  GLU n 
13 263  ALA n 
13 264  GLU n 
13 265  ASP n 
13 266  LYS n 
13 267  THR n 
13 268  LEU n 
13 269  VAL n 
13 270  ALA n 
13 271  LEU n 
13 272  GLU n 
13 273  LYS n 
13 274  GLN n 
13 275  GLU n 
13 276  ASP n 
13 277  TYR n 
13 278  ILE n 
13 279  ASP n 
13 280  ASN n 
13 281  LEU n 
13 282  VAL n 
14 1    MET n 
14 2    SER n 
14 3    SER n 
14 4    ASN n 
14 5    LYS n 
14 6    GLY n 
14 7    ASN n 
14 8    GLY n 
14 9    ARG n 
14 10   LEU n 
14 11   PRO n 
14 12   SER n 
14 13   LEU n 
14 14   LYS n 
14 15   ASP n 
14 16   SER n 
14 17   SER n 
14 18   SER n 
14 19   ASN n 
14 20   GLY n 
14 21   GLY n 
14 22   GLY n 
14 23   SER n 
14 24   ALA n 
14 25   LYS n 
14 26   PRO n 
14 27   SER n 
14 28   LEU n 
14 29   LYS n 
14 30   PHE n 
14 31   LYS n 
14 32   PRO n 
14 33   LYS n 
14 34   ALA n 
14 35   VAL n 
14 36   ALA n 
14 37   ARG n 
14 38   LYS n 
14 39   SER n 
14 40   LYS n 
14 41   GLU n 
14 42   GLU n 
14 43   ARG n 
14 44   GLU n 
14 45   ALA n 
14 46   ALA n 
14 47   ALA n 
14 48   SER n 
14 49   LYS n 
14 50   VAL n 
14 51   LYS n 
14 52   LEU n 
14 53   GLU n 
14 54   GLU n 
14 55   GLU n 
14 56   SER n 
14 57   LYS n 
14 58   ARG n 
14 59   GLY n 
14 60   ASN n 
14 61   ASP n 
14 62   LYS n 
14 63   LYS n 
14 64   HIS n 
14 65   PHE n 
14 66   ASN n 
14 67   ASN n 
14 68   LYS n 
14 69   ASN n 
14 70   LYS n 
14 71   ARG n 
14 72   VAL n 
14 73   THR n 
14 74   GLY n 
14 75   ALA n 
14 76   GLY n 
14 77   GLY n 
14 78   GLN n 
14 79   GLN n 
14 80   ARG n 
14 81   ARG n 
14 82   MET n 
14 83   ALA n 
14 84   LYS n 
14 85   TYR n 
14 86   LEU n 
14 87   ASN n 
14 88   ASN n 
14 89   THR n 
14 90   HIS n 
14 91   VAL n 
14 92   ILE n 
14 93   SER n 
14 94   SER n 
14 95   GLY n 
14 96   PRO n 
14 97   LEU n 
14 98   ALA n 
14 99   ALA n 
14 100  GLY n 
14 101  ASN n 
14 102  PHE n 
14 103  VAL n 
14 104  SER n 
14 105  GLU n 
14 106  LYS n 
14 107  GLY n 
14 108  ASP n 
14 109  LEU n 
14 110  ARG n 
14 111  ARG n 
14 112  GLY n 
14 113  PHE n 
14 114  ILE n 
14 115  LYS n 
14 116  SER n 
14 117  GLU n 
14 118  GLY n 
14 119  SER n 
14 120  GLY n 
14 121  SER n 
14 122  SER n 
14 123  LEU n 
14 124  VAL n 
14 125  GLN n 
14 126  LYS n 
14 127  GLY n 
14 128  LEU n 
14 129  GLU n 
14 130  THR n 
14 131  ILE n 
14 132  ASP n 
14 133  ASN n 
14 134  GLY n 
14 135  ALA n 
14 136  GLU n 
14 137  SER n 
14 138  SER n 
14 139  GLU n 
14 140  ASN n 
14 141  GLU n 
14 142  ALA n 
14 143  GLU n 
14 144  ASP n 
14 145  ASP n 
14 146  ASP n 
14 147  ASN n 
14 148  GLU n 
14 149  GLY n 
14 150  VAL n 
14 151  ALA n 
14 152  SER n 
14 153  LYS n 
14 154  SER n 
14 155  LYS n 
14 156  LYS n 
14 157  LYS n 
14 158  PHE n 
14 159  ASN n 
14 160  MET n 
14 161  GLY n 
14 162  LYS n 
14 163  GLU n 
14 164  PHE n 
14 165  GLU n 
14 166  ALA n 
14 167  ARG n 
14 168  ASN n 
14 169  LEU n 
14 170  ILE n 
14 171  GLU n 
14 172  ASP n 
14 173  GLU n 
14 174  ASP n 
14 175  ASP n 
14 176  GLY n 
14 177  GLU n 
14 178  SER n 
14 179  GLU n 
14 180  LYS n 
14 181  SER n 
14 182  SER n 
14 183  ASP n 
14 184  VAL n 
14 185  ASP n 
14 186  MET n 
14 187  ASP n 
14 188  ASP n 
14 189  GLU n 
14 190  GLU n 
14 191  TRP n 
14 192  ARG n 
14 193  SER n 
14 194  LYS n 
14 195  ARG n 
14 196  ILE n 
14 197  GLU n 
14 198  GLN n 
14 199  LEU n 
14 200  PHE n 
14 201  PRO n 
14 202  VAL n 
14 203  ARG n 
14 204  PRO n 
14 205  VAL n 
14 206  ARG n 
14 207  VAL n 
14 208  ARG n 
14 209  HIS n 
14 210  GLU n 
14 211  ASP n 
14 212  VAL n 
14 213  GLU n 
14 214  THR n 
14 215  VAL n 
14 216  LYS n 
14 217  ARG n 
14 218  GLU n 
14 219  ILE n 
14 220  GLN n 
14 221  GLU n 
14 222  ALA n 
14 223  LEU n 
14 224  SER n 
14 225  GLU n 
14 226  LYS n 
14 227  PRO n 
14 228  THR n 
14 229  ARG n 
14 230  GLU n 
14 231  PRO n 
14 232  THR n 
14 233  PRO n 
14 234  SER n 
14 235  VAL n 
14 236  LYS n 
14 237  THR n 
14 238  GLU n 
14 239  PRO n 
14 240  VAL n 
14 241  GLY n 
14 242  THR n 
14 243  GLY n 
14 244  LEU n 
14 245  GLN n 
14 246  SER n 
14 247  TYR n 
14 248  LEU n 
14 249  GLU n 
14 250  GLU n 
14 251  ARG n 
14 252  GLU n 
14 253  ARG n 
14 254  GLN n 
14 255  VAL n 
14 256  ASN n 
14 257  GLU n 
14 258  LYS n 
14 259  LEU n 
14 260  ALA n 
14 261  ASP n 
14 262  LEU n 
14 263  GLY n 
14 264  LEU n 
14 265  GLU n 
14 266  LYS n 
14 267  GLU n 
14 268  PHE n 
14 269  GLN n 
14 270  SER n 
14 271  VAL n 
14 272  ASP n 
14 273  GLY n 
14 274  LYS n 
14 275  GLU n 
14 276  ALA n 
14 277  ALA n 
14 278  ALA n 
14 279  GLU n 
14 280  LEU n 
14 281  GLU n 
14 282  LEU n 
14 283  LEU n 
14 284  ASN n 
14 285  ALA n 
14 286  ASP n 
14 287  HIS n 
14 288  GLN n 
14 289  HIS n 
14 290  ILE n 
14 291  LEU n 
14 292  ARG n 
14 293  LYS n 
14 294  LEU n 
14 295  LYS n 
14 296  LYS n 
14 297  MET n 
14 298  ASN n 
14 299  ASN n 
14 300  LYS n 
14 301  PRO n 
14 302  GLU n 
14 303  ARG n 
14 304  PHE n 
14 305  MET n 
14 306  VAL n 
14 307  PHE n 
14 308  GLN n 
14 309  LEU n 
14 310  PRO n 
14 311  THR n 
14 312  ARG n 
14 313  LEU n 
14 314  PRO n 
14 315  ALA n 
14 316  PHE n 
14 317  GLU n 
14 318  ARG n 
14 319  PRO n 
14 320  ALA n 
14 321  VAL n 
14 322  LYS n 
14 323  GLU n 
14 324  GLU n 
14 325  LYS n 
14 326  GLU n 
14 327  ASP n 
14 328  MET n 
14 329  GLU n 
14 330  THR n 
14 331  GLN n 
14 332  ALA n 
14 333  SER n 
14 334  ASP n 
14 335  PRO n 
14 336  SER n 
14 337  LYS n 
14 338  LYS n 
14 339  LYS n 
14 340  LYS n 
14 341  ASN n 
14 342  ILE n 
14 343  LYS n 
14 344  LYS n 
14 345  LYS n 
14 346  ASP n 
14 347  THR n 
14 348  LYS n 
14 349  ASP n 
14 350  ALA n 
14 351  LEU n 
14 352  SER n 
14 353  THR n 
14 354  ARG n 
14 355  GLU n 
14 356  LEU n 
14 357  ALA n 
14 358  GLY n 
14 359  LYS n 
14 360  VAL n 
14 361  GLY n 
14 362  SER n 
14 363  ILE n 
14 364  ARG n 
14 365  VAL n 
14 366  HIS n 
14 367  LYS n 
14 368  SER n 
14 369  GLY n 
14 370  LYS n 
14 371  LEU n 
14 372  SER n 
14 373  VAL n 
14 374  LYS n 
14 375  ILE n 
14 376  GLY n 
14 377  ASN n 
14 378  VAL n 
14 379  VAL n 
14 380  MET n 
14 381  ASP n 
14 382  ILE n 
14 383  GLY n 
14 384  LYS n 
14 385  GLY n 
14 386  ALA n 
14 387  GLU n 
14 388  THR n 
14 389  THR n 
14 390  PHE n 
14 391  LEU n 
14 392  GLN n 
14 393  ASP n 
14 394  VAL n 
14 395  ILE n 
14 396  ALA n 
14 397  LEU n 
14 398  SER n 
14 399  ILE n 
14 400  ALA n 
14 401  ASP n 
14 402  ASP n 
14 403  ALA n 
14 404  SER n 
14 405  SER n 
14 406  ALA n 
14 407  GLU n 
14 408  LEU n 
14 409  LEU n 
14 410  GLY n 
14 411  ARG n 
14 412  VAL n 
14 413  ASP n 
14 414  GLY n 
14 415  LYS n 
14 416  ILE n 
14 417  VAL n 
14 418  VAL n 
14 419  THR n 
14 420  PRO n 
14 421  GLN n 
14 422  ILE n 
15 1    MET n 
15 2    ASP n 
15 3    GLU n 
15 4    LEU n 
15 5    LEU n 
15 6    GLY n 
15 7    GLU n 
15 8    ALA n 
15 9    LEU n 
15 10   SER n 
15 11   ALA n 
15 12   GLU n 
15 13   ASN n 
15 14   GLN n 
15 15   THR n 
15 16   GLY n 
15 17   GLU n 
15 18   SER n 
15 19   THR n 
15 20   VAL n 
15 21   GLU n 
15 22   SER n 
15 23   GLU n 
15 24   LYS n 
15 25   LEU n 
15 26   VAL n 
15 27   THR n 
15 28   PRO n 
15 29   GLU n 
15 30   ASP n 
15 31   VAL n 
15 32   MET n 
15 33   THR n 
15 34   ILE n 
15 35   SER n 
15 36   SER n 
15 37   LEU n 
15 38   GLU n 
15 39   GLN n 
15 40   ARG n 
15 41   THR n 
15 42   LEU n 
15 43   ASN n 
15 44   PRO n 
15 45   ASP n 
15 46   LEU n 
15 47   PHE n 
15 48   LEU n 
15 49   TYR n 
15 50   LYS n 
15 51   GLU n 
15 52   LEU n 
15 53   VAL n 
15 54   LYS n 
15 55   ALA n 
15 56   HIS n 
15 57   LEU n 
15 58   GLY n 
15 59   GLU n 
15 60   ARG n 
15 61   ALA n 
15 62   ALA n 
15 63   SER n 
15 64   VAL n 
15 65   ILE n 
15 66   GLY n 
15 67   MET n 
15 68   LEU n 
15 69   VAL n 
15 70   ALA n 
15 71   LEU n 
15 72   GLY n 
15 73   ARG n 
15 74   LEU n 
15 75   SER n 
15 76   VAL n 
15 77   ARG n 
15 78   GLU n 
15 79   LEU n 
15 80   VAL n 
15 81   GLU n 
15 82   LYS n 
15 83   ILE n 
15 84   ASP n 
15 85   GLY n 
15 86   MET n 
15 87   ASP n 
15 88   VAL n 
15 89   ASP n 
15 90   SER n 
15 91   VAL n 
15 92   LYS n 
15 93   THR n 
15 94   THR n 
15 95   LEU n 
15 96   VAL n 
15 97   SER n 
15 98   LEU n 
15 99   THR n 
15 100  GLN n 
15 101  LEU n 
15 102  ARG n 
15 103  CYS n 
15 104  VAL n 
15 105  LYS n 
15 106  TYR n 
15 107  LEU n 
15 108  GLN n 
15 109  GLU n 
15 110  THR n 
15 111  ALA n 
15 112  ILE n 
15 113  SER n 
15 114  GLY n 
15 115  LYS n 
15 116  LYS n 
15 117  THR n 
15 118  THR n 
15 119  TYR n 
15 120  TYR n 
15 121  TYR n 
15 122  TYR n 
15 123  ASN n 
15 124  GLU n 
15 125  GLU n 
15 126  GLY n 
15 127  ILE n 
15 128  HIS n 
15 129  ILE n 
15 130  LEU n 
15 131  LEU n 
15 132  TYR n 
15 133  SER n 
15 134  GLY n 
15 135  LEU n 
15 136  ILE n 
15 137  ILE n 
15 138  ASP n 
15 139  GLU n 
15 140  ILE n 
15 141  ILE n 
15 142  THR n 
15 143  GLN n 
15 144  MET n 
15 145  ARG n 
15 146  VAL n 
15 147  ASN n 
15 148  ASP n 
15 149  GLU n 
15 150  GLU n 
15 151  GLU n 
15 152  HIS n 
15 153  LYS n 
15 154  GLN n 
15 155  LEU n 
15 156  VAL n 
15 157  ALA n 
15 158  GLU n 
15 159  ILE n 
15 160  VAL n 
15 161  GLN n 
15 162  ASN n 
15 163  VAL n 
15 164  ILE n 
15 165  SER n 
15 166  LEU n 
15 167  GLY n 
15 168  SER n 
15 169  LEU n 
15 170  THR n 
15 171  VAL n 
15 172  GLU n 
15 173  ASP n 
15 174  TYR n 
15 175  LEU n 
15 176  SER n 
15 177  SER n 
15 178  VAL n 
15 179  THR n 
15 180  SER n 
15 181  ASP n 
15 182  SER n 
15 183  MET n 
15 184  LYS n 
15 185  TYR n 
15 186  THR n 
15 187  ILE n 
15 188  SER n 
15 189  SER n 
15 190  LEU n 
15 191  PHE n 
15 192  VAL n 
15 193  GLN n 
15 194  LEU n 
15 195  CYS n 
15 196  GLU n 
15 197  MET n 
15 198  GLY n 
15 199  TYR n 
15 200  LEU n 
15 201  ILE n 
15 202  GLN n 
15 203  ILE n 
15 204  SER n 
15 205  LYS n 
15 206  LEU n 
15 207  HIS n 
15 208  TYR n 
15 209  THR n 
15 210  PRO n 
15 211  ILE n 
15 212  GLU n 
15 213  ASP n 
15 214  LEU n 
15 215  TRP n 
15 216  GLN n 
15 217  PHE n 
15 218  LEU n 
15 219  TYR n 
15 220  GLU n 
15 221  LYS n 
15 222  HIS n 
15 223  TYR n 
15 224  LYS n 
15 225  ASN n 
15 226  ILE n 
15 227  PRO n 
15 228  ARG n 
15 229  ASN n 
15 230  SER n 
15 231  PRO n 
15 232  LEU n 
15 233  SER n 
15 234  ASP n 
15 235  LEU n 
15 236  LYS n 
15 237  LYS n 
15 238  ARG n 
15 239  SER n 
15 240  GLN n 
15 241  ALA n 
15 242  LYS n 
15 243  MET n 
15 244  ASN n 
15 245  ALA n 
15 246  LYS n 
15 247  THR n 
15 248  ASP n 
15 249  PHE n 
15 250  ALA n 
15 251  LYS n 
15 252  ILE n 
15 253  ILE n 
15 254  ASN n 
15 255  LYS n 
15 256  PRO n 
15 257  ASN n 
15 258  GLU n 
15 259  LEU n 
15 260  SER n 
15 261  GLN n 
15 262  ILE n 
15 263  LEU n 
15 264  THR n 
15 265  VAL n 
15 266  ASP n 
15 267  PRO n 
15 268  LYS n 
15 269  THR n 
15 270  SER n 
15 271  LEU n 
15 272  ARG n 
15 273  ILE n 
15 274  VAL n 
15 275  LYS n 
15 276  PRO n 
15 277  THR n 
15 278  VAL n 
15 279  SER n 
15 280  LEU n 
15 281  THR n 
15 282  ILE n 
15 283  ASN n 
15 284  LEU n 
15 285  ASP n 
15 286  ARG n 
15 287  PHE n 
15 288  MET n 
15 289  LYS n 
15 290  GLY n 
15 291  ARG n 
15 292  ARG n 
15 293  SER n 
15 294  LYS n 
15 295  GLN n 
15 296  LEU n 
15 297  ILE n 
15 298  ASN n 
15 299  LEU n 
15 300  ALA n 
15 301  LYS n 
15 302  THR n 
15 303  ARG n 
15 304  VAL n 
15 305  GLY n 
15 306  SER n 
15 307  VAL n 
15 308  THR n 
15 309  ALA n 
15 310  GLN n 
15 311  VAL n 
15 312  TYR n 
15 313  LYS n 
15 314  ILE n 
15 315  ALA n 
15 316  LEU n 
15 317  ARG n 
15 318  LEU n 
15 319  THR n 
15 320  GLU n 
15 321  GLN n 
15 322  LYS n 
15 323  SER n 
15 324  PRO n 
15 325  LYS n 
15 326  ILE n 
15 327  ARG n 
15 328  ASP n 
15 329  PRO n 
15 330  LEU n 
15 331  THR n 
15 332  GLN n 
15 333  THR n 
15 334  GLY n 
15 335  LEU n 
15 336  LEU n 
15 337  GLN n 
15 338  ASP n 
15 339  LEU n 
15 340  GLU n 
15 341  GLU n 
15 342  ALA n 
15 343  LYS n 
15 344  SER n 
15 345  PHE n 
15 346  GLN n 
15 347  ASP n 
15 348  GLU n 
15 349  ALA n 
15 350  GLU n 
15 351  LEU n 
15 352  VAL n 
15 353  GLU n 
15 354  GLU n 
15 355  LYS n 
15 356  THR n 
15 357  PRO n 
15 358  GLY n 
15 359  LEU n 
15 360  THR n 
15 361  PHE n 
15 362  ASN n 
15 363  ALA n 
15 364  ILE n 
15 365  ASP n 
15 366  LEU n 
15 367  ALA n 
15 368  ARG n 
15 369  HIS n 
15 370  LEU n 
15 371  PRO n 
15 372  ALA n 
15 373  GLU n 
15 374  LEU n 
15 375  ASP n 
15 376  LEU n 
15 377  ARG n 
15 378  GLY n 
15 379  SER n 
15 380  LEU n 
15 381  LEU n 
15 382  SER n 
15 383  ARG n 
15 384  LYS n 
15 385  PRO n 
15 386  SER n 
15 387  ASP n 
15 388  ASN n 
15 389  LYS n 
15 390  LYS n 
15 391  ARG n 
15 392  SER n 
15 393  GLY n 
15 394  SER n 
15 395  ASN n 
15 396  ALA n 
15 397  ALA n 
15 398  ALA n 
15 399  SER n 
15 400  LEU n 
15 401  PRO n 
15 402  SER n 
15 403  LYS n 
15 404  LYS n 
15 405  LEU n 
15 406  LYS n 
15 407  THR n 
15 408  GLU n 
15 409  ASP n 
15 410  GLY n 
15 411  PHE n 
15 412  VAL n 
15 413  ILE n 
15 414  PRO n 
15 415  ALA n 
15 416  LEU n 
15 417  PRO n 
15 418  ALA n 
15 419  ALA n 
15 420  VAL n 
15 421  SER n 
15 422  LYS n 
15 423  SER n 
15 424  LEU n 
15 425  GLN n 
15 426  GLU n 
15 427  SER n 
15 428  GLY n 
15 429  ASP n 
15 430  THR n 
15 431  GLN n 
15 432  GLU n 
15 433  GLU n 
15 434  ASP n 
15 435  GLU n 
15 436  GLU n 
15 437  GLU n 
15 438  GLU n 
15 439  ASP n 
15 440  LEU n 
15 441  ASP n 
15 442  ALA n 
15 443  ASP n 
15 444  THR n 
15 445  GLU n 
15 446  ASP n 
15 447  PRO n 
15 448  HIS n 
15 449  SER n 
15 450  ALA n 
15 451  SER n 
15 452  LEU n 
15 453  ILE n 
15 454  ASN n 
15 455  SER n 
15 456  HIS n 
15 457  LEU n 
15 458  LYS n 
15 459  ILE n 
15 460  LEU n 
15 461  ALA n 
15 462  SER n 
15 463  SER n 
15 464  ASN n 
15 465  PHE n 
15 466  PRO n 
15 467  PHE n 
15 468  LEU n 
15 469  ASN n 
15 470  GLU n 
15 471  THR n 
15 472  LYS n 
15 473  PRO n 
15 474  GLY n 
15 475  VAL n 
15 476  TYR n 
15 477  TYR n 
15 478  VAL n 
15 479  PRO n 
15 480  TYR n 
15 481  SER n 
15 482  LYS n 
15 483  LEU n 
15 484  MET n 
15 485  PRO n 
15 486  VAL n 
15 487  LEU n 
15 488  LYS n 
15 489  SER n 
15 490  SER n 
15 491  VAL n 
15 492  TYR n 
15 493  GLU n 
15 494  TYR n 
15 495  VAL n 
15 496  ILE n 
15 497  ALA n 
15 498  SER n 
15 499  THR n 
15 500  LEU n 
15 501  GLY n 
15 502  PRO n 
15 503  SER n 
15 504  ALA n 
15 505  MET n 
15 506  ARG n 
15 507  LEU n 
15 508  SER n 
15 509  ARG n 
15 510  CYS n 
15 511  ILE n 
15 512  ARG n 
15 513  ASP n 
15 514  ASN n 
15 515  LYS n 
15 516  LEU n 
15 517  VAL n 
15 518  SER n 
15 519  GLU n 
15 520  LYS n 
15 521  ILE n 
15 522  ILE n 
15 523  ASN n 
15 524  SER n 
15 525  THR n 
15 526  ALA n 
15 527  LEU n 
15 528  MET n 
15 529  LYS n 
15 530  GLU n 
15 531  LYS n 
15 532  ASP n 
15 533  ILE n 
15 534  ARG n 
15 535  SER n 
15 536  THR n 
15 537  LEU n 
15 538  ALA n 
15 539  SER n 
15 540  LEU n 
15 541  ILE n 
15 542  ARG n 
15 543  TYR n 
15 544  ASN n 
15 545  SER n 
15 546  VAL n 
15 547  GLU n 
15 548  ILE n 
15 549  GLN n 
15 550  GLU n 
15 551  VAL n 
15 552  PRO n 
15 553  ARG n 
15 554  THR n 
15 555  ALA n 
15 556  ASP n 
15 557  ARG n 
15 558  SER n 
15 559  ALA n 
15 560  SER n 
15 561  ARG n 
15 562  ALA n 
15 563  VAL n 
15 564  PHE n 
15 565  LEU n 
15 566  PHE n 
15 567  ARG n 
15 568  CYS n 
15 569  LYS n 
15 570  GLU n 
15 571  THR n 
15 572  HIS n 
15 573  SER n 
15 574  TYR n 
15 575  ASN n 
15 576  PHE n 
15 577  MET n 
15 578  ARG n 
15 579  GLN n 
15 580  ASN n 
15 581  LEU n 
15 582  GLU n 
15 583  TRP n 
15 584  ASN n 
15 585  MET n 
15 586  ALA n 
15 587  ASN n 
15 588  LEU n 
15 589  LEU n 
15 590  PHE n 
15 591  LYS n 
15 592  LYS n 
15 593  GLU n 
15 594  LYS n 
15 595  LEU n 
15 596  LYS n 
15 597  GLN n 
15 598  GLU n 
15 599  ASN n 
15 600  SER n 
15 601  THR n 
15 602  LEU n 
15 603  LEU n 
15 604  LYS n 
15 605  LYS n 
15 606  ALA n 
15 607  ASN n 
15 608  ARG n 
15 609  ASP n 
15 610  ASP n 
15 611  VAL n 
15 612  LYS n 
15 613  GLY n 
15 614  ARG n 
15 615  GLU n 
15 616  ASN n 
15 617  GLU n 
15 618  LEU n 
15 619  LEU n 
15 620  LEU n 
15 621  PRO n 
15 622  SER n 
15 623  GLU n 
15 624  LEU n 
15 625  ASN n 
15 626  GLN n 
15 627  LEU n 
15 628  LYS n 
15 629  MET n 
15 630  VAL n 
15 631  ASN n 
15 632  GLU n 
15 633  ARG n 
15 634  GLU n 
15 635  LEU n 
15 636  ASN n 
15 637  VAL n 
15 638  PHE n 
15 639  ALA n 
15 640  ARG n 
15 641  LEU n 
15 642  SER n 
15 643  ARG n 
15 644  LEU n 
15 645  LEU n 
15 646  SER n 
15 647  LEU n 
15 648  TRP n 
15 649  GLU n 
15 650  VAL n 
15 651  PHE n 
15 652  GLN n 
15 653  MET n 
15 654  ALA n 
16 1    MET n 
16 2    SER n 
16 3    GLY n 
16 4    MET n 
16 5    ILE n 
16 6    GLU n 
16 7    ASN n 
16 8    GLY n 
16 9    LEU n 
16 10   GLN n 
16 11   LEU n 
16 12   SER n 
16 13   ASP n 
16 14   ASN n 
16 15   ALA n 
16 16   LYS n 
16 17   THR n 
16 18   LEU n 
16 19   HIS n 
16 20   SER n 
16 21   GLN n 
16 22   MET n 
16 23   MET n 
16 24   SER n 
16 25   LYS n 
16 26   GLY n 
16 27   ILE n 
16 28   GLY n 
16 29   ALA n 
16 30   LEU n 
16 31   PHE n 
16 32   THR n 
16 33   GLN n 
16 34   GLN n 
16 35   GLU n 
16 36   LEU n 
16 37   GLN n 
16 38   LYS n 
16 39   GLN n 
16 40   MET n 
16 41   GLY n 
16 42   ILE n 
16 43   GLY n 
16 44   SER n 
16 45   LEU n 
16 46   THR n 
16 47   ASP n 
16 48   LEU n 
16 49   MET n 
16 50   SER n 
16 51   ILE n 
16 52   VAL n 
16 53   GLN n 
16 54   GLU n 
16 55   LEU n 
16 56   LEU n 
16 57   ASP n 
16 58   LYS n 
16 59   ASN n 
16 60   LEU n 
16 61   ILE n 
16 62   LYS n 
16 63   LEU n 
16 64   VAL n 
16 65   LYS n 
16 66   GLN n 
16 67   ASN n 
16 68   ASP n 
16 69   GLU n 
16 70   LEU n 
16 71   LYS n 
16 72   PHE n 
16 73   GLN n 
16 74   GLY n 
16 75   VAL n 
16 76   LEU n 
16 77   GLU n 
16 78   SER n 
16 79   GLU n 
16 80   ALA n 
16 81   GLN n 
16 82   LYS n 
16 83   LYS n 
16 84   ALA n 
16 85   THR n 
16 86   MET n 
16 87   SER n 
16 88   ALA n 
16 89   GLU n 
16 90   GLU n 
16 91   ALA n 
16 92   LEU n 
16 93   VAL n 
16 94   TYR n 
16 95   SER n 
16 96   TYR n 
16 97   ILE n 
16 98   GLU n 
16 99   ALA n 
16 100  SER n 
16 101  GLY n 
16 102  ARG n 
16 103  GLU n 
16 104  GLY n 
16 105  ILE n 
16 106  TRP n 
16 107  SER n 
16 108  LYS n 
16 109  THR n 
16 110  ILE n 
16 111  LYS n 
16 112  ALA n 
16 113  ARG n 
16 114  THR n 
16 115  ASN n 
16 116  LEU n 
16 117  HIS n 
16 118  GLN n 
16 119  HIS n 
16 120  VAL n 
16 121  VAL n 
16 122  LEU n 
16 123  LYS n 
16 124  CYS n 
16 125  LEU n 
16 126  LYS n 
16 127  SER n 
16 128  LEU n 
16 129  GLU n 
16 130  SER n 
16 131  GLN n 
16 132  ARG n 
16 133  TYR n 
16 134  VAL n 
16 135  LYS n 
16 136  SER n 
16 137  VAL n 
16 138  LYS n 
16 139  SER n 
16 140  VAL n 
16 141  LYS n 
16 142  PHE n 
16 143  PRO n 
16 144  THR n 
16 145  ARG n 
16 146  LYS n 
16 147  ILE n 
16 148  TYR n 
16 149  MET n 
16 150  LEU n 
16 151  TYR n 
16 152  SER n 
16 153  LEU n 
16 154  GLN n 
16 155  PRO n 
16 156  SER n 
16 157  VAL n 
16 158  ASP n 
16 159  ILE n 
16 160  THR n 
16 161  GLY n 
16 162  GLY n 
16 163  PRO n 
16 164  TRP n 
16 165  PHE n 
16 166  THR n 
16 167  ASP n 
16 168  GLY n 
16 169  GLU n 
16 170  LEU n 
16 171  ASP n 
16 172  ILE n 
16 173  GLU n 
16 174  PHE n 
16 175  ILE n 
16 176  ASN n 
16 177  SER n 
16 178  LEU n 
16 179  LEU n 
16 180  THR n 
16 181  ILE n 
16 182  VAL n 
16 183  TRP n 
16 184  ARG n 
16 185  PHE n 
16 186  ILE n 
16 187  SER n 
16 188  GLU n 
16 189  ASN n 
16 190  THR n 
16 191  PHE n 
16 192  PRO n 
16 193  ASN n 
16 194  GLY n 
16 195  PHE n 
16 196  LYS n 
16 197  ASN n 
16 198  PHE n 
16 199  GLU n 
16 200  ASN n 
16 201  GLY n 
16 202  PRO n 
16 203  LYS n 
16 204  LYS n 
16 205  ASN n 
16 206  VAL n 
16 207  PHE n 
16 208  TYR n 
16 209  ALA n 
16 210  PRO n 
16 211  ASN n 
16 212  VAL n 
16 213  LYS n 
16 214  ASN n 
16 215  TYR n 
16 216  SER n 
16 217  THR n 
16 218  THR n 
16 219  GLN n 
16 220  GLU n 
16 221  ILE n 
16 222  LEU n 
16 223  GLU n 
16 224  PHE n 
16 225  ILE n 
16 226  THR n 
16 227  ALA n 
16 228  ALA n 
16 229  GLN n 
16 230  VAL n 
16 231  ALA n 
16 232  ASN n 
16 233  VAL n 
16 234  GLU n 
16 235  LEU n 
16 236  THR n 
16 237  PRO n 
16 238  SER n 
16 239  ASN n 
16 240  ILE n 
16 241  ARG n 
16 242  SER n 
16 243  LEU n 
16 244  CYS n 
16 245  GLU n 
16 246  VAL n 
16 247  LEU n 
16 248  VAL n 
16 249  TYR n 
16 250  ASP n 
16 251  ASP n 
16 252  LYS n 
16 253  LEU n 
16 254  GLU n 
16 255  LYS n 
16 256  VAL n 
16 257  THR n 
16 258  HIS n 
16 259  ASP n 
16 260  CYS n 
16 261  TYR n 
16 262  ARG n 
16 263  VAL n 
16 264  THR n 
16 265  LEU n 
16 266  GLU n 
16 267  SER n 
16 268  ILE n 
16 269  LEU n 
16 270  GLN n 
16 271  MET n 
16 272  ASN n 
16 273  GLN n 
16 274  GLY n 
16 275  GLU n 
16 276  GLY n 
16 277  GLU n 
16 278  PRO n 
16 279  GLU n 
16 280  ALA n 
16 281  GLY n 
16 282  ASN n 
16 283  LYS n 
16 284  ALA n 
16 285  LEU n 
16 286  GLU n 
16 287  ASP n 
16 288  GLU n 
16 289  GLU n 
16 290  GLU n 
16 291  PHE n 
16 292  SER n 
16 293  ILE n 
16 294  PHE n 
16 295  ASN n 
16 296  TYR n 
16 297  PHE n 
16 298  LYS n 
16 299  MET n 
16 300  PHE n 
16 301  PRO n 
16 302  ALA n 
16 303  SER n 
16 304  LYS n 
16 305  HIS n 
16 306  ASP n 
16 307  LYS n 
16 308  GLU n 
16 309  VAL n 
16 310  VAL n 
16 311  TYR n 
16 312  PHE n 
16 313  ASP n 
16 314  GLU n 
16 315  TRP n 
16 316  THR n 
16 317  ILE n 
17 1    MET n 
17 2    SER n 
17 3    SER n 
17 4    TYR n 
17 5    ARG n 
17 6    GLY n 
17 7    GLY n 
17 8    SER n 
17 9    ARG n 
17 10   GLY n 
17 11   GLY n 
17 12   GLY n 
17 13   SER n 
17 14   ASN n 
17 15   TYR n 
17 16   MET n 
17 17   SER n 
17 18   ASN n 
17 19   LEU n 
17 20   PRO n 
17 21   PHE n 
17 22   GLY n 
17 23   LEU n 
17 24   GLY n 
17 25   TYR n 
17 26   GLY n 
17 27   ASP n 
17 28   VAL n 
17 29   GLY n 
17 30   LYS n 
17 31   ASN n 
17 32   HIS n 
17 33   ILE n 
17 34   THR n 
17 35   GLU n 
17 36   PHE n 
17 37   PRO n 
17 38   SER n 
17 39   ILE n 
17 40   PRO n 
17 41   LEU n 
17 42   PRO n 
17 43   ILE n 
17 44   ASN n 
17 45   GLY n 
17 46   PRO n 
17 47   ILE n 
17 48   THR n 
17 49   ASN n 
17 50   LYS n 
17 51   GLU n 
17 52   ARG n 
17 53   SER n 
17 54   LEU n 
17 55   ALA n 
17 56   VAL n 
17 57   LYS n 
17 58   TYR n 
17 59   ILE n 
17 60   ASN n 
17 61   PHE n 
17 62   GLY n 
17 63   LYS n 
17 64   THR n 
17 65   VAL n 
17 66   LYS n 
17 67   ASP n 
17 68   GLY n 
17 69   PRO n 
17 70   PHE n 
17 71   UNK n 
17 72   UNK n 
17 73   UNK n 
17 74   UNK n 
17 75   UNK n 
17 76   UNK n 
17 77   UNK n 
17 78   UNK n 
17 79   UNK n 
17 80   UNK n 
17 81   UNK n 
17 82   UNK n 
17 83   UNK n 
17 84   UNK n 
17 85   UNK n 
17 86   UNK n 
17 87   UNK n 
17 88   UNK n 
17 89   UNK n 
17 90   ARG n 
17 91   LYS n 
17 92   PRO n 
17 93   ASN n 
17 94   ILE n 
17 95   ILE n 
17 96   LEU n 
17 97   ASP n 
17 98   GLU n 
17 99   ASP n 
17 100  ASP n 
17 101  THR n 
17 102  ASN n 
17 103  ASP n 
17 104  GLY n 
17 105  ILE n 
17 106  GLU n 
17 107  ARG n 
17 108  TYR n 
17 109  SER n 
17 110  ASP n 
17 111  LYS n 
17 112  TYR n 
17 113  LEU n 
17 114  LYS n 
17 115  LYS n 
17 116  ARG n 
17 117  LYS n 
17 118  ILE n 
17 119  GLY n 
17 120  ILE n 
17 121  SER n 
17 122  ILE n 
17 123  ASP n 
17 124  ASP n 
17 125  HIS n 
17 126  PRO n 
17 127  TYR n 
17 128  ASN n 
17 129  LEU n 
17 130  ASN n 
17 131  LEU n 
17 132  PHE n 
17 133  PRO n 
17 134  ASN n 
17 135  GLU n 
17 136  LEU n 
17 137  TYR n 
17 138  ASN n 
17 139  VAL n 
17 140  MET n 
17 141  GLY n 
17 142  ILE n 
17 143  ASN n 
17 144  LYS n 
17 145  LYS n 
17 146  LYS n 
17 147  LEU n 
17 148  LEU n 
17 149  ALA n 
17 150  ILE n 
17 151  SER n 
17 152  LYS n 
17 153  PHE n 
17 154  ASN n 
17 155  ASN n 
17 156  ALA n 
17 157  ASP n 
17 158  ASP n 
17 159  VAL n 
17 160  PHE n 
17 161  THR n 
17 162  GLY n 
17 163  THR n 
17 164  GLY n 
17 165  LEU n 
17 166  GLN n 
17 167  ASP n 
17 168  GLU n 
17 169  ASN n 
17 170  ILE n 
17 171  GLY n 
17 172  LEU n 
17 173  SER n 
17 174  MET n 
17 175  LEU n 
17 176  ALA n 
17 177  LYS n 
17 178  LEU n 
17 179  LYS n 
17 180  GLU n 
17 181  LEU n 
17 182  ALA n 
17 183  GLU n 
17 184  ASP n 
17 185  VAL n 
17 186  ASP n 
17 187  ASP n 
17 188  ALA n 
17 189  SER n 
17 190  THR n 
17 191  GLY n 
17 192  ASP n 
17 193  GLY n 
17 194  ALA n 
17 195  ALA n 
17 196  LYS n 
17 197  GLY n 
17 198  SER n 
17 199  LYS n 
17 200  THR n 
17 201  GLY n 
17 202  GLU n 
17 203  GLY n 
17 204  GLU n 
17 205  ASP n 
17 206  ASP n 
17 207  ASP n 
17 208  LEU n 
17 209  ALA n 
17 210  ASP n 
17 211  ASP n 
17 212  ASP n 
17 213  PHE n 
17 214  GLU n 
17 215  GLU n 
17 216  ASP n 
17 217  GLU n 
17 218  ASP n 
17 219  GLU n 
17 220  GLU n 
17 221  ASP n 
17 222  ASP n 
17 223  ASP n 
17 224  ASP n 
17 225  TYR n 
17 226  ASN n 
17 227  ALA n 
17 228  GLU n 
17 229  LYS n 
17 230  TYR n 
17 231  PHE n 
17 232  ASN n 
17 233  ASN n 
17 234  GLY n 
17 235  ASP n 
17 236  ASP n 
17 237  ASP n 
17 238  ASP n 
17 239  TYR n 
17 240  GLY n 
17 241  ASP n 
17 242  GLU n 
17 243  GLU n 
17 244  ASP n 
17 245  PRO n 
17 246  ASN n 
17 247  GLU n 
17 248  GLU n 
17 249  ALA n 
17 250  ALA n 
17 251  PHE n 
18 1    MET n 
18 2    PRO n 
18 3    VAL n 
18 4    CYS n 
18 5    LYS n 
18 6    ASN n 
18 7    CYS n 
18 8    HIS n 
18 9    GLY n 
18 10   THR n 
18 11   GLU n 
18 12   PHE n 
18 13   GLU n 
18 14   ARG n 
18 15   ASP n 
18 16   LEU n 
18 17   SER n 
18 18   ASN n 
18 19   ALA n 
18 20   ASN n 
18 21   ASN n 
18 22   ASP n 
18 23   LEU n 
18 24   VAL n 
18 25   CYS n 
18 26   LYS n 
18 27   ALA n 
18 28   CYS n 
18 29   GLY n 
18 30   VAL n 
18 31   VAL n 
18 32   SER n 
18 33   GLU n 
18 34   ASP n 
18 35   ASN n 
18 36   PRO n 
18 37   ILE n 
18 38   VAL n 
18 39   SER n 
18 40   GLU n 
18 41   VAL n 
18 42   THR n 
18 43   PHE n 
18 44   GLY n 
18 45   GLU n 
18 46   THR n 
18 47   SER n 
18 48   ALA n 
18 49   GLY n 
18 50   ALA n 
18 51   ALA n 
18 52   VAL n 
18 53   VAL n 
18 54   GLN n 
18 55   GLY n 
18 56   SER n 
18 57   PHE n 
18 58   ILE n 
18 59   GLY n 
18 60   ALA n 
18 61   GLY n 
18 62   GLN n 
18 63   SER n 
18 64   HIS n 
18 65   ALA n 
18 66   ALA n 
18 67   PHE n 
18 68   GLY n 
18 69   GLY n 
18 70   SER n 
18 71   SER n 
18 72   ALA n 
18 73   LEU n 
18 74   GLU n 
18 75   SER n 
18 76   ARG n 
18 77   GLU n 
18 78   ALA n 
18 79   THR n 
18 80   LEU n 
18 81   ASN n 
18 82   ASN n 
18 83   ALA n 
18 84   ARG n 
18 85   ARG n 
18 86   LYS n 
18 87   LEU n 
18 88   ARG n 
18 89   ALA n 
18 90   VAL n 
18 91   SER n 
18 92   TYR n 
18 93   ALA n 
18 94   LEU n 
18 95   HIS n 
18 96   ILE n 
18 97   PRO n 
18 98   GLU n 
18 99   TYR n 
18 100  ILE n 
18 101  THR n 
18 102  ASP n 
18 103  ALA n 
18 104  ALA n 
18 105  PHE n 
18 106  GLN n 
18 107  TRP n 
18 108  TYR n 
18 109  LYS n 
18 110  LEU n 
18 111  ALA n 
18 112  LEU n 
18 113  ALA n 
18 114  ASN n 
18 115  ASN n 
18 116  PHE n 
18 117  VAL n 
18 118  GLN n 
18 119  GLY n 
18 120  ARG n 
18 121  ARG n 
18 122  SER n 
18 123  GLN n 
18 124  ASN n 
18 125  VAL n 
18 126  ILE n 
18 127  ALA n 
18 128  SER n 
18 129  CYS n 
18 130  LEU n 
18 131  TYR n 
18 132  VAL n 
18 133  ALA n 
18 134  CYS n 
18 135  ARG n 
18 136  LYS n 
18 137  GLU n 
18 138  LYS n 
18 139  THR n 
18 140  HIS n 
18 141  HIS n 
18 142  MET n 
18 143  LEU n 
18 144  ILE n 
18 145  ASP n 
18 146  PHE n 
18 147  SER n 
18 148  SER n 
18 149  ARG n 
18 150  LEU n 
18 151  GLN n 
18 152  VAL n 
18 153  SER n 
18 154  VAL n 
18 155  TYR n 
18 156  SER n 
18 157  ILE n 
18 158  GLY n 
18 159  ALA n 
18 160  THR n 
18 161  PHE n 
18 162  LEU n 
18 163  LYS n 
18 164  MET n 
18 165  VAL n 
18 166  LYS n 
18 167  LYS n 
18 168  LEU n 
18 169  HIS n 
18 170  ILE n 
18 171  THR n 
18 172  GLU n 
18 173  LEU n 
18 174  PRO n 
18 175  LEU n 
18 176  ALA n 
18 177  ASP n 
18 178  PRO n 
18 179  SER n 
18 180  LEU n 
18 181  PHE n 
18 182  ILE n 
18 183  GLN n 
18 184  HIS n 
18 185  PHE n 
18 186  ALA n 
18 187  GLU n 
18 188  LYS n 
18 189  LEU n 
18 190  ASP n 
18 191  LEU n 
18 192  ALA n 
18 193  ASP n 
18 194  LYS n 
18 195  LYS n 
18 196  ILE n 
18 197  LYS n 
18 198  VAL n 
18 199  VAL n 
18 200  LYS n 
18 201  ASP n 
18 202  ALA n 
18 203  VAL n 
18 204  LYS n 
18 205  LEU n 
18 206  ALA n 
18 207  GLN n 
18 208  ARG n 
18 209  MET n 
18 210  SER n 
18 211  LYS n 
18 212  ASP n 
18 213  TRP n 
18 214  MET n 
18 215  PHE n 
18 216  GLU n 
18 217  GLY n 
18 218  ARG n 
18 219  ARG n 
18 220  PRO n 
18 221  ALA n 
18 222  GLY n 
18 223  ILE n 
18 224  ALA n 
18 225  GLY n 
18 226  ALA n 
18 227  CYS n 
18 228  ILE n 
18 229  LEU n 
18 230  LEU n 
18 231  ALA n 
18 232  CYS n 
18 233  ARG n 
18 234  MET n 
18 235  ASN n 
18 236  ASN n 
18 237  LEU n 
18 238  ARG n 
18 239  ARG n 
18 240  THR n 
18 241  HIS n 
18 242  THR n 
18 243  GLU n 
18 244  ILE n 
18 245  VAL n 
18 246  ALA n 
18 247  VAL n 
18 248  SER n 
18 249  HIS n 
18 250  VAL n 
18 251  ALA n 
18 252  GLU n 
18 253  GLU n 
18 254  THR n 
18 255  LEU n 
18 256  GLN n 
18 257  GLN n 
18 258  ARG n 
18 259  LEU n 
18 260  ASN n 
18 261  GLU n 
18 262  PHE n 
18 263  LYS n 
18 264  ASN n 
18 265  THR n 
18 266  LYS n 
18 267  ALA n 
18 268  ALA n 
18 269  LYS n 
18 270  LEU n 
18 271  SER n 
18 272  VAL n 
18 273  GLN n 
18 274  LYS n 
18 275  PHE n 
18 276  ARG n 
18 277  GLU n 
18 278  ASN n 
18 279  ASP n 
18 280  VAL n 
18 281  GLU n 
18 282  ASP n 
18 283  GLY n 
18 284  GLU n 
18 285  ALA n 
18 286  ARG n 
18 287  PRO n 
18 288  PRO n 
18 289  SER n 
18 290  PHE n 
18 291  VAL n 
18 292  LYS n 
18 293  ASN n 
18 294  ARG n 
18 295  LYS n 
18 296  LYS n 
18 297  GLU n 
18 298  ARG n 
18 299  LYS n 
18 300  ILE n 
18 301  LYS n 
18 302  ASP n 
18 303  SER n 
18 304  LEU n 
18 305  ASP n 
18 306  LYS n 
18 307  GLU n 
18 308  GLU n 
18 309  MET n 
18 310  PHE n 
18 311  GLN n 
18 312  THR n 
18 313  SER n 
18 314  GLU n 
18 315  GLU n 
18 316  ALA n 
18 317  LEU n 
18 318  ASN n 
18 319  LYS n 
18 320  ASN n 
18 321  PRO n 
18 322  ILE n 
18 323  LEU n 
18 324  THR n 
18 325  GLN n 
18 326  VAL n 
18 327  LEU n 
18 328  GLY n 
18 329  GLU n 
18 330  GLN n 
18 331  GLU n 
18 332  LEU n 
18 333  SER n 
18 334  SER n 
18 335  LYS n 
18 336  GLU n 
18 337  VAL n 
18 338  LEU n 
18 339  PHE n 
18 340  TYR n 
18 341  LEU n 
18 342  LYS n 
18 343  GLN n 
18 344  PHE n 
18 345  SER n 
18 346  GLU n 
18 347  ARG n 
18 348  ARG n 
18 349  ALA n 
18 350  ARG n 
18 351  VAL n 
18 352  VAL n 
18 353  GLU n 
18 354  ARG n 
18 355  ILE n 
18 356  LYS n 
18 357  ALA n 
18 358  THR n 
18 359  ASN n 
18 360  GLY n 
18 361  ILE n 
18 362  ASP n 
18 363  GLY n 
18 364  GLU n 
18 365  ASN n 
18 366  ILE n 
18 367  TYR n 
18 368  HIS n 
18 369  GLU n 
18 370  GLY n 
18 371  SER n 
18 372  GLU n 
18 373  ASN n 
18 374  GLU n 
18 375  THR n 
18 376  ARG n 
18 377  LYS n 
18 378  ARG n 
18 379  LYS n 
18 380  LEU n 
18 381  SER n 
18 382  GLU n 
18 383  ALA n 
18 384  MET n 
18 385  PRO n 
18 386  TRP n 
18 387  SER n 
18 388  GLY n 
18 389  ILE n 
18 390  VAL n 
18 391  PRO n 
18 392  THR n 
18 393  LEU n 
18 394  GLN n 
18 395  ASN n 
18 396  ILE n 
18 397  VAL n 
18 398  ALA n 
18 399  THR n 
18 400  VAL n 
18 401  THR n 
18 402  LEU n 
18 403  GLY n 
18 404  CYS n 
18 405  ARG n 
18 406  LEU n 
18 407  ASP n 
18 408  LEU n 
18 409  LYS n 
18 410  THR n 
18 411  VAL n 
18 412  ALA n 
18 413  LEU n 
18 414  HIS n 
18 415  ALA n 
18 416  ARG n 
18 417  ASN n 
18 418  ALA n 
18 419  GLU n 
18 420  TYR n 
18 421  ASN n 
18 422  PRO n 
18 423  LYS n 
18 424  ARG n 
18 425  PHE n 
18 426  ALA n 
18 427  ALA n 
18 428  VAL n 
18 429  ILE n 
18 430  MET n 
18 431  ARG n 
18 432  ILE n 
18 433  ARG n 
18 434  GLU n 
18 435  PRO n 
18 436  LYS n 
18 437  THR n 
18 438  THR n 
18 439  ALA n 
18 440  LEU n 
18 441  ILE n 
18 442  PHE n 
18 443  ALA n 
18 444  SER n 
18 445  GLY n 
18 446  LYS n 
18 447  MET n 
18 448  VAL n 
18 449  VAL n 
18 450  THR n 
18 451  GLY n 
18 452  ALA n 
18 453  LYS n 
18 454  SER n 
18 455  GLU n 
18 456  ASP n 
18 457  ASP n 
18 458  SER n 
18 459  LYS n 
18 460  LEU n 
18 461  ALA n 
18 462  SER n 
18 463  ARG n 
18 464  LYS n 
18 465  TYR n 
18 466  ALA n 
18 467  ARG n 
18 468  ILE n 
18 469  ILE n 
18 470  GLN n 
18 471  LYS n 
18 472  ILE n 
18 473  GLY n 
18 474  PHE n 
18 475  ALA n 
18 476  ALA n 
18 477  LYS n 
18 478  PHE n 
18 479  THR n 
18 480  ASP n 
18 481  PHE n 
18 482  LYS n 
18 483  ILE n 
18 484  GLN n 
18 485  ASN n 
18 486  ILE n 
18 487  VAL n 
18 488  GLY n 
18 489  SER n 
18 490  CYS n 
18 491  ASP n 
18 492  VAL n 
18 493  LYS n 
18 494  PHE n 
18 495  PRO n 
18 496  ILE n 
18 497  ARG n 
18 498  LEU n 
18 499  GLU n 
18 500  GLY n 
18 501  LEU n 
18 502  ALA n 
18 503  PHE n 
18 504  SER n 
18 505  HIS n 
18 506  GLY n 
18 507  THR n 
18 508  PHE n 
18 509  SER n 
18 510  SER n 
18 511  TYR n 
18 512  GLU n 
18 513  PRO n 
18 514  GLU n 
18 515  LEU n 
18 516  PHE n 
18 517  PRO n 
18 518  GLY n 
18 519  LEU n 
18 520  ILE n 
18 521  TYR n 
18 522  ARG n 
18 523  MET n 
18 524  VAL n 
18 525  LYS n 
18 526  PRO n 
18 527  LYS n 
18 528  ILE n 
18 529  VAL n 
18 530  LEU n 
18 531  LEU n 
18 532  ILE n 
18 533  PHE n 
18 534  VAL n 
18 535  SER n 
18 536  GLY n 
18 537  LYS n 
18 538  ILE n 
18 539  VAL n 
18 540  LEU n 
18 541  THR n 
18 542  GLY n 
18 543  ALA n 
18 544  LYS n 
18 545  GLN n 
18 546  ARG n 
18 547  GLU n 
18 548  GLU n 
18 549  ILE n 
18 550  TYR n 
18 551  GLN n 
18 552  ALA n 
18 553  PHE n 
18 554  GLU n 
18 555  ALA n 
18 556  ILE n 
18 557  TYR n 
18 558  PRO n 
18 559  VAL n 
18 560  LEU n 
18 561  SER n 
18 562  GLU n 
18 563  PHE n 
18 564  ARG n 
18 565  LYS n 
18 566  MET n 
18 567  GLY n 
18 568  SER n 
18 569  GLY n 
18 570  SER n 
18 571  GLY n 
18 572  SER n 
18 573  GLY n 
18 574  SER n 
18 575  GLY n 
18 576  SER n 
18 577  GLY n 
18 578  SER n 
18 579  PRO n 
18 580  ARG n 
18 581  ASN n 
18 582  LEU n 
18 583  HIS n 
18 584  LEU n 
18 585  LEU n 
18 586  PRO n 
18 587  THR n 
18 588  THR n 
18 589  ASP n 
18 590  THR n 
18 591  TYR n 
18 592  LEU n 
18 593  SER n 
18 594  LYS n 
18 595  VAL n 
18 596  SER n 
18 597  ASP n 
18 598  ASP n 
18 599  PRO n 
18 600  ASP n 
18 601  ASN n 
18 602  LEU n 
18 603  GLU n 
18 604  ASP n 
18 605  VAL n 
18 606  ASP n 
18 607  ASP n 
18 608  GLU n 
18 609  GLU n 
18 610  LEU n 
18 611  ASN n 
18 612  ALA n 
18 613  HIS n 
18 614  LEU n 
18 615  LEU n 
18 616  ASN n 
18 617  GLU n 
18 618  GLU n 
18 619  ALA n 
18 620  SER n 
18 621  LYS n 
18 622  LEU n 
18 623  LYS n 
18 624  GLU n 
18 625  ARG n 
18 626  ILE n 
18 627  TRP n 
18 628  ILE n 
18 629  GLY n 
18 630  LEU n 
18 631  ASN n 
18 632  ALA n 
18 633  ASP n 
18 634  PHE n 
18 635  LEU n 
18 636  LEU n 
18 637  GLU n 
18 638  GLN n 
18 639  GLU n 
18 640  SER n 
18 641  LYS n 
18 642  ARG n 
18 643  LEU n 
18 644  LYS n 
18 645  GLN n 
18 646  GLU n 
18 647  ALA n 
18 648  ASP n 
18 649  ILE n 
18 650  ALA n 
18 651  THR n 
18 652  GLY n 
18 653  ASN n 
18 654  THR n 
18 655  SER n 
18 656  VAL n 
18 657  LYS n 
18 658  LYS n 
18 659  LYS n 
18 660  ARG n 
18 661  THR n 
18 662  ARG n 
18 663  ARG n 
18 664  ARG n 
18 665  ASN n 
18 666  ASN n 
18 667  THR n 
18 668  ARG n 
18 669  SER n 
18 670  ASP n 
18 671  GLU n 
18 672  PRO n 
18 673  THR n 
18 674  LYS n 
18 675  THR n 
18 676  VAL n 
18 677  ASP n 
18 678  ALA n 
18 679  ALA n 
18 680  ALA n 
18 681  ALA n 
18 682  ILE n 
18 683  GLY n 
18 684  LEU n 
18 685  MET n 
18 686  SER n 
18 687  ASP n 
18 688  LEU n 
18 689  GLN n 
18 690  ASP n 
18 691  LYS n 
18 692  SER n 
18 693  GLY n 
18 694  LEU n 
18 695  HIS n 
18 696  ALA n 
18 697  ALA n 
18 698  LEU n 
18 699  LYS n 
18 700  ALA n 
18 701  ALA n 
18 702  GLU n 
18 703  GLU n 
18 704  SER n 
18 705  GLY n 
18 706  ASP n 
18 707  PHE n 
18 708  THR n 
18 709  THR n 
18 710  ALA n 
18 711  ASP n 
18 712  SER n 
18 713  VAL n 
18 714  LYS n 
18 715  ASN n 
18 716  MET n 
18 717  LEU n 
18 718  GLN n 
18 719  LYS n 
18 720  ALA n 
18 721  SER n 
18 722  PHE n 
18 723  SER n 
18 724  LYS n 
18 725  LYS n 
18 726  ILE n 
18 727  ASN n 
18 728  TYR n 
18 729  ASP n 
18 730  ALA n 
18 731  ILE n 
18 732  ASP n 
18 733  GLY n 
18 734  LEU n 
18 735  PHE n 
18 736  ARG n 
19 1    MET n 
19 2    SER n 
19 3    SER n 
19 4    ILE n 
19 5    VAL n 
19 6    ASN n 
19 7    LYS n 
19 8    SER n 
19 9    GLY n 
19 10   THR n 
19 11   ARG n 
19 12   PHE n 
19 13   ALA n 
19 14   PRO n 
19 15   LYS n 
19 16   VAL n 
19 17   ARG n 
19 18   GLN n 
19 19   ARG n 
19 20   ARG n 
19 21   ALA n 
19 22   ALA n 
19 23   THR n 
19 24   GLY n 
19 25   GLY n 
19 26   THR n 
19 27   PRO n 
19 28   THR n 
19 29   PRO n 
19 30   LYS n 
19 31   PRO n 
19 32   ARG n 
19 33   THR n 
19 34   PRO n 
19 35   GLN n 
19 36   LEU n 
19 37   PHE n 
19 38   ILE n 
19 39   PRO n 
19 40   GLU n 
19 41   SER n 
19 42   LYS n 
19 43   GLU n 
19 44   ILE n 
19 45   GLU n 
19 46   GLU n 
19 47   ASP n 
19 48   ASN n 
19 49   SER n 
19 50   ASP n 
19 51   ASN n 
19 52   ASP n 
19 53   LYS n 
19 54   GLY n 
19 55   VAL n 
19 56   ASP n 
19 57   GLU n 
19 58   ASN n 
19 59   GLU n 
19 60   THR n 
19 61   ALA n 
19 62   ILE n 
19 63   VAL n 
19 64   GLU n 
19 65   LYS n 
19 66   PRO n 
19 67   SER n 
19 68   LEU n 
19 69   VAL n 
19 70   GLY n 
19 71   GLU n 
19 72   ARG n 
19 73   SER n 
19 74   LEU n 
19 75   GLU n 
19 76   GLY n 
19 77   PHE n 
19 78   THR n 
19 79   LEU n 
19 80   THR n 
19 81   GLY n 
19 82   THR n 
19 83   ASN n 
19 84   GLY n 
19 85   HIS n 
19 86   ASP n 
19 87   ASN n 
19 88   GLU n 
19 89   ILE n 
19 90   GLY n 
19 91   ASP n 
19 92   GLU n 
19 93   GLY n 
19 94   PRO n 
19 95   ILE n 
19 96   ASP n 
19 97   ALA n 
19 98   SER n 
19 99   THR n 
19 100  GLN n 
19 101  ASN n 
19 102  PRO n 
19 103  LYS n 
19 104  ALA n 
19 105  ASP n 
19 106  VAL n 
19 107  ILE n 
19 108  GLU n 
19 109  ASP n 
19 110  ASN n 
19 111  VAL n 
19 112  THR n 
19 113  LEU n 
19 114  LYS n 
19 115  PRO n 
19 116  ALA n 
19 117  PRO n 
19 118  LEU n 
19 119  GLN n 
19 120  THR n 
19 121  HIS n 
19 122  ARG n 
19 123  ASP n 
19 124  GLN n 
19 125  LYS n 
19 126  VAL n 
19 127  PRO n 
19 128  ARG n 
19 129  SER n 
19 130  SER n 
19 131  ARG n 
19 132  LEU n 
19 133  ALA n 
19 134  SER n 
19 135  LEU n 
19 136  SER n 
19 137  LYS n 
19 138  ASP n 
19 139  ASN n 
19 140  GLU n 
19 141  SER n 
19 142  ARG n 
19 143  PRO n 
19 144  SER n 
19 145  PHE n 
19 146  LYS n 
19 147  PRO n 
19 148  SER n 
19 149  PHE n 
19 150  LEU n 
19 151  ASP n 
19 152  SER n 
19 153  SER n 
19 154  SER n 
19 155  ASN n 
19 156  SER n 
19 157  ASN n 
19 158  GLY n 
19 159  THR n 
19 160  ALA n 
19 161  ARG n 
19 162  ARG n 
19 163  LEU n 
19 164  SER n 
19 165  THR n 
19 166  ILE n 
19 167  SER n 
19 168  ASN n 
19 169  LYS n 
19 170  LEU n 
19 171  PRO n 
19 172  LYS n 
19 173  LYS n 
19 174  ILE n 
19 175  ARG n 
19 176  LEU n 
19 177  GLY n 
19 178  SER n 
19 179  ILE n 
19 180  THR n 
19 181  GLU n 
19 182  ASN n 
19 183  ASP n 
19 184  MET n 
19 185  ASN n 
19 186  LEU n 
19 187  LYS n 
19 188  THR n 
19 189  PHE n 
19 190  LYS n 
19 191  ARG n 
19 192  HIS n 
19 193  ARG n 
19 194  VAL n 
19 195  LEU n 
19 196  GLY n 
19 197  LYS n 
19 198  PRO n 
19 199  SER n 
19 200  SER n 
19 201  ALA n 
19 202  LYS n 
19 203  LYS n 
19 204  PRO n 
19 205  ALA n 
19 206  GLY n 
19 207  ALA n 
19 208  HIS n 
19 209  ARG n 
19 210  ILE n 
19 211  SER n 
19 212  ILE n 
19 213  VAL n 
19 214  SER n 
19 215  LYS n 
19 216  ILE n 
19 217  SER n 
19 218  PRO n 
19 219  PRO n 
19 220  THR n 
19 221  ALA n 
19 222  MET n 
19 223  THR n 
19 224  ASP n 
19 225  SER n 
19 226  LEU n 
19 227  ASP n 
19 228  ARG n 
19 229  ASN n 
19 230  GLU n 
19 231  PHE n 
19 232  SER n 
19 233  SER n 
19 234  GLU n 
19 235  THR n 
19 236  SER n 
19 237  THR n 
19 238  SER n 
19 239  ARG n 
19 240  GLU n 
19 241  ALA n 
19 242  ASP n 
19 243  GLU n 
19 244  ASN n 
19 245  GLU n 
19 246  ASN n 
19 247  TYR n 
19 248  VAL n 
19 249  ILE n 
19 250  SER n 
19 251  LYS n 
19 252  VAL n 
19 253  LYS n 
19 254  ASP n 
19 255  ILE n 
19 256  PRO n 
19 257  LYS n 
19 258  LYS n 
19 259  VAL n 
19 260  ARG n 
19 261  ASP n 
19 262  GLY n 
19 263  GLU n 
19 264  SER n 
19 265  ALA n 
19 266  LYS n 
19 267  TYR n 
19 268  PHE n 
19 269  ILE n 
19 270  ASP n 
19 271  GLU n 
19 272  GLU n 
19 273  ASN n 
19 274  PHE n 
19 275  THR n 
19 276  MET n 
19 277  ALA n 
19 278  GLU n 
19 279  LEU n 
19 280  CYS n 
19 281  LYS n 
19 282  PRO n 
19 283  ASN n 
19 284  PHE n 
19 285  PRO n 
19 286  ILE n 
19 287  GLY n 
19 288  GLN n 
19 289  ILE n 
19 290  SER n 
19 291  GLU n 
19 292  ASN n 
19 293  PHE n 
19 294  GLU n 
19 295  LYS n 
19 296  SER n 
19 297  LYS n 
19 298  MET n 
19 299  ALA n 
19 300  LYS n 
19 301  LYS n 
19 302  ALA n 
19 303  LYS n 
19 304  LEU n 
19 305  GLU n 
19 306  LYS n 
19 307  ARG n 
19 308  ARG n 
19 309  HIS n 
19 310  LEU n 
19 311  ARG n 
19 312  GLU n 
19 313  LEU n 
19 314  ARG n 
19 315  MET n 
19 316  ARG n 
19 317  UNK n 
19 318  UNK n 
19 319  UNK n 
19 320  UNK n 
19 321  UNK n 
19 322  UNK n 
19 323  UNK n 
19 324  UNK n 
19 325  UNK n 
19 326  UNK n 
19 327  UNK n 
19 328  UNK n 
19 329  UNK n 
19 330  UNK n 
19 331  UNK n 
19 332  UNK n 
19 333  UNK n 
19 334  UNK n 
19 335  UNK n 
19 336  UNK n 
19 337  UNK n 
19 338  UNK n 
19 339  UNK n 
19 340  UNK n 
19 341  UNK n 
19 342  UNK n 
19 343  UNK n 
19 344  UNK n 
19 345  UNK n 
19 346  UNK n 
19 347  UNK n 
19 348  UNK n 
19 349  UNK n 
19 350  UNK n 
19 351  UNK n 
19 352  UNK n 
19 353  UNK n 
19 354  UNK n 
19 355  UNK n 
19 356  UNK n 
19 357  UNK n 
19 358  UNK n 
19 359  UNK n 
19 360  THR n 
19 361  ALA n 
19 362  ILE n 
19 363  GLN n 
19 364  LEU n 
19 365  LYS n 
19 366  LEU n 
19 367  ASN n 
19 368  PRO n 
19 369  ASP n 
19 370  GLY n 
19 371  THR n 
19 372  MET n 
19 373  ALA n 
19 374  ILE n 
19 375  ASP n 
19 376  GLU n 
19 377  GLU n 
19 378  THR n 
19 379  MET n 
19 380  VAL n 
19 381  VAL n 
19 382  ASP n 
19 383  ARG n 
19 384  HIS n 
19 385  LYS n 
19 386  ASN n 
19 387  ALA n 
19 388  SER n 
19 389  ILE n 
19 390  GLU n 
19 391  ASN n 
19 392  GLU n 
19 393  TYR n 
19 394  LYS n 
19 395  GLU n 
19 396  LYS n 
19 397  VAL n 
19 398  ASP n 
19 399  GLU n 
19 400  ASN n 
19 401  PRO n 
19 402  PHE n 
19 403  ALA n 
19 404  ASN n 
19 405  LEU n 
19 406  TYR n 
19 407  ASN n 
19 408  TYR n 
19 409  GLY n 
19 410  SER n 
19 411  TYR n 
19 412  GLY n 
19 413  ARG n 
19 414  GLY n 
19 415  SER n 
19 416  TYR n 
19 417  THR n 
19 418  ASP n 
19 419  PRO n 
19 420  TRP n 
19 421  THR n 
19 422  VAL n 
19 423  GLU n 
19 424  GLU n 
19 425  MET n 
19 426  ILE n 
19 427  LYS n 
19 428  PHE n 
19 429  TYR n 
19 430  LYS n 
19 431  ALA n 
19 432  LEU n 
19 433  SER n 
19 434  MET n 
19 435  TRP n 
19 436  GLY n 
19 437  THR n 
19 438  ASP n 
19 439  PHE n 
19 440  ASN n 
19 441  LEU n 
19 442  ILE n 
19 443  SER n 
19 444  GLN n 
19 445  LEU n 
19 446  TYR n 
19 447  PRO n 
19 448  TYR n 
19 449  ARG n 
19 450  SER n 
19 451  ARG n 
19 452  LYS n 
19 453  GLN n 
19 454  VAL n 
19 455  LYS n 
19 456  ALA n 
19 457  LYS n 
19 458  PHE n 
19 459  VAL n 
19 460  ASN n 
19 461  GLU n 
19 462  GLU n 
19 463  LYS n 
19 464  LYS n 
19 465  ARG n 
19 466  PRO n 
19 467  ILE n 
19 468  LEU n 
19 469  ILE n 
19 470  GLU n 
19 471  LEU n 
19 472  ALA n 
19 473  LEU n 
19 474  ARG n 
19 475  SER n 
19 476  LYS n 
19 477  LEU n 
19 478  PRO n 
19 479  PRO n 
19 480  ASN n 
19 481  PHE n 
19 482  ASP n 
19 483  GLU n 
19 484  TYR n 
19 485  CYS n 
19 486  CYS n 
19 487  GLU n 
19 488  ILE n 
19 489  LYS n 
19 490  LYS n 
19 491  ASN n 
19 492  ILE n 
19 493  GLY n 
19 494  THR n 
19 495  VAL n 
19 496  ALA n 
19 497  ASP n 
19 498  PHE n 
19 499  ASN n 
19 500  GLU n 
19 501  LYS n 
19 502  LEU n 
19 503  ILE n 
19 504  GLU n 
19 505  LEU n 
19 506  GLN n 
19 507  ASN n 
19 508  GLU n 
19 509  HIS n 
19 510  LYS n 
19 511  HIS n 
19 512  HIS n 
19 513  MET n 
19 514  LYS n 
19 515  GLU n 
19 516  ILE n 
19 517  GLU n 
19 518  GLU n 
19 519  ALA n 
19 520  LYS n 
19 521  ASN n 
19 522  THR n 
19 523  ALA n 
19 524  LYS n 
19 525  GLU n 
19 526  GLU n 
19 527  ASP n 
19 528  GLN n 
19 529  THR n 
19 530  ALA n 
19 531  GLN n 
19 532  ARG n 
19 533  LEU n 
19 534  ASN n 
19 535  ASP n 
19 536  ALA n 
19 537  ASN n 
19 538  LEU n 
19 539  ASN n 
19 540  LYS n 
19 541  LYS n 
19 542  GLY n 
19 543  SER n 
19 544  GLY n 
19 545  GLY n 
19 546  ILE n 
19 547  MET n 
19 548  THR n 
19 549  ASN n 
19 550  ASP n 
19 551  LEU n 
19 552  LYS n 
19 553  VAL n 
19 554  TYR n 
19 555  ARG n 
19 556  LYS n 
19 557  THR n 
19 558  GLU n 
19 559  VAL n 
19 560  VAL n 
19 561  LEU n 
19 562  GLY n 
19 563  THR n 
19 564  ILE n 
19 565  ASP n 
19 566  ASP n 
19 567  LEU n 
19 568  LYS n 
19 569  ARG n 
19 570  LYS n 
19 571  LYS n 
19 572  LEU n 
19 573  LYS n 
19 574  GLU n 
19 575  ARG n 
19 576  ASN n 
19 577  ASN n 
19 578  ASP n 
19 579  ASP n 
19 580  ASN n 
19 581  GLU n 
19 582  ASP n 
19 583  ASN n 
19 584  GLU n 
19 585  GLY n 
19 586  SER n 
19 587  GLU n 
19 588  GLU n 
19 589  GLU n 
19 590  PRO n 
19 591  GLU n 
19 592  ILE n 
19 593  ASP n 
19 594  GLN n 
20 1    DT  n 
20 2    DT  n 
20 3    DT  n 
20 4    DT  n 
20 5    DC  n 
20 6    DA  n 
20 7    DA  n 
20 8    DC  n 
20 9    DA  n 
20 10   DT  n 
20 11   DA  n 
20 12   DT  n 
20 13   DA  n 
20 14   DT  n 
20 15   DT  n 
20 16   DA  n 
20 17   DG  n 
20 18   DT  n 
20 19   DA  n 
20 20   DA  n 
20 21   DT  n 
20 22   DA  n 
20 23   DC  n 
20 24   DT  n 
20 25   DT  n 
20 26   DT  n 
20 27   DT  n 
20 28   DT  n 
20 29   DC  n 
20 30   DT  n 
20 31   DG  n 
20 32   DT  n 
20 33   DA  n 
20 34   DT  n 
20 35   DT  n 
20 36   DT  n 
20 37   DT  n 
20 38   DT  n 
20 39   DT  n 
20 40   DT  n 
20 41   DT  n 
20 42   DT  n 
20 43   DT  n 
20 44   DT  n 
20 45   DT  n 
20 46   DT  n 
20 47   DT  n 
20 48   DT  n 
20 49   DT  n 
20 50   DA  n 
20 51   DA  n 
20 52   DA  n 
20 53   DT  n 
20 54   DG  n 
20 55   DA  n 
20 56   DC  n 
20 57   DT  n 
20 58   DC  n 
20 59   DC  n 
20 60   DA  n 
20 61   DT  n 
20 62   DG  n 
20 63   DG  n 
20 64   DC  n 
20 65   DC  n 
20 66   DA  n 
20 67   DA  n 
20 68   DG  n 
20 69   DT  n 
20 70   DT  n 
20 71   DG  n 
21 1    DC  n 
21 2    DA  n 
21 3    DA  n 
21 4    DC  n 
21 5    DT  n 
21 6    DT  n 
21 7    DG  n 
21 8    DG  n 
21 9    DC  n 
21 10   DC  n 
21 11   DA  n 
21 12   DT  n 
21 13   DG  n 
21 14   DG  n 
21 15   DA  n 
21 16   DG  n 
21 17   DT  n 
21 18   DC  n 
21 19   DA  n 
21 20   DT  n 
21 21   DT  n 
21 22   DT  n 
21 23   DT  n 
21 24   DA  n 
21 25   DT  n 
21 26   DC  n 
21 27   DT  n 
21 28   DT  n 
21 29   DG  n 
21 30   DT  n 
21 31   DG  n 
21 32   DT  n 
21 33   DC  n 
21 34   DA  n 
21 35   DC  n 
21 36   DT  n 
21 37   DT  n 
21 38   DT  n 
21 39   DT  n 
21 40   DA  n 
21 41   DC  n 
21 42   DA  n 
21 43   DG  n 
21 44   DA  n 
21 45   DA  n 
21 46   DA  n 
21 47   DA  n 
21 48   DA  n 
21 49   DG  n 
21 50   DT  n 
21 51   DA  n 
21 52   DT  n 
21 53   DT  n 
21 54   DA  n 
21 55   DC  n 
21 56   DT  n 
21 57   DA  n 
21 58   DA  n 
21 59   DT  n 
21 60   DA  n 
21 61   DT  n 
21 62   DA  n 
21 63   DT  n 
21 64   DG  n 
21 65   DT  n 
21 66   DT  n 
21 67   DG  n 
21 68   DA  n 
21 69   DA  n 
21 70   DA  n 
21 71   DA  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
18 1 sample 'Biological sequence' 1   382 
;Baker's yeast
;
? 'BRF1, PCF4, TDS4, YGR246C'  ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 2 sample 'Biological sequence' 383 566 
;Baker's yeast
;
? 'SPT15, BTF1, TBP1, YER148W' ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 3 sample 'Biological sequence' 567 736 
;Baker's yeast
;
? 'BRF1, PCF4, TDS4, YGR246C'  ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample 'Biological sequence' 1   316 
;Baker's yeast
;
? 'BDP1, TFC5, YNL039W, N2682' ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 2 sample 'Biological sequence' 317 359 
;Baker's yeast
;
? ?                            ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 3 sample 'Biological sequence' 360 594 
;Baker's yeast
;
? 'BDP1, TFC5, YNL039W, N2682' ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1  1460 
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 1  1149 
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1  335  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1  161  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1  215  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1  155  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1  212  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1  146  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1  110  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1  70   
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1  142  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1  70   
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1  282  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample 1  422  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample 1  654  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample 1  317  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample 1  70   
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 2 sample 71 89   
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 3 sample 90 251  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
20 1 sample 1 71 'Saccharomyces cerevisiae S288c' ? 559292 ? 
21 1 sample 1 71 'Saccharomyces cerevisiae S288c' ? 559292 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP RPC1_YEAST  P04051 ? 1  
;MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHGNLASCHGH
FGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGAL
NGVVKKAAAGAGSAALKIIHDTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQ
LTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK
VLTYPEKVTRYNRHKLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL
HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITG
SYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKS
LPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNWNAPLIMATCGSK
GSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTA
ETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM
ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQ
GIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT
LGVPRIKEIINASKVISTPIINAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL
TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLRRALPDVVVKGLPDISR
AVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGD
VMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD
LVPKRCLFESLSNEAALKAN
;
1   
2  UNP RPC2_YEAST  P22276 ? 2  
;MVAATKRRKTHIHKHVKDEAFDDLLKPVYKGKKLTDEINTAQDKWHLLPAFLKVKGLVKQHLDSFNYFVDTDLKKIIKAN
QLILSDVDPEFYLKYVDIRVGKKSSSSTKDYLTPPHECRLRDMTYSAPIYVDIEYTRGRNIIMHKDVEIGRMPIMLRSNK
CILYDADESKMAKLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKGIVQASVTSSTHERKSKTYVITKNGKI
YLKHNSIAEEIPIAIVLKACGILSDLEIMQLVCGNDSSYQDIFAVNLEESSKLDIYTQQQALEYIGAKVKTMRRQKLTIL
QEGIEAIATTVIAHLTVEALDFREKALYIAMMTRRVVMAMYNPKMIDDRDYVGNKRLELAGQLISLLFEDLFKKFNNDFK
LSIDKVLKKPNRAMEYDALLSINVHSNNITSGLNRAISTGNWSLKRFKMERAGVTHVLSRLSYISALGMMTRISSQFEKS
RKVSGPRALQPSQFGMLCTADTPEGEACGLVKNLALMTHITTDDEEEPIKKLCYVLGVEDITLIDSASLHLNYGVYLNGT
LIGSIRFPTKFVTQFRHLRRTGKVSEFISIYSNSHQMAVHIATDGGRICRPLIIVSDGQSRVKDIHLRKLLDGELDFDDF
LKLGLVEYLDVNEENDSYIALYEKDIVPSMTHLEIEPFTILGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKR
IDTLLYLMTYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCETRRKTTTVLKRYAN
HTQDIIGGMRVDENGDPIWQHQSLGPDGLGEVGMKVQSGQIYINKSVPTNSADAPNPNNVNVQTQYREAPVIYRGPEPSH
IDQVMMSVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDMPFNDQGIVPDIIMNPHGFPSRMTVGKMIE
LISGKAGVLNGTLEYGTCFGGSKLEDMSKILVDQGFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARAR
GPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCDKCGLMGYSGWCTTCKSAENIIKMT
IPYAAKLLFQELLSMNIAPRLRLEDIFQQ
;
1   
3  UNP RPAC1_YEAST P07703 ? 3  
;MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAA
EYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNA
HVYARDLKFEPQGRQSTTFADCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIK
GESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRI
LKNKAEYLKNCPITQ
;
1   
4  UNP RPC9_YEAST  P47076 ? 4  
;MKVLEERNAFLSDYEVLKFLTDLEKKHLWDQKSLAALKKSRSKGKQNRPYNHPELQGITRNVVNYLSINKNFINQEDEGE
ERESSGAKDAEKSGISKMSDESFAELMTKLNSFKLFKAEKLQIVNQLPANMVHLYSIVEECDARFDEKTIEEMLEIISGY
A
;
1   
5  UNP RPAB1_YEAST P20434 ? 5  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
1   
6  UNP RPAB2_YEAST P20435 ? 6  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
1   
7  UNP RPC8_YEAST  P35718 ? 7  
;MFILSKIADLVRIPPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQLKPGDGSSYINVTFRAVVFKPF
LGEIVTGWISKCTAEGIKVSLLGIFDDIFIPQNMLFEGCYYTPEESAWIWPMDEETKLYFDVNEKIRFRIEREVFVDVKP
KSPKERELEERAQLENEIEGKNEETPQNEKPPAYALLGSCQTDGMGLVSWWE
;
1   
8  UNP RPAB3_YEAST P20436 ? 8  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
1   
9  UNP RPC10_YEAST Q04307 ? 9  
;MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWDNVDQTKTQCPNYDTCGGESA
YFFQLQIRSADEPMTTFYKCVNCGHRWKEN
;
1   
10 UNP RPAB5_YEAST P22139 ? 10 MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 1   
11 UNP RPAC2_YEAST P28000 ? 11 
;MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVI
MKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM
;
1   
12 UNP RPAB4_YEAST P40422 ? 12 MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 1   
13 UNP RPC5_YEAST  P36121 ? 13 
;MSIDNKLFVTEEDEEDRTQDRADVEDESNDIDMIADENGTNSAIANEQEEKSEEVKAEDDTGEEEEDDPVIEEFPLKISG
EEESLHVFQYANRPRLVGRKPAEHPFISAARYKPKSHLWEIDIPLDEQAFYNKDKAESEWNGVNVQTLKGVGVENNGQYA
AFVKDMQVYLVPIERVAQLKPFFKYIDDANVTRKQEDARRNPNPSSQRAQVVTMSVKSVNDPSQNRLTGSLLAHKVADEE
ANIELTWAEGTFEQFKDTIVKEAEDKTLVALEKQEDYIDNLV
;
1   
14 UNP RPC4_YEAST  P25441 ? 14 
;MSSNKGNGRLPSLKDSSSNGGGSAKPSLKFKPKAVARKSKEEREAAASKVKLEEESKRGNDKKHFNNKNKRVTGAGGQQR
RMAKYLNNTHVISSGPLAAGNFVSEKGDLRRGFIKSEGSGSSLVQKGLETIDNGAESSENEAEDDDNEGVASKSKKKFNM
GKEFEARNLIEDEDDGESEKSSDVDMDDEEWRSKRIEQLFPVRPVRVRHEDVETVKREIQEALSEKPTREPTPSVKTEPV
GTGLQSYLEERERQVNEKLADLGLEKEFQSVDGKEAAAELELLNADHQHILRKLKKMNNKPERFMVFQLPTRLPAFERPA
VKEEKEDMETQASDPSKKKKNIKKKDTKDALSTRELAGKVGSIRVHKSGKLSVKIGNVVMDIGKGAETTFLQDVIALSIA
DDASSAELLGRVDGKIVVTPQI
;
1   
15 UNP RPC3_YEAST  P32349 ? 15 
;MDELLGEALSAENQTGESTVESEKLVTPEDVMTISSLEQRTLNPDLFLYKELVKAHLGERAASVIGMLVALGRLSVRELV
EKIDGMDVDSVKTTLVSLTQLRCVKYLQETAISGKKTTYYYYNEEGIHILLYSGLIIDEIITQMRVNDEEEHKQLVAEIV
QNVISLGSLTVEDYLSSVTSDSMKYTISSLFVQLCEMGYLIQISKLHYTPIEDLWQFLYEKHYKNIPRNSPLSDLKKRSQ
AKMNAKTDFAKIINKPNELSQILTVDPKTSLRIVKPTVSLTINLDRFMKGRRSKQLINLAKTRVGSVTAQVYKIALRLTE
QKSPKIRDPLTQTGLLQDLEEAKSFQDEAELVEEKTPGLTFNAIDLARHLPAELDLRGSLLSRKPSDNKKRSGSNAAASL
PSKKLKTEDGFVIPALPAAVSKSLQESGDTQEEDEEEEDLDADTEDPHSASLINSHLKILASSNFPFLNETKPGVYYVPY
SKLMPVLKSSVYEYVIASTLGPSAMRLSRCIRDNKLVSEKIINSTALMKEKDIRSTLASLIRYNSVEIQEVPRTADRSAS
RAVFLFRCKETHSYNFMRQNLEWNMANLLFKKEKLKQENSTLLKKANRDDVKGRENELLLPSELNQLKMVNERELNVFAR
LSRLLSLWEVFQMA
;
1   
16 UNP RPC6_YEAST  P32910 ? 16 
;MSGMIENGLQLSDNAKTLHSQMMSKGIGALFTQQELQKQMGIGSLTDLMSIVQELLDKNLIKLVKQNDELKFQGVLESEA
QKKATMSAEEALVYSYIEASGREGIWSKTIKARTNLHQHVVLKCLKSLESQRYVKSVKSVKFPTRKIYMLYSLQPSVDIT
GGPWFTDGELDIEFINSLLTIVWRFISENTFPNGFKNFENGPKKNVFYAPNVKNYSTTQEILEFITAAQVANVELTPSNI
RSLCEVLVYDDKLEKVTHDCYRVTLESILQMNQGEGEPEAGNKALEDEEEFSIFNYFKMFPASKHDKEVVYFDEWTI
;
1   
17 UNP RPC7_YEAST  P17890 ? 17 MSSYRGGSRGGGSNYMSNLPFGLGYGDVGKNHITEFPSIPLPINGPITNKERSLAVKYINFGKTVKDGPF 1   
18 PDB 6CNB        6CNB   ? 17 ? 71  
19 UNP RPC7_YEAST  P17890 ? 17 
;RKPNIILDEDDTNDGIERYSDKYLKKRKIGISIDDHPYNLNLFPNELYNVMGINKKKLLAISKFNNADDVFTGTGLQDEN
IGLSMLAKLKELAEDVDDASTGDGAAKGSKTGEGEDDDLADDDFEEDEDEEDDDDYNAEKYFNNGDDDDYGDEEDPNEEA
AF
;
90  
20 UNP TF3B_YEAST  P29056 ? 18 
;MPVCKNCHGTEFERDLSNANNDLVCKACGVVSEDNPIVSEVTFGETSAGAAVVQGSFIGAGQSHAAFGGSSALESREATL
NNARRKLRAVSYALHIPEYITDAAFQWYKLALANNFVQGRRSQNVIASCLYVACRKEKTHHMLIDFSSRLQVSVYSIGAT
FLKMVKKLHITELPLADPSLFIQHFAEKLDLADKKIKVVKDAVKLAQRMSKDWMFEGRRPAGIAGACILLACRMNNLRRT
HTEIVAVSHVAEETLQQRLNEFKNTKAAKLSVQKFRENDVEDGEARPPSFVKNRKKERKIKDSLDKEEMFQTSEEALNKN
PILTQVLGEQELSSKEVLFYLKQFSERRARVVERIKATNGIDGENIYHEGSENETRKRKLSE
;
1   
21 UNP TBP_YEAST   P13393 ? 18 
;SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYA
RIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQR
EEIYQAFEAIYPVLSEFRKM
;
61  
22 UNP TF3B_YEAST  P29056 ? 18 
;CPRNLHLLPTTDTYLSKVSDDPDNLEDVDDEELNAHLLNEEASKLKERIWIGLNADFLLEQESKRLKQEADIATGNTSVK
KKRTRRRNNTRSDEPTKTVDAAAAIGLMSDLQDKSGLHAALKAAEESGDFTTADSVKNMLQKASFSKKINYDAIDGLFR
;
438 
23 UNP TFC5_YEAST  P46678 ? 19 
;MSSIVNKSGTRFAPKVRQRRAATGGTPTPKPRTPQLFIPESKEIEEDNSDNDKGVDENETAIVEKPSLVGERSLEGFTLT
GTNGHDNEIGDEGPIDASTQNPKADVIEDNVTLKPAPLQTHRDQKVPRSSRLASLSKDNESRPSFKPSFLDSSSNSNGTA
RRLSTISNKLPKKIRLGSITENDMNLKTFKRHRVLGKPSSAKKPAGAHRISIVSKISPPTAMTDSLDRNEFSSETSTSRE
ADENENYVISKVKDIPKKVRDGESAKYFIDEENFTMAELCKPNFPIGQISENFEKSKMAKKAKLEKRRHLRELRMR
;
1   
24 PDB 6CNB        6CNB   ? 19 ? 317 
25 UNP TFC5_YEAST  P46678 ? 19 
;TAIQLKLNPDGTMAIDEETMVVDRHKNASIENEYKEKVDENPFANLYNYGSYGRGSYTDPWTVEEMIKFYKALSMWGTDF
NLISQLYPYRSRKQVKAKFVNEEKKRPILIELALRSKLPPNFDEYCCEIKKNIGTVADFNEKLIELQNEHKHHMKEIEEA
KNTAKEEDQTAQRLNDANLNKKGSGGIMTNDLKVYRKTEVVLGTIDDLKRKKLKERNNDDNEDNEGSEEEPEIDQ
;
360 
26 PDB 6CNB        6CNB   ? 20 ? 1   
27 PDB 6CNB        6CNB   ? 21 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6CNB A 1   ? 1460 ? P04051 1    ? 1460 ? 1    1460 
2  2  6CNB B 1   ? 1149 ? P22276 1    ? 1149 ? 1    1149 
3  3  6CNB C 1   ? 335  ? P07703 1    ? 335  ? 1    335  
4  4  6CNB D 1   ? 161  ? P47076 1    ? 161  ? 1    161  
5  5  6CNB E 1   ? 215  ? P20434 1    ? 215  ? 1    215  
6  6  6CNB F 1   ? 155  ? P20435 1    ? 155  ? 1    155  
7  7  6CNB G 1   ? 212  ? P35718 1    ? 212  ? 1    212  
8  8  6CNB H 1   ? 146  ? P20436 1    ? 146  ? 1    146  
9  9  6CNB I 1   ? 110  ? Q04307 1    ? 110  ? 1    110  
10 10 6CNB J 1   ? 70   ? P22139 1    ? 70   ? 1    70   
11 11 6CNB K 1   ? 142  ? P28000 1    ? 142  ? 1    142  
12 12 6CNB L 1   ? 70   ? P40422 1    ? 70   ? 1    70   
13 13 6CNB M 1   ? 282  ? P36121 1    ? 282  ? 1    282  
14 14 6CNB N 1   ? 422  ? P25441 1    ? 422  ? 1    422  
15 15 6CNB O 1   ? 654  ? P32349 1    ? 654  ? 1    654  
16 16 6CNB P 1   ? 317  ? P32910 1    ? 317  ? 1    317  
17 17 6CNB Q 1   ? 70   ? P17890 1    ? 70   ? 1    70   
18 18 6CNB Q 71  ? 89   ? 6CNB   1070 ? 1088 ? 1070 1088 
19 19 6CNB Q 90  ? 251  ? P17890 90   ? 251  ? 1089 1250 
20 20 6CNB R 1   ? 382  ? P29056 1    ? 382  ? 1    382  
21 21 6CNB R 387 ? 566  ? P13393 61   ? 240  ? 387  566  
22 22 6CNB R 578 ? 736  ? P29056 438  ? 596  ? 578  736  
23 23 6CNB S 1   ? 316  ? P46678 1    ? 316  ? -39  276  
24 24 6CNB S 317 ? 359  ? 6CNB   277  ? 319  ? 277  319  
25 25 6CNB S 360 ? 594  ? P46678 360  ? 594  ? 360  594  
26 26 6CNB X 1   ? 71   ? 6CNB   1    ? 71   ? 1    71   
27 27 6CNB Y 1   ? 71   ? 6CNB   -1   ? 69   ? -1   69   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
20 6CNB ALA R 383 ? UNP P29056 ?   ?   linker                383 1  
20 6CNB MET R 384 ? UNP P29056 ?   ?   linker                384 2  
20 6CNB PRO R 385 ? UNP P29056 ?   ?   linker                385 3  
20 6CNB TRP R 386 ? UNP P29056 ?   ?   linker                386 4  
21 6CNB GLY R 567 ? UNP P13393 ?   ?   linker                567 5  
21 6CNB SER R 568 ? UNP P13393 ?   ?   linker                568 6  
21 6CNB GLY R 569 ? UNP P13393 ?   ?   linker                569 7  
21 6CNB SER R 570 ? UNP P13393 ?   ?   linker                570 8  
21 6CNB GLY R 571 ? UNP P13393 ?   ?   linker                571 9  
21 6CNB SER R 572 ? UNP P13393 ?   ?   linker                572 10 
21 6CNB GLY R 573 ? UNP P13393 ?   ?   linker                573 11 
21 6CNB SER R 574 ? UNP P13393 ?   ?   linker                574 12 
21 6CNB GLY R 575 ? UNP P13393 ?   ?   linker                575 13 
21 6CNB SER R 576 ? UNP P13393 ?   ?   linker                576 14 
21 6CNB GLY R 577 ? UNP P13393 ?   ?   linker                577 15 
22 6CNB SER R 578 ? UNP P29056 CYS 438 'engineered mutation' 578 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
UNK 'L-peptide linking' . UNKNOWN                              ? 'C4 H9 N O2'      103.120 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CNB 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6CNB 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.008  ? 48942 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 1.162  ? 66562 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 10.014 ? 40378 ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.054  ? 7529  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.006  ? 8165  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6CNB 
_struct.title                        'Yeast RNA polymerase III initial transcribing complex' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase III subunit RPC1, DNA-directed RNA polymerase III subunit RPC2, DNA-directed RNA polymerases I and III subunit RPAC1, DNA-directed RNA polymerase III subunit RPC9, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerase III subunit RPC8, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase III subunit RPC10, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerases I and III subunit RPAC2, DNA-directed RNA polymerases I, II, and III subunit RPABC4, DNA-directed RNA polymerase III subunit RPC5, DNA-directed RNA polymerase III subunit RPC4, DNA-directed RNA polymerase III subunit RPC3, DNA-directed RNA polymerase III subunit RPC6, DNA-directed RNA polymerase III subunit RPC7,DNA-directed RNA polymerase III subunit RPC7,DNA-directed RNA polymerase III subunit RPC7, Transcription factor IIIB 70 kDa subunit, Transcription factor TFIIIB component B'',Transcription factor TFIIIB component B'',Transcription factor TFIIIB component B''/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CNB 
_struct_keywords.text            'RNA polymerase III, TFIIIB, tRNA, TRANSCRIPTION, transcription-dna complex' 
_struct_keywords.pdbx_keywords   transcription/dna 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 22 ? 
X  N N 22 ? 
Y  N N 22 ? 
Z  N N 22 ? 
AA N N 22 ? 
BA N N 22 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER A 22   ? ALA A 28   ? SER A 22   ALA A 28   1 ? 7  
HELX_P HELX_P2   AA2 ASP A 38   ? LEU A 42   ? ASP A 38   LEU A 42   5 ? 5  
HELX_P HELX_P3   AA3 GLY A 72   ? CYS A 77   ? GLY A 72   CYS A 77   1 ? 6  
HELX_P HELX_P4   AA4 TYR A 95   ? LEU A 103  ? TYR A 95   LEU A 103  1 ? 9  
HELX_P HELX_P5   AA5 SER A 116  ? ARG A 128  ? SER A 116  ARG A 128  1 ? 13 
HELX_P HELX_P6   AA6 ASP A 133  ? LYS A 150  ? ASP A 133  LYS A 150  1 ? 18 
HELX_P HELX_P7   AA7 ALA A 191  ? ALA A 206  ? ALA A 191  ALA A 206  1 ? 16 
HELX_P HELX_P8   AA8 ASN A 223  ? LYS A 232  ? ASN A 223  LYS A 232  1 ? 10 
HELX_P HELX_P9   AA9 ASP A 238  ? LEU A 242  ? ASP A 238  LEU A 242  5 ? 5  
HELX_P HELX_P10  AB1 ASP A 284  ? GLY A 302  ? ASP A 284  GLY A 302  1 ? 19 
HELX_P HELX_P11  AB2 SER A 308  ? ASN A 328  ? SER A 308  ASN A 328  1 ? 21 
HELX_P HELX_P12  AB3 ASP A 396  ? LYS A 400  ? ASP A 396  LYS A 400  1 ? 5  
HELX_P HELX_P13  AB4 ASN A 412  ? GLY A 423  ? ASN A 412  GLY A 423  1 ? 12 
HELX_P HELX_P14  AB5 ASN A 501  ? THR A 506  ? ASN A 501  THR A 506  5 ? 6  
HELX_P HELX_P15  AB6 THR A 524  ? GLY A 536  ? THR A 524  GLY A 536  1 ? 13 
HELX_P HELX_P16  AB7 VAL A 537  ? LEU A 541  ? VAL A 537  LEU A 541  5 ? 5  
HELX_P HELX_P17  AB8 GLN A 555  ? HIS A 566  ? GLN A 555  HIS A 566  1 ? 12 
HELX_P HELX_P18  AB9 ASP A 572  ? MET A 583  ? ASP A 572  MET A 583  1 ? 12 
HELX_P HELX_P19  AC1 THR A 605  ? LYS A 615  ? THR A 605  LYS A 615  1 ? 11 
HELX_P HELX_P20  AC2 LYS A 666  ? GLY A 670  ? LYS A 666  GLY A 670  5 ? 5  
HELX_P HELX_P21  AC3 SER A 676  ? GLY A 686  ? SER A 676  GLY A 686  1 ? 11 
HELX_P HELX_P22  AC4 GLY A 686  ? GLY A 709  ? GLY A 686  GLY A 709  1 ? 24 
HELX_P HELX_P23  AC5 GLY A 713  ? THR A 718  ? GLY A 713  THR A 718  1 ? 6  
HELX_P HELX_P24  AC6 ASP A 722  ? LYS A 747  ? ASP A 722  LYS A 747  1 ? 26 
HELX_P HELX_P25  AC7 GLN A 760  ? GLU A 784  ? GLN A 760  GLU A 784  1 ? 25 
HELX_P HELX_P26  AC8 ASN A 789  ? MET A 794  ? ASN A 789  MET A 794  1 ? 6  
HELX_P HELX_P27  AC9 SER A 802  ? ALA A 811  ? SER A 802  ALA A 811  1 ? 10 
HELX_P HELX_P28  AD1 SER A 857  ? GLU A 894  ? SER A 857  GLU A 894  1 ? 38 
HELX_P HELX_P29  AD2 GLU A 927  ? GLN A 931  ? GLU A 927  GLN A 931  5 ? 5  
HELX_P HELX_P30  AD3 ASN A 934  ? PHE A 947  ? ASN A 934  PHE A 947  1 ? 14 
HELX_P HELX_P31  AD4 TYR A 957  ? VAL A 975  ? TYR A 957  VAL A 975  1 ? 19 
HELX_P HELX_P32  AD5 TYR A 998  ? ARG A 1026 ? TYR A 998  ARG A 1026 1 ? 29 
HELX_P HELX_P33  AD6 ASN A 1051 ? TYR A 1060 ? ASN A 1051 TYR A 1060 1 ? 10 
HELX_P HELX_P34  AD7 GLU A 1064 ? ALA A 1081 ? GLU A 1064 ALA A 1081 1 ? 18 
HELX_P HELX_P35  AD8 ALA A 1088 ? GLU A 1099 ? ALA A 1088 GLU A 1099 1 ? 12 
HELX_P HELX_P36  AD9 GLY A 1122 ? ALA A 1132 ? GLY A 1122 ALA A 1132 1 ? 11 
HELX_P HELX_P37  AE1 ARG A 1152 ? VAL A 1161 ? ARG A 1152 VAL A 1161 1 ? 10 
HELX_P HELX_P38  AE2 LEU A 1165 ? ALA A 1170 ? LEU A 1165 ALA A 1170 1 ? 6  
HELX_P HELX_P39  AE3 ASP A 1189 ? LEU A 1196 ? ASP A 1189 LEU A 1196 1 ? 8  
HELX_P HELX_P40  AE4 ILE A 1202 ? SER A 1213 ? ILE A 1202 SER A 1213 1 ? 12 
HELX_P HELX_P41  AE5 LYS A 1214 ? LYS A 1216 ? LYS A 1214 LYS A 1216 5 ? 3  
HELX_P HELX_P42  AE6 ASN A 1254 ? LEU A 1267 ? ASN A 1254 LEU A 1267 1 ? 14 
HELX_P HELX_P43  AE7 ARG A 1301 ? THR A 1306 ? ARG A 1301 THR A 1306 1 ? 6  
HELX_P HELX_P44  AE8 HIS A 1318 ? SER A 1324 ? HIS A 1318 SER A 1324 1 ? 7  
HELX_P HELX_P45  AE9 ILE A 1328 ? HIS A 1346 ? ILE A 1328 HIS A 1346 1 ? 19 
HELX_P HELX_P46  AF1 VAL A 1350 ? TYR A 1364 ? VAL A 1350 TYR A 1364 1 ? 15 
HELX_P HELX_P47  AF2 LYS A 1391 ? MET A 1403 ? LYS A 1391 MET A 1403 1 ? 13 
HELX_P HELX_P48  AF3 GLU A 1413 ? GLY A 1418 ? GLU A 1413 GLY A 1418 1 ? 6  
HELX_P HELX_P49  AF4 ILE A 1423 ? PHE A 1428 ? ILE A 1423 PHE A 1428 5 ? 6  
HELX_P HELX_P50  AF5 SER A 1437 ? LEU A 1441 ? SER A 1437 LEU A 1441 5 ? 5  
HELX_P HELX_P51  AF6 LEU A 1447 ? GLU A 1454 ? LEU A 1447 GLU A 1454 1 ? 8  
HELX_P HELX_P52  AF7 GLN B 42   ? TRP B 45   ? GLN B 42   TRP B 45   5 ? 4  
HELX_P HELX_P53  AF8 HIS B 46   ? LYS B 55   ? HIS B 46   LYS B 55   1 ? 10 
HELX_P HELX_P54  AF9 LYS B 59   ? THR B 71   ? LYS B 59   THR B 71   1 ? 13 
HELX_P HELX_P55  AG1 THR B 71   ? ASN B 80   ? THR B 71   ASN B 80   1 ? 10 
HELX_P HELX_P56  AG2 PRO B 114  ? ARG B 121  ? PRO B 114  ARG B 121  1 ? 8  
HELX_P HELX_P57  AG3 SER B 169  ? LEU B 174  ? SER B 169  LEU B 174  1 ? 6  
HELX_P HELX_P58  AG4 PRO B 252  ? CYS B 260  ? PRO B 252  CYS B 260  1 ? 9  
HELX_P HELX_P59  AG5 LEU B 266  ? CYS B 273  ? LEU B 266  CYS B 273  1 ? 8  
HELX_P HELX_P60  AG6 TYR B 279  ? LYS B 292  ? TYR B 279  LYS B 292  1 ? 14 
HELX_P HELX_P61  AG7 GLN B 299  ? VAL B 309  ? GLN B 299  VAL B 309  1 ? 11 
HELX_P HELX_P62  AG8 LYS B 316  ? LEU B 320  ? LYS B 316  LEU B 320  5 ? 5  
HELX_P HELX_P63  AG9 GLU B 325  ? VAL B 331  ? GLU B 325  VAL B 331  1 ? 7  
HELX_P HELX_P64  AH1 PHE B 342  ? ASN B 362  ? PHE B 342  ASN B 362  1 ? 21 
HELX_P HELX_P65  AH2 TYR B 371  ? GLY B 373  ? TYR B 371  GLY B 373  5 ? 3  
HELX_P HELX_P66  AH3 LEU B 379  ? LYS B 409  ? LEU B 379  LYS B 409  1 ? 31 
HELX_P HELX_P67  AH4 LEU B 420  ? HIS B 425  ? LEU B 420  HIS B 425  1 ? 6  
HELX_P HELX_P68  AH5 THR B 430  ? GLY B 440  ? THR B 430  GLY B 440  1 ? 11 
HELX_P HELX_P69  AH6 SER B 462  ? MET B 470  ? SER B 462  MET B 470  1 ? 9  
HELX_P HELX_P70  AH7 GLN B 490  ? PHE B 494  ? GLN B 490  PHE B 494  5 ? 5  
HELX_P HELX_P71  AH8 GLU B 526  ? LEU B 536  ? GLU B 526  LEU B 536  1 ? 11 
HELX_P HELX_P72  AH9 ASP B 540  ? ILE B 544  ? ASP B 540  ILE B 544  5 ? 5  
HELX_P HELX_P73  AI1 PHE B 567  ? ARG B 580  ? PHE B 567  ARG B 580  1 ? 14 
HELX_P HELX_P74  AI2 LEU B 627  ? ASP B 632  ? LEU B 627  ASP B 632  1 ? 6  
HELX_P HELX_P75  AI3 ASP B 639  ? GLY B 644  ? ASP B 639  GLY B 644  1 ? 6  
HELX_P HELX_P76  AI4 VAL B 651  ? SER B 657  ? VAL B 651  SER B 657  1 ? 7  
HELX_P HELX_P77  AI5 GLU B 676  ? ILE B 680  ? GLU B 676  ILE B 680  5 ? 5  
HELX_P HELX_P78  AI6 VAL B 684  ? ILE B 688  ? VAL B 684  ILE B 688  5 ? 5  
HELX_P HELX_P79  AI7 TYR B 690  ? ASN B 694  ? TYR B 690  ASN B 694  5 ? 5  
HELX_P HELX_P80  AI8 GLN B 695  ? ALA B 704  ? GLN B 695  ALA B 704  1 ? 10 
HELX_P HELX_P81  AI9 MET B 705  ? ALA B 709  ? MET B 705  ALA B 709  5 ? 5  
HELX_P HELX_P82  AJ1 ILE B 741  ? LEU B 749  ? ILE B 741  LEU B 749  5 ? 9  
HELX_P HELX_P83  AJ2 SER B 777  ? GLY B 781  ? SER B 777  GLY B 781  5 ? 5  
HELX_P HELX_P84  AJ3 HIS B 947  ? MET B 953  ? HIS B 947  MET B 953  1 ? 7  
HELX_P HELX_P85  AJ4 VAL B 955  ? GLY B 971  ? VAL B 955  GLY B 971  1 ? 17 
HELX_P HELX_P86  AJ5 LYS B 983  ? ASP B 993  ? LYS B 983  ASP B 993  1 ? 11 
HELX_P HELX_P87  AJ6 MET B 1030 ? MET B 1035 ? MET B 1030 MET B 1035 1 ? 6  
HELX_P HELX_P88  AJ7 GLY B 1063 ? GLY B 1074 ? GLY B 1063 GLY B 1074 1 ? 12 
HELX_P HELX_P89  AJ8 SER B 1076 ? LEU B 1083 ? SER B 1076 LEU B 1083 1 ? 8  
HELX_P HELX_P90  AJ9 PRO B 1122 ? MET B 1135 ? PRO B 1122 MET B 1135 1 ? 14 
HELX_P HELX_P91  AK1 ASP C 60   ? GLU C 74   ? ASP C 60   GLU C 74   1 ? 15 
HELX_P HELX_P92  AK2 GLU C 95   ? VAL C 104  ? GLU C 95   VAL C 104  1 ? 10 
HELX_P HELX_P93  AK3 PRO C 121  ? LYS C 125  ? PRO C 121  LYS C 125  5 ? 5  
HELX_P HELX_P94  AK4 THR C 127  ? THR C 131  ? THR C 127  THR C 131  5 ? 5  
HELX_P HELX_P95  AK5 ARG C 165  ? LEU C 167  ? ARG C 165  LEU C 167  5 ? 3  
HELX_P HELX_P96  AK6 ARG C 174  ? ALA C 180  ? ARG C 174  ALA C 180  1 ? 7  
HELX_P HELX_P97  AK7 ILE C 212  ? SER C 220  ? ILE C 212  SER C 220  5 ? 9  
HELX_P HELX_P98  AK8 GLY C 241  ? PHE C 251  ? GLY C 241  PHE C 251  1 ? 11 
HELX_P HELX_P99  AK9 PHE C 285  ? ASP C 287  ? PHE C 285  ASP C 287  5 ? 3  
HELX_P HELX_P100 AL1 THR C 309  ? ASN C 330  ? THR C 309  ASN C 330  1 ? 22 
HELX_P HELX_P101 AL2 TYR D 14   ? HIS D 27   ? TYR D 14   HIS D 27   1 ? 14 
HELX_P HELX_P102 AL3 LEU D 55   ? PHE D 72   ? LEU D 55   PHE D 72   1 ? 18 
HELX_P HELX_P103 AL4 GLU D 101  ? ASN D 111  ? GLU D 101  ASN D 111  1 ? 11 
HELX_P HELX_P104 AL5 LYS D 117  ? ILE D 123  ? LYS D 117  ILE D 123  1 ? 7  
HELX_P HELX_P105 AL6 ASN D 130  ? SER D 136  ? ASN D 130  SER D 136  1 ? 7  
HELX_P HELX_P106 AL7 ASP D 146  ? GLY D 159  ? ASP D 146  GLY D 159  1 ? 14 
HELX_P HELX_P107 AL8 ASP E 2    ? ASP E 25   ? ASP E 2    ASP E 25   1 ? 24 
HELX_P HELX_P108 AL9 THR E 31   ? GLU E 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P109 AM1 PRO E 38   ? CYS E 47   ? PRO E 38   CYS E 47   1 ? 10 
HELX_P HELX_P110 AM2 GLN E 54   ? SER E 59   ? GLN E 54   SER E 59   1 ? 6  
HELX_P HELX_P111 AM3 GLU E 66   ? PHE E 72   ? GLU E 66   PHE E 72   1 ? 7  
HELX_P HELX_P112 AM4 GLY E 89   ? LYS E 103  ? GLY E 89   LYS E 103  1 ? 15 
HELX_P HELX_P113 AM5 THR E 117  ? LEU E 123  ? THR E 117  LEU E 123  1 ? 7  
HELX_P HELX_P114 AM6 ASN E 143  ? HIS E 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P115 AM7 SER E 157  ? ARG E 169  ? SER E 157  ARG E 169  1 ? 13 
HELX_P HELX_P116 AM8 ASP E 182  ? GLY E 189  ? ASP E 182  GLY E 189  1 ? 8  
HELX_P HELX_P117 AM9 THR F 86   ? MET F 103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P118 AN1 ASP F 116  ? ALA F 126  ? ASP F 116  ALA F 126  1 ? 11 
HELX_P HELX_P119 AN2 PRO G 14   ? ARG G 20   ? PRO G 14   ARG G 20   5 ? 7  
HELX_P HELX_P120 AN3 ASP G 21   ? PHE G 34   ? ASP G 21   PHE G 34   1 ? 14 
HELX_P HELX_P121 AN4 SER G 162  ? ARG G 166  ? SER G 162  ARG G 166  5 ? 5  
HELX_P HELX_P122 AN5 LEU G 207  ? TRP G 211  ? LEU G 207  TRP G 211  5 ? 5  
HELX_P HELX_P123 AN6 ARG H 130  ? ASN H 134  ? ARG H 130  ASN H 134  5 ? 5  
HELX_P HELX_P124 AN7 ASP J 16   ? GLU J 27   ? ASP J 16   GLU J 27   1 ? 12 
HELX_P HELX_P125 AN8 ASP J 31   ? LEU J 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P126 AN9 ARG J 43   ? THR J 52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P127 AO1 LEU J 56   ? ARG J 62   ? LEU J 56   ARG J 62   1 ? 7  
HELX_P HELX_P128 AO2 ASP K 69   ? LYS K 82   ? ASP K 69   LYS K 82   1 ? 14 
HELX_P HELX_P129 AO3 THR K 112  ? MET K 142  ? THR K 112  MET K 142  1 ? 31 
HELX_P HELX_P130 AO4 ASN M 132  ? GLU M 139  ? ASN M 132  GLU M 139  1 ? 8  
HELX_P HELX_P131 AO5 LYS M 184  ? GLN M 195  ? LYS M 184  GLN M 195  1 ? 12 
HELX_P HELX_P132 AO6 GLY M 229  ? GLU M 240  ? GLY M 229  GLU M 240  1 ? 12 
HELX_P HELX_P133 AO7 PHE M 252  ? LYS M 261  ? PHE M 252  LYS M 261  1 ? 10 
HELX_P HELX_P134 AO8 GLU N 275  ? LYS N 296  ? GLU N 275  LYS N 296  1 ? 22 
HELX_P HELX_P135 AO9 MET N 297  ? ASN N 299  ? MET N 297  ASN N 299  5 ? 3  
HELX_P HELX_P136 AP1 LEU O 46   ? LEU O 57   ? LEU O 46   LEU O 57   1 ? 12 
HELX_P HELX_P137 AP2 GLY O 58   ? GLY O 72   ? GLY O 58   GLY O 72   1 ? 15 
HELX_P HELX_P138 AP3 SER O 75   ? ASP O 84   ? SER O 75   ASP O 84   1 ? 10 
HELX_P HELX_P139 AP4 ASP O 89   ? LEU O 101  ? ASP O 89   LEU O 101  1 ? 13 
HELX_P HELX_P140 AP5 GLY O 126  ? SER O 133  ? GLY O 126  SER O 133  1 ? 8  
HELX_P HELX_P141 AP6 SER O 133  ? GLU O 139  ? SER O 133  GLU O 139  1 ? 7  
HELX_P HELX_P142 AP7 GLU O 139  ? MET O 144  ? GLU O 139  MET O 144  1 ? 6  
HELX_P HELX_P143 AP8 GLU O 150  ? GLY O 167  ? GLU O 150  GLY O 167  1 ? 18 
HELX_P HELX_P144 AP9 THR O 170  ? VAL O 178  ? THR O 170  VAL O 178  1 ? 9  
HELX_P HELX_P145 AQ1 MET O 183  ? SER O 188  ? MET O 183  SER O 188  1 ? 6  
HELX_P HELX_P146 AQ2 SER O 204  ? TYR O 208  ? SER O 204  TYR O 208  5 ? 5  
HELX_P HELX_P147 AQ3 PRO O 210  ? TYR O 219  ? PRO O 210  TYR O 219  1 ? 10 
HELX_P HELX_P148 AQ4 SER O 233  ? GLU O 258  ? SER O 233  GLU O 258  1 ? 26 
HELX_P HELX_P149 AQ5 LEU O 259  ? THR O 264  ? LEU O 259  THR O 264  1 ? 6  
HELX_P HELX_P150 AQ6 LEU O 284  ? VAL O 304  ? LEU O 284  VAL O 304  1 ? 21 
HELX_P HELX_P151 AQ7 GLY O 305  ? GLU O 320  ? GLY O 305  GLU O 320  1 ? 16 
HELX_P HELX_P152 AQ8 PRO O 329  ? THR O 333  ? PRO O 329  THR O 333  5 ? 5  
HELX_P HELX_P153 AQ9 GLU O 340  ? VAL O 352  ? GLU O 340  VAL O 352  1 ? 13 
HELX_P HELX_P154 AR1 LYS O 355  ? PHE O 361  ? LYS O 355  PHE O 361  1 ? 7  
HELX_P HELX_P155 AR2 ILE O 453  ? LYS O 458  ? ILE O 453  LYS O 458  1 ? 6  
HELX_P HELX_P156 AR3 ILE O 459  ? SER O 463  ? ILE O 459  SER O 463  5 ? 5  
HELX_P HELX_P157 AR4 LYS O 482  ? SER O 489  ? LYS O 482  SER O 489  1 ? 8  
HELX_P HELX_P158 AR5 GLY O 501  ? ASN O 514  ? GLY O 501  ASN O 514  1 ? 14 
HELX_P HELX_P159 AR6 SER O 518  ? ALA O 526  ? SER O 518  ALA O 526  1 ? 9  
HELX_P HELX_P160 AR7 LYS O 529  ? TYR O 543  ? LYS O 529  TYR O 543  1 ? 15 
HELX_P HELX_P161 AR8 LYS O 569  ? PHE O 576  ? LYS O 569  PHE O 576  1 ? 8  
HELX_P HELX_P162 AR9 ARG O 578  ? MET O 585  ? ARG O 578  MET O 585  1 ? 8  
HELX_P HELX_P163 AS1 ALA O 586  ? ASP O 610  ? ALA O 586  ASP O 610  1 ? 25 
HELX_P HELX_P164 AS2 LEU O 620  ? MET O 653  ? LEU O 620  MET O 653  1 ? 34 
HELX_P HELX_P165 AS3 LEU P 11   ? LYS P 25   ? LEU P 11   LYS P 25   1 ? 15 
HELX_P HELX_P166 AS4 THR P 32   ? MET P 40   ? THR P 32   MET P 40   1 ? 9  
HELX_P HELX_P167 AS5 SER P 44   ? LYS P 58   ? SER P 44   LYS P 58   1 ? 15 
HELX_P HELX_P168 AS6 GLU P 77   ? MET P 86   ? GLU P 77   MET P 86   1 ? 10 
HELX_P HELX_P169 AS7 SER P 87   ? ALA P 99   ? SER P 87   ALA P 99   1 ? 13 
HELX_P HELX_P170 AS8 SER P 100  ? GLY P 104  ? SER P 100  GLY P 104  5 ? 5  
HELX_P HELX_P171 AS9 LYS P 108  ? ASN P 115  ? LYS P 108  ASN P 115  1 ? 8  
HELX_P HELX_P172 AT1 GLN P 118  ? ARG P 132  ? GLN P 118  ARG P 132  1 ? 15 
HELX_P HELX_P173 AT2 ILE P 175  ? PHE P 191  ? ILE P 175  PHE P 191  1 ? 17 
HELX_P HELX_P174 AT3 GLN P 219  ? THR P 226  ? GLN P 219  THR P 226  1 ? 8  
HELX_P HELX_P175 AT4 THR P 236  ? ASP P 250  ? THR P 236  ASP P 250  1 ? 15 
HELX_P HELX_P176 AT5 GLU P 266  ? MET P 271  ? GLU P 266  MET P 271  1 ? 6  
HELX_P HELX_P177 AT6 THR Q 48   ? GLY Q 68   ? THR Q 48   GLY Q 68   1 ? 21 
HELX_P HELX_P178 AT7 UNK Q 85   ? UNK Q 89   ? UNK Q 1084 UNK Q 1088 5 ? 5  
HELX_P HELX_P179 AT8 GLU R 74   ? LEU R 94   ? GLU R 74   LEU R 94   1 ? 21 
HELX_P HELX_P180 AT9 PRO R 97   ? ASN R 114  ? PRO R 97   ASN R 114  1 ? 18 
HELX_P HELX_P181 AU1 ARG R 121  ? GLU R 137  ? ARG R 121  GLU R 137  1 ? 17 
HELX_P HELX_P182 AU2 MET R 142  ? SER R 148  ? MET R 142  SER R 148  1 ? 7  
HELX_P HELX_P183 AU3 TYR R 155  ? LEU R 168  ? TYR R 155  LEU R 168  1 ? 14 
HELX_P HELX_P184 AU4 ASP R 177  ? LEU R 189  ? ASP R 177  LEU R 189  1 ? 13 
HELX_P HELX_P185 AU5 ASP R 193  ? ASP R 212  ? ASP R 193  ASP R 212  1 ? 20 
HELX_P HELX_P186 AU6 ARG R 219  ? ASN R 235  ? ARG R 219  ASN R 235  1 ? 17 
HELX_P HELX_P187 AU7 HIS R 241  ? HIS R 249  ? HIS R 241  HIS R 249  1 ? 9  
HELX_P HELX_P188 AU8 ALA R 251  ? ASN R 264  ? ALA R 251  ASN R 264  1 ? 14 
HELX_P HELX_P189 AU9 SER R 289  ? GLU R 297  ? SER R 289  GLU R 297  1 ? 9  
HELX_P HELX_P190 AV1 ASP R 407  ? ALA R 412  ? ASP R 407  ALA R 412  1 ? 6  
HELX_P HELX_P191 AV2 GLU R 455  ? ILE R 472  ? GLU R 455  ILE R 472  1 ? 18 
HELX_P HELX_P192 AV3 ARG R 497  ? GLY R 506  ? ARG R 497  GLY R 506  1 ? 10 
HELX_P HELX_P193 AV4 GLN R 545  ? SER R 561  ? GLN R 545  SER R 561  1 ? 17 
HELX_P HELX_P194 AV5 THR R 587  ? LYS R 594  ? THR R 587  LYS R 594  1 ? 8  
HELX_P HELX_P195 AV6 GLU R 608  ? LEU R 614  ? GLU R 608  LEU R 614  1 ? 7  
HELX_P HELX_P196 AV7 ASN R 616  ? ASP R 648  ? ASN R 616  ASP R 648  1 ? 33 
HELX_P HELX_P197 AV8 UNK S 332  ? UNK S 357  ? UNK S 292  UNK S 317  1 ? 26 
HELX_P HELX_P198 AV9 ARG S 383  ? TYR S 393  ? ARG S 383  TYR S 393  1 ? 11 
HELX_P HELX_P199 AW1 THR S 421  ? TRP S 435  ? THR S 421  TRP S 435  1 ? 15 
HELX_P HELX_P200 AW2 ASP S 438  ? TYR S 446  ? ASP S 438  TYR S 446  1 ? 9  
HELX_P HELX_P201 AW3 SER S 450  ? ARG S 465  ? SER S 450  ARG S 465  1 ? 16 
HELX_P HELX_P202 AW4 ARG S 465  ? SER S 475  ? ARG S 465  SER S 475  1 ? 11 
HELX_P HELX_P203 AW5 ASN S 480  ? CYS S 486  ? ASN S 480  CYS S 486  1 ? 7  
HELX_P HELX_P204 AW6 THR S 494  ? GLN S 531  ? THR S 494  GLN S 531  1 ? 38 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1   disulf ? ? A CYS 67   SG  ? ? ? 1_555 A  CYS 77 SG ? ? A CYS 67   A CYS 77   1_555 ? ? ? ? ? ? ?                       
2.658 ? 
disulf2   disulf ? ? I CYS 5    SG  ? ? ? 1_555 I  CYS 26 SG ? ? I CYS 5    I CYS 26   1_555 ? ? ? ? ? ? ?                       
2.985 ? 
disulf3   disulf ? ? J CYS 10   SG  ? ? ? 1_555 J  CYS 46 SG ? ? J CYS 10   J CYS 46   1_555 ? ? ? ? ? ? ?                       
2.845 ? 
disulf4   disulf ? ? L CYS 34   SG  ? ? ? 1_555 L  CYS 51 SG ? ? L CYS 34   L CYS 51   1_555 ? ? ? ? ? ? ?                       
2.896 ? 
disulf5   disulf ? ? L CYS 48   SG  ? ? ? 1_555 L  CYS 51 SG ? ? L CYS 48   L CYS 51   1_555 ? ? ? ? ? ? ?                       
2.482 ? 
metalc1   metalc ? ? A CYS 67   SG  ? ? ? 1_555 V  ZN  .  ZN ? ? A CYS 67   A ZN  1501 1_555 ? ? ? ? ? ? ?                       
2.473 ? 
metalc2   metalc ? ? A CYS 70   O   ? ? ? 1_555 V  ZN  .  ZN ? ? A CYS 70   A ZN  1501 1_555 ? ? ? ? ? ? ?                       
2.371 ? 
metalc3   metalc ? ? A CYS 70   SG  ? ? ? 1_555 V  ZN  .  ZN ? ? A CYS 70   A ZN  1501 1_555 ? ? ? ? ? ? ?                       
2.583 ? 
metalc4   metalc ? ? A CYS 77   SG  ? ? ? 1_555 V  ZN  .  ZN ? ? A CYS 77   A ZN  1501 1_555 ? ? ? ? ? ? ?                       
2.562 ? 
metalc5   metalc ? ? A HIS 80   NE2 ? ? ? 1_555 V  ZN  .  ZN ? ? A HIS 80   A ZN  1501 1_555 ? ? ? ? ? ? ?                       
1.830 ? 
metalc6   metalc ? ? A CYS 107  SG  ? ? ? 1_555 W  ZN  .  ZN ? ? A CYS 107  A ZN  1502 1_555 ? ? ? ? ? ? ?                       
2.299 ? 
metalc7   metalc ? ? A CYS 110  SG  ? ? ? 1_555 W  ZN  .  ZN ? ? A CYS 110  A ZN  1502 1_555 ? ? ? ? ? ? ?                       
2.160 ? 
metalc8   metalc ? ? A CYS 154  SG  ? ? ? 1_555 W  ZN  .  ZN ? ? A CYS 154  A ZN  1502 1_555 ? ? ? ? ? ? ?                       
2.306 ? 
metalc9   metalc ? ? A CYS 157  SG  ? ? ? 1_555 W  ZN  .  ZN ? ? A CYS 157  A ZN  1502 1_555 ? ? ? ? ? ? ?                       
2.389 ? 
metalc10  metalc ? ? B CYS 1095 SG  ? ? ? 1_555 X  ZN  .  ZN ? ? B CYS 1095 B ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.487 ? 
metalc11  metalc ? ? B LYS 1097 O   ? ? ? 1_555 X  ZN  .  ZN ? ? B LYS 1097 B ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.547 ? 
metalc12  metalc ? ? B CYS 1098 SG  ? ? ? 1_555 X  ZN  .  ZN ? ? B CYS 1098 B ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.528 ? 
metalc13  metalc ? ? B CYS 1107 SG  ? ? ? 1_555 X  ZN  .  ZN ? ? B CYS 1107 B ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.380 ? 
metalc14  metalc ? ? B CYS 1110 SG  ? ? ? 1_555 X  ZN  .  ZN ? ? B CYS 1110 B ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.657 ? 
metalc15  metalc ? ? I CYS 5    SG  ? ? ? 1_555 Y  ZN  .  ZN ? ? I CYS 5    I ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.557 ? 
metalc16  metalc ? ? I CYS 8    SG  ? ? ? 1_555 Y  ZN  .  ZN ? ? I CYS 8    I ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.614 ? 
metalc17  metalc ? ? I CYS 26   SG  ? ? ? 1_555 Y  ZN  .  ZN ? ? I CYS 26   I ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.357 ? 
metalc18  metalc ? ? I CYS 29   O   ? ? ? 1_555 Y  ZN  .  ZN ? ? I CYS 29   I ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.632 ? 
metalc19  metalc ? ? I CYS 29   SG  ? ? ? 1_555 Y  ZN  .  ZN ? ? I CYS 29   I ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.620 ? 
metalc20  metalc ? ? J CYS 7    SG  ? ? ? 1_555 Z  ZN  .  ZN ? ? J CYS 7    J ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.518 ? 
metalc21  metalc ? ? J CYS 10   SG  ? ? ? 1_555 Z  ZN  .  ZN ? ? J CYS 10   J ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.344 ? 
metalc22  metalc ? ? J CYS 45   SG  ? ? ? 1_555 Z  ZN  .  ZN ? ? J CYS 45   J ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.346 ? 
metalc23  metalc ? ? J CYS 46   N   ? ? ? 1_555 Z  ZN  .  ZN ? ? J CYS 46   J ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.260 ? 
metalc24  metalc ? ? J CYS 46   SG  ? ? ? 1_555 Z  ZN  .  ZN ? ? J CYS 46   J ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.311 ? 
metalc25  metalc ? ? L CYS 31   SG  ? ? ? 1_555 AA ZN  .  ZN ? ? L CYS 31   L ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.497 ? 
metalc26  metalc ? ? L CYS 34   SG  ? ? ? 1_555 AA ZN  .  ZN ? ? L CYS 34   L ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.213 ? 
metalc27  metalc ? ? L CYS 48   SG  ? ? ? 1_555 AA ZN  .  ZN ? ? L CYS 48   L ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.286 ? 
metalc28  metalc ? ? L CYS 51   SG  ? ? ? 1_555 AA ZN  .  ZN ? ? L CYS 51   L ZN  2000 1_555 ? ? ? ? ? ? ?                       
2.258 ? 
metalc29  metalc ? ? R CYS 4    SG  ? ? ? 1_555 BA ZN  .  ZN ? ? R CYS 4    R ZN  1001 1_555 ? ? ? ? ? ? ?                       
2.114 ? 
metalc30  metalc ? ? R CYS 7    SG  ? ? ? 1_555 BA ZN  .  ZN ? ? R CYS 7    R ZN  1001 1_555 ? ? ? ? ? ? ?                       
2.255 ? 
metalc31  metalc ? ? R CYS 25   SG  ? ? ? 1_555 BA ZN  .  ZN ? ? R CYS 25   R ZN  1001 1_555 ? ? ? ? ? ? ?                       
2.268 ? 
metalc32  metalc ? ? R CYS 28   SG  ? ? ? 1_555 BA ZN  .  ZN ? ? R CYS 28   R ZN  1001 1_555 ? ? ? ? ? ? ?                       
2.859 ? 
hydrog1   hydrog ? ? T DT  1    N3  ? ? ? 1_555 U  DA  70 N1 ? ? X DT  1    Y DA  68   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog2   hydrog ? ? T DT  1    O4  ? ? ? 1_555 U  DA  70 N6 ? ? X DT  1    Y DA  68   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog3   hydrog ? ? T DT  1    N3  ? ? ? 1_555 U  DA  71 N1 ? ? X DT  1    Y DA  69   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog4   hydrog ? ? T DT  1    O4  ? ? ? 1_555 U  DA  71 N6 ? ? X DT  1    Y DA  69   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog5   hydrog ? ? T DT  2    N3  ? ? ? 1_555 U  DA  70 N1 ? ? X DT  2    Y DA  68   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog6   hydrog ? ? T DT  2    O4  ? ? ? 1_555 U  DA  70 N6 ? ? X DT  2    Y DA  68   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog7   hydrog ? ? T DT  3    N3  ? ? ? 1_555 U  DA  69 N1 ? ? X DT  3    Y DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog8   hydrog ? ? T DT  3    O4  ? ? ? 1_555 U  DA  69 N6 ? ? X DT  3    Y DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog9   hydrog ? ? T DT  4    N3  ? ? ? 1_555 U  DA  68 N1 ? ? X DT  4    Y DA  66   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog10  hydrog ? ? T DT  4    O4  ? ? ? 1_555 U  DA  68 N6 ? ? X DT  4    Y DA  66   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog11  hydrog ? ? T DC  5    N3  ? ? ? 1_555 U  DG  67 N2 ? ? X DC  5    Y DG  65   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog12  hydrog ? ? T DC  5    O2  ? ? ? 1_555 U  DG  67 N1 ? ? X DC  5    Y DG  65   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog13  hydrog ? ? T DA  6    N1  ? ? ? 1_555 U  DT  66 N3 ? ? X DA  6    Y DT  64   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog14  hydrog ? ? T DA  6    N6  ? ? ? 1_555 U  DT  66 O4 ? ? X DA  6    Y DT  64   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog15  hydrog ? ? T DA  7    N1  ? ? ? 1_555 U  DT  65 N3 ? ? X DA  7    Y DT  63   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog16  hydrog ? ? T DA  7    N6  ? ? ? 1_555 U  DT  65 O4 ? ? X DA  7    Y DT  63   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog17  hydrog ? ? T DC  8    N3  ? ? ? 1_555 U  DG  64 N2 ? ? X DC  8    Y DG  62   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog18  hydrog ? ? T DC  8    O2  ? ? ? 1_555 U  DG  64 N1 ? ? X DC  8    Y DG  62   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog19  hydrog ? ? T DA  9    N1  ? ? ? 1_555 U  DT  63 N3 ? ? X DA  9    Y DT  61   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog20  hydrog ? ? T DA  9    N6  ? ? ? 1_555 U  DT  63 O4 ? ? X DA  9    Y DT  61   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog21  hydrog ? ? T DT  10   N3  ? ? ? 1_555 U  DA  62 N1 ? ? X DT  10   Y DA  60   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog22  hydrog ? ? T DT  10   O4  ? ? ? 1_555 U  DA  62 N6 ? ? X DT  10   Y DA  60   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog23  hydrog ? ? T DA  11   N1  ? ? ? 1_555 U  DT  61 N3 ? ? X DA  11   Y DT  59   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog24  hydrog ? ? T DA  11   N6  ? ? ? 1_555 U  DT  61 O4 ? ? X DA  11   Y DT  59   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog25  hydrog ? ? T DT  12   N3  ? ? ? 1_555 U  DA  60 N1 ? ? X DT  12   Y DA  58   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog26  hydrog ? ? T DT  12   O4  ? ? ? 1_555 U  DA  60 N6 ? ? X DT  12   Y DA  58   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog27  hydrog ? ? T DA  13   N1  ? ? ? 1_555 U  DT  59 N3 ? ? X DA  13   Y DT  57   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog28  hydrog ? ? T DA  13   N6  ? ? ? 1_555 U  DT  59 O4 ? ? X DA  13   Y DT  57   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog29  hydrog ? ? T DT  14   N3  ? ? ? 1_555 U  DA  58 N1 ? ? X DT  14   Y DA  56   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog30  hydrog ? ? T DT  14   O4  ? ? ? 1_555 U  DA  58 N6 ? ? X DT  14   Y DA  56   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog31  hydrog ? ? T DT  15   N3  ? ? ? 1_555 U  DA  57 N1 ? ? X DT  15   Y DA  55   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog32  hydrog ? ? T DT  15   O4  ? ? ? 1_555 U  DA  57 N6 ? ? X DT  15   Y DA  55   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog33  hydrog ? ? T DA  16   N1  ? ? ? 1_555 U  DT  56 N3 ? ? X DA  16   Y DT  54   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog34  hydrog ? ? T DA  16   N6  ? ? ? 1_555 U  DT  56 O4 ? ? X DA  16   Y DT  54   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog35  hydrog ? ? T DG  17   N1  ? ? ? 1_555 U  DC  55 N3 ? ? X DG  17   Y DC  53   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog36  hydrog ? ? T DG  17   N2  ? ? ? 1_555 U  DC  55 O2 ? ? X DG  17   Y DC  53   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog37  hydrog ? ? T DG  17   O6  ? ? ? 1_555 U  DC  55 N4 ? ? X DG  17   Y DC  53   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog38  hydrog ? ? T DT  18   N3  ? ? ? 1_555 U  DA  54 N1 ? ? X DT  18   Y DA  52   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog39  hydrog ? ? T DT  18   O4  ? ? ? 1_555 U  DA  54 N6 ? ? X DT  18   Y DA  52   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog40  hydrog ? ? T DA  19   N1  ? ? ? 1_555 U  DT  53 N3 ? ? X DA  19   Y DT  51   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog41  hydrog ? ? T DA  19   N6  ? ? ? 1_555 U  DT  53 O4 ? ? X DA  19   Y DT  51   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog42  hydrog ? ? T DA  20   N1  ? ? ? 1_555 U  DT  52 N3 ? ? X DA  20   Y DT  50   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog43  hydrog ? ? T DA  20   N6  ? ? ? 1_555 U  DT  52 O4 ? ? X DA  20   Y DT  50   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog44  hydrog ? ? T DT  21   N3  ? ? ? 1_555 U  DA  51 N1 ? ? X DT  21   Y DA  49   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog45  hydrog ? ? T DT  21   O4  ? ? ? 1_555 U  DA  51 N6 ? ? X DT  21   Y DA  49   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog46  hydrog ? ? T DA  22   N1  ? ? ? 1_555 U  DG  49 N1 ? ? X DA  22   Y DG  47   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? 
? 
hydrog47  hydrog ? ? T DA  22   N6  ? ? ? 1_555 U  DG  49 O6 ? ? X DA  22   Y DG  47   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? 
? 
hydrog48  hydrog ? ? T DA  22   N1  ? ? ? 1_555 U  DT  50 N3 ? ? X DA  22   Y DT  48   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog49  hydrog ? ? T DA  22   N6  ? ? ? 1_555 U  DT  50 O4 ? ? X DA  22   Y DT  48   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog50  hydrog ? ? T DC  23   N3  ? ? ? 1_555 U  DG  49 N1 ? ? X DC  23   Y DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog51  hydrog ? ? T DC  23   N4  ? ? ? 1_555 U  DG  49 O6 ? ? X DC  23   Y DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog52  hydrog ? ? T DC  23   O2  ? ? ? 1_555 U  DG  49 N2 ? ? X DC  23   Y DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog53  hydrog ? ? T DT  24   N3  ? ? ? 1_555 U  DA  48 N1 ? ? X DT  24   Y DA  46   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog54  hydrog ? ? T DT  24   O4  ? ? ? 1_555 U  DA  48 N6 ? ? X DT  24   Y DA  46   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog55  hydrog ? ? T DT  25   N3  ? ? ? 1_555 U  DA  47 N1 ? ? X DT  25   Y DA  45   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog56  hydrog ? ? T DT  25   O4  ? ? ? 1_555 U  DA  47 N6 ? ? X DT  25   Y DA  45   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog57  hydrog ? ? T DT  26   N3  ? ? ? 1_555 U  DA  45 N1 ? ? X DT  26   Y DA  43   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog58  hydrog ? ? T DT  26   O4  ? ? ? 1_555 U  DA  45 N6 ? ? X DT  26   Y DA  43   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog59  hydrog ? ? T DT  26   N3  ? ? ? 1_555 U  DA  46 N1 ? ? X DT  26   Y DA  44   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog60  hydrog ? ? T DT  26   O4  ? ? ? 1_555 U  DA  46 N6 ? ? X DT  26   Y DA  44   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog61  hydrog ? ? T DT  27   N3  ? ? ? 1_555 U  DA  45 N1 ? ? X DT  27   Y DA  43   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog62  hydrog ? ? T DT  27   O4  ? ? ? 1_555 U  DA  45 N6 ? ? X DT  27   Y DA  43   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog63  hydrog ? ? T DT  28   N3  ? ? ? 1_555 U  DA  44 N1 ? ? X DT  28   Y DA  42   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog64  hydrog ? ? T DT  28   O4  ? ? ? 1_555 U  DA  44 N6 ? ? X DT  28   Y DA  42   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog65  hydrog ? ? T DC  29   N3  ? ? ? 1_555 U  DG  43 N1 ? ? X DC  29   Y DG  41   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog66  hydrog ? ? T DC  29   N4  ? ? ? 1_555 U  DG  43 O6 ? ? X DC  29   Y DG  41   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog67  hydrog ? ? T DC  29   O2  ? ? ? 1_555 U  DG  43 N2 ? ? X DC  29   Y DG  41   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog68  hydrog ? ? T DT  30   N3  ? ? ? 1_555 U  DA  42 N1 ? ? X DT  30   Y DA  40   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog69  hydrog ? ? T DT  30   O4  ? ? ? 1_555 U  DA  42 N6 ? ? X DT  30   Y DA  40   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog70  hydrog ? ? T DG  31   N1  ? ? ? 1_555 U  DC  41 N3 ? ? X DG  31   Y DC  39   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog71  hydrog ? ? T DG  31   N2  ? ? ? 1_555 U  DC  41 O2 ? ? X DG  31   Y DC  39   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog72  hydrog ? ? T DG  31   O6  ? ? ? 1_555 U  DC  41 N4 ? ? X DG  31   Y DC  39   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog73  hydrog ? ? T DA  50   N1  ? ? ? 1_555 U  DT  22 N3 ? ? X DA  50   Y DT  20   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog74  hydrog ? ? T DA  50   N6  ? ? ? 1_555 U  DT  22 O4 ? ? X DA  50   Y DT  20   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog75  hydrog ? ? T DA  51   N1  ? ? ? 1_555 U  DT  21 N3 ? ? X DA  51   Y DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog76  hydrog ? ? T DA  51   N6  ? ? ? 1_555 U  DT  21 O4 ? ? X DA  51   Y DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog77  hydrog ? ? T DA  52   N1  ? ? ? 1_555 U  DT  20 N3 ? ? X DA  52   Y DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog78  hydrog ? ? T DA  52   N6  ? ? ? 1_555 U  DT  20 O4 ? ? X DA  52   Y DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog79  hydrog ? ? T DG  54   N1  ? ? ? 1_555 U  DC  18 N3 ? ? X DG  54   Y DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog80  hydrog ? ? T DG  54   N2  ? ? ? 1_555 U  DC  18 O2 ? ? X DG  54   Y DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog81  hydrog ? ? T DG  54   O6  ? ? ? 1_555 U  DC  18 N4 ? ? X DG  54   Y DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog82  hydrog ? ? T DA  55   N1  ? ? ? 1_555 U  DT  17 N3 ? ? X DA  55   Y DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog83  hydrog ? ? T DA  55   N6  ? ? ? 1_555 U  DT  17 O4 ? ? X DA  55   Y DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog84  hydrog ? ? T DC  56   N3  ? ? ? 1_555 U  DG  16 N1 ? ? X DC  56   Y DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog85  hydrog ? ? T DC  56   N4  ? ? ? 1_555 U  DG  16 O6 ? ? X DC  56   Y DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog86  hydrog ? ? T DC  56   O2  ? ? ? 1_555 U  DG  16 N2 ? ? X DC  56   Y DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog87  hydrog ? ? T DT  57   N3  ? ? ? 1_555 U  DA  15 N1 ? ? X DT  57   Y DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog88  hydrog ? ? T DT  57   O4  ? ? ? 1_555 U  DA  15 N6 ? ? X DT  57   Y DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog89  hydrog ? ? T DC  58   N3  ? ? ? 1_555 U  DG  14 N1 ? ? X DC  58   Y DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog90  hydrog ? ? T DC  58   N4  ? ? ? 1_555 U  DG  14 O6 ? ? X DC  58   Y DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog91  hydrog ? ? T DC  58   O2  ? ? ? 1_555 U  DG  14 N2 ? ? X DC  58   Y DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog92  hydrog ? ? T DC  59   N3  ? ? ? 1_555 U  DG  13 N1 ? ? X DC  59   Y DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog93  hydrog ? ? T DC  59   N4  ? ? ? 1_555 U  DG  13 O6 ? ? X DC  59   Y DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog94  hydrog ? ? T DC  59   O2  ? ? ? 1_555 U  DG  13 N2 ? ? X DC  59   Y DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog95  hydrog ? ? T DA  60   N1  ? ? ? 1_555 U  DT  12 N3 ? ? X DA  60   Y DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog96  hydrog ? ? T DA  60   N6  ? ? ? 1_555 U  DT  12 O4 ? ? X DA  60   Y DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog97  hydrog ? ? T DT  61   N3  ? ? ? 1_555 U  DA  11 N1 ? ? X DT  61   Y DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog98  hydrog ? ? T DT  61   O4  ? ? ? 1_555 U  DA  11 N6 ? ? X DT  61   Y DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog99  hydrog ? ? T DG  62   N1  ? ? ? 1_555 U  DC  10 N3 ? ? X DG  62   Y DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog100 hydrog ? ? T DG  62   N2  ? ? ? 1_555 U  DC  10 O2 ? ? X DG  62   Y DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog101 hydrog ? ? T DG  62   O6  ? ? ? 1_555 U  DC  10 N4 ? ? X DG  62   Y DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog102 hydrog ? ? T DG  63   N1  ? ? ? 1_555 U  DG  8  O6 ? ? X DG  63   Y DG  6    1_555 ? ? ? ? ? ? TYPE_3_PAIR             ? 
? 
hydrog103 hydrog ? ? T DG  63   O6  ? ? ? 1_555 U  DG  8  N1 ? ? X DG  63   Y DG  6    1_555 ? ? ? ? ? ? TYPE_3_PAIR             ? 
? 
hydrog104 hydrog ? ? T DG  63   N1  ? ? ? 1_555 U  DC  9  N3 ? ? X DG  63   Y DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog105 hydrog ? ? T DG  63   N2  ? ? ? 1_555 U  DC  9  O2 ? ? X DG  63   Y DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog106 hydrog ? ? T DG  63   O6  ? ? ? 1_555 U  DC  9  N4 ? ? X DG  63   Y DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog107 hydrog ? ? T DC  64   N3  ? ? ? 1_555 U  DG  8  N1 ? ? X DC  64   Y DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog108 hydrog ? ? T DC  64   N4  ? ? ? 1_555 U  DG  8  O6 ? ? X DC  64   Y DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog109 hydrog ? ? T DC  64   O2  ? ? ? 1_555 U  DG  8  N2 ? ? X DC  64   Y DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog110 hydrog ? ? T DC  65   N3  ? ? ? 1_555 U  DG  7  N1 ? ? X DC  65   Y DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog111 hydrog ? ? T DC  65   N4  ? ? ? 1_555 U  DG  7  O6 ? ? X DC  65   Y DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog112 hydrog ? ? T DC  65   O2  ? ? ? 1_555 U  DG  7  N2 ? ? X DC  65   Y DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog113 hydrog ? ? T DA  67   N1  ? ? ? 1_555 U  DT  5  N3 ? ? X DA  67   Y DT  3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog114 hydrog ? ? T DA  67   N6  ? ? ? 1_555 U  DT  5  O4 ? ? X DA  67   Y DT  3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog115 hydrog ? ? T DA  67   N1  ? ? ? 1_555 U  DT  6  N3 ? ? X DA  67   Y DT  4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog116 hydrog ? ? T DA  67   N6  ? ? ? 1_555 U  DT  6  O4 ? ? X DA  67   Y DT  4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog117 hydrog ? ? T DG  68   N1  ? ? ? 1_555 U  DC  4  N3 ? ? X DG  68   Y DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog118 hydrog ? ? T DG  68   N2  ? ? ? 1_555 U  DC  4  O2 ? ? X DG  68   Y DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog119 hydrog ? ? T DG  68   O6  ? ? ? 1_555 U  DC  4  N4 ? ? X DG  68   Y DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog120 hydrog ? ? T DT  69   N3  ? ? ? 1_555 U  DA  3  N1 ? ? X DT  69   Y DA  1    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog121 hydrog ? ? T DT  69   O4  ? ? ? 1_555 U  DA  3  N6 ? ? X DT  69   Y DA  1    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 1099 A . ? GLU 1099 A PRO 1100 A ? PRO 1100 A 1 -6.87  
2 PHE 465  O . ? PHE 465  O PRO 466  O ? PRO 466  O 1 -20.64 
3 GLU 434  R . ? GLU 434  R PRO 435  R ? PRO 435  R 1 1.47   
4 LYS 525  R . ? LYS 525  R PRO 526  R ? PRO 526  R 1 -5.93  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 4 ? 
AA5 ? 3 ? 
AA6 ? 2 ? 
AA7 ? 3 ? 
AA8 ? 2 ? 
AA9 ? 4 ? 
AB1 ? 2 ? 
AB2 ? 4 ? 
AB3 ? 2 ? 
AB4 ? 3 ? 
AB5 ? 3 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 2 ? 
AB9 ? 3 ? 
AC1 ? 4 ? 
AC2 ? 5 ? 
AC3 ? 5 ? 
AC4 ? 3 ? 
AC5 ? 2 ? 
AC6 ? 2 ? 
AC7 ? 2 ? 
AC8 ? 2 ? 
AC9 ? 2 ? 
AD1 ? 3 ? 
AD2 ? 5 ? 
AD3 ? 4 ? 
AD4 ? 5 ? 
AD5 ? 2 ? 
AD6 ? 2 ? 
AD7 ? 4 ? 
AD8 ? 4 ? 
AD9 ? 4 ? 
AE1 ? 2 ? 
AE2 ? 2 ? 
AE3 ? 8 ? 
AE4 ? 4 ? 
AE5 ? 2 ? 
AE6 ? 5 ? 
AE7 ? 4 ? 
AE8 ? 7 ? 
AE9 ? 2 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
AF4 ? 2 ? 
AF5 ? 2 ? 
AF6 ? 2 ? 
AF7 ? 7 ? 
AF8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? parallel      
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? parallel      
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? parallel      
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC2 4 5 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC3 4 5 ? anti-parallel 
AC4 1 2 ? parallel      
AC4 2 3 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD2 4 5 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? anti-parallel 
AD4 4 5 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? parallel      
AD8 3 4 ? parallel      
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? parallel      
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE3 4 5 ? anti-parallel 
AE3 5 6 ? anti-parallel 
AE3 6 7 ? anti-parallel 
AE3 7 8 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE4 3 4 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE6 3 4 ? parallel      
AE6 4 5 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE7 3 4 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE8 3 4 ? parallel      
AE8 4 5 ? anti-parallel 
AE8 5 6 ? anti-parallel 
AE8 6 7 ? parallel      
AE9 1 2 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF7 2 3 ? anti-parallel 
AF7 3 4 ? anti-parallel 
AF7 4 5 ? anti-parallel 
AF7 5 6 ? anti-parallel 
AF7 6 7 ? anti-parallel 
AF8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 11   ? GLU A 17   ? LYS A 11   GLU A 17   
AA1 2 ARG B 1140 ? ASP B 1145 ? ARG B 1140 ASP B 1145 
AA2 1 GLY A 82   ? LEU A 84   ? GLY A 82   LEU A 84   
AA2 2 LEU A 261  ? ALA A 263  ? LEU A 261  ALA A 263  
AA3 1 GLY A 377  ? ARG A 378  ? GLY A 377  ARG A 378  
AA3 2 HIS B 1036 ? ALA B 1037 ? HIS B 1036 ALA B 1037 
AA4 1 GLU A 391  ? PRO A 395  ? GLU A 391  PRO A 395  
AA4 2 LEU A 486  ? ARG A 493  ? LEU A 486  ARG A 493  
AA4 3 VAL A 471  ? ASN A 475  ? VAL A 471  ASN A 475  
AA4 4 ASN A 518  ? HIS A 520  ? ASN A 518  HIS A 520  
AA5 1 TYR A 404  ? LYS A 407  ? TYR A 404  LYS A 407  
AA5 2 VAL A 461  ? ARG A 464  ? VAL A 461  ARG A 464  
AA5 3 ALA A 430  ? LEU A 434  ? ALA A 430  LEU A 434  
AA6 1 ILE A 597  ? MET A 598  ? ILE A 597  MET A 598  
AA6 2 TYR A 602  ? LEU A 603  ? TYR A 602  LEU A 603  
AA7 1 ASN A 625  ? LEU A 626  ? ASN A 625  LEU A 626  
AA7 2 ILE A 653  ? ARG A 655  ? ILE A 653  ARG A 655  
AA7 3 GLN A 658  ? SER A 661  ? GLN A 658  SER A 661  
AA8 1 SER A 897  ? CYS A 898  ? SER A 897  CYS A 898  
AA8 2 VAL A 904  ? ARG A 905  ? VAL A 904  ARG A 905  
AA9 1 ILE A 1278 ? ILE A 1283 ? ILE A 1278 ILE A 1283 
AA9 2 LEU A 1293 ? GLY A 1297 ? LEU A 1293 GLY A 1297 
AA9 3 ILE A 1140 ? ALA A 1143 ? ILE A 1140 ALA A 1143 
AA9 4 THR A 1314 ? THR A 1316 ? THR A 1314 THR A 1316 
AB1 1 VAL A 1173 ? LYS A 1178 ? VAL A 1173 LYS A 1178 
AB1 2 LEU A 1181 ? VAL A 1186 ? LEU A 1181 VAL A 1186 
AB2 1 ASP F 145  ? SER F 147  ? ASP F 145  SER F 147  
AB2 2 LEU F 132  ? ARG F 135  ? LEU F 132  ARG F 135  
AB2 3 VAL A 1430 ? LYS A 1432 ? VAL A 1430 LYS A 1432 
AB2 4 GLY G 57   ? GLN G 58   ? GLY G 57   GLN G 58   
AB3 1 LEU B 82   ? ILE B 83   ? LEU B 82   ILE B 83   
AB3 2 LEU B 93   ? LYS B 94   ? LEU B 93   LYS B 94   
AB4 1 ILE B 98   ? VAL B 100  ? ILE B 98   VAL B 100  
AB4 2 ALA B 127  ? VAL B 131  ? ALA B 127  VAL B 131  
AB4 3 ARG B 151  ? MET B 152  ? ARG B 151  MET B 152  
AB5 1 PHE B 185  ? VAL B 187  ? PHE B 185  VAL B 187  
AB5 2 THR B 190  ? ILE B 194  ? THR B 190  ILE B 194  
AB5 3 THR B 455  ? VAL B 457  ? THR B 455  VAL B 457  
AB6 1 LYS B 375  ? GLU B 378  ? LYS B 375  GLU B 378  
AB6 2 VAL B 196  ? LEU B 200  ? VAL B 196  LEU B 200  
AB6 3 ILE B 473  ? SER B 475  ? ILE B 473  SER B 475  
AB6 4 LEU B 510  ? LYS B 512  ? LEU B 510  LYS B 512  
AB7 1 ILE B 205  ? VAL B 207  ? ILE B 205  VAL B 207  
AB7 2 GLN B 217  ? THR B 221  ? GLN B 217  THR B 221  
AB7 3 LYS B 228  ? LYS B 236  ? LYS B 228  LYS B 236  
AB7 4 LYS B 239  ? LYS B 243  ? LYS B 239  LYS B 243  
AB8 1 TRP B 442  ? LEU B 444  ? TRP B 442  LEU B 444  
AB8 2 MET B 449  ? ARG B 451  ? MET B 449  ARG B 451  
AB9 1 VAL B 555  ? LEU B 557  ? VAL B 555  LEU B 557  
AB9 2 VAL B 599  ? ILE B 601  ? VAL B 599  ILE B 601  
AB9 3 ILE B 590  ? SER B 592  ? ILE B 590  SER B 592  
AC1 1 VAL B 646  ? ASP B 650  ? VAL B 646  ASP B 650  
AC1 2 CYS B 609  ? ILE B 614  ? CYS B 609  ILE B 614  
AC1 3 HIS B 672  ? LEU B 673  ? HIS B 672  LEU B 673  
AC1 4 ILE B 659  ? ALA B 660  ? ILE B 659  ALA B 660  
AC2 1 LEU B 724  ? MET B 728  ? LEU B 724  MET B 728  
AC2 2 CYS B 785  ? VAL B 794  ? CYS B 785  VAL B 794  
AC2 3 ALA B 894  ? GLN B 902  ? ALA B 894  GLN B 902  
AC2 4 PRO B 878  ? VAL B 888  ? PRO B 878  VAL B 888  
AC2 5 LYS B 835  ? GLN B 837  ? LYS B 835  GLN B 837  
AC3 1 LEU B 724  ? MET B 728  ? LEU B 724  MET B 728  
AC3 2 CYS B 785  ? VAL B 794  ? CYS B 785  VAL B 794  
AC3 3 ALA B 894  ? GLN B 902  ? ALA B 894  GLN B 902  
AC3 4 PRO B 878  ? VAL B 888  ? PRO B 878  VAL B 888  
AC3 5 LEU L 56   ? LEU L 57   ? LEU L 56   LEU L 57   
AC4 1 ILE B 943  ? MET B 944  ? ILE B 943  MET B 944  
AC4 2 GLN B 753  ? VAL B 759  ? GLN B 753  VAL B 759  
AC4 3 GLY B 1020 ? TYR B 1024 ? GLY B 1020 TYR B 1024 
AC5 1 ARG B 797  ? TYR B 798  ? ARG B 797  TYR B 798  
AC5 2 THR B 802  ? GLN B 803  ? THR B 802  GLN B 803  
AC6 1 SER B 846  ? PRO B 848  ? SER B 846  PRO B 848  
AC6 2 TYR B 866  ? GLU B 868  ? TYR B 866  GLU B 868  
AC7 1 LYS B 911  ? SER B 913  ? LYS B 911  SER B 913  
AC7 2 LYS B 919  ? VAL B 921  ? LYS B 919  VAL B 921  
AC8 1 GLY B 976  ? THR B 977  ? GLY B 976  THR B 977  
AC8 2 GLY B 980  ? GLY B 981  ? GLY B 980  GLY B 981  
AC9 1 LYS B 1001 ? ASP B 1002 ? LYS B 1001 ASP B 1002 
AC9 2 ILE B 1017 ? PHE B 1018 ? ILE B 1017 PHE B 1018 
AD1 1 MET B 1101 ? GLY B 1102 ? MET B 1101 GLY B 1102 
AD1 2 GLU B 1091 ? CYS B 1095 ? GLU B 1091 CYS B 1095 
AD1 3 ILE B 1116 ? THR B 1120 ? ILE B 1116 THR B 1120 
AD2 1 VAL C 12   ? THR C 13   ? VAL C 12   THR C 13   
AD2 2 ILE C 4    ? ILE C 7    ? ILE C 4    ILE C 7    
AD2 3 VAL C 289  ? VAL C 302  ? VAL C 289  VAL C 302  
AD2 4 ALA C 52   ? ILE C 57   ? ALA C 52   ILE C 57   
AD2 5 GLU C 41   ? LEU C 47   ? GLU C 41   LEU C 47   
AD3 1 VAL C 12   ? THR C 13   ? VAL C 12   THR C 13   
AD3 2 ILE C 4    ? ILE C 7    ? ILE C 4    ILE C 7    
AD3 3 VAL C 289  ? VAL C 302  ? VAL C 289  VAL C 302  
AD3 4 ALA C 225  ? ILE C 235  ? ALA C 225  ILE C 235  
AD4 1 LYS C 168  ? PHE C 169  ? LYS C 168  PHE C 169  
AD4 2 ILE C 132  ? LYS C 139  ? ILE C 132  LYS C 139  
AD4 3 GLU C 201  ? GLY C 211  ? GLU C 201  GLY C 211  
AD4 4 SER C 77   ? PHE C 86   ? SER C 77   PHE C 86   
AD4 5 VAL L 65   ? GLU L 68   ? VAL L 65   GLU L 68   
AD5 1 HIS C 161  ? TYR C 163  ? HIS C 161  TYR C 163  
AD5 2 LEU C 192  ? LYS C 195  ? LEU C 192  LYS C 195  
AD6 1 GLY C 257  ? ILE C 258  ? GLY C 257  ILE C 258  
AD6 2 ALA C 265  ? TYR C 266  ? ALA C 265  TYR C 266  
AD7 1 VAL D 3    ? ALA D 9    ? VAL D 3    ALA D 9    
AD7 2 LEU G 4    ? ILE G 13   ? LEU G 4    ILE G 13   
AD7 3 SER G 66   ? VAL G 76   ? SER G 66   VAL G 76   
AD7 4 CYS G 45   ? ILE G 48   ? CYS G 45   ILE G 48   
AD8 1 PHE E 60   ? ALA E 62   ? PHE E 60   ALA E 62   
AD8 2 LEU E 78   ? VAL E 80   ? LEU E 78   VAL E 80   
AD8 3 THR E 107  ? VAL E 111  ? THR E 107  VAL E 111  
AD8 4 THR E 131  ? PHE E 135  ? THR E 131  PHE E 135  
AD9 1 LYS E 152  ? ARG E 155  ? LYS E 152  ARG E 155  
AD9 2 VAL E 195  ? LYS E 201  ? VAL E 195  LYS E 201  
AD9 3 ARG E 207  ? MET E 215  ? ARG E 207  MET E 215  
AD9 4 ARG E 177  ? GLN E 179  ? ARG E 177  GLN E 179  
AE1 1 TRP G 88   ? ILE G 89   ? TRP G 88   ILE G 89   
AE1 2 VAL G 99   ? SER G 100  ? VAL G 99   SER G 100  
AE2 1 ARG G 152  ? PHE G 155  ? ARG G 152  PHE G 155  
AE2 2 TYR G 194  ? LEU G 197  ? TYR G 194  LEU G 197  
AE3 1 THR H 100  ? VAL H 107  ? THR H 100  VAL H 107  
AE3 2 LEU H 111  ? SER H 117  ? LEU H 111  SER H 117  
AE3 3 LEU H 122  ? LEU H 125  ? LEU H 122  LEU H 125  
AE3 4 LEU H 38   ? ASN H 43   ? LEU H 38   ASN H 43   
AE3 5 VAL H 23   ? SER H 30   ? VAL H 23   SER H 30   
AE3 6 THR H 4    ? ASP H 16   ? THR H 4    ASP H 16   
AE3 7 SER H 54   ? ALA H 60   ? SER H 54   ALA H 60   
AE3 8 TYR H 141  ? ARG H 145  ? TYR H 141  ARG H 145  
AE4 1 ILE K 47   ? LEU K 49   ? ILE K 47   LEU K 49   
AE4 2 SER K 62   ? VAL K 66   ? SER K 62   VAL K 66   
AE4 3 LEU K 100  ? GLN K 106  ? LEU K 100  GLN K 106  
AE4 4 PHE K 88   ? SER K 92   ? PHE K 88   SER K 92   
AE5 1 TYR L 29   ? ILE L 30   ? TYR L 29   ILE L 30   
AE5 2 LYS L 37   ? LEU L 38   ? LYS L 37   LEU L 38   
AE6 1 MET N 305  ? GLN N 308  ? MET N 305  GLN N 308  
AE6 2 GLN M 158  ? LYS M 164  ? GLN M 158  LYS M 164  
AE6 3 GLN M 167  ? PRO M 172  ? GLN M 167  PRO M 172  
AE6 4 PHE M 74   ? LYS M 77   ? PHE M 74   LYS M 77   
AE6 5 SER N 362  ? ILE N 363  ? SER N 362  ILE N 363  
AE7 1 ILE M 121  ? ILE M 123  ? ILE M 121  ILE M 123  
AE7 2 GLN M 146  ? LYS M 149  ? GLN M 146  LYS M 149  
AE7 3 VAL M 176  ? PRO M 181  ? VAL M 176  PRO M 181  
AE7 4 GLY M 152  ? VAL M 153  ? GLY M 152  VAL M 153  
AE8 1 ILE M 121  ? ILE M 123  ? ILE M 121  ILE M 123  
AE8 2 GLN M 146  ? LYS M 149  ? GLN M 146  LYS M 149  
AE8 3 VAL M 176  ? PRO M 181  ? VAL M 176  PRO M 181  
AE8 4 VAL M 87   ? TYR M 90   ? VAL M 87   TYR M 90   
AE8 5 ASP N 393  ? SER N 398  ? ASP N 393  SER N 398  
AE8 6 GLU N 407  ? LEU N 408  ? GLU N 407  LEU N 408  
AE8 7 ALA M 248  ? GLU M 249  ? ALA M 248  GLU M 249  
AE9 1 VAL O 104  ? GLU O 109  ? VAL O 104  GLU O 109  
AE9 2 THR O 117  ? TYR O 122  ? THR O 117  TYR O 122  
AF1 1 LEU O 200  ? GLN O 202  ? LEU O 200  GLN O 202  
AF1 2 LEU O 280  ? ILE O 282  ? LEU O 280  ILE O 282  
AF2 1 GLN O 549  ? VAL O 551  ? GLN O 549  VAL O 551  
AF2 2 VAL O 563  ? LEU O 565  ? VAL O 563  LEU O 565  
AF3 1 LEU P 63   ? VAL P 64   ? LEU P 63   VAL P 64   
AF3 2 LYS P 71   ? PHE P 72   ? LYS P 71   PHE P 72   
AF4 1 VAL P 134  ? VAL P 137  ? VAL P 134  VAL P 137  
AF4 2 ILE P 147  ? LEU P 150  ? ILE P 147  LEU P 150  
AF5 1 LEU P 253  ? LYS P 255  ? LEU P 253  LYS P 255  
AF5 2 TYR P 261  ? VAL P 263  ? TYR P 261  VAL P 263  
AF6 1 PHE R 12   ? ARG R 14   ? PHE R 12   ARG R 14   
AF6 2 LEU R 23   ? CYS R 25   ? LEU R 23   CYS R 25   
AF7 1 LYS R 446  ? ALA R 452  ? LYS R 446  ALA R 452  
AF7 2 THR R 392  ? THR R 401  ? THR R 392  THR R 401  
AF7 3 THR R 479  ? ASP R 491  ? THR R 479  ASP R 491  
AF7 4 LYS R 537  ? ALA R 543  ? LYS R 537  ALA R 543  
AF7 5 ILE R 528  ? ILE R 532  ? ILE R 528  ILE R 532  
AF7 6 LEU R 519  ? MET R 523  ? LEU R 519  MET R 523  
AF7 7 SER R 509  ? SER R 510  ? SER R 509  SER R 510  
AF8 1 TYR R 420  ? ASN R 421  ? TYR R 420  ASN R 421  
AF8 2 PHE R 425  ? VAL R 428  ? PHE R 425  VAL R 428  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 17   ? N GLU A 17   O ARG B 1140 ? O ARG B 1140 
AA2 1 2 N GLY A 82   ? N GLY A 82   O ALA A 263  ? O ALA A 263  
AA3 1 2 N ARG A 378  ? N ARG A 378  O HIS B 1036 ? O HIS B 1036 
AA4 1 2 N VAL A 394  ? N VAL A 394  O LYS A 491  ? O LYS A 491  
AA4 2 3 O HIS A 488  ? O HIS A 488  N VAL A 472  ? N VAL A 472  
AA4 3 4 N ASN A 475  ? N ASN A 475  O ASN A 518  ? O ASN A 518  
AA5 1 2 N GLU A 406  ? N GLU A 406  O VAL A 462  ? O VAL A 462  
AA5 2 3 O VAL A 461  ? O VAL A 461  N LEU A 434  ? N LEU A 434  
AA6 1 2 N ILE A 597  ? N ILE A 597  O LEU A 603  ? O LEU A 603  
AA7 1 2 N LEU A 626  ? N LEU A 626  O ILE A 654  ? O ILE A 654  
AA7 2 3 N ARG A 655  ? N ARG A 655  O GLN A 658  ? O GLN A 658  
AA8 1 2 N SER A 897  ? N SER A 897  O ARG A 905  ? O ARG A 905  
AA9 1 2 N VAL A 1282 ? N VAL A 1282 O LEU A 1294 ? O LEU A 1294 
AA9 2 3 O VAL A 1295 ? O VAL A 1295 N ILE A 1141 ? N ILE A 1141 
AA9 3 4 N ASN A 1142 ? N ASN A 1142 O THR A 1315 ? O THR A 1315 
AB1 1 2 N LYS A 1178 ? N LYS A 1178 O LEU A 1181 ? O LEU A 1181 
AB2 1 2 O TRP F 146  ? O TRP F 146  N ILE F 134  ? N ILE F 134  
AB2 2 3 O VAL F 133  ? O VAL F 133  N VAL A 1431 ? N VAL A 1431 
AB2 3 4 N LYS A 1432 ? N LYS A 1432 O GLY G 57   ? O GLY G 57   
AB3 1 2 N ILE B 83   ? N ILE B 83   O LEU B 93   ? O LEU B 93   
AB4 1 2 N ARG B 99   ? N ARG B 99   O TYR B 130  ? O TYR B 130  
AB4 2 3 N ALA B 127  ? N ALA B 127  O MET B 152  ? O MET B 152  
AB5 1 2 N VAL B 187  ? N VAL B 187  O THR B 190  ? O THR B 190  
AB5 2 3 N VAL B 193  ? N VAL B 193  O HIS B 456  ? O HIS B 456  
AB6 1 2 O ARG B 376  ? O ARG B 376  N GLN B 199  ? N GLN B 199  
AB6 2 3 N VAL B 196  ? N VAL B 196  O SER B 474  ? O SER B 474  
AB6 3 4 N SER B 475  ? N SER B 475  O LEU B 510  ? O LEU B 510  
AB7 1 2 N ILE B 206  ? N ILE B 206  O ALA B 218  ? O ALA B 218  
AB7 2 3 N GLN B 217  ? N GLN B 217  O TYR B 232  ? O TYR B 232  
AB7 3 4 N LYS B 236  ? N LYS B 236  O LYS B 239  ? O LYS B 239  
AB8 1 2 N TRP B 442  ? N TRP B 442  O ARG B 451  ? O ARG B 451  
AB9 1 2 N TYR B 556  ? N TYR B 556  O VAL B 599  ? O VAL B 599  
AB9 2 3 O HIS B 600  ? O HIS B 600  N TYR B 591  ? N TYR B 591  
AC1 1 2 O LEU B 649  ? O LEU B 649  N ARG B 610  ? N ARG B 610  
AC1 2 3 N ILE B 613  ? N ILE B 613  O LEU B 673  ? O LEU B 673  
AC1 3 4 O HIS B 672  ? O HIS B 672  N ALA B 660  ? N ALA B 660  
AC2 1 2 N LEU B 725  ? N LEU B 725  O ARG B 788  ? O ARG B 788  
AC2 2 3 N THR B 791  ? N THR B 791  O VAL B 898  ? O VAL B 898  
AC2 3 4 O LYS B 897  ? O LYS B 897  N MET B 885  ? N MET B 885  
AC2 4 5 O SER B 879  ? O SER B 879  N VAL B 836  ? N VAL B 836  
AC3 1 2 N LEU B 725  ? N LEU B 725  O ARG B 788  ? O ARG B 788  
AC3 2 3 N THR B 791  ? N THR B 791  O VAL B 898  ? O VAL B 898  
AC3 3 4 O LYS B 897  ? O LYS B 897  N MET B 885  ? N MET B 885  
AC3 4 5 N MET B 886  ? N MET B 886  O LEU L 56   ? O LEU L 56   
AC4 1 2 O MET B 944  ? O MET B 944  N ALA B 758  ? N ALA B 758  
AC4 2 3 N VAL B 757  ? N VAL B 757  O GLY B 1020 ? O GLY B 1020 
AC5 1 2 N TYR B 798  ? N TYR B 798  O THR B 802  ? O THR B 802  
AC6 1 2 N VAL B 847  ? N VAL B 847  O ARG B 867  ? O ARG B 867  
AC7 1 2 N PHE B 912  ? N PHE B 912  O GLY B 920  ? O GLY B 920  
AC8 1 2 N THR B 977  ? N THR B 977  O GLY B 980  ? O GLY B 980  
AC9 1 2 N ASP B 1002 ? N ASP B 1002 O ILE B 1017 ? O ILE B 1017 
AD1 1 2 O GLY B 1102 ? O GLY B 1102 N ASP B 1093 ? N ASP B 1093 
AD1 2 3 N VAL B 1092 ? N VAL B 1092 O MET B 1119 ? O MET B 1119 
AD2 1 2 O THR C 13   ? O THR C 13   N GLY C 6    ? N GLY C 6    
AD2 2 3 N VAL C 5    ? N VAL C 5    O ARG C 293  ? O ARG C 293  
AD2 3 4 O VAL C 302  ? O VAL C 302  N ALA C 52   ? N ALA C 52   
AD2 4 5 O ASP C 55   ? O ASP C 55   N ASN C 43   ? N ASN C 43   
AD3 1 2 O THR C 13   ? O THR C 13   N GLY C 6    ? N GLY C 6    
AD3 2 3 N VAL C 5    ? N VAL C 5    O ARG C 293  ? O ARG C 293  
AD3 3 4 O GLY C 292  ? O GLY C 292  N GLN C 232  ? N GLN C 232  
AD4 1 2 O LYS C 168  ? O LYS C 168  N SER C 135  ? N SER C 135  
AD4 2 3 N LEU C 136  ? N LEU C 136  O LEU C 204  ? O LEU C 204  
AD4 3 4 O SER C 203  ? O SER C 203  N PHE C 86   ? N PHE C 86   
AD4 4 5 N VAL C 83   ? N VAL C 83   O PHE L 67   ? O PHE L 67   
AD5 1 2 N VAL C 162  ? N VAL C 162  O ALA C 194  ? O ALA C 194  
AD6 1 2 N GLY C 257  ? N GLY C 257  O TYR C 266  ? O TYR C 266  
AD7 1 2 N ALA D 9    ? N ALA D 9    O LEU G 4    ? O LEU G 4    
AD7 2 3 N ASP G 9    ? N ASP G 9    O VAL G 70   ? O VAL G 70   
AD7 3 4 O VAL G 75   ? O VAL G 75   N ILE G 46   ? N ILE G 46   
AD8 1 2 N ALA E 62   ? N ALA E 62   O LEU E 78   ? O LEU E 78   
AD8 2 3 N TRP E 79   ? N TRP E 79   O ILE E 109  ? O ILE E 109  
AD8 3 4 N GLY E 108  ? N GLY E 108  O THR E 131  ? O THR E 131  
AD9 1 2 N ILE E 154  ? N ILE E 154  O LYS E 197  ? O LYS E 197  
AD9 2 3 N VAL E 196  ? N VAL E 196  O ARG E 212  ? O ARG E 212  
AD9 3 4 O ILE E 213  ? O ILE E 213  N ILE E 178  ? N ILE E 178  
AE1 1 2 N TRP G 88   ? N TRP G 88   O SER G 100  ? O SER G 100  
AE2 1 2 N VAL G 154  ? N VAL G 154  O ALA G 195  ? O ALA G 195  
AE3 1 2 N VAL H 107  ? N VAL H 107  O LEU H 111  ? O LEU H 111  
AE3 2 3 N VAL H 114  ? N VAL H 114  O LEU H 125  ? O LEU H 125  
AE3 3 4 O ARG H 124  ? O ARG H 124  N THR H 39   ? N THR H 39   
AE3 4 5 O LEU H 40   ? O LEU H 40   N ILE H 26   ? N ILE H 26   
AE3 5 6 O GLU H 27   ? O GLU H 27   N GLU H 14   ? N GLU H 14   
AE3 6 7 N ASP H 8    ? N ASP H 8    O VAL H 57   ? O VAL H 57   
AE3 7 8 N ALA H 60   ? N ALA H 60   O TYR H 141  ? O TYR H 141  
AE4 1 2 N LYS K 48   ? N LYS K 48   O GLN K 64   ? O GLN K 64   
AE4 2 3 N ILE K 65   ? N ILE K 65   O LEU K 101  ? O LEU K 101  
AE4 3 4 O GLN K 106  ? O GLN K 106  N PHE K 88   ? N PHE K 88   
AE5 1 2 N TYR L 29   ? N TYR L 29   O LEU L 38   ? O LEU L 38   
AE6 1 2 O PHE N 307  ? O PHE N 307  N TYR M 159  ? N TYR M 159  
AE6 2 3 N PHE M 162  ? N PHE M 162  O TYR M 169  ? O TYR M 169  
AE6 3 4 O LEU M 170  ? O LEU M 170  N LYS M 77   ? N LYS M 77   
AE6 4 5 N PHE M 74   ? N PHE M 74   O ILE N 363  ? O ILE N 363  
AE7 1 2 N ILE M 121  ? N ILE M 121  O LEU M 148  ? O LEU M 148  
AE7 2 3 N LYS M 149  ? N LYS M 149  O LYS M 180  ? O LYS M 180  
AE7 3 4 O VAL M 176  ? O VAL M 176  N VAL M 153  ? N VAL M 153  
AE8 1 2 N ILE M 121  ? N ILE M 121  O LEU M 148  ? O LEU M 148  
AE8 2 3 N LYS M 149  ? N LYS M 149  O LYS M 180  ? O LYS M 180  
AE8 3 4 O ALA M 177  ? O ALA M 177  N GLN M 89   ? N GLN M 89   
AE8 4 5 N PHE M 88   ? N PHE M 88   O ILE N 395  ? O ILE N 395  
AE8 5 6 N SER N 398  ? N SER N 398  O GLU N 407  ? O GLU N 407  
AE8 6 7 O LEU N 408  ? O LEU N 408  N ALA M 248  ? N ALA M 248  
AE9 1 2 N LYS O 105  ? N LYS O 105  O TYR O 121  ? O TYR O 121  
AF1 1 2 N ILE O 201  ? N ILE O 201  O THR O 281  ? O THR O 281  
AF2 1 2 N GLN O 549  ? N GLN O 549  O LEU O 565  ? O LEU O 565  
AF3 1 2 N VAL P 64   ? N VAL P 64   O LYS P 71   ? O LYS P 71   
AF4 1 2 N VAL P 137  ? N VAL P 137  O ILE P 147  ? O ILE P 147  
AF5 1 2 N GLU P 254  ? N GLU P 254  O ARG P 262  ? O ARG P 262  
AF6 1 2 N GLU R 13   ? N GLU R 13   O VAL R 24   ? O VAL R 24   
AF7 1 2 O ALA R 452  ? O ALA R 452  N ILE R 396  ? N ILE R 396  
AF7 2 3 N THR R 401  ? N THR R 401  O THR R 479  ? O THR R 479  
AF7 3 4 N GLY R 488  ? N GLY R 488  O LEU R 540  ? O LEU R 540  
AF7 4 5 O THR R 541  ? O THR R 541  N VAL R 529  ? N VAL R 529  
AF7 5 6 O LEU R 530  ? O LEU R 530  N TYR R 521  ? N TYR R 521  
AF7 6 7 O ILE R 520  ? O ILE R 520  N SER R 510  ? N SER R 510  
AF8 1 2 N ASN R 421  ? N ASN R 421  O PHE R 425  ? O PHE R 425  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 1501 ? 5 'binding site for residue ZN A 1501' 
AC2 Software A ZN 1502 ? 4 'binding site for residue ZN A 1502' 
AC3 Software B ZN 2000 ? 5 'binding site for residue ZN B 2000' 
AC4 Software I ZN 2000 ? 4 'binding site for residue ZN I 2000' 
AC5 Software J ZN 2000 ? 5 'binding site for residue ZN J 2000' 
AC6 Software L ZN 2000 ? 4 'binding site for residue ZN L 2000' 
AC7 Software R ZN 1001 ? 4 'binding site for residue ZN R 1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 CYS A 67   ? CYS A 67   . ? 1_555 ? 
