data_6CQ7
# 
_entry.id   6CQ7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CQ7         
WWPDB D_1000233209 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6CQ7 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Kall, S.L.' 1 ? 
'Lavie, A.'  2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'The SH3 domain of MLK3 in complex with poly-proline peptide derived from Htt' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kall, S.L.' 1 ? 
primary 'Lavie, A.'  2 ? 
# 
_cell.entry_id           6CQ7 
_cell.length_a           59.000 
_cell.length_b           59.000 
_cell.length_c           84.360 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         6CQ7 
_symmetry.space_group_name_H-M             'P 43 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                95 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Mitogen-activated protein kinase kinase kinase 11, Huntingtin fusion protein' 8434.170 1  2.7.11.25 ? ? ? 
2 water   nat water                                                                          18.015   30 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Mixed lineage kinase 3,Src-homology 3 domain-containing proline-rich kinase,Mixed lineage kinase 3,Src-homology 3 domain-containing proline-rich kinase,Huntington disease protein,HD protein
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSHMYANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPPGPAVAEE 
_entity_poly.pdbx_seq_one_letter_code_can   GSHMYANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPPGPAVAEE 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  HIS n 
1 4  MET n 
1 5  TYR n 
1 6  ALA n 
1 7  ASN n 
1 8  PRO n 
1 9  VAL n 
1 10 TRP n 
1 11 THR n 
1 12 ALA n 
1 13 LEU n 
1 14 PHE n 
1 15 ASP n 
1 16 TYR n 
1 17 GLU n 
1 18 PRO n 
1 19 SER n 
1 20 GLY n 
1 21 GLN n 
1 22 ASP n 
1 23 GLU n 
1 24 LEU n 
1 25 ALA n 
1 26 LEU n 
1 27 ARG n 
1 28 LYS n 
1 29 GLY n 
1 30 ASP n 
1 31 ARG n 
1 32 VAL n 
1 33 GLU n 
1 34 VAL n 
1 35 LEU n 
1 36 SER n 
1 37 ARG n 
1 38 ASP n 
1 39 ALA n 
1 40 ALA n 
1 41 ILE n 
1 42 SER n 
1 43 GLY n 
1 44 ASP n 
1 45 GLU n 
1 46 GLY n 
1 47 TRP n 
1 48 TRP n 
1 49 ALA n 
1 50 GLY n 
1 51 GLN n 
1 52 VAL n 
1 53 GLY n 
1 54 GLY n 
1 55 GLN n 
1 56 VAL n 
1 57 GLY n 
1 58 ILE n 
1 59 PHE n 
1 60 PRO n 
1 61 SER n 
1 62 ASN n 
1 63 TYR n 
1 64 VAL n 
1 65 SER n 
1 66 ARG n 
1 67 GLY n 
1 68 GLY n 
1 69 GLY n 
1 70 PRO n 
1 71 PRO n 
1 72 PRO n 
1 73 PRO n 
1 74 GLY n 
1 75 PRO n 
1 76 ALA n 
1 77 VAL n 
1 78 ALA n 
1 79 GLU n 
1 80 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1  72 Human ? 'MAP3K11, MLK3, PTK1, SPRK' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 73 80 Human ? 'HTT, HD, IT15'             ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP M3K11_HUMAN Q16584 ? 1 YANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPP 41 
2 PDB 6CQ7        6CQ7   ? 1 ?                                                                    73 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6CQ7 A 5  ? 72 ? Q16584 41  ? 108 ? 39  106 
2 2 6CQ7 A 73 ? 80 ? 6CQ7   107 ? 114 ? 107 114 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6CQ7 GLY A 1 ? UNP Q16584 ? ? 'expression tag' 35 1 
1 6CQ7 SER A 2 ? UNP Q16584 ? ? 'expression tag' 36 2 
1 6CQ7 HIS A 3 ? UNP Q16584 ? ? 'expression tag' 37 3 
1 6CQ7 MET A 4 ? UNP Q16584 ? ? 'expression tag' 38 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CQ7 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.35 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.74 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;0.5 M Ammonium Sulphate
0.1 M Sodium Citrate pH 5.6
1.1 M Lithium Sulphate
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-08-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97857 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-G' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97857 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-G 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6CQ7 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.0 
_reflns.d_resolution_low                 59.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       10431 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.6 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            23.56 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.04 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.00 
_reflns_shell.d_res_low                   2.12 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.46 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        97.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.674 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.843 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 6CQ7 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     9765 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             59.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    97.43 
_refine.ls_R_factor_obs                          0.19951 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19625 
_refine.ls_R_factor_R_free                       0.25977 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.3 
_refine.ls_number_reflns_R_free                  544 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.970 
_refine.correlation_coeff_Fo_to_Fc_free          0.943 
_refine.B_iso_mean                               60.496 
_refine.aniso_B[1][1]                            1.73 
_refine.aniso_B[2][2]                            1.73 
_refine.aniso_B[3][3]                            -3.45 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      5K28 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.114 
_refine.pdbx_overall_ESU_R_Free                  0.132 
_refine.overall_SU_ML                            0.123 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             5.035 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        542 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             30 
_refine_hist.number_atoms_total               572 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        59.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.019  0.019  ? 579  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.005  0.020  ? 511  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.751  1.957  ? 795  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.983  3.000  ? 1188 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.313  5.000  ? 76   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.665 23.704 ? 27   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.066 15.000 ? 75   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.108 15.000 ? 5    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.114  0.200  ? 78   'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.011  0.021  ? 685  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 124  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  4.923  5.862  ? 301  'X-RAY DIFFRACTION' ? 