2  AC1 5 THR A 69   ? THR A 69   . ? 1_555 ? 
3  AC1 5 CYS A 70   ? CYS A 70   . ? 1_555 ? 
4  AC1 5 CYS A 77   ? CYS A 77   . ? 1_555 ? 
5  AC1 5 HIS A 80   ? HIS A 80   . ? 1_555 ? 
6  AC2 4 CYS A 107  ? CYS A 107  . ? 1_555 ? 
7  AC2 4 CYS A 110  ? CYS A 110  . ? 1_555 ? 
8  AC2 4 CYS A 154  ? CYS A 154  . ? 1_555 ? 
9  AC2 4 CYS A 157  ? CYS A 157  . ? 1_555 ? 
10 AC3 5 CYS B 1095 ? CYS B 1095 . ? 1_555 ? 
11 AC3 5 LYS B 1097 ? LYS B 1097 . ? 1_555 ? 
12 AC3 5 CYS B 1098 ? CYS B 1098 . ? 1_555 ? 
13 AC3 5 CYS B 1107 ? CYS B 1107 . ? 1_555 ? 
14 AC3 5 CYS B 1110 ? CYS B 1110 . ? 1_555 ? 
15 AC4 4 CYS I 5    ? CYS I 5    . ? 1_555 ? 
16 AC4 4 CYS I 8    ? CYS I 8    . ? 1_555 ? 
17 AC4 4 CYS I 26   ? CYS I 26   . ? 1_555 ? 
18 AC4 4 CYS I 29   ? CYS I 29   . ? 1_555 ? 
19 AC5 5 CYS J 7    ? CYS J 7    . ? 1_555 ? 
20 AC5 5 SER J 9    ? SER J 9    . ? 1_555 ? 
21 AC5 5 CYS J 10   ? CYS J 10   . ? 1_555 ? 
22 AC5 5 CYS J 45   ? CYS J 45   . ? 1_555 ? 
23 AC5 5 CYS J 46   ? CYS J 46   . ? 1_555 ? 
24 AC6 4 CYS L 31   ? CYS L 31   . ? 1_555 ? 
25 AC6 4 CYS L 34   ? CYS L 34   . ? 1_555 ? 
26 AC6 4 CYS L 48   ? CYS L 48   . ? 1_555 ? 
27 AC6 4 CYS L 51   ? CYS L 51   . ? 1_555 ? 
28 AC7 4 CYS R 4    ? CYS R 4    . ? 1_555 ? 
29 AC7 4 CYS R 7    ? CYS R 7    . ? 1_555 ? 
30 AC7 4 CYS R 25   ? CYS R 25   . ? 1_555 ? 
31 AC7 4 CYS R 28   ? CYS R 28   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6CNB 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A  1  2    ? 173.060 163.932 115.373 1.00 0.00 ? 2    LYS A N     1 
ATOM   2     C  CA    . LYS A  1  2    ? 172.493 164.552 116.564 1.00 0.00 ? 2    LYS A CA    1 
ATOM   3     C  C     . LYS A  1  2    ? 173.563 165.327 117.319 1.00 0.00 ? 2    LYS A C     1 
ATOM   4     O  O     . LYS A  1  2    ? 174.415 165.973 116.710 1.00 0.00 ? 2    LYS A O     1 
ATOM   5     C  CB    . LYS A  1  2    ? 171.869 163.495 117.478 1.00 0.00 ? 2    LYS A CB    1 
ATOM   6     C  CG    . LYS A  1  2    ? 170.631 162.820 116.909 1.00 0.00 ? 2    LYS A CG    1 
ATOM   7     C  CD    . LYS A  1  2    ? 170.039 161.824 117.899 1.00 0.00 ? 2    LYS A CD    1 
ATOM   8     C  CE    . LYS A  1  2    ? 170.962 160.641 118.144 1.00 0.00 ? 2    LYS A CE    1 
ATOM   9     N  NZ    . LYS A  1  2    ? 171.154 159.815 116.921 1.00 0.00 ? 2    LYS A NZ    1 
ATOM   10    N  N     . GLU A  1  3    ? 173.506 165.253 118.649 1.00 0.00 ? 3    GLU A N     1 
ATOM   11    C  CA    . GLU A  1  3    ? 174.559 165.776 119.512 1.00 0.00 ? 3    GLU A CA    1 
ATOM   12    C  C     . GLU A  1  3    ? 174.812 167.268 119.346 1.00 0.00 ? 3    GLU A C     1 
ATOM   13    O  O     . GLU A  1  3    ? 175.818 167.665 118.753 1.00 0.00 ? 3    GLU A O     1 
ATOM   14    C  CB    . GLU A  1  3    ? 175.860 165.007 119.278 1.00 0.00 ? 3    GLU A CB    1 
ATOM   15    C  CG    . GLU A  1  3    ? 175.783 163.566 119.717 1.00 0.00 ? 3    GLU A CG    1 
ATOM   16    C  CD    . GLU A  1  3    ? 175.408 163.440 121.178 1.00 0.00 ? 3    GLU A CD    1 
ATOM   17    O  OE1   . GLU A  1  3    ? 175.893 164.258 121.988 1.00 0.00 ? 3    GLU A OE1   1 
ATOM   18    O  OE2   . GLU A  1  3    ? 174.623 162.531 121.517 1.00 0.00 ? 3    GLU A OE2   1 
ATOM   19    N  N     . VAL A  1  4    ? 173.905 168.104 119.848 1.00 0.00 ? 4    VAL A N     1 
ATOM   20    C  CA    . VAL A  1  4    ? 174.195 169.528 119.945 1.00 0.00 ? 4    VAL A CA    1 
ATOM   21    C  C     . VAL A  1  4    ? 175.418 169.733 120.835 1.00 0.00 ? 4    VAL A C     1 
ATOM   22    O  O     . VAL A  1  4    ? 175.699 168.936 121.740 1.00 0.00 ? 4    VAL A O     1 
ATOM   23    C  CB    . VAL A  1  4    ? 172.965 170.289 120.476 1.00 0.00 ? 4    VAL A CB    1 
ATOM   24    C  CG1   . VAL A  1  4    ? 172.620 169.829 121.880 1.00 0.00 ? 4    VAL A CG1   1 
ATOM   25    C  CG2   . VAL A  1  4    ? 173.186 171.795 120.435 1.00 0.00 ? 4    VAL A CG2   1 
ATOM   26    N  N     . VAL A  1  5    ? 176.175 170.794 120.557 1.00 0.00 ? 5    VAL A N     1 
ATOM   27    C  CA    . VAL A  1  5    ? 177.423 171.052 121.270 1.00 0.00 ? 5    VAL A CA    1 
ATOM   28    C  C     . VAL A  1  5    ? 177.122 171.327 122.738 1.00 0.00 ? 5    VAL A C     1 
ATOM   29    O  O     . VAL A  1  5    ? 176.102 171.937 123.075 1.00 0.00 ? 5    VAL A O     1 
ATOM   30    C  CB    . VAL A  1  5    ? 178.185 172.220 120.632 1.00 0.00 ? 5    VAL A CB    1 
ATOM   31    C  CG1   . VAL A  1  5    ? 179.432 172.560 121.433 1.00 0.00 ? 5    VAL A CG1   1 
ATOM   32    C  CG2   . VAL A  1  5    ? 178.562 171.885 119.211 1.00 0.00 ? 5    VAL A CG2   1 
ATOM   33    N  N     . VAL A  1  6    ? 178.013 170.874 123.617 1.00 0.00 ? 6    VAL A N     1 
ATOM   34    C  CA    . VAL A  1  6    ? 177.911 171.135 125.046 1.00 0.00 ? 6    VAL A CA    1 
ATOM   35    C  C     . VAL A  1  6    ? 178.940 172.210 125.376 1.00 0.00 ? 6    VAL A C     1 
ATOM   36    O  O     . VAL A  1  6    ? 180.104 172.112 124.989 1.00 0.00 ? 6    VAL A O     1 
ATOM   37    C  CB    . VAL A  1  6    ? 178.138 169.866 125.866 1.00 0.00 ? 6    VAL A CB    1 
ATOM   38    C  CG1   . VAL A  1  6    ? 178.123 170.185 127.351 1.00 0.00 ? 6    VAL A CG1   1 
ATOM   39    C  CG2   . VAL A  1  6    ? 177.089 168.832 125.520 1.00 0.00 ? 6    VAL A CG2   1 
ATOM   40    N  N     . SER A  1  7    ? 178.513 173.240 126.097 1.00 0.00 ? 7    SER A N     1 
ATOM   41    C  CA    . SER A  1  7    ? 179.384 174.348 126.463 1.00 0.00 ? 7    SER A CA    1 
ATOM   42    C  C     . SER A  1  7    ? 179.200 174.644 127.944 1.00 0.00 ? 7    SER A C     1 
ATOM   43    O  O     . SER A  1  7    ? 178.078 174.602 128.459 1.00 0.00 ? 7    SER A O     1 
ATOM   44    C  CB    . SER A  1  7    ? 179.080 175.583 125.620 1.00 0.00 ? 7    SER A CB    1 
ATOM   45    O  OG    . SER A  1  7    ? 179.359 175.350 124.253 1.00 0.00 ? 7    SER A OG    1 
ATOM   46    N  N     . GLU A  1  8    ? 180.301 174.937 128.625 1.00 0.00 ? 8    GLU A N     1 
ATOM   47    C  CA    . GLU A  1  8    ? 180.281 175.370 130.012 1.00 0.00 ? 8    GLU A CA    1 
ATOM   48    C  C     . GLU A  1  8    ? 181.492 176.253 130.263 1.00 0.00 ? 8    GLU A C     1 
ATOM   49    O  O     . GLU A  1  8    ? 182.479 176.200 129.524 1.00 0.00 ? 8    GLU A O     1 
ATOM   50    C  CB    . GLU A  1  8    ? 180.302 174.180 130.974 1.00 0.00 ? 8    GLU A CB    1 
ATOM   51    C  CG    . GLU A  1  8    ? 181.656 173.506 131.089 1.00 0.00 ? 8    GLU A CG    1 
ATOM   52    C  CD    . GLU A  1  8    ? 181.998 172.640 129.893 1.00 0.00 ? 8    GLU A CD    1 
ATOM   53    O  OE1   . GLU A  1  8    ? 181.224 172.617 128.915 1.00 0.00 ? 8    GLU A OE1   1 
ATOM   54    O  OE2   . GLU A  1  8    ? 183.055 171.980 129.932 1.00 0.00 ? 8    GLU A OE2   1 
ATOM   55    N  N     . THR A  1  9    ? 181.415 177.067 131.311 1.00 0.00 ? 9    THR A N     1 
ATOM   56    C  CA    . THR A  1  9    ? 182.520 177.922 131.648 1.00 0.00 ? 9    THR A CA    1 
ATOM   57    C  C     . THR A  1  9    ? 182.673 177.872 133.163 1.00 0.00 ? 9    THR A C     1 
ATOM   58    O  O     . THR A  1  9    ? 181.658 177.903 133.882 1.00 0.00 ? 9    THR A O     1 
ATOM   59    C  CB    . THR A  1  9    ? 182.271 179.349 131.181 1.00 0.00 ? 9    THR A CB    1 
ATOM   60    O  OG1   . THR A  1  9    ? 181.917 179.331 129.797 1.00 0.00 ? 9    THR A OG1   1 
ATOM   61    C  CG2   . THR A  1  9    ? 183.523 180.176 131.344 1.00 0.00 ? 9    THR A CG2   1 
ATOM   62    N  N     . PRO A  1  10   ? 183.894 177.804 133.679 1.00 0.00 ? 10   PRO A N     1 
ATOM   63    C  CA    . PRO A  1  10   ? 184.065 177.785 135.131 1.00 0.00 ? 10   PRO A CA    1 
ATOM   64    C  C     . PRO A  1  10   ? 183.628 179.103 135.747 1.00 0.00 ? 10   PRO A C     1 
ATOM   65    O  O     . PRO A  1  10   ? 184.008 180.180 135.287 1.00 0.00 ? 10   PRO A O     1 
ATOM   66    C  CB    . PRO A  1  10   ? 185.567 177.546 135.305 1.00 0.00 ? 10   PRO A CB    1 
ATOM   67    C  CG    . PRO A  1  10   ? 185.953 176.825 134.066 1.00 0.00 ? 10   PRO A CG    1 
ATOM   68    C  CD    . PRO A  1  10   ? 185.135 177.444 132.977 1.00 0.00 ? 10   PRO A CD    1 
ATOM   69    N  N     . LYS A  1  11   ? 182.824 179.008 136.796 1.00 0.00 ? 11   LYS A N     1 
ATOM   70    C  CA    . LYS A  1  11   ? 182.247 180.163 137.449 1.00 0.00 ? 11   LYS A CA    1 
ATOM   71    C  C     . LYS A  1  11   ? 182.679 180.186 138.908 1.00 0.00 ? 11   LYS A C     1 
ATOM   72    O  O     . LYS A  1  11   ? 182.945 179.145 139.508 1.00 0.00 ? 11   LYS A O     1 
ATOM   73    C  CB    . LYS A  1  11   ? 180.713 180.141 137.358 1.00 0.00 ? 11   LYS A CB    1 
ATOM   74    C  CG    . LYS A  1  11   ? 180.149 180.161 135.939 1.00 0.00 ? 11   LYS A CG    1 
ATOM   75    C  CD    . LYS A  1  11   ? 180.426 181.495 135.292 1.00 0.00 ? 11   LYS A CD    1 
ATOM   76    C  CE    . LYS A  1  11   ? 179.893 181.639 133.872 1.00 0.00 ? 11   LYS A CE    1 
ATOM   77    N  NZ    . LYS A  1  11   ? 178.419 181.758 133.788 1.00 0.00 ? 11   LYS A NZ    1 
ATOM   78    N  N     . ARG A  1  12   ? 182.755 181.386 139.480 1.00 0.00 ? 12   ARG A N     1 
ATOM   79    C  CA    . ARG A  1  12   ? 182.918 181.508 140.918 1.00 0.00 ? 12   ARG A CA    1 
ATOM   80    C  C     . ARG A  1  12   ? 181.952 182.564 141.424 1.00 0.00 ? 12   ARG A C     1 
ATOM   81    O  O     . ARG A  1  12   ? 181.479 183.414 140.669 1.00 0.00 ? 12   ARG A O     1 
ATOM   82    C  CB    . ARG A  1  12   ? 184.346 181.866 141.311 1.00 0.00 ? 12   ARG A CB    1 
ATOM   83    C  CG    . ARG A  1  12   ? 184.741 183.277 140.979 1.00 0.00 ? 12   ARG A CG    1 
ATOM   84    C  CD    . ARG A  1  12   ? 186.205 183.501 141.295 1.00 0.00 ? 12   ARG A CD    1 
ATOM   85    N  NE    . ARG A  1  12   ? 186.595 184.882 141.067 1.00 0.00 ? 12   ARG A NE    1 
ATOM   86    C  CZ    . ARG A  1  12   ? 186.600 185.814 142.010 1.00 0.00 ? 12   ARG A CZ    1 
ATOM   87    N  NH1   . ARG A  1  12   ? 186.272 185.500 143.253 1.00 0.00 ? 12   ARG A NH1   1 
ATOM   88    N  NH2   . ARG A  1  12   ? 186.964 187.052 141.715 1.00 0.00 ? 12   ARG A NH2   1 
ATOM   89    N  N     . ILE A  1  13   ? 181.659 182.497 142.714 1.00 0.00 ? 13   ILE A N     1 
ATOM   90    C  CA    . ILE A  1  13   ? 180.622 183.337 143.293 1.00 0.00 ? 13   ILE A CA    1 
ATOM   91    C  C     . ILE A  1  13   ? 181.105 184.773 143.327 1.00 0.00 ? 13   ILE A C     1 
ATOM   92    O  O     . ILE A  1  13   ? 182.124 185.080 143.950 1.00 0.00 ? 13   ILE A O     1 
ATOM   93    C  CB    . ILE A  1  13   ? 180.263 182.868 144.706 1.00 0.00 ? 13   ILE A CB    1 
ATOM   94    C  CG1   . ILE A  1  13   ? 179.743 181.440 144.691 1.00 0.00 ? 13   ILE A CG1   1 
ATOM   95    C  CG2   . ILE A  1  13   ? 179.234 183.785 145.301 1.00 0.00 ? 13   ILE A CG2   1 
ATOM   96    C  CD1   . ILE A  1  13   ? 180.776 180.458 145.148 1.00 0.00 ? 13   ILE A CD1   1 
ATOM   97    N  N     . LYS A  1  14   ? 180.358 185.666 142.699 1.00 0.00 ? 14   LYS A N     1 
ATOM   98    C  CA    . LYS A  1  14   ? 180.575 187.092 142.881 1.00 0.00 ? 14   LYS A CA    1 
ATOM   99    C  C     . LYS A  1  14   ? 179.341 187.605 143.605 1.00 0.00 ? 14   LYS A C     1 
ATOM   100   O  O     . LYS A  1  14   ? 178.268 187.739 143.018 1.00 0.00 ? 14   LYS A O     1 
ATOM   101   C  CB    . LYS A  1  14   ? 180.793 187.800 141.566 1.00 0.00 ? 14   LYS A CB    1 
ATOM   102   C  CG    . LYS A  1  14   ? 181.028 189.277 141.729 1.00 0.00 ? 14   LYS A CG    1 
ATOM   103   C  CD    . LYS A  1  14   ? 181.271 189.978 140.406 1.00 0.00 ? 14   LYS A CD    1 
ATOM   104   C  CE    . LYS A  1  14   ? 179.981 190.154 139.632 1.00 0.00 ? 14   LYS A CE    1 
ATOM   105   N  NZ    . LYS A  1  14   ? 180.171 190.894 138.358 1.00 0.00 ? 14   LYS A NZ    1 
ATOM   106   N  N     . GLY A  1  15   ? 179.497 187.895 144.885 1.00 0.00 ? 15   GLY A N     1 
ATOM   107   C  CA    . GLY A  1  15   ? 178.431 188.508 145.646 1.00 0.00 ? 15   GLY A CA    1 
ATOM   108   C  C     . GLY A  1  15   ? 177.298 187.567 145.992 1.00 0.00 ? 15   GLY A C     1 
ATOM   109   O  O     . GLY A  1  15   ? 177.121 186.530 145.350 1.00 0.00 ? 15   GLY A O     1 
ATOM   110   N  N     . LEU A  1  16   ? 176.525 187.922 147.007 1.00 0.00 ? 16   LEU A N     1 
ATOM   111   C  CA    . LEU A  1  16   ? 175.304 187.209 147.359 1.00 0.00 ? 16   LEU A CA    1 
ATOM   112   C  C     . LEU A  1  16   ? 174.181 188.232 147.416 1.00 0.00 ? 16   LEU A C     1 
ATOM   113   O  O     . LEU A  1  16   ? 174.157 189.085 148.305 1.00 0.00 ? 16   LEU A O     1 
ATOM   114   C  CB    . LEU A  1  16   ? 175.447 186.486 148.688 1.00 0.00 ? 16   LEU A CB    1 
ATOM   115   C  CG    . LEU A  1  16   ? 176.047 185.091 148.655 1.00 0.00 ? 16   LEU A CG    1 
ATOM   116   C  CD1   . LEU A  1  16   ? 177.498 185.152 148.290 1.00 0.00 ? 16   LEU A CD1   1 
ATOM   117   C  CD2   . LEU A  1  16   ? 175.876 184.414 149.985 1.00 0.00 ? 16   LEU A CD2   1 
ATOM   118   N  N     . GLU A  1  17   ? 173.240 188.150 146.485 1.00 0.00 ? 17   GLU A N     1 
ATOM   119   C  CA    . GLU A  1  17   ? 172.088 189.034 146.525 1.00 0.00 ? 17   GLU A CA    1 
ATOM   120   C  C     . GLU A  1  17   ? 171.120 188.463 147.546 1.00 0.00 ? 17   GLU A C     1 
ATOM   121   O  O     . GLU A  1  17   ? 170.600 187.359 147.364 1.00 0.00 ? 17   GLU A O     1 
ATOM   122   C  CB    . GLU A  1  17   ? 171.450 189.131 145.142 1.00 0.00 ? 17   GLU A CB    1 
ATOM   123   C  CG    . GLU A  1  17   ? 172.349 189.790 144.104 1.00 0.00 ? 17   GLU A CG    1 
ATOM   124   C  CD    . GLU A  1  17   ? 171.826 189.660 142.682 1.00 0.00 ? 17   GLU A CD    1 
ATOM   125   O  OE1   . GLU A  1  17   ? 170.856 188.909 142.459 1.00 0.00 ? 17   GLU A OE1   1 
ATOM   126   O  OE2   . GLU A  1  17   ? 172.404 190.296 141.779 1.00 0.00 ? 17   GLU A OE2   1 
ATOM   127   N  N     . PHE A  1  18   ? 170.896 189.185 148.633 1.00 0.00 ? 18   PHE A N     1 
ATOM   128   C  CA    . PHE A  1  18   ? 169.886 188.811 149.610 1.00 0.00 ? 18   PHE A CA    1 
ATOM   129   C  C     . PHE A  1  18   ? 168.522 189.310 149.178 1.00 0.00 ? 18   PHE A C     1 
ATOM   130   O  O     . PHE A  1  18   ? 168.418 190.269 148.408 1.00 0.00 ? 18   PHE A O     1 
ATOM   131   C  CB    . PHE A  1  18   ? 170.217 189.314 151.008 1.00 0.00 ? 18   PHE A CB    1 
ATOM   132   C  CG    . PHE A  1  18   ? 171.219 188.479 151.709 1.00 0.00 ? 18   PHE A CG    1 
ATOM   133   C  CD1   . PHE A  1  18   ? 171.585 187.259 151.189 1.00 0.00 ? 18   PHE A CD1   1 
ATOM   134   C  CD2   . PHE A  1  18   ? 171.732 188.862 152.918 1.00 0.00 ? 18   PHE A CD2   1 
ATOM   135   C  CE1   . PHE A  1  18   ? 172.483 186.462 151.838 1.00 0.00 ? 18   PHE A CE1   1 
ATOM   136   C  CE2   . PHE A  1  18   ? 172.625 188.063 153.572 1.00 0.00 ? 18   PHE A CE2   1 
ATOM   137   C  CZ    . PHE A  1  18   ? 173.006 186.864 153.029 1.00 0.00 ? 18   PHE A CZ    1 
ATOM   138   N  N     . SER A  1  19   ? 167.490 188.657 149.687 1.00 0.00 ? 19   SER A N     1 
ATOM   139   C  CA    . SER A  1  19   ? 166.115 189.088 149.533 1.00 0.00 ? 19   SER A CA    1 
ATOM   140   C  C     . SER A  1  19   ? 165.238 188.147 150.324 1.00 0.00 ? 19   SER A C     1 
ATOM   141   O  O     . SER A  1  19   ? 165.667 187.047 150.676 1.00 0.00 ? 19   SER A O     1 
ATOM   142   C  CB    . SER A  1  19   ? 165.686 189.078 148.072 1.00 0.00 ? 19   SER A CB    1 
ATOM   143   O  OG    . SER A  1  19   ? 164.309 189.372 147.968 1.00 0.00 ? 19   SER A OG    1 
ATOM   144   N  N     . ALA A  1  20   ? 164.021 188.561 150.621 1.00 0.00 ? 20   ALA A N     1 
ATOM   145   C  CA    . ALA A  1  20   ? 163.027 187.592 151.027 1.00 0.00 ? 20   ALA A CA    1 
ATOM   146   C  C     . ALA A  1  20   ? 162.536 186.934 149.757 1.00 0.00 ? 20   ALA A C     1 
ATOM   147   O  O     . ALA A  1  20   ? 162.533 187.561 148.696 1.00 0.00 ? 20   ALA A O     1 
ATOM   148   C  CB    . ALA A  1  20   ? 161.865 188.229 151.780 1.00 0.00 ? 20   ALA A CB    1 
ATOM   149   N  N     . LEU A  1  21   ? 162.158 185.668 149.850 1.00 0.00 ? 21   LEU A N     1 
ATOM   150   C  CA    . LEU A  1  21   ? 161.429 185.073 148.746 1.00 0.00 ? 21   LEU A CA    1 
ATOM   151   C  C     . LEU A  1  21   ? 160.081 185.752 148.637 1.00 0.00 ? 21   LEU A C     1 
ATOM   152   O  O     . LEU A  1  21   ? 159.593 186.336 149.606 1.00 0.00 ? 21   LEU A O     1 
ATOM   153   C  CB    . LEU A  1  21   ? 161.236 183.581 148.946 1.00 0.00 ? 21   LEU A CB    1 
ATOM   154   C  CG    . LEU A  1  21   ? 162.476 182.728 148.809 1.00 0.00 ? 21   LEU A CG    1 
ATOM   155   C  CD1   . LEU A  1  21   ? 162.094 181.300 149.088 1.00 0.00 ? 21   LEU A CD1   1 
ATOM   156   C  CD2   . LEU A  1  21   ? 163.018 182.879 147.414 1.00 0.00 ? 21   LEU A CD2   1 
ATOM   157   N  N     . SER A  1  22   ? 159.478 185.685 147.462 1.00 0.00 ? 22   SER A N     1 
ATOM   158   C  CA    . SER A  1  22   ? 158.159 186.267 147.354 1.00 0.00 ? 22   SER A CA    1 
ATOM   159   C  C     . SER A  1  22   ? 157.157 185.388 148.082 1.00 0.00 ? 22   SER A C     1 
ATOM   160   O  O     . SER A  1  22   ? 157.475 184.307 148.580 1.00 0.00 ? 22   SER A O     1 
ATOM   161   C  CB    . SER A  1  22   ? 157.740 186.395 145.896 1.00 0.00 ? 22   SER A CB    1 
ATOM   162   O  OG    . SER A  1  22   ? 157.496 185.110 145.353 1.00 0.00 ? 22   SER A OG    1 
ATOM   163   N  N     . ALA A  1  23   ? 155.921 185.859 148.125 1.00 0.00 ? 23   ALA A N     1 
ATOM   164   C  CA    . ALA A  1  23   ? 154.853 184.952 148.479 1.00 0.00 ? 23   ALA A CA    1 
ATOM   165   C  C     . ALA A  1  23   ? 154.715 183.866 147.434 1.00 0.00 ? 23   ALA A C     1 
ATOM   166   O  O     . ALA A  1  23   ? 154.491 182.705 147.782 1.00 0.00 ? 23   ALA A O     1 
ATOM   167   C  CB    . ALA A  1  23   ? 153.545 185.718 148.636 1.00 0.00 ? 23   ALA A CB    1 
ATOM   168   N  N     . ALA A  1  24   ? 154.885 184.215 146.162 1.00 0.00 ? 24   ALA A N     1 
ATOM   169   C  CA    . ALA A  1  24   ? 154.722 183.275 145.071 1.00 0.00 ? 24   ALA A CA    1 
ATOM   170   C  C     . ALA A  1  24   ? 155.899 182.340 144.876 1.00 0.00 ? 24   ALA A C     1 
ATOM   171   O  O     . ALA A  1  24   ? 155.682 181.135 144.730 1.00 0.00 ? 24   ALA A O     1 
ATOM   172   C  CB    . ALA A  1  24   ? 154.474 184.030 143.760 1.00 0.00 ? 24   ALA A CB    1 
ATOM   173   N  N     . ASP A  1  25   ? 157.127 182.849 144.874 1.00 0.00 ? 25   ASP A N     1 
ATOM   174   C  CA    . ASP A  1  25   ? 158.257 182.013 144.492 1.00 0.00 ? 25   ASP A CA    1 
ATOM   175   C  C     . ASP A  1  25   ? 158.353 180.743 145.311 1.00 0.00 ? 25   ASP A C     1 
ATOM   176   O  O     . ASP A  1  25   ? 158.840 179.732 144.800 1.00 0.00 ? 25   ASP A O     1 
ATOM   177   C  CB    . ASP A  1  25   ? 159.554 182.796 144.615 1.00 0.00 ? 25   ASP A CB    1 
ATOM   178   C  CG    . ASP A  1  25   ? 159.675 183.861 143.562 1.00 0.00 ? 25   ASP A CG    1 
ATOM   179   O  OD1   . ASP A  1  25   ? 158.930 183.778 142.563 1.00 0.00 ? 25   ASP A OD1   1 
ATOM   180   O  OD2   . ASP A  1  25   ? 160.502 184.782 143.733 1.00 0.00 ? 25   ASP A OD2   1 
ATOM   181   N  N     . ILE A  1  26   ? 157.900 180.767 146.561 1.00 0.00 ? 26   ILE A N     1 
ATOM   182   C  CA    . ILE A  1  26   ? 157.906 179.551 147.361 1.00 0.00 ? 26   ILE A CA    1 
ATOM   183   C  C     . ILE A  1  26   ? 157.108 178.459 146.678 1.00 0.00 ? 26   ILE A C     1 
ATOM   184   O  O     . ILE A  1  26   ? 157.665 177.445 146.244 1.00 0.00 ? 26   ILE A O     1 
ATOM   185   C  CB    . ILE A  1  26   ? 157.370 179.840 148.765 1.00 0.00 ? 26   ILE A CB    1 
ATOM   186   C  CG1   . ILE A  1  26   ? 158.330 180.776 149.470 1.00 0.00 ? 26   ILE A CG1   1 
ATOM   187   C  CG2   . ILE A  1  26   ? 157.253 178.569 149.531 1.00 0.00 ? 26   ILE A CG2   1 
ATOM   188   C  CD1   . ILE A  1  26   ? 157.817 181.307 150.745 1.00 0.00 ? 26   ILE A CD1   1 
ATOM   189   N  N     . VAL A  1  27   ? 155.793 178.649 146.556 1.00 0.00 ? 27   VAL A N     1 
ATOM   190   C  CA    . VAL A  1  27   ? 154.967 177.647 145.905 1.00 0.00 ? 27   VAL A CA    1 
ATOM   191   C  C     . VAL A  1  27   ? 155.421 177.416 144.472 1.00 0.00 ? 27   VAL A C     1 
ATOM   192   O  O     . VAL A  1  27   ? 155.088 176.389 143.875 1.00 0.00 ? 27   VAL A O     1 
ATOM   193   C  CB    . VAL A  1  27   ? 153.489 178.068 145.980 1.00 0.00 ? 27   VAL A CB    1 
ATOM   194   C  CG1   . VAL A  1  27   ? 153.265 179.328 145.195 1.00 0.00 ? 27   VAL A CG1   1 
ATOM   195   C  CG2   . VAL A  1  27   ? 152.584 176.955 145.494 1.00 0.00 ? 27   VAL A CG2   1 
ATOM   196   N  N     . ALA A  1  28   ? 156.197 178.341 143.910 1.00 0.00 ? 28   ALA A N     1 
ATOM   197   C  CA    . ALA A  1  28   ? 156.818 178.086 142.618 1.00 0.00 ? 28   ALA A CA    1 
ATOM   198   C  C     . ALA A  1  28   ? 158.046 177.202 142.758 1.00 0.00 ? 28   ALA A C     1 
ATOM   199   O  O     . ALA A  1  28   ? 158.587 176.734 141.752 1.00 0.00 ? 28   ALA A O     1 
ATOM   200   C  CB    . ALA A  1  28   ? 157.183 179.404 141.940 1.00 0.00 ? 28   ALA A CB    1 
ATOM   201   N  N     . GLN A  1  29   ? 158.506 176.973 143.986 1.00 0.00 ? 29   GLN A N     1 
ATOM   202   C  CA    . GLN A  1  29   ? 159.620 176.069 144.230 1.00 0.00 ? 29   GLN A CA    1 
ATOM   203   C  C     . GLN A  1  29   ? 159.302 174.643 144.609 1.00 0.00 ? 29   GLN A C     1 
ATOM   204   O  O     . GLN A  1  29   ? 159.500 173.744 143.789 1.00 0.00 ? 29   GLN A O     1 
ATOM   205   C  CB    . GLN A  1  29   ? 160.504 176.567 145.366 1.00 0.00 ? 29   GLN A CB    1 
ATOM   206   C  CG    . GLN A  1  29   ? 161.296 177.792 145.104 1.00 0.00 ? 29   GLN A CG    1 
ATOM   207   C  CD    . GLN A  1  29   ? 162.066 178.192 146.331 1.00 0.00 ? 29   GLN A CD    1 
ATOM   208   O  OE1   . GLN A  1  29   ? 161.674 177.869 147.450 1.00 0.00 ? 29   GLN A OE1   1 
ATOM   209   N  NE2   . GLN A  1  29   ? 163.174 178.885 146.135 1.00 0.00 ? 29   GLN A NE2   1 
ATOM   210   N  N     . SER A  1  30   ? 158.842 174.423 145.829 1.00 0.00 ? 30   SER A N     1 
ATOM   211   C  CA    . SER A  1  30   ? 158.763 173.065 146.359 1.00 0.00 ? 30   SER A CA    1 
ATOM   212   C  C     . SER A  1  30   ? 157.855 172.206 145.529 1.00 0.00 ? 30   SER A C     1 
ATOM   213   O  O     . SER A  1  30   ? 156.990 172.717 144.816 1.00 0.00 ? 30   SER A O     1 
ATOM   214   C  CB    . SER A  1  30   ? 158.295 173.075 147.805 1.00 0.00 ? 30   SER A CB    1 
ATOM   215   O  OG    . SER A  1  30   ? 156.989 173.614 147.841 1.00 0.00 ? 30   SER A OG    1 
ATOM   216   N  N     . GLU A  1  31   ? 158.096 170.907 145.571 1.00 0.00 ? 31   GLU A N     1 
ATOM   217   C  CA    . GLU A  1  31   ? 157.225 169.985 144.870 1.00 0.00 ? 31   GLU A CA    1 
ATOM   218   C  C     . GLU A  1  31   ? 155.799 169.837 145.377 1.00 0.00 ? 31   GLU A C     1 
ATOM   219   O  O     . GLU A  1  31   ? 154.854 169.831 144.584 1.00 0.00 ? 31   GLU A O     1 
ATOM   220   C  CB    . GLU A  1  31   ? 157.981 168.666 144.976 1.00 0.00 ? 31   GLU A CB    1 
ATOM   221   C  CG    . GLU A  1  31   ? 159.356 168.709 144.337 1.00 0.00 ? 31   GLU A CG    1 
ATOM   222   C  CD    . GLU A  1  31   ? 159.296 169.070 142.870 1.00 0.00 ? 31   GLU A CD    1 
ATOM   223   O  OE1   . GLU A  1  31   ? 158.362 168.608 142.181 1.00 0.00 ? 31   GLU A OE1   1 
ATOM   224   O  OE2   . GLU A  1  31   ? 160.186 169.809 142.402 1.00 0.00 ? 31   GLU A OE2   1 
ATOM   225   N  N     . VAL A  1  32   ? 155.614 169.722 146.691 1.00 0.00 ? 32   VAL A N     1 
ATOM   226   C  CA    . VAL A  1  32   ? 154.324 169.344 147.241 1.00 0.00 ? 32   VAL A CA    1 
ATOM   227   C  C     . VAL A  1  32   ? 154.011 170.156 148.486 1.00 0.00 ? 32   VAL A C     1 
ATOM   228   O  O     . VAL A  1  32   ? 154.845 170.350 149.366 1.00 0.00 ? 32   VAL A O     1 
ATOM   229   C  CB    . VAL A  1  32   ? 154.240 167.844 147.555 1.00 0.00 ? 32   VAL A CB    1 
ATOM   230   C  CG1   . VAL A  1  32   ? 154.276 167.072 146.279 1.00 0.00 ? 32   VAL A CG1   1 
ATOM   231   C  CG2   . VAL A  1  32   ? 155.368 167.437 148.477 1.00 0.00 ? 32   VAL A CG2   1 
ATOM   232   N  N     . GLU A  1  33   ? 152.770 170.610 148.543 1.00 0.00 ? 33   GLU A N     1 
ATOM   233   C  CA    . GLU A  1  33   ? 152.170 171.164 149.739 1.00 0.00 ? 33   GLU A CA    1 
ATOM   234   C  C     . GLU A  1  33   ? 152.266 170.147 150.858 1.00 0.00 ? 33   GLU A C     1 
ATOM   235   O  O     . GLU A  1  33   ? 151.878 168.990 150.693 1.00 0.00 ? 33   GLU A O     1 
ATOM   236   C  CB    . GLU A  1  33   ? 150.698 171.483 149.489 1.00 0.00 ? 33   GLU A CB    1 
ATOM   237   C  CG    . GLU A  1  33   ? 150.426 172.467 148.371 1.00 0.00 ? 33   GLU A CG    1 
ATOM   238   C  CD    . GLU A  1  33   ? 150.502 171.834 146.983 1.00 0.00 ? 33   GLU A CD    1 
ATOM   239   O  OE1   . GLU A  1  33   ? 150.812 170.626 146.892 1.00 0.00 ? 33   GLU A OE1   1 
ATOM   240   O  OE2   . GLU A  1  33   ? 150.258 172.549 145.984 1.00 0.00 ? 33   GLU A OE2   1 
ATOM   241   N  N     . VAL A  1  34   ? 152.805 170.567 151.996 1.00 0.00 ? 34   VAL A N     1 
ATOM   242   C  CA    . VAL A  1  34   ? 152.659 169.704 153.154 1.00 0.00 ? 34   VAL A CA    1 
ATOM   243   C  C     . VAL A  1  34   ? 151.171 169.652 153.464 1.00 0.00 ? 34   VAL A C     1 
ATOM   244   O  O     . VAL A  1  34   ? 150.558 168.581 153.399 1.00 0.00 ? 34   VAL A O     1 
ATOM   245   C  CB    . VAL A  1  34   ? 153.517 170.154 154.353 1.00 0.00 ? 34   VAL A CB    1 
ATOM   246   C  CG1   . VAL A  1  34   ? 153.269 171.587 154.723 1.00 0.00 ? 34   VAL A CG1   1 
ATOM   247   C  CG2   . VAL A  1  34   ? 153.230 169.274 155.536 1.00 0.00 ? 34   VAL A CG2   1 
ATOM   248   N  N     . SER A  1  35   ? 150.582 170.806 153.739 1.00 0.00 ? 35   SER A N     1 
ATOM   249   C  CA    . SER A  1  35   ? 149.141 171.005 153.884 1.00 0.00 ? 35   SER A CA    1 
ATOM   250   C  C     . SER A  1  35   ? 148.560 169.873 154.726 1.00 0.00 ? 35   SER A C     1 
ATOM   251   O  O     . SER A  1  35   ? 149.174 169.439 155.704 1.00 0.00 ? 35   SER A O     1 
ATOM   252   C  CB    . SER A  1  35   ? 148.529 171.148 152.507 1.00 0.00 ? 35   SER A CB    1 
ATOM   253   O  OG    . SER A  1  35   ? 148.990 172.326 151.870 1.00 0.00 ? 35   SER A OG    1 
ATOM   254   N  N     . THR A  1  36   ? 147.411 169.353 154.302 1.00 0.00 ? 36   THR A N     1 
ATOM   255   C  CA    . THR A  1  36   ? 146.833 168.138 154.856 1.00 0.00 ? 36   THR A CA    1 
ATOM   256   C  C     . THR A  1  36   ? 146.799 168.150 156.373 1.00 0.00 ? 36   THR A C     1 
ATOM   257   O  O     . THR A  1  36   ? 146.275 169.081 156.993 1.00 0.00 ? 36   THR A O     1 
ATOM   258   C  CB    . THR A  1  36   ? 147.623 166.920 154.384 1.00 0.00 ? 36   THR A CB    1 
ATOM   259   O  OG1   . THR A  1  36   ? 148.948 166.963 154.929 1.00 0.00 ? 36   THR A OG1   1 
ATOM   260   C  CG2   . THR A  1  36   ? 147.726 166.953 152.892 1.00 0.00 ? 36   THR A CG2   1 
ATOM   261   N  N     . ARG A  1  37   ? 147.371 167.113 156.967 1.00 0.00 ? 37   ARG A N     1 
ATOM   262   C  CA    . ARG A  1  37   ? 147.462 166.981 158.409 1.00 0.00 ? 37   ARG A CA    1 
ATOM   263   C  C     . ARG A  1  37   ? 148.791 166.295 158.670 1.00 0.00 ? 37   ARG A C     1 
ATOM   264   O  O     . ARG A  1  37   ? 149.625 166.175 157.772 1.00 0.00 ? 37   ARG A O     1 
ATOM   265   C  CB    . ARG A  1  37   ? 146.254 166.217 158.968 1.00 0.00 ? 37   ARG A CB    1 
ATOM   266   C  CG    . ARG A  1  37   ? 146.106 166.217 160.481 1.00 0.00 ? 37   ARG A CG    1 
ATOM   267   C  CD    . ARG A  1  37   ? 144.743 165.704 160.915 1.00 0.00 ? 37   ARG A CD    1 
ATOM   268   N  NE    . ARG A  1  37   ? 143.678 166.636 160.561 1.00 0.00 ? 37   ARG A NE    1 
ATOM   269   C  CZ    . ARG A  1  37   ? 142.824 166.451 159.561 1.00 0.00 ? 37   ARG A CZ    1 
ATOM   270   N  NH1   . ARG A  1  37   ? 142.909 165.360 158.813 1.00 0.00 ? 37   ARG A NH1   1 
ATOM   271   N  NH2   . ARG A  1  37   ? 141.885 167.354 159.313 1.00 0.00 ? 37   ARG A NH2   1 
ATOM   272   N  N     . ASP A  1  38   ? 148.999 165.863 159.903 1.00 0.00 ? 38   ASP A N     1 
ATOM   273   C  CA    . ASP A  1  38   ? 150.302 165.310 160.215 1.00 0.00 ? 38   ASP A CA    1 
ATOM   274   C  C     . ASP A  1  38   ? 150.313 163.787 160.294 1.00 0.00 ? 38   ASP A C     1 
ATOM   275   O  O     . ASP A  1  38   ? 150.652 163.121 159.314 1.00 0.00 ? 38   ASP A O     1 
ATOM   276   C  CB    . ASP A  1  38   ? 150.767 165.944 161.518 1.00 0.00 ? 38   ASP A CB    1 
ATOM   277   C  CG    . ASP A  1  38   ? 149.689 165.950 162.567 1.00 0.00 ? 38   ASP A CG    1 
ATOM   278   O  OD1   . ASP A  1  38   ? 148.565 165.519 162.246 1.00 0.00 ? 38   ASP A OD1   1 
ATOM   279   O  OD2   . ASP A  1  38   ? 149.948 166.409 163.695 1.00 0.00 ? 38   ASP A OD2   1 
ATOM   280   N  N     . LEU A  1  39   ? 149.962 163.229 161.449 1.00 0.00 ? 39   LEU A N     1 
ATOM   281   C  CA    . LEU A  1  39   ? 149.688 161.806 161.643 1.00 0.00 ? 39   LEU A CA    1 
ATOM   282   C  C     . LEU A  1  39   ? 150.854 160.881 161.302 1.00 0.00 ? 39   LEU A C     1 
ATOM   283   O  O     . LEU A  1  39   ? 150.994 159.813 161.908 1.00 0.00 ? 39   LEU A O     1 
ATOM   284   C  CB    . LEU A  1  39   ? 148.475 161.391 160.803 1.00 0.00 ? 39   LEU A CB    1 
ATOM   285   C  CG    . LEU A  1  39   ? 147.106 161.979 161.143 1.00 0.00 ? 39   LEU A CG    1 
ATOM   286   C  CD1   . LEU A  1  39   ? 146.074 161.558 160.108 1.00 0.00 ? 39   LEU A CD1   1 
ATOM   287   C  CD2   . LEU A  1  39   ? 146.674 161.555 162.537 1.00 0.00 ? 39   LEU A CD2   1 
ATOM   288   N  N     . PHE A  1  40   ? 151.728 161.311 160.384 1.00 0.00 ? 40   PHE A N     1 
ATOM   289   C  CA    . PHE A  1  40   ? 152.825 160.493 159.852 1.00 0.00 ? 40   PHE A CA    1 
ATOM   290   C  C     . PHE A  1  40   ? 152.402 159.049 159.596 1.00 0.00 ? 40   PHE A C     1 
ATOM   291   O  O     . PHE A  1  40   ? 153.156 158.116 159.883 1.00 0.00 ? 40   PHE A O     1 
ATOM   292   C  CB    . PHE A  1  40   ? 154.045 160.556 160.760 1.00 0.00 ? 40   PHE A CB    1 
ATOM   293   C  CG    . PHE A  1  40   ? 154.624 161.922 160.860 1.00 0.00 ? 40   PHE A CG    1 
ATOM   294   C  CD1   . PHE A  1  40   ? 154.351 162.860 159.890 1.00 0.00 ? 40   PHE A CD1   1 
ATOM   295   C  CD2   . PHE A  1  40   ? 155.418 162.280 161.927 1.00 0.00 ? 40   PHE A CD2   1 
ATOM   296   C  CE1   . PHE A  1  40   ? 154.871 164.119 159.973 1.00 0.00 ? 40   PHE A CE1   1 
ATOM   297   C  CE2   . PHE A  1  40   ? 155.941 163.541 162.017 1.00 0.00 ? 40   PHE A CE2   1 
ATOM   298   C  CZ    . PHE A  1  40   ? 155.669 164.463 161.040 1.00 0.00 ? 40   PHE A CZ    1 
ATOM   299   N  N     . ASP A  1  41   ? 151.159 158.879 159.131 1.00 0.00 ? 41   ASP A N     1 
ATOM   300   C  CA    . ASP A  1  41   ? 150.539 157.645 158.645 1.00 0.00 ? 41   ASP A CA    1 
ATOM   301   C  C     . ASP A  1  41   ? 150.972 156.386 159.388 1.00 0.00 ? 41   ASP A C     1 
ATOM   302   O  O     . ASP A  1  41   ? 151.601 155.498 158.804 1.00 0.00 ? 41   ASP A O     1 
ATOM   303   C  CB    . ASP A  1  41   ? 150.719 157.486 157.123 1.00 0.00 ? 41   ASP A CB    1 
ATOM   304   C  CG    . ASP A  1  41   ? 152.167 157.408 156.670 1.00 0.00 ? 41   ASP A CG    1 
ATOM   305   O  OD1   . ASP A  1  41   ? 153.091 157.294 157.493 1.00 0.00 ? 41   ASP A OD1   1 
ATOM   306   O  OD2   . ASP A  1  41   ? 152.382 157.442 155.441 1.00 0.00 ? 41   ASP A OD2   1 
ATOM   307   N  N     . LEU A  1  42   ? 150.597 156.266 160.661 1.00 0.00 ? 42   LEU A N     1 
ATOM   308   C  CA    . LEU A  1  42   ? 150.910 155.026 161.353 1.00 0.00 ? 42   LEU A CA    1 
ATOM   309   C  C     . LEU A  1  42   ? 149.906 153.972 160.914 1.00 0.00 ? 42   LEU A C     1 
ATOM   310   O  O     . LEU A  1  42   ? 148.728 154.018 161.281 1.00 0.00 ? 42   LEU A O     1 
ATOM   311   C  CB    . LEU A  1  42   ? 150.876 155.230 162.872 1.00 0.00 ? 42   LEU A CB    1 
ATOM   312   C  CG    . LEU A  1  42   ? 151.319 154.093 163.798 1.00 0.00 ? 42   LEU A CG    1 
ATOM   313   C  CD1   . LEU A  1  42   ? 151.964 154.641 165.066 1.00 0.00 ? 42   LEU A CD1   1 
ATOM   314   C  CD2   . LEU A  1  42   ? 150.144 153.201 164.153 1.00 0.00 ? 42   LEU A CD2   1 
ATOM   315   N  N     . GLU A  1  43   ? 150.406 153.013 160.143 1.00 0.00 ? 43   GLU A N     1 
ATOM   316   C  CA    . GLU A  1  43   ? 149.697 151.880 159.572 1.00 0.00 ? 43   GLU A CA    1 
ATOM   317   C  C     . GLU A  1  43   ? 150.698 151.259 158.616 1.00 0.00 ? 43   GLU A C     1 
ATOM   318   O  O     . GLU A  1  43   ? 151.631 151.939 158.190 1.00 0.00 ? 43   GLU A O     1 
ATOM   319   C  CB    . GLU A  1  43   ? 148.400 152.315 158.874 1.00 0.00 ? 43   GLU A CB    1 
ATOM   320   C  CG    . GLU A  1  43   ? 147.573 151.219 158.241 1.00 0.00 ? 43   GLU A CG    1 
ATOM   321   C  CD    . GLU A  1  43   ? 148.017 150.928 156.831 1.00 0.00 ? 43   GLU A CD    1 
ATOM   322   O  OE1   . GLU A  1  43   ? 148.602 151.837 156.213 1.00 0.00 ? 43   GLU A OE1   1 
ATOM   323   O  OE2   . GLU A  1  43   ? 147.784 149.804 156.342 1.00 0.00 ? 43   GLU A OE2   1 
ATOM   324   N  N     . LYS A  1  44   ? 150.500 149.985 158.269 1.00 0.00 ? 44   LYS A N     1 
ATOM   325   C  CA    . LYS A  1  44   ? 151.464 149.251 157.447 1.00 0.00 ? 44   LYS A CA    1 
ATOM   326   C  C     . LYS A  1  44   ? 152.881 149.495 157.968 1.00 0.00 ? 44   LYS A C     1 
ATOM   327   O  O     . LYS A  1  44   ? 153.199 149.128 159.104 1.00 0.00 ? 44   LYS A O     1 
ATOM   328   C  CB    . LYS A  1  44   ? 151.310 149.578 155.941 1.00 0.00 ? 44   LYS A CB    1 
ATOM   329   C  CG    . LYS A  1  44   ? 151.458 151.024 155.454 1.00 0.00 ? 44   LYS A CG    1 
ATOM   330   C  CD    . LYS A  1  44   ? 151.281 151.144 153.953 1.00 0.00 ? 44   LYS A CD    1 
ATOM   331   C  CE    . LYS A  1  44   ? 149.853 150.850 153.532 1.00 0.00 ? 44   LYS A CE    1 
ATOM   332   N  NZ    . LYS A  1  44   ? 149.675 150.983 152.061 1.00 0.00 ? 44   LYS A NZ    1 
ATOM   333   N  N     . ASP A  1  45   ? 153.729 150.108 157.153 1.00 0.00 ? 45   ASP A N     1 
ATOM   334   C  CA    . ASP A  1  45   ? 155.071 150.537 157.513 1.00 0.00 ? 45   ASP A CA    1 
ATOM   335   C  C     . ASP A  1  45   ? 155.049 151.430 158.749 1.00 0.00 ? 45   ASP A C     1 
ATOM   336   O  O     . ASP A  1  45   ? 154.067 152.115 159.034 1.00 0.00 ? 45   ASP A O     1 
ATOM   337   C  CB    . ASP A  1  45   ? 155.708 151.302 156.349 1.00 0.00 ? 45   ASP A CB    1 
ATOM   338   C  CG    . ASP A  1  45   ? 157.125 151.745 156.638 1.00 0.00 ? 45   ASP A CG    1 
ATOM   339   O  OD1   . ASP A  1  45   ? 157.692 151.329 157.668 1.00 0.00 ? 45   ASP A OD1   1 
ATOM   340   O  OD2   . ASP A  1  45   ? 157.670 152.528 155.836 1.00 0.00 ? 45   ASP A OD2   1 
ATOM   341   N  N     . ARG A  1  46   ? 156.139 151.387 159.511 1.00 0.00 ? 46   ARG A N     1 
ATOM   342   C  CA    . ARG A  1  46   ? 156.373 152.455 160.470 1.00 0.00 ? 46   ARG A CA    1 
ATOM   343   C  C     . ARG A  1  46   ? 156.521 153.740 159.675 1.00 0.00 ? 46   ARG A C     1 
ATOM   344   O  O     . ARG A  1  46   ? 157.403 153.824 158.815 1.00 0.00 ? 46   ARG A O     1 
ATOM   345   C  CB    . ARG A  1  46   ? 157.648 152.223 161.278 1.00 0.00 ? 46   ARG A CB    1 
ATOM   346   C  CG    . ARG A  1  46   ? 157.735 150.957 162.100 1.00 0.00 ? 46   ARG A CG    1 
ATOM   347   C  CD    . ARG A  1  46   ? 159.078 150.986 162.810 1.00 0.00 ? 46   ARG A CD    1 
ATOM   348   N  NE    . ARG A  1  46   ? 159.406 149.783 163.567 1.00 0.00 ? 46   ARG A NE    1 
ATOM   349   C  CZ    . ARG A  1  46   ? 160.560 149.619 164.208 1.00 0.00 ? 46   ARG A CZ    1 
ATOM   350   N  NH1   . ARG A  1  46   ? 161.459 150.591 164.200 1.00 0.00 ? 46   ARG A NH1   1 
ATOM   351   N  NH2   . ARG A  1  46   ? 160.812 148.505 164.876 1.00 0.00 ? 46   ARG A NH2   1 
ATOM   352   N  N     . ALA A  1  47   ? 155.689 154.740 159.958 1.00 0.00 ? 47   ALA A N     1 
ATOM   353   C  CA    . ALA A  1  47   ? 155.734 156.064 159.338 1.00 0.00 ? 47   ALA A CA    1 
ATOM   354   C  C     . ALA A  1  47   ? 156.184 156.054 157.876 1.00 0.00 ? 47   ALA A C     1 
ATOM   355   O  O     . ALA A  1  47   ? 157.171 156.720 157.538 1.00 0.00 ? 47   ALA A O     1 
ATOM   356   C  CB    . ALA A  1  47   ? 156.651 156.983 160.151 1.00 0.00 ? 47   ALA A CB    1 
ATOM   357   N  N     . PRO A  1  48   ? 155.498 155.340 156.974 1.00 0.00 ? 48   PRO A N     1 
ATOM   358   C  CA    . PRO A  1  48   ? 155.796 155.487 155.542 1.00 0.00 ? 48   PRO A CA    1 
ATOM   359   C  C     . PRO A  1  48   ? 155.603 156.901 155.038 1.00 0.00 ? 48   PRO A C     1 
ATOM   360   O  O     . PRO A  1  48   ? 155.901 157.164 153.869 1.00 0.00 ? 48   PRO A O     1 
ATOM   361   C  CB    . PRO A  1  48   ? 154.819 154.510 154.873 1.00 0.00 ? 48   PRO A CB    1 
ATOM   362   C  CG    . PRO A  1  48   ? 153.707 154.399 155.817 1.00 0.00 ? 48   PRO A CG    1 
ATOM   363   C  CD    . PRO A  1  48   ? 154.329 154.472 157.184 1.00 0.00 ? 48   PRO A CD    1 
ATOM   364   N  N     . LYS A  1  49   ? 155.024 157.773 155.864 1.00 0.00 ? 49   LYS A N     1 
ATOM   365   C  CA    . LYS A  1  49   ? 154.963 159.217 155.648 1.00 0.00 ? 49   LYS A CA    1 
ATOM   366   C  C     . LYS A  1  49   ? 154.276 159.549 154.328 1.00 0.00 ? 49   LYS A C     1 
ATOM   367   O  O     . LYS A  1  49   ? 154.901 159.906 153.331 1.00 0.00 ? 49   LYS A O     1 
ATOM   368   C  CB    . LYS A  1  49   ? 156.352 159.864 155.771 1.00 0.00 ? 49   LYS A CB    1 
ATOM   369   C  CG    . LYS A  1  49   ? 157.455 159.394 154.831 1.00 0.00 ? 49   LYS A CG    1 
ATOM   370   C  CD    . LYS A  1  49   ? 158.767 160.099 155.072 1.00 0.00 ? 49   LYS A CD    1 
ATOM   371   C  CE    . LYS A  1  49   ? 159.837 159.570 154.141 1.00 0.00 ? 49   LYS A CE    1 
ATOM   372   N  NZ    . LYS A  1  49   ? 160.124 158.138 154.433 1.00 0.00 ? 49   LYS A NZ    1 
ATOM   373   N  N     . ALA A  1  50   ? 152.957 159.381 154.320 1.00 0.00 ? 50   ALA A N     1 
ATOM   374   C  CA    . ALA A  1  50   ? 152.150 159.747 153.162 1.00 0.00 ? 50   ALA A CA    1 
ATOM   375   C  C     . ALA A  1  50   ? 151.836 161.234 153.216 1.00 0.00 ? 50   ALA A C     1 
ATOM   376   O  O     . ALA A  1  50   ? 151.262 161.716 154.198 1.00 0.00 ? 50   ALA A O     1 
ATOM   377   C  CB    . ALA A  1  50   ? 150.868 158.924 153.128 1.00 0.00 ? 50   ALA A CB    1 
ATOM   378   N  N     . ASN A  1  51   ? 152.192 161.954 152.150 1.00 0.00 ? 51   ASN A N     1 
ATOM   379   C  CA    . ASN A  1  51   ? 152.102 163.410 152.109 1.00 0.00 ? 51   ASN A CA    1 
ATOM   380   C  C     . ASN A  1  51   ? 152.752 163.967 153.370 1.00 0.00 ? 51   ASN A C     1 
ATOM   381   O  O     . ASN A  1  51   ? 153.839 163.523 153.726 1.00 0.00 ? 51   ASN A O     1 
ATOM   382   C  CB    . ASN A  1  51   ? 150.651 163.847 151.956 1.00 0.00 ? 51   ASN A CB    1 
ATOM   383   C  CG    . ASN A  1  51   ? 150.524 165.294 151.598 1.00 0.00 ? 51   ASN A CG    1 
ATOM   384   O  OD1   . ASN A  1  51   ? 151.358 166.109 151.971 1.00 0.00 ? 51   ASN A OD1   1 
ATOM   385   N  ND2   . ASN A  1  51   ? 149.524 165.614 150.799 1.00 0.00 ? 51   ASN A ND2   1 
ATOM   386   N  N     . GLY A  1  52   ? 152.119 164.920 154.052 1.00 0.00 ? 52   GLY A N     1 
ATOM   387   C  CA    . GLY A  1  52   ? 152.554 165.290 155.392 1.00 0.00 ? 52   GLY A CA    1 
ATOM   388   C  C     . GLY A  1  52   ? 153.916 165.950 155.515 1.00 0.00 ? 52   GLY A C     1 
ATOM   389   O  O     . GLY A  1  52   ? 154.574 166.202 154.504 1.00 0.00 ? 52   GLY A O     1 
ATOM   390   N  N     . ALA A  1  53   ? 154.353 166.234 156.745 1.00 0.00 ? 53   ALA A N     1 
ATOM   391   C  CA    . ALA A  1  53   ? 155.585 166.985 156.968 1.00 0.00 ? 53   ALA A CA    1 
ATOM   392   C  C     . ALA A  1  53   ? 156.795 166.254 156.413 1.00 0.00 ? 53   ALA A C     1 
ATOM   393   O  O     . ALA A  1  53   ? 157.477 166.770 155.524 1.00 0.00 ? 53   ALA A O     1 
ATOM   394   C  CB    . ALA A  1  53   ? 155.778 167.268 158.455 1.00 0.00 ? 53   ALA A CB    1 
ATOM   395   N  N     . LEU A  1  54   ? 157.071 165.054 156.908 1.00 0.00 ? 54   LEU A N     1 
ATOM   396   C  CA    . LEU A  1  54   ? 157.949 164.167 156.164 1.00 0.00 ? 54   LEU A CA    1 
ATOM   397   C  C     . LEU A  1  54   ? 157.230 163.782 154.890 1.00 0.00 ? 54   LEU A C     1 
ATOM   398   O  O     . LEU A  1  54   ? 156.005 163.850 154.834 1.00 0.00 ? 54   LEU A O     1 
ATOM   399   C  CB    . LEU A  1  54   ? 158.301 162.920 156.964 1.00 0.00 ? 54   LEU A CB    1 
ATOM   400   C  CG    . LEU A  1  54   ? 159.549 162.969 157.835 1.00 0.00 ? 54   LEU A CG    1 
ATOM   401   C  CD1   . LEU A  1  54   ? 159.346 163.866 159.011 1.00 0.00 ? 54   LEU A CD1   1 
ATOM   402   C  CD2   . LEU A  1  54   ? 159.946 161.586 158.278 1.00 0.00 ? 54   LEU A CD2   1 
ATOM   403   N  N     . ASP A  1  55   ? 157.978 163.362 153.884 1.00 0.00 ? 55   ASP A N     1 
ATOM   404   C  CA    . ASP A  1  55   ? 157.374 163.001 152.611 1.00 0.00 ? 55   ASP A CA    1 
ATOM   405   C  C     . ASP A  1  55   ? 158.473 162.530 151.677 1.00 0.00 ? 55   ASP A C     1 
ATOM   406   O  O     . ASP A  1  55   ? 159.496 163.204 151.534 1.00 0.00 ? 55   ASP A O     1 
ATOM   407   C  CB    . ASP A  1  55   ? 156.636 164.205 152.022 1.00 0.00 ? 55   ASP A CB    1 
ATOM   408   C  CG    . ASP A  1  55   ? 155.885 163.889 150.746 1.00 0.00 ? 55   ASP A CG    1 
ATOM   409   O  OD1   . ASP A  1  55   ? 156.014 162.776 150.208 1.00 0.00 ? 55   ASP A OD1   1 
ATOM   410   O  OD2   . ASP A  1  55   ? 155.124 164.765 150.289 1.00 0.00 ? 55   ASP A OD2   1 
ATOM   411   N  N     . PRO A  1  56   ? 158.291 161.401 151.003 1.00 0.00 ? 56   PRO A N     1 
ATOM   412   C  CA    . PRO A  1  56   ? 159.362 160.916 150.127 1.00 0.00 ? 56   PRO A CA    1 
ATOM   413   C  C     . PRO A  1  56   ? 159.684 161.869 149.001 1.00 0.00 ? 56   PRO A C     1 
ATOM   414   O  O     . PRO A  1  56   ? 160.834 161.931 148.561 1.00 0.00 ? 56   PRO A O     1 
ATOM   415   C  CB    . PRO A  1  56   ? 158.811 159.583 149.619 1.00 0.00 ? 56   PRO A CB    1 
ATOM   416   C  CG    . PRO A  1  56   ? 157.959 159.111 150.727 1.00 0.00 ? 56   PRO A CG    1 
ATOM   417   C  CD    . PRO A  1  56   ? 157.326 160.337 151.320 1.00 0.00 ? 56   PRO A CD    1 
ATOM   418   N  N     . LYS A  1  57   ? 158.706 162.627 148.521 1.00 0.00 ? 57   LYS A N     1 
ATOM   419   C  CA    . LYS A  1  57   ? 159.020 163.542 147.440 1.00 0.00 ? 57   LYS A CA    1 
ATOM   420   C  C     . LYS A  1  57   ? 159.453 164.908 147.934 1.00 0.00 ? 57   LYS A C     1 
ATOM   421   O  O     . LYS A  1  57   ? 159.752 165.774 147.111 1.00 0.00 ? 57   LYS A O     1 
ATOM   422   C  CB    . LYS A  1  57   ? 157.832 163.652 146.498 1.00 0.00 ? 57   LYS A CB    1 
ATOM   423   C  CG    . LYS A  1  57   ? 156.532 163.999 147.155 1.00 0.00 ? 57   LYS A CG    1 
ATOM   424   C  CD    . LYS A  1  57   ? 155.463 164.003 146.093 1.00 0.00 ? 57   LYS A CD    1 
ATOM   425   C  CE    . LYS A  1  57   ? 155.242 162.629 145.501 1.00 0.00 ? 57   LYS A CE    1 
ATOM   426   N  NZ    . LYS A  1  57   ? 154.270 162.705 144.380 1.00 0.00 ? 57   LYS A NZ    1 
ATOM   427   N  N     . MET A  1  58   ? 159.470 165.129 149.242 1.00 0.00 ? 58   MET A N     1 
ATOM   428   C  CA    . MET A  1  58   ? 160.195 166.255 149.811 1.00 0.00 ? 58   MET A CA    1 
ATOM   429   C  C     . MET A  1  58   ? 161.668 165.953 150.019 1.00 0.00 ? 58   MET A C     1 
ATOM   430   O  O     . MET A  1  58   ? 162.517 166.805 149.756 1.00 0.00 ? 58   MET A O     1 
ATOM   431   C  CB    . MET A  1  58   ? 159.574 166.668 151.139 1.00 0.00 ? 58   MET A CB    1 
ATOM   432   C  CG    . MET A  1  58   ? 160.190 167.895 151.729 1.00 0.00 ? 58   MET A CG    1 
ATOM   433   S  SD    . MET A  1  58   ? 159.292 168.352 153.205 1.00 0.00 ? 58   MET A SD    1 
ATOM   434   C  CE    . MET A  1  58   ? 157.792 168.925 152.437 1.00 0.00 ? 58   MET A CE    1 
ATOM   435   N  N     . GLY A  1  59   ? 161.973 164.756 150.493 1.00 0.00 ? 59   GLY A N     1 
ATOM   436   C  CA    . GLY A  1  59   ? 163.338 164.352 150.768 1.00 0.00 ? 59   GLY A CA    1 
ATOM   437   C  C     . GLY A  1  59   ? 163.296 162.981 151.399 1.00 0.00 ? 59   GLY A C     1 
ATOM   438   O  O     . GLY A  1  59   ? 162.262 162.307 151.402 1.00 0.00 ? 59   GLY A O     1 
ATOM   439   N  N     . VAL A  1  60   ? 164.438 162.567 151.939 1.00 0.00 ? 60   VAL A N     1 
ATOM   440   C  CA    . VAL A  1  60   ? 164.512 161.305 152.656 1.00 0.00 ? 60   VAL A CA    1 
ATOM   441   C  C     . VAL A  1  60   ? 165.365 161.489 153.897 1.00 0.00 ? 60   VAL A C     1 
ATOM   442   O  O     . VAL A  1  60   ? 166.000 162.525 154.094 1.00 0.00 ? 60   VAL A O     1 
ATOM   443   C  CB    . VAL A  1  60   ? 165.092 160.175 151.790 1.00 0.00 ? 60   VAL A CB    1 
ATOM   444   C  CG1   . VAL A  1  60   ? 164.186 159.890 150.616 1.00 0.00 ? 60   VAL A CG1   1 
ATOM   445   C  CG2   . VAL A  1  60   ? 166.479 160.539 151.317 1.00 0.00 ? 60   VAL A CG2   1 
ATOM   446   N  N     . SER A  1  61   ? 165.411 160.455 154.706 1.00 0.00 ? 61   SER A N     1 
ATOM   447   C  CA    . SER A  1  61   ? 166.197 160.520 155.932 1.00 0.00 ? 61   SER A CA    1 
ATOM   448   C  C     . SER A  1  61   ? 167.189 159.382 156.060 1.00 0.00 ? 61   SER A C     1 
ATOM   449   O  O     . SER A  1  61   ? 168.390 159.600 155.900 1.00 0.00 ? 61   SER A O     1 
ATOM   450   C  CB    . SER A  1  61   ? 165.271 160.513 157.143 1.00 0.00 ? 61   SER A CB    1 
ATOM   451   O  OG    . SER A  1  61   ? 164.564 159.290 157.216 1.00 0.00 ? 61   SER A OG    1 
ATOM   452   N  N     . SER A  1  62   ? 166.720 158.180 156.351 1.00 0.00 ? 62   SER A N     1 
ATOM   453   C  CA    . SER A  1  62   ? 167.557 156.994 156.377 1.00 0.00 ? 62   SER A CA    1 
ATOM   454   C  C     . SER A  1  62   ? 168.015 156.661 154.967 1.00 0.00 ? 62   SER A C     1 
ATOM   455   O  O     . SER A  1  62   ? 167.417 157.097 153.983 1.00 0.00 ? 62   SER A O     1 
ATOM   456   C  CB    . SER A  1  62   ? 166.791 155.812 156.969 1.00 0.00 ? 62   SER A CB    1 
ATOM   457   O  OG    . SER A  1  62   ? 167.549 154.621 156.886 1.00 0.00 ? 62   SER A OG    1 
ATOM   458   N  N     . SER A  1  63   ? 169.082 155.869 154.865 1.00 0.00 ? 63   SER A N     1 
ATOM   459   C  CA    . SER A  1  63   ? 169.416 155.309 153.566 1.00 0.00 ? 63   SER A CA    1 
ATOM   460   C  C     . SER A  1  63   ? 168.659 153.994 153.518 1.00 0.00 ? 63   SER A C     1 
ATOM   461   O  O     . SER A  1  63   ? 169.117 152.946 153.971 1.00 0.00 ? 63   SER A O     1 
ATOM   462   C  CB    . SER A  1  63   ? 170.918 155.116 153.414 1.00 0.00 ? 63   SER A CB    1 
ATOM   463   O  OG    . SER A  1  63   ? 171.221 154.483 152.187 1.00 0.00 ? 63   SER A OG    1 
ATOM   464   N  N     . SER A  1  64   ? 167.467 154.079 152.946 1.00 0.00 ? 64   SER A N     1 
ATOM   465   C  CA    . SER A  1  64   ? 166.579 152.949 152.754 1.00 0.00 ? 64   SER A CA    1 
ATOM   466   C  C     . SER A  1  64   ? 165.888 153.087 151.411 1.00 0.00 ? 64   SER A C     1 
ATOM   467   O  O     . SER A  1  64   ? 166.128 152.325 150.470 1.00 0.00 ? 64   SER A O     1 
ATOM   468   C  CB    . SER A  1  64   ? 165.553 152.887 153.883 1.00 0.00 ? 64   SER A CB    1 
ATOM   469   O  OG    . SER A  1  64   ? 164.746 154.053 153.882 1.00 0.00 ? 64   SER A OG    1 
ATOM   470   N  N     . LEU A  1  65   ? 165.047 154.109 151.339 1.00 0.00 ? 65   LEU A N     1 
ATOM   471   C  CA    . LEU A  1  65   ? 164.070 154.301 150.291 1.00 0.00 ? 65   LEU A CA    1 
ATOM   472   C  C     . LEU A  1  65   ? 164.411 155.527 149.460 1.00 0.00 ? 65   LEU A C     1 
ATOM   473   O  O     . LEU A  1  65   ? 165.083 156.455 149.914 1.00 0.00 ? 65   LEU A O     1 
ATOM   474   C  CB    . LEU A  1  65   ? 162.683 154.420 150.914 1.00 0.00 ? 65   LEU A CB    1 
ATOM   475   C  CG    . LEU A  1  65   ? 162.575 155.451 152.041 1.00 0.00 ? 65   LEU A CG    1 
ATOM   476   C  CD1   . LEU A  1  65   ? 162.306 156.862 151.553 1.00 0.00 ? 65   LEU A CD1   1 
ATOM   477   C  CD2   . LEU A  1  65   ? 161.538 155.010 153.051 1.00 0.00 ? 65   LEU A CD2   1 
ATOM   478   N  N     . GLU A  1  66   ? 163.936 155.519 148.224 1.00 0.00 ? 66   GLU A N     1 
ATOM   479   C  CA    . GLU A  1  66   ? 164.347 156.548 147.295 1.00 0.00 ? 66   GLU A CA    1 
ATOM   480   C  C     . GLU A  1  66   ? 163.605 157.847 147.575 1.00 0.00 ? 66   GLU A C     1 
ATOM   481   O  O     . GLU A  1  66   ? 162.705 157.924 148.412 1.00 0.00 ? 66   GLU A O     1 
ATOM   482   C  CB    . GLU A  1  66   ? 164.138 156.077 145.862 1.00 0.00 ? 66   GLU A CB    1 
ATOM   483   C  CG    . GLU A  1  66   ? 165.066 154.935 145.484 1.00 0.00 ? 66   GLU A CG    1 
ATOM   484   C  CD    . GLU A  1  66   ? 164.898 154.486 144.051 1.00 0.00 ? 66   GLU A CD    1 
ATOM   485   O  OE1   . GLU A  1  66   ? 163.964 154.978 143.384 1.00 0.00 ? 66   GLU A OE1   1 
ATOM   486   O  OE2   . GLU A  1  66   ? 165.695 153.639 143.595 1.00 0.00 ? 66   GLU A OE2   1 
ATOM   487   N  N     . CYS A  1  67   ? 164.008 158.884 146.855 1.00 0.00 ? 67   CYS A N     1 
ATOM   488   C  CA    . CYS A  1  67   ? 163.605 160.252 147.140 1.00 0.00 ? 67   CYS A CA    1 
ATOM   489   C  C     . CYS A  1  67   ? 162.488 160.747 146.228 1.00 0.00 ? 67   CYS A C     1 
ATOM   490   O  O     . CYS A  1  67   ? 162.156 161.934 146.263 1.00 0.00 ? 67   CYS A O     1 
ATOM   491   C  CB    . CYS A  1  67   ? 164.831 161.159 147.069 1.00 0.00 ? 67   CYS A CB    1 
ATOM   492   S  SG    . CYS A  1  67   ? 164.592 162.858 147.555 1.00 0.00 ? 67   CYS A SG    1 
ATOM   493   N  N     . ALA A  1  68   ? 161.915 159.880 145.393 1.00 0.00 ? 68   ALA A N     1 
ATOM   494   C  CA    . ALA A  1  68   ? 160.988 160.365 144.377 1.00 0.00 ? 68   ALA A CA    1 
ATOM   495   C  C     . ALA A  1  68   ? 161.707 161.372 143.490 1.00 0.00 ? 68   ALA A C     1 
ATOM   496   O  O     . ALA A  1  68   ? 162.554 160.979 142.683 1.00 0.00 ? 68   ALA A O     1 
ATOM   497   C  CB    . ALA A  1  68   ? 159.725 160.968 144.993 1.00 0.00 ? 68   ALA A CB    1 
ATOM   498   N  N     . THR A  1  69   ? 161.374 162.659 143.631 1.00 0.00 ? 69   THR A N     1 
ATOM   499   C  CA    . THR A  1  69   ? 161.752 163.712 142.694 1.00 0.00 ? 69   THR A CA    1 
ATOM   500   C  C     . THR A  1  69   ? 163.174 163.562 142.171 1.00 0.00 ? 69   THR A C     1 
ATOM   501   O  O     . THR A  1  69   ? 163.359 163.283 140.984 1.00 0.00 ? 69   THR A O     1 
ATOM   502   C  CB    . THR A  1  69   ? 161.620 165.062 143.372 1.00 0.00 ? 69   THR A CB    1 
ATOM   503   O  OG1   . THR A  1  69   ? 162.513 165.089 144.487 1.00 0.00 ? 69   THR A OG1   1 
ATOM   504   C  CG2   . THR A  1  69   ? 160.212 165.248 143.873 1.00 0.00 ? 69   THR A CG2   1 
ATOM   505   N  N     . CYS A  1  70   ? 164.190 163.739 143.016 1.00 0.00 ? 70   CYS A N     1 
ATOM   506   C  CA    . CYS A  1  70   ? 165.498 163.181 142.675 1.00 0.00 ? 70   CYS A CA    1 
ATOM   507   C  C     . CYS A  1  70   ? 165.856 162.097 143.684 1.00 0.00 ? 70   CYS A C     1 
ATOM   508   O  O     . CYS A  1  70   ? 166.249 162.349 144.819 1.00 0.00 ? 70   CYS A O     1 
ATOM   509   C  CB    . CYS A  1  70   ? 166.576 164.258 142.616 1.00 0.00 ? 70   CYS A CB    1 
ATOM   510   S  SG    . CYS A  1  70   ? 167.076 165.031 144.170 1.00 0.00 ? 70   CYS A SG    1 
ATOM   511   N  N     . HIS A  1  71   ? 165.756 160.865 143.214 1.00 0.00 ? 71   HIS A N     1 
ATOM   512   C  CA    . HIS A  1  71   ? 166.013 159.716 144.063 1.00 0.00 ? 71   HIS A CA    1 
ATOM   513   C  C     . HIS A  1  71   ? 167.476 159.312 143.993 1.00 0.00 ? 71   HIS A C     1 
ATOM   514   O  O     . HIS A  1  71   ? 168.321 160.077 143.526 1.00 0.00 ? 71   HIS A O     1 
ATOM   515   C  CB    . HIS A  1  71   ? 165.070 158.575 143.694 1.00 0.00 ? 71   HIS A CB    1 
ATOM   516   C  CG    . HIS A  1  71   ? 164.870 158.399 142.225 1.00 0.00 ? 71   HIS A CG    1 
ATOM   517   N  ND1   . HIS A  1  71   ? 164.107 159.268 141.476 1.00 0.00 ? 71   HIS A ND1   1 
ATOM   518   C  CD2   . HIS A  1  71   ? 165.295 157.438 141.374 1.00 0.00 ? 71   HIS A CD2   1 
ATOM   519   C  CE1   . HIS A  1  71   ? 164.094 158.864 140.220 1.00 0.00 ? 71   HIS A CE1   1 
ATOM   520   N  NE2   . HIS A  1  71   ? 164.802 157.753 140.132 1.00 0.00 ? 71   HIS A NE2   1 
ATOM   521   N  N     . GLY A  1  72   ? 167.778 158.112 144.474 1.00 0.00 ? 72   GLY A N     1 
ATOM   522   C  CA    . GLY A  1  72   ? 169.147 157.763 144.792 1.00 0.00 ? 72   GLY A CA    1 
ATOM   523   C  C     . GLY A  1  72   ? 169.582 158.216 146.170 1.00 0.00 ? 72   GLY A C     1 
ATOM   524   O  O     . GLY A  1  72   ? 170.663 158.783 146.345 1.00 0.00 ? 72   GLY A O     1 
ATOM   525   N  N     . ASN A  1  73   ? 168.708 157.995 147.141 1.00 0.00 ? 73   ASN A N     1 
ATOM   526   C  CA    . ASN A  1  73   ? 168.968 157.924 148.583 1.00 0.00 ? 73   ASN A CA    1 
ATOM   527   C  C     . ASN A  1  73   ? 169.751 159.141 149.071 1.00 0.00 ? 73   ASN A C     1 
ATOM   528   O  O     . ASN A  1  73   ? 169.579 160.254 148.568 1.00 0.00 ? 73   ASN A O     1 
ATOM   529   C  CB    . ASN A  1  73   ? 169.628 156.586 148.881 1.00 0.00 ? 73   ASN A CB    1 
ATOM   530   C  CG    . ASN A  1  73   ? 171.018 156.452 148.268 1.00 0.00 ? 73   ASN A CG    1 
ATOM   531   O  OD1   . ASN A  1  73   ? 171.808 157.395 148.263 1.00 0.00 ? 73   ASN A OD1   1 
ATOM   532   N  ND2   . ASN A  1  73   ? 171.310 155.276 147.727 1.00 0.00 ? 73   ASN A ND2   1 
ATOM   533   N  N     . LEU A  1  74   ? 170.659 158.922 150.017 1.00 0.00 ? 74   LEU A N     1 
ATOM   534   C  CA    . LEU A  1  74   ? 171.400 160.006 150.639 1.00 0.00 ? 74   LEU A CA    1 
ATOM   535   C  C     . LEU A  1  74   ? 172.554 160.491 149.789 1.00 0.00 ? 74   LEU A C     1 
ATOM   536   O  O     . LEU A  1  74   ? 173.093 161.566 150.067 1.00 0.00 ? 74   LEU A O     1 
ATOM   537   C  CB    . LEU A  1  74   ? 171.921 159.570 152.004 1.00 0.00 ? 74   LEU A CB    1 
ATOM   538   C  CG    . LEU A  1  74   ? 170.777 159.358 152.983 1.00 0.00 ? 74   LEU A CG    1 
ATOM   539   C  CD1   . LEU A  1  74   ? 171.292 158.876 154.316 1.00 0.00 ? 74   LEU A CD1   1 
ATOM   540   C  CD2   . LEU A  1  74   ? 169.991 160.645 153.138 1.00 0.00 ? 74   LEU A CD2   1 
ATOM   541   N  N     . ALA A  1  75   ? 172.961 159.727 148.785 1.00 0.00 ? 75   ALA A N     1 
ATOM   542   C  CA    . ALA A  1  75   ? 173.984 160.222 147.884 1.00 0.00 ? 75   ALA A CA    1 
ATOM   543   C  C     . ALA A  1  75   ? 173.594 161.524 147.208 1.00 0.00 ? 75   ALA A C     1 
ATOM   544   O  O     . ALA A  1  75   ? 174.113 162.577 147.589 1.00 0.00 ? 75   ALA A O     1 
ATOM   545   C  CB    . ALA A  1  75   ? 174.302 159.170 146.819 1.00 0.00 ? 75   ALA A CB    1 
ATOM   546   N  N     . SER A  1  76   ? 172.672 161.493 146.249 1.00 0.00 ? 76   SER A N     1 
ATOM   547   C  CA    . SER A  1  76   ? 172.550 162.650 145.372 1.00 0.00 ? 76   SER A CA    1 
ATOM   548   C  C     . SER A  1  76   ? 171.426 163.607 145.741 1.00 0.00 ? 76   SER A C     1 
ATOM   549   O  O     . SER A  1  76   ? 171.318 164.664 145.111 1.00 0.00 ? 76   SER A O     1 
ATOM   550   C  CB    . SER A  1  76   ? 172.354 162.189 143.933 1.00 0.00 ? 76   SER A CB    1 
ATOM   551   O  OG    . SER A  1  76   ? 171.147 161.466 143.798 1.00 0.00 ? 76   SER A OG    1 
ATOM   552   N  N     . CYS A  1  77   ? 170.593 163.305 146.726 1.00 0.00 ? 77   CYS A N     1 
ATOM   553   C  CA    . CYS A  1  77   ? 169.433 164.149 146.966 1.00 0.00 ? 77   CYS A CA    1 
ATOM   554   C  C     . CYS A  1  77   ? 169.793 165.219 147.984 1.00 0.00 ? 77   CYS A C     1 
ATOM   555   O  O     . CYS A  1  77   ? 170.052 164.918 149.152 1.00 0.00 ? 77   CYS A O     1 
ATOM   556   C  CB    . CYS A  1  77   ? 168.226 163.349 147.433 1.00 0.00 ? 77   CYS A CB    1 
ATOM   557   S  SG    . CYS A  1  77   ? 166.763 164.388 147.459 1.00 0.00 ? 77   CYS A SG    1 
ATOM   558   N  N     . HIS A  1  78   ? 169.788 166.468 147.535 1.00 0.00 ? 78   HIS A N     1 
ATOM   559   C  CA    . HIS A  1  78   ? 170.186 167.610 148.337 1.00 0.00 ? 78   HIS A CA    1 
ATOM   560   C  C     . HIS A  1  78   ? 169.035 168.071 149.212 1.00 0.00 ? 78   HIS A C     1 
ATOM   561   O  O     . HIS A  1  78   ? 169.162 169.033 149.972 1.00 0.00 ? 78   HIS A O     1 
ATOM   562   C  CB    . HIS A  1  78   ? 170.625 168.728 147.402 1.00 0.00 ? 78   HIS A CB    1 
ATOM   563   C  CG    . HIS A  1  78   ? 171.423 168.231 146.246 1.00 0.00 ? 78   HIS A CG    1 
ATOM   564   N  ND1   . HIS A  1  78   ? 172.697 167.729 146.376 1.00 0.00 ? 78   HIS A ND1   1 
ATOM   565   C  CD2   . HIS A  1  78   ? 171.096 168.094 144.943 1.00 0.00 ? 78   HIS A CD2   1 
ATOM   566   C  CE1   . HIS A  1  78   ? 173.138 167.341 145.193 1.00 0.00 ? 78   HIS A CE1   1 
ATOM   567   N  NE2   . HIS A  1  78   ? 172.183 167.551 144.305 1.00 0.00 ? 78   HIS A NE2   1 
ATOM   568   N  N     . GLY A  1  79   ? 167.904 167.401 149.090 1.00 0.00 ? 79   GLY A N     1 
ATOM   569   C  CA    . GLY A  1  79   ? 166.677 167.815 149.741 1.00 0.00 ? 79   GLY A CA    1 
ATOM   570   C  C     . GLY A  1  79   ? 165.904 168.618 148.717 1.00 0.00 ? 79   GLY A C     1 
ATOM   571   O  O     . GLY A  1  79   ? 166.430 169.042 147.689 1.00 0.00 ? 79   GLY A O     1 
ATOM   572   N  N     . HIS A  1  80   ? 164.620 168.796 148.974 1.00 0.00 ? 80   HIS A N     1 
ATOM   573   C  CA    . HIS A  1  80   ? 163.806 169.719 148.211 1.00 0.00 ? 80   HIS A CA    1 
ATOM   574   C  C     . HIS A  1  80   ? 162.990 170.490 149.222 1.00 0.00 ? 80   HIS A C     1 
ATOM   575   O  O     . HIS A  1  80   ? 163.028 170.184 150.409 1.00 0.00 ? 80   HIS A O     1 
ATOM   576   C  CB    . HIS A  1  80   ? 162.898 168.989 147.271 1.00 0.00 ? 80   HIS A CB    1 
ATOM   577   C  CG    . HIS A  1  80   ? 163.554 167.822 146.628 1.00 0.00 ? 80   HIS A CG    1 
ATOM   578   N  ND1   . HIS A  1  80   ? 164.536 167.940 145.670 1.00 0.00 ? 80   HIS A ND1   1 
ATOM   579   C  CD2   . HIS A  1  80   ? 163.414 166.500 146.867 1.00 0.00 ? 80   HIS A CD2   1 
ATOM   580   C  CE1   . HIS A  1  80   ? 164.943 166.734 145.318 1.00 0.00 ? 80   HIS A CE1   1 
ATOM   581   N  NE2   . HIS A  1  80   ? 164.273 165.844 146.027 1.00 0.00 ? 80   HIS A NE2   1 
ATOM   582   N  N     . PHE A  1  81   ? 162.215 171.449 148.769 1.00 0.00 ? 81   PHE A N     1 
ATOM   583   C  CA    . PHE A  1  81   ? 161.463 172.172 149.772 1.00 0.00 ? 81   PHE A CA    1 
ATOM   584   C  C     . PHE A  1  81   ? 160.061 171.608 149.908 1.00 0.00 ? 81   PHE A C     1 
ATOM   585   O  O     . PHE A  1  81   ? 159.683 170.613 149.293 1.00 0.00 ? 81   PHE A O     1 
ATOM   586   C  CB    . PHE A  1  81   ? 161.422 173.652 149.450 1.00 0.00 ? 81   PHE A CB    1 
ATOM   587   C  CG    . PHE A  1  81   ? 162.730 174.316 149.599 1.00 0.00 ? 81   PHE A CG    1 
ATOM   588   C  CD1   . PHE A  1  81   ? 163.690 173.788 150.434 1.00 0.00 ? 81   PHE A CD1   1 
ATOM   589   C  CD2   . PHE A  1  81   ? 163.018 175.444 148.876 1.00 0.00 ? 81   PHE A CD2   1 
ATOM   590   C  CE1   . PHE A  1  81   ? 164.902 174.393 150.568 1.00 0.00 ? 81   PHE A CE1   1 
ATOM   591   C  CE2   . PHE A  1  81   ? 164.232 176.052 149.000 1.00 0.00 ? 81   PHE A CE2   1 
ATOM   592   C  CZ    . PHE A  1  81   ? 165.180 175.526 149.848 1.00 0.00 ? 81   PHE A CZ    1 
ATOM   593   N  N     . GLY A  1  82   ? 159.288 172.277 150.744 1.00 0.00 ? 82   GLY A N     1 
ATOM   594   C  CA    . GLY A  1  82   ? 157.877 172.028 150.848 1.00 0.00 ? 82   GLY A CA    1 
ATOM   595   C  C     . GLY A  1  82   ? 157.254 173.344 151.222 1.00 0.00 ? 82   GLY A C     1 
ATOM   596   O  O     . GLY A  1  82   ? 157.903 174.174 151.857 1.00 0.00 ? 82   GLY A O     1 
ATOM   597   N  N     . HIS A  1  83   ? 156.006 173.562 150.850 1.00 0.00 ? 83   HIS A N     1 
ATOM   598   C  CA    . HIS A  1  83   ? 155.432 174.865 151.106 1.00 0.00 ? 83   HIS A CA    1 
ATOM   599   C  C     . HIS A  1  83   ? 154.116 174.715 151.836 1.00 0.00 ? 83   HIS A C     1 
ATOM   600   O  O     . HIS A  1  83   ? 153.133 174.203 151.298 1.00 0.00 ? 83   HIS A O     1 
ATOM   601   C  CB    . HIS A  1  83   ? 155.244 175.633 149.808 1.00 0.00 ? 83   HIS A CB    1 
ATOM   602   C  CG    . HIS A  1  83   ? 154.265 175.012 148.876 1.00 0.00 ? 83   HIS A CG    1 
ATOM   603   N  ND1   . HIS A  1  83   ? 154.521 173.846 148.193 1.00 0.00 ? 83   HIS A ND1   1 
ATOM   604   C  CD2   . HIS A  1  83   ? 153.026 175.405 148.504 1.00 0.00 ? 83   HIS A CD2   1 
ATOM   605   C  CE1   . HIS A  1  83   ? 153.480 173.544 147.439 1.00 0.00 ? 83   HIS A CE1   1 
ATOM   606   N  NE2   . HIS A  1  83   ? 152.562 174.476 147.606 1.00 0.00 ? 83   HIS A NE2   1 
ATOM   607   N  N     . LEU A  1  84   ? 154.106 175.175 153.072 1.00 0.00 ? 84   LEU A N     1 
ATOM   608   C  CA    . LEU A  1  84   ? 152.976 174.999 153.955 1.00 0.00 ? 84   LEU A CA    1 
ATOM   609   C  C     . LEU A  1  84   ? 151.979 176.106 153.688 1.00 0.00 ? 84   LEU A C     1 
ATOM   610   O  O     . LEU A  1  84   ? 152.261 177.278 153.944 1.00 0.00 ? 84   LEU A O     1 
ATOM   611   C  CB    . LEU A  1  84   ? 153.433 175.039 155.408 1.00 0.00 ? 84   LEU A CB    1 
ATOM   612   C  CG    . LEU A  1  84   ? 152.450 174.739 156.524 1.00 0.00 ? 84   LEU A CG    1 
ATOM   613   C  CD1   . LEU A  1  84   ? 153.223 174.120 157.655 1.00 0.00 ? 84   LEU A CD1   1 
ATOM   614   C  CD2   . LEU A  1  84   ? 151.789 176.006 156.995 1.00 0.00 ? 84   LEU A CD2   1 
ATOM   615   N  N     . LYS A  1  85   ? 150.806 175.739 153.187 1.00 0.00 ? 85   LYS A N     1 
ATOM   616   C  CA    . LYS A  1  85   ? 149.731 176.710 153.040 1.00 0.00 ? 85   LYS A CA    1 
ATOM   617   C  C     . LYS A  1  85   ? 149.235 177.086 154.431 1.00 0.00 ? 85   LYS A C     1 
ATOM   618   O  O     . LYS A  1  85   ? 149.129 176.258 155.331 1.00 0.00 ? 85   LYS A O     1 
ATOM   619   C  CB    . LYS A  1  85   ? 148.609 176.165 152.170 1.00 0.00 ? 85   LYS A CB    1 
ATOM   620   C  CG    . LYS A  1  85   ? 147.448 177.127 152.032 1.00 0.00 ? 85   LYS A CG    1 
ATOM   621   C  CD    . LYS A  1  85   ? 147.928 178.442 151.452 1.00 0.00 ? 85   LYS A CD    1 
ATOM   622   C  CE    . LYS A  1  85   ? 146.784 179.394 151.156 1.00 0.00 ? 85   LYS A CE    1 
ATOM   623   N  NZ    . LYS A  1  85   ? 147.285 180.747 150.776 1.00 0.00 ? 85   LYS A NZ    1 
ATOM   624   N  N     . LEU A  1  86   ? 148.945 178.366 154.601 1.00 0.00 ? 86   LEU A N     1 
ATOM   625   C  CA    . LEU A  1  86   ? 148.655 178.873 155.931 1.00 0.00 ? 86   LEU A CA    1 
ATOM   626   C  C     . LEU A  1  86   ? 147.455 179.800 155.860 1.00 0.00 ? 86   LEU A C     1 
ATOM   627   O  O     . LEU A  1  86   ? 147.383 180.663 154.982 1.00 0.00 ? 86   LEU A O     1 
ATOM   628   C  CB    . LEU A  1  86   ? 149.884 179.585 156.472 1.00 0.00 ? 86   LEU A CB    1 
ATOM   629   C  CG    . LEU A  1  86   ? 149.938 179.816 157.969 1.00 0.00 ? 86   LEU A CG    1 
ATOM   630   C  CD1   . LEU A  1  86   ? 151.380 179.776 158.377 1.00 0.00 ? 86   LEU A CD1   1 
ATOM   631   C  CD2   . LEU A  1  86   ? 149.332 181.130 158.323 1.00 0.00 ? 86   LEU A CD2   1 
ATOM   632   N  N     . ALA A  1  87   ? 146.503 179.624 156.766 1.00 0.00 ? 87   ALA A N     1 
ATOM   633   C  CA    . ALA A  1  87   ? 145.312 180.457 156.737 1.00 0.00 ? 87   ALA A CA    1 
ATOM   634   C  C     . ALA A  1  87   ? 145.523 181.710 157.571 1.00 0.00 ? 87   ALA A C     1 
ATOM   635   O  O     . ALA A  1  87   ? 146.014 181.649 158.698 1.00 0.00 ? 87   ALA A O     1 
ATOM   636   C  CB    . ALA A  1  87   ? 144.102 179.679 157.239 1.00 0.00 ? 87   ALA A CB    1 
ATOM   637   N  N     . LEU A  1  88   ? 145.163 182.851 156.992 1.00 0.00 ? 88   LEU A N     1 
ATOM   638   C  CA    . LEU A  1  88   ? 145.348 184.190 157.534 1.00 0.00 ? 88   LEU A CA    1 
ATOM   639   C  C     . LEU A  1  88   ? 146.830 184.558 157.512 1.00 0.00 ? 88   LEU A C     1 
ATOM   640   O  O     . LEU A  1  88   ? 147.685 183.684 157.656 1.00 0.00 ? 88   LEU A O     1 
ATOM   641   C  CB    . LEU A  1  88   ? 144.799 184.295 158.957 1.00 0.00 ? 88   LEU A CB    1 
ATOM   642   C  CG    . LEU A  1  88   ? 143.282 184.432 159.064 1.00 0.00 ? 88   LEU A CG    1 
ATOM   643   C  CD1   . LEU A  1  88   ? 142.582 183.145 158.668 1.00 0.00 ? 88   LEU A CD1   1 
ATOM   644   C  CD2   . LEU A  1  88   ? 142.852 184.872 160.442 1.00 0.00 ? 88   LEU A CD2   1 
ATOM   645   N  N     . PRO A  1  89   ? 147.163 185.817 157.362 1.00 0.00 ? 89   PRO A N     1 
ATOM   646   C  CA    . PRO A  1  89   ? 148.568 186.212 157.288 1.00 0.00 ? 89   PRO A CA    1 
ATOM   647   C  C     . PRO A  1  89   ? 149.214 186.363 158.651 1.00 0.00 ? 89   PRO A C     1 
ATOM   648   O  O     . PRO A  1  89   ? 149.274 187.466 159.206 1.00 0.00 ? 89   PRO A O     1 
ATOM   649   C  CB    . PRO A  1  89   ? 148.529 187.536 156.539 1.00 0.00 ? 89   PRO A CB    1 
ATOM   650   C  CG    . PRO A  1  89   ? 147.216 188.077 156.858 1.00 0.00 ? 89   PRO A CG    1 
ATOM   651   C  CD    . PRO A  1  89   ? 146.271 186.929 157.003 1.00 0.00 ? 89   PRO A CD    1 
ATOM   652   N  N     . VAL A  1  90   ? 149.684 185.251 159.182 1.00 0.00 ? 90   VAL A N     1 
ATOM   653   C  CA    . VAL A  1  90   ? 150.445 185.245 160.421 1.00 0.00 ? 90   VAL A CA    1 
ATOM   654   C  C     . VAL A  1  90   ? 151.598 186.232 160.338 1.00 0.00 ? 90   VAL A C     1 
ATOM   655   O  O     . VAL A  1  90   ? 152.223 186.419 159.293 1.00 0.00 ? 90   VAL A O     1 
ATOM   656   C  CB    . VAL A  1  90   ? 150.964 183.836 160.716 1.00 0.00 ? 90   VAL A CB    1 
ATOM   657   C  CG1   . VAL A  1  90   ? 151.784 183.359 159.551 1.00 0.00 ? 90   VAL A CG1   1 
ATOM   658   C  CG2   . VAL A  1  90   ? 151.832 183.866 161.912 1.00 0.00 ? 90   VAL A CG2   1 
ATOM   659   N  N     . PHE A  1  91   ? 151.889 186.853 161.470 1.00 0.00 ? 91   PHE A N     1 
ATOM   660   C  CA    . PHE A  1  91   ? 152.893 187.892 161.514 1.00 0.00 ? 91   PHE A CA    1 
ATOM   661   C  C     . PHE A  1  91   ? 154.264 187.228 161.511 1.00 0.00 ? 91   PHE A C     1 
ATOM   662   O  O     . PHE A  1  91   ? 154.371 186.002 161.506 1.00 0.00 ? 91   PHE A O     1 
ATOM   663   C  CB    . PHE A  1  91   ? 152.660 188.769 162.735 1.00 0.00 ? 91   PHE A CB    1 
ATOM   664   C  CG    . PHE A  1  91   ? 153.188 190.140 162.588 1.00 0.00 ? 91   PHE A CG    1 
ATOM   665   C  CD1   . PHE A  1  91   ? 152.454 191.104 161.902 1.00 0.00 ? 91   PHE A CD1   1 
ATOM   666   C  CD2   . PHE A  1  91   ? 154.388 190.480 163.124 1.00 0.00 ? 91   PHE A CD2   1 
ATOM   667   C  CE1   . PHE A  1  91   ? 152.890 192.352 161.761 1.00 0.00 ? 91   PHE A CE1   1 
ATOM   668   C  CE2   . PHE A  1  91   ? 154.861 191.761 162.974 1.00 0.00 ? 91   PHE A CE2   1 
ATOM   669   C  CZ    . PHE A  1  91   ? 154.097 192.708 162.291 1.00 0.00 ? 91   PHE A CZ    1 
ATOM   670   N  N     . HIS A  1  92   ? 155.337 188.007 161.514 1.00 0.00 ? 92   HIS A N     1 
ATOM   671   C  CA    . HIS A  1  92   ? 156.662 187.417 161.362 1.00 0.00 ? 92   HIS A CA    1 
ATOM   672   C  C     . HIS A  1  92   ? 157.624 187.985 162.385 1.00 0.00 ? 92   HIS A C     1 
ATOM   673   O  O     . HIS A  1  92   ? 157.749 189.206 162.507 1.00 0.00 ? 92   HIS A O     1 
ATOM   674   C  CB    . HIS A  1  92   ? 157.225 187.639 159.958 1.00 0.00 ? 92   HIS A CB    1 
ATOM   675   C  CG    . HIS A  1  92   ? 158.563 186.998 159.742 1.00 0.00 ? 92   HIS A CG    1 
ATOM   676   N  ND1   . HIS A  1  92   ? 159.347 187.250 158.637 1.00 0.00 ? 92   HIS A ND1   1 
ATOM   677   C  CD2   . HIS A  1  92   ? 159.263 186.127 160.503 1.00 0.00 ? 92   HIS A CD2   1 
ATOM   678   C  CE1   . HIS A  1  92   ? 160.463 186.552 158.722 1.00 0.00 ? 92   HIS A CE1   1 
ATOM   679   N  NE2   . HIS A  1  92   ? 160.438 185.864 159.847 1.00 0.00 ? 92   HIS A NE2   1 
ATOM   680   N  N     . ILE A  1  93   ? 158.319 187.101 163.096 1.00 0.00 ? 93   ILE A N     1 
ATOM   681   C  CA    . ILE A  1  93   ? 159.239 187.545 164.135 1.00 0.00 ? 93   ILE A CA    1 
ATOM   682   C  C     . ILE A  1  93   ? 160.592 187.971 163.582 1.00 0.00 ? 93   ILE A C     1 
ATOM   683   O  O     . ILE A  1  93   ? 161.273 188.795 164.197 1.00 0.00 ? 93   ILE A O     1 
ATOM   684   C  CB    . ILE A  1  93   ? 159.409 186.456 165.200 1.00 0.00 ? 93   ILE A CB    1 
ATOM   685   C  CG1   . ILE A  1  93   ? 160.091 187.043 166.424 1.00 0.00 ? 93   ILE A CG1   1 
ATOM   686   C  CG2   . ILE A  1  93   ? 160.262 185.345 164.684 1.00 0.00 ? 93   ILE A CG2   1 
ATOM   687   C  CD1   . ILE A  1  93   ? 159.297 188.133 167.067 1.00 0.00 ? 93   ILE A CD1   1 
ATOM   688   N  N     . GLY A  1  94   ? 161.007 187.434 162.438 1.00 0.00 ? 94   GLY A N     1 
ATOM   689   C  CA    . GLY A  1  94   ? 162.311 187.792 161.911 1.00 0.00 ? 94   GLY A CA    1 
ATOM   690   C  C     . GLY A  1  94   ? 162.371 189.238 161.461 1.00 0.00 ? 94   GLY A C     1 
ATOM   691   O  O     . GLY A  1  94   ? 163.225 190.009 161.906 1.00 0.00 ? 94   GLY A O     1 
ATOM   692   N  N     . TYR A  1  95   ? 161.470 189.623 160.566 1.00 0.00 ? 95   TYR A N     1 
ATOM   693   C  CA    . TYR A  1  95   ? 161.416 190.981 160.063 1.00 0.00 ? 95   TYR A CA    1 
ATOM   694   C  C     . TYR A  1  95   ? 160.626 191.888 160.971 1.00 0.00 ? 95   TYR A C     1 
ATOM   695   O  O     . TYR A  1  95   ? 160.411 193.049 160.623 1.00 0.00 ? 95   TYR A O     1 
ATOM   696   C  CB    . TYR A  1  95   ? 160.791 190.996 158.678 1.00 0.00 ? 95   TYR A CB    1 
ATOM   697   C  CG    . TYR A  1  95   ? 161.570 190.183 157.707 1.00 0.00 ? 95   TYR A CG    1 
ATOM   698   C  CD1   . TYR A  1  95   ? 162.942 190.182 157.733 1.00 0.00 ? 95   TYR A CD1   1 
ATOM   699   C  CD2   . TYR A  1  95   ? 160.938 189.416 156.766 1.00 0.00 ? 95   TYR A CD2   1 
ATOM   700   C  CE1   . TYR A  1  95   ? 163.661 189.439 156.840 1.00 0.00 ? 95   TYR A CE1   1 
ATOM   701   C  CE2   . TYR A  1  95   ? 161.647 188.668 155.870 1.00 0.00 ? 95   TYR A CE2   1 
ATOM   702   C  CZ    . TYR A  1  95   ? 163.008 188.683 155.910 1.00 0.00 ? 95   TYR A CZ    1 
ATOM   703   O  OH    . TYR A  1  95   ? 163.724 187.933 155.015 1.00 0.00 ? 95   TYR A OH    1 
ATOM   704   N  N     . PHE A  1  96   ? 160.165 191.372 162.109 1.00 0.00 ? 96   PHE A N     1 
ATOM   705   C  CA    . PHE A  1  96   ? 159.285 192.131 162.986 1.00 0.00 ? 96   PHE A CA    1 
ATOM   706   C  C     . PHE A  1  96   ? 159.789 193.548 163.199 1.00 0.00 ? 96   PHE A C     1 
ATOM   707   O  O     . PHE A  1  96   ? 159.196 194.513 162.702 1.00 0.00 ? 96   PHE A O     1 
ATOM   708   C  CB    . PHE A  1  96   ? 159.160 191.416 164.319 1.00 0.00 ? 96   PHE A CB    1 
ATOM   709   C  CG    . PHE A  1  96   ? 158.394 192.190 165.325 1.00 0.00 ? 96   PHE A CG    1 
ATOM   710   C  CD1   . PHE A  1  96   ? 157.015 192.243 165.272 1.00 0.00 ? 96   PHE A CD1   1 
ATOM   711   C  CD2   . PHE A  1  96   ? 159.061 192.871 166.333 1.00 0.00 ? 96   PHE A CD2   1 
ATOM   712   C  CE1   . PHE A  1  96   ? 156.328 192.957 166.199 1.00 0.00 ? 96   PHE A CE1   1 
ATOM   713   C  CE2   . PHE A  1  96   ? 158.353 193.599 167.267 1.00 0.00 ? 96   PHE A CE2   1 
ATOM   714   C  CZ    . PHE A  1  96   ? 156.993 193.632 167.187 1.00 0.00 ? 96   PHE A CZ    1 
ATOM   715   N  N     . LYS A  1  97   ? 160.924 193.686 163.881 1.00 0.00 ? 97   LYS A N     1 
ATOM   716   C  CA    . LYS A  1  97   ? 161.425 195.012 164.209 1.00 0.00 ? 97   LYS A CA    1 
ATOM   717   C  C     . LYS A  1  97   ? 161.605 195.864 162.962 1.00 0.00 ? 97   LYS A C     1 
ATOM   718   O  O     . LYS A  1  97   ? 161.517 197.093 163.036 1.00 0.00 ? 97   LYS A O     1 
ATOM   719   C  CB    . LYS A  1  97   ? 162.734 194.891 164.981 1.00 0.00 ? 97   LYS A CB    1 
ATOM   720   C  CG    . LYS A  1  97   ? 163.221 196.186 165.576 1.00 0.00 ? 97   LYS A CG    1 
ATOM   721   C  CD    . LYS A  1  97   ? 164.561 195.981 166.243 1.00 0.00 ? 97   LYS A CD    1 
ATOM   722   C  CE    . LYS A  1  97   ? 164.429 195.043 167.432 1.00 0.00 ? 97   LYS A CE    1 
ATOM   723   N  NZ    . LYS A  1  97   ? 165.743 194.832 168.100 1.00 0.00 ? 97   LYS A NZ    1 
ATOM   724   N  N     . ALA A  1  98   ? 161.835 195.239 161.806 1.00 0.00 ? 98   ALA A N     1 
ATOM   725   C  CA    . ALA A  1  98   ? 161.795 196.003 160.566 1.00 0.00 ? 98   ALA A CA    1 
ATOM   726   C  C     . ALA A  1  98   ? 160.370 196.393 160.211 1.00 0.00 ? 98   ALA A C     1 
ATOM   727   O  O     . ALA A  1  98   ? 160.131 197.507 159.726 1.00 0.00 ? 98   ALA A O     1 
ATOM   728   C  CB    . ALA A  1  98   ? 162.428 195.210 159.423 1.00 0.00 ? 98   ALA A CB    1 
ATOM   729   N  N     . THR A  1  99   ? 159.414 195.495 160.447 1.00 0.00 ? 99   THR A N     1 
ATOM   730   C  CA    . THR A  1  99   ? 158.025 195.836 160.186 1.00 0.00 ? 99   THR A CA    1 
ATOM   731   C  C     . THR A  1  99   ? 157.598 197.036 161.009 1.00 0.00 ? 99   THR A C     1 
ATOM   732   O  O     . THR A  1  99   ? 156.768 197.832 160.562 1.00 0.00 ? 99   THR A O     1 
ATOM   733   C  CB    . THR A  1  99   ? 157.120 194.641 160.458 1.00 0.00 ? 99   THR A CB    1 
ATOM   734   O  OG1   . THR A  1  99   ? 157.526 193.551 159.627 1.00 0.00 ? 99   THR A OG1   1 
ATOM   735   C  CG2   . THR A  1  99   ? 155.691 194.980 160.133 1.00 0.00 ? 99   THR A CG2   1 
ATOM   736   N  N     . ILE A  1  100  ? 158.187 197.216 162.187 1.00 0.00 ? 100  ILE A N     1 
ATOM   737   C  CA    . ILE A  1  100  ? 157.888 198.410 162.965 1.00 0.00 ? 100  ILE A CA    1 
ATOM   738   C  C     . ILE A  1  100  ? 158.476 199.644 162.293 1.00 0.00 ? 100  ILE A C     1 
ATOM   739   O  O     . ILE A  1  100  ? 158.062 200.773 162.571 1.00 0.00 ? 100  ILE A O     1 
ATOM   740   C  CB    . ILE A  1  100  ? 158.394 198.241 164.405 1.00 0.00 ? 100  ILE A CB    1 
ATOM   741   C  CG1   . ILE A  1  100  ? 157.797 196.975 164.999 1.00 0.00 ? 100  ILE A CG1   1 
ATOM   742   C  CG2   . ILE A  1  100  ? 157.999 199.423 165.257 1.00 0.00 ? 100  ILE A CG2   1 
ATOM   743   C  CD1   . ILE A  1  100  ? 156.295 196.971 164.973 1.00 0.00 ? 100  ILE A CD1   1 
ATOM   744   N  N     . GLN A  1  101  ? 159.451 199.458 161.403 1.00 0.00 ? 101  GLN A N     1 
ATOM   745   C  CA    . GLN A  1  101  ? 159.919 200.603 160.630 1.00 0.00 ? 101  GLN A CA    1 
ATOM   746   C  C     . GLN A  1  101  ? 159.015 200.858 159.438 1.00 0.00 ? 101  GLN A C     1 
ATOM   747   O  O     . GLN A  1  101  ? 158.376 201.912 159.356 1.00 0.00 ? 101  GLN A O     1 
ATOM   748   C  CB    . GLN A  1  101  ? 161.358 200.406 160.169 1.00 0.00 ? 101  GLN A CB    1 
ATOM   749   C  CG    . GLN A  1  101  ? 162.353 200.416 161.288 1.00 0.00 ? 101  GLN A CG    1 
ATOM   750   C  CD    . GLN A  1  101  ? 163.766 200.227 160.794 1.00 0.00 ? 101  GLN A CD    1 
ATOM   751   O  OE1   . GLN A  1  101  ? 163.993 199.687 159.712 1.00 0.00 ? 101  GLN A OE1   1 
ATOM   752   N  NE2   . GLN A  1  101  ? 164.731 200.667 161.590 1.00 0.00 ? 101  GLN A NE2   1 
ATOM   753   N  N     . ILE A  1  102  ? 158.954 199.911 158.500 1.00 0.00 ? 102  ILE A N     1 
ATOM   754   C  CA    . ILE A  1  102  ? 158.095 200.083 157.337 1.00 0.00 ? 102  ILE A CA    1 
ATOM   755   C  C     . ILE A  1  102  ? 156.702 200.545 157.716 1.00 0.00 ? 102  ILE A C     1 
ATOM   756   O  O     . ILE A  1  102  ? 156.132 201.393 157.026 1.00 0.00 ? 102  ILE A O     1 
ATOM   757   C  CB    . ILE A  1  102  ? 158.030 198.777 156.522 1.00 0.00 ? 102  ILE A CB    1 
ATOM   758   C  CG1   . ILE A  1  102  ? 157.123 198.939 155.307 1.00 0.00 ? 102  ILE A CG1   1 
ATOM   759   C  CG2   . ILE A  1  102  ? 157.580 197.631 157.370 1.00 0.00 ? 102  ILE A CG2   1 
ATOM   760   C  CD1   . ILE A  1  102  ? 157.670 199.834 154.280 1.00 0.00 ? 102  ILE A CD1   1 
ATOM   761   N  N     . LEU A  1  103  ? 156.149 200.038 158.814 1.00 0.00 ? 103  LEU A N     1 
ATOM   762   C  CA    . LEU A  1  103  ? 154.887 200.539 159.325 1.00 0.00 ? 103  LEU A CA    1 
ATOM   763   C  C     . LEU A  1  103  ? 155.046 201.808 160.140 1.00 0.00 ? 103  LEU A C     1 
ATOM   764   O  O     . LEU A  1  103  ? 154.120 202.621 160.175 1.00 0.00 ? 103  LEU A O     1 
ATOM   765   C  CB    . LEU A  1  103  ? 154.204 199.472 160.187 1.00 0.00 ? 103  LEU A CB    1 
ATOM   766   C  CG    . LEU A  1  103  ? 152.726 199.678 160.481 1.00 0.00 ? 103  LEU A CG    1 
ATOM   767   C  CD1   . LEU A  1  103  ? 152.096 198.320 160.521 1.00 0.00 ? 103  LEU A CD1   1 
ATOM   768   C  CD2   . LEU A  1  103  ? 152.503 200.402 161.790 1.00 0.00 ? 103  LEU A CD2   1 
ATOM   769   N  N     . GLN A  1  104  ? 156.193 201.992 160.789 1.00 0.00 ? 104  GLN A N     1 
ATOM   770   C  CA    . GLN A  1  104  ? 156.460 203.228 161.511 1.00 0.00 ? 104  GLN A CA    1 
ATOM   771   C  C     . GLN A  1  104  ? 156.365 204.421 160.577 1.00 0.00 ? 104  GLN A C     1 
ATOM   772   O  O     . GLN A  1  104  ? 155.883 205.491 160.962 1.00 0.00 ? 104  GLN A O     1 
ATOM   773   C  CB    . GLN A  1  104  ? 157.849 203.162 162.145 1.00 0.00 ? 104  GLN A CB    1 
ATOM   774   C  CG    . GLN A  1  104  ? 158.263 204.377 162.946 1.00 0.00 ? 104  GLN A CG    1 
ATOM   775   C  CD    . GLN A  1  104  ? 157.553 204.490 164.268 1.00 0.00 ? 104  GLN A CD    1 
ATOM   776   O  OE1   . GLN A  1  104  ? 157.683 203.620 165.124 1.00 0.00 ? 104  GLN A OE1   1 
ATOM   777   N  NE2   . GLN A  1  104  ? 156.812 205.571 164.453 1.00 0.00 ? 104  GLN A NE2   1 
ATOM   778   N  N     . GLY A  1  105  ? 156.798 204.243 159.337 1.00 0.00 ? 105  GLY A N     1 
ATOM   779   C  CA    . GLY A  1  105  ? 157.005 205.357 158.444 1.00 0.00 ? 105  GLY A CA    1 
ATOM   780   C  C     . GLY A  1  105  ? 155.939 205.575 157.398 1.00 0.00 ? 105  GLY A C     1 
ATOM   781   O  O     . GLY A  1  105  ? 156.206 206.197 156.368 1.00 0.00 ? 105  GLY A O     1 
ATOM   782   N  N     . ILE A  1  106  ? 154.734 205.075 157.634 1.00 0.00 ? 106  ILE A N     1 
ATOM   783   C  CA    . ILE A  1  106  ? 153.659 205.237 156.667 1.00 0.00 ? 106  ILE A CA    1 
ATOM   784   C  C     . ILE A  1  106  ? 152.379 205.551 157.421 1.00 0.00 ? 106  ILE A C     1 
ATOM   785   O  O     . ILE A  1  106  ? 152.102 204.963 158.469 1.00 0.00 ? 106  ILE A O     1 
ATOM   786   C  CB    . ILE A  1  106  ? 153.510 203.978 155.787 1.00 0.00 ? 106  ILE A CB    1 
ATOM   787   C  CG1   . ILE A  1  106  ? 152.369 204.163 154.799 1.00 0.00 ? 106  ILE A CG1   1 
ATOM   788   C  CG2   . ILE A  1  106  ? 153.306 202.754 156.641 1.00 0.00 ? 106  ILE A CG2   1 
ATOM   789   C  CD1   . ILE A  1  106  ? 152.315 203.093 153.778 1.00 0.00 ? 106  ILE A CD1   1 
ATOM   790   N  N     . CYS A  1  107  ? 151.603 206.492 156.889 1.00 0.00 ? 107  CYS A N     1 
ATOM   791   C  CA    . CYS A  1  107  ? 150.369 206.854 157.559 1.00 0.00 ? 107  CYS A CA    1 
ATOM   792   C  C     . CYS A  1  107  ? 149.413 205.670 157.550 1.00 0.00 ? 107  CYS A C     1 
ATOM   793   O  O     . CYS A  1  107  ? 149.370 204.875 156.611 1.00 0.00 ? 107  CYS A O     1 
ATOM   794   C  CB    . CYS A  1  107  ? 149.700 208.049 156.889 1.00 0.00 ? 107  CYS A CB    1 
ATOM   795   S  SG    . CYS A  1  107  ? 149.158 207.728 155.216 1.00 0.00 ? 107  CYS A SG    1 
ATOM   796   N  N     . LYS A  1  108  ? 148.622 205.569 158.605 1.00 0.00 ? 108  LYS A N     1 
ATOM   797   C  CA    . LYS A  1  108  ? 147.839 204.376 158.857 1.00 0.00 ? 108  LYS A CA    1 
ATOM   798   C  C     . LYS A  1  108  ? 146.489 204.408 158.163 1.00 0.00 ? 108  LYS A C     1 
ATOM   799   O  O     . LYS A  1  108  ? 145.698 203.477 158.332 1.00 0.00 ? 108  LYS A O     1 
ATOM   800   C  CB    . LYS A  1  108  ? 147.651 204.182 160.363 1.00 0.00 ? 108  LYS A CB    1 
ATOM   801   C  CG    . LYS A  1  108  ? 148.835 203.516 161.041 1.00 0.00 ? 108  LYS A CG    1 
ATOM   802   C  CD    . LYS A  1  108  ? 150.030 204.438 161.028 1.00 0.00 ? 108  LYS A CD    1 
ATOM   803   C  CE    . LYS A  1  108  ? 151.227 203.834 161.719 1.00 0.00 ? 108  LYS A CE    1 
ATOM   804   N  NZ    . LYS A  1  108  ? 152.407 204.744 161.652 1.00 0.00 ? 108  LYS A NZ    1 
ATOM   805   N  N     . ASN A  1  109  ? 146.187 205.460 157.406 1.00 0.00 ? 109  ASN A N     1 
ATOM   806   C  CA    . ASN A  1  109  ? 144.897 205.500 156.737 1.00 0.00 ? 109  ASN A CA    1 
ATOM   807   C  C     . ASN A  1  109  ? 145.061 205.303 155.238 1.00 0.00 ? 109  ASN A C     1 
ATOM   808   O  O     . ASN A  1  109  ? 144.829 204.202 154.729 1.00 0.00 ? 109  ASN A O     1 
ATOM   809   C  CB    . ASN A  1  109  ? 144.190 206.822 157.021 1.00 0.00 ? 109  ASN A CB    1 
ATOM   810   C  CG    . ASN A  1  109  ? 142.764 206.844 156.515 1.00 0.00 ? 109  ASN A CG    1 
ATOM   811   O  OD1   . ASN A  1  109  ? 142.383 206.055 155.654 1.00 0.00 ? 109  ASN A OD1   1 
ATOM   812   N  ND2   . ASN A  1  109  ? 141.966 207.758 157.048 1.00 0.00 ? 109  ASN A ND2   1 
ATOM   813   N  N     . CYS A  1  110  ? 145.478 206.343 154.519 1.00 0.00 ? 110  CYS A N     1 
ATOM   814   C  CA    . CYS A  1  110  ? 145.603 206.200 153.075 1.00 0.00 ? 110  CYS A CA    1 
ATOM   815   C  C     . CYS A  1  110  ? 146.914 205.556 152.673 1.00 0.00 ? 110  CYS A C     1 
ATOM   816   O  O     . CYS A  1  110  ? 147.086 205.221 151.498 1.00 0.00 ? 110  CYS A O     1 
ATOM   817   C  CB    . CYS A  1  110  ? 145.465 207.549 152.370 1.00 0.00 ? 110  CYS A CB    1 
ATOM   818   S  SG    . CYS A  1  110  ? 146.717 208.758 152.778 1.00 0.00 ? 110  CYS A SG    1 
ATOM   819   N  N     . SER A  1  111  ? 147.833 205.390 153.617 1.00 0.00 ? 111  SER A N     1 
ATOM   820   C  CA    . SER A  1  111  ? 149.028 204.577 153.445 1.00 0.00 ? 111  SER A CA    1 
ATOM   821   C  C     . SER A  1  111  ? 149.860 205.051 152.254 1.00 0.00 ? 111  SER A C     1 
ATOM   822   O  O     . SER A  1  111  ? 150.303 204.275 151.414 1.00 0.00 ? 111  SER A O     1 
ATOM   823   C  CB    . SER A  1  111  ? 148.650 203.106 153.293 1.00 0.00 ? 111  SER A CB    1 
ATOM   824   O  OG    . SER A  1  111  ? 148.064 202.627 154.481 1.00 0.00 ? 111  SER A OG    1 
ATOM   825   N  N     . ALA A  1  112  ? 150.046 206.363 152.204 1.00 0.00 ? 112  ALA A N     1 
ATOM   826   C  CA    . ALA A  1  112  ? 151.036 206.957 151.327 1.00 0.00 ? 112  ALA A CA    1 
ATOM   827   C  C     . ALA A  1  112  ? 152.226 207.346 152.182 1.00 0.00 ? 112  ALA A C     1 
ATOM   828   O  O     . ALA A  1  112  ? 152.083 207.679 153.360 1.00 0.00 ? 112  ALA A O     1 
ATOM   829   C  CB    . ALA A  1  112  ? 150.485 208.168 150.574 1.00 0.00 ? 112  ALA A CB    1 
ATOM   830   N  N     . ILE A  1  113  ? 153.418 207.265 151.592 1.00 0.00 ? 113  ILE A N     1 
ATOM   831   C  CA    . ILE A  1  113  ? 154.608 207.672 152.318 1.00 0.00 ? 113  ILE A CA    1 
ATOM   832   C  C     . ILE A  1  113  ? 154.413 209.094 152.807 1.00 0.00 ? 113  ILE A C     1 
ATOM   833   O  O     . ILE A  1  113  ? 154.060 209.996 152.038 1.00 0.00 ? 113  ILE A O     1 
ATOM   834   C  CB    . ILE A  1  113  ? 155.853 207.522 151.438 1.00 0.00 ? 113  ILE A CB    1 
ATOM   835   C  CG1   . ILE A  1  113  ? 157.098 207.913 152.227 1.00 0.00 ? 113  ILE A CG1   1 
ATOM   836   C  CG2   . ILE A  1  113  ? 155.694 208.261 150.126 1.00 0.00 ? 113  ILE A CG2   1 
ATOM   837   C  CD1   . ILE A  1  113  ? 157.366 206.998 153.384 1.00 0.00 ? 113  ILE A CD1   1 
ATOM   838   N  N     . LEU A  1  114  ? 154.591 209.295 154.107 1.00 0.00 ? 114  LEU A N     1 
ATOM   839   C  CA    . LEU A  1  114  ? 153.992 210.476 154.704 1.00 0.00 ? 114  LEU A CA    1 
ATOM   840   C  C     . LEU A  1  114  ? 154.953 211.650 154.823 1.00 0.00 ? 114  LEU A C     1 
ATOM   841   O  O     . LEU A  1  114  ? 154.544 212.707 155.312 1.00 0.00 ? 114  LEU A O     1 
ATOM   842   C  CB    . LEU A  1  114  ? 153.384 210.114 156.060 1.00 0.00 ? 114  LEU A CB    1 
ATOM   843   C  CG    . LEU A  1  114  ? 154.251 209.692 157.235 1.00 0.00 ? 114  LEU A CG    1 
ATOM   844   C  CD1   . LEU A  1  114  ? 154.685 210.915 157.975 1.00 0.00 ? 114  LEU A CD1   1 
ATOM   845   C  CD2   . LEU A  1  114  ? 153.493 208.768 158.150 1.00 0.00 ? 114  LEU A CD2   1 
ATOM   846   N  N     . LEU A  1  115  ? 156.206 211.499 154.413 1.00 0.00 ? 115  LEU A N     1 
ATOM   847   C  CA    . LEU A  1  115  ? 157.033 212.665 154.147 1.00 0.00 ? 115  LEU A CA    1 
ATOM   848   C  C     . LEU A  1  115  ? 156.661 213.169 152.760 1.00 0.00 ? 115  LEU A C     1 
ATOM   849   O  O     . LEU A  1  115  ? 156.148 212.402 151.942 1.00 0.00 ? 115  LEU A O     1 
ATOM   850   C  CB    . LEU A  1  115  ? 158.518 212.323 154.229 1.00 0.00 ? 115  LEU A CB    1 
ATOM   851   C  CG    . LEU A  1  115  ? 159.372 213.589 154.129 1.00 0.00 ? 115  LEU A CG    1 
ATOM   852   C  CD1   . LEU A  1  115  ? 159.136 214.454 155.356 1.00 0.00 ? 115  LEU A CD1   1 
ATOM   853   C  CD2   . LEU A  1  115  ? 160.844 213.303 153.948 1.00 0.00 ? 115  LEU A CD2   1 
ATOM   854   N  N     . SER A  1  116  ? 156.891 214.451 152.487 1.00 0.00 ? 116  SER A N     1 
ATOM   855   C  CA    . SER A  1  116  ? 156.216 215.008 151.323 1.00 0.00 ? 116  SER A CA    1 
ATOM   856   C  C     . SER A  1  116  ? 157.098 215.767 150.337 1.00 0.00 ? 116  SER A C     1 
ATOM   857   O  O     . SER A  1  116  ? 158.307 215.924 150.539 1.00 0.00 ? 116  SER A O     1 
ATOM   858   C  CB    . SER A  1  116  ? 155.085 215.917 151.798 1.00 0.00 ? 116  SER A CB    1 
ATOM   859   O  OG    . SER A  1  116  ? 155.598 217.006 152.540 1.00 0.00 ? 116  SER A OG    1 
ATOM   860   N  N     . GLU A  1  117  ? 156.463 216.209 149.249 1.00 0.00 ? 117  GLU A N     1 
ATOM   861   C  CA    . GLU A  1  117  ? 156.983 217.020 148.147 1.00 0.00 ? 117  GLU A CA    1 
ATOM   862   C  C     . GLU A  1  117  ? 158.312 216.530 147.588 1.00 0.00 ? 117  GLU A C     1 
ATOM   863   O  O     . GLU A  1  117  ? 158.573 215.326 147.532 1.00 0.00 ? 117  GLU A O     1 
ATOM   864   C  CB    . GLU A  1  117  ? 157.113 218.503 148.545 1.00 0.00 ? 117  GLU A CB    1 
ATOM   865   C  CG    . GLU A  1  117  ? 158.181 218.864 149.584 1.00 0.00 ? 117  GLU A CG    1 
ATOM   866   C  CD    . GLU A  1  117  ? 157.671 218.774 150.989 1.00 0.00 ? 117  GLU A CD    1 
ATOM   867   O  OE1   . GLU A  1  117  ? 156.465 218.514 151.149 1.00 0.00 ? 117  GLU A OE1   1 
ATOM   868   O  OE2   . GLU A  1  117  ? 158.474 218.924 151.932 1.00 0.00 ? 117  GLU A OE2   1 
ATOM   869   N  N     . THR A  1  118  ? 159.164 217.477 147.202 1.00 0.00 ? 118  THR A N     1 
ATOM   870   C  CA    . THR A  1  118  ? 160.524 217.235 146.755 1.00 0.00 ? 118  THR A CA    1 
ATOM   871   C  C     . THR A  1  118  ? 161.468 216.973 147.920 1.00 0.00 ? 118  THR A C     1 
ATOM   872   O  O     . THR A  1  118  ? 162.570 216.453 147.711 1.00 0.00 ? 118  THR A O     1 
ATOM   873   C  CB    . THR A  1  118  ? 160.982 218.439 145.915 1.00 0.00 ? 118  THR A CB    1 
ATOM   874   O  OG1   . THR A  1  118  ? 160.144 218.551 144.757 1.00 0.00 ? 118  THR A OG1   1 
ATOM   875   C  CG2   . THR A  1  118  ? 162.429 218.322 145.464 1.00 0.00 ? 118  THR A CG2   1 
ATOM   876   N  N     . ASP A  1  119  ? 161.064 217.307 149.144 1.00 0.00 ? 119  ASP A N     1 
ATOM   877   C  CA    . ASP A  1  119  ? 161.820 216.839 150.296 1.00 0.00 ? 119  ASP A CA    1 
ATOM   878   C  C     . ASP A  1  119  ? 162.023 215.332 150.218 1.00 0.00 ? 119  ASP A C     1 
ATOM   879   O  O     . ASP A  1  119  ? 163.135 214.833 150.444 1.00 0.00 ? 119  ASP A O     1 
ATOM   880   C  CB    . ASP A  1  119  ? 161.097 217.229 151.581 1.00 0.00 ? 119  ASP A CB    1 
ATOM   881   C  CG    . ASP A  1  119  ? 161.924 216.970 152.810 1.00 0.00 ? 119  ASP A CG    1 
ATOM   882   O  OD1   . ASP A  1  119  ? 163.096 216.573 152.665 1.00 0.00 ? 119  ASP A OD1   1 
ATOM   883   O  OD2   . ASP A  1  119  ? 161.406 217.168 153.925 1.00 0.00 ? 119  ASP A OD2   1 
ATOM   884   N  N     . LYS A  1  120  ? 160.950 214.613 149.902 1.00 0.00 ? 120  LYS A N     1 
ATOM   885   C  CA    . LYS A  1  120  ? 161.013 213.166 149.770 1.00 0.00 ? 120  LYS A CA    1 
ATOM   886   C  C     . LYS A  1  120  ? 161.942 212.836 148.612 1.00 0.00 ? 120  LYS A C     1 
ATOM   887   O  O     . LYS A  1  120  ? 162.623 211.810 148.616 1.00 0.00 ? 120  LYS A O     1 
ATOM   888   C  CB    . LYS A  1  120  ? 159.622 212.585 149.517 1.00 0.00 ? 120  LYS A CB    1 
ATOM   889   C  CG    . LYS A  1  120  ? 159.623 211.306 148.697 1.00 0.00 ? 120  LYS A CG    1 
ATOM   890   C  CD    . LYS A  1  120  ? 158.440 211.260 147.743 1.00 0.00 ? 120  LYS A CD    1 
ATOM   891   C  CE    . LYS A  1  120  ? 157.125 211.149 148.499 1.00 0.00 ? 120  LYS A CE    1 
ATOM   892   N  NZ    . LYS A  1  120  ? 155.999 210.772 147.601 1.00 0.00 ? 120  LYS A NZ    1 
ATOM   893   N  N     . ARG A  1  121  ? 161.961 213.720 147.620 1.00 0.00 ? 121  ARG A N     1 
ATOM   894   C  CA    . ARG A  1  121  ? 162.818 213.552 146.456 1.00 0.00 ? 121  ARG A CA    1 
ATOM   895   C  C     . ARG A  1  121  ? 164.255 213.838 146.867 1.00 0.00 ? 121  ARG A C     1 
ATOM   896   O  O     . ARG A  1  121  ? 165.194 213.226 146.359 1.00 0.00 ? 121  ARG A O     1 
ATOM   897   C  CB    . ARG A  1  121  ? 162.390 214.494 145.330 1.00 0.00 ? 121  ARG A CB    1 
ATOM   898   C  CG    . ARG A  1  121  ? 162.748 214.000 143.938 1.00 0.00 ? 121  ARG A CG    1 
ATOM   899   C  CD    . ARG A  1  121  ? 163.780 214.901 143.281 1.00 0.00 ? 121  ARG A CD    1 
ATOM   900   N  NE    . ARG A  1  121  ? 164.800 214.136 142.569 1.00 0.00 ? 121  ARG A NE    1 
ATOM   901   C  CZ    . ARG A  1  121  ? 165.952 214.643 142.142 1.00 0.00 ? 121  ARG A CZ    1 
ATOM   902   N  NH1   . ARG A  1  121  ? 166.235 215.921 142.354 1.00 0.00 ? 121  ARG A NH1   1 
ATOM   903   N  NH2   . ARG A  1  121  ? 166.822 213.873 141.502 1.00 0.00 ? 121  ARG A NH2   1 
ATOM   904   N  N     . GLN A  1  122  ? 164.416 214.777 147.795 1.00 0.00 ? 122  GLN A N     1 
ATOM   905   C  CA    . GLN A  1  122  ? 165.733 215.138 148.298 1.00 0.00 ? 122  GLN A CA    1 
ATOM   906   C  C     . GLN A  1  122  ? 166.353 213.918 148.962 1.00 0.00 ? 122  GLN A C     1 
ATOM   907   O  O     . GLN A  1  122  ? 167.522 213.602 148.739 1.00 0.00 ? 122  GLN A O     1 
ATOM   908   C  CB    . GLN A  1  122  ? 165.631 216.291 149.298 1.00 0.00 ? 122  GLN A CB    1 
ATOM   909   C  CG    . GLN A  1  122  ? 166.973 216.807 149.789 1.00 0.00 ? 122  GLN A CG    1 
ATOM   910   C  CD    . GLN A  1  122  ? 167.577 217.839 148.856 1.00 0.00 ? 122  GLN A CD    1 
ATOM   911   O  OE1   . GLN A  1  122  ? 168.596 217.590 148.212 1.00 0.00 ? 122  GLN A OE1   1 
ATOM   912   N  NE2   . GLN A  1  122  ? 166.949 219.006 148.780 1.00 0.00 ? 122  GLN A NE2   1 
ATOM   913   N  N     . PHE A  1  123  ? 165.560 213.234 149.781 1.00 0.00 ? 123  PHE A N     1 
ATOM   914   C  CA    . PHE A  1  123  ? 166.021 212.032 150.459 1.00 0.00 ? 123  PHE A CA    1 
ATOM   915   C  C     . PHE A  1  123  ? 166.492 211.042 149.405 1.00 0.00 ? 123  PHE A C     1 
ATOM   916   O  O     . PHE A  1  123  ? 167.465 210.315 149.606 1.00 0.00 ? 123  PHE A O     1 
ATOM   917   C  CB    . PHE A  1  123  ? 164.899 211.421 151.298 1.00 0.00 ? 123  PHE A CB    1 
ATOM   918   C  CG    . PHE A  1  123  ? 164.788 212.003 152.679 1.00 0.00 ? 123  PHE A CG    1 
ATOM   919   C  CD1   . PHE A  1  123  ? 165.701 211.663 153.663 1.00 0.00 ? 123  PHE A CD1   1 
ATOM   920   C  CD2   . PHE A  1  123  ? 163.771 212.889 152.992 1.00 0.00 ? 123  PHE A CD2   1 
ATOM   921   C  CE1   . PHE A  1  123  ? 165.602 212.197 154.934 1.00 0.00 ? 123  PHE A CE1   1 
ATOM   922   C  CE2   . PHE A  1  123  ? 163.666 213.426 154.261 1.00 0.00 ? 123  PHE A CE2   1 
ATOM   923   C  CZ    . PHE A  1  123  ? 164.583 213.080 155.234 1.00 0.00 ? 123  PHE A CZ    1 
ATOM   924   N  N     . LEU A  1  124  ? 165.789 211.022 148.276 1.00 0.00 ? 124  LEU A N     1 
ATOM   925   C  CA    . LEU A  1  124  ? 166.142 210.139 147.167 1.00 0.00 ? 124  LEU A CA    1 
ATOM   926   C  C     . LEU A  1  124  ? 167.459 210.537 146.522 1.00 0.00 ? 124  LEU A C     1 
ATOM   927   O  O     . LEU A  1  124  ? 168.431 209.776 146.577 1.00 0.00 ? 124  LEU A O     1 
ATOM   928   C  CB    . LEU A  1  124  ? 165.036 210.138 146.120 1.00 0.00 ? 124  LEU A CB    1 
ATOM   929   C  CG    . LEU A  1  124  ? 163.757 209.392 146.467 1.00 0.00 ? 124  LEU A CG    1 
ATOM   930   C  CD1   . LEU A  1  124  ? 162.691 209.663 145.432 1.00 0.00 ? 124  LEU A CD1   1 
ATOM   931   C  CD2   . LEU A  1  124  ? 164.064 207.917 146.504 1.00 0.00 ? 124  LEU A CD2   1 
ATOM   932   N  N     . HIS A  1  125  ? 167.509 211.730 145.935 1.00 0.00 ? 125  HIS A N     1 
ATOM   933   C  CA    . HIS A  1  125  ? 168.726 212.291 145.369 1.00 0.00 ? 125  HIS A CA    1 
ATOM   934   C  C     . HIS A  1  125  ? 169.915 212.169 146.300 1.00 0.00 ? 125  HIS A C     1 
ATOM   935   O  O     . HIS A  1  125  ? 171.045 212.025 145.823 1.00 0.00 ? 125  HIS A O     1 
ATOM   936   C  CB    . HIS A  1  125  ? 168.504 213.763 145.033 1.00 0.00 ? 125  HIS A CB    1 
ATOM   937   C  CG    . HIS A  1  125  ? 169.710 214.440 144.471 1.00 0.00 ? 125  HIS A CG    1 
ATOM   938   N  ND1   . HIS A  1  125  ? 170.721 214.933 145.265 1.00 0.00 ? 125  HIS A ND1   1 
ATOM   939   C  CD2   . HIS A  1  125  ? 170.069 214.707 143.194 1.00 0.00 ? 125  HIS A CD2   1 
ATOM   940   C  CE1   . HIS A  1  125  ? 171.652 215.476 144.502 1.00 0.00 ? 125  HIS A CE1   1 
ATOM   941   N  NE2   . HIS A  1  125  ? 171.281 215.351 143.241 1.00 0.00 ? 125  HIS A NE2   1 
ATOM   942   N  N     . GLU A  1  126  ? 169.695 212.235 147.609 1.00 0.00 ? 126  GLU A N     1 
ATOM   943   C  CA    . GLU A  1  126  ? 170.807 211.995 148.514 1.00 0.00 ? 126  GLU A CA    1 
ATOM   944   C  C     . GLU A  1  126  ? 171.254 210.538 148.456 1.00 0.00 ? 126  GLU A C     1 
ATOM   945   O  O     . GLU A  1  126  ? 172.458 210.265 148.428 1.00 0.00 ? 126  GLU A O     1 
ATOM   946   C  CB    . GLU A  1  126  ? 170.419 212.400 149.934 1.00 0.00 ? 126  GLU A CB    1 
ATOM   947   C  CG    . GLU A  1  126  ? 171.570 212.432 150.923 1.00 0.00 ? 126  GLU A CG    1 
ATOM   948   C  CD    . GLU A  1  126  ? 171.970 211.060 151.411 1.00 0.00 ? 126  GLU A CD    1 
ATOM   949   O  OE1   . GLU A  1  126  ? 171.129 210.141 151.354 1.00 0.00 ? 126  GLU A OE1   1 
ATOM   950   O  OE2   . GLU A  1  126  ? 173.125 210.902 151.854 1.00 0.00 ? 126  GLU A OE2   1 
ATOM   951   N  N     . LEU A  1  127  ? 170.313 209.589 148.428 1.00 0.00 ? 127  LEU A N     1 
ATOM   952   C  CA    . LEU A  1  127  ? 170.697 208.181 148.385 1.00 0.00 ? 127  LEU A CA    1 
ATOM   953   C  C     . LEU A  1  127  ? 171.501 207.827 147.146 1.00 0.00 ? 127  LEU A C     1 
ATOM   954   O  O     . LEU A  1  127  ? 172.606 207.295 147.275 1.00 0.00 ? 127  LEU A O     1 
ATOM   955   C  CB    . LEU A  1  127  ? 169.477 207.261 148.439 1.00 0.00 ? 127  LEU A CB    1 
ATOM   956   C  CG    . LEU A  1  127  ? 168.958 206.805 149.798 1.00 0.00 ? 127  LEU A CG    1 
ATOM   957   C  CD1   . LEU A  1  127  ? 168.344 207.963 150.525 1.00 0.00 ? 127  LEU A CD1   1 
ATOM   958   C  CD2   . LEU A  1  127  ? 167.970 205.674 149.644 1.00 0.00 ? 127  LEU A CD2   1 
ATOM   959   N  N     . ARG A  1  128  ? 170.988 208.122 145.955 1.00 0.00 ? 128  ARG A N     1 
ATOM   960   C  CA    . ARG A  1  128  ? 171.553 207.602 144.720 1.00 0.00 ? 128  ARG A CA    1 
ATOM   961   C  C     . ARG A  1  128  ? 172.907 208.204 144.379 1.00 0.00 ? 128  ARG A C     1 
ATOM   962   O  O     . ARG A  1  128  ? 173.509 207.803 143.377 1.00 0.00 ? 128  ARG A O     1 
ATOM   963   C  CB    . ARG A  1  128  ? 170.585 207.820 143.561 1.00 0.00 ? 128  ARG A CB    1 
ATOM   964   C  CG    . ARG A  1  128  ? 169.291 207.067 143.713 1.00 0.00 ? 128  ARG A CG    1 
ATOM   965   C  CD    . ARG A  1  128  ? 168.409 207.266 142.507 1.00 0.00 ? 128  ARG A CD    1 
ATOM   966   N  NE    . ARG A  1  128  ? 167.118 206.621 142.683 1.00 0.00 ? 128  ARG A NE    1 
ATOM   967   C  CZ    . ARG A  1  128  ? 166.080 207.210 143.261 1.00 0.00 ? 128  ARG A CZ    1 
ATOM   968   N  NH1   . ARG A  1  128  ? 166.191 208.454 143.695 1.00 0.00 ? 128  ARG A NH1   1 
ATOM   969   N  NH2   . ARG A  1  128  ? 164.932 206.565 143.396 1.00 0.00 ? 128  ARG A NH2   1 
ATOM   970   N  N     . ARG A  1  129  ? 173.385 209.168 145.158 1.00 0.00 ? 129  ARG A N     1 
ATOM   971   C  CA    . ARG A  1  129  ? 174.695 209.740 144.891 1.00 0.00 ? 129  ARG A CA    1 
ATOM   972   C  C     . ARG A  1  129  ? 175.740 208.626 144.868 1.00 0.00 ? 129  ARG A C     1 
ATOM   973   O  O     . ARG A  1  129  ? 175.819 207.830 145.808 1.00 0.00 ? 129  ARG A O     1 
ATOM   974   C  CB    . ARG A  1  129  ? 175.046 210.794 145.934 1.00 0.00 ? 129  ARG A CB    1 
ATOM   975   C  CG    . ARG A  1  129  ? 176.311 211.566 145.620 1.00 0.00 ? 129  ARG A CG    1 
ATOM   976   C  CD    . ARG A  1  129  ? 176.563 212.655 146.638 1.00 0.00 ? 129  ARG A CD    1 
ATOM   977   N  NE    . ARG A  1  129  ? 176.819 212.110 147.966 1.00 0.00 ? 129  ARG A NE    1 
ATOM   978   C  CZ    . ARG A  1  129  ? 175.929 212.099 148.952 1.00 0.00 ? 129  ARG A CZ    1 
ATOM   979   N  NH1   . ARG A  1  129  ? 174.717 212.601 148.761 1.00 0.00 ? 129  ARG A NH1   1 
ATOM   980   N  NH2   . ARG A  1  129  ? 176.252 211.583 150.129 1.00 0.00 ? 129  ARG A NH2   1 
ATOM   981   N  N     . PRO A  1  130  ? 176.548 208.542 143.808 1.00 0.00 ? 130  PRO A N     1 
ATOM   982   C  CA    . PRO A  1  130  ? 177.209 207.267 143.473 1.00 0.00 ? 130  PRO A CA    1 
ATOM   983   C  C     . PRO A  1  130  ? 178.071 206.670 144.569 1.00 0.00 ? 130  PRO A C     1 
ATOM   984   O  O     . PRO A  1  130  ? 178.282 205.452 144.565 1.00 0.00 ? 130  PRO A O     1 
ATOM   985   C  CB    . PRO A  1  130  ? 178.057 207.634 142.249 1.00 0.00 ? 130  PRO A CB    1 
ATOM   986   C  CG    . PRO A  1  130  ? 177.335 208.782 141.634 1.00 0.00 ? 130  PRO A CG    1 
ATOM   987   C  CD    . PRO A  1  130  ? 176.793 209.572 142.787 1.00 0.00 ? 130  PRO A CD    1 
ATOM   988   N  N     . GLY A  1  131  ? 178.572 207.466 145.505 1.00 0.00 ? 131  GLY A N     1 
ATOM   989   C  CA    . GLY A  1  131  ? 179.558 206.953 146.435 1.00 0.00 ? 131  GLY A CA    1 
ATOM   990   C  C     . GLY A  1  131  ? 179.024 206.503 147.779 1.00 0.00 ? 131  GLY A C     1 
ATOM   991   O  O     . GLY A  1  131  ? 179.793 206.322 148.725 1.00 0.00 ? 131  GLY A O     1 
ATOM   992   N  N     . VAL A  1  132  ? 177.715 206.305 147.879 1.00 0.00 ? 132  VAL A N     1 
ATOM   993   C  CA    . VAL A  1  132  ? 177.061 205.977 149.139 1.00 0.00 ? 132  VAL A CA    1 
ATOM   994   C  C     . VAL A  1  132  ? 177.336 204.521 149.480 1.00 0.00 ? 132  VAL A C     1 
ATOM   995   O  O     . VAL A  1  132  ? 177.136 203.633 148.645 1.00 0.00 ? 132  VAL A O     1 
ATOM   996   C  CB    . VAL A  1  132  ? 175.550 206.248 149.076 1.00 0.00 ? 132  VAL A CB    1 
ATOM   997   C  CG1   . VAL A  1  132  ? 174.866 205.706 150.311 1.00 0.00 ? 132  VAL A CG1   1 
ATOM   998   C  CG2   . VAL A  1  132  ? 175.305 207.736 148.957 1.00 0.00 ? 132  VAL A CG2   1 
ATOM   999   N  N     . ASP A  1  133  ? 177.790 204.284 150.704 1.00 0.00 ? 133  ASP A N     1 
ATOM   1000  C  CA    . ASP A  1  133  ? 178.058 202.949 151.208 1.00 0.00 ? 133  ASP A CA    1 
ATOM   1001  C  C     . ASP A  1  133  ? 176.919 202.507 152.123 1.00 0.00 ? 133  ASP A C     1 
ATOM   1002  O  O     . ASP A  1  133  ? 175.978 203.254 152.393 1.00 0.00 ? 133  ASP A O     1 
ATOM   1003  C  CB    . ASP A  1  133  ? 179.400 202.933 151.948 1.00 0.00 ? 133  ASP A CB    1 
ATOM   1004  C  CG    . ASP A  1  133  ? 179.858 201.537 152.311 1.00 0.00 ? 133  ASP A CG    1 
ATOM   1005  O  OD1   . ASP A  1  133  ? 179.170 200.564 151.941 1.00 0.00 ? 133  ASP A OD1   1 
ATOM   1006  O  OD2   . ASP A  1  133  ? 180.911 201.413 152.969 1.00 0.00 ? 133  ASP A OD2   1 
ATOM   1007  N  N     . ASN A  1  134  ? 177.024 201.271 152.612 1.00 0.00 ? 134  ASN A N     1 
ATOM   1008  C  CA    . ASN A  1  134  ? 175.977 200.706 153.455 1.00 0.00 ? 134  ASN A CA    1 
ATOM   1009  C  C     . ASN A  1  134  ? 175.766 201.542 154.710 1.00 0.00 ? 134  ASN A C     1 
ATOM   1010  O  O     . ASN A  1  134  ? 174.627 201.864 155.069 1.00 0.00 ? 134  ASN A O     1 
ATOM   1011  C  CB    . ASN A  1  134  ? 176.342 199.268 153.817 1.00 0.00 ? 134  ASN A CB    1 
ATOM   1012  C  CG    . ASN A  1  134  ? 175.211 198.519 154.493 1.00 0.00 ? 134  ASN A CG    1 
ATOM   1013  O  OD1   . ASN A  1  134  ? 174.292 199.110 155.058 1.00 0.00 ? 134  ASN A OD1   1 
ATOM   1014  N  ND2   . ASN A  1  134  ? 175.276 197.195 154.432 1.00 0.00 ? 134  ASN A ND2   1 
ATOM   1015  N  N     . LEU A  1  135  ? 176.853 201.887 155.400 1.00 0.00 ? 135  LEU A N     1 
ATOM   1016  C  CA    . LEU A  1  135  ? 176.734 202.732 156.580 1.00 0.00 ? 135  LEU A CA    1 
ATOM   1017  C  C     . LEU A  1  135  ? 175.980 204.019 156.274 1.00 0.00 ? 135  LEU A C     1 
ATOM   1018  O  O     . LEU A  1  135  ? 175.016 204.353 156.976 1.00 0.00 ? 135  LEU A O     1 
ATOM   1019  C  CB    . LEU A  1  135  ? 178.119 203.042 157.137 1.00 0.00 ? 135  LEU A CB    1 
ATOM   1020  C  CG    . LEU A  1  135  ? 178.112 203.981 158.337 1.00 0.00 ? 135  LEU A CG    1 
ATOM   1021  C  CD1   . LEU A  1  135  ? 177.334 203.348 159.472 1.00 0.00 ? 135  LEU A CD1   1 
ATOM   1022  C  CD2   . LEU A  1  135  ? 179.525 204.310 158.770 1.00 0.00 ? 135  LEU A CD2   1 
ATOM   1023  N  N     . ARG A  1  136  ? 176.391 204.738 155.226 1.00 0.00 ? 136  ARG A N     1 
ATOM   1024  C  CA    . ARG A  1  136  ? 175.657 205.923 154.801 1.00 0.00 ? 136  ARG A CA    1 
ATOM   1025  C  C     . ARG A  1  136  ? 174.179 205.629 154.609 1.00 0.00 ? 136  ARG A C     1 
ATOM   1026  O  O     . ARG A  1  136  ? 173.334 206.373 155.116 1.00 0.00 ? 136  ARG A O     1 
ATOM   1027  C  CB    . ARG A  1  136  ? 176.246 206.472 153.508 1.00 0.00 ? 136  ARG A CB    1 
ATOM   1028  C  CG    . ARG A  1  136  ? 177.668 206.941 153.634 1.00 0.00 ? 136  ARG A CG    1 
ATOM   1029  C  CD    . ARG A  1  136  ? 177.747 208.076 154.624 1.00 0.00 ? 136  ARG A CD    1 
ATOM   1030  N  NE    . ARG A  1  136  ? 176.854 209.167 154.251 1.00 0.00 ? 136  ARG A NE    1 
ATOM   1031  C  CZ    . ARG A  1  136  ? 177.137 210.085 153.334 1.00 0.00 ? 136  ARG A CZ    1 
ATOM   1032  N  NH1   . ARG A  1  136  ? 178.291 210.045 152.683 1.00 0.00 ? 136  ARG A NH1   1 
ATOM   1033  N  NH2   . ARG A  1  136  ? 176.260 211.041 153.065 1.00 0.00 ? 136  ARG A NH2   1 
ATOM   1034  N  N     . ARG A  1  137  ? 173.857 204.556 153.881 1.00 0.00 ? 137  ARG A N     1 
ATOM   1035  C  CA    . ARG A  1  137  ? 172.471 204.129 153.737 1.00 0.00 ? 137  ARG A CA    1 
ATOM   1036  C  C     . ARG A  1  137  ? 171.766 204.126 155.079 1.00 0.00 ? 137  ARG A C     1 
ATOM   1037  O  O     . ARG A  1  137  ? 170.857 204.928 155.318 1.00 0.00 ? 137  ARG A O     1 
ATOM   1038  C  CB    . ARG A  1  137  ? 172.415 202.731 153.127 1.00 0.00 ? 137  ARG A CB    1 
ATOM   1039  C  CG    . ARG A  1  137  ? 172.912 202.629 151.719 1.00 0.00 ? 137  ARG A CG    1 
ATOM   1040  C  CD    . ARG A  1  137  ? 171.937 203.283 150.787 1.00 0.00 ? 137  ARG A CD    1 
ATOM   1041  N  NE    . ARG A  1  137  ? 170.631 202.643 150.891 1.00 0.00 ? 137  ARG A NE    1 
ATOM   1042  C  CZ    . ARG A  1  137  ? 170.311 201.500 150.292 1.00 0.00 ? 137  ARG A CZ    1 
ATOM   1043  N  NH1   . ARG A  1  137  ? 171.206 200.869 149.553 1.00 0.00 ? 137  ARG A NH1   1 
ATOM   1044  N  NH2   . ARG A  1  137  ? 169.100 200.982 150.436 1.00 0.00 ? 137  ARG A NH2   1 
ATOM   1045  N  N     . MET A  1  138  ? 172.198 203.243 155.975 1.00 0.00 ? 138  MET A N     1 
ATOM   1046  C  CA    . MET A  1  138  ? 171.520 203.083 157.251 1.00 0.00 ? 138  MET A CA    1 
ATOM   1047  C  C     . MET A  1  138  ? 171.366 204.403 157.985 1.00 0.00 ? 138  MET A C     1 
ATOM   1048  O  O     . MET A  1  138  ? 170.312 204.660 158.571 1.00 0.00 ? 138  MET A O     1 
ATOM   1049  C  CB    . MET A  1  138  ? 172.280 202.082 158.106 1.00 0.00 ? 138  MET A CB    1 
ATOM   1050  C  CG    . MET A  1  138  ? 172.277 200.698 157.508 1.00 0.00 ? 138  MET A CG    1 
ATOM   1051  S  SD    . MET A  1  138  ? 170.570 200.209 157.272 1.00 0.00 ? 138  MET A SD    1 
ATOM   1052  C  CE    . MET A  1  138  ? 170.012 200.263 158.973 1.00 0.00 ? 138  MET A CE    1 
ATOM   1053  N  N     . GLY A  1  139  ? 172.391 205.252 157.959 1.00 0.00 ? 139  GLY A N     1 
ATOM   1054  C  CA    . GLY A  1  139  ? 172.254 206.559 158.578 1.00 0.00 ? 139  GLY A CA    1 
ATOM   1055  C  C     . GLY A  1  139  ? 171.140 207.381 157.958 1.00 0.00 ? 139  GLY A C     1 
ATOM   1056  O  O     . GLY A  1  139  ? 170.292 207.935 158.666 1.00 0.00 ? 139  GLY A O     1 
ATOM   1057  N  N     . ILE A  1  140  ? 171.124 207.468 156.629 1.00 0.00 ? 140  ILE A N     1 
ATOM   1058  C  CA    . ILE A  1  140  ? 170.076 208.219 155.957 1.00 0.00 ? 140  ILE A CA    1 
ATOM   1059  C  C     . ILE A  1  140  ? 168.710 207.672 156.320 1.00 0.00 ? 140  ILE A C     1 
ATOM   1060  O  O     . ILE A  1  140  ? 167.779 208.435 156.576 1.00 0.00 ? 140  ILE A O     1 
ATOM   1061  C  CB    . ILE A  1  140  ? 170.303 208.213 154.442 1.00 0.00 ? 140  ILE A CB    1 
ATOM   1062  C  CG1   . ILE A  1  140  ? 171.664 208.823 154.144 1.00 0.00 ? 140  ILE A CG1   1 
ATOM   1063  C  CG2   . ILE A  1  140  ? 169.214 208.999 153.758 1.00 0.00 ? 140  ILE A CG2   1 
ATOM   1064  C  CD1   . ILE A  1  140  ? 171.824 210.202 154.713 1.00 0.00 ? 140  ILE A CD1   1 
ATOM   1065  N  N     . LEU A  1  141  ? 168.571 206.350 156.365 1.00 0.00 ? 141  LEU A N     1 
ATOM   1066  C  CA    . LEU A  1  141  ? 167.317 205.777 156.829 1.00 0.00 ? 141  LEU A CA    1 
ATOM   1067  C  C     . LEU A  1  141  ? 166.989 206.246 158.236 1.00 0.00 ? 141  LEU A C     1 
ATOM   1068  O  O     . LEU A  1  141  ? 165.853 206.639 158.511 1.00 0.00 ? 141  LEU A O     1 
ATOM   1069  C  CB    . LEU A  1  141  ? 167.384 204.255 156.761 1.00 0.00 ? 141  LEU A CB    1 
ATOM   1070  C  CG    . LEU A  1  141  ? 167.526 203.806 155.312 1.00 0.00 ? 141  LEU A CG    1 
ATOM   1071  C  CD1   . LEU A  1  141  ? 167.725 202.318 155.243 1.00 0.00 ? 141  LEU A CD1   1 
ATOM   1072  C  CD2   . LEU A  1  141  ? 166.310 204.221 154.524 1.00 0.00 ? 141  LEU A CD2   1 
ATOM   1073  N  N     . LYS A  1  142  ? 167.973 206.229 159.131 1.00 0.00 ? 142  LYS A N     1 
ATOM   1074  C  CA    . LYS A  1  142  ? 167.785 206.750 160.477 1.00 0.00 ? 142  LYS A CA    1 
ATOM   1075  C  C     . LYS A  1  142  ? 167.295 208.187 160.456 1.00 0.00 ? 142  LYS A C     1 
ATOM   1076  O  O     . LYS A  1  142  ? 166.599 208.613 161.382 1.00 0.00 ? 142  LYS A O     1 
ATOM   1077  C  CB    . LYS A  1  142  ? 169.096 206.628 161.254 1.00 0.00 ? 142  LYS A CB    1 
ATOM   1078  C  CG    . LYS A  1  142  ? 169.085 207.144 162.684 1.00 0.00 ? 142  LYS A CG    1 
ATOM   1079  C  CD    . LYS A  1  142  ? 170.398 206.764 163.365 1.00 0.00 ? 142  LYS A CD    1 
ATOM   1080  C  CE    . LYS A  1  142  ? 170.522 207.353 164.760 1.00 0.00 ? 142  LYS A CE    1 
ATOM   1081  N  NZ    . LYS A  1  142  ? 170.786 208.814 164.718 1.00 0.00 ? 142  LYS A NZ    1 
ATOM   1082  N  N     . LYS A  1  143  ? 167.620 208.941 159.407 1.00 0.00 ? 143  LYS A N     1 
ATOM   1083  C  CA    . LYS A  1  143  ? 167.031 210.268 159.279 1.00 0.00 ? 143  LYS A CA    1 
ATOM   1084  C  C     . LYS A  1  143  ? 165.611 210.206 158.734 1.00 0.00 ? 143  LYS A C     1 
ATOM   1085  O  O     . LYS A  1  143  ? 164.674 210.630 159.413 1.00 0.00 ? 143  LYS A O     1 
ATOM   1086  C  CB    . LYS A  1  143  ? 167.899 211.162 158.402 1.00 0.00 ? 143  LYS A CB    1 
ATOM   1087  C  CG    . LYS A  1  143  ? 167.342 212.573 158.262 1.00 0.00 ? 143  LYS A CG    1 
ATOM   1088  C  CD    . LYS A  1  143  ? 168.268 213.480 157.472 1.00 0.00 ? 143  LYS A CD    1 
ATOM   1089  C  CE    . LYS A  1  143  ? 169.522 213.810 158.261 1.00 0.00 ? 143  LYS A CE    1 
ATOM   1090  N  NZ    . LYS A  1  143  ? 169.185 214.601 159.477 1.00 0.00 ? 143  LYS A NZ    1 
ATOM   1091  N  N     . ILE A  1  144  ? 165.434 209.699 157.516 1.00 0.00 ? 144  ILE A N     1 
ATOM   1092  C  CA    . ILE A  1  144  ? 164.122 209.674 156.883 1.00 0.00 ? 144  ILE A CA    1 
ATOM   1093  C  C     . ILE A  1  144  ? 163.040 209.104 157.785 1.00 0.00 ? 144  ILE A C     1 
ATOM   1094  O  O     . ILE A  1  144  ? 161.900 209.589 157.752 1.00 0.00 ? 144  ILE A O     1 
ATOM   1095  C  CB    . ILE A  1  144  ? 164.161 208.878 155.567 1.00 0.00 ? 144  ILE A CB    1 
ATOM   1096  C  CG1   . ILE A  1  144  ? 162.848 209.031 154.820 1.00 0.00 ? 144  ILE A CG1   1 
ATOM   1097  C  CG2   . ILE A  1  144  ? 164.409 207.418 155.816 1.00 0.00 ? 144  ILE A CG2   1 
ATOM   1098  C  CD1   . ILE A  1  144  ? 162.622 210.416 154.373 1.00 0.00 ? 144  ILE A CD1   1 
ATOM   1099  N  N     . LEU A  1  145  ? 163.361 208.102 158.597 1.00 0.00 ? 145  LEU A N     1 
ATOM   1100  C  CA    . LEU A  1  145  ? 162.354 207.530 159.474 1.00 0.00 ? 145  LEU A CA    1 
ATOM   1101  C  C     . LEU A  1  145  ? 161.834 208.567 160.462 1.00 0.00 ? 145  LEU A C     1 
ATOM   1102  O  O     . LEU A  1  145  ? 160.686 209.003 160.362 1.00 0.00 ? 145  LEU A O     1 
ATOM   1103  C  CB    . LEU A  1  145  ? 162.913 206.302 160.180 1.00 0.00 ? 145  LEU A CB    1 
ATOM   1104  C  CG    . LEU A  1  145  ? 161.820 205.471 160.839 1.00 0.00 ? 145  LEU A CG    1 
ATOM   1105  C  CD1   . LEU A  1  145  ? 162.120 203.991 160.703 1.00 0.00 ? 145  LEU A CD1   1 
ATOM   1106  C  CD2   . LEU A  1  145  ? 161.693 205.849 162.294 1.00 0.00 ? 145  LEU A CD2   1 
ATOM   1107  N  N     . ASP A  1  146  ? 162.662 209.005 161.409 1.00 0.00 ? 146  ASP A N     1 
ATOM   1108  C  CA    . ASP A  1  146  ? 162.084 209.914 162.390 1.00 0.00 ? 146  ASP A CA    1 
ATOM   1109  C  C     . ASP A  1  146  ? 161.678 211.244 161.775 1.00 0.00 ? 146  ASP A C     1 
ATOM   1110  O  O     . ASP A  1  146  ? 160.899 211.976 162.391 1.00 0.00 ? 146  ASP A O     1 
ATOM   1111  C  CB    . ASP A  1  146  ? 163.036 210.147 163.563 1.00 0.00 ? 146  ASP A CB    1 
ATOM   1112  C  CG    . ASP A  1  146  ? 164.289 210.878 163.165 1.00 0.00 ? 146  ASP A CG    1 
ATOM   1113  O  OD1   . ASP A  1  146  ? 164.482 211.117 161.961 1.00 0.00 ? 146  ASP A OD1   1 
ATOM   1114  O  OD2   . ASP A  1  146  ? 165.087 211.218 164.064 1.00 0.00 ? 146  ASP A OD2   1 
ATOM   1115  N  N     . GLN A  1  147  ? 162.180 211.570 160.582 1.00 0.00 ? 147  GLN A N     1 
ATOM   1116  C  CA    . GLN A  1  147  ? 161.657 212.729 159.874 1.00 0.00 ? 147  GLN A CA    1 
ATOM   1117  C  C     . GLN A  1  147  ? 160.173 212.579 159.594 1.00 0.00 ? 147  GLN A C     1 
ATOM   1118  O  O     . GLN A  1  147  ? 159.433 213.568 159.636 1.00 0.00 ? 147  GLN A O     1 
ATOM   1119  C  CB    . GLN A  1  147  ? 162.413 212.953 158.569 1.00 0.00 ? 147  GLN A CB    1 
ATOM   1120  C  CG    . GLN A  1  147  ? 161.891 214.130 157.755 1.00 0.00 ? 147  GLN A CG    1 
ATOM   1121  C  CD    . GLN A  1  147  ? 161.972 215.442 158.499 1.00 0.00 ? 147  GLN A CD    1 
ATOM   1122  O  OE1   . GLN A  1  147  ? 163.046 215.866 158.920 1.00 0.00 ? 147  GLN A OE1   1 
ATOM   1123  N  NE2   . GLN A  1  147  ? 160.832 216.098 158.662 1.00 0.00 ? 147  GLN A NE2   1 
ATOM   1124  N  N     . CYS A  1  148  ? 159.715 211.364 159.299 1.00 0.00 ? 148  CYS A N     1 
ATOM   1125  C  CA    . CYS A  1  148  ? 158.279 211.192 159.142 1.00 0.00 ? 148  CYS A CA    1 
ATOM   1126  C  C     . CYS A  1  148  ? 157.576 211.017 160.484 1.00 0.00 ? 148  CYS A C     1 
ATOM   1127  O  O     . CYS A  1  148  ? 156.386 211.327 160.587 1.00 0.00 ? 148  CYS A O     1 
ATOM   1128  C  CB    . CYS A  1  148  ? 157.964 210.031 158.194 1.00 0.00 ? 148  CYS A CB    1 
ATOM   1129  S  SG    . CYS A  1  148  ? 158.512 208.385 158.630 1.00 0.00 ? 148  CYS A SG    1 
ATOM   1130  N  N     . LYS A  1  149  ? 158.278 210.546 161.521 1.00 0.00 ? 149  LYS A N     1 
ATOM   1131  C  CA    . LYS A  1  149  ? 157.660 210.493 162.844 1.00 0.00 ? 149  LYS A CA    1 
ATOM   1132  C  C     . LYS A  1  149  ? 157.111 211.849 163.254 1.00 0.00 ? 149  LYS A C     1 
ATOM   1133  O  O     . LYS A  1  149  ? 155.937 211.966 163.617 1.00 0.00 ? 149  LYS A O     1 
ATOM   1134  C  CB    . LYS A  1  149  ? 158.646 210.012 163.906 1.00 0.00 ? 149  LYS A CB    1 
ATOM   1135  C  CG    . LYS A  1  149  ? 158.925 208.529 163.935 1.00 0.00 ? 149  LYS A CG    1 
ATOM   1136  C  CD    . LYS A  1  149  ? 159.879 208.205 165.076 1.00 0.00 ? 149  LYS A CD    1 
ATOM   1137  C  CE    . LYS A  1  149  ? 160.061 206.709 165.258 1.00 0.00 ? 149  LYS A CE    1 
ATOM   1138  N  NZ    . LYS A  1  149  ? 161.014 206.383 166.354 1.00 0.00 ? 149  LYS A NZ    1 
ATOM   1139  N  N     . LYS A  1  150  ? 157.944 212.883 163.206 1.00 0.00 ? 150  LYS A N     1 
ATOM   1140  C  CA    . LYS A  1  150  ? 157.544 214.192 163.701 1.00 0.00 ? 150  LYS A CA    1 
ATOM   1141  C  C     . LYS A  1  150  ? 156.454 214.840 162.860 1.00 0.00 ? 150  LYS A C     1 
ATOM   1142  O  O     . LYS A  1  150  ? 155.889 215.852 163.286 1.00 0.00 ? 150  LYS A O     1 
ATOM   1143  C  CB    . LYS A  1  150  ? 158.766 215.108 163.806 1.00 0.00 ? 150  LYS A CB    1 
ATOM   1144  C  CG    . LYS A  1  150  ? 159.490 215.351 162.506 1.00 0.00 ? 150  LYS A CG    1 
ATOM   1145  C  CD    . LYS A  1  150  ? 160.728 216.200 162.740 1.00 0.00 ? 150  LYS A CD    1 
ATOM   1146  C  CE    . LYS A  1  150  ? 161.745 215.447 163.588 1.00 0.00 ? 150  LYS A CE    1 
ATOM   1147  N  NZ    . LYS A  1  150  ? 162.990 216.228 163.824 1.00 0.00 ? 150  LYS A NZ    1 
ATOM   1148  N  N     . GLN A  1  151  ? 156.122 214.279 161.703 1.00 0.00 ? 151  GLN A N     1 
ATOM   1149  C  CA    . GLN A  1  151  ? 154.928 214.661 160.958 1.00 0.00 ? 151  GLN A CA    1 
ATOM   1150  C  C     . GLN A  1  151  ? 153.734 214.257 161.813 1.00 0.00 ? 151  GLN A C     1 
ATOM   1151  O  O     . GLN A  1  151  ? 153.855 213.389 162.681 1.00 0.00 ? 151  GLN A O     1 
ATOM   1152  C  CB    . GLN A  1  151  ? 154.898 213.983 159.592 1.00 0.00 ? 151  GLN A CB    1 
ATOM   1153  C  CG    . GLN A  1  151  ? 153.735 214.377 158.711 1.00 0.00 ? 151  GLN A CG    1 
ATOM   1154  C  CD    . GLN A  1  151  ? 153.798 215.822 158.301 1.00 0.00 ? 151  GLN A CD    1 
ATOM   1155  O  OE1   . GLN A  1  151  ? 153.138 216.672 158.890 1.00 0.00 ? 151  GLN A OE1   1 
ATOM   1156  N  NE2   . GLN A  1  151  ? 154.598 216.113 157.285 1.00 0.00 ? 151  GLN A NE2   1 
ATOM   1157  N  N     . ARG A  1  152  ? 152.589 214.893 161.590 1.00 0.00 ? 152  ARG A N     1 
ATOM   1158  C  CA    . ARG A  1  152  ? 151.432 214.610 162.430 1.00 0.00 ? 152  ARG A CA    1 
ATOM   1159  C  C     . ARG A  1  152  ? 150.264 214.109 161.605 1.00 0.00 ? 152  ARG A C     1 
ATOM   1160  O  O     . ARG A  1  152  ? 149.887 212.936 161.685 1.00 0.00 ? 152  ARG A O     1 
ATOM   1161  C  CB    . ARG A  1  152  ? 151.049 215.860 163.213 1.00 0.00 ? 152  ARG A CB    1 
ATOM   1162  C  CG    . ARG A  1  152  ? 152.153 216.270 164.139 1.00 0.00 ? 152  ARG A CG    1 
ATOM   1163  C  CD    . ARG A  1  152  ? 152.223 215.281 165.275 1.00 0.00 ? 152  ARG A CD    1 
ATOM   1164  N  NE    . ARG A  1  152  ? 153.398 215.488 166.104 1.00 0.00 ? 152  ARG A NE    1 
ATOM   1165  C  CZ    . ARG A  1  152  ? 154.520 214.796 165.963 1.00 0.00 ? 152  ARG A CZ    1 
ATOM   1166  N  NH1   . ARG A  1  152  ? 154.595 213.849 165.038 1.00 0.00 ? 152  ARG A NH1   1 
ATOM   1167  N  NH2   . ARG A  1  152  ? 155.556 215.035 166.753 1.00 0.00 ? 152  ARG A NH2   1 
ATOM   1168  N  N     . ARG A  1  153  ? 149.677 214.989 160.819 1.00 0.00 ? 153  ARG A N     1 
ATOM   1169  C  CA    . ARG A  1  153  ? 148.696 214.629 159.822 1.00 0.00 ? 153  ARG A CA    1 
ATOM   1170  C  C     . ARG A  1  153  ? 149.416 214.175 158.564 1.00 0.00 ? 153  ARG A C     1 
ATOM   1171  O  O     . ARG A  1  153  ? 150.459 214.719 158.193 1.00 0.00 ? 153  ARG A O     1 
ATOM   1172  C  CB    . ARG A  1  153  ? 147.804 215.821 159.523 1.00 0.00 ? 153  ARG A CB    1 
ATOM   1173  C  CG    . ARG A  1  153  ? 146.778 215.642 158.445 1.00 0.00 ? 153  ARG A CG    1 
ATOM   1174  C  CD    . ARG A  1  153  ? 146.133 216.993 158.198 1.00 0.00 ? 153  ARG A CD    1 
ATOM   1175  N  NE    . ARG A  1  153  ? 147.158 217.968 157.821 1.00 0.00 ? 153  ARG A NE    1 
ATOM   1176  C  CZ    . ARG A  1  153  ? 147.649 218.900 158.637 1.00 0.00 ? 153  ARG A CZ    1 
ATOM   1177  N  NH1   . ARG A  1  153  ? 147.194 219.013 159.876 1.00 0.00 ? 153  ARG A NH1   1 
ATOM   1178  N  NH2   . ARG A  1  153  ? 148.585 219.734 158.206 1.00 0.00 ? 153  ARG A NH2   1 
ATOM   1179  N  N     . CYS A  1  154  ? 148.859 213.157 157.915 1.00 0.00 ? 154  CYS A N     1 
ATOM   1180  C  CA    . CYS A  1  154  ? 149.384 212.722 156.629 1.00 0.00 ? 154  CYS A CA    1 
ATOM   1181  C  C     . CYS A  1  154  ? 149.113 213.766 155.564 1.00 0.00 ? 154  CYS A C     1 