r_mcbond_other               4.926  5.833  ? 300  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 6.563  8.702  ? 378  'X-RAY DIFFRACTION' ? 
r_mcangle_other              6.555  8.737  ? 379  'X-RAY DIFFRACTION' ? 
r_scbond_it                  6.020  6.292  ? 278  'X-RAY DIFFRACTION' ? 
r_scbond_other               6.014  6.229  ? 276  'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              8.814  9.226  ? 417  'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       10.601 65.093 ? 598  'X-RAY DIFFRACTION' ? 
r_long_range_B_other         10.609 64.440 ? 593  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.002 
_refine_ls_shell.d_res_low                        2.054 
_refine_ls_shell.number_reflns_R_work             678 
_refine_ls_shell.R_factor_R_work                  0.386 
_refine_ls_shell.percent_reflns_obs               94.72 
_refine_ls_shell.R_factor_R_free                  0.388 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             40 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     6CQ7 
_struct.title                        'The SH3 domain of MLK3 in complex with poly-proline peptide derived from Htt' 
_struct.pdbx_descriptor              'Mitogen-activated protein kinase kinase kinase 11, Huntingtin fusion protein (E.C.2.7.11.25)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CQ7 
_struct_keywords.text            'Huntington, peptide fusion, mixed lineage kinase 3, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       AA1 
_struct_conf.beg_label_comp_id       ASP 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        38 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLY 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        43 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASP 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         72 
_struct_conf.end_auth_comp_id        GLY 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         77 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A 55 ? PRO A 60 ? GLN A 89 PRO A 94 
AA1 2 TRP A 47 ? VAL A 52 ? TRP A 81 VAL A 86 
AA1 3 ARG A 31 ? SER A 36 ? ARG A 65 SER A 70 
AA1 4 VAL A 9  ? ALA A 12 ? VAL A 43 ALA A 46 
AA1 5 VAL A 64 ? SER A 65 ? VAL A 98 SER A 99 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLY A 57 ? O GLY A 91 N GLY A 50 ? N GLY A 84 
AA1 2 3 O ALA A 49 ? O ALA A 83 N SER A 36 ? N SER A 70 
AA1 3 4 O VAL A 32 ? O VAL A 66 N TRP A 10 ? N TRP A 44 
AA1 4 5 N THR A 11 ? N THR A 45 O SER A 65 ? O SER A 99 
# 
_atom_sites.entry_id                    6CQ7 
_atom_sites.fract_transf_matrix[1][1]   0.016949 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016949 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011854 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . ASN A 1 7  ? 6.072  25.663 1.686   1.00 100.56 ? 41  ASN A N   1 
ATOM   2   C CA  . ASN A 1 7  ? 6.412  26.528 0.559   1.00 97.75  ? 41  ASN A CA  1 
ATOM   3   C C   . ASN A 1 7  ? 7.358  25.860 -0.414  1.00 91.23  ? 41  ASN A C   1 
ATOM   4   O O   . ASN A 1 7  ? 8.514  25.620 -0.103  1.00 77.97  ? 41  ASN A O   1 
ATOM   5   C CB  . ASN A 1 7  ? 7.041  27.820 1.046   1.00 30.00  ? 41  ASN A CB  1 
ATOM   6   C CG  . ASN A 1 7  ? 6.037  28.761 1.636   1.00 30.00  ? 41  ASN A CG  1 
ATOM   7   O OD1 . ASN A 1 7  ? 4.844  28.593 1.476   1.00 30.00  ? 41  ASN A OD1 1 
ATOM   8   N ND2 . ASN A 1 7  ? 6.520  29.758 2.325   1.00 30.00  ? 41  ASN A ND2 1 
ATOM   9   N N   . PRO A 1 8  ? 6.863  25.568 -1.610  1.00 88.60  ? 42  PRO A N   1 
ATOM   10  C CA  . PRO A 1 8  ? 7.692  24.942 -2.627  1.00 79.76  ? 42  PRO A CA  1 
ATOM   11  C C   . PRO A 1 8  ? 8.659  25.957 -3.191  1.00 69.52  ? 42  PRO A C   1 
ATOM   12  O O   . PRO A 1 8  ? 8.387  27.135 -3.182  1.00 59.02  ? 42  PRO A O   1 
ATOM   13  C CB  . PRO A 1 8  ? 6.680  24.542 -3.682  1.00 83.25  ? 42  PRO A CB  1 
ATOM   14  C CG  . PRO A 1 8  ? 5.602  25.541 -3.546  1.00 82.85  ? 42  PRO A CG  1 
ATOM   15  C CD  . PRO A 1 8  ? 5.506  25.841 -2.092  1.00 81.87  ? 42  PRO A CD  1 
ATOM   16  N N   . VAL A 1 9  ? 9.797  25.489 -3.657  1.00 57.51  ? 43  VAL A N   1 
ATOM   17  C CA  . VAL A 1 9  ? 10.784 26.361 -4.222  1.00 61.35  ? 43  VAL A CA  1 
ATOM   18  C C   . VAL A 1 9  ? 10.945 26.030 -5.688  1.00 72.85  ? 43  VAL A C   1 
ATOM   19  O O   . VAL A 1 9  ? 11.401 24.961 -6.031  1.00 69.68  ? 43  VAL A O   1 
ATOM   20  C CB  . VAL A 1 9  ? 12.121 26.207 -3.505  1.00 70.55  ? 43  VAL A CB  1 
ATOM   21  C CG1 . VAL A 1 9  ? 13.177 27.033 -4.182  1.00 67.16  ? 43  VAL A CG1 1 
ATOM   22  C CG2 . VAL A 1 9  ? 11.993 26.629 -2.060  1.00 63.73  ? 43  VAL A CG2 1 
ATOM   23  N N   . TRP A 1 10 ? 10.537 26.954 -6.545  1.00 68.06  ? 44  TRP A N   1 
ATOM   24  C CA  . TRP A 1 10 ? 10.624 26.785 -8.004  1.00 56.76  ? 44  TRP A CA  1 
ATOM   25  C C   . TRP A 1 10 ? 11.920 27.432 -8.518  1.00 58.09  ? 44  TRP A C   1 
ATOM   26  O O   . TRP A 1 10 ? 12.658 27.998 -7.735  1.00 62.88  ? 44  TRP A O   1 
ATOM   27  C CB  . TRP A 1 10 ? 9.386  27.387 -8.639  1.00 55.07  ? 44  TRP A CB  1 
ATOM   28  C CG  . TRP A 1 10 ? 8.207  26.546 -8.470  1.00 60.12  ? 44  TRP A CG  1 
ATOM   29  C CD1 . TRP A 1 10 ? 7.750  26.035 -7.312  1.00 72.82  ? 44  TRP A CD1 1 
ATOM   30  C CD2 . TRP A 1 10 ? 7.296  26.124 -9.481  1.00 59.86  ? 44  TRP A CD2 1 
ATOM   31  N NE1 . TRP A 1 10 ? 6.623  25.305 -7.529  1.00 78.50  ? 44  TRP A NE1 1 
ATOM   32  C CE2 . TRP A 1 10 ? 6.308  25.359 -8.855  1.00 68.99  ? 44  TRP A CE2 1 
ATOM   33  C CE3 . TRP A 1 10 ? 7.214  26.324 -10.857 1.00 58.94  ? 44  TRP A CE3 1 
ATOM   34  C CZ2 . TRP A 1 10 ? 5.248  24.773 -9.562  1.00 69.73  ? 44  TRP A CZ2 1 
ATOM   35  C CZ3 . TRP A 1 10 ? 6.158  25.765 -11.555 1.00 62.57  ? 44  TRP A CZ3 1 
ATOM   36  C CH2 . TRP A 1 10 ? 5.197  24.993 -10.914 1.00 72.55  ? 44  TRP A CH2 1 
ATOM   37  N N   . THR A 1 11 ? 12.258 27.271 -9.796  1.00 52.57  ? 45  THR A N   1 
ATOM   38  C CA  . THR A 1 11 ? 13.495 27.880 -10.359 1.00 50.59  ? 45  THR A CA  1 
ATOM   39  C C   . THR A 1 11 ? 13.174 28.781 -11.602 1.00 48.94  ? 45  THR A C   1 
ATOM   40  O O   . THR A 1 11 ? 12.316 28.452 -12.430 1.00 47.61  ? 45  THR A O   1 
ATOM   41  C CB  . THR A 1 11 ? 14.503 26.774 -10.690 1.00 51.51  ? 45  THR A CB  1 
ATOM   42  O OG1 . THR A 1 11 ? 14.765 25.997 -9.516  1.00 56.23  ? 45  THR A OG1 1 
ATOM   43  C CG2 . THR A 1 11 ? 15.786 27.340 -11.281 1.00 50.28  ? 45  THR A CG2 1 
ATOM   44  N N   . ALA A 1 12 ? 13.808 29.948 -11.661 1.00 42.71  ? 46  ALA A N   1 