ATOM   1182  O  O     . CYS A  1  154  ? 148.260 214.640 155.742 1.00 0.00 ? 154  CYS A O     1 
ATOM   1183  C  CB    . CYS A  1  154  ? 148.790 211.388 156.201 1.00 0.00 ? 154  CYS A CB    1 
ATOM   1184  S  SG    . CYS A  1  154  ? 149.302 210.902 154.542 1.00 0.00 ? 154  CYS A SG    1 
ATOM   1185  N  N     . LEU A  1  155  ? 149.831 213.676 154.451 1.00 0.00 ? 155  LEU A N     1 
ATOM   1186  C  CA    . LEU A  1  155  ? 149.833 214.771 153.499 1.00 0.00 ? 155  LEU A CA    1 
ATOM   1187  C  C     . LEU A  1  155  ? 148.521 214.814 152.726 1.00 0.00 ? 155  LEU A C     1 
ATOM   1188  O  O     . LEU A  1  155  ? 147.747 215.758 152.900 1.00 0.00 ? 155  LEU A O     1 
ATOM   1189  C  CB    . LEU A  1  155  ? 151.060 214.670 152.589 1.00 0.00 ? 155  LEU A CB    1 
ATOM   1190  C  CG    . LEU A  1  155  ? 151.317 213.548 151.584 1.00 0.00 ? 155  LEU A CG    1 
ATOM   1191  C  CD1   . LEU A  1  155  ? 150.814 213.920 150.205 1.00 0.00 ? 155  LEU A CD1   1 
ATOM   1192  C  CD2   . LEU A  1  155  ? 152.780 213.211 151.539 1.00 0.00 ? 155  LEU A CD2   1 
ATOM   1193  N  N     . HIS A  1  156  ? 148.240 213.828 151.877 1.00 0.00 ? 156  HIS A N     1 
ATOM   1194  C  CA    . HIS A  1  156  ? 147.029 213.944 151.078 1.00 0.00 ? 156  HIS A CA    1 
ATOM   1195  C  C     . HIS A  1  156  ? 145.875 213.111 151.629 1.00 0.00 ? 156  HIS A C     1 
ATOM   1196  O  O     . HIS A  1  156  ? 144.792 213.091 151.035 1.00 0.00 ? 156  HIS A O     1 
ATOM   1197  C  CB    . HIS A  1  156  ? 147.284 213.595 149.609 1.00 0.00 ? 156  HIS A CB    1 
ATOM   1198  C  CG    . HIS A  1  156  ? 147.698 212.179 149.371 1.00 0.00 ? 156  HIS A CG    1 
ATOM   1199  N  ND1   . HIS A  1  156  ? 146.812 211.128 149.435 1.00 0.00 ? 156  HIS A ND1   1 
ATOM   1200  C  CD2   . HIS A  1  156  ? 148.889 211.645 149.011 1.00 0.00 ? 156  HIS A CD2   1 
ATOM   1201  C  CE1   . HIS A  1  156  ? 147.446 210.003 149.156 1.00 0.00 ? 156  HIS A CE1   1 
ATOM   1202  N  NE2   . HIS A  1  156  ? 148.708 210.290 148.896 1.00 0.00 ? 156  HIS A NE2   1 
ATOM   1203  N  N     . CYS A  1  157  ? 146.071 212.403 152.740 1.00 0.00 ? 157  CYS A N     1 
ATOM   1204  C  CA    . CYS A  1  157  ? 144.945 211.710 153.353 1.00 0.00 ? 157  CYS A CA    1 
ATOM   1205  C  C     . CYS A  1  157  ? 144.087 212.612 154.212 1.00 0.00 ? 157  CYS A C     1 
ATOM   1206  O  O     . CYS A  1  157  ? 142.874 212.410 154.271 1.00 0.00 ? 157  CYS A O     1 
ATOM   1207  C  CB    . CYS A  1  157  ? 145.404 210.545 154.235 1.00 0.00 ? 157  CYS A CB    1 
ATOM   1208  S  SG    . CYS A  1  157  ? 146.306 211.052 155.684 1.00 0.00 ? 157  CYS A SG    1 
ATOM   1209  N  N     . GLY A  1  158  ? 144.685 213.575 154.900 1.00 0.00 ? 158  GLY A N     1 
ATOM   1210  C  CA    . GLY A  1  158  ? 143.953 214.439 155.798 1.00 0.00 ? 158  GLY A CA    1 
ATOM   1211  C  C     . GLY A  1  158  ? 143.872 213.858 157.191 1.00 0.00 ? 158  GLY A C     1 
ATOM   1212  O  O     . GLY A  1  158  ? 143.703 214.589 158.170 1.00 0.00 ? 158  GLY A O     1 
ATOM   1213  N  N     . ALA A  1  159  ? 144.009 212.542 157.297 1.00 0.00 ? 159  ALA A N     1 
ATOM   1214  C  CA    . ALA A  1  159  ? 143.993 211.895 158.597 1.00 0.00 ? 159  ALA A CA    1 
ATOM   1215  C  C     . ALA A  1  159  ? 145.306 212.147 159.317 1.00 0.00 ? 159  ALA A C     1 
ATOM   1216  O  O     . ALA A  1  159  ? 146.314 212.501 158.699 1.00 0.00 ? 159  ALA A O     1 
ATOM   1217  C  CB    . ALA A  1  159  ? 143.754 210.394 158.454 1.00 0.00 ? 159  ALA A CB    1 
ATOM   1218  N  N     . LEU A  1  160  ? 145.286 211.980 160.629 1.00 0.00 ? 160  LEU A N     1 
ATOM   1219  C  CA    . LEU A  1  160  ? 146.477 212.157 161.441 1.00 0.00 ? 160  LEU A CA    1 
ATOM   1220  C  C     . LEU A  1  160  ? 146.993 210.783 161.864 1.00 0.00 ? 160  LEU A C     1 
ATOM   1221  O  O     . LEU A  1  160  ? 146.379 209.759 161.558 1.00 0.00 ? 160  LEU A O     1 
ATOM   1222  C  CB    . LEU A  1  160  ? 146.155 213.082 162.618 1.00 0.00 ? 160  LEU A CB    1 
ATOM   1223  C  CG    . LEU A  1  160  ? 145.013 212.664 163.547 1.00 0.00 ? 160  LEU A CG    1 
ATOM   1224  C  CD1   . LEU A  1  160  ? 145.450 211.645 164.584 1.00 0.00 ? 160  LEU A CD1   1 
ATOM   1225  C  CD2   . LEU A  1  160  ? 144.410 213.886 164.210 1.00 0.00 ? 160  LEU A CD2   1 
ATOM   1226  N  N     . ASN A  1  161  ? 148.103 210.745 162.592 1.00 0.00 ? 161  ASN A N     1 
ATOM   1227  C  CA    . ASN A  1  161  ? 148.644 209.495 163.096 1.00 0.00 ? 161  ASN A CA    1 
ATOM   1228  C  C     . ASN A  1  161  ? 149.604 209.806 164.234 1.00 0.00 ? 161  ASN A C     1 
ATOM   1229  O  O     . ASN A  1  161  ? 149.780 210.961 164.631 1.00 0.00 ? 161  ASN A O     1 
ATOM   1230  C  CB    . ASN A  1  161  ? 149.313 208.695 161.973 1.00 0.00 ? 161  ASN A CB    1 
ATOM   1231  C  CG    . ASN A  1  161  ? 150.469 209.429 161.337 1.00 0.00 ? 161  ASN A CG    1 
ATOM   1232  O  OD1   . ASN A  1  161  ? 151.165 210.209 161.982 1.00 0.00 ? 161  ASN A OD1   1 
ATOM   1233  N  ND2   . ASN A  1  161  ? 150.692 209.167 160.057 1.00 0.00 ? 161  ASN A ND2   1 
ATOM   1234  N  N     . GLY A  1  162  ? 150.259 208.767 164.737 1.00 0.00 ? 162  GLY A N     1 
ATOM   1235  C  CA    . GLY A  1  162  ? 151.091 208.902 165.912 1.00 0.00 ? 162  GLY A CA    1 
ATOM   1236  C  C     . GLY A  1  162  ? 152.030 207.733 166.099 1.00 0.00 ? 162  GLY A C     1 
ATOM   1237  O  O     . GLY A  1  162  ? 152.237 206.945 165.175 1.00 0.00 ? 162  GLY A O     1 
ATOM   1238  N  N     . VAL A  1  163  ? 152.607 207.617 167.291 1.00 0.00 ? 163  VAL A N     1 
ATOM   1239  C  CA    . VAL A  1  163  ? 153.636 206.631 167.580 1.00 0.00 ? 163  VAL A CA    1 
ATOM   1240  C  C     . VAL A  1  163  ? 153.043 205.235 167.505 1.00 0.00 ? 163  VAL A C     1 
ATOM   1241  O  O     . VAL A  1  163  ? 151.833 205.045 167.646 1.00 0.00 ? 163  VAL A O     1 
ATOM   1242  C  CB    . VAL A  1  163  ? 154.273 206.861 168.962 1.00 0.00 ? 163  VAL A CB    1 
ATOM   1243  C  CG1   . VAL A  1  163  ? 154.955 208.212 169.004 1.00 0.00 ? 163  VAL A CG1   1 
ATOM   1244  C  CG2   . VAL A  1  163  ? 153.219 206.755 170.050 1.00 0.00 ? 163  VAL A CG2   1 
ATOM   1245  N  N     . VAL A  1  164  ? 153.904 204.262 167.260 1.00 0.00 ? 164  VAL A N     1 
ATOM   1246  C  CA    . VAL A  1  164  ? 153.522 202.858 167.242 1.00 0.00 ? 164  VAL A CA    1 
ATOM   1247  C  C     . VAL A  1  164  ? 154.494 202.053 168.099 1.00 0.00 ? 164  VAL A C     1 
ATOM   1248  O  O     . VAL A  1  164  ? 155.673 201.898 167.772 1.00 0.00 ? 164  VAL A O     1 
ATOM   1249  C  CB    . VAL A  1  164  ? 153.445 202.350 165.790 1.00 0.00 ? 164  VAL A CB    1 
ATOM   1250  C  CG1   . VAL A  1  164  ? 154.706 202.677 165.044 1.00 0.00 ? 164  VAL A CG1   1 
ATOM   1251  C  CG2   . VAL A  1  164  ? 153.213 200.868 165.771 1.00 0.00 ? 164  VAL A CG2   1 
ATOM   1252  N  N     . LYS A  1  165  ? 153.985 201.523 169.214 1.00 0.00 ? 165  LYS A N     1 
ATOM   1253  C  CA    . LYS A  1  165  ? 154.832 201.208 170.357 1.00 0.00 ? 165  LYS A CA    1 
ATOM   1254  C  C     . LYS A  1  165  ? 155.270 199.762 170.543 1.00 0.00 ? 165  LYS A C     1 
ATOM   1255  O  O     . LYS A  1  165  ? 155.998 199.509 171.508 1.00 0.00 ? 165  LYS A O     1 
ATOM   1256  C  CB    . LYS A  1  165  ? 154.157 201.638 171.669 1.00 0.00 ? 165  LYS A CB    1 
ATOM   1257  C  CG    . LYS A  1  165  ? 154.125 203.129 171.922 1.00 0.00 ? 165  LYS A CG    1 
ATOM   1258  C  CD    . LYS A  1  165  ? 153.787 203.401 173.379 1.00 0.00 ? 165  LYS A CD    1 
ATOM   1259  C  CE    . LYS A  1  165  ? 152.409 202.878 173.734 1.00 0.00 ? 165  LYS A CE    1 
ATOM   1260  N  NZ    . LYS A  1  165  ? 152.065 203.178 175.145 1.00 0.00 ? 165  LYS A NZ    1 
ATOM   1261  N  N     . LYS A  1  166  ? 154.855 198.807 169.706 1.00 0.00 ? 166  LYS A N     1 
ATOM   1262  C  CA    . LYS A  1  166  ? 155.255 197.422 169.966 1.00 0.00 ? 166  LYS A CA    1 
ATOM   1263  C  C     . LYS A  1  166  ? 154.772 196.951 171.338 1.00 0.00 ? 166  LYS A C     1 
ATOM   1264  O  O     . LYS A  1  166  ? 155.546 196.956 172.299 1.00 0.00 ? 166  LYS A O     1 
ATOM   1265  C  CB    . LYS A  1  166  ? 156.777 197.268 169.857 1.00 0.00 ? 166  LYS A CB    1 
ATOM   1266  C  CG    . LYS A  1  166  ? 157.304 195.886 170.171 1.00 0.00 ? 166  LYS A CG    1 
ATOM   1267  C  CD    . LYS A  1  166  ? 158.803 195.845 170.015 1.00 0.00 ? 166  LYS A CD    1 
ATOM   1268  C  CE    . LYS A  1  166  ? 159.357 194.543 170.529 1.00 0.00 ? 166  LYS A CE    1 
ATOM   1269  N  NZ    . LYS A  1  166  ? 159.242 194.502 172.003 1.00 0.00 ? 166  LYS A NZ    1 
ATOM   1270  N  N     . ALA A  1  167  ? 153.489 196.603 171.453 1.00 0.00 ? 167  ALA A N     1 
ATOM   1271  C  CA    . ALA A  1  167  ? 152.840 196.445 172.753 1.00 0.00 ? 167  ALA A CA    1 
ATOM   1272  C  C     . ALA A  1  167  ? 153.638 195.571 173.715 1.00 0.00 ? 167  ALA A C     1 
ATOM   1273  O  O     . ALA A  1  167  ? 154.032 194.448 173.393 1.00 0.00 ? 167  ALA A O     1 
ATOM   1274  C  CB    . ALA A  1  167  ? 151.446 195.851 172.572 1.00 0.00 ? 167  ALA A CB    1 
ATOM   1275  N  N     . ALA A  1  168  ? 153.840 196.104 174.920 1.00 0.00 ? 168  ALA A N     1 
ATOM   1276  C  CA    . ALA A  1  168  ? 154.658 195.549 175.996 1.00 0.00 ? 168  ALA A CA    1 
ATOM   1277  C  C     . ALA A  1  168  ? 156.070 195.190 175.550 1.00 0.00 ? 168  ALA A C     1 
ATOM   1278  O  O     . ALA A  1  168  ? 156.625 195.843 174.662 1.00 0.00 ? 168  ALA A O     1 
ATOM   1279  C  CB    . ALA A  1  168  ? 153.980 194.316 176.591 1.00 0.00 ? 168  ALA A CB    1 
ATOM   1280  N  N     . ALA A  1  169  ? 156.662 194.152 176.155 1.00 0.00 ? 169  ALA A N     1 
ATOM   1281  C  CA    . ALA A  1  169  ? 157.970 193.671 175.710 1.00 0.00 ? 169  ALA A CA    1 
ATOM   1282  C  C     . ALA A  1  169  ? 158.165 192.224 176.169 1.00 0.00 ? 169  ALA A C     1 
ATOM   1283  O  O     . ALA A  1  169  ? 157.797 191.877 177.294 1.00 0.00 ? 169  ALA A O     1 
ATOM   1284  C  CB    . ALA A  1  169  ? 159.081 194.568 176.230 1.00 0.00 ? 169  ALA A CB    1 
ATOM   1285  N  N     . GLY A  1  170  ? 158.749 191.403 175.296 1.00 0.00 ? 170  GLY A N     1 
ATOM   1286  C  CA    . GLY A  1  170  ? 159.561 190.272 175.714 1.00 0.00 ? 170  GLY A CA    1 
ATOM   1287  C  C     . GLY A  1  170  ? 158.847 188.982 176.042 1.00 0.00 ? 170  GLY A C     1 
ATOM   1288  O  O     . GLY A  1  170  ? 159.456 187.914 175.951 1.00 0.00 ? 170  GLY A O     1 
ATOM   1289  N  N     . ALA A  1  171  ? 157.571 189.038 176.413 1.00 0.00 ? 171  ALA A N     1 
ATOM   1290  C  CA    . ALA A  1  171  ? 156.901 187.857 176.942 1.00 0.00 ? 171  ALA A CA    1 
ATOM   1291  C  C     . ALA A  1  171  ? 156.470 186.919 175.825 1.00 0.00 ? 171  ALA A C     1 
ATOM   1292  O  O     . ALA A  1  171  ? 156.627 185.699 175.931 1.00 0.00 ? 171  ALA A O     1 
ATOM   1293  C  CB    . ALA A  1  171  ? 155.694 188.264 177.788 1.00 0.00 ? 171  ALA A CB    1 
ATOM   1294  N  N     . GLY A  1  172  ? 155.943 187.484 174.748 1.00 0.00 ? 172  GLY A N     1 
ATOM   1295  C  CA    . GLY A  1  172  ? 155.370 186.695 173.678 1.00 0.00 ? 172  GLY A CA    1 
ATOM   1296  C  C     . GLY A  1  172  ? 153.866 186.705 173.758 1.00 0.00 ? 172  GLY A C     1 
ATOM   1297  O  O     . GLY A  1  172  ? 153.171 186.481 172.762 1.00 0.00 ? 172  GLY A O     1 
ATOM   1298  N  N     . SER A  1  173  ? 153.353 186.968 174.957 1.00 0.00 ? 173  SER A N     1 
ATOM   1299  C  CA    . SER A  1  173  ? 151.945 187.301 175.068 1.00 0.00 ? 173  SER A CA    1 
ATOM   1300  C  C     . SER A  1  173  ? 151.616 188.501 174.199 1.00 0.00 ? 173  SER A C     1 
ATOM   1301  O  O     . SER A  1  173  ? 150.938 188.359 173.175 1.00 0.00 ? 173  SER A O     1 
ATOM   1302  C  CB    . SER A  1  173  ? 151.584 187.577 176.526 1.00 0.00 ? 173  SER A CB    1 
ATOM   1303  O  OG    . SER A  1  173  ? 150.221 187.941 176.647 1.00 0.00 ? 173  SER A OG    1 
ATOM   1304  N  N     . ALA A  1  174  ? 152.107 189.681 174.575 1.00 0.00 ? 174  ALA A N     1 
ATOM   1305  C  CA    . ALA A  1  174  ? 151.963 190.878 173.760 1.00 0.00 ? 174  ALA A CA    1 
ATOM   1306  C  C     . ALA A  1  174  ? 153.042 191.018 172.692 1.00 0.00 ? 174  ALA A C     1 
ATOM   1307  O  O     . ALA A  1  174  ? 152.838 191.761 171.725 1.00 0.00 ? 174  ALA A O     1 
ATOM   1308  C  CB    . ALA A  1  174  ? 151.956 192.132 174.645 1.00 0.00 ? 174  ALA A CB    1 
ATOM   1309  N  N     . ALA A  1  175  ? 154.178 190.325 172.838 1.00 0.00 ? 175  ALA A N     1 
ATOM   1310  C  CA    . ALA A  1  175  ? 155.382 190.699 172.098 1.00 0.00 ? 175  ALA A CA    1 
ATOM   1311  C  C     . ALA A  1  175  ? 155.164 190.740 170.591 1.00 0.00 ? 175  ALA A C     1 
ATOM   1312  O  O     . ALA A  1  175  ? 155.845 191.498 169.896 1.00 0.00 ? 175  ALA A O     1 
ATOM   1313  C  CB    . ALA A  1  175  ? 156.530 189.752 172.434 1.00 0.00 ? 175  ALA A CB    1 
ATOM   1314  N  N     . LEU A  1  176  ? 154.246 189.942 170.058 1.00 0.00 ? 176  LEU A N     1 
ATOM   1315  C  CA    . LEU A  1  176  ? 153.963 189.990 168.633 1.00 0.00 ? 176  LEU A CA    1 
ATOM   1316  C  C     . LEU A  1  176  ? 152.823 190.930 168.282 1.00 0.00 ? 176  LEU A C     1 
ATOM   1317  O  O     . LEU A  1  176  ? 152.580 191.174 167.097 1.00 0.00 ? 176  LEU A O     1 
ATOM   1318  C  CB    . LEU A  1  176  ? 153.669 188.592 168.103 1.00 0.00 ? 176  LEU A CB    1 
ATOM   1319  C  CG    . LEU A  1  176  ? 154.903 187.853 167.602 1.00 0.00 ? 176  LEU A CG    1 
ATOM   1320  C  CD1   . LEU A  1  176  ? 155.897 187.623 168.719 1.00 0.00 ? 176  LEU A CD1   1 
ATOM   1321  C  CD2   . LEU A  1  176  ? 154.484 186.540 166.975 1.00 0.00 ? 176  LEU A CD2   1 
ATOM   1322  N  N     . LYS A  1  177  ? 152.118 191.461 169.267 1.00 0.00 ? 177  LYS A N     1 
ATOM   1323  C  CA    . LYS A  1  177  ? 151.032 192.397 169.023 1.00 0.00 ? 177  LYS A CA    1 
ATOM   1324  C  C     . LYS A  1  177  ? 151.628 193.793 168.951 1.00 0.00 ? 177  LYS A C     1 
ATOM   1325  O  O     . LYS A  1  177  ? 152.479 194.148 169.772 1.00 0.00 ? 177  LYS A O     1 
ATOM   1326  C  CB    . LYS A  1  177  ? 149.986 192.312 170.129 1.00 0.00 ? 177  LYS A CB    1 
ATOM   1327  C  CG    . LYS A  1  177  ? 149.444 190.919 170.352 1.00 0.00 ? 177  LYS A CG    1 
ATOM   1328  C  CD    . LYS A  1  177  ? 148.712 190.374 169.145 1.00 0.00 ? 177  LYS A CD    1 
ATOM   1329  C  CE    . LYS A  1  177  ? 147.315 190.964 169.036 1.00 0.00 ? 177  LYS A CE    1 
ATOM   1330  N  NZ    . LYS A  1  177  ? 146.514 190.305 167.967 1.00 0.00 ? 177  LYS A NZ    1 
ATOM   1331  N  N     . ILE A  1  178  ? 151.190 194.575 167.978 1.00 0.00 ? 178  ILE A N     1 
ATOM   1332  C  CA    . ILE A  1  178  ? 151.701 195.924 167.776 1.00 0.00 ? 178  ILE A CA    1 
ATOM   1333  C  C     . ILE A  1  178  ? 150.557 196.902 167.972 1.00 0.00 ? 178  ILE A C     1 
ATOM   1334  O  O     . ILE A  1  178  ? 149.387 196.546 167.789 1.00 0.00 ? 178  ILE A O     1 
ATOM   1335  C  CB    . ILE A  1  178  ? 152.327 196.072 166.380 1.00 0.00 ? 178  ILE A CB    1 
ATOM   1336  C  CG1   . ILE A  1  178  ? 151.257 195.960 165.304 1.00 0.00 ? 178  ILE A CG1   1 
ATOM   1337  C  CG2   . ILE A  1  178  ? 153.371 195.008 166.157 1.00 0.00 ? 178  ILE A CG2   1 
ATOM   1338  C  CD1   . ILE A  1  178  ? 150.834 197.296 164.756 1.00 0.00 ? 178  ILE A CD1   1 
ATOM   1339  N  N     . ILE A  1  179  ? 150.883 198.134 168.349 1.00 0.00 ? 179  ILE A N     1 
ATOM   1340  C  CA    . ILE A  1  179  ? 149.872 199.156 168.593 1.00 0.00 ? 179  ILE A CA    1 
ATOM   1341  C  C     . ILE A  1  179  ? 150.383 200.502 168.116 1.00 0.00 ? 179  ILE A C     1 
ATOM   1342  O  O     . ILE A  1  179  ? 151.532 200.862 168.386 1.00 0.00 ? 179  ILE A O     1 
ATOM   1343  C  CB    . ILE A  1  179  ? 149.498 199.253 170.081 1.00 0.00 ? 179  ILE A CB    1 
ATOM   1344  C  CG1   . ILE A  1  179  ? 148.721 198.022 170.516 1.00 0.00 ? 179  ILE A CG1   1 
ATOM   1345  C  CG2   . ILE A  1  179  ? 148.695 200.510 170.361 1.00 0.00 ? 179  ILE A CG2   1 
ATOM   1346  C  CD1   . ILE A  1  179  ? 148.451 197.994 171.989 1.00 0.00 ? 179  ILE A CD1   1 
ATOM   1347  N  N     . HIS A  1  180  ? 149.527 201.249 167.426 1.00 0.00 ? 180  HIS A N     1 
ATOM   1348  C  CA    . HIS A  1  180  ? 149.668 202.691 167.308 1.00 0.00 ? 180  HIS A CA    1 
ATOM   1349  C  C     . HIS A  1  180  ? 148.352 203.286 167.773 1.00 0.00 ? 180  HIS A C     1 
ATOM   1350  O  O     . HIS A  1  180  ? 147.352 202.573 167.879 1.00 0.00 ? 180  HIS A O     1 
ATOM   1351  C  CB    . HIS A  1  180  ? 149.939 203.154 165.880 1.00 0.00 ? 180  HIS A CB    1 
ATOM   1352  C  CG    . HIS A  1  180  ? 148.700 203.330 165.062 1.00 0.00 ? 180  HIS A CG    1 
ATOM   1353  N  ND1   . HIS A  1  180  ? 147.918 204.462 165.143 1.00 0.00 ? 180  HIS A ND1   1 
ATOM   1354  C  CD2   . HIS A  1  180  ? 148.101 202.525 164.158 1.00 0.00 ? 180  HIS A CD2   1 
ATOM   1355  C  CE1   . HIS A  1  180  ? 146.894 204.348 164.319 1.00 0.00 ? 180  HIS A CE1   1 
ATOM   1356  N  NE2   . HIS A  1  180  ? 146.981 203.181 163.709 1.00 0.00 ? 180  HIS A NE2   1 
ATOM   1357  N  N     . ASP A  1  181  ? 148.336 204.588 168.025 1.00 0.00 ? 181  ASP A N     1 
ATOM   1358  C  CA    . ASP A  1  181  ? 147.177 205.195 168.653 1.00 0.00 ? 181  ASP A CA    1 
ATOM   1359  C  C     . ASP A  1  181  ? 146.971 206.635 168.212 1.00 0.00 ? 181  ASP A C     1 
ATOM   1360  O  O     . ASP A  1  181  ? 147.707 207.177 167.385 1.00 0.00 ? 181  ASP A O     1 
ATOM   1361  C  CB    . ASP A  1  181  ? 147.314 205.131 170.173 1.00 0.00 ? 181  ASP A CB    1 
ATOM   1362  C  CG    . ASP A  1  181  ? 148.604 205.728 170.658 1.00 0.00 ? 181  ASP A CG    1 
ATOM   1363  O  OD1   . ASP A  1  181  ? 149.434 206.113 169.811 1.00 0.00 ? 181  ASP A OD1   1 
ATOM   1364  O  OD2   . ASP A  1  181  ? 148.805 205.785 171.886 1.00 0.00 ? 181  ASP A OD2   1 
ATOM   1365  N  N     . THR A  1  182  ? 145.925 207.239 168.776 1.00 0.00 ? 182  THR A N     1 
ATOM   1366  C  CA    . THR A  1  182  ? 145.695 208.676 168.678 1.00 0.00 ? 182  THR A CA    1 
ATOM   1367  C  C     . THR A  1  182  ? 146.419 209.323 169.850 1.00 0.00 ? 182  THR A C     1 
ATOM   1368  O  O     . THR A  1  182  ? 146.095 209.126 171.022 1.00 0.00 ? 182  THR A O     1 
ATOM   1369  C  CB    . THR A  1  182  ? 144.209 208.998 168.695 1.00 0.00 ? 182  THR A CB    1 
ATOM   1370  O  OG1   . THR A  1  182  ? 143.582 208.432 167.540 1.00 0.00 ? 182  THR A OG1   1 
ATOM   1371  C  CG2   . THR A  1  182  ? 143.991 210.496 168.702 1.00 0.00 ? 182  THR A CG2   1 
ATOM   1372  N  N     . PHE A  1  183  ? 147.427 210.111 169.515 1.00 0.00 ? 183  PHE A N     1 
ATOM   1373  C  CA    . PHE A  1  183  ? 148.290 210.687 170.522 1.00 0.00 ? 183  PHE A CA    1 
ATOM   1374  C  C     . PHE A  1  183  ? 148.566 212.144 170.171 1.00 0.00 ? 183  PHE A C     1 
ATOM   1375  O  O     . PHE A  1  183  ? 148.169 212.640 169.114 1.00 0.00 ? 183  PHE A O     1 
ATOM   1376  C  CB    . PHE A  1  183  ? 149.565 209.850 170.618 1.00 0.00 ? 183  PHE A CB    1 
ATOM   1377  C  CG    . PHE A  1  183  ? 150.541 210.312 171.651 1.00 0.00 ? 183  PHE A CG    1 
ATOM   1378  C  CD1   . PHE A  1  183  ? 150.310 210.077 172.991 1.00 0.00 ? 183  PHE A CD1   1 
ATOM   1379  C  CD2   . PHE A  1  183  ? 151.723 210.921 171.278 1.00 0.00 ? 183  PHE A CD2   1 
ATOM   1380  C  CE1   . PHE A  1  183  ? 151.219 210.483 173.944 1.00 0.00 ? 183  PHE A CE1   1 
ATOM   1381  C  CE2   . PHE A  1  183  ? 152.636 211.333 172.224 1.00 0.00 ? 183  PHE A CE2   1 
ATOM   1382  C  CZ    . PHE A  1  183  ? 152.386 211.111 173.559 1.00 0.00 ? 183  PHE A CZ    1 
ATOM   1383  N  N     . ARG A  1  184  ? 149.253 212.837 171.077 1.00 0.00 ? 184  ARG A N     1 
ATOM   1384  C  CA    . ARG A  1  184  ? 149.561 214.256 170.926 1.00 0.00 ? 184  ARG A CA    1 
ATOM   1385  C  C     . ARG A  1  184  ? 148.285 215.083 170.745 1.00 0.00 ? 184  ARG A C     1 
ATOM   1386  O  O     . ARG A  1  184  ? 148.268 216.120 170.084 1.00 0.00 ? 184  ARG A O     1 
ATOM   1387  C  CB    . ARG A  1  184  ? 150.513 214.480 169.751 1.00 0.00 ? 184  ARG A CB    1 
ATOM   1388  C  CG    . ARG A  1  184  ? 151.872 213.897 169.961 1.00 0.00 ? 184  ARG A CG    1 
ATOM   1389  C  CD    . ARG A  1  184  ? 152.706 214.073 168.737 1.00 0.00 ? 184  ARG A CD    1 
ATOM   1390  N  NE    . ARG A  1  184  ? 154.056 213.562 168.919 1.00 0.00 ? 184  ARG A NE    1 
ATOM   1391  C  CZ    . ARG A  1  184  ? 154.396 212.292 168.753 1.00 0.00 ? 184  ARG A CZ    1 
ATOM   1392  N  NH1   . ARG A  1  184  ? 153.481 211.403 168.400 1.00 0.00 ? 184  ARG A NH1   1 
ATOM   1393  N  NH2   . ARG A  1  184  ? 155.651 211.913 168.937 1.00 0.00 ? 184  ARG A NH2   1 
ATOM   1394  N  N     . TRP A  1  185  ? 147.208 214.589 171.346 1.00 0.00 ? 185  TRP A N     1 
ATOM   1395  C  CA    . TRP A  1  185  ? 145.929 215.276 171.285 1.00 0.00 ? 185  TRP A CA    1 
ATOM   1396  C  C     . TRP A  1  185  ? 145.883 216.486 172.205 1.00 0.00 ? 185  TRP A C     1 
ATOM   1397  O  O     . TRP A  1  185  ? 145.170 217.444 171.906 1.00 0.00 ? 185  TRP A O     1 
ATOM   1398  C  CB    . TRP A  1  185  ? 144.782 214.324 171.636 1.00 0.00 ? 185  TRP A CB    1 
ATOM   1399  C  CG    . TRP A  1  185  ? 144.777 213.838 173.066 1.00 0.00 ? 185  TRP A CG    1 
ATOM   1400  C  CD1   . TRP A  1  185  ? 144.184 214.449 174.134 1.00 0.00 ? 185  TRP A CD1   1 
ATOM   1401  C  CD2   . TRP A  1  185  ? 145.355 212.627 173.572 1.00 0.00 ? 185  TRP A CD2   1 
ATOM   1402  N  NE1   . TRP A  1  185  ? 144.375 213.708 175.274 1.00 0.00 ? 185  TRP A NE1   1 
ATOM   1403  C  CE2   . TRP A  1  185  ? 145.089 212.583 174.956 1.00 0.00 ? 185  TRP A CE2   1 
ATOM   1404  C  CE3   . TRP A  1  185  ? 146.078 211.580 172.991 1.00 0.00 ? 185  TRP A CE3   1 
ATOM   1405  C  CZ2   . TRP A  1  185  ? 145.522 211.535 175.767 1.00 0.00 ? 185  TRP A CZ2   1 
ATOM   1406  C  CZ3   . TRP A  1  185  ? 146.508 210.541 173.798 1.00 0.00 ? 185  TRP A CZ3   1 
ATOM   1407  C  CH2   . TRP A  1  185  ? 146.228 210.526 175.170 1.00 0.00 ? 185  TRP A CH2   1 
ATOM   1408  N  N     . VAL A  1  186  ? 146.539 216.402 173.365 1.00 0.00 ? 186  VAL A N     1 
ATOM   1409  C  CA    . VAL A  1  186  ? 146.740 217.444 174.379 1.00 0.00 ? 186  VAL A CA    1 
ATOM   1410  C  C     . VAL A  1  186  ? 145.406 217.855 174.994 1.00 0.00 ? 186  VAL A C     1 
ATOM   1411  O  O     . VAL A  1  186  ? 145.366 218.469 176.066 1.00 0.00 ? 186  VAL A O     1 
ATOM   1412  C  CB    . VAL A  1  186  ? 147.497 218.681 173.836 1.00 0.00 ? 186  VAL A CB    1 
ATOM   1413  C  CG1   . VAL A  1  186  ? 148.750 218.272 173.054 1.00 0.00 ? 186  VAL A CG1   1 
ATOM   1414  C  CG2   . VAL A  1  186  ? 146.600 219.676 173.092 1.00 0.00 ? 186  VAL A CG2   1 
ATOM   1415  N  N     . GLY A  1  187  ? 144.308 217.521 174.324 1.00 0.00 ? 187  GLY A N     1 
ATOM   1416  C  CA    . GLY A  1  187  ? 142.979 217.619 174.889 1.00 0.00 ? 187  GLY A CA    1 
ATOM   1417  C  C     . GLY A  1  187  ? 142.397 219.016 174.907 1.00 0.00 ? 187  GLY A C     1 
ATOM   1418  O  O     . GLY A  1  187  ? 141.174 219.175 174.954 1.00 0.00 ? 187  GLY A O     1 
ATOM   1419  N  N     . LYS A  1  188  ? 143.250 220.040 174.864 1.00 0.00 ? 188  LYS A N     1 
ATOM   1420  C  CA    . LYS A  1  188  ? 142.745 221.407 174.833 1.00 0.00 ? 188  LYS A CA    1 
ATOM   1421  C  C     . LYS A  1  188  ? 142.419 221.822 173.406 1.00 0.00 ? 188  LYS A C     1 
ATOM   1422  O  O     . LYS A  1  188  ? 141.444 222.543 173.172 1.00 0.00 ? 188  LYS A O     1 
ATOM   1423  C  CB    . LYS A  1  188  ? 143.735 222.375 175.494 1.00 0.00 ? 188  LYS A CB    1 
ATOM   1424  C  CG    . LYS A  1  188  ? 145.100 222.485 174.856 1.00 0.00 ? 188  LYS A CG    1 
ATOM   1425  C  CD    . LYS A  1  188  ? 146.029 223.261 175.785 1.00 0.00 ? 188  LYS A CD    1 
ATOM   1426  C  CE    . LYS A  1  188  ? 147.380 223.511 175.151 1.00 0.00 ? 188  LYS A CE    1 
ATOM   1427  N  NZ    . LYS A  1  188  ? 147.252 224.520 174.070 1.00 0.00 ? 188  LYS A NZ    1 
ATOM   1428  N  N     . LYS A  1  189  ? 143.229 221.382 172.447 1.00 0.00 ? 189  LYS A N     1 
ATOM   1429  C  CA    . LYS A  1  189  ? 142.915 221.604 171.046 1.00 0.00 ? 189  LYS A CA    1 
ATOM   1430  C  C     . LYS A  1  189  ? 141.803 220.655 170.626 1.00 0.00 ? 189  LYS A C     1 
ATOM   1431  O  O     . LYS A  1  189  ? 141.611 219.589 171.218 1.00 0.00 ? 189  LYS A O     1 
ATOM   1432  C  CB    . LYS A  1  189  ? 144.137 221.392 170.153 1.00 0.00 ? 189  LYS A CB    1 
ATOM   1433  C  CG    . LYS A  1  189  ? 144.628 219.958 170.109 1.00 0.00 ? 189  LYS A CG    1 
ATOM   1434  C  CD    . LYS A  1  189  ? 145.896 219.825 169.286 1.00 0.00 ? 189  LYS A CD    1 
ATOM   1435  C  CE    . LYS A  1  189  ? 146.336 218.373 169.196 1.00 0.00 ? 189  LYS A CE    1 
ATOM   1436  N  NZ    . LYS A  1  189  ? 145.382 217.547 168.406 1.00 0.00 ? 189  LYS A NZ    1 
ATOM   1437  N  N     . SER A  1  190  ? 141.068 221.049 169.588 1.00 0.00 ? 190  SER A N     1 
ATOM   1438  C  CA    . SER A  1  190  ? 139.935 220.256 169.118 1.00 0.00 ? 190  SER A CA    1 
ATOM   1439  C  C     . SER A  1  190  ? 140.469 219.052 168.353 1.00 0.00 ? 190  SER A C     1 
ATOM   1440  O  O     . SER A  1  190  ? 141.200 219.167 167.367 1.00 0.00 ? 190  SER A O     1 
ATOM   1441  C  CB    . SER A  1  190  ? 139.006 221.101 168.257 1.00 0.00 ? 190  SER A CB    1 
ATOM   1442  O  OG    . SER A  1  190  ? 138.410 222.142 169.007 1.00 0.00 ? 190  SER A OG    1 
ATOM   1443  N  N     . ALA A  1  191  ? 140.115 217.915 168.818 1.00 0.00 ? 191  ALA A N     1 
ATOM   1444  C  CA    . ALA A  1  191  ? 140.421 216.865 167.863 1.00 0.00 ? 191  ALA A CA    1 
ATOM   1445  C  C     . ALA A  1  191  ? 139.129 216.293 167.295 1.00 0.00 ? 191  ALA A C     1 
ATOM   1446  O  O     . ALA A  1  191  ? 138.424 215.548 167.985 1.00 0.00 ? 191  ALA A O     1 
ATOM   1447  C  CB    . ALA A  1  191  ? 141.227 215.752 168.519 1.00 0.00 ? 191  ALA A CB    1 
ATOM   1448  N  N     . PRO A  1  192  ? 138.803 216.633 166.047 1.00 0.00 ? 192  PRO A N     1 
ATOM   1449  C  CA    . PRO A  1  192  ? 137.595 216.064 165.432 1.00 0.00 ? 192  PRO A CA    1 
ATOM   1450  C  C     . PRO A  1  192  ? 137.633 214.557 165.370 1.00 0.00 ? 192  PRO A C     1 
ATOM   1451  O  O     . PRO A  1  192  ? 136.592 213.914 165.564 1.00 0.00 ? 192  PRO A O     1 
ATOM   1452  C  CB    . PRO A  1  192  ? 137.589 216.688 164.032 1.00 0.00 ? 192  PRO A CB    1 
ATOM   1453  C  CG    . PRO A  1  192  ? 139.022 217.009 163.767 1.00 0.00 ? 192  PRO A CG    1 
ATOM   1454  C  CD    . PRO A  1  192  ? 139.586 217.430 165.092 1.00 0.00 ? 192  PRO A CD    1 
ATOM   1455  N  N     . GLU A  1  193  ? 138.804 213.977 165.115 1.00 0.00 ? 193  GLU A N     1 
ATOM   1456  C  CA    . GLU A  1  193  ? 138.969 212.539 165.240 1.00 0.00 ? 193  GLU A CA    1 
ATOM   1457  C  C     . GLU A  1  193  ? 138.566 212.040 166.616 1.00 0.00 ? 193  GLU A C     1 
ATOM   1458  O  O     . GLU A  1  193  ? 137.649 211.225 166.714 1.00 0.00 ? 193  GLU A O     1 
ATOM   1459  C  CB    . GLU A  1  193  ? 140.408 212.142 164.929 1.00 0.00 ? 193  GLU A CB    1 
ATOM   1460  C  CG    . GLU A  1  193  ? 140.771 212.381 163.480 1.00 0.00 ? 193  GLU A CG    1 
ATOM   1461  C  CD    . GLU A  1  193  ? 139.823 211.671 162.533 1.00 0.00 ? 193  GLU A CD    1 
ATOM   1462  O  OE1   . GLU A  1  193  ? 139.420 210.527 162.836 1.00 0.00 ? 193  GLU A OE1   1 
ATOM   1463  O  OE2   . GLU A  1  193  ? 139.472 212.260 161.491 1.00 0.00 ? 193  GLU A OE2   1 
ATOM   1464  N  N     . LYS A  1  194  ? 139.236 212.497 167.678 1.00 0.00 ? 194  LYS A N     1 
ATOM   1465  C  CA    . LYS A  1  194  ? 138.865 212.075 169.025 1.00 0.00 ? 194  LYS A CA    1 
ATOM   1466  C  C     . LYS A  1  194  ? 137.392 212.327 169.315 1.00 0.00 ? 194  LYS A C     1 
ATOM   1467  O  O     . LYS A  1  194  ? 136.753 211.513 169.991 1.00 0.00 ? 194  LYS A O     1 
ATOM   1468  C  CB    . LYS A  1  194  ? 139.736 212.779 170.068 1.00 0.00 ? 194  LYS A CB    1 
ATOM   1469  C  CG    . LYS A  1  194  ? 139.509 212.294 171.498 1.00 0.00 ? 194  LYS A CG    1 
ATOM   1470  C  CD    . LYS A  1  194  ? 140.486 212.919 172.477 1.00 0.00 ? 194  LYS A CD    1 
ATOM   1471  C  CE    . LYS A  1  194  ? 140.290 212.365 173.877 1.00 0.00 ? 194  LYS A CE    1 
ATOM   1472  N  NZ    . LYS A  1  194  ? 141.276 212.925 174.836 1.00 0.00 ? 194  LYS A NZ    1 
ATOM   1473  N  N     . ASP A  1  195  ? 136.832 213.428 168.807 1.00 0.00 ? 195  ASP A N     1 
ATOM   1474  C  CA    . ASP A  1  195  ? 135.394 213.633 168.935 1.00 0.00 ? 195  ASP A CA    1 
ATOM   1475  C  C     . ASP A  1  195  ? 134.615 212.475 168.334 1.00 0.00 ? 195  ASP A C     1 
ATOM   1476  O  O     . ASP A  1  195  ? 133.674 211.970 168.957 1.00 0.00 ? 195  ASP A O     1 
ATOM   1477  C  CB    . ASP A  1  195  ? 134.980 214.944 168.272 1.00 0.00 ? 195  ASP A CB    1 
ATOM   1478  C  CG    . ASP A  1  195  ? 135.419 216.157 169.059 1.00 0.00 ? 195  ASP A CG    1 
ATOM   1479  O  OD1   . ASP A  1  195  ? 135.773 215.997 170.246 1.00 0.00 ? 195  ASP A OD1   1 
ATOM   1480  O  OD2   . ASP A  1  195  ? 135.404 217.270 168.493 1.00 0.00 ? 195  ASP A OD2   1 
ATOM   1481  N  N     . ILE A  1  196  ? 134.987 212.041 167.132 1.00 0.00 ? 196  ILE A N     1 
ATOM   1482  C  CA    . ILE A  1  196  ? 134.378 210.843 166.570 1.00 0.00 ? 196  ILE A CA    1 
ATOM   1483  C  C     . ILE A  1  196  ? 134.612 209.650 167.480 1.00 0.00 ? 196  ILE A C     1 
ATOM   1484  O  O     . ILE A  1  196  ? 133.710 208.840 167.700 1.00 0.00 ? 196  ILE A O     1 
ATOM   1485  C  CB    . ILE A  1  196  ? 134.918 210.585 165.155 1.00 0.00 ? 196  ILE A CB    1 
ATOM   1486  C  CG1   . ILE A  1  196  ? 134.587 211.762 164.240 1.00 0.00 ? 196  ILE A CG1   1 
ATOM   1487  C  CG2   . ILE A  1  196  ? 134.373 209.279 164.607 1.00 0.00 ? 196  ILE A CG2   1 
ATOM   1488  C  CD1   . ILE A  1  196  ? 133.111 212.042 164.135 1.00 0.00 ? 196  ILE A CD1   1 
ATOM   1489  N  N     . TRP A  1  197  ? 135.811 209.555 168.052 1.00 0.00 ? 197  TRP A N     1 
ATOM   1490  C  CA    . TRP A  1  197  ? 136.215 208.376 168.806 1.00 0.00 ? 197  TRP A CA    1 
ATOM   1491  C  C     . TRP A  1  197  ? 135.363 208.189 170.052 1.00 0.00 ? 197  TRP A C     1 
ATOM   1492  O  O     . TRP A  1  197  ? 134.884 207.083 170.325 1.00 0.00 ? 197  TRP A O     1 
ATOM   1493  C  CB    . TRP A  1  197  ? 137.690 208.500 169.175 1.00 0.00 ? 197  TRP A CB    1 
ATOM   1494  C  CG    . TRP A  1  197  ? 138.220 207.413 170.040 1.00 0.00 ? 197  TRP A CG    1 
ATOM   1495  C  CD1   . TRP A  1  197  ? 138.451 207.477 171.379 1.00 0.00 ? 197  TRP A CD1   1 
ATOM   1496  C  CD2   . TRP A  1  197  ? 138.622 206.106 169.626 1.00 0.00 ? 197  TRP A CD2   1 
ATOM   1497  N  NE1   . TRP A  1  197  ? 138.959 206.286 171.830 1.00 0.00 ? 197  TRP A NE1   1 
ATOM   1498  C  CE2   . TRP A  1  197  ? 139.075 205.426 170.771 1.00 0.00 ? 197  TRP A CE2   1 
ATOM   1499  C  CE3   . TRP A  1  197  ? 138.640 205.444 168.398 1.00 0.00 ? 197  TRP A CE3   1 
ATOM   1500  C  CZ2   . TRP A  1  197  ? 139.536 204.116 170.727 1.00 0.00 ? 197  TRP A CZ2   1 
ATOM   1501  C  CZ3   . TRP A  1  197  ? 139.095 204.143 168.354 1.00 0.00 ? 197  TRP A CZ3   1 
ATOM   1502  C  CH2   . TRP A  1  197  ? 139.539 203.492 169.511 1.00 0.00 ? 197  TRP A CH2   1 
ATOM   1503  N  N     . VAL A  1  198  ? 135.172 209.254 170.829 1.00 0.00 ? 198  VAL A N     1 
ATOM   1504  C  CA    . VAL A  1  198  ? 134.348 209.137 172.024 1.00 0.00 ? 198  VAL A CA    1 
ATOM   1505  C  C     . VAL A  1  198  ? 132.894 208.890 171.649 1.00 0.00 ? 198  VAL A C     1 
ATOM   1506  O  O     . VAL A  1  198  ? 132.219 208.064 172.274 1.00 0.00 ? 198  VAL A O     1 
ATOM   1507  C  CB    . VAL A  1  198  ? 134.518 210.382 172.915 1.00 0.00 ? 198  VAL A CB    1 
ATOM   1508  C  CG1   . VAL A  1  198  ? 134.113 211.648 172.176 1.00 0.00 ? 198  VAL A CG1   1 
ATOM   1509  C  CG2   . VAL A  1  198  ? 133.716 210.230 174.195 1.00 0.00 ? 198  VAL A CG2   1 
ATOM   1510  N  N     . GLY A  1  199  ? 132.389 209.578 170.625 1.00 0.00 ? 199  GLY A N     1 
ATOM   1511  C  CA    . GLY A  1  199  ? 131.049 209.319 170.143 1.00 0.00 ? 199  GLY A CA    1 
ATOM   1512  C  C     . GLY A  1  199  ? 130.815 207.899 169.711 1.00 0.00 ? 199  GLY A C     1 
ATOM   1513  O  O     . GLY A  1  199  ? 129.698 207.391 169.836 1.00 0.00 ? 199  GLY A O     1 
ATOM   1514  N  N     . GLU A  1  200  ? 131.860 207.244 169.206 1.00 0.00 ? 200  GLU A N     1 
ATOM   1515  C  CA    . GLU A  1  200  ? 131.791 205.820 168.913 1.00 0.00 ? 200  GLU A CA    1 
ATOM   1516  C  C     . GLU A  1  200  ? 131.368 205.028 170.140 1.00 0.00 ? 200  GLU A C     1 
ATOM   1517  O  O     . GLU A  1  200  ? 130.282 204.438 170.163 1.00 0.00 ? 200  GLU A O     1 
ATOM   1518  C  CB    . GLU A  1  200  ? 133.150 205.338 168.416 1.00 0.00 ? 200  GLU A CB    1 
ATOM   1519  C  CG    . GLU A  1  200  ? 133.573 205.910 167.075 1.00 0.00 ? 200  GLU A CG    1 
ATOM   1520  C  CD    . GLU A  1  200  ? 135.028 205.634 166.749 1.00 0.00 ? 200  GLU A CD    1 
ATOM   1521  O  OE1   . GLU A  1  200  ? 135.754 205.157 167.642 1.00 0.00 ? 200  GLU A OE1   1 
ATOM   1522  O  OE2   . GLU A  1  200  ? 135.452 205.912 165.609 1.00 0.00 ? 200  GLU A OE2   1 
ATOM   1523  N  N     . TRP A  1  201  ? 132.202 205.024 171.175 1.00 0.00 ? 201  TRP A N     1 
ATOM   1524  C  CA    . TRP A  1  201  ? 131.983 204.224 172.373 1.00 0.00 ? 201  TRP A CA    1 
ATOM   1525  C  C     . TRP A  1  201  ? 130.658 204.521 173.055 1.00 0.00 ? 201  TRP A C     1 
ATOM   1526  O  O     . TRP A  1  201  ? 130.175 203.681 173.828 1.00 0.00 ? 201  TRP A O     1 
ATOM   1527  C  CB    . TRP A  1  201  ? 133.120 204.457 173.360 1.00 0.00 ? 201  TRP A CB    1 
ATOM   1528  C  CG    . TRP A  1  201  ? 134.439 204.016 172.845 1.00 0.00 ? 201  TRP A CG    1 
ATOM   1529  C  CD1   . TRP A  1  201  ? 135.355 204.780 172.193 1.00 0.00 ? 201  TRP A CD1   1 
ATOM   1530  C  CD2   . TRP A  1  201  ? 134.997 202.705 172.931 1.00 0.00 ? 201  TRP A CD2   1 
ATOM   1531  N  NE1   . TRP A  1  201  ? 136.455 204.028 171.869 1.00 0.00 ? 201  TRP A NE1   1 
ATOM   1532  C  CE2   . TRP A  1  201  ? 136.258 202.748 172.312 1.00 0.00 ? 201  TRP A CE2   1 
ATOM   1533  C  CE3   . TRP A  1  201  ? 134.556 201.500 173.474 1.00 0.00 ? 201  TRP A CE3   1 
ATOM   1534  C  CZ2   . TRP A  1  201  ? 137.081 201.634 172.221 1.00 0.00 ? 201  TRP A CZ2   1 
ATOM   1535  C  CZ3   . TRP A  1  201  ? 135.373 200.394 173.382 1.00 0.00 ? 201  TRP A CZ3   1 
ATOM   1536  C  CH2   . TRP A  1  201  ? 136.620 200.467 172.761 1.00 0.00 ? 201  TRP A CH2   1 
ATOM   1537  N  N     . LYS A  1  202  ? 130.065 205.686 172.784 1.00 0.00 ? 202  LYS A N     1 
ATOM   1538  C  CA    . LYS A  1  202  ? 128.765 206.020 173.351 1.00 0.00 ? 202  LYS A CA    1 
ATOM   1539  C  C     . LYS A  1  202  ? 127.724 204.962 173.017 1.00 0.00 ? 202  LYS A C     1 
ATOM   1540  O  O     . LYS A  1  202  ? 126.768 204.774 173.775 1.00 0.00 ? 202  LYS A O     1 
ATOM   1541  C  CB    . LYS A  1  202  ? 128.317 207.390 172.842 1.00 0.00 ? 202  LYS A CB    1 
ATOM   1542  C  CG    . LYS A  1  202  ? 127.027 207.904 173.448 1.00 0.00 ? 202  LYS A CG    1 
ATOM   1543  C  CD    . LYS A  1  202  ? 127.200 208.242 174.918 1.00 0.00 ? 202  LYS A CD    1 
ATOM   1544  C  CE    . LYS A  1  202  ? 125.906 208.776 175.512 1.00 0.00 ? 202  LYS A CE    1 
ATOM   1545  N  NZ    . LYS A  1  202  ? 125.500 210.071 174.896 1.00 0.00 ? 202  LYS A NZ    1 
ATOM   1546  N  N     . GLU A  1  203  ? 127.895 204.257 171.900 1.00 0.00 ? 203  GLU A N     1 
ATOM   1547  C  CA    . GLU A  1  203  ? 126.972 203.191 171.544 1.00 0.00 ? 203  GLU A CA    1 
ATOM   1548  C  C     . GLU A  1  203  ? 127.342 201.852 172.163 1.00 0.00 ? 203  GLU A C     1 
ATOM   1549  O  O     . GLU A  1  203  ? 126.620 200.873 171.955 1.00 0.00 ? 203  GLU A O     1 
ATOM   1550  C  CB    . GLU A  1  203  ? 126.893 203.054 170.026 1.00 0.00 ? 203  GLU A CB    1 
ATOM   1551  C  CG    . GLU A  1  203  ? 126.317 204.279 169.350 1.00 0.00 ? 203  GLU A CG    1 
ATOM   1552  C  CD    . GLU A  1  203  ? 124.947 204.638 169.885 1.00 0.00 ? 203  GLU A CD    1 
ATOM   1553  O  OE1   . GLU A  1  203  ? 124.137 203.720 170.126 1.00 0.00 ? 203  GLU A OE1   1 
ATOM   1554  O  OE2   . GLU A  1  203  ? 124.688 205.843 170.084 1.00 0.00 ? 203  GLU A OE2   1 
ATOM   1555  N  N     . VAL A  1  204  ? 128.439 201.781 172.909 1.00 0.00 ? 204  VAL A N     1 
ATOM   1556  C  CA    . VAL A  1  204  ? 128.802 200.585 173.648 1.00 0.00 ? 204  VAL A CA    1 
ATOM   1557  C  C     . VAL A  1  204  ? 128.553 200.749 175.137 1.00 0.00 ? 204  VAL A C     1 
ATOM   1558  O  O     . VAL A  1  204  ? 127.761 200.007 175.719 1.00 0.00 ? 204  VAL A O     1 
ATOM   1559  C  CB    . VAL A  1  204  ? 130.264 200.185 173.385 1.00 0.00 ? 204  VAL A CB    1 
ATOM   1560  C  CG1   . VAL A  1  204  ? 130.673 199.082 174.342 1.00 0.00 ? 204  VAL A CG1   1 
ATOM   1561  C  CG2   . VAL A  1  204  ? 130.392 199.702 171.984 1.00 0.00 ? 204  VAL A CG2   1 
ATOM   1562  N  N     . LEU A  1  205  ? 129.249 201.693 175.774 1.00 0.00 ? 205  LEU A N     1 
ATOM   1563  C  CA    . LEU A  1  205  ? 129.063 201.908 177.204 1.00 0.00 ? 205  LEU A CA    1 
ATOM   1564  C  C     . LEU A  1  205  ? 127.592 202.059 177.562 1.00 0.00 ? 205  LEU A C     1 
ATOM   1565  O  O     . LEU A  1  205  ? 127.054 201.236 178.310 1.00 0.00 ? 205  LEU A O     1 
ATOM   1566  C  CB    . LEU A  1  205  ? 129.864 203.123 177.667 1.00 0.00 ? 205  LEU A CB    1 
ATOM   1567  C  CG    . LEU A  1  205  ? 131.324 202.859 178.045 1.00 0.00 ? 205  LEU A CG    1 
ATOM   1568  C  CD1   . LEU A  1  205  ? 132.143 202.419 176.846 1.00 0.00 ? 205  LEU A CD1   1 
ATOM   1569  C  CD2   . LEU A  1  205  ? 131.939 204.090 178.687 1.00 0.00 ? 205  LEU A CD2   1 
ATOM   1570  N  N     . ALA A  1  206  ? 126.923 203.081 177.032 1.00 0.00 ? 206  ALA A N     1 
ATOM   1571  C  CA    . ALA A  1  206  ? 125.493 203.261 177.240 1.00 0.00 ? 206  ALA A CA    1 
ATOM   1572  C  C     . ALA A  1  206  ? 124.687 202.022 176.884 1.00 0.00 ? 206  ALA A C     1 
ATOM   1573  O  O     . ALA A  1  206  ? 123.600 201.826 177.438 1.00 0.00 ? 206  ALA A O     1 
ATOM   1574  C  CB    . ALA A  1  206  ? 124.983 204.453 176.428 1.00 0.00 ? 206  ALA A CB    1 
ATOM   1575  N  N     . HIS A  1  207  ? 125.185 201.183 175.983 1.00 0.00 ? 207  HIS A N     1 
ATOM   1576  C  CA    . HIS A  1  207  ? 124.508 199.937 175.667 1.00 0.00 ? 207  HIS A CA    1 
ATOM   1577  C  C     . HIS A  1  207  ? 124.953 198.841 176.624 1.00 0.00 ? 207  HIS A C     1 
ATOM   1578  O  O     . HIS A  1  207  ? 124.130 198.219 177.301 1.00 0.00 ? 207  HIS A O     1 
ATOM   1579  C  CB    . HIS A  1  207  ? 124.761 199.511 174.227 1.00 0.00 ? 207  HIS A CB    1 
ATOM   1580  C  CG    . HIS A  1  207  ? 123.826 198.446 173.760 1.00 0.00 ? 207  HIS A CG    1 
ATOM   1581  N  ND1   . HIS A  1  207  ? 123.967 197.122 174.111 1.00 0.00 ? 207  HIS A ND1   1 
ATOM   1582  C  CD2   . HIS A  1  207  ? 122.717 198.515 172.987 1.00 0.00 ? 207  HIS A CD2   1 
ATOM   1583  C  CE1   . HIS A  1  207  ? 122.986 196.421 173.572 1.00 0.00 ? 207  HIS A CE1   1 
ATOM   1584  N  NE2   . HIS A  1  207  ? 122.218 197.242 172.878 1.00 0.00 ? 207  HIS A NE2   1 
ATOM   1585  N  N     . ASN A  1  208  ? 126.257 198.577 176.648 1.00 0.00 ? 208  ASN A N     1 
ATOM   1586  C  CA    . ASN A  1  208  ? 126.855 197.497 177.428 1.00 0.00 ? 208  ASN A CA    1 
ATOM   1587  C  C     . ASN A  1  208  ? 127.742 198.138 178.484 1.00 0.00 ? 208  ASN A C     1 
ATOM   1588  O  O     . ASN A  1  208  ? 128.962 198.254 178.303 1.00 0.00 ? 208  ASN A O     1 
ATOM   1589  C  CB    . ASN A  1  208  ? 127.639 196.548 176.527 1.00 0.00 ? 208  ASN A CB    1 
ATOM   1590  C  CG    . ASN A  1  208  ? 128.211 195.357 177.269 1.00 0.00 ? 208  ASN A CG    1 
ATOM   1591  O  OD1   . ASN A  1  208  ? 128.395 195.389 178.483 1.00 0.00 ? 208  ASN A OD1   1 
ATOM   1592  N  ND2   . ASN A  1  208  ? 128.504 194.296 176.532 1.00 0.00 ? 208  ASN A ND2   1 
ATOM   1593  N  N     . PRO A  1  209  ? 127.163 198.559 179.612 1.00 0.00 ? 209  PRO A N     1 
ATOM   1594  C  CA    . PRO A  1  209  ? 127.949 199.268 180.632 1.00 0.00 ? 209  PRO A CA    1 
ATOM   1595  C  C     . PRO A  1  209  ? 129.042 198.441 181.267 1.00 0.00 ? 209  PRO A C     1 
ATOM   1596  O  O     . PRO A  1  209  ? 129.854 199.006 182.002 1.00 0.00 ? 209  PRO A O     1 
ATOM   1597  C  CB    . PRO A  1  209  ? 126.892 199.658 181.674 1.00 0.00 ? 209  PRO A CB    1 
ATOM   1598  C  CG    . PRO A  1  209  ? 125.611 199.673 180.923 1.00 0.00 ? 209  PRO A CG    1 
ATOM   1599  C  CD    . PRO A  1  209  ? 125.732 198.548 179.940 1.00 0.00 ? 209  PRO A CD    1 
ATOM   1600  N  N     . GLU A  1  210  ? 129.060 197.121 181.068 1.00 0.00 ? 210  GLU A N     1 
ATOM   1601  C  CA    . GLU A  1  210  ? 130.057 196.294 181.739 1.00 0.00 ? 210  GLU A CA    1 
ATOM   1602  C  C     . GLU A  1  210  ? 131.473 196.780 181.460 1.00 0.00 ? 210  GLU A C     1 
ATOM   1603  O  O     . GLU A  1  210  ? 132.188 197.189 182.382 1.00 0.00 ? 210  GLU A O     1 
ATOM   1604  C  CB    . GLU A  1  210  ? 129.898 194.834 181.318 1.00 0.00 ? 210  GLU A CB    1 
ATOM   1605  C  CG    . GLU A  1  210  ? 130.864 193.895 182.020 1.00 0.00 ? 210  GLU A CG    1 
ATOM   1606  C  CD    . GLU A  1  210  ? 130.620 192.434 181.691 1.00 0.00 ? 210  GLU A CD    1 
ATOM   1607  O  OE1   . GLU A  1  210  ? 129.715 192.141 180.882 1.00 0.00 ? 210  GLU A OE1   1 
ATOM   1608  O  OE2   . GLU A  1  210  ? 131.332 191.576 182.253 1.00 0.00 ? 210  GLU A OE2   1 
ATOM   1609  N  N     . LEU A  1  211  ? 131.892 196.736 180.198 1.00 0.00 ? 211  LEU A N     1 
ATOM   1610  C  CA    . LEU A  1  211  ? 133.230 197.136 179.780 1.00 0.00 ? 211  LEU A CA    1 
ATOM   1611  C  C     . LEU A  1  211  ? 133.579 198.530 180.291 1.00 0.00 ? 211  LEU A C     1 
ATOM   1612  O  O     . LEU A  1  211  ? 134.668 198.752 180.832 1.00 0.00 ? 211  LEU A O     1 
ATOM   1613  C  CB    . LEU A  1  211  ? 133.311 197.080 178.259 1.00 0.00 ? 211  LEU A CB    1 
ATOM   1614  C  CG    . LEU A  1  211  ? 134.643 197.411 177.619 1.00 0.00 ? 211  LEU A CG    1 
ATOM   1615  C  CD1   . LEU A  1  211  ? 135.627 196.392 178.084 1.00 0.00 ? 211  LEU A CD1   1 
ATOM   1616  C  CD2   . LEU A  1  211  ? 134.498 197.341 176.123 1.00 0.00 ? 211  LEU A CD2   1 
ATOM   1617  N  N     . GLU A  1  212  ? 132.655 199.466 180.106 1.00 0.00 ? 212  GLU A N     1 
ATOM   1618  C  CA    . GLU A  1  212  ? 132.641 200.790 180.743 1.00 0.00 ? 212  GLU A CA    1 
ATOM   1619  C  C     . GLU A  1  212  ? 133.956 201.513 180.452 1.00 0.00 ? 212  GLU A C     1 
ATOM   1620  O  O     . GLU A  1  212  ? 134.522 201.329 179.363 1.00 0.00 ? 212  GLU A O     1 
ATOM   1621  C  CB    . GLU A  1  212  ? 132.313 200.522 182.214 1.00 0.00 ? 212  GLU A CB    1 
ATOM   1622  C  CG    . GLU A  1  212  ? 131.952 201.701 183.107 1.00 0.00 ? 212  GLU A CG    1 
ATOM   1623  C  CD    . GLU A  1  212  ? 133.151 202.312 183.792 1.00 0.00 ? 212  GLU A CD    1 
ATOM   1624  O  OE1   . GLU A  1  212  ? 134.168 201.600 183.940 1.00 0.00 ? 212  GLU A OE1   1 
ATOM   1625  O  OE2   . GLU A  1  212  ? 133.084 203.500 184.169 1.00 0.00 ? 212  GLU A OE2   1 
ATOM   1626  N  N     . ARG A  1  213  ? 134.485 202.311 181.376 1.00 0.00 ? 213  ARG A N     1 
ATOM   1627  C  CA    . ARG A  1  213  ? 135.774 202.972 181.262 1.00 0.00 ? 213  ARG A CA    1 
ATOM   1628  C  C     . ARG A  1  213  ? 136.861 202.224 182.018 1.00 0.00 ? 213  ARG A C     1 
ATOM   1629  O  O     . ARG A  1  213  ? 138.028 202.626 181.971 1.00 0.00 ? 213  ARG A O     1 
ATOM   1630  C  CB    . ARG A  1  213  ? 135.678 204.401 181.802 1.00 0.00 ? 213  ARG A CB    1 
ATOM   1631  C  CG    . ARG A  1  213  ? 134.684 205.346 181.121 1.00 0.00 ? 213  ARG A CG    1 
ATOM   1632  C  CD    . ARG A  1  213  ? 135.145 205.879 179.767 1.00 0.00 ? 213  ARG A CD    1 
ATOM   1633  N  NE    . ARG A  1  213  ? 134.181 206.846 179.237 1.00 0.00 ? 213  ARG A NE    1 
ATOM   1634  C  CZ    . ARG A  1  213  ? 134.233 207.387 178.024 1.00 0.00 ? 213  ARG A CZ    1 
ATOM   1635  N  NH1   . ARG A  1  213  ? 135.216 207.074 177.191 1.00 0.00 ? 213  ARG A NH1   1 
ATOM   1636  N  NH2   . ARG A  1  213  ? 133.301 208.253 177.645 1.00 0.00 ? 213  ARG A NH2   1 
ATOM   1637  N  N     . TYR A  1  214  ? 136.494 201.168 182.747 1.00 0.00 ? 214  TYR A N     1 
ATOM   1638  C  CA    . TYR A  1  214  ? 137.452 200.505 183.625 1.00 0.00 ? 214  TYR A CA    1 
ATOM   1639  C  C     . TYR A  1  214  ? 138.647 200.000 182.832 1.00 0.00 ? 214  TYR A C     1 
ATOM   1640  O  O     . TYR A  1  214  ? 139.748 200.553 182.921 1.00 0.00 ? 214  TYR A O     1 
ATOM   1641  C  CB    . TYR A  1  214  ? 136.769 199.363 184.378 1.00 0.00 ? 214  TYR A CB    1 
ATOM   1642  C  CG    . TYR A  1  214  ? 137.688 198.613 185.312 1.00 0.00 ? 214  TYR A CG    1 
ATOM   1643  C  CD1   . TYR A  1  214  ? 138.040 199.147 186.545 1.00 0.00 ? 214  TYR A CD1   1 
ATOM   1644  C  CD2   . TYR A  1  214  ? 138.200 197.370 184.966 1.00 0.00 ? 214  TYR A CD2   1 
ATOM   1645  C  CE1   . TYR A  1  214  ? 138.879 198.465 187.406 1.00 0.00 ? 214  TYR A CE1   1 
ATOM   1646  C  CE2   . TYR A  1  214  ? 139.039 196.681 185.819 1.00 0.00 ? 214  TYR A CE2   1 
ATOM   1647  C  CZ    . TYR A  1  214  ? 139.376 197.233 187.037 1.00 0.00 ? 214  TYR A CZ    1 
ATOM   1648  O  OH    . TYR A  1  214  ? 140.211 196.547 187.889 1.00 0.00 ? 214  TYR A OH    1 
ATOM   1649  N  N     . VAL A  1  215  ? 138.442 198.964 182.029 1.00 0.00 ? 215  VAL A N     1 
ATOM   1650  C  CA    . VAL A  1  215  ? 139.395 198.575 181.002 1.00 0.00 ? 215  VAL A CA    1 
ATOM   1651  C  C     . VAL A  1  215  ? 139.045 199.393 179.767 1.00 0.00 ? 215  VAL A C     1 
ATOM   1652  O  O     . VAL A  1  215  ? 137.932 199.290 179.236 1.00 0.00 ? 215  VAL A O     1 
ATOM   1653  C  CB    . VAL A  1  215  ? 139.368 197.060 180.745 1.00 0.00 ? 215  VAL A CB    1 
ATOM   1654  C  CG1   . VAL A  1  215  ? 139.944 196.326 181.936 1.00 0.00 ? 215  VAL A CG1   1 
ATOM   1655  C  CG2   . VAL A  1  215  ? 137.960 196.588 180.560 1.00 0.00 ? 215  VAL A CG2   1 
ATOM   1656  N  N     . LYS A  1  216  ? 139.977 200.239 179.341 1.00 0.00 ? 216  LYS A N     1 
ATOM   1657  C  CA    . LYS A  1  216  ? 139.680 201.304 178.395 1.00 0.00 ? 216  LYS A CA    1 
ATOM   1658  C  C     . LYS A  1  216  ? 141.002 201.916 177.945 1.00 0.00 ? 216  LYS A C     1 
ATOM   1659  O  O     . LYS A  1  216  ? 142.078 201.498 178.384 1.00 0.00 ? 216  LYS A O     1 
ATOM   1660  C  CB    . LYS A  1  216  ? 138.721 202.306 179.058 1.00 0.00 ? 216  LYS A CB    1 
ATOM   1661  C  CG    . LYS A  1  216  ? 138.339 203.540 178.268 1.00 0.00 ? 216  LYS A CG    1 
ATOM   1662  C  CD    . LYS A  1  216  ? 137.659 203.201 176.968 1.00 0.00 ? 216  LYS A CD    1 
ATOM   1663  C  CE    . LYS A  1  216  ? 137.185 204.473 176.299 1.00 0.00 ? 216  LYS A CE    1 
ATOM   1664  N  NZ    . LYS A  1  216  ? 136.664 204.219 174.942 1.00 0.00 ? 216  LYS A NZ    1 
ATOM   1665  N  N     . ARG A  1  217  ? 140.921 202.903 177.055 1.00 0.00 ? 217  ARG A N     1 
ATOM   1666  C  CA    . ARG A  1  217  ? 142.087 203.621 176.561 1.00 0.00 ? 217  ARG A CA    1 
ATOM   1667  C  C     . ARG A  1  217  ? 143.040 202.683 175.838 1.00 0.00 ? 217  ARG A C     1 
ATOM   1668  O  O     . ARG A  1  217  ? 144.239 202.948 175.736 1.00 0.00 ? 217  ARG A O     1 
ATOM   1669  C  CB    . ARG A  1  217  ? 142.802 204.362 177.692 1.00 0.00 ? 217  ARG A CB    1 
ATOM   1670  C  CG    . ARG A  1  217  ? 141.917 205.372 178.396 1.00 0.00 ? 217  ARG A CG    1 
ATOM   1671  C  CD    . ARG A  1  217  ? 141.480 206.471 177.449 1.00 0.00 ? 217  ARG A CD    1 
ATOM   1672  N  NE    . ARG A  1  217  ? 142.623 207.203 176.913 1.00 0.00 ? 217  ARG A NE    1 
ATOM   1673  C  CZ    . ARG A  1  217  ? 143.238 208.195 177.547 1.00 0.00 ? 217  ARG A CZ    1 
ATOM   1674  N  NH1   . ARG A  1  217  ? 142.822 208.578 178.745 1.00 0.00 ? 217  ARG A NH1   1 
ATOM   1675  N  NH2   . ARG A  1  217  ? 144.273 208.804 176.986 1.00 0.00 ? 217  ARG A NH2   1 
ATOM   1676  N  N     . CYS A  1  218  ? 142.505 201.577 175.330 1.00 0.00 ? 218  CYS A N     1 
ATOM   1677  C  CA    . CYS A  1  218  ? 143.276 200.674 174.491 1.00 0.00 ? 218  CYS A CA    1 
ATOM   1678  C  C     . CYS A  1  218  ? 143.628 201.289 173.149 1.00 0.00 ? 218  CYS A C     1 
ATOM   1679  O  O     . CYS A  1  218  ? 144.578 200.836 172.498 1.00 0.00 ? 218  CYS A O     1 
ATOM   1680  C  CB    . CYS A  1  218  ? 142.502 199.375 174.258 1.00 0.00 ? 218  CYS A CB    1 
ATOM   1681  S  SG    . CYS A  1  218  ? 143.378 198.171 173.231 1.00 0.00 ? 218  CYS A SG    1 
ATOM   1682  N  N     . MET A  1  219  ? 142.895 202.317 172.735 1.00 0.00 ? 219  MET A N     1 
ATOM   1683  C  CA    . MET A  1  219  ? 143.003 202.873 171.385 1.00 0.00 ? 219  MET A CA    1 
ATOM   1684  C  C     . MET A  1  219  ? 142.764 201.700 170.440 1.00 0.00 ? 219  MET A C     1 
ATOM   1685  O  O     . MET A  1  219  ? 141.816 200.931 170.664 1.00 0.00 ? 219  MET A O     1 
ATOM   1686  C  CB    . MET A  1  219  ? 144.329 203.597 171.227 1.00 0.00 ? 219  MET A CB    1 
ATOM   1687  C  CG    . MET A  1  219  ? 144.488 204.807 172.135 1.00 0.00 ? 219  MET A CG    1 
ATOM   1688  S  SD    . MET A  1  219  ? 143.334 206.141 171.755 1.00 0.00 ? 219  MET A SD    1 
ATOM   1689  C  CE    . MET A  1  219  ? 142.109 205.926 173.043 1.00 0.00 ? 219  MET A CE    1 
ATOM   1690  N  N     . ASP A  1  220  ? 143.583 201.502 169.416 1.00 0.00 ? 220  ASP A N     1 
ATOM   1691  C  CA    . ASP A  1  220  ? 143.441 200.347 168.550 1.00 0.00 ? 220  ASP A CA    1 
ATOM   1692  C  C     . ASP A  1  220  ? 144.801 199.717 168.313 1.00 0.00 ? 220  ASP A C     1 
ATOM   1693  O  O     . ASP A  1  220  ? 145.834 200.212 168.769 1.00 0.00 ? 220  ASP A O     1 
ATOM   1694  C  CB    . ASP A  1  220  ? 142.792 200.723 167.214 1.00 0.00 ? 220  ASP A CB    1 
ATOM   1695  C  CG    . ASP A  1  220  ? 143.577 201.772 166.464 1.00 0.00 ? 220  ASP A CG    1 
ATOM   1696  O  OD1   . ASP A  1  220  ? 144.537 202.323 167.037 1.00 0.00 ? 220  ASP A OD1   1 
ATOM   1697  O  OD2   . ASP A  1  220  ? 143.230 202.051 165.299 1.00 0.00 ? 220  ASP A OD2   1 
ATOM   1698  N  N     . ASP A  1  221  ? 144.782 198.612 167.582 1.00 0.00 ? 221  ASP A N     1 
ATOM   1699  C  CA    . ASP A  1  221  ? 145.979 197.904 167.172 1.00 0.00 ? 221  ASP A CA    1 
ATOM   1700  C  C     . ASP A  1  221  ? 145.894 197.653 165.678 1.00 0.00 ? 221  ASP A C     1 
ATOM   1701  O  O     . ASP A  1  221  ? 144.980 198.123 164.996 1.00 0.00 ? 221  ASP A O     1 
ATOM   1702  C  CB    . ASP A  1  221  ? 146.133 196.572 167.911 1.00 0.00 ? 221  ASP A CB    1 
ATOM   1703  C  CG    . ASP A  1  221  ? 145.023 195.596 167.578 1.00 0.00 ? 221  ASP A CG    1 
ATOM   1704  O  OD1   . ASP A  1  221  ? 144.024 196.003 166.949 1.00 0.00 ? 221  ASP A OD1   1 
ATOM   1705  O  OD2   . ASP A  1  221  ? 145.158 194.405 167.922 1.00 0.00 ? 221  ASP A OD2   1 
ATOM   1706  N  N     . LEU A  1  222  ? 146.847 196.890 165.166 1.00 0.00 ? 222  LEU A N     1 
ATOM   1707  C  CA    . LEU A  1  222  ? 146.783 196.405 163.798 1.00 0.00 ? 222  LEU A CA    1 
ATOM   1708  C  C     . LEU A  1  222  ? 146.778 194.888 163.824 1.00 0.00 ? 222  LEU A C     1 
ATOM   1709  O  O     . LEU A  1  222  ? 147.772 194.263 164.204 1.00 0.00 ? 222  LEU A O     1 
ATOM   1710  C  CB    . LEU A  1  222  ? 147.935 196.941 162.960 1.00 0.00 ? 222  LEU A CB    1 
ATOM   1711  C  CG    . LEU A  1  222  ? 147.645 198.280 162.290 1.00 0.00 ? 222  LEU A CG    1 
ATOM   1712  C  CD1   . LEU A  1  222  ? 147.469 199.372 163.302 1.00 0.00 ? 222  LEU A CD1   1 
ATOM   1713  C  CD2   . LEU A  1  222  ? 148.738 198.644 161.321 1.00 0.00 ? 222  LEU A CD2   1 
ATOM   1714  N  N     . ASN A  1  223  ? 145.649 194.308 163.440 1.00 0.00 ? 223  ASN A N     1 
ATOM   1715  C  CA    . ASN A  1  223  ? 145.600 192.892 163.155 1.00 0.00 ? 223  ASN A CA    1 
ATOM   1716  C  C     . ASN A  1  223  ? 146.604 192.568 162.052 1.00 0.00 ? 223  ASN A C     1 
ATOM   1717  O  O     . ASN A  1  223  ? 146.513 193.102 160.948 1.00 0.00 ? 223  ASN A O     1 
ATOM   1718  C  CB    . ASN A  1  223  ? 144.198 192.498 162.702 1.00 0.00 ? 223  ASN A CB    1 
ATOM   1719  C  CG    . ASN A  1  223  ? 143.978 191.012 162.730 1.00 0.00 ? 223  ASN A CG    1 
ATOM   1720  O  OD1   . ASN A  1  223  ? 144.510 190.321 163.586 1.00 0.00 ? 223  ASN A OD1   1 
ATOM   1721  N  ND2   . ASN A  1  223  ? 143.182 190.508 161.797 1.00 0.00 ? 223  ASN A ND2   1 
ATOM   1722  N  N     . PRO A  1  224  ? 147.575 191.700 162.331 1.00 0.00 ? 224  PRO A N     1 
ATOM   1723  C  CA    . PRO A  1  224  ? 148.540 191.327 161.288 1.00 0.00 ? 224  PRO A CA    1 
ATOM   1724  C  C     . PRO A  1  224  ? 147.902 190.940 159.974 1.00 0.00 ? 224  PRO A C     1 
ATOM   1725  O  O     . PRO A  1  224  ? 148.574 191.009 158.943 1.00 0.00 ? 224  PRO A O     1 
ATOM   1726  C  CB    . PRO A  1  224  ? 149.295 190.160 161.918 1.00 0.00 ? 224  PRO A CB    1 
ATOM   1727  C  CG    . PRO A  1  224  ? 149.327 190.533 163.359 1.00 0.00 ? 224  PRO A CG    1 
ATOM   1728  C  CD    . PRO A  1  224  ? 148.036 191.277 163.661 1.00 0.00 ? 224  PRO A CD    1 
ATOM   1729  N  N     . LEU A  1  225  ? 146.642 190.529 159.965 1.00 0.00 ? 225  LEU A N     1 
ATOM   1730  C  CA    . LEU A  1  225  ? 145.899 190.603 158.715 1.00 0.00 ? 225  LEU A CA    1 
ATOM   1731  C  C     . LEU A  1  225  ? 145.865 192.021 158.173 1.00 0.00 ? 225  LEU A C     1 
ATOM   1732  O  O     . LEU A  1  225  ? 146.423 192.284 157.104 1.00 0.00 ? 225  LEU A O     1 
ATOM   1733  C  CB    . LEU A  1  225  ? 144.481 190.083 158.892 1.00 0.00 ? 225  LEU A CB    1 
ATOM   1734  C  CG    . LEU A  1  225  ? 143.572 190.367 157.703 1.00 0.00 ? 225  LEU A CG    1 
ATOM   1735  C  CD1   . LEU A  1  225  ? 144.078 189.739 156.433 1.00 0.00 ? 225  LEU A CD1   1 
ATOM   1736  C  CD2   . LEU A  1  225  ? 142.196 189.861 158.021 1.00 0.00 ? 225  LEU A CD2   1 
ATOM   1737  N  N     . LYS A  1  226  ? 145.230 192.945 158.898 1.00 0.00 ? 226  LYS A N     1 
ATOM   1738  C  CA    . LYS A  1  226  ? 145.012 194.284 158.365 1.00 0.00 ? 226  LYS A CA    1 
ATOM   1739  C  C     . LYS A  1  226  ? 146.309 194.935 157.914 1.00 0.00 ? 226  LYS A C     1 
ATOM   1740  O  O     . LYS A  1  226  ? 146.314 195.684 156.936 1.00 0.00 ? 226  LYS A O     1 
ATOM   1741  C  CB    . LYS A  1  226  ? 144.321 195.172 159.395 1.00 0.00 ? 226  LYS A CB    1 
ATOM   1742  C  CG    . LYS A  1  226  ? 144.066 196.565 158.866 1.00 0.00 ? 226  LYS A CG    1 
ATOM   1743  C  CD    . LYS A  1  226  ? 143.361 197.442 159.861 1.00 0.00 ? 226  LYS A CD    1 
ATOM   1744  C  CE    . LYS A  1  226  ? 144.304 197.926 160.941 1.00 0.00 ? 226  LYS A CE    1 
ATOM   1745  N  NZ    . LYS A  1  226  ? 143.636 198.858 161.889 1.00 0.00 ? 226  LYS A NZ    1 
ATOM   1746  N  N     . THR A  1  227  ? 147.424 194.657 158.586 1.00 0.00 ? 227  THR A N     1 
ATOM   1747  C  CA    . THR A  1  227  ? 148.667 195.246 158.114 1.00 0.00 ? 227  THR A CA    1 
ATOM   1748  C  C     . THR A  1  227  ? 149.237 194.923 156.740 1.00 0.00 ? 227  THR A C     1 
ATOM   1749  O  O     . THR A  1  227  ? 150.004 195.724 156.198 1.00 0.00 ? 227  THR A O     1 
ATOM   1750  C  CB    . THR A  1  227  ? 149.796 195.028 159.121 1.00 0.00 ? 227  THR A CB    1 
ATOM   1751  O  OG1   . THR A  1  227  ? 150.923 195.827 158.744 1.00 0.00 ? 227  THR A OG1   1 
ATOM   1752  C  CG2   . THR A  1  227  ? 150.230 193.595 159.138 1.00 0.00 ? 227  THR A CG2   1 
ATOM   1753  N  N     . LEU A  1  228  ? 148.875 193.781 156.155 1.00 0.00 ? 228  LEU A N     1 
ATOM   1754  C  CA    . LEU A  1  228  ? 149.165 193.586 154.727 1.00 0.00 ? 228  LEU A CA    1 
ATOM   1755  C  C     . LEU A  1  228  ? 148.153 194.180 153.709 1.00 0.00 ? 228  LEU A C     1 
ATOM   1756  O  O     . LEU A  1  228  ? 148.488 194.668 152.626 1.00 0.00 ? 228  LEU A O     1 
ATOM   1757  C  CB    . LEU A  1  228  ? 149.136 192.099 154.399 1.00 0.00 ? 228  LEU A CB    1 
ATOM   1758  C  CG    . LEU A  1  228  ? 147.809 191.387 154.626 1.00 0.00 ? 228  LEU A CG    1 
ATOM   1759  C  CD1   . LEU A  1  228  ? 146.867 191.643 153.483 1.00 0.00 ? 228  LEU A CD1   1 
ATOM   1760  C  CD2   . LEU A  1  228  ? 148.086 189.911 154.710 1.00 0.00 ? 228  LEU A CD2   1 
ATOM   1761  N  N     . ASN A  1  229  ? 146.920 194.280 154.191 1.00 0.00 ? 229  ASN A N     1 
ATOM   1762  C  CA    . ASN A  1  229  ? 145.880 194.938 153.436 1.00 0.00 ? 229  ASN A CA    1 
ATOM   1763  C  C     . ASN A  1  229  ? 146.361 196.386 153.390 1.00 0.00 ? 229  ASN A C     1 
ATOM   1764  O  O     . ASN A  1  229  ? 146.080 197.116 152.438 1.00 0.00 ? 229  ASN A O     1 
ATOM   1765  C  CB    . ASN A  1  229  ? 144.537 194.838 154.154 1.00 0.00 ? 229  ASN A CB    1 
ATOM   1766  C  CG    . ASN A  1  229  ? 143.738 193.622 153.729 1.00 0.00 ? 229  ASN A CG    1 
ATOM   1767  O  OD1   . ASN A  1  229  ? 143.357 193.491 152.565 1.00 0.00 ? 229  ASN A OD1   1 
ATOM   1768  N  ND2   . ASN A  1  229  ? 143.479 192.724 154.672 1.00 0.00 ? 229  ASN A ND2   1 
ATOM   1769  N  N     . LEU A  1  230  ? 147.092 196.795 154.432 1.00 0.00 ? 230  LEU A N     1 
ATOM   1770  C  CA    . LEU A  1  230  ? 147.659 198.129 154.487 1.00 0.00 ? 230  LEU A CA    1 
ATOM   1771  C  C     . LEU A  1  230  ? 148.959 198.232 153.711 1.00 0.00 ? 230  LEU A C     1 
ATOM   1772  O  O     . LEU A  1  230  ? 149.189 199.238 153.038 1.00 0.00 ? 230  LEU A O     1 
ATOM   1773  C  CB    . LEU A  1  230  ? 147.873 198.551 155.940 1.00 0.00 ? 230  LEU A CB    1 
ATOM   1774  C  CG    . LEU A  1  230  ? 148.209 200.020 156.172 1.00 0.00 ? 230  LEU A CG    1 
ATOM   1775  C  CD1   . LEU A  1  230  ? 147.559 200.482 157.453 1.00 0.00 ? 230  LEU A CD1   1 
ATOM   1776  C  CD2   . LEU A  1  230  ? 149.703 200.229 156.252 1.00 0.00 ? 230  LEU A CD2   1 
ATOM   1777  N  N     . PHE A  1  231  ? 149.822 197.215 153.786 1.00 0.00 ? 231  PHE A N     1 
ATOM   1778  C  CA    . PHE A  1  231  ? 151.024 197.214 152.962 1.00 0.00 ? 231  PHE A CA    1 
ATOM   1779  C  C     . PHE A  1  231  ? 150.719 197.229 151.478 1.00 0.00 ? 231  PHE A C     1 
ATOM   1780  O  O     . PHE A  1  231  ? 151.605 197.552 150.683 1.00 0.00 ? 231  PHE A O     1 
ATOM   1781  C  CB    . PHE A  1  231  ? 151.902 196.005 153.256 1.00 0.00 ? 231  PHE A CB    1 
ATOM   1782  C  CG    . PHE A  1  231  ? 152.595 196.070 154.567 1.00 0.00 ? 231  PHE A CG    1 
ATOM   1783  C  CD1   . PHE A  1  231  ? 152.672 197.258 155.254 1.00 0.00 ? 231  PHE A CD1   1 
ATOM   1784  C  CD2   . PHE A  1  231  ? 153.205 194.954 155.096 1.00 0.00 ? 231  PHE A CD2   1 
ATOM   1785  C  CE1   . PHE A  1  231  ? 153.317 197.328 156.451 1.00 0.00 ? 231  PHE A CE1   1 
ATOM   1786  C  CE2   . PHE A  1  231  ? 153.852 195.019 156.298 1.00 0.00 ? 231  PHE A CE2   1 
ATOM   1787  C  CZ    . PHE A  1  231  ? 153.909 196.208 156.976 1.00 0.00 ? 231  PHE A CZ    1 
ATOM   1788  N  N     . LYS A  1  232  ? 149.502 196.896 151.083 1.00 0.00 ? 232  LYS A N     1 
ATOM   1789  C  CA    . LYS A  1  232  ? 149.214 196.757 149.669 1.00 0.00 ? 232  LYS A CA    1 
ATOM   1790  C  C     . LYS A  1  232  ? 148.953 198.082 148.964 1.00 0.00 ? 232  LYS A C     1 
ATOM   1791  O  O     . LYS A  1  232  ? 148.755 198.080 147.749 1.00 0.00 ? 232  LYS A O     1 
ATOM   1792  C  CB    . LYS A  1  232  ? 148.033 195.815 149.468 1.00 0.00 ? 232  LYS A CB    1 
ATOM   1793  C  CG    . LYS A  1  232  ? 148.359 194.379 149.800 1.00 0.00 ? 232  LYS A CG    1 
ATOM   1794  C  CD    . LYS A  1  232  ? 147.206 193.466 149.451 1.00 0.00 ? 232  LYS A CD    1 
ATOM   1795  C  CE    . LYS A  1  232  ? 147.581 192.012 149.584 1.00 0.00 ? 232  LYS A CE    1 
ATOM   1796  N  NZ    . LYS A  1  232  ? 148.690 191.624 148.664 1.00 0.00 ? 232  LYS A NZ    1 
ATOM   1797  N  N     . GLN A  1  233  ? 148.953 199.182 149.711 1.00 0.00 ? 233  GLN A N     1 
ATOM   1798  C  CA    . GLN A  1  233  ? 148.714 200.499 149.134 1.00 0.00 ? 233  GLN A CA    1 
ATOM   1799  C  C     . GLN A  1  233  ? 149.795 201.065 148.218 1.00 0.00 ? 233  GLN A C     1 
ATOM   1800  O  O     . GLN A  1  233  ? 149.712 200.943 146.996 1.00 0.00 ? 233  GLN A O     1 
ATOM   1801  C  CB    . GLN A  1  233  ? 148.356 201.506 150.229 1.00 0.00 ? 233  GLN A CB    1 
ATOM   1802  C  CG    . GLN A  1  233  ? 146.902 201.456 150.667 1.00 0.00 ? 233  GLN A CG    1 
ATOM   1803  C  CD    . GLN A  1  233  ? 146.376 200.039 150.782 1.00 0.00 ? 233  GLN A CD    1 
ATOM   1804  O  OE1   . GLN A  1  233  ? 146.915 199.223 151.529 1.00 0.00 ? 233  GLN A OE1   1 
ATOM   1805  N  NE2   . GLN A  1  233  ? 145.317 199.739 150.039 1.00 0.00 ? 233  GLN A NE2   1 
ATOM   1806  N  N     . ILE A  1  234  ? 150.807 201.684 148.817 1.00 0.00 ? 234  ILE A N     1 
ATOM   1807  C  CA    . ILE A  1  234  ? 151.911 202.232 148.017 1.00 0.00 ? 234  ILE A CA    1 
ATOM   1808  C  C     . ILE A  1  234  ? 152.734 201.061 147.423 1.00 0.00 ? 234  ILE A C     1 
ATOM   1809  O  O     . ILE A  1  234  ? 153.411 200.312 148.127 1.00 0.00 ? 234  ILE A O     1 
ATOM   1810  C  CB    . ILE A  1  234  ? 152.832 203.104 148.891 1.00 0.00 ? 234  ILE A CB    1 
ATOM   1811  C  CG1   . ILE A  1  234  ? 153.824 203.875 148.018 1.00 0.00 ? 234  ILE A CG1   1 
ATOM   1812  C  CG2   . ILE A  1  234  ? 153.566 202.248 149.911 1.00 0.00 ? 234  ILE A CG2   1 
ATOM   1813  C  CD1   . ILE A  1  234  ? 153.174 204.905 147.120 1.00 0.00 ? 234  ILE A CD1   1 
ATOM   1814  N  N     . LYS A  1  235  ? 152.518 200.842 146.130 1.00 0.00 ? 235  LYS A N     1 
ATOM   1815  C  CA    . LYS A  1  235  ? 153.077 199.681 145.447 1.00 0.00 ? 235  LYS A CA    1 
ATOM   1816  C  C     . LYS A  1  235  ? 154.004 200.314 144.415 1.00 0.00 ? 235  LYS A C     1 
ATOM   1817  O  O     . LYS A  1  235  ? 153.864 200.079 143.215 1.00 0.00 ? 235  LYS A O     1 
ATOM   1818  C  CB    . LYS A  1  235  ? 151.960 198.906 144.746 1.00 0.00 ? 235  LYS A CB    1 
ATOM   1819  C  CG    . LYS A  1  235  ? 150.970 198.249 145.693 1.00 0.00 ? 235  LYS A CG    1 
ATOM   1820  C  CD    . LYS A  1  235  ? 149.877 197.518 144.930 1.00 0.00 ? 235  LYS A CD    1 
ATOM   1821  C  CE    . LYS A  1  235  ? 148.900 196.840 145.877 1.00 0.00 ? 235  LYS A CE    1 
ATOM   1822  N  NZ    . LYS A  1  235  ? 147.810 196.141 145.143 1.00 0.00 ? 235  LYS A NZ    1 
ATOM   1823  N  N     . SER A  1  236  ? 154.950 201.118 144.889 1.00 0.00 ? 236  SER A N     1 
ATOM   1824  C  CA    . SER A  1  236  ? 155.905 201.786 144.003 1.00 0.00 ? 236  SER A CA    1 
ATOM   1825  C  C     . SER A  1  236  ? 156.399 203.033 144.719 1.00 0.00 ? 236  SER A C     1 
ATOM   1826  O  O     . SER A  1  236  ? 156.656 202.995 145.929 1.00 0.00 ? 236  SER A O     1 
ATOM   1827  C  CB    . SER A  1  236  ? 155.258 202.044 142.666 1.00 0.00 ? 236  SER A CB    1 
ATOM   1828  O  OG    . SER A  1  236  ? 154.190 202.967 142.789 1.00 0.00 ? 236  SER A OG    1 
ATOM   1829  N  N     . ALA A  1  237  ? 156.510 204.138 143.982 1.00 0.00 ? 237  ALA A N     1 
ATOM   1830  C  CA    . ALA A  1  237  ? 156.739 205.422 144.618 1.00 0.00 ? 237  ALA A CA    1 
ATOM   1831  C  C     . ALA A  1  237  ? 157.975 205.345 145.492 1.00 0.00 ? 237  ALA A C     1 
ATOM   1832  O  O     . ALA A  1  237  ? 159.098 205.226 144.998 1.00 0.00 ? 237  ALA A O     1 
ATOM   1833  C  CB    . ALA A  1  237  ? 155.519 205.844 145.433 1.00 0.00 ? 237  ALA A CB    1 
ATOM   1834  N  N     . ASP A  1  238  ? 157.755 205.385 146.799 1.00 0.00 ? 238  ASP A N     1 
ATOM   1835  C  CA    . ASP A  1  238  ? 158.822 205.453 147.779 1.00 0.00 ? 238  ASP A CA    1 
ATOM   1836  C  C     . ASP A  1  238  ? 159.633 204.166 147.839 1.00 0.00 ? 238  ASP A C     1 
ATOM   1837  O  O     . ASP A  1  238  ? 160.783 204.156 147.387 1.00 0.00 ? 238  ASP A O     1 
ATOM   1838  C  CB    . ASP A  1  238  ? 158.210 205.747 149.142 1.00 0.00 ? 238  ASP A CB    1 
ATOM   1839  C  CG    . ASP A  1  238  ? 157.089 204.798 149.471 1.00 0.00 ? 238  ASP A CG    1 
ATOM   1840  O  OD1   . ASP A  1  238  ? 156.671 204.064 148.551 1.00 0.00 ? 238  ASP A OD1   1 
ATOM   1841  O  OD2   . ASP A  1  238  ? 156.660 204.744 150.637 1.00 0.00 ? 238  ASP A OD2   1 
ATOM   1842  N  N     . CYS A  1  239  ? 159.054 203.082 148.369 1.00 0.00 ? 239  CYS A N     1 
ATOM   1843  C  CA    . CYS A  1  239  ? 159.793 201.830 148.448 1.00 0.00 ? 239  CYS A CA    1 
ATOM   1844  C  C     . CYS A  1  239  ? 161.133 202.102 149.109 1.00 0.00 ? 239  CYS A C     1 
ATOM   1845  O  O     . CYS A  1  239  ? 161.215 202.306 150.324 1.00 0.00 ? 239  CYS A O     1 
ATOM   1846  C  CB    . CYS A  1  239  ? 159.975 201.197 147.073 1.00 0.00 ? 239  CYS A CB    1 
ATOM   1847  S  SG    . CYS A  1  239  ? 158.439 200.640 146.308 1.00 0.00 ? 239  CYS A SG    1 
ATOM   1848  N  N     . GLU A  1  240  ? 162.184 202.108 148.289 1.00 0.00 ? 240  GLU A N     1 
ATOM   1849  C  CA    . GLU A  1  240  ? 163.559 202.254 148.750 1.00 0.00 ? 240  GLU A CA    1 
ATOM   1850  C  C     . GLU A  1  240  ? 163.752 203.389 149.743 1.00 0.00 ? 240  GLU A C     1 
ATOM   1851  O  O     . GLU A  1  240  ? 164.705 203.333 150.526 1.00 0.00 ? 240  GLU A O     1 
ATOM   1852  C  CB    . GLU A  1  240  ? 164.479 202.460 147.551 1.00 0.00 ? 240  GLU A CB    1 
ATOM   1853  C  CG    . GLU A  1  240  ? 164.169 203.708 146.755 1.00 0.00 ? 240  GLU A CG    1 
ATOM   1854  C  CD    . GLU A  1  240  ? 165.004 203.803 145.499 1.00 0.00 ? 240  GLU A CD    1 
ATOM   1855  O  OE1   . GLU A  1  240  ? 166.018 203.082 145.409 1.00 0.00 ? 240  GLU A OE1   1 
ATOM   1856  O  OE2   . GLU A  1  240  ? 164.654 204.601 144.606 1.00 0.00 ? 240  GLU A OE2   1 
ATOM   1857  N  N     . LEU A  1  241  ? 162.895 204.403 149.690 1.00 0.00 ? 241  LEU A N     1 
ATOM   1858  C  CA    . LEU A  1  241  ? 162.988 205.489 150.653 1.00 0.00 ? 241  LEU A CA    1 
ATOM   1859  C  C     . LEU A  1  241  ? 163.076 204.841 152.032 1.00 0.00 ? 241  LEU A C     1 
ATOM   1860  O  O     . LEU A  1  241  ? 163.730 205.358 152.937 1.00 0.00 ? 241  LEU A O     1 
ATOM   1861  C  CB    . LEU A  1  241  ? 161.761 206.397 150.566 1.00 0.00 ? 241  LEU A CB    1 
ATOM   1862  C  CG    . LEU A  1  241  ? 161.848 207.560 149.576 1.00 0.00 ? 241  LEU A CG    1 
ATOM   1863  C  CD1   . LEU A  1  241  ? 160.599 208.425 149.652 1.00 0.00 ? 241  LEU A CD1   1 
ATOM   1864  C  CD2   . LEU A  1  241  ? 163.097 208.390 149.830 1.00 0.00 ? 241  LEU A CD2   1 
ATOM   1865  N  N     . LEU A  1  242  ? 162.406 203.699 152.175 1.00 0.00 ? 242  LEU A N     1 
ATOM   1866  C  CA    . LEU A  1  242  ? 162.410 202.936 153.410 1.00 0.00 ? 242  LEU A CA    1 
ATOM   1867  C  C     . LEU A  1  242  ? 163.629 202.022 153.426 1.00 0.00 ? 242  LEU A C     1 
ATOM   1868  O  O     . LEU A  1  242  ? 164.236 201.812 154.476 1.00 0.00 ? 242  LEU A O     1 
ATOM   1869  C  CB    . LEU A  1  242  ? 161.128 202.111 153.537 1.00 0.00 ? 242  LEU A CB    1 
ATOM   1870  C  CG    . LEU A  1  242  ? 159.818 202.899 153.599 1.00 0.00 ? 242  LEU A CG    1 
ATOM   1871  C  CD1   . LEU A  1  242  ? 158.626 201.957 153.657 1.00 0.00 ? 242  LEU A CD1   1 
ATOM   1872  C  CD2   . LEU A  1  242  ? 159.817 203.847 154.788 1.00 0.00 ? 242  LEU A CD2   1 
ATOM   1873  N  N     . GLY A  1  243  ? 163.992 201.477 152.265 1.00 0.00 ? 243  GLY A N     1 
ATOM   1874  C  CA    . GLY A  1  243  ? 165.154 200.610 152.208 1.00 0.00 ? 243  GLY A CA    1 
ATOM   1875  C  C     . GLY A  1  243  ? 165.061 199.443 151.252 1.00 0.00 ? 243  GLY A C     1 
ATOM   1876  O  O     . GLY A  1  243  ? 165.976 198.609 151.244 1.00 0.00 ? 243  GLY A O     1 
ATOM   1877  N  N     . ILE A  1  244  ? 164.029 199.327 150.425 1.00 0.00 ? 244  ILE A N     1 
ATOM   1878  C  CA    . ILE A  1  244  ? 163.840 198.158 149.578 1.00 0.00 ? 244  ILE A CA    1 
ATOM   1879  C  C     . ILE A  1  244  ? 163.871 198.602 148.126 1.00 0.00 ? 244  ILE A C     1 
ATOM   1880  O  O     . ILE A  1  244  ? 162.963 199.307 147.673 1.00 0.00 ? 244  ILE A O     1 
ATOM   1881  C  CB    . ILE A  1  244  ? 162.513 197.451 149.879 1.00 0.00 ? 244  ILE A CB    1 
ATOM   1882  C  CG1   . ILE A  1  244  ? 162.460 197.012 151.338 1.00 0.00 ? 244  ILE A CG1   1 
ATOM   1883  C  CG2   . ILE A  1  244  ? 162.335 196.265 148.953 1.00 0.00 ? 244  ILE A CG2   1 
ATOM   1884  C  CD1   . ILE A  1  244  ? 161.703 197.970 152.226 1.00 0.00 ? 244  ILE A CD1   1 
ATOM   1885  N  N     . ASP A  1  245  ? 164.896 198.185 147.389 1.00 0.00 ? 245  ASP A N     1 
ATOM   1886  C  CA    . ASP A  1  245  ? 164.836 198.336 145.945 1.00 0.00 ? 245  ASP A CA    1 
ATOM   1887  C  C     . ASP A  1  245  ? 163.662 197.536 145.417 1.00 0.00 ? 245  ASP A C     1 
ATOM   1888  O  O     . ASP A  1  245  ? 163.576 196.327 145.634 1.00 0.00 ? 245  ASP A O     1 
ATOM   1889  C  CB    . ASP A  1  245  ? 166.119 197.837 145.278 1.00 0.00 ? 245  ASP A CB    1 
ATOM   1890  C  CG    . ASP A  1  245  ? 167.294 198.763 145.493 1.00 0.00 ? 245  ASP A CG    1 
ATOM   1891  O  OD1   . ASP A  1  245  ? 167.071 199.923 145.894 1.00 0.00 ? 245  ASP A OD1   1 
ATOM   1892  O  OD2   . ASP A  1  245  ? 168.443 198.333 145.249 1.00 0.00 ? 245  ASP A OD2   1 
ATOM   1893  N  N     . ALA A  1  246  ? 162.743 198.205 144.732 1.00 0.00 ? 246  ALA A N     1 
ATOM   1894  C  CA    . ALA A  1  246  ? 161.747 197.477 143.961 1.00 0.00 ? 246  ALA A CA    1 
ATOM   1895  C  C     . ALA A  1  246  ? 161.937 197.828 142.498 1.00 0.00 ? 246  ALA A C     1 
ATOM   1896  O  O     . ALA A  1  246  ? 161.475 198.867 142.028 1.00 0.00 ? 246  ALA A O     1 
ATOM   1897  C  CB    . ALA A  1  246  ? 160.339 197.812 144.433 1.00 0.00 ? 246  ALA A CB    1 
ATOM   1898  N  N     . THR A  1  247  ? 162.606 196.941 141.775 1.00 0.00 ? 247  THR A N     1 
ATOM   1899  C  CA    . THR A  1  247  ? 162.408 196.766 140.347 1.00 0.00 ? 247  THR A CA    1 
ATOM   1900  C  C     . THR A  1  247  ? 161.481 195.564 140.238 1.00 0.00 ? 247  THR A C     1 
ATOM   1901  O  O     . THR A  1  247  ? 161.355 194.944 139.179 1.00 0.00 ? 247  THR A O     1 
ATOM   1902  C  CB    . THR A  1  247  ? 163.727 196.604 139.593 1.00 0.00 ? 247  THR A CB    1 
ATOM   1903  O  OG1   . THR A  1  247  ? 163.470 196.619 138.184 1.00 0.00 ? 247  THR A OG1   1 
ATOM   1904  C  CG2   . THR A  1  247  ? 164.421 195.325 139.968 1.00 0.00 ? 247  THR A CG2   1 
ATOM   1905  N  N     . VAL A  1  248  ? 160.922 195.200 141.393 1.00 0.00 ? 248  VAL A N     1 
ATOM   1906  C  CA    . VAL A  1  248  ? 160.040 194.071 141.728 1.00 0.00 ? 248  VAL A CA    1 
ATOM   1907  C  C     . VAL A  1  248  ? 160.586 192.696 141.356 1.00 0.00 ? 248  VAL A C     1 
ATOM   1908  O  O     . VAL A  1  248  ? 159.854 191.879 140.777 1.00 0.00 ? 248  VAL A O     1 
ATOM   1909  C  CB    . VAL A  1  248  ? 158.614 194.252 141.154 1.00 0.00 ? 248  VAL A CB    1 
ATOM   1910  C  CG1   . VAL A  1  248  ? 157.957 195.490 141.746 1.00 0.00 ? 248  VAL A CG1   1 
ATOM   1911  C  CG2   . VAL A  1  248  ? 158.546 194.268 139.614 1.00 0.00 ? 248  VAL A CG2   1 
ATOM   1912  N  N     . PRO A  1  249  ? 161.826 192.358 141.699 1.00 0.00 ? 249  PRO A N     1 
ATOM   1913  C  CA    . PRO A  1  249  ? 162.138 190.938 141.813 1.00 0.00 ? 249  PRO A CA    1 
ATOM   1914  C  C     . PRO A  1  249  ? 161.356 190.358 142.983 1.00 0.00 ? 249  PRO A C     1 
ATOM   1915  O  O     . PRO A  1  249  ? 160.680 189.334 142.847 1.00 0.00 ? 249  PRO A O     1 
ATOM   1916  C  CB    . PRO A  1  249  ? 163.655 190.929 142.042 1.00 0.00 ? 249  PRO A CB    1 
ATOM   1917  C  CG    . PRO A  1  249  ? 163.941 192.226 142.677 1.00 0.00 ? 249  PRO A CG    1 
ATOM   1918  C  CD    . PRO A  1  249  ? 162.964 193.198 142.114 1.00 0.00 ? 249  PRO A CD    1 
ATOM   1919  N  N     . SER A  1  250  ? 161.401 191.047 144.125 1.00 0.00 ? 250  SER A N     1 
ATOM   1920  C  CA    . SER A  1  250  ? 160.605 190.680 145.284 1.00 0.00 ? 250  SER A CA    1 
ATOM   1921  C  C     . SER A  1  250  ? 159.180 191.176 145.181 1.00 0.00 ? 250  SER A C     1 
ATOM   1922  O  O     . SER A  1  250  ? 158.261 190.467 145.603 1.00 0.00 ? 250  SER A O     1 
ATOM   1923  C  CB    . SER A  1  250  ? 161.214 191.250 146.563 1.00 0.00 ? 250  SER A CB    1 
ATOM   1924  O  OG    . SER A  1  250  ? 161.091 192.658 146.571 1.00 0.00 ? 250  SER A OG    1 
ATOM   1925  N  N     . GLY A  1  251  ? 158.978 192.359 144.613 1.00 0.00 ? 251  GLY A N     1 
ATOM   1926  C  CA    . GLY A  1  251  ? 157.652 192.931 144.527 1.00 0.00 ? 251  GLY A CA    1 
ATOM   1927  C  C     . GLY A  1  251  ? 157.087 193.589 145.772 1.00 0.00 ? 251  GLY A C     1 
ATOM   1928  O  O     . GLY A  1  251  ? 155.977 193.246 146.200 1.00 0.00 ? 251  GLY A O     1 
ATOM   1929  N  N     . ARG A  1  252  ? 157.806 194.573 146.305 1.00 0.00 ? 252  ARG A N     1 
ATOM   1930  C  CA    . ARG A  1  252  ? 157.343 195.358 147.453 1.00 0.00 ? 252  ARG A CA    1 
ATOM   1931  C  C     . ARG A  1  252  ? 157.383 194.700 148.832 1.00 0.00 ? 252  ARG A C     1 
ATOM   1932  O  O     . ARG A  1  252  ? 157.785 193.545 148.973 1.00 0.00 ? 252  ARG A O     1 
ATOM   1933  C  CB    . ARG A  1  252  ? 155.931 195.891 147.186 1.00 0.00 ? 252  ARG A CB    1 
ATOM   1934  C  CG    . ARG A  1  252  ? 155.849 196.884 146.038 1.00 0.00 ? 252  ARG A CG    1 
ATOM   1935  C  CD    . ARG A  1  252  ? 154.420 197.346 145.808 1.00 0.00 ? 252  ARG A CD    1 
ATOM   1936  N  NE    . ARG A  1  252  ? 153.808 196.682 144.661 1.00 0.00 ? 252  ARG A NE    1 
ATOM   1937  C  CZ    . ARG A  1  252  ? 154.224 196.823 143.406 1.00 0.00 ? 252  ARG A CZ    1 
ATOM   1938  N  NH1   . ARG A  1  252  ? 155.256 197.609 143.133 1.00 0.00 ? 252  ARG A NH1   1 
ATOM   1939  N  NH2   . ARG A  1  252  ? 153.607 196.179 142.425 1.00 0.00 ? 252  ARG A NH2   1 
ATOM   1940  N  N     . PRO A  1  253  ? 156.956 195.462 149.854 1.00 0.00 ? 253  PRO A N     1 
ATOM   1941  C  CA    . PRO A  1  253  ? 156.888 195.099 151.271 1.00 0.00 ? 253  PRO A CA    1 
ATOM   1942  C  C     . PRO A  1  253  ? 155.551 194.469 151.654 1.00 0.00 ? 253  PRO A C     1 
ATOM   1943  O  O     . PRO A  1  253  ? 154.657 195.143 152.166 1.00 0.00 ? 253  PRO A O     1 
ATOM   1944  C  CB    . PRO A  1  253  ? 157.046 196.447 151.970 1.00 0.00 ? 253  PRO A CB    1 
ATOM   1945  C  CG    . PRO A  1  253  ? 156.427 197.424 151.025 1.00 0.00 ? 253  PRO A CG    1 
ATOM   1946  C  CD    . PRO A  1  253  ? 156.526 196.854 149.632 1.00 0.00 ? 253  PRO A CD    1 
ATOM   1947  N  N     . GLU A  1  254  ? 155.408 193.191 151.324 1.00 0.00 ? 254  GLU A N     1 
ATOM   1948  C  CA    . GLU A  1  254  ? 154.196 192.430 151.603 1.00 0.00 ? 254  GLU A CA    1 
ATOM   1949  C  C     . GLU A  1  254  ? 154.564 190.979 151.886 1.00 0.00 ? 254  GLU A C     1 
ATOM   1950  O  O     . GLU A  1  254  ? 153.799 190.239 152.504 1.00 0.00 ? 254  GLU A O     1 
ATOM   1951  C  CB    . GLU A  1  254  ? 153.226 192.510 150.424 1.00 0.00 ? 254  GLU A CB    1 
ATOM   1952  C  CG    . GLU A  1  254  ? 153.694 191.766 149.184 1.00 0.00 ? 254  GLU A CG    1 
ATOM   1953  C  CD    . GLU A  1  254  ? 153.751 192.656 147.958 1.00 0.00 ? 254  GLU A CD    1 
ATOM   1954  O  OE1   . GLU A  1  254  ? 153.614 193.888 148.108 1.00 0.00 ? 254  GLU A OE1   1 
ATOM   1955  O  OE2   . GLU A  1  254  ? 153.934 192.123 146.843 1.00 0.00 ? 254  GLU A OE2   1 
ATOM   1956  N  N     . THR A  1  255  ? 155.749 190.582 151.426 1.00 0.00 ? 255  THR A N     1 
ATOM   1957  C  CA    . THR A  1  255  ? 156.260 189.236 151.640 1.00 0.00 ? 255  THR A CA    1 
ATOM   1958  C  C     . THR A  1  255  ? 156.957 189.156 152.997 1.00 0.00 ? 255  THR A C     1 
ATOM   1959  O  O     . THR A  1  255  ? 157.226 188.064 153.500 1.00 0.00 ? 255  THR A O     1 
ATOM   1960  C  CB    . THR A  1  255  ? 157.251 188.824 150.536 1.00 0.00 ? 255  THR A CB    1 
ATOM   1961  O  OG1   . THR A  1  255  ? 158.546 189.365 150.826 1.00 0.00 ? 255  THR A OG1   1 
ATOM   1962  C  CG2   . THR A  1  255  ? 156.783 189.336 149.183 1.00 0.00 ? 255  THR A CG2   1 
ATOM   1963  N  N     . TYR A  1  256  ? 157.257 190.319 153.573 1.00 0.00 ? 256  TYR A N     1 
ATOM   1964  C  CA    . TYR A  1  256  ? 157.897 190.402 154.877 1.00 0.00 ? 256  TYR A CA    1 
ATOM   1965  C  C     . TYR A  1  256  ? 157.068 189.609 155.874 1.00 0.00 ? 256  TYR A C     1 
ATOM   1966  O  O     . TYR A  1  256  ? 157.612 188.922 156.738 1.00 0.00 ? 256  TYR A O     1 
ATOM   1967  C  CB    . TYR A  1  256  ? 158.017 191.859 155.327 1.00 0.00 ? 256  TYR A CB    1 
ATOM   1968  C  CG    . TYR A  1  256  ? 159.190 192.592 154.718 1.00 0.00 ? 256  TYR A CG    1 
ATOM   1969  C  CD1   . TYR A  1  256  ? 160.338 191.911 154.336 1.00 0.00 ? 256  TYR A CD1   1 
ATOM   1970  C  CD2   . TYR A  1  256  ? 159.150 193.966 154.523 1.00 0.00 ? 256  TYR A CD2   1 
ATOM   1971  C  CE1   . TYR A  1  256  ? 161.413 192.577 153.779 1.00 0.00 ? 256  TYR A CE1   1 
ATOM   1972  C  CE2   . TYR A  1  256  ? 160.220 194.641 153.967 1.00 0.00 ? 256  TYR A CE2   1 
ATOM   1973  C  CZ    . TYR A  1  256  ? 161.348 193.942 153.597 1.00 0.00 ? 256  TYR A CZ    1 
ATOM   1974  O  OH    . TYR A  1  256  ? 162.416 194.609 153.042 1.00 0.00 ? 256  TYR A OH    1 
ATOM   1975  N  N     . ILE A  1  257  ? 155.747 189.704 155.750 1.00 0.00 ? 257  ILE A N     1 
ATOM   1976  C  CA    . ILE A  1  257  ? 154.873 188.950 156.631 1.00 0.00 ? 257  ILE A CA    1 
ATOM   1977  C  C     . ILE A  1  257  ? 154.558 187.627 155.962 1.00 0.00 ? 257  ILE A C     1 
ATOM   1978  O  O     . ILE A  1  257  ? 154.384 187.543 154.743 1.00 0.00 ? 257  ILE A O     1 
ATOM   1979  C  CB    . ILE A  1  257  ? 153.602 189.742 156.963 1.00 0.00 ? 257  ILE A CB    1 
ATOM   1980  C  CG1   . ILE A  1  257  ? 152.883 190.098 155.675 1.00 0.00 ? 257  ILE A CG1   1 
ATOM   1981  C  CG2   . ILE A  1  257  ? 153.959 190.981 157.729 1.00 0.00 ? 257  ILE A CG2   1 
ATOM   1982  C  CD1   . ILE A  1  257  ? 151.595 190.790 155.902 1.00 0.00 ? 257  ILE A CD1   1 
ATOM   1983  N  N     . TRP A  1  258  ? 154.517 186.573 156.766 1.00 0.00 ? 258  TRP A N     1 
ATOM   1984  C  CA    . TRP A  1  258  ? 154.377 185.230 156.226 1.00 0.00 ? 258  TRP A CA    1 
ATOM   1985  C  C     . TRP A  1  258  ? 153.055 185.109 155.501 1.00 0.00 ? 258  TRP A C     1 
ATOM   1986  O  O     . TRP A  1  258  ? 152.042 185.658 155.939 1.00 0.00 ? 258  TRP A O     1 
ATOM   1987  C  CB    . TRP A  1  258  ? 154.444 184.185 157.328 1.00 0.00 ? 258  TRP A CB    1 
ATOM   1988  C  CG    . TRP A  1  258  ? 155.732 184.075 157.996 1.00 0.00 ? 258  TRP A CG    1 
ATOM   1989  C  CD1   . TRP A  1  258  ? 156.055 184.563 159.211 1.00 0.00 ? 258  TRP A CD1   1 
ATOM   1990  C  CD2   . TRP A  1  258  ? 156.898 183.436 157.492 1.00 0.00 ? 258  TRP A CD2   1 
ATOM   1991  N  NE1   . TRP A  1  258  ? 157.350 184.258 159.511 1.00 0.00 ? 258  TRP A NE1   1 
ATOM   1992  C  CE2   . TRP A  1  258  ? 157.896 183.575 158.462 1.00 0.00 ? 258  TRP A CE2   1 
ATOM   1993  C  CE3   . TRP A  1  258  ? 157.196 182.768 156.311 1.00 0.00 ? 258  TRP A CE3   1 
ATOM   1994  C  CZ2   . TRP A  1  258  ? 159.168 183.063 158.297 1.00 0.00 ? 258  TRP A CZ2   1 
ATOM   1995  C  CZ3   . TRP A  1  258  ? 158.458 182.270 156.142 1.00 0.00 ? 258  TRP A CZ3   1 
ATOM   1996  C  CH2   . TRP A  1  258  ? 159.429 182.410 157.134 1.00 0.00 ? 258  TRP A CH2   1 
ATOM   1997  N  N     . ARG A  1  259  ? 153.065 184.398 154.388 1.00 0.00 ? 259  ARG A N     1 
ATOM   1998  C  CA    . ARG A  1  259  ? 151.853 183.859 153.795 1.00 0.00 ? 259  ARG A CA    1 
ATOM   1999  C  C     . ARG A  1  259  ? 151.983 182.385 153.493 1.00 0.00 ? 259  ARG A C     1 
ATOM   2000  O  O     . ARG A  1  259  ? 151.262 181.578 154.077 1.00 0.00 ? 259  ARG A O     1 
ATOM   2001  C  CB    . ARG A  1  259  ? 151.486 184.631 152.529 1.00 0.00 ? 259  ARG A CB    1 
ATOM   2002  C  CG    . ARG A  1  259  ? 151.118 186.066 152.821 1.00 0.00 ? 259  ARG A CG    1 
ATOM   2003  C  CD    . ARG A  1  259  ? 150.805 186.845 151.568 1.00 0.00 ? 259  ARG A CD    1 
ATOM   2004  N  NE    . ARG A  1  259  ? 149.633 186.309 150.894 1.00 0.00 ? 259  ARG A NE    1 
ATOM   2005  C  CZ    . ARG A  1  259  ? 149.150 186.795 149.761 1.00 0.00 ? 259  ARG A CZ    1 
ATOM   2006  N  NH1   . ARG A  1  259  ? 149.732 187.837 149.200 1.00 0.00 ? 259  ARG A NH1   1 
ATOM   2007  N  NH2   . ARG A  1  259  ? 148.081 186.253 149.201 1.00 0.00 ? 259  ARG A NH2   1 
ATOM   2008  N  N     . TYR A  1  260  ? 152.905 182.008 152.620 1.00 0.00 ? 260  TYR A N     1 
ATOM   2009  C  CA    . TYR A  1  260  ? 153.243 180.612 152.397 1.00 0.00 ? 260  TYR A CA    1 
ATOM   2010  C  C     . TYR A  1  260  ? 154.526 180.306 153.144 1.00 0.00 ? 260  TYR A C     1 
ATOM   2011  O  O     . TYR A  1  260  ? 155.592 180.797 152.777 1.00 0.00 ? 260  TYR A O     1 
ATOM   2012  C  CB    . TYR A  1  260  ? 153.414 180.326 150.914 1.00 0.00 ? 260  TYR A CB    1 
ATOM   2013  C  CG    . TYR A  1  260  ? 152.153 180.502 150.115 1.00 0.00 ? 260  TYR A CG    1 
ATOM   2014  C  CD1   . TYR A  1  260  ? 151.270 179.456 149.941 1.00 0.00 ? 260  TYR A CD1   1 
ATOM   2015  C  CD2   . TYR A  1  260  ? 151.843 181.716 149.541 1.00 0.00 ? 260  TYR A CD2   1 
ATOM   2016  C  CE1   . TYR A  1  260  ? 150.120 179.611 149.208 1.00 0.00 ? 260  TYR A CE1   1 
ATOM   2017  C  CE2   . TYR A  1  260  ? 150.693 181.882 148.809 1.00 0.00 ? 260  TYR A CE2   1 
ATOM   2018  C  CZ    . TYR A  1  260  ? 149.831 180.827 148.648 1.00 0.00 ? 260  TYR A CZ    1 
ATOM   2019  O  OH    . TYR A  1  260  ? 148.679 180.996 147.914 1.00 0.00 ? 260  TYR A OH    1 
ATOM   2020  N  N     . LEU A  1  261  ? 154.427 179.495 154.179 1.00 0.00 ? 261  LEU A N     1 
ATOM   2021  C  CA    . LEU A  1  261  ? 155.594 179.179 154.985 1.00 0.00 ? 261  LEU A CA    1 
ATOM   2022  C  C     . LEU A  1  261  ? 156.454 178.067 154.423 1.00 0.00 ? 261  LEU A C     1 
ATOM   2023  O  O     . LEU A  1  261  ? 155.979 176.932 154.315 1.00 0.00 ? 261  LEU A O     1 
ATOM   2024  C  CB    . LEU A  1  261  ? 155.179 178.871 156.409 1.00 0.00 ? 261  LEU A CB    1 
ATOM   2025  C  CG    . LEU A  1  261  ? 156.315 178.389 157.292 1.00 0.00 ? 261  LEU A CG    1 
ATOM   2026  C  CD1   . LEU A  1  261  ? 157.324 179.471 157.425 1.00 0.00 ? 261  LEU A CD1   1 
ATOM   2027  C  CD2   . LEU A  1  261  ? 155.781 178.022 158.642 1.00 0.00 ? 261  LEU A CD2   1 
ATOM   2028  N  N     . PRO A  1  262  ? 157.697 178.389 154.039 1.00 0.00 ? 262  PRO A N     1 
ATOM   2029  C  CA    . PRO A  1  262  ? 158.650 177.445 153.443 1.00 0.00 ? 262  PRO A CA    1 
ATOM   2030  C  C     . PRO A  1  262  ? 159.039 176.279 154.347 1.00 0.00 ? 262  PRO A C     1 
ATOM   2031  O  O     . PRO A  1  262  ? 159.698 176.480 155.367 1.00 0.00 ? 262  PRO A O     1 
ATOM   2032  C  CB    . PRO A  1  262  ? 159.881 178.318 153.164 1.00 0.00 ? 262  PRO A CB    1 
ATOM   2033  C  CG    . PRO A  1  262  ? 159.365 179.717 153.120 1.00 0.00 ? 262  PRO A CG    1 
ATOM   2034  C  CD    . PRO A  1  262  ? 158.249 179.751 154.120 1.00 0.00 ? 262  PRO A CD    1 
ATOM   2035  N  N     . ALA A  1  263  ? 158.630 175.072 153.967 1.00 0.00 ? 263  ALA A N     1 
ATOM   2036  C  CA    . ALA A  1  263  ? 158.973 173.875 154.722 1.00 0.00 ? 263  ALA A CA    1 
ATOM   2037  C  C     . ALA A  1  263  ? 160.383 173.487 154.304 1.00 0.00 ? 263  ALA A C     1 
ATOM   2038  O  O     . ALA A  1  263  ? 160.686 173.444 153.111 1.00 0.00 ? 263  ALA A O     1 
ATOM   2039  C  CB    . ALA A  1  263  ? 157.995 172.753 154.420 1.00 0.00 ? 263  ALA A CB    1 
ATOM   2040  N  N     . PRO A  1  264  ? 161.258 173.201 155.278 1.00 0.00 ? 264  PRO A N     1 
ATOM   2041  C  CA    . PRO A  1  264  ? 162.620 172.875 154.903 1.00 0.00 ? 264  PRO A CA    1 
ATOM   2042  C  C     . PRO A  1  264  ? 162.722 171.429 154.468 1.00 0.00 ? 264  PRO A C     1 
ATOM   2043  O  O     . PRO A  1  264  ? 161.829 170.622 154.752 1.00 0.00 ? 264  PRO A O     1 
ATOM   2044  C  CB    . PRO A  1  264  ? 163.412 173.129 156.196 1.00 0.00 ? 264  PRO A CB    1 
ATOM   2045  C  CG    . PRO A  1  264  ? 162.446 172.814 157.255 1.00 0.00 ? 264  PRO A CG    1 
ATOM   2046  C  CD    . PRO A  1  264  ? 161.089 173.245 156.736 1.00 0.00 ? 264  PRO A CD    1 
ATOM   2047  N  N     . PRO A  1  265  ? 163.790 171.057 153.773 1.00 0.00 ? 265  PRO A N     1 
ATOM   2048  C  CA    . PRO A  1  265  ? 163.914 169.686 153.280 1.00 0.00 ? 265  PRO A CA    1 
ATOM   2049  C  C     . PRO A  1  265  ? 163.979 168.679 154.412 1.00 0.00 ? 265  PRO A C     1 
ATOM   2050  O  O     . PRO A  1  265  ? 163.961 169.023 155.593 1.00 0.00 ? 265  PRO A O     1 
ATOM   2051  C  CB    . PRO A  1  265  ? 165.224 169.710 152.494 1.00 0.00 ? 265  PRO A CB    1 
ATOM   2052  C  CG    . PRO A  1  265  ? 165.374 171.125 152.082 1.00 0.00 ? 265  PRO A CG    1 
ATOM   2053  C  CD    . PRO A  1  265  ? 164.835 171.930 153.218 1.00 0.00 ? 265  PRO A CD    1 
ATOM   2054  N  N     . VAL A  1  266  ? 164.048 167.405 154.034 1.00 0.00 ? 266  VAL A N     1 
ATOM   2055  C  CA    . VAL A  1  266  ? 164.235 166.383 155.049 1.00 0.00 ? 266  VAL A CA    1 
ATOM   2056  C  C     . VAL A  1  266  ? 165.695 166.312 155.442 1.00 0.00 ? 266  VAL A C     1 
ATOM   2057  O  O     . VAL A  1  266  ? 166.022 166.126 156.618 1.00 0.00 ? 266  VAL A O     1 
ATOM   2058  C  CB    . VAL A  1  266  ? 163.728 165.029 154.549 1.00 0.00 ? 266  VAL A CB    1 
ATOM   2059  C  CG1   . VAL A  1  266  ? 163.835 164.010 155.650 1.00 0.00 ? 266  VAL A CG1   1 
ATOM   2060  C  CG2   . VAL A  1  266  ? 162.315 165.162 154.080 1.00 0.00 ? 266  VAL A CG2   1 
ATOM   2061  N  N     . CYS A  1  267  ? 166.597 166.470 154.475 1.00 0.00 ? 267  CYS A N     1 
ATOM   2062  C  CA    . CYS A  1  267  ? 168.020 166.406 154.763 1.00 0.00 ? 267  CYS A CA    1 
ATOM   2063  C  C     . CYS A  1  267  ? 168.476 167.528 155.686 1.00 0.00 ? 267  CYS A C     1 
ATOM   2064  O  O     . CYS A  1  267  ? 169.588 167.467 156.213 1.00 0.00 ? 267  CYS A O     1 
ATOM   2065  C  CB    . CYS A  1  267  ? 168.812 166.433 153.460 1.00 0.00 ? 267  CYS A CB    1 
ATOM   2066  S  SG    . CYS A  1  267  ? 170.585 166.226 153.678 1.00 0.00 ? 267  CYS A SG    1 
ATOM   2067  N  N     . ILE A  1  268  ? 167.653 168.554 155.891 1.00 0.00 ? 268  ILE A N     1 
ATOM   2068  C  CA    . ILE A  1  268  ? 167.947 169.525 156.936 1.00 0.00 ? 268  ILE A CA    1 
ATOM   2069  C  C     . ILE A  1  268  ? 167.444 168.980 158.256 1.00 0.00 ? 268  ILE A C     1 
ATOM   2070  O  O     . ILE A  1  268  ? 168.064 169.171 159.303 1.00 0.00 ? 268  ILE A O     1 
ATOM   2071  C  CB    . ILE A  1  268  ? 167.278 170.871 156.637 1.00 0.00 ? 268  ILE A CB    1 
ATOM   2072  C  CG1   . ILE A  1  268  ? 167.610 171.302 155.224 1.00 0.00 ? 268  ILE A CG1   1 
ATOM   2073  C  CG2   . ILE A  1  268  ? 167.686 171.905 157.662 1.00 0.00 ? 268  ILE A CG2   1 
ATOM   2074  C  CD1   . ILE A  1  268  ? 169.044 171.337 154.945 1.00 0.00 ? 268  ILE A CD1   1 
ATOM   2075  N  N     . ARG A  1  269  ? 166.293 168.318 158.235 1.00 0.00 ? 269  ARG A N     1 
ATOM   2076  C  CA    . ARG A  1  269  ? 165.657 167.821 159.443 1.00 0.00 ? 269  ARG A CA    1 
ATOM   2077  C  C     . ARG A  1  269  ? 165.562 166.301 159.426 1.00 0.00 ? 269  ARG A C     1 
ATOM   2078  O  O     . ARG A  1  269  ? 164.463 165.730 159.383 1.00 0.00 ? 269  ARG A O     1 
ATOM   2079  C  CB    . ARG A  1  269  ? 164.283 168.454 159.614 1.00 0.00 ? 269  ARG A CB    1 
ATOM   2080  C  CG    . ARG A  1  269  ? 163.395 168.152 158.457 1.00 0.00 ? 269  ARG A CG    1 
ATOM   2081  C  CD    . ARG A  1  269  ? 162.007 168.706 158.691 1.00 0.00 ? 269  ARG A CD    1 
ATOM   2082  N  NE    . ARG A  1  269  ? 161.074 168.403 157.610 1.00 0.00 ? 269  ARG A NE    1 
ATOM   2083  C  CZ    . ARG A  1  269  ? 159.815 168.835 157.568 1.00 0.00 ? 269  ARG A CZ    1 
ATOM   2084  N  NH1   . ARG A  1  269  ? 159.323 169.596 158.527 1.00 0.00 ? 269  ARG A NH1   1 
ATOM   2085  N  NH2   . ARG A  1  269  ? 159.038 168.495 156.544 1.00 0.00 ? 269  ARG A NH2   1 
ATOM   2086  N  N     . PRO A  1  270  ? 166.697 165.620 159.440 1.00 0.00 ? 270  PRO A N     1 
ATOM   2087  C  CA    . PRO A  1  270  ? 166.676 164.162 159.319 1.00 0.00 ? 270  PRO A CA    1 
ATOM   2088  C  C     . PRO A  1  270  ? 165.957 163.525 160.486 1.00 0.00 ? 270  PRO A C     1 
ATOM   2089  O  O     . PRO A  1  270  ? 166.229 163.837 161.646 1.00 0.00 ? 270  PRO A O     1 
ATOM   2090  C  CB    . PRO A  1  270  ? 168.145 163.744 159.283 1.00 0.00 ? 270  PRO A CB    1 
ATOM   2091  C  CG    . PRO A  1  270  ? 168.822 164.763 160.124 1.00 0.00 ? 270  PRO A CG    1 
ATOM   2092  C  CD    . PRO A  1  270  ? 168.087 166.057 159.884 1.00 0.00 ? 270  PRO A CD    1 
ATOM   2093  N  N     . SER A  1  271  ? 165.017 162.647 160.170 1.00 0.00 ? 271  SER A N     1 
ATOM   2094  C  CA    . SER A  1  271  ? 164.461 161.789 161.199 1.00 0.00 ? 271  SER A CA    1 
ATOM   2095  C  C     . SER A  1  271  ? 165.597 161.002 161.829 1.00 0.00 ? 271  SER A C     1 
ATOM   2096  O  O     . SER A  1  271  ? 166.439 160.433 161.132 1.00 0.00 ? 271  SER A O     1 
ATOM   2097  C  CB    . SER A  1  271  ? 163.409 160.848 160.614 1.00 0.00 ? 271  SER A CB    1 
ATOM   2098  O  OG    . SER A  1  271  ? 162.863 160.011 161.617 1.00 0.00 ? 271  SER A OG    1 
ATOM   2099  N  N     . VAL A  1  272  ? 165.630 160.988 163.158 1.00 0.00 ? 272  VAL A N     1 
ATOM   2100  C  CA    . VAL A  1  272  ? 166.705 160.315 163.868 1.00 0.00 ? 272  VAL A CA    1 
ATOM   2101  C  C     . VAL A  1  272  ? 166.632 158.829 163.545 1.00 0.00 ? 272  VAL A C     1 
ATOM   2102  O  O     . VAL A  1  272  ? 165.621 158.339 163.026 1.00 0.00 ? 272  VAL A O     1 
ATOM   2103  C  CB    . VAL A  1  272  ? 166.582 160.595 165.378 1.00 0.00 ? 272  VAL A CB    1 
ATOM   2104  C  CG1   . VAL A  1  272  ? 167.718 159.977 166.170 1.00 0.00 ? 272  VAL A CG1   1 
ATOM   2105  C  CG2   . VAL A  1  272  ? 166.524 162.084 165.628 1.00 0.00 ? 272  VAL A CG2   1 
ATOM   2106  N  N     . MET A  1  273  ? 167.729 158.115 163.790 1.00 0.00 ? 273  MET A N     1 
ATOM   2107  C  CA    . MET A  1  273  ? 167.790 156.703 163.455 1.00 0.00 ? 273  MET A CA    1 
ATOM   2108  C  C     . MET A  1  273  ? 166.553 155.985 163.979 1.00 0.00 ? 273  MET A C     1 
ATOM   2109  O  O     . MET A  1  273  ? 166.063 156.253 165.074 1.00 0.00 ? 273  MET A O     1 
ATOM   2110  C  CB    . MET A  1  273  ? 169.053 156.059 164.033 1.00 0.00 ? 273  MET A CB    1 
ATOM   2111  C  CG    . MET A  1  273  ? 169.126 156.034 165.557 1.00 0.00 ? 273  MET A CG    1 
ATOM   2112  S  SD    . MET A  1  273  ? 170.699 155.434 166.220 1.00 0.00 ? 273  MET A SD    1 
ATOM   2113  C  CE    . MET A  1  273  ? 171.681 156.929 166.266 1.00 0.00 ? 273  MET A CE    1 
ATOM   2114  N  N     . MET A  1  274  ? 166.013 155.097 163.143 1.00 0.00 ? 274  MET A N     1 
ATOM   2115  C  CA    . MET A  1  274  ? 164.802 154.381 163.523 1.00 0.00 ? 274  MET A CA    1 
ATOM   2116  C  C     . MET A  1  274  ? 165.012 153.593 164.806 1.00 0.00 ? 274  MET A C     1 
ATOM   2117  O  O     . MET A  1  274  ? 164.055 153.352 165.550 1.00 0.00 ? 274  MET A O     1 
ATOM   2118  C  CB    . MET A  1  274  ? 164.361 153.473 162.378 1.00 0.00 ? 274  MET A CB    1 
ATOM   2119  C  CG    . MET A  1  274  ? 163.936 154.249 161.148 1.00 0.00 ? 274  MET A CG    1 
ATOM   2120  S  SD    . MET A  1  274  ? 163.528 153.203 159.741 1.00 0.00 ? 274  MET A SD    1 
ATOM   2121  C  CE    . MET A  1  274  ? 163.099 154.442 158.518 1.00 0.00 ? 274  MET A CE    1 
ATOM   2122  N  N     . GLN A  1  275  ? 166.257 153.205 165.065 1.00 0.00 ? 275  GLN A N     1 
ATOM   2123  C  CA    . GLN A  1  275  ? 166.599 152.451 166.266 1.00 0.00 ? 275  GLN A CA    1 
ATOM   2124  C  C     . GLN A  1  275  ? 165.722 151.216 166.438 1.00 0.00 ? 275  GLN A C     1 
ATOM   2125  O  O     . GLN A  1  275  ? 164.786 150.993 165.669 1.00 0.00 ? 275  GLN A O     1 
ATOM   2126  C  CB    . GLN A  1  275  ? 166.494 153.344 167.505 1.00 0.00 ? 275  GLN A CB    1 
ATOM   2127  C  CG    . GLN A  1  275  ? 166.486 154.833 167.198 1.00 0.00 ? 275  GLN A CG    1 
ATOM   2128  C  CD    . GLN A  1  275  ? 166.908 155.675 168.385 1.00 0.00 ? 275  GLN A CD    1 
ATOM   2129  O  OE1   . GLN A  1  275  ? 168.098 155.857 168.641 1.00 0.00 ? 275  GLN A OE1   1 
ATOM   2130  N  NE2   . GLN A  1  275  ? 165.930 156.193 169.120 1.00 0.00 ? 275  GLN A NE2   1 
ATOM   2131  N  N     . ASP A  1  276  ? 166.033 150.417 167.453 1.00 0.00 ? 276  ASP A N     1 
ATOM   2132  C  CA    . ASP A  1  276  ? 165.279 149.202 167.735 1.00 0.00 ? 276  ASP A CA    1 
ATOM   2133  C  C     . ASP A  1  276  ? 163.904 149.529 168.308 1.00 0.00 ? 276  ASP A C     1 
ATOM   2134  O  O     . ASP A  1  276  ? 163.791 150.089 169.398 1.00 0.00 ? 276  ASP A O     1 
ATOM   2135  C  CB    . ASP A  1  276  ? 166.052 148.304 168.703 1.00 0.00 ? 276  ASP A CB    1 
ATOM   2136  C  CG    . ASP A  1  276  ? 165.321 147.011 169.008 1.00 0.00 ? 276  ASP A CG    1 
ATOM   2137  O  OD1   . ASP A  1  276  ? 165.126 146.203 168.075 1.00 0.00 ? 276  ASP A OD1   1 
ATOM   2138  O  OD2   . ASP A  1  276  ? 164.941 146.803 170.179 1.00 0.00 ? 276  ASP A OD2   1 
ATOM   2139  N  N     . SER A  1  277  ? 162.862 149.174 167.564 1.00 0.00 ? 277  SER A N     1 
ATOM   2140  C  CA    . SER A  1  277  ? 161.479 149.428 167.994 1.00 0.00 ? 277  SER A CA    1 
ATOM   2141  C  C     . SER A  1  277  ? 160.914 150.681 167.326 1.00 0.00 ? 277  SER A C     1 
ATOM   2142  O  O     . SER A  1  277  ? 161.683 151.517 166.834 1.00 0.00 ? 277  SER A O     1 
ATOM   2143  C  CB    . SER A  1  277  ? 161.385 149.552 169.522 1.00 0.00 ? 277  SER A CB    1 
ATOM   2144  O  OG    . SER A  1  277  ? 161.743 148.343 170.166 1.00 0.00 ? 277  SER A OG    1 
ATOM   2145  N  N     . PRO A  1  278  ? 159.583 150.835 167.267 1.00 0.00 ? 278  PRO A N     1 
ATOM   2146  C  CA    . PRO A  1  278  ? 158.978 151.662 166.212 1.00 0.00 ? 278  PRO A CA    1 
ATOM   2147  C  C     . PRO A  1  278  ? 159.351 153.124 166.241 1.00 0.00 ? 278  PRO A C     1 
ATOM   2148  O  O     . PRO A  1  278  ? 159.627 153.694 165.177 1.00 0.00 ? 278  PRO A O     1 
ATOM   2149  C  CB    . PRO A  1  278  ? 157.471 151.496 166.461 1.00 0.00 ? 278  PRO A CB    1 
ATOM   2150  C  CG    . PRO A  1  278  ? 157.366 151.195 167.892 1.00 0.00 ? 278  PRO A CG    1 
ATOM   2151  C  CD    . PRO A  1  278  ? 158.550 150.326 168.189 1.00 0.00 ? 278  PRO A CD    1 
ATOM   2152  N  N     . ALA A  1  279  ? 159.372 153.761 167.405 1.00 0.00 ? 279  ALA A N     1 
ATOM   2153  C  CA    . ALA A  1  279  ? 159.509 155.210 167.435 1.00 0.00 ? 279  ALA A CA    1 
ATOM   2154  C  C     . ALA A  1  279  ? 160.972 155.551 167.187 1.00 0.00 ? 279  ALA A C     1 
ATOM   2155  O  O     . ALA A  1  279  ? 161.878 155.204 167.948 1.00 0.00 ? 279  ALA A O     1 
ATOM   2156  C  CB    . ALA A  1  279  ? 159.004 155.777 168.755 1.00 0.00 ? 279  ALA A CB    1 
ATOM   2157  N  N     . SER A  1  280  ? 161.190 156.237 166.073 1.00 0.00 ? 280  SER A N     1 
ATOM   2158  C  CA    . SER A  1  280  ? 162.410 156.987 165.866 1.00 0.00 ? 280  SER A CA    1 
ATOM   2159  C  C     . SER A  1  280  ? 162.215 158.367 166.457 1.00 0.00 ? 280  SER A C     1 
ATOM   2160  O  O     . SER A  1  280  ? 161.123 158.935 166.384 1.00 0.00 ? 280  SER A O     1 
ATOM   2161  C  CB    . SER A  1  280  ? 162.731 157.102 164.380 1.00 0.00 ? 280  SER A CB    1 
ATOM   2162  O  OG    . SER A  1  280  ? 161.724 157.843 163.722 1.00 0.00 ? 280  SER A OG    1 
ATOM   2163  N  N     . ASN A  1  281  ? 163.268 158.901 167.058 1.00 0.00 ? 281  ASN A N     1 
ATOM   2164  C  CA    . ASN A  1  281  ? 163.168 160.225 167.645 1.00 0.00 ? 281  ASN A CA    1 
ATOM   2165  C  C     . ASN A  1  281  ? 162.818 161.239 166.567 1.00 0.00 ? 281  ASN A C     1 
ATOM   2166  O  O     . ASN A  1  281  ? 163.228 161.101 165.411 1.00 0.00 ? 281  ASN A O     1 
ATOM   2167  C  CB    . ASN A  1  281  ? 164.472 160.609 168.324 1.00 0.00 ? 281  ASN A CB    1 
ATOM   2168  C  CG    . ASN A  1  281  ? 164.304 161.777 169.252 1.00 0.00 ? 281  ASN A CG    1 
ATOM   2169  O  OD1   . ASN A  1  281  ? 163.265 161.926 169.894 1.00 0.00 ? 281  ASN A OD1   1 
ATOM   2170  N  ND2   . ASN A  1  281  ? 165.313 162.633 169.313 1.00 0.00 ? 281  ASN A ND2   1 
ATOM   2171  N  N     . GLU A  1  282  ? 162.049 162.250 166.948 1.00 0.00 ? 282  GLU A N     1 
ATOM   2172  C  CA    . GLU A  1  282  ? 161.635 163.286 166.025 1.00 0.00 ? 282  GLU A CA    1 
ATOM   2173  C  C     . GLU A  1  282  ? 162.940 164.043 165.868 1.00 0.00 ? 282  GLU A C     1 
ATOM   2174  O  O     . GLU A  1  282  ? 163.975 163.677 166.429 1.00 0.00 ? 282  GLU A O     1 
ATOM   2175  C  CB    . GLU A  1  282  ? 160.524 164.139 166.632 1.00 0.00 ? 282  GLU A CB    1 
ATOM   2176  C  CG    . GLU A  1  282  ? 161.009 165.126 167.714 1.00 0.00 ? 282  GLU A CG    1 
ATOM   2177  C  CD    . GLU A  1  282  ? 161.241 164.487 169.075 1.00 0.00 ? 282  GLU A CD    1 
ATOM   2178  O  OE1   . GLU A  1  282  ? 161.025 163.264 169.200 1.00 0.00 ? 282  GLU A OE1   1 
ATOM   2179  O  OE2   . GLU A  1  282  ? 161.659 165.208 170.012 1.00 0.00 ? 282  GLU A OE2   1 
ATOM   2180  N  N     . ASP A  1  283  ? 162.889 165.119 165.091 1.00 0.00 ? 283  ASP A N     1 
ATOM   2181  C  CA    . ASP A  1  283  ? 164.001 166.036 164.928 1.00 0.00 ? 283  ASP A CA    1 
ATOM   2182  C  C     . ASP A  1  283  ? 163.283 167.426 164.757 1.00 0.00 ? 283  ASP A C     1 
ATOM   2183  O  O     . ASP A  1  283  ? 162.807 167.823 163.693 1.00 0.00 ? 283  ASP A O     1 
ATOM   2184  C  CB    . ASP A  1  283  ? 164.837 165.654 163.704 1.00 0.00 ? 283  ASP A CB    1 
ATOM   2185  C  CG    . ASP A  1  283  ? 166.039 166.559 163.515 1.00 0.00 ? 283  ASP A CG    1 
ATOM   2186  O  OD1   . ASP A  1  283  ? 166.937 166.545 164.383 1.00 0.00 ? 283  ASP A OD1   1 
ATOM   2187  O  OD2   . ASP A  1  283  ? 166.085 167.283 162.499 1.00 0.00 ? 283  ASP A OD2   1 
ATOM   2188  N  N     . ASP A  1  284  ? 163.259 168.163 165.863 1.00 0.00 ? 284  ASP A N     1 
ATOM   2189  C  CA    . ASP A  1  284  ? 162.672 169.505 165.938 1.00 0.00 ? 284  ASP A CA    1 
ATOM   2190  C  C     . ASP A  1  284  ? 161.656 169.883 164.853 1.00 0.00 ? 284  ASP A C     1 
ATOM   2191  O  O     . ASP A  1  284  ? 160.484 169.517 164.945 1.00 0.00 ? 284  ASP A O     1 
ATOM   2192  C  CB    . ASP A  1  284  ? 163.781 170.561 165.991 1.00 0.00 ? 284  ASP A CB    1 
ATOM   2193  C  CG    . ASP A  1  284  ? 164.376 170.712 167.377 1.00 0.00 ? 284  ASP A CG    1 
ATOM   2194  O  OD1   . ASP A  1  284  ? 163.877 170.055 168.315 1.00 0.00 ? 284  ASP A OD1   1 
ATOM   2195  O  OD2   . ASP A  1  284  ? 165.343 171.488 167.529 1.00 0.00 ? 284  ASP A OD2   1 
ATOM   2196  N  N     . LEU A  1  285  ? 162.125 170.641 163.858 1.00 0.00 ? 285  LEU A N     1 
ATOM   2197  C  CA    . LEU A  1  285  ? 161.321 171.146 162.731 1.00 0.00 ? 285  LEU A CA    1 
ATOM   2198  C  C     . LEU A  1  285  ? 160.246 170.195 162.209 1.00 0.00 ? 285  LEU A C     1 
ATOM   2199  O  O     . LEU A  1  285  ? 159.279 170.613 161.572 1.00 0.00 ? 285  LEU A O     1 
ATOM   2200  C  CB    . LEU A  1  285  ? 162.236 171.573 161.579 1.00 0.00 ? 285  LEU A CB    1 
ATOM   2201  C  CG    . LEU A  1  285  ? 162.904 172.943 161.715 1.00 0.00 ? 285  LEU A CG    1 
ATOM   2202  C  CD1   . LEU A  1  285  ? 163.060 173.321 163.180 1.00 0.00 ? 285  LEU A CD1   1 
ATOM   2203  C  CD2   . LEU A  1  285  ? 164.250 172.957 161.007 1.00 0.00 ? 285  LEU A CD2   1 
ATOM   2204  N  N     . THR A  1  286  ? 160.433 168.914 162.492 1.00 0.00 ? 286  THR A N     1 
ATOM   2205  C  CA    . THR A  1  286  ? 159.498 167.866 162.099 1.00 0.00 ? 286  THR A CA    1 
ATOM   2206  C  C     . THR A  1  286  ? 158.267 167.857 163.000 1.00 0.00 ? 286  THR A C     1 
ATOM   2207  O  O     . THR A  1  286  ? 157.214 167.343 162.623 1.00 0.00 ? 286  THR A O     1 
ATOM   2208  C  CB    . THR A  1  286  ? 160.159 166.476 162.134 1.00 0.00 ? 286  THR A CB    1 
ATOM   2209  O  OG1   . THR A  1  286  ? 161.264 166.446 161.222 1.00 0.00 ? 286  THR A OG1   1 
ATOM   2210  C  CG2   . THR A  1  286  ? 159.157 165.400 161.747 1.00 0.00 ? 286  THR A CG2   1 
ATOM   2211  N  N     . VAL A  1  287  ? 158.408 168.429 164.191 1.00 0.00 ? 287  VAL A N     1 
ATOM   2212  C  CA    . VAL A  1  287  ? 157.308 168.490 165.148 1.00 0.00 ? 287  VAL A CA    1 
ATOM   2213  C  C     . VAL A  1  287  ? 156.666 169.866 165.136 1.00 0.00 ? 287  VAL A C     1 
ATOM   2214  O  O     . VAL A  1  287  ? 155.436 169.984 165.087 1.00 0.00 ? 287  VAL A O     1 
ATOM   2215  C  CB    . VAL A  1  287  ? 157.786 168.101 166.556 1.00 0.00 ? 287  VAL A CB    1 
ATOM   2216  C  CG1   . VAL A  1  287  ? 156.721 168.419 167.584 1.00 0.00 ? 287  VAL A CG1   1 
ATOM   2217  C  CG2   . VAL A  1  287  ? 158.074 166.638 166.593 1.00 0.00 ? 287  VAL A CG2   1 
ATOM   2218  N  N     . LYS A  1  288  ? 157.475 170.926 165.165 1.00 0.00 ? 288  LYS A N     1 
ATOM   2219  C  CA    . LYS A  1  288  ? 156.894 172.263 165.180 1.00 0.00 ? 288  LYS A CA    1 
ATOM   2220  C  C     . LYS A  1  288  ? 155.952 172.466 164.006 1.00 0.00 ? 288  LYS A C     1 
ATOM   2221  O  O     . LYS A  1  288  ? 154.741 172.585 164.204 1.00 0.00 ? 288  LYS A O     1 
ATOM   2222  C  CB    . LYS A  1  288  ? 157.978 173.334 165.191 1.00 0.00 ? 288  LYS A CB    1 
ATOM   2223  C  CG    . LYS A  1  288  ? 158.861 173.289 166.413 1.00 0.00 ? 288  LYS A CG    1 
ATOM   2224  C  CD    . LYS A  1  288  ? 158.045 173.365 167.694 1.00 0.00 ? 288  LYS A CD    1 
ATOM   2225  C  CE    . LYS A  1  288  ? 157.467 174.745 167.915 1.00 0.00 ? 288  LYS A CE    1 
ATOM   2226  N  NZ    . LYS A  1  288  ? 156.796 174.852 169.238 1.00 0.00 ? 288  LYS A NZ    1 
ATOM   2227  N  N     . LEU A  1  289  ? 156.465 172.472 162.777 1.00 0.00 ? 289  LEU A N     1 
ATOM   2228  C  CA    . LEU A  1  289  ? 155.565 172.805 161.682 1.00 0.00 ? 289  LEU A CA    1 
ATOM   2229  C  C     . LEU A  1  289  ? 154.491 171.743 161.490 1.00 0.00 ? 289  LEU A C     1 
ATOM   2230  O  O     . LEU A  1  289  ? 153.352 172.082 161.154 1.00 0.00 ? 289  LEU A O     1 
ATOM   2231  C  CB    . LEU A  1  289  ? 156.340 173.045 160.385 1.00 0.00 ? 289  LEU A CB    1 
ATOM   2232  C  CG    . LEU A  1  289  ? 157.087 171.950 159.641 1.00 0.00 ? 289  LEU A CG    1 
ATOM   2233  C  CD1   . LEU A  1  289  ? 156.169 171.139 158.745 1.00 0.00 ? 289  LEU A CD1   1 
ATOM   2234  C  CD2   . LEU A  1  289  ? 158.170 172.598 158.825 1.00 0.00 ? 289  LEU A CD2   1 
ATOM   2235  N  N     . THR A  1  290  ? 154.807 170.470 161.729 1.00 0.00 ? 290  THR A N     1 
ATOM   2236  C  CA    . THR A  1  290  ? 153.767 169.455 161.643 1.00 0.00 ? 290  THR A CA    1 
ATOM   2237  C  C     . THR A  1  290  ? 152.657 169.706 162.647 1.00 0.00 ? 290  THR A C     1 
ATOM   2238  O  O     . THR A  1  290  ? 151.561 169.164 162.488 1.00 0.00 ? 290  THR A O     1 
ATOM   2239  C  CB    . THR A  1  290  ? 154.333 168.052 161.864 1.00 0.00 ? 290  THR A CB    1 
ATOM   2240  O  OG1   . THR A  1  290  ? 153.462 167.102 161.253 1.00 0.00 ? 290  THR A OG1   1 
ATOM   2241  C  CG2   . THR A  1  290  ? 154.363 167.709 163.339 1.00 0.00 ? 290  THR A CG2   1 
ATOM   2242  N  N     . GLU A  1  291  ? 152.931 170.491 163.684 1.00 0.00 ? 291  GLU A N     1 
ATOM   2243  C  CA    . GLU A  1  291  ? 151.865 171.059 164.487 1.00 0.00 ? 291  GLU A CA    1 
ATOM   2244  C  C     . GLU A  1  291  ? 151.269 172.294 163.824 1.00 0.00 ? 291  GLU A C     1 
ATOM   2245  O  O     . GLU A  1  291  ? 150.050 172.492 163.877 1.00 0.00 ? 291  GLU A O     1 
ATOM   2246  C  CB    . GLU A  1  291  ? 152.396 171.368 165.886 1.00 0.00 ? 291  GLU A CB    1 
ATOM   2247  C  CG    . GLU A  1  291  ? 151.405 171.988 166.827 1.00 0.00 ? 291  GLU A CG    1 
ATOM   2248  C  CD    . GLU A  1  291  ? 151.285 173.465 166.596 1.00 0.00 ? 291  GLU A CD    1 
ATOM   2249  O  OE1   . GLU A  1  291  ? 152.231 174.041 166.029 1.00 0.00 ? 291  GLU A OE1   1 
ATOM   2250  O  OE2   . GLU A  1  291  ? 150.252 174.048 166.963 1.00 0.00 ? 291  GLU A OE2   1 
ATOM   2251  N  N     . ILE A  1  292  ? 152.100 173.137 163.205 1.00 0.00 ? 292  ILE A N     1 
ATOM   2252  C  CA    . ILE A  1  292  ? 151.575 174.323 162.537 1.00 0.00 ? 292  ILE A CA    1 
ATOM   2253  C  C     . ILE A  1  292  ? 150.567 173.943 161.473 1.00 0.00 ? 292  ILE A C     1 
ATOM   2254  O  O     . ILE A  1  292  ? 149.565 174.640 161.288 1.00 0.00 ? 292  ILE A O     1 
ATOM   2255  C  CB    . ILE A  1  292  ? 152.712 175.178 161.951 1.00 0.00 ? 292  ILE A CB    1 
ATOM   2256  C  CG1   . ILE A  1  292  ? 153.418 175.930 163.068 1.00 0.00 ? 292  ILE A CG1   1 
ATOM   2257  C  CG2   . ILE A  1  292  ? 152.194 176.131 160.907 1.00 0.00 ? 292  ILE A CG2   1 
ATOM   2258  C  CD1   . ILE A  1  292  ? 154.591 176.729 162.617 1.00 0.00 ? 292  ILE A CD1   1 
ATOM   2259  N  N     . VAL A  1  293  ? 150.798 172.846 160.756 1.00 0.00 ? 293  VAL A N     1 
ATOM   2260  C  CA    . VAL A  1  293  ? 149.748 172.345 159.880 1.00 0.00 ? 293  VAL A CA    1 
ATOM   2261  C  C     . VAL A  1  293  ? 148.467 172.130 160.662 1.00 0.00 ? 293  VAL A C     1 
ATOM   2262  O  O     . VAL A  1  293  ? 147.388 172.553 160.239 1.00 0.00 ? 293  VAL A O     1 
ATOM   2263  C  CB    . VAL A  1  293  ? 150.184 171.052 159.180 1.00 0.00 ? 293  VAL A CB    1 
ATOM   2264  C  CG1   . VAL A  1  293  ? 148.978 170.384 158.583 1.00 0.00 ? 293  VAL A CG1   1 
ATOM   2265  C  CG2   . VAL A  1  293  ? 151.146 171.368 158.083 1.00 0.00 ? 293  VAL A CG2   1 
ATOM   2266  N  N     . TRP A  1  294  ? 148.565 171.479 161.818 1.00 0.00 ? 294  TRP A N     1 
ATOM   2267  C  CA    . TRP A  1  294  ? 147.366 171.189 162.594 1.00 0.00 ? 294  TRP A CA    1 
ATOM   2268  C  C     . TRP A  1  294  ? 146.616 172.460 162.949 1.00 0.00 ? 294  TRP A C     1 
ATOM   2269  O  O     . TRP A  1  294  ? 145.451 172.618 162.580 1.00 0.00 ? 294  TRP A O     1 
ATOM   2270  C  CB    . TRP A  1  294  ? 147.717 170.415 163.856 1.00 0.00 ? 294  TRP A CB    1 
ATOM   2271  C  CG    . TRP A  1  294  ? 146.545 170.237 164.737 1.00 0.00 ? 294  TRP A CG    1 
ATOM   2272  C  CD1   . TRP A  1  294  ? 146.285 170.905 165.892 1.00 0.00 ? 294  TRP A CD1   1 
ATOM   2273  C  CD2   . TRP A  1  294  ? 145.447 169.351 164.526 1.00 0.00 ? 294  TRP A CD2   1 
ATOM   2274  N  NE1   . TRP A  1  294  ? 145.096 170.480 166.423 1.00 0.00 ? 294  TRP A NE1   1 
ATOM   2275  C  CE2   . TRP A  1  294  ? 144.561 169.526 165.601 1.00 0.00 ? 294  TRP A CE2   1 
ATOM   2276  C  CE3   . TRP A  1  294  ? 145.131 168.421 163.536 1.00 0.00 ? 294  TRP A CE3   1 
ATOM   2277  C  CZ2   . TRP A  1  294  ? 143.376 168.804 165.714 1.00 0.00 ? 294  TRP A CZ2   1 
ATOM   2278  C  CZ3   . TRP A  1  294  ? 143.955 167.707 163.650 1.00 0.00 ? 294  TRP A CZ3   1 
ATOM   2279  C  CH2   . TRP A  1  294  ? 143.093 167.902 164.729 1.00 0.00 ? 294  TRP A CH2   1 
ATOM   2280  N  N     . THR A  1  295  ? 147.267 173.386 163.656 1.00 0.00 ? 295  THR A N     1 
ATOM   2281  C  CA    . THR A  1  295  ? 146.580 174.618 164.025 1.00 0.00 ? 295  THR A CA    1 
ATOM   2282  C  C     . THR A  1  295  ? 146.097 175.392 162.806 1.00 0.00 ? 295  THR A C     1 
ATOM   2283  O  O     . THR A  1  295  ? 145.021 176.005 162.857 1.00 0.00 ? 295  THR A O     1 
ATOM   2284  C  CB    . THR A  1  295  ? 147.486 175.490 164.890 1.00 0.00 ? 295  THR A CB    1 
ATOM   2285  O  OG1   . THR A  1  295  ? 146.770 176.655 165.311 1.00 0.00 ? 295  THR A OG1   1 
ATOM   2286  C  CG2   . THR A  1  295  ? 148.724 175.896 164.134 1.00 0.00 ? 295  THR A CG2   1 
ATOM   2287  N  N     . SER A  1  296  ? 146.844 175.352 161.707 1.00 0.00 ? 296  SER A N     1 
ATOM   2288  C  CA    . SER A  1  296  ? 146.356 175.941 160.472 1.00 0.00 ? 296  SER A CA    1 
ATOM   2289  C  C     . SER A  1  296  ? 145.025 175.336 160.073 1.00 0.00 ? 296  SER A C     1 
ATOM   2290  O  O     . SER A  1  296  ? 143.996 176.003 160.175 1.00 0.00 ? 296  SER A O     1 
ATOM   2291  C  CB    . SER A  1  296  ? 147.368 175.759 159.353 1.00 0.00 ? 296  SER A CB    1 
ATOM   2292  O  OG    . SER A  1  296  ? 146.834 176.255 158.141 1.00 0.00 ? 296  SER A OG    1 
ATOM   2293  N  N     . SER A  1  297  ? 145.022 174.061 159.675 1.00 0.00 ? 297  SER A N     1 
ATOM   2294  C  CA    . SER A  1  297  ? 143.791 173.406 159.238 1.00 0.00 ? 297  SER A CA    1 
ATOM   2295  C  C     . SER A  1  297  ? 142.680 173.537 160.265 1.00 0.00 ? 297  SER A C     1 
ATOM   2296  O  O     . SER A  1  297  ? 141.503 173.481 159.906 1.00 0.00 ? 297  SER A O     1 
ATOM   2297  C  CB    . SER A  1  297  ? 144.045 171.931 158.939 1.00 0.00 ? 297  SER A CB    1 
ATOM   2298  O  OG    . SER A  1  297  ? 144.872 171.778 157.803 1.00 0.00 ? 297  SER A OG    1 
ATOM   2299  N  N     . LEU A  1  298  ? 143.028 173.695 161.538 1.00 0.00 ? 298  LEU A N     1 
ATOM   2300  C  CA    . LEU A  1  298  ? 142.037 174.139 162.503 1.00 0.00 ? 298  LEU A CA    1 
ATOM   2301  C  C     . LEU A  1  298  ? 141.413 175.452 162.058 1.00 0.00 ? 298  LEU A C     1 
ATOM   2302  O  O     . LEU A  1  298  ? 140.204 175.522 161.813 1.00 0.00 ? 298  LEU A O     1 
ATOM   2303  C  CB    . LEU A  1  298  ? 142.667 174.276 163.883 1.00 0.00 ? 298  LEU A CB    1 
ATOM   2304  C  CG    . LEU A  1  298  ? 141.663 174.762 164.917 1.00 0.00 ? 298  LEU A CG    1 
ATOM   2305  C  CD1   . LEU A  1  298  ? 140.569 173.734 165.028 1.00 0.00 ? 298  LEU A CD1   1 
ATOM   2306  C  CD2   . LEU A  1  298  ? 142.329 174.983 166.261 1.00 0.00 ? 298  LEU A CD2   1 
ATOM   2307  N  N     . ILE A  1  299  ? 142.227 176.501 161.923 1.00 0.00 ? 299  ILE A N     1 
ATOM   2308  C  CA    . ILE A  1  299  ? 141.690 177.821 161.595 1.00 0.00 ? 299  ILE A CA    1 
ATOM   2309  C  C     . ILE A  1  299  ? 141.101 177.837 160.187 1.00 0.00 ? 299  ILE A C     1 
ATOM   2310  O  O     . ILE A  1  299  ? 140.343 178.741 159.825 1.00 0.00 ? 299  ILE A O     1 
ATOM   2311  C  CB    . ILE A  1  299  ? 142.790 178.876 161.776 1.00 0.00 ? 299  ILE A CB    1 
ATOM   2312  C  CG1   . ILE A  1  299  ? 143.250 178.854 163.222 1.00 0.00 ? 299  ILE A CG1   1 
ATOM   2313  C  CG2   . ILE A  1  299  ? 142.287 180.268 161.463 1.00 0.00 ? 299  ILE A CG2   1 
ATOM   2314  C  CD1   . ILE A  1  299  ? 144.461 179.685 163.475 1.00 0.00 ? 299  ILE A CD1   1 
ATOM   2315  N  N     . LYS A  1  300  ? 141.444 176.847 159.369 1.00 0.00 ? 300  LYS A N     1 
ATOM   2316  C  CA    . LYS A  1  300  ? 140.827 176.729 158.056 1.00 0.00 ? 300  LYS A CA    1 
ATOM   2317  C  C     . LYS A  1  300  ? 139.439 176.123 158.167 1.00 0.00 ? 300  LYS A C     1 
ATOM   2318  O  O     . LYS A  1  300  ? 138.480 176.644 157.590 1.00 0.00 ? 300  LYS A O     1 
ATOM   2319  C  CB    . LYS A  1  300  ? 141.709 175.881 157.149 1.00 0.00 ? 300  LYS A CB    1 
ATOM   2320  C  CG    . LYS A  1  300  ? 141.217 175.771 155.728 1.00 0.00 ? 300  LYS A CG    1 
ATOM   2321  C  CD    . LYS A  1  300  ? 141.309 177.110 155.041 1.00 0.00 ? 300  LYS A CD    1 
ATOM   2322  C  CE    . LYS A  1  300  ? 140.895 177.010 153.589 1.00 0.00 ? 300  LYS A CE    1 
ATOM   2323  N  NZ    . LYS A  1  300  ? 141.850 176.159 152.826 1.00 0.00 ? 300  LYS A NZ    1 
ATOM   2324  N  N     . ALA A  1  301  ? 139.314 175.019 158.904 1.00 0.00 ? 301  ALA A N     1 
ATOM   2325  C  CA    . ALA A  1  301  ? 137.998 174.473 159.209 1.00 0.00 ? 301  ALA A CA    1 
ATOM   2326  C  C     . ALA A  1  301  ? 137.243 175.401 160.142 1.00 0.00 ? 301  ALA A C     1 
ATOM   2327  O  O     . ALA A  1  301  ? 136.047 175.648 159.953 1.00 0.00 ? 301  ALA A O     1 
ATOM   2328  C  CB    . ALA A  1  301  ? 138.131 173.082 159.821 1.00 0.00 ? 301  ALA A CB    1 
ATOM   2329  N  N     . GLY A  1  302  ? 137.927 175.937 161.144 1.00 0.00 ? 302  GLY A N     1 
ATOM   2330  C  CA    . GLY A  1  302  ? 137.456 177.129 161.803 1.00 0.00 ? 302  GLY A CA    1 
ATOM   2331  C  C     . GLY A  1  302  ? 137.364 178.244 160.786 1.00 0.00 ? 302  GLY A C     1 
ATOM   2332  O  O     . GLY A  1  302  ? 137.873 178.153 159.669 1.00 0.00 ? 302  GLY A O     1 
ATOM   2333  N  N     . LEU A  1  303  ? 136.611 179.276 161.148 1.00 0.00 ? 303  LEU A N     1 
ATOM   2334  C  CA    . LEU A  1  303  ? 136.436 180.440 160.286 1.00 0.00 ? 303  LEU A CA    1 
ATOM   2335  C  C     . LEU A  1  303  ? 135.679 180.049 159.023 1.00 0.00 ? 303  LEU A C     1 
ATOM   2336  O  O     . LEU A  1  303  ? 135.145 180.909 158.318 1.00 0.00 ? 303  LEU A O     1 
ATOM   2337  C  CB    . LEU A  1  303  ? 137.793 181.068 159.943 1.00 0.00 ? 303  LEU A CB    1 
ATOM   2338  C  CG    . LEU A  1  303  ? 137.857 182.354 159.118 1.00 0.00 ? 303  LEU A CG    1 
ATOM   2339  C  CD1   . LEU A  1  303  ? 139.022 183.204 159.562 1.00 0.00 ? 303  LEU A CD1   1 
ATOM   2340  C  CD2   . LEU A  1  303  ? 137.997 182.039 157.641 1.00 0.00 ? 303  LEU A CD2   1 
ATOM   2341  N  N     . ASP A  1  304  ? 135.605 178.750 158.746 1.00 0.00 ? 304  ASP A N     1 
ATOM   2342  C  CA    . ASP A  1  304  ? 134.793 178.270 157.639 1.00 0.00 ? 304  ASP A CA    1 
ATOM   2343  C  C     . ASP A  1  304  ? 133.327 178.203 158.027 1.00 0.00 ? 304  ASP A C     1 
ATOM   2344  O  O     . ASP A  1  304  ? 132.464 178.718 157.310 1.00 0.00 ? 304  ASP A O     1 
ATOM   2345  C  CB    . ASP A  1  304  ? 135.289 176.900 157.195 1.00 0.00 ? 304  ASP A CB    1 
ATOM   2346  C  CG    . ASP A  1  304  ? 134.437 176.304 156.106 1.00 0.00 ? 304  ASP A CG    1 
ATOM   2347  O  OD1   . ASP A  1  304  ? 134.451 176.842 154.983 1.00 0.00 ? 304  ASP A OD1   1 
ATOM   2348  O  OD2   . ASP A  1  304  ? 133.746 175.300 156.378 1.00 0.00 ? 304  ASP A OD2   1 
ATOM   2349  N  N     . LYS A  1  305  ? 133.030 177.588 159.167 1.00 0.00 ? 305  LYS A N     1 
ATOM   2350  C  CA    . LYS A  1  305  ? 131.650 177.434 159.597 1.00 0.00 ? 305  LYS A CA    1 
ATOM   2351  C  C     . LYS A  1  305  ? 131.464 177.908 161.032 1.00 0.00 ? 305  LYS A C     1 
ATOM   2352  O  O     . LYS A  1  305  ? 130.701 178.842 161.298 1.00 0.00 ? 305  LYS A O     1 
ATOM   2353  C  CB    . LYS A  1  305  ? 131.188 175.981 159.420 1.00 0.00 ? 305  LYS A CB    1 
ATOM   2354  C  CG    . LYS A  1  305  ? 131.997 174.918 160.149 1.00 0.00 ? 305  LYS A CG    1 
ATOM   2355  C  CD    . LYS A  1  305  ? 131.517 173.526 159.784 1.00 0.00 ? 305  LYS A CD    1 
ATOM   2356  C  CE    . LYS A  1  305  ? 132.211 172.474 160.624 1.00 0.00 ? 305  LYS A CE    1 
ATOM   2357  N  NZ    . LYS A  1  305  ? 131.750 172.536 162.040 1.00 0.00 ? 305  LYS A NZ    1 
ATOM   2358  N  N     . GLY A  1  306  ? 132.180 177.276 161.956 1.00 0.00 ? 306  GLY A N     1 
ATOM   2359  C  CA    . GLY A  1  306  ? 131.904 177.375 163.368 1.00 0.00 ? 306  GLY A CA    1 
ATOM   2360  C  C     . GLY A  1  306  ? 132.682 178.484 164.054 1.00 0.00 ? 306  GLY A C     1 
ATOM   2361  O  O     . GLY A  1  306  ? 132.778 179.612 163.579 1.00 0.00 ? 306  GLY A O     1 
ATOM   2362  N  N     . ILE A  1  307  ? 133.144 178.145 165.256 1.00 0.00 ? 307  ILE A N     1 
ATOM   2363  C  CA    . ILE A  1  307  ? 133.946 178.951 166.175 1.00 0.00 ? 307  ILE A CA    1 
ATOM   2364  C  C     . ILE A  1  307  ? 133.266 180.283 166.466 1.00 0.00 ? 307  ILE A C     1 
ATOM   2365  O  O     . ILE A  1  307  ? 132.036 180.354 166.548 1.00 0.00 ? 307  ILE A O     1 
ATOM   2366  C  CB    . ILE A  1  307  ? 135.398 179.147 165.674 1.00 0.00 ? 307  ILE A CB    1 
ATOM   2367  C  CG1   . ILE A  1  307  ? 135.514 179.966 164.383 1.00 0.00 ? 307  ILE A CG1   1 
ATOM   2368  C  CG2   . ILE A  1  307  ? 136.084 177.797 165.490 1.00 0.00 ? 307  ILE A CG2   1 
ATOM   2369  C  CD1   . ILE A  1  307  ? 136.925 180.416 164.093 1.00 0.00 ? 307  ILE A CD1   1 
ATOM   2370  N  N     . SER A  1  308  ? 134.055 181.345 166.598 1.00 0.00 ? 308  SER A N     1 
ATOM   2371  C  CA    . SER A  1  308  ? 133.562 182.635 167.053 1.00 0.00 ? 308  SER A CA    1 
ATOM   2372  C  C     . SER A  1  308  ? 134.709 183.625 167.038 1.00 0.00 ? 308  SER A C     1 
ATOM   2373  O  O     . SER A  1  308  ? 135.879 183.249 167.108 1.00 0.00 ? 308  SER A O     1 
ATOM   2374  C  CB    . SER A  1  308  ? 132.966 182.548 168.458 1.00 0.00 ? 308  SER A CB    1 
ATOM   2375  O  OG    . SER A  1  308  ? 132.594 183.831 168.923 1.00 0.00 ? 308  SER A OG    1 
ATOM   2376  N  N     . ILE A  1  309  ? 134.360 184.911 166.998 1.00 0.00 ? 309  ILE A N     1 
ATOM   2377  C  CA    . ILE A  1  309  ? 135.397 185.918 166.849 1.00 0.00 ? 309  ILE A CA    1 