ATOM   45  C CA  . ALA A 1 12 ? 13.584 30.903 -12.704 1.00 45.19  ? 46  ALA A CA  1 
ATOM   46  C C   . ALA A 1 12 ? 14.204 30.401 -14.011 1.00 41.57  ? 46  ALA A C   1 
ATOM   47  O O   . ALA A 1 12 ? 15.381 30.045 -14.042 1.00 45.96  ? 46  ALA A O   1 
ATOM   48  C CB  . ALA A 1 12 ? 14.169 32.265 -12.307 1.00 42.99  ? 46  ALA A CB  1 
ATOM   49  N N   . LEU A 1 13 ? 13.402 30.413 -15.063 1.00 45.80  ? 47  LEU A N   1 
ATOM   50  C CA  . LEU A 1 13 ? 13.811 30.031 -16.457 1.00 46.20  ? 47  LEU A CA  1 
ATOM   51  C C   . LEU A 1 13 ? 14.475 31.184 -17.210 1.00 47.56  ? 47  LEU A C   1 
ATOM   52  O O   . LEU A 1 13 ? 15.267 30.950 -18.094 1.00 48.55  ? 47  LEU A O   1 
ATOM   53  C CB  . LEU A 1 13 ? 12.556 29.643 -17.220 1.00 46.36  ? 47  LEU A CB  1 
ATOM   54  C CG  . LEU A 1 13 ? 11.873 28.420 -16.652 1.00 52.16  ? 47  LEU A CG  1 
ATOM   55  C CD1 . LEU A 1 13 ? 10.494 28.226 -17.272 1.00 56.35  ? 47  LEU A CD1 1 
ATOM   56  C CD2 . LEU A 1 13 ? 12.766 27.245 -16.877 1.00 49.14  ? 47  LEU A CD2 1 
ATOM   57  N N   . PHE A 1 14 ? 14.157 32.432 -16.836 1.00 44.96  ? 48  PHE A N   1 
ATOM   58  C CA  . PHE A 1 14 ? 14.649 33.620 -17.564 1.00 46.06  ? 48  PHE A CA  1 
ATOM   59  C C   . PHE A 1 14 ? 14.852 34.722 -16.582 1.00 47.79  ? 48  PHE A C   1 
ATOM   60  O O   . PHE A 1 14 ? 14.227 34.718 -15.502 1.00 43.86  ? 48  PHE A O   1 
ATOM   61  C CB  . PHE A 1 14 ? 13.597 34.173 -18.546 1.00 45.71  ? 48  PHE A CB  1 
ATOM   62  C CG  . PHE A 1 14 ? 12.842 33.135 -19.309 1.00 43.35  ? 48  PHE A CG  1 
ATOM   63  C CD1 . PHE A 1 14 ? 13.401 32.536 -20.426 1.00 46.23  ? 48  PHE A CD1 1 
ATOM   64  C CD2 . PHE A 1 14 ? 11.560 32.815 -18.964 1.00 45.42  ? 48  PHE A CD2 1 
ATOM   65  C CE1 . PHE A 1 14 ? 12.683 31.618 -21.145 1.00 48.29  ? 48  PHE A CE1 1 
ATOM   66  C CE2 . PHE A 1 14 ? 10.825 31.906 -19.693 1.00 46.00  ? 48  PHE A CE2 1 
ATOM   67  C CZ  . PHE A 1 14 ? 11.413 31.264 -20.736 1.00 45.86  ? 48  PHE A CZ  1 
ATOM   68  N N   . ASP A 1 15 ? 15.679 35.683 -16.978 1.00 43.28  ? 49  ASP A N   1 
ATOM   69  C CA  . ASP A 1 15 ? 15.729 37.047 -16.408 1.00 43.14  ? 49  ASP A CA  1 
ATOM   70  C C   . ASP A 1 15 ? 14.401 37.771 -16.559 1.00 44.74  ? 49  ASP A C   1 
ATOM   71  O O   . ASP A 1 15 ? 13.764 37.615 -17.562 1.00 47.50  ? 49  ASP A O   1 
ATOM   72  C CB  . ASP A 1 15 ? 16.792 37.895 -17.114 1.00 42.10  ? 49  ASP A CB  1 
ATOM   73  C CG  . ASP A 1 15 ? 18.229 37.416 -16.789 1.00 49.17  ? 49  ASP A CG  1 
ATOM   74  O OD1 . ASP A 1 15 ? 18.433 36.398 -16.047 1.00 43.75  ? 49  ASP A OD1 1 
ATOM   75  O OD2 . ASP A 1 15 ? 19.179 38.048 -17.276 1.00 50.45  ? 49  ASP A OD2 1 
ATOM   76  N N   . TYR A 1 16 ? 14.015 38.519 -15.529 1.00 49.89  ? 50  TYR A N   1 
ATOM   77  C CA  . TYR A 1 16 ? 12.851 39.363 -15.514 1.00 43.02  ? 50  TYR A CA  1 
ATOM   78  C C   . TYR A 1 16 ? 13.198 40.731 -14.867 1.00 44.71  ? 50  TYR A C   1 
ATOM   79  O O   . TYR A 1 16 ? 13.610 40.809 -13.664 1.00 43.47  ? 50  TYR A O   1 
ATOM   80  C CB  . TYR A 1 16 ? 11.686 38.691 -14.716 1.00 44.46  ? 50  TYR A CB  1 
ATOM   81  C CG  . TYR A 1 16 ? 10.451 39.608 -14.803 1.00 49.63  ? 50  TYR A CG  1 
ATOM   82  C CD1 . TYR A 1 16 ? 9.912  39.937 -16.070 1.00 52.77  ? 50  TYR A CD1 1 
ATOM   83  C CD2 . TYR A 1 16 ? 9.925  40.265 -13.661 1.00 46.55  ? 50  TYR A CD2 1 
ATOM   84  C CE1 . TYR A 1 16 ? 8.851  40.819 -16.199 1.00 54.52  ? 50  TYR A CE1 1 
ATOM   85  C CE2 . TYR A 1 16 ? 8.855  41.151 -13.786 1.00 54.04  ? 50  TYR A CE2 1 
ATOM   86  C CZ  . TYR A 1 16 ? 8.320  41.418 -15.054 1.00 54.74  ? 50  TYR A CZ  1 
ATOM   87  O OH  . TYR A 1 16 ? 7.266  42.307 -15.217 1.00 63.48  ? 50  TYR A OH  1 
ATOM   88  N N   . GLU A 1 17 ? 13.007 41.807 -15.622 1.00 40.50  ? 51  GLU A N   1 
ATOM   89  C CA  . GLU A 1 17 ? 13.284 43.158 -15.160 1.00 45.17  ? 51  GLU A CA  1 
ATOM   90  C C   . GLU A 1 17 ? 11.952 43.732 -14.654 1.00 52.19  ? 51  GLU A C   1 
ATOM   91  O O   . GLU A 1 17 ? 11.030 43.773 -15.376 1.00 49.79  ? 51  GLU A O   1 
ATOM   92  C CB  . GLU A 1 17 ? 13.827 44.018 -16.288 1.00 48.58  ? 51  GLU A CB  1 
ATOM   93  C CG  . GLU A 1 17 ? 14.326 45.441 -15.812 1.00 51.74  ? 51  GLU A CG  1 
ATOM   94  C CD  . GLU A 1 17 ? 15.507 45.396 -14.777 1.00 62.04  ? 51  GLU A CD  1 
ATOM   95  O OE1 . GLU A 1 17 ? 16.231 44.353 -14.745 1.00 48.65  ? 51  GLU A OE1 1 
ATOM   96  O OE2 . GLU A 1 17 ? 15.705 46.395 -13.995 1.00 51.64  ? 51  GLU A OE2 1 
ATOM   97  N N   . PRO A 1 18 ? 11.844 44.151 -13.383 1.00 53.89  ? 52  PRO A N   1 
ATOM   98  C CA  . PRO A 1 18 ? 10.562 44.654 -12.911 1.00 53.97  ? 52  PRO A CA  1 
ATOM   99  C C   . PRO A 1 18 ? 10.122 45.953 -13.606 1.00 56.79  ? 52  PRO A C   1 
ATOM   100 O O   . PRO A 1 18 ? 10.952 46.817 -13.923 1.00 51.10  ? 52  PRO A O   1 
ATOM   101 C CB  . PRO A 1 18 ? 10.816 44.960 -11.427 1.00 50.22  ? 52  PRO A CB  1 
ATOM   102 C CG  . PRO A 1 18 ? 12.061 44.268 -11.082 1.00 53.62  ? 52  PRO A CG  1 
ATOM   103 C CD  . PRO A 1 18 ? 12.862 44.160 -12.325 1.00 53.15  ? 52  PRO A CD  1 
ATOM   104 N N   . SER A 1 19 ? 8.817  46.079 -13.806 1.00 60.41  ? 53  SER A N   1 
ATOM   105 C CA  . SER A 1 19 ? 8.214  47.337 -14.256 1.00 70.88  ? 53  SER A CA  1 
ATOM   106 C C   . SER A 1 19 ? 7.605  48.151 -13.086 1.00 67.72  ? 53  SER A C   1 
ATOM   107 O O   . SER A 1 19 ? 7.086  49.220 -13.313 1.00 83.81  ? 53  SER A O   1 
ATOM   108 C CB  . SER A 1 19 ? 7.186  47.070 -15.359 1.00 75.38  ? 53  SER A CB  1 
ATOM   109 O OG  . SER A 1 19 ? 6.170  46.258 -14.826 1.00 82.48  ? 53  SER A OG  1 
ATOM   110 N N   . GLY A 1 20 ? 7.734  47.691 -11.842 1.00 66.13  ? 54  GLY A N   1 
ATOM   111 C CA  . GLY A 1 20 ? 7.405  48.492 -10.666 1.00 65.96  ? 54  GLY A CA  1 
ATOM   112 C C   . GLY A 1 20 ? 7.941  47.912 -9.366  1.00 70.06  ? 54  GLY A C   1 
ATOM   113 O O   . GLY A 1 20 ? 8.517  46.815 -9.353  1.00 65.06  ? 54  GLY A O   1 
ATOM   114 N N   . GLN A 1 21 ? 7.745  48.644 -8.265  1.00 61.43  ? 55  GLN A N   1 
ATOM   115 C CA  . GLN A 1 21 ? 8.274  48.250 -6.940  1.00 64.81  ? 55  GLN A CA  1 
ATOM   116 C C   . GLN A 1 21 ? 7.648  46.978 -6.423  1.00 63.28  ? 55  GLN A C   1 
ATOM   117 O O   . GLN A 1 21 ? 8.246  46.333 -5.596  1.00 61.58  ? 55  GLN A O   1 
ATOM   118 C CB  . GLN A 1 21 ? 8.104  49.347 -5.867  1.00 68.29  ? 55  GLN A CB  1 
ATOM   119 C CG  . GLN A 1 21 ? 6.637  49.582 -5.499  1.00 86.63  ? 55  GLN A CG  1 
ATOM   120 C CD  . GLN A 1 21 ? 6.365  50.963 -4.927  1.00 97.02  ? 55  GLN A CD  1 
ATOM   121 O OE1 . GLN A 1 21 ? 5.378  51.636 -5.292  1.00 102.12 ? 55  GLN A OE1 1 
ATOM   122 N NE2 . GLN A 1 21 ? 7.235  51.394 -4.016  1.00 85.51  ? 55  GLN A NE2 1 
ATOM   123 N N   . ASP A 1 22 ? 6.446  46.627 -6.864  1.00 57.76  ? 56  ASP A N   1 
ATOM   124 C CA  . ASP A 1 22 ? 5.811  45.378 -6.386  1.00 61.69  ? 56  ASP A CA  1 
ATOM   125 C C   . ASP A 1 22 ? 6.251  44.097 -7.080  1.00 55.16  ? 56  ASP A C   1 
ATOM   126 O O   . ASP A 1 22 ? 5.957  42.980 -6.586  1.00 48.83  ? 56  ASP A O   1 
ATOM   127 C CB  . ASP A 1 22 ? 4.302  45.505 -6.468  1.00 75.52  ? 56  ASP A CB  1 
ATOM   128 C CG  . ASP A 1 22 ? 3.747  46.434 -5.392  1.00 87.55  ? 56  ASP A CG  1 
ATOM   129 O OD1 . ASP A 1 22 ? 4.513  46.915 -4.500  1.00 97.26  ? 56  ASP A OD1 1 
ATOM   130 O OD2 . ASP A 1 22 ? 2.525  46.673 -5.434  1.00 99.45  ? 56  ASP A OD2 1 
ATOM   131 N N   . GLU A 1 23 ? 6.993  44.254 -8.175  1.00 50.48  ? 57  GLU A N   1 
ATOM   132 C CA  . GLU A 1 23 ? 7.446  43.122 -8.960  1.00 51.93  ? 57  GLU A CA  1 
ATOM   133 C C   . GLU A 1 23 ? 8.860  42.716 -8.522  1.00 51.52  ? 57  GLU A C   1 
ATOM   134 O O   . GLU A 1 23 ? 9.734  43.550 -8.250  1.00 51.39  ? 57  GLU A O   1 
ATOM   135 C CB  . GLU A 1 23 ? 7.365  43.450 -10.463 1.00 53.25  ? 57  GLU A CB  1 
ATOM   136 C CG  . GLU A 1 23 ? 5.938  43.597 -10.957 1.00 54.64  ? 57  GLU A CG  1 
ATOM   137 C CD  . GLU A 1 23 ? 5.857  43.884 -12.441 1.00 67.95  ? 57  GLU A CD  1 
ATOM   138 O OE1 . GLU A 1 23 ? 6.901  43.907 -13.166 1.00 64.90  ? 57  GLU A OE1 1 
ATOM   139 O OE2 . GLU A 1 23 ? 4.719  44.075 -12.897 1.00 72.71  ? 57  GLU A OE2 1 
ATOM   140 N N   . LEU A 1 24 ? 9.040  41.414 -8.418  1.00 44.64  ? 58  LEU A N   1 
ATOM   141 C CA  . LEU A 1 24 ? 10.263 40.822 -7.993  1.00 46.77  ? 58  LEU A CA  1 
ATOM   142 C C   . LEU A 1 24 ? 11.205 40.642 -9.214  1.00 45.05  ? 58  LEU A C   1 
ATOM   143 O O   . LEU A 1 24 ? 10.879 39.956 -10.153 1.00 47.75  ? 58  LEU A O   1 
ATOM   144 C CB  . LEU A 1 24 ? 9.910  39.454 -7.352  1.00 45.93  ? 58  LEU A CB  1 
ATOM   145 C CG  . LEU A 1 24 ? 11.033 38.683 -6.667  1.00 52.70  ? 58  LEU A CG  1 
ATOM   146 C CD1 . LEU A 1 24 ? 11.679 39.444 -5.518  1.00 53.31  ? 58  LEU A CD1 1 
ATOM   147 C CD2 . LEU A 1 24 ? 10.529 37.319 -6.143  1.00 51.40  ? 58  LEU A CD2 1 
ATOM   148 N N   . ALA A 1 25 ? 12.387 41.226 -9.190  1.00 42.59  ? 59  ALA A N   1 
ATOM   149 C CA  . ALA A 1 25 ? 13.376 40.926 -10.209 1.00 45.57  ? 59  ALA A CA  1 
ATOM   150 C C   . ALA A 1 25 ? 13.825 39.450 -10.142 1.00 49.31  ? 59  ALA A C   1 
ATOM   151 O O   . ALA A 1 25 ? 14.063 38.911 -9.049  1.00 52.11  ? 59  ALA A O   1 
ATOM   152 C CB  . ALA A 1 25 ? 14.578 41.843 -10.040 1.00 49.05  ? 59  ALA A CB  1 
ATOM   153 N N   . LEU A 1 26 ? 13.907 38.816 -11.300 1.00 44.45  ? 60  LEU A N   1 
ATOM   154 C CA  . LEU A 1 26 ? 14.401 37.420 -11.416 1.00 44.69  ? 60  LEU A CA  1 
ATOM   155 C C   . LEU A 1 26 ? 15.663 37.379 -12.304 1.00 47.78  ? 60  LEU A C   1 
ATOM   156 O O   . LEU A 1 26 ? 15.842 38.221 -13.231 1.00 41.79  ? 60  LEU A O   1 
ATOM   157 C CB  . LEU A 1 26 ? 13.342 36.514 -12.032 1.00 44.86  ? 60  LEU A CB  1 
ATOM   158 C CG  . LEU A 1 26 ? 11.953 36.408 -11.421 1.00 48.72  ? 60  LEU A CG  1 
ATOM   159 C CD1 . LEU A 1 26 ? 11.077 35.385 -12.140 1.00 50.16  ? 60  LEU A CD1 1 
ATOM   160 C CD2 . LEU A 1 26 ? 12.129 36.003 -9.984  1.00 49.01  ? 60  LEU A CD2 1 
ATOM   161 N N   . ARG A 1 27 ? 16.557 36.444 -11.979 1.00 41.27  ? 61  ARG A N   1 
ATOM   162 C CA  . ARG A 1 27 ? 17.692 36.070 -12.827 1.00 43.73  ? 61  ARG A CA  1 
ATOM   163 C C   . ARG A 1 27 ? 17.559 34.579 -13.034 1.00 49.59  ? 61  ARG A C   1 
ATOM   164 O O   . ARG A 1 27 ? 17.090 33.868 -12.120 1.00 43.37  ? 61  ARG A O   1 
ATOM   165 C CB  . ARG A 1 27 ? 19.003 36.357 -12.145 1.00 43.80  ? 61  ARG A CB  1 
ATOM   166 C CG  . ARG A 1 27 ? 19.266 37.846 -11.979 1.00 46.08  ? 61  ARG A CG  1 
ATOM   167 C CD  . ARG A 1 27 ? 19.348 38.579 -13.312 1.00 46.23  ? 61  ARG A CD  1 
ATOM   168 N NE  . ARG A 1 27 ? 19.551 40.014 -13.116 1.00 43.70  ? 61  ARG A NE  1 
ATOM   169 C CZ  . ARG A 1 27 ? 20.692 40.585 -12.790 1.00 47.49  ? 61  ARG A CZ  1 
ATOM   170 N NH1 . ARG A 1 27 ? 21.801 39.863 -12.682 1.00 51.80  ? 61  ARG A NH1 1 
ATOM   171 N NH2 . ARG A 1 27 ? 20.746 41.905 -12.599 1.00 54.02  ? 61  ARG A NH2 1 
ATOM   172 N N   . LYS A 1 28 ? 17.840 34.133 -14.264 1.00 43.74  ? 62  LYS A N   1 
ATOM   173 C CA  . LYS A 1 28 ? 17.829 32.726 -14.602 1.00 48.35  ? 62  LYS A CA  1 
ATOM   174 C C   . LYS A 1 28 ? 18.608 31.932 -13.551 1.00 44.20  ? 62  LYS A C   1 
ATOM   175 O O   . LYS A 1 28 ? 19.676 32.338 -13.168 1.00 47.39  ? 62  LYS A O   1 
ATOM   176 C CB  . LYS A 1 28 ? 18.484 32.515 -15.966 1.00 52.75  ? 62  LYS A CB  1 
ATOM   177 C CG  . LYS A 1 28 ? 18.545 31.064 -16.420 1.00 65.55  ? 62  LYS A CG  1 
ATOM   178 C CD  . LYS A 1 28 ? 18.781 30.988 -17.925 1.00 75.50  ? 62  LYS A CD  1 
ATOM   179 C CE  . LYS A 1 28 ? 19.447 29.683 -18.349 1.00 77.64  ? 62  LYS A CE  1 
ATOM   180 N NZ  . LYS A 1 28 ? 18.555 28.515 -18.215 1.00 84.41  ? 62  LYS A NZ  1 
ATOM   181 N N   . GLY A 1 29 ? 18.054 30.796 -13.123 1.00 49.09  ? 63  GLY A N   1 
ATOM   182 C CA  . GLY A 1 29 ? 18.658 30.021 -12.078 1.00 51.33  ? 63  GLY A CA  1 
ATOM   183 C C   . GLY A 1 29 ? 18.207 30.406 -10.665 1.00 53.14  ? 63  GLY A C   1 
ATOM   184 O O   . GLY A 1 29 ? 18.288 29.586 -9.790  1.00 52.89  ? 63  GLY A O   1 
ATOM   185 N N   . ASP A 1 30 ? 17.713 31.613 -10.397 1.00 51.00  ? 64  ASP A N   1 
ATOM   186 C CA  . ASP A 1 30 ? 17.157 31.907 -9.032  1.00 52.12  ? 64  ASP A CA  1 
ATOM   187 C C   . ASP A 1 30 ? 16.236 30.828 -8.476  1.00 49.47  ? 64  ASP A C   1 
ATOM   188 O O   . ASP A 1 30 ? 15.374 30.327 -9.200  1.00 47.86  ? 64  ASP A O   1 
ATOM   189 C CB  . ASP A 1 30 ? 16.302 33.164 -9.030  1.00 55.35  ? 64  ASP A CB  1 
ATOM   190 C CG  . ASP A 1 30 ? 17.115 34.430 -9.070  1.00 57.03  ? 64  ASP A CG  1 
ATOM   191 O OD1 . ASP A 1 30 ? 18.343 34.456 -8.814  1.00 57.39  ? 64  ASP A OD1 1 
ATOM   192 O OD2 . ASP A 1 30 ? 16.483 35.447 -9.328  1.00 55.73  ? 64  ASP A OD2 1 
ATOM   193 N N   A ARG A 1 31 ? 16.444 30.450 -7.216  0.50 47.42  ? 65  ARG A N   1 
ATOM   194 N N   B ARG A 1 31 ? 16.433 30.500 -7.192  0.50 49.80  ? 65  ARG A N   1 
ATOM   195 C CA  A ARG A 1 31 ? 15.503 29.614 -6.509  0.50 49.04  ? 65  ARG A CA  1 
ATOM   196 C CA  B ARG A 1 31 ? 15.565 29.623 -6.412  0.50 52.85  ? 65  ARG A CA  1 
ATOM   197 C C   A ARG A 1 31 ? 14.484 30.572 -5.930  0.50 49.21  ? 65  ARG A C   1 
ATOM   198 C C   B ARG A 1 31 ? 14.457 30.475 -5.783  0.50 51.68  ? 65  ARG A C   1 
ATOM   199 O O   A ARG A 1 31 ? 14.852 31.537 -5.270  0.50 47.68  ? 65  ARG A O   1 
ATOM   200 O O   B ARG A 1 31 ? 14.726 31.224 -4.858  0.50 55.22  ? 65  ARG A O   1 
ATOM   201 C CB  A ARG A 1 31 ? 16.205 28.825 -5.408  0.50 55.07  ? 65  ARG A CB  1 
ATOM   202 C CB  B ARG A 1 31 ? 16.399 28.923 -5.306  0.50 60.83  ? 65  ARG A CB  1 
ATOM   203 C CG  A ARG A 1 31 ? 17.434 28.012 -5.845  0.50 59.63  ? 65  ARG A CG  1 
ATOM   204 C CG  B ARG A 1 31 ? 17.338 27.784 -5.776  0.50 68.01  ? 65  ARG A CG  1 