ATOM   2378  C  C     . ILE A  1  309  ? 136.317 185.904 168.055 1.00 0.00 ? 309  ILE A C     1 
ATOM   2379  O  O     . ILE A  1  309  ? 137.508 186.207 167.939 1.00 0.00 ? 309  ILE A O     1 
ATOM   2380  C  CB    . ILE A  1  309  ? 134.775 187.305 166.618 1.00 0.00 ? 309  ILE A CB    1 
ATOM   2381  C  CG1   . ILE A  1  309  ? 135.863 188.284 166.203 1.00 0.00 ? 309  ILE A CG1   1 
ATOM   2382  C  CG2   . ILE A  1  309  ? 134.069 187.796 167.865 1.00 0.00 ? 309  ILE A CG2   1 
ATOM   2383  C  CD1   . ILE A  1  309  ? 136.514 187.930 164.891 1.00 0.00 ? 309  ILE A CD1   1 
ATOM   2384  N  N     . ASN A  1  310  ? 135.798 185.533 169.222 1.00 0.00 ? 310  ASN A N     1 
ATOM   2385  C  CA    . ASN A  1  310  ? 136.667 185.412 170.382 1.00 0.00 ? 310  ASN A CA    1 
ATOM   2386  C  C     . ASN A  1  310  ? 137.524 184.161 170.299 1.00 0.00 ? 310  ASN A C     1 
ATOM   2387  O  O     . ASN A  1  310  ? 138.749 184.236 170.430 1.00 0.00 ? 310  ASN A O     1 
ATOM   2388  C  CB    . ASN A  1  310  ? 135.847 185.404 171.664 1.00 0.00 ? 310  ASN A CB    1 
ATOM   2389  C  CG    . ASN A  1  310  ? 136.714 185.407 172.892 1.00 0.00 ? 310  ASN A CG    1 
ATOM   2390  O  OD1   . ASN A  1  310  ? 137.838 185.905 172.869 1.00 0.00 ? 310  ASN A OD1   1 
ATOM   2391  N  ND2   . ASN A  1  310  ? 136.200 184.853 173.978 1.00 0.00 ? 310  ASN A ND2   1 
ATOM   2392  N  N     . ASN A  1  311  ? 136.907 183.010 170.073 1.00 0.00 ? 311  ASN A N     1 
ATOM   2393  C  CA    . ASN A  1  311  ? 137.650 181.754 170.040 1.00 0.00 ? 311  ASN A CA    1 
ATOM   2394  C  C     . ASN A  1  311  ? 138.394 181.583 168.724 1.00 0.00 ? 311  ASN A C     1 
ATOM   2395  O  O     . ASN A  1  311  ? 139.149 180.632 168.532 1.00 0.00 ? 311  ASN A O     1 
ATOM   2396  C  CB    . ASN A  1  311  ? 136.731 180.578 170.327 1.00 0.00 ? 311  ASN A CB    1 
ATOM   2397  C  CG    . ASN A  1  311  ? 135.598 180.470 169.349 1.00 0.00 ? 311  ASN A CG    1 
ATOM   2398  O  OD1   . ASN A  1  311  ? 135.737 180.807 168.185 1.00 0.00 ? 311  ASN A OD1   1 
ATOM   2399  N  ND2   . ASN A  1  311  ? 134.458 179.989 169.821 1.00 0.00 ? 311  ASN A ND2   1 
ATOM   2400  N  N     . MET A  1  312  ? 138.199 182.522 167.804 1.00 0.00 ? 312  MET A N     1 
ATOM   2401  C  CA    . MET A  1  312  ? 139.029 182.549 166.611 1.00 0.00 ? 312  MET A CA    1 
ATOM   2402  C  C     . MET A  1  312  ? 140.429 182.972 166.989 1.00 0.00 ? 312  MET A C     1 
ATOM   2403  O  O     . MET A  1  312  ? 141.382 182.202 166.851 1.00 0.00 ? 312  MET A O     1 
ATOM   2404  C  CB    . MET A  1  312  ? 138.507 183.528 165.568 1.00 0.00 ? 312  MET A CB    1 
ATOM   2405  C  CG    . MET A  1  312  ? 139.386 183.596 164.343 1.00 0.00 ? 312  MET A CG    1 
ATOM   2406  S  SD    . MET A  1  312  ? 138.835 184.851 163.192 1.00 0.00 ? 312  MET A SD    1 
ATOM   2407  C  CE    . MET A  1  312  ? 137.345 184.085 162.571 1.00 0.00 ? 312  MET A CE    1 
ATOM   2408  N  N     . MET A  1  313  ? 140.552 184.211 167.466 1.00 0.00 ? 313  MET A N     1 
ATOM   2409  C  CA    . MET A  1  313  ? 141.861 184.833 167.541 1.00 0.00 ? 313  MET A CA    1 
ATOM   2410  C  C     . MET A  1  313  ? 142.845 184.002 168.350 1.00 0.00 ? 313  MET A C     1 
ATOM   2411  O  O     . MET A  1  313  ? 143.875 183.596 167.814 1.00 0.00 ? 313  MET A O     1 
ATOM   2412  C  CB    . MET A  1  313  ? 141.750 186.257 168.074 1.00 0.00 ? 313  MET A CB    1 
ATOM   2413  C  CG    . MET A  1  313  ? 141.199 187.193 167.020 1.00 0.00 ? 313  MET A CG    1 
ATOM   2414  S  SD    . MET A  1  313  ? 141.128 188.914 167.508 1.00 0.00 ? 313  MET A SD    1 
ATOM   2415  C  CE    . MET A  1  313  ? 142.870 189.301 167.586 1.00 0.00 ? 313  MET A CE    1 
ATOM   2416  N  N     . GLU A  1  314  ? 142.525 183.662 169.601 1.00 0.00 ? 314  GLU A N     1 
ATOM   2417  C  CA    . GLU A  1  314  ? 143.531 183.042 170.466 1.00 0.00 ? 314  GLU A CA    1 
ATOM   2418  C  C     . GLU A  1  314  ? 144.206 181.850 169.797 1.00 0.00 ? 314  GLU A C     1 
ATOM   2419  O  O     . GLU A  1  314  ? 145.398 181.615 170.021 1.00 0.00 ? 314  GLU A O     1 
ATOM   2420  C  CB    . GLU A  1  314  ? 142.912 182.612 171.791 1.00 0.00 ? 314  GLU A CB    1 
ATOM   2421  C  CG    . GLU A  1  314  ? 142.218 181.276 171.780 1.00 0.00 ? 314  GLU A CG    1 
ATOM   2422  C  CD    . GLU A  1  314  ? 140.922 181.293 171.014 1.00 0.00 ? 314  GLU A CD    1 
ATOM   2423  O  OE1   . GLU A  1  314  ? 140.643 182.309 170.344 1.00 0.00 ? 314  GLU A OE1   1 
ATOM   2424  O  OE2   . GLU A  1  314  ? 140.179 180.289 171.098 1.00 0.00 ? 314  GLU A OE2   1 
ATOM   2425  N  N     . HIS A  1  315  ? 143.479 181.092 168.974 1.00 0.00 ? 315  HIS A N     1 
ATOM   2426  C  CA    . HIS A  1  315  ? 144.160 180.167 168.082 1.00 0.00 ? 315  HIS A CA    1 
ATOM   2427  C  C     . HIS A  1  315  ? 145.185 180.881 167.221 1.00 0.00 ? 315  HIS A C     1 
ATOM   2428  O  O     . HIS A  1  315  ? 146.378 180.618 167.346 1.00 0.00 ? 315  HIS A O     1 
ATOM   2429  C  CB    . HIS A  1  315  ? 143.164 179.447 167.186 1.00 0.00 ? 315  HIS A CB    1 
ATOM   2430  C  CG    . HIS A  1  315  ? 142.297 178.477 167.910 1.00 0.00 ? 315  HIS A CG    1 
ATOM   2431  N  ND1   . HIS A  1  315  ? 141.122 177.994 167.379 1.00 0.00 ? 315  HIS A ND1   1 
ATOM   2432  C  CD2   . HIS A  1  315  ? 142.444 177.877 169.112 1.00 0.00 ? 315  HIS A CD2   1 
ATOM   2433  C  CE1   . HIS A  1  315  ? 140.572 177.151 168.232 1.00 0.00 ? 315  HIS A CE1   1 
ATOM   2434  N  NE2   . HIS A  1  315  ? 141.355 177.060 169.292 1.00 0.00 ? 315  HIS A NE2   1 
ATOM   2435  N  N     . TRP A  1  316  ? 144.729 181.783 166.362 1.00 0.00 ? 316  TRP A N     1 
ATOM   2436  C  CA    . TRP A  1  316  ? 145.567 182.539 165.441 1.00 0.00 ? 316  TRP A CA    1 
ATOM   2437  C  C     . TRP A  1  316  ? 146.781 183.160 166.128 1.00 0.00 ? 316  TRP A C     1 
ATOM   2438  O  O     . TRP A  1  316  ? 147.913 183.017 165.644 1.00 0.00 ? 316  TRP A O     1 
ATOM   2439  C  CB    . TRP A  1  316  ? 144.660 183.578 164.791 1.00 0.00 ? 316  TRP A CB    1 
ATOM   2440  C  CG    . TRP A  1  316  ? 145.208 184.462 163.782 1.00 0.00 ? 316  TRP A CG    1 
ATOM   2441  C  CD1   . TRP A  1  316  ? 145.329 184.219 162.458 1.00 0.00 ? 316  TRP A CD1   1 
ATOM   2442  C  CD2   . TRP A  1  316  ? 145.618 185.798 163.987 1.00 0.00 ? 316  TRP A CD2   1 
ATOM   2443  N  NE1   . TRP A  1  316  ? 145.835 185.318 161.823 1.00 0.00 ? 316  TRP A NE1   1 
ATOM   2444  C  CE2   . TRP A  1  316  ? 146.022 186.305 162.750 1.00 0.00 ? 316  TRP A CE2   1 
ATOM   2445  C  CE3   . TRP A  1  316  ? 145.708 186.610 165.110 1.00 0.00 ? 316  TRP A CE3   1 
ATOM   2446  C  CZ2   . TRP A  1  316  ? 146.506 187.585 162.602 1.00 0.00 ? 316  TRP A CZ2   1 
ATOM   2447  C  CZ3   . TRP A  1  316  ? 146.188 187.876 164.962 1.00 0.00 ? 316  TRP A CZ3   1 
ATOM   2448  C  CH2   . TRP A  1  316  ? 146.587 188.350 163.721 1.00 0.00 ? 316  TRP A CH2   1 
ATOM   2449  N  N     . ASP A  1  317  ? 146.569 183.838 167.252 1.00 0.00 ? 317  ASP A N     1 
ATOM   2450  C  CA    . ASP A  1  317  ? 147.673 184.242 168.105 1.00 0.00 ? 317  ASP A CA    1 
ATOM   2451  C  C     . ASP A  1  317  ? 148.596 183.073 168.409 1.00 0.00 ? 317  ASP A C     1 
ATOM   2452  O  O     . ASP A  1  317  ? 149.811 183.185 168.226 1.00 0.00 ? 317  ASP A O     1 
ATOM   2453  C  CB    . ASP A  1  317  ? 147.140 184.832 169.399 1.00 0.00 ? 317  ASP A CB    1 
ATOM   2454  C  CG    . ASP A  1  317  ? 148.229 185.402 170.264 1.00 0.00 ? 317  ASP A CG    1 
ATOM   2455  O  OD1   . ASP A  1  317  ? 149.389 185.463 169.816 1.00 0.00 ? 317  ASP A OD1   1 
ATOM   2456  O  OD2   . ASP A  1  317  ? 147.932 185.780 171.410 1.00 0.00 ? 317  ASP A OD2   1 
ATOM   2457  N  N     . TYR A  1  318  ? 148.047 181.946 168.856 1.00 0.00 ? 318  TYR A N     1 
ATOM   2458  C  CA    . TYR A  1  318  ? 148.898 180.784 169.074 1.00 0.00 ? 318  TYR A CA    1 
ATOM   2459  C  C     . TYR A  1  318  ? 149.633 180.383 167.805 1.00 0.00 ? 318  TYR A C     1 
ATOM   2460  O  O     . TYR A  1  318  ? 150.699 179.767 167.879 1.00 0.00 ? 318  TYR A O     1 
ATOM   2461  C  CB    . TYR A  1  318  ? 148.073 179.623 169.615 1.00 0.00 ? 318  TYR A CB    1 
ATOM   2462  C  CG    . TYR A  1  318  ? 148.810 178.315 169.691 1.00 0.00 ? 318  TYR A CG    1 
ATOM   2463  C  CD1   . TYR A  1  318  ? 149.728 178.069 170.693 1.00 0.00 ? 318  TYR A CD1   1 
ATOM   2464  C  CD2   . TYR A  1  318  ? 148.573 177.315 168.768 1.00 0.00 ? 318  TYR A CD2   1 
ATOM   2465  C  CE1   . TYR A  1  318  ? 150.394 176.865 170.766 1.00 0.00 ? 318  TYR A CE1   1 
ATOM   2466  C  CE2   . TYR A  1  318  ? 149.228 176.118 168.836 1.00 0.00 ? 318  TYR A CE2   1 
ATOM   2467  C  CZ    . TYR A  1  318  ? 150.138 175.894 169.833 1.00 0.00 ? 318  TYR A CZ    1 
ATOM   2468  O  OH    . TYR A  1  318  ? 150.799 174.692 169.896 1.00 0.00 ? 318  TYR A OH    1 
ATOM   2469  N  N     . LEU A  1  319  ? 149.105 180.742 166.637 1.00 0.00 ? 319  LEU A N     1 
ATOM   2470  C  CA    . LEU A  1  319  ? 149.811 180.447 165.405 1.00 0.00 ? 319  LEU A CA    1 
ATOM   2471  C  C     . LEU A  1  319  ? 151.047 181.319 165.277 1.00 0.00 ? 319  LEU A C     1 
ATOM   2472  O  O     . LEU A  1  319  ? 152.159 180.806 165.120 1.00 0.00 ? 319  LEU A O     1 
ATOM   2473  C  CB    . LEU A  1  319  ? 148.893 180.631 164.208 1.00 0.00 ? 319  LEU A CB    1 
ATOM   2474  C  CG    . LEU A  1  319  ? 149.599 180.429 162.886 1.00 0.00 ? 319  LEU A CG    1 
ATOM   2475  C  CD1   . LEU A  1  319  ? 150.088 179.020 162.824 1.00 0.00 ? 319  LEU A CD1   1 
ATOM   2476  C  CD2   . LEU A  1  319  ? 148.630 180.684 161.782 1.00 0.00 ? 319  LEU A CD2   1 
ATOM   2477  N  N     . GLN A  1  320  ? 150.889 182.643 165.371 1.00 0.00 ? 320  GLN A N     1 
ATOM   2478  C  CA    . GLN A  1  320  ? 152.080 183.478 165.223 1.00 0.00 ? 320  GLN A CA    1 
ATOM   2479  C  C     . GLN A  1  320  ? 153.083 183.245 166.336 1.00 0.00 ? 320  GLN A C     1 
ATOM   2480  O  O     . GLN A  1  320  ? 154.286 183.176 166.064 1.00 0.00 ? 320  GLN A O     1 
ATOM   2481  C  CB    . GLN A  1  320  ? 151.726 184.959 165.156 1.00 0.00 ? 320  GLN A CB    1 
ATOM   2482  C  CG    . GLN A  1  320  ? 151.110 185.516 166.395 1.00 0.00 ? 320  GLN A CG    1 
ATOM   2483  C  CD    . GLN A  1  320  ? 150.863 186.994 166.283 1.00 0.00 ? 320  GLN A CD    1 
ATOM   2484  O  OE1   . GLN A  1  320  ? 150.847 187.546 165.188 1.00 0.00 ? 320  GLN A OE1   1 
ATOM   2485  N  NE2   . GLN A  1  320  ? 150.660 187.647 167.415 1.00 0.00 ? 320  GLN A NE2   1 
ATOM   2486  N  N     . LEU A  1  321  ? 152.617 183.099 167.572 1.00 0.00 ? 321  LEU A N     1 
ATOM   2487  C  CA    . LEU A  1  321  ? 153.518 182.716 168.642 1.00 0.00 ? 321  LEU A CA    1 
ATOM   2488  C  C     . LEU A  1  321  ? 154.256 181.436 168.294 1.00 0.00 ? 321  LEU A C     1 
ATOM   2489  O  O     . LEU A  1  321  ? 155.474 181.347 168.485 1.00 0.00 ? 321  LEU A O     1 
ATOM   2490  C  CB    . LEU A  1  321  ? 152.746 182.546 169.942 1.00 0.00 ? 321  LEU A CB    1 
ATOM   2491  C  CG    . LEU A  1  321  ? 153.645 182.058 171.062 1.00 0.00 ? 321  LEU A CG    1 
ATOM   2492  C  CD1   . LEU A  1  321  ? 154.728 183.083 171.258 1.00 0.00 ? 321  LEU A CD1   1 
ATOM   2493  C  CD2   . LEU A  1  321  ? 152.849 181.862 172.328 1.00 0.00 ? 321  LEU A CD2   1 
ATOM   2494  N  N     . THR A  1  322  ? 153.540 180.443 167.766 1.00 0.00 ? 322  THR A N     1 
ATOM   2495  C  CA    . THR A  1  322  ? 154.202 179.210 167.369 1.00 0.00 ? 322  THR A CA    1 
ATOM   2496  C  C     . THR A  1  322  ? 155.288 179.477 166.342 1.00 0.00 ? 322  THR A C     1 
ATOM   2497  O  O     . THR A  1  322  ? 156.473 179.408 166.665 1.00 0.00 ? 322  THR A O     1 
ATOM   2498  C  CB    . THR A  1  322  ? 153.196 178.215 166.819 1.00 0.00 ? 322  THR A CB    1 
ATOM   2499  O  OG1   . THR A  1  322  ? 152.240 177.900 167.835 1.00 0.00 ? 322  THR A OG1   1 
ATOM   2500  C  CG2   . THR A  1  322  ? 153.911 176.953 166.408 1.00 0.00 ? 322  THR A CG2   1 
ATOM   2501  N  N     . VAL A  1  323  ? 154.905 179.826 165.110 1.00 0.00 ? 323  VAL A N     1 
ATOM   2502  C  CA    . VAL A  1  323  ? 155.882 179.968 164.032 1.00 0.00 ? 323  VAL A CA    1 
ATOM   2503  C  C     . VAL A  1  323  ? 157.045 180.870 164.431 1.00 0.00 ? 323  VAL A C     1 
ATOM   2504  O  O     . VAL A  1  323  ? 158.200 180.608 164.056 1.00 0.00 ? 323  VAL A O     1 
ATOM   2505  C  CB    . VAL A  1  323  ? 155.180 180.480 162.764 1.00 0.00 ? 323  VAL A CB    1 
ATOM   2506  C  CG1   . VAL A  1  323  ? 154.642 181.859 162.981 1.00 0.00 ? 323  VAL A CG1   1 
ATOM   2507  C  CG2   . VAL A  1  323  ? 156.110 180.472 161.594 1.00 0.00 ? 323  VAL A CG2   1 
ATOM   2508  N  N     . ALA A  1  324  ? 156.779 181.906 165.225 1.00 0.00 ? 324  ALA A N     1 
ATOM   2509  C  CA    . ALA A  1  324  ? 157.874 182.643 165.833 1.00 0.00 ? 324  ALA A CA    1 
ATOM   2510  C  C     . ALA A  1  324  ? 158.774 181.708 166.622 1.00 0.00 ? 324  ALA A C     1 
ATOM   2511  O  O     . ALA A  1  324  ? 159.997 181.735 166.458 1.00 0.00 ? 324  ALA A O     1 
ATOM   2512  C  CB    . ALA A  1  324  ? 157.332 183.753 166.725 1.00 0.00 ? 324  ALA A CB    1 
ATOM   2513  N  N     . MET A  1  325  ? 158.194 180.854 167.463 1.00 0.00 ? 325  MET A N     1 
ATOM   2514  C  CA    . MET A  1  325  ? 159.029 179.899 168.179 1.00 0.00 ? 325  MET A CA    1 
ATOM   2515  C  C     . MET A  1  325  ? 159.671 178.896 167.231 1.00 0.00 ? 325  MET A C     1 
ATOM   2516  O  O     . MET A  1  325  ? 160.671 178.269 167.582 1.00 0.00 ? 325  MET A O     1 
ATOM   2517  C  CB    . MET A  1  325  ? 158.205 179.182 169.247 1.00 0.00 ? 325  MET A CB    1 
ATOM   2518  C  CG    . MET A  1  325  ? 159.023 178.277 170.125 1.00 0.00 ? 325  MET A CG    1 
ATOM   2519  S  SD    . MET A  1  325  ? 160.165 179.280 171.089 1.00 0.00 ? 325  MET A SD    1 
ATOM   2520  C  CE    . MET A  1  325  ? 161.105 178.021 171.944 1.00 0.00 ? 325  MET A CE    1 
ATOM   2521  N  N     . TYR A  1  326  ? 159.124 178.743 166.031 1.00 0.00 ? 326  TYR A N     1 
ATOM   2522  C  CA    . TYR A  1  326  ? 159.717 177.870 165.036 1.00 0.00 ? 326  TYR A CA    1 
ATOM   2523  C  C     . TYR A  1  326  ? 161.022 178.418 164.500 1.00 0.00 ? 326  TYR A C     1 
ATOM   2524  O  O     . TYR A  1  326  ? 161.976 177.655 164.347 1.00 0.00 ? 326  TYR A O     1 
ATOM   2525  C  CB    . TYR A  1  326  ? 158.719 177.648 163.908 1.00 0.00 ? 326  TYR A CB    1 
ATOM   2526  C  CG    . TYR A  1  326  ? 159.273 177.040 162.655 1.00 0.00 ? 326  TYR A CG    1 
ATOM   2527  C  CD1   . TYR A  1  326  ? 159.557 175.699 162.574 1.00 0.00 ? 326  TYR A CD1   1 
ATOM   2528  C  CD2   . TYR A  1  326  ? 159.472 177.812 161.534 1.00 0.00 ? 326  TYR A CD2   1 
ATOM   2529  C  CE1   . TYR A  1  326  ? 160.055 175.151 161.416 1.00 0.00 ? 326  TYR A CE1   1 
ATOM   2530  C  CE2   . TYR A  1  326  ? 159.963 177.273 160.380 1.00 0.00 ? 326  TYR A CE2   1 
ATOM   2531  C  CZ    . TYR A  1  326  ? 160.253 175.947 160.325 1.00 0.00 ? 326  TYR A CZ    1 
ATOM   2532  O  OH    . TYR A  1  326  ? 160.745 175.421 159.163 1.00 0.00 ? 326  TYR A OH    1 
ATOM   2533  N  N     . ILE A  1  327  ? 161.095 179.710 164.193 1.00 0.00 ? 327  ILE A N     1 
ATOM   2534  C  CA    . ILE A  1  327  ? 162.371 180.275 163.764 1.00 0.00 ? 327  ILE A CA    1 
ATOM   2535  C  C     . ILE A  1  327  ? 163.145 180.950 164.876 1.00 0.00 ? 327  ILE A C     1 
ATOM   2536  O  O     . ILE A  1  327  ? 164.109 181.674 164.584 1.00 0.00 ? 327  ILE A O     1 
ATOM   2537  C  CB    . ILE A  1  327  ? 162.200 181.242 162.580 1.00 0.00 ? 327  ILE A CB    1 
ATOM   2538  C  CG1   . ILE A  1  327  ? 161.389 182.454 162.977 1.00 0.00 ? 327  ILE A CG1   1 
ATOM   2539  C  CG2   . ILE A  1  327  ? 161.539 180.536 161.439 1.00 0.00 ? 327  ILE A CG2   1 
ATOM   2540  C  CD1   . ILE A  1  327  ? 161.397 183.498 161.902 1.00 0.00 ? 327  ILE A CD1   1 
ATOM   2541  N  N     . ASN A  1  328  ? 162.763 180.840 166.144 1.00 0.00 ? 328  ASN A N     1 
ATOM   2542  C  CA    . ASN A  1  328  ? 163.512 181.513 167.194 1.00 0.00 ? 328  ASN A CA    1 
ATOM   2543  C  C     . ASN A  1  328  ? 163.219 180.855 168.538 1.00 0.00 ? 328  ASN A C     1 
ATOM   2544  O  O     . ASN A  1  328  ? 162.514 179.850 168.620 1.00 0.00 ? 328  ASN A O     1 
ATOM   2545  C  CB    . ASN A  1  328  ? 163.169 183.004 167.214 1.00 0.00 ? 328  ASN A CB    1 
ATOM   2546  C  CG    . ASN A  1  328  ? 164.117 183.805 168.059 1.00 0.00 ? 328  ASN A CG    1 
ATOM   2547  O  OD1   . ASN A  1  328  ? 164.822 183.258 168.902 1.00 0.00 ? 328  ASN A OD1   1 
ATOM   2548  N  ND2   . ASN A  1  328  ? 164.135 185.112 167.849 1.00 0.00 ? 328  ASN A ND2   1 
ATOM   2549  N  N     . SER A  1  329  ? 163.800 181.410 169.601 1.00 0.00 ? 329  SER A N     1 
ATOM   2550  C  CA    . SER A  1  329  ? 163.412 181.046 170.957 1.00 0.00 ? 329  SER A CA    1 
ATOM   2551  C  C     . SER A  1  329  ? 162.634 182.179 171.600 1.00 0.00 ? 329  SER A C     1 
ATOM   2552  O  O     . SER A  1  329  ? 161.423 182.067 171.793 1.00 0.00 ? 329  SER A O     1 
ATOM   2553  C  CB    . SER A  1  329  ? 164.621 180.736 171.824 1.00 0.00 ? 329  SER A CB    1 
ATOM   2554  O  OG    . SER A  1  329  ? 165.422 181.890 171.991 1.00 0.00 ? 329  SER A OG    1 
ATOM   2555  N  N     . ASP A  1  330  ? 163.346 183.243 171.985 1.00 0.00 ? 330  ASP A N     1 
ATOM   2556  C  CA    . ASP A  1  330  ? 162.778 184.516 172.425 1.00 0.00 ? 330  ASP A CA    1 
ATOM   2557  C  C     . ASP A  1  330  ? 161.674 184.286 173.456 1.00 0.00 ? 330  ASP A C     1 
ATOM   2558  O  O     . ASP A  1  330  ? 161.958 183.845 174.573 1.00 0.00 ? 330  ASP A O     1 
ATOM   2559  C  CB    . ASP A  1  330  ? 162.348 185.381 171.216 1.00 0.00 ? 330  ASP A CB    1 
ATOM   2560  C  CG    . ASP A  1  330  ? 161.138 184.851 170.445 1.00 0.00 ? 330  ASP A CG    1 
ATOM   2561  O  OD1   . ASP A  1  330  ? 160.312 184.094 170.983 1.00 0.00 ? 330  ASP A OD1   1 
ATOM   2562  O  OD2   . ASP A  1  330  ? 161.020 185.206 169.259 1.00 0.00 ? 330  ASP A OD2   1 
ATOM   2563  N  N     . SER A  1  331  ? 160.428 184.611 173.109 1.00 0.00 ? 331  SER A N     1 
ATOM   2564  C  CA    . SER A  1  331  ? 159.256 184.384 173.955 1.00 0.00 ? 331  SER A CA    1 
ATOM   2565  C  C     . SER A  1  331  ? 159.261 182.944 174.461 1.00 0.00 ? 331  SER A C     1 
ATOM   2566  O  O     . SER A  1  331  ? 159.403 181.981 173.705 1.00 0.00 ? 331  SER A O     1 
ATOM   2567  C  CB    . SER A  1  331  ? 157.996 184.683 173.167 1.00 0.00 ? 331  SER A CB    1 
ATOM   2568  O  OG    . SER A  1  331  ? 157.901 183.826 172.046 1.00 0.00 ? 331  SER A OG    1 
ATOM   2569  N  N     . VAL A  1  332  ? 159.086 182.801 175.776 1.00 0.00 ? 332  VAL A N     1 
ATOM   2570  C  CA    . VAL A  1  332  ? 159.287 181.519 176.443 1.00 0.00 ? 332  VAL A CA    1 
ATOM   2571  C  C     . VAL A  1  332  ? 157.967 180.865 176.844 1.00 0.00 ? 332  VAL A C     1 
ATOM   2572  O  O     . VAL A  1  332  ? 157.554 179.874 176.231 1.00 0.00 ? 332  VAL A O     1 
ATOM   2573  C  CB    . VAL A  1  332  ? 160.246 181.684 177.642 1.00 0.00 ? 332  VAL A CB    1 
ATOM   2574  C  CG1   . VAL A  1  332  ? 159.812 182.822 178.570 1.00 0.00 ? 332  VAL A CG1   1 
ATOM   2575  C  CG2   . VAL A  1  332  ? 160.367 180.380 178.407 1.00 0.00 ? 332  VAL A CG2   1 
ATOM   2576  N  N     . ASN A  1  333  ? 157.293 181.397 177.866 1.00 0.00 ? 333  ASN A N     1 
ATOM   2577  C  CA    . ASN A  1  333  ? 156.069 180.793 178.380 1.00 0.00 ? 333  ASN A CA    1 
ATOM   2578  C  C     . ASN A  1  333  ? 155.060 181.872 178.756 1.00 0.00 ? 333  ASN A C     1 
ATOM   2579  O  O     . ASN A  1  333  ? 154.841 182.138 179.944 1.00 0.00 ? 333  ASN A O     1 
ATOM   2580  C  CB    . ASN A  1  333  ? 156.379 179.889 179.577 1.00 0.00 ? 333  ASN A CB    1 
ATOM   2581  C  CG    . ASN A  1  333  ? 157.080 180.626 180.708 1.00 0.00 ? 333  ASN A CG    1 
ATOM   2582  O  OD1   . ASN A  1  333  ? 157.584 181.732 180.524 1.00 0.00 ? 333  ASN A OD1   1 
ATOM   2583  N  ND2   . ASN A  1  333  ? 157.114 180.012 181.884 1.00 0.00 ? 333  ASN A ND2   1 
ATOM   2584  N  N     . PRO A  1  334  ? 154.419 182.502 177.788 1.00 0.00 ? 334  PRO A N     1 
ATOM   2585  C  CA    . PRO A  1  334  ? 153.468 183.584 178.074 1.00 0.00 ? 334  PRO A CA    1 
ATOM   2586  C  C     . PRO A  1  334  ? 152.158 183.090 178.685 1.00 0.00 ? 334  PRO A C     1 
ATOM   2587  O  O     . PRO A  1  334  ? 151.075 183.317 178.142 1.00 0.00 ? 334  PRO A O     1 
ATOM   2588  C  CB    . PRO A  1  334  ? 153.249 184.213 176.695 1.00 0.00 ? 334  PRO A CB    1 
ATOM   2589  C  CG    . PRO A  1  334  ? 153.449 183.093 175.750 1.00 0.00 ? 334  PRO A CG    1 
ATOM   2590  C  CD    . PRO A  1  334  ? 154.523 182.226 176.345 1.00 0.00 ? 334  PRO A CD    1 
ATOM   2591  N  N     . ALA A  1  335  ? 152.262 182.409 179.830 1.00 0.00 ? 335  ALA A N     1 
ATOM   2592  C  CA    . ALA A  1  335  ? 151.107 181.831 180.521 1.00 0.00 ? 335  ALA A CA    1 
ATOM   2593  C  C     . ALA A  1  335  ? 150.267 180.981 179.572 1.00 0.00 ? 335  ALA A C     1 
ATOM   2594  O  O     . ALA A  1  335  ? 149.061 181.189 179.425 1.00 0.00 ? 335  ALA A O     1 
ATOM   2595  C  CB    . ALA A  1  335  ? 150.253 182.916 181.181 1.00 0.00 ? 335  ALA A CB    1 
ATOM   2596  N  N     . MET A  1  336  ? 150.909 180.020 178.911 1.00 0.00 ? 336  MET A N     1 
ATOM   2597  C  CA    . MET A  1  336  ? 150.255 179.264 177.854 1.00 0.00 ? 336  MET A CA    1 
ATOM   2598  C  C     . MET A  1  336  ? 150.240 177.760 178.074 1.00 0.00 ? 336  MET A C     1 
ATOM   2599  O  O     . MET A  1  336  ? 149.163 177.197 178.278 1.00 0.00 ? 336  MET A O     1 
ATOM   2600  C  CB    . MET A  1  336  ? 150.925 179.550 176.504 1.00 0.00 ? 336  MET A CB    1 
ATOM   2601  C  CG    . MET A  1  336  ? 150.285 178.816 175.344 1.00 0.00 ? 336  MET A CG    1 
ATOM   2602  S  SD    . MET A  1  336  ? 148.593 179.379 175.083 1.00 0.00 ? 336  MET A SD    1 
ATOM   2603  C  CE    . MET A  1  336  ? 148.073 178.327 173.733 1.00 0.00 ? 336  MET A CE    1 
ATOM   2604  N  N     . LEU A  1  337  ? 151.407 177.106 178.020 1.00 0.00 ? 337  LEU A N     1 
ATOM   2605  C  CA    . LEU A  1  337  ? 151.594 175.656 177.981 1.00 0.00 ? 337  LEU A CA    1 
ATOM   2606  C  C     . LEU A  1  337  ? 151.112 175.123 176.631 1.00 0.00 ? 337  LEU A C     1 
ATOM   2607  O  O     . LEU A  1  337  ? 150.229 175.722 176.006 1.00 0.00 ? 337  LEU A O     1 
ATOM   2608  C  CB    . LEU A  1  337  ? 150.879 174.964 179.147 1.00 0.00 ? 337  LEU A CB    1 
ATOM   2609  C  CG    . LEU A  1  337  ? 151.462 175.281 180.524 1.00 0.00 ? 337  LEU A CG    1 
ATOM   2610  C  CD1   . LEU A  1  337  ? 150.633 174.653 181.634 1.00 0.00 ? 337  LEU A CD1   1 
ATOM   2611  C  CD2   . LEU A  1  337  ? 152.903 174.807 180.594 1.00 0.00 ? 337  LEU A CD2   1 
ATOM   2612  N  N     . PRO A  1  338  ? 151.663 174.004 176.148 1.00 0.00 ? 338  PRO A N     1 
ATOM   2613  C  CA    . PRO A  1  338  ? 151.397 173.609 174.756 1.00 0.00 ? 338  PRO A CA    1 
ATOM   2614  C  C     . PRO A  1  338  ? 150.186 172.713 174.559 1.00 0.00 ? 338  PRO A C     1 
ATOM   2615  O  O     . PRO A  1  338  ? 149.521 172.299 175.516 1.00 0.00 ? 338  PRO A O     1 
ATOM   2616  C  CB    . PRO A  1  338  ? 152.693 172.891 174.357 1.00 0.00 ? 338  PRO A CB    1 
ATOM   2617  C  CG    . PRO A  1  338  ? 153.220 172.336 175.630 1.00 0.00 ? 338  PRO A CG    1 
ATOM   2618  C  CD    . PRO A  1  338  ? 152.757 173.226 176.751 1.00 0.00 ? 338  PRO A CD    1 
ATOM   2619  N  N     . GLY A  1  339  ? 149.902 172.411 173.290 1.00 0.00 ? 339  GLY A N     1 
ATOM   2620  C  CA    . GLY A  1  339  ? 148.748 171.651 172.849 1.00 0.00 ? 339  GLY A CA    1 
ATOM   2621  C  C     . GLY A  1  339  ? 149.058 170.205 172.517 1.00 0.00 ? 339  GLY A C     1 
ATOM   2622  O  O     . GLY A  1  339  ? 149.845 169.564 173.211 1.00 0.00 ? 339  GLY A O     1 
ATOM   2623  N  N     . SER A  1  340  ? 148.406 169.668 171.489 1.00 0.00 ? 340  SER A N     1 
ATOM   2624  C  CA    . SER A  1  340  ? 148.693 168.323 171.018 1.00 0.00 ? 340  SER A CA    1 
ATOM   2625  C  C     . SER A  1  340  ? 150.190 168.142 170.784 1.00 0.00 ? 340  SER A C     1 
ATOM   2626  O  O     . SER A  1  340  ? 150.874 169.022 170.256 1.00 0.00 ? 340  SER A O     1 
ATOM   2627  C  CB    . SER A  1  340  ? 147.936 168.033 169.727 1.00 0.00 ? 340  SER A CB    1 
ATOM   2628  O  OG    . SER A  1  340  ? 148.374 168.890 168.687 1.00 0.00 ? 340  SER A OG    1 
ATOM   2629  N  N     . SER A  1  341  ? 150.693 166.977 171.194 1.00 0.00 ? 341  SER A N     1 
ATOM   2630  C  CA    . SER A  1  341  ? 152.127 166.691 171.212 1.00 0.00 ? 341  SER A CA    1 
ATOM   2631  C  C     . SER A  1  341  ? 152.859 167.719 172.083 1.00 0.00 ? 341  SER A C     1 
ATOM   2632  O  O     . SER A  1  341  ? 153.555 168.614 171.603 1.00 0.00 ? 341  SER A O     1 
ATOM   2633  C  CB    . SER A  1  341  ? 152.701 166.642 169.789 1.00 0.00 ? 341  SER A CB    1 
ATOM   2634  O  OG    . SER A  1  341  ? 152.150 165.566 169.048 1.00 0.00 ? 341  SER A OG    1 
ATOM   2635  N  N     . ASN A  1  342  ? 152.650 167.572 173.393 1.00 0.00 ? 342  ASN A N     1 
ATOM   2636  C  CA    . ASN A  1  342  ? 153.124 168.553 174.365 1.00 0.00 ? 342  ASN A CA    1 
ATOM   2637  C  C     . ASN A  1  342  ? 154.189 168.020 175.316 1.00 0.00 ? 342  ASN A C     1 
ATOM   2638  O  O     . ASN A  1  342  ? 155.287 168.581 175.383 1.00 0.00 ? 342  ASN A O     1 
ATOM   2639  C  CB    . ASN A  1  342  ? 151.961 169.132 175.179 1.00 0.00 ? 342  ASN A CB    1 
ATOM   2640  C  CG    . ASN A  1  342  ? 151.196 168.085 175.956 1.00 0.00 ? 342  ASN A CG    1 
ATOM   2641  O  OD1   . ASN A  1  342  ? 151.293 166.891 175.677 1.00 0.00 ? 342  ASN A OD1   1 
ATOM   2642  N  ND2   . ASN A  1  342  ? 150.442 168.529 176.955 1.00 0.00 ? 342  ASN A ND2   1 
ATOM   2643  N  N     . GLY A  1  343  ? 153.894 166.961 176.066 1.00 0.00 ? 343  GLY A N     1 
ATOM   2644  C  CA    . GLY A  1  343  ? 154.566 166.810 177.338 1.00 0.00 ? 343  GLY A CA    1 
ATOM   2645  C  C     . GLY A  1  343  ? 153.978 167.802 178.320 1.00 0.00 ? 343  GLY A C     1 
ATOM   2646  O  O     . GLY A  1  343  ? 152.790 167.712 178.645 1.00 0.00 ? 343  GLY A O     1 
ATOM   2647  N  N     . GLY A  1  344  ? 154.773 168.750 178.801 1.00 0.00 ? 344  GLY A N     1 
ATOM   2648  C  CA    . GLY A  1  344  ? 154.309 169.613 179.869 1.00 0.00 ? 344  GLY A CA    1 
ATOM   2649  C  C     . GLY A  1  344  ? 155.018 169.350 181.177 1.00 0.00 ? 344  GLY A C     1 
ATOM   2650  O  O     . GLY A  1  344  ? 154.611 169.840 182.235 1.00 0.00 ? 344  GLY A O     1 
ATOM   2651  N  N     . GLY A  1  345  ? 156.091 168.571 181.106 1.00 0.00 ? 345  GLY A N     1 
ATOM   2652  C  CA    . GLY A  1  345  ? 157.033 168.481 182.201 1.00 0.00 ? 345  GLY A CA    1 
ATOM   2653  C  C     . GLY A  1  345  ? 157.990 169.654 182.166 1.00 0.00 ? 345  GLY A C     1 
ATOM   2654  O  O     . GLY A  1  345  ? 159.069 169.607 182.764 1.00 0.00 ? 345  GLY A O     1 
ATOM   2655  N  N     . LYS A  1  346  ? 157.595 170.711 181.452 1.00 0.00 ? 346  LYS A N     1 
ATOM   2656  C  CA    . LYS A  1  346  ? 158.369 171.944 181.312 1.00 0.00 ? 346  LYS A CA    1 
ATOM   2657  C  C     . LYS A  1  346  ? 159.724 171.671 180.650 1.00 0.00 ? 346  LYS A C     1 
ATOM   2658  O  O     . LYS A  1  346  ? 160.786 171.724 181.273 1.00 0.00 ? 346  LYS A O     1 
ATOM   2659  C  CB    . LYS A  1  346  ? 158.541 172.636 182.671 1.00 0.00 ? 346  LYS A CB    1 
ATOM   2660  C  CG    . LYS A  1  346  ? 157.237 173.014 183.357 1.00 0.00 ? 346  LYS A CG    1 
ATOM   2661  C  CD    . LYS A  1  346  ? 156.523 174.128 182.610 1.00 0.00 ? 346  LYS A CD    1 
ATOM   2662  C  CE    . LYS A  1  346  ? 155.271 174.576 183.347 1.00 0.00 ? 346  LYS A CE    1 
ATOM   2663  N  NZ    . LYS A  1  346  ? 154.216 173.525 183.337 1.00 0.00 ? 346  LYS A NZ    1 
ATOM   2664  N  N     . VAL A  1  347  ? 159.653 171.380 179.354 1.00 0.00 ? 347  VAL A N     1 
ATOM   2665  C  CA    . VAL A  1  347  ? 160.857 171.169 178.557 1.00 0.00 ? 347  VAL A CA    1 
ATOM   2666  C  C     . VAL A  1  347  ? 161.274 172.498 177.939 1.00 0.00 ? 347  VAL A C     1 
ATOM   2667  O  O     . VAL A  1  347  ? 160.606 173.016 177.036 1.00 0.00 ? 347  VAL A O     1 
ATOM   2668  C  CB    . VAL A  1  347  ? 160.615 170.098 177.482 1.00 0.00 ? 347  VAL A CB    1 
ATOM   2669  C  CG1   . VAL A  1  347  ? 161.827 169.953 176.582 1.00 0.00 ? 347  VAL A CG1   1 
ATOM   2670  C  CG2   . VAL A  1  347  ? 160.278 168.766 178.132 1.00 0.00 ? 347  VAL A CG2   1 
ATOM   2671  N  N     . LYS A  1  348  ? 162.392 173.047 178.421 1.00 0.00 ? 348  LYS A N     1 
ATOM   2672  C  CA    . LYS A  1  348  ? 162.836 174.395 178.078 1.00 0.00 ? 348  LYS A CA    1 
ATOM   2673  C  C     . LYS A  1  348  ? 163.305 174.564 176.629 1.00 0.00 ? 348  LYS A C     1 
ATOM   2674  O  O     . LYS A  1  348  ? 162.818 175.473 175.944 1.00 0.00 ? 348  LYS A O     1 
ATOM   2675  C  CB    . LYS A  1  348  ? 163.930 174.857 179.056 1.00 0.00 ? 348  LYS A CB    1 
ATOM   2676  C  CG    . LYS A  1  348  ? 165.189 173.997 179.127 1.00 0.00 ? 348  LYS A CG    1 
ATOM   2677  C  CD    . LYS A  1  348  ? 166.201 174.521 180.142 1.00 0.00 ? 348  LYS A CD    1 
ATOM   2678  C  CE    . LYS A  1  348  ? 167.436 173.630 180.203 1.00 0.00 ? 348  LYS A CE    1 
ATOM   2679  N  NZ    . LYS A  1  348  ? 168.470 174.091 181.181 1.00 0.00 ? 348  LYS A NZ    1 
ATOM   2680  N  N     . PRO A  1  349  ? 164.226 173.728 176.099 1.00 0.00 ? 349  PRO A N     1 
ATOM   2681  C  CA    . PRO A  1  349  ? 164.912 174.126 174.866 1.00 0.00 ? 349  PRO A CA    1 
ATOM   2682  C  C     . PRO A  1  349  ? 164.098 173.816 173.626 1.00 0.00 ? 349  PRO A C     1 
ATOM   2683  O  O     . PRO A  1  349  ? 164.576 173.137 172.708 1.00 0.00 ? 349  PRO A O     1 
ATOM   2684  C  CB    . PRO A  1  349  ? 166.198 173.293 174.912 1.00 0.00 ? 349  PRO A CB    1 
ATOM   2685  C  CG    . PRO A  1  349  ? 165.810 172.051 175.720 1.00 0.00 ? 349  PRO A CG    1 
ATOM   2686  C  CD    . PRO A  1  349  ? 164.443 172.293 176.338 1.00 0.00 ? 349  PRO A CD    1 
ATOM   2687  N  N     . ILE A  1  350  ? 162.863 174.319 173.582 1.00 0.00 ? 350  ILE A N     1 
ATOM   2688  C  CA    . ILE A  1  350  ? 161.999 174.059 172.436 1.00 0.00 ? 350  ILE A CA    1 
ATOM   2689  C  C     . ILE A  1  350  ? 162.571 174.711 171.187 1.00 0.00 ? 350  ILE A C     1 
ATOM   2690  O  O     . ILE A  1  350  ? 162.268 174.303 170.060 1.00 0.00 ? 350  ILE A O     1 
ATOM   2691  C  CB    . ILE A  1  350  ? 160.570 174.545 172.748 1.00 0.00 ? 350  ILE A CB    1 
ATOM   2692  C  CG1   . ILE A  1  350  ? 160.026 173.815 173.978 1.00 0.00 ? 350  ILE A CG1   1 
ATOM   2693  C  CG2   . ILE A  1  350  ? 159.642 174.304 171.565 1.00 0.00 ? 350  ILE A CG2   1 
ATOM   2694  C  CD1   . ILE A  1  350  ? 158.741 174.406 174.517 1.00 0.00 ? 350  ILE A CD1   1 
ATOM   2695  N  N     . ARG A  1  351  ? 163.424 175.714 171.367 1.00 0.00 ? 351  ARG A N     1 
ATOM   2696  C  CA    . ARG A  1  351  ? 164.026 176.399 170.236 1.00 0.00 ? 351  ARG A CA    1 
ATOM   2697  C  C     . ARG A  1  351  ? 164.804 175.417 169.369 1.00 0.00 ? 351  ARG A C     1 
ATOM   2698  O  O     . ARG A  1  351  ? 165.683 174.688 169.838 1.00 0.00 ? 351  ARG A O     1 
ATOM   2699  C  CB    . ARG A  1  351  ? 164.937 177.525 170.728 1.00 0.00 ? 351  ARG A CB    1 
ATOM   2700  C  CG    . ARG A  1  351  ? 166.143 177.070 171.561 1.00 0.00 ? 351  ARG A CG    1 
ATOM   2701  C  CD    . ARG A  1  351  ? 166.955 178.252 172.071 1.00 0.00 ? 351  ARG A CD    1 
ATOM   2702  N  NE    . ARG A  1  351  ? 168.219 177.872 172.696 1.00 0.00 ? 351  ARG A NE    1 
ATOM   2703  C  CZ    . ARG A  1  351  ? 168.348 177.537 173.973 1.00 0.00 ? 351  ARG A CZ    1 
ATOM   2704  N  NH1   . ARG A  1  351  ? 167.286 177.538 174.762 1.00 0.00 ? 351  ARG A NH1   1 
ATOM   2705  N  NH2   . ARG A  1  351  ? 169.536 177.208 174.462 1.00 0.00 ? 351  ARG A NH2   1 
ATOM   2706  N  N     . GLY A  1  352  ? 164.422 175.351 168.103 1.00 0.00 ? 352  GLY A N     1 
ATOM   2707  C  CA    . GLY A  1  352  ? 165.130 174.470 167.210 1.00 0.00 ? 352  GLY A CA    1 
ATOM   2708  C  C     . GLY A  1  352  ? 166.001 175.079 166.135 1.00 0.00 ? 352  GLY A C     1 
ATOM   2709  O  O     . GLY A  1  352  ? 166.878 174.386 165.618 1.00 0.00 ? 352  GLY A O     1 
ATOM   2710  N  N     . PHE A  1  353  ? 165.817 176.359 165.802 1.00 0.00 ? 353  PHE A N     1 
ATOM   2711  C  CA    . PHE A  1  353  ? 166.226 176.836 164.481 1.00 0.00 ? 353  PHE A CA    1 
ATOM   2712  C  C     . PHE A  1  353  ? 167.201 178.004 164.528 1.00 0.00 ? 353  PHE A C     1 
ATOM   2713  O  O     . PHE A  1  353  ? 168.359 177.865 164.134 1.00 0.00 ? 353  PHE A O     1 
ATOM   2714  C  CB    . PHE A  1  353  ? 165.001 177.245 163.665 1.00 0.00 ? 353  PHE A CB    1 
ATOM   2715  C  CG    . PHE A  1  353  ? 165.316 177.602 162.249 1.00 0.00 ? 353  PHE A CG    1 
ATOM   2716  C  CD1   . PHE A  1  353  ? 165.700 178.882 161.912 1.00 0.00 ? 353  PHE A CD1   1 
ATOM   2717  C  CD2   . PHE A  1  353  ? 165.278 176.640 161.263 1.00 0.00 ? 353  PHE A CD2   1 
ATOM   2718  C  CE1   . PHE A  1  353  ? 166.009 179.203 160.620 1.00 0.00 ? 353  PHE A CE1   1 
ATOM   2719  C  CE2   . PHE A  1  353  ? 165.568 176.955 159.967 1.00 0.00 ? 353  PHE A CE2   1 
ATOM   2720  C  CZ    . PHE A  1  353  ? 165.940 178.241 159.644 1.00 0.00 ? 353  PHE A CZ    1 
ATOM   2721  N  N     . CYS A  1  354  ? 166.735 179.179 164.941 1.00 0.00 ? 354  CYS A N     1 
ATOM   2722  C  CA    . CYS A  1  354  ? 167.614 180.338 164.943 1.00 0.00 ? 354  CYS A CA    1 
ATOM   2723  C  C     . CYS A  1  354  ? 168.925 180.044 165.640 1.00 0.00 ? 354  CYS A C     1 
ATOM   2724  O  O     . CYS A  1  354  ? 169.966 180.554 165.221 1.00 0.00 ? 354  CYS A O     1 
ATOM   2725  C  CB    . CYS A  1  354  ? 166.935 181.522 165.622 1.00 0.00 ? 354  CYS A CB    1 
ATOM   2726  S  SG    . CYS A  1  354  ? 167.875 183.053 165.568 1.00 0.00 ? 354  CYS A SG    1 
ATOM   2727  N  N     . GLN A  1  355  ? 168.894 179.206 166.669 1.00 0.00 ? 355  GLN A N     1 
ATOM   2728  C  CA    . GLN A  1  355  ? 170.078 178.932 167.467 1.00 0.00 ? 355  GLN A CA    1 
ATOM   2729  C  C     . GLN A  1  355  ? 170.988 177.903 166.823 1.00 0.00 ? 355  GLN A C     1 
ATOM   2730  O  O     . GLN A  1  355  ? 172.211 178.081 166.841 1.00 0.00 ? 355  GLN A O     1 
ATOM   2731  C  CB    . GLN A  1  355  ? 169.658 178.466 168.852 1.00 0.00 ? 355  GLN A CB    1 
ATOM   2732  C  CG    . GLN A  1  355  ? 168.858 179.519 169.553 1.00 0.00 ? 355  GLN A CG    1 
ATOM   2733  C  CD    . GLN A  1  355  ? 167.422 179.533 169.082 1.00 0.00 ? 355  GLN A CD    1 
ATOM   2734  O  OE1   . GLN A  1  355  ? 167.017 178.693 168.280 1.00 0.00 ? 355  GLN A OE1   1 
ATOM   2735  N  NE2   . GLN A  1  355  ? 166.656 180.507 169.544 1.00 0.00 ? 355  GLN A NE2   1 
ATOM   2736  N  N     . ARG A  1  356  ? 170.427 176.822 166.270 1.00 0.00 ? 356  ARG A N     1 
ATOM   2737  C  CA    . ARG A  1  356  ? 171.267 175.857 165.571 1.00 0.00 ? 356  ARG A CA    1 
ATOM   2738  C  C     . ARG A  1  356  ? 172.105 176.551 164.517 1.00 0.00 ? 356  ARG A C     1 
ATOM   2739  O  O     . ARG A  1  356  ? 173.215 176.109 164.220 1.00 0.00 ? 356  ARG A O     1 
ATOM   2740  C  CB    . ARG A  1  356  ? 170.427 174.772 164.911 1.00 0.00 ? 356  ARG A CB    1 
ATOM   2741  C  CG    . ARG A  1  356  ? 169.619 175.316 163.776 1.00 0.00 ? 356  ARG A CG    1 
ATOM   2742  C  CD    . ARG A  1  356  ? 168.790 174.300 163.068 1.00 0.00 ? 356  ARG A CD    1 
ATOM   2743  N  NE    . ARG A  1  356  ? 169.622 173.323 162.401 1.00 0.00 ? 356  ARG A NE    1 
ATOM   2744  C  CZ    . ARG A  1  356  ? 169.126 172.331 161.687 1.00 0.00 ? 356  ARG A CZ    1 
ATOM   2745  N  NH1   . ARG A  1  356  ? 167.822 172.231 161.545 1.00 0.00 ? 356  ARG A NH1   1 
ATOM   2746  N  NH2   . ARG A  1  356  ? 169.928 171.464 161.100 1.00 0.00 ? 356  ARG A NH2   1 
ATOM   2747  N  N     . LEU A  1  357  ? 171.598 177.647 163.968 1.00 0.00 ? 357  LEU A N     1 
ATOM   2748  C  CA    . LEU A  1  357  ? 172.328 178.472 163.029 1.00 0.00 ? 357  LEU A CA    1 
ATOM   2749  C  C     . LEU A  1  357  ? 173.317 179.402 163.712 1.00 0.00 ? 357  LEU A C     1 
ATOM   2750  O  O     . LEU A  1  357  ? 174.236 179.897 163.054 1.00 0.00 ? 357  LEU A O     1 
ATOM   2751  C  CB    . LEU A  1  357  ? 171.340 179.298 162.201 1.00 0.00 ? 357  LEU A CB    1 
ATOM   2752  C  CG    . LEU A  1  357  ? 171.921 180.279 161.192 1.00 0.00 ? 357  LEU A CG    1 
ATOM   2753  C  CD1   . LEU A  1  357  ? 172.634 179.509 160.129 1.00 0.00 ? 357  LEU A CD1   1 
ATOM   2754  C  CD2   . LEU A  1  357  ? 170.842 181.130 160.593 1.00 0.00 ? 357  LEU A CD2   1 
ATOM   2755  N  N     . LYS A  1  358  ? 173.191 179.622 165.018 1.00 0.00 ? 358  LYS A N     1 
ATOM   2756  C  CA    . LYS A  1  358  ? 173.716 180.856 165.586 1.00 0.00 ? 358  LYS A CA    1 
ATOM   2757  C  C     . LYS A  1  358  ? 174.986 180.734 166.414 1.00 0.00 ? 358  LYS A C     1 
ATOM   2758  O  O     . LYS A  1  358  ? 176.075 181.058 165.935 1.00 0.00 ? 358  LYS A O     1 
ATOM   2759  C  CB    . LYS A  1  358  ? 172.640 181.486 166.465 1.00 0.00 ? 358  LYS A CB    1 
ATOM   2760  C  CG    . LYS A  1  358  ? 173.016 182.787 167.105 1.00 0.00 ? 358  LYS A CG    1 
ATOM   2761  C  CD    . LYS A  1  358  ? 171.852 183.262 167.925 1.00 0.00 ? 358  LYS A CD    1 
ATOM   2762  C  CE    . LYS A  1  358  ? 172.136 184.567 168.611 1.00 0.00 ? 358  LYS A CE    1 
ATOM   2763  N  NZ    . LYS A  1  358  ? 170.955 184.989 169.405 1.00 0.00 ? 358  LYS A NZ    1 
ATOM   2764  N  N     . GLY A  1  359  ? 174.854 180.282 167.653 1.00 0.00 ? 359  GLY A N     1 
ATOM   2765  C  CA    . GLY A  1  359  ? 175.829 180.652 168.658 1.00 0.00 ? 359  GLY A CA    1 
ATOM   2766  C  C     . GLY A  1  359  ? 176.800 179.615 169.172 1.00 0.00 ? 359  GLY A C     1 
ATOM   2767  O  O     . GLY A  1  359  ? 176.724 178.432 168.825 1.00 0.00 ? 359  GLY A O     1 
ATOM   2768  N  N     . LYS A  1  360  ? 177.711 180.082 170.025 1.00 0.00 ? 360  LYS A N     1 
ATOM   2769  C  CA    . LYS A  1  360  ? 178.625 179.262 170.826 1.00 0.00 ? 360  LYS A CA    1 
ATOM   2770  C  C     . LYS A  1  360  ? 179.357 178.339 169.857 1.00 0.00 ? 360  LYS A C     1 
ATOM   2771  O  O     . LYS A  1  360  ? 179.985 178.833 168.907 1.00 0.00 ? 360  LYS A O     1 
ATOM   2772  C  CB    . LYS A  1  360  ? 177.823 178.582 171.923 1.00 0.00 ? 360  LYS A CB    1 
ATOM   2773  C  CG    . LYS A  1  360  ? 176.938 179.546 172.709 1.00 0.00 ? 360  LYS A CG    1 
ATOM   2774  C  CD    . LYS A  1  360  ? 177.721 180.719 173.277 1.00 0.00 ? 360  LYS A CD    1 
ATOM   2775  C  CE    . LYS A  1  360  ? 178.550 180.323 174.485 1.00 0.00 ? 360  LYS A CE    1 
ATOM   2776  N  NZ    . LYS A  1  360  ? 179.208 181.501 175.124 1.00 0.00 ? 360  LYS A NZ    1 
ATOM   2777  N  N     . GLN A  1  361  ? 179.287 177.025 170.018 1.00 0.00 ? 361  GLN A N     1 
ATOM   2778  C  CA    . GLN A  1  361  ? 179.572 176.139 168.913 1.00 0.00 ? 361  GLN A CA    1 
ATOM   2779  C  C     . GLN A  1  361  ? 178.233 175.681 168.349 1.00 0.00 ? 361  GLN A C     1 
ATOM   2780  O  O     . GLN A  1  361  ? 177.641 174.687 168.772 1.00 0.00 ? 361  GLN A O     1 
ATOM   2781  C  CB    . GLN A  1  361  ? 180.434 174.970 169.388 1.00 0.00 ? 361  GLN A CB    1 
ATOM   2782  C  CG    . GLN A  1  361  ? 181.841 175.375 169.818 1.00 0.00 ? 361  GLN A CG    1 
ATOM   2783  C  CD    . GLN A  1  361  ? 181.877 176.030 171.185 1.00 0.00 ? 361  GLN A CD    1 
ATOM   2784  O  OE1   . GLN A  1  361  ? 180.844 176.221 171.818 1.00 0.00 ? 361  GLN A OE1   1 
ATOM   2785  N  NE2   . GLN A  1  361  ? 183.071 176.386 171.642 1.00 0.00 ? 361  GLN A NE2   1 
ATOM   2786  N  N     . GLY A  1  362  ? 177.791 176.416 167.338 1.00 0.00 ? 362  GLY A N     1 
ATOM   2787  C  CA    . GLY A  1  362  ? 176.583 176.138 166.599 1.00 0.00 ? 362  GLY A CA    1 
ATOM   2788  C  C     . GLY A  1  362  ? 176.938 175.785 165.181 1.00 0.00 ? 362  GLY A C     1 
ATOM   2789  O  O     . GLY A  1  362  ? 178.052 175.333 164.915 1.00 0.00 ? 362  GLY A O     1 
ATOM   2790  N  N     . ARG A  1  363  ? 176.005 175.982 164.259 1.00 0.00 ? 363  ARG A N     1 
ATOM   2791  C  CA    . ARG A  1  363  ? 176.370 175.909 162.855 1.00 0.00 ? 363  ARG A CA    1 
ATOM   2792  C  C     . ARG A  1  363  ? 177.424 176.930 162.467 1.00 0.00 ? 363  ARG A C     1 
ATOM   2793  O  O     . ARG A  1  363  ? 178.597 176.594 162.298 1.00 0.00 ? 363  ARG A O     1 
ATOM   2794  C  CB    . ARG A  1  363  ? 175.158 176.135 161.968 1.00 0.00 ? 363  ARG A CB    1 
ATOM   2795  C  CG    . ARG A  1  363  ? 175.469 176.060 160.507 1.00 0.00 ? 363  ARG A CG    1 
ATOM   2796  C  CD    . ARG A  1  363  ? 176.062 174.723 160.201 1.00 0.00 ? 363  ARG A CD    1 
ATOM   2797  N  NE    . ARG A  1  363  ? 175.265 173.685 160.829 1.00 0.00 ? 363  ARG A NE    1 
ATOM   2798  C  CZ    . ARG A  1  363  ? 174.092 173.280 160.376 1.00 0.00 ? 363  ARG A CZ    1 
ATOM   2799  N  NH1   . ARG A  1  363  ? 173.572 173.844 159.304 1.00 0.00 ? 363  ARG A NH1   1 
ATOM   2800  N  NH2   . ARG A  1  363  ? 173.430 172.331 161.013 1.00 0.00 ? 363  ARG A NH2   1 
ATOM   2801  N  N     . PHE A  1  364  ? 177.013 178.192 162.380 1.00 0.00 ? 364  PHE A N     1 
ATOM   2802  C  CA    . PHE A  1  364  ? 177.703 179.123 161.500 1.00 0.00 ? 364  PHE A CA    1 
ATOM   2803  C  C     . PHE A  1  364  ? 179.188 179.184 161.815 1.00 0.00 ? 364  PHE A C     1 
ATOM   2804  O  O     . PHE A  1  364  ? 180.026 179.125 160.912 1.00 0.00 ? 364  PHE A O     1 
ATOM   2805  C  CB    . PHE A  1  364  ? 177.108 180.520 161.615 1.00 0.00 ? 364  PHE A CB    1 
ATOM   2806  C  CG    . PHE A  1  364  ? 177.489 181.410 160.484 1.00 0.00 ? 364  PHE A CG    1 
ATOM   2807  C  CD1   . PHE A  1  364  ? 178.745 181.963 160.407 1.00 0.00 ? 364  PHE A CD1   1 
ATOM   2808  C  CD2   . PHE A  1  364  ? 176.623 181.593 159.433 1.00 0.00 ? 364  PHE A CD2   1 
ATOM   2809  C  CE1   . PHE A  1  364  ? 179.097 182.733 159.333 1.00 0.00 ? 364  PHE A CE1   1 
ATOM   2810  C  CE2   . PHE A  1  364  ? 176.962 182.381 158.374 1.00 0.00 ? 364  PHE A CE2   1 
ATOM   2811  C  CZ    . PHE A  1  364  ? 178.203 182.950 158.323 1.00 0.00 ? 364  PHE A CZ    1 
ATOM   2812  N  N     . ARG A  1  365  ? 179.529 179.292 163.095 1.00 0.00 ? 365  ARG A N     1 
ATOM   2813  C  CA    . ARG A  1  365  ? 180.911 179.464 163.512 1.00 0.00 ? 365  ARG A CA    1 
ATOM   2814  C  C     . ARG A  1  365  ? 181.608 178.136 163.774 1.00 0.00 ? 365  ARG A C     1 
ATOM   2815  O  O     . ARG A  1  365  ? 182.493 177.737 163.014 1.00 0.00 ? 365  ARG A O     1 
ATOM   2816  C  CB    . ARG A  1  365  ? 180.979 180.344 164.760 1.00 0.00 ? 365  ARG A CB    1 
ATOM   2817  C  CG    . ARG A  1  365  ? 182.390 180.590 165.191 1.00 0.00 ? 365  ARG A CG    1 
ATOM   2818  C  CD    . ARG A  1  365  ? 182.497 181.464 166.420 1.00 0.00 ? 365  ARG A CD    1 
ATOM   2819  N  NE    . ARG A  1  365  ? 181.984 180.825 167.618 1.00 0.00 ? 365  ARG A NE    1 
ATOM   2820  C  CZ    . ARG A  1  365  ? 181.826 181.450 168.776 1.00 0.00 ? 365  ARG A CZ    1 
ATOM   2821  N  NH1   . ARG A  1  365  ? 182.167 182.725 168.897 1.00 0.00 ? 365  ARG A NH1   1 
ATOM   2822  N  NH2   . ARG A  1  365  ? 181.355 180.793 169.821 1.00 0.00 ? 365  ARG A NH2   1 
ATOM   2823  N  N     . GLY A  1  366  ? 181.221 177.442 164.844 1.00 0.00 ? 366  GLY A N     1 
ATOM   2824  C  CA    . GLY A  1  366  ? 181.900 176.217 165.226 1.00 0.00 ? 366  GLY A CA    1 
ATOM   2825  C  C     . GLY A  1  366  ? 181.825 175.109 164.198 1.00 0.00 ? 366  GLY A C     1 
ATOM   2826  O  O     . GLY A  1  366  ? 182.620 174.168 164.262 1.00 0.00 ? 366  GLY A O     1 
ATOM   2827  N  N     . ASN A  1  367  ? 180.905 175.204 163.250 1.00 0.00 ? 367  ASN A N     1 
ATOM   2828  C  CA    . ASN A  1  367  ? 180.724 174.173 162.239 1.00 0.00 ? 367  ASN A CA    1 
ATOM   2829  C  C     . ASN A  1  367  ? 181.214 174.597 160.868 1.00 0.00 ? 367  ASN A C     1 
ATOM   2830  O  O     . ASN A  1  367  ? 182.066 173.921 160.298 1.00 0.00 ? 367  ASN A O     1 
ATOM   2831  C  CB    . ASN A  1  367  ? 179.255 173.753 162.165 1.00 0.00 ? 367  ASN A CB    1 
ATOM   2832  C  CG    . ASN A  1  367  ? 179.036 172.541 161.308 1.00 0.00 ? 367  ASN A CG    1 
ATOM   2833  O  OD1   . ASN A  1  367  ? 179.838 172.221 160.438 1.00 0.00 ? 367  ASN A OD1   1 
ATOM   2834  N  ND2   . ASN A  1  367  ? 177.934 171.848 161.554 1.00 0.00 ? 367  ASN A ND2   1 
ATOM   2835  N  N     . LEU A  1  368  ? 180.673 175.668 160.296 1.00 0.00 ? 368  LEU A N     1 
ATOM   2836  C  CA    . LEU A  1  368  ? 181.075 176.031 158.943 1.00 0.00 ? 368  LEU A CA    1 
ATOM   2837  C  C     . LEU A  1  368  ? 182.460 176.670 158.888 1.00 0.00 ? 368  LEU A C     1 
ATOM   2838  O  O     . LEU A  1  368  ? 183.251 176.352 157.998 1.00 0.00 ? 368  LEU A O     1 
ATOM   2839  C  CB    . LEU A  1  368  ? 180.043 176.965 158.321 1.00 0.00 ? 368  LEU A CB    1 
ATOM   2840  C  CG    . LEU A  1  368  ? 180.232 177.157 156.822 1.00 0.00 ? 368  LEU A CG    1 
ATOM   2841  C  CD1   . LEU A  1  368  ? 178.887 177.325 156.168 1.00 0.00 ? 368  LEU A CD1   1 
ATOM   2842  C  CD2   . LEU A  1  368  ? 181.096 178.355 156.533 1.00 0.00 ? 368  LEU A CD2   1 
ATOM   2843  N  N     . SER A  1  369  ? 182.754 177.614 159.781 1.00 0.00 ? 369  SER A N     1 
ATOM   2844  C  CA    . SER A  1  369  ? 184.098 178.181 159.811 1.00 0.00 ? 369  SER A CA    1 
ATOM   2845  C  C     . SER A  1  369  ? 185.068 177.289 160.573 1.00 0.00 ? 369  SER A C     1 
ATOM   2846  O  O     . SER A  1  369  ? 186.283 177.371 160.365 1.00 0.00 ? 369  SER A O     1 
ATOM   2847  C  CB    . SER A  1  369  ? 184.070 179.570 160.435 1.00 0.00 ? 369  SER A CB    1 
ATOM   2848  O  OG    . SER A  1  369  ? 185.375 180.110 160.493 1.00 0.00 ? 369  SER A OG    1 
ATOM   2849  N  N     . GLY A  1  370  ? 184.550 176.454 161.464 1.00 0.00 ? 370  GLY A N     1 
ATOM   2850  C  CA    . GLY A  1  370  ? 185.326 175.587 162.329 1.00 0.00 ? 370  GLY A CA    1 
ATOM   2851  C  C     . GLY A  1  370  ? 185.370 174.137 161.904 1.00 0.00 ? 370  GLY A C     1 
ATOM   2852  O  O     . GLY A  1  370  ? 185.468 173.252 162.756 1.00 0.00 ? 370  GLY A O     1 
ATOM   2853  N  N     . LYS A  1  371  ? 185.249 173.883 160.606 1.00 0.00 ? 371  LYS A N     1 
ATOM   2854  C  CA    . LYS A  1  371  ? 184.953 172.556 160.101 1.00 0.00 ? 371  LYS A CA    1 
ATOM   2855  C  C     . LYS A  1  371  ? 185.872 171.506 160.701 1.00 0.00 ? 371  LYS A C     1 
ATOM   2856  O  O     . LYS A  1  371  ? 187.094 171.640 160.714 1.00 0.00 ? 371  LYS A O     1 
ATOM   2857  C  CB    . LYS A  1  371  ? 185.086 172.535 158.584 1.00 0.00 ? 371  LYS A CB    1 
ATOM   2858  C  CG    . LYS A  1  371  ? 184.060 173.398 157.890 1.00 0.00 ? 371  LYS A CG    1 
ATOM   2859  C  CD    . LYS A  1  371  ? 184.216 173.337 156.397 1.00 0.00 ? 371  LYS A CD    1 
ATOM   2860  C  CE    . LYS A  1  371  ? 183.929 171.940 155.928 1.00 0.00 ? 371  LYS A CE    1 
ATOM   2861  N  NZ    . LYS A  1  371  ? 182.530 171.526 156.209 1.00 0.00 ? 371  LYS A NZ    1 
ATOM   2862  N  N     . ARG A  1  372  ? 185.253 170.458 161.224 1.00 0.00 ? 372  ARG A N     1 
ATOM   2863  C  CA    . ARG A  1  372  ? 185.969 169.270 161.642 1.00 0.00 ? 372  ARG A CA    1 
ATOM   2864  C  C     . ARG A  1  372  ? 186.458 168.565 160.387 1.00 0.00 ? 372  ARG A C     1 
ATOM   2865  O  O     . ARG A  1  372  ? 185.788 168.573 159.355 1.00 0.00 ? 372  ARG A O     1 
ATOM   2866  C  CB    . ARG A  1  372  ? 185.063 168.369 162.480 1.00 0.00 ? 372  ARG A CB    1 
ATOM   2867  C  CG    . ARG A  1  372  ? 185.755 167.239 163.209 1.00 0.00 ? 372  ARG A CG    1 
ATOM   2868  C  CD    . ARG A  1  372  ? 184.752 166.402 163.975 1.00 0.00 ? 372  ARG A CD    1 
ATOM   2869  N  NE    . ARG A  1  372  ? 184.096 167.134 165.053 1.00 0.00 ? 372  ARG A NE    1 
ATOM   2870  C  CZ    . ARG A  1  372  ? 184.529 167.164 166.306 1.00 0.00 ? 372  ARG A CZ    1 
ATOM   2871  N  NH1   . ARG A  1  372  ? 185.607 166.481 166.653 1.00 0.00 ? 372  ARG A NH1   1 
ATOM   2872  N  NH2   . ARG A  1  372  ? 183.869 167.854 167.221 1.00 0.00 ? 372  ARG A NH2   1 
ATOM   2873  N  N     . VAL A  1  373  ? 187.640 167.974 160.464 1.00 0.00 ? 373  VAL A N     1 
ATOM   2874  C  CA    . VAL A  1  373  ? 188.429 167.700 159.272 1.00 0.00 ? 373  VAL A CA    1 
ATOM   2875  C  C     . VAL A  1  373  ? 188.670 166.205 159.157 1.00 0.00 ? 373  VAL A C     1 
ATOM   2876  O  O     . VAL A  1  373  ? 188.277 165.436 160.037 1.00 0.00 ? 373  VAL A O     1 
ATOM   2877  C  CB    . VAL A  1  373  ? 189.746 168.485 159.322 1.00 0.00 ? 373  VAL A CB    1 
ATOM   2878  C  CG1   . VAL A  1  373  ? 190.553 168.322 158.070 1.00 0.00 ? 373  VAL A CG1   1 
ATOM   2879  C  CG2   . VAL A  1  373  ? 189.430 169.916 159.512 1.00 0.00 ? 373  VAL A CG2   1 
ATOM   2880  N  N     . ASP A  1  374  ? 189.303 165.797 158.069 1.00 0.00 ? 374  ASP A N     1 
ATOM   2881  C  CA    . ASP A  1  374  ? 189.581 164.422 157.709 1.00 0.00 ? 374  ASP A CA    1 
ATOM   2882  C  C     . ASP A  1  374  ? 191.068 164.270 157.401 1.00 0.00 ? 374  ASP A C     1 
ATOM   2883  O  O     . ASP A  1  374  ? 191.782 165.255 157.211 1.00 0.00 ? 374  ASP A O     1 
ATOM   2884  C  CB    . ASP A  1  374  ? 188.715 164.045 156.510 1.00 0.00 ? 374  ASP A CB    1 
ATOM   2885  C  CG    . ASP A  1  374  ? 188.888 162.623 156.089 1.00 0.00 ? 374  ASP A CG    1 
ATOM   2886  O  OD1   . ASP A  1  374  ? 188.583 161.727 156.899 1.00 0.00 ? 374  ASP A OD1   1 
ATOM   2887  O  OD2   . ASP A  1  374  ? 189.300 162.397 154.937 1.00 0.00 ? 374  ASP A OD2   1 
ATOM   2888  N  N     . PHE A  1  375  ? 191.535 163.023 157.365 1.00 0.00 ? 375  PHE A N     1 
ATOM   2889  C  CA    . PHE A  1  375  ? 192.961 162.716 157.275 1.00 0.00 ? 375  PHE A CA    1 
ATOM   2890  C  C     . PHE A  1  375  ? 193.724 163.355 158.427 1.00 0.00 ? 375  PHE A C     1 
ATOM   2891  O  O     . PHE A  1  375  ? 194.518 164.270 158.239 1.00 0.00 ? 375  PHE A O     1 
ATOM   2892  C  CB    . PHE A  1  375  ? 193.569 163.171 155.952 1.00 0.00 ? 375  PHE A CB    1 
ATOM   2893  C  CG    . PHE A  1  375  ? 193.100 162.415 154.778 1.00 0.00 ? 375  PHE A CG    1 
ATOM   2894  C  CD1   . PHE A  1  375  ? 193.655 161.198 154.470 1.00 0.00 ? 375  PHE A CD1   1 
ATOM   2895  C  CD2   . PHE A  1  375  ? 192.136 162.936 153.956 1.00 0.00 ? 375  PHE A CD2   1 
ATOM   2896  C  CE1   . PHE A  1  375  ? 193.240 160.500 153.381 1.00 0.00 ? 375  PHE A CE1   1 
ATOM   2897  C  CE2   . PHE A  1  375  ? 191.710 162.242 152.863 1.00 0.00 ? 375  PHE A CE2   1 
ATOM   2898  C  CZ    . PHE A  1  375  ? 192.263 161.020 152.573 1.00 0.00 ? 375  PHE A CZ    1 
ATOM   2899  N  N     . SER A  1  376  ? 193.481 162.859 159.628 1.00 0.00 ? 376  SER A N     1 
ATOM   2900  C  CA    . SER A  1  376  ? 194.163 163.409 160.783 1.00 0.00 ? 376  SER A CA    1 
ATOM   2901  C  C     . SER A  1  376  ? 194.529 162.305 161.753 1.00 0.00 ? 376  SER A C     1 
ATOM   2902  O  O     . SER A  1  376  ? 194.350 161.117 161.485 1.00 0.00 ? 376  SER A O     1 
ATOM   2903  C  CB    . SER A  1  376  ? 193.313 164.467 161.481 1.00 0.00 ? 376  SER A CB    1 
ATOM   2904  O  OG    . SER A  1  376  ? 192.129 163.904 161.998 1.00 0.00 ? 376  SER A OG    1 
ATOM   2905  N  N     . GLY A  1  377  ? 195.069 162.722 162.891 1.00 0.00 ? 377  GLY A N     1 
ATOM   2906  C  CA    . GLY A  1  377  ? 195.500 161.796 163.916 1.00 0.00 ? 377  GLY A CA    1 
ATOM   2907  C  C     . GLY A  1  377  ? 195.855 162.567 165.164 1.00 0.00 ? 377  GLY A C     1 
ATOM   2908  O  O     . GLY A  1  377  ? 196.199 163.744 165.113 1.00 0.00 ? 377  GLY A O     1 
ATOM   2909  N  N     . ARG A  1  378  ? 195.781 161.878 166.294 1.00 0.00 ? 378  ARG A N     1 
ATOM   2910  C  CA    . ARG A  1  378  ? 195.988 162.527 167.579 1.00 0.00 ? 378  ARG A CA    1 
ATOM   2911  C  C     . ARG A  1  378  ? 196.734 161.545 168.459 1.00 0.00 ? 378  ARG A C     1 
ATOM   2912  O  O     . ARG A  1  378  ? 196.390 160.362 168.481 1.00 0.00 ? 378  ARG A O     1 
ATOM   2913  C  CB    . ARG A  1  378  ? 194.650 162.915 168.195 1.00 0.00 ? 378  ARG A CB    1 
ATOM   2914  C  CG    . ARG A  1  378  ? 194.734 163.797 169.409 1.00 0.00 ? 378  ARG A CG    1 
ATOM   2915  C  CD    . ARG A  1  378  ? 193.364 164.155 169.922 1.00 0.00 ? 378  ARG A CD    1 
ATOM   2916  N  NE    . ARG A  1  378  ? 193.444 165.068 171.053 1.00 0.00 ? 378  ARG A NE    1 
ATOM   2917  C  CZ    . ARG A  1  378  ? 193.502 166.389 170.940 1.00 0.00 ? 378  ARG A CZ    1 
ATOM   2918  N  NH1   . ARG A  1  378  ? 193.476 166.954 169.747 1.00 0.00 ? 378  ARG A NH1   1 
ATOM   2919  N  NH2   . ARG A  1  378  ? 193.577 167.144 172.024 1.00 0.00 ? 378  ARG A NH2   1 
ATOM   2920  N  N     . THR A  1  379  ? 197.759 162.011 169.165 1.00 0.00 ? 379  THR A N     1 
ATOM   2921  C  CA    . THR A  1  379  ? 198.586 161.095 169.930 1.00 0.00 ? 379  THR A CA    1 
ATOM   2922  C  C     . THR A  1  379  ? 199.307 161.867 171.021 1.00 0.00 ? 379  THR A C     1 
ATOM   2923  O  O     . THR A  1  379  ? 199.421 163.091 170.972 1.00 0.00 ? 379  THR A O     1 
ATOM   2924  C  CB    . THR A  1  379  ? 199.598 160.387 169.026 1.00 0.00 ? 379  THR A CB    1 
ATOM   2925  O  OG1   . THR A  1  379  ? 198.923 159.824 167.898 1.00 0.00 ? 379  THR A OG1   1 
ATOM   2926  C  CG2   . THR A  1  379  ? 200.269 159.248 169.761 1.00 0.00 ? 379  THR A CG2   1 
ATOM   2927  N  N     . VAL A  1  380  ? 199.779 161.135 172.020 1.00 0.00 ? 380  VAL A N     1 
ATOM   2928  C  CA    . VAL A  1  380  ? 200.725 161.671 172.983 1.00 0.00 ? 380  VAL A CA    1 
ATOM   2929  C  C     . VAL A  1  380  ? 202.058 161.843 172.279 1.00 0.00 ? 380  VAL A C     1 
ATOM   2930  O  O     . VAL A  1  380  ? 202.305 161.216 171.247 1.00 0.00 ? 380  VAL A O     1 
ATOM   2931  C  CB    . VAL A  1  380  ? 200.856 160.743 174.193 1.00 0.00 ? 380  VAL A CB    1 
ATOM   2932  C  CG1   . VAL A  1  380  ? 199.548 160.666 174.935 1.00 0.00 ? 380  VAL A CG1   1 
ATOM   2933  C  CG2   . VAL A  1  380  ? 201.261 159.381 173.729 1.00 0.00 ? 380  VAL A CG2   1 
ATOM   2934  N  N     . ILE A  1  381  ? 202.927 162.679 172.837 1.00 0.00 ? 381  ILE A N     1 
ATOM   2935  C  CA    . ILE A  1  381  ? 204.181 163.080 172.217 1.00 0.00 ? 381  ILE A CA    1 
ATOM   2936  C  C     . ILE A  1  381  ? 205.304 162.298 172.880 1.00 0.00 ? 381  ILE A C     1 
ATOM   2937  O  O     . ILE A  1  381  ? 205.054 161.471 173.760 1.00 0.00 ? 381  ILE A O     1 
ATOM   2938  C  CB    . ILE A  1  381  ? 204.375 164.589 172.402 1.00 0.00 ? 381  ILE A CB    1 
ATOM   2939  C  CG1   . ILE A  1  381  ? 203.083 165.290 172.079 1.00 0.00 ? 381  ILE A CG1   1 
ATOM   2940  C  CG2   . ILE A  1  381  ? 205.369 165.141 171.429 1.00 0.00 ? 381  ILE A CG2   1 
ATOM   2941  C  CD1   . ILE A  1  381  ? 203.095 166.692 172.520 1.00 0.00 ? 381  ILE A CD1   1 
ATOM   2942  N  N     . SER A  1  382  ? 206.549 162.564 172.464 1.00 0.00 ? 382  SER A N     1 
ATOM   2943  C  CA    . SER A  1  382  ? 207.732 162.116 173.197 1.00 0.00 ? 382  SER A CA    1 
ATOM   2944  C  C     . SER A  1  382  ? 208.963 162.639 172.487 1.00 0.00 ? 382  SER A C     1 
ATOM   2945  O  O     . SER A  1  382  ? 208.993 162.641 171.251 1.00 0.00 ? 382  SER A O     1 
ATOM   2946  C  CB    . SER A  1  382  ? 207.830 160.599 173.294 1.00 0.00 ? 382  SER A CB    1 
ATOM   2947  O  OG    . SER A  1  382  ? 208.147 160.066 172.032 1.00 0.00 ? 382  SER A OG    1 
ATOM   2948  N  N     . PRO A  1  383  ? 209.990 163.055 173.212 1.00 0.00 ? 383  PRO A N     1 
ATOM   2949  C  CA    . PRO A  1  383  ? 211.125 163.724 172.578 1.00 0.00 ? 383  PRO A CA    1 
ATOM   2950  C  C     . PRO A  1  383  ? 211.894 162.763 171.694 1.00 0.00 ? 383  PRO A C     1 
ATOM   2951  O  O     . PRO A  1  383  ? 211.926 161.555 171.917 1.00 0.00 ? 383  PRO A O     1 
ATOM   2952  C  CB    . PRO A  1  383  ? 211.983 164.164 173.759 1.00 0.00 ? 383  PRO A CB    1 
ATOM   2953  C  CG    . PRO A  1  383  ? 211.079 164.120 174.932 1.00 0.00 ? 383  PRO A CG    1 
ATOM   2954  C  CD    . PRO A  1  383  ? 210.143 162.996 174.668 1.00 0.00 ? 383  PRO A CD    1 
ATOM   2955  N  N     . ASP A  1  384  ? 212.485 163.322 170.647 1.00 0.00 ? 384  ASP A N     1 
ATOM   2956  C  CA    . ASP A  1  384  ? 213.436 162.602 169.816 1.00 0.00 ? 384  ASP A CA    1 
ATOM   2957  C  C     . ASP A  1  384  ? 214.559 163.534 169.372 1.00 0.00 ? 384  ASP A C     1 
ATOM   2958  O  O     . ASP A  1  384  ? 214.437 164.174 168.325 1.00 0.00 ? 384  ASP A O     1 
ATOM   2959  C  CB    . ASP A  1  384  ? 212.760 161.982 168.600 1.00 0.00 ? 384  ASP A CB    1 
ATOM   2960  C  CG    . ASP A  1  384  ? 213.703 161.111 167.797 1.00 0.00 ? 384  ASP A CG    1 
ATOM   2961  O  OD1   . ASP A  1  384  ? 214.892 160.995 168.174 1.00 0.00 ? 384  ASP A OD1   1 
ATOM   2962  O  OD2   . ASP A  1  384  ? 213.264 160.541 166.784 1.00 0.00 ? 384  ASP A OD2   1 
ATOM   2963  N  N     . PRO A  1  385  ? 215.626 163.663 170.130 1.00 0.00 ? 385  PRO A N     1 
ATOM   2964  C  CA    . PRO A  1  385  ? 216.737 164.505 169.693 1.00 0.00 ? 385  PRO A CA    1 
ATOM   2965  C  C     . PRO A  1  385  ? 217.354 164.033 168.389 1.00 0.00 ? 385  PRO A C     1 
ATOM   2966  O  O     . PRO A  1  385  ? 217.542 164.830 167.476 1.00 0.00 ? 385  PRO A O     1 
ATOM   2967  C  CB    . PRO A  1  385  ? 217.737 164.378 170.838 1.00 0.00 ? 385  PRO A CB    1 
ATOM   2968  C  CG    . PRO A  1  385  ? 217.490 163.034 171.357 1.00 0.00 ? 385  PRO A CG    1 
ATOM   2969  C  CD    . PRO A  1  385  ? 216.004 162.856 171.297 1.00 0.00 ? 385  PRO A CD    1 
ATOM   2970  N  N     . ASN A  1  386  ? 217.665 162.740 168.295 1.00 0.00 ? 386  ASN A N     1 
ATOM   2971  C  CA    . ASN A  1  386  ? 218.355 162.202 167.130 1.00 0.00 ? 386  ASN A CA    1 
ATOM   2972  C  C     . ASN A  1  386  ? 217.706 162.595 165.822 1.00 0.00 ? 386  ASN A C     1 
ATOM   2973  O  O     . ASN A  1  386  ? 218.417 162.878 164.857 1.00 0.00 ? 386  ASN A O     1 
ATOM   2974  C  CB    . ASN A  1  386  ? 218.420 160.692 167.233 1.00 0.00 ? 386  ASN A CB    1 
ATOM   2975  C  CG    . ASN A  1  386  ? 219.316 160.246 168.338 1.00 0.00 ? 386  ASN A CG    1 
ATOM   2976  O  OD1   . ASN A  1  386  ? 218.923 159.474 169.206 1.00 0.00 ? 386  ASN A OD1   1 
ATOM   2977  N  ND2   . ASN A  1  386  ? 220.547 160.721 168.309 1.00 0.00 ? 386  ASN A ND2   1 
ATOM   2978  N  N     . LEU A  1  387  ? 216.387 162.618 165.769 1.00 0.00 ? 387  LEU A N     1 
ATOM   2979  C  CA    . LEU A  1  387  ? 215.680 163.098 164.601 1.00 0.00 ? 387  LEU A CA    1 
ATOM   2980  C  C     . LEU A  1  387  ? 216.045 164.552 164.353 1.00 0.00 ? 387  LEU A C     1 
ATOM   2981  O  O     . LEU A  1  387  ? 216.197 165.332 165.294 1.00 0.00 ? 387  LEU A O     1 
ATOM   2982  C  CB    . LEU A  1  387  ? 214.175 162.950 164.802 1.00 0.00 ? 387  LEU A CB    1 
ATOM   2983  C  CG    . LEU A  1  387  ? 213.344 163.504 163.663 1.00 0.00 ? 387  LEU A CG    1 
ATOM   2984  C  CD1   . LEU A  1  387  ? 213.725 162.769 162.406 1.00 0.00 ? 387  LEU A CD1   1 
ATOM   2985  C  CD2   . LEU A  1  387  ? 211.877 163.323 163.958 1.00 0.00 ? 387  LEU A CD2   1 
ATOM   2986  N  N     . SER A  1  388  ? 216.186 164.917 163.086 1.00 0.00 ? 388  SER A N     1 
ATOM   2987  C  CA    . SER A  1  388  ? 216.576 166.275 162.750 1.00 0.00 ? 388  SER A CA    1 
ATOM   2988  C  C     . SER A  1  388  ? 215.444 167.248 163.060 1.00 0.00 ? 388  SER A C     1 
ATOM   2989  O  O     . SER A  1  388  ? 214.378 166.862 163.540 1.00 0.00 ? 388  SER A O     1 
ATOM   2990  C  CB    . SER A  1  388  ? 216.961 166.357 161.277 1.00 0.00 ? 388  SER A CB    1 
ATOM   2991  O  OG    . SER A  1  388  ? 217.053 167.698 160.854 1.00 0.00 ? 388  SER A OG    1 
ATOM   2992  N  N     . ILE A  1  389  ? 215.674 168.537 162.792 1.00 0.00 ? 389  ILE A N     1 
ATOM   2993  C  CA    . ILE A  1  389  ? 214.543 169.453 162.830 1.00 0.00 ? 389  ILE A CA    1 
ATOM   2994  C  C     . ILE A  1  389  ? 213.685 169.198 161.599 1.00 0.00 ? 389  ILE A C     1 
ATOM   2995  O  O     . ILE A  1  389  ? 214.007 168.369 160.755 1.00 0.00 ? 389  ILE A O     1 
ATOM   2996  C  CB    . ILE A  1  389  ? 215.003 170.917 162.902 1.00 0.00 ? 389  ILE A CB    1 
ATOM   2997  C  CG1   . ILE A  1  389  ? 215.861 171.117 164.123 1.00 0.00 ? 389  ILE A CG1   1 
ATOM   2998  C  CG2   . ILE A  1  389  ? 213.861 171.880 163.117 1.00 0.00 ? 389  ILE A CG2   1 
ATOM   2999  C  CD1   . ILE A  1  389  ? 216.430 172.482 164.179 1.00 0.00 ? 389  ILE A CD1   1 
ATOM   3000  N  N     . ASP A  1  390  ? 212.555 169.885 161.533 1.00 0.00 ? 390  ASP A N     1 
ATOM   3001  C  CA    . ASP A  1  390  ? 211.629 169.866 160.408 1.00 0.00 ? 390  ASP A CA    1 
ATOM   3002  C  C     . ASP A  1  390  ? 211.266 168.451 159.990 1.00 0.00 ? 390  ASP A C     1 
ATOM   3003  O  O     . ASP A  1  390  ? 210.909 168.211 158.837 1.00 0.00 ? 390  ASP A O     1 
ATOM   3004  C  CB    . ASP A  1  390  ? 212.155 170.699 159.221 1.00 0.00 ? 390  ASP A CB    1 
ATOM   3005  C  CG    . ASP A  1  390  ? 213.311 170.054 158.445 1.00 0.00 ? 390  ASP A CG    1 
ATOM   3006  O  OD1   . ASP A  1  390  ? 213.529 168.832 158.477 1.00 0.00 ? 390  ASP A OD1   1 
ATOM   3007  O  OD2   . ASP A  1  390  ? 214.031 170.813 157.765 1.00 0.00 ? 390  ASP A OD2   1 
ATOM   3008  N  N     . GLU A  1  391  ? 211.330 167.499 160.917 1.00 0.00 ? 391  GLU A N     1 
ATOM   3009  C  CA    . GLU A  1  391  ? 210.662 166.223 160.740 1.00 0.00 ? 391  GLU A CA    1 
ATOM   3010  C  C     . GLU A  1  391  ? 209.770 165.964 161.932 1.00 0.00 ? 391  GLU A C     1 
ATOM   3011  O  O     . GLU A  1  391  ? 209.953 166.548 162.999 1.00 0.00 ? 391  GLU A O     1 
ATOM   3012  C  CB    . GLU A  1  391  ? 211.591 165.021 160.610 1.00 0.00 ? 391  GLU A CB    1 
ATOM   3013  C  CG    . GLU A  1  391  ? 212.490 164.982 159.416 1.00 0.00 ? 391  GLU A CG    1 
ATOM   3014  C  CD    . GLU A  1  391  ? 213.856 165.451 159.773 1.00 0.00 ? 391  GLU A CD    1 
ATOM   3015  O  OE1   . GLU A  1  391  ? 214.030 165.796 160.952 1.00 0.00 ? 391  GLU A OE1   1 
ATOM   3016  O  OE2   . GLU A  1  391  ? 214.751 165.456 158.905 1.00 0.00 ? 391  GLU A OE2   1 
ATOM   3017  N  N     . VAL A  1  392  ? 208.804 165.081 161.738 1.00 0.00 ? 392  VAL A N     1 
ATOM   3018  C  CA    . VAL A  1  392  ? 208.002 164.530 162.813 1.00 0.00 ? 392  VAL A CA    1 
ATOM   3019  C  C     . VAL A  1  392  ? 208.010 163.028 162.650 1.00 0.00 ? 392  VAL A C     1 
ATOM   3020  O  O     . VAL A  1  392  ? 207.455 162.507 161.677 1.00 0.00 ? 392  VAL A O     1 
ATOM   3021  C  CB    . VAL A  1  392  ? 206.568 165.062 162.781 1.00 0.00 ? 392  VAL A CB    1 
ATOM   3022  C  CG1   . VAL A  1  392  ? 205.735 164.298 163.752 1.00 0.00 ? 392  VAL A CG1   1 
ATOM   3023  C  CG2   . VAL A  1  392  ? 206.559 166.498 163.142 1.00 0.00 ? 392  VAL A CG2   1 
ATOM   3024  N  N     . ALA A  1  393  ? 208.634 162.324 163.582 1.00 0.00 ? 393  ALA A N     1 
ATOM   3025  C  CA    . ALA A  1  393  ? 208.564 160.870 163.535 1.00 0.00 ? 393  ALA A CA    1 
ATOM   3026  C  C     . ALA A  1  393  ? 207.098 160.497 163.707 1.00 0.00 ? 393  ALA A C     1 
ATOM   3027  O  O     . ALA A  1  393  ? 206.386 161.013 164.568 1.00 0.00 ? 393  ALA A O     1 
ATOM   3028  C  CB    . ALA A  1  393  ? 209.437 160.236 164.598 1.00 0.00 ? 393  ALA A CB    1 
ATOM   3029  N  N     . VAL A  1  394  ? 206.629 159.613 162.845 1.00 0.00 ? 394  VAL A N     1 
ATOM   3030  C  CA    . VAL A  1  394  ? 205.220 159.234 162.913 1.00 0.00 ? 394  VAL A CA    1 
ATOM   3031  C  C     . VAL A  1  394  ? 205.136 157.734 163.136 1.00 0.00 ? 394  VAL A C     1 
ATOM   3032  O  O     . VAL A  1  394  ? 205.888 156.977 162.505 1.00 0.00 ? 394  VAL A O     1 
ATOM   3033  C  CB    . VAL A  1  394  ? 204.501 159.640 161.628 1.00 0.00 ? 394  VAL A CB    1 
ATOM   3034  C  CG1   . VAL A  1  394  ? 203.060 159.194 161.642 1.00 0.00 ? 394  VAL A CG1   1 
ATOM   3035  C  CG2   . VAL A  1  394  ? 204.558 161.125 161.456 1.00 0.00 ? 394  VAL A CG2   1 
ATOM   3036  N  N     . PRO A  1  395  ? 204.259 157.257 164.004 1.00 0.00 ? 395  PRO A N     1 
ATOM   3037  C  CA    . PRO A  1  395  ? 204.185 155.821 164.232 1.00 0.00 ? 395  PRO A CA    1 
ATOM   3038  C  C     . PRO A  1  395  ? 203.632 155.132 163.010 1.00 0.00 ? 395  PRO A C     1 
ATOM   3039  O  O     . PRO A  1  395  ? 202.602 155.533 162.466 1.00 0.00 ? 395  PRO A O     1 
ATOM   3040  C  CB    . PRO A  1  395  ? 203.230 155.708 165.416 1.00 0.00 ? 395  PRO A CB    1 
ATOM   3041  C  CG    . PRO A  1  395  ? 202.397 156.899 165.316 1.00 0.00 ? 395  PRO A CG    1 
ATOM   3042  C  CD    . PRO A  1  395  ? 203.296 157.986 164.830 1.00 0.00 ? 395  PRO A CD    1 
ATOM   3043  N  N     . ASP A  1  396  ? 204.317 154.083 162.585 1.00 0.00 ? 396  ASP A N     1 
ATOM   3044  C  CA    . ASP A  1  396  ? 203.866 153.409 161.380 1.00 0.00 ? 396  ASP A CA    1 
ATOM   3045  C  C     . ASP A  1  396  ? 202.442 152.908 161.519 1.00 0.00 ? 396  ASP A C     1 
ATOM   3046  O  O     . ASP A  1  396  ? 201.757 152.731 160.512 1.00 0.00 ? 396  ASP A O     1 
ATOM   3047  C  CB    . ASP A  1  396  ? 204.790 152.254 161.031 1.00 0.00 ? 396  ASP A CB    1 
ATOM   3048  C  CG    . ASP A  1  396  ? 204.800 151.193 162.081 1.00 0.00 ? 396  ASP A CG    1 
ATOM   3049  O  OD1   . ASP A  1  396  ? 204.187 151.406 163.143 1.00 0.00 ? 396  ASP A OD1   1 
ATOM   3050  O  OD2   . ASP A  1  396  ? 205.418 150.137 161.848 1.00 0.00 ? 396  ASP A OD2   1 
ATOM   3051  N  N     . ARG A  1  397  ? 201.972 152.709 162.747 1.00 0.00 ? 397  ARG A N     1 
ATOM   3052  C  CA    . ARG A  1  397  ? 200.652 152.129 162.928 1.00 0.00 ? 397  ARG A CA    1 
ATOM   3053  C  C     . ARG A  1  397  ? 199.552 153.159 162.698 1.00 0.00 ? 397  ARG A C     1 
ATOM   3054  O  O     . ARG A  1  397  ? 198.382 152.796 162.558 1.00 0.00 ? 397  ARG A O     1 
ATOM   3055  C  CB    . ARG A  1  397  ? 200.557 151.499 164.312 1.00 0.00 ? 397  ARG A CB    1 
ATOM   3056  C  CG    . ARG A  1  397  ? 199.292 150.725 164.560 1.00 0.00 ? 397  ARG A CG    1 
ATOM   3057  C  CD    . ARG A  1  397  ? 199.443 149.841 165.774 1.00 0.00 ? 397  ARG A CD    1 
ATOM   3058  N  NE    . ARG A  1  397  ? 200.448 148.807 165.551 1.00 0.00 ? 397  ARG A NE    1 
ATOM   3059  C  CZ    . ARG A  1  397  ? 201.665 148.818 166.082 1.00 0.00 ? 397  ARG A CZ    1 
ATOM   3060  N  NH1   . ARG A  1  397  ? 202.033 149.813 166.872 1.00 0.00 ? 397  ARG A NH1   1 
ATOM   3061  N  NH2   . ARG A  1  397  ? 202.514 147.834 165.821 1.00 0.00 ? 397  ARG A NH2   1 
ATOM   3062  N  N     . VAL A  1  398  ? 199.892 154.448 162.666 1.00 0.00 ? 398  VAL A N     1 
ATOM   3063  C  CA    . VAL A  1  398  ? 198.974 155.386 162.030 1.00 0.00 ? 398  VAL A CA    1 
ATOM   3064  C  C     . VAL A  1  398  ? 199.418 155.714 160.618 1.00 0.00 ? 398  VAL A C     1 
ATOM   3065  O  O     . VAL A  1  398  ? 198.722 156.450 159.915 1.00 0.00 ? 398  VAL A O     1 
ATOM   3066  C  CB    . VAL A  1  398  ? 198.797 156.701 162.801 1.00 0.00 ? 398  VAL A CB    1 
ATOM   3067  C  CG1   . VAL A  1  398  ? 198.351 156.429 164.213 1.00 0.00 ? 398  VAL A CG1   1 
ATOM   3068  C  CG2   . VAL A  1  398  ? 200.043 157.521 162.751 1.00 0.00 ? 398  VAL A CG2   1 
ATOM   3069  N  N     . ALA A  1  399  ? 200.559 155.197 160.182 1.00 0.00 ? 399  ALA A N     1 
ATOM   3070  C  CA    . ALA A  1  399  ? 200.944 155.372 158.793 1.00 0.00 ? 399  ALA A CA    1 
ATOM   3071  C  C     . ALA A  1  399  ? 200.240 154.392 157.881 1.00 0.00 ? 399  ALA A C     1 
ATOM   3072  O  O     . ALA A  1  399  ? 200.041 154.692 156.703 1.00 0.00 ? 399  ALA A O     1 
ATOM   3073  C  CB    . ALA A  1  399  ? 202.453 155.219 158.634 1.00 0.00 ? 399  ALA A CB    1 
ATOM   3074  N  N     . LYS A  1  400  ? 199.871 153.222 158.393 1.00 0.00 ? 400  LYS A N     1 
ATOM   3075  C  CA    . LYS A  1  400  ? 199.120 152.278 157.590 1.00 0.00 ? 400  LYS A CA    1 
ATOM   3076  C  C     . LYS A  1  400  ? 197.762 152.834 157.195 1.00 0.00 ? 400  LYS A C     1 
ATOM   3077  O  O     . LYS A  1  400  ? 197.339 152.641 156.052 1.00 0.00 ? 400  LYS A O     1 
ATOM   3078  C  CB    . LYS A  1  400  ? 198.949 150.959 158.340 1.00 0.00 ? 400  LYS A CB    1 
ATOM   3079  C  CG    . LYS A  1  400  ? 200.231 150.156 158.562 1.00 0.00 ? 400  LYS A CG    1 
ATOM   3080  C  CD    . LYS A  1  400  ? 199.926 148.863 159.310 1.00 0.00 ? 400  LYS A CD    1 
ATOM   3081  C  CE    . LYS A  1  400  ? 201.128 147.943 159.419 1.00 0.00 ? 400  LYS A CE    1 
ATOM   3082  N  NZ    . LYS A  1  400  ? 202.128 148.368 160.420 1.00 0.00 ? 400  LYS A NZ    1 
ATOM   3083  N  N     . VAL A  1  401  ? 197.070 153.514 158.106 1.00 0.00 ? 401  VAL A N     1 
ATOM   3084  C  CA    . VAL A  1  401  ? 195.693 153.905 157.876 1.00 0.00 ? 401  VAL A CA    1 
ATOM   3085  C  C     . VAL A  1  401  ? 195.547 155.351 157.423 1.00 0.00 ? 401  VAL A C     1 
ATOM   3086  O  O     . VAL A  1  401  ? 194.420 155.792 157.179 1.00 0.00 ? 401  VAL A O     1 
ATOM   3087  C  CB    . VAL A  1  401  ? 194.845 153.654 159.134 1.00 0.00 ? 401  VAL A CB    1 
ATOM   3088  C  CG1   . VAL A  1  401  ? 194.906 152.193 159.518 1.00 0.00 ? 401  VAL A CG1   1 
ATOM   3089  C  CG2   . VAL A  1  401  ? 195.325 154.531 160.245 1.00 0.00 ? 401  VAL A CG2   1 
ATOM   3090  N  N     . LEU A  1  402  ? 196.628 156.111 157.336 1.00 0.00 ? 402  LEU A N     1 
ATOM   3091  C  CA    . LEU A  1  402  ? 196.533 157.522 156.972 1.00 0.00 ? 402  LEU A CA    1 
ATOM   3092  C  C     . LEU A  1  402  ? 197.279 157.716 155.664 1.00 0.00 ? 402  LEU A C     1 
ATOM   3093  O  O     . LEU A  1  402  ? 198.508 157.675 155.629 1.00 0.00 ? 402  LEU A O     1 
ATOM   3094  C  CB    . LEU A  1  402  ? 197.108 158.375 158.088 1.00 0.00 ? 402  LEU A CB    1 
ATOM   3095  C  CG    . LEU A  1  402  ? 197.136 159.879 157.952 1.00 0.00 ? 402  LEU A CG    1 
ATOM   3096  C  CD1   . LEU A  1  402  ? 195.739 160.391 157.920 1.00 0.00 ? 402  LEU A CD1   1 
ATOM   3097  C  CD2   . LEU A  1  402  ? 197.859 160.421 159.138 1.00 0.00 ? 402  LEU A CD2   1 
ATOM   3098  N  N     . THR A  1  403  ? 196.550 157.961 154.587 1.00 0.00 ? 403  THR A N     1 
ATOM   3099  C  CA    . THR A  1  403  ? 197.079 157.737 153.252 1.00 0.00 ? 403  THR A CA    1 
ATOM   3100  C  C     . THR A  1  403  ? 197.182 159.032 152.469 1.00 0.00 ? 403  THR A C     1 
ATOM   3101  O  O     . THR A  1  403  ? 196.524 160.029 152.754 1.00 0.00 ? 403  THR A O     1 
ATOM   3102  C  CB    . THR A  1  403  ? 196.199 156.754 152.485 1.00 0.00 ? 403  THR A CB    1 
ATOM   3103  O  OG1   . THR A  1  403  ? 194.917 157.340 152.268 1.00 0.00 ? 403  THR A OG1   1 
ATOM   3104  C  CG2   . THR A  1  403  ? 196.013 155.481 153.286 1.00 0.00 ? 403  THR A CG2   1 
ATOM   3105  N  N     . TYR A  1  404  ? 198.022 158.996 151.460 1.00 0.00 ? 404  TYR A N     1 
ATOM   3106  C  CA    . TYR A  1  404  ? 198.147 160.172 150.623 1.00 0.00 ? 404  TYR A CA    1 
ATOM   3107  C  C     . TYR A  1  404  ? 197.870 159.810 149.172 1.00 0.00 ? 404  TYR A C     1 
ATOM   3108  O  O     . TYR A  1  404  ? 198.341 158.772 148.692 1.00 0.00 ? 404  TYR A O     1 
ATOM   3109  C  CB    . TYR A  1  404  ? 199.540 160.758 150.789 1.00 0.00 ? 404  TYR A CB    1 
ATOM   3110  C  CG    . TYR A  1  404  ? 199.863 161.815 149.787 1.00 0.00 ? 404  TYR A CG    1 
ATOM   3111  C  CD1   . TYR A  1  404  ? 199.345 163.082 149.900 1.00 0.00 ? 404  TYR A CD1   1 
ATOM   3112  C  CD2   . TYR A  1  404  ? 200.695 161.547 148.727 1.00 0.00 ? 404  TYR A CD2   1 
ATOM   3113  C  CE1   . TYR A  1  404  ? 199.633 164.044 148.977 1.00 0.00 ? 404  TYR A CE1   1 
ATOM   3114  C  CE2   . TYR A  1  404  ? 201.005 162.510 147.811 1.00 0.00 ? 404  TYR A CE2   1 
ATOM   3115  C  CZ    . TYR A  1  404  ? 200.465 163.751 147.933 1.00 0.00 ? 404  TYR A CZ    1 
ATOM   3116  O  OH    . TYR A  1  404  ? 200.777 164.704 147.004 1.00 0.00 ? 404  TYR A OH    1 
ATOM   3117  N  N     . PRO A  1  405  ? 197.117 160.631 148.444 1.00 0.00 ? 405  PRO A N     1 
ATOM   3118  C  CA    . PRO A  1  405  ? 196.811 160.305 147.049 1.00 0.00 ? 405  PRO A CA    1 
ATOM   3119  C  C     . PRO A  1  405  ? 197.979 160.644 146.144 1.00 0.00 ? 405  PRO A C     1 
ATOM   3120  O  O     . PRO A  1  405  ? 198.724 161.588 146.396 1.00 0.00 ? 405  PRO A O     1 
ATOM   3121  C  CB    . PRO A  1  405  ? 195.590 161.172 146.740 1.00 0.00 ? 405  PRO A CB    1 
ATOM   3122  C  CG    . PRO A  1  405  ? 195.733 162.313 147.633 1.00 0.00 ? 405  PRO A CG    1 
ATOM   3123  C  CD    . PRO A  1  405  ? 196.342 161.788 148.906 1.00 0.00 ? 405  PRO A CD    1 
ATOM   3124  N  N     . GLU A  1  406  ? 198.109 159.879 145.071 1.00 0.00 ? 406  GLU A N     1 
ATOM   3125  C  CA    . GLU A  1  406  ? 199.197 160.006 144.116 1.00 0.00 ? 406  GLU A CA    1 
ATOM   3126  C  C     . GLU A  1  406  ? 198.628 159.700 142.744 1.00 0.00 ? 406  GLU A C     1 
ATOM   3127  O  O     . GLU A  1  406  ? 197.888 158.725 142.585 1.00 0.00 ? 406  GLU A O     1 
ATOM   3128  C  CB    . GLU A  1  406  ? 200.327 159.038 144.453 1.00 0.00 ? 406  GLU A CB    1 
ATOM   3129  C  CG    . GLU A  1  406  ? 201.507 159.113 143.531 1.00 0.00 ? 406  GLU A CG    1 
ATOM   3130  C  CD    . GLU A  1  406  ? 202.304 160.363 143.724 1.00 0.00 ? 406  GLU A CD    1 
ATOM   3131  O  OE1   . GLU A  1  406  ? 202.111 161.021 144.763 1.00 0.00 ? 406  GLU A OE1   1 
ATOM   3132  O  OE2   . GLU A  1  406  ? 203.134 160.680 142.846 1.00 0.00 ? 406  GLU A OE2   1 
ATOM   3133  N  N     . LYS A  1  407  ? 198.964 160.522 141.761 1.00 0.00 ? 407  LYS A N     1 
ATOM   3134  C  CA    . LYS A  1  407  ? 198.586 160.222 140.391 1.00 0.00 ? 407  LYS A CA    1 
ATOM   3135  C  C     . LYS A  1  407  ? 199.790 159.640 139.675 1.00 0.00 ? 407  LYS A C     1 
ATOM   3136  O  O     . LYS A  1  407  ? 200.763 160.348 139.408 1.00 0.00 ? 407  LYS A O     1 
ATOM   3137  C  CB    . LYS A  1  407  ? 198.090 161.476 139.675 1.00 0.00 ? 407  LYS A CB    1 
ATOM   3138  C  CG    . LYS A  1  407  ? 196.783 162.020 140.220 1.00 0.00 ? 407  LYS A CG    1 
ATOM   3139  C  CD    . LYS A  1  407  ? 196.340 163.262 139.469 1.00 0.00 ? 407  LYS A CD    1 
ATOM   3140  C  CE    . LYS A  1  407  ? 195.005 163.774 139.990 1.00 0.00 ? 407  LYS A CE    1 
ATOM   3141  N  NZ    . LYS A  1  407  ? 194.574 165.028 139.314 1.00 0.00 ? 407  LYS A NZ    1 
ATOM   3142  N  N     . VAL A  1  408  ? 199.735 158.349 139.364 1.00 0.00 ? 408  VAL A N     1 
ATOM   3143  C  CA    . VAL A  1  408  ? 200.937 157.694 138.879 1.00 0.00 ? 408  VAL A CA    1 
ATOM   3144  C  C     . VAL A  1  408  ? 201.138 158.162 137.450 1.00 0.00 ? 408  VAL A C     1 
ATOM   3145  O  O     . VAL A  1  408  ? 200.276 157.984 136.586 1.00 0.00 ? 408  VAL A O     1 
ATOM   3146  C  CB    . VAL A  1  408  ? 200.746 156.170 138.864 1.00 0.00 ? 408  VAL A CB    1 
ATOM   3147  C  CG1   . VAL A  1  408  ? 199.487 155.792 138.118 1.00 0.00 ? 408  VAL A CG1   1 
ATOM   3148  C  CG2   . VAL A  1  408  ? 201.943 155.509 138.207 1.00 0.00 ? 408  VAL A CG2   1 
ATOM   3149  N  N     . THR A  1  409  ? 202.277 158.783 137.184 1.00 0.00 ? 409  THR A N     1 
ATOM   3150  C  CA    . THR A  1  409  ? 202.474 159.146 135.810 1.00 0.00 ? 409  THR A CA    1 
ATOM   3151  C  C     . THR A  1  409  ? 203.966 159.033 135.493 1.00 0.00 ? 409  THR A C     1 
ATOM   3152  O  O     . THR A  1  409  ? 204.840 159.657 136.083 1.00 0.00 ? 409  THR A O     1 
ATOM   3153  C  CB    . THR A  1  409  ? 201.877 160.513 135.486 1.00 0.00 ? 409  THR A CB    1 
ATOM   3154  O  OG1   . THR A  1  409  ? 202.501 161.470 136.328 1.00 0.00 ? 409  THR A OG1   1 
ATOM   3155  C  CG2   . THR A  1  409  ? 200.378 160.515 135.703 1.00 0.00 ? 409  THR A CG2   1 
ATOM   3156  N  N     . ARG A  1  410  ? 204.259 158.111 134.583 1.00 0.00 ? 410  ARG A N     1 
ATOM   3157  C  CA    . ARG A  1  410  ? 205.520 158.028 133.860 1.00 0.00 ? 410  ARG A CA    1 
ATOM   3158  C  C     . ARG A  1  410  ? 206.827 157.935 134.635 1.00 0.00 ? 410  ARG A C     1 
ATOM   3159  O  O     . ARG A  1  410  ? 207.792 157.322 134.169 1.00 0.00 ? 410  ARG A O     1 
ATOM   3160  C  CB    . ARG A  1  410  ? 205.585 159.214 132.901 1.00 0.00 ? 410  ARG A CB    1 
ATOM   3161  C  CG    . ARG A  1  410  ? 206.799 159.184 132.003 1.00 0.00 ? 410  ARG A CG    1 
ATOM   3162  C  CD    . ARG A  1  410  ? 206.896 160.402 131.116 1.00 0.00 ? 410  ARG A CD    1 
ATOM   3163  N  NE    . ARG A  1  410  ? 205.847 160.434 130.109 1.00 0.00 ? 410  ARG A NE    1 
ATOM   3164  C  CZ    . ARG A  1  410  ? 205.702 161.419 129.235 1.00 0.00 ? 410  ARG A CZ    1 
ATOM   3165  N  NH1   . ARG A  1  410  ? 206.541 162.442 129.259 1.00 0.00 ? 410  ARG A NH1   1 
ATOM   3166  N  NH2   . ARG A  1  410  ? 204.723 161.385 128.345 1.00 0.00 ? 410  ARG A NH2   1 
ATOM   3167  N  N     . TYR A  1  411  ? 206.865 158.530 135.826 1.00 0.00 ? 411  TYR A N     1 
ATOM   3168  C  CA    . TYR A  1  411  ? 208.049 158.438 136.663 1.00 0.00 ? 411  TYR A CA    1 
ATOM   3169  C  C     . TYR A  1  411  ? 207.835 157.496 137.833 1.00 0.00 ? 411  TYR A C     1 
ATOM   3170  O  O     . TYR A  1  411  ? 208.801 157.016 138.431 1.00 0.00 ? 411  TYR A O     1 
ATOM   3171  C  CB    . TYR A  1  411  ? 208.392 159.833 137.159 1.00 0.00 ? 411  TYR A CB    1 
ATOM   3172  C  CG    . TYR A  1  411  ? 208.464 160.815 136.026 1.00 0.00 ? 411  TYR A CG    1 
ATOM   3173  C  CD1   . TYR A  1  411  ? 209.122 160.499 134.857 1.00 0.00 ? 411  TYR A CD1   1 
ATOM   3174  C  CD2   . TYR A  1  411  ? 207.817 162.032 136.103 1.00 0.00 ? 411  TYR A CD2   1 
ATOM   3175  C  CE1   . TYR A  1  411  ? 209.172 161.385 133.812 1.00 0.00 ? 411  TYR A CE1   1 
ATOM   3176  C  CE2   . TYR A  1  411  ? 207.861 162.924 135.063 1.00 0.00 ? 411  TYR A CE2   1 
ATOM   3177  C  CZ    . TYR A  1  411  ? 208.541 162.596 133.920 1.00 0.00 ? 411  TYR A CZ    1 
ATOM   3178  O  OH    . TYR A  1  411  ? 208.588 163.483 132.874 1.00 0.00 ? 411  TYR A OH    1 
ATOM   3179  N  N     . ASN A  1  412  ? 206.581 157.212 138.161 1.00 0.00 ? 412  ASN A N     1 
ATOM   3180  C  CA    . ASN A  1  412  ? 206.258 156.561 139.416 1.00 0.00 ? 412  ASN A CA    1 
ATOM   3181  C  C     . ASN A  1  412  ? 206.069 155.066 139.288 1.00 0.00 ? 412  ASN A C     1 
ATOM   3182  O  O     . ASN A  1  412  ? 206.024 154.372 140.308 1.00 0.00 ? 412  ASN A O     1 
ATOM   3183  C  CB    . ASN A  1  412  ? 204.999 157.183 140.002 1.00 0.00 ? 412  ASN A CB    1 
ATOM   3184  C  CG    . ASN A  1  412  ? 205.196 158.623 140.346 1.00 0.00 ? 412  ASN A CG    1 
ATOM   3185  O  OD1   . ASN A  1  412  ? 206.326 159.074 140.483 1.00 0.00 ? 412  ASN A OD1   1 
ATOM   3186  N  ND2   . ASN A  1  412  ? 204.104 159.359 140.502 1.00 0.00 ? 412  ASN A ND2   1 
ATOM   3187  N  N     . ARG A  1  413  ? 205.970 154.556 138.064 1.00 0.00 ? 413  ARG A N     1 
ATOM   3188  C  CA    . ARG A  1  413  ? 205.486 153.196 137.879 1.00 0.00 ? 413  ARG A CA    1 
ATOM   3189  C  C     . ARG A  1  413  ? 206.343 152.186 138.626 1.00 0.00 ? 413  ARG A C     1 
ATOM   3190  O  O     . ARG A  1  413  ? 205.860 151.527 139.552 1.00 0.00 ? 413  ARG A O     1 
ATOM   3191  C  CB    . ARG A  1  413  ? 205.409 152.865 136.396 1.00 0.00 ? 413  ARG A CB    1 
ATOM   3192  C  CG    . ARG A  1  413  ? 204.286 153.585 135.688 1.00 0.00 ? 413  ARG A CG    1 
ATOM   3193  C  CD    . ARG A  1  413  ? 204.284 153.251 134.217 1.00 0.00 ? 413  ARG A CD    1 
ATOM   3194  N  NE    . ARG A  1  413  ? 204.047 151.831 134.003 1.00 0.00 ? 413  ARG A NE    1 
ATOM   3195  C  CZ    . ARG A  1  413  ? 202.840 151.281 133.951 1.00 0.00 ? 413  ARG A CZ    1 
ATOM   3196  N  NH1   . ARG A  1  413  ? 201.763 152.037 134.096 1.00 0.00 ? 413  ARG A NH1   1 
ATOM   3197  N  NH2   . ARG A  1  413  ? 202.709 149.978 133.754 1.00 0.00 ? 413  ARG A NH2   1 
ATOM   3198  N  N     . HIS A  1  414  ? 207.615 152.063 138.258 1.00 0.00 ? 414  HIS A N     1 
ATOM   3199  C  CA    . HIS A  1  414  ? 208.453 151.020 138.831 1.00 0.00 ? 414  HIS A CA    1 
ATOM   3200  C  C     . HIS A  1  414  ? 208.635 151.148 140.330 1.00 0.00 ? 414  HIS A C     1 
ATOM   3201  O  O     . HIS A  1  414  ? 209.158 150.218 140.953 1.00 0.00 ? 414  HIS A O     1 
ATOM   3202  C  CB    . HIS A  1  414  ? 209.795 151.000 138.125 1.00 0.00 ? 414  HIS A CB    1 
ATOM   3203  C  CG    . HIS A  1  414  ? 209.669 150.678 136.678 1.00 0.00 ? 414  HIS A CG    1 
ATOM   3204  N  ND1   . HIS A  1  414  ? 209.261 149.439 136.236 1.00 0.00 ? 414  HIS A ND1   1 
ATOM   3205  C  CD2   . HIS A  1  414  ? 209.840 151.437 135.571 1.00 0.00 ? 414  HIS A CD2   1 
ATOM   3206  C  CE1   . HIS A  1  414  ? 209.211 149.441 134.917 1.00 0.00 ? 414  HIS A CE1   1 
ATOM   3207  N  NE2   . HIS A  1  414  ? 209.559 150.641 134.488 1.00 0.00 ? 414  HIS A NE2   1 
ATOM   3208  N  N     . LYS A  1  415  ? 208.237 152.266 140.924 1.00 0.00 ? 415  LYS A N     1 
ATOM   3209  C  CA    . LYS A  1  415  ? 207.806 152.238 142.304 1.00 0.00 ? 415  LYS A CA    1 
ATOM   3210  C  C     . LYS A  1  415  ? 206.415 151.664 142.438 1.00 0.00 ? 415  LYS A C     1 
ATOM   3211  O  O     . LYS A  1  415  ? 206.257 150.581 143.006 1.00 0.00 ? 415  LYS A O     1 
ATOM   3212  C  CB    . LYS A  1  415  ? 207.807 153.631 142.937 1.00 0.00 ? 415  LYS A CB    1 
ATOM   3213  C  CG    . LYS A  1  415  ? 209.137 154.332 142.992 1.00 0.00 ? 415  LYS A CG    1 
ATOM   3214  C  CD    . LYS A  1  415  ? 210.072 153.541 143.887 1.00 0.00 ? 415  LYS A CD    1 
ATOM   3215  C  CE    . LYS A  1  415  ? 211.405 154.258 144.028 1.00 0.00 ? 415  LYS A CE    1 
ATOM   3216  N  NZ    . LYS A  1  415  ? 212.349 153.497 144.879 1.00 0.00 ? 415  LYS A NZ    1 
ATOM   3217  N  N     . LEU A  1  416  ? 205.410 152.335 141.901 1.00 0.00 ? 416  LEU A N     1 
ATOM   3218  C  CA    . LEU A  1  416  ? 204.035 152.041 142.256 1.00 0.00 ? 416  LEU A CA    1 
ATOM   3219  C  C     . LEU A  1  416  ? 203.543 150.699 141.751 1.00 0.00 ? 416  LEU A C     1 
ATOM   3220  O  O     . LEU A  1  416  ? 202.893 149.984 142.514 1.00 0.00 ? 416  LEU A O     1 
ATOM   3221  C  CB    . LEU A  1  416  ? 203.114 153.154 141.757 1.00 0.00 ? 416  LEU A CB    1 
ATOM   3222  C  CG    . LEU A  1  416  ? 202.980 154.332 142.720 1.00 0.00 ? 416  LEU A CG    1 
ATOM   3223  C  CD1   . LEU A  1  416  ? 204.316 154.963 142.998 1.00 0.00 ? 416  LEU A CD1   1 
ATOM   3224  C  CD2   . LEU A  1  416  ? 202.099 155.347 142.089 1.00 0.00 ? 416  LEU A CD2   1 
ATOM   3225  N  N     . GLN A  1  417  ? 203.850 150.315 140.509 1.00 0.00 ? 417  GLN A N     1 
ATOM   3226  C  CA    . GLN A  1  417  ? 203.464 148.975 140.087 1.00 0.00 ? 417  GLN A CA    1 
ATOM   3227  C  C     . GLN A  1  417  ? 204.071 147.925 140.997 1.00 0.00 ? 417  GLN A C     1 
ATOM   3228  O  O     . GLN A  1  417  ? 203.510 146.834 141.132 1.00 0.00 ? 417  GLN A O     1 
ATOM   3229  C  CB    . GLN A  1  417  ? 203.866 148.697 138.637 1.00 0.00 ? 417  GLN A CB    1 
ATOM   3230  C  CG    . GLN A  1  417  ? 205.352 148.585 138.395 1.00 0.00 ? 417  GLN A CG    1 
ATOM   3231  C  CD    . GLN A  1  417  ? 205.675 148.208 136.964 1.00 0.00 ? 417  GLN A CD    1 
ATOM   3232  O  OE1   . GLN A  1  417  ? 204.851 148.375 136.065 1.00 0.00 ? 417  GLN A OE1   1 
ATOM   3233  N  NE2   . GLN A  1  417  ? 206.875 147.681 136.747 1.00 0.00 ? 417  GLN A NE2   1 
ATOM   3234  N  N     . GLU A  1  418  ? 205.203 148.234 141.622 1.00 0.00 ? 418  GLU A N     1 
ATOM   3235  C  CA    . GLU A  1  418  ? 205.689 147.448 142.741 1.00 0.00 ? 418  GLU A CA    1 
ATOM   3236  C  C     . GLU A  1  418  ? 204.988 147.807 144.041 1.00 0.00 ? 418  GLU A C     1 
ATOM   3237  O  O     . GLU A  1  418  ? 204.675 146.915 144.831 1.00 0.00 ? 418  GLU A O     1 
ATOM   3238  C  CB    . GLU A  1  418  ? 207.204 147.630 142.888 1.00 0.00 ? 418  GLU A CB    1 
ATOM   3239  C  CG    . GLU A  1  418  ? 207.842 146.876 144.042 1.00 0.00 ? 418  GLU A CG    1 
ATOM   3240  C  CD    . GLU A  1  418  ? 207.708 147.610 145.356 1.00 0.00 ? 418  GLU A CD    1 
ATOM   3241  O  OE1   . GLU A  1  418  ? 207.504 148.838 145.320 1.00 0.00 ? 418  GLU A OE1   1 
ATOM   3242  O  OE2   . GLU A  1  418  ? 207.803 146.966 146.420 1.00 0.00 ? 418  GLU A OE2   1 
ATOM   3243  N  N     . LEU A  1  419  ? 204.732 149.090 144.286 1.00 0.00 ? 419  LEU A N     1 
ATOM   3244  C  CA    . LEU A  1  419  ? 204.241 149.484 145.599 1.00 0.00 ? 419  LEU A CA    1 
ATOM   3245  C  C     . LEU A  1  419  ? 202.889 148.862 145.919 1.00 0.00 ? 419  LEU A C     1 
ATOM   3246  O  O     . LEU A  1  419  ? 202.566 148.687 147.096 1.00 0.00 ? 419  LEU A O     1 
ATOM   3247  C  CB    . LEU A  1  419  ? 204.148 151.001 145.691 1.00 0.00 ? 419  LEU A CB    1 
ATOM   3248  C  CG    . LEU A  1  419  ? 203.885 151.543 147.084 1.00 0.00 ? 419  LEU A CG    1 
ATOM   3249  C  CD1   . LEU A  1  419  ? 205.087 151.222 147.921 1.00 0.00 ? 419  LEU A CD1   1 
ATOM   3250  C  CD2   . LEU A  1  419  ? 203.671 153.024 147.031 1.00 0.00 ? 419  LEU A CD2   1 
ATOM   3251  N  N     . ILE A  1  420  ? 202.100 148.523 144.901 1.00 0.00 ? 420  ILE A N     1 
ATOM   3252  C  CA    . ILE A  1  420  ? 200.852 147.804 145.129 1.00 0.00 ? 420  ILE A CA    1 
ATOM   3253  C  C     . ILE A  1  420  ? 201.114 146.398 145.631 1.00 0.00 ? 420  ILE A C     1 
ATOM   3254  O  O     . ILE A  1  420  ? 200.488 145.952 146.598 1.00 0.00 ? 420  ILE A O     1 
ATOM   3255  C  CB    . ILE A  1  420  ? 199.996 147.786 143.854 1.00 0.00 ? 420  ILE A CB    1 
ATOM   3256  C  CG1   . ILE A  1  420  ? 199.464 149.175 143.565 1.00 0.00 ? 420  ILE A CG1   1 
ATOM   3257  C  CG2   . ILE A  1  420  ? 198.844 146.834 144.006 1.00 0.00 ? 420  ILE A CG2   1 
ATOM   3258  C  CD1   . ILE A  1  420  ? 198.574 149.671 144.655 1.00 0.00 ? 420  ILE A CD1   1 
ATOM   3259  N  N     . VAL A  1  421  ? 202.043 145.677 144.999 1.00 0.00 ? 421  VAL A N     1 
ATOM   3260  C  CA    . VAL A  1  421  ? 202.164 144.254 145.277 1.00 0.00 ? 421  VAL A CA    1 
ATOM   3261  C  C     . VAL A  1  421  ? 202.477 144.007 146.745 1.00 0.00 ? 421  VAL A C     1 
ATOM   3262  O  O     . VAL A  1  421  ? 202.256 142.900 147.244 1.00 0.00 ? 421  VAL A O     1 
ATOM   3263  C  CB    . VAL A  1  421  ? 203.225 143.595 144.376 1.00 0.00 ? 421  VAL A CB    1 
ATOM   3264  C  CG1   . VAL A  1  421  ? 204.621 143.929 144.844 1.00 0.00 ? 421  VAL A CG1   1 
ATOM   3265  C  CG2   . VAL A  1  421  ? 203.017 142.090 144.296 1.00 0.00 ? 421  VAL A CG2   1 
ATOM   3266  N  N     . ASN A  1  422  ? 202.967 145.017 147.463 1.00 0.00 ? 422  ASN A N     1 
ATOM   3267  C  CA    . ASN A  1  422  ? 203.089 144.881 148.908 1.00 0.00 ? 422  ASN A CA    1 
ATOM   3268  C  C     . ASN A  1  422  ? 201.723 144.722 149.555 1.00 0.00 ? 422  ASN A C     1 
ATOM   3269  O  O     . ASN A  1  422  ? 201.520 143.835 150.390 1.00 0.00 ? 422  ASN A O     1 
ATOM   3270  C  CB    . ASN A  1  422  ? 203.821 146.080 149.497 1.00 0.00 ? 422  ASN A CB    1 
ATOM   3271  C  CG    . ASN A  1  422  ? 205.302 146.037 149.231 1.00 0.00 ? 422  ASN A CG    1 
ATOM   3272  O  OD1   . ASN A  1  422  ? 205.862 144.977 148.963 1.00 0.00 ? 422  ASN A OD1   1 
ATOM   3273  N  ND2   . ASN A  1  422  ? 205.954 147.185 149.320 1.00 0.00 ? 422  ASN A ND2   1 
ATOM   3274  N  N     . GLY A  1  423  ? 200.767 145.560 149.176 1.00 0.00 ? 423  GLY A N     1 
ATOM   3275  C  CA    . GLY A  1  423  ? 199.451 145.507 149.757 1.00 0.00 ? 423  GLY A CA    1 
ATOM   3276  C  C     . GLY A  1  423  ? 199.381 146.333 151.017 1.00 0.00 ? 423  GLY A C     1 
ATOM   3277  O  O     . GLY A  1  423  ? 200.394 146.808 151.527 1.00 0.00 ? 423  GLY A O     1 
ATOM   3278  N  N     . PRO A  1  424  ? 198.182 146.521 151.555 1.00 0.00 ? 424  PRO A N     1 
ATOM   3279  C  CA    . PRO A  1  424  ? 198.006 147.433 152.687 1.00 0.00 ? 424  PRO A CA    1 
ATOM   3280  C  C     . PRO A  1  424  ? 198.569 146.939 154.005 1.00 0.00 ? 424  PRO A C     1 
ATOM   3281  O  O     . PRO A  1  424  ? 198.763 147.760 154.907 1.00 0.00 ? 424  PRO A O     1 
ATOM   3282  C  CB    . PRO A  1  424  ? 196.490 147.583 152.776 1.00 0.00 ? 424  PRO A CB    1 
ATOM   3283  C  CG    . PRO A  1  424  ? 195.971 146.317 152.231 1.00 0.00 ? 424  PRO A CG    1 
ATOM   3284  C  CD    . PRO A  1  424  ? 196.903 145.950 151.114 1.00 0.00 ? 424  PRO A CD    1 
ATOM   3285  N  N     . ASN A  1  425  ? 198.832 145.645 154.172 1.00 0.00 ? 425  ASN A N     1 
ATOM   3286  C  CA    . ASN A  1  425  ? 199.270 145.179 155.480 1.00 0.00 ? 425  ASN A CA    1 
ATOM   3287  C  C     . ASN A  1  425  ? 200.681 145.661 155.810 1.00 0.00 ? 425  ASN A C     1 
ATOM   3288  O  O     . ASN A  1  425  ? 200.896 146.264 156.866 1.00 0.00 ? 425  ASN A O     1 
ATOM   3289  C  CB    . ASN A  1  425  ? 199.159 143.658 155.555 1.00 0.00 ? 425  ASN A CB    1 
ATOM   3290  C  CG    . ASN A  1  425  ? 199.933 142.963 154.467 1.00 0.00 ? 425  ASN A CG    1 
ATOM   3291  O  OD1   . ASN A  1  425  ? 200.991 143.426 154.046 1.00 0.00 ? 425  ASN A OD1   1 
ATOM   3292  N  ND2   . ASN A  1  425  ? 199.398 141.844 153.988 1.00 0.00 ? 425  ASN A ND2   1 
ATOM   3293  N  N     . VAL A  1  426  ? 201.649 145.431 154.928 1.00 0.00 ? 426  VAL A N     1 
ATOM   3294  C  CA    . VAL A  1  426  ? 203.014 145.878 155.185 1.00 0.00 ? 426  VAL A CA    1 
ATOM   3295  C  C     . VAL A  1  426  ? 203.124 147.377 154.926 1.00 0.00 ? 426  VAL A C     1 
ATOM   3296  O  O     . VAL A  1  426  ? 202.384 147.928 154.104 1.00 0.00 ? 426  VAL A O     1 
ATOM   3297  C  CB    . VAL A  1  426  ? 204.027 145.085 154.344 1.00 0.00 ? 426  VAL A CB    1 
ATOM   3298  C  CG1   . VAL A  1  426  ? 204.047 143.650 154.776 1.00 0.00 ? 426  VAL A CG1   1 
ATOM   3299  C  CG2   . VAL A  1  426  ? 203.667 145.168 152.877 1.00 0.00 ? 426  VAL A CG2   1 
ATOM   3300  N  N     . HIS A  1  427  ? 204.036 148.058 155.644 1.00 0.00 ? 427  HIS A N     1 
ATOM   3301  C  CA    . HIS A  1  427  ? 204.048 149.521 155.599 1.00 0.00 ? 427  HIS A CA    1 
ATOM   3302  C  C     . HIS A  1  427  ? 204.376 150.097 154.228 1.00 0.00 ? 427  HIS A C     1 
ATOM   3303  O  O     . HIS A  1  427  ? 203.551 150.845 153.680 1.00 0.00 ? 427  HIS A O     1 
ATOM   3304  C  CB    . HIS A  1  427  ? 204.990 150.080 156.661 1.00 0.00 ? 427  HIS A CB    1 
ATOM   3305  C  CG    . HIS A  1  427  ? 205.176 151.560 156.554 1.00 0.00 ? 427  HIS A CG    1 
ATOM   3306  N  ND1   . HIS A  1  427  ? 206.037 152.128 155.642 1.00 0.00 ? 427  HIS A ND1   1 
ATOM   3307  C  CD2   . HIS A  1  427  ? 204.594 152.587 157.212 1.00 0.00 ? 427  HIS A CD2   1 
ATOM   3308  C  CE1   . HIS A  1  427  ? 205.991 153.441 155.756 1.00 0.00 ? 427  HIS A CE1   1 
ATOM   3309  N  NE2   . HIS A  1  427  ? 205.127 153.746 156.705 1.00 0.00 ? 427  HIS A NE2   1 
ATOM   3310  N  N     . PRO A  1  428  ? 205.467 149.848 153.667 1.00 0.00 ? 428  PRO A N     1 
ATOM   3311  C  CA    . PRO A  1  428  ? 205.799 150.623 152.467 1.00 0.00 ? 428  PRO A CA    1 
ATOM   3312  C  C     . PRO A  1  428  ? 204.988 150.125 151.277 1.00 0.00 ? 428  PRO A C     1 
ATOM   3313  O  O     . PRO A  1  428  ? 205.443 149.364 150.425 1.00 0.00 ? 428  PRO A O     1 
ATOM   3314  C  CB    . PRO A  1  428  ? 207.301 150.382 152.309 1.00 0.00 ? 428  PRO A CB    1 
ATOM   3315  C  CG    . PRO A  1  428  ? 207.505 149.044 152.871 1.00 0.00 ? 428  PRO A CG    1 
ATOM   3316  C  CD    . PRO A  1  428  ? 206.512 148.852 153.971 1.00 0.00 ? 428  PRO A CD    1 
ATOM   3317  N  N     . GLY A  1  429  ? 203.740 150.593 151.223 1.00 0.00 ? 429  GLY A N     1 
ATOM   3318  C  CA    . GLY A  1  429  ? 202.766 150.082 150.286 1.00 0.00 ? 429  GLY A CA    1 
ATOM   3319  C  C     . GLY A  1  429  ? 201.552 150.983 150.129 1.00 0.00 ? 429  GLY A C     1 
ATOM   3320  O  O     . GLY A  1  429  ? 201.552 152.113 150.602 1.00 0.00 ? 429  GLY A O     1 
ATOM   3321  N  N     . ALA A  1  430  ? 200.488 150.460 149.524 1.00 0.00 ? 430  ALA A N     1 
ATOM   3322  C  CA    . ALA A  1  430  ? 199.308 151.275 149.275 1.00 0.00 ? 430  ALA A CA    1 
ATOM   3323  C  C     . ALA A  1  430  ? 198.084 150.492 149.712 1.00 0.00 ? 430  ALA A C     1 
ATOM   3324  O  O     . ALA A  1  430  ? 198.174 149.303 150.021 1.00 0.00 ? 430  ALA A O     1 
ATOM   3325  C  CB    . ALA A  1  430  ? 199.234 151.660 147.798 1.00 0.00 ? 430  ALA A CB    1 
ATOM   3326  N  N     . ASN A  1  431  ? 196.935 151.159 149.770 1.00 0.00 ? 431  ASN A N     1 
ATOM   3327  C  CA    . ASN A  1  431  ? 195.713 150.396 149.966 1.00 0.00 ? 431  ASN A CA    1 
ATOM   3328  C  C     . ASN A  1  431  ? 194.656 150.711 148.914 1.00 0.00 ? 431  ASN A C     1 
ATOM   3329  O  O     . ASN A  1  431  ? 194.347 149.853 148.089 1.00 0.00 ? 431  ASN A O     1 
ATOM   3330  C  CB    . ASN A  1  431  ? 195.175 150.596 151.379 1.00 0.00 ? 431  ASN A CB    1 
ATOM   3331  C  CG    . ASN A  1  431  ? 194.924 152.026 151.702 1.00 0.00 ? 431  ASN A CG    1 
ATOM   3332  O  OD1   . ASN A  1  431  ? 194.646 152.826 150.820 1.00 0.00 ? 431  ASN A OD1   1 
ATOM   3333  N  ND2   . ASN A  1  431  ? 194.989 152.361 152.978 1.00 0.00 ? 431  ASN A ND2   1 
ATOM   3334  N  N     . TYR A  1  432  ? 194.091 151.910 148.906 1.00 0.00 ? 432  TYR A N     1 
ATOM   3335  C  CA    . TYR A  1  432  ? 193.058 152.191 147.924 1.00 0.00 ? 432  TYR A CA    1 
ATOM   3336  C  C     . TYR A  1  432  ? 193.662 152.463 146.554 1.00 0.00 ? 432  TYR A C     1 
ATOM   3337  O  O     . TYR A  1  432  ? 194.758 153.014 146.443 1.00 0.00 ? 432  TYR A O     1 
ATOM   3338  C  CB    . TYR A  1  432  ? 192.205 153.376 148.354 1.00 0.00 ? 432  TYR A CB    1 
ATOM   3339  C  CG    . TYR A  1  432  ? 191.328 153.079 149.531 1.00 0.00 ? 432  TYR A CG    1 
ATOM   3340  C  CD1   . TYR A  1  432  ? 190.825 151.818 149.728 1.00 0.00 ? 432  TYR A CD1   1 
ATOM   3341  C  CD2   . TYR A  1  432  ? 190.947 154.071 150.404 1.00 0.00 ? 432  TYR A CD2   1 
ATOM   3342  C  CE1   . TYR A  1  432  ? 190.004 151.538 150.786 1.00 0.00 ? 432  TYR A CE1   1 
ATOM   3343  C  CE2   . TYR A  1  432  ? 190.116 153.796 151.465 1.00 0.00 ? 432  TYR A CE2   1 
ATOM   3344  C  CZ    . TYR A  1  432  ? 189.653 152.529 151.648 1.00 0.00 ? 432  TYR A CZ    1 
ATOM   3345  O  OH    . TYR A  1  432  ? 188.824 152.251 152.705 1.00 0.00 ? 432  TYR A OH    1 
ATOM   3346  N  N     . LEU A  1  433  ? 192.934 152.086 145.505 1.00 0.00 ? 433  LEU A N     1 
ATOM   3347  C  CA    . LEU A  1  433  ? 193.352 152.355 144.135 1.00 0.00 ? 433  LEU A CA    1 
ATOM   3348  C  C     . LEU A  1  433  ? 192.147 152.829 143.340 1.00 0.00 ? 433  LEU A C     1 
ATOM   3349  O  O     . LEU A  1  433  ? 191.034 152.339 143.545 1.00 0.00 ? 433  LEU A O     1 
ATOM   3350  C  CB    . LEU A  1  433  ? 193.971 151.120 143.477 1.00 0.00 ? 433  LEU A CB    1 
ATOM   3351  C  CG    . LEU A  1  433  ? 194.576 151.324 142.088 1.00 0.00 ? 433  LEU A CG    1 
ATOM   3352  C  CD1   . LEU A  1  433  ? 195.792 150.447 141.909 1.00 0.00 ? 433  LEU A CD1   1 
ATOM   3353  C  CD2   . LEU A  1  433  ? 193.565 151.021 141.003 1.00 0.00 ? 433  LEU A CD2   1 
ATOM   3354  N  N     . LEU A  1  434  ? 192.378 153.779 142.435 1.00 0.00 ? 434  LEU A N     1 
ATOM   3355  C  CA    . LEU A  1  434  ? 191.328 154.394 141.629 1.00 0.00 ? 434  LEU A CA    1 
ATOM   3356  C  C     . LEU A  1  434  ? 191.779 154.520 140.183 1.00 0.00 ? 434  LEU A C     1 
ATOM   3357  O  O     . LEU A  1  434  ? 192.744 155.235 139.897 1.00 0.00 ? 434  LEU A O     1 
ATOM   3358  C  CB    . LEU A  1  434  ? 190.965 155.776 142.165 1.00 0.00 ? 434  LEU A CB    1 
ATOM   3359  C  CG    . LEU A  1  434  ? 189.992 156.532 141.270 1.00 0.00 ? 434  LEU A CG    1 
ATOM   3360  C  CD1   . LEU A  1  434  ? 188.720 155.750 141.143 1.00 0.00 ? 434  LEU A CD1   1 
ATOM   3361  C  CD2   . LEU A  1  434  ? 189.701 157.894 141.840 1.00 0.00 ? 434  LEU A CD2   1 
ATOM   3362  N  N     . LYS A  1  435  ? 191.061 153.871 139.272 1.00 0.00 ? 435  LYS A N     1 
ATOM   3363  C  CA    . LYS A  1  435  ? 191.427 153.892 137.862 1.00 0.00 ? 435  LYS A CA    1 
ATOM   3364  C  C     . LYS A  1  435  ? 190.975 155.195 137.200 1.00 0.00 ? 435  LYS A C     1 
ATOM   3365  O  O     . LYS A  1  435  ? 190.022 155.838 137.645 1.00 0.00 ? 435  LYS A O     1 
ATOM   3366  C  CB    . LYS A  1  435  ? 190.859 152.676 137.129 1.00 0.00 ? 435  LYS A CB    1 
ATOM   3367  C  CG    . LYS A  1  435  ? 191.581 151.375 137.389 1.00 0.00 ? 435  LYS A CG    1 
ATOM   3368  C  CD    . LYS A  1  435  ? 191.035 150.287 136.475 1.00 0.00 ? 435  LYS A CD    1 
ATOM   3369  C  CE    . LYS A  1  435  ? 191.791 148.980 136.622 1.00 0.00 ? 435  LYS A CE    1 
ATOM   3370  N  NZ    . LYS A  1  435  ? 191.213 147.931 135.733 1.00 0.00 ? 435  LYS A NZ    1 
ATOM   3371  N  N     . ARG A  1  436  ? 191.640 155.569 136.103 1.00 0.00 ? 436  ARG A N     1 
ATOM   3372  C  CA    . ARG A  1  436  ? 191.313 156.735 135.291 1.00 0.00 ? 436  ARG A CA    1 
ATOM   3373  C  C     . ARG A  1  436  ? 189.889 156.711 134.760 1.00 0.00 ? 436  ARG A C     1 
ATOM   3374  O  O     . ARG A  1  436  ? 189.374 157.757 134.356 1.00 0.00 ? 436  ARG A O     1 
ATOM   3375  C  CB    . ARG A  1  436  ? 192.287 156.829 134.110 1.00 0.00 ? 436  ARG A CB    1 
ATOM   3376  C  CG    . ARG A  1  436  ? 192.148 158.055 133.228 1.00 0.00 ? 436  ARG A CG    1 
ATOM   3377  C  CD    . ARG A  1  436  ? 193.199 158.056 132.127 1.00 0.00 ? 436  ARG A CD    1 
ATOM   3378  N  NE    . ARG A  1  436  ? 193.054 159.206 131.238 1.00 0.00 ? 436  ARG A NE    1 
ATOM   3379  C  CZ    . ARG A  1  436  ? 193.574 160.406 131.472 1.00 0.00 ? 436  ARG A CZ    1 
ATOM   3380  N  NH1   . ARG A  1  436  ? 194.287 160.624 132.566 1.00 0.00 ? 436  ARG A NH1   1 
ATOM   3381  N  NH2   . ARG A  1  436  ? 193.386 161.395 130.611 1.00 0.00 ? 436  ARG A NH2   1 
ATOM   3382  N  N     . ASN A  1  437  ? 189.238 155.560 134.794 1.00 0.00 ? 437  ASN A N     1 
ATOM   3383  C  CA    . ASN A  1  437  ? 187.902 155.339 134.264 1.00 0.00 ? 437  ASN A CA    1 
ATOM   3384  C  C     . ASN A  1  437  ? 186.837 155.795 135.202 1.00 0.00 ? 437  ASN A C     1 
ATOM   3385  O  O     . ASN A  1  437  ? 185.655 155.575 134.936 1.00 0.00 ? 437  ASN A O     1 
ATOM   3386  C  CB    . ASN A  1  437  ? 187.715 153.864 133.914 1.00 0.00 ? 437  ASN A CB    1 
ATOM   3387  C  CG    . ASN A  1  437  ? 188.610 153.426 132.778 1.00 0.00 ? 437  ASN A CG    1 
ATOM   3388  O  OD1   . ASN A  1  437  ? 189.272 152.396 132.856 1.00 0.00 ? 437  ASN A OD1   1 
ATOM   3389  N  ND2   . ASN A  1  437  ? 188.644 154.220 131.714 1.00 0.00 ? 437  ASN A ND2   1 
ATOM   3390  N  N     . GLU A  1  438  ? 187.284 156.420 136.289 1.00 0.00 ? 438  GLU A N     1 
ATOM   3391  C  CA    . GLU A  1  438  ? 186.447 157.188 137.204 1.00 0.00 ? 438  GLU A CA    1 
ATOM   3392  C  C     . GLU A  1  438  ? 185.237 156.398 137.685 1.00 0.00 ? 438  GLU A C     1 
ATOM   3393  O  O     . GLU A  1  438  ? 184.121 156.922 137.735 1.00 0.00 ? 438  GLU A O     1 
ATOM   3394  C  CB    . GLU A  1  438  ? 186.002 158.522 136.564 1.00 0.00 ? 438  GLU A CB    1 
ATOM   3395  C  CG    . GLU A  1  438  ? 184.970 158.487 135.404 1.00 0.00 ? 438  GLU A CG    1 
ATOM   3396  C  CD    . GLU A  1  438  ? 185.568 158.400 133.999 1.00 0.00 ? 438  GLU A CD    1 
ATOM   3397  O  OE1   . GLU A  1  438  ? 186.807 158.365 133.855 1.00 0.00 ? 438  GLU A OE1   1 
ATOM   3398  O  OE2   . GLU A  1  438  ? 184.780 158.364 133.029 1.00 0.00 ? 438  GLU A OE2   1 
ATOM   3399  N  N     . ASP A  1  439  ? 185.442 155.155 138.095 1.00 0.00 ? 439  ASP A N     1 
ATOM   3400  C  CA    . ASP A  1  439  ? 184.271 154.353 138.397 1.00 0.00 ? 439  ASP A CA    1 
ATOM   3401  C  C     . ASP A  1  439  ? 183.755 154.692 139.787 1.00 0.00 ? 439  ASP A C     1 
ATOM   3402  O  O     . ASP A  1  439  ? 182.855 155.523 139.937 1.00 0.00 ? 439  ASP A O     1 
ATOM   3403  C  CB    . ASP A  1  439  ? 184.635 152.874 138.311 1.00 0.00 ? 439  ASP A CB    1 
ATOM   3404  C  CG    . ASP A  1  439  ? 185.120 152.485 136.938 1.00 0.00 ? 439  ASP A CG    1 
ATOM   3405  O  OD1   . ASP A  1  439  ? 184.893 153.267 135.999 1.00 0.00 ? 439  ASP A OD1   1 
ATOM   3406  O  OD2   . ASP A  1  439  ? 185.740 151.411 136.796 1.00 0.00 ? 439  ASP A OD2   1 
ATOM   3407  N  N     . ALA A  1  440  ? 184.360 154.103 140.810 1.00 0.00 ? 440  ALA A N     1 
ATOM   3408  C  CA    . ALA A  1  440  ? 184.187 154.560 142.177 1.00 0.00 ? 440  ALA A CA    1 
ATOM   3409  C  C     . ALA A  1  440  ? 185.559 154.589 142.824 1.00 0.00 ? 440  ALA A C     1 
ATOM   3410  O  O     . ALA A  1  440  ? 186.101 155.663 143.102 1.00 0.00 ? 440  ALA A O     1 
ATOM   3411  C  CB    . ALA A  1  440  ? 183.222 153.657 142.945 1.00 0.00 ? 440  ALA A CB    1 
ATOM   3412  N  N     . ARG A  1  441  ? 186.110 153.400 143.060 1.00 0.00 ? 441  ARG A N     1 
ATOM   3413  C  CA    . ARG A  1  441  ? 187.491 153.129 143.436 1.00 0.00 ? 441  ARG A CA    1 
ATOM   3414  C  C     . ARG A  1  441  ? 187.584 151.654 143.778 1.00 0.00 ? 441  ARG A C     1 
ATOM   3415  O  O     . ARG A  1  441  ? 186.565 151.006 144.019 1.00 0.00 ? 441  ARG A O     1 
ATOM   3416  C  CB    . ARG A  1  441  ? 187.942 153.958 144.631 1.00 0.00 ? 441  ARG A CB    1 
ATOM   3417  C  CG    . ARG A  1  441  ? 187.346 153.487 145.921 1.00 0.00 ? 441  ARG A CG    1 
ATOM   3418  C  CD    . ARG A  1  441  ? 188.033 154.180 147.048 1.00 0.00 ? 441  ARG A CD    1 
ATOM   3419  N  NE    . ARG A  1  441  ? 187.759 155.604 147.014 1.00 0.00 ? 441  ARG A NE    1 
ATOM   3420  C  CZ    . ARG A  1  441  ? 188.583 156.509 147.511 1.00 0.00 ? 441  ARG A CZ    1 
ATOM   3421  N  NH1   . ARG A  1  441  ? 189.734 156.119 148.033 1.00 0.00 ? 441  ARG A NH1   1 
ATOM   3422  N  NH2   . ARG A  1  441  ? 188.272 157.793 147.459 1.00 0.00 ? 441  ARG A NH2   1 
ATOM   3423  N  N     . ARG A  1  442  ? 188.800 151.134 143.821 1.00 0.00 ? 442  ARG A N     1 
ATOM   3424  C  CA    . ARG A  1  442  ? 189.031 149.755 144.231 1.00 0.00 ? 442  ARG A CA    1 
ATOM   3425  C  C     . ARG A  1  442  ? 189.819 149.757 145.529 1.00 0.00 ? 442  ARG A C     1 
ATOM   3426  O  O     . ARG A  1  442  ? 191.014 150.056 145.539 1.00 0.00 ? 442  ARG A O     1 
ATOM   3427  C  CB    . ARG A  1  442  ? 189.772 148.963 143.160 1.00 0.00 ? 442  ARG A CB    1 
ATOM   3428  C  CG    . ARG A  1  442  ? 188.943 148.644 141.944 1.00 0.00 ? 442  ARG A CG    1 
ATOM   3429  C  CD    . ARG A  1  442  ? 189.744 147.869 140.925 1.00 0.00 ? 442  ARG A CD    1 
ATOM   3430  N  NE    . ARG A  1  442  ? 188.922 147.507 139.778 1.00 0.00 ? 442  ARG A NE    1 
ATOM   3431  C  CZ    . ARG A  1  442  ? 188.614 148.347 138.798 1.00 0.00 ? 442  ARG A CZ    1 
ATOM   3432  N  NH1   . ARG A  1  442  ? 189.045 149.597 138.847 1.00 0.00 ? 442  ARG A NH1   1 
ATOM   3433  N  NH2   . ARG A  1  442  ? 187.864 147.949 137.780 1.00 0.00 ? 442  ARG A NH2   1 
ATOM   3434  N  N     . ASN A  1  443  ? 189.157 149.388 146.615 1.00 0.00 ? 443  ASN A N     1 
ATOM   3435  C  CA    . ASN A  1  443  ? 189.871 149.008 147.821 1.00 0.00 ? 443  ASN A CA    1 
ATOM   3436  C  C     . ASN A  1  443  ? 190.735 147.794 147.524 1.00 0.00 ? 443  ASN A C     1 
ATOM   3437  O  O     . ASN A  1  443  ? 190.455 147.021 146.607 1.00 0.00 ? 443  ASN A O     1 
ATOM   3438  C  CB    . ASN A  1  443  ? 188.873 148.695 148.936 1.00 0.00 ? 443  ASN A CB    1 
ATOM   3439  C  CG    . ASN A  1  443  ? 189.533 148.369 150.252 1.00 0.00 ? 443  ASN A CG    1 
ATOM   3440  O  OD1   . ASN A  1  443  ? 190.698 147.979 150.305 1.00 0.00 ? 443  ASN A OD1   1 
ATOM   3441  N  ND2   . ASN A  1  443  ? 188.782 148.530 151.337 1.00 0.00 ? 443  ASN A ND2   1 
ATOM   3442  N  N     . LEU A  1  444  ? 191.804 147.629 148.299 1.00 0.00 ? 444  LEU A N     1 
ATOM   3443  C  CA    . LEU A  1  444  ? 192.538 146.373 148.234 1.00 0.00 ? 444  LEU A CA    1 
ATOM   3444  C  C     . LEU A  1  444  ? 192.079 145.501 149.391 1.00 0.00 ? 444  LEU A C     1 
ATOM   3445  O  O     . LEU A  1  444  ? 192.534 145.577 150.530 1.00 0.00 ? 444  LEU A O     1 
ATOM   3446  C  CB    . LEU A  1  444  ? 194.037 146.610 148.252 1.00 0.00 ? 444  LEU A CB    1 
ATOM   3447  C  CG    . LEU A  1  444  ? 194.607 146.662 146.838 1.00 0.00 ? 444  LEU A CG    1 
ATOM   3448  C  CD1   . LEU A  1  444  ? 193.948 147.723 146.010 1.00 0.00 ? 444  LEU A CD1   1 
ATOM   3449  C  CD2   . LEU A  1  444  ? 196.093 146.893 146.883 1.00 0.00 ? 444  LEU A CD2   1 
ATOM   3450  N  N     . ARG A  1  445  ? 191.167 144.645 149.026 1.00 0.00 ? 445  ARG A N     1 
ATOM   3451  C  CA    . ARG A  1  445  ? 190.356 143.828 149.896 1.00 0.00 ? 445  ARG A CA    1 
ATOM   3452  C  C     . ARG A  1  445  ? 190.250 142.413 149.395 1.00 0.00 ? 445  ARG A C     1 
ATOM   3453  O  O     . ARG A  1  445  ? 190.792 141.495 150.008 1.00 0.00 ? 445  ARG A O     1 
ATOM   3454  C  CB    . ARG A  1  445  ? 188.950 144.423 149.975 1.00 0.00 ? 445  ARG A CB    1 
ATOM   3455  C  CG    . ARG A  1  445  ? 187.969 143.629 150.778 1.00 0.00 ? 445  ARG A CG    1 
ATOM   3456  C  CD    . ARG A  1  445  ? 188.395 143.630 152.209 1.00 0.00 ? 445  ARG A CD    1 
ATOM   3457  N  NE    . ARG A  1  445  ? 187.518 142.821 153.033 1.00 0.00 ? 445  ARG A NE    1 
ATOM   3458  C  CZ    . ARG A  1  445  ? 187.653 141.511 153.170 1.00 0.00 ? 445  ARG A CZ    1 
ATOM   3459  N  NH1   . ARG A  1  445  ? 188.620 140.878 152.521 1.00 0.00 ? 445  ARG A NH1   1 
ATOM   3460  N  NH2   . ARG A  1  445  ? 186.820 140.836 153.944 1.00 0.00 ? 445  ARG A NH2   1 
ATOM   3461  N  N     . TYR A  1  446  ? 189.553 142.245 148.274 1.00 0.00 ? 446  TYR A N     1 
ATOM   3462  C  CA    . TYR A  1  446  ? 189.386 140.945 147.648 1.00 0.00 ? 446  TYR A CA    1 
ATOM   3463  C  C     . TYR A  1  446  ? 190.716 140.239 147.468 1.00 0.00 ? 446  TYR A C     1 
ATOM   3464  O  O     . TYR A  1  446  ? 191.020 139.259 148.156 1.00 0.00 ? 446  TYR A O     1 
ATOM   3465  C  CB    . TYR A  1  446  ? 188.685 141.119 146.299 1.00 0.00 ? 446  TYR A CB    1 
ATOM   3466  C  CG    . TYR A  1  446  ? 188.816 139.926 145.373 1.00 0.00 ? 446  TYR A CG    1 
ATOM   3467  C  CD1   . TYR A  1  446  ? 188.207 138.718 145.671 1.00 0.00 ? 446  TYR A CD1   1 
ATOM   3468  C  CD2   . TYR A  1  446  ? 189.520 140.022 144.181 1.00 0.00 ? 446  TYR A CD2   1 
ATOM   3469  C  CE1   . TYR A  1  446  ? 188.312 137.630 144.828 1.00 0.00 ? 446  TYR A CE1   1 
ATOM   3470  C  CE2   . TYR A  1  446  ? 189.632 138.937 143.330 1.00 0.00 ? 446  TYR A CE2   1 
ATOM   3471  C  CZ    . TYR A  1  446  ? 189.025 137.743 143.659 1.00 0.00 ? 446  TYR A CZ    1 
ATOM   3472  O  OH    . TYR A  1  446  ? 189.132 136.660 142.816 1.00 0.00 ? 446  TYR A OH    1 
ATOM   3473  N  N     . GLY A  1  447  ? 191.538 140.752 146.569 1.00 0.00 ? 447  GLY A N     1 
ATOM   3474  C  CA    . GLY A  1  447  ? 192.529 139.912 145.946 1.00 0.00 ? 447  GLY A CA    1 
ATOM   3475  C  C     . GLY A  1  447  ? 193.061 140.600 144.718 1.00 0.00 ? 447  GLY A C     1 
ATOM   3476  O  O     . GLY A  1  447  ? 193.113 141.833 144.676 1.00 0.00 ? 447  GLY A O     1 
ATOM   3477  N  N     . ASP A  1  448  ? 193.469 139.816 143.723 1.00 0.00 ? 448  ASP A N     1 
ATOM   3478  C  CA    . ASP A  1  448  ? 194.164 140.369 142.575 1.00 0.00 ? 448  ASP A CA    1 
ATOM   3479  C  C     . ASP A  1  448  ? 195.446 141.032 143.042 1.00 0.00 ? 448  ASP A C     1 
ATOM   3480  O  O     . ASP A  1  448  ? 196.398 140.349 143.432 1.00 0.00 ? 448  ASP A O     1 
ATOM   3481  C  CB    . ASP A  1  448  ? 193.291 141.370 141.813 1.00 0.00 ? 448  ASP A CB    1 
ATOM   3482  C  CG    . ASP A  1  448  ? 192.110 140.714 141.152 1.00 0.00 ? 448  ASP A CG    1 
ATOM   3483  O  OD1   . ASP A  1  448  ? 192.128 139.476 141.005 1.00 0.00 ? 448  ASP A OD1   1 
ATOM   3484  O  OD2   . ASP A  1  448  ? 191.159 141.433 140.787 1.00 0.00 ? 448  ASP A OD2   1 
ATOM   3485  N  N     . ARG A  1  449  ? 195.480 142.358 142.961 1.00 0.00 ? 449  ARG A N     1 
ATOM   3486  C  CA    . ARG A  1  449  ? 196.719 143.114 142.944 1.00 0.00 ? 449  ARG A CA    1 
ATOM   3487  C  C     . ARG A  1  449  ? 197.517 142.536 141.791 1.00 0.00 ? 449  ARG A C     1 
ATOM   3488  O  O     . ARG A  1  449  ? 196.907 142.053 140.832 1.00 0.00 ? 449  ARG A O     1 
ATOM   3489  C  CB    . ARG A  1  449  ? 197.451 143.007 144.285 1.00 0.00 ? 449  ARG A CB    1 
ATOM   3490  C  CG    . ARG A  1  449  ? 196.705 143.670 145.433 1.00 0.00 ? 449  ARG A CG    1 
ATOM   3491  C  CD    . ARG A  1  449  ? 197.360 143.412 146.778 1.00 0.00 ? 449  ARG A CD    1 
ATOM   3492  N  NE    . ARG A  1  449  ? 197.290 142.010 147.164 1.00 0.00 ? 449  ARG A NE    1 
ATOM   3493  C  CZ    . ARG A  1  449  ? 197.781 141.525 148.298 1.00 0.00 ? 449  ARG A CZ    1 
ATOM   3494  N  NH1   . ARG A  1  449  ? 198.381 142.331 149.160 1.00 0.00 ? 449  ARG A NH1   1 
ATOM   3495  N  NH2   . ARG A  1  449  ? 197.671 140.235 148.572 1.00 0.00 ? 449  ARG A NH2   1 
ATOM   3496  N  N     . MET A  1  450  ? 198.848 142.509 141.888 1.00 0.00 ? 450  MET A N     1 
ATOM   3497  C  CA    . MET A  1  450  ? 199.622 141.712 140.945 1.00 0.00 ? 450  MET A CA    1 
ATOM   3498  C  C     . MET A  1  450  ? 199.111 141.954 139.535 1.00 0.00 ? 450  MET A C     1 
ATOM   3499  O  O     . MET A  1  450  ? 199.302 143.035 138.969 1.00 0.00 ? 450  MET A O     1 
ATOM   3500  C  CB    . MET A  1  450  ? 199.600 140.241 141.336 1.00 0.00 ? 450  MET A CB    1 
ATOM   3501  C  CG    . MET A  1  450  ? 200.459 139.993 142.565 1.00 0.00 ? 450  MET A CG    1 
ATOM   3502  S  SD    . MET A  1  450  ? 200.650 138.276 143.070 1.00 0.00 ? 450  MET A SD    1 
ATOM   3503  C  CE    . MET A  1  450  ? 199.088 137.978 143.888 1.00 0.00 ? 450  MET A CE    1 
ATOM   3504  N  N     . LYS A  1  451  ? 198.420 140.953 138.985 1.00 0.00 ? 451  LYS A N     1 
ATOM   3505  C  CA    . LYS A  1  451  ? 197.768 141.108 137.690 1.00 0.00 ? 451  LYS A CA    1 
ATOM   3506  C  C     . LYS A  1  451  ? 196.889 142.352 137.637 1.00 0.00 ? 451  LYS A C     1 
ATOM   3507  O  O     . LYS A  1  451  ? 196.557 142.822 136.543 1.00 0.00 ? 451  LYS A O     1 
ATOM   3508  C  CB    . LYS A  1  451  ? 196.933 139.869 137.370 1.00 0.00 ? 451  LYS A CB    1 
ATOM   3509  C  CG    . LYS A  1  451  ? 197.733 138.573 137.290 1.00 0.00 ? 451  LYS A CG    1 
ATOM   3510  C  CD    . LYS A  1  451  ? 198.820 138.656 136.222 1.00 0.00 ? 451  LYS A CD    1 
ATOM   3511  C  CE    . LYS A  1  451  ? 198.238 138.571 134.810 1.00 0.00 ? 451  LYS A CE    1 
ATOM   3512  N  NZ    . LYS A  1  451  ? 199.295 138.555 133.752 1.00 0.00 ? 451  LYS A NZ    1 
ATOM   3513  N  N     . LEU A  1  452  ? 196.496 142.900 138.789 1.00 0.00 ? 452  LEU A N     1 
ATOM   3514  C  CA    . LEU A  1  452  ? 195.946 144.250 138.779 1.00 0.00 ? 452  LEU A CA    1 
ATOM   3515  C  C     . LEU A  1  452  ? 197.027 145.285 138.509 1.00 0.00 ? 452  LEU A C     1 
ATOM   3516  O  O     . LEU A  1  452  ? 196.848 146.161 137.657 1.00 0.00 ? 452  LEU A O     1 
ATOM   3517  C  CB    . LEU A  1  452  ? 195.239 144.558 140.098 1.00 0.00 ? 452  LEU A CB    1 
ATOM   3518  C  CG    . LEU A  1  452  ? 194.528 145.909 140.205 1.00 0.00 ? 452  LEU A CG    1 
ATOM   3519  C  CD1   . LEU A  1  452  ? 193.299 145.788 141.076 1.00 0.00 ? 452  LEU A CD1   1 
ATOM   3520  C  CD2   . LEU A  1  452  ? 195.453 146.957 140.771 1.00 0.00 ? 452  LEU A CD2   1 
ATOM   3521  N  N     . ALA A  1  453  ? 198.146 145.216 139.228 1.00 0.00 ? 453  ALA A N     1 
ATOM   3522  C  CA    . ALA A  1  453  ? 199.203 146.196 139.028 1.00 0.00 ? 453  ALA A CA    1 
ATOM   3523  C  C     . ALA A  1  453  ? 199.853 146.085 137.662 1.00 0.00 ? 453  ALA A C     1 
ATOM   3524  O  O     . ALA A  1  453  ? 200.520 147.030 137.229 1.00 0.00 ? 453  ALA A O     1 
ATOM   3525  C  CB    . ALA A  1  453  ? 200.271 146.056 140.109 1.00 0.00 ? 453  ALA A CB    1 
ATOM   3526  N  N     . LYS A  1  454  ? 199.659 144.969 136.962 1.00 0.00 ? 454  LYS A N     1 
ATOM   3527  C  CA    . LYS A  1  454  ? 200.248 144.833 135.638 1.00 0.00 ? 454  LYS A CA    1 
ATOM   3528  C  C     . LYS A  1  454  ? 199.565 145.735 134.627 1.00 0.00 ? 454  LYS A C     1 
ATOM   3529  O  O     . LYS A  1  454  ? 200.015 145.825 133.481 1.00 0.00 ? 454  LYS A O     1 
ATOM   3530  C  CB    . LYS A  1  454  ? 200.187 143.384 135.169 1.00 0.00 ? 454  LYS A CB    1 
ATOM   3531  C  CG    . LYS A  1  454  ? 200.961 142.420 136.039 1.00 0.00 ? 454  LYS A CG    1 
ATOM   3532  C  CD    . LYS A  1  454  ? 202.414 142.842 136.146 1.00 0.00 ? 454  LYS A CD    1 
ATOM   3533  C  CE    . LYS A  1  454  ? 203.152 142.602 134.844 1.00 0.00 ? 454  LYS A CE    1 
ATOM   3534  N  NZ    . LYS A  1  454  ? 204.604 142.907 134.969 1.00 0.00 ? 454  LYS A NZ    1 
ATOM   3535  N  N     . ASN A  1  455  ? 198.488 146.407 135.015 1.00 0.00 ? 455  ASN A N     1 
ATOM   3536  C  CA    . ASN A  1  455  ? 197.930 147.392 134.107 1.00 0.00 ? 455  ASN A CA    1 
ATOM   3537  C  C     . ASN A  1  455  ? 198.356 148.783 134.538 1.00 0.00 ? 455  ASN A C     1 
ATOM   3538  O  O     . ASN A  1  455  ? 199.318 149.328 133.991 1.00 0.00 ? 455  ASN A O     1 
ATOM   3539  C  CB    . ASN A  1  455  ? 196.411 147.280 134.060 1.00 0.00 ? 455  ASN A CB    1 
ATOM   3540  C  CG    . ASN A  1  455  ? 195.950 146.024 133.365 1.00 0.00 ? 455  ASN A CG    1 
ATOM   3541  O  OD1   . ASN A  1  455  ? 195.982 145.932 132.139 1.00 0.00 ? 455  ASN A OD1   1 
ATOM   3542  N  ND2   . ASN A  1  455  ? 195.525 145.041 134.145 1.00 0.00 ? 455  ASN A ND2   1 
ATOM   3543  N  N     . LEU A  1  456  ? 197.692 149.327 135.556 1.00 0.00 ? 456  LEU A N     1 
ATOM   3544  C  CA    . LEU A  1  456  ? 198.029 150.629 136.117 1.00 0.00 ? 456  LEU A CA    1 
ATOM   3545  C  C     . LEU A  1  456  ? 198.324 151.642 135.019 1.00 0.00 ? 456  LEU A C     1 
ATOM   3546  O  O     . LEU A  1  456  ? 199.488 151.971 134.771 1.00 0.00 ? 456  LEU A O     1 
ATOM   3547  C  CB    . LEU A  1  456  ? 199.215 150.516 137.072 1.00 0.00 ? 456  LEU A CB    1 
ATOM   3548  C  CG    . LEU A  1  456  ? 199.504 151.795 137.853 1.00 0.00 ? 456  LEU A CG    1 
ATOM   3549  C  CD1   . LEU A  1  456  ? 198.303 152.131 138.702 1.00 0.00 ? 456  LEU A CD1   1 
ATOM   3550  C  CD2   . LEU A  1  456  ? 200.715 151.610 138.728 1.00 0.00 ? 456  LEU A CD2   1 
ATOM   3551  N  N     . GLN A  1  457  ? 197.294 152.121 134.333 1.00 0.00 ? 457  GLN A N     1 
ATOM   3552  C  CA    . GLN A  1  457  ? 197.535 153.066 133.259 1.00 0.00 ? 457  GLN A CA    1 
ATOM   3553  C  C     . GLN A  1  457  ? 198.056 154.377 133.841 1.00 0.00 ? 457  GLN A C     1 
ATOM   3554  O  O     . GLN A  1  457  ? 198.299 154.502 135.042 1.00 0.00 ? 457  GLN A O     1 
ATOM   3555  C  CB    . GLN A  1  457  ? 196.261 153.299 132.451 1.00 0.00 ? 457  GLN A CB    1 
ATOM   3556  C  CG    . GLN A  1  457  ? 195.757 152.056 131.743 1.00 0.00 ? 457  GLN A CG    1 
ATOM   3557  C  CD    . GLN A  1  457  ? 196.718 151.556 130.686 1.00 0.00 ? 457  GLN A CD    1 
ATOM   3558  O  OE1   . GLN A  1  457  ? 197.496 150.636 130.926 1.00 0.00 ? 457  GLN A OE1   1 
ATOM   3559  N  NE2   . GLN A  1  457  ? 196.658 152.152 129.503 1.00 0.00 ? 457  GLN A NE2   1 
ATOM   3560  N  N     . ILE A  1  458  ? 198.238 155.370 132.976 1.00 0.00 ? 458  ILE A N     1 
ATOM   3561  C  CA    . ILE A  1  458  ? 198.925 156.574 133.419 1.00 0.00 ? 458  ILE A CA    1 
ATOM   3562  C  C     . ILE A  1  458  ? 198.052 157.365 134.377 1.00 0.00 ? 458  ILE A C     1 
ATOM   3563  O  O     . ILE A  1  458  ? 198.330 157.428 135.575 1.00 0.00 ? 458  ILE A O     1 
ATOM   3564  C  CB    . ILE A  1  458  ? 199.354 157.419 132.213 1.00 0.00 ? 458  ILE A CB    1 
ATOM   3565  C  CG1   . ILE A  1  458  ? 200.224 156.578 131.283 1.00 0.00 ? 458  ILE A CG1   1 
ATOM   3566  C  CG2   . ILE A  1  458  ? 200.098 158.650 132.677 1.00 0.00 ? 458  ILE A CG2   1 
ATOM   3567  C  CD1   . ILE A  1  458  ? 201.430 155.986 131.957 1.00 0.00 ? 458  ILE A CD1   1 
ATOM   3568  N  N     . GLY A  1  459  ? 196.946 157.907 133.898 1.00 0.00 ? 459  GLY A N     1 
ATOM   3569  C  CA    . GLY A  1  459  ? 196.178 158.815 134.723 1.00 0.00 ? 459  GLY A CA    1 
ATOM   3570  C  C     . GLY A  1  459  ? 195.557 158.209 135.967 1.00 0.00 ? 459  GLY A C     1 
ATOM   3571  O  O     . GLY A  1  459  ? 194.847 158.902 136.697 1.00 0.00 ? 459  GLY A O     1 
ATOM   3572  N  N     . ASP A  1  460  ? 195.799 156.928 136.226 1.00 0.00 ? 460  ASP A N     1 
ATOM   3573  C  CA    . ASP A  1  460  ? 195.248 156.254 137.390 1.00 0.00 ? 460  ASP A CA    1 
ATOM   3574  C  C     . ASP A  1  460  ? 195.800 156.859 138.673 1.00 0.00 ? 460  ASP A C     1 
ATOM   3575  O  O     . ASP A  1  460  ? 196.861 157.485 138.689 1.00 0.00 ? 460  ASP A O     1 
ATOM   3576  C  CB    . ASP A  1  460  ? 195.554 154.756 137.367 1.00 0.00 ? 460  ASP A CB    1 
ATOM   3577  C  CG    . ASP A  1  460  ? 194.753 154.013 136.322 1.00 0.00 ? 460  ASP A CG    1 
ATOM   3578  O  OD1   . ASP A  1  460  ? 193.754 154.572 135.827 1.00 0.00 ? 460  ASP A OD1   1 
ATOM   3579  O  OD2   . ASP A  1  460  ? 195.128 152.869 135.993 1.00 0.00 ? 460  ASP A OD2   1 
ATOM   3580  N  N     . VAL A  1  461  ? 195.055 156.659 139.756 1.00 0.00 ? 461  VAL A N     1 
ATOM   3581  C  CA    . VAL A  1  461  ? 195.397 157.199 141.064 1.00 0.00 ? 461  VAL A CA    1 
ATOM   3582  C  C     . VAL A  1  461  ? 195.579 156.047 142.036 1.00 0.00 ? 461  VAL A C     1 
ATOM   3583  O  O     . VAL A  1  461  ? 194.750 155.132 142.078 1.00 0.00 ? 461  VAL A O     1 
ATOM   3584  C  CB    . VAL A  1  461  ? 194.319 158.160 141.581 1.00 0.00 ? 461  VAL A CB    1 
ATOM   3585  C  CG1   . VAL A  1  461  ? 194.641 158.588 142.984 1.00 0.00 ? 461  VAL A CG1   1 
ATOM   3586  C  CG2   . VAL A  1  461  ? 194.222 159.360 140.678 1.00 0.00 ? 461  VAL A CG2   1 
ATOM   3587  N  N     . VAL A  1  462  ? 196.645 156.103 142.825 1.00 0.00 ? 462  VAL A N     1 
ATOM   3588  C  CA    . VAL A  1  462  ? 196.893 155.161 143.906 1.00 0.00 ? 462  VAL A CA    1 
ATOM   3589  C  C     . VAL A  1  462  ? 196.982 155.975 145.179 1.00 0.00 ? 462  VAL A C     1 
ATOM   3590  O  O     . VAL A  1  462  ? 197.166 157.191 145.130 1.00 0.00 ? 462  VAL A O     1 
ATOM   3591  C  CB    . VAL A  1  462  ? 198.192 154.371 143.702 1.00 0.00 ? 462  VAL A CB    1 
ATOM   3592  C  CG1   . VAL A  1  462  ? 199.344 155.272 143.939 1.00 0.00 ? 462  VAL A CG1   1 
ATOM   3593  C  CG2   . VAL A  1  462  ? 198.256 153.193 144.622 1.00 0.00 ? 462  VAL A CG2   1 
ATOM   3594  N  N     . GLU A  1  463  ? 196.845 155.321 146.318 1.00 0.00 ? 463  GLU A N     1 
ATOM   3595  C  CA    . GLU A  1  463  ? 197.025 155.999 147.592 1.00 0.00 ? 463  GLU A CA    1 
ATOM   3596  C  C     . GLU A  1  463  ? 198.145 155.322 148.368 1.00 0.00 ? 463  GLU A C     1 
ATOM   3597  O  O     . GLU A  1  463  ? 197.972 154.221 148.891 1.00 0.00 ? 463  GLU A O     1 
ATOM   3598  C  CB    . GLU A  1  463  ? 195.728 156.009 148.386 1.00 0.00 ? 463  GLU A CB    1 
ATOM   3599  C  CG    . GLU A  1  463  ? 194.615 156.767 147.702 1.00 0.00 ? 463  GLU A CG    1 
ATOM   3600  C  CD    . GLU A  1  463  ? 193.383 156.882 148.569 1.00 0.00 ? 463  GLU A CD    1 
ATOM   3601  O  OE1   . GLU A  1  463  ? 193.354 156.263 149.651 1.00 0.00 ? 463  GLU A OE1   1 
ATOM   3602  O  OE2   . GLU A  1  463  ? 192.443 157.599 148.169 1.00 0.00 ? 463  GLU A OE2   1 
ATOM   3603  N  N     . ARG A  1  464  ? 199.277 156.005 148.473 1.00 0.00 ? 464  ARG A N     1 
ATOM   3604  C  CA    . ARG A  1  464  ? 200.384 155.500 149.257 1.00 0.00 ? 464  ARG A CA    1 
ATOM   3605  C  C     . ARG A  1  464  ? 200.013 155.527 150.733 1.00 0.00 ? 464  ARG A C     1 
ATOM   3606  O  O     . ARG A  1  464  ? 199.175 156.319 151.171 1.00 0.00 ? 464  ARG A O     1 
ATOM   3607  C  CB    . ARG A  1  464  ? 201.642 156.332 149.012 1.00 0.00 ? 464  ARG A CB    1 
ATOM   3608  C  CG    . ARG A  1  464  ? 202.205 156.214 147.622 1.00 0.00 ? 464  ARG A CG    1 
ATOM   3609  C  CD    . ARG A  1  464  ? 203.480 157.023 147.452 1.00 0.00 ? 464  ARG A CD    1 
ATOM   3610  N  NE    . ARG A  1  464  ? 204.041 157.008 146.106 1.00 0.00 ? 464  ARG A NE    1 
ATOM   3611  C  CZ    . ARG A  1  464  ? 205.080 157.737 145.719 1.00 0.00 ? 464  ARG A CZ    1 
ATOM   3612  N  NH1   . ARG A  1  464  ? 205.660 158.570 146.562 1.00 0.00 ? 464  ARG A NH1   1 
ATOM   3613  N  NH2   . ARG A  1  464  ? 205.531 157.642 144.480 1.00 0.00 ? 464  ARG A NH2   1 
ATOM   3614  N  N     . HIS A  1  465  ? 200.609 154.618 151.505 1.00 0.00 ? 465  HIS A N     1 
ATOM   3615  C  CA    . HIS A  1  465  ? 200.503 154.772 152.943 1.00 0.00 ? 465  HIS A CA    1 
ATOM   3616  C  C     . HIS A  1  465  ? 201.066 156.121 153.331 1.00 0.00 ? 465  HIS A C     1 
ATOM   3617  O  O     . HIS A  1  465  ? 200.313 157.061 153.594 1.00 0.00 ? 465  HIS A O     1 
ATOM   3618  C  CB    . HIS A  1  465  ? 201.244 153.675 153.692 1.00 0.00 ? 465  HIS A CB    1 
ATOM   3619  C  CG    . HIS A  1  465  ? 200.549 152.357 153.662 1.00 0.00 ? 465  HIS A CG    1 
ATOM   3620  N  ND1   . HIS A  1  465  ? 200.711 151.458 152.642 1.00 0.00 ? 465  HIS A ND1   1 
ATOM   3621  C  CD2   . HIS A  1  465  ? 199.674 151.797 154.520 1.00 0.00 ? 465  HIS A CD2   1 
ATOM   3622  C  CE1   . HIS A  1  465  ? 199.972 150.390 152.872 1.00 0.00 ? 465  HIS A CE1   1 
ATOM   3623  N  NE2   . HIS A  1  465  ? 199.328 150.570 154.015 1.00 0.00 ? 465  HIS A NE2   1 
ATOM   3624  N  N     . LEU A  1  466  ? 202.386 156.227 153.294 1.00 0.00 ? 466  LEU A N     1 
ATOM   3625  C  CA    . LEU A  1  466  ? 203.110 157.450 153.618 1.00 0.00 ? 466  LEU A CA    1 
ATOM   3626  C  C     . LEU A  1  466  ? 204.569 157.008 153.542 1.00 0.00 ? 466  LEU A C     1 
ATOM   3627  O  O     . LEU A  1  466  ? 204.872 155.822 153.652 1.00 0.00 ? 466  LEU A O     1 
ATOM   3628  C  CB    . LEU A  1  466  ? 202.722 157.965 155.000 1.00 0.00 ? 466  LEU A CB    1 
ATOM   3629  C  CG    . LEU A  1  466  ? 203.045 159.359 155.493 1.00 0.00 ? 466  LEU A CG    1 
ATOM   3630  C  CD1   . LEU A  1  466  ? 202.256 160.330 154.667 1.00 0.00 ? 466  LEU A CD1   1 
ATOM   3631  C  CD2   . LEU A  1  466  ? 202.656 159.481 156.944 1.00 0.00 ? 466  LEU A CD2   1 
ATOM   3632  N  N     . GLU A  1  467  ? 205.489 157.946 153.373 1.00 0.00 ? 467  GLU A N     1 
ATOM   3633  C  CA    . GLU A  1  467  ? 206.868 157.521 153.530 1.00 0.00 ? 467  GLU A CA    1 
ATOM   3634  C  C     . GLU A  1  467  ? 207.691 158.584 154.221 1.00 0.00 ? 467  GLU A C     1 
ATOM   3635  O  O     . GLU A  1  467  ? 207.214 159.662 154.574 1.00 0.00 ? 467  GLU A O     1 
ATOM   3636  C  CB    . GLU A  1  467  ? 207.567 157.228 152.203 1.00 0.00 ? 467  GLU A CB    1 
ATOM   3637  C  CG    . GLU A  1  467  ? 207.029 156.121 151.344 1.00 0.00 ? 467  GLU A CG    1 
ATOM   3638  C  CD    . GLU A  1  467  ? 206.148 156.653 150.252 1.00 0.00 ? 467  GLU A CD    1 
ATOM   3639  O  OE1   . GLU A  1  467  ? 205.936 157.883 150.213 1.00 0.00 ? 467  GLU A OE1   1 
ATOM   3640  O  OE2   . GLU A  1  467  ? 205.684 155.851 149.421 1.00 0.00 ? 467  GLU A OE2   1 
ATOM   3641  N  N     . ASP A  1  468  ? 208.965 158.266 154.374 1.00 0.00 ? 468  ASP A N     1 
ATOM   3642  C  CA    . ASP A  1  468  ? 209.965 159.297 154.552 1.00 0.00 ? 468  ASP A CA    1 
ATOM   3643  C  C     . ASP A  1  468  ? 209.803 160.320 153.438 1.00 0.00 ? 468  ASP A C     1 
ATOM   3644  O  O     . ASP A  1  468  ? 209.678 159.961 152.266 1.00 0.00 ? 468  ASP A O     1 
ATOM   3645  C  CB    . ASP A  1  468  ? 211.360 158.677 154.525 1.00 0.00 ? 468  ASP A CB    1 
ATOM   3646  C  CG    . ASP A  1  468  ? 212.462 159.696 154.741 1.00 0.00 ? 468  ASP A CG    1 
ATOM   3647  O  OD1   . ASP A  1  468  ? 212.152 160.878 154.984 1.00 0.00 ? 468  ASP A OD1   1 
ATOM   3648  O  OD2   . ASP A  1  468  ? 213.648 159.319 154.666 1.00 0.00 ? 468  ASP A OD2   1 
ATOM   3649  N  N     . GLY A  1  469  ? 209.761 161.592 153.809 1.00 0.00 ? 469  GLY A N     1 
ATOM   3650  C  CA    . GLY A  1  469  ? 209.700 162.666 152.844 1.00 0.00 ? 469  GLY A CA    1 
ATOM   3651  C  C     . GLY A  1  469  ? 208.324 163.232 152.579 1.00 0.00 ? 469  GLY A C     1 
ATOM   3652  O  O     . GLY A  1  469  ? 208.237 164.377 152.128 1.00 0.00 ? 469  GLY A O     1 
ATOM   3653  N  N     . ASP A  1  470  ? 207.248 162.491 152.834 1.00 0.00 ? 470  ASP A N     1 
ATOM   3654  C  CA    . ASP A  1  470  ? 205.914 163.046 152.648 1.00 0.00 ? 470  ASP A CA    1 
ATOM   3655  C  C     . ASP A  1  470  ? 205.693 164.205 153.602 1.00 0.00 ? 470  ASP A C     1 
ATOM   3656  O  O     . ASP A  1  470  ? 205.966 164.114 154.800 1.00 0.00 ? 470  ASP A O     1 
ATOM   3657  C  CB    . ASP A  1  470  ? 204.834 161.990 152.856 1.00 0.00 ? 470  ASP A CB    1 
ATOM   3658  C  CG    . ASP A  1  470  ? 204.685 161.072 151.663 1.00 0.00 ? 470  ASP A CG    1 
ATOM   3659  O  OD1   . ASP A  1  470  ? 205.132 161.456 150.564 1.00 0.00 ? 470  ASP A OD1   1 
ATOM   3660  O  OD2   . ASP A  1  470  ? 204.135 159.962 151.819 1.00 0.00 ? 470  ASP A OD2   1 
ATOM   3661  N  N     . VAL A  1  471  ? 205.208 165.304 153.054 1.00 0.00 ? 471  VAL A N     1 
ATOM   3662  C  CA    . VAL A  1  471  ? 205.093 166.552 153.791 1.00 0.00 ? 471  VAL A CA    1 
ATOM   3663  C  C     . VAL A  1  471  ? 203.844 166.504 154.646 1.00 0.00 ? 471  VAL A C     1 
ATOM   3664  O  O     . VAL A  1  471  ? 202.739 166.325 154.130 1.00 0.00 ? 471  VAL A O     1 
ATOM   3665  C  CB    . VAL A  1  471  ? 205.048 167.745 152.836 1.00 0.00 ? 471  VAL A CB    1 
ATOM   3666  C  CG1   . VAL A  1  471  ? 204.758 168.999 153.610 1.00 0.00 ? 471  VAL A CG1   1 
ATOM   3667  C  CG2   . VAL A  1  471  ? 206.359 167.855 152.108 1.00 0.00 ? 471  VAL A CG2   1 
ATOM   3668  N  N     . VAL A  1  472  ? 204.004 166.690 155.950 1.00 0.00 ? 472  VAL A N     1 
ATOM   3669  C  CA    . VAL A  1  472  ? 202.885 166.588 156.877 1.00 0.00 ? 472  VAL A CA    1 
ATOM   3670  C  C     . VAL A  1  472  ? 202.881 167.800 157.788 1.00 0.00 ? 472  VAL A C     1 
ATOM   3671  O  O     . VAL A  1  472  ? 203.890 168.088 158.433 1.00 0.00 ? 472  VAL A O     1 
ATOM   3672  C  CB    . VAL A  1  472  ? 202.966 165.321 157.728 1.00 0.00 ? 472  VAL A CB    1 
ATOM   3673  C  CG1   . VAL A  1  472  ? 201.828 165.326 158.665 1.00 0.00 ? 472  VAL A CG1   1 
ATOM   3674  C  CG2   . VAL A  1  472  ? 202.920 164.104 156.857 1.00 0.00 ? 472  VAL A CG2   1 
ATOM   3675  N  N     . LEU A  1  473  ? 201.751 168.494 157.868 1.00 0.00 ? 473  LEU A N     1 
ATOM   3676  C  CA    . LEU A  1  473  ? 201.670 169.659 158.734 1.00 0.00 ? 473  LEU A CA    1 
ATOM   3677  C  C     . LEU A  1  473  ? 201.108 169.263 160.090 1.00 0.00 ? 473  LEU A C     1 
ATOM   3678  O  O     . LEU A  1  473  ? 200.265 168.375 160.209 1.00 0.00 ? 473  LEU A O     1 
ATOM   3679  C  CB    . LEU A  1  473  ? 200.830 170.766 158.108 1.00 0.00 ? 473  LEU A CB    1 
ATOM   3680  C  CG    . LEU A  1  473  ? 199.329 170.658 157.939 1.00 0.00 ? 473  LEU A CG    1 
ATOM   3681  C  CD1   . LEU A  1  473  ? 198.605 171.110 159.184 1.00 0.00 ? 473  LEU A CD1   1 
ATOM   3682  C  CD2   . LEU A  1  473  ? 198.939 171.505 156.769 1.00 0.00 ? 473  LEU A CD2   1 
ATOM   3683  N  N     . PHE A  1  474  ? 201.583 169.952 161.119 1.00 0.00 ? 474  PHE A N     1 
ATOM   3684  C  CA    . PHE A  1  474  ? 201.562 169.440 162.475 1.00 0.00 ? 474  PHE A CA    1 
ATOM   3685  C  C     . PHE A  1  474  ? 201.092 170.507 163.452 1.00 0.00 ? 474  PHE A C     1 
ATOM   3686  O  O     . PHE A  1  474  ? 201.656 171.601 163.502 1.00 0.00 ? 474  PHE A O     1 
ATOM   3687  C  CB    . PHE A  1  474  ? 202.944 168.975 162.841 1.00 0.00 ? 474  PHE A CB    1 
ATOM   3688  C  CG    . PHE A  1  474  ? 203.019 168.302 164.140 1.00 0.00 ? 474  PHE A CG    1 
ATOM   3689  C  CD1   . PHE A  1  474  ? 202.743 166.965 164.234 1.00 0.00 ? 474  PHE A CD1   1 
ATOM   3690  C  CD2   . PHE A  1  474  ? 203.375 168.993 165.266 1.00 0.00 ? 474  PHE A CD2   1 
ATOM   3691  C  CE1   . PHE A  1  474  ? 202.816 166.325 165.429 1.00 0.00 ? 474  PHE A CE1   1 
ATOM   3692  C  CE2   . PHE A  1  474  ? 203.451 168.357 166.466 1.00 0.00 ? 474  PHE A CE2   1 
ATOM   3693  C  CZ    . PHE A  1  474  ? 203.167 167.020 166.550 1.00 0.00 ? 474  PHE A CZ    1 
ATOM   3694  N  N     . ASN A  1  475  ? 200.077 170.181 164.242 1.00 0.00 ? 475  ASN A N     1 
ATOM   3695  C  CA    . ASN A  1  475  ? 199.425 171.146 165.117 1.00 0.00 ? 475  ASN A CA    1 
ATOM   3696  C  C     . ASN A  1  475  ? 199.354 170.639 166.544 1.00 0.00 ? 475  ASN A C     1 
ATOM   3697  O  O     . ASN A  1  475  ? 199.417 169.434 166.784 1.00 0.00 ? 475  ASN A O     1 
ATOM   3698  C  CB    . ASN A  1  475  ? 198.038 171.444 164.636 1.00 0.00 ? 475  ASN A CB    1 
ATOM   3699  C  CG    . ASN A  1  475  ? 197.353 172.449 165.487 1.00 0.00 ? 475  ASN A CG    1 
ATOM   3700  O  OD1   . ASN A  1  475  ? 198.000 173.171 166.239 1.00 0.00 ? 475  ASN A OD1   1 
ATOM   3701  N  ND2   . ASN A  1  475  ? 196.040 172.521 165.381 1.00 0.00 ? 475  ASN A ND2   1 
ATOM   3702  N  N     . ARG A  1  476  ? 199.206 171.562 167.503 1.00 0.00 ? 476  ARG A N     1 
ATOM   3703  C  CA    . ARG A  1  476  ? 199.290 171.103 168.881 1.00 0.00 ? 476  ARG A CA    1 
ATOM   3704  C  C     . ARG A  1  476  ? 198.030 171.269 169.728 1.00 0.00 ? 476  ARG A C     1 
ATOM   3705  O  O     . ARG A  1  476  ? 197.282 170.316 169.933 1.00 0.00 ? 476  ARG A O     1 
ATOM   3706  C  CB    . ARG A  1  476  ? 200.425 171.814 169.619 1.00 0.00 ? 476  ARG A CB    1 
ATOM   3707  C  CG    . ARG A  1  476  ? 200.521 171.384 171.036 1.00 0.00 ? 476  ARG A CG    1 
ATOM   3708  C  CD    . ARG A  1  476  ? 201.561 172.166 171.764 1.00 0.00 ? 476  ARG A CD    1 
ATOM   3709  N  NE    . ARG A  1  476  ? 201.562 171.970 173.205 1.00 0.00 ? 476  ARG A NE    1 
ATOM   3710  C  CZ    . ARG A  1  476  ? 202.105 170.926 173.810 1.00 0.00 ? 476  ARG A CZ    1 
ATOM   3711  N  NH1   . ARG A  1  476  ? 202.681 169.973 173.095 1.00 0.00 ? 476  ARG A NH1   1 
ATOM   3712  N  NH2   . ARG A  1  476  ? 202.060 170.831 175.128 1.00 0.00 ? 476  ARG A NH2   1 
ATOM   3713  N  N     . GLN A  1  477  ? 197.827 172.458 170.243 1.00 0.00 ? 477  GLN A N     1 
ATOM   3714  C  CA    . GLN A  1  477  ? 196.932 172.715 171.363 1.00 0.00 ? 477  GLN A CA    1 
ATOM   3715  C  C     . GLN A  1  477  ? 195.925 173.780 170.979 1.00 0.00 ? 477  GLN A C     1 
ATOM   3716  O  O     . GLN A  1  477  ? 195.801 174.132 169.798 1.00 0.00 ? 477  GLN A O     1 
ATOM   3717  C  CB    . GLN A  1  477  ? 197.701 173.175 172.598 1.00 0.00 ? 477  GLN A CB    1 
ATOM   3718  C  CG    . GLN A  1  477  ? 198.310 172.071 173.412 1.00 0.00 ? 477  GLN A CG    1 
ATOM   3719  C  CD    . GLN A  1  477  ? 199.147 172.607 174.550 1.00 0.00 ? 477  GLN A CD    1 
ATOM   3720  O  OE1   . GLN A  1  477  ? 199.662 173.724 174.487 1.00 0.00 ? 477  GLN A OE1   1 
ATOM   3721  N  NE2   . GLN A  1  477  ? 199.305 171.812 175.585 1.00 0.00 ? 477  GLN A NE2   1 
ATOM   3722  N  N     . PRO A  1  478  ? 195.182 174.315 171.934 1.00 0.00 ? 478  PRO A N     1 
ATOM   3723  C  CA    . PRO A  1  478  ? 194.661 175.658 171.712 1.00 0.00 ? 478  PRO A CA    1 
ATOM   3724  C  C     . PRO A  1  478  ? 195.826 176.494 171.256 1.00 0.00 ? 478  PRO A C     1 
ATOM   3725  O  O     . PRO A  1  478  ? 196.839 176.598 171.947 1.00 0.00 ? 478  PRO A O     1 
ATOM   3726  C  CB    . PRO A  1  478  ? 194.167 176.063 173.106 1.00 0.00 ? 478  PRO A CB    1 
ATOM   3727  C  CG    . PRO A  1  478  ? 193.913 174.768 173.821 1.00 0.00 ? 478  PRO A CG    1 
ATOM   3728  C  CD    . PRO A  1  478  ? 194.434 173.629 172.995 1.00 0.00 ? 478  PRO A CD    1 
ATOM   3729  N  N     . SER A  1  479  ? 195.692 177.109 170.086 1.00 0.00 ? 479  SER A N     1 
ATOM   3730  C  CA    . SER A  1  479  ? 196.870 177.594 169.412 1.00 0.00 ? 479  SER A CA    1 
ATOM   3731  C  C     . SER A  1  479  ? 196.998 179.092 169.613 1.00 0.00 ? 479  SER A C     1 
ATOM   3732  O  O     . SER A  1  479  ? 196.274 179.898 169.024 1.00 0.00 ? 479  SER A O     1 
ATOM   3733  C  CB    . SER A  1  479  ? 196.804 177.255 167.929 1.00 0.00 ? 479  SER A CB    1 
ATOM   3734  O  OG    . SER A  1  479  ? 195.721 177.924 167.319 1.00 0.00 ? 479  SER A OG    1 
ATOM   3735  N  N     . LEU A  1  480  ? 197.960 179.457 170.444 1.00 0.00 ? 480  LEU A N     1 
ATOM   3736  C  CA    . LEU A  1  480  ? 198.094 180.822 170.915 1.00 0.00 ? 480  LEU A CA    1 
ATOM   3737  C  C     . LEU A  1  480  ? 198.443 181.791 169.801 1.00 0.00 ? 480  LEU A C     1 
ATOM   3738  O  O     . LEU A  1  480  ? 197.911 182.901 169.777 1.00 0.00 ? 480  LEU A O     1 
ATOM   3739  C  CB    . LEU A  1  480  ? 199.149 180.892 172.019 1.00 0.00 ? 480  LEU A CB    1 
ATOM   3740  C  CG    . LEU A  1  480  ? 198.670 180.537 173.429 1.00 0.00 ? 480  LEU A CG    1 
ATOM   3741  C  CD1   . LEU A  1  480  ? 198.267 179.076 173.549 1.00 0.00 ? 480  LEU A CD1   1 
ATOM   3742  C  CD2   . LEU A  1  480  ? 199.747 180.869 174.433 1.00 0.00 ? 480  LEU A CD2   1 
ATOM   3743  N  N     . HIS A  1  481  ? 199.306 181.397 168.865 1.00 0.00 ? 481  HIS A N     1 
ATOM   3744  C  CA    . HIS A  1  481  ? 199.707 182.337 167.830 1.00 0.00 ? 481  HIS A CA    1 
ATOM   3745  C  C     . HIS A  1  481  ? 200.224 181.677 166.563 1.00 0.00 ? 481  HIS A C     1 
ATOM   3746  O  O     . HIS A  1  481  ? 200.175 180.452 166.417 1.00 0.00 ? 481  HIS A O     1 
ATOM   3747  C  CB    . HIS A  1  481  ? 200.763 183.293 168.375 1.00 0.00 ? 481  HIS A CB    1 
ATOM   3748  C  CG    . HIS A  1  481  ? 202.018 182.620 168.818 1.00 0.00 ? 481  HIS A CG    1 
ATOM   3749  N  ND1   . HIS A  1  481  ? 202.064 181.788 169.914 1.00 0.00 ? 481  HIS A ND1   1 
ATOM   3750  C  CD2   . HIS A  1  481  ? 203.284 182.693 168.347 1.00 0.00 ? 481  HIS A CD2   1 
ATOM   3751  C  CE1   . HIS A  1  481  ? 203.298 181.351 170.080 1.00 0.00 ? 481  HIS A CE1   1 
ATOM   3752  N  NE2   . HIS A  1  481  ? 204.059 181.887 169.144 1.00 0.00 ? 481  HIS A NE2   1 
ATOM   3753  N  N     . ARG A  1  482  ? 200.745 182.508 165.661 1.00 0.00 ? 482  ARG A N     1 
ATOM   3754  C  CA    . ARG A  1  482  ? 201.031 182.094 164.291 1.00 0.00 ? 482  ARG A CA    1 
ATOM   3755  C  C     . ARG A  1  482  ? 201.899 180.847 164.237 1.00 0.00 ? 482  ARG A C     1 
ATOM   3756  O  O     . ARG A  1  482  ? 201.860 180.108 163.251 1.00 0.00 ? 482  ARG A O     1 
ATOM   3757  C  CB    . ARG A  1  482  ? 201.700 183.244 163.540 1.00 0.00 ? 482  ARG A CB    1 
ATOM   3758  C  CG    . ARG A  1  482  ? 202.135 182.937 162.115 1.00 0.00 ? 482  ARG A CG    1 
ATOM   3759  C  CD    . ARG A  1  482  ? 202.734 184.173 161.487 1.00 0.00 ? 482  ARG A CD    1 
ATOM   3760  N  NE    . ARG A  1  482  ? 203.149 183.978 160.107 1.00 0.00 ? 482  ARG A NE    1 
ATOM   3761  C  CZ    . ARG A  1  482  ? 204.356 183.573 159.743 1.00 0.00 ? 482  ARG A CZ    1 
ATOM   3762  N  NH1   . ARG A  1  482  ? 205.277 183.325 160.657 1.00 0.00 ? 482  ARG A NH1   1 
ATOM   3763  N  NH2   . ARG A  1  482  ? 204.644 183.434 158.462 1.00 0.00 ? 482  ARG A NH2   1 
ATOM   3764  N  N     . LEU A  1  483  ? 202.686 180.571 165.272 1.00 0.00 ? 483  LEU A N     1 
ATOM   3765  C  CA    . LEU A  1  483  ? 203.395 179.302 165.243 1.00 0.00 ? 483  LEU A CA    1 
ATOM   3766  C  C     . LEU A  1  483  ? 202.634 178.322 166.117 1.00 0.00 ? 483  LEU A C     1 
ATOM   3767  O  O     . LEU A  1  483  ? 202.785 178.253 167.337 1.00 0.00 ? 483  LEU A O     1 
ATOM   3768  C  CB    . LEU A  1  483  ? 204.831 179.469 165.705 1.00 0.00 ? 483  LEU A CB    1 
ATOM   3769  C  CG    . LEU A  1  483  ? 205.615 180.327 164.731 1.00 0.00 ? 483  LEU A CG    1 
ATOM   3770  C  CD1   . LEU A  1  483  ? 206.960 180.624 165.283 1.00 0.00 ? 483  LEU A CD1   1 
ATOM   3771  C  CD2   . LEU A  1  483  ? 205.750 179.598 163.426 1.00 0.00 ? 483  LEU A CD2   1 
ATOM   3772  N  N     . SER A  1  484  ? 201.799 177.546 165.453 1.00 0.00 ? 484  SER A N     1 
ATOM   3773  C  CA    . SER A  1  484  ? 201.310 176.277 165.941 1.00 0.00 ? 484  SER A CA    1 
ATOM   3774  C  C     . SER A  1  484  ? 201.339 175.361 164.741 1.00 0.00 ? 484  SER A C     1 
ATOM   3775  O  O     . SER A  1  484  ? 202.062 174.365 164.716 1.00 0.00 ? 484  SER A O     1 
ATOM   3776  C  CB    . SER A  1  484  ? 199.918 176.398 166.530 1.00 0.00 ? 484  SER A CB    1 
ATOM   3777  O  OG    . SER A  1  484  ? 199.949 177.209 167.684 1.00 0.00 ? 484  SER A OG    1 
ATOM   3778  N  N     . ILE A  1  485  ? 200.543 175.696 163.744 1.00 0.00 ? 485  ILE A N     1 
ATOM   3779  C  CA    . ILE A  1  485  ? 200.583 175.015 162.463 1.00 0.00 ? 485  ILE A CA    1 
ATOM   3780  C  C     . ILE A  1  485  ? 202.003 175.190 161.946 1.00 0.00 ? 485  ILE A C     1 
ATOM   3781  O  O     . ILE A  1  485  ? 202.476 176.308 161.737 1.00 0.00 ? 485  ILE A O     1 
ATOM   3782  C  CB    . ILE A  1  485  ? 199.562 175.580 161.479 1.00 0.00 ? 485  ILE A CB    1 
ATOM   3783  C  CG1   . ILE A  1  485  ? 198.179 175.585 162.101 1.00 0.00 ? 485  ILE A CG1   1 
ATOM   3784  C  CG2   . ILE A  1  485  ? 199.517 174.730 160.235 1.00 0.00 ? 485  ILE A CG2   1 
ATOM   3785  C  CD1   . ILE A  1  485  ? 197.720 174.223 162.475 1.00 0.00 ? 485  ILE A CD1   1 
ATOM   3786  N  N     . LEU A  1  486  ? 202.683 174.081 161.721 1.00 0.00 ? 486  LEU A N     1 
ATOM   3787  C  CA    . LEU A  1  486  ? 203.967 174.038 161.043 1.00 0.00 ? 486  LEU A CA    1 
ATOM   3788  C  C     . LEU A  1  486  ? 203.913 172.889 160.053 1.00 0.00 ? 486  LEU A C     1 
ATOM   3789  O  O     . LEU A  1  486  ? 202.878 172.235 159.916 1.00 0.00 ? 486  LEU A O     1 
ATOM   3790  C  CB    . LEU A  1  486  ? 205.121 173.835 162.021 1.00 0.00 ? 486  LEU A CB    1 
ATOM   3791  C  CG    . LEU A  1  486  ? 205.741 175.062 162.677 1.00 0.00 ? 486  LEU A CG    1 
ATOM   3792  C  CD1   . LEU A  1  486  ? 204.811 175.698 163.626 1.00 0.00 ? 486  LEU A CD1   1 
ATOM   3793  C  CD2   . LEU A  1  486  ? 206.990 174.693 163.396 1.00 0.00 ? 486  LEU A CD2   1 
ATOM   3794  N  N     . SER A  1  487  ? 205.004 172.629 159.359 1.00 0.00 ? 487  SER A N     1 
ATOM   3795  C  CA    . SER A  1  487  ? 205.000 171.453 158.512 1.00 0.00 ? 487  SER A CA    1 
ATOM   3796  C  C     . SER A  1  487  ? 206.379 170.838 158.435 1.00 0.00 ? 487  SER A C     1 
ATOM   3797  O  O     . SER A  1  487  ? 207.392 171.530 158.340 1.00 0.00 ? 487  SER A O     1 
ATOM   3798  C  CB    . SER A  1  487  ? 204.498 171.787 157.115 1.00 0.00 ? 487  SER A CB    1 
ATOM   3799  O  OG    . SER A  1  487  ? 205.390 172.659 156.468 1.00 0.00 ? 487  SER A OG    1 
ATOM   3800  N  N     . HIS A  1  488  ? 206.398 169.516 158.450 1.00 0.00 ? 488  HIS A N     1 
ATOM   3801  C  CA    . HIS A  1  488  ? 207.606 168.747 158.634 1.00 0.00 ? 488  HIS A CA    1 
ATOM   3802  C  C     . HIS A  1  488  ? 207.658 167.672 157.569 1.00 0.00 ? 488  HIS A C     1 
ATOM   3803  O  O     . HIS A  1  488  ? 206.631 167.143 157.145 1.00 0.00 ? 488  HIS A O     1 
ATOM   3804  C  CB    . HIS A  1  488  ? 207.614 168.084 160.003 1.00 0.00 ? 488  HIS A CB    1 
ATOM   3805  C  CG    . HIS A  1  488  ? 207.399 169.025 161.142 1.00 0.00 ? 488  HIS A CG    1 
ATOM   3806  N  ND1   . HIS A  1  488  ? 208.419 169.727 161.742 1.00 0.00 ? 488  HIS A ND1   1 
ATOM   3807  C  CD2   . HIS A  1  488  ? 206.263 169.412 161.764 1.00 0.00 ? 488  HIS A CD2   1 
ATOM   3808  C  CE1   . HIS A  1  488  ? 207.926 170.462 162.722 1.00 0.00 ? 488  HIS A CE1   1 
ATOM   3809  N  NE2   . HIS A  1  488  ? 206.619 170.294 162.751 1.00 0.00 ? 488  HIS A NE2   1 
ATOM   3810  N  N     . TYR A  1  489  ? 208.862 167.339 157.139 1.00 0.00 ? 489  TYR A N     1 
ATOM   3811  C  CA    . TYR A  1  489  ? 209.037 166.109 156.397 1.00 0.00 ? 489  TYR A CA    1 
ATOM   3812  C  C     . TYR A  1  489  ? 208.821 164.942 157.344 1.00 0.00 ? 489  TYR A C     1 
ATOM   3813  O  O     . TYR A  1  489  ? 209.531 164.802 158.335 1.00 0.00 ? 489  TYR A O     1 
ATOM   3814  C  CB    . TYR A  1  489  ? 210.442 166.037 155.811 1.00 0.00 ? 489  TYR A CB    1 
ATOM   3815  C  CG    . TYR A  1  489  ? 210.768 167.086 154.784 1.00 0.00 ? 489  TYR A CG    1 
ATOM   3816  C  CD1   . TYR A  1  489  ? 209.845 167.467 153.847 1.00 0.00 ? 489  TYR A CD1   1 
ATOM   3817  C  CD2   . TYR A  1  489  ? 212.013 167.666 154.738 1.00 0.00 ? 489  TYR A CD2   1 
ATOM   3818  C  CE1   . TYR A  1  489  ? 210.146 168.407 152.901 1.00 0.00 ? 489  TYR A CE1   1 
ATOM   3819  C  CE2   . TYR A  1  489  ? 212.320 168.613 153.800 1.00 0.00 ? 489  TYR A CE2   1 
ATOM   3820  C  CZ    . TYR A  1  489  ? 211.383 168.981 152.884 1.00 0.00 ? 489  TYR A CZ    1 
ATOM   3821  O  OH    . TYR A  1  489  ? 211.688 169.928 151.937 1.00 0.00 ? 489  TYR A OH    1 
ATOM   3822  N  N     . ALA A  1  490  ? 207.855 164.086 157.042 1.00 0.00 ? 490  ALA A N     1 
ATOM   3823  C  CA    . ALA A  1  490  ? 207.542 163.013 157.977 1.00 0.00 ? 490  ALA A CA    1 
ATOM   3824  C  C     . ALA A  1  490  ? 208.529 161.875 157.793 1.00 0.00 ? 490  ALA A C     1 
ATOM   3825  O  O     . ALA A  1  490  ? 208.943 161.584 156.668 1.00 0.00 ? 490  ALA A O     1 
ATOM   3826  C  CB    . ALA A  1  490  ? 206.113 162.524 157.786 1.00 0.00 ? 490  ALA A CB    1 
ATOM   3827  N  N     . LYS A  1  491  ? 208.915 161.246 158.893 1.00 0.00 ? 491  LYS A N     1 
ATOM   3828  C  CA    . LYS A  1  491  ? 209.754 160.060 158.869 1.00 0.00 ? 491  LYS A CA    1 
ATOM   3829  C  C     . LYS A  1  491  ? 209.114 158.993 159.741 1.00 0.00 ? 491  LYS A C     1 
ATOM   3830  O  O     . LYS A  1  491  ? 208.665 159.281 160.853 1.00 0.00 ? 491  LYS A O     1 
ATOM   3831  C  CB    . LYS A  1  491  ? 211.162 160.359 159.361 1.00 0.00 ? 491  LYS A CB    1 
ATOM   3832  C  CG    . LYS A  1  491  ? 212.091 159.171 159.274 1.00 0.00 ? 491  LYS A CG    1 
ATOM   3833  C  CD    . LYS A  1  491  ? 213.463 159.510 159.808 1.00 0.00 ? 491  LYS A CD    1 
ATOM   3834  C  CE    . LYS A  1  491  ? 214.135 160.556 158.950 1.00 0.00 ? 491  LYS A CE    1 
ATOM   3835  N  NZ    . LYS A  1  491  ? 214.374 160.055 157.574 1.00 0.00 ? 491  LYS A NZ    1 
ATOM   3836  N  N     . ILE A  1  492  ? 209.086 157.762 159.247 1.00 0.00 ? 492  ILE A N     1 
ATOM   3837  C  CA    . ILE A  1  492  ? 208.326 156.686 159.865 1.00 0.00 ? 492  ILE A CA    1 
ATOM   3838  C  C     . ILE A  1  492  ? 209.239 155.852 160.749 1.00 0.00 ? 492  ILE A C     1 
ATOM   3839  O  O     . ILE A  1  492  ? 210.348 155.492 160.344 1.00 0.00 ? 492  ILE A O     1 
ATOM   3840  C  CB    . ILE A  1  492  ? 207.658 155.815 158.800 1.00 0.00 ? 492  ILE A CB    1 
ATOM   3841  C  CG1   . ILE A  1  492  ? 206.766 156.694 157.946 1.00 0.00 ? 492  ILE A CG1   1 
ATOM   3842  C  CG2   . ILE A  1  492  ? 206.861 154.740 159.451 1.00 0.00 ? 492  ILE A CG2   1 
ATOM   3843  C  CD1   . ILE A  1  492  ? 205.750 157.423 158.760 1.00 0.00 ? 492  ILE A CD1   1 
ATOM   3844  N  N     . ARG A  1  493  ? 208.771 155.536 161.947 1.00 0.00 ? 493  ARG A N     1 
ATOM   3845  C  CA    . ARG A  1  493  ? 209.510 154.742 162.913 1.00 0.00 ? 493  ARG A CA    1 
ATOM   3846  C  C     . ARG A  1  493  ? 208.557 153.774 163.592 1.00 0.00 ? 493  ARG A C     1 
ATOM   3847  O  O     . ARG A  1  493  ? 207.351 153.795 163.329 1.00 0.00 ? 493  ARG A O     1 
ATOM   3848  C  CB    . ARG A  1  493  ? 210.172 155.634 163.970 1.00 0.00 ? 493  ARG A CB    1 
ATOM   3849  C  CG    . ARG A  1  493  ? 211.256 156.546 163.467 1.00 0.00 ? 493  ARG A CG    1 
ATOM   3850  C  CD    . ARG A  1  493  ? 212.445 155.761 162.987 1.00 0.00 ? 493  ARG A CD    1 
ATOM   3851  N  NE    . ARG A  1  493  ? 213.551 156.639 162.631 1.00 0.00 ? 493  ARG A NE    1 
ATOM   3852  C  CZ    . ARG A  1  493  ? 214.632 156.236 161.976 1.00 0.00 ? 493  ARG A CZ    1 
ATOM   3853  N  NH1   . ARG A  1  493  ? 214.743 154.971 161.598 1.00 0.00 ? 493  ARG A NH1   1 
ATOM   3854  N  NH2   . ARG A  1  493  ? 215.600 157.097 161.696 1.00 0.00 ? 493  ARG A NH2   1 
ATOM   3855  N  N     . PRO A  1  494  ? 209.067 152.904 164.455 1.00 0.00 ? 494  PRO A N     1 
ATOM   3856  C  CA    . PRO A  1  494  ? 208.186 152.078 165.288 1.00 0.00 ? 494  PRO A CA    1 
ATOM   3857  C  C     . PRO A  1  494  ? 207.704 152.737 166.569 1.00 0.00 ? 494  PRO A C     1 
ATOM   3858  O  O     . PRO A  1  494  ? 207.813 153.947 166.770 1.00 0.00 ? 494  PRO A O     1 
ATOM   3859  C  CB    . PRO A  1  494  ? 209.048 150.852 165.595 1.00 0.00 ? 494  PRO A CB    1 
ATOM   3860  C  CG    . PRO A  1  494  ? 210.417 151.338 165.505 1.00 0.00 ? 494  PRO A CG    1 
ATOM   3861  C  CD    . PRO A  1  494  ? 210.415 152.320 164.379 1.00 0.00 ? 494  PRO A CD    1 
ATOM   3862  N  N     . TRP A  1  495  ? 207.167 151.890 167.439 1.00 0.00 ? 495  TRP A N     1 
ATOM   3863  C  CA    . TRP A  1  495  ? 206.330 152.201 168.590 1.00 0.00 ? 495  TRP A CA    1 
ATOM   3864  C  C     . TRP A  1  495  ? 205.106 152.992 168.173 1.00 0.00 ? 495  TRP A C     1 
ATOM   3865  O  O     . TRP A  1  495  ? 204.656 152.885 167.032 1.00 0.00 ? 495  TRP A O     1 
ATOM   3866  C  CB    . TRP A  1  495  ? 207.102 152.988 169.648 1.00 0.00 ? 495  TRP A CB    1 
ATOM   3867  C  CG    . TRP A  1  495  ? 208.204 152.212 170.250 1.00 0.00 ? 495  TRP A CG    1 
ATOM   3868  C  CD1   . TRP A  1  495  ? 209.531 152.379 170.036 1.00 0.00 ? 495  TRP A CD1   1 
ATOM   3869  C  CD2   . TRP A  1  495  ? 208.076 151.081 171.107 1.00 0.00 ? 495  TRP A CD2   1 
ATOM   3870  N  NE1   . TRP A  1  495  ? 210.248 151.452 170.746 1.00 0.00 ? 495  TRP A NE1   1 
ATOM   3871  C  CE2   . TRP A  1  495  ? 209.372 150.634 171.405 1.00 0.00 ? 495  TRP A CE2   1 
ATOM   3872  C  CE3   . TRP A  1  495  ? 206.989 150.409 171.662 1.00 0.00 ? 495  TRP A CE3   1 
ATOM   3873  C  CZ2   . TRP A  1  495  ? 209.613 149.549 172.238 1.00 0.00 ? 495  TRP A CZ2   1 
ATOM   3874  C  CZ3   . TRP A  1  495  ? 207.227 149.334 172.487 1.00 0.00 ? 495  TRP A CZ3   1 
ATOM   3875  C  CH2   . TRP A  1  495  ? 208.528 148.912 172.768 1.00 0.00 ? 495  TRP A CH2   1 
ATOM   3876  N  N     . ARG A  1  496  ? 204.566 153.797 169.076 1.00 0.00 ? 496  ARG A N     1 
ATOM   3877  C  CA    . ARG A  1  496  ? 203.487 154.668 168.656 1.00 0.00 ? 496  ARG A CA    1 
ATOM   3878  C  C     . ARG A  1  496  ? 203.554 155.951 169.484 1.00 0.00 ? 496  ARG A C     1 
ATOM   3879  O  O     . ARG A  1  496  ? 203.276 155.966 170.680 1.00 0.00 ? 496  ARG A O     1 
ATOM   3880  C  CB    . ARG A  1  496  ? 202.146 153.950 168.773 1.00 0.00 ? 496  ARG A CB    1 
ATOM   3881  C  CG    . ARG A  1  496  ? 201.719 153.636 170.179 1.00 0.00 ? 496  ARG A CG    1 
ATOM   3882  C  CD    . ARG A  1  496  ? 200.444 152.849 170.200 1.00 0.00 ? 496  ARG A CD    1 
ATOM   3883  N  NE    . ARG A  1  496  ? 200.685 151.493 169.730 1.00 0.00 ? 496  ARG A NE    1 
ATOM   3884  C  CZ    . ARG A  1  496  ? 199.736 150.659 169.335 1.00 0.00 ? 496  ARG A CZ    1 
ATOM   3885  N  NH1   . ARG A  1  496  ? 198.469 151.037 169.354 1.00 0.00 ? 496  ARG A NH1   1 
ATOM   3886  N  NH2   . ARG A  1  496  ? 200.060 149.444 168.930 1.00 0.00 ? 496  ARG A NH2   1 
ATOM   3887  N  N     . THR A  1  497  ? 203.900 157.045 168.818 1.00 0.00 ? 497  THR A N     1 
ATOM   3888  C  CA    . THR A  1  497  ? 203.743 158.387 169.353 1.00 0.00 ? 497  THR A CA    1 
ATOM   3889  C  C     . THR A  1  497  ? 204.396 159.354 168.391 1.00 0.00 ? 497  THR A C     1 
ATOM   3890  O  O     . THR A  1  497  ? 205.278 158.972 167.622 1.00 0.00 ? 497  THR A O     1 
ATOM   3891  C  CB    . THR A  1  497  ? 204.369 158.562 170.727 1.00 0.00 ? 497  THR A CB    1 
ATOM   3892  O  OG1   . THR A  1  497  ? 204.115 159.888 171.189 1.00 0.00 ? 497  THR A OG1   1 
ATOM   3893  C  CG2   . THR A  1  497  ? 205.838 158.347 170.637 1.00 0.00 ? 497  THR A CG2   1 
ATOM   3894  N  N     . PHE A  1  498  ? 204.006 160.617 168.482 1.00 0.00 ? 498  PHE A N     1 
ATOM   3895  C  CA    . PHE A  1  498  ? 204.546 161.642 167.601 1.00 0.00 ? 498  PHE A CA    1 
ATOM   3896  C  C     . PHE A  1  498  ? 205.836 162.154 168.209 1.00 0.00 ? 498  PHE A C     1 
ATOM   3897  O  O     . PHE A  1  498  ? 205.836 162.719 169.304 1.00 0.00 ? 498  PHE A O     1 
ATOM   3898  C  CB    . PHE A  1  498  ? 203.548 162.771 167.396 1.00 0.00 ? 498  PHE A CB    1 
ATOM   3899  C  CG    . PHE A  1  498  ? 202.353 162.361 166.627 1.00 0.00 ? 498  PHE A CG    1 
ATOM   3900  C  CD1   . PHE A  1  498  ? 202.388 161.242 165.839 1.00 0.00 ? 498  PHE A CD1   1 
ATOM   3901  C  CD2   . PHE A  1  498  ? 201.192 163.084 166.699 1.00 0.00 ? 498  PHE A CD2   1 
ATOM   3902  C  CE1   . PHE A  1  498  ? 201.288 160.857 165.134 1.00 0.00 ? 498  PHE A CE1   1 
ATOM   3903  C  CE2   . PHE A  1  498  ? 200.090 162.703 165.998 1.00 0.00 ? 498  PHE A CE2   1 
ATOM   3904  C  CZ    . PHE A  1  498  ? 200.138 161.588 165.214 1.00 0.00 ? 498  PHE A CZ    1 
ATOM   3905  N  N     . ARG A  1  499  ? 206.929 161.959 167.503 1.00 0.00 ? 499  ARG A N     1 
ATOM   3906  C  CA    . ARG A  1  499  ? 208.235 162.369 167.980 1.00 0.00 ? 499  ARG A CA    1 
ATOM   3907  C  C     . ARG A  1  499  ? 208.688 163.537 167.125 1.00 0.00 ? 499  ARG A C     1 
ATOM   3908  O  O     . ARG A  1  499  ? 208.947 163.383 165.929 1.00 0.00 ? 499  ARG A O     1 
ATOM   3909  C  CB    . ARG A  1  499  ? 209.194 161.190 167.931 1.00 0.00 ? 499  ARG A CB    1 
ATOM   3910  C  CG    . ARG A  1  499  ? 208.849 160.165 168.979 1.00 0.00 ? 499  ARG A CG    1 
ATOM   3911  C  CD    . ARG A  1  499  ? 209.816 159.023 169.014 1.00 0.00 ? 499  ARG A CD    1 
ATOM   3912  N  NE    . ARG A  1  499  ? 209.683 158.263 167.790 1.00 0.00 ? 499  ARG A NE    1 
ATOM   3913  C  CZ    . ARG A  1  499  ? 208.749 157.347 167.603 1.00 0.00 ? 499  ARG A CZ    1 
ATOM   3914  N  NH1   . ARG A  1  499  ? 207.875 157.083 168.559 1.00 0.00 ? 499  ARG A NH1   1 
ATOM   3915  N  NH2   . ARG A  1  499  ? 208.685 156.701 166.458 1.00 0.00 ? 499  ARG A NH2   1 
ATOM   3916  N  N     . LEU A  1  500  ? 208.723 164.714 167.732 1.00 0.00 ? 500  LEU A N     1 
ATOM   3917  C  CA    . LEU A  1  500  ? 209.355 165.889 167.164 1.00 0.00 ? 500  LEU A CA    1 
ATOM   3918  C  C     . LEU A  1  500  ? 210.714 166.102 167.811 1.00 0.00 ? 500  LEU A C     1 
ATOM   3919  O  O     . LEU A  1  500  ? 211.092 165.411 168.756 1.00 0.00 ? 500  LEU A O     1 
ATOM   3920  C  CB    . LEU A  1  500  ? 208.452 167.109 167.341 1.00 0.00 ? 500  LEU A CB    1 
ATOM   3921  C  CG    . LEU A  1  500  ? 207.895 167.345 168.740 1.00 0.00 ? 500  LEU A CG    1 
ATOM   3922  C  CD1   . LEU A  1  500  ? 208.895 167.966 169.661 1.00 0.00 ? 500  LEU A CD1   1 
ATOM   3923  C  CD2   . LEU A  1  500  ? 206.663 168.202 168.668 1.00 0.00 ? 500  LEU A CD2   1 
ATOM   3924  N  N     . ASN A  1  501  ? 211.441 167.086 167.316 1.00 0.00 ? 501  ASN A N     1 
ATOM   3925  C  CA    . ASN A  1  501  ? 212.726 167.383 167.914 1.00 0.00 ? 501  ASN A CA    1 
ATOM   3926  C  C     . ASN A  1  501  ? 212.560 168.494 168.929 1.00 0.00 ? 501  ASN A C     1 
ATOM   3927  O  O     . ASN A  1  501  ? 211.891 169.492 168.682 1.00 0.00 ? 501  ASN A O     1 
ATOM   3928  C  CB    . ASN A  1  501  ? 213.753 167.772 166.861 1.00 0.00 ? 501  ASN A CB    1 
ATOM   3929  C  CG    . ASN A  1  501  ? 215.140 167.977 167.445 1.00 0.00 ? 501  ASN A CG    1 
ATOM   3930  O  OD1   . ASN A  1  501  ? 215.298 168.318 168.615 1.00 0.00 ? 501  ASN A OD1   1 
ATOM   3931  N  ND2   . ASN A  1  501  ? 216.154 167.721 166.640 1.00 0.00 ? 501  ASN A ND2   1 
ATOM   3932  N  N     . GLU A  1  502  ? 213.190 168.310 170.072 1.00 0.00 ? 502  GLU A N     1 
ATOM   3933  C  CA    . GLU A  1  502  ? 212.948 169.130 171.244 1.00 0.00 ? 502  GLU A CA    1 
ATOM   3934  C  C     . GLU A  1  502  ? 213.016 170.608 170.950 1.00 0.00 ? 502  GLU A C     1 
ATOM   3935  O  O     . GLU A  1  502  ? 212.254 171.383 171.531 1.00 0.00 ? 502  GLU A O     1 
ATOM   3936  C  CB    . GLU A  1  502  ? 213.997 168.789 172.260 1.00 0.00 ? 502  GLU A CB    1 
ATOM   3937  C  CG    . GLU A  1  502  ? 214.078 167.345 172.355 1.00 0.00 ? 502  GLU A CG    1 
ATOM   3938  C  CD    . GLU A  1  502  ? 215.363 166.930 172.941 1.00 0.00 ? 502  GLU A CD    1 
ATOM   3939  O  OE1   . GLU A  1  502  ? 216.181 167.826 173.236 1.00 0.00 ? 502  GLU A OE1   1 
ATOM   3940  O  OE2   . GLU A  1  502  ? 215.566 165.712 173.073 1.00 0.00 ? 502  GLU A OE2   1 
ATOM   3941  N  N     . CYS A  1  503  ? 213.926 171.003 170.069 1.00 0.00 ? 503  CYS A N     1 
ATOM   3942  C  CA    . CYS A  1  503  ? 214.088 172.386 169.687 1.00 0.00 ? 503  CYS A CA    1 
ATOM   3943  C  C     . CYS A  1  503  ? 212.797 173.039 169.246 1.00 0.00 ? 503  CYS A C     1 
ATOM   3944  O  O     . CYS A  1  503  ? 212.646 174.245 169.440 1.00 0.00 ? 503  CYS A O     1 
ATOM   3945  C  CB    . CYS A  1  503  ? 215.094 172.493 168.548 1.00 0.00 ? 503  CYS A CB    1 
ATOM   3946  S  SG    . CYS A  1  503  ? 216.762 172.036 168.985 1.00 0.00 ? 503  CYS A SG    1 
ATOM   3947  N  N     . VAL A  1  504  ? 211.872 172.291 168.657 1.00 0.00 ? 504  VAL A N     1 
ATOM   3948  C  CA    . VAL A  1  504  ? 210.631 172.868 168.175 1.00 0.00 ? 504  VAL A CA    1 
ATOM   3949  C  C     . VAL A  1  504  ? 209.537 172.804 169.236 1.00 0.00 ? 504  VAL A C     1 
ATOM   3950  O  O     . VAL A  1  504  ? 208.384 173.103 168.947 1.00 0.00 ? 504  VAL A O     1 
ATOM   3951  C  CB    . VAL A  1  504  ? 210.158 172.223 166.867 1.00 0.00 ? 504  VAL A CB    1 
ATOM   3952  C  CG1   . VAL A  1  504  ? 211.241 172.312 165.818 1.00 0.00 ? 504  VAL A CG1   1 
ATOM   3953  C  CG2   . VAL A  1  504  ? 209.701 170.817 167.090 1.00 0.00 ? 504  VAL A CG2   1 
ATOM   3954  N  N     . CYS A  1  505  ? 209.869 172.390 170.452 1.00 0.00 ? 505  CYS A N     1 
ATOM   3955  C  CA    . CYS A  1  505  ? 208.844 172.404 171.479 1.00 0.00 ? 505  CYS A CA    1 
ATOM   3956  C  C     . CYS A  1  505  ? 208.410 173.811 171.860 1.00 0.00 ? 505  CYS A C     1 
ATOM   3957  O  O     . CYS A  1  505  ? 207.239 174.005 172.194 1.00 0.00 ? 505  CYS A O     1 
ATOM   3958  C  CB    . CYS A  1  505  ? 209.321 171.669 172.724 1.00 0.00 ? 505  CYS A CB    1 
ATOM   3959  S  SG    . CYS A  1  505  ? 209.581 169.921 172.465 1.00 0.00 ? 505  CYS A SG    1 
ATOM   3960  N  N     . THR A  1  506  ? 209.305 174.784 171.810 1.00 0.00 ? 506  THR A N     1 
ATOM   3961  C  CA    . THR A  1  506  ? 208.969 176.121 172.276 1.00 0.00 ? 506  THR A CA    1 
ATOM   3962  C  C     . THR A  1  506  ? 207.909 176.841 171.444 1.00 0.00 ? 506  THR A C     1 
ATOM   3963  O  O     . THR A  1  506  ? 207.090 177.555 172.027 1.00 0.00 ? 506  THR A O     1 
ATOM   3964  C  CB    . THR A  1  506  ? 210.234 176.966 172.376 1.00 0.00 ? 506  THR A CB    1 
ATOM   3965  O  OG1   . THR A  1  506  ? 210.915 176.971 171.122 1.00 0.00 ? 506  THR A OG1   1 
ATOM   3966  C  CG2   . THR A  1  506  ? 211.149 176.386 173.432 1.00 0.00 ? 506  THR A CG2   1 
ATOM   3967  N  N     . PRO A  1  507  ? 207.882 176.732 170.109 1.00 0.00 ? 507  PRO A N     1 
ATOM   3968  C  CA    . PRO A  1  507  ? 206.779 177.380 169.387 1.00 0.00 ? 507  PRO A CA    1 
ATOM   3969  C  C     . PRO A  1  507  ? 205.436 176.861 169.818 1.00 0.00 ? 507  PRO A C     1 
ATOM   3970  O  O     . PRO A  1  507  ? 204.493 177.632 170.019 1.00 0.00 ? 507  PRO A O     1 
ATOM   3971  C  CB    . PRO A  1  507  ? 207.066 177.031 167.926 1.00 0.00 ? 507  PRO A CB    1 
ATOM   3972  C  CG    . PRO A  1  507  ? 208.491 176.811 167.890 1.00 0.00 ? 507  PRO A CG    1 
ATOM   3973  C  CD    . PRO A  1  507  ? 208.823 176.122 169.164 1.00 0.00 ? 507  PRO A CD    1 
ATOM   3974  N  N     . TYR A  1  508  ? 205.334 175.554 169.967 1.00 0.00 ? 508  TYR A N     1 
ATOM   3975  C  CA    . TYR A  1  508  ? 204.130 174.919 170.461 1.00 0.00 ? 508  TYR A CA    1 
ATOM   3976  C  C     . TYR A  1  508  ? 203.911 175.160 171.940 1.00 0.00 ? 508  TYR A C     1 
ATOM   3977  O  O     . TYR A  1  508  ? 202.863 174.778 172.451 1.00 0.00 ? 508  TYR A O     1 
ATOM   3978  C  CB    . TYR A  1  508  ? 204.217 173.418 170.228 1.00 0.00 ? 508  TYR A CB    1 
ATOM   3979  C  CG    . TYR A  1  508  ? 204.465 172.995 168.815 1.00 0.00 ? 508  TYR A CG    1 
ATOM   3980  C  CD1   . TYR A  1  508  ? 203.826 173.582 167.760 1.00 0.00 ? 508  TYR A CD1   1 
ATOM   3981  C  CD2   . TYR A  1  508  ? 205.368 172.006 168.545 1.00 0.00 ? 508  TYR A CD2   1 
ATOM   3982  C  CE1   . TYR A  1  508  ? 204.070 173.176 166.481 1.00 0.00 ? 508  TYR A CE1   1 
ATOM   3983  C  CE2   . TYR A  1  508  ? 205.615 171.598 167.275 1.00 0.00 ? 508  TYR A CE2   1 
ATOM   3984  C  CZ    . TYR A  1  508  ? 204.968 172.186 166.243 1.00 0.00 ? 508  TYR A CZ    1 
ATOM   3985  O  OH    . TYR A  1  508  ? 205.220 171.780 164.956 1.00 0.00 ? 508  TYR A OH    1 
ATOM   3986  N  N     . ASN A  1  509  ? 204.892 175.766 172.614 1.00 0.00 ? 509  ASN A N     1 
ATOM   3987  C  CA    . ASN A  1  509  ? 205.146 175.734 174.054 1.00 0.00 ? 509  ASN A CA    1 
ATOM   3988  C  C     . ASN A  1  509  ? 204.933 174.305 174.537 1.00 0.00 ? 509  ASN A C     1 
ATOM   3989  O  O     . ASN A  1  509  ? 204.412 174.067 175.630 1.00 0.00 ? 509  ASN A O     1 
ATOM   3990  C  CB    . ASN A  1  509  ? 204.337 176.785 174.846 1.00 0.00 ? 509  ASN A CB    1 
ATOM   3991  C  CG    . ASN A  1  509  ? 202.894 176.390 175.163 1.00 0.00 ? 509  ASN A CG    1 
ATOM   3992  O  OD1   . ASN A  1  509  ? 202.329 175.450 174.633 1.00 0.00 ? 509  ASN A OD1   1 
ATOM   3993  N  ND2   . ASN A  1  509  ? 202.299 177.142 176.078 1.00 0.00 ? 509  ASN A ND2   1 
ATOM   3994  N  N     . ALA A  1  510  ? 205.370 173.349 173.725 1.00 0.00 ? 510  ALA A N     1 
ATOM   3995  C  CA    . ALA A  1  510  ? 205.157 171.940 174.003 1.00 0.00 ? 510  ALA A CA    1 
ATOM   3996  C  C     . ALA A  1  510  ? 205.854 171.564 175.298 1.00 0.00 ? 510  ALA A C     1 
ATOM   3997  O  O     . ALA A  1  510  ? 207.065 171.747 175.437 1.00 0.00 ? 510  ALA A O     1 
ATOM   3998  C  CB    . ALA A  1  510  ? 205.668 171.084 172.853 1.00 0.00 ? 510  ALA A CB    1 
ATOM   3999  N  N     . ASP A  1  511  ? 205.084 171.035 176.241 1.00 0.00 ? 511  ASP A N     1 
ATOM   4000  C  CA    . ASP A  1  511  ? 205.591 170.644 177.547 1.00 0.00 ? 511  ASP A CA    1 
ATOM   4001  C  C     . ASP A  1  511  ? 205.913 169.162 177.625 1.00 0.00 ? 511  ASP A C     1 
ATOM   4002  O  O     . ASP A  1  511  ? 206.441 168.697 178.643 1.00 0.00 ? 511  ASP A O     1 
ATOM   4003  C  CB    . ASP A  1  511  ? 204.573 171.021 178.621 1.00 0.00 ? 511  ASP A CB    1 
ATOM   4004  C  CG    . ASP A  1  511  ? 203.226 170.393 178.371 1.00 0.00 ? 511  ASP A CG    1 
ATOM   4005  O  OD1   . ASP A  1  511  ? 203.081 169.770 177.304 1.00 0.00 ? 511  ASP A OD1   1 
ATOM   4006  O  OD2   . ASP A  1  511  ? 202.319 170.521 179.221 1.00 0.00 ? 511  ASP A OD2   1 
ATOM   4007  N  N     . PHE A  1  512  ? 205.629 168.414 176.564 1.00 0.00 ? 512  PHE A N     1 
ATOM   4008  C  CA    . PHE A  1  512  ? 205.494 166.971 176.673 1.00 0.00 ? 512  PHE A CA    1 
ATOM   4009  C  C     . PHE A  1  512  ? 204.543 166.652 177.801 1.00 0.00 ? 512  PHE A C     1 
ATOM   4010  O  O     . PHE A  1  512  ? 203.368 167.026 177.737 1.00 0.00 ? 512  PHE A O     1 
ATOM   4011  C  CB    . PHE A  1  512  ? 206.825 166.275 176.887 1.00 0.00 ? 512  PHE A CB    1 
ATOM   4012  C  CG    . PHE A  1  512  ? 207.709 166.361 175.714 1.00 0.00 ? 512  PHE A CG    1 
ATOM   4013  C  CD1   . PHE A  1  512  ? 207.526 165.520 174.644 1.00 0.00 ? 512  PHE A CD1   1 
ATOM   4014  C  CD2   . PHE A  1  512  ? 208.708 167.299 175.659 1.00 0.00 ? 512  PHE A CD2   1 
ATOM   4015  C  CE1   . PHE A  1  512  ? 208.322 165.616 173.546 1.00 0.00 ? 512  PHE A CE1   1 
ATOM   4016  C  CE2   . PHE A  1  512  ? 209.518 167.384 174.567 1.00 0.00 ? 512  PHE A CE2   1 
ATOM   4017  C  CZ    . PHE A  1  512  ? 209.322 166.546 173.506 1.00 0.00 ? 512  PHE A CZ    1 
ATOM   4018  N  N     . ASP A  1  513  ? 205.037 165.979 178.828 1.00 0.00 ? 513  ASP A N     1 
ATOM   4019  C  CA    . ASP A  1  513  ? 204.133 165.518 179.870 1.00 0.00 ? 513  ASP A CA    1 
ATOM   4020  C  C     . ASP A  1  513  ? 203.087 164.673 179.142 1.00 0.00 ? 513  ASP A C     1 
ATOM   4021  O  O     . ASP A  1  513  ? 203.455 163.750 178.404 1.00 0.00 ? 513  ASP A O     1 
ATOM   4022  C  CB    . ASP A  1  513  ? 203.617 166.707 180.632 1.00 0.00 ? 513  ASP A CB    1 
ATOM   4023  C  CG    . ASP A  1  513  ? 202.833 166.324 181.840 1.00 0.00 ? 513  ASP A CG    1 
ATOM   4024  O  OD1   . ASP A  1  513  ? 202.659 165.113 182.073 1.00 0.00 ? 513  ASP A OD1   1 
ATOM   4025  O  OD2   . ASP A  1  513  ? 202.390 167.236 182.562 1.00 0.00 ? 513  ASP A OD2   1 
ATOM   4026  N  N     . GLY A  1  514  ? 201.806 164.989 179.239 1.00 0.00 ? 514  GLY A N     1 
ATOM   4027  C  CA    . GLY A  1  514  ? 200.835 164.179 178.533 1.00 0.00 ? 514  GLY A CA    1 
ATOM   4028  C  C     . GLY A  1  514  ? 200.129 164.801 177.341 1.00 0.00 ? 514  GLY A C     1 
ATOM   4029  O  O     . GLY A  1  514  ? 199.151 164.222 176.862 1.00 0.00 ? 514  GLY A O     1 
ATOM   4030  N  N     . ASP A  1  515  ? 200.568 165.960 176.861 1.00 0.00 ? 515  ASP A N     1 
ATOM   4031  C  CA    . ASP A  1  515  ? 199.748 166.704 175.914 1.00 0.00 ? 515  ASP A CA    1 
ATOM   4032  C  C     . ASP A  1  515  ? 199.610 165.967 174.589 1.00 0.00 ? 515  ASP A C     1 
ATOM   4033  O  O     . ASP A  1  515  ? 200.395 165.075 174.265 1.00 0.00 ? 515  ASP A O     1 
ATOM   4034  C  CB    . ASP A  1  515  ? 200.316 168.098 175.679 1.00 0.00 ? 515  ASP A CB    1 
ATOM   4035  C  CG    . ASP A  1  515  ? 200.124 169.014 176.876 1.00 0.00 ? 515  ASP A CG    1 
ATOM   4036  O  OD1   . ASP A  1  515  ? 199.456 168.606 177.849 1.00 0.00 ? 515  ASP A OD1   1 
ATOM   4037  O  OD2   . ASP A  1  515  ? 200.587 170.168 176.828 1.00 0.00 ? 515  ASP A OD2   1 
ATOM   4038  N  N     . GLU A  1  516  ? 198.590 166.347 173.823 1.00 0.00 ? 516  GLU A N     1 
ATOM   4039  C  CA    . GLU A  1  516  ? 198.189 165.654 172.603 1.00 0.00 ? 516  GLU A CA    1 
ATOM   4040  C  C     . GLU A  1  516  ? 198.427 166.568 171.416 1.00 0.00 ? 516  GLU A C     1 
ATOM   4041  O  O     . GLU A  1  516  ? 198.480 167.789 171.565 1.00 0.00 ? 516  GLU A O     1 
ATOM   4042  C  CB    . GLU A  1  516  ? 196.720 165.251 172.650 1.00 0.00 ? 516  GLU A CB    1 
ATOM   4043  C  CG    . GLU A  1  516  ? 196.369 164.198 173.662 1.00 0.00 ? 516  GLU A CG    1 
ATOM   4044  C  CD    . GLU A  1  516  ? 194.873 163.987 173.748 1.00 0.00 ? 516  GLU A CD    1 
ATOM   4045  O  OE1   . GLU A  1  516  ? 194.132 164.763 173.124 1.00 0.00 ? 516  GLU A OE1   1 
ATOM   4046  O  OE2   . GLU A  1  516  ? 194.428 163.072 174.462 1.00 0.00 ? 516  GLU A OE2   1 
ATOM   4047  N  N     . MET A  1  517  ? 198.540 165.980 170.241 1.00 0.00 ? 517  MET A N     1 
ATOM   4048  C  CA    . MET A  1  517  ? 198.819 166.724 169.034 1.00 0.00 ? 517  MET A CA    1 
ATOM   4049  C  C     . MET A  1  517  ? 197.741 166.472 167.994 1.00 0.00 ? 517  MET A C     1 
ATOM   4050  O  O     . MET A  1  517  ? 196.720 165.842 168.255 1.00 0.00 ? 517  MET A O     1 
ATOM   4051  C  CB    . MET A  1  517  ? 200.175 166.329 168.487 1.00 0.00 ? 517  MET A CB    1 
ATOM   4052  C  CG    . MET A  1  517  ? 201.319 166.781 169.310 1.00 0.00 ? 517  MET A CG    1 
ATOM   4053  S  SD    . MET A  1  517  ? 201.436 168.547 169.142 1.00 0.00 ? 517  MET A SD    1 
ATOM   4054  C  CE    . MET A  1  517  ? 202.967 168.868 169.968 1.00 0.00 ? 517  MET A CE    1 
ATOM   4055  N  N     . ASN A  1  518  ? 197.951 167.010 166.807 1.00 0.00 ? 518  ASN A N     1 
ATOM   4056  C  CA    . ASN A  1  518  ? 197.143 166.692 165.654 1.00 0.00 ? 518  ASN A CA    1 
ATOM   4057  C  C     . ASN A  1  518  ? 198.054 166.610 164.445 1.00 0.00 ? 518  ASN A C     1 
ATOM   4058  O  O     . ASN A  1  518  ? 198.830 167.524 164.164 1.00 0.00 ? 518  ASN A O     1 
ATOM   4059  C  CB    . ASN A  1  518  ? 196.039 167.723 165.438 1.00 0.00 ? 518  ASN A CB    1 
ATOM   4060  C  CG    . ASN A  1  518  ? 195.070 167.773 166.582 1.00 0.00 ? 518  ASN A CG    1 
ATOM   4061  O  OD1   . ASN A  1  518  ? 194.662 168.846 167.016 1.00 0.00 ? 518  ASN A OD1   1 
ATOM   4062  N  ND2   . ASN A  1  518  ? 194.724 166.611 167.111 1.00 0.00 ? 518  ASN A ND2   1 
ATOM   4063  N  N     . LEU A  1  519  ? 197.945 165.508 163.719 1.00 0.00 ? 519  LEU A N     1 
ATOM   4064  C  CA    . LEU A  1  519  ? 198.786 165.279 162.557 1.00 0.00 ? 519  LEU A CA    1 
ATOM   4065  C  C     . LEU A  1  519  ? 197.899 165.399 161.334 1.00 0.00 ? 519  LEU A C     1 
ATOM   4066  O  O     . LEU A  1  519  ? 196.977 164.600 161.175 1.00 0.00 ? 519  LEU A O     1 
ATOM   4067  C  CB    . LEU A  1  519  ? 199.410 163.905 162.628 1.00 0.00 ? 519  LEU A CB    1 
ATOM   4068  C  CG    . LEU A  1  519  ? 200.442 163.611 161.562 1.00 0.00 ? 519  LEU A CG    1 
ATOM   4069  C  CD1   . LEU A  1  519  ? 201.613 164.479 161.860 1.00 0.00 ? 519  LEU A CD1   1 
ATOM   4070  C  CD2   . LEU A  1  519  ? 200.845 162.172 161.603 1.00 0.00 ? 519  LEU A CD2   1 
ATOM   4071  N  N     . HIS A  1  520  ? 198.151 166.384 160.484 1.00 0.00 ? 520  HIS A N     1 
ATOM   4072  C  CA    . HIS A  1  520  ? 197.367 166.578 159.274 1.00 0.00 ? 520  HIS A CA    1 
ATOM   4073  C  C     . HIS A  1  520  ? 198.237 166.380 158.046 1.00 0.00 ? 520  HIS A C     1 
ATOM   4074  O  O     . HIS A  1  520  ? 199.172 167.150 157.819 1.00 0.00 ? 520  HIS A O     1 
ATOM   4075  C  CB    . HIS A  1  520  ? 196.794 167.982 159.189 1.00 0.00 ? 520  HIS A CB    1 
ATOM   4076  C  CG    . HIS A  1  520  ? 195.872 168.344 160.304 1.00 0.00 ? 520  HIS A CG    1 
ATOM   4077  N  ND1   . HIS A  1  520  ? 195.499 169.646 160.556 1.00 0.00 ? 520  HIS A ND1   1 
ATOM   4078  C  CD2   . HIS A  1  520  ? 195.240 167.586 161.225 1.00 0.00 ? 520  HIS A CD2   1 
ATOM   4079  C  CE1   . HIS A  1  520  ? 194.683 169.675 161.591 1.00 0.00 ? 520  HIS A CE1   1 
ATOM   4080  N  NE2   . HIS A  1  520  ? 194.507 168.439 162.013 1.00 0.00 ? 520  HIS A NE2   1 
ATOM   4081  N  N     . VAL A  1  521  ? 197.925 165.374 157.238 1.00 0.00 ? 521  VAL A N     1 
ATOM   4082  C  CA    . VAL A  1  521  ? 198.480 165.329 155.891 1.00 0.00 ? 521  VAL A CA    1 
ATOM   4083  C  C     . VAL A  1  521  ? 197.657 166.274 155.035 1.00 0.00 ? 521  VAL A C     1 
ATOM   4084  O  O     . VAL A  1  521  ? 196.465 166.461 155.306 1.00 0.00 ? 521  VAL A O     1 
ATOM   4085  C  CB    . VAL A  1  521  ? 198.464 163.916 155.307 1.00 0.00 ? 521  VAL A CB    1 
ATOM   4086  C  CG1   . VAL A  1  521  ? 199.420 163.024 156.051 1.00 0.00 ? 521  VAL A CG1   1 
ATOM   4087  C  CG2   . VAL A  1  521  ? 197.081 163.368 155.396 1.00 0.00 ? 521  VAL A CG2   1 
ATOM   4088  N  N     . PRO A  1  522  ? 198.233 166.916 154.042 1.00 0.00 ? 522  PRO A N     1 
ATOM   4089  C  CA    . PRO A  1  522  ? 197.395 167.567 153.037 1.00 0.00 ? 522  PRO A CA    1 
ATOM   4090  C  C     . PRO A  1  522  ? 196.901 166.519 152.067 1.00 0.00 ? 522  PRO A C     1 
ATOM   4091  O  O     . PRO A  1  522  ? 197.110 165.326 152.293 1.00 0.00 ? 522  PRO A O     1 
ATOM   4092  C  CB    . PRO A  1  522  ? 198.350 168.556 152.366 1.00 0.00 ? 522  PRO A CB    1 
ATOM   4093  C  CG    . PRO A  1  522  ? 199.427 168.743 153.351 1.00 0.00 ? 522  PRO A CG    1 
ATOM   4094  C  CD    . PRO A  1  522  ? 199.612 167.401 153.965 1.00 0.00 ? 522  PRO A CD    1 
ATOM   4095  N  N     . GLN A  1  523  ? 196.264 166.935 150.984 1.00 0.00 ? 523  GLN A N     1 
ATOM   4096  C  CA    . GLN A  1  523  ? 195.855 165.973 149.978 1.00 0.00 ? 523  GLN A CA    1 
ATOM   4097  C  C     . GLN A  1  523  ? 196.358 166.382 148.606 1.00 0.00 ? 523  GLN A C     1 
ATOM   4098  O  O     . GLN A  1  523  ? 197.226 165.722 148.034 1.00 0.00 ? 523  GLN A O     1 
ATOM   4099  C  CB    . GLN A  1  523  ? 194.340 165.826 149.961 1.00 0.00 ? 523  GLN A CB    1 
ATOM   4100  C  CG    . GLN A  1  523  ? 193.775 165.206 151.205 1.00 0.00 ? 523  GLN A CG    1 
ATOM   4101  C  CD    . GLN A  1  523  ? 194.225 163.786 151.381 1.00 0.00 ? 523  GLN A CD    1 
ATOM   4102  O  OE1   . GLN A  1  523  ? 195.065 163.486 152.216 1.00 0.00 ? 523  GLN A OE1   1 
ATOM   4103  N  NE2   . GLN A  1  523  ? 193.677 162.898 150.575 1.00 0.00 ? 523  GLN A NE2   1 
ATOM   4104  N  N     . THR A  1  524  ? 195.827 167.476 148.078 1.00 0.00 ? 524  THR A N     1 
ATOM   4105  C  CA    . THR A  1  524  ? 196.113 167.842 146.704 1.00 0.00 ? 524  THR A CA    1 
ATOM   4106  C  C     . THR A  1  524  ? 197.577 168.230 146.531 1.00 0.00 ? 524  THR A C     1 
ATOM   4107  O  O     . THR A  1  524  ? 198.207 168.812 147.416 1.00 0.00 ? 524  THR A O     1 
ATOM   4108  C  CB    . THR A  1  524  ? 195.203 168.981 146.259 1.00 0.00 ? 524  THR A CB    1 
ATOM   4109  O  OG1   . THR A  1  524  ? 195.421 169.252 144.870 1.00 0.00 ? 524  THR A OG1   1 
ATOM   4110  C  CG2   . THR A  1  524  ? 195.473 170.232 147.064 1.00 0.00 ? 524  THR A CG2   1 
ATOM   4111  N  N     . GLU A  1  525  ? 198.112 167.898 145.356 1.00 0.00 ? 525  GLU A N     1 
ATOM   4112  C  CA    . GLU A  1  525  ? 199.541 168.026 145.099 1.00 0.00 ? 525  GLU A CA    1 
ATOM   4113  C  C     . GLU A  1  525  ? 200.075 169.421 145.355 1.00 0.00 ? 525  GLU A C     1 
ATOM   4114  O  O     . GLU A  1  525  ? 201.248 169.557 145.704 1.00 0.00 ? 525  GLU A O     1 
ATOM   4115  C  CB    . GLU A  1  525  ? 199.853 167.631 143.661 1.00 0.00 ? 525  GLU A CB    1 
ATOM   4116  C  CG    . GLU A  1  525  ? 199.721 166.150 143.377 1.00 0.00 ? 525  GLU A CG    1 
ATOM   4117  C  CD    . GLU A  1  525  ? 200.685 165.338 144.202 1.00 0.00 ? 525  GLU A CD    1 
ATOM   4118  O  OE1   . GLU A  1  525  ? 201.810 165.823 144.436 1.00 0.00 ? 525  GLU A OE1   1 
ATOM   4119  O  OE2   . GLU A  1  525  ? 200.334 164.216 144.617 1.00 0.00 ? 525  GLU A OE2   1 
ATOM   4120  N  N     . GLU A  1  526  ? 199.258 170.456 145.185 1.00 0.00 ? 526  GLU A N     1 
ATOM   4121  C  CA    . GLU A  1  526  ? 199.761 171.810 145.357 1.00 0.00 ? 526  GLU A CA    1 
ATOM   4122  C  C     . GLU A  1  526  ? 199.599 172.329 146.774 1.00 0.00 ? 526  GLU A C     1 
ATOM   4123  O  O     . GLU A  1  526  ? 200.157 173.378 147.097 1.00 0.00 ? 526  GLU A O     1 
ATOM   4124  C  CB    . GLU A  1  526  ? 199.070 172.768 144.397 1.00 0.00 ? 526  GLU A CB    1 
ATOM   4125  C  CG    . GLU A  1  526  ? 197.599 172.916 144.651 1.00 0.00 ? 526  GLU A CG    1 
ATOM   4126  C  CD    . GLU A  1  526  ? 196.927 173.785 143.618 1.00 0.00 ? 526  GLU A CD    1 
ATOM   4127  O  OE1   . GLU A  1  526  ? 197.645 174.520 142.912 1.00 0.00 ? 526  GLU A OE1   1 
ATOM   4128  O  OE2   . GLU A  1  526  ? 195.684 173.737 143.511 1.00 0.00 ? 526  GLU A OE2   1 
ATOM   4129  N  N     . ALA A  1  527  ? 198.853 171.632 147.629 1.00 0.00 ? 527  ALA A N     1 
ATOM   4130  C  CA    . ALA A  1  527  ? 198.812 172.050 149.023 1.00 0.00 ? 527  ALA A CA    1 
ATOM   4131  C  C     . ALA A  1  527  ? 200.079 171.633 149.753 1.00 0.00 ? 527  ALA A C     1 
ATOM   4132  O  O     . ALA A  1  527  ? 200.557 172.354 150.632 1.00 0.00 ? 527  ALA A O     1 
ATOM   4133  C  CB    . ALA A  1  527  ? 197.584 171.482 149.719 1.00 0.00 ? 527  ALA A CB    1 
ATOM   4134  N  N     . ARG A  1  528  ? 200.625 170.467 149.409 1.00 0.00 ? 528  ARG A N     1 
ATOM   4135  C  CA    . ARG A  1  528  ? 201.950 170.098 149.890 1.00 0.00 ? 528  ARG A CA    1 
ATOM   4136  C  C     . ARG A  1  528  ? 202.953 171.207 149.651 1.00 0.00 ? 528  ARG A C     1 
ATOM   4137  O  O     . ARG A  1  528  ? 203.400 171.856 150.602 1.00 0.00 ? 528  ARG A O     1 
ATOM   4138  C  CB    . ARG A  1  528  ? 202.426 168.815 149.223 1.00 0.00 ? 528  ARG A CB    1 
ATOM   4139  C  CG    . ARG A  1  528  ? 201.722 167.613 149.736 1.00 0.00 ? 528  ARG A CG    1 
ATOM   4140  C  CD    . ARG A  1  528  ? 202.144 166.362 149.027 1.00 0.00 ? 528  ARG A CD    1 
ATOM   4141  N  NE    . ARG A  1  528  ? 203.545 166.056 149.229 1.00 0.00 ? 528  ARG A NE    1 
ATOM   4142  C  CZ    . ARG A  1  528  ? 204.444 166.057 148.262 1.00 0.00 ? 528  ARG A CZ    1 
ATOM   4143  N  NH1   . ARG A  1  528  ? 204.069 166.328 147.033 1.00 0.00 ? 528  ARG A NH1   1 
ATOM   4144  N  NH2   . ARG A  1  528  ? 205.702 165.756 148.527 1.00 0.00 ? 528  ARG A NH2   1 
ATOM   4145  N  N     . ALA A  1  529  ? 203.302 171.457 148.394 1.00 0.00 ? 529  ALA A N     1 
ATOM   4146  C  CA    . ALA A  1  529  ? 204.289 172.481 148.097 1.00 0.00 ? 529  ALA A CA    1 
ATOM   4147  C  C     . ALA A  1  529  ? 203.942 173.814 148.720 1.00 0.00 ? 529  ALA A C     1 
ATOM   4148  O  O     . ALA A  1  529  ? 204.835 174.628 148.953 1.00 0.00 ? 529  ALA A O     1 
ATOM   4149  C  CB    . ALA A  1  529  ? 204.442 172.647 146.586 1.00 0.00 ? 529  ALA A CB    1 
ATOM   4150  N  N     . GLU A  1  530  ? 202.677 174.055 149.001 1.00 0.00 ? 530  GLU A N     1 
ATOM   4151  C  CA    . GLU A  1  530  ? 202.318 175.169 149.850 1.00 0.00 ? 530  GLU A CA    1 
ATOM   4152  C  C     . GLU A  1  530  ? 202.801 174.997 151.279 1.00 0.00 ? 530  GLU A C     1 
ATOM   4153  O  O     . GLU A  1  530  ? 203.196 175.984 151.901 1.00 0.00 ? 530  GLU A O     1 
ATOM   4154  C  CB    . GLU A  1  530  ? 200.807 175.360 149.855 1.00 0.00 ? 530  GLU A CB    1 
ATOM   4155  C  CG    . GLU A  1  530  ? 200.336 176.533 150.671 1.00 0.00 ? 530  GLU A CG    1 
ATOM   4156  C  CD    . GLU A  1  530  ? 200.665 177.856 150.036 1.00 0.00 ? 530  GLU A CD    1 
ATOM   4157  O  OE1   . GLU A  1  530  ? 200.956 177.881 148.825 1.00 0.00 ? 530  GLU A OE1   1 
ATOM   4158  O  OE2   . GLU A  1  530  ? 200.644 178.876 150.749 1.00 0.00 ? 530  GLU A OE2   1 
ATOM   4159  N  N     . ALA A  1  531  ? 202.817 173.776 151.807 1.00 0.00 ? 531  ALA A N     1 
ATOM   4160  C  CA    . ALA A  1  531  ? 203.098 173.565 153.220 1.00 0.00 ? 531  ALA A CA    1 
ATOM   4161  C  C     . ALA A  1  531  ? 204.596 173.624 153.487 1.00 0.00 ? 531  ALA A C     1 
ATOM   4162  O  O     . ALA A  1  531  ? 205.076 174.635 154.000 1.00 0.00 ? 531  ALA A O     1 
ATOM   4163  C  CB    . ALA A  1  531  ? 202.507 172.241 153.696 1.00 0.00 ? 531  ALA A CB    1 
ATOM   4164  N  N     . ILE A  1  532  ? 205.361 172.593 153.117 1.00 0.00 ? 532  ILE A N     1 
ATOM   4165  C  CA    . ILE A  1  532  ? 206.764 172.579 153.514 1.00 0.00 ? 532  ILE A CA    1 
ATOM   4166  C  C     . ILE A  1  532  ? 207.492 173.819 153.030 1.00 0.00 ? 532  ILE A C     1 
ATOM   4167  O  O     . ILE A  1  532  ? 208.284 174.407 153.773 1.00 0.00 ? 532  ILE A O     1 
ATOM   4168  C  CB    . ILE A  1  532  ? 207.490 171.313 153.042 1.00 0.00 ? 532  ILE A CB    1 
ATOM   4169  C  CG1   . ILE A  1  532  ? 208.929 171.371 153.538 1.00 0.00 ? 532  ILE A CG1   1 
ATOM   4170  C  CG2   . ILE A  1  532  ? 207.488 171.212 151.545 1.00 0.00 ? 532  ILE A CG2   1 
ATOM   4171  C  CD1   . ILE A  1  532  ? 209.062 171.401 155.032 1.00 0.00 ? 532  ILE A CD1   1 
ATOM   4172  N  N     . ASN A  1  533  ? 207.225 174.266 151.812 1.00 0.00 ? 533  ASN A N     1 
ATOM   4173  C  CA    . ASN A  1  533  ? 207.951 175.415 151.302 1.00 0.00 ? 533  ASN A CA    1 
ATOM   4174  C  C     . ASN A  1  533  ? 207.648 176.701 152.043 1.00 0.00 ? 533  ASN A C     1 
ATOM   4175  O  O     . ASN A  1  533  ? 208.579 177.362 152.506 1.00 0.00 ? 533  ASN A O     1 
ATOM   4176  C  CB    . ASN A  1  533  ? 207.667 175.632 149.827 1.00 0.00 ? 533  ASN A CB    1 
ATOM   4177  C  CG    . ASN A  1  533  ? 208.491 176.748 149.262 1.00 0.00 ? 533  ASN A CG    1 
ATOM   4178  O  OD1   . ASN A  1  533  ? 209.586 177.023 149.743 1.00 0.00 ? 533  ASN A OD1   1 
ATOM   4179  N  ND2   . ASN A  1  533  ? 207.968 177.417 148.247 1.00 0.00 ? 533  ASN A ND2   1 
ATOM   4180  N  N     . LEU A  1  534  ? 206.385 177.075 152.161 1.00 0.00 ? 534  LEU A N     1 
ATOM   4181  C  CA    . LEU A  1  534  ? 206.014 178.291 152.868 1.00 0.00 ? 534  LEU A CA    1 
ATOM   4182  C  C     . LEU A  1  534  ? 205.891 178.058 154.363 1.00 0.00 ? 534  LEU A C     1 
ATOM   4183  O  O     . LEU A  1  534  ? 206.625 178.673 155.140 1.00 0.00 ? 534  LEU A O     1 
ATOM   4184  C  CB    . LEU A  1  534  ? 204.709 178.851 152.300 1.00 0.00 ? 534  LEU A CB    1 
ATOM   4185  C  CG    . LEU A  1  534  ? 204.139 179.975 153.136 1.00 0.00 ? 534  LEU A CG    1 
ATOM   4186  C  CD1   . LEU A  1  534  ? 205.165 181.058 153.267 1.00 0.00 ? 534  LEU A CD1   1 
ATOM   4187  C  CD2   . LEU A  1  534  ? 202.928 180.488 152.424 1.00 0.00 ? 534  LEU A CD2   1 
ATOM   4188  N  N     . MET A  1  535  ? 204.989 177.193 154.780 1.00 0.00 ? 535  MET A N     1 
ATOM   4189  C  CA    . MET A  1  535  ? 204.588 177.041 156.164 1.00 0.00 ? 535  MET A CA    1 
ATOM   4190  C  C     . MET A  1  535  ? 205.528 176.136 156.941 1.00 0.00 ? 535  MET A C     1 
ATOM   4191  O  O     . MET A  1  535  ? 205.315 175.877 158.126 1.00 0.00 ? 535  MET A O     1 
ATOM   4192  C  CB    . MET A  1  535  ? 203.149 176.519 156.188 1.00 0.00 ? 535  MET A CB    1 
ATOM   4193  C  CG    . MET A  1  535  ? 202.452 176.510 157.504 1.00 0.00 ? 535  MET A CG    1 
ATOM   4194  S  SD    . MET A  1  535  ? 200.771 175.982 157.207 1.00 0.00 ? 535  MET A SD    1 
ATOM   4195  C  CE    . MET A  1  535  ? 200.093 177.498 156.579 1.00 0.00 ? 535  MET A CE    1 
ATOM   4196  N  N     . GLY A  1  536  ? 206.591 175.667 156.306 1.00 0.00 ? 536  GLY A N     1 
ATOM   4197  C  CA    . GLY A  1  536  ? 207.496 174.728 156.932 1.00 0.00 ? 536  GLY A CA    1 
ATOM   4198  C  C     . GLY A  1  536  ? 208.262 175.338 158.083 1.00 0.00 ? 536  GLY A C     1 
ATOM   4199  O  O     . GLY A  1  536  ? 208.089 176.496 158.457 1.00 0.00 ? 536  GLY A O     1 
ATOM   4200  N  N     . VAL A  1  537  ? 209.143 174.526 158.655 1.00 0.00 ? 537  VAL A N     1 
ATOM   4201  C  CA    . VAL A  1  537  ? 209.917 174.969 159.803 1.00 0.00 ? 537  VAL A CA    1 
ATOM   4202  C  C     . VAL A  1  537  ? 211.031 175.909 159.387 1.00 0.00 ? 537  VAL A C     1 
ATOM   4203  O  O     . VAL A  1  537  ? 211.040 177.074 159.790 1.00 0.00 ? 537  VAL A O     1 
ATOM   4204  C  CB    . VAL A  1  537  ? 210.468 173.774 160.585 1.00 0.00 ? 537  VAL A CB    1 
ATOM   4205  C  CG1   . VAL A  1  537  ? 211.342 174.277 161.689 1.00 0.00 ? 537  VAL A CG1   1 
ATOM   4206  C  CG2   . VAL A  1  537  ? 209.346 173.008 161.171 1.00 0.00 ? 537  VAL A CG2   1 
ATOM   4207  N  N     . LYS A  1  538  ? 211.967 175.417 158.576 1.00 0.00 ? 538  LYS A N     1 
ATOM   4208  C  CA    . LYS A  1  538  ? 213.168 176.181 158.270 1.00 0.00 ? 538  LYS A CA    1 
ATOM   4209  C  C     . LYS A  1  538  ? 213.060 177.670 157.974 1.00 0.00 ? 538  LYS A C     1 
ATOM   4210  O  O     . LYS A  1  538  ? 213.882 178.460 158.446 1.00 0.00 ? 538  LYS A O     1 
ATOM   4211  C  CB    . LYS A  1  538  ? 213.967 175.477 157.182 1.00 0.00 ? 538  LYS A CB    1 
ATOM   4212  C  CG    . LYS A  1  538  ? 214.603 174.198 157.661 1.00 0.00 ? 538  LYS A CG    1 
ATOM   4213  C  CD    . LYS A  1  538  ? 215.444 173.562 156.580 1.00 0.00 ? 538  LYS A CD    1 
ATOM   4214  C  CE    . LYS A  1  538  ? 214.588 173.177 155.410 1.00 0.00 ? 538  LYS A CE    1 
ATOM   4215  N  NZ    . LYS A  1  538  ? 213.567 172.193 155.818 1.00 0.00 ? 538  LYS A NZ    1 
ATOM   4216  N  N     . ASN A  1  539  ? 212.083 178.031 157.144 1.00 0.00 ? 539  ASN A N     1 
ATOM   4217  C  CA    . ASN A  1  539  ? 211.861 179.418 156.747 1.00 0.00 ? 539  ASN A CA    1 
ATOM   4218  C  C     . ASN A  1  539  ? 211.085 180.191 157.801 1.00 0.00 ? 539  ASN A C     1 
ATOM   4219  O  O     . ASN A  1  539  ? 211.124 181.421 157.842 1.00 0.00 ? 539  ASN A O     1 
ATOM   4220  C  CB    . ASN A  1  539  ? 211.132 179.481 155.404 1.00 0.00 ? 539  ASN A CB    1 
ATOM   4221  C  CG    . ASN A  1  539  ? 212.079 179.410 154.223 1.00 0.00 ? 539  ASN A CG    1 
ATOM   4222  O  OD1   . ASN A  1  539  ? 213.293 179.549 154.376 1.00 0.00 ? 539  ASN A OD1   1 
ATOM   4223  N  ND2   . ASN A  1  539  ? 211.528 179.192 153.034 1.00 0.00 ? 539  ASN A ND2   1 
ATOM   4224  N  N     . ASN A  1  540  ? 210.380 179.457 158.654 1.00 0.00 ? 540  ASN A N     1 
ATOM   4225  C  CA    . ASN A  1  540  ? 209.606 180.057 159.732 1.00 0.00 ? 540  ASN A CA    1 
ATOM   4226  C  C     . ASN A  1  540  ? 210.356 179.926 161.053 1.00 0.00 ? 540  ASN A C     1 
ATOM   4227  O  O     . ASN A  1  540  ? 209.771 180.048 162.129 1.00 0.00 ? 540  ASN A O     1 
ATOM   4228  C  CB    . ASN A  1  540  ? 208.229 179.401 159.837 1.00 0.00 ? 540  ASN A CB    1 
ATOM   4229  C  CG    . ASN A  1  540  ? 207.238 179.962 158.837 1.00 0.00 ? 540  ASN A CG    1 
ATOM   4230  O  OD1   . ASN A  1  540  ? 206.848 181.127 158.919 1.00 0.00 ? 540  ASN A OD1   1 
ATOM   4231  N  ND2   . ASN A  1  540  ? 206.825 179.134 157.884 1.00 0.00 ? 540  ASN A ND2   1 
ATOM   4232  N  N     . LEU A  1  541  ? 211.658 179.673 160.952 1.00 0.00 ? 541  LEU A N     1 
ATOM   4233  C  CA    . LEU A  1  541  ? 212.517 179.516 162.114 1.00 0.00 ? 541  LEU A CA    1 
ATOM   4234  C  C     . LEU A  1  541  ? 212.371 180.684 163.078 1.00 0.00 ? 541  LEU A C     1 
ATOM   4235  O  O     . LEU A  1  541  ? 212.551 180.521 164.285 1.00 0.00 ? 541  LEU A O     1 
ATOM   4236  C  CB    . LEU A  1  541  ? 213.979 179.373 161.683 1.00 0.00 ? 541  LEU A CB    1 
ATOM   4237  C  CG    . LEU A  1  541  ? 214.934 178.771 162.715 1.00 0.00 ? 541  LEU A CG    1 
ATOM   4238  C  CD1   . LEU A  1  541  ? 216.007 177.937 162.033 1.00 0.00 ? 541  LEU A CD1   1 
ATOM   4239  C  CD2   . LEU A  1  541  ? 215.559 179.862 163.571 1.00 0.00 ? 541  LEU A CD2   1 
ATOM   4240  N  N     . LEU A  1  542  ? 212.044 181.863 162.555 1.00 0.00 ? 542  LEU A N     1 
ATOM   4241  C  CA    . LEU A  1  542  ? 211.888 183.013 163.433 1.00 0.00 ? 542  LEU A CA    1 
ATOM   4242  C  C     . LEU A  1  542  ? 210.462 183.122 163.953 1.00 0.00 ? 542  LEU A C     1 
ATOM   4243  O  O     . LEU A  1  542  ? 209.646 182.209 163.826 1.00 0.00 ? 542  LEU A O     1 
ATOM   4244  C  CB    . LEU A  1  542  ? 212.274 184.298 162.730 1.00 0.00 ? 542  LEU A CB    1 
ATOM   4245  C  CG    . LEU A  1  542  ? 213.719 184.715 162.884 1.00 0.00 ? 542  LEU A CG    1 
ATOM   4246  C  CD1   . LEU A  1  542  ? 214.590 183.764 162.151 1.00 0.00 ? 542  LEU A CD1   1 
ATOM   4247  C  CD2   . LEU A  1  542  ? 213.881 186.103 162.349 1.00 0.00 ? 542  LEU A CD2   1 
ATOM   4248  N  N     . THR A  1  543  ? 210.151 184.258 164.551 1.00 0.00 ? 543  THR A N     1 
ATOM   4249  C  CA    . THR A  1  543  ? 208.834 184.558 165.060 1.00 0.00 ? 543  THR A CA    1 
ATOM   4250  C  C     . THR A  1  543  ? 208.218 185.667 164.233 1.00 0.00 ? 543  THR A C     1 
ATOM   4251  O  O     . THR A  1  543  ? 208.946 186.498 163.684 1.00 0.00 ? 543  THR A O     1 
ATOM   4252  C  CB    . THR A  1  543  ? 208.884 185.004 166.524 1.00 0.00 ? 543  THR A CB    1 
ATOM   4253  O  OG1   . THR A  1  543  ? 207.559 185.070 167.049 1.00 0.00 ? 543  THR A OG1   1 
ATOM   4254  C  CG2   . THR A  1  543  ? 209.507 186.379 166.637 1.00 0.00 ? 543  THR A CG2   1 
ATOM   4255  N  N     . PRO A  1  544  ? 206.896 185.714 164.097 1.00 0.00 ? 544  PRO A N     1 
ATOM   4256  C  CA    . PRO A  1  544  ? 206.270 186.795 163.341 1.00 0.00 ? 544  PRO A CA    1 
ATOM   4257  C  C     . PRO A  1  544  ? 206.368 188.164 163.989 1.00 0.00 ? 544  PRO A C     1 
ATOM   4258  O  O     . PRO A  1  544  ? 206.615 189.138 163.277 1.00 0.00 ? 544  PRO A O     1 
ATOM   4259  C  CB    . PRO A  1  544  ? 204.807 186.341 163.257 1.00 0.00 ? 544  PRO A CB    1 
ATOM   4260  C  CG    . PRO A  1  544  ? 204.619 185.479 164.434 1.00 0.00 ? 544  PRO A CG    1 
ATOM   4261  C  CD    . PRO A  1  544  ? 205.908 184.736 164.566 1.00 0.00 ? 544  PRO A CD    1 
ATOM   4262  N  N     . LYS A  1  545  ? 206.181 188.284 165.302 1.00 0.00 ? 545  LYS A N     1 
ATOM   4263  C  CA    . LYS A  1  545  ? 206.077 189.596 165.918 1.00 0.00 ? 545  LYS A CA    1 
ATOM   4264  C  C     . LYS A  1  545  ? 207.407 190.287 166.161 1.00 0.00 ? 545  LYS A C     1 
ATOM   4265  O  O     . LYS A  1  545  ? 207.535 191.469 165.832 1.00 0.00 ? 545  LYS A O     1 
ATOM   4266  C  CB    . LYS A  1  545  ? 205.325 189.508 167.254 1.00 0.00 ? 545  LYS A CB    1 
ATOM   4267  C  CG    . LYS A  1  545  ? 205.999 188.664 168.315 1.00 0.00 ? 545  LYS A CG    1 
ATOM   4268  C  CD    . LYS A  1  545  ? 205.194 188.616 169.592 1.00 0.00 ? 545  LYS A CD    1 
ATOM   4269  C  CE    . LYS A  1  545  ? 205.855 187.704 170.606 1.00 0.00 ? 545  LYS A CE    1 
ATOM   4270  N  NZ    . LYS A  1  545  ? 205.053 187.618 171.853 1.00 0.00 ? 545  LYS A NZ    1 
ATOM   4271  N  N     . SER A  1  546  ? 208.380 189.605 166.747 1.00 0.00 ? 546  SER A N     1 
ATOM   4272  C  CA    . SER A  1  546  ? 209.568 190.294 167.214 1.00 0.00 ? 546  SER A CA    1 
ATOM   4273  C  C     . SER A  1  546  ? 210.749 190.145 166.273 1.00 0.00 ? 546  SER A C     1 
ATOM   4274  O  O     . SER A  1  546  ? 211.787 190.775 166.477 1.00 0.00 ? 546  SER A O     1 
ATOM   4275  C  CB    . SER A  1  546  ? 209.930 189.784 168.598 1.00 0.00 ? 546  SER A CB    1 
ATOM   4276  O  OG    . SER A  1  546  ? 208.873 190.056 169.495 1.00 0.00 ? 546  SER A OG    1 
ATOM   4277  N  N     . GLY A  1  547  ? 210.598 189.346 165.229 1.00 0.00 ? 547  GLY A N     1 
ATOM   4278  C  CA    . GLY A  1  547  ? 211.740 189.018 164.405 1.00 0.00 ? 547  GLY A CA    1 
ATOM   4279  C  C     . GLY A  1  547  ? 212.860 188.474 165.258 1.00 0.00 ? 547  GLY A C     1 
ATOM   4280  O  O     . GLY A  1  547  ? 213.996 188.945 165.205 1.00 0.00 ? 547  GLY A O     1 
ATOM   4281  N  N     . GLU A  1  548  ? 212.528 187.485 166.070 1.00 0.00 ? 548  GLU A N     1 
ATOM   4282  C  CA    . GLU A  1  548  ? 213.368 186.974 167.123 1.00 0.00 ? 548  GLU A CA    1 
ATOM   4283  C  C     . GLU A  1  548  ? 213.347 185.454 167.091 1.00 0.00 ? 548  GLU A C     1 
ATOM   4284  O  O     . GLU A  1  548  ? 212.281 184.870 166.888 1.00 0.00 ? 548  GLU A O     1 
ATOM   4285  C  CB    . GLU A  1  548  ? 212.819 187.498 168.448 1.00 0.00 ? 548  GLU A CB    1 
ATOM   4286  C  CG    . GLU A  1  548  ? 213.531 187.118 169.705 1.00 0.00 ? 548  GLU A CG    1 
ATOM   4287  C  CD    . GLU A  1  548  ? 212.891 187.790 170.901 1.00 0.00 ? 548  GLU A CD    1 
ATOM   4288  O  OE1   . GLU A  1  548  ? 211.924 188.547 170.700 1.00 0.00 ? 548  GLU A OE1   1 
ATOM   4289  O  OE2   . GLU A  1  548  ? 213.335 187.561 172.038 1.00 0.00 ? 548  GLU A OE2   1 
ATOM   4290  N  N     . PRO A  1  549  ? 214.474 184.786 167.278 1.00 0.00 ? 549  PRO A N     1 
ATOM   4291  C  CA    . PRO A  1  549  ? 214.469 183.331 167.107 1.00 0.00 ? 549  PRO A CA    1 
ATOM   4292  C  C     . PRO A  1  549  ? 213.558 182.671 168.118 1.00 0.00 ? 549  PRO A C     1 
ATOM   4293  O  O     . PRO A  1  549  ? 213.710 182.888 169.320 1.00 0.00 ? 549  PRO A O     1 
ATOM   4294  C  CB    . PRO A  1  549  ? 215.934 182.950 167.329 1.00 0.00 ? 549  PRO A CB    1 
ATOM   4295  C  CG    . PRO A  1  549  ? 216.465 184.033 168.168 1.00 0.00 ? 549  PRO A CG    1 
ATOM   4296  C  CD    . PRO A  1  549  ? 215.797 185.276 167.681 1.00 0.00 ? 549  PRO A CD    1 
ATOM   4297  N  N     . ILE A  1  550  ? 212.588 181.889 167.647 1.00 0.00 ? 550  ILE A N     1 
ATOM   4298  C  CA    . ILE A  1  550  ? 211.721 181.204 168.592 1.00 0.00 ? 550  ILE A CA    1 
ATOM   4299  C  C     . ILE A  1  550  ? 212.060 179.722 168.709 1.00 0.00 ? 550  ILE A C     1 
ATOM   4300  O  O     . ILE A  1  550  ? 211.519 179.035 169.578 1.00 0.00 ? 550  ILE A O     1 
ATOM   4301  C  CB    . ILE A  1  550  ? 210.259 181.411 168.189 1.00 0.00 ? 550  ILE A CB    1 
ATOM   4302  C  CG1   . ILE A  1  550  ? 209.332 181.044 169.343 1.00 0.00 ? 550  ILE A CG1   1 
ATOM   4303  C  CG2   . ILE A  1  550  ? 209.965 180.547 167.006 1.00 0.00 ? 550  ILE A CG2   1 
ATOM   4304  C  CD1   . ILE A  1  550  ? 209.526 181.902 170.562 1.00 0.00 ? 550  ILE A CD1   1 
ATOM   4305  N  N     . ILE A  1  551  ? 212.953 179.187 167.883 1.00 0.00 ? 551  ILE A N     1 
ATOM   4306  C  CA    . ILE A  1  551  ? 213.368 177.799 168.035 1.00 0.00 ? 551  ILE A CA    1 
ATOM   4307  C  C     . ILE A  1  551  ? 214.863 177.764 168.299 1.00 0.00 ? 551  ILE A C     1 
ATOM   4308  O  O     . ILE A  1  551  ? 215.652 178.382 167.574 1.00 0.00 ? 551  ILE A O     1 
ATOM   4309  C  CB    . ILE A  1  551  ? 212.992 176.934 166.818 1.00 0.00 ? 551  ILE A CB    1 
ATOM   4310  C  CG1   . ILE A  1  551  ? 213.818 177.253 165.588 1.00 0.00 ? 551  ILE A CG1   1 
ATOM   4311  C  CG2   . ILE A  1  551  ? 211.568 177.162 166.440 1.00 0.00 ? 551  ILE A CG2   1 
ATOM   4312  C  CD1   . ILE A  1  551  ? 213.619 176.238 164.498 1.00 0.00 ? 551  ILE A CD1   1 
ATOM   4313  N  N     . ALA A  1  552  ? 215.247 177.070 169.361 1.00 0.00 ? 552  ALA A N     1 
ATOM   4314  C  CA    . ALA A  1  552  ? 216.644 176.977 169.749 1.00 0.00 ? 552  ALA A CA    1 
ATOM   4315  C  C     . ALA A  1  552  ? 216.820 175.900 170.802 1.00 0.00 ? 552  ALA A C     1 
ATOM   4316  O  O     . ALA A  1  552  ? 215.876 175.178 171.132 1.00 0.00 ? 552  ALA A O     1 
ATOM   4317  C  CB    . ALA A  1  552  ? 217.154 178.313 170.279 1.00 0.00 ? 552  ALA A CB    1 
ATOM   4318  N  N     . ALA A  1  553  ? 218.027 175.788 171.329 1.00 0.00 ? 553  ALA A N     1 
ATOM   4319  C  CA    . ALA A  1  553  ? 218.311 174.865 172.407 1.00 0.00 ? 553  ALA A CA    1 
ATOM   4320  C  C     . ALA A  1  553  ? 217.565 175.287 173.666 1.00 0.00 ? 553  ALA A C     1 
ATOM   4321  O  O     . ALA A  1  553  ? 217.500 176.473 173.994 1.00 0.00 ? 553  ALA A O     1 
ATOM   4322  C  CB    . ALA A  1  553  ? 219.815 174.823 172.663 1.00 0.00 ? 553  ALA A CB    1 
ATOM   4323  N  N     . THR A  1  554  ? 216.991 174.309 174.363 1.00 0.00 ? 554  THR A N     1 
ATOM   4324  C  CA    . THR A  1  554  ? 216.281 174.554 175.611 1.00 0.00 ? 554  THR A CA    1 
ATOM   4325  C  C     . THR A  1  554  ? 216.545 173.417 176.583 1.00 0.00 ? 554  THR A C     1 
ATOM   4326  O  O     . THR A  1  554  ? 216.620 172.256 176.174 1.00 0.00 ? 554  THR A O     1 
ATOM   4327  C  CB    . THR A  1  554  ? 214.775 174.693 175.382 1.00 0.00 ? 554  THR A CB    1 
ATOM   4328  O  OG1   . THR A  1  554  ? 214.291 173.544 174.679 1.00 0.00 ? 554  THR A OG1   1 
ATOM   4329  C  CG2   . THR A  1  554  ? 214.457 175.952 174.602 1.00 0.00 ? 554  THR A CG2   1 
ATOM   4330  N  N     . GLN A  1  555  ? 216.675 173.754 177.864 1.00 0.00 ? 555  GLN A N     1 
ATOM   4331  C  CA    . GLN A  1  555  ? 216.956 172.779 178.910 1.00 0.00 ? 555  GLN A CA    1 
ATOM   4332  C  C     . GLN A  1  555  ? 218.229 172.011 178.585 1.00 0.00 ? 555  GLN A C     1 
ATOM   4333  O  O     . GLN A  1  555  ? 219.277 172.636 178.429 1.00 0.00 ? 555  GLN A O     1 
ATOM   4334  C  CB    . GLN A  1  555  ? 215.764 171.850 179.109 1.00 0.00 ? 555  GLN A CB    1 
ATOM   4335  C  CG    . GLN A  1  555  ? 214.544 172.600 179.596 1.00 0.00 ? 555  GLN A CG    1 
ATOM   4336  C  CD    . GLN A  1  555  ? 213.361 171.704 179.873 1.00 0.00 ? 555  GLN A CD    1 
ATOM   4337  O  OE1   . GLN A  1  555  ? 213.273 170.592 179.356 1.00 0.00 ? 555  GLN A OE1   1 
ATOM   4338  N  NE2   . GLN A  1  555  ? 212.434 172.190 180.687 1.00 0.00 ? 555  GLN A NE2   1 
ATOM   4339  N  N     . ASP A  1  556  ? 218.158 170.679 178.458 1.00 0.00 ? 556  ASP A N     1 
ATOM   4340  C  CA    . ASP A  1  556  ? 219.375 169.873 178.341 1.00 0.00 ? 556  ASP A CA    1 
ATOM   4341  C  C     . ASP A  1  556  ? 220.359 170.462 177.349 1.00 0.00 ? 556  ASP A C     1 
ATOM   4342  O  O     . ASP A  1  556  ? 221.554 170.573 177.644 1.00 0.00 ? 556  ASP A O     1 
ATOM   4343  C  CB    . ASP A  1  556  ? 219.046 168.442 177.930 1.00 0.00 ? 556  ASP A CB    1 
ATOM   4344  C  CG    . ASP A  1  556  ? 218.713 167.566 179.095 1.00 0.00 ? 556  ASP A CG    1 
ATOM   4345  O  OD1   . ASP A  1  556  ? 219.100 167.928 180.219 1.00 0.00 ? 556  ASP A OD1   1 
ATOM   4346  O  OD2   . ASP A  1  556  ? 218.075 166.516 178.888 1.00 0.00 ? 556  ASP A OD2   1 
ATOM   4347  N  N     . PHE A  1  557  ? 219.879 170.863 176.180 1.00 0.00 ? 557  PHE A N     1 
ATOM   4348  C  CA    . PHE A  1  557  ? 220.798 171.356 175.175 1.00 0.00 ? 557  PHE A CA    1 
ATOM   4349  C  C     . PHE A  1  557  ? 221.631 172.530 175.655 1.00 0.00 ? 557  PHE A C     1 
ATOM   4350  O  O     . PHE A  1  557  ? 222.839 172.538 175.409 1.00 0.00 ? 557  PHE A O     1 
ATOM   4351  C  CB    . PHE A  1  557  ? 220.038 171.727 173.918 1.00 0.00 ? 557  PHE A CB    1 
ATOM   4352  C  CG    . PHE A  1  557  ? 219.509 170.556 173.179 1.00 0.00 ? 557  PHE A CG    1 
ATOM   4353  C  CD1   . PHE A  1  557  ? 219.998 169.297 173.435 1.00 0.00 ? 557  PHE A CD1   1 
ATOM   4354  C  CD2   . PHE A  1  557  ? 218.550 170.715 172.205 1.00 0.00 ? 557  PHE A CD2   1 
ATOM   4355  C  CE1   . PHE A  1  557  ? 219.530 168.223 172.752 1.00 0.00 ? 557  PHE A CE1   1 
ATOM   4356  C  CE2   . PHE A  1  557  ? 218.083 169.645 171.519 1.00 0.00 ? 557  PHE A CE2   1 
ATOM   4357  C  CZ    . PHE A  1  557  ? 218.573 168.395 171.792 1.00 0.00 ? 557  PHE A CZ    1 
ATOM   4358  N  N     . ILE A  1  558  ? 221.041 173.499 176.341 1.00 0.00 ? 558  ILE A N     1 
ATOM   4359  C  CA    . ILE A  1  558  ? 221.829 174.599 176.873 1.00 0.00 ? 558  ILE A CA    1 
ATOM   4360  C  C     . ILE A  1  558  ? 222.895 174.059 177.811 1.00 0.00 ? 558  ILE A C     1 
ATOM   4361  O  O     . ILE A  1  558  ? 224.086 174.083 177.484 1.00 0.00 ? 558  ILE A O     1 
ATOM   4362  C  CB    . ILE A  1  558  ? 220.948 175.631 177.580 1.00 0.00 ? 558  ILE A CB    1 
ATOM   4363  C  CG1   . ILE A  1  558  ? 220.050 176.313 176.559 1.00 0.00 ? 558  ILE A CG1   1 
ATOM   4364  C  CG2   . ILE A  1  558  ? 221.813 176.633 178.281 1.00 0.00 ? 558  ILE A CG2   1 
ATOM   4365  C  CD1   . ILE A  1  558  ? 219.022 177.221 177.171 1.00 0.00 ? 558  ILE A CD1   1 
ATOM   4366  N  N     . THR A  1  559  ? 222.473 173.535 178.964 1.00 0.00 ? 559  THR A N     1 
ATOM   4367  C  CA    . THR A  1  559  ? 223.420 173.121 179.991 1.00 0.00 ? 559  THR A CA    1 
ATOM   4368  C  C     . THR A  1  559  ? 224.487 172.171 179.473 1.00 0.00 ? 559  THR A C     1 
ATOM   4369  O  O     . THR A  1  559  ? 225.670 172.377 179.764 1.00 0.00 ? 559  THR A O     1 
ATOM   4370  C  CB    . THR A  1  559  ? 222.694 172.480 181.168 1.00 0.00 ? 559  THR A CB    1 
ATOM   4371  O  OG1   . THR A  1  559  ? 223.653 172.092 182.153 1.00 0.00 ? 559  THR A OG1   1 
ATOM   4372  C  CG2   . THR A  1  559  ? 221.892 171.280 180.737 1.00 0.00 ? 559  THR A CG2   1 
ATOM   4373  N  N     . GLY A  1  560  ? 224.110 171.147 178.712 1.00 0.00 ? 560  GLY A N     1 
ATOM   4374  C  CA    . GLY A  1  560  ? 225.117 170.276 178.139 1.00 0.00 ? 560  GLY A CA    1 
ATOM   4375  C  C     . GLY A  1  560  ? 226.122 171.055 177.321 1.00 0.00 ? 560  GLY A C     1 
ATOM   4376  O  O     . GLY A  1  560  ? 227.330 170.958 177.553 1.00 0.00 ? 560  GLY A O     1 
ATOM   4377  N  N     . SER A  1  561  ? 225.635 171.864 176.379 1.00 0.00 ? 561  SER A N     1 
ATOM   4378  C  CA    . SER A  1  561  ? 226.522 172.780 175.681 1.00 0.00 ? 561  SER A CA    1 
ATOM   4379  C  C     . SER A  1  561  ? 227.357 173.578 176.660 1.00 0.00 ? 561  SER A C     1 
ATOM   4380  O  O     . SER A  1  561  ? 228.579 173.669 176.500 1.00 0.00 ? 561  SER A O     1 
ATOM   4381  C  CB    . SER A  1  561  ? 225.721 173.719 174.790 1.00 0.00 ? 561  SER A CB    1 
ATOM   4382  O  OG    . SER A  1  561  ? 225.120 173.013 173.725 1.00 0.00 ? 561  SER A OG    1 
ATOM   4383  N  N     . TYR A  1  562  ? 226.728 174.122 177.694 1.00 0.00 ? 562  TYR A N     1 
ATOM   4384  C  CA    . TYR A  1  562  ? 227.489 174.863 178.683 1.00 0.00 ? 562  TYR A CA    1 
ATOM   4385  C  C     . TYR A  1  562  ? 228.647 174.038 179.212 1.00 0.00 ? 562  TYR A C     1 
ATOM   4386  O  O     . TYR A  1  562  ? 229.786 174.513 179.251 1.00 0.00 ? 562  TYR A O     1 
ATOM   4387  C  CB    . TYR A  1  562  ? 226.586 175.297 179.826 1.00 0.00 ? 562  TYR A CB    1 
ATOM   4388  C  CG    . TYR A  1  562  ? 227.344 175.984 180.914 1.00 0.00 ? 562  TYR A CG    1 
ATOM   4389  C  CD1   . TYR A  1  562  ? 227.744 177.287 180.776 1.00 0.00 ? 562  TYR A CD1   1 
ATOM   4390  C  CD2   . TYR A  1  562  ? 227.674 175.326 182.070 1.00 0.00 ? 562  TYR A CD2   1 
ATOM   4391  C  CE1   . TYR A  1  562  ? 228.444 177.917 181.763 1.00 0.00 ? 562  TYR A CE1   1 
ATOM   4392  C  CE2   . TYR A  1  562  ? 228.374 175.949 183.063 1.00 0.00 ? 562  TYR A CE2   1 
ATOM   4393  C  CZ    . TYR A  1  562  ? 228.757 177.244 182.904 1.00 0.00 ? 562  TYR A CZ    1 
ATOM   4394  O  OH    . TYR A  1  562  ? 229.460 177.874 183.895 1.00 0.00 ? 562  TYR A OH    1 
ATOM   4395  N  N     . LEU A  1  563  ? 228.386 172.790 179.593 1.00 0.00 ? 563  LEU A N     1 
ATOM   4396  C  CA    . LEU A  1  563  ? 229.439 172.011 180.223 1.00 0.00 ? 563  LEU A CA    1 
ATOM   4397  C  C     . LEU A  1  563  ? 230.573 171.717 179.260 1.00 0.00 ? 563  LEU A C     1 
ATOM   4398  O  O     . LEU A  1  563  ? 231.690 171.433 179.697 1.00 0.00 ? 563  LEU A O     1 
ATOM   4399  C  CB    . LEU A  1  563  ? 228.873 170.720 180.790 1.00 0.00 ? 563  LEU A CB    1 
ATOM   4400  C  CG    . LEU A  1  563  ? 227.930 170.962 181.959 1.00 0.00 ? 563  LEU A CG    1 
ATOM   4401  C  CD1   . LEU A  1  563  ? 227.342 169.659 182.427 1.00 0.00 ? 563  LEU A CD1   1 
ATOM   4402  C  CD2   . LEU A  1  563  ? 228.664 171.647 183.089 1.00 0.00 ? 563  LEU A CD2   1 
ATOM   4403  N  N     . ILE A  1  564  ? 230.318 171.778 177.957 1.00 0.00 ? 564  ILE A N     1 
ATOM   4404  C  CA    . ILE A  1  564  ? 231.416 171.691 177.003 1.00 0.00 ? 564  ILE A CA    1 
ATOM   4405  C  C     . ILE A  1  564  ? 232.096 173.043 176.878 1.00 0.00 ? 564  ILE A C     1 
ATOM   4406  O  O     . ILE A  1  564  ? 233.320 173.145 176.747 1.00 0.00 ? 564  ILE A O     1 
ATOM   4407  C  CB    . ILE A  1  564  ? 230.913 171.191 175.643 1.00 0.00 ? 564  ILE A CB    1 
ATOM   4408  C  CG1   . ILE A  1  564  ? 230.346 169.792 175.778 1.00 0.00 ? 564  ILE A CG1   1 
ATOM   4409  C  CG2   . ILE A  1  564  ? 232.031 171.173 174.648 1.00 0.00 ? 564  ILE A CG2   1 
ATOM   4410  C  CD1   . ILE A  1  564  ? 229.705 169.316 174.527 1.00 0.00 ? 564  ILE A CD1   1 
ATOM   4411  N  N     . SER A  1  565  ? 231.308 174.099 176.921 1.00 0.00 ? 565  SER A N     1 
ATOM   4412  C  CA    . SER A  1  565  ? 231.835 175.443 176.831 1.00 0.00 ? 565  SER A CA    1 
ATOM   4413  C  C     . SER A  1  565  ? 232.535 175.882 178.091 1.00 0.00 ? 565  SER A C     1 
ATOM   4414  O  O     . SER A  1  565  ? 233.113 176.970 178.113 1.00 0.00 ? 565  SER A O     1 
ATOM   4415  C  CB    . SER A  1  565  ? 230.709 176.418 176.506 1.00 0.00 ? 565  SER A CB    1 
ATOM   4416  O  OG    . SER A  1  565  ? 231.201 177.738 176.458 1.00 0.00 ? 565  SER A OG    1 
ATOM   4417  N  N     . HIS A  1  566  ? 232.501 175.083 179.147 1.00 0.00 ? 566  HIS A N     1 
ATOM   4418  C  CA    . HIS A  1  566  ? 233.027 175.548 180.416 1.00 0.00 ? 566  HIS A CA    1 
ATOM   4419  C  C     . HIS A  1  566  ? 234.538 175.669 180.320 1.00 0.00 ? 566  HIS A C     1 
ATOM   4420  O  O     . HIS A  1  566  ? 235.239 174.695 180.035 1.00 0.00 ? 566  HIS A O     1 
ATOM   4421  C  CB    . HIS A  1  566  ? 232.625 174.584 181.527 1.00 0.00 ? 566  HIS A CB    1 
ATOM   4422  C  CG    . HIS A  1  566  ? 232.829 175.126 182.902 1.00 0.00 ? 566  HIS A CG    1 
ATOM   4423  N  ND1   . HIS A  1  566  ? 232.218 176.279 183.338 1.00 0.00 ? 566  HIS A ND1   1 
ATOM   4424  C  CD2   . HIS A  1  566  ? 233.543 174.659 183.951 1.00 0.00 ? 566  HIS A CD2   1 
ATOM   4425  C  CE1   . HIS A  1  566  ? 232.561 176.512 184.590 1.00 0.00 ? 566  HIS A CE1   1 
ATOM   4426  N  NE2   . HIS A  1  566  ? 233.368 175.545 184.986 1.00 0.00 ? 566  HIS A NE2   1 
ATOM   4427  N  N     . LYS A  1  567  ? 235.034 176.885 180.561 1.00 0.00 ? 567  LYS A N     1 
ATOM   4428  C  CA    . LYS A  1  567  ? 236.446 177.187 180.358 1.00 0.00 ? 567  LYS A CA    1 
ATOM   4429  C  C     . LYS A  1  567  ? 237.335 176.174 181.051 1.00 0.00 ? 567  LYS A C     1 
ATOM   4430  O  O     . LYS A  1  567  ? 238.432 175.875 180.574 1.00 0.00 ? 567  LYS A O     1 
ATOM   4431  C  CB    . LYS A  1  567  ? 236.747 178.593 180.866 1.00 0.00 ? 567  LYS A CB    1 
ATOM   4432  C  CG    . LYS A  1  567  ? 238.159 179.057 180.629 1.00 0.00 ? 567  LYS A CG    1 
ATOM   4433  C  CD    . LYS A  1  567  ? 238.354 180.418 181.247 1.00 0.00 ? 567  LYS A CD    1 
ATOM   4434  C  CE    . LYS A  1  567  ? 237.497 181.453 180.540 1.00 0.00 ? 567  LYS A CE    1 
ATOM   4435  N  NZ    . LYS A  1  567  ? 237.668 182.799 181.140 1.00 0.00 ? 567  LYS A NZ    1 
ATOM   4436  N  N     . ASP A  1  568  ? 236.867 175.634 182.164 1.00 0.00 ? 568  ASP A N     1 
ATOM   4437  C  CA    . ASP A  1  568  ? 237.599 174.618 182.889 1.00 0.00 ? 568  ASP A CA    1 
ATOM   4438  C  C     . ASP A  1  568  ? 237.881 173.380 182.060 1.00 0.00 ? 568  ASP A C     1 
ATOM   4439  O  O     . ASP A  1  568  ? 238.879 172.701 182.309 1.00 0.00 ? 568  ASP A O     1 
ATOM   4440  C  CB    . ASP A  1  568  ? 236.809 174.207 184.119 1.00 0.00 ? 568  ASP A CB    1 
ATOM   4441  C  CG    . ASP A  1  568  ? 237.527 173.200 184.934 1.00 0.00 ? 568  ASP A CG    1 
ATOM   4442  O  OD1   . ASP A  1  568  ? 238.534 173.583 185.550 1.00 0.00 ? 568  ASP A OD1   1 
ATOM   4443  O  OD2   . ASP A  1  568  ? 237.111 172.026 184.941 1.00 0.00 ? 568  ASP A OD2   1 
ATOM   4444  N  N     . SER A  1  569  ? 237.032 173.061 181.095 1.00 0.00 ? 569  SER A N     1 
ATOM   4445  C  CA    . SER A  1  569  ? 237.090 171.750 180.473 1.00 0.00 ? 569  SER A CA    1 
ATOM   4446  C  C     . SER A  1  569  ? 238.277 171.616 179.534 1.00 0.00 ? 569  SER A C     1 
ATOM   4447  O  O     . SER A  1  569  ? 238.877 172.602 179.106 1.00 0.00 ? 569  SER A O     1 
ATOM   4448  C  CB    . SER A  1  569  ? 235.815 171.451 179.693 1.00 0.00 ? 569  SER A CB    1 
ATOM   4449  O  OG    . SER A  1  569  ? 235.923 170.184 179.069 1.00 0.00 ? 569  SER A OG    1 
ATOM   4450  N  N     . PHE A  1  570  ? 238.625 170.368 179.242 1.00 0.00 ? 570  PHE A N     1 
ATOM   4451  C  CA    . PHE A  1  570  ? 239.534 170.039 178.161 1.00 0.00 ? 570  PHE A CA    1 
ATOM   4452  C  C     . PHE A  1  570  ? 239.120 168.701 177.581 1.00 0.00 ? 570  PHE A C     1 
ATOM   4453  O  O     . PHE A  1  570  ? 238.184 168.060 178.060 1.00 0.00 ? 570  PHE A O     1 
ATOM   4454  C  CB    . PHE A  1  570  ? 240.981 169.993 178.632 1.00 0.00 ? 570  PHE A CB    1 
ATOM   4455  C  CG    . PHE A  1  570  ? 241.492 171.311 179.092 1.00 0.00 ? 570  PHE A CG    1 
ATOM   4456  C  CD1   . PHE A  1  570  ? 241.976 172.232 178.186 1.00 0.00 ? 570  PHE A CD1   1 
ATOM   4457  C  CD2   . PHE A  1  570  ? 241.464 171.643 180.424 1.00 0.00 ? 570  PHE A CD2   1 
ATOM   4458  C  CE1   . PHE A  1  570  ? 242.436 173.452 178.607 1.00 0.00 ? 570  PHE A CE1   1 
ATOM   4459  C  CE2   . PHE A  1  570  ? 241.919 172.858 180.850 1.00 0.00 ? 570  PHE A CE2   1 
ATOM   4460  C  CZ    . PHE A  1  570  ? 242.408 173.766 179.943 1.00 0.00 ? 570  PHE A CZ    1 
ATOM   4461  N  N     . TYR A  1  571  ? 239.816 168.286 176.532 1.00 0.00 ? 571  TYR A N     1 
ATOM   4462  C  CA    . TYR A  1  571  ? 239.545 167.001 175.918 1.00 0.00 ? 571  TYR A CA    1 
ATOM   4463  C  C     . TYR A  1  571  ? 240.817 166.474 175.301 1.00 0.00 ? 571  TYR A C     1 
ATOM   4464  O  O     . TYR A  1  571  ? 241.873 167.096 175.402 1.00 0.00 ? 571  TYR A O     1 
ATOM   4465  C  CB    . TYR A  1  571  ? 238.484 167.088 174.837 1.00 0.00 ? 571  TYR A CB    1 
ATOM   4466  C  CG    . TYR A  1  571  ? 237.200 167.612 175.361 1.00 0.00 ? 571  TYR A CG    1 
ATOM   4467  C  CD1   . TYR A  1  571  ? 236.293 166.786 175.975 1.00 0.00 ? 571  TYR A CD1   1 
ATOM   4468  C  CD2   . TYR A  1  571  ? 236.902 168.946 175.258 1.00 0.00 ? 571  TYR A CD2   1 
ATOM   4469  C  CE1   . TYR A  1  571  ? 235.118 167.281 176.472 1.00 0.00 ? 571  TYR A CE1   1 
ATOM   4470  C  CE2   . TYR A  1  571  ? 235.735 169.449 175.748 1.00 0.00 ? 571  TYR A CE2   1 
ATOM   4471  C  CZ    . TYR A  1  571  ? 234.840 168.616 176.352 1.00 0.00 ? 571  TYR A CZ    1 
ATOM   4472  O  OH    . TYR A  1  571  ? 233.662 169.129 176.841 1.00 0.00 ? 571  TYR A OH    1 
ATOM   4473  N  N     . ASP A  1  572  ? 240.696 165.344 174.635 1.00 0.00 ? 572  ASP A N     1 
ATOM   4474  C  CA    . ASP A  1  572  ? 241.850 164.756 174.006 1.00 0.00 ? 572  ASP A CA    1 
ATOM   4475  C  C     . ASP A  1  572  ? 241.451 164.178 172.659 1.00 0.00 ? 572  ASP A C     1 
ATOM   4476  O  O     . ASP A  1  572  ? 240.278 163.927 172.380 1.00 0.00 ? 572  ASP A O     1 
ATOM   4477  C  CB    . ASP A  1  572  ? 242.450 163.703 174.917 1.00 0.00 ? 572  ASP A CB    1 
ATOM   4478  C  CG    . ASP A  1  572  ? 243.758 163.187 174.410 1.00 0.00 ? 572  ASP A CG    1 
ATOM   4479  O  OD1   . ASP A  1  572  ? 244.153 163.590 173.297 1.00 0.00 ? 572  ASP A OD1   1 
ATOM   4480  O  OD2   . ASP A  1  572  ? 244.410 162.410 175.136 1.00 0.00 ? 572  ASP A OD2   1 
ATOM   4481  N  N     . ARG A  1  573  ? 242.456 163.953 171.818 1.00 0.00 ? 573  ARG A N     1 
ATOM   4482  C  CA    . ARG A  1  573  ? 242.191 163.685 170.416 1.00 0.00 ? 573  ARG A CA    1 
ATOM   4483  C  C     . ARG A  1  573  ? 241.311 162.455 170.245 1.00 0.00 ? 573  ARG A C     1 
ATOM   4484  O  O     . ARG A  1  573  ? 240.532 162.363 169.291 1.00 0.00 ? 573  ARG A O     1 
ATOM   4485  C  CB    . ARG A  1  573  ? 243.499 163.526 169.661 1.00 0.00 ? 573  ARG A CB    1 
ATOM   4486  C  CG    . ARG A  1  573  ? 243.308 163.534 168.175 1.00 0.00 ? 573  ARG A CG    1 
ATOM   4487  C  CD    . ARG A  1  573  ? 244.633 163.495 167.468 1.00 0.00 ? 573  ARG A CD    1 
ATOM   4488  N  NE    . ARG A  1  573  ? 244.458 163.721 166.044 1.00 0.00 ? 573  ARG A NE    1 
ATOM   4489  C  CZ    . ARG A  1  573  ? 244.371 164.933 165.516 1.00 0.00 ? 573  ARG A CZ    1 
ATOM   4490  N  NH1   . ARG A  1  573  ? 244.466 165.986 166.301 1.00 0.00 ? 573  ARG A NH1   1 
ATOM   4491  N  NH2   . ARG A  1  573  ? 244.212 165.090 164.212 1.00 0.00 ? 573  ARG A NH2   1 
ATOM   4492  N  N     . ALA A  1  574  ? 241.423 161.483 171.151 1.00 0.00 ? 574  ALA A N     1 
ATOM   4493  C  CA    . ALA A  1  574  ? 240.453 160.402 171.121 1.00 0.00 ? 574  ALA A CA    1 
ATOM   4494  C  C     . ALA A  1  574  ? 239.087 160.889 171.557 1.00 0.00 ? 574  ALA A C     1 
ATOM   4495  O  O     . ALA A  1  574  ? 238.121 160.784 170.793 1.00 0.00 ? 574  ALA A O     1 
ATOM   4496  C  CB    . ALA A  1  574  ? 240.900 159.241 172.007 1.00 0.00 ? 574  ALA A CB    1 
ATOM   4497  N  N     . THR A  1  575  ? 238.996 161.455 172.758 1.00 0.00 ? 575  THR A N     1 
ATOM   4498  C  CA    . THR A  1  575  ? 237.717 161.953 173.236 1.00 0.00 ? 575  THR A CA    1 
ATOM   4499  C  C     . THR A  1  575  ? 237.166 162.999 172.283 1.00 0.00 ? 575  THR A C     1 
ATOM   4500  O  O     . THR A  1  575  ? 236.016 162.902 171.844 1.00 0.00 ? 575  THR A O     1 
ATOM   4501  C  CB    . THR A  1  575  ? 237.851 162.531 174.637 1.00 0.00 ? 575  THR A CB    1 
ATOM   4502  O  OG1   . THR A  1  575  ? 238.322 161.511 175.519 1.00 0.00 ? 575  THR A OG1   1 
ATOM   4503  C  CG2   . THR A  1  575  ? 236.496 163.007 175.131 1.00 0.00 ? 575  THR A CG2   1 
ATOM   4504  N  N     . LEU A  1  576  ? 237.972 164.011 171.951 1.00 0.00 ? 576  LEU A N     1 
ATOM   4505  C  CA    . LEU A  1  576  ? 237.491 165.007 171.002 1.00 0.00 ? 576  LEU A CA    1 
ATOM   4506  C  C     . LEU A  1  576  ? 237.070 164.364 169.701 1.00 0.00 ? 576  LEU A C     1 
ATOM   4507  O  O     . LEU A  1  576  ? 235.953 164.593 169.240 1.00 0.00 ? 576  LEU A O     1 
ATOM   4508  C  CB    . LEU A  1  576  ? 238.540 166.078 170.719 1.00 0.00 ? 576  LEU A CB    1 
ATOM   4509  C  CG    . LEU A  1  576  ? 237.990 167.110 169.726 1.00 0.00 ? 576  LEU A CG    1 
ATOM   4510  C  CD1   . LEU A  1  576  ? 238.430 168.490 170.061 1.00 0.00 ? 576  LEU A CD1   1 
ATOM   4511  C  CD2   . LEU A  1  576  ? 238.437 166.803 168.317 1.00 0.00 ? 576  LEU A CD2   1 
ATOM   4512  N  N     . THR A  1  577  ? 237.949 163.576 169.095 1.00 0.00 ? 577  THR A N     1 
ATOM   4513  C  CA    . THR A  1  577  ? 237.604 162.916 167.847 1.00 0.00 ? 577  THR A CA    1 
ATOM   4514  C  C     . THR A  1  577  ? 236.229 162.285 167.935 1.00 0.00 ? 577  THR A C     1 
ATOM   4515  O  O     . THR A  1  577  ? 235.383 162.483 167.057 1.00 0.00 ? 577  THR A O     1 
ATOM   4516  C  CB    . THR A  1  577  ? 238.650 161.864 167.523 1.00 0.00 ? 577  THR A CB    1 
ATOM   4517  O  OG1   . THR A  1  577  ? 239.884 162.506 167.176 1.00 0.00 ? 577  THR A OG1   1 
ATOM   4518  C  CG2   . THR A  1  577  ? 238.174 160.974 166.407 1.00 0.00 ? 577  THR A CG2   1 
ATOM   4519  N  N     . GLN A  1  578  ? 235.964 161.576 169.024 1.00 0.00 ? 578  GLN A N     1 
ATOM   4520  C  CA    . GLN A  1  578  ? 234.668 160.933 169.142 1.00 0.00 ? 578  GLN A CA    1 
ATOM   4521  C  C     . GLN A  1  578  ? 233.543 161.945 169.295 1.00 0.00 ? 578  GLN A C     1 
ATOM   4522  O  O     . GLN A  1  578  ? 232.477 161.762 168.712 1.00 0.00 ? 578  GLN A O     1 
ATOM   4523  C  CB    . GLN A  1  578  ? 234.648 159.954 170.299 1.00 0.00 ? 578  GLN A CB    1 
ATOM   4524  C  CG    . GLN A  1  578  ? 233.335 159.259 170.321 1.00 0.00 ? 578  GLN A CG    1 
ATOM   4525  C  CD    . GLN A  1  578  ? 233.272 158.135 171.294 1.00 0.00 ? 578  GLN A CD    1 
ATOM   4526  O  OE1   . GLN A  1  578  ? 234.269 157.771 171.918 1.00 0.00 ? 578  GLN A OE1   1 
ATOM   4527  N  NE2   . GLN A  1  578  ? 232.085 157.561 171.438 1.00 0.00 ? 578  GLN A NE2   1 
ATOM   4528  N  N     . LEU A  1  579  ? 233.738 163.004 170.082 1.00 0.00 ? 579  LEU A N     1 
ATOM   4529  C  CA    . LEU A  1  579  ? 232.722 164.052 170.119 1.00 0.00 ? 579  LEU A CA    1 
ATOM   4530  C  C     . LEU A  1  579  ? 232.443 164.580 168.726 1.00 0.00 ? 579  LEU A C     1 
ATOM   4531  O  O     . LEU A  1  579  ? 231.350 164.384 168.185 1.00 0.00 ? 579  LEU A O     1 
ATOM   4532  C  CB    . LEU A  1  579  ? 233.148 165.199 171.026 1.00 0.00 ? 579  LEU A CB    1 
ATOM   4533  C  CG    . LEU A  1  579  ? 233.176 164.896 172.508 1.00 0.00 ? 579  LEU A CG    1 
ATOM   4534  C  CD1   . LEU A  1  579  ? 233.684 166.088 173.261 1.00 0.00 ? 579  LEU A CD1   1 
ATOM   4535  C  CD2   . LEU A  1  579  ? 231.785 164.558 172.940 1.00 0.00 ? 579  LEU A CD2   1 
ATOM   4536  N  N     . LEU A  1  580  ? 233.452 165.191 168.112 1.00 0.00 ? 580  LEU A N     1 
ATOM   4537  C  CA    . LEU A  1  580  ? 233.320 165.776 166.791 1.00 0.00 ? 580  LEU A CA    1 
ATOM   4538  C  C     . LEU A  1  580  ? 232.713 164.785 165.810 1.00 0.00 ? 580  LEU A C     1 
ATOM   4539  O  O     . LEU A  1  580  ? 232.151 165.191 164.789 1.00 0.00 ? 580  LEU A O     1 
ATOM   4540  C  CB    . LEU A  1  580  ? 234.693 166.240 166.323 1.00 0.00 ? 580  LEU A CB    1 
ATOM   4541  C  CG    . LEU A  1  580  ? 234.790 166.941 164.984 1.00 0.00 ? 580  LEU A CG    1 
ATOM   4542  C  CD1   . LEU A  1  580  ? 234.055 168.235 165.083 1.00 0.00 ? 580  LEU A CD1   1 
ATOM   4543  C  CD2   . LEU A  1  580  ? 236.237 167.177 164.671 1.00 0.00 ? 580  LEU A CD2   1 
ATOM   4544  N  N     . SER A  1  581  ? 232.813 163.489 166.101 1.00 0.00 ? 581  SER A N     1 
ATOM   4545  C  CA    . SER A  1  581  ? 232.000 162.512 165.396 1.00 0.00 ? 581  SER A CA    1 
ATOM   4546  C  C     . SER A  1  581  ? 230.546 162.555 165.829 1.00 0.00 ? 581  SER A C     1 
ATOM   4547  O  O     . SER A  1  581  ? 229.698 162.970 165.042 1.00 0.00 ? 581  SER A O     1 
ATOM   4548  C  CB    . SER A  1  581  ? 232.550 161.109 165.621 1.00 0.00 ? 581  SER A CB    1 
ATOM   4549  O  OG    . SER A  1  581  ? 231.686 160.131 165.074 1.00 0.00 ? 581  SER A OG    1 
ATOM   4550  N  N     . MET A  1  582  ? 230.256 162.199 167.073 1.00 0.00 ? 582  MET A N     1 
ATOM   4551  C  CA    . MET A  1  582  ? 228.911 162.116 167.617 1.00 0.00 ? 582  MET A CA    1 
ATOM   4552  C  C     . MET A  1  582  ? 228.048 163.288 167.209 1.00 0.00 ? 582  MET A C     1 
ATOM   4553  O  O     . MET A  1  582  ? 226.855 163.107 166.962 1.00 0.00 ? 582  MET A O     1 
ATOM   4554  C  CB    . MET A  1  582  ? 228.987 162.083 169.141 1.00 0.00 ? 582  MET A CB    1 
ATOM   4555  C  CG    . MET A  1  582  ? 229.621 160.846 169.712 1.00 0.00 ? 582  MET A CG    1 
ATOM   4556  S  SD    . MET A  1  582  ? 230.122 161.119 171.412 1.00 0.00 ? 582  MET A SD    1 
ATOM   4557  C  CE    . MET A  1  582  ? 228.554 161.374 172.208 1.00 0.00 ? 582  MET A CE    1 
ATOM   4558  N  N     . MET A  1  583  ? 228.639 164.475 167.142 1.00 0.00 ? 583  MET A N     1 
ATOM   4559  C  CA    . MET A  1  583  ? 227.932 165.665 166.704 1.00 0.00 ? 583  MET A CA    1 
ATOM   4560  C  C     . MET A  1  583  ? 227.269 165.468 165.352 1.00 0.00 ? 583  MET A C     1 
ATOM   4561  O  O     . MET A  1  583  ? 226.219 166.057 165.089 1.00 0.00 ? 583  MET A O     1 
ATOM   4562  C  CB    . MET A  1  583  ? 228.919 166.819 166.659 1.00 0.00 ? 583  MET A CB    1 
ATOM   4563  C  CG    . MET A  1  583  ? 228.360 168.132 166.263 1.00 0.00 ? 583  MET A CG    1 
ATOM   4564  S  SD    . MET A  1  583  ? 229.730 169.262 166.418 1.00 0.00 ? 583  MET A SD    1 
ATOM   4565  C  CE    . MET A  1  583  ? 230.663 168.768 164.989 1.00 0.00 ? 583  MET A CE    1 
ATOM   4566  N  N     . SER A  1  584  ? 227.865 164.668 164.481 1.00 0.00 ? 584  SER A N     1 
ATOM   4567  C  CA    . SER A  1  584  ? 227.198 164.254 163.262 1.00 0.00 ? 584  SER A CA    1 
ATOM   4568  C  C     . SER A  1  584  ? 227.480 162.781 163.057 1.00 0.00 ? 584  SER A C     1 
ATOM   4569  O  O     . SER A  1  584  ? 228.626 162.376 162.870 1.00 0.00 ? 584  SER A O     1 
ATOM   4570  C  CB    . SER A  1  584  ? 227.656 165.060 162.053 1.00 0.00 ? 584  SER A CB    1 
ATOM   4571  O  OG    . SER A  1  584  ? 229.022 164.827 161.776 1.00 0.00 ? 584  SER A OG    1 
ATOM   4572  N  N     . ASP A  1  585  ? 226.409 161.998 162.981 1.00 0.00 ? 585  ASP A N     1 
ATOM   4573  C  CA    . ASP A  1  585  ? 226.476 160.577 163.295 1.00 0.00 ? 585  ASP A CA    1 
ATOM   4574  C  C     . ASP A  1  585  ? 227.546 159.842 162.503 1.00 0.00 ? 585  ASP A C     1 
ATOM   4575  O  O     . ASP A  1  585  ? 227.823 158.676 162.786 1.00 0.00 ? 585  ASP A O     1 
ATOM   4576  C  CB    . ASP A  1  585  ? 225.115 159.952 163.031 1.00 0.00 ? 585  ASP A CB    1 
ATOM   4577  C  CG    . ASP A  1  585  ? 224.664 160.146 161.611 1.00 0.00 ? 585  ASP A CG    1 
ATOM   4578  O  OD1   . ASP A  1  585  ? 225.486 160.581 160.782 1.00 0.00 ? 585  ASP A OD1   1 
ATOM   4579  O  OD2   . ASP A  1  585  ? 223.483 159.869 161.321 1.00 0.00 ? 585  ASP A OD2   1 
ATOM   4580  N  N     . GLY A  1  586  ? 228.123 160.494 161.531 1.00 0.00 ? 586  GLY A N     1 
ATOM   4581  C  CA    . GLY A  1  586  ? 228.992 159.924 160.556 1.00 0.00 ? 586  GLY A CA    1 
ATOM   4582  C  C     . GLY A  1  586  ? 229.166 160.965 159.470 1.00 0.00 ? 586  GLY A C     1 
ATOM   4583  O  O     . GLY A  1  586  ? 229.148 162.166 159.745 1.00 0.00 ? 586  GLY A O     1 
ATOM   4584  N  N     . ILE A  1  587  ? 229.387 160.491 158.255 1.00 0.00 ? 587  ILE A N     1 
ATOM   4585  C  CA    . ILE A  1  587  ? 228.947 161.240 157.087 1.00 0.00 ? 587  ILE A CA    1 
ATOM   4586  C  C     . ILE A  1  587  ? 229.835 162.442 156.786 1.00 0.00 ? 587  ILE A C     1 
ATOM   4587  O  O     . ILE A  1  587  ? 229.807 162.967 155.668 1.00 0.00 ? 587  ILE A O     1 
ATOM   4588  C  CB    . ILE A  1  587  ? 227.483 161.689 157.276 1.00 0.00 ? 587  ILE A CB    1 
ATOM   4589  C  CG1   . ILE A  1  587  ? 226.603 160.501 157.640 1.00 0.00 ? 587  ILE A CG1   1 
ATOM   4590  C  CG2   . ILE A  1  587  ? 226.926 162.311 156.019 1.00 0.00 ? 587  ILE A CG2   1 
ATOM   4591  C  CD1   . ILE A  1  587  ? 226.630 159.424 156.621 1.00 0.00 ? 587  ILE A CD1   1 
ATOM   4592  N  N     . GLU A  1  588  ? 230.656 162.883 157.735 1.00 0.00 ? 588  GLU A N     1 
ATOM   4593  C  CA    . GLU A  1  588  ? 231.308 164.167 157.515 1.00 0.00 ? 588  GLU A CA    1 
ATOM   4594  C  C     . GLU A  1  588  ? 232.825 164.089 157.602 1.00 0.00 ? 588  GLU A C     1 
ATOM   4595  O  O     . GLU A  1  588  ? 233.400 163.235 158.278 1.00 0.00 ? 588  GLU A O     1 
ATOM   4596  C  CB    . GLU A  1  588  ? 230.786 165.204 158.495 1.00 0.00 ? 588  GLU A CB    1 
ATOM   4597  C  CG    . GLU A  1  588  ? 229.355 165.569 158.225 1.00 0.00 ? 588  GLU A CG    1 
ATOM   4598  C  CD    . GLU A  1  588  ? 228.841 166.584 159.207 1.00 0.00 ? 588  GLU A CD    1 
ATOM   4599  O  OE1   . GLU A  1  588  ? 229.549 166.842 160.198 1.00 0.00 ? 588  GLU A OE1   1 
ATOM   4600  O  OE2   . GLU A  1  588  ? 227.737 167.128 158.994 1.00 0.00 ? 588  GLU A OE2   1 
ATOM   4601  N  N     . HIS A  1  589  ? 233.464 165.017 156.896 1.00 0.00 ? 589  HIS A N     1 
ATOM   4602  C  CA    . HIS A  1  589  ? 234.913 165.121 156.792 1.00 0.00 ? 589  HIS A CA    1 
ATOM   4603  C  C     . HIS A  1  589  ? 235.367 166.259 157.681 1.00 0.00 ? 589  HIS A C     1 
ATOM   4604  O  O     . HIS A  1  589  ? 235.198 167.429 157.341 1.00 0.00 ? 589  HIS A O     1 
ATOM   4605  C  CB    . HIS A  1  589  ? 235.322 165.372 155.347 1.00 0.00 ? 589  HIS A CB    1 
ATOM   4606  C  CG    . HIS A  1  589  ? 236.794 165.549 155.151 1.00 0.00 ? 589  HIS A CG    1 
ATOM   4607  N  ND1   . HIS A  1  589  ? 237.452 166.724 155.443 1.00 0.00 ? 589  HIS A ND1   1 
ATOM   4608  C  CD2   . HIS A  1  589  ? 237.729 164.711 154.651 1.00 0.00 ? 589  HIS A CD2   1 
ATOM   4609  C  CE1   . HIS A  1  589  ? 238.734 166.593 155.150 1.00 0.00 ? 589  HIS A CE1   1 
ATOM   4610  N  NE2   . HIS A  1  589  ? 238.929 165.378 154.672 1.00 0.00 ? 589  HIS A NE2   1 
ATOM   4611  N  N     . PHE A  1  590  ? 235.993 165.922 158.793 1.00 0.00 ? 590  PHE A N     1 
ATOM   4612  C  CA    . PHE A  1  590  ? 236.425 166.947 159.717 1.00 0.00 ? 590  PHE A CA    1 
ATOM   4613  C  C     . PHE A  1  590  ? 237.907 167.211 159.567 1.00 0.00 ? 590  PHE A C     1 
ATOM   4614  O  O     . PHE A  1  590  ? 238.714 166.297 159.393 1.00 0.00 ? 590  PHE A O     1 
ATOM   4615  C  CB    . PHE A  1  590  ? 236.101 166.547 161.145 1.00 0.00 ? 590  PHE A CB    1 
ATOM   4616  C  CG    . PHE A  1  590  ? 234.645 166.517 161.427 1.00 0.00 ? 590  PHE A CG    1 
ATOM   4617  C  CD1   . PHE A  1  590  ? 233.977 167.680 161.713 1.00 0.00 ? 590  PHE A CD1   1 
ATOM   4618  C  CD2   . PHE A  1  590  ? 233.937 165.337 161.395 1.00 0.00 ? 590  PHE A CD2   1 
ATOM   4619  C  CE1   . PHE A  1  590  ? 232.640 167.668 161.973 1.00 0.00 ? 590  PHE A CE1   1 
ATOM   4620  C  CE2   . PHE A  1  590  ? 232.592 165.324 161.652 1.00 0.00 ? 590  PHE A CE2   1 
ATOM   4621  C  CZ    . PHE A  1  590  ? 231.947 166.491 161.942 1.00 0.00 ? 590  PHE A CZ    1 
ATOM   4622  N  N     . ASP A  1  591  ? 238.249 168.487 159.593 1.00 0.00 ? 591  ASP A N     1 
ATOM   4623  C  CA    . ASP A  1  591  ? 239.627 168.938 159.601 1.00 0.00 ? 591  ASP A CA    1 
ATOM   4624  C  C     . ASP A  1  591  ? 239.937 169.462 160.993 1.00 0.00 ? 591  ASP A C     1 
ATOM   4625  O  O     . ASP A  1  591  ? 239.435 170.515 161.392 1.00 0.00 ? 591  ASP A O     1 
ATOM   4626  C  CB    . ASP A  1  591  ? 239.845 170.003 158.534 1.00 0.00 ? 591  ASP A CB    1 
ATOM   4627  C  CG    . ASP A  1  591  ? 238.807 171.098 158.589 1.00 0.00 ? 591  ASP A CG    1 
ATOM   4628  O  OD1   . ASP A  1  591  ? 237.822 170.938 159.337 1.00 0.00 ? 591  ASP A OD1   1 
ATOM   4629  O  OD2   . ASP A  1  591  ? 238.965 172.112 157.880 1.00 0.00 ? 591  ASP A OD2   1 
ATOM   4630  N  N     . ILE A  1  592  ? 240.761 168.730 161.728 1.00 0.00 ? 592  ILE A N     1 
ATOM   4631  C  CA    . ILE A  1  592  ? 240.993 169.077 163.122 1.00 0.00 ? 592  ILE A CA    1 
ATOM   4632  C  C     . ILE A  1  592  ? 241.926 170.272 163.176 1.00 0.00 ? 592  ILE A C     1 
ATOM   4633  O  O     . ILE A  1  592  ? 243.025 170.230 162.600 1.00 0.00 ? 592  ILE A O     1 
ATOM   4634  C  CB    . ILE A  1  592  ? 241.565 167.897 163.908 1.00 0.00 ? 592  ILE A CB    1 
ATOM   4635  C  CG1   . ILE A  1  592  ? 240.584 166.742 163.892 1.00 0.00 ? 592  ILE A CG1   1 
ATOM   4636  C  CG2   . ILE A  1  592  ? 241.846 168.312 165.322 1.00 0.00 ? 592  ILE A CG2   1 
ATOM   4637  C  CD1   . ILE A  1  592  ? 240.924 165.718 162.859 1.00 0.00 ? 592  ILE A CD1   1 
ATOM   4638  N  N     . PRO A  1  593  ? 241.533 171.346 163.836 1.00 0.00 ? 593  PRO A N     1 
ATOM   4639  C  CA    . PRO A  1  593  ? 242.381 172.519 163.901 1.00 0.00 ? 593  PRO A CA    1 
ATOM   4640  C  C     . PRO A  1  593  ? 243.513 172.283 164.877 1.00 0.00 ? 593  PRO A C     1 
ATOM   4641  O  O     . PRO A  1  593  ? 243.536 171.258 165.566 1.00 0.00 ? 593  PRO A O     1 
ATOM   4642  C  CB    . PRO A  1  593  ? 241.423 173.599 164.404 1.00 0.00 ? 593  PRO A CB    1 
ATOM   4643  C  CG    . PRO A  1  593  ? 240.457 172.851 165.228 1.00 0.00 ? 593  PRO A CG    1 
ATOM   4644  C  CD    . PRO A  1  593  ? 240.276 171.530 164.556 1.00 0.00 ? 593  PRO A CD    1 
ATOM   4645  N  N     . PRO A  1  594  ? 244.460 173.210 164.978 1.00 0.00 ? 594  PRO A N     1 
ATOM   4646  C  CA    . PRO A  1  594  ? 245.577 173.013 165.883 1.00 0.00 ? 594  PRO A CA    1 
ATOM   4647  C  C     . PRO A  1  594  ? 245.103 172.961 167.320 1.00 0.00 ? 594  PRO A C     1 
ATOM   4648  O  O     . PRO A  1  594  ? 244.195 173.708 167.715 1.00 0.00 ? 594  PRO A O     1 
ATOM   4649  C  CB    . PRO A  1  594  ? 246.472 174.228 165.623 1.00 0.00 ? 594  PRO A CB    1 
ATOM   4650  C  CG    . PRO A  1  594  ? 245.565 175.233 165.053 1.00 0.00 ? 594  PRO A CG    1 
ATOM   4651  C  CD    . PRO A  1  594  ? 244.631 174.448 164.199 1.00 0.00 ? 594  PRO A CD    1 
ATOM   4652  N  N     . PRO A  1  595  ? 245.670 172.071 168.122 1.00 0.00 ? 595  PRO A N     1 
ATOM   4653  C  CA    . PRO A  1  595  ? 245.243 171.953 169.512 1.00 0.00 ? 595  PRO A CA    1 
ATOM   4654  C  C     . PRO A  1  595  ? 245.662 173.154 170.332 1.00 0.00 ? 595  PRO A C     1 
ATOM   4655  O  O     . PRO A  1  595  ? 246.694 173.781 170.091 1.00 0.00 ? 595  PRO A O     1 
ATOM   4656  C  CB    . PRO A  1  595  ? 245.953 170.681 169.985 1.00 0.00 ? 595  PRO A CB    1 
ATOM   4657  C  CG    . PRO A  1  595  ? 247.132 170.574 169.099 1.00 0.00 ? 595  PRO A CG    1 
ATOM   4658  C  CD    . PRO A  1  595  ? 246.708 171.095 167.776 1.00 0.00 ? 595  PRO A CD    1 
ATOM   4659  N  N     . ALA A  1  596  ? 244.829 173.458 171.317 1.00 0.00 ? 596  ALA A N     1 
ATOM   4660  C  CA    . ALA A  1  596  ? 245.012 174.669 172.113 1.00 0.00 ? 596  ALA A CA    1 
ATOM   4661  C  C     . ALA A  1  596  ? 246.361 174.683 172.806 1.00 0.00 ? 596  ALA A C     1 
ATOM   4662  O  O     . ALA A  1  596  ? 247.065 175.694 172.775 1.00 0.00 ? 596  ALA A O     1 
ATOM   4663  C  CB    . ALA A  1  596  ? 243.892 174.794 173.132 1.00 0.00 ? 596  ALA A CB    1 
ATOM   4664  N  N     . ILE A  1  597  ? 246.738 173.588 173.449 1.00 0.00 ? 597  ILE A N     1 
ATOM   4665  C  CA    . ILE A  1  597  ? 247.983 173.576 174.199 1.00 0.00 ? 597  ILE A CA    1 
ATOM   4666  C  C     . ILE A  1  597  ? 248.797 172.367 173.778 1.00 0.00 ? 597  ILE A C     1 
ATOM   4667  O  O     . ILE A  1  597  ? 248.258 171.373 173.285 1.00 0.00 ? 597  ILE A O     1 
ATOM   4668  C  CB    . ILE A  1  597  ? 247.731 173.577 175.712 1.00 0.00 ? 597  ILE A CB    1 
ATOM   4669  C  CG1   . ILE A  1  597  ? 247.081 172.284 176.135 1.00 0.00 ? 597  ILE A CG1   1 
ATOM   4670  C  CG2   . ILE A  1  597  ? 246.763 174.660 176.074 1.00 0.00 ? 597  ILE A CG2   1 
ATOM   4671  C  CD1   . ILE A  1  597  ? 246.960 172.210 177.604 1.00 0.00 ? 597  ILE A CD1   1 
ATOM   4672  N  N     . MET A  1  598  ? 250.108 172.463 173.958 1.00 0.00 ? 598  MET A N     1 
ATOM   4673  C  CA    . MET A  1  598  ? 251.026 171.495 173.392 1.00 0.00 ? 598  MET A CA    1 
ATOM   4674  C  C     . MET A  1  598  ? 252.195 171.321 174.350 1.00 0.00 ? 598  MET A C     1 
ATOM   4675  O  O     . MET A  1  598  ? 252.652 172.268 174.988 1.00 0.00 ? 598  MET A O     1 
ATOM   4676  C  CB    . MET A  1  598  ? 251.520 171.959 172.022 1.00 0.00 ? 598  MET A CB    1 
ATOM   4677  C  CG    . MET A  1  598  ? 250.460 172.045 170.956 1.00 0.00 ? 598  MET A CG    1 
ATOM   4678  S  SD    . MET A  1  598  ? 251.156 172.790 169.484 1.00 0.00 ? 598  MET A SD    1 
ATOM   4679  C  CE    . MET A  1  598  ? 252.353 171.536 169.048 1.00 0.00 ? 598  MET A CE    1 
ATOM   4680  N  N     . LYS A  1  599  ? 252.663 170.087 174.511 1.00 0.00 ? 599  LYS A N     1 
ATOM   4681  C  CA    . LYS A  1  599  ? 253.767 169.815 175.435 1.00 0.00 ? 599  LYS A CA    1 
ATOM   4682  C  C     . LYS A  1  599  ? 253.333 168.772 176.466 1.00 0.00 ? 599  LYS A C     1 
ATOM   4683  O  O     . LYS A  1  599  ? 253.396 167.572 176.191 1.00 0.00 ? 599  LYS A O     1 
ATOM   4684  C  CB    . LYS A  1  599  ? 254.216 171.102 176.130 1.00 0.00 ? 599  LYS A CB    1 
ATOM   4685  C  CG    . LYS A  1  599  ? 254.692 172.188 175.179 1.00 0.00 ? 599  LYS A CG    1 
ATOM   4686  C  CD    . LYS A  1  599  ? 255.864 171.710 174.338 1.00 0.00 ? 599  LYS A CD    1 
ATOM   4687  C  CE    . LYS A  1  599  ? 257.119 171.548 175.181 1.00 0.00 ? 599  LYS A CE    1 
ATOM   4688  N  NZ    . LYS A  1  599  ? 258.313 171.243 174.346 1.00 0.00 ? 599  LYS A NZ    1 
ATOM   4689  N  N     . PRO A  1  600  ? 252.913 169.226 177.665 1.00 0.00 ? 600  PRO A N     1 
ATOM   4690  C  CA    . PRO A  1  600  ? 252.421 168.321 178.713 1.00 0.00 ? 600  PRO A CA    1 
ATOM   4691  C  C     . PRO A  1  600  ? 251.187 167.569 178.261 1.00 0.00 ? 600  PRO A C     1 
ATOM   4692  O  O     . PRO A  1  600  ? 250.108 167.610 178.853 1.00 0.00 ? 600  PRO A O     1 
ATOM   4693  C  CB    . PRO A  1  600  ? 251.908 169.296 179.779 1.00 0.00 ? 600  PRO A CB    1 
ATOM   4694  C  CG    . PRO A  1  600  ? 251.746 170.606 179.079 1.00 0.00 ? 600  PRO A CG    1 
ATOM   4695  C  CD    . PRO A  1  600  ? 252.800 170.625 178.015 1.00 0.00 ? 600  PRO A CD    1 
ATOM   4696  N  N     . TYR A  1  601  ? 251.407 166.867 177.159 1.00 0.00 ? 601  TYR A N     1 
ATOM   4697  C  CA    . TYR A  1  601  ? 250.352 166.186 176.395 1.00 0.00 ? 601  TYR A CA    1 
ATOM   4698  C  C     . TYR A  1  601  ? 249.882 167.090 175.279 1.00 0.00 ? 601  TYR A C     1 
ATOM   4699  O  O     . TYR A  1  601  ? 250.653 167.952 174.853 1.00 0.00 ? 601  TYR A O     1 
ATOM   4700  C  CB    . TYR A  1  601  ? 249.130 165.852 177.250 1.00 0.00 ? 601  TYR A CB    1 
ATOM   4701  C  CG    . TYR A  1  601  ? 249.394 164.890 178.365 1.00 0.00 ? 601  TYR A CG    1 
ATOM   4702  C  CD1   . TYR A  1  601  ? 250.192 163.780 178.174 1.00 0.00 ? 601  TYR A CD1   1 
ATOM   4703  C  CD2   . TYR A  1  601  ? 248.851 165.103 179.620 1.00 0.00 ? 601  TYR A CD2   1 
ATOM   4704  C  CE1   . TYR A  1  601  ? 250.434 162.898 179.200 1.00 0.00 ? 601  TYR A CE1   1 
ATOM   4705  C  CE2   . TYR A  1  601  ? 249.086 164.230 180.653 1.00 0.00 ? 601  TYR A CE2   1 
ATOM   4706  C  CZ    . TYR A  1  601  ? 249.880 163.128 180.439 1.00 0.00 ? 601  TYR A CZ    1 
ATOM   4707  O  OH    . TYR A  1  601  ? 250.120 162.245 181.464 1.00 0.00 ? 601  TYR A OH    1 
ATOM   4708  N  N     . TYR A  1  602  ? 248.618 166.901 174.902 1.00 0.00 ? 602  TYR A N     1 
ATOM   4709  C  CA    . TYR A  1  602  ? 247.900 167.662 173.889 1.00 0.00 ? 602  TYR A CA    1 
ATOM   4710  C  C     . TYR A  1  602  ? 246.457 167.735 174.398 1.00 0.00 ? 602  TYR A C     1 
ATOM   4711  O  O     . TYR A  1  602  ? 245.985 166.808 175.058 1.00 0.00 ? 602  TYR A O     1 
ATOM   4712  C  CB    . TYR A  1  602  ? 247.958 166.957 172.536 1.00 0.00 ? 602  TYR A CB    1 
ATOM   4713  C  CG    . TYR A  1  602  ? 249.264 167.149 171.800 1.00 0.00 ? 602  TYR A CG    1 
ATOM   4714  C  CD1   . TYR A  1  602  ? 250.093 168.226 172.087 1.00 0.00 ? 602  TYR A CD1   1 
ATOM   4715  C  CD2   . TYR A  1  602  ? 249.669 166.256 170.817 1.00 0.00 ? 602  TYR A CD2   1 
ATOM   4716  C  CE1   . TYR A  1  602  ? 251.289 168.406 171.417 1.00 0.00 ? 602  TYR A CE1   1 
ATOM   4717  C  CE2   . TYR A  1  602  ? 250.862 166.428 170.142 1.00 0.00 ? 602  TYR A CE2   1 
ATOM   4718  C  CZ    . TYR A  1  602  ? 251.668 167.504 170.445 1.00 0.00 ? 602  TYR A CZ    1 
ATOM   4719  O  OH    . TYR A  1  602  ? 252.857 167.680 169.776 1.00 0.00 ? 602  TYR A OH    1 
ATOM   4720  N  N     . LEU A  1  603  ? 245.753 168.822 174.097 1.00 0.00 ? 603  LEU A N     1 
ATOM   4721  C  CA    . LEU A  1  603  ? 244.383 169.001 174.575 1.00 0.00 ? 603  LEU A CA    1 
ATOM   4722  C  C     . LEU A  1  603  ? 243.694 169.868 173.533 1.00 0.00 ? 603  LEU A C     1 
ATOM   4723  O  O     . LEU A  1  603  ? 244.352 170.479 172.689 1.00 0.00 ? 603  LEU A O     1 
ATOM   4724  C  CB    . LEU A  1  603  ? 244.300 169.662 175.955 1.00 0.00 ? 603  LEU A CB    1 
ATOM   4725  C  CG    . LEU A  1  603  ? 244.713 168.970 177.260 1.00 0.00 ? 603  LEU A CG    1 
ATOM   4726  C  CD1   . LEU A  1  603  ? 244.577 169.873 178.463 1.00 0.00 ? 603  LEU A CD1   1 
ATOM   4727  C  CD2   . LEU A  1  603  ? 243.940 167.691 177.488 1.00 0.00 ? 603  LEU A CD2   1 
ATOM   4728  N  N     . TRP A  1  604  ? 242.373 169.907 173.583 1.00 0.00 ? 604  TRP A N     1 
ATOM   4729  C  CA    . TRP A  1  604  ? 241.609 170.845 172.778 1.00 0.00 ? 604  TRP A CA    1 
ATOM   4730  C  C     . TRP A  1  604  ? 240.535 171.481 173.636 1.00 0.00 ? 604  TRP A C     1 
ATOM   4731  O  O     . TRP A  1  604  ? 239.709 170.780 174.224 1.00 0.00 ? 604  TRP A O     1 
ATOM   4732  C  CB    . TRP A  1  604  ? 240.962 170.132 171.602 1.00 0.00 ? 604  TRP A CB    1 
ATOM   4733  C  CG    . TRP A  1  604  ? 241.836 169.882 170.427 1.00 0.00 ? 604  TRP A CG    1 
ATOM   4734  C  CD1   . TRP A  1  604  ? 241.947 170.658 169.336 1.00 0.00 ? 604  TRP A CD1   1 
ATOM   4735  C  CD2   . TRP A  1  604  ? 242.702 168.779 170.222 1.00 0.00 ? 604  TRP A CD2   1 
ATOM   4736  N  NE1   . TRP A  1  604  ? 242.828 170.120 168.449 1.00 0.00 ? 604  TRP A NE1   1 
ATOM   4737  C  CE2   . TRP A  1  604  ? 243.308 168.957 168.974 1.00 0.00 ? 604  TRP A CE2   1 
ATOM   4738  C  CE3   . TRP A  1  604  ? 243.026 167.657 170.973 1.00 0.00 ? 604  TRP A CE3   1 
ATOM   4739  C  CZ2   . TRP A  1  604  ? 244.225 168.074 168.468 1.00 0.00 ? 604  TRP A CZ2   1 
ATOM   4740  C  CZ3   . TRP A  1  604  ? 243.941 166.775 170.467 1.00 0.00 ? 604  TRP A CZ3   1 
ATOM   4741  C  CH2   . TRP A  1  604  ? 244.528 166.984 169.223 1.00 0.00 ? 604  TRP A CH2   1 
ATOM   4742  N  N     . THR A  1  605  ? 240.530 172.805 173.702 1.00 0.00 ? 605  THR A N     1 
ATOM   4743  C  CA    . THR A  1  605  ? 239.585 173.454 174.590 1.00 0.00 ? 605  THR A CA    1 
ATOM   4744  C  C     . THR A  1  605  ? 238.170 173.344 174.049 1.00 0.00 ? 605  THR A C     1 
ATOM   4745  O  O     . THR A  1  605  ? 237.929 173.284 172.841 1.00 0.00 ? 605  THR A O     1 
ATOM   4746  C  CB    . THR A  1  605  ? 239.944 174.917 174.792 1.00 0.00 ? 605  THR A CB    1 
ATOM   4747  O  OG1   . THR A  1  605  ? 240.025 175.567 173.522 1.00 0.00 ? 605  THR A OG1   1 
ATOM   4748  C  CG2   . THR A  1  605  ? 241.261 175.035 175.493 1.00 0.00 ? 605  THR A CG2   1 
ATOM   4749  N  N     . GLY A  1  606  ? 237.219 173.339 174.978 1.00 0.00 ? 606  GLY A N     1 
ATOM   4750  C  CA    . GLY A  1  606  ? 235.828 173.193 174.615 1.00 0.00 ? 606  GLY A CA    1 
ATOM   4751  C  C     . GLY A  1  606  ? 235.360 174.180 173.576 1.00 0.00 ? 606  GLY A C     1 
ATOM   4752  O  O     . GLY A  1  606  ? 234.481 173.851 172.777 1.00 0.00 ? 606  GLY A O     1 
ATOM   4753  N  N     . LYS A  1  607  ? 235.929 175.380 173.564 1.00 0.00 ? 607  LYS A N     1 
ATOM   4754  C  CA    . LYS A  1  607  ? 235.534 176.370 172.578 1.00 0.00 ? 607  LYS A CA    1 
ATOM   4755  C  C     . LYS A  1  607  ? 235.836 175.898 171.167 1.00 0.00 ? 607  LYS A C     1 
ATOM   4756  O  O     . LYS A  1  607  ? 235.261 176.415 170.207 1.00 0.00 ? 607  LYS A O     1 
ATOM   4757  C  CB    . LYS A  1  607  ? 236.254 177.681 172.854 1.00 0.00 ? 607  LYS A CB    1 
ATOM   4758  C  CG    . LYS A  1  607  ? 236.156 178.106 174.289 1.00 0.00 ? 607  LYS A CG    1 
ATOM   4759  C  CD    . LYS A  1  607  ? 234.748 178.391 174.693 1.00 0.00 ? 607  LYS A CD    1 
ATOM   4760  C  CE    . LYS A  1  607  ? 234.710 178.835 176.132 1.00 0.00 ? 607  LYS A CE    1 
ATOM   4761  N  NZ    . LYS A  1  607  ? 235.437 180.119 176.318 1.00 0.00 ? 607  LYS A NZ    1 
ATOM   4762  N  N     . GLN A  1  608  ? 236.730 174.930 171.023 1.00 0.00 ? 608  GLN A N     1 
ATOM   4763  C  CA    . GLN A  1  608  ? 237.023 174.391 169.707 1.00 0.00 ? 608  GLN A CA    1 
ATOM   4764  C  C     . GLN A  1  608  ? 236.060 173.279 169.333 1.00 0.00 ? 608  GLN A C     1 
ATOM   4765  O  O     . GLN A  1  608  ? 235.361 173.393 168.323 1.00 0.00 ? 608  GLN A O     1 
ATOM   4766  C  CB    . GLN A  1  608  ? 238.457 173.892 169.657 1.00 0.00 ? 608  GLN A CB    1 
ATOM   4767  C  CG    . GLN A  1  608  ? 239.466 174.991 169.768 1.00 0.00 ? 608  GLN A CG    1 
ATOM   4768  C  CD    . GLN A  1  608  ? 240.859 174.450 169.831 1.00 0.00 ? 608  GLN A CD    1 
ATOM   4769  O  OE1   . GLN A  1  608  ? 241.067 173.312 170.242 1.00 0.00 ? 608  GLN A OE1   1 