ATOM   205 C CD  A ARG A 1 31 ? 17.188 26.959 -6.933  0.50 62.51  ? 65  ARG A CD  1 
ATOM   206 C CD  B ARG A 1 31 ? 18.159 27.087 -4.657  0.50 73.34  ? 65  ARG A CD  1 
ATOM   207 N NE  A ARG A 1 31 ? 16.095 26.017 -6.672  0.50 66.56  ? 65  ARG A NE  1 
ATOM   208 N NE  B ARG A 1 31 ? 17.331 26.568 -3.558  0.50 76.50  ? 65  ARG A NE  1 
ATOM   209 C CZ  A ARG A 1 31 ? 16.138 25.000 -5.811  0.50 62.20  ? 65  ARG A CZ  1 
ATOM   210 C CZ  B ARG A 1 31 ? 17.425 26.972 -2.298  0.50 71.85  ? 65  ARG A CZ  1 
ATOM   211 N NH1 A ARG A 1 31 ? 17.217 24.781 -5.071  0.50 64.52  ? 65  ARG A NH1 1 
ATOM   212 N NH1 B ARG A 1 31 ? 18.347 27.868 -1.956  0.50 64.53  ? 65  ARG A NH1 1 
ATOM   213 N NH2 A ARG A 1 31 ? 15.086 24.208 -5.686  0.50 55.98  ? 65  ARG A NH2 1 
ATOM   214 N NH2 B ARG A 1 31 ? 16.608 26.463 -1.393  0.50 69.24  ? 65  ARG A NH2 1 
ATOM   215 N N   . VAL A 1 32 ? 13.219 30.354 -6.273  1.00 47.52  ? 66  VAL A N   1 
ATOM   216 C CA  . VAL A 1 32 ? 12.126 31.222 -5.879  1.00 48.75  ? 66  VAL A CA  1 
ATOM   217 C C   . VAL A 1 32 ? 11.205 30.475 -4.969  1.00 46.77  ? 66  VAL A C   1 
ATOM   218 O O   . VAL A 1 32 ? 10.669 29.455 -5.313  1.00 54.11  ? 66  VAL A O   1 
ATOM   219 C CB  . VAL A 1 32 ? 11.248 31.647 -7.092  1.00 48.35  ? 66  VAL A CB  1 
ATOM   220 C CG1 . VAL A 1 32 ? 10.140 32.576 -6.634  1.00 53.40  ? 66  VAL A CG1 1 
ATOM   221 C CG2 . VAL A 1 32 ? 12.125 32.326 -8.133  1.00 50.96  ? 66  VAL A CG2 1 
ATOM   222 N N   . GLU A 1 33 ? 11.000 31.026 -3.808  1.00 47.32  ? 67  GLU A N   1 
ATOM   223 C CA  . GLU A 1 33 ? 10.105 30.456 -2.846  1.00 48.96  ? 67  GLU A CA  1 
ATOM   224 C C   . GLU A 1 33 ? 8.752  31.012 -3.168  1.00 47.10  ? 67  GLU A C   1 
ATOM   225 O O   . GLU A 1 33 ? 8.531  32.219 -3.144  1.00 51.76  ? 67  GLU A O   1 
ATOM   226 C CB  . GLU A 1 33 ? 10.597 30.877 -1.463  1.00 52.12  ? 67  GLU A CB  1 
ATOM   227 C CG  . GLU A 1 33 ? 9.759  30.390 -0.289  1.00 67.95  ? 67  GLU A CG  1 
ATOM   228 C CD  . GLU A 1 33 ? 10.114 31.170 0.998   1.00 74.88  ? 67  GLU A CD  1 
ATOM   229 O OE1 . GLU A 1 33 ? 10.987 32.076 0.961   1.00 83.85  ? 67  GLU A OE1 1 
ATOM   230 O OE2 . GLU A 1 33 ? 9.517  30.881 2.045   1.00 77.60  ? 67  GLU A OE2 1 
ATOM   231 N N   . VAL A 1 34 ? 7.853  30.133 -3.500  1.00 49.16  ? 68  VAL A N   1 
ATOM   232 C CA  . VAL A 1 34 ? 6.547  30.525 -3.926  1.00 50.93  ? 68  VAL A CA  1 
ATOM   233 C C   . VAL A 1 34 ? 5.626  30.606 -2.723  1.00 52.36  ? 68  VAL A C   1 
ATOM   234 O O   . VAL A 1 34 ? 5.280  29.580 -2.149  1.00 59.83  ? 68  VAL A O   1 
ATOM   235 C CB  . VAL A 1 34 ? 5.990  29.492 -4.939  1.00 58.26  ? 68  VAL A CB  1 
ATOM   236 C CG1 . VAL A 1 34 ? 4.573  29.906 -5.366  1.00 58.39  ? 68  VAL A CG1 1 
ATOM   237 C CG2 . VAL A 1 34 ? 6.920  29.411 -6.147  1.00 57.42  ? 68  VAL A CG2 1 
ATOM   238 N N   . LEU A 1 35 ? 5.227  31.827 -2.395  1.00 52.94  ? 69  LEU A N   1 
ATOM   239 C CA  . LEU A 1 35 ? 4.384  32.130 -1.252  1.00 54.06  ? 69  LEU A CA  1 
ATOM   240 C C   . LEU A 1 35 ? 2.884  32.012 -1.569  1.00 60.55  ? 69  LEU A C   1 
ATOM   241 O O   . LEU A 1 35 ? 2.115  31.684 -0.686  1.00 58.25  ? 69  LEU A O   1 
ATOM   242 C CB  . LEU A 1 35 ? 4.665  33.529 -0.772  1.00 49.66  ? 69  LEU A CB  1 
ATOM   243 C CG  . LEU A 1 35 ? 6.129  33.720 -0.360  1.00 54.51  ? 69  LEU A CG  1 
ATOM   244 C CD1 . LEU A 1 35 ? 6.332  35.189 -0.071  1.00 57.36  ? 69  LEU A CD1 1 
ATOM   245 C CD2 . LEU A 1 35 ? 6.465  32.874 0.868   1.00 56.38  ? 69  LEU A CD2 1 
ATOM   246 N N   . SER A 1 36 ? 2.468  32.260 -2.816  1.00 55.72  ? 70  SER A N   1 
ATOM   247 C CA  . SER A 1 36 ? 1.044  32.142 -3.187  1.00 61.99  ? 70  SER A CA  1 
ATOM   248 C C   . SER A 1 36 ? 0.833  32.167 -4.712  1.00 61.34  ? 70  SER A C   1 
ATOM   249 O O   . SER A 1 36 ? 1.311  33.070 -5.416  1.00 53.02  ? 70  SER A O   1 
ATOM   250 C CB  . SER A 1 36 ? 0.218  33.277 -2.575  1.00 60.35  ? 70  SER A CB  1 
ATOM   251 O OG  . SER A 1 36 ? -1.069 33.344 -3.172  1.00 56.63  ? 70  SER A OG  1 
ATOM   252 N N   . ARG A 1 37 ? 0.066  31.201 -5.190  1.00 60.04  ? 71  ARG A N   1 
ATOM   253 C CA  . ARG A 1 37 ? -0.230 31.107 -6.593  1.00 61.92  ? 71  ARG A CA  1 
ATOM   254 C C   . ARG A 1 37 ? -1.541 31.784 -6.856  1.00 59.49  ? 71  ARG A C   1 
ATOM   255 O O   . ARG A 1 37 ? -2.017 31.752 -7.952  1.00 66.85  ? 71  ARG A O   1 
ATOM   256 C CB  . ARG A 1 37 ? -0.306 29.668 -7.025  1.00 57.11  ? 71  ARG A CB  1 
ATOM   257 C CG  . ARG A 1 37 ? 0.952  28.856 -6.791  1.00 64.44  ? 71  ARG A CG  1 
ATOM   258 C CD  . ARG A 1 37 ? 0.648  27.415 -7.180  1.00 70.60  ? 71  ARG A CD  1 
ATOM   259 N NE  . ARG A 1 37 ? 1.801  26.540 -7.284  1.00 77.72  ? 71  ARG A NE  1 
ATOM   260 C CZ  . ARG A 1 37 ? 2.481  26.007 -6.263  1.00 94.86  ? 71  ARG A CZ  1 
ATOM   261 N NH1 . ARG A 1 37 ? 2.179  26.288 -4.999  1.00 101.71 ? 71  ARG A NH1 1 
ATOM   262 N NH2 . ARG A 1 37 ? 3.509  25.185 -6.508  1.00 95.44  ? 71  ARG A NH2 1 
ATOM   263 N N   . ASP A 1 38 ? -2.108 32.446 -5.874  1.00 62.33  ? 72  ASP A N   1 
ATOM   264 C CA  . ASP A 1 38 ? -3.465 32.908 -5.990  1.00 62.78  ? 72  ASP A CA  1 
ATOM   265 C C   . ASP A 1 38 ? -3.553 34.387 -6.334  1.00 54.82  ? 72  ASP A C   1 
ATOM   266 O O   . ASP A 1 38 ? -2.855 35.237 -5.763  1.00 54.90  ? 72  ASP A O   1 
ATOM   267 C CB  . ASP A 1 38 ? -4.212 32.616 -4.670  1.00 74.44  ? 72  ASP A CB  1 
ATOM   268 C CG  . ASP A 1 38 ? -5.721 32.666 -4.844  1.00 85.01  ? 72  ASP A CG  1 
ATOM   269 O OD1 . ASP A 1 38 ? -6.273 33.754 -5.206  1.00 82.69  ? 72  ASP A OD1 1 
ATOM   270 O OD2 . ASP A 1 38 ? -6.327 31.598 -4.671  1.00 80.06  ? 72  ASP A OD2 1 
ATOM   271 N N   . ALA A 1 39 ? -4.444 34.723 -7.258  1.00 50.80  ? 73  ALA A N   1 
ATOM   272 C CA  . ALA A 1 39 ? -4.559 36.113 -7.700  1.00 52.99  ? 73  ALA A CA  1 
ATOM   273 C C   . ALA A 1 39 ? -5.159 37.051 -6.648  1.00 56.40  ? 73  ALA A C   1 
ATOM   274 O O   . ALA A 1 39 ? -4.979 38.300 -6.702  1.00 51.90  ? 73  ALA A O   1 
ATOM   275 C CB  . ALA A 1 39 ? -5.365 36.178 -8.990  1.00 60.62  ? 73  ALA A CB  1 
ATOM   276 N N   . ALA A 1 40 ? -5.878 36.467 -5.689  1.00 55.21  ? 74  ALA A N   1 
ATOM   277 C CA  . ALA A 1 40 ? -6.284 37.207 -4.470  1.00 58.67  ? 74  ALA A CA  1 
ATOM   278 C C   . ALA A 1 40 ? -5.072 37.797 -3.689  1.00 60.20  ? 74  ALA A C   1 
ATOM   279 O O   . ALA A 1 40 ? -5.172 38.858 -3.085  1.00 60.99  ? 74  ALA A O   1 
ATOM   280 C CB  . ALA A 1 40 ? -7.090 36.295 -3.554  1.00 64.48  ? 74  ALA A CB  1 
ATOM   281 N N   . ILE A 1 41 ? -3.926 37.108 -3.702  1.00 54.83  ? 75  ILE A N   1 
ATOM   282 C CA  . ILE A 1 41 ? -2.675 37.699 -3.159  1.00 54.37  ? 75  ILE A CA  1 
ATOM   283 C C   . ILE A 1 41 ? -1.919 38.474 -4.259  1.00 60.95  ? 75  ILE A C   1 
ATOM   284 O O   . ILE A 1 41 ? -1.561 39.627 -4.052  1.00 56.37  ? 75  ILE A O   1 
ATOM   285 C CB  . ILE A 1 41 ? -1.811 36.582 -2.538  1.00 55.03  ? 75  ILE A CB  1 
ATOM   286 C CG1 . ILE A 1 41 ? -2.572 35.917 -1.374  1.00 65.22  ? 75  ILE A CG1 1 
ATOM   287 C CG2 . ILE A 1 41 ? -0.480 37.123 -2.038  1.00 59.63  ? 75  ILE A CG2 1 
ATOM   288 C CD1 . ILE A 1 41 ? -2.913 36.888 -0.248  1.00 62.80  ? 75  ILE A CD1 1 
ATOM   289 N N   . SER A 1 42 ? -1.672 37.881 -5.435  1.00 60.20  ? 76  SER A N   1 
ATOM   290 C CA  . SER A 1 42 ? -0.730 38.557 -6.394  1.00 57.12  ? 76  SER A CA  1 
ATOM   291 C C   . SER A 1 42 ? -1.325 39.749 -7.092  1.00 60.13  ? 76  SER A C   1 
ATOM   292 O O   . SER A 1 42 ? -0.626 40.659 -7.511  1.00 60.74  ? 76  SER A O   1 
ATOM   293 C CB  . SER A 1 42 ? -0.252 37.570 -7.438  1.00 62.99  ? 76  SER A CB  1 
ATOM   294 O OG  . SER A 1 42 ? -1.303 37.194 -8.305  1.00 54.69  ? 76  SER A OG  1 
ATOM   295 N N   . GLY A 1 43 ? -2.645 39.764 -7.205  1.00 63.95  ? 77  GLY A N   1 
ATOM   296 C CA  . GLY A 1 43 ? -3.344 40.894 -7.811  1.00 61.12  ? 77  GLY A CA  1 
ATOM   297 C C   . GLY A 1 43 ? -3.632 40.721 -9.282  1.00 66.92  ? 77  GLY A C   1 
ATOM   298 O O   . GLY A 1 43 ? -4.182 41.633 -9.906  1.00 66.78  ? 77  GLY A O   1 
ATOM   299 N N   . ASP A 1 44 ? -3.266 39.561 -9.831  1.00 68.49  ? 78  ASP A N   1 
ATOM   300 C CA  . ASP A 1 44 ? -3.349 39.321 -11.271 1.00 67.44  ? 78  ASP A CA  1 
ATOM   301 C C   . ASP A 1 44 ? -3.158 37.869 -11.598 1.00 62.66  ? 78  ASP A C   1 
ATOM   302 O O   . ASP A 1 44 ? -2.231 37.215 -11.166 1.00 61.67  ? 78  ASP A O   1 
ATOM   303 C CB  . ASP A 1 44 ? -2.344 40.151 -12.036 1.00 76.27  ? 78  ASP A CB  1 
ATOM   304 C CG  . ASP A 1 44 ? -2.739 40.334 -13.494 1.00 91.72  ? 78  ASP A CG  1 
ATOM   305 O OD1 . ASP A 1 44 ? -3.118 39.338 -14.172 1.00 100.47 ? 78  ASP A OD1 1 
ATOM   306 O OD2 . ASP A 1 44 ? -2.670 41.489 -13.960 1.00 100.78 ? 78  ASP A OD2 1 
ATOM   307 N N   . GLU A 1 45 ? -4.088 37.373 -12.370 1.00 64.43  ? 79  GLU A N   1 
ATOM   308 C CA  . GLU A 1 45 ? -4.087 36.026 -12.866 1.00 70.41  ? 79  GLU A CA  1 
ATOM   309 C C   . GLU A 1 45 ? -2.754 35.755 -13.574 1.00 66.86  ? 79  GLU A C   1 
ATOM   310 O O   . GLU A 1 45 ? -2.242 36.621 -14.322 1.00 60.14  ? 79  GLU A O   1 
ATOM   311 C CB  . GLU A 1 45 ? -5.276 35.869 -13.888 1.00 79.68  ? 79  GLU A CB  1 
ATOM   312 C CG  . GLU A 1 45 ? -5.946 34.508 -13.861 1.00 85.43  ? 79  GLU A CG  1 
ATOM   313 C CD  . GLU A 1 45 ? -6.499 34.177 -12.473 1.00 103.50 ? 79  GLU A CD  1 
ATOM   314 O OE1 . GLU A 1 45 ? -7.268 34.997 -11.890 1.00 105.29 ? 79  GLU A OE1 1 
ATOM   315 O OE2 . GLU A 1 45 ? -6.138 33.102 -11.946 1.00 97.01  ? 79  GLU A OE2 1 
ATOM   316 N N   . GLY A 1 46 ? -2.198 34.568 -13.357 1.00 62.22  ? 80  GLY A N   1 
ATOM   317 C CA  . GLY A 1 46 ? -0.919 34.234 -13.973 1.00 69.49  ? 80  GLY A CA  1 
ATOM   318 C C   . GLY A 1 46 ? 0.357  34.856 -13.380 1.00 65.13  ? 80  GLY A C   1 
ATOM   319 O O   . GLY A 1 46 ? 1.451  34.618 -13.900 1.00 65.33  ? 80  GLY A O   1 
ATOM   320 N N   . TRP A 1 47 ? 0.219  35.625 -12.302 1.00 55.61  ? 81  TRP A N   1 
ATOM   321 C CA  . TRP A 1 47 ? 1.342  36.165 -11.511 1.00 59.75  ? 81  TRP A CA  1 
ATOM   322 C C   . TRP A 1 47 ? 1.266  35.521 -10.136 1.00 60.55  ? 81  TRP A C   1 
ATOM   323 O O   . TRP A 1 47 ? 0.197  35.331 -9.613  1.00 51.93  ? 81  TRP A O   1 
ATOM   324 C CB  . TRP A 1 47 ? 1.261  37.686 -11.379 1.00 57.94  ? 81  TRP A CB  1 
ATOM   325 C CG  . TRP A 1 47 ? 1.512  38.335 -12.667 1.00 57.56  ? 81  TRP A CG  1 
ATOM   326 C CD1 . TRP A 1 47 ? 0.713  38.273 -13.801 1.00 58.61  ? 81  TRP A CD1 1 
ATOM   327 C CD2 . TRP A 1 47 ? 2.653  39.099 -13.025 1.00 53.69  ? 81  TRP A CD2 1 
ATOM   328 N NE1 . TRP A 1 47 ? 1.284  39.001 -14.808 1.00 54.93  ? 81  TRP A NE1 1 
ATOM   329 C CE2 . TRP A 1 47 ? 2.468  39.525 -14.367 1.00 53.62  ? 81  TRP A CE2 1 
ATOM   330 C CE3 . TRP A 1 47 ? 3.792  39.503 -12.343 1.00 55.69  ? 81  TRP A CE3 1 
ATOM   331 C CZ2 . TRP A 1 47 ? 3.386  40.289 -15.028 1.00 49.29  ? 81  TRP A CZ2 1 
ATOM   332 C CZ3 . TRP A 1 47 ? 4.720  40.274 -13.003 1.00 52.95  ? 81  TRP A CZ3 1 
ATOM   333 C CH2 . TRP A 1 47 ? 4.508  40.668 -14.335 1.00 53.06  ? 81  TRP A CH2 1 
ATOM   334 N N   . TRP A 1 48 ? 2.412  35.132 -9.598  1.00 49.93  ? 82  TRP A N   1 
ATOM   335 C CA  . TRP A 1 48 ? 2.531  34.547 -8.298  1.00 42.72  ? 82  TRP A CA  1 
ATOM   336 C C   . TRP A 1 48 ? 3.258  35.530 -7.384  1.00 48.43  ? 82  TRP A C   1 
ATOM   337 O O   . TRP A 1 48 ? 3.879  36.507 -7.842  1.00 50.68  ? 82  TRP A O   1 
ATOM   338 C CB  . TRP A 1 48 ? 3.299  33.226 -8.404  1.00 44.00  ? 82  TRP A CB  1 
ATOM   339 C CG  . TRP A 1 48 ? 2.554  32.149 -9.153  1.00 49.06  ? 82  TRP A CG  1 
ATOM   340 C CD1 . TRP A 1 48 ? 1.278  32.221 -9.623  1.00 54.06  ? 82  TRP A CD1 1 
ATOM   341 C CD2 . TRP A 1 48 ? 3.021  30.835 -9.475  1.00 48.65  ? 82  TRP A CD2 1 
ATOM   342 N NE1 . TRP A 1 48 ? 0.944  31.069 -10.242 1.00 48.71  ? 82  TRP A NE1 1 
ATOM   343 C CE2 . TRP A 1 48 ? 1.990  30.193 -10.174 1.00 48.41  ? 82  TRP A CE2 1 
ATOM   344 C CE3 . TRP A 1 48 ? 4.233  30.153 -9.272  1.00 54.44  ? 82  TRP A CE3 1 
ATOM   345 C CZ2 . TRP A 1 48 ? 2.105  28.870 -10.666 1.00 56.19  ? 82  TRP A CZ2 1 
ATOM   346 C CZ3 . TRP A 1 48 ? 4.362  28.852 -9.761  1.00 57.23  ? 82  TRP A CZ3 1 
ATOM   347 C CH2 . TRP A 1 48 ? 3.302  28.215 -10.459 1.00 55.38  ? 82  TRP A CH2 1 
ATOM   348 N N   . ALA A 1 49 ? 3.178  35.258 -6.069  1.00 51.55  ? 83  ALA A N   1 
ATOM   349 C CA  . ALA A 1 49 ? 3.904  36.014 -5.066  1.00 49.29  ? 83  ALA A CA  1 
ATOM   350 C C   . ALA A 1 49 ? 4.991  35.101 -4.567  1.00 44.73  ? 83  ALA A C   1 
ATOM   351 O O   . ALA A 1 49 ? 4.791  33.908 -4.326  1.00 43.91  ? 83  ALA A O   1 
ATOM   352 C CB  . ALA A 1 49 ? 2.996  36.477 -3.912  1.00 55.94  ? 83  ALA A CB  1 
ATOM   353 N N   . GLY A 1 50 ? 6.193  35.653 -4.476  1.00 46.55  ? 84  GLY A N   1 
ATOM   354 C CA  . GLY A 1 50 ? 7.281  34.876 -3.951  1.00 45.24  ? 84  GLY A CA  1 
ATOM   355 C C   . GLY A 1 50 ? 8.372  35.675 -3.351  1.00 44.39  ? 84  GLY A C   1 
ATOM   356 O O   . GLY A 1 50 ? 8.272  36.916 -3.250  1.00 44.81  ? 84  GLY A O   1 
ATOM   357 N N   . GLN A 1 51 ? 9.439  34.950 -3.021  1.00 43.71  ? 85  GLN A N   1 
ATOM   358 C CA  . GLN A 1 51 ? 10.628 35.508 -2.390  1.00 49.87  ? 85  GLN A CA  1 
ATOM   359 C C   . GLN A 1 51 ? 11.956 34.989 -2.965  1.00 44.19  ? 85  GLN A C   1 
ATOM   360 O O   . GLN A 1 51 ? 12.110 33.791 -3.146  1.00 44.50  ? 85  GLN A O   1 
ATOM   361 C CB  . GLN A 1 51 ? 10.636 35.110 -0.893  1.00 53.49  ? 85  GLN A CB  1 
ATOM   362 C CG  . GLN A 1 51 ? 11.674 35.896 -0.113  1.00 57.49  ? 85  GLN A CG  1 
ATOM   363 C CD  . GLN A 1 51 ? 11.528 35.699 1.388   1.00 71.12  ? 85  GLN A CD  1 
ATOM   364 O OE1 . GLN A 1 51 ? 10.411 35.680 1.929   1.00 64.54  ? 85  GLN A OE1 1 