ATOM   4770  N  NE2   . GLN A  1  608  ? 241.829 175.254 169.425 1.00 0.00 ? 608  GLN A NE2   1 
ATOM   4771  N  N     . VAL A  1  609  ? 236.026 172.197 170.117 1.00 0.00 ? 609  VAL A N     1 
ATOM   4772  C  CA    . VAL A  1  609  ? 235.086 171.110 169.872 1.00 0.00 ? 609  VAL A CA    1 
ATOM   4773  C  C     . VAL A  1  609  ? 233.683 171.636 169.686 1.00 0.00 ? 609  VAL A C     1 
ATOM   4774  O  O     . VAL A  1  609  ? 232.906 171.066 168.918 1.00 0.00 ? 609  VAL A O     1 
ATOM   4775  C  CB    . VAL A  1  609  ? 235.126 170.075 171.012 1.00 0.00 ? 609  VAL A CB    1 
ATOM   4776  C  CG1   . VAL A  1  609  ? 234.792 170.725 172.325 1.00 0.00 ? 609  VAL A CG1   1 
ATOM   4777  C  CG2   . VAL A  1  609  ? 234.144 168.964 170.752 1.00 0.00 ? 609  VAL A CG2   1 
ATOM   4778  N  N     . PHE A  1  610  ? 233.338 172.726 170.349 1.00 0.00 ? 610  PHE A N     1 
ATOM   4779  C  CA    . PHE A  1  610  ? 232.102 173.398 170.012 1.00 0.00 ? 610  PHE A CA    1 
ATOM   4780  C  C     . PHE A  1  610  ? 232.243 174.325 168.817 1.00 0.00 ? 610  PHE A C     1 
ATOM   4781  O  O     . PHE A  1  610  ? 231.263 174.532 168.101 1.00 0.00 ? 610  PHE A O     1 
ATOM   4782  C  CB    . PHE A  1  610  ? 231.566 174.202 171.188 1.00 0.00 ? 610  PHE A CB    1 
ATOM   4783  C  CG    . PHE A  1  610  ? 230.191 174.689 170.960 1.00 0.00 ? 610  PHE A CG    1 
ATOM   4784  C  CD1   . PHE A  1  610  ? 229.122 173.892 171.278 1.00 0.00 ? 610  PHE A CD1   1 
ATOM   4785  C  CD2   . PHE A  1  610  ? 229.962 175.897 170.346 1.00 0.00 ? 610  PHE A CD2   1 
ATOM   4786  C  CE1   . PHE A  1  610  ? 227.850 174.317 171.049 1.00 0.00 ? 610  PHE A CE1   1 
ATOM   4787  C  CE2   . PHE A  1  610  ? 228.689 176.319 170.088 1.00 0.00 ? 610  PHE A CE2   1 
ATOM   4788  C  CZ    . PHE A  1  610  ? 227.629 175.538 170.451 1.00 0.00 ? 610  PHE A CZ    1 
ATOM   4789  N  N     . SER A  1  611  ? 233.415 174.917 168.600 1.00 0.00 ? 611  SER A N     1 
ATOM   4790  C  CA    . SER A  1  611  ? 233.572 175.759 167.424 1.00 0.00 ? 611  SER A CA    1 
ATOM   4791  C  C     . SER A  1  611  ? 233.399 174.965 166.149 1.00 0.00 ? 611  SER A C     1 
ATOM   4792  O  O     . SER A  1  611  ? 232.683 175.408 165.249 1.00 0.00 ? 611  SER A O     1 
ATOM   4793  C  CB    . SER A  1  611  ? 234.939 176.431 167.409 1.00 0.00 ? 611  SER A CB    1 
ATOM   4794  O  OG    . SER A  1  611  ? 235.118 177.169 166.213 1.00 0.00 ? 611  SER A OG    1 
ATOM   4795  N  N     . LEU A  1  612  ? 234.020 173.793 166.062 1.00 0.00 ? 612  LEU A N     1 
ATOM   4796  C  CA    . LEU A  1  612  ? 233.901 172.980 164.865 1.00 0.00 ? 612  LEU A CA    1 
ATOM   4797  C  C     . LEU A  1  612  ? 232.467 172.606 164.548 1.00 0.00 ? 612  LEU A C     1 
ATOM   4798  O  O     . LEU A  1  612  ? 232.166 172.317 163.387 1.00 0.00 ? 612  LEU A O     1 
ATOM   4799  C  CB    . LEU A  1  612  ? 234.730 171.718 165.009 1.00 0.00 ? 612  LEU A CB    1 
ATOM   4800  C  CG    . LEU A  1  612  ? 236.210 172.015 165.143 1.00 0.00 ? 612  LEU A CG    1 
ATOM   4801  C  CD1   . LEU A  1  612  ? 236.951 170.723 165.300 1.00 0.00 ? 612  LEU A CD1   1 
ATOM   4802  C  CD2   . LEU A  1  612  ? 236.692 172.776 163.939 1.00 0.00 ? 612  LEU A CD2   1 
ATOM   4803  N  N     . LEU A  1  613  ? 231.589 172.591 165.550 1.00 0.00 ? 613  LEU A N     1 
ATOM   4804  C  CA    . LEU A  1  613  ? 230.159 172.445 165.306 1.00 0.00 ? 613  LEU A CA    1 
ATOM   4805  C  C     . LEU A  1  613  ? 229.679 173.386 164.218 1.00 0.00 ? 613  LEU A C     1 
ATOM   4806  O  O     . LEU A  1  613  ? 228.837 173.019 163.391 1.00 0.00 ? 613  LEU A O     1 
ATOM   4807  C  CB    . LEU A  1  613  ? 229.396 172.717 166.594 1.00 0.00 ? 613  LEU A CB    1 
ATOM   4808  C  CG    . LEU A  1  613  ? 227.890 172.897 166.508 1.00 0.00 ? 613  LEU A CG    1 
ATOM   4809  C  CD1   . LEU A  1  613  ? 227.272 171.631 166.076 1.00 0.00 ? 613  LEU A CD1   1 
ATOM   4810  C  CD2   . LEU A  1  613  ? 227.349 173.315 167.842 1.00 0.00 ? 613  LEU A CD2   1 
ATOM   4811  N  N     . ILE A  1  614  ? 230.193 174.607 164.212 1.00 0.00 ? 614  ILE A N     1 
ATOM   4812  C  CA    . ILE A  1  614  ? 229.721 175.606 163.272 1.00 0.00 ? 614  ILE A CA    1 
ATOM   4813  C  C     . ILE A  1  614  ? 230.318 175.386 161.891 1.00 0.00 ? 614  ILE A C     1 
ATOM   4814  O  O     . ILE A  1  614  ? 229.600 175.370 160.888 1.00 0.00 ? 614  ILE A O     1 
ATOM   4815  C  CB    . ILE A  1  614  ? 230.034 176.997 163.827 1.00 0.00 ? 614  ILE A CB    1 
ATOM   4816  C  CG1   . ILE A  1  614  ? 229.121 177.259 165.017 1.00 0.00 ? 614  ILE A CG1   1 
ATOM   4817  C  CG2   . ILE A  1  614  ? 229.901 178.023 162.753 1.00 0.00 ? 614  ILE A CG2   1 
ATOM   4818  C  CD1   . ILE A  1  614  ? 229.478 178.478 165.778 1.00 0.00 ? 614  ILE A CD1   1 
ATOM   4819  N  N     . LYS A  1  615  ? 231.630 175.176 161.820 1.00 0.00 ? 615  LYS A N     1 
ATOM   4820  C  CA    . LYS A  1  615  ? 232.354 175.057 160.558 1.00 0.00 ? 615  LYS A CA    1 
ATOM   4821  C  C     . LYS A  1  615  ? 233.028 173.693 160.514 1.00 0.00 ? 615  LYS A C     1 
ATOM   4822  O  O     . LYS A  1  615  ? 234.257 173.594 160.625 1.00 0.00 ? 615  LYS A O     1 
ATOM   4823  C  CB    . LYS A  1  615  ? 233.378 176.175 160.417 1.00 0.00 ? 615  LYS A CB    1 
ATOM   4824  C  CG    . LYS A  1  615  ? 234.094 176.201 159.087 1.00 0.00 ? 615  LYS A CG    1 
ATOM   4825  C  CD    . LYS A  1  615  ? 235.084 177.340 159.034 1.00 0.00 ? 615  LYS A CD    1 
ATOM   4826  C  CE    . LYS A  1  615  ? 235.908 177.289 157.765 1.00 0.00 ? 615  LYS A CE    1 
ATOM   4827  N  NZ    . LYS A  1  615  ? 235.045 177.443 156.567 1.00 0.00 ? 615  LYS A NZ    1 
ATOM   4828  N  N     . PRO A  1  616  ? 232.275 172.627 160.361 1.00 0.00 ? 616  PRO A N     1 
ATOM   4829  C  CA    . PRO A  1  616  ? 232.868 171.291 160.420 1.00 0.00 ? 616  PRO A CA    1 
ATOM   4830  C  C     . PRO A  1  616  ? 233.916 171.046 159.352 1.00 0.00 ? 616  PRO A C     1 
ATOM   4831  O  O     . PRO A  1  616  ? 235.027 170.611 159.652 1.00 0.00 ? 616  PRO A O     1 
ATOM   4832  C  CB    . PRO A  1  616  ? 231.658 170.377 160.213 1.00 0.00 ? 616  PRO A CB    1 
ATOM   4833  C  CG    . PRO A  1  616  ? 230.730 171.192 159.410 1.00 0.00 ? 616  PRO A CG    1 
ATOM   4834  C  CD    . PRO A  1  616  ? 230.856 172.571 159.979 1.00 0.00 ? 616  PRO A CD    1 
ATOM   4835  N  N     . ASN A  1  617  ? 233.589 171.345 158.113 1.00 0.00 ? 617  ASN A N     1 
ATOM   4836  C  CA    . ASN A  1  617  ? 234.501 171.105 157.019 1.00 0.00 ? 617  ASN A CA    1 
ATOM   4837  C  C     . ASN A  1  617  ? 235.416 172.316 156.895 1.00 0.00 ? 617  ASN A C     1 
ATOM   4838  O  O     . ASN A  1  617  ? 235.364 173.232 157.719 1.00 0.00 ? 617  ASN A O     1 
ATOM   4839  C  CB    . ASN A  1  617  ? 233.698 170.856 155.737 1.00 0.00 ? 617  ASN A CB    1 
ATOM   4840  C  CG    . ASN A  1  617  ? 232.813 169.625 155.825 1.00 0.00 ? 617  ASN A CG    1 
ATOM   4841  O  OD1   . ASN A  1  617  ? 233.040 168.740 156.644 1.00 0.00 ? 617  ASN A OD1   1 
ATOM   4842  N  ND2   . ASN A  1  617  ? 231.794 169.567 154.973 1.00 0.00 ? 617  ASN A ND2   1 
ATOM   4843  N  N     . HIS A  1  618  ? 236.261 172.334 155.873 1.00 0.00 ? 618  HIS A N     1 
ATOM   4844  C  CA    . HIS A  1  618  ? 236.706 173.602 155.330 1.00 0.00 ? 618  HIS A CA    1 
ATOM   4845  C  C     . HIS A  1  618  ? 235.825 174.078 154.197 1.00 0.00 ? 618  HIS A C     1 
ATOM   4846  O  O     . HIS A  1  618  ? 235.957 175.231 153.782 1.00 0.00 ? 618  HIS A O     1 
ATOM   4847  C  CB    . HIS A  1  618  ? 238.152 173.521 154.825 1.00 0.00 ? 618  HIS A CB    1 
ATOM   4848  C  CG    . HIS A  1  618  ? 238.334 172.582 153.680 1.00 0.00 ? 618  HIS A CG    1 
ATOM   4849  N  ND1   . HIS A  1  618  ? 237.972 172.900 152.390 1.00 0.00 ? 618  HIS A ND1   1 
ATOM   4850  C  CD2   . HIS A  1  618  ? 238.837 171.328 153.633 1.00 0.00 ? 618  HIS A CD2   1 
ATOM   4851  C  CE1   . HIS A  1  618  ? 238.249 171.881 151.595 1.00 0.00 ? 618  HIS A CE1   1 
ATOM   4852  N  NE2   . HIS A  1  618  ? 238.776 170.915 152.324 1.00 0.00 ? 618  HIS A NE2   1 
ATOM   4853  N  N     . ASN A  1  619  ? 234.939 173.228 153.683 1.00 0.00 ? 619  ASN A N     1 
ATOM   4854  C  CA    . ASN A  1  619  ? 234.031 173.603 152.613 1.00 0.00 ? 619  ASN A CA    1 
ATOM   4855  C  C     . ASN A  1  619  ? 232.656 174.011 153.097 1.00 0.00 ? 619  ASN A C     1 
ATOM   4856  O  O     . ASN A  1  619  ? 231.822 174.382 152.268 1.00 0.00 ? 619  ASN A O     1 
ATOM   4857  C  CB    . ASN A  1  619  ? 233.862 172.462 151.615 1.00 0.00 ? 619  ASN A CB    1 
ATOM   4858  C  CG    . ASN A  1  619  ? 235.115 172.180 150.859 1.00 0.00 ? 619  ASN A CG    1 
ATOM   4859  O  OD1   . ASN A  1  619  ? 235.518 171.030 150.714 1.00 0.00 ? 619  ASN A OD1   1 
ATOM   4860  N  ND2   . ASN A  1  619  ? 235.764 173.234 150.383 1.00 0.00 ? 619  ASN A ND2   1 
ATOM   4861  N  N     . SER A  1  620  ? 232.384 173.936 154.380 1.00 0.00 ? 620  SER A N     1 
ATOM   4862  C  CA    . SER A  1  620  ? 231.094 174.400 154.842 1.00 0.00 ? 620  SER A CA    1 
ATOM   4863  C  C     . SER A  1  620  ? 231.095 175.916 154.762 1.00 0.00 ? 620  SER A C     1 
ATOM   4864  O  O     . SER A  1  620  ? 231.829 176.566 155.513 1.00 0.00 ? 620  SER A O     1 
ATOM   4865  C  CB    . SER A  1  620  ? 230.820 173.925 156.261 1.00 0.00 ? 620  SER A CB    1 
ATOM   4866  O  OG    . SER A  1  620  ? 231.761 174.448 157.183 1.00 0.00 ? 620  SER A OG    1 
ATOM   4867  N  N     . PRO A  1  621  ? 230.304 176.516 153.893 1.00 0.00 ? 621  PRO A N     1 
ATOM   4868  C  CA    . PRO A  1  621  ? 230.433 177.954 153.658 1.00 0.00 ? 621  PRO A CA    1 
ATOM   4869  C  C     . PRO A  1  621  ? 229.817 178.761 154.778 1.00 0.00 ? 621  PRO A C     1 
ATOM   4870  O  O     . PRO A  1  621  ? 228.997 179.650 154.536 1.00 0.00 ? 621  PRO A O     1 
ATOM   4871  C  CB    . PRO A  1  621  ? 229.682 178.158 152.342 1.00 0.00 ? 621  PRO A CB    1 
ATOM   4872  C  CG    . PRO A  1  621  ? 228.635 177.099 152.368 1.00 0.00 ? 621  PRO A CG    1 
ATOM   4873  C  CD    . PRO A  1  621  ? 229.213 175.921 153.104 1.00 0.00 ? 621  PRO A CD    1 
ATOM   4874  N  N     . VAL A  1  622  ? 230.201 178.468 156.012 1.00 0.00 ? 622  VAL A N     1 
ATOM   4875  C  CA    . VAL A  1  622  ? 229.742 179.221 157.168 1.00 0.00 ? 622  VAL A CA    1 
ATOM   4876  C  C     . VAL A  1  622  ? 230.937 179.947 157.762 1.00 0.00 ? 622  VAL A C     1 
ATOM   4877  O  O     . VAL A  1  622  ? 231.875 179.322 158.267 1.00 0.00 ? 622  VAL A O     1 
ATOM   4878  C  CB    . VAL A  1  622  ? 229.050 178.341 158.202 1.00 0.00 ? 622  VAL A CB    1 
ATOM   4879  C  CG1   . VAL A  1  622  ? 227.704 177.981 157.702 1.00 0.00 ? 622  VAL A CG1   1 
ATOM   4880  C  CG2   . VAL A  1  622  ? 229.840 177.082 158.390 1.00 0.00 ? 622  VAL A CG2   1 
ATOM   4881  N  N     . VAL A  1  623  ? 230.920 181.261 157.675 1.00 0.00 ? 623  VAL A N     1 
ATOM   4882  C  CA    . VAL A  1  623  ? 231.888 182.108 158.341 1.00 0.00 ? 623  VAL A CA    1 
ATOM   4883  C  C     . VAL A  1  623  ? 231.056 183.100 159.137 1.00 0.00 ? 623  VAL A C     1 
ATOM   4884  O  O     . VAL A  1  623  ? 230.162 183.754 158.599 1.00 0.00 ? 623  VAL A O     1 
ATOM   4885  C  CB    . VAL A  1  623  ? 232.826 182.813 157.365 1.00 0.00 ? 623  VAL A CB    1 
ATOM   4886  C  CG1   . VAL A  1  623  ? 233.750 183.726 158.123 1.00 0.00 ? 623  VAL A CG1   1 
ATOM   4887  C  CG2   . VAL A  1  623  ? 233.615 181.795 156.584 1.00 0.00 ? 623  VAL A CG2   1 
ATOM   4888  N  N     . ILE A  1  624  ? 231.317 183.200 160.433 1.00 0.00 ? 624  ILE A N     1 
ATOM   4889  C  CA    . ILE A  1  624  ? 230.555 184.078 161.304 1.00 0.00 ? 624  ILE A CA    1 
ATOM   4890  C  C     . ILE A  1  624  ? 231.518 185.082 161.914 1.00 0.00 ? 624  ILE A C     1 
ATOM   4891  O  O     . ILE A  1  624  ? 232.723 185.052 161.636 1.00 0.00 ? 624  ILE A O     1 
ATOM   4892  C  CB    . ILE A  1  624  ? 229.838 183.286 162.407 1.00 0.00 ? 624  ILE A CB    1 
ATOM   4893  C  CG1   . ILE A  1  624  ? 229.090 182.121 161.811 1.00 0.00 ? 624  ILE A CG1   1 
ATOM   4894  C  CG2   . ILE A  1  624  ? 228.731 184.096 163.028 1.00 0.00 ? 624  ILE A CG2   1 
ATOM   4895  C  CD1   . ILE A  1  624  ? 228.557 181.231 162.879 1.00 0.00 ? 624  ILE A CD1   1 
ATOM   4896  N  N     . ASN A  1  625  ? 230.971 185.973 162.729 1.00 0.00 ? 625  ASN A N     1 
ATOM   4897  C  CA    . ASN A  1  625  ? 231.673 186.721 163.751 1.00 0.00 ? 625  ASN A CA    1 
ATOM   4898  C  C     . ASN A  1  625  ? 230.628 187.559 164.458 1.00 0.00 ? 625  ASN A C     1 
ATOM   4899  O  O     . ASN A  1  625  ? 229.568 187.826 163.891 1.00 0.00 ? 625  ASN A O     1 
ATOM   4900  C  CB    . ASN A  1  625  ? 232.780 187.589 163.166 1.00 0.00 ? 625  ASN A CB    1 
ATOM   4901  C  CG    . ASN A  1  625  ? 232.289 188.455 162.054 1.00 0.00 ? 625  ASN A CG    1 
ATOM   4902  O  OD1   . ASN A  1  625  ? 231.218 188.218 161.498 1.00 0.00 ? 625  ASN A OD1   1 
ATOM   4903  N  ND2   . ASN A  1  625  ? 233.070 189.464 161.707 1.00 0.00 ? 625  ASN A ND2   1 
ATOM   4904  N  N     . LEU A  1  626  ? 230.936 187.991 165.677 1.00 0.00 ? 626  LEU A N     1 
ATOM   4905  C  CA    . LEU A  1  626  ? 229.893 188.448 166.578 1.00 0.00 ? 626  LEU A CA    1 
ATOM   4906  C  C     . LEU A  1  626  ? 230.498 188.825 167.918 1.00 0.00 ? 626  LEU A C     1 
ATOM   4907  O  O     . LEU A  1  626  ? 231.609 188.401 168.240 1.00 0.00 ? 626  LEU A O     1 
ATOM   4908  C  CB    . LEU A  1  626  ? 228.856 187.336 166.758 1.00 0.00 ? 626  LEU A CB    1 
ATOM   4909  C  CG    . LEU A  1  626  ? 227.624 187.456 167.636 1.00 0.00 ? 626  LEU A CG    1 
ATOM   4910  C  CD1   . LEU A  1  626  ? 226.497 186.697 166.992 1.00 0.00 ? 626  LEU A CD1   1 
ATOM   4911  C  CD2   . LEU A  1  626  ? 227.926 186.833 168.964 1.00 0.00 ? 626  LEU A CD2   1 
ATOM   4912  N  N     . ASP A  1  627  ? 229.761 189.618 168.690 1.00 0.00 ? 627  ASP A N     1 
ATOM   4913  C  CA    . ASP A  1  627  ? 229.958 189.739 170.127 1.00 0.00 ? 627  ASP A CA    1 
ATOM   4914  C  C     . ASP A  1  627  ? 228.598 189.589 170.782 1.00 0.00 ? 627  ASP A C     1 
ATOM   4915  O  O     . ASP A  1  627  ? 227.571 189.743 170.115 1.00 0.00 ? 627  ASP A O     1 
ATOM   4916  C  CB    . ASP A  1  627  ? 230.597 191.071 170.529 1.00 0.00 ? 627  ASP A CB    1 
ATOM   4917  C  CG    . ASP A  1  627  ? 229.753 192.266 170.154 1.00 0.00 ? 627  ASP A CG    1 
ATOM   4918  O  OD1   . ASP A  1  627  ? 228.788 192.105 169.384 1.00 0.00 ? 627  ASP A OD1   1 
ATOM   4919  O  OD2   . ASP A  1  627  ? 230.040 193.373 170.653 1.00 0.00 ? 627  ASP A OD2   1 
ATOM   4920  N  N     . ALA A  1  628  ? 228.584 189.280 172.070 1.00 0.00 ? 628  ALA A N     1 
ATOM   4921  C  CA    . ALA A  1  628  ? 227.334 189.108 172.787 1.00 0.00 ? 628  ALA A CA    1 
ATOM   4922  C  C     . ALA A  1  628  ? 227.589 189.228 174.279 1.00 0.00 ? 628  ALA A C     1 
ATOM   4923  O  O     . ALA A  1  628  ? 228.716 189.444 174.728 1.00 0.00 ? 628  ALA A O     1 
ATOM   4924  C  CB    . ALA A  1  628  ? 226.685 187.762 172.450 1.00 0.00 ? 628  ALA A CB    1 
ATOM   4925  N  N     . LYS A  1  629  ? 226.514 189.123 175.048 1.00 0.00 ? 629  LYS A N     1 
ATOM   4926  C  CA    . LYS A  1  629  ? 226.595 189.025 176.496 1.00 0.00 ? 629  LYS A CA    1 
ATOM   4927  C  C     . LYS A  1  629  ? 225.652 187.926 176.937 1.00 0.00 ? 629  LYS A C     1 
ATOM   4928  O  O     . LYS A  1  629  ? 224.434 188.066 176.799 1.00 0.00 ? 629  LYS A O     1 
ATOM   4929  C  CB    . LYS A  1  629  ? 226.209 190.342 177.167 1.00 0.00 ? 629  LYS A CB    1 
ATOM   4930  C  CG    . LYS A  1  629  ? 227.151 191.478 176.896 1.00 0.00 ? 629  LYS A CG    1 
ATOM   4931  C  CD    . LYS A  1  629  ? 226.544 192.801 177.321 1.00 0.00 ? 629  LYS A CD    1 
ATOM   4932  C  CE    . LYS A  1  629  ? 226.269 192.819 178.813 1.00 0.00 ? 629  LYS A CE    1 
ATOM   4933  N  NZ    . LYS A  1  629  ? 225.631 194.095 179.239 1.00 0.00 ? 629  LYS A NZ    1 
ATOM   4934  N  N     . ASN A  1  630  ? 226.195 186.849 177.482 1.00 0.00 ? 630  ASN A N     1 
ATOM   4935  C  CA    . ASN A  1  630  ? 225.265 185.954 178.134 1.00 0.00 ? 630  ASN A CA    1 
ATOM   4936  C  C     . ASN A  1  630  ? 224.840 186.565 179.462 1.00 0.00 ? 630  ASN A C     1 
ATOM   4937  O  O     . ASN A  1  630  ? 225.360 187.596 179.891 1.00 0.00 ? 630  ASN A O     1 
ATOM   4938  C  CB    . ASN A  1  630  ? 225.884 184.575 178.314 1.00 0.00 ? 630  ASN A CB    1 
ATOM   4939  C  CG    . ASN A  1  630  ? 227.161 184.621 179.091 1.00 0.00 ? 630  ASN A CG    1 
ATOM   4940  O  OD1   . ASN A  1  630  ? 227.746 185.684 179.278 1.00 0.00 ? 630  ASN A OD1   1 
ATOM   4941  N  ND2   . ASN A  1  630  ? 227.612 183.465 179.549 1.00 0.00 ? 630  ASN A ND2   1 
ATOM   4942  N  N     . LYS A  1  631  ? 223.887 185.928 180.129 1.00 0.00 ? 631  LYS A N     1 
ATOM   4943  C  CA    . LYS A  1  631  ? 223.453 186.505 181.387 1.00 0.00 ? 631  LYS A CA    1 
ATOM   4944  C  C     . LYS A  1  631  ? 224.428 186.101 182.486 1.00 0.00 ? 631  LYS A C     1 
ATOM   4945  O  O     . LYS A  1  631  ? 225.399 185.380 182.251 1.00 0.00 ? 631  LYS A O     1 
ATOM   4946  C  CB    . LYS A  1  631  ? 222.000 186.133 181.672 1.00 0.00 ? 631  LYS A CB    1 
ATOM   4947  C  CG    . LYS A  1  631  ? 221.678 184.666 181.656 1.00 0.00 ? 631  LYS A CG    1 
ATOM   4948  C  CD    . LYS A  1  631  ? 220.185 184.472 181.867 1.00 0.00 ? 631  LYS A CD    1 
ATOM   4949  C  CE    . LYS A  1  631  ? 219.391 185.072 180.716 1.00 0.00 ? 631  LYS A CE    1 
ATOM   4950  N  NZ    . LYS A  1  631  ? 217.922 184.904 180.900 1.00 0.00 ? 631  LYS A NZ    1 
ATOM   4951  N  N     . VAL A  1  632  ? 224.182 186.618 183.690 1.00 0.00 ? 632  VAL A N     1 
ATOM   4952  C  CA    . VAL A  1  632  ? 225.144 186.670 184.790 1.00 0.00 ? 632  VAL A CA    1 
ATOM   4953  C  C     . VAL A  1  632  ? 226.512 187.068 184.253 1.00 0.00 ? 632  VAL A C     1 
ATOM   4954  O  O     . VAL A  1  632  ? 227.539 186.498 184.634 1.00 0.00 ? 632  VAL A O     1 
ATOM   4955  C  CB    . VAL A  1  632  ? 225.194 185.374 185.628 1.00 0.00 ? 632  VAL A CB    1 
ATOM   4956  C  CG1   . VAL A  1  632  ? 223.869 185.184 186.337 1.00 0.00 ? 632  VAL A CG1   1 
ATOM   4957  C  CG2   . VAL A  1  632  ? 225.571 184.133 184.829 1.00 0.00 ? 632  VAL A CG2   1 
ATOM   4958  N  N     . PHE A  1  633  ? 226.529 188.051 183.361 1.00 0.00 ? 633  PHE A N     1 
ATOM   4959  C  CA    . PHE A  1  633  ? 227.765 188.726 183.011 1.00 0.00 ? 633  PHE A CA    1 
ATOM   4960  C  C     . PHE A  1  633  ? 228.313 189.450 184.228 1.00 0.00 ? 633  PHE A C     1 
ATOM   4961  O  O     . PHE A  1  633  ? 227.561 190.061 184.990 1.00 0.00 ? 633  PHE A O     1 
ATOM   4962  C  CB    . PHE A  1  633  ? 227.535 189.721 181.878 1.00 0.00 ? 633  PHE A CB    1 
ATOM   4963  C  CG    . PHE A  1  633  ? 228.702 190.617 181.628 1.00 0.00 ? 633  PHE A CG    1 
ATOM   4964  C  CD1   . PHE A  1  633  ? 229.806 190.160 180.937 1.00 0.00 ? 633  PHE A CD1   1 
ATOM   4965  C  CD2   . PHE A  1  633  ? 228.694 191.919 182.087 1.00 0.00 ? 633  PHE A CD2   1 
ATOM   4966  C  CE1   . PHE A  1  633  ? 230.881 190.987 180.712 1.00 0.00 ? 633  PHE A CE1   1 
ATOM   4967  C  CE2   . PHE A  1  633  ? 229.762 192.748 181.865 1.00 0.00 ? 633  PHE A CE2   1 
ATOM   4968  C  CZ    . PHE A  1  633  ? 230.857 192.282 181.177 1.00 0.00 ? 633  PHE A CZ    1 
ATOM   4969  N  N     . VAL A  1  634  ? 229.622 189.387 184.411 1.00 0.00 ? 634  VAL A N     1 
ATOM   4970  C  CA    . VAL A  1  634  ? 230.268 189.989 185.570 1.00 0.00 ? 634  VAL A CA    1 
ATOM   4971  C  C     . VAL A  1  634  ? 231.166 191.119 185.083 1.00 0.00 ? 634  VAL A C     1 
ATOM   4972  O  O     . VAL A  1  634  ? 232.129 190.863 184.349 1.00 0.00 ? 634  VAL A O     1 
ATOM   4973  C  CB    . VAL A  1  634  ? 231.067 188.959 186.378 1.00 0.00 ? 634  VAL A CB    1 
ATOM   4974  C  CG1   . VAL A  1  634  ? 231.814 189.647 187.497 1.00 0.00 ? 634  VAL A CG1   1 
ATOM   4975  C  CG2   . VAL A  1  634  ? 230.128 187.913 186.940 1.00 0.00 ? 634  VAL A CG2   1 
ATOM   4976  N  N     . PRO A  1  635  ? 230.888 192.365 185.451 1.00 0.00 ? 635  PRO A N     1 
ATOM   4977  C  CA    . PRO A  1  635  ? 231.748 193.475 185.054 1.00 0.00 ? 635  PRO A CA    1 
ATOM   4978  C  C     . PRO A  1  635  ? 233.175 193.240 185.507 1.00 0.00 ? 635  PRO A C     1 
ATOM   4979  O  O     . PRO A  1  635  ? 233.417 192.823 186.649 1.00 0.00 ? 635  PRO A O     1 
ATOM   4980  C  CB    . PRO A  1  635  ? 231.127 194.678 185.775 1.00 0.00 ? 635  PRO A CB    1 
ATOM   4981  C  CG    . PRO A  1  635  ? 229.694 194.299 185.962 1.00 0.00 ? 635  PRO A CG    1 
ATOM   4982  C  CD    . PRO A  1  635  ? 229.709 192.818 186.208 1.00 0.00 ? 635  PRO A CD    1 
ATOM   4983  N  N     . PRO A  1  636  ? 234.136 193.477 184.638 1.00 0.00 ? 636  PRO A N     1 
ATOM   4984  C  CA    . PRO A  1  636  ? 235.536 193.207 184.978 1.00 0.00 ? 636  PRO A CA    1 
ATOM   4985  C  C     . PRO A  1  636  ? 236.103 194.249 185.921 1.00 0.00 ? 636  PRO A C     1 
ATOM   4986  O  O     . PRO A  1  636  ? 235.360 195.064 186.475 1.00 0.00 ? 636  PRO A O     1 
ATOM   4987  C  CB    . PRO A  1  636  ? 236.238 193.262 183.618 1.00 0.00 ? 636  PRO A CB    1 
ATOM   4988  C  CG    . PRO A  1  636  ? 235.139 193.069 182.622 1.00 0.00 ? 636  PRO A CG    1 
ATOM   4989  C  CD    . PRO A  1  636  ? 233.969 193.763 183.209 1.00 0.00 ? 636  PRO A CD    1 
ATOM   4990  N  N     . LYS A  1  637  ? 237.414 194.223 186.129 1.00 0.00 ? 637  LYS A N     1 
ATOM   4991  C  CA    . LYS A  1  637  ? 238.057 195.414 186.653 1.00 0.00 ? 637  LYS A CA    1 
ATOM   4992  C  C     . LYS A  1  637  ? 237.831 196.561 185.676 1.00 0.00 ? 637  LYS A C     1 
ATOM   4993  O  O     . LYS A  1  637  ? 238.181 196.478 184.496 1.00 0.00 ? 637  LYS A O     1 
ATOM   4994  C  CB    . LYS A  1  637  ? 239.556 195.186 186.855 1.00 0.00 ? 637  LYS A CB    1 
ATOM   4995  C  CG    . LYS A  1  637  ? 239.927 194.560 188.189 1.00 0.00 ? 637  LYS A CG    1 
ATOM   4996  C  CD    . LYS A  1  637  ? 239.450 193.122 188.277 1.00 0.00 ? 637  LYS A CD    1 
ATOM   4997  C  CE    . LYS A  1  637  ? 239.803 192.505 189.611 1.00 0.00 ? 637  LYS A CE    1 
ATOM   4998  N  NZ    . LYS A  1  637  ? 239.313 191.107 189.713 1.00 0.00 ? 637  LYS A NZ    1 
ATOM   4999  N  N     . SER A  1  638  ? 237.230 197.642 186.177 1.00 0.00 ? 638  SER A N     1 
ATOM   5000  C  CA    . SER A  1  638  ? 236.808 198.720 185.292 1.00 0.00 ? 638  SER A CA    1 
ATOM   5001  C  C     . SER A  1  638  ? 237.965 199.348 184.531 1.00 0.00 ? 638  SER A C     1 
ATOM   5002  O  O     . SER A  1  638  ? 237.730 199.995 183.507 1.00 0.00 ? 638  SER A O     1 
ATOM   5003  C  CB    . SER A  1  638  ? 236.067 199.803 186.075 1.00 0.00 ? 638  SER A CB    1 
ATOM   5004  O  OG    . SER A  1  638  ? 235.657 200.848 185.210 1.00 0.00 ? 638  SER A OG    1 
ATOM   5005  N  N     . LYS A  1  639  ? 239.197 199.172 185.003 1.00 0.00 ? 639  LYS A N     1 
ATOM   5006  C  CA    . LYS A  1  639  ? 240.363 199.598 184.238 1.00 0.00 ? 639  LYS A CA    1 
ATOM   5007  C  C     . LYS A  1  639  ? 240.407 198.923 182.878 1.00 0.00 ? 639  LYS A C     1 
ATOM   5008  O  O     . LYS A  1  639  ? 240.699 199.568 181.867 1.00 0.00 ? 639  LYS A O     1 
ATOM   5009  C  CB    . LYS A  1  639  ? 241.638 199.295 185.011 1.00 0.00 ? 639  LYS A CB    1 
ATOM   5010  C  CG    . LYS A  1  639  ? 242.916 199.657 184.261 1.00 0.00 ? 639  LYS A CG    1 
ATOM   5011  C  CD    . LYS A  1  639  ? 242.976 201.141 183.956 1.00 0.00 ? 639  LYS A CD    1 
ATOM   5012  C  CE    . LYS A  1  639  ? 244.310 201.518 183.333 1.00 0.00 ? 639  LYS A CE    1 
ATOM   5013  N  NZ    . LYS A  1  639  ? 244.327 202.926 182.852 1.00 0.00 ? 639  LYS A NZ    1 
ATOM   5014  N  N     . SER A  1  640  ? 240.061 197.641 182.824 1.00 0.00 ? 640  SER A N     1 
ATOM   5015  C  CA    . SER A  1  640  ? 240.037 196.957 181.543 1.00 0.00 ? 640  SER A CA    1 
ATOM   5016  C  C     . SER A  1  640  ? 238.765 197.339 180.809 1.00 0.00 ? 640  SER A C     1 
ATOM   5017  O  O     . SER A  1  640  ? 237.654 197.069 181.276 1.00 0.00 ? 640  SER A O     1 
ATOM   5018  C  CB    . SER A  1  640  ? 240.104 195.448 181.735 1.00 0.00 ? 640  SER A CB    1 
ATOM   5019  O  OG    . SER A  1  640  ? 239.989 194.774 180.494 1.00 0.00 ? 640  SER A OG    1 
ATOM   5020  N  N     . LEU A  1  641  ? 238.930 198.007 179.673 1.00 0.00 ? 641  LEU A N     1 
ATOM   5021  C  CA    . LEU A  1  641  ? 237.764 198.423 178.898 1.00 0.00 ? 641  LEU A CA    1 
ATOM   5022  C  C     . LEU A  1  641  ? 237.058 197.241 178.248 1.00 0.00 ? 641  LEU A C     1 
ATOM   5023  O  O     . LEU A  1  641  ? 235.834 197.114 178.420 1.00 0.00 ? 641  LEU A O     1 
ATOM   5024  C  CB    . LEU A  1  641  ? 238.172 199.499 177.894 1.00 0.00 ? 641  LEU A CB    1 
ATOM   5025  C  CG    . LEU A  1  641  ? 238.676 200.751 178.615 1.00 0.00 ? 641  LEU A CG    1 
ATOM   5026  C  CD1   . LEU A  1  641  ? 239.137 201.812 177.632 1.00 0.00 ? 641  LEU A CD1   1 
ATOM   5027  C  CD2   . LEU A  1  641  ? 237.608 201.293 179.556 1.00 0.00 ? 641  LEU A CD2   1 
ATOM   5028  N  N     . PRO A  1  642  ? 237.727 196.351 177.517 1.00 0.00 ? 642  PRO A N     1 
ATOM   5029  C  CA    . PRO A  1  642  ? 237.013 195.214 176.935 1.00 0.00 ? 642  PRO A CA    1 
ATOM   5030  C  C     . PRO A  1  642  ? 236.519 194.292 178.030 1.00 0.00 ? 642  PRO A C     1 
ATOM   5031  O  O     . PRO A  1  642  ? 237.247 193.898 178.939 1.00 0.00 ? 642  PRO A O     1 
ATOM   5032  C  CB    . PRO A  1  642  ? 238.069 194.526 176.073 1.00 0.00 ? 642  PRO A CB    1 
ATOM   5033  C  CG    . PRO A  1  642  ? 239.319 194.835 176.748 1.00 0.00 ? 642  PRO A CG    1 
ATOM   5034  C  CD    . PRO A  1  642  ? 239.173 196.245 177.243 1.00 0.00 ? 642  PRO A CD    1 
ATOM   5035  N  N     . ASN A  1  643  ? 235.234 193.961 177.930 1.00 0.00 ? 643  ASN A N     1 
ATOM   5036  C  CA    . ASN A  1  643  ? 234.579 193.135 178.926 1.00 0.00 ? 643  ASN A CA    1 
ATOM   5037  C  C     . ASN A  1  643  ? 234.870 191.664 178.709 1.00 0.00 ? 643  ASN A C     1 
ATOM   5038  O  O     . ASN A  1  643  ? 234.572 190.844 179.585 1.00 0.00 ? 643  ASN A O     1 
ATOM   5039  C  CB    . ASN A  1  643  ? 233.079 193.397 178.902 1.00 0.00 ? 643  ASN A CB    1 
ATOM   5040  C  CG    . ASN A  1  643  ? 232.750 194.850 179.119 1.00 0.00 ? 643  ASN A CG    1 
ATOM   5041  O  OD1   . ASN A  1  643  ? 231.943 195.429 178.399 1.00 0.00 ? 643  ASN A OD1   1 
ATOM   5042  N  ND2   . ASN A  1  643  ? 233.398 195.461 180.101 1.00 0.00 ? 643  ASN A ND2   1 
ATOM   5043  N  N     . GLU A  1  644  ? 235.445 191.320 177.559 1.00 0.00 ? 644  GLU A N     1 
ATOM   5044  C  CA    . GLU A  1  644  ? 235.817 189.947 177.265 1.00 0.00 ? 644  GLU A CA    1 
ATOM   5045  C  C     . GLU A  1  644  ? 236.588 189.314 178.405 1.00 0.00 ? 644  GLU A C     1 
ATOM   5046  O  O     . GLU A  1  644  ? 236.216 188.231 178.866 1.00 0.00 ? 644  GLU A O     1 
ATOM   5047  C  CB    . GLU A  1  644  ? 236.659 189.908 175.998 1.00 0.00 ? 644  GLU A CB    1 
ATOM   5048  C  CG    . GLU A  1  644  ? 235.917 190.338 174.754 1.00 0.00 ? 644  GLU A CG    1 
ATOM   5049  C  CD    . GLU A  1  644  ? 235.941 191.835 174.590 1.00 0.00 ? 644  GLU A CD    1 
ATOM   5050  O  OE1   . GLU A  1  644  ? 236.490 192.503 175.486 1.00 0.00 ? 644  GLU A OE1   1 
ATOM   5051  O  OE2   . GLU A  1  644  ? 235.389 192.346 173.596 1.00 0.00 ? 644  GLU A OE2   1 
ATOM   5052  N  N     . MET A  1  645  ? 237.630 189.975 178.892 1.00 0.00 ? 645  MET A N     1 
ATOM   5053  C  CA    . MET A  1  645  ? 238.305 189.573 180.118 1.00 0.00 ? 645  MET A CA    1 
ATOM   5054  C  C     . MET A  1  645  ? 237.416 190.032 181.261 1.00 0.00 ? 645  MET A C     1 
ATOM   5055  O  O     . MET A  1  645  ? 236.978 191.181 181.291 1.00 0.00 ? 645  MET A O     1 
ATOM   5056  C  CB    . MET A  1  645  ? 239.695 190.154 180.206 1.00 0.00 ? 645  MET A CB    1 
ATOM   5057  C  CG    . MET A  1  645  ? 240.620 189.537 179.205 1.00 0.00 ? 645  MET A CG    1 
ATOM   5058  S  SD    . MET A  1  645  ? 242.287 190.181 179.233 1.00 0.00 ? 645  MET A SD    1 
ATOM   5059  C  CE    . MET A  1  645  ? 243.006 189.158 177.951 1.00 0.00 ? 645  MET A CE    1 
ATOM   5060  N  N     . SER A  1  646  ? 237.146 189.129 182.187 1.00 0.00 ? 646  SER A N     1 
ATOM   5061  C  CA    . SER A  1  646  ? 236.283 189.372 183.326 1.00 0.00 ? 646  SER A CA    1 
ATOM   5062  C  C     . SER A  1  646  ? 236.643 188.390 184.432 1.00 0.00 ? 646  SER A C     1 
ATOM   5063  O  O     . SER A  1  646  ? 237.521 187.535 184.269 1.00 0.00 ? 646  SER A O     1 
ATOM   5064  C  CB    . SER A  1  646  ? 234.824 189.233 182.909 1.00 0.00 ? 646  SER A CB    1 
ATOM   5065  O  OG    . SER A  1  646  ? 234.566 187.899 182.516 1.00 0.00 ? 646  SER A OG    1 
ATOM   5066  N  N     . GLN A  1  647  ? 235.957 188.510 185.569 1.00 0.00 ? 647  GLN A N     1 
ATOM   5067  C  CA    . GLN A  1  647  ? 236.124 187.517 186.622 1.00 0.00 ? 647  GLN A CA    1 
ATOM   5068  C  C     . GLN A  1  647  ? 235.776 186.123 186.128 1.00 0.00 ? 647  GLN A C     1 
ATOM   5069  O  O     . GLN A  1  647  ? 236.406 185.145 186.544 1.00 0.00 ? 647  GLN A O     1 
ATOM   5070  C  CB    . GLN A  1  647  ? 235.276 187.885 187.836 1.00 0.00 ? 647  GLN A CB    1 
ATOM   5071  C  CG    . GLN A  1  647  ? 235.797 189.088 188.599 1.00 0.00 ? 647  GLN A CG    1 
ATOM   5072  C  CD    . GLN A  1  647  ? 235.433 190.401 187.943 1.00 0.00 ? 647  GLN A CD    1 
ATOM   5073  O  OE1   . GLN A  1  647  ? 234.783 190.429 186.897 1.00 0.00 ? 647  GLN A OE1   1 
ATOM   5074  N  NE2   . GLN A  1  647  ? 235.866 191.500 188.547 1.00 0.00 ? 647  GLN A NE2   1 
ATOM   5075  N  N     . ASN A  1  648  ? 234.785 186.008 185.248 1.00 0.00 ? 648  ASN A N     1 
ATOM   5076  C  CA    . ASN A  1  648  ? 234.482 184.716 184.641 1.00 0.00 ? 648  ASN A CA    1 
ATOM   5077  C  C     . ASN A  1  648  ? 233.942 184.963 183.244 1.00 0.00 ? 648  ASN A C     1 
ATOM   5078  O  O     . ASN A  1  648  ? 233.269 185.972 183.015 1.00 0.00 ? 648  ASN A O     1 
ATOM   5079  C  CB    . ASN A  1  648  ? 233.480 183.931 185.475 1.00 0.00 ? 648  ASN A CB    1 
ATOM   5080  C  CG    . ASN A  1  648  ? 232.134 184.612 185.562 1.00 0.00 ? 648  ASN A CG    1 
ATOM   5081  O  OD1   . ASN A  1  648  ? 232.014 185.813 185.335 1.00 0.00 ? 648  ASN A OD1   1 
ATOM   5082  N  ND2   . ASN A  1  648  ? 231.104 183.837 185.871 1.00 0.00 ? 648  ASN A ND2   1 
ATOM   5083  N  N     . ASP A  1  649  ? 234.252 184.055 182.328 1.00 0.00 ? 649  ASP A N     1 
ATOM   5084  C  CA    . ASP A  1  649  ? 233.593 183.973 181.023 1.00 0.00 ? 649  ASP A CA    1 
ATOM   5085  C  C     . ASP A  1  649  ? 233.604 185.363 180.401 1.00 0.00 ? 649  ASP A C     1 
ATOM   5086  O  O     . ASP A  1  649  ? 234.642 186.036 180.383 1.00 0.00 ? 649  ASP A O     1 
ATOM   5087  C  CB    . ASP A  1  649  ? 232.240 183.378 181.234 1.00 0.00 ? 649  ASP A CB    1 
ATOM   5088  C  CG    . ASP A  1  649  ? 232.320 182.013 181.864 1.00 0.00 ? 649  ASP A CG    1 
ATOM   5089  O  OD1   . ASP A  1  649  ? 233.408 181.400 181.799 1.00 0.00 ? 649  ASP A OD1   1 
ATOM   5090  O  OD2   . ASP A  1  649  ? 231.322 181.572 182.468 1.00 0.00 ? 649  ASP A OD2   1 
ATOM   5091  N  N     . GLY A  1  650  ? 232.466 185.824 179.896 1.00 0.00 ? 650  GLY A N     1 
ATOM   5092  C  CA    . GLY A  1  650  ? 232.430 187.189 179.424 1.00 0.00 ? 650  GLY A CA    1 
ATOM   5093  C  C     . GLY A  1  650  ? 231.484 187.421 178.273 1.00 0.00 ? 650  GLY A C     1 
ATOM   5094  O  O     . GLY A  1  650  ? 230.461 186.745 178.136 1.00 0.00 ? 650  GLY A O     1 
ATOM   5095  N  N     . PHE A  1  651  ? 231.816 188.419 177.464 1.00 0.00 ? 651  PHE A N     1 
ATOM   5096  C  CA    . PHE A  1  651  ? 231.327 188.451 176.101 1.00 0.00 ? 651  PHE A CA    1 
ATOM   5097  C  C     . PHE A  1  651  ? 231.569 187.103 175.449 1.00 0.00 ? 651  PHE A C     1 
ATOM   5098  O  O     . PHE A  1  651  ? 232.600 186.463 175.671 1.00 0.00 ? 651  PHE A O     1 
ATOM   5099  C  CB    . PHE A  1  651  ? 232.051 189.511 175.275 1.00 0.00 ? 651  PHE A CB    1 
ATOM   5100  C  CG    . PHE A  1  651  ? 231.730 190.920 175.643 1.00 0.00 ? 651  PHE A CG    1 
ATOM   5101  C  CD1   . PHE A  1  651  ? 230.610 191.237 176.383 1.00 0.00 ? 651  PHE A CD1   1 
ATOM   5102  C  CD2   . PHE A  1  651  ? 232.546 191.944 175.200 1.00 0.00 ? 651  PHE A CD2   1 
ATOM   5103  C  CE1   . PHE A  1  651  ? 230.333 192.554 176.698 1.00 0.00 ? 651  PHE A CE1   1 
ATOM   5104  C  CE2   . PHE A  1  651  ? 232.270 193.252 175.505 1.00 0.00 ? 651  PHE A CE2   1 
ATOM   5105  C  CZ    . PHE A  1  651  ? 231.157 193.559 176.248 1.00 0.00 ? 651  PHE A CZ    1 
ATOM   5106  N  N     . VAL A  1  652  ? 230.610 186.661 174.653 1.00 0.00 ? 652  VAL A N     1 
ATOM   5107  C  CA    . VAL A  1  652  ? 230.934 185.645 173.672 1.00 0.00 ? 652  VAL A CA    1 
ATOM   5108  C  C     . VAL A  1  652  ? 231.288 186.390 172.406 1.00 0.00 ? 652  VAL A C     1 
ATOM   5109  O  O     . VAL A  1  652  ? 230.416 186.955 171.739 1.00 0.00 ? 652  VAL A O     1 
ATOM   5110  C  CB    . VAL A  1  652  ? 229.770 184.682 173.436 1.00 0.00 ? 652  VAL A CB    1 
ATOM   5111  C  CG1   . VAL A  1  652  ? 230.094 183.762 172.289 1.00 0.00 ? 652  VAL A CG1   1 
ATOM   5112  C  CG2   . VAL A  1  652  ? 229.523 183.893 174.665 1.00 0.00 ? 652  VAL A CG2   1 
ATOM   5113  N  N     . ILE A  1  653  ? 232.560 186.399 172.063 1.00 0.00 ? 653  ILE A N     1 
ATOM   5114  C  CA    . ILE A  1  653  ? 232.975 187.049 170.835 1.00 0.00 ? 653  ILE A CA    1 
ATOM   5115  C  C     . ILE A  1  653  ? 233.592 186.012 169.920 1.00 0.00 ? 653  ILE A C     1 
ATOM   5116  O  O     . ILE A  1  653  ? 234.537 185.308 170.290 1.00 0.00 ? 653  ILE A O     1 
ATOM   5117  C  CB    . ILE A  1  653  ? 233.933 188.209 171.117 1.00 0.00 ? 653  ILE A CB    1 
ATOM   5118  C  CG1   . ILE A  1  653  ? 234.342 188.843 169.792 1.00 0.00 ? 653  ILE A CG1   1 
ATOM   5119  C  CG2   . ILE A  1  653  ? 235.115 187.746 171.930 1.00 0.00 ? 653  ILE A CG2   1 
ATOM   5120  C  CD1   . ILE A  1  653  ? 234.958 190.190 169.930 1.00 0.00 ? 653  ILE A CD1   1 
ATOM   5121  N  N     . ILE A  1  654  ? 233.024 185.890 168.732 1.00 0.00 ? 654  ILE A N     1 
ATOM   5122  C  CA    . ILE A  1  654  ? 233.379 184.855 167.781 1.00 0.00 ? 654  ILE A CA    1 
ATOM   5123  C  C     . ILE A  1  654  ? 233.970 185.546 166.568 1.00 0.00 ? 654  ILE A C     1 
ATOM   5124  O  O     . ILE A  1  654  ? 233.486 186.607 166.163 1.00 0.00 ? 654  ILE A O     1 
ATOM   5125  C  CB    . ILE A  1  654  ? 232.148 184.016 167.408 1.00 0.00 ? 654  ILE A CB    1 
ATOM   5126  C  CG1   . ILE A  1  654  ? 231.595 183.338 168.655 1.00 0.00 ? 654  ILE A CG1   1 
ATOM   5127  C  CG2   . ILE A  1  654  ? 232.492 182.984 166.370 1.00 0.00 ? 654  ILE A CG2   1 
ATOM   5128  C  CD1   . ILE A  1  654  ? 230.240 182.740 168.463 1.00 0.00 ? 654  ILE A CD1   1 
ATOM   5129  N  N     . ARG A  1  655  ? 235.034 184.975 166.016 1.00 0.00 ? 655  ARG A N     1 
ATOM   5130  C  CA    . ARG A  1  655  ? 235.674 185.519 164.827 1.00 0.00 ? 655  ARG A CA    1 
ATOM   5131  C  C     . ARG A  1  655  ? 236.041 184.360 163.925 1.00 0.00 ? 655  ARG A C     1 
ATOM   5132  O  O     . ARG A  1  655  ? 236.441 183.301 164.415 1.00 0.00 ? 655  ARG A O     1 
ATOM   5133  C  CB    . ARG A  1  655  ? 236.916 186.332 165.186 1.00 0.00 ? 655  ARG A CB    1 
ATOM   5134  C  CG    . ARG A  1  655  ? 236.615 187.505 166.072 1.00 0.00 ? 655  ARG A CG    1 
ATOM   5135  C  CD    . ARG A  1  655  ? 235.775 188.516 165.345 1.00 0.00 ? 655  ARG A CD    1 
ATOM   5136  N  NE    . ARG A  1  655  ? 235.410 189.615 166.224 1.00 0.00 ? 655  ARG A NE    1 
ATOM   5137  C  CZ    . ARG A  1  655  ? 236.186 190.662 166.451 1.00 0.00 ? 655  ARG A CZ    1 
ATOM   5138  N  NH1   . ARG A  1  655  ? 237.370 190.744 165.866 1.00 0.00 ? 655  ARG A NH1   1 
ATOM   5139  N  NH2   . ARG A  1  655  ? 235.785 191.623 167.265 1.00 0.00 ? 655  ARG A NH2   1 
ATOM   5140  N  N     . GLY A  1  656  ? 235.897 184.554 162.620 1.00 0.00 ? 656  GLY A N     1 
ATOM   5141  C  CA    . GLY A  1  656  ? 236.226 183.505 161.675 1.00 0.00 ? 656  GLY A CA    1 
ATOM   5142  C  C     . GLY A  1  656  ? 235.548 182.192 161.991 1.00 0.00 ? 656  GLY A C     1 
ATOM   5143  O  O     . GLY A  1  656  ? 236.107 181.126 161.706 1.00 0.00 ? 656  GLY A O     1 
ATOM   5144  N  N     . SER A  1  657  ? 234.365 182.247 162.596 1.00 0.00 ? 657  SER A N     1 
ATOM   5145  C  CA    . SER A  1  657  ? 233.650 181.059 163.042 1.00 0.00 ? 657  SER A CA    1 
ATOM   5146  C  C     . SER A  1  657  ? 234.510 180.204 163.958 1.00 0.00 ? 657  SER A C     1 
ATOM   5147  O  O     . SER A  1  657  ? 234.569 178.984 163.821 1.00 0.00 ? 657  SER A O     1 
ATOM   5148  C  CB    . SER A  1  657  ? 233.133 180.246 161.859 1.00 0.00 ? 657  SER A CB    1 
ATOM   5149  O  OG    . SER A  1  657  ? 232.142 180.986 161.174 1.00 0.00 ? 657  SER A OG    1 
ATOM   5150  N  N     . GLN A  1  658  ? 235.206 180.850 164.879 1.00 0.00 ? 658  GLN A N     1 
ATOM   5151  C  CA    . GLN A  1  658  ? 235.797 180.183 166.024 1.00 0.00 ? 658  GLN A CA    1 
ATOM   5152  C  C     . GLN A  1  658  ? 235.318 180.907 167.261 1.00 0.00 ? 658  GLN A C     1 
ATOM   5153  O  O     . GLN A  1  658  ? 235.228 182.135 167.259 1.00 0.00 ? 658  GLN A O     1 
ATOM   5154  C  CB    . GLN A  1  658  ? 237.320 180.189 165.975 1.00 0.00 ? 658  GLN A CB    1 
ATOM   5155  C  CG    . GLN A  1  658  ? 237.888 179.292 164.923 1.00 0.00 ? 658  GLN A CG    1 
ATOM   5156  C  CD    . GLN A  1  658  ? 239.393 179.324 164.905 1.00 0.00 ? 658  GLN A CD    1 
ATOM   5157  O  OE1   . GLN A  1  658  ? 240.008 180.296 165.339 1.00 0.00 ? 658  GLN A OE1   1 
ATOM   5158  N  NE2   . GLN A  1  658  ? 240.000 178.258 164.403 1.00 0.00 ? 658  GLN A NE2   1 
ATOM   5159  N  N     . ILE A  1  659  ? 234.990 180.162 168.304 1.00 0.00 ? 659  ILE A N     1 
ATOM   5160  C  CA    . ILE A  1  659  ? 234.701 180.800 169.577 1.00 0.00 ? 659  ILE A CA    1 
ATOM   5161  C  C     . ILE A  1  659  ? 236.018 181.226 170.199 1.00 0.00 ? 659  ILE A C     1 
ATOM   5162  O  O     . ILE A  1  659  ? 237.033 180.539 170.063 1.00 0.00 ? 659  ILE A O     1 
ATOM   5163  C  CB    . ILE A  1  659  ? 233.897 179.877 170.497 1.00 0.00 ? 659  ILE A CB    1 
ATOM   5164  C  CG1   . ILE A  1  659  ? 232.470 179.797 169.974 1.00 0.00 ? 659  ILE A CG1   1 
ATOM   5165  C  CG2   . ILE A  1  659  ? 233.894 180.400 171.898 1.00 0.00 ? 659  ILE A CG2   1 
ATOM   5166  C  CD1   . ILE A  1  659  ? 231.624 178.848 170.723 1.00 0.00 ? 659  ILE A CD1   1 
ATOM   5167  N  N     . LEU A  1  660  ? 236.018 182.397 170.824 1.00 0.00 ? 660  LEU A N     1 
ATOM   5168  C  CA    . LEU A  1  660  ? 237.225 182.975 171.395 1.00 0.00 ? 660  LEU A CA    1 
ATOM   5169  C  C     . LEU A  1  660  ? 237.104 183.114 172.908 1.00 0.00 ? 660  LEU A C     1 
ATOM   5170  O  O     . LEU A  1  660  ? 237.905 182.545 173.651 1.00 0.00 ? 660  LEU A O     1 
ATOM   5171  C  CB    . LEU A  1  660  ? 237.519 184.324 170.744 1.00 0.00 ? 660  LEU A CB    1 
ATOM   5172  C  CG    . LEU A  1  660  ? 238.351 184.292 169.463 1.00 0.00 ? 660  LEU A CG    1 
ATOM   5173  C  CD1   . LEU A  1  660  ? 237.676 183.567 168.341 1.00 0.00 ? 660  LEU A CD1   1 
ATOM   5174  C  CD2   . LEU A  1  660  ? 238.666 185.699 169.024 1.00 0.00 ? 660  LEU A CD2   1 
ATOM   5175  N  N     . SER A  1  661  ? 236.131 183.887 173.378 1.00 0.00 ? 661  SER A N     1 
ATOM   5176  C  CA    . SER A  1  661  ? 235.992 184.100 174.808 1.00 0.00 ? 661  SER A CA    1 
ATOM   5177  C  C     . SER A  1  661  ? 234.560 183.846 175.255 1.00 0.00 ? 661  SER A C     1 
ATOM   5178  O  O     . SER A  1  661  ? 233.601 184.093 174.522 1.00 0.00 ? 661  SER A O     1 
ATOM   5179  C  CB    . SER A  1  661  ? 236.411 185.513 175.206 1.00 0.00 ? 661  SER A CB    1 
ATOM   5180  O  OG    . SER A  1  661  ? 236.202 185.723 176.590 1.00 0.00 ? 661  SER A OG    1 
ATOM   5181  N  N     . GLY A  1  662  ? 234.438 183.343 176.480 1.00 0.00 ? 662  GLY A N     1 
ATOM   5182  C  CA    . GLY A  1  662  ? 233.162 183.235 177.150 1.00 0.00 ? 662  GLY A CA    1 
ATOM   5183  C  C     . GLY A  1  662  ? 232.454 181.912 176.967 1.00 0.00 ? 662  GLY A C     1 
ATOM   5184  O  O     . GLY A  1  662  ? 232.706 181.196 175.997 1.00 0.00 ? 662  GLY A O     1 
ATOM   5185  N  N     . VAL A  1  663  ? 231.564 181.586 177.899 1.00 0.00 ? 663  VAL A N     1 
ATOM   5186  C  CA    . VAL A  1  663  ? 230.705 180.424 177.737 1.00 0.00 ? 663  VAL A CA    1 
ATOM   5187  C  C     . VAL A  1  663  ? 229.401 180.855 177.087 1.00 0.00 ? 663  VAL A C     1 
ATOM   5188  O  O     . VAL A  1  663  ? 229.108 182.041 176.957 1.00 0.00 ? 663  VAL A O     1 
ATOM   5189  C  CB    . VAL A  1  663  ? 230.433 179.745 179.081 1.00 0.00 ? 663  VAL A CB    1 
ATOM   5190  C  CG1   . VAL A  1  663  ? 231.723 179.347 179.735 1.00 0.00 ? 663  VAL A CG1   1 
ATOM   5191  C  CG2   . VAL A  1  663  ? 229.627 180.686 179.969 1.00 0.00 ? 663  VAL A CG2   1 
ATOM   5192  N  N     . MET A  1  664  ? 228.567 179.880 176.764 1.00 0.00 ? 664  MET A N     1 
ATOM   5193  C  CA    . MET A  1  664  ? 227.496 180.187 175.831 1.00 0.00 ? 664  MET A CA    1 
ATOM   5194  C  C     . MET A  1  664  ? 226.152 180.276 176.528 1.00 0.00 ? 664  MET A C     1 
ATOM   5195  O  O     . MET A  1  664  ? 225.658 181.380 176.770 1.00 0.00 ? 664  MET A O     1 
ATOM   5196  C  CB    . MET A  1  664  ? 227.510 179.155 174.730 1.00 0.00 ? 664  MET A CB    1 
ATOM   5197  C  CG    . MET A  1  664  ? 228.823 179.220 174.029 1.00 0.00 ? 664  MET A CG    1 
ATOM   5198  S  SD    . MET A  1  664  ? 228.819 178.081 172.689 1.00 0.00 ? 664  MET A SD    1 
ATOM   5199  C  CE    . MET A  1  664  ? 228.772 176.562 173.615 1.00 0.00 ? 664  MET A CE    1 
ATOM   5200  N  N     . ASP A  1  665  ? 225.570 179.138 176.882 1.00 0.00 ? 665  ASP A N     1 
ATOM   5201  C  CA    . ASP A  1  665  ? 224.632 179.151 177.988 1.00 0.00 ? 665  ASP A CA    1 
ATOM   5202  C  C     . ASP A  1  665  ? 223.400 180.016 177.750 1.00 0.00 ? 665  ASP A C     1 
ATOM   5203  O  O     . ASP A  1  665  ? 223.322 181.141 178.250 1.00 0.00 ? 665  ASP A O     1 
ATOM   5204  C  CB    . ASP A  1  665  ? 225.371 179.639 179.219 1.00 0.00 ? 665  ASP A CB    1 
ATOM   5205  C  CG    . ASP A  1  665  ? 224.565 179.507 180.447 1.00 0.00 ? 665  ASP A CG    1 
ATOM   5206  O  OD1   . ASP A  1  665  ? 224.475 178.368 180.949 1.00 0.00 ? 665  ASP A OD1   1 
ATOM   5207  O  OD2   . ASP A  1  665  ? 223.995 180.529 180.877 1.00 0.00 ? 665  ASP A OD2   1 
ATOM   5208  N  N     . LYS A  1  666  ? 222.456 179.520 176.954 1.00 0.00 ? 666  LYS A N     1 
ATOM   5209  C  CA    . LYS A  1  666  ? 221.326 180.304 176.478 1.00 0.00 ? 666  LYS A CA    1 
ATOM   5210  C  C     . LYS A  1  666  ? 221.930 181.489 175.745 1.00 0.00 ? 666  LYS A C     1 
ATOM   5211  O  O     . LYS A  1  666  ? 222.959 181.313 175.082 1.00 0.00 ? 666  LYS A O     1 
ATOM   5212  C  CB    . LYS A  1  666  ? 220.397 180.727 177.626 1.00 0.00 ? 666  LYS A CB    1 
ATOM   5213  C  CG    . LYS A  1  666  ? 219.047 181.301 177.196 1.00 0.00 ? 666  LYS A CG    1 
ATOM   5214  C  CD    . LYS A  1  666  ? 218.198 181.704 178.394 1.00 0.00 ? 666  LYS A CD    1 
ATOM   5215  C  CE    . LYS A  1  666  ? 216.867 182.306 177.966 1.00 0.00 ? 666  LYS A CE    1 
ATOM   5216  N  NZ    . LYS A  1  666  ? 216.027 182.730 179.123 1.00 0.00 ? 666  LYS A NZ    1 
ATOM   5217  N  N     . SER A  1  667  ? 221.356 182.686 175.871 1.00 0.00 ? 667  SER A N     1 
ATOM   5218  C  CA    . SER A  1  667  ? 221.967 183.846 175.244 1.00 0.00 ? 667  SER A CA    1 
ATOM   5219  C  C     . SER A  1  667  ? 222.254 183.552 173.781 1.00 0.00 ? 667  SER A C     1 
ATOM   5220  O  O     . SER A  1  667  ? 221.337 183.429 172.968 1.00 0.00 ? 667  SER A O     1 
ATOM   5221  C  CB    . SER A  1  667  ? 223.249 184.233 175.957 1.00 0.00 ? 667  SER A CB    1 
ATOM   5222  O  OG    . SER A  1  667  ? 224.214 183.209 175.828 1.00 0.00 ? 667  SER A OG    1 
ATOM   5223  N  N     . VAL A  1  668  ? 223.544 183.444 173.457 1.00 0.00 ? 668  VAL A N     1 
ATOM   5224  C  CA    . VAL A  1  668  ? 224.021 183.205 172.097 1.00 0.00 ? 668  VAL A CA    1 
ATOM   5225  C  C     . VAL A  1  668  ? 223.294 182.100 171.345 1.00 0.00 ? 668  VAL A C     1 
ATOM   5226  O  O     . VAL A  1  668  ? 222.938 182.297 170.180 1.00 0.00 ? 668  VAL A O     1 
ATOM   5227  C  CB    . VAL A  1  668  ? 225.527 182.898 172.160 1.00 0.00 ? 668  VAL A CB    1 
ATOM   5228  C  CG1   . VAL A  1  668  ? 226.262 184.103 172.666 1.00 0.00 ? 668  VAL A CG1   1 
ATOM   5229  C  CG2   . VAL A  1  668  ? 225.780 181.755 173.082 1.00 0.00 ? 668  VAL A CG2   1 
ATOM   5230  N  N     . LEU A  1  669  ? 223.106 180.924 171.930 1.00 0.00 ? 669  LEU A N     1 
ATOM   5231  C  CA    . LEU A  1  669  ? 222.272 179.947 171.223 1.00 0.00 ? 669  LEU A CA    1 
ATOM   5232  C  C     . LEU A  1  669  ? 220.848 179.910 171.762 1.00 0.00 ? 669  LEU A C     1 
ATOM   5233  O  O     . LEU A  1  669  ? 220.067 179.050 171.345 1.00 0.00 ? 669  LEU A O     1 
ATOM   5234  C  CB    . LEU A  1  669  ? 222.946 178.579 171.246 1.00 0.00 ? 669  LEU A CB    1 
ATOM   5235  C  CG    . LEU A  1  669  ? 223.367 178.029 172.593 1.00 0.00 ? 669  LEU A CG    1 
ATOM   5236  C  CD1   . LEU A  1  669  ? 222.207 177.403 173.309 1.00 0.00 ? 669  LEU A CD1   1 
ATOM   5237  C  CD2   . LEU A  1  669  ? 224.473 177.034 172.383 1.00 0.00 ? 669  LEU A CD2   1 
ATOM   5238  N  N     . GLY A  1  670  ? 220.488 180.822 172.651 1.00 0.00 ? 670  GLY A N     1 
ATOM   5239  C  CA    . GLY A  1  670  ? 219.437 180.630 173.625 1.00 0.00 ? 670  GLY A CA    1 
ATOM   5240  C  C     . GLY A  1  670  ? 218.016 181.101 173.410 1.00 0.00 ? 670  GLY A C     1 
ATOM   5241  O  O     . GLY A  1  670  ? 217.355 181.405 174.407 1.00 0.00 ? 670  GLY A O     1 
ATOM   5242  N  N     . ASP A  1  671  ? 217.532 181.207 172.173 1.00 0.00 ? 671  ASP A N     1 
ATOM   5243  C  CA    . ASP A  1  671  ? 216.100 181.431 172.014 1.00 0.00 ? 671  ASP A CA    1 
ATOM   5244  C  C     . ASP A  1  671  ? 215.608 182.760 172.570 1.00 0.00 ? 671  ASP A C     1 
ATOM   5245  O  O     . ASP A  1  671  ? 215.087 182.815 173.686 1.00 0.00 ? 671  ASP A O     1 
ATOM   5246  C  CB    . ASP A  1  671  ? 215.328 180.285 172.672 1.00 0.00 ? 671  ASP A CB    1 
ATOM   5247  C  CG    . ASP A  1  671  ? 213.828 180.456 172.590 1.00 0.00 ? 671  ASP A CG    1 
ATOM   5248  O  OD1   . ASP A  1  671  ? 213.344 181.373 171.897 1.00 0.00 ? 671  ASP A OD1   1 
ATOM   5249  O  OD2   . ASP A  1  671  ? 213.124 179.682 173.266 1.00 0.00 ? 671  ASP A OD2   1 
ATOM   5250  N  N     . GLY A  1  672  ? 215.743 183.835 171.805 1.00 0.00 ? 672  GLY A N     1 
ATOM   5251  C  CA    . GLY A  1  672  ? 215.129 185.066 172.251 1.00 0.00 ? 672  GLY A CA    1 
ATOM   5252  C  C     . GLY A  1  672  ? 215.988 186.254 172.618 1.00 0.00 ? 672  GLY A C     1 
ATOM   5253  O  O     . GLY A  1  672  ? 215.540 187.127 173.361 1.00 0.00 ? 672  GLY A O     1 
ATOM   5254  N  N     . LYS A  1  673  ? 217.228 186.292 172.156 1.00 0.00 ? 673  LYS A N     1 
ATOM   5255  C  CA    . LYS A  1  673  ? 217.901 187.567 171.986 1.00 0.00 ? 673  LYS A CA    1 
ATOM   5256  C  C     . LYS A  1  673  ? 218.390 187.665 170.549 1.00 0.00 ? 673  LYS A C     1 
ATOM   5257  O  O     . LYS A  1  673  ? 218.904 186.700 169.977 1.00 0.00 ? 673  LYS A O     1 
ATOM   5258  C  CB    . LYS A  1  673  ? 219.048 187.751 172.982 1.00 0.00 ? 673  LYS A CB    1 
ATOM   5259  C  CG    . LYS A  1  673  ? 218.621 187.731 174.456 1.00 0.00 ? 673  LYS A CG    1 
ATOM   5260  C  CD    . LYS A  1  673  ? 217.607 188.817 174.809 1.00 0.00 ? 673  LYS A CD    1 
ATOM   5261  C  CE    . LYS A  1  673  ? 218.230 190.201 174.921 1.00 0.00 ? 673  LYS A CE    1 
ATOM   5262  N  NZ    . LYS A  1  673  ? 217.224 191.194 175.390 1.00 0.00 ? 673  LYS A NZ    1 
ATOM   5263  N  N     . LYS A  1  674  ? 218.187 188.849 169.961 1.00 0.00 ? 674  LYS A N     1 
ATOM   5264  C  CA    . LYS A  1  674  ? 218.553 189.103 168.571 1.00 0.00 ? 674  LYS A CA    1 
ATOM   5265  C  C     . LYS A  1  674  ? 219.965 188.634 168.263 1.00 0.00 ? 674  LYS A C     1 
ATOM   5266  O  O     . LYS A  1  674  ? 220.155 187.761 167.411 1.00 0.00 ? 674  LYS A O     1 
ATOM   5267  C  CB    . LYS A  1  674  ? 218.419 190.588 168.254 1.00 0.00 ? 674  LYS A CB    1 
ATOM   5268  C  CG    . LYS A  1  674  ? 217.014 191.123 168.362 1.00 0.00 ? 674  LYS A CG    1 
ATOM   5269  C  CD    . LYS A  1  674  ? 216.139 190.563 167.268 1.00 0.00 ? 674  LYS A CD    1 
ATOM   5270  C  CE    . LYS A  1  674  ? 214.735 191.097 167.402 1.00 0.00 ? 674  LYS A CE    1 
ATOM   5271  N  NZ    . LYS A  1  674  ? 214.690 192.571 167.233 1.00 0.00 ? 674  LYS A NZ    1 
ATOM   5272  N  N     . HIS A  1  675  ? 220.965 189.215 168.916 1.00 0.00 ? 675  HIS A N     1 
ATOM   5273  C  CA    . HIS A  1  675  ? 222.322 188.693 168.840 1.00 0.00 ? 675  HIS A CA    1 
ATOM   5274  C  C     . HIS A  1  675  ? 222.287 187.257 169.332 1.00 0.00 ? 675  HIS A C     1 
ATOM   5275  O  O     . HIS A  1  675  ? 221.799 186.983 170.431 1.00 0.00 ? 675  HIS A O     1 
ATOM   5276  C  CB    . HIS A  1  675  ? 223.271 189.530 169.683 1.00 0.00 ? 675  HIS A CB    1 
ATOM   5277  C  CG    . HIS A  1  675  ? 222.915 189.548 171.133 1.00 0.00 ? 675  HIS A CG    1 
ATOM   5278  N  ND1   . HIS A  1  675  ? 221.886 190.314 171.632 1.00 0.00 ? 675  HIS A ND1   1 
ATOM   5279  C  CD2   . HIS A  1  675  ? 223.423 188.867 172.187 1.00 0.00 ? 675  HIS A CD2   1 
ATOM   5280  C  CE1   . HIS A  1  675  ? 221.788 190.121 172.935 1.00 0.00 ? 675  HIS A CE1   1 
ATOM   5281  N  NE2   . HIS A  1  675  ? 222.710 189.247 173.297 1.00 0.00 ? 675  HIS A NE2   1 
ATOM   5282  N  N     . SER A  1  676  ? 222.799 186.339 168.523 1.00 0.00 ? 676  SER A N     1 
ATOM   5283  C  CA    . SER A  1  676  ? 222.641 184.920 168.787 1.00 0.00 ? 676  SER A CA    1 
ATOM   5284  C  C     . SER A  1  676  ? 223.367 184.139 167.707 1.00 0.00 ? 676  SER A C     1 
ATOM   5285  O  O     . SER A  1  676  ? 223.650 184.668 166.632 1.00 0.00 ? 676  SER A O     1 
ATOM   5286  C  CB    . SER A  1  676  ? 221.166 184.504 168.813 1.00 0.00 ? 676  SER A CB    1 
ATOM   5287  O  OG    . SER A  1  676  ? 220.469 185.117 169.885 1.00 0.00 ? 676  SER A OG    1 
ATOM   5288  N  N     . VAL A  1  677  ? 223.654 182.871 167.991 1.00 0.00 ? 677  VAL A N     1 
ATOM   5289  C  CA    . VAL A  1  677  ? 224.375 182.064 167.017 1.00 0.00 ? 677  VAL A CA    1 
ATOM   5290  C  C     . VAL A  1  677  ? 223.412 181.472 166.008 1.00 0.00 ? 677  VAL A C     1 
ATOM   5291  O  O     . VAL A  1  677  ? 223.458 181.793 164.815 1.00 0.00 ? 677  VAL A O     1 
ATOM   5292  C  CB    . VAL A  1  677  ? 225.192 180.966 167.707 1.00 0.00 ? 677  VAL A CB    1 
ATOM   5293  C  CG1   . VAL A  1  677  ? 225.845 180.112 166.653 1.00 0.00 ? 677  VAL A CG1   1 
ATOM   5294  C  CG2   . VAL A  1  677  ? 226.223 181.583 168.612 1.00 0.00 ? 677  VAL A CG2   1 
ATOM   5295  N  N     . PHE A  1  678  ? 222.519 180.602 166.470 1.00 0.00 ? 678  PHE A N     1 
ATOM   5296  C  CA    . PHE A  1  678  ? 221.536 180.009 165.575 1.00 0.00 ? 678  PHE A CA    1 
ATOM   5297  C  C     . PHE A  1  678  ? 220.659 181.060 164.928 1.00 0.00 ? 678  PHE A C     1 
ATOM   5298  O  O     . PHE A  1  678  ? 219.941 180.761 163.970 1.00 0.00 ? 678  PHE A O     1 
ATOM   5299  C  CB    . PHE A  1  678  ? 220.700 178.998 166.336 1.00 0.00 ? 678  PHE A CB    1 
ATOM   5300  C  CG    . PHE A  1  678  ? 221.465 177.791 166.716 1.00 0.00 ? 678  PHE A CG    1 
ATOM   5301  C  CD1   . PHE A  1  678  ? 222.545 177.402 165.960 1.00 0.00 ? 678  PHE A CD1   1 
ATOM   5302  C  CD2   . PHE A  1  678  ? 221.153 177.079 167.851 1.00 0.00 ? 678  PHE A CD2   1 
ATOM   5303  C  CE1   . PHE A  1  678  ? 223.268 176.298 166.292 1.00 0.00 ? 678  PHE A CE1   1 
ATOM   5304  C  CE2   . PHE A  1  678  ? 221.880 175.975 168.194 1.00 0.00 ? 678  PHE A CE2   1 
ATOM   5305  C  CZ    . PHE A  1  678  ? 222.943 175.586 167.412 1.00 0.00 ? 678  PHE A CZ    1 
ATOM   5306  N  N     . TYR A  1  679  ? 220.697 182.287 165.430 1.00 0.00 ? 679  TYR A N     1 
ATOM   5307  C  CA    . TYR A  1  679  ? 220.127 183.381 164.666 1.00 0.00 ? 679  TYR A CA    1 
ATOM   5308  C  C     . TYR A  1  679  ? 221.075 183.833 163.571 1.00 0.00 ? 679  TYR A C     1 
ATOM   5309  O  O     . TYR A  1  679  ? 220.752 183.701 162.389 1.00 0.00 ? 679  TYR A O     1 
ATOM   5310  C  CB    . TYR A  1  679  ? 219.790 184.547 165.578 1.00 0.00 ? 679  TYR A CB    1 
ATOM   5311  C  CG    . TYR A  1  679  ? 219.265 185.727 164.825 1.00 0.00 ? 679  TYR A CG    1 
ATOM   5312  C  CD1   . TYR A  1  679  ? 217.962 185.764 164.394 1.00 0.00 ? 679  TYR A CD1   1 
ATOM   5313  C  CD2   . TYR A  1  679  ? 220.076 186.790 164.521 1.00 0.00 ? 679  TYR A CD2   1 
ATOM   5314  C  CE1   . TYR A  1  679  ? 217.478 186.837 163.701 1.00 0.00 ? 679  TYR A CE1   1 
ATOM   5315  C  CE2   . TYR A  1  679  ? 219.601 187.860 163.828 1.00 0.00 ? 679  TYR A CE2   1 
ATOM   5316  C  CZ    . TYR A  1  679  ? 218.304 187.880 163.417 1.00 0.00 ? 679  TYR A CZ    1 
ATOM   5317  O  OH    . TYR A  1  679  ? 217.837 188.962 162.716 1.00 0.00 ? 679  TYR A OH    1 
ATOM   5318  N  N     . THR A  1  680  ? 222.248 184.345 163.948 1.00 0.00 ? 680  THR A N     1 
ATOM   5319  C  CA    . THR A  1  680  ? 223.178 184.922 162.984 1.00 0.00 ? 680  THR A CA    1 
ATOM   5320  C  C     . THR A  1  680  ? 223.454 183.997 161.812 1.00 0.00 ? 680  THR A C     1 
ATOM   5321  O  O     . THR A  1  680  ? 223.440 184.448 160.663 1.00 0.00 ? 680  THR A O     1 
ATOM   5322  C  CB    . THR A  1  680  ? 224.485 185.271 163.674 1.00 0.00 ? 680  THR A CB    1 
ATOM   5323  O  OG1   . THR A  1  680  ? 224.238 186.263 164.672 1.00 0.00 ? 680  THR A OG1   1 
ATOM   5324  C  CG2   . THR A  1  680  ? 225.475 185.807 162.680 1.00 0.00 ? 680  THR A CG2   1 
ATOM   5325  N  N     . ILE A  1  681  ? 223.710 182.715 162.074 1.00 0.00 ? 681  ILE A N     1 
ATOM   5326  C  CA    . ILE A  1  681  ? 223.916 181.766 160.985 1.00 0.00 ? 681  ILE A CA    1 
ATOM   5327  C  C     . ILE A  1  681  ? 222.784 181.855 159.979 1.00 0.00 ? 681  ILE A C     1 
ATOM   5328  O  O     . ILE A  1  681  ? 223.014 181.908 158.766 1.00 0.00 ? 681  ILE A O     1 
ATOM   5329  C  CB    . ILE A  1  681  ? 224.049 180.340 161.535 1.00 0.00 ? 681  ILE A CB    1 
ATOM   5330  C  CG1   . ILE A  1  681  ? 225.318 180.215 162.348 1.00 0.00 ? 681  ILE A CG1   1 
ATOM   5331  C  CG2   . ILE A  1  681  ? 224.060 179.343 160.412 1.00 0.00 ? 681  ILE A CG2   1 
ATOM   5332  C  CD1   . ILE A  1  681  ? 225.422 178.921 163.076 1.00 0.00 ? 681  ILE A CD1   1 
ATOM   5333  N  N     . LEU A  1  682  ? 221.547 181.888 160.463 1.00 0.00 ? 682  LEU A N     1 
ATOM   5334  C  CA    . LEU A  1  682  ? 220.407 182.011 159.564 1.00 0.00 ? 682  LEU A CA    1 
ATOM   5335  C  C     . LEU A  1  682  ? 220.393 183.357 158.861 1.00 0.00 ? 682  LEU A C     1 
ATOM   5336  O  O     . LEU A  1  682  ? 220.281 183.420 157.634 1.00 0.00 ? 682  LEU A O     1 
ATOM   5337  C  CB    . LEU A  1  682  ? 219.118 181.801 160.339 1.00 0.00 ? 682  LEU A CB    1 
ATOM   5338  C  CG    . LEU A  1  682  ? 217.859 182.190 159.586 1.00 0.00 ? 682  LEU A CG    1 
ATOM   5339  C  CD1   . LEU A  1  682  ? 217.785 181.522 158.257 1.00 0.00 ? 682  LEU A CD1   1 
ATOM   5340  C  CD2   . LEU A  1  682  ? 216.704 181.738 160.410 1.00 0.00 ? 682  LEU A CD2   1 
ATOM   5341  N  N     . ARG A  1  683  ? 220.494 184.443 159.624 1.00 0.00 ? 683  ARG A N     1 
ATOM   5342  C  CA    . ARG A  1  683  ? 220.434 185.775 159.037 1.00 0.00 ? 683  ARG A CA    1 
ATOM   5343  C  C     . ARG A  1  683  ? 221.456 185.940 157.933 1.00 0.00 ? 683  ARG A C     1 
ATOM   5344  O  O     . ARG A  1  683  ? 221.263 186.740 157.012 1.00 0.00 ? 683  ARG A O     1 
ATOM   5345  C  CB    . ARG A  1  683  ? 220.659 186.826 160.115 1.00 0.00 ? 683  ARG A CB    1 
ATOM   5346  C  CG    . ARG A  1  683  ? 220.541 188.246 159.621 1.00 0.00 ? 683  ARG A CG    1 
ATOM   5347  C  CD    . ARG A  1  683  ? 219.166 188.456 159.050 1.00 0.00 ? 683  ARG A CD    1 
ATOM   5348  N  NE    . ARG A  1  683  ? 218.150 188.218 160.059 1.00 0.00 ? 683  ARG A NE    1 
ATOM   5349  C  CZ    . ARG A  1  683  ? 216.848 188.221 159.814 1.00 0.00 ? 683  ARG A CZ    1 
ATOM   5350  N  NH1   . ARG A  1  683  ? 216.404 188.454 158.588 1.00 0.00 ? 683  ARG A NH1   1 
ATOM   5351  N  NH2   . ARG A  1  683  ? 215.992 187.993 160.798 1.00 0.00 ? 683  ARG A NH2   1 
ATOM   5352  N  N     . ASP A  1  684  ? 222.540 185.186 158.002 1.00 0.00 ? 684  ASP A N     1 
ATOM   5353  C  CA    . ASP A  1  684  ? 223.571 185.198 156.985 1.00 0.00 ? 684  ASP A CA    1 
ATOM   5354  C  C     . ASP A  1  684  ? 223.269 184.248 155.836 1.00 0.00 ? 684  ASP A C     1 
ATOM   5355  O  O     . ASP A  1  684  ? 222.987 184.692 154.721 1.00 0.00 ? 684  ASP A O     1 
ATOM   5356  C  CB    . ASP A  1  684  ? 224.911 184.841 157.640 1.00 0.00 ? 684  ASP A CB    1 
ATOM   5357  C  CG    . ASP A  1  684  ? 226.072 184.946 156.689 1.00 0.00 ? 684  ASP A CG    1 
ATOM   5358  O  OD1   . ASP A  1  684  ? 225.848 185.192 155.490 1.00 0.00 ? 684  ASP A OD1   1 
ATOM   5359  O  OD2   . ASP A  1  684  ? 227.223 184.821 157.144 1.00 0.00 ? 684  ASP A OD2   1 
ATOM   5360  N  N     . TYR A  1  685  ? 223.309 182.948 156.087 1.00 0.00 ? 685  TYR A N     1 
ATOM   5361  C  CA    . TYR A  1  685  ? 223.422 181.941 155.042 1.00 0.00 ? 685  TYR A CA    1 
ATOM   5362  C  C     . TYR A  1  685  ? 222.097 181.298 154.646 1.00 0.00 ? 685  TYR A C     1 
ATOM   5363  O  O     . TYR A  1  685  ? 222.071 180.418 153.787 1.00 0.00 ? 685  TYR A O     1 
ATOM   5364  C  CB    . TYR A  1  685  ? 224.421 180.888 155.488 1.00 0.00 ? 685  TYR A CB    1 
ATOM   5365  C  CG    . TYR A  1  685  ? 225.793 181.472 155.607 1.00 0.00 ? 685  TYR A CG    1 
ATOM   5366  C  CD1   . TYR A  1  685  ? 226.316 182.248 154.596 1.00 0.00 ? 685  TYR A CD1   1 
ATOM   5367  C  CD2   . TYR A  1  685  ? 226.540 181.298 156.744 1.00 0.00 ? 685  TYR A CD2   1 
ATOM   5368  C  CE1   . TYR A  1  685  ? 227.565 182.794 154.697 1.00 0.00 ? 685  TYR A CE1   1 
ATOM   5369  C  CE2   . TYR A  1  685  ? 227.784 181.847 156.856 1.00 0.00 ? 685  TYR A CE2   1 
ATOM   5370  C  CZ    . TYR A  1  685  ? 228.297 182.588 155.830 1.00 0.00 ? 685  TYR A CZ    1 
ATOM   5371  O  OH    . TYR A  1  685  ? 229.550 183.133 155.952 1.00 0.00 ? 685  TYR A OH    1 
ATOM   5372  N  N     . GLY A  1  686  ? 220.991 181.709 155.250 1.00 0.00 ? 686  GLY A N     1 
ATOM   5373  C  CA    . GLY A  1  686  ? 219.716 181.108 154.939 1.00 0.00 ? 686  GLY A CA    1 
ATOM   5374  C  C     . GLY A  1  686  ? 219.485 179.856 155.757 1.00 0.00 ? 686  GLY A C     1 
ATOM   5375  O  O     . GLY A  1  686  ? 220.425 179.249 156.273 1.00 0.00 ? 686  GLY A O     1 
ATOM   5376  N  N     . PRO A  1  687  ? 218.227 179.428 155.873 1.00 0.00 ? 687  PRO A N     1 
ATOM   5377  C  CA    . PRO A  1  687  ? 217.871 178.434 156.888 1.00 0.00 ? 687  PRO A CA    1 
ATOM   5378  C  C     . PRO A  1  687  ? 218.515 177.073 156.738 1.00 0.00 ? 687  PRO A C     1 
ATOM   5379  O  O     . PRO A  1  687  ? 219.018 176.551 157.740 1.00 0.00 ? 687  PRO A O     1 
ATOM   5380  C  CB    . PRO A  1  687  ? 216.353 178.322 156.726 1.00 0.00 ? 687  PRO A CB    1 
ATOM   5381  C  CG    . PRO A  1  687  ? 216.119 178.654 155.311 1.00 0.00 ? 687  PRO A CG    1 
ATOM   5382  C  CD    . PRO A  1  687  ? 217.097 179.738 154.991 1.00 0.00 ? 687  PRO A CD    1 
ATOM   5383  N  N     . GLN A  1  688  ? 218.548 176.505 155.531 1.00 0.00 ? 688  GLN A N     1 
ATOM   5384  C  CA    . GLN A  1  688  ? 218.966 175.115 155.378 1.00 0.00 ? 688  GLN A CA    1 
ATOM   5385  C  C     . GLN A  1  688  ? 220.283 174.846 156.081 1.00 0.00 ? 688  GLN A C     1 
ATOM   5386  O  O     . GLN A  1  688  ? 220.519 173.734 156.567 1.00 0.00 ? 688  GLN A O     1 
ATOM   5387  C  CB    . GLN A  1  688  ? 219.071 174.746 153.906 1.00 0.00 ? 688  GLN A CB    1 
ATOM   5388  C  CG    . GLN A  1  688  ? 219.556 173.340 153.716 1.00 0.00 ? 688  GLN A CG    1 
ATOM   5389  C  CD    . GLN A  1  688  ? 218.697 172.354 154.457 1.00 0.00 ? 688  GLN A CD    1 
ATOM   5390  O  OE1   . GLN A  1  688  ? 217.503 172.242 154.200 1.00 0.00 ? 688  GLN A OE1   1 
ATOM   5391  N  NE2   . GLN A  1  688  ? 219.293 171.651 155.409 1.00 0.00 ? 688  GLN A NE2   1 
ATOM   5392  N  N     . GLU A  1  689  ? 221.143 175.850 156.168 1.00 0.00 ? 689  GLU A N     1 
ATOM   5393  C  CA    . GLU A  1  689  ? 222.342 175.694 156.968 1.00 0.00 ? 689  GLU A CA    1 
ATOM   5394  C  C     . GLU A  1  689  ? 222.086 175.884 158.454 1.00 0.00 ? 689  GLU A C     1 
ATOM   5395  O  O     . GLU A  1  689  ? 222.626 175.118 159.261 1.00 0.00 ? 689  GLU A O     1 
ATOM   5396  C  CB    . GLU A  1  689  ? 223.410 176.671 156.508 1.00 0.00 ? 689  GLU A CB    1 
ATOM   5397  C  CG    . GLU A  1  689  ? 224.723 176.457 157.204 1.00 0.00 ? 689  GLU A CG    1 
ATOM   5398  C  CD    . GLU A  1  689  ? 225.374 175.133 156.850 1.00 0.00 ? 689  GLU A CD    1 
ATOM   5399  O  OE1   . GLU A  1  689  ? 224.944 174.494 155.869 1.00 0.00 ? 689  GLU A OE1   1 
ATOM   5400  O  OE2   . GLU A  1  689  ? 226.332 174.733 157.545 1.00 0.00 ? 689  GLU A OE2   1 
ATOM   5401  N  N     . ALA A  1  690  ? 221.286 176.879 158.832 1.00 0.00 ? 690  ALA A N     1 
ATOM   5402  C  CA    . ALA A  1  690  ? 220.984 177.072 160.244 1.00 0.00 ? 690  ALA A CA    1 
ATOM   5403  C  C     . ALA A  1  690  ? 220.478 175.788 160.874 1.00 0.00 ? 690  ALA A C     1 
ATOM   5404  O  O     . ALA A  1  690  ? 221.147 175.214 161.738 1.00 0.00 ? 690  ALA A O     1 
ATOM   5405  C  CB    . ALA A  1  690  ? 219.961 178.185 160.416 1.00 0.00 ? 690  ALA A CB    1 
ATOM   5406  N  N     . ALA A  1  691  ? 219.313 175.312 160.446 1.00 0.00 ? 691  ALA A N     1 
ATOM   5407  C  CA    . ALA A  1  691  ? 218.765 174.082 160.997 1.00 0.00 ? 691  ALA A CA    1 
ATOM   5408  C  C     . ALA A  1  691  ? 219.752 172.933 160.937 1.00 0.00 ? 691  ALA A C     1 
ATOM   5409  O  O     . ALA A  1  691  ? 219.691 172.035 161.780 1.00 0.00 ? 691  ALA A O     1 
ATOM   5410  C  CB    . ALA A  1  691  ? 217.488 173.686 160.262 1.00 0.00 ? 691  ALA A CB    1 
ATOM   5411  N  N     . ASN A  1  692  ? 220.659 172.943 159.970 1.00 0.00 ? 692  ASN A N     1 
ATOM   5412  C  CA    . ASN A  1  692  ? 221.720 171.953 159.972 1.00 0.00 ? 692  ASN A CA    1 
ATOM   5413  C  C     . ASN A  1  692  ? 222.553 172.069 161.240 1.00 0.00 ? 692  ASN A C     1 
ATOM   5414  O  O     . ASN A  1  692  ? 222.763 171.072 161.953 1.00 0.00 ? 692  ASN A O     1 
ATOM   5415  C  CB    . ASN A  1  692  ? 222.574 172.132 158.725 1.00 0.00 ? 692  ASN A CB    1 
ATOM   5416  C  CG    . ASN A  1  692  ? 223.527 171.003 158.509 1.00 0.00 ? 692  ASN A CG    1 
ATOM   5417  O  OD1   . ASN A  1  692  ? 223.848 170.258 159.429 1.00 0.00 ? 692  ASN A OD1   1 
ATOM   5418  N  ND2   . ASN A  1  692  ? 223.989 170.858 157.280 1.00 0.00 ? 692  ASN A ND2   1 
ATOM   5419  N  N     . ALA A  1  693  ? 223.010 173.284 161.553 1.00 0.00 ? 693  ALA A N     1 
ATOM   5420  C  CA    . ALA A  1  693  ? 223.723 173.476 162.807 1.00 0.00 ? 693  ALA A CA    1 
ATOM   5421  C  C     . ALA A  1  693  ? 222.950 172.886 163.972 1.00 0.00 ? 693  ALA A C     1 
ATOM   5422  O  O     . ALA A  1  693  ? 223.414 171.922 164.584 1.00 0.00 ? 693  ALA A O     1 
ATOM   5423  C  CB    . ALA A  1  693  ? 224.002 174.953 163.050 1.00 0.00 ? 693  ALA A CB    1 
ATOM   5424  N  N     . MET A  1  694  ? 221.759 173.407 164.255 1.00 0.00 ? 694  MET A N     1 
ATOM   5425  C  CA    . MET A  1  694  ? 220.965 172.909 165.370 1.00 0.00 ? 694  MET A CA    1 
ATOM   5426  C  C     . MET A  1  694  ? 220.801 171.399 165.374 1.00 0.00 ? 694  MET A C     1 
ATOM   5427  O  O     . MET A  1  694  ? 220.836 170.801 166.452 1.00 0.00 ? 694  MET A O     1 
ATOM   5428  C  CB    . MET A  1  694  ? 219.586 173.557 165.389 1.00 0.00 ? 694  MET A CB    1 
ATOM   5429  C  CG    . MET A  1  694  ? 219.619 175.008 165.773 1.00 0.00 ? 694  MET A CG    1 
ATOM   5430  S  SD    . MET A  1  694  ? 217.997 175.729 166.043 1.00 0.00 ? 694  MET A SD    1 
ATOM   5431  C  CE    . MET A  1  694  ? 217.436 175.901 164.356 1.00 0.00 ? 694  MET A CE    1 
ATOM   5432  N  N     . ASN A  1  695  ? 220.611 170.768 164.215 1.00 0.00 ? 695  ASN A N     1 
ATOM   5433  C  CA    . ASN A  1  695  ? 220.616 169.311 164.192 1.00 0.00 ? 695  ASN A CA    1 
ATOM   5434  C  C     . ASN A  1  695  ? 221.873 168.775 164.843 1.00 0.00 ? 695  ASN A C     1 
ATOM   5435  O  O     . ASN A  1  695  ? 221.809 167.922 165.737 1.00 0.00 ? 695  ASN A O     1 
ATOM   5436  C  CB    . ASN A  1  695  ? 220.511 168.792 162.766 1.00 0.00 ? 695  ASN A CB    1 
ATOM   5437  C  CG    . ASN A  1  695  ? 219.131 168.927 162.208 1.00 0.00 ? 695  ASN A CG    1 
ATOM   5438  O  OD1   . ASN A  1  695  ? 218.154 168.994 162.947 1.00 0.00 ? 695  ASN A OD1   1 
ATOM   5439  N  ND2   . ASN A  1  695  ? 219.029 168.948 160.888 1.00 0.00 ? 695  ASN A ND2   1 
ATOM   5440  N  N     . ARG A  1  696  ? 223.027 169.291 164.431 1.00 0.00 ? 696  ARG A N     1 
ATOM   5441  C  CA    . ARG A  1  696  ? 224.262 168.838 165.052 1.00 0.00 ? 696  ARG A CA    1 
ATOM   5442  C  C     . ARG A  1  696  ? 224.305 169.156 166.537 1.00 0.00 ? 696  ARG A C     1 
ATOM   5443  O  O     . ARG A  1  696  ? 224.758 168.326 167.324 1.00 0.00 ? 696  ARG A O     1 
ATOM   5444  C  CB    . ARG A  1  696  ? 225.437 169.472 164.349 1.00 0.00 ? 696  ARG A CB    1 
ATOM   5445  C  CG    . ARG A  1  696  ? 225.604 169.024 162.955 1.00 0.00 ? 696  ARG A CG    1 
ATOM   5446  C  CD    . ARG A  1  696  ? 226.600 169.909 162.309 1.00 0.00 ? 696  ARG A CD    1 
ATOM   5447  N  NE    . ARG A  1  696  ? 226.782 169.552 160.922 1.00 0.00 ? 696  ARG A NE    1 
ATOM   5448  C  CZ    . ARG A  1  696  ? 227.382 170.341 160.053 1.00 0.00 ? 696  ARG A CZ    1 
ATOM   5449  N  NH1   . ARG A  1  696  ? 227.800 171.533 160.444 1.00 0.00 ? 696  ARG A NH1   1 
ATOM   5450  N  NH2   . ARG A  1  696  ? 227.525 169.955 158.797 1.00 0.00 ? 696  ARG A NH2   1 
ATOM   5451  N  N     . MET A  1  697  ? 223.861 170.349 166.932 1.00 0.00 ? 697  MET A N     1 
ATOM   5452  C  CA    . MET A  1  697  ? 223.715 170.650 168.351 1.00 0.00 ? 697  MET A CA    1 
ATOM   5453  C  C     . MET A  1  697  ? 223.023 169.520 169.081 1.00 0.00 ? 697  MET A C     1 
ATOM   5454  O  O     . MET A  1  697  ? 223.619 168.888 169.958 1.00 0.00 ? 697  MET A O     1 
ATOM   5455  C  CB    . MET A  1  697  ? 222.925 171.934 168.543 1.00 0.00 ? 697  MET A CB    1 
ATOM   5456  C  CG    . MET A  1  697  ? 222.566 172.188 169.981 1.00 0.00 ? 697  MET A CG    1 
ATOM   5457  S  SD    . MET A  1  697  ? 224.031 172.404 170.974 1.00 0.00 ? 697  MET A SD    1 
ATOM   5458  C  CE    . MET A  1  697  ? 224.488 174.039 170.438 1.00 0.00 ? 697  MET A CE    1 
ATOM   5459  N  N     . ALA A  1  698  ? 221.765 169.255 168.735 1.00 0.00 ? 698  ALA A N     1 
ATOM   5460  C  CA    . ALA A  1  698  ? 221.029 168.158 169.340 1.00 0.00 ? 698  ALA A CA    1 
ATOM   5461  C  C     . ALA A  1  698  ? 221.834 166.875 169.364 1.00 0.00 ? 698  ALA A C     1 
ATOM   5462  O  O     . ALA A  1  698  ? 222.157 166.384 170.447 1.00 0.00 ? 698  ALA A O     1 
ATOM   5463  C  CB    . ALA A  1  698  ? 219.717 167.931 168.599 1.00 0.00 ? 698  ALA A CB    1 
ATOM   5464  N  N     . LYS A  1  699  ? 222.206 166.347 168.208 1.00 0.00 ? 699  LYS A N     1 
ATOM   5465  C  CA    . LYS A  1  699  ? 222.888 165.064 168.194 1.00 0.00 ? 699  LYS A CA    1 
ATOM   5466  C  C     . LYS A  1  699  ? 224.233 165.096 168.902 1.00 0.00 ? 699  LYS A C     1 
ATOM   5467  O  O     . LYS A  1  699  ? 224.850 164.040 169.068 1.00 0.00 ? 699  LYS A O     1 
ATOM   5468  C  CB    . LYS A  1  699  ? 223.058 164.577 166.756 1.00 0.00 ? 699  LYS A CB    1 
ATOM   5469  C  CG    . LYS A  1  699  ? 221.733 164.279 166.081 1.00 0.00 ? 699  LYS A CG    1 
ATOM   5470  C  CD    . LYS A  1  699  ? 221.873 164.075 164.593 1.00 0.00 ? 699  LYS A CD    1 
ATOM   5471  C  CE    . LYS A  1  699  ? 222.710 162.855 164.312 1.00 0.00 ? 699  LYS A CE    1 
ATOM   5472  N  NZ    . LYS A  1  699  ? 222.873 162.615 162.861 1.00 0.00 ? 699  LYS A NZ    1 
ATOM   5473  N  N     . LEU A  1  700  ? 224.712 166.271 169.323 1.00 0.00 ? 700  LEU A N     1 
ATOM   5474  C  CA    . LEU A  1  700  ? 225.888 166.313 170.189 1.00 0.00 ? 700  LEU A CA    1 
ATOM   5475  C  C     . LEU A  1  700  ? 225.495 166.333 171.653 1.00 0.00 ? 700  LEU A C     1 
ATOM   5476  O  O     . LEU A  1  700  ? 225.757 165.374 172.382 1.00 0.00 ? 700  LEU A O     1 
ATOM   5477  C  CB    . LEU A  1  700  ? 226.760 167.528 169.898 1.00 0.00 ? 700  LEU A CB    1 
ATOM   5478  C  CG    . LEU A  1  700  ? 227.845 167.605 170.972 1.00 0.00 ? 700  LEU A CG    1 
ATOM   5479  C  CD1   . LEU A  1  700  ? 228.714 166.386 170.901 1.00 0.00 ? 700  LEU A CD1   1 
ATOM   5480  C  CD2   . LEU A  1  700  ? 228.676 168.845 170.843 1.00 0.00 ? 700  LEU A CD2   1 
ATOM   5481  N  N     . CYS A  1  701  ? 224.894 167.435 172.100 1.00 0.00 ? 701  CYS A N     1 
ATOM   5482  C  CA    . CYS A  1  701  ? 224.575 167.592 173.510 1.00 0.00 ? 701  CYS A CA    1 
ATOM   5483  C  C     . CYS A  1  701  ? 223.844 166.379 174.057 1.00 0.00 ? 701  CYS A C     1 
ATOM   5484  O  O     . CYS A  1  701  ? 224.159 165.911 175.154 1.00 0.00 ? 701  CYS A O     1 
ATOM   5485  C  CB    . CYS A  1  701  ? 223.745 168.852 173.717 1.00 0.00 ? 701  CYS A CB    1 
ATOM   5486  S  SG    . CYS A  1  701  ? 223.373 169.175 175.432 1.00 0.00 ? 701  CYS A SG    1 
ATOM   5487  N  N     . ALA A  1  702  ? 222.896 165.843 173.296 1.00 0.00 ? 702  ALA A N     1 
ATOM   5488  C  CA    . ALA A  1  702  ? 222.203 164.635 173.717 1.00 0.00 ? 702  ALA A CA    1 
ATOM   5489  C  C     . ALA A  1  702  ? 223.186 163.528 174.065 1.00 0.00 ? 702  ALA A C     1 
ATOM   5490  O  O     . ALA A  1  702  ? 223.380 163.204 175.239 1.00 0.00 ? 702  ALA A O     1 
ATOM   5491  C  CB    . ALA A  1  702  ? 221.254 164.175 172.616 1.00 0.00 ? 702  ALA A CB    1 
ATOM   5492  N  N     . ARG A  1  703  ? 223.843 162.964 173.059 1.00 0.00 ? 703  ARG A N     1 
ATOM   5493  C  CA    . ARG A  1  703  ? 224.672 161.781 173.243 1.00 0.00 ? 703  ARG A CA    1 
ATOM   5494  C  C     . ARG A  1  703  ? 225.850 162.015 174.170 1.00 0.00 ? 703  ARG A C     1 
ATOM   5495  O  O     . ARG A  1  703  ? 226.326 161.066 174.799 1.00 0.00 ? 703  ARG A O     1 
ATOM   5496  C  CB    . ARG A  1  703  ? 225.175 161.313 171.885 1.00 0.00 ? 703  ARG A CB    1 
ATOM   5497  C  CG    . ARG A  1  703  ? 224.059 160.892 170.988 1.00 0.00 ? 703  ARG A CG    1 
ATOM   5498  C  CD    . ARG A  1  703  ? 224.536 160.497 169.627 1.00 0.00 ? 703  ARG A CD    1 
ATOM   5499  N  NE    . ARG A  1  703  ? 223.409 160.024 168.844 1.00 0.00 ? 703  ARG A NE    1 
ATOM   5500  C  CZ    . ARG A  1  703  ? 222.937 158.790 168.940 1.00 0.00 ? 703  ARG A CZ    1 
ATOM   5501  N  NH1   . ARG A  1  703  ? 223.507 157.934 169.775 1.00 0.00 ? 703  ARG A NH1   1 
ATOM   5502  N  NH2   . ARG A  1  703  ? 221.905 158.402 168.210 1.00 0.00 ? 703  ARG A NH2   1 
ATOM   5503  N  N     . PHE A  1  704  ? 226.343 163.244 174.257 1.00 0.00 ? 704  PHE A N     1 
ATOM   5504  C  CA    . PHE A  1  704  ? 227.462 163.521 175.144 1.00 0.00 ? 704  PHE A CA    1 
ATOM   5505  C  C     . PHE A  1  704  ? 227.038 163.657 176.595 1.00 0.00 ? 704  PHE A C     1 
ATOM   5506  O  O     . PHE A  1  704  ? 227.750 163.193 177.493 1.00 0.00 ? 704  PHE A O     1 
ATOM   5507  C  CB    . PHE A  1  704  ? 228.176 164.790 174.719 1.00 0.00 ? 704  PHE A CB    1 
ATOM   5508  C  CG    . PHE A  1  704  ? 229.041 165.351 175.783 1.00 0.00 ? 704  PHE A CG    1 
ATOM   5509  C  CD1   . PHE A  1  704  ? 230.277 164.817 176.046 1.00 0.00 ? 704  PHE A CD1   1 
ATOM   5510  C  CD2   . PHE A  1  704  ? 228.598 166.408 176.541 1.00 0.00 ? 704  PHE A CD2   1 
ATOM   5511  C  CE1   . PHE A  1  704  ? 231.056 165.335 177.041 1.00 0.00 ? 704  PHE A CE1   1 
ATOM   5512  C  CE2   . PHE A  1  704  ? 229.363 166.925 177.526 1.00 0.00 ? 704  PHE A CE2   1 
ATOM   5513  C  CZ    . PHE A  1  704  ? 230.597 166.396 177.781 1.00 0.00 ? 704  PHE A CZ    1 
ATOM   5514  N  N     . LEU A  1  705  ? 225.904 164.306 176.848 1.00 0.00 ? 705  LEU A N     1 
ATOM   5515  C  CA    . LEU A  1  705  ? 225.598 164.701 178.214 1.00 0.00 ? 705  LEU A CA    1 
ATOM   5516  C  C     . LEU A  1  705  ? 225.481 163.489 179.121 1.00 0.00 ? 705  LEU A C     1 
ATOM   5517  O  O     . LEU A  1  705  ? 226.073 163.464 180.203 1.00 0.00 ? 705  LEU A O     1 
ATOM   5518  C  CB    . LEU A  1  705  ? 224.323 165.525 178.241 1.00 0.00 ? 705  LEU A CB    1 
ATOM   5519  C  CG    . LEU A  1  705  ? 224.056 166.150 179.595 1.00 0.00 ? 705  LEU A CG    1 
ATOM   5520  C  CD1   . LEU A  1  705  ? 225.191 167.078 179.927 1.00 0.00 ? 705  LEU A CD1   1 
ATOM   5521  C  CD2   . LEU A  1  705  ? 222.778 166.924 179.515 1.00 0.00 ? 705  LEU A CD2   1 
ATOM   5522  N  N     . GLY A  1  706  ? 224.762 162.465 178.689 1.00 0.00 ? 706  GLY A N     1 
ATOM   5523  C  CA    . GLY A  1  706  ? 224.773 161.231 179.439 1.00 0.00 ? 706  GLY A CA    1 
ATOM   5524  C  C     . GLY A  1  706  ? 226.131 160.596 179.599 1.00 0.00 ? 706  GLY A C     1 
ATOM   5525  O  O     . GLY A  1  706  ? 226.514 160.262 180.720 1.00 0.00 ? 706  GLY A O     1 
ATOM   5526  N  N     . ASN A  1  707  ? 226.875 160.439 178.512 1.00 0.00 ? 707  ASN A N     1 
ATOM   5527  C  CA    . ASN A  1  707  ? 228.173 159.789 178.551 1.00 0.00 ? 707  ASN A CA    1 
ATOM   5528  C  C     . ASN A  1  707  ? 229.156 160.513 179.463 1.00 0.00 ? 707  ASN A C     1 
ATOM   5529  O  O     . ASN A  1  707  ? 230.162 159.923 179.859 1.00 0.00 ? 707  ASN A O     1 
ATOM   5530  C  CB    . ASN A  1  707  ? 228.736 159.693 177.129 1.00 0.00 ? 707  ASN A CB    1 
ATOM   5531  C  CG    . ASN A  1  707  ? 229.815 158.643 176.985 1.00 0.00 ? 707  ASN A CG    1 
ATOM   5532  O  OD1   . ASN A  1  707  ? 230.412 158.200 177.962 1.00 0.00 ? 707  ASN A OD1   1 
ATOM   5533  N  ND2   . ASN A  1  707  ? 230.062 158.225 175.746 1.00 0.00 ? 707  ASN A ND2   1 
ATOM   5534  N  N     . ARG A  1  708  ? 228.898 161.775 179.798 1.00 0.00 ? 708  ARG A N     1 
ATOM   5535  C  CA    . ARG A  1  708  ? 229.626 162.471 180.855 1.00 0.00 ? 708  ARG A CA    1 
ATOM   5536  C  C     . ARG A  1  708  ? 228.870 162.449 182.170 1.00 0.00 ? 708  ARG A C     1 
ATOM   5537  O  O     . ARG A  1  708  ? 229.400 162.005 183.190 1.00 0.00 ? 708  ARG A O     1 
ATOM   5538  C  CB    . ARG A  1  708  ? 229.921 163.918 180.477 1.00 0.00 ? 708  ARG A CB    1 
ATOM   5539  C  CG    . ARG A  1  708  ? 230.622 164.685 181.581 1.00 0.00 ? 708  ARG A CG    1 
ATOM   5540  C  CD    . ARG A  1  708  ? 230.922 166.103 181.147 1.00 0.00 ? 708  ARG A CD    1 
ATOM   5541  N  NE    . ARG A  1  708  ? 231.615 166.870 182.173 1.00 0.00 ? 708  ARG A NE    1 
ATOM   5542  C  CZ    . ARG A  1  708  ? 231.001 167.534 183.142 1.00 0.00 ? 708  ARG A CZ    1 
ATOM   5543  N  NH1   . ARG A  1  708  ? 229.682 167.513 183.218 1.00 0.00 ? 708  ARG A NH1   1 
ATOM   5544  N  NH2   . ARG A  1  708  ? 231.703 168.212 184.037 1.00 0.00 ? 708  ARG A NH2   1 
ATOM   5545  N  N     . GLY A  1  709  ? 227.660 162.985 182.174 1.00 0.00 ? 709  GLY A N     1 
ATOM   5546  C  CA    . GLY A  1  709  ? 226.776 162.878 183.313 1.00 0.00 ? 709  GLY A CA    1 
ATOM   5547  C  C     . GLY A  1  709  ? 226.627 164.158 184.094 1.00 0.00 ? 709  GLY A C     1 
ATOM   5548  O  O     . GLY A  1  709  ? 227.537 164.987 184.140 1.00 0.00 ? 709  GLY A O     1 
ATOM   5549  N  N     . PHE A  1  710  ? 225.446 164.341 184.670 1.00 0.00 ? 710  PHE A N     1 
ATOM   5550  C  CA    . PHE A  1  710  ? 225.133 165.526 185.450 1.00 0.00 ? 710  PHE A CA    1 
ATOM   5551  C  C     . PHE A  1  710  ? 223.993 165.154 186.381 1.00 0.00 ? 710  PHE A C     1 
ATOM   5552  O  O     . PHE A  1  710  ? 223.140 164.351 185.998 1.00 0.00 ? 710  PHE A O     1 
ATOM   5553  C  CB    . PHE A  1  710  ? 224.749 166.667 184.512 1.00 0.00 ? 710  PHE A CB    1 
ATOM   5554  C  CG    . PHE A  1  710  ? 224.409 167.943 185.200 1.00 0.00 ? 710  PHE A CG    1 
ATOM   5555  C  CD1   . PHE A  1  710  ? 225.405 168.755 185.690 1.00 0.00 ? 710  PHE A CD1   1 
ATOM   5556  C  CD2   . PHE A  1  710  ? 223.100 168.361 185.304 1.00 0.00 ? 710  PHE A CD2   1 
ATOM   5557  C  CE1   . PHE A  1  710  ? 225.106 169.935 186.307 1.00 0.00 ? 710  PHE A CE1   1 
ATOM   5558  C  CE2   . PHE A  1  710  ? 222.793 169.544 185.920 1.00 0.00 ? 710  PHE A CE2   1 
ATOM   5559  C  CZ    . PHE A  1  710  ? 223.798 170.333 186.421 1.00 0.00 ? 710  PHE A CZ    1 
ATOM   5560  N  N     . SER A  1  711  ? 223.956 165.725 187.579 1.00 0.00 ? 711  SER A N     1 
ATOM   5561  C  CA    . SER A  1  711  ? 222.886 165.382 188.513 1.00 0.00 ? 711  SER A CA    1 
ATOM   5562  C  C     . SER A  1  711  ? 222.806 166.455 189.590 1.00 0.00 ? 711  SER A C     1 
ATOM   5563  O  O     . SER A  1  711  ? 223.605 167.394 189.614 1.00 0.00 ? 711  SER A O     1 
ATOM   5564  C  CB    . SER A  1  711  ? 223.105 163.996 189.117 1.00 0.00 ? 711  SER A CB    1 
ATOM   5565  O  OG    . SER A  1  711  ? 224.251 163.984 189.938 1.00 0.00 ? 711  SER A OG    1 
ATOM   5566  N  N     . ILE A  1  712  ? 221.847 166.305 190.501 1.00 0.00 ? 712  ILE A N     1 
ATOM   5567  C  CA    . ILE A  1  712  ? 221.526 167.370 191.443 1.00 0.00 ? 712  ILE A CA    1 
ATOM   5568  C  C     . ILE A  1  712  ? 221.936 166.997 192.861 1.00 0.00 ? 712  ILE A C     1 
ATOM   5569  O  O     . ILE A  1  712  ? 222.962 167.474 193.357 1.00 0.00 ? 712  ILE A O     1 
ATOM   5570  C  CB    . ILE A  1  712  ? 220.031 167.709 191.375 1.00 0.00 ? 712  ILE A CB    1 
ATOM   5571  C  CG1   . ILE A  1  712  ? 219.710 168.309 190.019 1.00 0.00 ? 712  ILE A CG1   1 
ATOM   5572  C  CG2   . ILE A  1  712  ? 219.650 168.693 192.449 1.00 0.00 ? 712  ILE A CG2   1 
ATOM   5573  C  CD1   . ILE A  1  712  ? 218.256 168.534 189.803 1.00 0.00 ? 712  ILE A CD1   1 
ATOM   5574  N  N     . GLY A  1  713  ? 221.163 166.147 193.516 1.00 0.00 ? 713  GLY A N     1 
ATOM   5575  C  CA    . GLY A  1  713  ? 221.481 165.703 194.859 1.00 0.00 ? 713  GLY A CA    1 
ATOM   5576  C  C     . GLY A  1  713  ? 221.017 166.685 195.931 1.00 0.00 ? 713  GLY A C     1 
ATOM   5577  O  O     . GLY A  1  713  ? 220.736 167.860 195.660 1.00 0.00 ? 713  GLY A O     1 
ATOM   5578  N  N     . ILE A  1  714  ? 220.939 166.188 197.173 1.00 0.00 ? 714  ILE A N     1 
ATOM   5579  C  CA    . ILE A  1  714  ? 220.514 167.011 198.302 1.00 0.00 ? 714  ILE A CA    1 
ATOM   5580  C  C     . ILE A  1  714  ? 221.588 168.006 198.702 1.00 0.00 ? 714  ILE A C     1 
ATOM   5581  O  O     . ILE A  1  714  ? 221.311 169.204 198.830 1.00 0.00 ? 714  ILE A O     1 
ATOM   5582  C  CB    . ILE A  1  714  ? 220.108 166.128 199.495 1.00 0.00 ? 714  ILE A CB    1 
ATOM   5583  C  CG1   . ILE A  1  714  ? 218.750 165.504 199.241 1.00 0.00 ? 714  ILE A CG1   1 
ATOM   5584  C  CG2   . ILE A  1  714  ? 220.035 166.940 200.764 1.00 0.00 ? 714  ILE A CG2   1 
ATOM   5585  C  CD1   . ILE A  1  714  ? 217.662 166.535 199.244 1.00 0.00 ? 714  ILE A CD1   1 
ATOM   5586  N  N     . ASN A  1  715  ? 222.826 167.539 198.902 1.00 0.00 ? 715  ASN A N     1 
ATOM   5587  C  CA    . ASN A  1  715  ? 223.889 168.426 199.367 1.00 0.00 ? 715  ASN A CA    1 
ATOM   5588  C  C     . ASN A  1  715  ? 223.956 169.691 198.535 1.00 0.00 ? 715  ASN A C     1 
ATOM   5589  O  O     . ASN A  1  715  ? 224.383 170.737 199.031 1.00 0.00 ? 715  ASN A O     1 
ATOM   5590  C  CB    . ASN A  1  715  ? 225.242 167.727 199.305 1.00 0.00 ? 715  ASN A CB    1 
ATOM   5591  C  CG    . ASN A  1  715  ? 225.671 167.445 197.887 1.00 0.00 ? 715  ASN A CG    1 
ATOM   5592  O  OD1   . ASN A  1  715  ? 224.858 167.494 196.965 1.00 0.00 ? 715  ASN A OD1   1 
ATOM   5593  N  ND2   . ASN A  1  715  ? 226.954 167.169 197.697 1.00 0.00 ? 715  ASN A ND2   1 
ATOM   5594  N  N     . ASP A  1  716  ? 223.520 169.601 197.282 1.00 0.00 ? 716  ASP A N     1 
ATOM   5595  C  CA    . ASP A  1  716  ? 223.487 170.752 196.398 1.00 0.00 ? 716  ASP A CA    1 
ATOM   5596  C  C     . ASP A  1  716  ? 222.465 171.778 196.873 1.00 0.00 ? 716  ASP A C     1 
ATOM   5597  O  O     . ASP A  1  716  ? 222.687 172.988 196.760 1.00 0.00 ? 716  ASP A O     1 
ATOM   5598  C  CB    . ASP A  1  716  ? 223.191 170.256 194.987 1.00 0.00 ? 716  ASP A CB    1 
ATOM   5599  C  CG    . ASP A  1  716  ? 223.381 171.310 193.947 1.00 0.00 ? 716  ASP A CG    1 
ATOM   5600  O  OD1   . ASP A  1  716  ? 223.541 172.495 194.299 1.00 0.00 ? 716  ASP A OD1   1 
ATOM   5601  O  OD2   . ASP A  1  716  ? 223.438 170.935 192.757 1.00 0.00 ? 716  ASP A OD2   1 
ATOM   5602  N  N     . VAL A  1  717  ? 221.340 171.317 197.417 1.00 0.00 ? 717  VAL A N     1 
ATOM   5603  C  CA    . VAL A  1  717  ? 220.404 172.256 198.023 1.00 0.00 ? 717  VAL A CA    1 
ATOM   5604  C  C     . VAL A  1  717  ? 220.692 172.410 199.513 1.00 0.00 ? 717  VAL A C     1 
ATOM   5605  O  O     . VAL A  1  717  ? 220.149 173.301 200.173 1.00 0.00 ? 717  VAL A O     1 
ATOM   5606  C  CB    . VAL A  1  717  ? 218.962 171.799 197.748 1.00 0.00 ? 717  VAL A CB    1 
ATOM   5607  C  CG1   . VAL A  1  717  ? 217.941 172.753 198.349 1.00 0.00 ? 717  VAL A CG1   1 
ATOM   5608  C  CG2   . VAL A  1  717  ? 218.739 171.698 196.264 1.00 0.00 ? 717  VAL A CG2   1 
ATOM   5609  N  N     . THR A  1  718  ? 221.569 171.591 200.059 1.00 0.00 ? 718  THR A N     1 
ATOM   5610  C  CA    . THR A  1  718  ? 221.861 171.672 201.484 1.00 0.00 ? 718  THR A CA    1 
ATOM   5611  C  C     . THR A  1  718  ? 222.649 172.930 201.810 1.00 0.00 ? 718  THR A C     1 
ATOM   5612  O  O     . THR A  1  718  ? 223.747 173.119 201.273 1.00 0.00 ? 718  THR A O     1 
ATOM   5613  C  CB    . THR A  1  718  ? 222.649 170.459 201.938 1.00 0.00 ? 718  THR A CB    1 
ATOM   5614  O  OG1   . THR A  1  718  ? 221.854 169.283 201.764 1.00 0.00 ? 718  THR A OG1   1 
ATOM   5615  C  CG2   . THR A  1  718  ? 223.032 170.601 203.395 1.00 0.00 ? 718  THR A CG2   1 
ATOM   5616  N  N     . PRO A  1  719  ? 222.147 173.803 202.672 1.00 0.00 ? 719  PRO A N     1 
ATOM   5617  C  CA    . PRO A  1  719  ? 222.990 174.880 203.194 1.00 0.00 ? 719  PRO A CA    1 
ATOM   5618  C  C     . PRO A  1  719  ? 224.042 174.312 204.133 1.00 0.00 ? 719  PRO A C     1 
ATOM   5619  O  O     . PRO A  1  719  ? 223.771 173.401 204.918 1.00 0.00 ? 719  PRO A O     1 
ATOM   5620  C  CB    . PRO A  1  719  ? 221.994 175.770 203.945 1.00 0.00 ? 719  PRO A CB    1 
ATOM   5621  C  CG    . PRO A  1  719  ? 220.916 174.824 204.368 1.00 0.00 ? 719  PRO A CG    1 
ATOM   5622  C  CD    . PRO A  1  719  ? 220.797 173.816 203.260 1.00 0.00 ? 719  PRO A CD    1 
ATOM   5623  N  N     . ALA A  1  720  ? 225.260 174.845 204.044 1.00 0.00 ? 720  ALA A N     1 
ATOM   5624  C  CA    . ALA A  1  720  ? 226.369 174.365 204.870 1.00 0.00 ? 720  ALA A CA    1 
ATOM   5625  C  C     . ALA A  1  720  ? 226.923 175.528 205.689 1.00 0.00 ? 720  ALA A C     1 
ATOM   5626  O  O     . ALA A  1  720  ? 227.537 176.454 205.164 1.00 0.00 ? 720  ALA A O     1 
ATOM   5627  C  CB    . ALA A  1  720  ? 227.443 173.721 203.999 1.00 0.00 ? 720  ALA A CB    1 
ATOM   5628  N  N     . ASP A  1  721  ? 226.718 175.450 207.000 1.00 0.00 ? 721  ASP A N     1 
ATOM   5629  C  CA    . ASP A  1  721  ? 227.175 176.459 207.982 1.00 0.00 ? 721  ASP A CA    1 
ATOM   5630  C  C     . ASP A  1  721  ? 226.724 177.826 207.456 1.00 0.00 ? 721  ASP A C     1 
ATOM   5631  O  O     . ASP A  1  721  ? 225.593 177.932 206.957 1.00 0.00 ? 721  ASP A O     1 
ATOM   5632  C  CB    . ASP A  1  721  ? 228.667 176.308 208.211 1.00 0.00 ? 721  ASP A CB    1 
ATOM   5633  C  CG    . ASP A  1  721  ? 229.184 177.205 209.319 1.00 0.00 ? 721  ASP A CG    1 
ATOM   5634  O  OD1   . ASP A  1  721  ? 228.833 176.962 210.492 1.00 0.00 ? 721  ASP A OD1   1 
ATOM   5635  O  OD2   . ASP A  1  721  ? 229.929 178.162 209.015 1.00 0.00 ? 721  ASP A OD2   1 
ATOM   5636  N  N     . ASP A  1  722  ? 227.556 178.869 207.565 1.00 0.00 ? 722  ASP A N     1 
ATOM   5637  C  CA    . ASP A  1  722  ? 227.503 180.003 206.647 1.00 0.00 ? 722  ASP A CA    1 
ATOM   5638  C  C     . ASP A  1  722  ? 226.086 180.534 206.498 1.00 0.00 ? 722  ASP A C     1 
ATOM   5639  O  O     . ASP A  1  722  ? 225.550 181.184 207.399 1.00 0.00 ? 722  ASP A O     1 
ATOM   5640  C  CB    . ASP A  1  722  ? 228.080 179.622 205.282 1.00 0.00 ? 722  ASP A CB    1 
ATOM   5641  C  CG    . ASP A  1  722  ? 228.205 180.817 204.347 1.00 0.00 ? 722  ASP A CG    1 
ATOM   5642  O  OD1   . ASP A  1  722  ? 229.018 181.718 204.640 1.00 0.00 ? 722  ASP A OD1   1 
ATOM   5643  O  OD2   . ASP A  1  722  ? 227.491 180.857 203.323 1.00 0.00 ? 722  ASP A OD2   1 
ATOM   5644  N  N     . LEU A  1  723  ? 225.490 180.260 205.336 1.00 0.00 ? 723  LEU A N     1 
ATOM   5645  C  CA    . LEU A  1  723  ? 224.153 180.745 205.011 1.00 0.00 ? 723  LEU A CA    1 
ATOM   5646  C  C     . LEU A  1  723  ? 223.134 180.387 206.095 1.00 0.00 ? 723  LEU A C     1 
ATOM   5647  O  O     . LEU A  1  723  ? 222.029 180.936 206.109 1.00 0.00 ? 723  LEU A O     1 
ATOM   5648  C  CB    . LEU A  1  723  ? 223.733 180.190 203.648 1.00 0.00 ? 723  LEU A CB    1 
ATOM   5649  C  CG    . LEU A  1  723  ? 222.379 180.584 203.057 1.00 0.00 ? 723  LEU A CG    1 
ATOM   5650  C  CD1   . LEU A  1  723  ? 222.312 182.083 202.851 1.00 0.00 ? 723  LEU A CD1   1 
ATOM   5651  C  CD2   . LEU A  1  723  ? 222.159 179.868 201.741 1.00 0.00 ? 723  LEU A CD2   1 
ATOM   5652  N  N     . LYS A  1  724  ? 223.461 179.448 206.992 1.00 0.00 ? 724  LYS A N     1 
ATOM   5653  C  CA    . LYS A  1  724  ? 222.687 179.364 208.229 1.00 0.00 ? 724  LYS A CA    1 
ATOM   5654  C  C     . LYS A  1  724  ? 222.994 180.531 209.160 1.00 0.00 ? 724  LYS A C     1 
ATOM   5655  O  O     . LYS A  1  724  ? 222.068 181.156 209.690 1.00 0.00 ? 724  LYS A O     1 
ATOM   5656  C  CB    . LYS A  1  724  ? 222.935 178.046 208.971 1.00 0.00 ? 724  LYS A CB    1 
ATOM   5657  C  CG    . LYS A  1  724  ? 222.271 176.816 208.372 1.00 0.00 ? 724  LYS A CG    1 
ATOM   5658  C  CD    . LYS A  1  724  ? 222.352 175.638 209.342 1.00 0.00 ? 724  LYS A CD    1 
ATOM   5659  C  CE    . LYS A  1  724  ? 223.781 175.187 209.575 1.00 0.00 ? 724  LYS A CE    1 
ATOM   5660  N  NZ    . LYS A  1  724  ? 224.371 174.604 208.339 1.00 0.00 ? 724  LYS A NZ    1 
ATOM   5661  N  N     . GLN A  1  725  ? 224.278 180.830 209.380 1.00 0.00 ? 725  GLN A N     1 
ATOM   5662  C  CA    . GLN A  1  725  ? 224.646 181.950 210.241 1.00 0.00 ? 725  GLN A CA    1 
ATOM   5663  C  C     . GLN A  1  725  ? 224.074 183.260 209.713 1.00 0.00 ? 725  GLN A C     1 
ATOM   5664  O  O     . GLN A  1  725  ? 223.436 184.011 210.459 1.00 0.00 ? 725  GLN A O     1 
ATOM   5665  C  CB    . GLN A  1  725  ? 226.169 182.035 210.361 1.00 0.00 ? 725  GLN A CB    1 
ATOM   5666  C  CG    . GLN A  1  725  ? 226.665 183.099 211.319 1.00 0.00 ? 725  GLN A CG    1 
ATOM   5667  C  CD    . GLN A  1  725  ? 226.267 182.809 212.751 1.00 0.00 ? 725  GLN A CD    1 
ATOM   5668  O  OE1   . GLN A  1  725  ? 225.303 183.376 213.266 1.00 0.00 ? 725  GLN A OE1   1 
ATOM   5669  N  NE2   . GLN A  1  725  ? 227.006 181.918 213.402 1.00 0.00 ? 725  GLN A NE2   1 
ATOM   5670  N  N     . LYS A  1  726  ? 224.289 183.548 208.428 1.00 0.00 ? 726  LYS A N     1 
ATOM   5671  C  CA    . LYS A  1  726  ? 223.671 184.718 207.816 1.00 0.00 ? 726  LYS A CA    1 
ATOM   5672  C  C     . LYS A  1  726  ? 222.157 184.587 207.739 1.00 0.00 ? 726  LYS A C     1 
ATOM   5673  O  O     . LYS A  1  726  ? 221.447 185.592 207.835 1.00 0.00 ? 726  LYS A O     1 
ATOM   5674  C  CB    . LYS A  1  726  ? 224.239 184.955 206.415 1.00 0.00 ? 726  LYS A CB    1 
ATOM   5675  C  CG    . LYS A  1  726  ? 225.427 185.900 206.357 1.00 0.00 ? 726  LYS A CG    1 
ATOM   5676  C  CD    . LYS A  1  726  ? 226.662 185.306 206.999 1.00 0.00 ? 726  LYS A CD    1 
ATOM   5677  C  CE    . LYS A  1  726  ? 227.830 186.272 206.911 1.00 0.00 ? 726  LYS A CE    1 
ATOM   5678  N  NZ    . LYS A  1  726  ? 229.065 185.706 207.517 1.00 0.00 ? 726  LYS A NZ    1 
ATOM   5679  N  N     . LYS A  1  727  ? 221.649 183.367 207.559 1.00 0.00 ? 727  LYS A N     1 
ATOM   5680  C  CA    . LYS A  1  727  ? 220.207 183.161 207.488 1.00 0.00 ? 727  LYS A CA    1 
ATOM   5681  C  C     . LYS A  1  727  ? 219.516 183.614 208.763 1.00 0.00 ? 727  LYS A C     1 
ATOM   5682  O  O     . LYS A  1  727  ? 218.519 184.342 208.704 1.00 0.00 ? 727  LYS A O     1 
ATOM   5683  C  CB    . LYS A  1  727  ? 219.896 181.687 207.222 1.00 0.00 ? 727  LYS A CB    1 
ATOM   5684  C  CG    . LYS A  1  727  ? 218.412 181.368 207.111 1.00 0.00 ? 727  LYS A CG    1 
ATOM   5685  C  CD    . LYS A  1  727  ? 218.180 179.878 206.891 1.00 0.00 ? 727  LYS A CD    1 
ATOM   5686  C  CE    . LYS A  1  727  ? 218.564 179.070 208.119 1.00 0.00 ? 727  LYS A CE    1 
ATOM   5687  N  NZ    . LYS A  1  727  ? 217.694 179.391 209.283 1.00 0.00 ? 727  LYS A NZ    1 
ATOM   5688  N  N     . GLU A  1  728  ? 220.028 183.193 209.920 1.00 0.00 ? 728  GLU A N     1 
ATOM   5689  C  CA    . GLU A  1  728  ? 219.404 183.559 211.185 1.00 0.00 ? 728  GLU A CA    1 
ATOM   5690  C  C     . GLU A  1  728  ? 219.448 185.062 211.420 1.00 0.00 ? 728  GLU A C     1 
ATOM   5691  O  O     . GLU A  1  728  ? 218.401 185.689 211.611 1.00 0.00 ? 728  GLU A O     1 
ATOM   5692  C  CB    . GLU A  1  728  ? 220.084 182.802 212.327 1.00 0.00 ? 728  GLU A CB    1 
ATOM   5693  C  CG    . GLU A  1  728  ? 219.494 183.035 213.710 1.00 0.00 ? 728  GLU A CG    1 
ATOM   5694  C  CD    . GLU A  1  728  ? 220.039 184.278 214.388 1.00 0.00 ? 728  GLU A CD    1 
ATOM   5695  O  OE1   . GLU A  1  728  ? 221.144 184.726 214.016 1.00 0.00 ? 728  GLU A OE1   1 
ATOM   5696  O  OE2   . GLU A  1  728  ? 219.371 184.793 215.307 1.00 0.00 ? 728  GLU A OE2   1 
ATOM   5697  N  N     . GLU A  1  729  ? 220.637 185.660 211.391 1.00 0.00 ? 729  GLU A N     1 
ATOM   5698  C  CA    . GLU A  1  729  ? 220.804 187.077 211.691 1.00 0.00 ? 729  GLU A CA    1 
ATOM   5699  C  C     . GLU A  1  729  ? 220.119 187.987 210.680 1.00 0.00 ? 729  GLU A C     1 
ATOM   5700  O  O     . GLU A  1  729  ? 219.383 188.895 211.079 1.00 0.00 ? 729  GLU A O     1 
ATOM   5701  C  CB    . GLU A  1  729  ? 222.295 187.423 211.776 1.00 0.00 ? 729  GLU A CB    1 
ATOM   5702  C  CG    . GLU A  1  729  ? 222.610 188.856 212.197 1.00 0.00 ? 729  GLU A CG    1 
ATOM   5703  C  CD    . GLU A  1  729  ? 222.544 189.844 211.048 1.00 0.00 ? 729  GLU A CD    1 
ATOM   5704  O  OE1   . GLU A  1  729  ? 222.703 189.416 209.887 1.00 0.00 ? 729  GLU A OE1   1 
ATOM   5705  O  OE2   . GLU A  1  729  ? 222.335 191.047 211.305 1.00 0.00 ? 729  GLU A OE2   1 
ATOM   5706  N  N     . LEU A  1  730  ? 220.346 187.772 209.381 1.00 0.00 ? 730  LEU A N     1 
ATOM   5707  C  CA    . LEU A  1  730  ? 219.727 188.617 208.364 1.00 0.00 ? 730  LEU A CA    1 
ATOM   5708  C  C     . LEU A  1  730  ? 218.208 188.605 208.443 1.00 0.00 ? 730  LEU A C     1 
ATOM   5709  O  O     . LEU A  1  730  ? 217.569 189.562 207.998 1.00 0.00 ? 730  LEU A O     1 
ATOM   5710  C  CB    . LEU A  1  730  ? 220.180 188.189 206.968 1.00 0.00 ? 730  LEU A CB    1 
ATOM   5711  C  CG    . LEU A  1  730  ? 221.647 188.450 206.623 1.00 0.00 ? 730  LEU A CG    1 
ATOM   5712  C  CD1   . LEU A  1  730  ? 222.000 187.850 205.271 1.00 0.00 ? 730  LEU A CD1   1 
ATOM   5713  C  CD2   . LEU A  1  730  ? 221.930 189.940 206.640 1.00 0.00 ? 730  LEU A CD2   1 
ATOM   5714  N  N     . VAL A  1  731  ? 217.612 187.540 208.972 1.00 0.00 ? 731  VAL A N     1 
ATOM   5715  C  CA    . VAL A  1  731  ? 216.186 187.582 209.264 1.00 0.00 ? 731  VAL A CA    1 
ATOM   5716  C  C     . VAL A  1  731  ? 215.933 188.294 210.586 1.00 0.00 ? 731  VAL A C     1 
ATOM   5717  O  O     . VAL A  1  731  ? 215.019 189.117 210.694 1.00 0.00 ? 731  VAL A O     1 
ATOM   5718  C  CB    . VAL A  1  731  ? 215.598 186.162 209.255 1.00 0.00 ? 731  VAL A CB    1 
ATOM   5719  C  CG1   . VAL A  1  731  ? 214.168 186.184 209.740 1.00 0.00 ? 731  VAL A CG1   1 
ATOM   5720  C  CG2   . VAL A  1  731  ? 215.663 185.586 207.853 1.00 0.00 ? 731  VAL A CG2   1 
ATOM   5721  N  N     . GLU A  1  732  ? 216.748 188.009 211.605 1.00 0.00 ? 732  GLU A N     1 
ATOM   5722  C  CA    . GLU A  1  732  ? 216.563 188.659 212.897 1.00 0.00 ? 732  GLU A CA    1 
ATOM   5723  C  C     . GLU A  1  732  ? 216.817 190.156 212.837 1.00 0.00 ? 732  GLU A C     1 
ATOM   5724  O  O     . GLU A  1  732  ? 216.223 190.899 213.625 1.00 0.00 ? 732  GLU A O     1 
ATOM   5725  C  CB    . GLU A  1  732  ? 217.471 188.029 213.949 1.00 0.00 ? 732  GLU A CB    1 
ATOM   5726  C  CG    . GLU A  1  732  ? 217.105 186.605 214.300 1.00 0.00 ? 732  GLU A CG    1 
ATOM   5727  C  CD    . GLU A  1  732  ? 215.699 186.486 214.837 1.00 0.00 ? 732  GLU A CD    1 
ATOM   5728  O  OE1   . GLU A  1  732  ? 215.280 187.380 215.600 1.00 0.00 ? 732  GLU A OE1   1 
ATOM   5729  O  OE2   . GLU A  1  732  ? 215.013 185.500 214.497 1.00 0.00 ? 732  GLU A OE2   1 
ATOM   5730  N  N     . ILE A  1  733  ? 217.680 190.616 211.927 1.00 0.00 ? 733  ILE A N     1 
ATOM   5731  C  CA    . ILE A  1  733  ? 217.896 192.050 211.794 1.00 0.00 ? 733  ILE A CA    1 
ATOM   5732  C  C     . ILE A  1  733  ? 216.608 192.755 211.389 1.00 0.00 ? 733  ILE A C     1 
ATOM   5733  O  O     . ILE A  1  733  ? 216.382 193.900 211.790 1.00 0.00 ? 733  ILE A O     1 
ATOM   5734  C  CB    . ILE A  1  733  ? 219.038 192.346 210.798 1.00 0.00 ? 733  ILE A CB    1 
ATOM   5735  C  CG1   . ILE A  1  733  ? 219.482 193.809 210.874 1.00 0.00 ? 733  ILE A CG1   1 
ATOM   5736  C  CG2   . ILE A  1  733  ? 218.627 192.038 209.379 1.00 0.00 ? 733  ILE A CG2   1 
ATOM   5737  C  CD1   . ILE A  1  733  ? 220.219 194.169 212.136 1.00 0.00 ? 733  ILE A CD1   1 
ATOM   5738  N  N     . ALA A  1  734  ? 215.739 192.086 210.628 1.00 0.00 ? 734  ALA A N     1 
ATOM   5739  C  CA    . ALA A  1  734  ? 214.470 192.664 210.213 1.00 0.00 ? 734  ALA A CA    1 
ATOM   5740  C  C     . ALA A  1  734  ? 213.397 192.609 211.289 1.00 0.00 ? 734  ALA A C     1 
ATOM   5741  O  O     . ALA A  1  734  ? 212.578 193.531 211.365 1.00 0.00 ? 734  ALA A O     1 
ATOM   5742  C  CB    . ALA A  1  734  ? 213.950 191.959 208.955 1.00 0.00 ? 734  ALA A CB    1 
ATOM   5743  N  N     . TYR A  1  735  ? 213.377 191.556 212.113 1.00 0.00 ? 735  TYR A N     1 
ATOM   5744  C  CA    . TYR A  1  735  ? 212.351 191.444 213.146 1.00 0.00 ? 735  TYR A CA    1 
ATOM   5745  C  C     . TYR A  1  735  ? 212.362 192.649 214.077 1.00 0.00 ? 735  TYR A C     1 
ATOM   5746  O  O     . TYR A  1  735  ? 211.303 193.173 214.438 1.00 0.00 ? 735  TYR A O     1 
ATOM   5747  C  CB    . TYR A  1  735  ? 212.528 190.157 213.951 1.00 0.00 ? 735  TYR A CB    1 
ATOM   5748  C  CG    . TYR A  1  735  ? 212.156 188.884 213.226 1.00 0.00 ? 735  TYR A CG    1 
ATOM   5749  C  CD1   . TYR A  1  735  ? 211.075 188.845 212.357 1.00 0.00 ? 735  TYR A CD1   1 
ATOM   5750  C  CD2   . TYR A  1  735  ? 212.855 187.706 213.451 1.00 0.00 ? 735  TYR A CD2   1 
ATOM   5751  C  CE1   . TYR A  1  735  ? 210.724 187.676 211.704 1.00 0.00 ? 735  TYR A CE1   1 
ATOM   5752  C  CE2   . TYR A  1  735  ? 212.507 186.533 212.809 1.00 0.00 ? 735  TYR A CE2   1 
ATOM   5753  C  CZ    . TYR A  1  735  ? 211.442 186.524 211.937 1.00 0.00 ? 735  TYR A CZ    1 
ATOM   5754  O  OH    . TYR A  1  735  ? 211.097 185.358 211.297 1.00 0.00 ? 735  TYR A OH    1 
ATOM   5755  N  N     . HIS A  1  736  ? 213.548 193.090 214.501 1.00 0.00 ? 736  HIS A N     1 
ATOM   5756  C  CA    . HIS A  1  736  ? 213.600 194.233 215.405 1.00 0.00 ? 736  HIS A CA    1 
ATOM   5757  C  C     . HIS A  1  736  ? 213.508 195.558 214.659 1.00 0.00 ? 736  HIS A C     1 
ATOM   5758  O  O     . HIS A  1  736  ? 213.059 196.554 215.234 1.00 0.00 ? 736  HIS A O     1 
ATOM   5759  C  CB    . HIS A  1  736  ? 214.865 194.189 216.258 1.00 0.00 ? 736  HIS A CB    1 
ATOM   5760  C  CG    . HIS A  1  736  ? 216.131 194.309 215.472 1.00 0.00 ? 736  HIS A CG    1 
ATOM   5761  N  ND1   . HIS A  1  736  ? 216.591 195.513 214.981 1.00 0.00 ? 736  HIS A ND1   1 
ATOM   5762  C  CD2   . HIS A  1  736  ? 217.042 193.379 215.103 1.00 0.00 ? 736  HIS A CD2   1 
ATOM   5763  C  CE1   . HIS A  1  736  ? 217.727 195.317 214.338 1.00 0.00 ? 736  HIS A CE1   1 
ATOM   5764  N  NE2   . HIS A  1  736  ? 218.024 194.031 214.399 1.00 0.00 ? 736  HIS A NE2   1 
ATOM   5765  N  N     . LYS A  1  737  ? 213.944 195.606 213.396 1.00 0.00 ? 737  LYS A N     1 
ATOM   5766  C  CA    . LYS A  1  737  ? 213.753 196.828 212.621 1.00 0.00 ? 737  LYS A CA    1 
ATOM   5767  C  C     . LYS A  1  737  ? 212.275 197.133 212.426 1.00 0.00 ? 737  LYS A C     1 
ATOM   5768  O  O     . LYS A  1  737  ? 211.796 198.193 212.842 1.00 0.00 ? 737  LYS A O     1 
ATOM   5769  C  CB    . LYS A  1  737  ? 214.454 196.735 211.265 1.00 0.00 ? 737  LYS A CB    1 
ATOM   5770  C  CG    . LYS A  1  737  ? 215.963 196.899 211.307 1.00 0.00 ? 737  LYS A CG    1 
ATOM   5771  C  CD    . LYS A  1  737  ? 216.550 196.841 209.903 1.00 0.00 ? 737  LYS A CD    1 
ATOM   5772  C  CE    . LYS A  1  737  ? 218.058 197.028 209.919 1.00 0.00 ? 737  LYS A CE    1 
ATOM   5773  N  NZ    . LYS A  1  737  ? 218.442 198.372 210.430 1.00 0.00 ? 737  LYS A NZ    1 
ATOM   5774  N  N     . CYS A  1  738  ? 211.532 196.213 211.809 1.00 0.00 ? 738  CYS A N     1 
ATOM   5775  C  CA    . CYS A  1  738  ? 210.113 196.469 211.595 1.00 0.00 ? 738  CYS A CA    1 
ATOM   5776  C  C     . CYS A  1  738  ? 209.333 196.380 212.899 1.00 0.00 ? 738  CYS A C     1 
ATOM   5777  O  O     . CYS A  1  738  ? 208.301 197.044 213.050 1.00 0.00 ? 738  CYS A O     1 
ATOM   5778  C  CB    . CYS A  1  738  ? 209.543 195.498 210.566 1.00 0.00 ? 738  CYS A CB    1 
ATOM   5779  S  SG    . CYS A  1  738  ? 207.827 195.846 210.148 1.00 0.00 ? 738  CYS A SG    1 
ATOM   5780  N  N     . ASP A  1  739  ? 209.807 195.566 213.845 1.00 0.00 ? 739  ASP A N     1 
ATOM   5781  C  CA    . ASP A  1  739  ? 209.227 195.572 215.182 1.00 0.00 ? 739  ASP A CA    1 
ATOM   5782  C  C     . ASP A  1  739  ? 209.303 196.955 215.808 1.00 0.00 ? 739  ASP A C     1 
ATOM   5783  O  O     . ASP A  1  739  ? 208.346 197.398 216.450 1.00 0.00 ? 739  ASP A O     1 
ATOM   5784  C  CB    . ASP A  1  739  ? 209.936 194.551 216.070 1.00 0.00 ? 739  ASP A CB    1 
ATOM   5785  C  CG    . ASP A  1  739  ? 209.375 194.513 217.476 1.00 0.00 ? 739  ASP A CG    1 
ATOM   5786  O  OD1   . ASP A  1  739  ? 208.207 194.107 217.639 1.00 0.00 ? 739  ASP A OD1   1 
ATOM   5787  O  OD2   . ASP A  1  739  ? 210.101 194.887 218.420 1.00 0.00 ? 739  ASP A OD2   1 
ATOM   5788  N  N     . GLU A  1  740  ? 210.429 197.647 215.625 1.00 0.00 ? 740  GLU A N     1 
ATOM   5789  C  CA    . GLU A  1  740  ? 210.558 199.021 216.094 1.00 0.00 ? 740  GLU A CA    1 
ATOM   5790  C  C     . GLU A  1  740  ? 209.544 199.938 215.423 1.00 0.00 ? 740  GLU A C     1 
ATOM   5791  O  O     . GLU A  1  740  ? 208.951 200.796 216.088 1.00 0.00 ? 740  GLU A O     1 
ATOM   5792  C  CB    . GLU A  1  740  ? 211.989 199.510 215.852 1.00 0.00 ? 740  GLU A CB    1 
ATOM   5793  C  CG    . GLU A  1  740  ? 212.277 200.944 216.275 1.00 0.00 ? 740  GLU A CG    1 
ATOM   5794  C  CD    . GLU A  1  740  ? 211.890 201.957 215.213 1.00 0.00 ? 740  GLU A CD    1 
ATOM   5795  O  OE1   . GLU A  1  740  ? 211.822 201.572 214.026 1.00 0.00 ? 740  GLU A OE1   1 
ATOM   5796  O  OE2   . GLU A  1  740  ? 211.664 203.135 215.559 1.00 0.00 ? 740  GLU A OE2   1 
ATOM   5797  N  N     . LEU A  1  741  ? 209.326 199.769 214.121 1.00 0.00 ? 741  LEU A N     1 
ATOM   5798  C  CA    . LEU A  1  741  ? 208.358 200.583 213.396 1.00 0.00 ? 741  LEU A CA    1 
ATOM   5799  C  C     . LEU A  1  741  ? 206.931 200.359 213.872 1.00 0.00 ? 741  LEU A C     1 
ATOM   5800  O  O     . LEU A  1  741  ? 206.197 201.331 214.085 1.00 0.00 ? 741  LEU A O     1 
ATOM   5801  C  CB    . LEU A  1  741  ? 208.453 200.293 211.896 1.00 0.00 ? 741  LEU A CB    1 
ATOM   5802  C  CG    . LEU A  1  741  ? 209.782 200.678 211.244 1.00 0.00 ? 741  LEU A CG    1 
ATOM   5803  C  CD1   . LEU A  1  741  ? 209.855 200.179 209.810 1.00 0.00 ? 741  LEU A CD1   1 
ATOM   5804  C  CD2   . LEU A  1  741  ? 209.980 202.184 211.294 1.00 0.00 ? 741  LEU A CD2   1 
ATOM   5805  N  N     . ILE A  1  742  ? 206.521 199.108 214.056 1.00 0.00 ? 742  ILE A N     1 
ATOM   5806  C  CA    . ILE A  1  742  ? 205.161 198.841 214.505 1.00 0.00 ? 742  ILE A CA    1 
ATOM   5807  C  C     . ILE A  1  742  ? 204.959 199.180 215.982 1.00 0.00 ? 742  ILE A C     1 
ATOM   5808  O  O     . ILE A  1  742  ? 203.883 199.654 216.360 1.00 0.00 ? 742  ILE A O     1 
ATOM   5809  C  CB    . ILE A  1  742  ? 204.773 197.380 214.208 1.00 0.00 ? 742  ILE A CB    1 
ATOM   5810  C  CG1   . ILE A  1  742  ? 203.314 197.115 214.590 1.00 0.00 ? 742  ILE A CG1   1 
ATOM   5811  C  CG2   . ILE A  1  742  ? 205.700 196.409 214.916 1.00 0.00 ? 742  ILE A CG2   1 
ATOM   5812  C  CD1   . ILE A  1  742  ? 202.314 197.890 213.781 1.00 0.00 ? 742  ILE A CD1   1 
ATOM   5813  N  N     . THR A  1  743  ? 205.969 198.968 216.829 1.00 0.00 ? 743  THR A N     1 
ATOM   5814  C  CA    . THR A  1  743  ? 205.767 199.209 218.253 1.00 0.00 ? 743  THR A CA    1 
ATOM   5815  C  C     . THR A  1  743  ? 205.709 200.692 218.593 1.00 0.00 ? 743  THR A C     1 
ATOM   5816  O  O     . THR A  1  743  ? 205.139 201.047 219.630 1.00 0.00 ? 743  THR A O     1 
ATOM   5817  C  CB    . THR A  1  743  ? 206.863 198.531 219.081 1.00 0.00 ? 743  THR A CB    1 
ATOM   5818  O  OG1   . THR A  1  743  ? 206.483 198.535 220.462 1.00 0.00 ? 743  THR A OG1   1 
ATOM   5819  C  CG2   . THR A  1  743  ? 208.184 199.271 218.941 1.00 0.00 ? 743  THR A CG2   1 
ATOM   5820  N  N     . LEU A  1  744  ? 206.287 201.560 217.761 1.00 0.00 ? 744  LEU A N     1 
ATOM   5821  C  CA    . LEU A  1  744  ? 206.174 202.998 217.952 1.00 0.00 ? 744  LEU A CA    1 
ATOM   5822  C  C     . LEU A  1  744  ? 205.045 203.624 217.149 1.00 0.00 ? 744  LEU A C     1 
ATOM   5823  O  O     . LEU A  1  744  ? 204.794 204.825 217.301 1.00 0.00 ? 744  LEU A O     1 
ATOM   5824  C  CB    . LEU A  1  744  ? 207.497 203.692 217.596 1.00 0.00 ? 744  LEU A CB    1 
ATOM   5825  C  CG    . LEU A  1  744  ? 208.670 203.341 218.514 1.00 0.00 ? 744  LEU A CG    1 
ATOM   5826  C  CD1   . LEU A  1  744  ? 209.949 204.004 218.036 1.00 0.00 ? 744  LEU A CD1   1 
ATOM   5827  C  CD2   . LEU A  1  744  ? 208.361 203.735 219.950 1.00 0.00 ? 744  LEU A CD2   1 
ATOM   5828  N  N     . PHE A  1  745  ? 204.373 202.856 216.293 1.00 0.00 ? 745  PHE A N     1 
ATOM   5829  C  CA    . PHE A  1  745  ? 203.198 203.350 215.588 1.00 0.00 ? 745  PHE A CA    1 
ATOM   5830  C  C     . PHE A  1  745  ? 201.939 203.293 216.440 1.00 0.00 ? 745  PHE A C     1 
ATOM   5831  O  O     . PHE A  1  745  ? 201.059 204.148 216.289 1.00 0.00 ? 745  PHE A O     1 
ATOM   5832  C  CB    . PHE A  1  745  ? 202.979 202.553 214.298 1.00 0.00 ? 745  PHE A CB    1 
ATOM   5833  C  CG    . PHE A  1  745  ? 201.750 202.959 213.535 1.00 0.00 ? 745  PHE A CG    1 
ATOM   5834  C  CD1   . PHE A  1  745  ? 201.764 204.078 212.720 1.00 0.00 ? 745  PHE A CD1   1 
ATOM   5835  C  CD2   . PHE A  1  745  ? 200.580 202.223 213.636 1.00 0.00 ? 745  PHE A CD2   1 
ATOM   5836  C  CE1   . PHE A  1  745  ? 200.635 204.456 212.017 1.00 0.00 ? 745  PHE A CE1   1 
ATOM   5837  C  CE2   . PHE A  1  745  ? 199.448 202.596 212.936 1.00 0.00 ? 745  PHE A CE2   1 
ATOM   5838  C  CZ    . PHE A  1  745  ? 199.476 203.714 212.125 1.00 0.00 ? 745  PHE A CZ    1 
ATOM   5839  N  N     . ASN A  1  746  ? 201.823 202.296 217.318 1.00 0.00 ? 746  ASN A N     1 
ATOM   5840  C  CA    . ASN A  1  746  ? 200.628 202.167 218.141 1.00 0.00 ? 746  ASN A CA    1 
ATOM   5841  C  C     . ASN A  1  746  ? 200.592 203.162 219.296 1.00 0.00 ? 746  ASN A C     1 
ATOM   5842  O  O     . ASN A  1  746  ? 199.575 203.839 219.476 1.00 0.00 ? 746  ASN A O     1 
ATOM   5843  C  CB    . ASN A  1  746  ? 200.508 200.730 218.656 1.00 0.00 ? 746  ASN A CB    1 
ATOM   5844  C  CG    . ASN A  1  746  ? 201.727 200.280 219.441 1.00 0.00 ? 746  ASN A CG    1 
ATOM   5845  O  OD1   . ASN A  1  746  ? 202.368 201.069 220.136 1.00 0.00 ? 746  ASN A OD1   1 
ATOM   5846  N  ND2   . ASN A  1  746  ? 202.058 199.000 219.324 1.00 0.00 ? 746  ASN A ND2   1 
ATOM   5847  N  N     . LYS A  1  747  ? 201.668 203.268 220.077 1.00 0.00 ? 747  LYS A N     1 
ATOM   5848  C  CA    . LYS A  1  747  ? 201.711 204.167 221.226 1.00 0.00 ? 747  LYS A CA    1 
ATOM   5849  C  C     . LYS A  1  747  ? 202.336 205.516 220.893 1.00 0.00 ? 747  LYS A C     1 
ATOM   5850  O  O     . LYS A  1  747  ? 202.501 206.350 221.791 1.00 0.00 ? 747  LYS A O     1 
ATOM   5851  C  CB    . LYS A  1  747  ? 202.459 203.517 222.395 1.00 0.00 ? 747  LYS A CB    1 
ATOM   5852  C  CG    . LYS A  1  747  ? 201.704 202.363 223.035 1.00 0.00 ? 747  LYS A CG    1 
ATOM   5853  C  CD    . LYS A  1  747  ? 202.338 201.932 224.350 1.00 0.00 ? 747  LYS A CD    1 
ATOM   5854  C  CE    . LYS A  1  747  ? 203.722 201.340 224.148 1.00 0.00 ? 747  LYS A CE    1 
ATOM   5855  N  NZ    . LYS A  1  747  ? 204.283 200.826 225.429 1.00 0.00 ? 747  LYS A NZ    1 
ATOM   5856  N  N     . GLY A  1  748  ? 202.687 205.750 219.633 1.00 0.00 ? 748  GLY A N     1 
ATOM   5857  C  CA    . GLY A  1  748  ? 203.220 207.028 219.210 1.00 0.00 ? 748  GLY A CA    1 
ATOM   5858  C  C     . GLY A  1  748  ? 203.014 207.233 217.726 1.00 0.00 ? 748  GLY A C     1 
ATOM   5859  O  O     . GLY A  1  748  ? 202.362 206.413 217.074 1.00 0.00 ? 748  GLY A O     1 
ATOM   5860  N  N     . GLU A  1  749  ? 203.556 208.313 217.172 1.00 0.00 ? 749  GLU A N     1 
ATOM   5861  C  CA    . GLU A  1  749  ? 203.471 208.541 215.739 1.00 0.00 ? 749  GLU A CA    1 
ATOM   5862  C  C     . GLU A  1  749  ? 204.870 208.448 215.150 1.00 0.00 ? 749  GLU A C     1 
ATOM   5863  O  O     . GLU A  1  749  ? 205.862 208.296 215.867 1.00 0.00 ? 749  GLU A O     1 
ATOM   5864  C  CB    . GLU A  1  749  ? 202.812 209.889 215.419 1.00 0.00 ? 749  GLU A CB    1 
ATOM   5865  C  CG    . GLU A  1  749  ? 201.344 209.951 215.824 1.00 0.00 ? 749  GLU A CG    1 
ATOM   5866  C  CD    . GLU A  1  749  ? 200.705 211.293 215.529 1.00 0.00 ? 749  GLU A CD    1 
ATOM   5867  O  OE1   . GLU A  1  749  ? 201.438 212.233 215.156 1.00 0.00 ? 749  GLU A OE1   1 
ATOM   5868  O  OE2   . GLU A  1  749  ? 199.470 211.409 215.676 1.00 0.00 ? 749  GLU A OE2   1 
ATOM   5869  N  N     . LEU A  1  750  ? 204.943 208.549 213.827 1.00 0.00 ? 750  LEU A N     1 
ATOM   5870  C  CA    . LEU A  1  750  ? 206.163 208.273 213.083 1.00 0.00 ? 750  LEU A CA    1 
ATOM   5871  C  C     . LEU A  1  750  ? 206.221 209.174 211.858 1.00 0.00 ? 750  LEU A C     1 
ATOM   5872  O  O     . LEU A  1  750  ? 205.437 210.116 211.709 1.00 0.00 ? 750  LEU A O     1 
ATOM   5873  C  CB    . LEU A  1  750  ? 206.235 206.799 212.661 1.00 0.00 ? 750  LEU A CB    1 
ATOM   5874  C  CG    . LEU A  1  750  ? 206.310 205.727 213.748 1.00 0.00 ? 750  LEU A CG    1 
ATOM   5875  C  CD1   . LEU A  1  750  ? 206.215 204.350 213.124 1.00 0.00 ? 750  LEU A CD1   1 
ATOM   5876  C  CD2   . LEU A  1  750  ? 207.588 205.865 214.558 1.00 0.00 ? 750  LEU A CD2   1 
ATOM   5877  N  N     . GLU A  1  751  ? 207.166 208.872 210.972 1.00 0.00 ? 751  GLU A N     1 
ATOM   5878  C  CA    . GLU A  1  751  ? 207.267 209.553 209.688 1.00 0.00 ? 751  GLU A CA    1 
ATOM   5879  C  C     . GLU A  1  751  ? 206.469 208.761 208.663 1.00 0.00 ? 751  GLU A C     1 
ATOM   5880  O  O     . GLU A  1  751  ? 206.837 207.635 208.313 1.00 0.00 ? 751  GLU A O     1 
ATOM   5881  C  CB    . GLU A  1  751  ? 208.725 209.678 209.258 1.00 0.00 ? 751  GLU A CB    1 
ATOM   5882  C  CG    . GLU A  1  751  ? 209.568 210.566 210.145 1.00 0.00 ? 751  GLU A CG    1 
ATOM   5883  C  CD    . GLU A  1  751  ? 211.018 210.590 209.712 1.00 0.00 ? 751  GLU A CD    1 
ATOM   5884  O  OE1   . GLU A  1  751  ? 211.392 209.772 208.845 1.00 0.00 ? 751  GLU A OE1   1 
ATOM   5885  O  OE2   . GLU A  1  751  ? 211.782 211.426 210.237 1.00 0.00 ? 751  GLU A OE2   1 
ATOM   5886  N  N     . THR A  1  752  ? 205.380 209.343 208.179 1.00 0.00 ? 752  THR A N     1 
ATOM   5887  C  CA    . THR A  1  752  ? 204.529 208.690 207.197 1.00 0.00 ? 752  THR A CA    1 
ATOM   5888  C  C     . THR A  1  752  ? 204.958 209.123 205.801 1.00 0.00 ? 752  THR A C     1 
ATOM   5889  O  O     . THR A  1  752  ? 204.845 210.303 205.452 1.00 0.00 ? 752  THR A O     1 
ATOM   5890  C  CB    . THR A  1  752  ? 203.060 209.030 207.444 1.00 0.00 ? 752  THR A CB    1 
ATOM   5891  O  OG1   . THR A  1  752  ? 202.879 210.449 207.366 1.00 0.00 ? 752  THR A OG1   1 
ATOM   5892  C  CG2   . THR A  1  752  ? 202.631 208.547 208.822 1.00 0.00 ? 752  THR A CG2   1 
ATOM   5893  N  N     . GLN A  1  753  ? 205.446 208.172 205.007 1.00 0.00 ? 753  GLN A N     1 
ATOM   5894  C  CA    . GLN A  1  753  ? 205.856 208.462 203.643 1.00 0.00 ? 753  GLN A CA    1 
ATOM   5895  C  C     . GLN A  1  753  ? 204.654 208.882 202.807 1.00 0.00 ? 753  GLN A C     1 
ATOM   5896  O  O     . GLN A  1  753  ? 203.504 208.685 203.210 1.00 0.00 ? 753  GLN A O     1 
ATOM   5897  C  CB    . GLN A  1  753  ? 206.536 207.243 203.020 1.00 0.00 ? 753  GLN A CB    1 
ATOM   5898  C  CG    . GLN A  1  753  ? 207.912 206.921 203.580 1.00 0.00 ? 753  GLN A CG    1 
ATOM   5899  C  CD    . GLN A  1  753  ? 207.857 206.049 204.809 1.00 0.00 ? 753  GLN A CD    1 
ATOM   5900  O  OE1   . GLN A  1  753  ? 206.783 205.651 205.251 1.00 0.00 ? 753  GLN A OE1   1 
ATOM   5901  N  NE2   . GLN A  1  753  ? 209.021 205.744 205.370 1.00 0.00 ? 753  GLN A NE2   1 
ATOM   5902  N  N     . PRO A  1  754  ? 204.887 209.471 201.620 1.00 0.00 ? 754  PRO A N     1 
ATOM   5903  C  CA    . PRO A  1  754  ? 203.756 209.933 200.803 1.00 0.00 ? 754  PRO A CA    1 
ATOM   5904  C  C     . PRO A  1  754  ? 202.869 208.798 200.322 1.00 0.00 ? 754  PRO A C     1 
ATOM   5905  O  O     . PRO A  1  754  ? 202.679 208.599 199.119 1.00 0.00 ? 754  PRO A O     1 
ATOM   5906  C  CB    . PRO A  1  754  ? 204.447 210.634 199.625 1.00 0.00 ? 754  PRO A CB    1 
ATOM   5907  C  CG    . PRO A  1  754  ? 205.747 211.089 200.178 1.00 0.00 ? 754  PRO A CG    1 
ATOM   5908  C  CD    . PRO A  1  754  ? 206.168 210.013 201.135 1.00 0.00 ? 754  PRO A CD    1 
ATOM   5909  N  N     . GLY A  1  755  ? 202.322 208.046 201.275 1.00 0.00 ? 755  GLY A N     1 
ATOM   5910  C  CA    . GLY A  1  755  ? 201.360 207.001 201.000 1.00 0.00 ? 755  GLY A CA    1 
ATOM   5911  C  C     . GLY A  1  755  ? 199.954 207.454 201.324 1.00 0.00 ? 755  GLY A C     1 
ATOM   5912  O  O     . GLY A  1  755  ? 199.076 206.629 201.598 1.00 0.00 ? 755  GLY A O     1 
ATOM   5913  N  N     . CYS A  1  756  ? 199.737 208.771 201.305 1.00 0.00 ? 756  CYS A N     1 
ATOM   5914  C  CA    . CYS A  1  756  ? 198.478 209.386 201.731 1.00 0.00 ? 756  CYS A CA    1 
ATOM   5915  C  C     . CYS A  1  756  ? 198.245 208.986 203.183 1.00 0.00 ? 756  CYS A C     1 
ATOM   5916  O  O     . CYS A  1  756  ? 199.040 209.395 204.047 1.00 0.00 ? 756  CYS A O     1 
ATOM   5917  C  CB    . CYS A  1  756  ? 197.370 209.018 200.743 1.00 0.00 ? 756  CYS A CB    1 
ATOM   5918  S  SG    . CYS A  1  756  ? 197.620 209.683 199.081 1.00 0.00 ? 756  CYS A SG    1 
ATOM   5919  N  N     . ASN A  1  757  ? 197.211 208.215 203.505 1.00 0.00 ? 757  ASN A N     1 
ATOM   5920  C  CA    . ASN A  1  757  ? 196.867 207.956 204.892 1.00 0.00 ? 757  ASN A CA    1 
ATOM   5921  C  C     . ASN A  1  757  ? 197.927 207.077 205.553 1.00 0.00 ? 757  ASN A C     1 
ATOM   5922  O  O     . ASN A  1  757  ? 198.892 206.633 204.925 1.00 0.00 ? 757  ASN A O     1 
ATOM   5923  C  CB    . ASN A  1  757  ? 195.489 207.308 204.976 1.00 0.00 ? 757  ASN A CB    1 
ATOM   5924  C  CG    . ASN A  1  757  ? 195.416 206.003 204.209 1.00 0.00 ? 757  ASN A CG    1 
ATOM   5925  O  OD1   . ASN A  1  757  ? 196.282 205.709 203.385 1.00 0.00 ? 757  ASN A OD1   1 
ATOM   5926  N  ND2   . ASN A  1  757  ? 194.381 205.215 204.472 1.00 0.00 ? 757  ASN A ND2   1 
ATOM   5927  N  N     . GLU A  1  758  ? 197.738 206.817 206.842 1.00 0.00 ? 758  GLU A N     1 
ATOM   5928  C  CA    . GLU A  1  758  ? 198.729 206.091 207.622 1.00 0.00 ? 758  GLU A CA    1 
ATOM   5929  C  C     . GLU A  1  758  ? 198.258 204.656 207.847 1.00 0.00 ? 758  GLU A C     1 
ATOM   5930  O  O     . GLU A  1  758  ? 197.166 204.262 207.430 1.00 0.00 ? 758  GLU A O     1 
ATOM   5931  C  CB    . GLU A  1  758  ? 199.011 206.827 208.929 1.00 0.00 ? 758  GLU A CB    1 
ATOM   5932  C  CG    . GLU A  1  758  ? 197.803 206.989 209.836 1.00 0.00 ? 758  GLU A CG    1 
ATOM   5933  C  CD    . GLU A  1  758  ? 198.102 207.838 211.059 1.00 0.00 ? 758  GLU A CD    1 
ATOM   5934  O  OE1   . GLU A  1  758  ? 199.295 208.020 211.383 1.00 0.00 ? 758  GLU A OE1   1 
ATOM   5935  O  OE2   . GLU A  1  758  ? 197.145 208.328 211.694 1.00 0.00 ? 758  GLU A OE2   1 
ATOM   5936  N  N     . GLU A  1  759  ? 199.104 203.867 208.513 1.00 0.00 ? 759  GLU A N     1 
ATOM   5937  C  CA    . GLU A  1  759  ? 198.956 202.430 208.737 1.00 0.00 ? 759  GLU A CA    1 
ATOM   5938  C  C     . GLU A  1  759  ? 199.267 201.664 207.454 1.00 0.00 ? 759  GLU A C     1 
ATOM   5939  O  O     . GLU A  1  759  ? 199.555 200.463 207.497 1.00 0.00 ? 759  GLU A O     1 
ATOM   5940  C  CB    . GLU A  1  759  ? 197.561 202.082 209.276 1.00 0.00 ? 759  GLU A CB    1 
ATOM   5941  C  CG    . GLU A  1  759  ? 197.382 200.623 209.667 1.00 0.00 ? 759  GLU A CG    1 
ATOM   5942  C  CD    . GLU A  1  759  ? 196.025 200.334 210.277 1.00 0.00 ? 759  GLU A CD    1 
ATOM   5943  O  OE1   . GLU A  1  759  ? 195.193 201.261 210.357 1.00 0.00 ? 759  GLU A OE1   1 
ATOM   5944  O  OE2   . GLU A  1  759  ? 195.795 199.177 210.687 1.00 0.00 ? 759  GLU A OE2   1 
ATOM   5945  N  N     . GLN A  1  760  ? 199.253 202.350 206.308 1.00 0.00 ? 760  GLN A N     1 
ATOM   5946  C  CA    . GLN A  1  760  ? 199.929 201.819 205.129 1.00 0.00 ? 760  GLN A CA    1 
ATOM   5947  C  C     . GLN A  1  760  ? 201.384 202.238 205.080 1.00 0.00 ? 760  GLN A C     1 
ATOM   5948  O  O     . GLN A  1  760  ? 202.152 201.684 204.285 1.00 0.00 ? 760  GLN A O     1 
ATOM   5949  C  CB    . GLN A  1  760  ? 199.226 202.258 203.842 1.00 0.00 ? 760  GLN A CB    1 
ATOM   5950  C  CG    . GLN A  1  760  ? 197.843 201.666 203.648 1.00 0.00 ? 760  GLN A CG    1 
ATOM   5951  C  CD    . GLN A  1  760  ? 196.767 202.475 204.331 1.00 0.00 ? 760  GLN A CD    1 
ATOM   5952  O  OE1   . GLN A  1  760  ? 197.040 203.525 204.903 1.00 0.00 ? 760  GLN A OE1   1 
ATOM   5953  N  NE2   . GLN A  1  760  ? 195.537 201.981 204.290 1.00 0.00 ? 760  GLN A NE2   1 
ATOM   5954  N  N     . THR A  1  761  ? 201.759 203.214 205.907 1.00 0.00 ? 761  THR A N     1 
ATOM   5955  C  CA    . THR A  1  761  ? 203.158 203.585 206.072 1.00 0.00 ? 761  THR A CA    1 
ATOM   5956  C  C     . THR A  1  761  ? 204.004 202.368 206.418 1.00 0.00 ? 761  THR A C     1 
ATOM   5957  O  O     . THR A  1  761  ? 204.840 201.927 205.618 1.00 0.00 ? 761  THR A O     1 
ATOM   5958  C  CB    . THR A  1  761  ? 203.270 204.654 207.161 1.00 0.00 ? 761  THR A CB    1 
ATOM   5959  O  OG1   . THR A  1  761  ? 202.555 205.828 206.758 1.00 0.00 ? 761  THR A OG1   1 
ATOM   5960  C  CG2   . THR A  1  761  ? 204.712 205.010 207.431 1.00 0.00 ? 761  THR A CG2   1 
ATOM   5961  N  N     . LEU A  1  762  ? 203.780 201.796 207.601 1.00 0.00 ? 762  LEU A N     1 
ATOM   5962  C  CA    . LEU A  1  762  ? 204.497 200.594 207.997 1.00 0.00 ? 762  LEU A CA    1 
ATOM   5963  C  C     . LEU A  1  762  ? 204.183 199.410 207.096 1.00 0.00 ? 762  LEU A C     1 
ATOM   5964  O  O     . LEU A  1  762  ? 204.906 198.413 207.139 1.00 0.00 ? 762  LEU A O     1 
ATOM   5965  C  CB    . LEU A  1  762  ? 204.181 200.261 209.456 1.00 0.00 ? 762  LEU A CB    1 