ATOM   365 N NE2 . GLN A 1 51 ? 12.662 35.488 2.065   1.00 64.79  ? 85  GLN A NE2 1 
ATOM   366 N N   . VAL A 1 52 ? 12.897 35.884 -3.172  1.00 43.46  ? 86  VAL A N   1 
ATOM   367 C CA  . VAL A 1 52 ? 14.247 35.565 -3.659  1.00 51.67  ? 86  VAL A CA  1 
ATOM   368 C C   . VAL A 1 52 ? 15.180 36.532 -2.975  1.00 47.28  ? 86  VAL A C   1 
ATOM   369 O O   . VAL A 1 52 ? 14.969 37.735 -3.078  1.00 50.80  ? 86  VAL A O   1 
ATOM   370 C CB  . VAL A 1 52 ? 14.464 35.868 -5.198  1.00 53.14  ? 86  VAL A CB  1 
ATOM   371 C CG1 . VAL A 1 52 ? 15.941 35.677 -5.606  1.00 63.22  ? 86  VAL A CG1 1 
ATOM   372 C CG2 . VAL A 1 52 ? 13.648 34.958 -6.053  1.00 52.57  ? 86  VAL A CG2 1 
ATOM   373 N N   . GLY A 1 53 ? 16.268 36.038 -2.374  1.00 54.93  ? 87  GLY A N   1 
ATOM   374 C CA  . GLY A 1 53 ? 17.326 36.910 -1.822  1.00 52.79  ? 87  GLY A CA  1 
ATOM   375 C C   . GLY A 1 53 ? 16.774 37.813 -0.727  1.00 58.39  ? 87  GLY A C   1 
ATOM   376 O O   . GLY A 1 53 ? 17.188 38.941 -0.584  1.00 50.15  ? 87  GLY A O   1 
ATOM   377 N N   . GLY A 1 54 ? 15.793 37.337 0.028   1.00 54.55  ? 88  GLY A N   1 
ATOM   378 C CA  . GLY A 1 54 ? 15.175 38.195 1.016   1.00 57.94  ? 88  GLY A CA  1 
ATOM   379 C C   . GLY A 1 54 ? 14.262 39.287 0.487   1.00 57.08  ? 88  GLY A C   1 
ATOM   380 O O   . GLY A 1 54 ? 13.781 40.046 1.255   1.00 55.32  ? 88  GLY A O   1 
ATOM   381 N N   . GLN A 1 55 ? 14.005 39.388 -0.807  1.00 50.73  ? 89  GLN A N   1 
ATOM   382 C CA  . GLN A 1 55 ? 12.921 40.325 -1.351  1.00 47.98  ? 89  GLN A CA  1 
ATOM   383 C C   . GLN A 1 55 ? 11.664 39.538 -1.680  1.00 45.73  ? 89  GLN A C   1 
ATOM   384 O O   . GLN A 1 55 ? 11.779 38.391 -2.204  1.00 47.80  ? 89  GLN A O   1 
ATOM   385 C CB  . GLN A 1 55 ? 13.403 40.942 -2.674  1.00 49.23  ? 89  GLN A CB  1 
ATOM   386 C CG  . GLN A 1 55 ? 14.705 41.720 -2.504  1.00 53.33  ? 89  GLN A CG  1 
ATOM   387 C CD  . GLN A 1 55 ? 14.394 43.042 -1.847  1.00 59.40  ? 89  GLN A CD  1 
ATOM   388 O OE1 . GLN A 1 55 ? 13.240 43.498 -1.865  1.00 52.83  ? 89  GLN A OE1 1 
ATOM   389 N NE2 . GLN A 1 55 ? 15.397 43.688 -1.327  1.00 54.14  ? 89  GLN A NE2 1 
ATOM   390 N N   A VAL A 1 56 ? 10.489 40.093 -1.379  0.50 47.97  ? 90  VAL A N   1 
ATOM   391 N N   B VAL A 1 56 ? 10.510 40.178 -1.472  0.50 43.47  ? 90  VAL A N   1 
ATOM   392 C CA  A VAL A 1 56 ? 9.204  39.480 -1.743  0.50 51.43  ? 90  VAL A CA  1 
ATOM   393 C CA  B VAL A 1 56 ? 9.175  39.613 -1.682  0.50 44.44  ? 90  VAL A CA  1 
ATOM   394 C C   A VAL A 1 56 ? 8.488  40.391 -2.749  0.50 49.75  ? 90  VAL A C   1 
ATOM   395 C C   B VAL A 1 56 ? 8.470  40.437 -2.768  0.50 45.65  ? 90  VAL A C   1 
ATOM   396 O O   A VAL A 1 56 ? 8.598  41.596 -2.698  0.50 46.74  ? 90  VAL A O   1 
ATOM   397 O O   B VAL A 1 56 ? 8.557  41.644 -2.793  0.50 43.03  ? 90  VAL A O   1 
ATOM   398 C CB  A VAL A 1 56 ? 8.270  39.213 -0.521  0.50 58.89  ? 90  VAL A CB  1 
ATOM   399 C CB  B VAL A 1 56 ? 8.306  39.691 -0.386  0.50 45.17  ? 90  VAL A CB  1 
ATOM   400 C CG1 A VAL A 1 56 ? 8.885  38.195 0.434   0.50 60.75  ? 90  VAL A CG1 1 
ATOM   401 C CG1 B VAL A 1 56 ? 6.937  39.038 -0.604  0.50 38.02  ? 90  VAL A CG1 1 
ATOM   402 C CG2 A VAL A 1 56 ? 7.933  40.505 0.212   0.50 58.34  ? 90  VAL A CG2 1 
ATOM   403 C CG2 B VAL A 1 56 ? 9.046  39.078 0.798   0.50 45.60  ? 90  VAL A CG2 1 
ATOM   404 N N   . GLY A 1 57 ? 7.763  39.796 -3.673  1.00 46.13  ? 91  GLY A N   1 
ATOM   405 C CA  . GLY A 1 57 ? 7.078  40.546 -4.709  1.00 49.35  ? 91  GLY A CA  1 
ATOM   406 C C   . GLY A 1 57 ? 6.439  39.539 -5.634  1.00 47.85  ? 91  GLY A C   1 
ATOM   407 O O   . GLY A 1 57 ? 6.451  38.324 -5.369  1.00 43.82  ? 91  GLY A O   1 
ATOM   408 N N   . ILE A 1 58 ? 5.846  40.049 -6.694  1.00 45.80  ? 92  ILE A N   1 
ATOM   409 C CA  . ILE A 1 58 ? 5.107  39.212 -7.629  1.00 49.36  ? 92  ILE A CA  1 
ATOM   410 C C   . ILE A 1 58 ? 5.959  38.996 -8.900  1.00 46.42  ? 92  ILE A C   1 
ATOM   411 O O   . ILE A 1 58 ? 6.801  39.817 -9.264  1.00 44.50  ? 92  ILE A O   1 
ATOM   412 C CB  . ILE A 1 58 ? 3.726  39.830 -7.985  1.00 48.14  ? 92  ILE A CB  1 
ATOM   413 C CG1 . ILE A 1 58 ? 3.860  41.214 -8.615  1.00 49.20  ? 92  ILE A CG1 1 
ATOM   414 C CG2 . ILE A 1 58 ? 2.872  39.975 -6.718  1.00 51.96  ? 92  ILE A CG2 1 
ATOM   415 C CD1 . ILE A 1 58 ? 2.566  41.738 -9.284  1.00 54.11  ? 92  ILE A CD1 1 
ATOM   416 N N   . PHE A 1 59 ? 5.700  37.915 -9.601  1.00 44.65  ? 93  PHE A N   1 
ATOM   417 C CA  . PHE A 1 59 ? 6.477  37.642 -10.815 1.00 45.57  ? 93  PHE A CA  1 
ATOM   418 C C   . PHE A 1 59 ? 5.631  36.708 -11.720 1.00 46.96  ? 93  PHE A C   1 
ATOM   419 O O   . PHE A 1 59 ? 4.684  36.065 -11.239 1.00 44.20  ? 93  PHE A O   1 
ATOM   420 C CB  . PHE A 1 59 ? 7.771  36.938 -10.381 1.00 42.47  ? 93  PHE A CB  1 
ATOM   421 C CG  . PHE A 1 59 ? 7.529  35.613 -9.674  1.00 43.40  ? 93  PHE A CG  1 
ATOM   422 C CD1 . PHE A 1 59 ? 7.397  34.419 -10.395 1.00 46.65  ? 93  PHE A CD1 1 
ATOM   423 C CD2 . PHE A 1 59 ? 7.387  35.538 -8.296  1.00 49.86  ? 93  PHE A CD2 1 
ATOM   424 C CE1 . PHE A 1 59 ? 7.124  33.207 -9.761  1.00 46.95  ? 93  PHE A CE1 1 
ATOM   425 C CE2 . PHE A 1 59 ? 7.115  34.301 -7.654  1.00 45.87  ? 93  PHE A CE2 1 
ATOM   426 C CZ  . PHE A 1 59 ? 6.988  33.158 -8.368  1.00 45.94  ? 93  PHE A CZ  1 
ATOM   427 N N   . PRO A 1 60 ? 5.993  36.555 -12.995 1.00 46.47  ? 94  PRO A N   1 
ATOM   428 C CA  . PRO A 1 60 ? 5.129  35.777 -13.881 1.00 44.90  ? 94  PRO A CA  1 
ATOM   429 C C   . PRO A 1 60 ? 5.322  34.331 -13.708 1.00 44.56  ? 94  PRO A C   1 
ATOM   430 O O   . PRO A 1 60 ? 6.431  33.851 -13.547 1.00 48.85  ? 94  PRO A O   1 
ATOM   431 C CB  . PRO A 1 60 ? 5.559  36.196 -15.280 1.00 48.03  ? 94  PRO A CB  1 
ATOM   432 C CG  . PRO A 1 60 ? 6.511  37.310 -15.108 1.00 52.05  ? 94  PRO A CG  1 
ATOM   433 C CD  . PRO A 1 60 ? 7.047  37.272 -13.726 1.00 53.40  ? 94  PRO A CD  1 
ATOM   434 N N   . SER A 1 61 ? 4.230  33.614 -13.703 1.00 43.47  ? 95  SER A N   1 
ATOM   435 C CA  . SER A 1 61 ? 4.269  32.179 -13.407 1.00 49.68  ? 95  SER A CA  1 
ATOM   436 C C   . SER A 1 61 ? 4.857  31.406 -14.552 1.00 50.25  ? 95  SER A C   1 
ATOM   437 O O   . SER A 1 61 ? 5.384  30.358 -14.332 1.00 52.77  ? 95  SER A O   1 
ATOM   438 C CB  . SER A 1 61 ? 2.860  31.636 -13.077 1.00 55.41  ? 95  SER A CB  1 
ATOM   439 O OG  . SER A 1 61 ? 1.971  31.906 -14.164 1.00 60.14  ? 95  SER A OG  1 
ATOM   440 N N   . ASN A 1 62 ? 4.851  31.951 -15.765 1.00 49.37  ? 96  ASN A N   1 
ATOM   441 C CA  . ASN A 1 62 ? 5.522  31.282 -16.881 1.00 49.77  ? 96  ASN A CA  1 
ATOM   442 C C   . ASN A 1 62 ? 7.006  31.524 -16.898 1.00 47.00  ? 96  ASN A C   1 
ATOM   443 O O   . ASN A 1 62 ? 7.703  31.072 -17.835 1.00 46.90  ? 96  ASN A O   1 
ATOM   444 C CB  . ASN A 1 62 ? 4.855  31.645 -18.262 1.00 47.56  ? 96  ASN A CB  1 