ATOM   5966  C  CG    . LEU A  1  762  ? 202.728 199.987 209.857 1.00 0.00 ? 762  LEU A CG    1 
ATOM   5967  C  CD1   . LEU A  1  762  ? 202.300 198.539 209.611 1.00 0.00 ? 762  LEU A CD1   1 
ATOM   5968  C  CD2   . LEU A  1  762  ? 202.515 200.379 211.304 1.00 0.00 ? 762  LEU A CD2   1 
ATOM   5969  N  N     . GLU A  1  763  ? 203.116 199.488 206.298 1.00 0.00 ? 763  GLU A N     1 
ATOM   5970  C  CA    . GLU A  1  763  ? 202.837 198.427 205.336 1.00 0.00 ? 763  GLU A CA    1 
ATOM   5971  C  C     . GLU A  1  763  ? 203.839 198.442 204.187 1.00 0.00 ? 763  GLU A C     1 
ATOM   5972  O  O     . GLU A  1  763  ? 204.458 197.412 203.888 1.00 0.00 ? 763  GLU A O     1 
ATOM   5973  C  CB    . GLU A  1  763  ? 201.400 198.563 204.826 1.00 0.00 ? 763  GLU A CB    1 
ATOM   5974  C  CG    . GLU A  1  763  ? 200.943 197.489 203.846 1.00 0.00 ? 763  GLU A CG    1 
ATOM   5975  C  CD    . GLU A  1  763  ? 201.350 197.787 202.416 1.00 0.00 ? 763  GLU A CD    1 
ATOM   5976  O  OE1   . GLU A  1  763  ? 201.563 198.976 202.099 1.00 0.00 ? 763  GLU A OE1   1 
ATOM   5977  O  OE2   . GLU A  1  763  ? 201.453 196.838 201.610 1.00 0.00 ? 763  GLU A OE2   1 
ATOM   5978  N  N     . ALA A  1  764  ? 204.015 199.592 203.533 1.00 0.00 ? 764  ALA A N     1 
ATOM   5979  C  CA    . ALA A  1  764  ? 205.063 199.707 202.528 1.00 0.00 ? 764  ALA A CA    1 
ATOM   5980  C  C     . ALA A  1  764  ? 206.441 199.498 203.134 1.00 0.00 ? 764  ALA A C     1 
ATOM   5981  O  O     . ALA A  1  764  ? 207.309 198.892 202.493 1.00 0.00 ? 764  ALA A O     1 
ATOM   5982  C  CB    . ALA A  1  764  ? 204.993 201.070 201.839 1.00 0.00 ? 764  ALA A CB    1 
ATOM   5983  N  N     . LYS A  1  765  ? 206.657 199.985 204.359 1.00 0.00 ? 765  LYS A N     1 
ATOM   5984  C  CA    . LYS A  1  765  ? 207.921 199.731 205.041 1.00 0.00 ? 765  LYS A CA    1 
ATOM   5985  C  C     . LYS A  1  765  ? 208.188 198.238 205.163 1.00 0.00 ? 765  LYS A C     1 
ATOM   5986  O  O     . LYS A  1  765  ? 209.229 197.747 204.716 1.00 0.00 ? 765  LYS A O     1 
ATOM   5987  C  CB    . LYS A  1  765  ? 207.925 200.384 206.423 1.00 0.00 ? 765  LYS A CB    1 
ATOM   5988  C  CG    . LYS A  1  765  ? 207.990 201.900 206.423 1.00 0.00 ? 765  LYS A CG    1 
ATOM   5989  C  CD    . LYS A  1  765  ? 207.903 202.425 207.847 1.00 0.00 ? 765  LYS A CD    1 
ATOM   5990  C  CE    . LYS A  1  765  ? 208.039 203.931 207.910 1.00 0.00 ? 765  LYS A CE    1 
ATOM   5991  N  NZ    . LYS A  1  765  ? 207.881 204.436 209.300 1.00 0.00 ? 765  LYS A NZ    1 
ATOM   5992  N  N     . ILE A  1  766  ? 207.251 197.495 205.757 1.00 0.00 ? 766  ILE A N     1 
ATOM   5993  C  CA    . ILE A  1  766  ? 207.493 196.077 206.000 1.00 0.00 ? 766  ILE A CA    1 
ATOM   5994  C  C     . ILE A  1  766  ? 207.634 195.323 204.682 1.00 0.00 ? 766  ILE A C     1 
ATOM   5995  O  O     . ILE A  1  766  ? 208.503 194.448 204.549 1.00 0.00 ? 766  ILE A O     1 
ATOM   5996  C  CB    . ILE A  1  766  ? 206.384 195.486 206.897 1.00 0.00 ? 766  ILE A CB    1 
ATOM   5997  C  CG1   . ILE A  1  766  ? 206.736 194.063 207.317 1.00 0.00 ? 766  ILE A CG1   1 
ATOM   5998  C  CG2   . ILE A  1  766  ? 205.035 195.469 206.202 1.00 0.00 ? 766  ILE A CG2   1 
ATOM   5999  C  CD1   . ILE A  1  766  ? 205.838 193.517 208.404 1.00 0.00 ? 766  ILE A CD1   1 
ATOM   6000  N  N     . GLY A  1  767  ? 206.822 195.671 203.679 1.00 0.00 ? 767  GLY A N     1 
ATOM   6001  C  CA    . GLY A  1  767  ? 206.926 195.025 202.383 1.00 0.00 ? 767  GLY A CA    1 
ATOM   6002  C  C     . GLY A  1  767  ? 208.249 195.256 201.686 1.00 0.00 ? 767  GLY A C     1 
ATOM   6003  O  O     . GLY A  1  767  ? 208.787 194.326 201.075 1.00 0.00 ? 767  GLY A O     1 
ATOM   6004  N  N     . GLY A  1  768  ? 208.783 196.471 201.759 1.00 0.00 ? 768  GLY A N     1 
ATOM   6005  C  CA    . GLY A  1  768  ? 210.078 196.751 201.173 1.00 0.00 ? 768  GLY A CA    1 
ATOM   6006  C  C     . GLY A  1  768  ? 211.212 196.091 201.928 1.00 0.00 ? 768  GLY A C     1 
ATOM   6007  O  O     . GLY A  1  768  ? 212.071 195.434 201.330 1.00 0.00 ? 768  GLY A O     1 
ATOM   6008  N  N     . LEU A  1  769  ? 211.216 196.260 203.253 1.00 0.00 ? 769  LEU A N     1 
ATOM   6009  C  CA    . LEU A  1  769  ? 212.281 195.697 204.078 1.00 0.00 ? 769  LEU A CA    1 
ATOM   6010  C  C     . LEU A  1  769  ? 212.375 194.188 203.909 1.00 0.00 ? 769  LEU A C     1 
ATOM   6011  O  O     . LEU A  1  769  ? 213.459 193.652 203.655 1.00 0.00 ? 769  LEU A O     1 
ATOM   6012  C  CB    . LEU A  1  769  ? 212.069 196.062 205.547 1.00 0.00 ? 769  LEU A CB    1 
ATOM   6013  C  CG    . LEU A  1  769  ? 212.719 197.356 206.049 1.00 0.00 ? 769  LEU A CG    1 
ATOM   6014  C  CD1   . LEU A  1  769  ? 212.135 198.598 205.390 1.00 0.00 ? 769  LEU A CD1   1 
ATOM   6015  C  CD2   . LEU A  1  769  ? 212.621 197.454 207.566 1.00 0.00 ? 769  LEU A CD2   1 
ATOM   6016  N  N     . LEU A  1  770  ? 211.249 193.482 204.034 1.00 0.00 ? 770  LEU A N     1 
ATOM   6017  C  CA    . LEU A  1  770  ? 211.319 192.028 203.939 1.00 0.00 ? 770  LEU A CA    1 
ATOM   6018  C  C     . LEU A  1  770  ? 211.722 191.569 202.543 1.00 0.00 ? 770  LEU A C     1 
ATOM   6019  O  O     . LEU A  1  770  ? 212.394 190.541 202.402 1.00 0.00 ? 770  LEU A O     1 
ATOM   6020  C  CB    . LEU A  1  770  ? 209.990 191.408 204.358 1.00 0.00 ? 770  LEU A CB    1 
ATOM   6021  C  CG    . LEU A  1  770  ? 209.710 191.673 205.837 1.00 0.00 ? 770  LEU A CG    1 
ATOM   6022  C  CD1   . LEU A  1  770  ? 208.372 191.106 206.250 1.00 0.00 ? 770  LEU A CD1   1 
ATOM   6023  C  CD2   . LEU A  1  770  ? 210.829 191.111 206.699 1.00 0.00 ? 770  LEU A CD2   1 
ATOM   6024  N  N     . SER A  1  771  ? 211.338 192.316 201.506 1.00 0.00 ? 771  SER A N     1 
ATOM   6025  C  CA    . SER A  1  771  ? 211.791 191.980 200.162 1.00 0.00 ? 771  SER A CA    1 
ATOM   6026  C  C     . SER A  1  771  ? 213.299 192.140 200.024 1.00 0.00 ? 771  SER A C     1 
ATOM   6027  O  O     . SER A  1  771  ? 213.972 191.236 199.511 1.00 0.00 ? 771  SER A O     1 
ATOM   6028  C  CB    . SER A  1  771  ? 211.070 192.845 199.128 1.00 0.00 ? 771  SER A CB    1 
ATOM   6029  O  OG    . SER A  1  771  ? 211.526 192.560 197.817 1.00 0.00 ? 771  SER A OG    1 
ATOM   6030  N  N     . LYS A  1  772  ? 213.848 193.270 200.478 1.00 0.00 ? 772  LYS A N     1 
ATOM   6031  C  CA    . LYS A  1  772  ? 215.290 193.471 200.377 1.00 0.00 ? 772  LYS A CA    1 
ATOM   6032  C  C     . LYS A  1  772  ? 216.056 192.443 201.199 1.00 0.00 ? 772  LYS A C     1 
ATOM   6033  O  O     . LYS A  1  772  ? 217.116 191.973 200.773 1.00 0.00 ? 772  LYS A O     1 
ATOM   6034  C  CB    . LYS A  1  772  ? 215.669 194.887 200.814 1.00 0.00 ? 772  LYS A CB    1 
ATOM   6035  C  CG    . LYS A  1  772  ? 217.159 195.175 200.682 1.00 0.00 ? 772  LYS A CG    1 
ATOM   6036  C  CD    . LYS A  1  772  ? 217.495 196.630 200.952 1.00 0.00 ? 772  LYS A CD    1 
ATOM   6037  C  CE    . LYS A  1  772  ? 218.994 196.872 200.837 1.00 0.00 ? 772  LYS A CE    1 
ATOM   6038  N  NZ    . LYS A  1  772  ? 219.745 196.239 201.956 1.00 0.00 ? 772  LYS A NZ    1 
ATOM   6039  N  N     . VAL A  1  773  ? 215.542 192.088 202.377 1.00 0.00 ? 773  VAL A N     1 
ATOM   6040  C  CA    . VAL A  1  773  ? 216.182 191.052 203.180 1.00 0.00 ? 773  VAL A CA    1 
ATOM   6041  C  C     . VAL A  1  773  ? 216.161 189.716 202.451 1.00 0.00 ? 773  VAL A C     1 
ATOM   6042  O  O     . VAL A  1  773  ? 217.191 189.038 202.339 1.00 0.00 ? 773  VAL A O     1 
ATOM   6043  C  CB    . VAL A  1  773  ? 215.508 190.955 204.559 1.00 0.00 ? 773  VAL A CB    1 
ATOM   6044  C  CG1   . VAL A  1  773  ? 216.011 189.736 205.301 1.00 0.00 ? 773  VAL A CG1   1 
ATOM   6045  C  CG2   . VAL A  1  773  ? 215.784 192.213 205.366 1.00 0.00 ? 773  VAL A CG2   1 
ATOM   6046  N  N     . ARG A  1  774  ? 214.992 189.317 201.943 1.00 0.00 ? 774  ARG A N     1 
ATOM   6047  C  CA    . ARG A  1  774  ? 214.872 188.041 201.243 1.00 0.00 ? 774  ARG A CA    1 
ATOM   6048  C  C     . ARG A  1  774  ? 215.814 187.961 200.052 1.00 0.00 ? 774  ARG A C     1 
ATOM   6049  O  O     . ARG A  1  774  ? 216.496 186.948 199.858 1.00 0.00 ? 774  ARG A O     1 
ATOM   6050  C  CB    . ARG A  1  774  ? 213.430 187.832 200.799 1.00 0.00 ? 774  ARG A CB    1 
ATOM   6051  C  CG    . ARG A  1  774  ? 213.207 186.627 199.917 1.00 0.00 ? 774  ARG A CG    1 
ATOM   6052  C  CD    . ARG A  1  774  ? 211.722 186.475 199.645 1.00 0.00 ? 774  ARG A CD    1 
ATOM   6053  N  NE    . ARG A  1  774  ? 211.426 185.408 198.699 1.00 0.00 ? 774  ARG A NE    1 
ATOM   6054  C  CZ    . ARG A  1  774  ? 211.319 185.589 197.388 1.00 0.00 ? 774  ARG A CZ    1 
ATOM   6055  N  NH1   . ARG A  1  774  ? 211.464 186.800 196.869 1.00 0.00 ? 774  ARG A NH1   1 
ATOM   6056  N  NH2   . ARG A  1  774  ? 211.052 184.564 196.600 1.00 0.00 ? 774  ARG A NH2   1 
ATOM   6057  N  N     . GLU A  1  775  ? 215.864 189.015 199.240 1.00 0.00 ? 775  GLU A N     1 
ATOM   6058  C  CA    . GLU A  1  775  ? 216.798 189.031 198.120 1.00 0.00 ? 775  GLU A CA    1 
ATOM   6059  C  C     . GLU A  1  775  ? 218.248 189.019 198.592 1.00 0.00 ? 775  GLU A C     1 
ATOM   6060  O  O     . GLU A  1  775  ? 219.090 188.347 197.984 1.00 0.00 ? 775  GLU A O     1 
ATOM   6061  C  CB    . GLU A  1  775  ? 216.512 190.248 197.236 1.00 0.00 ? 775  GLU A CB    1 
ATOM   6062  C  CG    . GLU A  1  775  ? 217.396 190.387 196.014 1.00 0.00 ? 775  GLU A CG    1 
ATOM   6063  C  CD    . GLU A  1  775  ? 218.718 191.042 196.340 1.00 0.00 ? 775  GLU A CD    1 
ATOM   6064  O  OE1   . GLU A  1  775  ? 218.776 191.773 197.350 1.00 0.00 ? 775  GLU A OE1   1 
ATOM   6065  O  OE2   . GLU A  1  775  ? 219.697 190.821 195.598 1.00 0.00 ? 775  GLU A OE2   1 
ATOM   6066  N  N     . GLU A  1  776  ? 218.550 189.737 199.675 1.00 0.00 ? 776  GLU A N     1 
ATOM   6067  C  CA    . GLU A  1  776  ? 219.921 189.798 200.167 1.00 0.00 ? 776  GLU A CA    1 
ATOM   6068  C  C     . GLU A  1  776  ? 220.404 188.433 200.640 1.00 0.00 ? 776  GLU A C     1 
ATOM   6069  O  O     . GLU A  1  776  ? 221.563 188.068 200.414 1.00 0.00 ? 776  GLU A O     1 
ATOM   6070  C  CB    . GLU A  1  776  ? 220.030 190.826 201.292 1.00 0.00 ? 776  GLU A CB    1 
ATOM   6071  C  CG    . GLU A  1  776  ? 221.439 191.013 201.826 1.00 0.00 ? 776  GLU A CG    1 
ATOM   6072  C  CD    . GLU A  1  776  ? 221.517 192.077 202.901 1.00 0.00 ? 776  GLU A CD    1 
ATOM   6073  O  OE1   . GLU A  1  776  ? 220.461 192.642 203.256 1.00 0.00 ? 776  GLU A OE1   1 
ATOM   6074  O  OE2   . GLU A  1  776  ? 222.632 192.349 203.392 1.00 0.00 ? 776  GLU A OE2   1 
ATOM   6075  N  N     . VAL A  1  777  ? 219.536 187.664 201.300 1.00 0.00 ? 777  VAL A N     1 
ATOM   6076  C  CA    . VAL A  1  777  ? 219.943 186.329 201.722 1.00 0.00 ? 777  VAL A CA    1 
ATOM   6077  C  C     . VAL A  1  777  ? 220.154 185.438 200.504 1.00 0.00 ? 777  VAL A C     1 
ATOM   6078  O  O     . VAL A  1  777  ? 221.004 184.538 200.519 1.00 0.00 ? 777  VAL A O     1 
ATOM   6079  C  CB    . VAL A  1  777  ? 218.912 185.740 202.702 1.00 0.00 ? 777  VAL A CB    1 
ATOM   6080  C  CG1   . VAL A  1  777  ? 219.336 184.359 203.162 1.00 0.00 ? 777  VAL A CG1   1 
ATOM   6081  C  CG2   . VAL A  1  777  ? 218.735 186.663 203.896 1.00 0.00 ? 777  VAL A CG2   1 
ATOM   6082  N  N     . GLY A  1  778  ? 219.410 185.683 199.425 1.00 0.00 ? 778  GLY A N     1 
ATOM   6083  C  CA    . GLY A  1  778  ? 219.682 185.003 198.173 1.00 0.00 ? 778  GLY A CA    1 
ATOM   6084  C  C     . GLY A  1  778  ? 220.999 185.396 197.539 1.00 0.00 ? 778  GLY A C     1 
ATOM   6085  O  O     . GLY A  1  778  ? 221.607 184.579 196.839 1.00 0.00 ? 778  GLY A O     1 
ATOM   6086  N  N     . ASP A  1  779  ? 221.453 186.631 197.770 1.00 0.00 ? 779  ASP A N     1 
ATOM   6087  C  CA    . ASP A  1  779  ? 222.755 187.052 197.261 1.00 0.00 ? 779  ASP A CA    1 
ATOM   6088  C  C     . ASP A  1  779  ? 223.872 186.208 197.865 1.00 0.00 ? 779  ASP A C     1 
ATOM   6089  O  O     . ASP A  1  779  ? 224.687 185.626 197.139 1.00 0.00 ? 779  ASP A O     1 
ATOM   6090  C  CB    . ASP A  1  779  ? 222.972 188.537 197.556 1.00 0.00 ? 779  ASP A CB    1 
ATOM   6091  C  CG    . ASP A  1  779  ? 224.238 189.086 196.926 1.00 0.00 ? 779  ASP A CG    1 
ATOM   6092  O  OD1   . ASP A  1  779  ? 224.969 188.319 196.264 1.00 0.00 ? 779  ASP A OD1   1 
ATOM   6093  O  OD2   . ASP A  1  779  ? 224.499 190.297 197.086 1.00 0.00 ? 779  ASP A OD2   1 
ATOM   6094  N  N     . VAL A  1  780  ? 223.923 186.127 199.197 1.00 0.00 ? 780  VAL A N     1 
ATOM   6095  C  CA    . VAL A  1  780  ? 224.895 185.253 199.838 1.00 0.00 ? 780  VAL A CA    1 
ATOM   6096  C  C     . VAL A  1  780  ? 224.555 183.789 199.613 1.00 0.00 ? 780  VAL A C     1 
ATOM   6097  O  O     . VAL A  1  780  ? 225.384 182.916 199.889 1.00 0.00 ? 780  VAL A O     1 
ATOM   6098  C  CB    . VAL A  1  780  ? 225.001 185.555 201.344 1.00 0.00 ? 780  VAL A CB    1 
ATOM   6099  C  CG1   . VAL A  1  780  ? 225.509 186.967 201.562 1.00 0.00 ? 780  VAL A CG1   1 
ATOM   6100  C  CG2   . VAL A  1  780  ? 223.663 185.360 202.022 1.00 0.00 ? 780  VAL A CG2   1 
ATOM   6101  N  N     . CYS A  1  781  ? 223.350 183.493 199.119 1.00 0.00 ? 781  CYS A N     1 
ATOM   6102  C  CA    . CYS A  1  781  ? 223.025 182.116 198.763 1.00 0.00 ? 781  CYS A CA    1 
ATOM   6103  C  C     . CYS A  1  781  ? 223.692 181.699 197.462 1.00 0.00 ? 781  CYS A C     1 
ATOM   6104  O  O     . CYS A  1  781  ? 224.274 180.613 197.391 1.00 0.00 ? 781  CYS A O     1 
ATOM   6105  C  CB    . CYS A  1  781  ? 221.515 181.934 198.648 1.00 0.00 ? 781  CYS A CB    1 
ATOM   6106  S  SG    . CYS A  1  781  ? 221.016 180.252 198.222 1.00 0.00 ? 781  CYS A SG    1 
ATOM   6107  N  N     . ILE A  1  782  ? 223.619 182.531 196.429 1.00 0.00 ? 782  ILE A N     1 
ATOM   6108  C  CA    . ILE A  1  782  ? 224.212 182.214 195.138 1.00 0.00 ? 782  ILE A CA    1 
ATOM   6109  C  C     . ILE A  1  782  ? 225.717 182.452 195.133 1.00 0.00 ? 782  ILE A C     1 
ATOM   6110  O  O     . ILE A  1  782  ? 226.467 181.670 194.546 1.00 0.00 ? 782  ILE A O     1 
ATOM   6111  C  CB    . ILE A  1  782  ? 223.514 183.011 194.012 1.00 0.00 ? 782  ILE A CB    1 
ATOM   6112  C  CG1   . ILE A  1  782  ? 224.105 182.641 192.647 1.00 0.00 ? 782  ILE A CG1   1 
ATOM   6113  C  CG2   . ILE A  1  782  ? 223.592 184.512 194.267 1.00 0.00 ? 782  ILE A CG2   1 
ATOM   6114  C  CD1   . ILE A  1  782  ? 223.323 183.176 191.465 1.00 0.00 ? 782  ILE A CD1   1 
ATOM   6115  N  N     . ASN A  1  783  ? 226.180 183.515 195.790 1.00 0.00 ? 783  ASN A N     1 
ATOM   6116  C  CA    . ASN A  1  783  ? 227.590 183.880 195.706 1.00 0.00 ? 783  ASN A CA    1 
ATOM   6117  C  C     . ASN A  1  783  ? 228.461 182.893 196.473 1.00 0.00 ? 783  ASN A C     1 
ATOM   6118  O  O     . ASN A  1  783  ? 229.425 182.344 195.930 1.00 0.00 ? 783  ASN A O     1 
ATOM   6119  C  CB    . ASN A  1  783  ? 227.789 185.304 196.233 1.00 0.00 ? 783  ASN A CB    1 
ATOM   6120  C  CG    . ASN A  1  783  ? 229.194 185.837 195.990 1.00 0.00 ? 783  ASN A CG    1 
ATOM   6121  O  OD1   . ASN A  1  783  ? 230.139 185.080 195.765 1.00 0.00 ? 783  ASN A OD1   1 
ATOM   6122  N  ND2   . ASN A  1  783  ? 229.333 187.156 196.039 1.00 0.00 ? 783  ASN A ND2   1 
ATOM   6123  N  N     . GLU A  1  784  ? 228.134 182.652 197.738 1.00 0.00 ? 784  GLU A N     1 
ATOM   6124  C  CA    . GLU A  1  784  ? 229.019 181.883 198.601 1.00 0.00 ? 784  GLU A CA    1 
ATOM   6125  C  C     . GLU A  1  784  ? 228.712 180.395 198.530 1.00 0.00 ? 784  GLU A C     1 
ATOM   6126  O  O     . GLU A  1  784  ? 229.301 179.598 199.266 1.00 0.00 ? 784  GLU A O     1 
ATOM   6127  C  CB    . GLU A  1  784  ? 228.929 182.390 200.041 1.00 0.00 ? 784  GLU A CB    1 
ATOM   6128  C  CG    . GLU A  1  784  ? 229.484 183.798 200.219 1.00 0.00 ? 784  GLU A CG    1 
ATOM   6129  C  CD    . GLU A  1  784  ? 229.364 184.311 201.641 1.00 0.00 ? 784  GLU A CD    1 
ATOM   6130  O  OE1   . GLU A  1  784  ? 228.691 183.652 202.461 1.00 0.00 ? 784  GLU A OE1   1 
ATOM   6131  O  OE2   . GLU A  1  784  ? 229.944 185.376 201.940 1.00 0.00 ? 784  GLU A OE2   1 
ATOM   6132  N  N     . LEU A  1  785  ? 227.786 180.010 197.661 1.00 0.00 ? 785  LEU A N     1 
ATOM   6133  C  CA    . LEU A  1  785  ? 227.518 178.609 197.391 1.00 0.00 ? 785  LEU A CA    1 
ATOM   6134  C  C     . LEU A  1  785  ? 228.726 178.008 196.690 1.00 0.00 ? 785  LEU A C     1 
ATOM   6135  O  O     . LEU A  1  785  ? 229.480 178.710 196.012 1.00 0.00 ? 785  LEU A O     1 
ATOM   6136  C  CB    . LEU A  1  785  ? 226.263 178.439 196.532 1.00 0.00 ? 785  LEU A CB    1 
ATOM   6137  C  CG    . LEU A  1  785  ? 225.826 177.021 196.178 1.00 0.00 ? 785  LEU A CG    1 
ATOM   6138  C  CD1   . LEU A  1  785  ? 225.515 176.252 197.446 1.00 0.00 ? 785  LEU A CD1   1 
ATOM   6139  C  CD2   . LEU A  1  785  ? 224.617 177.054 195.264 1.00 0.00 ? 785  LEU A CD2   1 
ATOM   6140  N  N     . ASP A  1  786  ? 228.908 176.703 196.861 1.00 0.00 ? 786  ASP A N     1 
ATOM   6141  C  CA    . ASP A  1  786  ? 230.057 176.035 196.270 1.00 0.00 ? 786  ASP A CA    1 
ATOM   6142  C  C     . ASP A  1  786  ? 229.968 176.048 194.750 1.00 0.00 ? 786  ASP A C     1 
ATOM   6143  O  O     . ASP A  1  786  ? 228.891 176.207 194.171 1.00 0.00 ? 786  ASP A O     1 
ATOM   6144  C  CB    . ASP A  1  786  ? 230.143 174.595 196.771 1.00 0.00 ? 786  ASP A CB    1 
ATOM   6145  C  CG    . ASP A  1  786  ? 231.380 173.873 196.275 1.00 0.00 ? 786  ASP A CG    1 
ATOM   6146  O  OD1   . ASP A  1  786  ? 232.250 174.509 195.644 1.00 0.00 ? 786  ASP A OD1   1 
ATOM   6147  O  OD2   . ASP A  1  786  ? 231.471 172.653 196.504 1.00 0.00 ? 786  ASP A OD2   1 
ATOM   6148  N  N     . ASN A  1  787  ? 231.120 175.896 194.111 1.00 0.00 ? 787  ASN A N     1 
ATOM   6149  C  CA    . ASN A  1  787  ? 231.199 175.685 192.679 1.00 0.00 ? 787  ASN A CA    1 
ATOM   6150  C  C     . ASN A  1  787  ? 230.669 174.300 192.320 1.00 0.00 ? 787  ASN A C     1 
ATOM   6151  O  O     . ASN A  1  787  ? 230.573 173.407 193.166 1.00 0.00 ? 787  ASN A O     1 
ATOM   6152  C  CB    . ASN A  1  787  ? 232.642 175.853 192.210 1.00 0.00 ? 787  ASN A CB    1 
ATOM   6153  C  CG    . ASN A  1  787  ? 232.766 175.878 190.711 1.00 0.00 ? 787  ASN A CG    1 
ATOM   6154  O  OD1   . ASN A  1  787  ? 231.810 176.189 190.003 1.00 0.00 ? 787  ASN A OD1   1 
ATOM   6155  N  ND2   . ASN A  1  787  ? 233.963 175.595 190.215 1.00 0.00 ? 787  ASN A ND2   1 
ATOM   6156  N  N     . TRP A  1  788  ? 230.310 174.137 191.043 1.00 0.00 ? 788  TRP A N     1 
ATOM   6157  C  CA    . TRP A  1  788  ? 229.926 172.847 190.475 1.00 0.00 ? 788  TRP A CA    1 
ATOM   6158  C  C     . TRP A  1  788  ? 228.695 172.215 191.099 1.00 0.00 ? 788  TRP A C     1 
ATOM   6159  O  O     . TRP A  1  788  ? 228.716 171.020 191.411 1.00 0.00 ? 788  TRP A O     1 
ATOM   6160  C  CB    . TRP A  1  788  ? 231.063 171.837 190.607 1.00 0.00 ? 788  TRP A CB    1 
ATOM   6161  C  CG    . TRP A  1  788  ? 232.214 172.070 189.729 1.00 0.00 ? 788  TRP A CG    1 
ATOM   6162  C  CD1   . TRP A  1  788  ? 233.384 172.674 190.053 1.00 0.00 ? 788  TRP A CD1   1 
ATOM   6163  C  CD2   . TRP A  1  788  ? 232.318 171.695 188.358 1.00 0.00 ? 788  TRP A CD2   1 
ATOM   6164  N  NE1   . TRP A  1  788  ? 234.219 172.701 188.965 1.00 0.00 ? 788  TRP A NE1   1 
ATOM   6165  C  CE2   . TRP A  1  788  ? 233.584 172.107 187.908 1.00 0.00 ? 788  TRP A CE2   1 
ATOM   6166  C  CE3   . TRP A  1  788  ? 231.462 171.053 187.466 1.00 0.00 ? 788  TRP A CE3   1 
ATOM   6167  C  CZ2   . TRP A  1  788  ? 234.015 171.898 186.605 1.00 0.00 ? 788  TRP A CZ2   1 
ATOM   6168  C  CZ3   . TRP A  1  788  ? 231.888 170.846 186.179 1.00 0.00 ? 788  TRP A CZ3   1 
ATOM   6169  C  CH2   . TRP A  1  788  ? 233.154 171.266 185.758 1.00 0.00 ? 788  TRP A CH2   1 
ATOM   6170  N  N     . ASN A  1  789  ? 227.606 172.954 191.259 1.00 0.00 ? 789  ASN A N     1 
ATOM   6171  C  CA    . ASN A  1  789  ? 226.413 172.306 191.774 1.00 0.00 ? 789  ASN A CA    1 
ATOM   6172  C  C     . ASN A  1  789  ? 225.183 172.883 191.088 1.00 0.00 ? 789  ASN A C     1 
ATOM   6173  O  O     . ASN A  1  789  ? 225.144 174.060 190.728 1.00 0.00 ? 789  ASN A O     1 
ATOM   6174  C  CB    . ASN A  1  789  ? 226.357 172.411 193.296 1.00 0.00 ? 789  ASN A CB    1 
ATOM   6175  C  CG    . ASN A  1  789  ? 226.322 173.825 193.782 1.00 0.00 ? 789  ASN A CG    1 
ATOM   6176  O  OD1   . ASN A  1  789  ? 226.609 174.759 193.040 1.00 0.00 ? 789  ASN A OD1   1 
ATOM   6177  N  ND2   . ASN A  1  789  ? 225.974 173.996 195.049 1.00 0.00 ? 789  ASN A ND2   1 
ATOM   6178  N  N     . ALA A  1  790  ? 224.179 172.026 190.910 1.00 0.00 ? 790  ALA A N     1 
ATOM   6179  C  CA    . ALA A  1  790  ? 223.253 172.178 189.789 1.00 0.00 ? 790  ALA A CA    1 
ATOM   6180  C  C     . ALA A  1  790  ? 222.335 173.387 189.891 1.00 0.00 ? 790  ALA A C     1 
ATOM   6181  O  O     . ALA A  1  790  ? 222.210 174.117 188.894 1.00 0.00 ? 790  ALA A O     1 
ATOM   6182  C  CB    . ALA A  1  790  ? 222.469 170.876 189.608 1.00 0.00 ? 790  ALA A CB    1 
ATOM   6183  N  N     . PRO A  1  791  ? 221.674 173.670 191.018 1.00 0.00 ? 791  PRO A N     1 
ATOM   6184  C  CA    . PRO A  1  791  ? 220.947 174.944 191.114 1.00 0.00 ? 791  PRO A CA    1 
ATOM   6185  C  C     . PRO A  1  791  ? 221.797 176.153 190.795 1.00 0.00 ? 791  PRO A C     1 
ATOM   6186  O  O     . PRO A  1  791  ? 221.246 177.234 190.545 1.00 0.00 ? 791  PRO A O     1 
ATOM   6187  C  CB    . PRO A  1  791  ? 220.466 174.948 192.564 1.00 0.00 ? 791  PRO A CB    1 
ATOM   6188  C  CG    . PRO A  1  791  ? 220.209 173.535 192.841 1.00 0.00 ? 791  PRO A CG    1 
ATOM   6189  C  CD    . PRO A  1  791  ? 221.190 172.731 192.042 1.00 0.00 ? 791  PRO A CD    1 
ATOM   6190  N  N     . LEU A  1  792  ? 223.117 176.015 190.791 1.00 0.00 ? 792  LEU A N     1 
ATOM   6191  C  CA    . LEU A  1  792  ? 223.940 177.039 190.176 1.00 0.00 ? 792  LEU A CA    1 
ATOM   6192  C  C     . LEU A  1  792  ? 224.087 176.836 188.675 1.00 0.00 ? 792  LEU A C     1 
ATOM   6193  O  O     . LEU A  1  792  ? 223.390 177.512 187.910 1.00 0.00 ? 792  LEU A O     1 
ATOM   6194  C  CB    . LEU A  1  792  ? 225.318 177.076 190.841 1.00 0.00 ? 792  LEU A CB    1 
ATOM   6195  C  CG    . LEU A  1  792  ? 226.242 178.262 190.576 1.00 0.00 ? 792  LEU A CG    1 
ATOM   6196  C  CD1   . LEU A  1  792  ? 227.097 178.475 191.807 1.00 0.00 ? 792  LEU A CD1   1 
ATOM   6197  C  CD2   . LEU A  1  792  ? 227.104 178.051 189.344 1.00 0.00 ? 792  LEU A CD2   1 
ATOM   6198  N  N     . ILE A  1  793  ? 224.886 175.862 188.245 1.00 0.00 ? 793  ILE A N     1 
ATOM   6199  C  CA    . ILE A  1  793  ? 225.245 175.733 186.836 1.00 0.00 ? 793  ILE A CA    1 
ATOM   6200  C  C     . ILE A  1  793  ? 224.031 175.798 185.916 1.00 0.00 ? 793  ILE A C     1 
ATOM   6201  O  O     . ILE A  1  793  ? 224.120 176.343 184.814 1.00 0.00 ? 793  ILE A O     1 
ATOM   6202  C  CB    . ILE A  1  793  ? 226.040 174.436 186.622 1.00 0.00 ? 793  ILE A CB    1 
ATOM   6203  C  CG1   . ILE A  1  793  ? 227.385 174.532 187.332 1.00 0.00 ? 793  ILE A CG1   1 
ATOM   6204  C  CG2   . ILE A  1  793  ? 226.265 174.177 185.162 1.00 0.00 ? 793  ILE A CG2   1 
ATOM   6205  C  CD1   . ILE A  1  793  ? 228.164 173.244 187.328 1.00 0.00 ? 793  ILE A CD1   1 
ATOM   6206  N  N     . MET A  1  794  ? 222.885 175.283 186.347 1.00 0.00 ? 794  MET A N     1 
ATOM   6207  C  CA    . MET A  1  794  ? 221.671 175.481 185.566 1.00 0.00 ? 794  MET A CA    1 
ATOM   6208  C  C     . MET A  1  794  ? 221.126 176.891 185.744 1.00 0.00 ? 794  MET A C     1 
ATOM   6209  O  O     . MET A  1  794  ? 221.243 177.730 184.848 1.00 0.00 ? 794  MET A O     1 
ATOM   6210  C  CB    . MET A  1  794  ? 220.598 174.468 185.971 1.00 0.00 ? 794  MET A CB    1 
ATOM   6211  C  CG    . MET A  1  794  ? 220.919 173.047 185.613 1.00 0.00 ? 794  MET A CG    1 
ATOM   6212  S  SD    . MET A  1  794  ? 219.544 171.965 186.010 1.00 0.00 ? 794  MET A SD    1 
ATOM   6213  C  CE    . MET A  1  794  ? 219.661 171.974 187.787 1.00 0.00 ? 794  MET A CE    1 
ATOM   6214  N  N     . ALA A  1  795  ? 220.563 177.171 186.916 1.00 0.00 ? 795  ALA A N     1 
ATOM   6215  C  CA    . ALA A  1  795  ? 219.787 178.391 187.084 1.00 0.00 ? 795  ALA A CA    1 
ATOM   6216  C  C     . ALA A  1  795  ? 220.681 179.618 187.094 1.00 0.00 ? 795  ALA A C     1 
ATOM   6217  O  O     . ALA A  1  795  ? 220.338 180.649 186.506 1.00 0.00 ? 795  ALA A O     1 
ATOM   6218  C  CB    . ALA A  1  795  ? 218.961 178.312 188.362 1.00 0.00 ? 795  ALA A CB    1 
ATOM   6219  N  N     . THR A  1  796  ? 221.835 179.532 187.761 1.00 0.00 ? 796  THR A N     1 
ATOM   6220  C  CA    . THR A  1  796  ? 222.776 180.650 187.729 1.00 0.00 ? 796  THR A CA    1 
ATOM   6221  C  C     . THR A  1  796  ? 223.069 181.061 186.300 1.00 0.00 ? 796  THR A C     1 
ATOM   6222  O  O     . THR A  1  796  ? 223.263 182.244 186.011 1.00 0.00 ? 796  THR A O     1 
ATOM   6223  C  CB    . THR A  1  796  ? 224.078 180.287 188.447 1.00 0.00 ? 796  THR A CB    1 
ATOM   6224  O  OG1   . THR A  1  796  ? 223.815 180.063 189.837 1.00 0.00 ? 796  THR A OG1   1 
ATOM   6225  C  CG2   . THR A  1  796  ? 225.132 181.381 188.295 1.00 0.00 ? 796  THR A CG2   1 
ATOM   6226  N  N     . CYS A  1  797  ? 223.078 180.102 185.388 1.00 0.00 ? 797  CYS A N     1 
ATOM   6227  C  CA    . CYS A  1  797  ? 223.405 180.438 184.020 1.00 0.00 ? 797  CYS A CA    1 
ATOM   6228  C  C     . CYS A  1  797  ? 222.328 179.990 183.040 1.00 0.00 ? 797  CYS A C     1 
ATOM   6229  O  O     . CYS A  1  797  ? 221.535 180.809 182.567 1.00 0.00 ? 797  CYS A O     1 
ATOM   6230  C  CB    . CYS A  1  797  ? 224.756 179.817 183.681 1.00 0.00 ? 797  CYS A CB    1 
ATOM   6231  S  SG    . CYS A  1  797  ? 226.095 180.418 184.727 1.00 0.00 ? 797  CYS A SG    1 
ATOM   6232  N  N     . GLY A  1  798  ? 222.287 178.703 182.728 1.00 0.00 ? 798  GLY A N     1 
ATOM   6233  C  CA    . GLY A  1  798  ? 221.638 178.336 181.488 1.00 0.00 ? 798  GLY A CA    1 
ATOM   6234  C  C     . GLY A  1  798  ? 220.140 178.399 181.306 1.00 0.00 ? 798  GLY A C     1 
ATOM   6235  O  O     . GLY A  1  798  ? 219.646 179.237 180.547 1.00 0.00 ? 798  GLY A O     1 
ATOM   6236  N  N     . SER A  1  799  ? 219.391 177.555 182.002 1.00 0.00 ? 799  SER A N     1 
ATOM   6237  C  CA    . SER A  1  799  ? 218.064 177.293 181.474 1.00 0.00 ? 799  SER A CA    1 
ATOM   6238  C  C     . SER A  1  799  ? 216.948 177.359 182.503 1.00 0.00 ? 799  SER A C     1 
ATOM   6239  O  O     . SER A  1  799  ? 216.169 178.317 182.530 1.00 0.00 ? 799  SER A O     1 
ATOM   6240  C  CB    . SER A  1  799  ? 218.048 175.931 180.791 1.00 0.00 ? 799  SER A CB    1 
ATOM   6241  O  OG    . SER A  1  799  ? 218.315 174.891 181.712 1.00 0.00 ? 799  SER A OG    1 
ATOM   6242  N  N     . LYS A  1  800  ? 216.869 176.349 183.359 1.00 0.00 ? 800  LYS A N     1 
ATOM   6243  C  CA    . LYS A  1  800  ? 215.704 176.146 184.204 1.00 0.00 ? 800  LYS A CA    1 
ATOM   6244  C  C     . LYS A  1  800  ? 215.922 176.850 185.533 1.00 0.00 ? 800  LYS A C     1 
ATOM   6245  O  O     . LYS A  1  800  ? 217.040 176.870 186.053 1.00 0.00 ? 800  LYS A O     1 
ATOM   6246  C  CB    . LYS A  1  800  ? 215.427 174.658 184.387 1.00 0.00 ? 800  LYS A CB    1 
ATOM   6247  C  CG    . LYS A  1  800  ? 215.060 173.977 183.088 1.00 0.00 ? 800  LYS A CG    1 
ATOM   6248  C  CD    . LYS A  1  800  ? 213.848 174.646 182.471 1.00 0.00 ? 800  LYS A CD    1 
ATOM   6249  C  CE    . LYS A  1  800  ? 212.593 174.289 183.235 1.00 0.00 ? 800  LYS A CE    1 
ATOM   6250  N  NZ    . LYS A  1  800  ? 211.376 174.868 182.610 1.00 0.00 ? 800  LYS A NZ    1 
ATOM   6251  N  N     . GLY A  1  801  ? 214.860 177.450 186.064 1.00 0.00 ? 801  GLY A N     1 
ATOM   6252  C  CA    . GLY A  1  801  ? 214.948 178.197 187.298 1.00 0.00 ? 801  GLY A CA    1 
ATOM   6253  C  C     . GLY A  1  801  ? 215.775 179.455 187.154 1.00 0.00 ? 801  GLY A C     1 
ATOM   6254  O  O     . GLY A  1  801  ? 216.231 179.831 186.072 1.00 0.00 ? 801  GLY A O     1 
ATOM   6255  N  N     . SER A  1  802  ? 215.967 180.126 188.284 1.00 0.00 ? 802  SER A N     1 
ATOM   6256  C  CA    . SER A  1  802  ? 216.787 181.328 188.331 1.00 0.00 ? 802  SER A CA    1 
ATOM   6257  C  C     . SER A  1  802  ? 217.307 181.481 189.755 1.00 0.00 ? 802  SER A C     1 
ATOM   6258  O  O     . SER A  1  802  ? 216.981 180.691 190.648 1.00 0.00 ? 802  SER A O     1 
ATOM   6259  C  CB    . SER A  1  802  ? 215.988 182.545 187.847 1.00 0.00 ? 802  SER A CB    1 
ATOM   6260  O  OG    . SER A  1  802  ? 216.781 183.715 187.908 1.00 0.00 ? 802  SER A OG    1 
ATOM   6261  N  N     . THR A  1  803  ? 218.123 182.511 189.978 1.00 0.00 ? 803  THR A N     1 
ATOM   6262  C  CA    . THR A  1  803  ? 218.727 182.721 191.285 1.00 0.00 ? 803  THR A CA    1 
ATOM   6263  C  C     . THR A  1  803  ? 217.698 182.970 192.377 1.00 0.00 ? 803  THR A C     1 
ATOM   6264  O  O     . THR A  1  803  ? 217.931 182.575 193.525 1.00 0.00 ? 803  THR A O     1 
ATOM   6265  C  CB    . THR A  1  803  ? 219.719 183.882 191.227 1.00 0.00 ? 803  THR A CB    1 
ATOM   6266  O  OG1   . THR A  1  803  ? 220.398 183.991 192.482 1.00 0.00 ? 803  THR A OG1   1 
ATOM   6267  C  CG2   . THR A  1  803  ? 219.011 185.189 190.921 1.00 0.00 ? 803  THR A CG2   1 
ATOM   6268  N  N     . LEU A  1  804  ? 216.575 183.608 192.053 1.00 0.00 ? 804  LEU A N     1 
ATOM   6269  C  CA    . LEU A  1  804  ? 215.495 183.758 193.017 1.00 0.00 ? 804  LEU A CA    1 
ATOM   6270  C  C     . LEU A  1  804  ? 214.933 182.403 193.415 1.00 0.00 ? 804  LEU A C     1 
ATOM   6271  O  O     . LEU A  1  804  ? 214.655 182.157 194.597 1.00 0.00 ? 804  LEU A O     1 
ATOM   6272  C  CB    . LEU A  1  804  ? 214.398 184.637 192.422 1.00 0.00 ? 804  LEU A CB    1 
ATOM   6273  C  CG    . LEU A  1  804  ? 213.148 184.844 193.266 1.00 0.00 ? 804  LEU A CG    1 
ATOM   6274  C  CD1   . LEU A  1  804  ? 213.508 185.576 194.540 1.00 0.00 ? 804  LEU A CD1   1 
ATOM   6275  C  CD2   . LEU A  1  804  ? 212.107 185.611 192.469 1.00 0.00 ? 804  LEU A CD2   1 
ATOM   6276  N  N     . ASN A  1  805  ? 214.781 181.512 192.436 1.00 0.00 ? 805  ASN A N     1 
ATOM   6277  C  CA    . ASN A  1  805  ? 214.248 180.185 192.708 1.00 0.00 ? 805  ASN A CA    1 
ATOM   6278  C  C     . ASN A  1  805  ? 215.139 179.426 193.683 1.00 0.00 ? 805  ASN A C     1 
ATOM   6279  O  O     . ASN A  1  805  ? 214.665 178.957 194.724 1.00 0.00 ? 805  ASN A O     1 
ATOM   6280  C  CB    . ASN A  1  805  ? 214.086 179.422 191.396 1.00 0.00 ? 805  ASN A CB    1 
ATOM   6281  C  CG    . ASN A  1  805  ? 213.324 178.129 191.562 1.00 0.00 ? 805  ASN A CG    1 
ATOM   6282  O  OD1   . ASN A  1  805  ? 213.262 177.560 192.647 1.00 0.00 ? 805  ASN A OD1   1 
ATOM   6283  N  ND2   . ASN A  1  805  ? 212.720 177.664 190.480 1.00 0.00 ? 805  ASN A ND2   1 
ATOM   6284  N  N     . VAL A  1  806  ? 216.432 179.302 193.373 1.00 0.00 ? 806  VAL A N     1 
ATOM   6285  C  CA    . VAL A  1  806  ? 217.335 178.618 194.291 1.00 0.00 ? 806  VAL A CA    1 
ATOM   6286  C  C     . VAL A  1  806  ? 217.420 179.343 195.624 1.00 0.00 ? 806  VAL A C     1 
ATOM   6287  O  O     . VAL A  1  806  ? 217.601 178.701 196.665 1.00 0.00 ? 806  VAL A O     1 
ATOM   6288  C  CB    . VAL A  1  806  ? 218.729 178.445 193.662 1.00 0.00 ? 806  VAL A CB    1 
ATOM   6289  C  CG1   . VAL A  1  806  ? 219.321 179.783 193.295 1.00 0.00 ? 806  VAL A CG1   1 
ATOM   6290  C  CG2   . VAL A  1  806  ? 219.651 177.725 194.623 1.00 0.00 ? 806  VAL A CG2   1 
ATOM   6291  N  N     . SER A  1  807  ? 217.273 180.668 195.628 1.00 0.00 ? 807  SER A N     1 
ATOM   6292  C  CA    . SER A  1  807  ? 217.157 181.382 196.890 1.00 0.00 ? 807  SER A CA    1 
ATOM   6293  C  C     . SER A  1  807  ? 215.988 180.882 197.723 1.00 0.00 ? 807  SER A C     1 
ATOM   6294  O  O     . SER A  1  807  ? 216.137 180.733 198.940 1.00 0.00 ? 807  SER A O     1 
ATOM   6295  C  CB    . SER A  1  807  ? 217.008 182.881 196.636 1.00 0.00 ? 807  SER A CB    1 
ATOM   6296  O  OG    . SER A  1  807  ? 216.851 183.587 197.852 1.00 0.00 ? 807  SER A OG    1 
ATOM   6297  N  N     . GLN A  1  808  ? 214.845 180.605 197.102 1.00 0.00 ? 808  GLN A N     1 
ATOM   6298  C  CA    . GLN A  1  808  ? 213.721 180.028 197.824 1.00 0.00 ? 808  GLN A CA    1 
ATOM   6299  C  C     . GLN A  1  808  ? 213.998 178.622 198.338 1.00 0.00 ? 808  GLN A C     1 
ATOM   6300  O  O     . GLN A  1  808  ? 213.432 178.235 199.363 1.00 0.00 ? 808  GLN A O     1 
ATOM   6301  C  CB    . GLN A  1  808  ? 212.469 180.015 196.947 1.00 0.00 ? 808  GLN A CB    1 
ATOM   6302  C  CG    . GLN A  1  808  ? 211.844 181.374 196.723 1.00 0.00 ? 808  GLN A CG    1 
ATOM   6303  C  CD    . GLN A  1  808  ? 210.685 181.310 195.754 1.00 0.00 ? 808  GLN A CD    1 
ATOM   6304  O  OE1   . GLN A  1  808  ? 210.637 180.437 194.890 1.00 0.00 ? 808  GLN A OE1   1 
ATOM   6305  N  NE2   . GLN A  1  808  ? 209.736 182.224 195.898 1.00 0.00 ? 808  GLN A NE2   1 
ATOM   6306  N  N     . MET A  1  809  ? 214.856 177.849 197.679 1.00 0.00 ? 809  MET A N     1 
ATOM   6307  C  CA    . MET A  1  809  ? 215.213 176.538 198.199 1.00 0.00 ? 809  MET A CA    1 
ATOM   6308  C  C     . MET A  1  809  ? 216.131 176.637 199.409 1.00 0.00 ? 809  MET A C     1 
ATOM   6309  O  O     . MET A  1  809  ? 215.718 176.336 200.529 1.00 0.00 ? 809  MET A O     1 
ATOM   6310  C  CB    . MET A  1  809  ? 215.888 175.664 197.135 1.00 0.00 ? 809  MET A CB    1 
ATOM   6311  C  CG    . MET A  1  809  ? 214.984 175.070 196.085 1.00 0.00 ? 809  MET A CG    1 
ATOM   6312  S  SD    . MET A  1  809  ? 215.967 173.972 195.047 1.00 0.00 ? 809  MET A SD    1 
ATOM   6313  C  CE    . MET A  1  809  ? 214.725 173.344 193.940 1.00 0.00 ? 809  MET A CE    1 
ATOM   6314  N  N     . VAL A  1  810  ? 217.376 177.047 199.204 1.00 0.00 ? 810  VAL A N     1 
ATOM   6315  C  CA    . VAL A  1  810  ? 218.399 176.895 200.228 1.00 0.00 ? 810  VAL A CA    1 
ATOM   6316  C  C     . VAL A  1  810  ? 218.299 177.974 201.293 1.00 0.00 ? 810  VAL A C     1 
ATOM   6317  O  O     . VAL A  1  810  ? 218.340 177.680 202.489 1.00 0.00 ? 810  VAL A O     1 
ATOM   6318  C  CB    . VAL A  1  810  ? 219.782 176.895 199.560 1.00 0.00 ? 810  VAL A CB    1 
ATOM   6319  C  CG1   . VAL A  1  810  ? 220.870 176.673 200.594 1.00 0.00 ? 810  VAL A CG1   1 
ATOM   6320  C  CG2   . VAL A  1  810  ? 219.828 175.859 198.459 1.00 0.00 ? 810  VAL A CG2   1 
ATOM   6321  N  N     . ALA A  1  811  ? 218.159 179.230 200.882 1.00 0.00 ? 811  ALA A N     1 
ATOM   6322  C  CA    . ALA A  1  811  ? 218.303 180.328 201.824 1.00 0.00 ? 811  ALA A CA    1 
ATOM   6323  C  C     . ALA A  1  811  ? 217.027 180.544 202.622 1.00 0.00 ? 811  ALA A C     1 
ATOM   6324  O  O     . ALA A  1  811  ? 216.950 180.144 203.788 1.00 0.00 ? 811  ALA A O     1 
ATOM   6325  C  CB    . ALA A  1  811  ? 218.688 181.607 201.081 1.00 0.00 ? 811  ALA A CB    1 
ATOM   6326  N  N     . VAL A  1  812  ? 216.011 181.144 202.005 1.00 0.00 ? 812  VAL A N     1 
ATOM   6327  C  CA    . VAL A  1  812  ? 214.749 181.376 202.689 1.00 0.00 ? 812  VAL A CA    1 
ATOM   6328  C  C     . VAL A  1  812  ? 213.679 181.607 201.637 1.00 0.00 ? 812  VAL A C     1 
ATOM   6329  O  O     . VAL A  1  812  ? 213.978 181.938 200.488 1.00 0.00 ? 812  VAL A O     1 
ATOM   6330  C  CB    . VAL A  1  812  ? 214.857 182.572 203.669 1.00 0.00 ? 812  VAL A CB    1 
ATOM   6331  C  CG1   . VAL A  1  812  ? 214.968 183.875 202.905 1.00 0.00 ? 812  VAL A CG1   1 
ATOM   6332  C  CG2   . VAL A  1  812  ? 213.698 182.590 204.651 1.00 0.00 ? 812  VAL A CG2   1 
ATOM   6333  N  N     . VAL A  1  813  ? 212.432 181.414 202.031 1.00 0.00 ? 813  VAL A N     1 
ATOM   6334  C  CA    . VAL A  1  813  ? 211.282 181.878 201.288 1.00 0.00 ? 813  VAL A CA    1 
ATOM   6335  C  C     . VAL A  1  813  ? 210.731 183.060 202.063 1.00 0.00 ? 813  VAL A C     1 
ATOM   6336  O  O     . VAL A  1  813  ? 210.874 183.143 203.281 1.00 0.00 ? 813  VAL A O     1 
ATOM   6337  C  CB    . VAL A  1  813  ? 210.223 180.770 201.133 1.00 0.00 ? 813  VAL A CB    1 
ATOM   6338  C  CG1   . VAL A  1  813  ? 209.028 181.260 200.338 1.00 0.00 ? 813  VAL A CG1   1 
ATOM   6339  C  CG2   . VAL A  1  813  ? 210.843 179.571 200.504 1.00 0.00 ? 813  VAL A CG2   1 
ATOM   6340  N  N     . GLY A  1  814  ? 210.114 184.007 201.370 1.00 0.00 ? 814  GLY A N     1 
ATOM   6341  C  CA    . GLY A  1  814  ? 209.534 185.078 202.151 1.00 0.00 ? 814  GLY A CA    1 
ATOM   6342  C  C     . GLY A  1  814  ? 208.332 185.769 201.560 1.00 0.00 ? 814  GLY A C     1 
ATOM   6343  O  O     . GLY A  1  814  ? 208.177 185.849 200.339 1.00 0.00 ? 814  GLY A O     1 
ATOM   6344  N  N     . GLN A  1  815  ? 207.494 186.303 202.447 1.00 0.00 ? 815  GLN A N     1 
ATOM   6345  C  CA    . GLN A  1  815  ? 206.308 187.058 202.073 1.00 0.00 ? 815  GLN A CA    1 
ATOM   6346  C  C     . GLN A  1  815  ? 205.505 186.408 200.959 1.00 0.00 ? 815  GLN A C     1 
ATOM   6347  O  O     . GLN A  1  815  ? 205.540 186.880 199.819 1.00 0.00 ? 815  GLN A O     1 
ATOM   6348  C  CB    . GLN A  1  815  ? 206.689 188.485 201.684 1.00 0.00 ? 815  GLN A CB    1 
ATOM   6349  C  CG    . GLN A  1  815  ? 206.984 189.350 202.885 1.00 0.00 ? 815  GLN A CG    1 
ATOM   6350  C  CD    . GLN A  1  815  ? 205.762 189.496 203.774 1.00 0.00 ? 815  GLN A CD    1 
ATOM   6351  O  OE1   . GLN A  1  815  ? 204.649 189.687 203.286 1.00 0.00 ? 815  GLN A OE1   1 
ATOM   6352  N  NE2   . GLN A  1  815  ? 205.958 189.377 205.080 1.00 0.00 ? 815  GLN A NE2   1 
ATOM   6353  N  N     . GLN A  1  816  ? 204.804 185.315 201.260 1.00 0.00 ? 816  GLN A N     1 
ATOM   6354  C  CA    . GLN A  1  816  ? 203.761 184.859 200.349 1.00 0.00 ? 816  GLN A CA    1 
ATOM   6355  C  C     . GLN A  1  816  ? 202.855 186.063 200.173 1.00 0.00 ? 816  GLN A C     1 
ATOM   6356  O  O     . GLN A  1  816  ? 202.326 186.621 201.133 1.00 0.00 ? 816  GLN A O     1 
ATOM   6357  C  CB    . GLN A  1  816  ? 203.008 183.651 200.888 1.00 0.00 ? 816  GLN A CB    1 
ATOM   6358  C  CG    . GLN A  1  816  ? 203.799 182.364 200.896 1.00 0.00 ? 816  GLN A CG    1 
ATOM   6359  C  CD    . GLN A  1  816  ? 204.666 182.214 202.120 1.00 0.00 ? 816  GLN A CD    1 
ATOM   6360  O  OE1   . GLN A  1  816  ? 204.691 183.087 202.987 1.00 0.00 ? 816  GLN A OE1   1 
ATOM   6361  N  NE2   . GLN A  1  816  ? 205.380 181.097 202.204 1.00 0.00 ? 816  GLN A NE2   1 
ATOM   6362  N  N     . ILE A  1  817  ? 202.693 186.478 198.923 1.00 0.00 ? 817  ILE A N     1 
ATOM   6363  C  CA    . ILE A  1  817  ? 202.025 187.735 198.641 1.00 0.00 ? 817  ILE A CA    1 
ATOM   6364  C  C     . ILE A  1  817  ? 200.846 187.475 197.717 1.00 0.00 ? 817  ILE A C     1 
ATOM   6365  O  O     . ILE A  1  817  ? 201.014 187.058 196.564 1.00 0.00 ? 817  ILE A O     1 
ATOM   6366  C  CB    . ILE A  1  817  ? 203.028 188.742 198.053 1.00 0.00 ? 817  ILE A CB    1 
ATOM   6367  C  CG1   . ILE A  1  817  ? 202.348 190.060 197.683 1.00 0.00 ? 817  ILE A CG1   1 
ATOM   6368  C  CG2   . ILE A  1  817  ? 203.816 188.141 196.891 1.00 0.00 ? 817  ILE A CG2   1 
ATOM   6369  C  CD1   . ILE A  1  817  ? 203.330 191.149 197.316 1.00 0.00 ? 817  ILE A CD1   1 
ATOM   6370  N  N     . ILE A  1  818  ? 199.640 187.692 198.229 1.00 0.00 ? 818  ILE A N     1 
ATOM   6371  C  CA    . ILE A  1  818  ? 198.423 187.444 197.469 1.00 0.00 ? 818  ILE A CA    1 
ATOM   6372  C  C     . ILE A  1  818  ? 197.713 188.768 197.255 1.00 0.00 ? 818  ILE A C     1 
ATOM   6373  O  O     . ILE A  1  818  ? 197.670 189.616 198.153 1.00 0.00 ? 818  ILE A O     1 
ATOM   6374  C  CB    . ILE A  1  818  ? 197.504 186.427 198.172 1.00 0.00 ? 818  ILE A CB    1 
ATOM   6375  C  CG1   . ILE A  1  818  ? 197.039 186.952 199.527 1.00 0.00 ? 818  ILE A CG1   1 
ATOM   6376  C  CG2   . ILE A  1  818  ? 198.233 185.123 198.371 1.00 0.00 ? 818  ILE A CG2   1 
ATOM   6377  C  CD1   . ILE A  1  818  ? 195.986 186.085 200.168 1.00 0.00 ? 818  ILE A CD1   1 
ATOM   6378  N  N     . SER A  1  819  ? 197.181 188.954 196.047 1.00 0.00 ? 819  SER A N     1 
ATOM   6379  C  CA    . SER A  1  819  ? 196.446 190.160 195.681 1.00 0.00 ? 819  SER A CA    1 
ATOM   6380  C  C     . SER A  1  819  ? 197.306 191.413 195.826 1.00 0.00 ? 819  SER A C     1 
ATOM   6381  O  O     . SER A  1  819  ? 196.787 192.517 196.006 1.00 0.00 ? 819  SER A O     1 
ATOM   6382  C  CB    . SER A  1  819  ? 195.158 190.289 196.501 1.00 0.00 ? 819  SER A CB    1 
ATOM   6383  O  OG    . SER A  1  819  ? 194.452 191.471 196.171 1.00 0.00 ? 819  SER A OG    1 
ATOM   6384  N  N     . GLY A  1  820  ? 198.627 191.257 195.750 1.00 0.00 ? 820  GLY A N     1 
ATOM   6385  C  CA    . GLY A  1  820  ? 199.532 192.387 195.761 1.00 0.00 ? 820  GLY A CA    1 
ATOM   6386  C  C     . GLY A  1  820  ? 200.154 192.731 197.098 1.00 0.00 ? 820  GLY A C     1 
ATOM   6387  O  O     . GLY A  1  820  ? 201.078 193.554 197.134 1.00 0.00 ? 820  GLY A O     1 
ATOM   6388  N  N     . ASN A  1  821  ? 199.689 192.138 198.193 1.00 0.00 ? 821  ASN A N     1 
ATOM   6389  C  CA    . ASN A  1  821  ? 200.201 192.473 199.517 1.00 0.00 ? 821  ASN A CA    1 
ATOM   6390  C  C     . ASN A  1  821  ? 200.182 191.242 200.409 1.00 0.00 ? 821  ASN A C     1 
ATOM   6391  O  O     . ASN A  1  821  ? 200.039 190.117 199.919 1.00 0.00 ? 821  ASN A O     1 
ATOM   6392  C  CB    . ASN A  1  821  ? 199.395 193.606 200.151 1.00 0.00 ? 821  ASN A CB    1 
ATOM   6393  C  CG    . ASN A  1  821  ? 197.954 193.226 200.407 1.00 0.00 ? 821  ASN A CG    1 
ATOM   6394  O  OD1   . ASN A  1  821  ? 197.454 192.238 199.871 1.00 0.00 ? 821  ASN A OD1   1 
ATOM   6395  N  ND2   . ASN A  1  821  ? 197.276 194.012 201.234 1.00 0.00 ? 821  ASN A ND2   1 
ATOM   6396  N  N     . ARG A  1  822  ? 200.316 191.440 201.716 1.00 0.00 ? 822  ARG A N     1 
ATOM   6397  C  CA    . ARG A  1  822  ? 200.314 190.326 202.652 1.00 0.00 ? 822  ARG A CA    1 
ATOM   6398  C  C     . ARG A  1  822  ? 198.918 189.706 202.650 1.00 0.00 ? 822  ARG A C     1 
ATOM   6399  O  O     . ARG A  1  822  ? 198.007 190.178 201.965 1.00 0.00 ? 822  ARG A O     1 
ATOM   6400  C  CB    . ARG A  1  822  ? 200.725 190.813 204.039 1.00 0.00 ? 822  ARG A CB    1 
ATOM   6401  C  CG    . ARG A  1  822  ? 202.113 191.426 204.099 1.00 0.00 ? 822  ARG A CG    1 
ATOM   6402  C  CD    . ARG A  1  822  ? 202.386 192.056 205.459 1.00 0.00 ? 822  ARG A CD    1 
ATOM   6403  N  NE    . ARG A  1  822  ? 202.427 191.077 206.541 1.00 0.00 ? 822  ARG A NE    1 
ATOM   6404  C  CZ    . ARG A  1  822  ? 202.532 191.394 207.827 1.00 0.00 ? 822  ARG A CZ    1 
ATOM   6405  N  NH1   . ARG A  1  822  ? 202.599 192.665 208.192 1.00 0.00 ? 822  ARG A NH1   1 
ATOM   6406  N  NH2   . ARG A  1  822  ? 202.568 190.444 208.751 1.00 0.00 ? 822  ARG A NH2   1 
ATOM   6407  N  N     . VAL A  1  823  ? 198.720 188.639 203.415 1.00 0.00 ? 823  VAL A N     1 
ATOM   6408  C  CA    . VAL A  1  823  ? 197.433 187.952 203.379 1.00 0.00 ? 823  VAL A CA    1 
ATOM   6409  C  C     . VAL A  1  823  ? 196.422 188.744 204.202 1.00 0.00 ? 823  VAL A C     1 
ATOM   6410  O  O     . VAL A  1  823  ? 196.686 189.078 205.365 1.00 0.00 ? 823  VAL A O     1 
ATOM   6411  C  CB    . VAL A  1  823  ? 197.553 186.495 203.857 1.00 0.00 ? 823  VAL A CB    1 
ATOM   6412  C  CG1   . VAL A  1  823  ? 198.383 185.694 202.874 1.00 0.00 ? 823  VAL A CG1   1 
ATOM   6413  C  CG2   . VAL A  1  823  ? 198.170 186.420 205.239 1.00 0.00 ? 823  VAL A CG2   1 
ATOM   6414  N  N     . PRO A  1  824  ? 195.273 189.088 203.631 1.00 0.00 ? 824  PRO A N     1 
ATOM   6415  C  CA    . PRO A  1  824  ? 194.262 189.831 204.383 1.00 0.00 ? 824  PRO A CA    1 
ATOM   6416  C  C     . PRO A  1  824  ? 193.613 188.957 205.442 1.00 0.00 ? 824  PRO A C     1 
ATOM   6417  O  O     . PRO A  1  824  ? 193.752 187.733 205.448 1.00 0.00 ? 824  PRO A O     1 
ATOM   6418  C  CB    . PRO A  1  824  ? 193.252 190.235 203.303 1.00 0.00 ? 824  PRO A CB    1 
ATOM   6419  C  CG    . PRO A  1  824  ? 193.370 189.159 202.279 1.00 0.00 ? 824  PRO A CG    1 
ATOM   6420  C  CD    . PRO A  1  824  ? 194.822 188.764 202.268 1.00 0.00 ? 824  PRO A CD    1 
ATOM   6421  N  N     . ASP A  1  825  ? 192.901 189.608 206.357 1.00 0.00 ? 825  ASP A N     1 
ATOM   6422  C  CA    . ASP A  1  825  ? 192.200 188.878 207.409 1.00 0.00 ? 825  ASP A CA    1 
ATOM   6423  C  C     . ASP A  1  825  ? 191.033 188.123 206.792 1.00 0.00 ? 825  ASP A C     1 
ATOM   6424  O  O     . ASP A  1  825  ? 190.113 188.710 206.218 1.00 0.00 ? 825  ASP A O     1 
ATOM   6425  C  CB    . ASP A  1  825  ? 191.705 189.824 208.497 1.00 0.00 ? 825  ASP A CB    1 
ATOM   6426  C  CG    . ASP A  1  825  ? 192.814 190.329 209.391 1.00 0.00 ? 825  ASP A CG    1 
ATOM   6427  O  OD1   . ASP A  1  825  ? 193.909 189.733 209.372 1.00 0.00 ? 825  ASP A OD1   1 
ATOM   6428  O  OD2   . ASP A  1  825  ? 192.584 191.313 210.127 1.00 0.00 ? 825  ASP A OD2   1 
ATOM   6429  N  N     . GLY A  1  826  ? 191.063 186.798 206.921 1.00 0.00 ? 826  GLY A N     1 
ATOM   6430  C  CA    . GLY A  1  826  ? 189.829 186.043 206.861 1.00 0.00 ? 826  GLY A CA    1 
ATOM   6431  C  C     . GLY A  1  826  ? 189.100 186.084 208.185 1.00 0.00 ? 826  GLY A C     1 
ATOM   6432  O  O     . GLY A  1  826  ? 187.878 186.249 208.225 1.00 0.00 ? 826  GLY A O     1 
ATOM   6433  N  N     . PHE A  1  827  ? 189.842 185.951 209.281 1.00 0.00 ? 827  PHE A N     1 
ATOM   6434  C  CA    . PHE A  1  827  ? 189.331 186.062 210.638 1.00 0.00 ? 827  PHE A CA    1 
ATOM   6435  C  C     . PHE A  1  827  ? 189.278 187.508 211.112 1.00 0.00 ? 827  PHE A C     1 
ATOM   6436  O  O     . PHE A  1  827  ? 189.431 188.439 210.316 1.00 0.00 ? 827  PHE A O     1 
ATOM   6437  C  CB    . PHE A  1  827  ? 190.201 185.245 211.586 1.00 0.00 ? 827  PHE A CB    1 
ATOM   6438  C  CG    . PHE A  1  827  ? 189.989 183.765 211.489 1.00 0.00 ? 827  PHE A CG    1 
ATOM   6439  C  CD1   . PHE A  1  827  ? 188.810 183.249 210.997 1.00 0.00 ? 827  PHE A CD1   1 
ATOM   6440  C  CD2   . PHE A  1  827  ? 190.969 182.889 211.916 1.00 0.00 ? 827  PHE A CD2   1 
ATOM   6441  C  CE1   . PHE A  1  827  ? 188.618 181.889 210.930 1.00 0.00 ? 827  PHE A CE1   1 
ATOM   6442  C  CE2   . PHE A  1  827  ? 190.783 181.527 211.841 1.00 0.00 ? 827  PHE A CE2   1 
ATOM   6443  C  CZ    . PHE A  1  827  ? 189.609 181.027 211.345 1.00 0.00 ? 827  PHE A CZ    1 
ATOM   6444  N  N     . GLN A  1  828  ? 189.060 187.701 212.412 1.00 0.00 ? 828  GLN A N     1 
ATOM   6445  C  CA    . GLN A  1  828  ? 188.956 189.029 213.014 1.00 0.00 ? 828  GLN A CA    1 
ATOM   6446  C  C     . GLN A  1  828  ? 190.247 189.339 213.766 1.00 0.00 ? 828  GLN A C     1 
ATOM   6447  O  O     . GLN A  1  828  ? 190.630 188.605 214.682 1.00 0.00 ? 828  GLN A O     1 
ATOM   6448  C  CB    . GLN A  1  828  ? 187.750 189.109 213.941 1.00 0.00 ? 828  GLN A CB    1 
ATOM   6449  C  CG    . GLN A  1  828  ? 187.531 190.480 214.540 1.00 0.00 ? 828  GLN A CG    1 
ATOM   6450  C  CD    . GLN A  1  828  ? 186.242 190.567 215.321 1.00 0.00 ? 828  GLN A CD    1 
ATOM   6451  O  OE1   . GLN A  1  828  ? 185.456 189.620 215.347 1.00 0.00 ? 828  GLN A OE1   1 
ATOM   6452  N  NE2   . GLN A  1  828  ? 186.015 191.707 215.966 1.00 0.00 ? 828  GLN A NE2   1 
ATOM   6453  N  N     . ASP A  1  829  ? 190.912 190.426 213.372 1.00 0.00 ? 829  ASP A N     1 
ATOM   6454  C  CA    . ASP A  1  829  ? 192.107 190.927 214.054 1.00 0.00 ? 829  ASP A CA    1 
ATOM   6455  C  C     . ASP A  1  829  ? 193.215 189.877 214.057 1.00 0.00 ? 829  ASP A C     1 
ATOM   6456  O  O     . ASP A  1  829  ? 194.142 189.923 214.869 1.00 0.00 ? 829  ASP A O     1 
ATOM   6457  C  CB    . ASP A  1  829  ? 191.765 191.365 215.485 1.00 0.00 ? 829  ASP A CB    1 
ATOM   6458  C  CG    . ASP A  1  829  ? 192.892 192.122 216.168 1.00 0.00 ? 829  ASP A CG    1 
ATOM   6459  O  OD1   . ASP A  1  829  ? 193.887 192.472 215.500 1.00 0.00 ? 829  ASP A OD1   1 
ATOM   6460  O  OD2   . ASP A  1  829  ? 192.782 192.351 217.390 1.00 0.00 ? 829  ASP A OD2   1 
ATOM   6461  N  N     . ARG A  1  830  ? 193.120 188.907 213.156 1.00 0.00 ? 830  ARG A N     1 
ATOM   6462  C  CA    . ARG A  1  830  ? 194.107 187.841 213.104 1.00 0.00 ? 830  ARG A CA    1 
ATOM   6463  C  C     . ARG A  1  830  ? 193.980 187.141 211.766 1.00 0.00 ? 830  ARG A C     1 
ATOM   6464  O  O     . ARG A  1  830  ? 192.972 187.283 211.073 1.00 0.00 ? 830  ARG A O     1 
ATOM   6465  C  CB    . ARG A  1  830  ? 193.919 186.852 214.257 1.00 0.00 ? 830  ARG A CB    1 
ATOM   6466  C  CG    . ARG A  1  830  ? 192.628 186.080 214.188 1.00 0.00 ? 830  ARG A CG    1 
ATOM   6467  C  CD    . ARG A  1  830  ? 192.350 185.365 215.487 1.00 0.00 ? 830  ARG A CD    1 
ATOM   6468  N  NE    . ARG A  1  830  ? 193.372 184.398 215.848 1.00 0.00 ? 830  ARG A NE    1 
ATOM   6469  C  CZ    . ARG A  1  830  ? 193.398 183.757 217.011 1.00 0.00 ? 830  ARG A CZ    1 
ATOM   6470  N  NH1   . ARG A  1  830  ? 192.457 183.983 217.918 1.00 0.00 ? 830  ARG A NH1   1 
ATOM   6471  N  NH2   . ARG A  1  830  ? 194.358 182.894 217.271 1.00 0.00 ? 830  ARG A NH2   1 
ATOM   6472  N  N     . SER A  1  831  ? 195.016 186.393 211.410 1.00 0.00 ? 831  SER A N     1 
ATOM   6473  C  CA    . SER A  1  831  ? 194.993 185.570 210.212 1.00 0.00 ? 831  SER A CA    1 
ATOM   6474  C  C     . SER A  1  831  ? 194.465 184.173 210.513 1.00 0.00 ? 831  SER A C     1 
ATOM   6475  O  O     . SER A  1  831  ? 193.410 183.777 210.012 1.00 0.00 ? 831  SER A O     1 
ATOM   6476  C  CB    . SER A  1  831  ? 196.400 185.507 209.613 1.00 0.00 ? 831  SER A CB    1 
ATOM   6477  O  OG    . SER A  1  831  ? 197.298 184.925 210.541 1.00 0.00 ? 831  SER A OG    1 
ATOM   6478  N  N     . LEU A  1  832  ? 195.179 183.426 211.345 1.00 0.00 ? 832  LEU A N     1 
ATOM   6479  C  CA    . LEU A  1  832  ? 194.949 182.031 211.678 1.00 0.00 ? 832  LEU A CA    1 
ATOM   6480  C  C     . LEU A  1  832  ? 194.694 181.859 213.172 1.00 0.00 ? 832  LEU A C     1 
ATOM   6481  O  O     . LEU A  1  832  ? 194.988 182.758 213.964 1.00 0.00 ? 832  LEU A O     1 
ATOM   6482  C  CB    . LEU A  1  832  ? 196.147 181.167 211.272 1.00 0.00 ? 832  LEU A CB    1 
ATOM   6483  C  CG    . LEU A  1  832  ? 196.079 180.551 209.880 1.00 0.00 ? 832  LEU A CG    1 
ATOM   6484  C  CD1   . LEU A  1  832  ? 196.032 181.624 208.819 1.00 0.00 ? 832  LEU A CD1   1 
ATOM   6485  C  CD2   . LEU A  1  832  ? 197.277 179.653 209.676 1.00 0.00 ? 832  LEU A CD2   1 
ATOM   6486  N  N     . PRO A  1  833  ? 194.120 180.723 213.584 1.00 0.00 ? 833  PRO A N     1 
ATOM   6487  C  CA    . PRO A  1  833  ? 193.875 180.493 215.013 1.00 0.00 ? 833  PRO A CA    1 
ATOM   6488  C  C     . PRO A  1  833  ? 195.127 180.478 215.870 1.00 0.00 ? 833  PRO A C     1 
ATOM   6489  O  O     . PRO A  1  833  ? 195.018 180.567 217.096 1.00 0.00 ? 833  PRO A O     1 
ATOM   6490  C  CB    . PRO A  1  833  ? 193.191 179.122 215.033 1.00 0.00 ? 833  PRO A CB    1 
ATOM   6491  C  CG    . PRO A  1  833  ? 192.572 179.000 213.693 1.00 0.00 ? 833  PRO A CG    1 
ATOM   6492  C  CD    . PRO A  1  833  ? 193.524 179.664 212.755 1.00 0.00 ? 833  PRO A CD    1 
ATOM   6493  N  N     . HIS A  1  834  ? 196.310 180.367 215.272 1.00 0.00 ? 834  HIS A N     1 
ATOM   6494  C  CA    . HIS A  1  834  ? 197.519 180.138 216.049 1.00 0.00 ? 834  HIS A CA    1 
ATOM   6495  C  C     . HIS A  1  834  ? 198.195 181.419 216.512 1.00 0.00 ? 834  HIS A C     1 
ATOM   6496  O  O     . HIS A  1  834  ? 199.261 181.346 217.131 1.00 0.00 ? 834  HIS A O     1 
ATOM   6497  C  CB    . HIS A  1  834  ? 198.495 179.297 215.229 1.00 0.00 ? 834  HIS A CB    1 
ATOM   6498  C  CG    . HIS A  1  834  ? 197.910 178.011 214.740 1.00 0.00 ? 834  HIS A CG    1 
ATOM   6499  N  ND1   . HIS A  1  834  ? 197.619 176.956 215.578 1.00 0.00 ? 834  HIS A ND1   1 
ATOM   6500  C  CD2   . HIS A  1  834  ? 197.529 177.622 213.501 1.00 0.00 ? 834  HIS A CD2   1 
ATOM   6501  C  CE1   . HIS A  1  834  ? 197.098 175.968 214.873 1.00 0.00 ? 834  HIS A CE1   1 
ATOM   6502  N  NE2   . HIS A  1  834  ? 197.033 176.347 213.610 1.00 0.00 ? 834  HIS A NE2   1 
ATOM   6503  N  N     . PHE A  1  835  ? 197.616 182.586 216.242 1.00 0.00 ? 835  PHE A N     1 
ATOM   6504  C  CA    . PHE A  1  835  ? 198.289 183.838 216.528 1.00 0.00 ? 835  PHE A CA    1 
ATOM   6505  C  C     . PHE A  1  835  ? 197.480 184.681 217.500 1.00 0.00 ? 835  PHE A C     1 
ATOM   6506  O  O     . PHE A  1  835  ? 196.242 184.635 217.470 1.00 0.00 ? 835  PHE A O     1 
ATOM   6507  C  CB    . PHE A  1  835  ? 198.525 184.619 215.238 1.00 0.00 ? 835  PHE A CB    1 
ATOM   6508  C  CG    . PHE A  1  835  ? 199.438 183.925 214.282 1.00 0.00 ? 835  PHE A CG    1 
ATOM   6509  C  CD1   . PHE A  1  835  ? 200.342 182.985 214.736 1.00 0.00 ? 835  PHE A CD1   1 
ATOM   6510  C  CD2   . PHE A  1  835  ? 199.373 184.183 212.929 1.00 0.00 ? 835  PHE A CD2   1 
ATOM   6511  C  CE1   . PHE A  1  835  ? 201.174 182.332 213.867 1.00 0.00 ? 835  PHE A CE1   1 
ATOM   6512  C  CE2   . PHE A  1  835  ? 200.202 183.528 212.054 1.00 0.00 ? 835  PHE A CE2   1 
ATOM   6513  C  CZ    . PHE A  1  835  ? 201.106 182.605 212.523 1.00 0.00 ? 835  PHE A CZ    1 
ATOM   6514  N  N     . PRO A  1  836  ? 198.127 185.440 218.382 1.00 0.00 ? 836  PRO A N     1 
ATOM   6515  C  CA    . PRO A  1  836  ? 197.377 186.334 219.270 1.00 0.00 ? 836  PRO A CA    1 
ATOM   6516  C  C     . PRO A  1  836  ? 196.677 187.434 218.499 1.00 0.00 ? 836  PRO A C     1 
ATOM   6517  O  O     . PRO A  1  836  ? 196.843 187.554 217.282 1.00 0.00 ? 836  PRO A O     1 
ATOM   6518  C  CB    . PRO A  1  836  ? 198.464 186.895 220.194 1.00 0.00 ? 836  PRO A CB    1 
ATOM   6519  C  CG    . PRO A  1  836  ? 199.530 185.857 220.182 1.00 0.00 ? 836  PRO A CG    1 
ATOM   6520  C  CD    . PRO A  1  836  ? 199.542 185.345 218.773 1.00 0.00 ? 836  PRO A CD    1 
ATOM   6521  N  N     . LYS A  1  837  ? 195.905 188.259 219.200 1.00 0.00 ? 837  LYS A N     1 
ATOM   6522  C  CA    . LYS A  1  837  ? 195.183 189.327 218.534 1.00 0.00 ? 837  LYS A CA    1 
ATOM   6523  C  C     . LYS A  1  837  ? 196.056 190.572 218.438 1.00 0.00 ? 837  LYS A C     1 
ATOM   6524  O  O     . LYS A  1  837  ? 196.846 190.881 219.335 1.00 0.00 ? 837  LYS A O     1 
ATOM   6525  C  CB    . LYS A  1  837  ? 193.882 189.638 219.272 1.00 0.00 ? 837  LYS A CB    1 
ATOM   6526  C  CG    . LYS A  1  837  ? 192.898 188.480 219.254 1.00 0.00 ? 837  LYS A CG    1 
ATOM   6527  C  CD    . LYS A  1  837  ? 191.580 188.836 219.915 1.00 0.00 ? 837  LYS A CD    1 
ATOM   6528  C  CE    . LYS A  1  837  ? 190.777 189.792 219.050 1.00 0.00 ? 837  LYS A CE    1 
ATOM   6529  N  NZ    . LYS A  1  837  ? 190.355 189.135 217.780 1.00 0.00 ? 837  LYS A NZ    1 
ATOM   6530  N  N     . ASN A  1  838  ? 195.908 191.286 217.320 1.00 0.00 ? 838  ASN A N     1 
ATOM   6531  C  CA    . ASN A  1  838  ? 196.728 192.457 217.010 1.00 0.00 ? 838  ASN A CA    1 
ATOM   6532  C  C     . ASN A  1  838  ? 198.213 192.100 216.957 1.00 0.00 ? 838  ASN A C     1 
ATOM   6533  O  O     . ASN A  1  838  ? 199.050 192.721 217.614 1.00 0.00 ? 838  ASN A O     1 
ATOM   6534  C  CB    . ASN A  1  838  ? 196.476 193.597 217.999 1.00 0.00 ? 838  ASN A CB    1 
ATOM   6535  C  CG    . ASN A  1  838  ? 195.097 194.197 217.853 1.00 0.00 ? 838  ASN A CG    1 
ATOM   6536  O  OD1   . ASN A  1  838  ? 194.371 194.366 218.832 1.00 0.00 ? 838  ASN A OD1   1 
ATOM   6537  N  ND2   . ASN A  1  838  ? 194.728 194.531 216.623 1.00 0.00 ? 838  ASN A ND2   1 
ATOM   6538  N  N     . SER A  1  839  ? 198.537 191.077 216.170 1.00 0.00 ? 839  SER A N     1 
ATOM   6539  C  CA    . SER A  1  839  ? 199.929 190.768 215.870 1.00 0.00 ? 839  SER A CA    1 
ATOM   6540  C  C     . SER A  1  839  ? 200.235 191.252 214.460 1.00 0.00 ? 839  SER A C     1 
ATOM   6541  O  O     . SER A  1  839  ? 199.775 190.661 213.479 1.00 0.00 ? 839  SER A O     1 
ATOM   6542  C  CB    . SER A  1  839  ? 200.194 189.272 216.007 1.00 0.00 ? 839  SER A CB    1 
ATOM   6543  O  OG    . SER A  1  839  ? 200.023 188.842 217.346 1.00 0.00 ? 839  SER A OG    1 
ATOM   6544  N  N     . LYS A  1  840  ? 201.010 192.330 214.357 1.00 0.00 ? 840  LYS A N     1 
ATOM   6545  C  CA    . LYS A  1  840  ? 201.466 192.839 213.074 1.00 0.00 ? 840  LYS A CA    1 
ATOM   6546  C  C     . LYS A  1  840  ? 202.850 192.336 212.700 1.00 0.00 ? 840  LYS A C     1 
ATOM   6547  O  O     . LYS A  1  840  ? 203.344 192.682 211.621 1.00 0.00 ? 840  LYS A O     1 
ATOM   6548  C  CB    . LYS A  1  840  ? 201.471 194.375 213.076 1.00 0.00 ? 840  LYS A CB    1 
ATOM   6549  C  CG    . LYS A  1  840  ? 200.123 194.998 213.391 1.00 0.00 ? 840  LYS A CG    1 
ATOM   6550  C  CD    . LYS A  1  840  ? 199.069 194.612 212.372 1.00 0.00 ? 840  LYS A CD    1 
ATOM   6551  C  CE    . LYS A  1  840  ? 199.269 195.368 211.070 1.00 0.00 ? 840  LYS A CE    1 
ATOM   6552  N  NZ    . LYS A  1  840  ? 198.154 195.133 210.114 1.00 0.00 ? 840  LYS A NZ    1 
ATOM   6553  N  N     . THR A  1  841  ? 203.482 191.543 213.559 1.00 0.00 ? 841  THR A N     1 
ATOM   6554  C  CA    . THR A  1  841  ? 204.779 190.964 213.266 1.00 0.00 ? 841  THR A CA    1 
ATOM   6555  C  C     . THR A  1  841  ? 204.715 190.142 211.981 1.00 0.00 ? 841  THR A C     1 
ATOM   6556  O  O     . THR A  1  841  ? 203.641 189.691 211.576 1.00 0.00 ? 841  THR A O     1 
ATOM   6557  C  CB    . THR A  1  841  ? 205.225 190.074 214.426 1.00 0.00 ? 841  THR A CB    1 
ATOM   6558  O  OG1   . THR A  1  841  ? 206.559 189.601 214.204 1.00 0.00 ? 841  THR A OG1   1 
ATOM   6559  C  CG2   . THR A  1  841  ? 204.289 188.885 214.573 1.00 0.00 ? 841  THR A CG2   1 
ATOM   6560  N  N     . PRO A  1  842  ? 205.849 189.944 211.306 1.00 0.00 ? 842  PRO A N     1 
ATOM   6561  C  CA    . PRO A  1  842  ? 205.866 188.957 210.223 1.00 0.00 ? 842  PRO A CA    1 
ATOM   6562  C  C     . PRO A  1  842  ? 205.592 187.568 210.770 1.00 0.00 ? 842  PRO A C     1 
ATOM   6563  O  O     . PRO A  1  842  ? 205.470 187.391 211.987 1.00 0.00 ? 842  PRO A O     1 
ATOM   6564  C  CB    . PRO A  1  842  ? 207.281 189.088 209.645 1.00 0.00 ? 842  PRO A CB    1 
ATOM   6565  C  CG    . PRO A  1  842  ? 208.080 189.701 210.744 1.00 0.00 ? 842  PRO A CG    1 
ATOM   6566  C  CD    . PRO A  1  842  ? 207.137 190.645 211.421 1.00 0.00 ? 842  PRO A CD    1 
ATOM   6567  N  N     . GLN A  1  843  ? 205.468 186.583 209.885 1.00 0.00 ? 843  GLN A N     1 
ATOM   6568  C  CA    . GLN A  1  843  ? 205.006 185.235 210.191 1.00 0.00 ? 843  GLN A CA    1 
ATOM   6569  C  C     . GLN A  1  843  ? 203.547 185.241 210.633 1.00 0.00 ? 843  GLN A C     1 
ATOM   6570  O  O     . GLN A  1  843  ? 202.907 184.187 210.627 1.00 0.00 ? 843  GLN A O     1 
ATOM   6571  C  CB    . GLN A  1  843  ? 205.874 184.542 211.258 1.00 0.00 ? 843  GLN A CB    1 
ATOM   6572  C  CG    . GLN A  1  843  ? 205.551 183.076 211.517 1.00 0.00 ? 843  GLN A CG    1 
ATOM   6573  C  CD    . GLN A  1  843  ? 206.548 182.410 212.447 1.00 0.00 ? 843  GLN A CD    1 
ATOM   6574  O  OE1   . GLN A  1  843  ? 207.561 183.000 212.817 1.00 0.00 ? 843  GLN A OE1   1 
ATOM   6575  N  NE2   . GLN A  1  843  ? 206.258 181.175 212.834 1.00 0.00 ? 843  GLN A NE2   1 
ATOM   6576  N  N     . SER A  1  844  ? 202.989 186.402 210.985 1.00 0.00 ? 844  SER A N     1 
ATOM   6577  C  CA    . SER A  1  844  ? 201.566 186.545 211.238 1.00 0.00 ? 844  SER A CA    1 
ATOM   6578  C  C     . SER A  1  844  ? 200.740 186.739 209.979 1.00 0.00 ? 844  SER A C     1 
ATOM   6579  O  O     . SER A  1  844  ? 199.595 186.279 209.942 1.00 0.00 ? 844  SER A O     1 
ATOM   6580  C  CB    . SER A  1  844  ? 201.299 187.716 212.195 1.00 0.00 ? 844  SER A CB    1 
ATOM   6581  O  OG    . SER A  1  844  ? 199.910 187.884 212.417 1.00 0.00 ? 844  SER A OG    1 
ATOM   6582  N  N     . LYS A  1  845  ? 201.270 187.404 208.959 1.00 0.00 ? 845  LYS A N     1 
ATOM   6583  C  CA    . LYS A  1  845  ? 200.622 187.489 207.655 1.00 0.00 ? 845  LYS A CA    1 
ATOM   6584  C  C     . LYS A  1  845  ? 201.597 186.989 206.595 1.00 0.00 ? 845  LYS A C     1 
ATOM   6585  O  O     . LYS A  1  845  ? 202.610 187.635 206.314 1.00 0.00 ? 845  LYS A O     1 
ATOM   6586  C  CB    . LYS A  1  845  ? 200.171 188.911 207.338 1.00 0.00 ? 845  LYS A CB    1 
ATOM   6587  C  CG    . LYS A  1  845  ? 199.064 189.471 208.201 1.00 0.00 ? 845  LYS A CG    1 
ATOM   6588  C  CD    . LYS A  1  845  ? 198.773 190.907 207.777 1.00 0.00 ? 845  LYS A CD    1 
ATOM   6589  C  CE    . LYS A  1  845  ? 197.629 191.511 208.564 1.00 0.00 ? 845  LYS A CE    1 
ATOM   6590  N  NZ    . LYS A  1  845  ? 197.389 192.924 208.165 1.00 0.00 ? 845  LYS A NZ    1 
ATOM   6591  N  N     . GLY A  1  846  ? 201.279 185.839 206.013 1.00 0.00 ? 846  GLY A N     1 
ATOM   6592  C  CA    . GLY A  1  846  ? 201.892 185.366 204.787 1.00 0.00 ? 846  GLY A CA    1 
ATOM   6593  C  C     . GLY A  1  846  ? 203.400 185.446 204.689 1.00 0.00 ? 846  GLY A C     1 
ATOM   6594  O  O     . GLY A  1  846  ? 203.925 185.676 203.597 1.00 0.00 ? 846  GLY A O     1 
ATOM   6595  N  N     . PHE A  1  847  ? 204.115 185.251 205.794 1.00 0.00 ? 847  PHE A N     1 
ATOM   6596  C  CA    . PHE A  1  847  ? 205.570 185.258 205.760 1.00 0.00 ? 847  PHE A CA    1 
ATOM   6597  C  C     . PHE A  1  847  ? 206.101 183.948 206.316 1.00 0.00 ? 847  PHE A C     1 
ATOM   6598  O  O     . PHE A  1  847  ? 205.431 183.274 207.103 1.00 0.00 ? 847  PHE A O     1 
ATOM   6599  C  CB    . PHE A  1  847  ? 206.164 186.431 206.544 1.00 0.00 ? 847  PHE A CB    1 
ATOM   6600  C  CG    . PHE A  1  847  ? 207.667 186.489 206.500 1.00 0.00 ? 847  PHE A CG    1 
ATOM   6601  C  CD1   . PHE A  1  847  ? 208.319 186.995 205.389 1.00 0.00 ? 847  PHE A CD1   1 
ATOM   6602  C  CD2   . PHE A  1  847  ? 208.427 186.047 207.570 1.00 0.00 ? 847  PHE A CD2   1 
ATOM   6603  C  CE1   . PHE A  1  847  ? 209.699 187.054 205.342 1.00 0.00 ? 847  PHE A CE1   1 
ATOM   6604  C  CE2   . PHE A  1  847  ? 209.809 186.105 207.527 1.00 0.00 ? 847  PHE A CE2   1 
ATOM   6605  C  CZ    . PHE A  1  847  ? 210.443 186.610 206.412 1.00 0.00 ? 847  PHE A CZ    1 
ATOM   6606  N  N     . VAL A  1  848  ? 207.311 183.602 205.893 1.00 0.00 ? 848  VAL A N     1 
ATOM   6607  C  CA    . VAL A  1  848  ? 207.980 182.363 206.258 1.00 0.00 ? 848  VAL A CA    1 
ATOM   6608  C  C     . VAL A  1  848  ? 209.455 182.661 206.487 1.00 0.00 ? 848  VAL A C     1 
ATOM   6609  O  O     . VAL A  1  848  ? 210.079 183.388 205.709 1.00 0.00 ? 848  VAL A O     1 
ATOM   6610  C  CB    . VAL A  1  848  ? 207.772 181.288 205.168 1.00 0.00 ? 848  VAL A CB    1 
ATOM   6611  C  CG1   . VAL A  1  848  ? 208.079 181.847 203.810 1.00 0.00 ? 848  VAL A CG1   1 
ATOM   6612  C  CG2   . VAL A  1  848  ? 208.680 180.117 205.398 1.00 0.00 ? 848  VAL A CG2   1 
ATOM   6613  N  N     . ARG A  1  849  ? 209.992 182.164 207.597 1.00 0.00 ? 849  ARG A N     1 
ATOM   6614  C  CA    . ARG A  1  849  ? 211.418 182.262 207.855 1.00 0.00 ? 849  ARG A CA    1 
ATOM   6615  C  C     . ARG A  1  849  ? 212.181 180.990 207.519 1.00 0.00 ? 849  ARG A C     1 
ATOM   6616  O  O     . ARG A  1  849  ? 213.407 180.970 207.671 1.00 0.00 ? 849  ARG A O     1 
ATOM   6617  C  CB    . ARG A  1  849  ? 211.680 182.639 209.318 1.00 0.00 ? 849  ARG A CB    1 
ATOM   6618  C  CG    . ARG A  1  849  ? 211.170 181.631 210.320 1.00 0.00 ? 849  ARG A CG    1 
ATOM   6619  C  CD    . ARG A  1  849  ? 211.550 182.039 211.728 1.00 0.00 ? 849  ARG A CD    1 
ATOM   6620  N  NE    . ARG A  1  849  ? 212.999 182.024 211.908 1.00 0.00 ? 849  ARG A NE    1 
ATOM   6621  C  CZ    . ARG A  1  849  ? 213.621 182.415 213.015 1.00 0.00 ? 849  ARG A CZ    1 
ATOM   6622  N  NH1   . ARG A  1  849  ? 212.923 182.857 214.050 1.00 0.00 ? 849  ARG A NH1   1 
ATOM   6623  N  NH2   . ARG A  1  849  ? 214.944 182.366 213.087 1.00 0.00 ? 849  ARG A NH2   1 
ATOM   6624  N  N     . ASN A  1  850  ? 211.508 179.936 207.066 1.00 0.00 ? 850  ASN A N     1 
ATOM   6625  C  CA    . ASN A  1  850  ? 212.124 178.630 206.871 1.00 0.00 ? 850  ASN A CA    1 
ATOM   6626  C  C     . ASN A  1  850  ? 212.284 178.347 205.385 1.00 0.00 ? 850  ASN A C     1 
ATOM   6627  O  O     . ASN A  1  850  ? 211.390 178.652 204.591 1.00 0.00 ? 850  ASN A O     1 
ATOM   6628  C  CB    . ASN A  1  850  ? 211.286 177.530 207.525 1.00 0.00 ? 850  ASN A CB    1 
ATOM   6629  C  CG    . ASN A  1  850  ? 211.275 177.625 209.038 1.00 0.00 ? 850  ASN A CG    1 
ATOM   6630  O  OD1   . ASN A  1  850  ? 212.183 178.193 209.643 1.00 0.00 ? 850  ASN A OD1   1 
ATOM   6631  N  ND2   . ASN A  1  850  ? 210.241 177.069 209.657 1.00 0.00 ? 850  ASN A ND2   1 
ATOM   6632  N  N     . SER A  1  851  ? 213.418 177.762 205.016 1.00 0.00 ? 851  SER A N     1 
ATOM   6633  C  CA    . SER A  1  851  ? 213.611 177.288 203.657 1.00 0.00 ? 851  SER A CA    1 
ATOM   6634  C  C     . SER A  1  851  ? 212.696 176.098 203.385 1.00 0.00 ? 851  SER A C     1 
ATOM   6635  O  O     . SER A  1  851  ? 212.203 175.440 204.305 1.00 0.00 ? 851  SER A O     1 
ATOM   6636  C  CB    . SER A  1  851  ? 215.071 176.894 203.438 1.00 0.00 ? 851  SER A CB    1 
ATOM   6637  O  OG    . SER A  1  851  ? 215.929 178.012 203.567 1.00 0.00 ? 851  SER A OG    1 
ATOM   6638  N  N     . PHE A  1  852  ? 212.452 175.823 202.099 1.00 0.00 ? 852  PHE A N     1 
ATOM   6639  C  CA    . PHE A  1  852  ? 211.796 174.565 201.769 1.00 0.00 ? 852  PHE A CA    1 
ATOM   6640  C  C     . PHE A  1  852  ? 212.575 173.376 202.295 1.00 0.00 ? 852  PHE A C     1 
ATOM   6641  O  O     . PHE A  1  852  ? 211.972 172.345 202.603 1.00 0.00 ? 852  PHE A O     1 
ATOM   6642  C  CB    . PHE A  1  852  ? 211.604 174.398 200.265 1.00 0.00 ? 852  PHE A CB    1 
ATOM   6643  C  CG    . PHE A  1  852  ? 210.597 175.321 199.681 1.00 0.00 ? 852  PHE A CG    1 
ATOM   6644  C  CD1   . PHE A  1  852  ? 209.252 175.088 199.864 1.00 0.00 ? 852  PHE A CD1   1 
ATOM   6645  C  CD2   . PHE A  1  852  ? 210.987 176.393 198.910 1.00 0.00 ? 852  PHE A CD2   1 
ATOM   6646  C  CE1   . PHE A  1  852  ? 208.315 175.931 199.323 1.00 0.00 ? 852  PHE A CE1   1 
ATOM   6647  C  CE2   . PHE A  1  852  ? 210.051 177.231 198.358 1.00 0.00 ? 852  PHE A CE2   1 
ATOM   6648  C  CZ    . PHE A  1  852  ? 208.715 177.004 198.567 1.00 0.00 ? 852  PHE A CZ    1 
ATOM   6649  N  N     . PHE A  1  853  ? 213.892 173.506 202.417 1.00 0.00 ? 853  PHE A N     1 
ATOM   6650  C  CA    . PHE A  1  853  ? 214.742 172.435 202.909 1.00 0.00 ? 853  PHE A CA    1 
ATOM   6651  C  C     . PHE A  1  853  ? 214.578 172.206 204.404 1.00 0.00 ? 853  PHE A C     1 
ATOM   6652  O  O     . PHE A  1  853  ? 214.508 171.056 204.845 1.00 0.00 ? 853  PHE A O     1 
ATOM   6653  C  CB    . PHE A  1  853  ? 216.197 172.746 202.582 1.00 0.00 ? 853  PHE A CB    1 
ATOM   6654  C  CG    . PHE A  1  853  ? 217.160 171.751 203.127 1.00 0.00 ? 853  PHE A CG    1 
ATOM   6655  C  CD1   . PHE A  1  853  ? 217.347 170.538 202.501 1.00 0.00 ? 853  PHE A CD1   1 
ATOM   6656  C  CD2   . PHE A  1  853  ? 217.894 172.036 204.260 1.00 0.00 ? 853  PHE A CD2   1 
ATOM   6657  C  CE1   . PHE A  1  853  ? 218.241 169.620 203.000 1.00 0.00 ? 853  PHE A CE1   1 
ATOM   6658  C  CE2   . PHE A  1  853  ? 218.790 171.124 204.763 1.00 0.00 ? 853  PHE A CE2   1 
ATOM   6659  C  CZ    . PHE A  1  853  ? 218.964 169.914 204.134 1.00 0.00 ? 853  PHE A CZ    1 
ATOM   6660  N  N     . SER A  1  854  ? 214.504 173.275 205.195 1.00 0.00 ? 854  SER A N     1 
ATOM   6661  C  CA    . SER A  1  854  ? 214.328 173.118 206.632 1.00 0.00 ? 854  SER A CA    1 
ATOM   6662  C  C     . SER A  1  854  ? 212.921 172.687 207.014 1.00 0.00 ? 854  SER A C     1 
ATOM   6663  O  O     . SER A  1  854  ? 212.683 172.390 208.189 1.00 0.00 ? 854  SER A O     1 
ATOM   6664  C  CB    . SER A  1  854  ? 214.674 174.419 207.353 1.00 0.00 ? 854  SER A CB    1 
ATOM   6665  O  OG    . SER A  1  854  ? 216.048 174.723 207.211 1.00 0.00 ? 854  SER A OG    1 
ATOM   6666  N  N     . GLY A  1  855  ? 211.993 172.638 206.065 1.00 0.00 ? 855  GLY A N     1 
ATOM   6667  C  CA    . GLY A  1  855  ? 210.614 172.335 206.381 1.00 0.00 ? 855  GLY A CA    1 
ATOM   6668  C  C     . GLY A  1  855  ? 209.816 173.595 206.639 1.00 0.00 ? 855  GLY A C     1 
ATOM   6669  O  O     . GLY A  1  855  ? 210.362 174.698 206.559 1.00 0.00 ? 855  GLY A O     1 
ATOM   6670  N  N     . LEU A  1  856  ? 208.531 173.453 206.938 1.00 0.00 ? 856  LEU A N     1 
ATOM   6671  C  CA    . LEU A  1  856  ? 207.669 174.593 207.204 1.00 0.00 ? 856  LEU A CA    1 
ATOM   6672  C  C     . LEU A  1  856  ? 206.926 174.408 208.520 1.00 0.00 ? 856  LEU A C     1 
ATOM   6673  O  O     . LEU A  1  856  ? 206.849 173.304 209.061 1.00 0.00 ? 856  LEU A O     1 
ATOM   6674  C  CB    . LEU A  1  856  ? 206.664 174.793 206.067 1.00 0.00 ? 856  LEU A CB    1 
ATOM   6675  C  CG    . LEU A  1  856  ? 207.023 175.708 204.892 1.00 0.00 ? 856  LEU A CG    1 
ATOM   6676  C  CD1   . LEU A  1  856  ? 208.223 175.206 204.139 1.00 0.00 ? 856  LEU A CD1   1 
ATOM   6677  C  CD2   . LEU A  1  856  ? 205.844 175.821 203.954 1.00 0.00 ? 856  LEU A CD2   1 
ATOM   6678  N  N     . SER A  1  857  ? 206.431 175.503 209.057 1.00 0.00 ? 857  SER A N     1 
ATOM   6679  C  CA    . SER A  1  857  ? 205.441 175.412 210.116 1.00 0.00 ? 857  SER A CA    1 
ATOM   6680  C  C     . SER A  1  857  ? 204.044 175.460 209.520 1.00 0.00 ? 857  SER A C     1 
ATOM   6681  O  O     . SER A  1  857  ? 203.849 175.983 208.420 1.00 0.00 ? 857  SER A O     1 
ATOM   6682  C  CB    . SER A  1  857  ? 205.623 176.552 211.114 1.00 0.00 ? 857  SER A CB    1 
ATOM   6683  O  OG    . SER A  1  857  ? 205.303 177.798 210.528 1.00 0.00 ? 857  SER A OG    1 
ATOM   6684  N  N     . PRO A  1  858  ? 203.049 174.903 210.203 1.00 0.00 ? 858  PRO A N     1 
ATOM   6685  C  CA    . PRO A  1  858  ? 201.679 174.938 209.677 1.00 0.00 ? 858  PRO A CA    1 
ATOM   6686  C  C     . PRO A  1  858  ? 201.219 176.347 209.343 1.00 0.00 ? 858  PRO A C     1 
ATOM   6687  O  O     . PRO A  1  858  ? 200.630 176.555 208.270 1.00 0.00 ? 858  PRO A O     1 
ATOM   6688  C  CB    . PRO A  1  858  ? 200.851 174.319 210.810 1.00 0.00 ? 858  PRO A CB    1 
ATOM   6689  C  CG    . PRO A  1  858  ? 201.798 173.375 211.451 1.00 0.00 ? 858  PRO A CG    1 
ATOM   6690  C  CD    . PRO A  1  858  ? 203.157 174.026 211.382 1.00 0.00 ? 858  PRO A CD    1 
ATOM   6691  N  N     . PRO A  1  859  ? 201.462 177.345 210.205 1.00 0.00 ? 859  PRO A N     1 
ATOM   6692  C  CA    . PRO A  1  859  ? 200.989 178.698 209.860 1.00 0.00 ? 859  PRO A CA    1 
ATOM   6693  C  C     . PRO A  1  859  ? 201.547 179.201 208.545 1.00 0.00 ? 859  PRO A C     1 
ATOM   6694  O  O     . PRO A  1  859  ? 200.814 179.799 207.746 1.00 0.00 ? 859  PRO A O     1 
ATOM   6695  C  CB    . PRO A  1  859  ? 201.477 179.542 211.041 1.00 0.00 ? 859  PRO A CB    1 
ATOM   6696  C  CG    . PRO A  1  859  ? 201.566 178.599 212.152 1.00 0.00 ? 859  PRO A CG    1 
ATOM   6697  C  CD    . PRO A  1  859  ? 202.075 177.344 211.542 1.00 0.00 ? 859  PRO A CD    1 
ATOM   6698  N  N     . GLU A  1  860  ? 202.830 178.982 208.302 1.00 0.00 ? 860  GLU A N     1 
ATOM   6699  C  CA    . GLU A  1  860  ? 203.417 179.413 207.047 1.00 0.00 ? 860  GLU A CA    1 
ATOM   6700  C  C     . GLU A  1  860  ? 203.102 178.451 205.912 1.00 0.00 ? 860  GLU A C     1 
ATOM   6701  O  O     . GLU A  1  860  ? 203.102 178.864 204.750 1.00 0.00 ? 860  GLU A O     1 
ATOM   6702  C  CB    . GLU A  1  860  ? 204.925 179.583 207.231 1.00 0.00 ? 860  GLU A CB    1 
ATOM   6703  C  CG    . GLU A  1  860  ? 205.640 178.297 207.535 1.00 0.00 ? 860  GLU A CG    1 
ATOM   6704  C  CD    . GLU A  1  860  ? 206.991 178.516 208.169 1.00 0.00 ? 860  GLU A CD    1 
ATOM   6705  O  OE1   . GLU A  1  860  ? 207.465 179.673 208.194 1.00 0.00 ? 860  GLU A OE1   1 
ATOM   6706  O  OE2   . GLU A  1  860  ? 207.577 177.524 208.652 1.00 0.00 ? 860  GLU A OE2   1 
ATOM   6707  N  N     . PHE A  1  861  ? 202.834 177.180 206.218 1.00 0.00 ? 861  PHE A N     1 
ATOM   6708  C  CA    . PHE A  1  861  ? 202.442 176.255 205.162 1.00 0.00 ? 861  PHE A CA    1 
ATOM   6709  C  C     . PHE A  1  861  ? 201.097 176.631 204.573 1.00 0.00 ? 861  PHE A C     1 
ATOM   6710  O  O     . PHE A  1  861  ? 200.948 176.691 203.349 1.00 0.00 ? 861  PHE A O     1 
ATOM   6711  C  CB    . PHE A  1  861  ? 202.397 174.824 205.678 1.00 0.00 ? 861  PHE A CB    1 
ATOM   6712  C  CG    . PHE A  1  861  ? 201.822 173.851 204.695 1.00 0.00 ? 861  PHE A CG    1 
ATOM   6713  C  CD1   . PHE A  1  861  ? 202.568 173.418 203.620 1.00 0.00 ? 861  PHE A CD1   1 
ATOM   6714  C  CD2   . PHE A  1  861  ? 200.543 173.354 204.859 1.00 0.00 ? 861  PHE A CD2   1 
ATOM   6715  C  CE1   . PHE A  1  861  ? 202.046 172.522 202.719 1.00 0.00 ? 861  PHE A CE1   1 
ATOM   6716  C  CE2   . PHE A  1  861  ? 200.017 172.452 203.962 1.00 0.00 ? 861  PHE A CE2   1 
ATOM   6717  C  CZ    . PHE A  1  861  ? 200.769 172.038 202.890 1.00 0.00 ? 861  PHE A CZ    1 
ATOM   6718  N  N     . LEU A  1  862  ? 200.099 176.868 205.422 1.00 0.00 ? 862  LEU A N     1 
ATOM   6719  C  CA    . LEU A  1  862  ? 198.802 177.269 204.896 1.00 0.00 ? 862  LEU A CA    1 
ATOM   6720  C  C     . LEU A  1  862  ? 198.916 178.530 204.056 1.00 0.00 ? 862  LEU A C     1 
ATOM   6721  O  O     . LEU A  1  862  ? 198.228 178.662 203.040 1.00 0.00 ? 862  LEU A O     1 
ATOM   6722  C  CB    . LEU A  1  862  ? 197.808 177.476 206.031 1.00 0.00 ? 862  LEU A CB    1 
ATOM   6723  C  CG    . LEU A  1  862  ? 196.438 177.939 205.552 1.00 0.00 ? 862  LEU A CG    1 
ATOM   6724  C  CD1   . LEU A  1  862  ? 195.815 176.869 204.688 1.00 0.00 ? 862  LEU A CD1   1 
ATOM   6725  C  CD2   . LEU A  1  862  ? 195.555 178.263 206.729 1.00 0.00 ? 862  LEU A CD2   1 
ATOM   6726  N  N     . PHE A  1  863  ? 199.795 179.452 204.449 1.00 0.00 ? 863  PHE A N     1 
ATOM   6727  C  CA    . PHE A  1  863  ? 200.050 180.629 203.629 1.00 0.00 ? 863  PHE A CA    1 
ATOM   6728  C  C     . PHE A  1  863  ? 200.639 180.247 202.283 1.00 0.00 ? 863  PHE A C     1 
ATOM   6729  O  O     . PHE A  1  863  ? 200.144 180.676 201.235 1.00 0.00 ? 863  PHE A O     1 
ATOM   6730  C  CB    . PHE A  1  863  ? 200.988 181.579 204.366 1.00 0.00 ? 863  PHE A CB    1 
ATOM   6731  C  CG    . PHE A  1  863  ? 200.380 182.191 205.577 1.00 0.00 ? 863  PHE A CG    1 
ATOM   6732  C  CD1   . PHE A  1  863  ? 199.012 182.290 205.687 1.00 0.00 ? 863  PHE A CD1   1 
ATOM   6733  C  CD2   . PHE A  1  863  ? 201.168 182.648 206.616 1.00 0.00 ? 863  PHE A CD2   1 
ATOM   6734  C  CE1   . PHE A  1  863  ? 198.439 182.849 206.794 1.00 0.00 ? 863  PHE A CE1   1 
ATOM   6735  C  CE2   . PHE A  1  863  ? 200.598 183.208 207.731 1.00 0.00 ? 863  PHE A CE2   1 
ATOM   6736  C  CZ    . PHE A  1  863  ? 199.230 183.306 207.821 1.00 0.00 ? 863  PHE A CZ    1 
ATOM   6737  N  N     . HIS A  1  864  ? 201.694 179.433 202.286 1.00 0.00 ? 864  HIS A N     1 
ATOM   6738  C  CA    . HIS A  1  864  ? 202.313 179.044 201.029 1.00 0.00 ? 864  HIS A CA    1 
ATOM   6739  C  C     . HIS A  1  864  ? 201.388 178.189 200.181 1.00 0.00 ? 864  HIS A C     1 
ATOM   6740  O  O     . HIS A  1  864  ? 201.687 177.940 199.009 1.00 0.00 ? 864  HIS A O     1 
ATOM   6741  C  CB    . HIS A  1  864  ? 203.609 178.293 201.290 1.00 0.00 ? 864  HIS A CB    1 
ATOM   6742  C  CG    . HIS A  1  864  ? 204.379 178.003 200.047 1.00 0.00 ? 864  HIS A CG    1 
ATOM   6743  N  ND1   . HIS A  1  864  ? 204.885 179.000 199.244 1.00 0.00 ? 864  HIS A ND1   1 
ATOM   6744  C  CD2   . HIS A  1  864  ? 204.701 176.834 199.448 1.00 0.00 ? 864  HIS A CD2   1 
ATOM   6745  C  CE1   . HIS A  1  864  ? 205.506 178.457 198.213 1.00 0.00 ? 864  HIS A CE1   1 
ATOM   6746  N  NE2   . HIS A  1  864  ? 205.410 177.144 198.314 1.00 0.00 ? 864  HIS A NE2   1 
ATOM   6747  N  N     . ALA A  1  865  ? 200.275 177.741 200.744 1.00 0.00 ? 865  ALA A N     1 
ATOM   6748  C  CA    . ALA A  1  865  ? 199.233 177.057 200.001 1.00 0.00 ? 865  ALA A CA    1 
ATOM   6749  C  C     . ALA A  1  865  ? 198.231 178.024 199.418 1.00 0.00 ? 865  ALA A C     1 
ATOM   6750  O  O     . ALA A  1  865  ? 197.207 177.591 198.887 1.00 0.00 ? 865  ALA A O     1 
ATOM   6751  C  CB    . ALA A  1  865  ? 198.518 176.046 200.896 1.00 0.00 ? 865  ALA A CB    1 
ATOM   6752  N  N     . ILE A  1  866  ? 198.492 179.321 199.546 1.00 0.00 ? 866  ILE A N     1 
ATOM   6753  C  CA    . ILE A  1  866  ? 197.629 180.353 199.003 1.00 0.00 ? 866  ILE A CA    1 
ATOM   6754  C  C     . ILE A  1  866  ? 198.245 181.018 197.780 1.00 0.00 ? 866  ILE A C     1 
ATOM   6755  O  O     . ILE A  1  866  ? 197.658 180.978 196.700 1.00 0.00 ? 866  ILE A O     1 
ATOM   6756  C  CB    . ILE A  1  866  ? 197.271 181.400 200.074 1.00 0.00 ? 866  ILE A CB    1 
ATOM   6757  C  CG1   . ILE A  1  866  ? 196.704 180.685 201.287 1.00 0.00 ? 866  ILE A CG1   1 
ATOM   6758  C  CG2   . ILE A  1  866  ? 196.256 182.373 199.528 1.00 0.00 ? 866  ILE A CG2   1 
ATOM   6759  C  CD1   . ILE A  1  866  ? 195.570 179.777 200.944 1.00 0.00 ? 866  ILE A CD1   1 
ATOM   6760  N  N     . SER A  1  867  ? 199.418 181.643 197.931 1.00 0.00 ? 867  SER A N     1 
ATOM   6761  C  CA    . SER A  1  867  ? 199.985 182.457 196.855 1.00 0.00 ? 867  SER A CA    1 
ATOM   6762  C  C     . SER A  1  867  ? 200.001 181.719 195.522 1.00 0.00 ? 867  SER A C     1 
ATOM   6763  O  O     . SER A  1  867  ? 199.402 182.184 194.539 1.00 0.00 ? 867  SER A O     1 
ATOM   6764  C  CB    . SER A  1  867  ? 201.397 182.897 197.233 1.00 0.00 ? 867  SER A CB    1 
ATOM   6765  O  OG    . SER A  1  867  ? 201.991 183.635 196.183 1.00 0.00 ? 867  SER A OG    1 
ATOM   6766  N  N     . GLY A  1  868  ? 200.646 180.550 195.476 1.00 0.00 ? 868  GLY A N     1 
ATOM   6767  C  CA    . GLY A  1  868  ? 200.667 179.764 194.257 1.00 0.00 ? 868  GLY A CA    1 
ATOM   6768  C  C     . GLY A  1  868  ? 199.293 179.441 193.720 1.00 0.00 ? 868  GLY A C     1 
ATOM   6769  O  O     . GLY A  1  868  ? 199.133 179.274 192.507 1.00 0.00 ? 868  GLY A O     1 
ATOM   6770  N  N     . ARG A  1  869  ? 198.296 179.362 194.596 1.00 0.00 ? 869  ARG A N     1 
ATOM   6771  C  CA    . ARG A  1  869  ? 196.918 179.135 194.195 1.00 0.00 ? 869  ARG A CA    1 
ATOM   6772  C  C     . ARG A  1  869  ? 196.252 180.364 193.597 1.00 0.00 ? 869  ARG A C     1 
ATOM   6773  O  O     . ARG A  1  869  ? 195.604 180.249 192.550 1.00 0.00 ? 869  ARG A O     1 
ATOM   6774  C  CB    . ARG A  1  869  ? 196.113 178.649 195.398 1.00 0.00 ? 869  ARG A CB    1 
ATOM   6775  C  CG    . ARG A  1  869  ? 196.546 177.290 195.878 1.00 0.00 ? 869  ARG A CG    1 
ATOM   6776  C  CD    . ARG A  1  869  ? 196.202 176.287 194.818 1.00 0.00 ? 869  ARG A CD    1 
ATOM   6777  N  NE    . ARG A  1  869  ? 194.802 176.479 194.484 1.00 0.00 ? 869  ARG A NE    1 
ATOM   6778  C  CZ    . ARG A  1  869  ? 193.794 176.024 195.215 1.00 0.00 ? 869  ARG A CZ    1 
ATOM   6779  N  NH1   . ARG A  1  869  ? 194.029 175.332 196.321 1.00 0.00 ? 869  ARG A NH1   1 
ATOM   6780  N  NH2   . ARG A  1  869  ? 192.552 176.273 194.838 1.00 0.00 ? 869  ARG A NH2   1 
ATOM   6781  N  N     . GLU A  1  870  ? 196.393 181.526 194.235 1.00 0.00 ? 870  GLU A N     1 
ATOM   6782  C  CA    . GLU A  1  870  ? 195.904 182.767 193.650 1.00 0.00 ? 870  GLU A CA    1 
ATOM   6783  C  C     . GLU A  1  870  ? 196.494 182.979 192.263 1.00 0.00 ? 870  GLU A C     1 
ATOM   6784  O  O     . GLU A  1  870  ? 195.819 183.502 191.368 1.00 0.00 ? 870  GLU A O     1 
ATOM   6785  C  CB    . GLU A  1  870  ? 196.224 183.939 194.578 1.00 0.00 ? 870  GLU A CB    1 
ATOM   6786  C  CG    . GLU A  1  870  ? 195.702 185.289 194.113 1.00 0.00 ? 870  GLU A CG    1 
ATOM   6787  C  CD    . GLU A  1  870  ? 196.598 185.936 193.079 1.00 0.00 ? 870  GLU A CD    1 
ATOM   6788  O  OE1   . GLU A  1  870  ? 197.801 185.604 193.053 1.00 0.00 ? 870  GLU A OE1   1 
ATOM   6789  O  OE2   . GLU A  1  870  ? 196.101 186.766 192.290 1.00 0.00 ? 870  GLU A OE2   1 
ATOM   6790  N  N     . GLY A  1  871  ? 197.750 182.572 192.058 1.00 0.00 ? 871  GLY A N     1 
ATOM   6791  C  CA    . GLY A  1  871  ? 198.254 182.520 190.697 1.00 0.00 ? 871  GLY A CA    1 
ATOM   6792  C  C     . GLY A  1  871  ? 197.491 181.573 189.795 1.00 0.00 ? 871  GLY A C     1 
ATOM   6793  O  O     . GLY A  1  871  ? 197.189 181.929 188.649 1.00 0.00 ? 871  GLY A O     1 
ATOM   6794  N  N     . LEU A  1  872  ? 197.152 180.384 190.301 1.00 0.00 ? 872  LEU A N     1 
ATOM   6795  C  CA    . LEU A  1  872  ? 196.458 179.386 189.492 1.00 0.00 ? 872  LEU A CA    1 
ATOM   6796  C  C     . LEU A  1  872  ? 195.095 179.888 189.031 1.00 0.00 ? 872  LEU A C     1 
ATOM   6797  O  O     . LEU A  1  872  ? 194.764 179.793 187.842 1.00 0.00 ? 872  LEU A O     1 
ATOM   6798  C  CB    . LEU A  1  872  ? 196.326 178.085 190.285 1.00 0.00 ? 872  LEU A CB    1 
ATOM   6799  C  CG    . LEU A  1  872  ? 195.761 176.840 189.601 1.00 0.00 ? 872  LEU A CG    1 
ATOM   6800  C  CD1   . LEU A  1  872  ? 196.416 175.586 190.155 1.00 0.00 ? 872  LEU A CD1   1 
ATOM   6801  C  CD2   . LEU A  1  872  ? 194.257 176.768 189.793 1.00 0.00 ? 872  LEU A CD2   1 
ATOM   6802  N  N     . VAL A  1  873  ? 194.285 180.416 189.950 1.00 0.00 ? 873  VAL A N     1 
ATOM   6803  C  CA    . VAL A  1  873  ? 193.018 181.009 189.532 1.00 0.00 ? 873  VAL A CA    1 
ATOM   6804  C  C     . VAL A  1  873  ? 193.243 182.217 188.628 1.00 0.00 ? 873  VAL A C     1 
ATOM   6805  O  O     . VAL A  1  873  ? 192.555 182.369 187.607 1.00 0.00 ? 873  VAL A O     1 
ATOM   6806  C  CB    . VAL A  1  873  ? 192.153 181.378 190.748 1.00 0.00 ? 873  VAL A CB    1 
ATOM   6807  C  CG1   . VAL A  1  873  ? 192.931 182.224 191.730 1.00 0.00 ? 873  VAL A CG1   1 
ATOM   6808  C  CG2   . VAL A  1  873  ? 190.946 182.163 190.281 1.00 0.00 ? 873  VAL A CG2   1 
ATOM   6809  N  N     . ASP A  1  874  ? 194.205 183.080 188.976 1.00 0.00 ? 874  ASP A N     1 
ATOM   6810  C  CA    . ASP A  1  874  ? 194.497 184.265 188.180 1.00 0.00 ? 874  ASP A CA    1 
ATOM   6811  C  C     . ASP A  1  874  ? 194.769 183.923 186.723 1.00 0.00 ? 874  ASP A C     1 
ATOM   6812  O  O     . ASP A  1  874  ? 194.414 184.706 185.838 1.00 0.00 ? 874  ASP A O     1 
ATOM   6813  C  CB    . ASP A  1  874  ? 195.690 185.011 188.774 1.00 0.00 ? 874  ASP A CB    1 
ATOM   6814  C  CG    . ASP A  1  874  ? 196.002 186.290 188.032 1.00 0.00 ? 874  ASP A CG    1 
ATOM   6815  O  OD1   . ASP A  1  874  ? 195.180 187.226 188.096 1.00 0.00 ? 874  ASP A OD1   1 
ATOM   6816  O  OD2   . ASP A  1  874  ? 197.066 186.360 187.382 1.00 0.00 ? 874  ASP A OD2   1 
ATOM   6817  N  N     . THR A  1  875  ? 195.388 182.776 186.458 1.00 0.00 ? 875  THR A N     1 
ATOM   6818  C  CA    . THR A  1  875  ? 195.457 182.237 185.106 1.00 0.00 ? 875  THR A CA    1 
ATOM   6819  C  C     . THR A  1  875  ? 194.114 181.713 184.615 1.00 0.00 ? 875  THR A C     1 
ATOM   6820  O  O     . THR A  1  875  ? 193.631 182.133 183.548 1.00 0.00 ? 875  THR A O     1 
ATOM   6821  C  CB    . THR A  1  875  ? 196.487 181.103 185.044 1.00 0.00 ? 875  THR A CB    1 
ATOM   6822  O  OG1   . THR A  1  875  ? 197.793 181.615 185.336 1.00 0.00 ? 875  THR A OG1   1 
ATOM   6823  C  CG2   . THR A  1  875  ? 196.489 180.455 183.670 1.00 0.00 ? 875  THR A CG2   1 
ATOM   6824  N  N     . ALA A  1  876  ? 193.489 180.836 185.409 1.00 0.00 ? 876  ALA A N     1 
ATOM   6825  C  CA    . ALA A  1  876  ? 192.348 180.054 184.941 1.00 0.00 ? 876  ALA A CA    1 
ATOM   6826  C  C     . ALA A  1  876  ? 191.202 180.937 184.468 1.00 0.00 ? 876  ALA A C     1 
ATOM   6827  O  O     . ALA A  1  876  ? 190.643 180.708 183.389 1.00 0.00 ? 876  ALA A O     1 
ATOM   6828  C  CB    . ALA A  1  876  ? 191.872 179.116 186.049 1.00 0.00 ? 876  ALA A CB    1 
ATOM   6829  N  N     . VAL A  1  877  ? 190.829 181.946 185.256 1.00 0.00 ? 877  VAL A N     1 
ATOM   6830  C  CA    . VAL A  1  877  ? 189.654 182.730 184.888 1.00 0.00 ? 877  VAL A CA    1 
ATOM   6831  C  C     . VAL A  1  877  ? 189.951 183.640 183.701 1.00 0.00 ? 877  VAL A C     1 
ATOM   6832  O  O     . VAL A  1  877  ? 189.104 183.814 182.816 1.00 0.00 ? 877  VAL A O     1 
ATOM   6833  C  CB    . VAL A  1  877  ? 189.145 183.531 186.102 1.00 0.00 ? 877  VAL A CB    1 
ATOM   6834  C  CG1   . VAL A  1  877  ? 187.955 184.403 185.713 1.00 0.00 ? 877  VAL A CG1   1 
ATOM   6835  C  CG2   . VAL A  1  877  ? 188.779 182.596 187.250 1.00 0.00 ? 877  VAL A CG2   1 
ATOM   6836  N  N     . LYS A  1  878  ? 191.152 184.216 183.646 1.00 0.00 ? 878  LYS A N     1 
ATOM   6837  C  CA    . LYS A  1  878  ? 191.422 185.279 182.684 1.00 0.00 ? 878  LYS A CA    1 
ATOM   6838  C  C     . LYS A  1  878  ? 191.743 184.747 181.287 1.00 0.00 ? 878  LYS A C     1 
ATOM   6839  O  O     . LYS A  1  878  ? 191.341 185.365 180.288 1.00 0.00 ? 878  LYS A O     1 
ATOM   6840  C  CB    . LYS A  1  878  ? 192.561 186.156 183.196 1.00 0.00 ? 878  LYS A CB    1 
ATOM   6841  C  CG    . LYS A  1  878  ? 192.826 187.384 182.358 1.00 0.00 ? 878  LYS A CG    1 
ATOM   6842  C  CD    . LYS A  1  878  ? 194.066 188.103 182.847 1.00 0.00 ? 878  LYS A CD    1 
ATOM   6843  C  CE    . LYS A  1  878  ? 193.850 188.697 184.224 1.00 0.00 ? 878  LYS A CE    1 
ATOM   6844  N  NZ    . LYS A  1  878  ? 195.074 189.383 184.721 1.00 0.00 ? 878  LYS A NZ    1 
ATOM   6845  N  N     . THR A  1  879  ? 192.486 183.633 181.184 1.00 0.00 ? 879  THR A N     1 
ATOM   6846  C  CA    . THR A  1  879  ? 192.845 183.131 179.855 1.00 0.00 ? 879  THR A CA    1 
ATOM   6847  C  C     . THR A  1  879  ? 191.626 182.932 178.960 1.00 0.00 ? 879  THR A C     1 
ATOM   6848  O  O     . THR A  1  879  ? 191.703 183.194 177.749 1.00 0.00 ? 879  THR A O     1 
ATOM   6849  C  CB    . THR A  1  879  ? 193.624 181.821 179.965 1.00 0.00 ? 879  THR A CB    1 
ATOM   6850  O  OG1   . THR A  1  879  ? 192.851 180.863 180.698 1.00 0.00 ? 879  THR A OG1   1 
ATOM   6851  C  CG2   . THR A  1  879  ? 194.961 182.047 180.662 1.00 0.00 ? 879  THR A CG2   1 
ATOM   6852  N  N     . ALA A  1  880  ? 190.501 182.505 179.539 1.00 0.00 ? 880  ALA A N     1 
ATOM   6853  C  CA    . ALA A  1  880  ? 189.259 182.401 178.784 1.00 0.00 ? 880  ALA A CA    1 
ATOM   6854  C  C     . ALA A  1  880  ? 188.828 183.746 178.222 1.00 0.00 ? 880  ALA A C     1 
ATOM   6855  O  O     . ALA A  1  880  ? 188.125 183.793 177.209 1.00 0.00 ? 880  ALA A O     1 
ATOM   6856  C  CB    . ALA A  1  880  ? 188.152 181.823 179.665 1.00 0.00 ? 880  ALA A CB    1 
ATOM   6857  N  N     . GLU A  1  881  ? 189.214 184.842 178.865 1.00 0.00 ? 881  GLU A N     1 
ATOM   6858  C  CA    . GLU A  1  881  ? 188.975 186.143 178.264 1.00 0.00 ? 881  GLU A CA    1 
ATOM   6859  C  C     . GLU A  1  881  ? 189.994 186.457 177.183 1.00 0.00 ? 881  GLU A C     1 
ATOM   6860  O  O     . GLU A  1  881  ? 189.630 187.039 176.155 1.00 0.00 ? 881  GLU A O     1 
ATOM   6861  C  CB    . GLU A  1  881  ? 188.989 187.242 179.330 1.00 0.00 ? 881  GLU A CB    1 
ATOM   6862  C  CG    . GLU A  1  881  ? 188.624 188.621 178.807 1.00 0.00 ? 881  GLU A CG    1 
ATOM   6863  C  CD    . GLU A  1  881  ? 189.770 189.297 178.096 1.00 0.00 ? 881  GLU A CD    1 
ATOM   6864  O  OE1   . GLU A  1  881  ? 190.934 188.977 178.408 1.00 0.00 ? 881  GLU A OE1   1 
ATOM   6865  O  OE2   . GLU A  1  881  ? 189.509 190.120 177.198 1.00 0.00 ? 881  GLU A OE2   1 
ATOM   6866  N  N     . THR A  1  882  ? 191.261 186.086 177.392 1.00 0.00 ? 882  THR A N     1 
ATOM   6867  C  CA    . THR A  1  882  ? 192.283 186.387 176.391 1.00 0.00 ? 882  THR A CA    1 
ATOM   6868  C  C     . THR A  1  882  ? 191.952 185.760 175.042 1.00 0.00 ? 882  THR A C     1 
ATOM   6869  O  O     . THR A  1  882  ? 192.120 186.400 173.994 1.00 0.00 ? 882  THR A O     1 
ATOM   6870  C  CB    . THR A  1  882  ? 193.650 185.914 176.869 1.00 0.00 ? 882  THR A CB    1 
ATOM   6871  O  OG1   . THR A  1  882  ? 194.005 186.621 178.063 1.00 0.00 ? 882  THR A OG1   1 
ATOM   6872  C  CG2   . THR A  1  882  ? 194.696 186.169 175.802 1.00 0.00 ? 882  THR A CG2   1 
ATOM   6873  N  N     . GLY A  1  883  ? 191.485 184.509 175.040 1.00 0.00 ? 883  GLY A N     1 
ATOM   6874  C  CA    . GLY A  1  883  ? 191.086 183.903 173.780 1.00 0.00 ? 883  GLY A CA    1 
ATOM   6875  C  C     . GLY A  1  883  ? 190.109 184.760 173.000 1.00 0.00 ? 883  GLY A C     1 
ATOM   6876  O  O     . GLY A  1  883  ? 190.360 185.096 171.838 1.00 0.00 ? 883  GLY A O     1 
ATOM   6877  N  N     . TYR A  1  884  ? 189.002 185.149 173.631 1.00 0.00 ? 884  TYR A N     1 
ATOM   6878  C  CA    . TYR A  1  884  ? 188.069 186.078 173.014 1.00 0.00 ? 884  TYR A CA    1 
ATOM   6879  C  C     . TYR A  1  884  ? 188.749 187.363 172.570 1.00 0.00 ? 884  TYR A C     1 
ATOM   6880  O  O     . TYR A  1  884  ? 188.419 187.894 171.503 1.00 0.00 ? 884  TYR A O     1 
ATOM   6881  C  CB    . TYR A  1  884  ? 186.934 186.389 173.983 1.00 0.00 ? 884  TYR A CB    1 
ATOM   6882  C  CG    . TYR A  1  884  ? 185.991 187.457 173.501 1.00 0.00 ? 884  TYR A CG    1 
ATOM   6883  C  CD1   . TYR A  1  884  ? 185.077 187.198 172.498 1.00 0.00 ? 884  TYR A CD1   1 
ATOM   6884  C  CD2   . TYR A  1  884  ? 185.998 188.718 174.066 1.00 0.00 ? 884  TYR A CD2   1 
ATOM   6885  C  CE1   . TYR A  1  884  ? 184.210 188.168 172.061 1.00 0.00 ? 884  TYR A CE1   1 
ATOM   6886  C  CE2   . TYR A  1  884  ? 185.132 189.693 173.637 1.00 0.00 ? 884  TYR A CE2   1 
ATOM   6887  C  CZ    . TYR A  1  884  ? 184.241 189.415 172.633 1.00 0.00 ? 884  TYR A CZ    1 
ATOM   6888  O  OH    . TYR A  1  884  ? 183.378 190.390 172.198 1.00 0.00 ? 884  TYR A OH    1 
ATOM   6889  N  N     . MET A  1  885  ? 189.698 187.865 173.364 1.00 0.00 ? 885  MET A N     1 
ATOM   6890  C  CA    . MET A  1  885  ? 190.459 189.043 172.962 1.00 0.00 ? 885  MET A CA    1 
ATOM   6891  C  C     . MET A  1  885  ? 191.088 188.860 171.586 1.00 0.00 ? 885  MET A C     1 
ATOM   6892  O  O     . MET A  1  885  ? 190.854 189.666 170.679 1.00 0.00 ? 885  MET A O     1 
ATOM   6893  C  CB    . MET A  1  885  ? 191.531 189.355 174.001 1.00 0.00 ? 885  MET A CB    1 
ATOM   6894  C  CG    . MET A  1  885  ? 192.496 190.434 173.585 1.00 0.00 ? 885  MET A CG    1 
ATOM   6895  S  SD    . MET A  1  885  ? 193.622 190.786 174.937 1.00 0.00 ? 885  MET A SD    1 
ATOM   6896  C  CE    . MET A  1  885  ? 194.838 191.802 174.112 1.00 0.00 ? 885  MET A CE    1 
ATOM   6897  N  N     . SER A  1  886  ? 191.884 187.807 171.404 1.00 0.00 ? 886  SER A N     1 
ATOM   6898  C  CA    . SER A  1  886  ? 192.487 187.609 170.093 1.00 0.00 ? 886  SER A CA    1 
ATOM   6899  C  C     . SER A  1  886  ? 191.448 187.394 169.013 1.00 0.00 ? 886  SER A C     1 
ATOM   6900  O  O     . SER A  1  886  ? 191.493 188.077 167.982 1.00 0.00 ? 886  SER A O     1 
ATOM   6901  C  CB    . SER A  1  886  ? 193.436 186.420 170.109 1.00 0.00 ? 886  SER A CB    1 
ATOM   6902  O  OG    . SER A  1  886  ? 194.521 186.660 170.977 1.00 0.00 ? 886  SER A OG    1 
ATOM   6903  N  N     . ARG A  1  887  ? 190.510 186.473 169.232 1.00 0.00 ? 887  ARG A N     1 
ATOM   6904  C  CA    . ARG A  1  887  ? 189.539 186.151 168.196 1.00 0.00 ? 887  ARG A CA    1 
ATOM   6905  C  C     . ARG A  1  887  ? 188.834 187.394 167.678 1.00 0.00 ? 887  ARG A C     1 
ATOM   6906  O  O     . ARG A  1  887  ? 188.752 187.605 166.463 1.00 0.00 ? 887  ARG A O     1 
ATOM   6907  C  CB    . ARG A  1  887  ? 188.513 185.154 168.713 1.00 0.00 ? 887  ARG A CB    1 
ATOM   6908  C  CG    . ARG A  1  887  ? 187.438 184.891 167.702 1.00 0.00 ? 887  ARG A CG    1 
ATOM   6909  C  CD    . ARG A  1  887  ? 186.402 183.936 168.236 1.00 0.00 ? 887  ARG A CD    1 
ATOM   6910  N  NE    . ARG A  1  887  ? 185.323 183.802 167.273 1.00 0.00 ? 887  ARG A NE    1 
ATOM   6911  C  CZ    . ARG A  1  887  ? 184.281 184.619 167.223 1.00 0.00 ? 887  ARG A CZ    1 
ATOM   6912  N  NH1   . ARG A  1  887  ? 184.178 185.610 168.093 1.00 0.00 ? 887  ARG A NH1   1 
ATOM   6913  N  NH2   . ARG A  1  887  ? 183.343 184.447 166.307 1.00 0.00 ? 887  ARG A NH2   1 
ATOM   6914  N  N     . ARG A  1  888  ? 188.317 188.236 168.575 1.00 0.00 ? 888  ARG A N     1 
ATOM   6915  C  CA    . ARG A  1  888  ? 187.617 189.410 168.074 1.00 0.00 ? 888  ARG A CA    1 
ATOM   6916  C  C     . ARG A  1  888  ? 188.590 190.435 167.531 1.00 0.00 ? 888  ARG A C     1 
ATOM   6917  O  O     . ARG A  1  888  ? 188.275 191.124 166.558 1.00 0.00 ? 888  ARG A O     1 
ATOM   6918  C  CB    . ARG A  1  888  ? 186.758 190.058 169.149 1.00 0.00 ? 888  ARG A CB    1 
ATOM   6919  C  CG    . ARG A  1  888  ? 187.555 190.662 170.260 1.00 0.00 ? 888  ARG A CG    1 
ATOM   6920  C  CD    . ARG A  1  888  ? 186.672 191.445 171.183 1.00 0.00 ? 888  ARG A CD    1 
ATOM   6921  N  NE    . ARG A  1  888  ? 187.455 192.079 172.231 1.00 0.00 ? 888  ARG A NE    1 
ATOM   6922  C  CZ    . ARG A  1  888  ? 186.926 192.755 173.240 1.00 0.00 ? 888  ARG A CZ    1 
ATOM   6923  N  NH1   . ARG A  1  888  ? 185.612 192.877 173.338 1.00 0.00 ? 888  ARG A NH1   1 
ATOM   6924  N  NH2   . ARG A  1  888  ? 187.713 193.301 174.150 1.00 0.00 ? 888  ARG A NH2   1 
ATOM   6925  N  N     . LEU A  1  889  ? 189.773 190.553 168.135 1.00 0.00 ? 889  LEU A N     1 
ATOM   6926  C  CA    . LEU A  1  889  ? 190.743 191.504 167.615 1.00 0.00 ? 889  LEU A CA    1 
ATOM   6927  C  C     . LEU A  1  889  ? 191.060 191.207 166.167 1.00 0.00 ? 889  LEU A C     1 
ATOM   6928  O  O     . LEU A  1  889  ? 191.432 192.108 165.412 1.00 0.00 ? 889  LEU A O     1 
ATOM   6929  C  CB    . LEU A  1  889  ? 192.012 191.482 168.451 1.00 0.00 ? 889  LEU A CB    1 
ATOM   6930  C  CG    . LEU A  1  889  ? 193.079 192.427 167.925 1.00 0.00 ? 889  LEU A CG    1 
ATOM   6931  C  CD1   . LEU A  1  889  ? 192.522 193.832 167.888 1.00 0.00 ? 889  LEU A CD1   1 
ATOM   6932  C  CD2   . LEU A  1  889  ? 194.279 192.372 168.828 1.00 0.00 ? 889  LEU A CD2   1 
ATOM   6933  N  N     . MET A  1  890  ? 190.885 189.960 165.754 1.00 0.00 ? 890  MET A N     1 
ATOM   6934  C  CA    . MET A  1  890  ? 191.063 189.639 164.349 1.00 0.00 ? 890  MET A CA    1 
ATOM   6935  C  C     . MET A  1  890  ? 189.955 190.238 163.497 1.00 0.00 ? 890  MET A C     1 
ATOM   6936  O  O     . MET A  1  890  ? 190.224 190.928 162.512 1.00 0.00 ? 890  MET A O     1 
ATOM   6937  C  CB    . MET A  1  890  ? 191.097 188.138 164.172 1.00 0.00 ? 890  MET A CB    1 
ATOM   6938  C  CG    . MET A  1  890  ? 191.497 187.694 162.822 1.00 0.00 ? 890  MET A CG    1 
ATOM   6939  S  SD    . MET A  1  890  ? 191.567 185.952 163.085 1.00 0.00 ? 890  MET A SD    1 
ATOM   6940  C  CE    . MET A  1  890  ? 192.816 186.022 164.370 1.00 0.00 ? 890  MET A CE    1 
ATOM   6941  N  N     . LYS A  1  891  ? 188.699 189.984 163.865 1.00 0.00 ? 891  LYS A N     1 
ATOM   6942  C  CA    . LYS A  1  891  ? 187.601 190.135 162.914 1.00 0.00 ? 891  LYS A CA    1 
ATOM   6943  C  C     . LYS A  1  891  ? 187.574 191.501 162.255 1.00 0.00 ? 891  LYS A C     1 
ATOM   6944  O  O     . LYS A  1  891  ? 187.267 191.604 161.063 1.00 0.00 ? 891  LYS A O     1 
ATOM   6945  C  CB    . LYS A  1  891  ? 186.274 189.834 163.592 1.00 0.00 ? 891  LYS A CB    1 
ATOM   6946  C  CG    . LYS A  1  891  ? 186.138 188.371 163.850 1.00 0.00 ? 891  LYS A CG    1 
ATOM   6947  C  CD    . LYS A  1  891  ? 186.046 187.700 162.511 1.00 0.00 ? 891  LYS A CD    1 
ATOM   6948  C  CE    . LYS A  1  891  ? 185.988 186.216 162.628 1.00 0.00 ? 891  LYS A CE    1 
ATOM   6949  N  NZ    . LYS A  1  891  ? 184.778 185.780 163.365 1.00 0.00 ? 891  LYS A NZ    1 
ATOM   6950  N  N     . SER A  1  892  ? 187.912 192.552 162.983 1.00 0.00 ? 892  SER A N     1 
ATOM   6951  C  CA    . SER A  1  892  ? 188.099 193.844 162.351 1.00 0.00 ? 892  SER A CA    1 
ATOM   6952  C  C     . SER A  1  892  ? 189.393 193.910 161.565 1.00 0.00 ? 892  SER A C     1 
ATOM   6953  O  O     . SER A  1  892  ? 189.442 194.551 160.511 1.00 0.00 ? 892  SER A O     1 
ATOM   6954  C  CB    . SER A  1  892  ? 188.063 194.954 163.395 1.00 0.00 ? 892  SER A CB    1 
ATOM   6955  O  OG    . SER A  1  892  ? 188.354 196.203 162.802 1.00 0.00 ? 892  SER A OG    1 
ATOM   6956  N  N     . LEU A  1  893  ? 190.435 193.251 162.054 1.00 0.00 ? 893  LEU A N     1 
ATOM   6957  C  CA    . LEU A  1  893  ? 191.741 193.337 161.396 1.00 0.00 ? 893  LEU A CA    1 
ATOM   6958  C  C     . LEU A  1  893  ? 191.995 192.154 160.468 1.00 0.00 ? 893  LEU A C     1 
ATOM   6959  O  O     . LEU A  1  893  ? 193.066 192.088 159.858 1.00 0.00 ? 893  LEU A O     1 
ATOM   6960  C  CB    . LEU A  1  893  ? 192.808 193.445 162.482 1.00 0.00 ? 893  LEU A CB    1 
ATOM   6961  C  CG    . LEU A  1  893  ? 194.243 193.656 162.055 1.00 0.00 ? 893  LEU A CG    1 
ATOM   6962  C  CD1   . LEU A  1  893  ? 194.261 194.971 161.365 1.00 0.00 ? 893  LEU A CD1   1 
ATOM   6963  C  CD2   . LEU A  1  893  ? 195.144 193.666 163.254 1.00 0.00 ? 893  LEU A CD2   1 
ATOM   6964  N  N     . GLU A  1  894  ? 191.038 191.234 160.316 1.00 0.00 ? 894  GLU A N     1 
ATOM   6965  C  CA    . GLU A  1  894  ? 191.301 189.909 159.759 1.00 0.00 ? 894  GLU A CA    1 
ATOM   6966  C  C     . GLU A  1  894  ? 191.832 189.959 158.337 1.00 0.00 ? 894  GLU A C     1 
ATOM   6967  O  O     . GLU A  1  894  ? 192.864 189.351 158.044 1.00 0.00 ? 894  GLU A O     1 
ATOM   6968  C  CB    . GLU A  1  894  ? 190.036 189.060 159.809 1.00 0.00 ? 894  GLU A CB    1 
ATOM   6969  C  CG    . GLU A  1  894  ? 190.246 187.613 159.390 1.00 0.00 ? 894  GLU A CG    1 
ATOM   6970  C  CD    . GLU A  1  894  ? 189.002 186.770 159.597 1.00 0.00 ? 894  GLU A CD    1 
ATOM   6971  O  OE1   . GLU A  1  894  ? 187.964 187.329 160.006 1.00 0.00 ? 894  GLU A OE1   1 
ATOM   6972  O  OE2   . GLU A  1  894  ? 189.061 185.545 159.368 1.00 0.00 ? 894  GLU A OE2   1 
ATOM   6973  N  N     . ASP A  1  895  ? 191.145 190.637 157.430 1.00 0.00 ? 895  ASP A N     1 
ATOM   6974  C  CA    . ASP A  1  895  ? 191.682 190.763 156.080 1.00 0.00 ? 895  ASP A CA    1 
ATOM   6975  C  C     . ASP A  1  895  ? 192.259 192.158 155.940 1.00 0.00 ? 895  ASP A C     1 
ATOM   6976  O  O     . ASP A  1  895  ? 191.541 193.145 155.805 1.00 0.00 ? 895  ASP A O     1 
ATOM   6977  C  CB    . ASP A  1  895  ? 190.609 190.511 155.035 1.00 0.00 ? 895  ASP A CB    1 
ATOM   6978  C  CG    . ASP A  1  895  ? 191.164 190.519 153.633 1.00 0.00 ? 895  ASP A CG    1 
ATOM   6979  O  OD1   . ASP A  1  895  ? 192.402 190.612 153.488 1.00 0.00 ? 895  ASP A OD1   1 
ATOM   6980  O  OD2   . ASP A  1  895  ? 190.368 190.441 152.676 1.00 0.00 ? 895  ASP A OD2   1 
ATOM   6981  N  N     . LEU A  1  896  ? 193.580 192.240 155.979 1.00 0.00 ? 896  LEU A N     1 
ATOM   6982  C  CA    . LEU A  1  896  ? 194.260 193.475 155.632 1.00 0.00 ? 896  LEU A CA    1 
ATOM   6983  C  C     . LEU A  1  896  ? 195.512 193.065 154.881 1.00 0.00 ? 896  LEU A C     1 
ATOM   6984  O  O     . LEU A  1  896  ? 196.383 192.410 155.460 1.00 0.00 ? 896  LEU A O     1 
ATOM   6985  C  CB    . LEU A  1  896  ? 194.584 194.263 156.884 1.00 0.00 ? 896  LEU A CB    1 
ATOM   6986  C  CG    . LEU A  1  896  ? 195.032 195.686 156.658 1.00 0.00 ? 896  LEU A CG    1 
ATOM   6987  C  CD1   . LEU A  1  896  ? 193.850 196.425 156.106 1.00 0.00 ? 896  LEU A CD1   1 
ATOM   6988  C  CD2   . LEU A  1  896  ? 195.506 196.300 157.940 1.00 0.00 ? 896  LEU A CD2   1 
ATOM   6989  N  N     . SER A  1  897  ? 195.626 193.445 153.618 1.00 0.00 ? 897  SER A N     1 
ATOM   6990  C  CA    . SER A  1  897  ? 196.667 192.879 152.780 1.00 0.00 ? 897  SER A CA    1 
ATOM   6991  C  C     . SER A  1  897  ? 197.620 193.954 152.310 1.00 0.00 ? 897  SER A C     1 
ATOM   6992  O  O     . SER A  1  897  ? 197.247 195.114 152.140 1.00 0.00 ? 897  SER A O     1 
ATOM   6993  C  CB    . SER A  1  897  ? 196.087 192.180 151.565 1.00 0.00 ? 897  SER A CB    1 
ATOM   6994  O  OG    . SER A  1  897  ? 197.138 191.798 150.704 1.00 0.00 ? 897  SER A OG    1 
ATOM   6995  N  N     . CYS A  1  898  ? 198.855 193.548 152.057 1.00 0.00 ? 898  CYS A N     1 
ATOM   6996  C  CA    . CYS A  1  898  ? 199.830 194.411 151.415 1.00 0.00 ? 898  CYS A CA    1 
ATOM   6997  C  C     . CYS A  1  898  ? 199.816 194.142 149.921 1.00 0.00 ? 898  CYS A C     1 
ATOM   6998  O  O     . CYS A  1  898  ? 200.302 193.102 149.472 1.00 0.00 ? 898  CYS A O     1 
ATOM   6999  C  CB    . CYS A  1  898  ? 201.229 194.178 151.972 1.00 0.00 ? 898  CYS A CB    1 
ATOM   7000  S  SG    . CYS A  1  898  ? 202.482 195.199 151.181 1.00 0.00 ? 898  CYS A SG    1 
ATOM   7001  N  N     . GLN A  1  899  ? 199.305 195.098 149.160 1.00 0.00 ? 899  GLN A N     1 
ATOM   7002  C  CA    . GLN A  1  899  ? 199.232 194.986 147.717 1.00 0.00 ? 899  GLN A CA    1 
ATOM   7003  C  C     . GLN A  1  899  ? 200.608 195.233 147.122 1.00 0.00 ? 899  GLN A C     1 
ATOM   7004  O  O     . GLN A  1  899  ? 201.608 195.334 147.833 1.00 0.00 ? 899  GLN A O     1 
ATOM   7005  C  CB    . GLN A  1  899  ? 198.212 195.968 147.160 1.00 0.00 ? 899  GLN A CB    1 
ATOM   7006  C  CG    . GLN A  1  899  ? 196.824 195.724 147.666 1.00 0.00 ? 899  GLN A CG    1 
ATOM   7007  C  CD    . GLN A  1  899  ? 196.306 194.366 147.270 1.00 0.00 ? 899  GLN A CD    1 
ATOM   7008  O  OE1   . GLN A  1  899  ? 196.348 193.422 148.051 1.00 0.00 ? 899  GLN A OE1   1 
ATOM   7009  N  NE2   . GLN A  1  899  ? 195.804 194.260 146.052 1.00 0.00 ? 899  GLN A NE2   1 
ATOM   7010  N  N     . TYR A  1  900  ? 200.668 195.339 145.802 1.00 0.00 ? 900  TYR A N     1 
ATOM   7011  C  CA    . TYR A  1  900  ? 201.955 195.518 145.154 1.00 0.00 ? 900  TYR A CA    1 
ATOM   7012  C  C     . TYR A  1  900  ? 202.370 196.973 145.041 1.00 0.00 ? 900  TYR A C     1 
ATOM   7013  O  O     . TYR A  1  900  ? 203.418 197.260 144.459 1.00 0.00 ? 900  TYR A O     1 
ATOM   7014  C  CB    . TYR A  1  900  ? 201.935 194.875 143.781 1.00 0.00 ? 900  TYR A CB    1 
ATOM   7015  C  CG    . TYR A  1  900  ? 201.872 193.384 143.869 1.00 0.00 ? 900  TYR A CG    1 
ATOM   7016  C  CD1   . TYR A  1  900  ? 200.666 192.734 143.964 1.00 0.00 ? 900  TYR A CD1   1 
ATOM   7017  C  CD2   . TYR A  1  900  ? 203.023 192.627 143.893 1.00 0.00 ? 900  TYR A CD2   1 
ATOM   7018  C  CE1   . TYR A  1  900  ? 200.605 191.373 144.054 1.00 0.00 ? 900  TYR A CE1   1 
ATOM   7019  C  CE2   . TYR A  1  900  ? 202.971 191.262 143.981 1.00 0.00 ? 900  TYR A CE2   1 
ATOM   7020  C  CZ    . TYR A  1  900  ? 201.759 190.642 144.063 1.00 0.00 ? 900  TYR A CZ    1 
ATOM   7021  O  OH    . TYR A  1  900  ? 201.694 189.276 144.158 1.00 0.00 ? 900  TYR A OH    1 
ATOM   7022  N  N     . ASP A  1  901  ? 201.583 197.894 145.578 1.00 0.00 ? 901  ASP A N     1 
ATOM   7023  C  CA    . ASP A  1  901  ? 202.004 199.278 145.710 1.00 0.00 ? 901  ASP A CA    1 
ATOM   7024  C  C     . ASP A  1  901  ? 202.708 199.534 147.023 1.00 0.00 ? 901  ASP A C     1 
ATOM   7025  O  O     . ASP A  1  901  ? 203.051 200.681 147.321 1.00 0.00 ? 901  ASP A O     1 
ATOM   7026  C  CB    . ASP A  1  901  ? 200.803 200.209 145.588 1.00 0.00 ? 901  ASP A CB    1 
ATOM   7027  C  CG    . ASP A  1  901  ? 200.259 200.256 144.194 1.00 0.00 ? 901  ASP A CG    1 
ATOM   7028  O  OD1   . ASP A  1  901  ? 200.981 199.824 143.276 1.00 0.00 ? 901  ASP A OD1   1 
ATOM   7029  O  OD2   . ASP A  1  901  ? 199.113 200.713 144.013 1.00 0.00 ? 901  ASP A OD2   1 
ATOM   7030  N  N     . ASN A  1  902  ? 202.914 198.494 147.822 1.00 0.00 ? 902  ASN A N     1 
ATOM   7031  C  CA    . ASN A  1  902  ? 203.279 198.651 149.221 1.00 0.00 ? 902  ASN A CA    1 
ATOM   7032  C  C     . ASN A  1  902  ? 202.266 199.512 149.956 1.00 0.00 ? 902  ASN A C     1 
ATOM   7033  O  O     . ASN A  1  902  ? 202.606 200.186 150.928 1.00 0.00 ? 902  ASN A O     1 
ATOM   7034  C  CB    . ASN A  1  902  ? 204.680 199.234 149.380 1.00 0.00 ? 902  ASN A CB    1 
ATOM   7035  C  CG    . ASN A  1  902  ? 205.747 198.271 148.958 1.00 0.00 ? 902  ASN A CG    1 
ATOM   7036  O  OD1   . ASN A  1  902  ? 205.529 197.064 148.939 1.00 0.00 ? 902  ASN A OD1   1 
ATOM   7037  N  ND2   . ASN A  1  902  ? 206.914 198.792 148.613 1.00 0.00 ? 902  ASN A ND2   1 
ATOM   7038  N  N     . THR A  1  903  ? 201.019 199.503 149.502 1.00 0.00 ? 903  THR A N     1 
ATOM   7039  C  CA    . THR A  1  903  ? 199.941 200.213 150.166 1.00 0.00 ? 903  THR A CA    1 
ATOM   7040  C  C     . THR A  1  903  ? 198.969 199.197 150.728 1.00 0.00 ? 903  THR A C     1 
ATOM   7041  O  O     . THR A  1  903  ? 198.221 198.567 149.980 1.00 0.00 ? 903  THR A O     1 
ATOM   7042  C  CB    . THR A  1  903  ? 199.204 201.127 149.209 1.00 0.00 ? 903  THR A CB    1 
ATOM   7043  O  OG1   . THR A  1  903  ? 198.615 200.341 148.168 1.00 0.00 ? 903  THR A OG1   1 
ATOM   7044  C  CG2   . THR A  1  903  ? 200.166 202.107 148.585 1.00 0.00 ? 903  THR A CG2   1 
ATOM   7045  N  N     . VAL A  1  904  ? 198.966 199.050 152.043 1.00 0.00 ? 904  VAL A N     1 
ATOM   7046  C  CA    . VAL A  1  904  ? 198.201 198.000 152.694 1.00 0.00 ? 904  VAL A CA    1 
ATOM   7047  C  C     . VAL A  1  904  ? 196.734 198.392 152.672 1.00 0.00 ? 904  VAL A C     1 
ATOM   7048  O  O     . VAL A  1  904  ? 196.375 199.509 153.055 1.00 0.00 ? 904  VAL A O     1 
ATOM   7049  C  CB    . VAL A  1  904  ? 198.713 197.743 154.119 1.00 0.00 ? 904  VAL A CB    1 
ATOM   7050  C  CG1   . VAL A  1  904  ? 198.605 198.967 154.950 1.00 0.00 ? 904  VAL A CG1   1 
ATOM   7051  C  CG2   . VAL A  1  904  ? 197.967 196.602 154.747 1.00 0.00 ? 904  VAL A CG2   1 
ATOM   7052  N  N     . ARG A  1  905  ? 195.886 197.491 152.192 1.00 0.00 ? 905  ARG A N     1 
ATOM   7053  C  CA    . ARG A  1  905  ? 194.520 197.854 151.864 1.00 0.00 ? 905  ARG A CA    1 
ATOM   7054  C  C     . ARG A  1  905  ? 193.545 196.817 152.386 1.00 0.00 ? 905  ARG A C     1 
ATOM   7055  O  O     . ARG A  1  905  ? 193.924 195.716 152.783 1.00 0.00 ? 905  ARG A O     1 
ATOM   7056  C  CB    . ARG A  1  905  ? 194.333 198.013 150.360 1.00 0.00 ? 905  ARG A CB    1 
ATOM   7057  C  CG    . ARG A  1  905  ? 195.180 199.099 149.772 1.00 0.00 ? 905  ARG A CG    1 
ATOM   7058  C  CD    . ARG A  1  905  ? 194.737 199.476 148.393 1.00 0.00 ? 905  ARG A CD    1 
ATOM   7059  N  NE    . ARG A  1  905  ? 195.701 200.380 147.793 1.00 0.00 ? 905  ARG A NE    1 
ATOM   7060  C  CZ    . ARG A  1  905  ? 195.536 200.948 146.614 1.00 0.00 ? 905  ARG A CZ    1 
ATOM   7061  N  NH1   . ARG A  1  905  ? 194.415 200.754 145.945 1.00 0.00 ? 905  ARG A NH1   1 
ATOM   7062  N  NH2   . ARG A  1  905  ? 196.474 201.746 146.135 1.00 0.00 ? 905  ARG A NH2   1 
ATOM   7063  N  N     . THR A  1  906  ? 192.270 197.183 152.362 1.00 0.00 ? 906  THR A N     1 
ATOM   7064  C  CA    . THR A  1  906  ? 191.229 196.364 152.964 1.00 0.00 ? 906  THR A CA    1 
ATOM   7065  C  C     . THR A  1  906  ? 190.770 195.251 152.043 1.00 0.00 ? 906  THR A C     1 
ATOM   7066  O  O     . THR A  1  906  ? 191.377 194.994 151.000 1.00 0.00 ? 906  THR A O     1 
ATOM   7067  C  CB    . THR A  1  906  ? 190.013 197.207 153.318 1.00 0.00 ? 906  THR A CB    1 
ATOM   7068  O  OG1   . THR A  1  906  ? 189.522 197.834 152.129 1.00 0.00 ? 906  THR A OG1   1 
ATOM   7069  C  CG2   . THR A  1  906  ? 190.368 198.264 154.333 1.00 0.00 ? 906  THR A CG2   1 
ATOM   7070  N  N     . SER A  1  907  ? 189.685 194.594 152.439 1.00 0.00 ? 907  SER A N     1 
ATOM   7071  C  CA    . SER A  1  907  ? 188.994 193.626 151.608 1.00 0.00 ? 907  SER A CA    1 
ATOM   7072  C  C     . SER A  1  907  ? 188.365 194.318 150.412 1.00 0.00 ? 907  SER A C     1 
ATOM   7073  O  O     . SER A  1  907  ? 188.497 193.861 149.272 1.00 0.00 ? 907  SER A O     1 
ATOM   7074  C  CB    . SER A  1  907  ? 187.913 192.919 152.431 1.00 0.00 ? 907  SER A CB    1 
ATOM   7075  O  OG    . SER A  1  907  ? 187.166 192.028 151.622 1.00 0.00 ? 907  SER A OG    1 
ATOM   7076  N  N     . ALA A  1  908  ? 187.696 195.437 150.672 1.00 0.00 ? 908  ALA A N     1 
ATOM   7077  C  CA    . ALA A  1  908  ? 186.870 196.118 149.676 1.00 0.00 ? 908  ALA A CA    1 
ATOM   7078  C  C     . ALA A  1  908  ? 187.732 197.028 148.802 1.00 0.00 ? 908  ALA A C     1 
ATOM   7079  O  O     . ALA A  1  908  ? 187.250 197.804 147.981 1.00 0.00 ? 908  ALA A O     1 
ATOM   7080  C  CB    . ALA A  1  908  ? 185.752 196.896 150.355 1.00 0.00 ? 908  ALA A CB    1 
ATOM   7081  N  N     . ASN A  1  909  ? 189.038 196.933 149.031 1.00 0.00 ? 909  ASN A N     1 
ATOM   7082  C  CA    . ASN A  1  909  ? 190.026 197.715 148.296 1.00 0.00 ? 909  ASN A CA    1 
ATOM   7083  C  C     . ASN A  1  909  ? 189.897 199.196 148.639 1.00 0.00 ? 909  ASN A C     1 
ATOM   7084  O  O     . ASN A  1  909  ? 189.960 200.069 147.774 1.00 0.00 ? 909  ASN A O     1 
ATOM   7085  C  CB    . ASN A  1  909  ? 189.915 197.473 146.789 1.00 0.00 ? 909  ASN A CB    1 
ATOM   7086  C  CG    . ASN A  1  909  ? 191.110 197.977 146.021 1.00 0.00 ? 909  ASN A CG    1 
ATOM   7087  O  OD1   . ASN A  1  909  ? 191.864 198.827 146.488 1.00 0.00 ? 909  ASN A OD1   1 
ATOM   7088  N  ND2   . ASN A  1  909  ? 191.300 197.433 144.826 1.00 0.00 ? 909  ASN A ND2   1 
ATOM   7089  N  N     . GLY A  1  910  ? 189.669 199.479 149.917 1.00 0.00 ? 910  GLY A N     1 
ATOM   7090  C  CA    . GLY A  1  910  ? 189.912 200.809 150.430 1.00 0.00 ? 910  GLY A CA    1 
ATOM   7091  C  C     . GLY A  1  910  ? 191.383 200.914 150.758 1.00 0.00 ? 910  GLY A C     1 
ATOM   7092  O  O     . GLY A  1  910  ? 192.153 200.037 150.369 1.00 0.00 ? 910  GLY A O     1 
ATOM   7093  N  N     . ILE A  1  911  ? 191.806 201.957 151.451 1.00 0.00 ? 911  ILE A N     1 
ATOM   7094  C  CA    . ILE A  1  911  ? 193.202 202.045 151.853 1.00 0.00 ? 911  ILE A CA    1 
ATOM   7095  C  C     . ILE A  1  911  ? 193.292 202.490 153.304 1.00 0.00 ? 911  ILE A C     1 
ATOM   7096  O  O     . ILE A  1  911  ? 192.857 203.588 153.665 1.00 0.00 ? 911  ILE A O     1 
ATOM   7097  C  CB    . ILE A  1  911  ? 193.977 202.984 150.924 1.00 0.00 ? 911  ILE A CB    1 
ATOM   7098  C  CG1   . ILE A  1  911  ? 195.427 203.046 151.352 1.00 0.00 ? 911  ILE A CG1   1 
ATOM   7099  C  CG2   . ILE A  1  911  ? 193.407 204.367 150.929 1.00 0.00 ? 911  ILE A CG2   1 
ATOM   7100  C  CD1   . ILE A  1  911  ? 196.298 203.722 150.349 1.00 0.00 ? 911  ILE A CD1   1 
ATOM   7101  N  N     . VAL A  1  912  ? 193.831 201.622 154.152 1.00 0.00 ? 912  VAL A N     1 
ATOM   7102  C  CA    . VAL A  1  912  ? 194.041 201.988 155.542 1.00 0.00 ? 912  VAL A CA    1 
ATOM   7103  C  C     . VAL A  1  912  ? 195.357 202.721 155.743 1.00 0.00 ? 912  VAL A C     1 
ATOM   7104  O  O     . VAL A  1  912  ? 195.514 203.435 156.733 1.00 0.00 ? 912  VAL A O     1 
ATOM   7105  C  CB    . VAL A  1  912  ? 193.978 200.756 156.445 1.00 0.00 ? 912  VAL A CB    1 
ATOM   7106  C  CG1   . VAL A  1  912  ? 192.614 200.139 156.390 1.00 0.00 ? 912  VAL A CG1   1 
ATOM   7107  C  CG2   . VAL A  1  912  ? 195.021 199.777 156.018 1.00 0.00 ? 912  VAL A CG2   1 
ATOM   7108  N  N     . GLN A  1  913  ? 196.316 202.552 154.842 1.00 0.00 ? 913  GLN A N     1 
ATOM   7109  C  CA    . GLN A  1  913  ? 197.630 203.120 155.085 1.00 0.00 ? 913  GLN A CA    1 
ATOM   7110  C  C     . GLN A  1  913  ? 198.353 203.215 153.755 1.00 0.00 ? 913  GLN A C     1 
ATOM   7111  O  O     . GLN A  1  913  ? 198.045 202.460 152.836 1.00 0.00 ? 913  GLN A O     1 
ATOM   7112  C  CB    . GLN A  1  913  ? 198.379 202.240 156.075 1.00 0.00 ? 913  GLN A CB    1 
ATOM   7113  C  CG    . GLN A  1  913  ? 199.588 202.833 156.695 1.00 0.00 ? 913  GLN A CG    1 
ATOM   7114  C  CD    . GLN A  1  913  ? 200.062 201.989 157.853 1.00 0.00 ? 913  GLN A CD    1 
ATOM   7115  O  OE1   . GLN A  1  913  ? 199.393 201.041 158.249 1.00 0.00 ? 913  GLN A OE1   1 
ATOM   7116  N  NE2   . GLN A  1  913  ? 201.213 202.325 158.401 1.00 0.00 ? 913  GLN A NE2   1 
ATOM   7117  N  N     . PHE A  1  914  ? 199.326 204.114 153.657 1.00 0.00 ? 914  PHE A N     1 
ATOM   7118  C  CA    . PHE A  1  914  ? 199.957 204.308 152.359 1.00 0.00 ? 914  PHE A CA    1 
ATOM   7119  C  C     . PHE A  1  914  ? 201.240 203.511 152.246 1.00 0.00 ? 914  PHE A C     1 
ATOM   7120  O  O     . PHE A  1  914  ? 201.308 202.562 151.467 1.00 0.00 ? 914  PHE A O     1 
ATOM   7121  C  CB    . PHE A  1  914  ? 200.191 205.783 152.097 1.00 0.00 ? 914  PHE A CB    1 
ATOM   7122  C  CG    . PHE A  1  914  ? 198.933 206.528 151.832 1.00 0.00 ? 914  PHE A CG    1 
ATOM   7123  C  CD1   . PHE A  1  914  ? 198.389 206.544 150.566 1.00 0.00 ? 914  PHE A CD1   1 
ATOM   7124  C  CD2   . PHE A  1  914  ? 198.273 207.180 152.846 1.00 0.00 ? 914  PHE A CD2   1 
ATOM   7125  C  CE1   . PHE A  1  914  ? 197.225 207.217 150.310 1.00 0.00 ? 914  PHE A CE1   1 
ATOM   7126  C  CE2   . PHE A  1  914  ? 197.104 207.859 152.596 1.00 0.00 ? 914  PHE A CE2   1 
ATOM   7127  C  CZ    . PHE A  1  914  ? 196.581 207.878 151.325 1.00 0.00 ? 914  PHE A CZ    1 
ATOM   7128  N  N     . THR A  1  915  ? 202.263 203.871 152.997 1.00 0.00 ? 915  THR A N     1 
ATOM   7129  C  CA    . THR A  1  915  ? 203.360 202.942 153.181 1.00 0.00 ? 915  THR A CA    1 
ATOM   7130  C  C     . THR A  1  915  ? 203.037 202.065 154.372 1.00 0.00 ? 915  THR A C     1 
ATOM   7131  O  O     . THR A  1  915  ? 201.960 202.177 154.957 1.00 0.00 ? 915  THR A O     1 
ATOM   7132  C  CB    . THR A  1  915  ? 204.671 203.677 153.402 1.00 0.00 ? 915  THR A CB    1 
ATOM   7133  O  OG1   . THR A  1  915  ? 205.732 202.723 153.517 1.00 0.00 ? 915  THR A OG1   1 
ATOM   7134  C  CG2   . THR A  1  915  ? 204.586 204.496 154.656 1.00 0.00 ? 915  THR A CG2   1 
ATOM   7135  N  N     . TYR A  1  916  ? 203.961 201.193 154.738 1.00 0.00 ? 916  TYR A N     1 
ATOM   7136  C  CA    . TYR A  1  916  ? 203.732 200.371 155.919 1.00 0.00 ? 916  TYR A CA    1 
ATOM   7137  C  C     . TYR A  1  916  ? 204.495 200.963 157.088 1.00 0.00 ? 916  TYR A C     1 
ATOM   7138  O  O     . TYR A  1  916  ? 205.723 201.051 157.062 1.00 0.00 ? 916  TYR A O     1 
ATOM   7139  C  CB    . TYR A  1  916  ? 204.150 198.933 155.674 1.00 0.00 ? 916  TYR A CB    1 
ATOM   7140  C  CG    . TYR A  1  916  ? 204.010 198.095 156.910 1.00 0.00 ? 916  TYR A CG    1 
ATOM   7141  C  CD1   . TYR A  1  916  ? 202.780 197.672 157.333 1.00 0.00 ? 916  TYR A CD1   1 
ATOM   7142  C  CD2   . TYR A  1  916  ? 205.106 197.735 157.656 1.00 0.00 ? 916  TYR A CD2   1 
ATOM   7143  C  CE1   . TYR A  1  916  ? 202.644 196.915 158.461 1.00 0.00 ? 916  TYR A CE1   1 
ATOM   7144  C  CE2   . TYR A  1  916  ? 204.976 196.975 158.789 1.00 0.00 ? 916  TYR A CE2   1 
ATOM   7145  C  CZ    . TYR A  1  916  ? 203.742 196.564 159.186 1.00 0.00 ? 916  TYR A CZ    1 
ATOM   7146  O  OH    . TYR A  1  916  ? 203.604 195.803 160.319 1.00 0.00 ? 916  TYR A OH    1 
ATOM   7147  N  N     . GLY A  1  917  ? 203.765 201.369 158.120 1.00 0.00 ? 917  GLY A N     1 
ATOM   7148  C  CA    . GLY A  1  917  ? 204.370 201.941 159.304 1.00 0.00 ? 917  GLY A CA    1 
ATOM   7149  C  C     . GLY A  1  917  ? 205.391 203.012 159.027 1.00 0.00 ? 917  GLY A C     1 
ATOM   7150  O  O     . GLY A  1  917  ? 206.423 203.057 159.695 1.00 0.00 ? 917  GLY A O     1 
ATOM   7151  N  N     . GLY A  1  918  ? 205.146 203.865 158.039 1.00 0.00 ? 918  GLY A N     1 
ATOM   7152  C  CA    . GLY A  1  918  ? 206.139 204.847 157.653 1.00 0.00 ? 918  GLY A CA    1 
ATOM   7153  C  C     . GLY A  1  918  ? 207.421 204.238 157.150 1.00 0.00 ? 918  GLY A C     1 
ATOM   7154  O  O     . GLY A  1  918  ? 208.429 204.935 157.021 1.00 0.00 ? 918  GLY A O     1 
ATOM   7155  N  N     . ASP A  1  919  ? 207.409 202.947 156.856 1.00 0.00 ? 919  ASP A N     1 
ATOM   7156  C  CA    . ASP A  1  919  ? 208.653 202.225 156.677 1.00 0.00 ? 919  ASP A CA    1 
ATOM   7157  C  C     . ASP A  1  919  ? 208.627 201.416 155.395 1.00 0.00 ? 919  ASP A C     1 
ATOM   7158  O  O     . ASP A  1  919  ? 209.415 201.652 154.476 1.00 0.00 ? 919  ASP A O     1 
ATOM   7159  C  CB    . ASP A  1  919  ? 208.881 201.313 157.874 1.00 0.00 ? 919  ASP A CB    1 
ATOM   7160  C  CG    . ASP A  1  919  ? 210.237 200.676 157.864 1.00 0.00 ? 919  ASP A CG    1 
ATOM   7161  O  OD1   . ASP A  1  919  ? 211.065 201.048 157.011 1.00 0.00 ? 919  ASP A OD1   1 
ATOM   7162  O  OD2   . ASP A  1  919  ? 210.469 199.799 158.717 1.00 0.00 ? 919  ASP A OD2   1 
ATOM   7163  N  N     . GLY A  1  920  ? 207.724 200.445 155.340 1.00 0.00 ? 920  GLY A N     1 
ATOM   7164  C  CA    . GLY A  1  920  ? 207.697 199.520 154.230 1.00 0.00 ? 920  GLY A CA    1 
ATOM   7165  C  C     . GLY A  1  920  ? 208.488 198.267 154.495 1.00 0.00 ? 920  GLY A C     1 
ATOM   7166  O  O     . GLY A  1  920  ? 208.711 197.477 153.577 1.00 0.00 ? 920  GLY A O     1 
ATOM   7167  N  N     . LEU A  1  921  ? 208.904 198.056 155.735 1.00 0.00 ? 921  LEU A N     1 
ATOM   7168  C  CA    . LEU A  1  921  ? 209.810 196.981 156.098 1.00 0.00 ? 921  LEU A CA    1 
ATOM   7169  C  C     . LEU A  1  921  ? 209.117 195.982 157.010 1.00 0.00 ? 921  LEU A C     1 
ATOM   7170  O  O     . LEU A  1  921  ? 208.637 196.320 158.094 1.00 0.00 ? 921  LEU A O     1 
ATOM   7171  C  CB    . LEU A  1  921  ? 211.054 197.548 156.780 1.00 0.00 ? 921  LEU A CB    1 
ATOM   7172  C  CG    . LEU A  1  921  ? 212.181 198.005 155.859 1.00 0.00 ? 921  LEU A CG    1 
ATOM   7173  C  CD1   . LEU A  1  921  ? 211.724 199.027 154.846 1.00 0.00 ? 921  LEU A CD1   1 
ATOM   7174  C  CD2   . LEU A  1  921  ? 213.265 198.620 156.696 1.00 0.00 ? 921  LEU A CD2   1 
ATOM   7175  N  N     . ASP A  1  922  ? 209.073 194.735 156.549 1.00 0.00 ? 922  ASP A N     1 
ATOM   7176  C  CA    . ASP A  1  922  ? 208.445 193.644 157.289 1.00 0.00 ? 922  ASP A CA    1 
ATOM   7177  C  C     . ASP A  1  922  ? 209.116 193.494 158.645 1.00 0.00 ? 922  ASP A C     1 
ATOM   7178  O  O     . ASP A  1  922  ? 210.329 193.263 158.700 1.00 0.00 ? 922  ASP A O     1 
ATOM   7179  C  CB    . ASP A  1  922  ? 208.561 192.350 156.491 1.00 0.00 ? 922  ASP A CB    1 
ATOM   7180  C  CG    . ASP A  1  922  ? 207.854 191.178 157.146 1.00 0.00 ? 922  ASP A CG    1 
ATOM   7181  O  OD1   . ASP A  1  922  ? 207.341 191.324 158.267 1.00 0.00 ? 922  ASP A OD1   1 
ATOM   7182  O  OD2   . ASP A  1  922  ? 207.798 190.099 156.517 1.00 0.00 ? 922  ASP A OD2   1 
ATOM   7183  N  N     . PRO A  1  923  ? 208.381 193.601 159.752 1.00 0.00 ? 923  PRO A N     1 
ATOM   7184  C  CA    . PRO A  1  923  ? 209.019 193.478 161.071 1.00 0.00 ? 923  PRO A CA    1 
ATOM   7185  C  C     . PRO A  1  923  ? 209.712 192.153 161.279 1.00 0.00 ? 923  PRO A C     1 
ATOM   7186  O  O     . PRO A  1  923  ? 210.641 192.096 162.095 1.00 0.00 ? 923  PRO A O     1 
ATOM   7187  C  CB    . PRO A  1  923  ? 207.852 193.644 162.045 1.00 0.00 ? 923  PRO A CB    1 
ATOM   7188  C  CG    . PRO A  1  923  ? 206.674 193.226 161.267 1.00 0.00 ? 923  PRO A CG    1 
ATOM   7189  C  CD    . PRO A  1  923  ? 206.926 193.770 159.891 1.00 0.00 ? 923  PRO A CD    1 
ATOM   7190  N  N     . LEU A  1  924  ? 209.297 191.099 160.587 1.00 0.00 ? 924  LEU A N     1 
ATOM   7191  C  CA    . LEU A  1  924  ? 209.907 189.793 160.812 1.00 0.00 ? 924  LEU A CA    1 
ATOM   7192  C  C     . LEU A  1  924  ? 211.404 189.814 160.549 1.00 0.00 ? 924  LEU A C     1 
ATOM   7193  O  O     . LEU A  1  924  ? 212.193 189.721 161.490 1.00 0.00 ? 924  LEU A O     1 
ATOM   7194  C  CB    . LEU A  1  924  ? 209.230 188.733 159.953 1.00 0.00 ? 924  LEU A CB    1 
ATOM   7195  C  CG    . LEU A  1  924  ? 209.709 187.314 160.240 1.00 0.00 ? 924  LEU A CG    1 
ATOM   7196  C  CD1   . LEU A  1  924  ? 208.554 186.371 160.126 1.00 0.00 ? 924  LEU A CD1   1 
ATOM   7197  C  CD2   . LEU A  1  924  ? 210.783 186.892 159.264 1.00 0.00 ? 924  LEU A CD2   1 
ATOM   7198  N  N     . GLU A  1  925  ? 211.820 189.959 159.299 1.00 0.00 ? 925  GLU A N     1 
ATOM   7199  C  CA    . GLU A  1  925  ? 213.231 189.787 158.985 1.00 0.00 ? 925  GLU A CA    1 
ATOM   7200  C  C     . GLU A  1  925  ? 214.016 191.050 159.296 1.00 0.00 ? 925  GLU A C     1 
ATOM   7201  O  O     . GLU A  1  925  ? 215.227 191.107 159.074 1.00 0.00 ? 925  GLU A O     1 
ATOM   7202  C  CB    . GLU A  1  925  ? 213.397 189.382 157.526 1.00 0.00 ? 925  GLU A CB    1 
ATOM   7203  C  CG    . GLU A  1  925  ? 212.830 190.381 156.560 1.00 0.00 ? 925  GLU A CG    1 
ATOM   7204  C  CD    . GLU A  1  925  ? 212.807 189.860 155.143 1.00 0.00 ? 925  GLU A CD    1 
ATOM   7205  O  OE1   . GLU A  1  925  ? 213.513 188.870 154.854 1.00 0.00 ? 925  GLU A OE1   1 
ATOM   7206  O  OE2   . GLU A  1  925  ? 212.068 190.435 154.322 1.00 0.00 ? 925  GLU A OE2   1 
ATOM   7207  N  N     . MET A  1  926  ? 213.335 192.066 159.801 1.00 0.00 ? 926  MET A N     1 
ATOM   7208  C  CA    . MET A  1  926  ? 213.984 193.248 160.333 1.00 0.00 ? 926  MET A CA    1 
ATOM   7209  C  C     . MET A  1  926  ? 214.877 192.860 161.501 1.00 0.00 ? 926  MET A C     1 
ATOM   7210  O  O     . MET A  1  926  ? 214.431 192.219 162.454 1.00 0.00 ? 926  MET A O     1 
ATOM   7211  C  CB    . MET A  1  926  ? 212.948 194.274 160.769 1.00 0.00 ? 926  MET A CB    1 
ATOM   7212  C  CG    . MET A  1  926  ? 213.510 195.499 161.429 1.00 0.00 ? 926  MET A CG    1 
ATOM   7213  S  SD    . MET A  1  926  ? 212.168 196.662 161.694 1.00 0.00 ? 926  MET A SD    1 
ATOM   7214  C  CE    . MET A  1  926  ? 211.241 195.792 162.951 1.00 0.00 ? 926  MET A CE    1 
ATOM   7215  N  N     . GLU A  1  927  ? 216.142 193.260 161.425 1.00 0.00 ? 927  GLU A N     1 
ATOM   7216  C  CA    . GLU A  1  927  ? 217.131 192.832 162.405 1.00 0.00 ? 927  GLU A CA    1 
ATOM   7217  C  C     . GLU A  1  927  ? 217.142 193.822 163.566 1.00 0.00 ? 927  GLU A C     1 
ATOM   7218  O  O     . GLU A  1  927  ? 216.247 194.664 163.657 1.00 0.00 ? 927  GLU A O     1 
ATOM   7219  C  CB    . GLU A  1  927  ? 218.496 192.677 161.729 1.00 0.00 ? 927  GLU A CB    1 
ATOM   7220  C  CG    . GLU A  1  927  ? 219.553 191.959 162.549 1.00 0.00 ? 927  GLU A CG    1 
ATOM   7221  C  CD    . GLU A  1  927  ? 220.781 191.611 161.740 1.00 0.00 ? 927  GLU A CD    1 
ATOM   7222  O  OE1   . GLU A  1  927  ? 220.797 191.906 160.528 1.00 0.00 ? 927  GLU A OE1   1 
ATOM   7223  O  OE2   . GLU A  1  927  ? 221.732 191.041 162.318 1.00 0.00 ? 927  GLU A OE2   1 
ATOM   7224  N  N     . GLY A  1  928  ? 218.141 193.746 164.441 1.00 0.00 ? 928  GLY A N     1 
ATOM   7225  C  CA    . GLY A  1  928  ? 218.095 194.358 165.757 1.00 0.00 ? 928  GLY A CA    1 
ATOM   7226  C  C     . GLY A  1  928  ? 217.642 195.799 165.881 1.00 0.00 ? 928  GLY A C     1 
ATOM   7227  O  O     . GLY A  1  928  ? 217.981 196.652 165.058 1.00 0.00 ? 928  GLY A O     1 
ATOM   7228  N  N     . ASN A  1  929  ? 216.847 196.059 166.921 1.00 0.00 ? 929  ASN A N     1 
ATOM   7229  C  CA    . ASN A  1  929  ? 216.397 197.398 167.309 1.00 0.00 ? 929  ASN A CA    1 
ATOM   7230  C  C     . ASN A  1  929  ? 215.528 198.062 166.251 1.00 0.00 ? 929  ASN A C     1 
ATOM   7231  O  O     . ASN A  1  929  ? 215.380 199.284 166.240 1.00 0.00 ? 929  ASN A O     1 
ATOM   7232  C  CB    . ASN A  1  929  ? 217.580 198.302 167.649 1.00 0.00 ? 929  ASN A CB    1 
ATOM   7233  C  CG    . ASN A  1  929  ? 218.254 197.901 168.930 1.00 0.00 ? 929  ASN A CG    1 
ATOM   7234  O  OD1   . ASN A  1  929  ? 217.646 197.257 169.782 1.00 0.00 ? 929  ASN A OD1   1 
ATOM   7235  N  ND2   . ASN A  1  929  ? 219.516 198.275 169.080 1.00 0.00 ? 929  ASN A ND2   1 
ATOM   7236  N  N     . ALA A  1  930  ? 214.921 197.266 165.378 1.00 0.00 ? 930  ALA A N     1 
ATOM   7237  C  CA    . ALA A  1  930  ? 213.941 197.738 164.406 1.00 0.00 ? 930  ALA A CA    1 
ATOM   7238  C  C     . ALA A  1  930  ? 214.519 198.715 163.383 1.00 0.00 ? 930  ALA A C     1 
ATOM   7239  O  O     . ALA A  1  930  ? 213.790 199.553 162.851 1.00 0.00 ? 930  ALA A O     1 
ATOM   7240  C  CB    . ALA A  1  930  ? 212.729 198.365 165.103 1.00 0.00 ? 930  ALA A CB    1 
ATOM   7241  N  N     . GLN A  1  931  ? 215.814 198.641 163.086 1.00 0.00 ? 931  GLN A N     1 
ATOM   7242  C  CA    . GLN A  1  931  ? 216.382 199.296 161.909 1.00 0.00 ? 931  GLN A CA    1 
ATOM   7243  C  C     . GLN A  1  931  ? 217.243 198.245 161.230 1.00 0.00 ? 931  GLN A C     1 
ATOM   7244  O  O     . GLN A  1  931  ? 218.431 198.103 161.577 1.00 0.00 ? 931  GLN A O     1 
ATOM   7245  C  CB    . GLN A  1  931  ? 217.206 200.539 162.232 1.00 0.00 ? 931  GLN A CB    1 
ATOM   7246  C  CG    . GLN A  1  931  ? 216.428 201.618 162.923 1.00 0.00 ? 931  GLN A CG    1 
ATOM   7247  C  CD    . GLN A  1  931  ? 216.488 201.461 164.417 1.00 0.00 ? 931  GLN A CD    1 
ATOM   7248  O  OE1   . GLN A  1  931  ? 217.208 200.604 164.925 1.00 0.00 ? 931  GLN A OE1   1 
ATOM   7249  N  NE2   . GLN A  1  931  ? 215.722 202.272 165.135 1.00 0.00 ? 931  GLN A NE2   1 
ATOM   7250  N  N     . PRO A  1  932  ? 216.728 197.525 160.300 1.00 0.00 ? 932  PRO A N     1 
ATOM   7251  C  CA    . PRO A  1  932  ? 217.273 196.215 159.924 1.00 0.00 ? 932  PRO A CA    1 
ATOM   7252  C  C     . PRO A  1  932  ? 218.676 196.248 159.329 1.00 0.00 ? 932  PRO A C     1 
ATOM   7253  O  O     . PRO A  1  932  ? 218.891 195.879 158.177 1.00 0.00 ? 932  PRO A O     1 
ATOM   7254  C  CB    . PRO A  1  932  ? 216.257 195.717 158.894 1.00 0.00 ? 932  PRO A CB    1 
ATOM   7255  C  CG    . PRO A  1  932  ? 215.779 196.957 158.274 1.00 0.00 ? 932  PRO A CG    1 
ATOM   7256  C  CD    . PRO A  1  932  ? 215.673 197.960 159.375 1.00 0.00 ? 932  PRO A CD    1 
ATOM   7257  N  N     . VAL A  1  933  ? 219.637 196.714 160.116 1.00 0.00 ? 933  VAL A N     1 
ATOM   7258  C  CA    . VAL A  1  933  ? 221.039 196.464 159.822 1.00 0.00 ? 933  VAL A CA    1 
ATOM   7259  C  C     . VAL A  1  933  ? 221.752 196.011 161.081 1.00 0.00 ? 933  VAL A C     1 
ATOM   7260  O  O     . VAL A  1  933  ? 222.319 194.916 161.126 1.00 0.00 ? 933  VAL A O     1 
ATOM   7261  C  CB    . VAL A  1  933  ? 221.732 197.689 159.221 1.00 0.00 ? 933  VAL A CB    1 
ATOM   7262  C  CG1   . VAL A  1  933  ? 223.218 197.446 159.172 1.00 0.00 ? 933  VAL A CG1   1 
ATOM   7263  C  CG2   . VAL A  1  933  ? 221.228 197.899 157.837 1.00 0.00 ? 933  VAL A CG2   1 
ATOM   7264  N  N     . ASN A  1  934  ? 221.743 196.873 162.097 1.00 0.00 ? 934  ASN A N     1 
ATOM   7265  C  CA    . ASN A  1  934  ? 222.630 196.759 163.245 1.00 0.00 ? 934  ASN A CA    1 
ATOM   7266  C  C     . ASN A  1  934  ? 224.062 196.870 162.750 1.00 0.00 ? 934  ASN A C     1 
ATOM   7267  O  O     . ASN A  1  934  ? 224.809 195.886 162.735 1.00 0.00 ? 934  ASN A O     1 
ATOM   7268  C  CB    . ASN A  1  934  ? 222.402 195.459 164.017 1.00 0.00 ? 934  ASN A CB    1 
ATOM   7269  C  CG    . ASN A  1  934  ? 223.171 195.411 165.317 1.00 0.00 ? 934  ASN A CG    1 
ATOM   7270  O  OD1   . ASN A  1  934  ? 224.156 196.123 165.499 1.00 0.00 ? 934  ASN A OD1   1 
ATOM   7271  N  ND2   . ASN A  1  934  ? 222.723 194.568 166.234 1.00 0.00 ? 934  ASN A ND2   1 
ATOM   7272  N  N     . PHE A  1  935  ? 224.434 198.082 162.342 1.00 0.00 ? 935  PHE A N     1 
ATOM   7273  C  CA    . PHE A  1  935  ? 225.751 198.381 161.804 1.00 0.00 ? 935  PHE A CA    1 
ATOM   7274  C  C     . PHE A  1  935  ? 226.872 197.844 162.663 1.00 0.00 ? 935  PHE A C     1 
ATOM   7275  O  O     . PHE A  1  935  ? 227.924 197.492 162.123 1.00 0.00 ? 935  PHE A O     1 
ATOM   7276  C  CB    . PHE A  1  935  ? 225.926 199.884 161.683 1.00 0.00 ? 935  PHE A CB    1 
ATOM   7277  C  CG    . PHE A  1  935  ? 224.852 200.533 160.909 1.00 0.00 ? 935  PHE A CG    1 
ATOM   7278  C  CD1   . PHE A  1  935  ? 224.873 200.509 159.542 1.00 0.00 ? 935  PHE A CD1   1 
ATOM   7279  C  CD2   . PHE A  1  935  ? 223.804 201.157 161.552 1.00 0.00 ? 935  PHE A CD2   1 
ATOM   7280  C  CE1   . PHE A  1  935  ? 223.870 201.094 158.830 1.00 0.00 ? 935  PHE A CE1   1 
ATOM   7281  C  CE2   . PHE A  1  935  ? 222.805 201.753 160.842 1.00 0.00 ? 935  PHE A CE2   1 
ATOM   7282  C  CZ    . PHE A  1  935  ? 222.840 201.725 159.481 1.00 0.00 ? 935  PHE A CZ    1 
ATOM   7283  N  N     . ASN A  1  936  ? 226.679 197.811 163.979 1.00 0.00 ? 936  ASN A N     1 
ATOM   7284  C  CA    . ASN A  1  936  ? 227.723 197.341 164.871 1.00 0.00 ? 936  ASN A CA    1 
ATOM   7285  C  C     . ASN A  1  936  ? 228.276 196.009 164.389 1.00 0.00 ? 936  ASN A C     1 
ATOM   7286  O  O     . ASN A  1  936  ? 229.438 195.925 163.979 1.00 0.00 ? 936  ASN A O     1 
ATOM   7287  C  CB    . ASN A  1  936  ? 227.171 197.229 166.289 1.00 0.00 ? 936  ASN A CB    1 
ATOM   7288  C  CG    . ASN A  1  936  ? 228.256 197.115 167.334 1.00 0.00 ? 936  ASN A CG    1 
ATOM   7289  O  OD1   . ASN A  1  936  ? 229.406 196.811 167.027 1.00 0.00 ? 936  ASN A OD1   1 
ATOM   7290  N  ND2   . ASN A  1  936  ? 227.891 197.357 168.586 1.00 0.00 ? 936  ASN A ND2   1 
ATOM   7291  N  N     . ARG A  1  937  ? 227.450 194.966 164.382 1.00 0.00 ? 937  ARG A N     1 
ATOM   7292  C  CA    . ARG A  1  937  ? 227.957 193.665 163.979 1.00 0.00 ? 937  ARG A CA    1 
ATOM   7293  C  C     . ARG A  1  937  ? 228.394 193.628 162.524 1.00 0.00 ? 937  ARG A C     1 
ATOM   7294  O  O     . ARG A  1  937  ? 229.477 193.110 162.239 1.00 0.00 ? 937  ARG A O     1 
ATOM   7295  C  CB    . ARG A  1  937  ? 226.927 192.549 164.203 1.00 0.00 ? 937  ARG A CB    1 
ATOM   7296  C  CG    . ARG A  1  937  ? 225.836 192.473 163.164 1.00 0.00 ? 937  ARG A CG    1 
ATOM   7297  C  CD    . ARG A  1  937  ? 225.135 191.144 163.180 1.00 0.00 ? 937  ARG A CD    1 
ATOM   7298  N  NE    . ARG A  1  937  ? 224.373 190.958 164.400 1.00 0.00 ? 937  ARG A NE    1 
ATOM   7299  C  CZ    . ARG A  1  937  ? 223.898 189.788 164.797 1.00 0.00 ? 937  ARG A CZ    1 
ATOM   7300  N  NH1   . ARG A  1  937  ? 224.112 188.704 164.063 1.00 0.00 ? 937  ARG A NH1   1 
ATOM   7301  N  NH2   . ARG A  1  937  ? 223.204 189.705 165.923 1.00 0.00 ? 937  ARG A NH2   1 
ATOM   7302  N  N     . SER A  1  938  ? 227.602 194.182 161.604 1.00 0.00 ? 938  SER A N     1 
ATOM   7303  C  CA    . SER A  1  938  ? 227.890 193.983 160.192 1.00 0.00 ? 938  SER A CA    1 
ATOM   7304  C  C     . SER A  1  938  ? 229.220 194.604 159.818 1.00 0.00 ? 938  SER A C     1 
ATOM   7305  O  O     . SER A  1  938  ? 229.920 194.095 158.938 1.00 0.00 ? 938  SER A O     1 
ATOM   7306  C  CB    . SER A  1  938  ? 226.765 194.552 159.335 1.00 0.00 ? 938  SER A CB    1 
ATOM   7307  O  OG    . SER A  1  938  ? 225.590 193.781 159.493 1.00 0.00 ? 938  SER A OG    1 
ATOM   7308  N  N     . TRP A  1  939  ? 229.598 195.688 160.491 1.00 0.00 ? 939  TRP A N     1 
ATOM   7309  C  CA    . TRP A  1  939  ? 230.933 196.222 160.283 1.00 0.00 ? 939  TRP A CA    1 
ATOM   7310  C  C     . TRP A  1  939  ? 231.990 195.167 160.542 1.00 0.00 ? 939  TRP A C     1 
ATOM   7311  O  O     . TRP A  1  939  ? 232.933 195.029 159.756 1.00 0.00 ? 939  TRP A O     1 
ATOM   7312  C  CB    . TRP A  1  939  ? 231.171 197.439 161.166 1.00 0.00 ? 939  TRP A CB    1 
ATOM   7313  C  CG    . TRP A  1  939  ? 232.552 197.903 161.023 1.00 0.00 ? 939  TRP A CG    1 
ATOM   7314  C  CD1   . TRP A  1  939  ? 233.551 197.759 161.922 1.00 0.00 ? 939  TRP A CD1   1 
ATOM   7315  C  CD2   . TRP A  1  939  ? 233.125 198.527 159.879 1.00 0.00 ? 939  TRP A CD2   1 
ATOM   7316  N  NE1   . TRP A  1  939  ? 234.713 198.285 161.425 1.00 0.00 ? 939  TRP A NE1   1 
ATOM   7317  C  CE2   . TRP A  1  939  ? 234.476 198.762 160.166 1.00 0.00 ? 939  TRP A CE2   1 
ATOM   7318  C  CE3   . TRP A  1  939  ? 232.621 198.928 158.644 1.00 0.00 ? 939  TRP A CE3   1 
ATOM   7319  C  CZ2   . TRP A  1  939  ? 235.332 199.378 159.265 1.00 0.00 ? 939  TRP A CZ2   1 
ATOM   7320  C  CZ3   . TRP A  1  939  ? 233.472 199.537 157.752 1.00 0.00 ? 939  TRP A CZ3   1 
ATOM   7321  C  CH2   . TRP A  1  939  ? 234.812 199.757 158.066 1.00 0.00 ? 939  TRP A CH2   1 
ATOM   7322  N  N     . ASP A  1  940  ? 231.841 194.402 161.620 1.00 0.00 ? 940  ASP A N     1 
ATOM   7323  C  CA    . ASP A  1  940  ? 232.721 193.262 161.813 1.00 0.00 ? 940  ASP A CA    1 
ATOM   7324  C  C     . ASP A  1  940  ? 232.547 192.246 160.695 1.00 0.00 ? 940  ASP A C     1 
ATOM   7325  O  O     . ASP A  1  940  ? 233.520 191.896 160.021 1.00 0.00 ? 940  ASP A O     1 
ATOM   7326  C  CB    . ASP A  1  940  ? 232.462 192.617 163.174 1.00 0.00 ? 940  ASP A CB    1 
ATOM   7327  C  CG    . ASP A  1  940  ? 232.877 193.506 164.326 1.00 0.00 ? 940  ASP A CG    1 
ATOM   7328  O  OD1   . ASP A  1  940  ? 233.630 194.470 164.089 1.00 0.00 ? 940  ASP A OD1   1 
ATOM   7329  O  OD2   . ASP A  1  940  ? 232.454 193.241 165.471 1.00 0.00 ? 940  ASP A OD2   1 
ATOM   7330  N  N     . HIS A  1  941  ? 231.313 191.783 160.471 1.00 0.00 ? 941  HIS A N     1 
ATOM   7331  C  CA    . HIS A  1  941  ? 231.086 190.677 159.547 1.00 0.00 ? 941  HIS A CA    1 
ATOM   7332  C  C     . HIS A  1  941  ? 231.704 190.956 158.193 1.00 0.00 ? 941  HIS A C     1 
ATOM   7333  O  O     . HIS A  1  941  ? 232.112 190.030 157.488 1.00 0.00 ? 941  HIS A O     1 
ATOM   7334  C  CB    . HIS A  1  941  ? 229.598 190.404 159.388 1.00 0.00 ? 941  HIS A CB    1 
ATOM   7335  C  CG    . HIS A  1  941  ? 229.299 189.152 158.628 1.00 0.00 ? 941  HIS A CG    1 
ATOM   7336  N  ND1   . HIS A  1  941  ? 229.423 189.061 157.259 1.00 0.00 ? 941  HIS A ND1   1 
ATOM   7337  C  CD2   . HIS A  1  941  ? 228.861 187.944 159.048 1.00 0.00 ? 941  HIS A CD2   1 
ATOM   7338  C  CE1   . HIS A  1  941  ? 229.085 187.846 156.870 1.00 0.00 ? 941  HIS A CE1   1 
ATOM   7339  N  NE2   . HIS A  1  941  ? 228.741 187.149 157.936 1.00 0.00 ? 941  HIS A NE2   1 
ATOM   7340  N  N     . ALA A  1  942  ? 231.776 192.222 157.809 1.00 0.00 ? 942  ALA A N     1 
ATOM   7341  C  CA    . ALA A  1  942  ? 232.573 192.614 156.663 1.00 0.00 ? 942  ALA A CA    1 
ATOM   7342  C  C     . ALA A  1  942  ? 234.049 192.425 156.916 1.00 0.00 ? 942  ALA A C     1 
ATOM   7343  O  O     . ALA A  1  942  ? 234.729 191.733 156.149 1.00 0.00 ? 942  ALA A O     1 
ATOM   7344  C  CB    . ALA A  1  942  ? 232.282 194.067 156.297 1.00 0.00 ? 942  ALA A CB    1 
ATOM   7345  N  N     . TYR A  1  943  ? 234.544 192.984 158.011 1.00 0.00 ? 943  TYR A N     1 
ATOM   7346  C  CA    . TYR A  1  943  ? 235.965 193.080 158.290 1.00 0.00 ? 943  TYR A CA    1 
ATOM   7347  C  C     . TYR A  1  943  ? 236.680 191.744 158.208 1.00 0.00 ? 943  TYR A C     1 
ATOM   7348  O  O     . TYR A  1  943  ? 237.446 191.521 157.265 1.00 0.00 ? 943  TYR A O     1 
ATOM   7349  C  CB    . TYR A  1  943  ? 236.169 193.702 159.674 1.00 0.00 ? 943  TYR A CB    1 
ATOM   7350  C  CG    . TYR A  1  943  ? 237.610 193.823 160.063 1.00 0.00 ? 943  TYR A CG    1 
ATOM   7351  C  CD1   . TYR A  1  943  ? 238.415 194.780 159.485 1.00 0.00 ? 943  TYR A CD1   1 
ATOM   7352  C  CD2   . TYR A  1  943  ? 238.164 192.999 161.018 1.00 0.00 ? 943  TYR A CD2   1 
ATOM   7353  C  CE1   . TYR A  1  943  ? 239.737 194.904 159.832 1.00 0.00 ? 943  TYR A CE1   1 
ATOM   7354  C  CE2   . TYR A  1  943  ? 239.490 193.120 161.375 1.00 0.00 ? 943  TYR A CE2   1 
ATOM   7355  C  CZ    . TYR A  1  943  ? 240.271 194.074 160.776 1.00 0.00 ? 943  TYR A CZ    1 
ATOM   7356  O  OH    . TYR A  1  943  ? 241.594 194.202 161.126 1.00 0.00 ? 943  TYR A OH    1 
ATOM   7357  N  N     . ASN A  1  944  ? 236.437 190.833 159.148 1.00 0.00 ? 944  ASN A N     1 
ATOM   7358  C  CA    . ASN A  1  944  ? 237.252 189.627 159.195 1.00 0.00 ? 944  ASN A CA    1 
ATOM   7359  C  C     . ASN A  1  944  ? 237.036 188.725 157.991 1.00 0.00 ? 944  ASN A C     1 
ATOM   7360  O  O     . ASN A  1  944  ? 237.767 187.743 157.835 1.00 0.00 ? 944  ASN A O     1 
ATOM   7361  C  CB    . ASN A  1  944  ? 236.973 188.829 160.455 1.00 0.00 ? 944  ASN A CB    1 
ATOM   7362  C  CG    . ASN A  1  944  ? 235.602 188.236 160.451 1.00 0.00 ? 944  ASN A CG    1 
ATOM   7363  O  OD1   . ASN A  1  944  ? 234.734 188.665 159.693 1.00 0.00 ? 944  ASN A OD1   1 
ATOM   7364  N  ND2   . ASN A  1  944  ? 235.396 187.219 161.272 1.00 0.00 ? 944  ASN A ND2   1 
ATOM   7365  N  N     . ILE A  1  945  ? 236.033 188.998 157.159 1.00 0.00 ? 945  ILE A N     1 
ATOM   7366  C  CA    . ILE A  1  945  ? 235.971 188.327 155.866 1.00 0.00 ? 945  ILE A CA    1 
ATOM   7367  C  C     . ILE A  1  945  ? 236.949 188.974 154.900 1.00 0.00 ? 945  ILE A C     1 
ATOM   7368  O  O     . ILE A  1  945  ? 237.907 188.344 154.441 1.00 0.00 ? 945  ILE A O     1 
ATOM   7369  C  CB    . ILE A  1  945  ? 234.542 188.338 155.301 1.00 0.00 ? 945  ILE A CB    1 
ATOM   7370  C  CG1   . ILE A  1  945  ? 233.616 187.494 156.166 1.00 0.00 ? 945  ILE A CG1   1 
ATOM   7371  C  CG2   . ILE A  1  945  ? 234.540 187.806 153.884 1.00 0.00 ? 945  ILE A CG2   1 
ATOM   7372  C  CD1   . ILE A  1  945  ? 232.178 187.529 155.717 1.00 0.00 ? 945  ILE A CD1   1 
ATOM   7373  N  N     . THR A  1  946  ? 236.730 190.247 154.589 1.00 0.00 ? 946  THR A N     1 
ATOM   7374  C  CA    . THR A  1  946  ? 237.612 191.007 153.721 1.00 0.00 ? 946  THR A CA    1 
ATOM   7375  C  C     . THR A  1  946  ? 238.986 191.216 154.326 1.00 0.00 ? 946  THR A C     1 
ATOM   7376  O  O     . THR A  1  946  ? 239.871 191.749 153.650 1.00 0.00 ? 946  THR A O     1 
ATOM   7377  C  CB    . THR A  1  946  ? 237.001 192.365 153.402 1.00 0.00 ? 946  THR A CB    1 
ATOM   7378  O  OG1   . THR A  1  946  ? 237.765 192.997 152.371 1.00 0.00 ? 946  THR A OG1   1 
ATOM   7379  C  CG2   . THR A  1  946  ? 237.047 193.233 154.638 1.00 0.00 ? 946  THR A CG2   1 
ATOM   7380  N  N     . PHE A  1  947  ? 239.172 190.845 155.587 1.00 0.00 ? 947  PHE A N     1 
ATOM   7381  C  CA    . PHE A  1  947  ? 240.454 191.005 156.263 1.00 0.00 ? 947  PHE A CA    1 
ATOM   7382  C  C     . PHE A  1  947  ? 241.549 190.391 155.413 1.00 0.00 ? 947  PHE A C     1 
ATOM   7383  O  O     . PHE A  1  947  ? 241.403 189.284 154.891 1.00 0.00 ? 947  PHE A O     1 
ATOM   7384  C  CB    . PHE A  1  947  ? 240.431 190.353 157.634 1.00 0.00 ? 947  PHE A CB    1 
ATOM   7385  C  CG    . PHE A  1  947  ? 241.770 190.310 158.283 1.00 0.00 ? 947  PHE A CG    1 
ATOM   7386  C  CD1   . PHE A  1  947  ? 242.259 191.412 158.944 1.00 0.00 ? 947  PHE A CD1   1 
ATOM   7387  C  CD2   . PHE A  1  947  ? 242.554 189.175 158.205 1.00 0.00 ? 947  PHE A CD2   1 
ATOM   7388  C  CE1   . PHE A  1  947  ? 243.491 191.380 159.531 1.00 0.00 ? 947  PHE A CE1   1 
ATOM   7389  C  CE2   . PHE A  1  947  ? 243.793 189.140 158.788 1.00 0.00 ? 947  PHE A CE2   1 
ATOM   7390  C  CZ    . PHE A  1  947  ? 244.264 190.244 159.453 1.00 0.00 ? 947  PHE A CZ    1 
ATOM   7391  N  N     . ASN A  1  948  ? 242.640 191.125 155.252 1.00 0.00 ? 948  ASN A N     1 
ATOM   7392  C  CA    . ASN A  1  948  ? 243.829 190.608 154.601 1.00 0.00 ? 948  ASN A CA    1 
ATOM   7393  C  C     . ASN A  1  948  ? 245.046 191.156 155.322 1.00 0.00 ? 948  ASN A C     1 
ATOM   7394  O  O     . ASN A  1  948  ? 245.175 192.371 155.496 1.00 0.00 ? 948  ASN A O     1 
ATOM   7395  C  CB    . ASN A  1  948  ? 243.863 190.997 153.124 1.00 0.00 ? 948  ASN A CB    1 
ATOM   7396  C  CG    . ASN A  1  948  ? 244.930 190.256 152.352 1.00 0.00 ? 948  ASN A CG    1 
ATOM   7397  O  OD1   . ASN A  1  948  ? 245.854 189.691 152.930 1.00 0.00 ? 948  ASN A OD1   1 
ATOM   7398  N  ND2   . ASN A  1  948  ? 244.805 190.254 151.032 1.00 0.00 ? 948  ASN A ND2   1 
ATOM   7399  N  N     . ASN A  1  949  ? 245.936 190.265 155.732 1.00 0.00 ? 949  ASN A N     1 
ATOM   7400  C  CA    . ASN A  1  949  ? 247.210 190.710 156.258 1.00 0.00 ? 949  ASN A CA    1 
ATOM   7401  C  C     . ASN A  1  949  ? 248.087 191.217 155.119 1.00 0.00 ? 949  ASN A C     1 
ATOM   7402  O  O     . ASN A  1  949  ? 248.000 190.757 153.979 1.00 0.00 ? 949  ASN A O     1 
ATOM   7403  C  CB    . ASN A  1  949  ? 247.908 189.571 156.999 1.00 0.00 ? 949  ASN A CB    1 
ATOM   7404  C  CG    . ASN A  1  949  ? 249.179 190.012 157.708 1.00 0.00 ? 949  ASN A CG    1 
ATOM   7405  O  OD1   . ASN A  1  949  ? 249.760 191.052 157.398 1.00 0.00 ? 949  ASN A OD1   1 
ATOM   7406  N  ND2   . ASN A  1  949  ? 249.622 189.207 158.664 1.00 0.00 ? 949  ASN A ND2   1 
ATOM   7407  N  N     . GLN A  1  950  ? 248.941 192.184 155.444 1.00 0.00 ? 950  GLN A N     1 
ATOM   7408  C  CA    . GLN A  1  950  ? 249.993 192.619 154.530 1.00 0.00 ? 950  GLN A CA    1 
ATOM   7409  C  C     . GLN A  1  950  ? 249.398 193.256 153.272 1.00 0.00 ? 950  GLN A C     1 
ATOM   7410  O  O     . GLN A  1  950  ? 249.977 193.206 152.186 1.00 0.00 ? 950  GLN A O     1 
ATOM   7411  C  CB    . GLN A  1  950  ? 250.916 191.438 154.191 1.00 0.00 ? 950  GLN A CB    1 
ATOM   7412  C  CG    . GLN A  1  950  ? 252.171 191.744 153.384 1.00 0.00 ? 950  GLN A CG    1 
ATOM   7413  C  CD    . GLN A  1  950  ? 253.147 192.630 154.123 1.00 0.00 ? 950  GLN A CD    1 
ATOM   7414  O  OE1   . GLN A  1  950  ? 253.210 193.835 153.885 1.00 0.00 ? 950  GLN A OE1   1 
ATOM   7415  N  NE2   . GLN A  1  950  ? 253.922 192.037 155.023 1.00 0.00 ? 950  GLN A NE2   1 
ATOM   7416  N  N     . ASP A  1  951  ? 248.218 193.853 153.401 1.00 0.00 ? 951  ASP A N     1 
ATOM   7417  C  CA    . ASP A  1  951  ? 247.594 194.538 152.274 1.00 0.00 ? 951  ASP A CA    1 
ATOM   7418  C  C     . ASP A  1  951  ? 247.068 195.902 152.722 1.00 0.00 ? 951  ASP A C     1 
ATOM   7419  O  O     . ASP A  1  951  ? 246.082 195.986 153.460 1.00 0.00 ? 951  ASP A O     1 
ATOM   7420  C  CB    . ASP A  1  951  ? 246.483 193.668 151.694 1.00 0.00 ? 951  ASP A CB    1 
ATOM   7421  C  CG    . ASP A  1  951  ? 245.911 194.232 150.414 1.00 0.00 ? 951  ASP A CG    1 
ATOM   7422  O  OD1   . ASP A  1  951  ? 246.441 195.247 149.921 1.00 0.00 ? 951  ASP A OD1   1 
ATOM   7423  O  OD2   . ASP A  1  951  ? 244.930 193.657 149.899 1.00 0.00 ? 951  ASP A OD2   1 
ATOM   7424  N  N     . LYS A  1  952  ? 247.729 196.963 152.246 1.00 0.00 ? 952  LYS A N     1 
ATOM   7425  C  CA    . LYS A  1  952  ? 247.223 198.334 152.225 1.00 0.00 ? 952  LYS A CA    1 
ATOM   7426  C  C     . LYS A  1  952  ? 246.480 198.716 153.494 1.00 0.00 ? 952  LYS A C     1 
ATOM   7427  O  O     . LYS A  1  952  ? 247.006 198.590 154.603 1.00 0.00 ? 952  LYS A O     1 
ATOM   7428  C  CB    . LYS A  1  952  ? 246.316 198.551 151.014 1.00 0.00 ? 952  LYS A CB    1 
ATOM   7429  C  CG    . LYS A  1  952  ? 247.014 198.362 149.683 1.00 0.00 ? 952  LYS A CG    1 
ATOM   7430  C  CD    . LYS A  1  952  ? 248.213 199.286 149.569 1.00 0.00 ? 952  LYS A CD    1 
ATOM   7431  C  CE    . LYS A  1  952  ? 247.778 200.726 149.372 1.00 0.00 ? 952  LYS A CE    1 
ATOM   7432  N  NZ    . LYS A  1  952  ? 248.931 201.642 149.152 1.00 0.00 ? 952  LYS A NZ    1 
ATOM   7433  N  N     . GLY A  1  953  ? 245.251 199.186 153.325 1.00 0.00 ? 953  GLY A N     1 
ATOM   7434  C  CA    . GLY A  1  953  ? 244.347 199.345 154.437 1.00 0.00 ? 953  GLY A CA    1 
ATOM   7435  C  C     . GLY A  1  953  ? 244.337 200.694 155.106 1.00 0.00 ? 953  GLY A C     1 
ATOM   7436  O  O     . GLY A  1  953  ? 243.743 200.824 156.182 1.00 0.00 ? 953  GLY A O     1 
ATOM   7437  N  N     . LEU A  1  954  ? 244.965 201.708 154.520 1.00 0.00 ? 954  LEU A N     1 
ATOM   7438  C  CA    . LEU A  1  954  ? 244.891 203.062 155.055 1.00 0.00 ? 954  LEU A CA    1 
ATOM   7439  C  C     . LEU A  1  954  ? 244.413 203.987 153.936 1.00 0.00 ? 954  LEU A C     1 
ATOM   7440  O  O     . LEU A  1  954  ? 245.131 204.275 152.980 1.00 0.00 ? 954  LEU A O     1 
ATOM   7441  C  CB    . LEU A  1  954  ? 246.242 203.499 155.616 1.00 0.00 ? 954  LEU A CB    1 
ATOM   7442  C  CG    . LEU A  1  954  ? 246.743 202.692 156.816 1.00 0.00 ? 954  LEU A CG    1 
ATOM   7443  C  CD1   . LEU A  1  954  ? 248.135 203.144 157.241 1.00 0.00 ? 954  LEU A CD1   1 
ATOM   7444  C  CD2   . LEU A  1  954  ? 245.755 202.777 157.974 1.00 0.00 ? 954  LEU A CD2   1 
ATOM   7445  N  N     . LEU A  1  955  ? 243.173 204.455 154.058 1.00 0.00 ? 955  LEU A N     1 
ATOM   7446  C  CA    . LEU A  1  955  ? 242.601 205.398 153.099 1.00 0.00 ? 955  LEU A CA    1 
ATOM   7447  C  C     . LEU A  1  955  ? 241.622 206.319 153.813 1.00 0.00 ? 955  LEU A C     1 
ATOM   7448  O  O     . LEU A  1  955  ? 240.436 206.378 153.477 1.00 0.00 ? 955  LEU A O     1 
ATOM   7449  C  CB    . LEU A  1  955  ? 241.965 204.634 151.934 1.00 0.00 ? 955  LEU A CB    1 
ATOM   7450  C  CG    . LEU A  1  955  ? 241.048 203.417 152.148 1.00 0.00 ? 955  LEU A CG    1 
ATOM   7451  C  CD1   . LEU A  1  955  ? 239.581 203.732 152.236 1.00 0.00 ? 955  LEU A CD1   1 
ATOM   7452  C  CD2   . LEU A  1  955  ? 241.264 202.395 151.056 1.00 0.00 ? 955  LEU A CD2   1 
ATOM   7453  N  N     . PRO A  1  956  ? 242.111 207.119 154.766 1.00 0.00 ? 956  PRO A N     1 
ATOM   7454  C  CA    . PRO A  1  956  ? 241.196 207.742 155.736 1.00 0.00 ? 956  PRO A CA    1 
ATOM   7455  C  C     . PRO A  1  956  ? 240.166 208.675 155.126 1.00 0.00 ? 956  PRO A C     1 
ATOM   7456  O  O     . PRO A  1  956  ? 238.980 208.526 155.435 1.00 0.00 ? 956  PRO A O     1 
ATOM   7457  C  CB    . PRO A  1  956  ? 242.141 208.495 156.674 1.00 0.00 ? 956  PRO A CB    1 
ATOM   7458  C  CG    . PRO A  1  956  ? 243.316 208.777 155.846 1.00 0.00 ? 956  PRO A CG    1 
ATOM   7459  C  CD    . PRO A  1  956  ? 243.480 207.636 154.895 1.00 0.00 ? 956  PRO A CD    1 
ATOM   7460  N  N     . TYR A  1  957  ? 240.552 209.608 154.261 1.00 0.00 ? 957  TYR A N     1 
ATOM   7461  C  CA    . TYR A  1  957  ? 239.540 210.403 153.577 1.00 0.00 ? 957  TYR A CA    1 
ATOM   7462  C  C     . TYR A  1  957  ? 238.921 209.649 152.418 1.00 0.00 ? 957  TYR A C     1 
ATOM   7463  O  O     . TYR A  1  957  ? 237.728 209.818 152.140 1.00 0.00 ? 957  TYR A O     1 
ATOM   7464  C  CB    . TYR A  1  957  ? 240.131 211.714 153.062 1.00 0.00 ? 957  TYR A CB    1 
ATOM   7465  C  CG    . TYR A  1  957  ? 241.150 211.513 151.974 1.00 0.00 ? 957  TYR A CG    1 
ATOM   7466  C  CD1   . TYR A  1  957  ? 242.477 211.295 152.282 1.00 0.00 ? 957  TYR A CD1   1 
ATOM   7467  C  CD2   . TYR A  1  957  ? 240.782 211.518 150.639 1.00 0.00 ? 957  TYR A CD2   1 
ATOM   7468  C  CE1   . TYR A  1  957  ? 243.416 211.104 151.297 1.00 0.00 ? 957  TYR A CE1   1 
ATOM   7469  C  CE2   . TYR A  1  957  ? 241.713 211.318 149.646 1.00 0.00 ? 957  TYR A CE2   1 
ATOM   7470  C  CZ    . TYR A  1  957  ? 243.031 211.118 149.979 1.00 0.00 ? 957  TYR A CZ    1 
ATOM   7471  O  OH    . TYR A  1  957  ? 243.968 210.924 148.992 1.00 0.00 ? 957  TYR A OH    1 
ATOM   7472  N  N     . ALA A  1  958  ? 239.708 208.820 151.736 1.00 0.00 ? 958  ALA A N     1 
ATOM   7473  C  CA    . ALA A  1  958  ? 239.201 208.006 150.646 1.00 0.00 ? 958  ALA A CA    1 
ATOM   7474  C  C     . ALA A  1  958  ? 238.083 207.081 151.083 1.00 0.00 ? 958  ALA A C     1 
ATOM   7475  O  O     . ALA A  1  958  ? 237.321 206.613 150.229 1.00 0.00 ? 958  ALA A O     1 
ATOM   7476  C  CB    . ALA A  1  958  ? 240.341 207.199 150.023 1.00 0.00 ? 958  ALA A CB    1 
ATOM   7477  N  N     . ILE A  1  959  ? 237.983 206.792 152.385 1.00 0.00 ? 959  ILE A N     1 
ATOM   7478  C  CA    . ILE A  1  959  ? 236.785 206.154 152.906 1.00 0.00 ? 959  ILE A CA    1 
ATOM   7479  C  C     . ILE A  1  959  ? 235.552 206.923 152.463 1.00 0.00 ? 959  ILE A C     1 
ATOM   7480  O  O     . ILE A  1  959  ? 234.595 206.343 151.941 1.00 0.00 ? 959  ILE A O     1 
ATOM   7481  C  CB    . ILE A  1  959  ? 236.847 206.041 154.440 1.00 0.00 ? 959  ILE A CB    1 
ATOM   7482  C  CG1   . ILE A  1  959  ? 237.958 205.097 154.881 1.00 0.00 ? 959  ILE A CG1   1 
ATOM   7483  C  CG2   . ILE A  1  959  ? 235.557 205.499 154.969 1.00 0.00 ? 959  ILE A CG2   1 
ATOM   7484  C  CD1   . ILE A  1  959  ? 238.150 205.054 156.368 1.00 0.00 ? 959  ILE A CD1   1 
ATOM   7485  N  N     . MET A  1  960  ? 235.566 208.243 152.637 1.00 0.00 ? 960  MET A N     1 
ATOM   7486  C  CA    . MET A  1  960  ? 234.439 209.043 152.189 1.00 0.00 ? 960  MET A CA    1 
ATOM   7487  C  C     . MET A  1  960  ? 234.303 209.004 150.677 1.00 0.00 ? 960  MET A C     1 
ATOM   7488  O  O     . MET A  1  960  ? 233.183 209.056 150.157 1.00 0.00 ? 960  MET A O     1 
ATOM   7489  C  CB    . MET A  1  960  ? 234.585 210.478 152.685 1.00 0.00 ? 960  MET A CB    1 
ATOM   7490  C  CG    . MET A  1  960  ? 234.550 210.596 154.196 1.00 0.00 ? 960  MET A CG    1 
ATOM   7491  S  SD    . MET A  1  960  ? 232.995 210.006 154.888 1.00 0.00 ? 960  MET A SD    1 
ATOM   7492  C  CE    . MET A  1  960  ? 233.482 208.381 155.458 1.00 0.00 ? 960  MET A CE    1 
ATOM   7493  N  N     . GLU A  1  961  ? 235.424 208.909 149.961 1.00 0.00 ? 961  GLU A N     1 
ATOM   7494  C  CA    . GLU A  1  961  ? 235.361 208.731 148.516 1.00 0.00 ? 961  GLU A CA    1 
ATOM   7495  C  C     . GLU A  1  961  ? 234.510 207.526 148.152 1.00 0.00 ? 961  GLU A C     1 
ATOM   7496  O  O     . GLU A  1  961  ? 233.439 207.673 147.551 1.00 0.00 ? 961  GLU A O     1 
ATOM   7497  C  CB    . GLU A  1  961  ? 236.764 208.574 147.938 1.00 0.00 ? 961  GLU A CB    1 
ATOM   7498  C  CG    . GLU A  1  961  ? 237.593 209.826 147.980 1.00 0.00 ? 961  GLU A CG    1 
ATOM   7499  C  CD    . GLU A  1  961  ? 236.977 210.924 147.158 1.00 0.00 ? 961  GLU A CD    1 
ATOM   7500  O  OE1   . GLU A  1  961  ? 236.438 210.610 146.076 1.00 0.00 ? 961  GLU A OE1   1 
ATOM   7501  O  OE2   . GLU A  1  961  ? 237.021 212.093 147.593 1.00 0.00 ? 961  GLU A OE2   1 
ATOM   7502  N  N     . THR A  1  962  ? 234.965 206.332 148.526 1.00 0.00 ? 962  THR A N     1 
ATOM   7503  C  CA    . THR A  1  962  ? 234.230 205.111 148.236 1.00 0.00 ? 962  THR A CA    1 
ATOM   7504  C  C     . THR A  1  962  ? 232.812 205.136 148.779 1.00 0.00 ? 962  THR A C     1 
ATOM   7505  O  O     . THR A  1  962  ? 231.894 204.671 148.099 1.00 0.00 ? 962  THR A O     1 
ATOM   7506  C  CB    . THR A  1  962  ? 234.965 203.908 148.816 1.00 0.00 ? 962  THR A CB    1 
ATOM   7507  O  OG1   . THR A  1  962  ? 235.118 204.094 150.225 1.00 0.00 ? 962  THR A OG1   1 
ATOM   7508  C  CG2   . THR A  1  962  ? 236.332 203.766 148.182 1.00 0.00 ? 962  THR A CG2   1 
ATOM   7509  N  N     . ALA A  1  963  ? 232.616 205.652 149.988 1.00 0.00 ? 963  ALA A N     1 
ATOM   7510  C  CA    . ALA A  1  963  ? 231.269 205.768 150.526 1.00 0.00 ? 963  ALA A CA    1 
ATOM   7511  C  C     . ALA A  1  963  ? 230.373 206.565 149.592 1.00 0.00 ? 963  ALA A C     1 
ATOM   7512  O  O     . ALA A  1  963  ? 229.460 206.005 148.974 1.00 0.00 ? 963  ALA A O     1 
ATOM   7513  C  CB    . ALA A  1  963  ? 231.313 206.415 151.907 1.00 0.00 ? 963  ALA A CB    1 
ATOM   7514  N  N     . ASN A  1  964  ? 230.637 207.863 149.451 1.00 0.00 ? 964  ASN A N     1 
ATOM   7515  C  CA    . ASN A  1  964  ? 229.874 208.678 148.517 1.00 0.00 ? 964  ASN A CA    1 
ATOM   7516  C  C     . ASN A  1  964  ? 229.905 208.129 147.100 1.00 0.00 ? 964  ASN A C     1 
ATOM   7517  O  O     . ASN A  1  964  ? 228.991 208.423 146.323 1.00 0.00 ? 964  ASN A O     1 
ATOM   7518  C  CB    . ASN A  1  964  ? 230.394 210.110 148.532 1.00 0.00 ? 964  ASN A CB    1 
ATOM   7519  C  CG    . ASN A  1  964  ? 230.075 210.819 149.822 1.00 0.00 ? 964  ASN A CG    1 
ATOM   7520  O  OD1   . ASN A  1  964  ? 229.135 210.455 150.526 1.00 0.00 ? 964  ASN A OD1   1 
ATOM   7521  N  ND2   . ASN A  1  964  ? 230.859 211.836 150.146 1.00 0.00 ? 964  ASN A ND2   1 
ATOM   7522  N  N     . GLU A  1  965  ? 230.921 207.345 146.748 1.00 0.00 ? 965  GLU A N     1 
ATOM   7523  C  CA    . GLU A  1  965  ? 230.901 206.647 145.474 1.00 0.00 ? 965  GLU A CA    1 
ATOM   7524  C  C     . GLU A  1  965  ? 229.681 205.757 145.320 1.00 0.00 ? 965  GLU A C     1 
ATOM   7525  O  O     . GLU A  1  965  ? 229.090 205.733 144.237 1.00 0.00 ? 965  GLU A O     1 
ATOM   7526  C  CB    . GLU A  1  965  ? 232.169 205.814 145.313 1.00 0.00 ? 965  GLU A CB    1 
ATOM   7527  C  CG    . GLU A  1  965  ? 232.263 205.057 144.011 1.00 0.00 ? 965  GLU A CG    1 
ATOM   7528  C  CD    . GLU A  1  965  ? 232.390 205.970 142.816 1.00 0.00 ? 965  GLU A CD    1 
ATOM   7529  O  OE1   . GLU A  1  965  ? 232.636 207.180 143.006 1.00 0.00 ? 965  GLU A OE1   1 
ATOM   7530  O  OE2   . GLU A  1  965  ? 232.257 205.474 141.680 1.00 0.00 ? 965  GLU A OE2   1 
ATOM   7531  N  N     . ILE A  1  966  ? 229.290 205.032 146.366 1.00 0.00 ? 966  ILE A N     1 
ATOM   7532  C  CA    . ILE A  1  966  ? 228.111 204.177 146.317 1.00 0.00 ? 966  ILE A CA    1 
ATOM   7533  C  C     . ILE A  1  966  ? 226.839 204.998 146.441 1.00 0.00 ? 966  ILE A C     1 
ATOM   7534  O  O     . ILE A  1  966  ? 225.917 204.867 145.629 1.00 0.00 ? 966  ILE A O     1 
ATOM   7535  C  CB    . ILE A  1  966  ? 228.160 203.108 147.418 1.00 0.00 ? 966  ILE A CB    1 
ATOM   7536  C  CG1   . ILE A  1  966  ? 229.361 202.196 147.206 1.00 0.00 ? 966  ILE A CG1   1 
ATOM   7537  C  CG2   . ILE A  1  966  ? 226.877 202.316 147.435 1.00 0.00 ? 966  ILE A CG2   1 
ATOM   7538  C  CD1   . ILE A  1  966  ? 229.338 201.494 145.878 1.00 0.00 ? 966  ILE A CD1   1 
ATOM   7539  N  N     . LEU A  1  967  ? 226.784 205.858 147.455 1.00 0.00 ? 967  LEU A N     1 
ATOM   7540  C  CA    . LEU A  1  967  ? 225.525 206.513 147.781 1.00 0.00 ? 967  LEU A CA    1 
ATOM   7541  C  C     . LEU A  1  967  ? 225.144 207.553 146.741 1.00 0.00 ? 967  LEU A C     1 
ATOM   7542  O  O     . LEU A  1  967  ? 223.957 207.864 146.584 1.00 0.00 ? 967  LEU A O     1 
ATOM   7543  C  CB    . LEU A  1  967  ? 225.625 207.146 149.160 1.00 0.00 ? 967  LEU A CB    1 
ATOM   7544  C  CG    . LEU A  1  967  ? 225.934 206.064 150.186 1.00 0.00 ? 967  LEU A CG    1 
ATOM   7545  C  CD1   . LEU A  1  967  ? 226.163 206.682 151.535 1.00 0.00 ? 967  LEU A CD1   1 
ATOM   7546  C  CD2   . LEU A  1  967  ? 224.814 205.048 150.234 1.00 0.00 ? 967  LEU A CD2   1 
ATOM   7547  N  N     . GLY A  1  968  ? 226.122 208.088 146.018 1.00 0.00 ? 968  GLY A N     1 
ATOM   7548  C  CA    . GLY A  1  968  ? 225.852 209.073 145.005 1.00 0.00 ? 968  GLY A CA    1 
ATOM   7549  C  C     . GLY A  1  968  ? 224.844 208.553 144.007 1.00 0.00 ? 968  GLY A C     1 
ATOM   7550  O  O     . GLY A  1  968  ? 223.769 209.127 143.825 1.00 0.00 ? 968  GLY A O     1 
ATOM   7551  N  N     . PRO A  1  969  ? 225.151 207.434 143.370 1.00 0.00 ? 969  PRO A N     1 
ATOM   7552  C  CA    . PRO A  1  969  ? 224.145 206.805 142.512 1.00 0.00 ? 969  PRO A CA    1 
ATOM   7553  C  C     . PRO A  1  969  ? 223.181 205.948 143.308 1.00 0.00 ? 969  PRO A C     1 
ATOM   7554  O  O     . PRO A  1  969  ? 222.891 204.807 142.941 1.00 0.00 ? 969  PRO A O     1 
ATOM   7555  C  CB    . PRO A  1  969  ? 224.992 205.945 141.565 1.00 0.00 ? 969  PRO A CB    1 
ATOM   7556  C  CG    . PRO A  1  969  ? 226.343 206.557 141.607 1.00 0.00 ? 969  PRO A CG    1 
ATOM   7557  C  CD    . PRO A  1  969  ? 226.502 206.981 143.029 1.00 0.00 ? 969  PRO A CD    1 
ATOM   7558  N  N     . LEU A  1  970  ? 222.700 206.490 144.421 1.00 0.00 ? 970  LEU A N     1 
ATOM   7559  C  CA    . LEU A  1  970  ? 221.503 206.009 145.093 1.00 0.00 ? 970  LEU A CA    1 
ATOM   7560  C  C     . LEU A  1  970  ? 220.664 207.212 145.475 1.00 0.00 ? 970  LEU A C     1 
ATOM   7561  O  O     . LEU A  1  970  ? 219.531 207.373 145.011 1.00 0.00 ? 970  LEU A O     1 
ATOM   7562  C  CB    . LEU A  1  970  ? 221.837 205.170 146.322 1.00 0.00 ? 970  LEU A CB    1 
ATOM   7563  C  CG    . LEU A  1  970  ? 222.460 203.810 146.037 1.00 0.00 ? 970  LEU A CG    1 
ATOM   7564  C  CD1   . LEU A  1  970  ? 222.798 203.108 147.332 1.00 0.00 ? 970  LEU A CD1   1 
ATOM   7565  C  CD2   . LEU A  1  970  ? 221.511 202.976 145.203 1.00 0.00 ? 970  LEU A CD2   1 
ATOM   7566  N  N     . GLU A  1  971  ? 221.243 208.045 146.341 1.00 0.00 ? 971  GLU A N     1 
ATOM   7567  C  CA    . GLU A  1  971  ? 220.579 209.240 146.844 1.00 0.00 ? 971  GLU A CA    1 
ATOM   7568  C  C     . GLU A  1  971  ? 219.876 209.992 145.722 1.00 0.00 ? 971  GLU A C     1 
ATOM   7569  O  O     . GLU A  1  971  ? 218.643 210.074 145.691 1.00 0.00 ? 971  GLU A O     1 
ATOM   7570  C  CB    . GLU A  1  971  ? 221.614 210.132 147.529 1.00 0.00 ? 971  GLU A CB    1 
ATOM   7571  C  CG    . GLU A  1  971  ? 222.257 209.498 148.752 1.00 0.00 ? 971  GLU A CG    1 
ATOM   7572  C  CD    . GLU A  1  971  ? 223.424 210.306 149.289 1.00 0.00 ? 971  GLU A CD    1 
ATOM   7573  O  OE1   . GLU A  1  971  ? 223.869 211.243 148.596 1.00 0.00 ? 971  GLU A OE1   1 
ATOM   7574  O  OE2   . GLU A  1  971  ? 223.901 210.005 150.403 1.00 0.00 ? 971  GLU A OE2   1 
ATOM   7575  N  N     . GLU A  1  972  ? 220.640 210.528 144.774 1.00 0.00 ? 972  GLU A N     1 
ATOM   7576  C  CA    . GLU A  1  972  ? 220.041 211.280 143.682 1.00 0.00 ? 972  GLU A CA    1 
ATOM   7577  C  C     . GLU A  1  972  ? 219.140 210.431 142.799 1.00 0.00 ? 972  GLU A C     1 
ATOM   7578  O  O     . GLU A  1  972  ? 218.227 210.977 142.180 1.00 0.00 ? 972  GLU A O     1 
ATOM   7579  C  CB    . GLU A  1  972  ? 221.118 211.936 142.817 1.00 0.00 ? 972  GLU A CB    1 
ATOM   7580  C  CG    . GLU A  1  972  ? 221.966 210.961 142.031 1.00 0.00 ? 972  GLU A CG    1 
ATOM   7581  C  CD    . GLU A  1  972  ? 223.053 211.653 141.238 1.00 0.00 ? 972  GLU A CD    1 
ATOM   7582  O  OE1   . GLU A  1  972  ? 222.969 212.887 141.073 1.00 0.00 ? 972  GLU A OE1   1 
ATOM   7583  O  OE2   . GLU A  1  972  ? 223.983 210.964 140.765 1.00 0.00 ? 972  GLU A OE2   1 
ATOM   7584  N  N     . ARG A  1  973  ? 219.364 209.121 142.714 1.00 0.00 ? 973  ARG A N     1 
ATOM   7585  C  CA    . ARG A  1  973  ? 218.451 208.280 141.953 1.00 0.00 ? 973  ARG A CA    1 
ATOM   7586  C  C     . ARG A  1  973  ? 217.077 208.211 142.590 1.00 0.00 ? 973  ARG A C     1 
ATOM   7587  O  O     . ARG A  1  973  ? 216.120 207.765 141.947 1.00 0.00 ? 973  ARG A O     1 
ATOM   7588  C  CB    . ARG A  1  973  ? 219.019 206.869 141.803 1.00 0.00 ? 973  ARG A CB    1 
ATOM   7589  C  CG    . ARG A  1  973  ? 220.266 206.818 140.950 1.00 0.00 ? 973  ARG A CG    1 
ATOM   7590  C  CD    . ARG A  1  973  ? 220.754 205.398 140.753 1.00 0.00 ? 973  ARG A CD    1 
ATOM   7591  N  NE    . ARG A  1  973  ? 221.984 205.361 139.968 1.00 0.00 ? 973  ARG A NE    1 
ATOM   7592  C  CZ    . ARG A  1  973  ? 222.690 204.260 139.733 1.00 0.00 ? 973  ARG A CZ    1 
ATOM   7593  N  NH1   . ARG A  1  973  ? 222.292 203.096 140.226 1.00 0.00 ? 973  ARG A NH1   1 
ATOM   7594  N  NH2   . ARG A  1  973  ? 223.796 204.323 139.006 1.00 0.00 ? 973  ARG A NH2   1 
ATOM   7595  N  N     . LEU A  1  974  ? 216.966 208.629 143.847 1.00 0.00 ? 974  LEU A N     1 
ATOM   7596  C  CA    . LEU A  1  974  ? 215.662 208.721 144.481 1.00 0.00 ? 974  LEU A CA    1 
ATOM   7597  C  C     . LEU A  1  974  ? 214.946 210.013 144.106 1.00 0.00 ? 974  LEU A C     1 
ATOM   7598  O  O     . LEU A  1  974  ? 213.712 210.072 144.153 1.00 0.00 ? 974  LEU A O     1 
ATOM   7599  C  CB    . LEU A  1  974  ? 215.827 208.624 145.991 1.00 0.00 ? 974  LEU A CB    1 
ATOM   7600  C  CG    . LEU A  1  974  ? 214.511 208.632 146.739 1.00 0.00 ? 974  LEU A CG    1 
ATOM   7601  C  CD1   . LEU A  1  974  ? 213.757 207.413 146.294 1.00 0.00 ? 974  LEU A CD1   1 
ATOM   7602  C  CD2   . LEU A  1  974  ? 214.743 208.600 148.216 1.00 0.00 ? 974  LEU A CD2   1 
ATOM   7603  N  N     . VAL A  1  975  ? 215.712 211.052 143.770 1.00 0.00 ? 975  VAL A N     1 
ATOM   7604  C  CA    . VAL A  1  975  ? 215.284 212.425 143.485 1.00 0.00 ? 975  VAL A CA    1 
ATOM   7605  C  C     . VAL A  1  975  ? 214.292 212.914 144.531 1.00 0.00 ? 975  VAL A C     1 
ATOM   7606  O  O     . VAL A  1  975  ? 214.323 212.474 145.685 1.00 0.00 ? 975  VAL A O     1 
ATOM   7607  C  CB    . VAL A  1  975  ? 214.701 212.591 142.057 1.00 0.00 ? 975  VAL A CB    1 
ATOM   7608  C  CG1   . VAL A  1  975  ? 215.756 212.319 141.002 1.00 0.00 ? 975  VAL A CG1   1 
ATOM   7609  C  CG2   . VAL A  1  975  ? 213.447 211.743 141.792 1.00 0.00 ? 975  VAL A CG2   1 
ATOM   7610  N  N     . ARG A  1  976  ? 213.388 213.799 144.113 1.00 0.00 ? 976  ARG A N     1 
ATOM   7611  C  CA    . ARG A  1  976  ? 212.202 214.219 144.844 1.00 0.00 ? 976  ARG A CA    1 
ATOM   7612  C  C     . ARG A  1  976  ? 211.227 214.758 143.812 1.00 0.00 ? 976  ARG A C     1 
ATOM   7613  O  O     . ARG A  1  976  ? 211.646 215.234 142.754 1.00 0.00 ? 976  ARG A O     1 
ATOM   7614  C  CB    . ARG A  1  976  ? 212.483 215.308 145.894 1.00 0.00 ? 976  ARG A CB    1 
ATOM   7615  C  CG    . ARG A  1  976  ? 213.322 214.878 147.086 1.00 0.00 ? 976  ARG A CG    1 
ATOM   7616  C  CD    . ARG A  1  976  ? 213.529 216.006 148.080 1.00 0.00 ? 976  ARG A CD    1 
ATOM   7617  N  NE    . ARG A  1  976  ? 212.280 216.372 148.735 1.00 0.00 ? 976  ARG A NE    1 
ATOM   7618  C  CZ    . ARG A  1  976  ? 211.806 215.766 149.818 1.00 0.00 ? 976  ARG A CZ    1 
ATOM   7619  N  NH1   . ARG A  1  976  ? 212.486 214.772 150.372 1.00 0.00 ? 976  ARG A NH1   1 
ATOM   7620  N  NH2   . ARG A  1  976  ? 210.656 216.155 150.348 1.00 0.00 ? 976  ARG A NH2   1 
ATOM   7621  N  N     . TYR A  1  977  ? 209.939 214.700 144.118 1.00 0.00 ? 977  TYR A N     1 
ATOM   7622  C  CA    . TYR A  1  977  ? 208.913 215.344 143.304 1.00 0.00 ? 977  TYR A CA    1 
ATOM   7623  C  C     . TYR A  1  977  ? 208.077 216.228 144.214 1.00 0.00 ? 977  TYR A C     1 
ATOM   7624  O  O     . TYR A  1  977  ? 207.445 215.739 145.155 1.00 0.00 ? 977  TYR A O     1 
ATOM   7625  C  CB    . TYR A  1  977  ? 208.041 214.327 142.572 1.00 0.00 ? 977  TYR A CB    1 
ATOM   7626  C  CG    . TYR A  1  977  ? 208.768 213.587 141.480 1.00 0.00 ? 977  TYR A CG    1 
ATOM   7627  C  CD1   . TYR A  1  977  ? 209.647 214.245 140.637 1.00 0.00 ? 977  TYR A CD1   1 
ATOM   7628  C  CD2   . TYR A  1  977  ? 208.570 212.233 141.288 1.00 0.00 ? 977  TYR A CD2   1 
ATOM   7629  C  CE1   . TYR A  1  977  ? 210.316 213.571 139.643 1.00 0.00 ? 977  TYR A CE1   1 
ATOM   7630  C  CE2   . TYR A  1  977  ? 209.232 211.550 140.297 1.00 0.00 ? 977  TYR A CE2   1 
ATOM   7631  C  CZ    . TYR A  1  977  ? 210.105 212.224 139.476 1.00 0.00 ? 977  TYR A CZ    1 
ATOM   7632  O  OH    . TYR A  1  977  ? 210.776 211.555 138.479 1.00 0.00 ? 977  TYR A OH    1 
ATOM   7633  N  N     . ASP A  1  978  ? 208.047 217.519 143.914 1.00 0.00 ? 978  ASP A N     1 
ATOM   7634  C  CA    . ASP A  1  978  ? 207.352 218.475 144.766 1.00 0.00 ? 978  ASP A CA    1 
ATOM   7635  C  C     . ASP A  1  978  ? 205.860 218.384 144.532 1.00 0.00 ? 978  ASP A C     1 
ATOM   7636  O  O     . ASP A  1  978  ? 205.377 218.693 143.442 1.00 0.00 ? 978  ASP A O     1 
ATOM   7637  C  CB    . ASP A  1  978  ? 207.823 219.888 144.469 1.00 0.00 ? 978  ASP A CB    1 
ATOM   7638  C  CG    . ASP A  1  978  ? 206.894 220.927 145.051 1.00 0.00 ? 978  ASP A CG    1 
ATOM   7639  O  OD1   . ASP A  1  978  ? 206.824 221.021 146.285 1.00 0.00 ? 978  ASP A OD1   1 
ATOM   7640  O  OD2   . ASP A  1  978  ? 206.197 221.616 144.273 1.00 0.00 ? 978  ASP A OD2   1 
ATOM   7641  N  N     . ASN A  1  979  ? 205.129 217.986 145.571 1.00 0.00 ? 979  ASN A N     1 
ATOM   7642  C  CA    . ASN A  1  979  ? 203.680 218.105 145.580 1.00 0.00 ? 979  ASN A CA    1 
ATOM   7643  C  C     . ASN A  1  979  ? 203.125 217.527 144.287 1.00 0.00 ? 979  ASN A C     1 
ATOM   7644  O  O     . ASN A  1  979  ? 203.199 216.316 144.063 1.00 0.00 ? 979  ASN A O     1 
ATOM   7645  C  CB    . ASN A  1  979  ? 203.262 219.557 145.780 1.00 0.00 ? 979  ASN A CB    1 
ATOM   7646  C  CG    . ASN A  1  979  ? 201.815 219.688 146.197 1.00 0.00 ? 979  ASN A CG    1 
ATOM   7647  O  OD1   . ASN A  1  979  ? 201.004 218.786 145.976 1.00 0.00 ? 979  ASN A OD1   1 
ATOM   7648  N  ND2   . ASN A  1  979  ? 201.485 220.810 146.826 1.00 0.00 ? 979  ASN A ND2   1 
ATOM   7649  N  N     . SER A  1  980  ? 202.567 218.381 143.434 1.00 0.00 ? 980  SER A N     1 
ATOM   7650  C  CA    . SER A  1  980  ? 202.081 217.953 142.126 1.00 0.00 ? 980  SER A CA    1 
ATOM   7651  C  C     . SER A  1  980  ? 203.144 218.203 141.068 1.00 0.00 ? 980  SER A C     1 
ATOM   7652  O  O     . SER A  1  980  ? 203.453 219.356 140.753 1.00 0.00 ? 980  SER A O     1 
ATOM   7653  C  CB    . SER A  1  980  ? 200.785 218.665 141.763 1.00 0.00 ? 980  SER A CB    1 
ATOM   7654  O  OG    . SER A  1  980  ? 199.778 218.285 142.672 1.00 0.00 ? 980  SER A OG    1 
ATOM   7655  N  N     . GLY A  1  981  ? 203.699 217.117 140.534 1.00 0.00 ? 981  GLY A N     1 
ATOM   7656  C  CA    . GLY A  1  981  ? 204.401 217.119 139.258 1.00 0.00 ? 981  GLY A CA    1 
ATOM   7657  C  C     . GLY A  1  981  ? 205.442 218.196 139.057 1.00 0.00 ? 981  GLY A C     1 
ATOM   7658  O  O     . GLY A  1  981  ? 205.494 218.800 137.981 1.00 0.00 ? 981  GLY A O     1 
ATOM   7659  N  N     . CYS A  1  982  ? 206.291 218.441 140.050 1.00 0.00 ? 982  CYS A N     1 
ATOM   7660  C  CA    . CYS A  1  982  ? 207.376 219.399 139.906 1.00 0.00 ? 982  CYS A CA    1 
ATOM   7661  C  C     . CYS A  1  982  ? 208.561 218.946 140.743 1.00 0.00 ? 982  CYS A C     1 
ATOM   7662  O  O     . CYS A  1  982  ? 208.419 218.165 141.686 1.00 0.00 ? 982  CYS A O     1 
ATOM   7663  C  CB    . CYS A  1  982  ? 206.950 220.814 140.319 1.00 0.00 ? 982  CYS A CB    1 
ATOM   7664  S  SG    . CYS A  1  982  ? 205.722 221.596 139.247 1.00 0.00 ? 982  CYS A SG    1 
ATOM   7665  N  N     . LEU A  1  983  ? 209.739 219.447 140.385 1.00 0.00 ? 983  LEU A N     1 
ATOM   7666  C  CA    . LEU A  1  983  ? 210.959 219.191 141.138 1.00 0.00 ? 983  LEU A CA    1 
ATOM   7667  C  C     . LEU A  1  983  ? 211.292 220.424 141.960 1.00 0.00 ? 983  LEU A C     1 
ATOM   7668  O  O     . LEU A  1  983  ? 211.707 221.447 141.408 1.00 0.00 ? 983  LEU A O     1 
ATOM   7669  C  CB    . LEU A  1  983  ? 212.126 218.841 140.214 1.00 0.00 ? 983  LEU A CB    1 
ATOM   7670  C  CG    . LEU A  1  983  ? 212.283 217.384 139.779 1.00 0.00 ? 983  LEU A CG    1 
ATOM   7671  C  CD1   . LEU A  1  983  ? 211.145 216.952 138.873 1.00 0.00 ? 983  LEU A CD1   1 
ATOM   7672  C  CD2   . LEU A  1  983  ? 213.625 217.177 139.100 1.00 0.00 ? 983  LEU A CD2   1 
ATOM   7673  N  N     . VAL A  1  984  ? 211.117 220.323 143.269 1.00 0.00 ? 984  VAL A N     1 
ATOM   7674  C  CA    . VAL A  1  984  ? 211.541 221.383 144.173 1.00 0.00 ? 984  VAL A CA    1 
ATOM   7675  C  C     . VAL A  1  984  ? 213.055 221.331 144.300 1.00 0.00 ? 984  VAL A C     1 
ATOM   7676  O  O     . VAL A  1  984  ? 213.647 220.248 144.377 1.00 0.00 ? 984  VAL A O     1 
ATOM   7677  C  CB    . VAL A  1  984  ? 210.853 221.238 145.538 1.00 0.00 ? 984  VAL A CB    1 
ATOM   7678  C  CG1   . VAL A  1  984  ? 211.123 219.865 146.123 1.00 0.00 ? 984  VAL A CG1   1 
ATOM   7679  C  CG2   . VAL A  1  984  ? 211.329 222.319 146.492 1.00 0.00 ? 984  VAL A CG2   1 
ATOM   7680  N  N     . LYS A  1  985  ? 213.693 222.498 144.306 1.00 0.00 ? 985  LYS A N     1 
ATOM   7681  C  CA    . LYS A  1  985  ? 215.151 222.571 144.341 1.00 0.00 ? 985  LYS A CA    1 
ATOM   7682  C  C     . LYS A  1  985  ? 215.616 223.498 145.457 1.00 0.00 ? 985  LYS A C     1 
ATOM   7683  O  O     . LYS A  1  985  ? 215.403 224.713 145.396 1.00 0.00 ? 985  LYS A O     1 
ATOM   7684  C  CB    . LYS A  1  985  ? 215.697 223.033 142.999 1.00 0.00 ? 985  LYS A CB    1 
ATOM   7685  C  CG    . LYS A  1  985  ? 215.477 222.050 141.871 1.00 0.00 ? 985  LYS A CG    1 
ATOM   7686  C  CD    . LYS A  1  985  ? 215.980 222.628 140.562 1.00 0.00 ? 985  LYS A CD    1 
ATOM   7687  C  CE    . LYS A  1  985  ? 215.782 221.655 139.416 1.00 0.00 ? 985  LYS A CE    1 
ATOM   7688  N  NZ    . LYS A  1  985  ? 216.203 222.239 138.112 1.00 0.00 ? 985  LYS A NZ    1 
ATOM   7689  N  N     . ARG A  1  986  ? 216.246 222.908 146.470 1.00 0.00 ? 986  ARG A N     1 
ATOM   7690  C  CA    . ARG A  1  986  ? 217.104 223.620 147.418 1.00 0.00 ? 986  ARG A CA    1 
ATOM   7691  C  C     . ARG A  1  986  ? 216.370 224.752 148.129 1.00 0.00 ? 986  ARG A C     1 
ATOM   7692  O  O     . ARG A  1  986  ? 216.983 225.695 148.633 1.00 0.00 ? 986  ARG A O     1 
ATOM   7693  C  CB    . ARG A  1  986  ? 218.357 224.136 146.719 1.00 0.00 ? 986  ARG A CB    1 
ATOM   7694  C  CG    . ARG A  1  986  ? 219.254 223.012 146.240 1.00 0.00 ? 986  ARG A CG    1 
ATOM   7695  C  CD    . ARG A  1  986  ? 220.479 223.544 145.535 1.00 0.00 ? 986  ARG A CD    1 
ATOM   7696  N  NE    . ARG A  1  986  ? 221.274 224.377 146.432 1.00 0.00 ? 986  ARG A NE    1 
ATOM   7697  C  CZ    . ARG A  1  986  ? 222.147 223.905 147.315 1.00 0.00 ? 986  ARG A CZ    1 
ATOM   7698  N  NH1   . ARG A  1  986  ? 222.341 222.598 147.430 1.00 0.00 ? 986  ARG A NH1   1 
ATOM   7699  N  NH2   . ARG A  1  986  ? 222.822 224.743 148.089 1.00 0.00 ? 986  ARG A NH2   1 
ATOM   7700  N  N     . GLU A  1  987  ? 215.053 224.654 148.182 1.00 0.00 ? 987  GLU A N     1 
ATOM   7701  C  CA    . GLU A  1  987  ? 214.242 225.590 148.943 1.00 0.00 ? 987  GLU A CA    1 
ATOM   7702  C  C     . GLU A  1  987  ? 213.630 224.949 150.172 1.00 0.00 ? 987  GLU A C     1 
ATOM   7703  O  O     . GLU A  1  987  ? 214.115 225.169 151.284 1.00 0.00 ? 987  GLU A O     1 
ATOM   7704  C  CB    . GLU A  1  987  ? 213.125 226.160 148.060 1.00 0.00 ? 987  GLU A CB    1 
ATOM   7705  C  CG    . GLU A  1  987  ? 213.617 227.006 146.902 1.00 0.00 ? 987  GLU A CG    1 
ATOM   7706  C  CD    . GLU A  1  987  ? 212.485 227.457 145.997 1.00 0.00 ? 987  GLU A CD    1 
ATOM   7707  O  OE1   . GLU A  1  987  ? 211.347 226.977 146.182 1.00 0.00 ? 987  GLU A OE1   1 
ATOM   7708  O  OE2   . GLU A  1  987  ? 212.735 228.282 145.093 1.00 0.00 ? 987  GLU A OE2   1 
ATOM   7709  N  N     . ASP A  1  988  ? 212.586 224.144 149.995 1.00 0.00 ? 988  ASP A N     1 
ATOM   7710  C  CA    . ASP A  1  988  ? 212.143 223.227 151.023 1.00 0.00 ? 988  ASP A CA    1 
ATOM   7711  C  C     . ASP A  1  988  ? 212.576 221.826 150.595 1.00 0.00 ? 988  ASP A C     1 
ATOM   7712  O  O     . ASP A  1  988  ? 211.986 221.195 149.723 1.00 0.00 ? 988  ASP A O     1 
ATOM   7713  C  CB    . ASP A  1  988  ? 210.632 223.323 151.228 1.00 0.00 ? 988  ASP A CB    1 
ATOM   7714  C  CG    . ASP A  1  988  ? 210.114 222.332 152.253 1.00 0.00 ? 988  ASP A CG    1 
ATOM   7715  O  OD1   . ASP A  1  988  ? 210.447 222.472 153.444 1.00 0.00 ? 988  ASP A OD1   1 
ATOM   7716  O  OD2   . ASP A  1  988  ? 209.366 221.407 151.868 1.00 0.00 ? 988  ASP A OD2   1 
ATOM   7717  N  N     . LEU A  1  989  ? 213.632 221.333 151.229 1.00 0.00 ? 989  LEU A N     1 
ATOM   7718  C  CA    . LEU A  1  989  ? 214.074 219.953 151.103 1.00 0.00 ? 989  LEU A CA    1 
ATOM   7719  C  C     . LEU A  1  989  ? 214.378 219.323 152.443 1.00 0.00 ? 989  LEU A C     1 
ATOM   7720  O  O     . LEU A  1  989  ? 213.660 218.426 152.879 1.00 0.00 ? 989  LEU A O     1 
ATOM   7721  C  CB    . LEU A  1  989  ? 215.323 219.863 150.230 1.00 0.00 ? 989  LEU A CB    1 
ATOM   7722  C  CG    . LEU A  1  989  ? 215.171 220.319 148.790 1.00 0.00 ? 989  LEU A CG    1 
ATOM   7723  C  CD1   . LEU A  1  989  ? 216.497 220.151 148.089 1.00 0.00 ? 989  LEU A CD1   1 
ATOM   7724  C  CD2   . LEU A  1  989  ? 214.090 219.522 148.106 1.00 0.00 ? 989  LEU A CD2   1 
ATOM   7725  N  N     . ASN A  1  990  ? 215.442 219.778 153.095 1.00 0.00 ? 990  ASN A N     1 
ATOM   7726  C  CA    . ASN A  1  990  ? 215.664 219.484 154.497 1.00 0.00 ? 990  ASN A CA    1 
ATOM   7727  C  C     . ASN A  1  990  ? 214.595 220.107 155.376 1.00 0.00 ? 990  ASN A C     1 
ATOM   7728  O  O     . ASN A  1  990  ? 214.108 219.442 156.295 1.00 0.00 ? 990  ASN A O     1 
ATOM   7729  C  CB    . ASN A  1  990  ? 217.050 219.988 154.922 1.00 0.00 ? 990  ASN A CB    1 
ATOM   7730  C  CG    . ASN A  1  990  ? 217.476 219.480 156.291 1.00 0.00 ? 990  ASN A CG    1 
ATOM   7731  O  OD1   . ASN A  1  990  ? 216.657 219.056 157.104 1.00 0.00 ? 990  ASN A OD1   1 
ATOM   7732  N  ND2   . ASN A  1  990  ? 218.776 219.523 156.548 1.00 0.00 ? 990  ASN A ND2   1 
ATOM   7733  N  N     . LYS A  1  991  ? 214.213 221.361 155.109 1.00 0.00 ? 991  LYS A N     1 
ATOM   7734  C  CA    . LYS A  1  991  ? 213.061 221.944 155.784 1.00 0.00 ? 991  LYS A CA    1 
ATOM   7735  C  C     . LYS A  1  991  ? 211.829 221.064 155.631 1.00 0.00 ? 991  LYS A C     1 
ATOM   7736  O  O     . LYS A  1  991  ? 211.073 220.900 156.594 1.00 0.00 ? 991  LYS A O     1 
ATOM   7737  C  CB    . LYS A  1  991  ? 212.793 223.352 155.246 1.00 0.00 ? 991  LYS A CB    1 
ATOM   7738  C  CG    . LYS A  1  991  ? 211.658 224.095 155.947 1.00 0.00 ? 991  LYS A CG    1 
ATOM   7739  C  CD    . LYS A  1  991  ? 212.012 224.431 157.391 1.00 0.00 ? 991  LYS A CD    1 
ATOM   7740  C  CE    . LYS A  1  991  ? 210.874 225.164 158.095 1.00 0.00 ? 991  LYS A CE    1 
ATOM   7741  N  NZ    . LYS A  1  991  ? 210.604 226.506 157.505 1.00 0.00 ? 991  LYS A NZ    1 
ATOM   7742  N  N     . ALA A  1  992  ? 211.619 220.500 154.443 1.00 0.00 ? 992  ALA A N     1 
ATOM   7743  C  CA    . ALA A  1  992  ? 210.805 219.302 154.257 1.00 0.00 ? 992  ALA A CA    1 
ATOM   7744  C  C     . ALA A  1  992  ? 209.370 219.500 154.751 1.00 0.00 ? 992  ALA A C     1 
ATOM   7745  O  O     . ALA A  1  992  ? 208.953 218.964 155.778 1.00 0.00 ? 992  ALA A O     1 
ATOM   7746  C  CB    . ALA A  1  992  ? 211.450 218.104 154.961 1.00 0.00 ? 992  ALA A CB    1 
ATOM   7747  N  N     . GLU A  1  993  ? 208.627 220.306 154.006 1.00 0.00 ? 993  GLU A N     1 
ATOM   7748  C  CA    . GLU A  1  993  ? 207.178 220.196 154.047 1.00 0.00 ? 993  GLU A CA    1 
ATOM   7749  C  C     . GLU A  1  993  ? 206.605 219.370 152.917 1.00 0.00 ? 993  GLU A C     1 
ATOM   7750  O  O     . GLU A  1  993  ? 205.397 219.110 152.923 1.00 0.00 ? 993  GLU A O     1 
ATOM   7751  C  CB    . GLU A  1  993  ? 206.528 221.582 154.029 1.00 0.00 ? 993  GLU A CB    1 
ATOM   7752  C  CG    . GLU A  1  993  ? 206.836 222.357 155.278 1.00 0.00 ? 993  GLU A CG    1 
ATOM   7753  C  CD    . GLU A  1  993  ? 206.448 221.579 156.515 1.00 0.00 ? 993  GLU A CD    1 
ATOM   7754  O  OE1   . GLU A  1  993  ? 205.382 220.928 156.501 1.00 0.00 ? 993  GLU A OE1   1 
ATOM   7755  O  OE2   . GLU A  1  993  ? 207.219 221.601 157.495 1.00 0.00 ? 993  GLU A OE2   1 
ATOM   7756  N  N     . TYR A  1  994  ? 207.414 218.968 151.944 1.00 0.00 ? 994  TYR A N     1 
ATOM   7757  C  CA    . TYR A  1  994  ? 206.962 218.136 150.845 1.00 0.00 ? 994  TYR A CA    1 
ATOM   7758  C  C     . TYR A  1  994  ? 207.018 216.642 151.134 1.00 0.00 ? 994  TYR A C     1 
ATOM   7759  O  O     . TYR A  1  994  ? 206.075 215.932 150.767 1.00 0.00 ? 994  TYR A O     1 
ATOM   7760  C  CB    . TYR A  1  994  ? 207.762 218.490 149.596 1.00 0.00 ? 994  TYR A CB    1 
ATOM   7761  C  CG    . TYR A  1  994  ? 207.588 219.950 149.273 1.00 0.00 ? 994  TYR A CG    1 
ATOM   7762  C  CD1   . TYR A  1  994  ? 206.364 220.572 149.468 1.00 0.00 ? 994  TYR A CD1   1 
ATOM   7763  C  CD2   . TYR A  1  994  ? 208.639 220.713 148.803 1.00 0.00 ? 994  TYR A CD2   1 
ATOM   7764  C  CE1   . TYR A  1  994  ? 206.190 221.910 149.189 1.00 0.00 ? 994  TYR A CE1   1 
ATOM   7765  C  CE2   . TYR A  1  994  ? 208.475 222.056 148.526 1.00 0.00 ? 994  TYR A CE2   1 
ATOM   7766  C  CZ    . TYR A  1  994  ? 207.248 222.647 148.717 1.00 0.00 ? 994  TYR A CZ    1 
ATOM   7767  O  OH    . TYR A  1  994  ? 207.079 223.982 148.439 1.00 0.00 ? 994  TYR A OH    1 
ATOM   7768  N  N     . VAL A  1  995  ? 208.092 216.145 151.764 1.00 0.00 ? 995  VAL A N     1 
ATOM   7769  C  CA    . VAL A  1  995  ? 208.221 214.750 152.202 1.00 0.00 ? 995  VAL A CA    1 
ATOM   7770  C  C     . VAL A  1  995  ? 207.809 213.816 151.068 1.00 0.00 ? 995  VAL A C     1 
ATOM   7771  O  O     . VAL A  1  995  ? 208.582 213.602 150.129 1.00 0.00 ? 995  VAL A O     1 
ATOM   7772  C  CB    . VAL A  1  995  ? 207.509 214.444 153.540 1.00 0.00 ? 995  VAL A CB    1 
ATOM   7773  C  CG1   . VAL A  1  995  ? 208.280 215.080 154.676 1.00 0.00 ? 995  VAL A CG1   1 
ATOM   7774  C  CG2   . VAL A  1  995  ? 206.092 214.938 153.602 1.00 0.00 ? 995  VAL A CG2   1 
ATOM   7775  N  N     . ASP A  1  996  ? 206.624 213.213 151.175 1.00 0.00 ? 996  ASP A N     1 
ATOM   7776  C  CA    . ASP A  1  996  ? 206.138 212.229 150.207 1.00 0.00 ? 996  ASP A CA    1 
ATOM   7777  C  C     . ASP A  1  996  ? 206.995 210.973 150.235 1.00 0.00 ? 996  ASP A C     1 
ATOM   7778  O  O     . ASP A  1  996  ? 207.755 210.685 149.310 1.00 0.00 ? 996  ASP A O     1 
ATOM   7779  C  CB    . ASP A  1  996  ? 206.071 212.811 148.793 1.00 0.00 ? 996  ASP A CB    1 
ATOM   7780  C  CG    . ASP A  1  996  ? 205.591 211.802 147.768 1.00 0.00 ? 996  ASP A CG    1 
ATOM   7781  O  OD1   . ASP A  1  996  ? 204.409 211.410 147.824 1.00 0.00 ? 996  ASP A OD1   1 
ATOM   7782  O  OD2   . ASP A  1  996  ? 206.403 211.394 146.911 1.00 0.00 ? 996  ASP A OD2   1 
ATOM   7783  N  N     . GLN A  1  997  ? 206.892 210.258 151.351 1.00 0.00 ? 997  GLN A N     1 
ATOM   7784  C  CA    . GLN A  1  997  ? 207.501 208.964 151.631 1.00 0.00 ? 997  GLN A CA    1 
ATOM   7785  C  C     . GLN A  1  997  ? 208.969 208.939 151.235 1.00 0.00 ? 997  GLN A C     1 
ATOM   7786  O  O     . GLN A  1  997  ? 209.636 209.979 151.250 1.00 0.00 ? 997  GLN A O     1 
ATOM   7787  C  CB    . GLN A  1  997  ? 206.708 207.843 150.942 1.00 0.00 ? 997  GLN A CB    1 
ATOM   7788  C  CG    . GLN A  1  997  ? 206.680 207.884 149.427 1.00 0.00 ? 997  GLN A CG    1 
ATOM   7789  C  CD    . GLN A  1  997  ? 205.785 206.828 148.838 1.00 0.00 ? 997  GLN A CD    1 
ATOM   7790  O  OE1   . GLN A  1  997  ? 204.902 206.305 149.514 1.00 0.00 ? 997  GLN A OE1   1 
ATOM   7791  N  NE2   . GLN A  1  997  ? 206.001 206.506 147.570 1.00 0.00 ? 997  GLN A NE2   1 
ATOM   7792  N  N     . TYR A  1  998  ? 209.488 207.764 150.889 1.00 0.00 ? 998  TYR A N     1 
ATOM   7793  C  CA    . TYR A  1  998  ? 210.884 207.585 150.501 1.00 0.00 ? 998  TYR A CA    1 
ATOM   7794  C  C     . TYR A  1  998  ? 211.851 208.084 151.571 1.00 0.00 ? 998  TYR A C     1 
ATOM   7795  O  O     . TYR A  1  998  ? 213.053 207.816 151.501 1.00 0.00 ? 998  TYR A O     1 
ATOM   7796  C  CB    . TYR A  1  998  ? 211.200 208.245 149.159 1.00 0.00 ? 998  TYR A CB    1 
ATOM   7797  C  CG    . TYR A  1  998  ? 210.480 207.622 148.000 1.00 0.00 ? 998  TYR A CG    1 
ATOM   7798  C  CD1   . TYR A  1  998  ? 210.872 206.392 147.509 1.00 0.00 ? 998  TYR A CD1   1 
ATOM   7799  C  CD2   . TYR A  1  998  ? 209.456 208.287 147.354 1.00 0.00 ? 998  TYR A CD2   1 
ATOM   7800  C  CE1   . TYR A  1  998  ? 210.239 205.818 146.440 1.00 0.00 ? 998  TYR A CE1   1 
ATOM   7801  C  CE2   . TYR A  1  998  ? 208.813 207.721 146.274 1.00 0.00 ? 998  TYR A CE2   1 
ATOM   7802  C  CZ    . TYR A  1  998  ? 209.212 206.483 145.821 1.00 0.00 ? 998  TYR A CZ    1 
ATOM   7803  O  OH    . TYR A  1  998  ? 208.583 205.903 144.745 1.00 0.00 ? 998  TYR A OH    1 
ATOM   7804  N  N     . ASP A  1  999  ? 211.344 208.802 152.572 1.00 0.00 ? 999  ASP A N     1 
ATOM   7805  C  CA    . ASP A  1  999  ? 212.211 209.486 153.517 1.00 0.00 ? 999  ASP A CA    1 
ATOM   7806  C  C     . ASP A  1  999  ? 212.768 208.540 154.559 1.00 0.00 ? 999  ASP A C     1 
ATOM   7807  O  O     . ASP A  1  999  ? 213.807 208.830 155.160 1.00 0.00 ? 999  ASP A O     1 
ATOM   7808  C  CB    . ASP A  1  999  ? 211.463 210.634 154.186 1.00 0.00 ? 999  ASP A CB    1 
ATOM   7809  C  CG    . ASP A  1  999  ? 211.262 211.799 153.254 1.00 0.00 ? 999  ASP A CG    1 
ATOM   7810  O  OD1   . ASP A  1  999  ? 211.923 211.813 152.195 1.00 0.00 ? 999  ASP A OD1   1 
ATOM   7811  O  OD2   . ASP A  1  999  ? 210.465 212.704 153.576 1.00 0.00 ? 999  ASP A OD2   1 
ATOM   7812  N  N     . ALA A  1  1000 ? 212.102 207.415 154.792 1.00 0.00 ? 1000 ALA A N     1 
ATOM   7813  C  CA    . ALA A  1  1000 ? 212.742 206.367 155.569 1.00 0.00 ? 1000 ALA A CA    1 
ATOM   7814  C  C     . ALA A  1  1000 ? 214.005 205.887 154.872 1.00 0.00 ? 1000 ALA A C     1 
ATOM   7815  O  O     . ALA A  1  1000 ? 214.987 205.526 155.528 1.00 0.00 ? 1000 ALA A O     1 
ATOM   7816  C  CB    . ALA A  1  1000 ? 211.773 205.212 155.797 1.00 0.00 ? 1000 ALA A CB    1 
ATOM   7817  N  N     . GLU A  1  1001 ? 214.003 205.887 153.540 1.00 0.00 ? 1001 GLU A N     1 
ATOM   7818  C  CA    . GLU A  1  1001 ? 215.182 205.438 152.816 1.00 0.00 ? 1001 GLU A CA    1 
ATOM   7819  C  C     . GLU A  1  1001 ? 216.231 206.539 152.722 1.00 0.00 ? 1001 GLU A C     1 
ATOM   7820  O  O     . GLU A  1  1001 ? 217.428 206.274 152.884 1.00 0.00 ? 1001 GLU A O     1 
ATOM   7821  C  CB    . GLU A  1  1001 ? 214.783 204.935 151.437 1.00 0.00 ? 1001 GLU A CB    1 
ATOM   7822  C  CG    . GLU A  1  1001 ? 215.920 204.281 150.701 1.00 0.00 ? 1001 GLU A CG    1 
ATOM   7823  C  CD    . GLU A  1  1001 ? 215.488 203.649 149.402 1.00 0.00 ? 1001 GLU A CD    1 
ATOM   7824  O  OE1   . GLU A  1  1001 ? 214.292 203.750 149.061 1.00 0.00 ? 1001 GLU A OE1   1 
ATOM   7825  O  OE2   . GLU A  1  1001 ? 216.343 203.043 148.724 1.00 0.00 ? 1001 GLU A OE2   1 
ATOM   7826  N  N     . ARG A  1  1002 ? 215.810 207.779 152.449 1.00 0.00 ? 1002 ARG A N     1 
ATOM   7827  C  CA    . ARG A  1  1002 ? 216.746 208.893 152.551 1.00 0.00 ? 1002 ARG A CA    1 
ATOM   7828  C  C     . ARG A  1  1002 ? 217.439 208.885 153.899 1.00 0.00 ? 1002 ARG A C     1 
ATOM   7829  O  O     . ARG A  1  1002 ? 218.658 209.070 153.981 1.00 0.00 ? 1002 ARG A O     1 
ATOM   7830  C  CB    . ARG A  1  1002 ? 216.038 210.227 152.359 1.00 0.00 ? 1002 ARG A CB    1 
ATOM   7831  C  CG    . ARG A  1  1002 ? 215.508 210.466 150.985 1.00 0.00 ? 1002 ARG A CG    1 
ATOM   7832  C  CD    . ARG A  1  1002 ? 214.865 211.826 150.896 1.00 0.00 ? 1002 ARG A CD    1 
ATOM   7833  N  NE    . ARG A  1  1002 ? 214.279 212.034 149.584 1.00 0.00 ? 1002 ARG A NE    1 
ATOM   7834  C  CZ    . ARG A  1  1002 ? 213.064 211.621 149.252 1.00 0.00 ? 1002 ARG A CZ    1 
ATOM   7835  N  NH1   . ARG A  1  1002 ? 212.312 210.995 150.146 1.00 0.00 ? 1002 ARG A NH1   1 
ATOM   7836  N  NH2   . ARG A  1  1002 ? 212.597 211.840 148.033 1.00 0.00 ? 1002 ARG A NH2   1 
ATOM   7837  N  N     . ASP A  1  1003 ? 216.671 208.685 154.968 1.00 0.00 ? 1003 ASP A N     1 
ATOM   7838  C  CA    . ASP A  1  1003 ? 217.280 208.468 156.268 1.00 0.00 ? 1003 ASP A CA    1 
ATOM   7839  C  C     . ASP A  1  1003 ? 218.257 207.311 156.230 1.00 0.00 ? 1003 ASP A C     1 
ATOM   7840  O  O     . ASP A  1  1003 ? 219.457 207.533 156.343 1.00 0.00 ? 1003 ASP A O     1 
ATOM   7841  C  CB    . ASP A  1  1003 ? 216.211 208.228 157.325 1.00 0.00 ? 1003 ASP A CB    1 
ATOM   7842  C  CG    . ASP A  1  1003 ? 215.495 209.494 157.713 1.00 0.00 ? 1003 ASP A CG    1 
ATOM   7843  O  OD1   . ASP A  1  1003 ? 216.018 210.583 157.400 1.00 0.00 ? 1003 ASP A OD1   1 
ATOM   7844  O  OD2   . ASP A  1  1003 ? 214.418 209.405 158.338 1.00 0.00 ? 1003 ASP A OD2   1 
ATOM   7845  N  N     . PHE A  1  1004 ? 217.772 206.091 156.005 1.00 0.00 ? 1004 PHE A N     1 
ATOM   7846  C  CA    . PHE A  1  1004 ? 218.614 204.908 156.148 1.00 0.00 ? 1004 PHE A CA    1 
ATOM   7847  C  C     . PHE A  1  1004 ? 219.954 205.082 155.445 1.00 0.00 ? 1004 PHE A C     1 
ATOM   7848  O  O     . PHE A  1  1004 ? 221.014 204.825 156.030 1.00 0.00 ? 1004 PHE A O     1 
ATOM   7849  C  CB    . PHE A  1  1004 ? 217.877 203.692 155.610 1.00 0.00 ? 1004 PHE A CB    1 
ATOM   7850  C  CG    . PHE A  1  1004 ? 218.703 202.467 155.589 1.00 0.00 ? 1004 PHE A CG    1 
ATOM   7851  C  CD1   . PHE A  1  1004 ? 218.948 201.782 156.749 1.00 0.00 ? 1004 PHE A CD1   1 
ATOM   7852  C  CD2   . PHE A  1  1004 ? 219.236 201.998 154.408 1.00 0.00 ? 1004 PHE A CD2   1 
ATOM   7853  C  CE1   . PHE A  1  1004 ? 219.708 200.662 156.733 1.00 0.00 ? 1004 PHE A CE1   1 
ATOM   7854  C  CE2   . PHE A  1  1004 ? 219.996 200.871 154.389 1.00 0.00 ? 1004 PHE A CE2   1 
ATOM   7855  C  CZ    . PHE A  1  1004 ? 220.235 200.205 155.550 1.00 0.00 ? 1004 PHE A CZ    1 
ATOM   7856  N  N     . TYR A  1  1005 ? 219.927 205.547 154.197 1.00 0.00 ? 1005 TYR A N     1 
ATOM   7857  C  CA    . TYR A  1  1005 ? 221.161 205.952 153.540 1.00 0.00 ? 1005 TYR A CA    1 
ATOM   7858  C  C     . TYR A  1  1005 ? 221.929 206.972 154.363 1.00 0.00 ? 1005 TYR A C     1 
ATOM   7859  O  O     . TYR A  1  1005 ? 223.070 206.714 154.761 1.00 0.00 ? 1005 TYR A O     1 
ATOM   7860  C  CB    . TYR A  1  1005 ? 220.860 206.514 152.162 1.00 0.00 ? 1005 TYR A CB    1 
ATOM   7861  C  CG    . TYR A  1  1005 ? 220.399 205.469 151.196 1.00 0.00 ? 1005 TYR A CG    1 
ATOM   7862  C  CD1   . TYR A  1  1005 ? 220.962 204.212 151.201 1.00 0.00 ? 1005 TYR A CD1   1 
ATOM   7863  C  CD2   . TYR A  1  1005 ? 219.419 205.741 150.268 1.00 0.00 ? 1005 TYR A CD2   1 
ATOM   7864  C  CE1   . TYR A  1  1005 ? 220.556 203.251 150.318 1.00 0.00 ? 1005 TYR A CE1   1 
ATOM   7865  C  CE2   . TYR A  1  1005 ? 219.010 204.785 149.375 1.00 0.00 ? 1005 TYR A CE2   1 
ATOM   7866  C  CZ    . TYR A  1  1005 ? 219.578 203.539 149.409 1.00 0.00 ? 1005 TYR A CZ    1 
ATOM   7867  O  OH    . TYR A  1  1005 ? 219.169 202.576 148.522 1.00 0.00 ? 1005 TYR A OH    1 
ATOM   7868  N  N     . HIS A  1  1006 ? 221.314 208.127 154.613 1.00 0.00 ? 1006 HIS A N     1 
ATOM   7869  C  CA    . HIS A  1  1006 ? 221.968 209.231 155.305 1.00 0.00 ? 1006 HIS A CA    1 
ATOM   7870  C  C     . HIS A  1  1006 ? 222.655 208.763 156.582 1.00 0.00 ? 1006 HIS A C     1 
ATOM   7871  O  O     . HIS A  1  1006 ? 223.857 208.986 156.770 1.00 0.00 ? 1006 HIS A O     1 
ATOM   7872  C  CB    . HIS A  1  1006 ? 220.915 210.292 155.607 1.00 0.00 ? 1006 HIS A CB    1 
ATOM   7873  C  CG    . HIS A  1  1006 ? 221.467 211.587 156.097 1.00 0.00 ? 1006 HIS A CG    1 
ATOM   7874  N  ND1   . HIS A  1  1006 ? 221.837 211.795 157.407 1.00 0.00 ? 1006 HIS A ND1   1 
ATOM   7875  C  CD2   . HIS A  1  1006 ? 221.682 212.757 155.454 1.00 0.00 ? 1006 HIS A CD2   1 
ATOM   7876  C  CE1   . HIS A  1  1006 ? 222.272 213.034 157.546 1.00 0.00 ? 1006 HIS A CE1   1 
ATOM   7877  N  NE2   . HIS A  1  1006 ? 222.190 213.639 156.375 1.00 0.00 ? 1006 HIS A NE2   1 
ATOM   7878  N  N     . SER A  1  1007 ? 221.899 208.102 157.459 1.00 0.00 ? 1007 SER A N     1 
ATOM   7879  C  CA    . SER A  1  1007 ? 222.440 207.443 158.637 1.00 0.00 ? 1007 SER A CA    1 
ATOM   7880  C  C     . SER A  1  1007 ? 223.652 206.595 158.305 1.00 0.00 ? 1007 SER A C     1 
ATOM   7881  O  O     . SER A  1  1007 ? 224.726 206.834 158.856 1.00 0.00 ? 1007 SER A O     1 
ATOM   7882  C  CB    . SER A  1  1007 ? 221.370 206.577 159.292 1.00 0.00 ? 1007 SER A CB    1 
ATOM   7883  O  OG    . SER A  1  1007 ? 221.907 205.867 160.391 1.00 0.00 ? 1007 SER A OG    1 
ATOM   7884  N  N     . LEU A  1  1008 ? 223.494 205.589 157.445 1.00 0.00 ? 1008 LEU A N     1 
ATOM   7885  C  CA    . LEU A  1  1008 ? 224.618 204.723 157.104 1.00 0.00 ? 1008 LEU A CA    1 
ATOM   7886  C  C     . LEU A  1  1008 ? 225.872 205.527 156.782 1.00 0.00 ? 1008 LEU A C     1 
ATOM   7887  O  O     . LEU A  1  1008 ? 226.952 205.265 157.335 1.00 0.00 ? 1008 LEU A O     1 
ATOM   7888  C  CB    . LEU A  1  1008 ? 224.229 203.837 155.928 1.00 0.00 ? 1008 LEU A CB    1 
ATOM   7889  C  CG    . LEU A  1  1008 ? 225.270 202.953 155.259 1.00 0.00 ? 1008 LEU A CG    1 
ATOM   7890  C  CD1   . LEU A  1  1008 ? 225.798 201.915 156.195 1.00 0.00 ? 1008 LEU A CD1   1 
ATOM   7891  C  CD2   . LEU A  1  1008 ? 224.617 202.296 154.073 1.00 0.00 ? 1008 LEU A CD2   1 
ATOM   7892  N  N     . ARG A  1  1009 ? 225.741 206.532 155.916 1.00 0.00 ? 1009 ARG A N     1 
ATOM   7893  C  CA    . ARG A  1  1009 ? 226.888 207.366 155.584 1.00 0.00 ? 1009 ARG A CA    1 
ATOM   7894  C  C     . ARG A  1  1009 ? 227.469 208.020 156.825 1.00 0.00 ? 1009 ARG A C     1 
ATOM   7895  O  O     . ARG A  1  1009 ? 228.684 207.978 157.042 1.00 0.00 ? 1009 ARG A O     1 
ATOM   7896  C  CB    . ARG A  1  1009 ? 226.487 208.428 154.569 1.00 0.00 ? 1009 ARG A CB    1 
ATOM   7897  C  CG    . ARG A  1  1009 ? 227.624 209.304 154.093 1.00 0.00 ? 1009 ARG A CG    1 
ATOM   7898  C  CD    . ARG A  1  1009 ? 227.065 210.360 153.172 1.00 0.00 ? 1009 ARG A CD    1 
ATOM   7899  N  NE    . ARG A  1  1009 ? 226.127 211.209 153.898 1.00 0.00 ? 1009 ARG A NE    1 
ATOM   7900  C  CZ    . ARG A  1  1009 ? 225.192 211.962 153.330 1.00 0.00 ? 1009 ARG A CZ    1 
ATOM   7901  N  NH1   . ARG A  1  1009 ? 225.044 211.970 152.013 1.00 0.00 ? 1009 ARG A NH1   1 
ATOM   7902  N  NH2   . ARG A  1  1009 ? 224.392 212.699 154.085 1.00 0.00 ? 1009 ARG A NH2   1 
ATOM   7903  N  N     . GLU A  1  1010 ? 226.617 208.618 157.658 1.00 0.00 ? 1010 GLU A N     1 
ATOM   7904  C  CA    . GLU A  1  1010 ? 227.111 209.284 158.859 1.00 0.00 ? 1010 GLU A CA    1 
ATOM   7905  C  C     . GLU A  1  1010 ? 227.809 208.301 159.789 1.00 0.00 ? 1010 GLU A C     1 
ATOM   7906  O  O     . GLU A  1  1010 ? 228.734 208.676 160.516 1.00 0.00 ? 1010 GLU A O     1 
ATOM   7907  C  CB    . GLU A  1  1010 ? 225.960 209.982 159.577 1.00 0.00 ? 1010 GLU A CB    1 
ATOM   7908  C  CG    . GLU A  1  1010 ? 226.378 210.752 160.810 1.00 0.00 ? 1010 GLU A CG    1 
ATOM   7909  C  CD    . GLU A  1  1010 ? 225.217 211.472 161.461 1.00 0.00 ? 1010 GLU A CD    1 
ATOM   7910  O  OE1   . GLU A  1  1010 ? 224.079 211.358 160.958 1.00 0.00 ? 1010 GLU A OE1   1 
ATOM   7911  O  OE2   . GLU A  1  1010 ? 225.443 212.151 162.482 1.00 0.00 ? 1010 GLU A OE2   1 
ATOM   7912  N  N     . TYR A  1  1011 ? 227.383 207.042 159.778 1.00 0.00 ? 1011 TYR A N     1 
ATOM   7913  C  CA    . TYR A  1  1011 ? 228.071 206.024 160.557 1.00 0.00 ? 1011 TYR A CA    1 
ATOM   7914  C  C     . TYR A  1  1011 ? 229.477 205.799 160.030 1.00 0.00 ? 1011 TYR A C     1 
ATOM   7915  O  O     . TYR A  1  1011 ? 230.448 205.872 160.792 1.00 0.00 ? 1011 TYR A O     1 
ATOM   7916  C  CB    . TYR A  1  1011 ? 227.280 204.721 160.538 1.00 0.00 ? 1011 TYR A CB    1 
ATOM   7917  C  CG    . TYR A  1  1011 ? 228.001 203.581 161.205 1.00 0.00 ? 1011 TYR A CG    1 
ATOM   7918  C  CD1   . TYR A  1  1011 ? 228.029 203.462 162.579 1.00 0.00 ? 1011 TYR A CD1   1 
ATOM   7919  C  CD2   . TYR A  1  1011 ? 228.669 202.634 160.459 1.00 0.00 ? 1011 TYR A CD2   1 
ATOM   7920  C  CE1   . TYR A  1  1011 ? 228.695 202.424 163.186 1.00 0.00 ? 1011 TYR A CE1   1 
ATOM   7921  C  CE2   . TYR A  1  1011 ? 229.331 201.597 161.059 1.00 0.00 ? 1011 TYR A CE2   1 
ATOM   7922  C  CZ    . TYR A  1  1011 ? 229.343 201.496 162.421 1.00 0.00 ? 1011 TYR A CZ    1 
ATOM   7923  O  OH    . TYR A  1  1011 ? 230.012 200.456 163.019 1.00 0.00 ? 1011 TYR A OH    1 
ATOM   7924  N  N     . ILE A  1  1012 ? 229.608 205.531 158.730 1.00 0.00 ? 1012 ILE A N     1 
ATOM   7925  C  CA    . ILE A  1  1012 ? 230.940 205.340 158.168 1.00 0.00 ? 1012 ILE A CA    1 
ATOM   7926  C  C     . ILE A  1  1012 ? 231.819 206.548 158.448 1.00 0.00 ? 1012 ILE A C     1 
ATOM   7927  O  O     . ILE A  1  1012 ? 232.969 206.409 158.876 1.00 0.00 ? 1012 ILE A O     1 
ATOM   7928  C  CB    . ILE A  1  1012 ? 230.849 205.052 156.664 1.00 0.00 ? 1012 ILE A CB    1 
ATOM   7929  C  CG1   . ILE A  1  1012 ? 230.134 203.729 156.441 1.00 0.00 ? 1012 ILE A CG1   1 
ATOM   7930  C  CG2   . ILE A  1  1012 ? 232.221 204.983 156.058 1.00 0.00 ? 1012 ILE A CG2   1 
ATOM   7931  C  CD1   . ILE A  1  1012 ? 229.868 203.428 154.999 1.00 0.00 ? 1012 ILE A CD1   1 
ATOM   7932  N  N     . ASN A  1  1013 ? 231.295 207.747 158.208 1.00 0.00 ? 1013 ASN A N     1 
ATOM   7933  C  CA    . ASN A  1  1013 ? 232.030 208.961 158.538 1.00 0.00 ? 1013 ASN A CA    1 
ATOM   7934  C  C     . ASN A  1  1013 ? 232.514 208.929 159.978 1.00 0.00 ? 1013 ASN A C     1 
ATOM   7935  O  O     . ASN A  1  1013 ? 233.724 208.954 160.232 1.00 0.00 ? 1013 ASN A O     1 
ATOM   7936  C  CB    . ASN A  1  1013 ? 231.150 210.184 158.286 1.00 0.00 ? 1013 ASN A CB    1 
ATOM   7937  C  CG    . ASN A  1  1013 ? 231.908 211.490 158.416 1.00 0.00 ? 1013 ASN A CG    1 
ATOM   7938  O  OD1   . ASN A  1  1013 ? 232.961 211.557 159.045 1.00 0.00 ? 1013 ASN A OD1   1 
ATOM   7939  N  ND2   . ASN A  1  1013 ? 231.371 212.540 157.812 1.00 0.00 ? 1013 ASN A ND2   1 
ATOM   7940  N  N     . GLY A  1  1014 ? 231.582 208.869 160.928 1.00 0.00 ? 1014 GLY A N     1 
ATOM   7941  C  CA    . GLY A  1  1014 ? 231.927 208.814 162.335 1.00 0.00 ? 1014 GLY A CA    1 
ATOM   7942  C  C     . GLY A  1  1014 ? 232.965 207.768 162.677 1.00 0.00 ? 1014 GLY A C     1 
ATOM   7943  O  O     . GLY A  1  1014 ? 233.712 207.947 163.644 1.00 0.00 ? 1014 GLY A O     1 
ATOM   7944  N  N     . LYS A  1  1015 ? 233.024 206.673 161.922 1.00 0.00 ? 1015 LYS A N     1 
ATOM   7945  C  CA    . LYS A  1  1015 ? 234.104 205.728 162.158 1.00 0.00 ? 1015 LYS A CA    1 
ATOM   7946  C  C     . LYS A  1  1015 ? 235.427 206.219 161.586 1.00 0.00 ? 1015 LYS A C     1 
ATOM   7947  O  O     . LYS A  1  1015 ? 236.457 206.143 162.262 1.00 0.00 ? 1015 LYS A O     1 
ATOM   7948  C  CB    . LYS A  1  1015 ? 233.759 204.359 161.578 1.00 0.00 ? 1015 LYS A CB    1 
ATOM   7949  C  CG    . LYS A  1  1015 ? 234.822 203.319 161.857 1.00 0.00 ? 1015 LYS A CG    1 
ATOM   7950  C  CD    . LYS A  1  1015 ? 234.419 201.958 161.337 1.00 0.00 ? 1015 LYS A CD    1 
ATOM   7951  C  CE    . LYS A  1  1015 ? 233.258 201.386 162.131 1.00 0.00 ? 1015 LYS A CE    1 
ATOM   7952  N  NZ    . LYS A  1  1015 ? 233.640 201.123 163.546 1.00 0.00 ? 1015 LYS A NZ    1 
ATOM   7953  N  N     . ALA A  1  1016 ? 235.419 206.732 160.356 1.00 0.00 ? 1016 ALA A N     1 
ATOM   7954  C  CA    . ALA A  1  1016 ? 236.654 207.215 159.752 1.00 0.00 ? 1016 ALA A CA    1 
ATOM   7955  C  C     . ALA A  1  1016 ? 237.289 208.326 160.574 1.00 0.00 ? 1016 ALA A C     1 
ATOM   7956  O  O     . ALA A  1  1016 ? 238.505 208.309 160.810 1.00 0.00 ? 1016 ALA A O     1 
ATOM   7957  C  CB    . ALA A  1  1016 ? 236.385 207.703 158.332 1.00 0.00 ? 1016 ALA A CB    1 
ATOM   7958  N  N     . THR A  1  1017 ? 236.486 209.294 161.019 1.00 0.00 ? 1017 THR A N     1 
ATOM   7959  C  CA    . THR A  1  1017 ? 237.020 210.399 161.801 1.00 0.00 ? 1017 THR A CA    1 
ATOM   7960  C  C     . THR A  1  1017 ? 237.718 209.919 163.062 1.00 0.00 ? 1017 THR A C     1 
ATOM   7961  O  O     . THR A  1  1017 ? 238.609 210.611 163.556 1.00 0.00 ? 1017 THR A O     1 
ATOM   7962  C  CB    . THR A  1  1017 ? 235.908 211.390 162.160 1.00 0.00 ? 1017 THR A CB    1 
ATOM   7963  O  OG1   . THR A  1  1017 ? 236.479 212.549 162.777 1.00 0.00 ? 1017 THR A OG1   1 
ATOM   7964  C  CG2   . THR A  1  1017 ? 234.913 210.769 163.114 1.00 0.00 ? 1017 THR A CG2   1 
ATOM   7965  N  N     . ALA A  1  1018 ? 237.345 208.754 163.588 1.00 0.00 ? 1018 ALA A N     1 
ATOM   7966  C  CA    . ALA A  1  1018 ? 238.093 208.198 164.705 1.00 0.00 ? 1018 ALA A CA    1 
ATOM   7967  C  C     . ALA A  1  1018 ? 239.470 207.732 164.262 1.00 0.00 ? 1018 ALA A C     1 
ATOM   7968  O  O     . ALA A  1  1018 ? 240.473 208.048 164.916 1.00 0.00 ? 1018 ALA A O     1 
ATOM   7969  C  CB    . ALA A  1  1018 ? 237.317 207.046 165.337 1.00 0.00 ? 1018 ALA A CB    1 
ATOM   7970  N  N     . LEU A  1  1019 ? 239.535 206.982 163.159 1.00 0.00 ? 1019 LEU A N     1 
ATOM   7971  C  CA    . LEU A  1  1019 ? 240.824 206.633 162.582 1.00 0.00 ? 1019 LEU A CA    1 
ATOM   7972  C  C     . LEU A  1  1019 ? 241.716 207.851 162.444 1.00 0.00 ? 1019 LEU A C     1 
ATOM   7973  O  O     . LEU A  1  1019 ? 242.872 207.827 162.881 1.00 0.00 ? 1019 LEU A O     1 
ATOM   7974  C  CB    . LEU A  1  1019 ? 240.634 205.979 161.220 1.00 0.00 ? 1019 LEU A CB    1 
ATOM   7975  C  CG    . LEU A  1  1019 ? 241.938 205.771 160.456 1.00 0.00 ? 1019 LEU A CG    1 
ATOM   7976  C  CD1   . LEU A  1  1019 ? 242.852 204.836 161.211 1.00 0.00 ? 1019 LEU A CD1   1 
ATOM   7977  C  CD2   . LEU A  1  1019 ? 241.670 205.250 159.063 1.00 0.00 ? 1019 LEU A CD2   1 
ATOM   7978  N  N     . ALA A  1  1020 ? 241.193 208.928 161.865 1.00 0.00 ? 1020 ALA A N     1 
ATOM   7979  C  CA    . ALA A  1  1020 ? 241.981 210.147 161.759 1.00 0.00 ? 1020 ALA A CA    1 
ATOM   7980  C  C     . ALA A  1  1020 ? 242.351 210.694 163.133 1.00 0.00 ? 1020 ALA A C     1 
ATOM   7981  O  O     . ALA A  1  1020 ? 243.474 211.173 163.331 1.00 0.00 ? 1020 ALA A O     1 
ATOM   7982  C  CB    . ALA A  1  1020 ? 241.216 211.192 160.952 1.00 0.00 ? 1020 ALA A CB    1 
ATOM   7983  N  N     . ASN A  1  1021 ? 241.423 210.619 164.091 1.00 0.00 ? 1021 ASN A N     1 
ATOM   7984  C  CA    . ASN A  1  1021 ? 241.688 211.138 165.428 1.00 0.00 ? 1021 ASN A CA    1 
ATOM   7985  C  C     . ASN A  1  1021 ? 242.908 210.477 166.044 1.00 0.00 ? 1021 ASN A C     1 
ATOM   7986  O  O     . ASN A  1  1021 ? 243.790 211.163 166.571 1.00 0.00 ? 1021 ASN A O     1 
ATOM   7987  C  CB    . ASN A  1  1021 ? 240.470 210.948 166.329 1.00 0.00 ? 1021 ASN A CB    1 
ATOM   7988  C  CG    . ASN A  1  1021 ? 239.369 211.935 166.031 1.00 0.00 ? 1021 ASN A CG    1 
ATOM   7989  O  OD1   . ASN A  1  1021 ? 239.620 213.019 165.506 1.00 0.00 ? 1021 ASN A OD1   1 
ATOM   7990  N  ND2   . ASN A  1  1021 ? 238.139 211.567 166.360 1.00 0.00 ? 1021 ASN A ND2   1 
ATOM   7991  N  N     . LEU A  1  1022 ? 242.980 209.152 165.995 1.00 0.00 ? 1022 LEU A N     1 
ATOM   7992  C  CA    . LEU A  1  1022 ? 244.198 208.517 166.468 1.00 0.00 ? 1022 LEU A CA    1 
ATOM   7993  C  C     . LEU A  1  1022 ? 245.392 208.862 165.603 1.00 0.00 ? 1022 LEU A C     1 
ATOM   7994  O  O     . LEU A  1  1022 ? 246.436 209.241 166.145 1.00 0.00 ? 1022 LEU A O     1 
ATOM   7995  C  CB    . LEU A  1  1022 ? 244.033 207.001 166.536 1.00 0.00 ? 1022 LEU A CB    1 
ATOM   7996  C  CG    . LEU A  1  1022 ? 243.506 206.486 167.878 1.00 0.00 ? 1022 LEU A CG    1 
ATOM   7997  C  CD1   . LEU A  1  1022 ? 242.079 206.937 168.155 1.00 0.00 ? 1022 LEU A CD1   1 
ATOM   7998  C  CD2   . LEU A  1  1022 ? 243.613 204.979 167.933 1.00 0.00 ? 1022 LEU A CD2   1 
ATOM   7999  N  N     . ARG A  1  1023 ? 245.245 208.773 164.281 1.00 0.00 ? 1023 ARG A N     1 
ATOM   8000  C  CA    . ARG A  1  1023 ? 246.363 209.023 163.384 1.00 0.00 ? 1023 ARG A CA    1 
ATOM   8001  C  C     . ARG A  1  1023 ? 247.075 210.321 163.734 1.00 0.00 ? 1023 ARG A C     1 
ATOM   8002  O  O     . ARG A  1  1023 ? 248.298 210.330 163.905 1.00 0.00 ? 1023 ARG A O     1 
ATOM   8003  C  CB    . ARG A  1  1023 ? 245.873 209.051 161.939 1.00 0.00 ? 1023 ARG A CB    1 
ATOM   8004  C  CG    . ARG A  1  1023 ? 246.981 209.108 160.911 1.00 0.00 ? 1023 ARG A CG    1 
ATOM   8005  C  CD    . ARG A  1  1023 ? 246.406 209.075 159.515 1.00 0.00 ? 1023 ARG A CD    1 
ATOM   8006  N  NE    . ARG A  1  1023 ? 247.434 209.135 158.485 1.00 0.00 ? 1023 ARG A NE    1 
ATOM   8007  C  CZ    . ARG A  1  1023 ? 248.072 208.074 158.007 1.00 0.00 ? 1023 ARG A CZ    1 
ATOM   8008  N  NH1   . ARG A  1  1023 ? 247.785 206.866 158.466 1.00 0.00 ? 1023 ARG A NH1   1 
ATOM   8009  N  NH2   . ARG A  1  1023 ? 248.993 208.223 157.067 1.00 0.00 ? 1023 ARG A NH2   1 
ATOM   8010  N  N     . LYS A  1  1024 ? 246.328 211.416 163.892 1.00 0.00 ? 1024 LYS A N     1 
ATOM   8011  C  CA    . LYS A  1  1024 ? 246.972 212.649 164.323 1.00 0.00 ? 1024 LYS A CA    1 
ATOM   8012  C  C     . LYS A  1  1024 ? 247.524 212.548 165.740 1.00 0.00 ? 1024 LYS A C     1 
ATOM   8013  O  O     . LYS A  1  1024 ? 248.707 212.838 165.945 1.00 0.00 ? 1024 LYS A O     1 
ATOM   8014  C  CB    . LYS A  1  1024 ? 246.016 213.843 164.217 1.00 0.00 ? 1024 LYS A CB    1 
ATOM   8015  C  CG    . LYS A  1  1024 ? 244.753 213.746 165.054 1.00 0.00 ? 1024 LYS A CG    1 
ATOM   8016  C  CD    . LYS A  1  1024 ? 243.970 215.047 165.030 1.00 0.00 ? 1024 LYS A CD    1 
ATOM   8017  C  CE    . LYS A  1  1024 ? 243.425 215.356 163.652 1.00 0.00 ? 1024 LYS A CE    1 
ATOM   8018  N  NZ    . LYS A  1  1024 ? 242.643 216.623 163.651 1.00 0.00 ? 1024 LYS A NZ    1 
ATOM   8019  N  N     . SER A  1  1025 ? 246.713 212.124 166.715 1.00 0.00 ? 1025 SER A N     1 
ATOM   8020  C  CA    . SER A  1  1025 ? 247.180 212.075 168.096 1.00 0.00 ? 1025 SER A CA    1 
ATOM   8021  C  C     . SER A  1  1025 ? 248.303 211.069 168.280 1.00 0.00 ? 1025 SER A C     1 
ATOM   8022  O  O     . SER A  1  1025 ? 248.979 211.092 169.313 1.00 0.00 ? 1025 SER A O     1 
ATOM   8023  C  CB    . SER A  1  1025 ? 246.025 211.750 169.043 1.00 0.00 ? 1025 SER A CB    1 
ATOM   8024  O  OG    . SER A  1  1025 ? 246.479 211.690 170.385 1.00 0.00 ? 1025 SER A OG    1 
ATOM   8025  N  N     . ARG A  1  1026 ? 248.523 210.203 167.301 1.00 0.00 ? 1026 ARG A N     1 
ATOM   8026  C  CA    . ARG A  1  1026 ? 249.701 209.354 167.283 1.00 0.00 ? 1026 ARG A CA    1 
ATOM   8027  C  C     . ARG A  1  1026 ? 250.881 210.035 166.613 1.00 0.00 ? 1026 ARG A C     1 
ATOM   8028  O  O     . ARG A  1  1026 ? 251.914 209.392 166.405 1.00 0.00 ? 1026 ARG A O     1 
ATOM   8029  C  CB    . ARG A  1  1026 ? 249.384 208.029 166.593 1.00 0.00 ? 1026 ARG A CB    1 
ATOM   8030  C  CG    . ARG A  1  1026 ? 248.362 207.197 167.343 1.00 0.00 ? 1026 ARG A CG    1 
ATOM   8031  C  CD    . ARG A  1  1026 ? 248.949 206.577 168.595 1.00 0.00 ? 1026 ARG A CD    1 
ATOM   8032  N  NE    . ARG A  1  1026 ? 249.923 205.545 168.265 1.00 0.00 ? 1026 ARG A NE    1 
ATOM   8033  C  CZ    . ARG A  1  1026 ? 250.658 204.898 169.159 1.00 0.00 ? 1026 ARG A CZ    1 
ATOM   8034  N  NH1   . ARG A  1  1026 ? 250.535 205.176 170.448 1.00 0.00 ? 1026 ARG A NH1   1 
ATOM   8035  N  NH2   . ARG A  1  1026 ? 251.514 203.972 168.759 1.00 0.00 ? 1026 ARG A NH2   1 
ATOM   8036  N  N     . GLY A  1  1027 ? 250.751 211.314 166.272 1.00 0.00 ? 1027 GLY A N     1 
ATOM   8037  C  CA    . GLY A  1  1027 ? 251.841 212.074 165.699 1.00 0.00 ? 1027 GLY A CA    1 
ATOM   8038  C  C     . GLY A  1  1027 ? 251.682 212.451 164.245 1.00 0.00 ? 1027 GLY A C     1 
ATOM   8039  O  O     . GLY A  1  1027 ? 252.546 213.159 163.716 1.00 0.00 ? 1027 GLY A O     1 
ATOM   8040  N  N     . MET A  1  1028 ? 250.634 211.991 163.568 1.00 0.00 ? 1028 MET A N     1 
ATOM   8041  C  CA    . MET A  1  1028 ? 250.470 212.322 162.159 1.00 0.00 ? 1028 MET A CA    1 
ATOM   8042  C  C     . MET A  1  1028 ? 249.592 213.542 161.935 1.00 0.00 ? 1028 MET A C     1 
ATOM   8043  O  O     . MET A  1  1028 ? 249.265 214.273 162.875 1.00 0.00 ? 1028 MET A O     1 
ATOM   8044  C  CB    . MET A  1  1028 ? 249.893 211.136 161.396 1.00 0.00 ? 1028 MET A CB    1 
ATOM   8045  C  CG    . MET A  1  1028 ? 250.808 209.950 161.381 1.00 0.00 ? 1028 MET A CG    1 
ATOM   8046  S  SD    . MET A  1  1028 ? 252.377 210.438 160.662 1.00 0.00 ? 1028 MET A SD    1 
ATOM   8047  C  CE    . MET A  1  1028 ? 253.443 210.461 162.102 1.00 0.00 ? 1028 MET A CE    1 
ATOM   8048  N  N     . LEU A  1  1029 ? 249.236 213.777 160.678 1.00 0.00 ? 1029 LEU A N     1 
ATOM   8049  C  CA    . LEU A  1  1029 ? 248.265 214.793 160.315 1.00 0.00 ? 1029 LEU A CA    1 
ATOM   8050  C  C     . LEU A  1  1029 ? 246.910 214.122 160.173 1.00 0.00 ? 1029 LEU A C     1 
ATOM   8051  O  O     . LEU A  1  1029 ? 246.810 213.006 159.656 1.00 0.00 ? 1029 LEU A O     1 
ATOM   8052  C  CB    . LEU A  1  1029 ? 248.674 215.508 159.017 1.00 0.00 ? 1029 LEU A CB    1 
ATOM   8053  C  CG    . LEU A  1  1029 ? 248.832 214.694 157.725 1.00 0.00 ? 1029 LEU A CG    1 
ATOM   8054  C  CD1   . LEU A  1  1029 ? 247.515 214.494 156.982 1.00 0.00 ? 1029 LEU A CD1   1 
ATOM   8055  C  CD2   . LEU A  1  1029 ? 249.863 215.330 156.815 1.00 0.00 ? 1029 LEU A CD2   1 
ATOM   8056  N  N     . GLY A  1  1030 ? 245.869 214.787 160.666 1.00 0.00 ? 1030 GLY A N     1 
ATOM   8057  C  CA    . GLY A  1  1030 ? 244.544 214.263 160.421 1.00 0.00 ? 1030 GLY A CA    1 
ATOM   8058  C  C     . GLY A  1  1030 ? 244.239 214.357 158.944 1.00 0.00 ? 1030 GLY A C     1 
ATOM   8059  O  O     . GLY A  1  1030 ? 244.205 215.450 158.375 1.00 0.00 ? 1030 GLY A O     1 
ATOM   8060  N  N     . LEU A  1  1031 ? 244.018 213.216 158.308 1.00 0.00 ? 1031 LEU A N     1 
ATOM   8061  C  CA    . LEU A  1  1031 ? 243.826 213.195 156.867 1.00 0.00 ? 1031 LEU A CA    1 
ATOM   8062  C  C     . LEU A  1  1031 ? 242.333 213.128 156.559 1.00 0.00 ? 1031 LEU A C     1 
ATOM   8063  O  O     . LEU A  1  1031 ? 241.929 212.941 155.408 1.00 0.00 ? 1031 LEU A O     1 
ATOM   8064  C  CB    . LEU A  1  1031 ? 244.628 212.050 156.249 1.00 0.00 ? 1031 LEU A CB    1 
ATOM   8065  C  CG    . LEU A  1  1031 ? 244.735 212.024 154.726 1.00 0.00 ? 1031 LEU A CG    1 
ATOM   8066  C  CD1   . LEU A  1  1031 ? 245.361 213.318 154.234 1.00 0.00 ? 1031 LEU A CD1   1 
ATOM   8067  C  CD2   . LEU A  1  1031 ? 245.561 210.839 154.259 1.00 0.00 ? 1031 LEU A CD2   1 
ATOM   8068  N  N     . LEU A  1  1032 ? 241.506 213.308 157.592 1.00 0.00 ? 1032 LEU A N     1 
ATOM   8069  C  CA    . LEU A  1  1032 ? 240.059 213.127 157.553 1.00 0.00 ? 1032 LEU A CA    1 
ATOM   8070  C  C     . LEU A  1  1032 ? 239.401 213.837 156.380 1.00 0.00 ? 1032 LEU A C     1 
ATOM   8071  O  O     . LEU A  1  1032 ? 238.274 213.497 156.006 1.00 0.00 ? 1032 LEU A O     1 
ATOM   8072  C  CB    . LEU A  1  1032 ? 239.448 213.635 158.859 1.00 0.00 ? 1032 LEU A CB    1 
ATOM   8073  C  CG    . LEU A  1  1032 ? 239.599 215.129 159.185 1.00 0.00 ? 1032 LEU A CG    1 
ATOM   8074  C  CD1   . LEU A  1  1032 ? 238.536 216.014 158.527 1.00 0.00 ? 1032 LEU A CD1   1 
ATOM   8075  C  CD2   . LEU A  1  1032 ? 239.617 215.353 160.681 1.00 0.00 ? 1032 LEU A CD2   1 
ATOM   8076  N  N     . GLU A  1  1033 ? 240.076 214.799 155.799 1.00 0.00 ? 1033 GLU A N     1 
ATOM   8077  C  CA    . GLU A  1  1033 ? 239.601 215.722 154.800 1.00 0.00 ? 1033 GLU A CA    1 
ATOM   8078  C  C     . GLU A  1  1033 ? 240.248 215.387 153.460 1.00 0.00 ? 1033 GLU A C     1 
ATOM   8079  O  O     . GLU A  1  1033 ? 241.365 214.859 153.432 1.00 0.00 ? 1033 GLU A O     1 
ATOM   8080  C  CB    . GLU A  1  1033 ? 239.979 217.142 155.241 1.00 0.00 ? 1033 GLU A CB    1 
ATOM   8081  C  CG    . GLU A  1  1033 ? 239.482 218.282 154.387 1.00 0.00 ? 1033 GLU A CG    1 
ATOM   8082  C  CD    . GLU A  1  1033 ? 239.895 219.627 154.930 1.00 0.00 ? 1033 GLU A CD    1 
ATOM   8083  O  OE1   . GLU A  1  1033 ? 240.603 219.658 155.959 1.00 0.00 ? 1033 GLU A OE1   1 
ATOM   8084  O  OE2   . GLU A  1  1033 ? 239.516 220.651 154.325 1.00 0.00 ? 1033 GLU A OE2   1 
ATOM   8085  N  N     . PRO A  1  1034 ? 239.578 215.646 152.338 1.00 0.00 ? 1034 PRO A N     1 
ATOM   8086  C  CA    . PRO A  1  1034 ? 240.165 215.329 151.032 1.00 0.00 ? 1034 PRO A CA    1 
ATOM   8087  C  C     . PRO A  1  1034 ? 241.533 215.967 150.876 1.00 0.00 ? 1034 PRO A C     1 
ATOM   8088  O  O     . PRO A  1  1034 ? 241.825 216.993 151.511 1.00 0.00 ? 1034 PRO A O     1 
ATOM   8089  C  CB    . PRO A  1  1034 ? 239.147 215.911 150.039 1.00 0.00 ? 1034 PRO A CB    1 
ATOM   8090  C  CG    . PRO A  1  1034 ? 238.344 216.889 150.843 1.00 0.00 ? 1034 PRO A CG    1 
ATOM   8091  C  CD    . PRO A  1  1034 ? 238.229 216.205 152.169 1.00 0.00 ? 1034 PRO A CD    1 
ATOM   8092  N  N     . PRO A  1  1035 ? 242.395 215.396 150.037 1.00 0.00 ? 1035 PRO A N     1 
ATOM   8093  C  CA    . PRO A  1  1035 ? 243.807 215.778 150.050 1.00 0.00 ? 1035 PRO A CA    1 
ATOM   8094  C  C     . PRO A  1  1035 ? 243.989 217.234 149.662 1.00 0.00 ? 1035 PRO A C     1 
ATOM   8095  O  O     . PRO A  1  1035 ? 243.075 217.898 149.171 1.00 0.00 ? 1035 PRO A O     1 
ATOM   8096  C  CB    . PRO A  1  1035 ? 244.438 214.845 149.013 1.00 0.00 ? 1035 PRO A CB    1 
ATOM   8097  C  CG    . PRO A  1  1035 ? 243.341 214.572 148.063 1.00 0.00 ? 1035 PRO A CG    1 
ATOM   8098  C  CD    . PRO A  1  1035 ? 242.075 214.541 148.880 1.00 0.00 ? 1035 PRO A CD    1 
ATOM   8099  N  N     . ALA A  1  1036 ? 245.196 217.730 149.898 1.00 0.00 ? 1036 ALA A N     1 
ATOM   8100  C  CA    . ALA A  1  1036 ? 245.479 219.134 149.653 1.00 0.00 ? 1036 ALA A CA    1 
ATOM   8101  C  C     . ALA A  1  1036 ? 245.445 219.385 148.148 1.00 0.00 ? 1036 ALA A C     1 
ATOM   8102  O  O     . ALA A  1  1036 ? 245.271 218.471 147.336 1.00 0.00 ? 1036 ALA A O     1 
ATOM   8103  C  CB    . ALA A  1  1036 ? 246.818 219.519 150.274 1.00 0.00 ? 1036 ALA A CB    1 
ATOM   8104  N  N     . LYS A  1  1037 ? 245.628 220.647 147.761 1.00 0.00 ? 1037 LYS A N     1 
ATOM   8105  C  CA    . LYS A  1  1037 ? 245.395 221.036 146.376 1.00 0.00 ? 1037 LYS A CA    1 
ATOM   8106  C  C     . LYS A  1  1037 ? 246.341 220.311 145.429 1.00 0.00 ? 1037 LYS A C     1 
ATOM   8107  O  O     . LYS A  1  1037 ? 245.997 220.060 144.267 1.00 0.00 ? 1037 LYS A O     1 
ATOM   8108  C  CB    . LYS A  1  1037 ? 245.539 222.549 146.231 1.00 0.00 ? 1037 LYS A CB    1 
ATOM   8109  C  CG    . LYS A  1  1037 ? 245.290 223.039 144.827 1.00 0.00 ? 1037 LYS A CG    1 
ATOM   8110  C  CD    . LYS A  1  1037 ? 243.902 222.630 144.373 1.00 0.00 ? 1037 LYS A CD    1 
ATOM   8111  C  CE    . LYS A  1  1037 ? 243.512 223.342 143.096 1.00 0.00 ? 1037 LYS A CE    1 
ATOM   8112  N  NZ    . LYS A  1  1037 ? 244.461 223.008 141.999 1.00 0.00 ? 1037 LYS A NZ    1 
ATOM   8113  N  N     . GLU A  1  1038 ? 247.523 219.949 145.910 1.00 0.00 ? 1038 GLU A N     1 
ATOM   8114  C  CA    . GLU A  1  1038 ? 248.497 219.274 145.074 1.00 0.00 ? 1038 GLU A CA    1 
ATOM   8115  C  C     . GLU A  1  1038 ? 247.996 217.882 144.697 1.00 0.00 ? 1038 GLU A C     1 
ATOM   8116  O  O     . GLU A  1  1038 ? 247.163 217.281 145.381 1.00 0.00 ? 1038 GLU A O     1 
ATOM   8117  C  CB    . GLU A  1  1038 ? 249.846 219.198 145.790 1.00 0.00 ? 1038 GLU A CB    1 
ATOM   8118  C  CG    . GLU A  1  1038 ? 250.982 218.638 144.950 1.00 0.00 ? 1038 GLU A CG    1 
ATOM   8119  C  CD    . GLU A  1  1038 ? 252.304 218.636 145.686 1.00 0.00 ? 1038 GLU A CD    1 
ATOM   8120  O  OE1   . GLU A  1  1038 ? 252.328 219.041 146.867 1.00 0.00 ? 1038 GLU A OE1   1 
ATOM   8121  O  OE2   . GLU A  1  1038 ? 253.319 218.231 145.083 1.00 0.00 ? 1038 GLU A OE2   1 
ATOM   8122  N  N     . LEU A  1  1039 ? 248.513 217.379 143.579 1.00 0.00 ? 1039 LEU A N     1 
ATOM   8123  C  CA    . LEU A  1  1039 ? 248.071 216.104 143.038 1.00 0.00 ? 1039 LEU A CA    1 
ATOM   8124  C  C     . LEU A  1  1039 ? 248.418 214.960 143.984 1.00 0.00 ? 1039 LEU A C     1 
ATOM   8125  O  O     . LEU A  1  1039 ? 249.322 215.061 144.818 1.00 0.00 ? 1039 LEU A O     1 
ATOM   8126  C  CB    . LEU A  1  1039 ? 248.713 215.878 141.667 1.00 0.00 ? 1039 LEU A CB    1 
ATOM   8127  C  CG    . LEU A  1  1039 ? 248.445 214.582 140.902 1.00 0.00 ? 1039 LEU A CG    1 
ATOM   8128  C  CD1   . LEU A  1  1039 ? 246.966 214.444 140.584 1.00 0.00 ? 1039 LEU A CD1   1 
ATOM   8129  C  CD2   . LEU A  1  1039 ? 249.276 214.542 139.632 1.00 0.00 ? 1039 LEU A CD2   1 
ATOM   8130  N  N     . GLN A  1  1040 ? 247.675 213.863 143.850 1.00 0.00 ? 1040 GLN A N     1 
ATOM   8131  C  CA    . GLN A  1  1040 ? 247.946 212.661 144.625 1.00 0.00 ? 1040 GLN A CA    1 
ATOM   8132  C  C     . GLN A  1  1040 ? 249.324 212.114 144.268 1.00 0.00 ? 1040 GLN A C     1 
ATOM   8133  O  O     . GLN A  1  1040 ? 249.854 212.388 143.188 1.00 0.00 ? 1040 GLN A O     1 
ATOM   8134  C  CB    . GLN A  1  1040 ? 246.858 211.618 144.354 1.00 0.00 ? 1040 GLN A CB    1 
ATOM   8135  C  CG    . GLN A  1  1040 ? 246.974 210.332 145.157 1.00 0.00 ? 1040 GLN A CG    1 
ATOM   8136  C  CD    . GLN A  1  1040 ? 246.836 210.562 146.648 1.00 0.00 ? 1040 GLN A CD    1 
ATOM   8137  O  OE1   . GLN A  1  1040 ? 247.829 210.604 147.375 1.00 0.00 ? 1040 GLN A OE1   1 
ATOM   8138  N  NE2   . GLN A  1  1040 ? 245.600 210.713 147.112 1.00 0.00 ? 1040 GLN A NE2   1 
ATOM   8139  N  N     . GLY A  1  1041 ? 249.907 211.343 145.183 1.00 0.00 ? 1041 GLY A N     1 
ATOM   8140  C  CA    . GLY A  1  1041 ? 251.262 210.860 145.014 1.00 0.00 ? 1041 GLY A CA    1 
ATOM   8141  C  C     . GLY A  1  1041 ? 252.223 211.569 145.943 1.00 0.00 ? 1041 GLY A C     1 
ATOM   8142  O  O     . GLY A  1  1041 ? 253.428 211.299 145.937 1.00 0.00 ? 1041 GLY A O     1 
ATOM   8143  N  N     . ILE A  1  1042 ? 251.688 212.486 146.748 1.00 0.00 ? 1042 ILE A N     1 
ATOM   8144  C  CA    . ILE A  1  1042 ? 252.484 213.112 147.795 1.00 0.00 ? 1042 ILE A CA    1 
ATOM   8145  C  C     . ILE A  1  1042 ? 252.872 212.087 148.852 1.00 0.00 ? 1042 ILE A C     1 
ATOM   8146  O  O     . ILE A  1  1042 ? 253.944 212.192 149.462 1.00 0.00 ? 1042 ILE A O     1 
ATOM   8147  C  CB    . ILE A  1  1042 ? 251.709 214.287 148.412 1.00 0.00 ? 1042 ILE A CB    1 
ATOM   8148  C  CG1   . ILE A  1  1042 ? 251.439 215.356 147.357 1.00 0.00 ? 1042 ILE A CG1   1 
ATOM   8149  C  CG2   . ILE A  1  1042 ? 252.474 214.898 149.574 1.00 0.00 ? 1042 ILE A CG2   1 
ATOM   8150  C  CD1   . ILE A  1  1042 ? 250.478 216.411 147.826 1.00 0.00 ? 1042 ILE A CD1   1 
ATOM   8151  N  N     . ASP A  1  1043 ? 252.028 211.072 149.061 1.00 0.00 ? 1043 ASP A N     1 
ATOM   8152  C  CA    . ASP A  1  1043 ? 252.210 210.052 150.086 1.00 0.00 ? 1043 ASP A CA    1 
ATOM   8153  C  C     . ASP A  1  1043 ? 252.423 210.738 151.429 1.00 0.00 ? 1043 ASP A C     1 
ATOM   8154  O  O     . ASP A  1  1043 ? 253.551 210.781 151.935 1.00 0.00 ? 1043 ASP A O     1 
ATOM   8155  C  CB    . ASP A  1  1043 ? 253.382 209.132 149.742 1.00 0.00 ? 1043 ASP A CB    1 
ATOM   8156  C  CG    . ASP A  1  1043 ? 253.527 207.987 150.719 1.00 0.00 ? 1043 ASP A CG    1 
ATOM   8157  O  OD1   . ASP A  1  1043 ? 252.636 207.111 150.745 1.00 0.00 ? 1043 ASP A OD1   1 
ATOM   8158  O  OD2   . ASP A  1  1043 ? 254.527 207.964 151.467 1.00 0.00 ? 1043 ASP A OD2   1 
ATOM   8159  N  N     . PRO A  1  1044 ? 251.367 211.298 152.022 1.00 0.00 ? 1044 PRO A N     1 
ATOM   8160  C  CA    . PRO A  1  1044 ? 251.550 212.169 153.195 1.00 0.00 ? 1044 PRO A CA    1 
ATOM   8161  C  C     . PRO A  1  1044 ? 252.290 211.515 154.348 1.00 0.00 ? 1044 PRO A C     1 
ATOM   8162  O  O     . PRO A  1  1044 ? 252.795 212.224 155.226 1.00 0.00 ? 1044 PRO A O     1 
ATOM   8163  C  CB    . PRO A  1  1044 ? 250.109 212.523 153.584 1.00 0.00 ? 1044 PRO A CB    1 
ATOM   8164  C  CG    . PRO A  1  1044 ? 249.337 212.389 152.311 1.00 0.00 ? 1044 PRO A CG    1 
ATOM   8165  C  CD    . PRO A  1  1044 ? 249.957 211.221 151.605 1.00 0.00 ? 1044 PRO A CD    1 
ATOM   8166  N  N     . ASP A  1  1045 ? 252.372 210.190 154.376 1.00 0.00 ? 1045 ASP A N     1 
ATOM   8167  C  CA    . ASP A  1  1045 ? 253.076 209.483 155.443 1.00 0.00 ? 1045 ASP A CA    1 
ATOM   8168  C  C     . ASP A  1  1045 ? 254.546 209.249 155.097 1.00 0.00 ? 1045 ASP A C     1 
ATOM   8169  O  O     . ASP A  1  1045 ? 255.253 208.509 155.777 1.00 0.00 ? 1045 ASP A O     1 
ATOM   8170  C  CB    . ASP A  1  1045 ? 252.365 208.173 155.763 1.00 0.00 ? 1045 ASP A CB    1 
ATOM   8171  C  CG    . ASP A  1  1045 ? 252.270 207.255 154.572 1.00 0.00 ? 1045 ASP A CG    1 
ATOM   8172  O  OD1   . ASP A  1  1045 ? 252.604 207.698 153.459 1.00 0.00 ? 1045 ASP A OD1   1 
ATOM   8173  O  OD2   . ASP A  1  1045 ? 251.868 206.086 154.751 1.00 0.00 ? 1045 ASP A OD2   1 
ATOM   8174  N  N     . GLU A  1  1046 ? 255.007 209.849 154.001 1.00 0.00 ? 1046 GLU A N     1 
ATOM   8175  C  CA    . GLU A  1  1046 ? 256.384 209.702 153.544 1.00 0.00 ? 1046 GLU A CA    1 
ATOM   8176  C  C     . GLU A  1  1046 ? 257.413 209.987 154.628 1.00 0.00 ? 1046 GLU A C     1 
ATOM   8177  O  O     . GLU A  1  1046 ? 258.445 209.312 154.690 1.00 0.00 ? 1046 GLU A O     1 
ATOM   8178  C  CB    . GLU A  1  1046 ? 256.638 210.620 152.340 1.00 0.00 ? 1046 GLU A CB    1 
ATOM   8179  C  CG    . GLU A  1  1046 ? 258.028 210.490 151.739 1.00 0.00 ? 1046 GLU A CG    1 
ATOM   8180  C  CD    . GLU A  1  1046 ? 258.285 209.123 151.126 1.00 0.00 ? 1046 GLU A CD    1 
ATOM   8181  O  OE1   . GLU A  1  1046 ? 257.316 208.361 150.921 1.00 0.00 ? 1046 GLU A OE1   1 
ATOM   8182  O  OE2   . GLU A  1  1046 ? 259.461 208.808 150.849 1.00 0.00 ? 1046 GLU A OE2   1 
ATOM   8183  N  N     . THR A  1  1047 ? 257.156 210.963 155.496 1.00 0.00 ? 1047 THR A N     1 
ATOM   8184  C  CA    . THR A  1  1047 ? 258.103 211.362 156.530 1.00 0.00 ? 1047 THR A CA    1 
ATOM   8185  C  C     . THR A  1  1047 ? 257.871 210.664 157.871 1.00 0.00 ? 1047 THR A C     1 
ATOM   8186  O  O     . THR A  1  1047 ? 258.524 211.031 158.857 1.00 0.00 ? 1047 THR A O     1 
ATOM   8187  C  CB    . THR A  1  1047 ? 258.064 212.878 156.727 1.00 0.00 ? 1047 THR A CB    1 
ATOM   8188  O  OG1   . THR A  1  1047 ? 259.120 213.271 157.613 1.00 0.00 ? 1047 THR A OG1   1 
ATOM   8189  C  CG2   . THR A  1  1047 ? 256.731 213.303 157.316 1.00 0.00 ? 1047 THR A CG2   1 
ATOM   8190  N  N     . VAL A  1  1048 ? 256.955 209.708 157.940 1.00 0.00 ? 1048 VAL A N     1 
ATOM   8191  C  CA    . VAL A  1  1048 ? 256.683 208.996 159.192 1.00 0.00 ? 1048 VAL A CA    1 
ATOM   8192  C  C     . VAL A  1  1048 ? 257.967 208.327 159.671 1.00 0.00 ? 1048 VAL A C     1 
ATOM   8193  O  O     . VAL A  1  1048 ? 258.712 207.777 158.846 1.00 0.00 ? 1048 VAL A O     1 
ATOM   8194  C  CB    . VAL A  1  1048 ? 255.580 207.964 158.995 1.00 0.00 ? 1048 VAL A CB    1 
ATOM   8195  C  CG1   . VAL A  1  1048 ? 255.400 207.131 160.252 1.00 0.00 ? 1048 VAL A CG1   1 
ATOM   8196  C  CG2   . VAL A  1  1048 ? 254.298 208.643 158.649 1.00 0.00 ? 1048 VAL A CG2   1 
ATOM   8197  N  N     . PRO A  1  1049 ? 258.252 208.338 160.969 1.00 0.00 ? 1049 PRO A N     1 
ATOM   8198  C  CA    . PRO A  1  1049 ? 259.333 207.492 161.483 1.00 0.00 ? 1049 PRO A CA    1 
ATOM   8199  C  C     . PRO A  1  1049 ? 258.941 206.022 161.491 1.00 0.00 ? 1049 PRO A C     1 
ATOM   8200  O  O     . PRO A  1  1049 ? 259.015 205.362 162.533 1.00 0.00 ? 1049 PRO A O     1 
ATOM   8201  C  CB    . PRO A  1  1049 ? 259.549 208.026 162.903 1.00 0.00 ? 1049 PRO A CB    1 
ATOM   8202  C  CG    . PRO A  1  1049 ? 258.227 208.590 163.286 1.00 0.00 ? 1049 PRO A CG    1 
ATOM   8203  C  CD    . PRO A  1  1049 ? 257.658 209.177 162.024 1.00 0.00 ? 1049 PRO A CD    1 
ATOM   8204  N  N     . ASP A  1  1050 ? 258.523 205.507 160.333 1.00 0.00 ? 1050 ASP A N     1 
ATOM   8205  C  CA    . ASP A  1  1050 ? 258.198 204.096 160.179 1.00 0.00 ? 1050 ASP A CA    1 
ATOM   8206  C  C     . ASP A  1  1050 ? 257.125 203.668 161.170 1.00 0.00 ? 1050 ASP A C     1 
ATOM   8207  O  O     . ASP A  1  1050 ? 255.963 204.062 161.042 1.00 0.00 ? 1050 ASP A O     1 
ATOM   8208  C  CB    . ASP A  1  1050 ? 259.447 203.225 160.330 1.00 0.00 ? 1050 ASP A CB    1 
ATOM   8209  C  CG    . ASP A  1  1050 ? 259.203 201.791 159.906 1.00 0.00 ? 1050 ASP A CG    1 
ATOM   8210  O  OD1   . ASP A  1  1050 ? 258.093 201.493 159.417 1.00 0.00 ? 1050 ASP A OD1   1 
ATOM   8211  O  OD2   . ASP A  1  1050 ? 260.121 200.962 160.056 1.00 0.00 ? 1050 ASP A OD2   1 
ATOM   8212  N  N     . ASN A  1  1051 ? 257.530 202.877 162.167 1.00 0.00 ? 1051 ASN A N     1 
ATOM   8213  C  CA    . ASN A  1  1051 ? 256.639 202.059 162.983 1.00 0.00 ? 1051 ASN A CA    1 
ATOM   8214  C  C     . ASN A  1  1051 ? 255.369 202.777 163.409 1.00 0.00 ? 1051 ASN A C     1 
ATOM   8215  O  O     . ASN A  1  1051 ? 254.353 202.110 163.624 1.00 0.00 ? 1051 ASN A O     1 
ATOM   8216  C  CB    . ASN A  1  1051 ? 257.385 201.603 164.230 1.00 0.00 ? 1051 ASN A CB    1 
ATOM   8217  C  CG    . ASN A  1  1051 ? 257.849 202.767 165.074 1.00 0.00 ? 1051 ASN A CG    1 
ATOM   8218  O  OD1   . ASN A  1  1051 ? 257.858 203.911 164.616 1.00 0.00 ? 1051 ASN A OD1   1 
ATOM   8219  N  ND2   . ASN A  1  1051 ? 258.237 202.490 166.312 1.00 0.00 ? 1051 ASN A ND2   1 
ATOM   8220  N  N     . VAL A  1  1052 ? 255.415 204.099 163.593 1.00 0.00 ? 1052 VAL A N     1 
ATOM   8221  C  CA    . VAL A  1  1052 ? 254.178 204.846 163.792 1.00 0.00 ? 1052 VAL A CA    1 
ATOM   8222  C  C     . VAL A  1  1052 ? 253.153 204.455 162.737 1.00 0.00 ? 1052 VAL A C     1 
ATOM   8223  O  O     . VAL A  1  1052 ? 251.983 204.208 163.060 1.00 0.00 ? 1052 VAL A O     1 
ATOM   8224  C  CB    . VAL A  1  1052 ? 254.456 206.358 163.781 1.00 0.00 ? 1052 VAL A CB    1 
ATOM   8225  C  CG1   . VAL A  1  1052 ? 253.156 207.129 163.888 1.00 0.00 ? 1052 VAL A CG1   1 
ATOM   8226  C  CG2   . VAL A  1  1052 ? 255.394 206.721 164.917 1.00 0.00 ? 1052 VAL A CG2   1 
ATOM   8227  N  N     . LYS A  1  1053 ? 253.569 204.374 161.468 1.00 0.00 ? 1053 LYS A N     1 
ATOM   8228  C  CA    . LYS A  1  1053 ? 252.751 203.677 160.484 1.00 0.00 ? 1053 LYS A CA    1 
ATOM   8229  C  C     . LYS A  1  1053 ? 252.316 202.319 161.003 1.00 0.00 ? 1053 LYS A C     1 
ATOM   8230  O  O     . LYS A  1  1053 ? 251.135 202.126 161.295 1.00 0.00 ? 1053 LYS A O     1 
ATOM   8231  C  CB    . LYS A  1  1053 ? 253.505 203.483 159.167 1.00 0.00 ? 1053 LYS A CB    1 
ATOM   8232  C  CG    . LYS A  1  1053 ? 253.722 204.728 158.338 1.00 0.00 ? 1053 LYS A CG    1 
ATOM   8233  C  CD    . LYS A  1  1053 ? 254.215 204.348 156.947 1.00 0.00 ? 1053 LYS A CD    1 
ATOM   8234  C  CE    . LYS A  1  1053 ? 255.564 203.645 157.010 1.00 0.00 ? 1053 LYS A CE    1 
ATOM   8235  N  NZ    . LYS A  1  1053 ? 256.097 203.313 155.657 1.00 0.00 ? 1053 LYS A NZ    1 
ATOM   8236  N  N     . THR A  1  1054 ? 253.261 201.390 161.158 1.00 0.00 ? 1054 THR A N     1 
ATOM   8237  C  CA    . THR A  1  1054 ? 252.922 200.023 161.540 1.00 0.00 ? 1054 THR A CA    1 
ATOM   8238  C  C     . THR A  1  1054 ? 252.062 199.992 162.797 1.00 0.00 ? 1054 THR A C     1 
ATOM   8239  O  O     . THR A  1  1054 ? 251.140 199.174 162.902 1.00 0.00 ? 1054 THR A O     1 
ATOM   8240  C  CB    . THR A  1  1054 ? 254.202 199.216 161.735 1.00 0.00 ? 1054 THR A CB    1 
ATOM   8241  O  OG1   . THR A  1  1054 ? 254.954 199.228 160.516 1.00 0.00 ? 1054 THR A OG1   1 
ATOM   8242  C  CG2   . THR A  1  1054 ? 253.877 197.780 162.096 1.00 0.00 ? 1054 THR A CG2   1 
ATOM   8243  N  N     . SER A  1  1055 ? 252.341 200.880 163.753 1.00 0.00 ? 1055 SER A N     1 
ATOM   8244  C  CA    . SER A  1  1055 ? 251.451 201.040 164.896 1.00 0.00 ? 1055 SER A CA    1 
ATOM   8245  C  C     . SER A  1  1055 ? 250.020 201.304 164.455 1.00 0.00 ? 1055 SER A C     1 
ATOM   8246  O  O     . SER A  1  1055 ? 249.099 200.598 164.883 1.00 0.00 ? 1055 SER A O     1 
ATOM   8247  C  CB    . SER A  1  1055 ? 251.943 202.176 165.787 1.00 0.00 ? 1055 SER A CB    1 
ATOM   8248  O  OG    . SER A  1  1055 ? 251.060 202.386 166.872 1.00 0.00 ? 1055 SER A OG    1 
ATOM   8249  N  N     . VAL A  1  1056 ? 249.816 202.306 163.600 1.00 0.00 ? 1056 VAL A N     1 
ATOM   8250  C  CA    . VAL A  1  1056 ? 248.488 202.549 163.050 1.00 0.00 ? 1056 VAL A CA    1 
ATOM   8251  C  C     . VAL A  1  1056 ? 247.944 201.298 162.377 1.00 0.00 ? 1056 VAL A C     1 
ATOM   8252  O  O     . VAL A  1  1056 ? 246.935 200.736 162.815 1.00 0.00 ? 1056 VAL A O     1 
ATOM   8253  C  CB    . VAL A  1  1056 ? 248.527 203.740 162.080 1.00 0.00 ? 1056 VAL A CB    1 
ATOM   8254  C  CG1   . VAL A  1  1056 ? 247.191 203.896 161.385 1.00 0.00 ? 1056 VAL A CG1   1 
ATOM   8255  C  CG2   . VAL A  1  1056 ? 248.888 205.006 162.825 1.00 0.00 ? 1056 VAL A CG2   1 
ATOM   8256  N  N     . SER A  1  1057 ? 248.621 200.840 161.322 1.00 0.00 ? 1057 SER A N     1 
ATOM   8257  C  CA    . SER A  1  1057 ? 248.174 199.715 160.513 1.00 0.00 ? 1057 SER A CA    1 
ATOM   8258  C  C     . SER A  1  1057 ? 247.733 198.526 161.349 1.00 0.00 ? 1057 SER A C     1 
ATOM   8259  O  O     . SER A  1  1057 ? 246.737 197.885 161.004 1.00 0.00 ? 1057 SER A O     1 
ATOM   8260  C  CB    . SER A  1  1057 ? 249.289 199.286 159.559 1.00 0.00 ? 1057 SER A CB    1 
ATOM   8261  O  OG    . SER A  1  1057 ? 248.908 198.155 158.797 1.00 0.00 ? 1057 SER A OG    1 
ATOM   8262  N  N     . GLN A  1  1058 ? 248.433 198.215 162.434 1.00 0.00 ? 1058 GLN A N     1 
ATOM   8263  C  CA    . GLN A  1  1058 ? 247.953 197.144 163.288 1.00 0.00 ? 1058 GLN A CA    1 
ATOM   8264  C  C     . GLN A  1  1058 ? 246.814 197.580 164.192 1.00 0.00 ? 1058 GLN A C     1 
ATOM   8265  O  O     . GLN A  1  1058 ? 245.960 196.754 164.524 1.00 0.00 ? 1058 GLN A O     1 
ATOM   8266  C  CB    . GLN A  1  1058 ? 249.084 196.569 164.146 1.00 0.00 ? 1058 GLN A CB    1 
ATOM   8267  C  CG    . GLN A  1  1058 ? 249.646 197.507 165.190 1.00 0.00 ? 1058 GLN A CG    1 
ATOM   8268  C  CD    . GLN A  1  1058 ? 250.686 196.836 166.063 1.00 0.00 ? 1058 GLN A CD    1 
ATOM   8269  O  OE1   . GLN A  1  1058 ? 251.252 195.808 165.695 1.00 0.00 ? 1058 GLN A OE1   1 
ATOM   8270  N  NE2   . GLN A  1  1058 ? 250.934 197.407 167.232 1.00 0.00 ? 1058 GLN A NE2   1 
ATOM   8271  N  N     . LEU A  1  1059 ? 246.773 198.845 164.605 1.00 0.00 ? 1059 LEU A N     1 
ATOM   8272  C  CA    . LEU A  1  1059 ? 245.719 199.242 165.528 1.00 0.00 ? 1059 LEU A CA    1 
ATOM   8273  C  C     . LEU A  1  1059 ? 244.397 199.488 164.809 1.00 0.00 ? 1059 LEU A C     1 
ATOM   8274  O  O     . LEU A  1  1059 ? 243.351 199.015 165.262 1.00 0.00 ? 1059 LEU A O     1 
ATOM   8275  C  CB    . LEU A  1  1059 ? 246.152 200.481 166.307 1.00 0.00 ? 1059 LEU A CB    1 
ATOM   8276  C  CG    . LEU A  1  1059 ? 245.425 200.753 167.623 1.00 0.00 ? 1059 LEU A CG    1 
ATOM   8277  C  CD1   . LEU A  1  1059 ? 246.342 201.517 168.566 1.00 0.00 ? 1059 LEU A CD1   1 
ATOM   8278  C  CD2   . LEU A  1  1059 ? 244.135 201.501 167.412 1.00 0.00 ? 1059 LEU A CD2   1 
ATOM   8279  N  N     . TYR A  1  1060 ? 244.417 200.230 163.705 1.00 0.00 ? 1060 TYR A N     1 
ATOM   8280  C  CA    . TYR A  1  1060 ? 243.303 200.275 162.766 1.00 0.00 ? 1060 TYR A CA    1 
ATOM   8281  C  C     . TYR A  1  1060 ? 243.833 199.984 161.376 1.00 0.00 ? 1060 TYR A C     1 
ATOM   8282  O  O     . TYR A  1  1060 ? 244.880 200.507 160.989 1.00 0.00 ? 1060 TYR A O     1 
ATOM   8283  C  CB    . TYR A  1  1060 ? 242.593 201.629 162.733 1.00 0.00 ? 1060 TYR A CB    1 
ATOM   8284  C  CG    . TYR A  1  1060 ? 241.729 201.965 163.915 1.00 0.00 ? 1060 TYR A CG    1 
ATOM   8285  C  CD1   . TYR A  1  1060 ? 240.424 201.512 163.989 1.00 0.00 ? 1060 TYR A CD1   1 
ATOM   8286  C  CD2   . TYR A  1  1060 ? 242.188 202.794 164.917 1.00 0.00 ? 1060 TYR A CD2   1 
ATOM   8287  C  CE1   . TYR A  1  1060 ? 239.617 201.838 165.055 1.00 0.00 ? 1060 TYR A CE1   1 
ATOM   8288  C  CE2   . TYR A  1  1060 ? 241.391 203.127 165.985 1.00 0.00 ? 1060 TYR A CE2   1 
ATOM   8289  C  CZ    . TYR A  1  1060 ? 240.107 202.649 166.052 1.00 0.00 ? 1060 TYR A CZ    1 
ATOM   8290  O  OH    . TYR A  1  1060 ? 239.316 202.985 167.125 1.00 0.00 ? 1060 TYR A OH    1 
ATOM   8291  N  N     . ARG A  1  1061 ? 243.119 199.151 160.632 1.00 0.00 ? 1061 ARG A N     1 
ATOM   8292  C  CA    . ARG A  1  1061 ? 243.360 199.026 159.202 1.00 0.00 ? 1061 ARG A CA    1 
ATOM   8293  C  C     . ARG A  1  1061 ? 242.014 198.806 158.534 1.00 0.00 ? 1061 ARG A C     1 
ATOM   8294  O  O     . ARG A  1  1061 ? 241.250 197.932 158.949 1.00 0.00 ? 1061 ARG A O     1 
ATOM   8295  C  CB    . ARG A  1  1061 ? 244.335 197.891 158.900 1.00 0.00 ? 1061 ARG A CB    1 
ATOM   8296  C  CG    . ARG A  1  1061 ? 244.740 197.837 157.451 1.00 0.00 ? 1061 ARG A CG    1 
ATOM   8297  C  CD    . ARG A  1  1061 ? 245.840 196.833 157.157 1.00 0.00 ? 1061 ARG A CD    1 
ATOM   8298  N  NE    . ARG A  1  1061 ? 245.438 195.444 157.327 1.00 0.00 ? 1061 ARG A NE    1 
ATOM   8299  C  CZ    . ARG A  1  1061 ? 245.807 194.682 158.348 1.00 0.00 ? 1061 ARG A CZ    1 
ATOM   8300  N  NH1   . ARG A  1  1061 ? 246.584 195.174 159.301 1.00 0.00 ? 1061 ARG A NH1   1 
ATOM   8301  N  NH2   . ARG A  1  1061 ? 245.404 193.424 158.411 1.00 0.00 ? 1061 ARG A NH2   1 
ATOM   8302  N  N     . ILE A  1  1062 ? 241.720 199.606 157.517 1.00 0.00 ? 1062 ILE A N     1 
ATOM   8303  C  CA    . ILE A  1  1062 ? 240.466 199.527 156.783 1.00 0.00 ? 1062 ILE A CA    1 
ATOM   8304  C  C     . ILE A  1  1062 ? 240.801 199.584 155.304 1.00 0.00 ? 1062 ILE A C     1 
ATOM   8305  O  O     . ILE A  1  1062 ? 241.251 200.623 154.808 1.00 0.00 ? 1062 ILE A O     1 
ATOM   8306  C  CB    . ILE A  1  1062 ? 239.525 200.672 157.173 1.00 0.00 ? 1062 ILE A CB    1 
ATOM   8307  C  CG1   . ILE A  1  1062 ? 239.144 200.570 158.645 1.00 0.00 ? 1062 ILE A CG1   1 
ATOM   8308  C  CG2   . ILE A  1  1062 ? 238.297 200.656 156.308 1.00 0.00 ? 1062 ILE A CG2   1 
ATOM   8309  C  CD1   . ILE A  1  1062 ? 238.420 201.785 159.158 1.00 0.00 ? 1062 ILE A CD1   1 
ATOM   8310  N  N     . SER A  1  1063 ? 240.570 198.488 154.591 1.00 0.00 ? 1063 SER A N     1 
ATOM   8311  C  CA    . SER A  1  1063 ? 240.975 198.397 153.191 1.00 0.00 ? 1063 SER A CA    1 
ATOM   8312  C  C     . SER A  1  1063 ? 239.758 198.223 152.299 1.00 0.00 ? 1063 SER A C     1 
ATOM   8313  O  O     . SER A  1  1063 ? 239.190 197.132 152.246 1.00 0.00 ? 1063 SER A O     1 
ATOM   8314  C  CB    . SER A  1  1063 ? 241.955 197.238 153.012 1.00 0.00 ? 1063 SER A CB    1 
ATOM   8315  O  OG    . SER A  1  1063 ? 242.295 197.062 151.649 1.00 0.00 ? 1063 SER A OG    1 
ATOM   8316  N  N     . GLU A  1  1064 ? 239.385 199.291 151.583 1.00 0.00 ? 1064 GLU A N     1 
ATOM   8317  C  CA    . GLU A  1  1064 ? 238.639 199.143 150.338 1.00 0.00 ? 1064 GLU A CA    1 
ATOM   8318  C  C     . GLU A  1  1064 ? 237.471 198.190 150.535 1.00 0.00 ? 1064 GLU A C     1 
ATOM   8319  O  O     . GLU A  1  1064 ? 236.462 198.544 151.153 1.00 0.00 ? 1064 GLU A O     1 
ATOM   8320  C  CB    . GLU A  1  1064 ? 239.554 198.675 149.205 1.00 0.00 ? 1064 GLU A CB    1 
ATOM   8321  C  CG    . GLU A  1  1064 ? 238.885 198.661 147.831 1.00 0.00 ? 1064 GLU A CG    1 
ATOM   8322  C  CD    . GLU A  1  1064 ? 238.467 200.041 147.355 1.00 0.00 ? 1064 GLU A CD    1 
ATOM   8323  O  OE1   . GLU A  1  1064 ? 238.954 201.046 147.913 1.00 0.00 ? 1064 GLU A OE1   1 
ATOM   8324  O  OE2   . GLU A  1  1064 ? 237.637 200.120 146.423 1.00 0.00 ? 1064 GLU A OE2   1 
ATOM   8325  N  N     . LYS A  1  1065 ? 237.626 196.971 150.007 1.00 0.00 ? 1065 LYS A N     1 
ATOM   8326  C  CA    . LYS A  1  1065 ? 236.637 195.913 150.159 1.00 0.00 ? 1065 LYS A CA    1 
ATOM   8327  C  C     . LYS A  1  1065 ? 236.136 195.797 151.587 1.00 0.00 ? 1065 LYS A C     1 
ATOM   8328  O  O     . LYS A  1  1065 ? 235.052 195.251 151.803 1.00 0.00 ? 1065 LYS A O     1 
ATOM   8329  C  CB    . LYS A  1  1065 ? 237.233 194.576 149.731 1.00 0.00 ? 1065 LYS A CB    1 
ATOM   8330  C  CG    . LYS A  1  1065 ? 237.551 194.472 148.262 1.00 0.00 ? 1065 LYS A CG    1 
ATOM   8331  C  CD    . LYS A  1  1065 ? 238.128 193.107 147.941 1.00 0.00 ? 1065 LYS A CD    1 
ATOM   8332  C  CE    . LYS A  1  1065 ? 239.464 192.893 148.638 1.00 0.00 ? 1065 LYS A CE    1 
ATOM   8333  N  NZ    . LYS A  1  1065 ? 240.508 193.851 148.180 1.00 0.00 ? 1065 LYS A NZ    1 
ATOM   8334  N  N     . SER A  1  1066 ? 236.914 196.260 152.565 1.00 0.00 ? 1066 SER A N     1 
ATOM   8335  C  CA    . SER A  1  1066 ? 236.324 196.563 153.861 1.00 0.00 ? 1066 SER A CA    1 
ATOM   8336  C  C     . SER A  1  1066 ? 235.009 197.296 153.689 1.00 0.00 ? 1066 SER A C     1 
ATOM   8337  O  O     . SER A  1  1066 ? 233.947 196.750 154.002 1.00 0.00 ? 1066 SER A O     1 
ATOM   8338  C  CB    . SER A  1  1066 ? 237.276 197.417 154.695 1.00 0.00 ? 1066 SER A CB    1 
ATOM   8339  O  OG    . SER A  1  1066 ? 238.491 196.747 154.962 1.00 0.00 ? 1066 SER A OG    1 
ATOM   8340  N  N     . VAL A  1  1067 ? 235.055 198.509 153.157 1.00 0.00 ? 1067 VAL A N     1 
ATOM   8341  C  CA    . VAL A  1  1067 ? 233.847 199.290 152.946 1.00 0.00 ? 1067 VAL A CA    1 
ATOM   8342  C  C     . VAL A  1  1067 ? 232.930 198.639 151.925 1.00 0.00 ? 1067 VAL A C     1 
ATOM   8343  O  O     . VAL A  1  1067 ? 231.724 198.546 152.148 1.00 0.00 ? 1067 VAL A O     1 
ATOM   8344  C  CB    . VAL A  1  1067 ? 234.221 200.718 152.526 1.00 0.00 ? 1067 VAL A CB    1 
ATOM   8345  C  CG1   . VAL A  1  1067 ? 232.970 201.498 152.193 1.00 0.00 ? 1067 VAL A CG1   1 
ATOM   8346  C  CG2   . VAL A  1  1067 ? 234.980 201.391 153.634 1.00 0.00 ? 1067 VAL A CG2   1 
ATOM   8347  N  N     . ARG A  1  1068 ? 233.468 198.188 150.792 1.00 0.00 ? 1068 ARG A N     1 
ATOM   8348  C  CA    . ARG A  1  1068 ? 232.598 197.674 149.738 1.00 0.00 ? 1068 ARG A CA    1 
ATOM   8349  C  C     . ARG A  1  1068 ? 231.764 196.494 150.219 1.00 0.00 ? 1068 ARG A C     1 
ATOM   8350  O  O     . ARG A  1  1068 ? 230.531 196.543 150.159 1.00 0.00 ? 1068 ARG A O     1 
ATOM   8351  C  CB    . ARG A  1  1068 ? 233.415 197.292 148.510 1.00 0.00 ? 1068 ARG A CB    1 
ATOM   8352  C  CG    . ARG A  1  1068 ? 233.989 198.486 147.779 1.00 0.00 ? 1068 ARG A CG    1 
ATOM   8353  C  CD    . ARG A  1  1068 ? 234.698 198.065 146.510 1.00 0.00 ? 1068 ARG A CD    1 
ATOM   8354  N  NE    . ARG A  1  1068 ? 235.212 199.210 145.770 1.00 0.00 ? 1068 ARG A NE    1 
ATOM   8355  C  CZ    . ARG A  1  1068 ? 234.482 199.933 144.930 1.00 0.00 ? 1068 ARG A CZ    1 
ATOM   8356  N  NH1   . ARG A  1  1068 ? 233.209 199.625 144.733 1.00 0.00 ? 1068 ARG A NH1   1 
ATOM   8357  N  NH2   . ARG A  1  1068 ? 235.02