ATOM   445 C CG  . ASN A 1 62 ? 5.018  33.095 -18.653 1.00 52.17  ? 96  ASN A CG  1 
ATOM   446 O OD1 . ASN A 1 62 ? 5.061  33.977 -17.790 1.00 53.39  ? 96  ASN A OD1 1 
ATOM   447 N ND2 . ASN A 1 62 ? 5.008  33.375 -19.971 1.00 56.80  ? 96  ASN A ND2 1 
ATOM   448 N N   . TYR A 1 63 ? 7.525  32.228 -15.890 1.00 45.96  ? 97  TYR A N   1 
ATOM   449 C CA  . TYR A 1 63 ? 8.988  32.429 -15.758 1.00 43.66  ? 97  TYR A CA  1 
ATOM   450 C C   . TYR A 1 63 ? 9.675  31.466 -14.832 1.00 46.57  ? 97  TYR A C   1 
ATOM   451 O O   . TYR A 1 63 ? 10.918 31.578 -14.635 1.00 43.04  ? 97  TYR A O   1 
ATOM   452 C CB  . TYR A 1 63 ? 9.305  33.872 -15.348 1.00 45.12  ? 97  TYR A CB  1 
ATOM   453 C CG  . TYR A 1 63 ? 9.348  34.838 -16.510 1.00 44.37  ? 97  TYR A CG  1 
ATOM   454 C CD1 . TYR A 1 63 ? 8.293  34.920 -17.405 1.00 46.72  ? 97  TYR A CD1 1 
ATOM   455 C CD2 . TYR A 1 63 ? 10.426 35.644 -16.700 1.00 42.69  ? 97  TYR A CD2 1 
ATOM   456 C CE1 . TYR A 1 63 ? 8.328  35.776 -18.481 1.00 43.90  ? 97  TYR A CE1 1 
ATOM   457 C CE2 . TYR A 1 63 ? 10.486 36.525 -17.758 1.00 47.58  ? 97  TYR A CE2 1 
ATOM   458 C CZ  . TYR A 1 63 ? 9.413  36.601 -18.635 1.00 45.97  ? 97  TYR A CZ  1 
ATOM   459 O OH  . TYR A 1 63 ? 9.488  37.440 -19.704 1.00 47.73  ? 97  TYR A OH  1 
ATOM   460 N N   . VAL A 1 64 ? 8.924  30.512 -14.256 1.00 44.54  ? 98  VAL A N   1 
ATOM   461 C CA  . VAL A 1 64 ? 9.560  29.547 -13.336 1.00 44.73  ? 98  VAL A CA  1 
ATOM   462 C C   . VAL A 1 64 ? 9.188  28.119 -13.719 1.00 51.61  ? 98  VAL A C   1 
ATOM   463 O O   . VAL A 1 64 ? 8.155  27.926 -14.348 1.00 44.32  ? 98  VAL A O   1 
ATOM   464 C CB  . VAL A 1 64 ? 9.148  29.834 -11.865 1.00 45.11  ? 98  VAL A CB  1 
ATOM   465 C CG1 . VAL A 1 64 ? 9.769  31.115 -11.415 1.00 49.75  ? 98  VAL A CG1 1 
ATOM   466 C CG2 . VAL A 1 64 ? 7.630  29.897 -11.732 1.00 45.52  ? 98  VAL A CG2 1 
ATOM   467 N N   . SER A 1 65 ? 9.969  27.140 -13.295 1.00 45.61  ? 99  SER A N   1 
ATOM   468 C CA  . SER A 1 65 ? 9.661  25.731 -13.504 1.00 52.27  ? 99  SER A CA  1 
ATOM   469 C C   . SER A 1 65 ? 9.961  24.992 -12.211 1.00 54.62  ? 99  SER A C   1 
ATOM   470 O O   . SER A 1 65 ? 10.762 25.454 -11.432 1.00 52.66  ? 99  SER A O   1 
ATOM   471 C CB  . SER A 1 65 ? 10.426 25.128 -14.661 1.00 54.03  ? 99  SER A CB  1 
ATOM   472 O OG  . SER A 1 65 ? 11.722 24.770 -14.296 1.00 52.24  ? 99  SER A OG  1 
ATOM   473 N N   . ARG A 1 66 ? 9.304  23.864 -11.992 1.00 61.87  ? 100 ARG A N   1 
ATOM   474 C CA  . ARG A 1 66 ? 9.475  23.098 -10.773 1.00 61.69  ? 100 ARG A CA  1 
ATOM   475 C C   . ARG A 1 66 ? 10.922 22.863 -10.460 1.00 61.28  ? 100 ARG A C   1 
ATOM   476 O O   . ARG A 1 66 ? 11.366 23.162 -9.379  1.00 65.14  ? 100 ARG A O   1 
ATOM   477 C CB  . ARG A 1 66 ? 8.710  21.780 -10.809 1.00 62.46  ? 100 ARG A CB  1 
ATOM   478 C CG  . ARG A 1 66 ? 7.247  21.889 -10.415 1.00 77.64  ? 100 ARG A CG  1 
ATOM   479 C CD  . ARG A 1 66 ? 6.835  20.923 -9.306  1.00 96.63  ? 100 ARG A CD  1 
ATOM   480 N NE  . ARG A 1 66 ? 5.389  20.928 -9.057  1.00 111.37 ? 100 ARG A NE  1 
ATOM   481 C CZ  . ARG A 1 66 ? 4.810  21.276 -7.907  1.00 109.30 ? 100 ARG A CZ  1 
ATOM   482 N NH1 . ARG A 1 66 ? 5.546  21.651 -6.870  1.00 104.99 ? 100 ARG A NH1 1 
ATOM   483 N NH2 . ARG A 1 66 ? 3.492  21.253 -7.793  1.00 88.76  ? 100 ARG A NH2 1 
ATOM   484 N N   . GLY A 1 67 ? 11.673 22.346 -11.407 1.00 60.05  ? 101 GLY A N   1 
ATOM   485 C CA  . GLY A 1 67 ? 13.060 22.087 -11.141 1.00 56.21  ? 101 GLY A CA  1 
ATOM   486 C C   . GLY A 1 67 ? 14.027 22.918 -11.927 1.00 65.62  ? 101 GLY A C   1 
ATOM   487 O O   . GLY A 1 67 ? 15.206 22.702 -11.837 1.00 62.40  ? 101 GLY A O   1 
ATOM   488 N N   . GLY A 1 68 ? 13.548 23.873 -12.700 1.00 62.60  ? 102 GLY A N   1 
ATOM   489 C CA  . GLY A 1 68 ? 14.494 24.680 -13.482 1.00 64.39  ? 102 GLY A CA  1 
ATOM   490 C C   . GLY A 1 68 ? 14.726 24.205 -14.915 1.00 66.43  ? 102 GLY A C   1 
ATOM   491 O O   . GLY A 1 68 ? 15.272 24.930 -15.705 1.00 63.08  ? 102 GLY A O   1 
ATOM   492 N N   . GLY A 1 69 ? 14.308 22.994 -15.248 1.00 65.43  ? 103 GLY A N   1 
ATOM   493 C CA  . GLY A 1 69 ? 14.321 22.538 -16.618 1.00 57.67  ? 103 GLY A CA  1 
ATOM   494 C C   . GLY A 1 69 ? 13.113 23.043 -17.393 1.00 56.65  ? 103 GLY A C   1 
ATOM   495 O O   . GLY A 1 69 ? 12.237 23.777 -16.879 1.00 53.51  ? 103 GLY A O   1 
ATOM   496 N N   . PRO A 1 70 ? 13.041 22.650 -18.655 1.00 57.05  ? 104 PRO A N   1 
ATOM   497 C CA  . PRO A 1 70 ? 12.006 23.203 -19.509 1.00 52.82  ? 104 PRO A CA  1 
ATOM   498 C C   . PRO A 1 70 ? 10.642 22.959 -18.954 1.00 54.44  ? 104 PRO A C   1 
ATOM   499 O O   . PRO A 1 70 ? 10.405 21.957 -18.389 1.00 57.37  ? 104 PRO A O   1 
ATOM   500 C CB  . PRO A 1 70 ? 12.224 22.438 -20.802 1.00 59.13  ? 104 PRO A CB  1 
ATOM   501 C CG  . PRO A 1 70 ? 13.731 22.329 -20.830 1.00 62.66  ? 104 PRO A CG  1 
ATOM   502 C CD  . PRO A 1 70 ? 14.047 21.891 -19.434 1.00 56.23  ? 104 PRO A CD  1 
ATOM   503 N N   . PRO A 1 71 ? 9.731  23.882 -19.121 1.00 53.76  ? 105 PRO A N   1 
ATOM   504 C CA  . PRO A 1 71 ? 8.411  23.635 -18.626 1.00 54.41  ? 105 PRO A CA  1 
ATOM   505 C C   . PRO A 1 71 ? 7.620  22.564 -19.399 1.00 58.80  ? 105 PRO A C   1 
ATOM   506 O O   . PRO A 1 71 ? 8.019  22.182 -20.480 1.00 53.98  ? 105 PRO A O   1 
ATOM   507 C CB  . PRO A 1 71 ? 7.729  24.987 -18.833 1.00 57.57  ? 105 PRO A CB  1 
ATOM   508 C CG  . PRO A 1 71 ? 8.389  25.553 -20.027 1.00 56.93  ? 105 PRO A CG  1 
ATOM   509 C CD  . PRO A 1 71 ? 9.796  25.045 -20.011 1.00 55.15  ? 105 PRO A CD  1 
ATOM   510 N N   . PRO A 1 72 ? 6.479  22.122 -18.849 1.00 57.55  ? 106 PRO A N   1 
ATOM   511 C CA  . PRO A 1 72 ? 5.587  21.201 -19.534 1.00 62.25  ? 106 PRO A CA  1 
ATOM   512 C C   . PRO A 1 72 ? 5.115  21.742 -20.882 1.00 60.58  ? 106 PRO A C   1 
ATOM   513 O O   . PRO A 1 72 ? 4.707  22.927 -20.976 1.00 58.37  ? 106 PRO A O   1 
ATOM   514 C CB  . PRO A 1 72 ? 4.368  21.058 -18.582 1.00 64.35  ? 106 PRO A CB  1 
ATOM   515 C CG  . PRO A 1 72 ? 4.524  22.172 -17.593 1.00 64.69  ? 106 PRO A CG  1 
ATOM   516 C CD  . PRO A 1 72 ? 6.000  22.408 -17.486 1.00 58.79  ? 106 PRO A CD  1 
ATOM   517 N N   . PRO A 1 73 ? 5.154  20.876 -21.911 1.00 58.12  ? 107 PRO A N   1 
ATOM   518 C CA  . PRO A 1 73 ? 4.792  21.330 -23.266 1.00 60.93  ? 107 PRO A CA  1 
ATOM   519 C C   . PRO A 1 73 ? 3.315  21.714 -23.357 1.00 57.77  ? 107 PRO A C   1 
ATOM   520 O O   . PRO A 1 73 ? 2.501  21.010 -22.842 1.00 73.50  ? 107 PRO A O   1 
ATOM   521 C CB  . PRO A 1 73 ? 5.123  20.138 -24.136 1.00 58.11  ? 107 PRO A CB  1 
ATOM   522 C CG  . PRO A 1 73 ? 5.864  19.156 -23.325 1.00 59.62  ? 107 PRO A CG  1 
ATOM   523 C CD  . PRO A 1 73 ? 5.866  19.587 -21.914 1.00 57.98  ? 107 PRO A CD  1 
ATOM   524 N N   . GLY A 1 74 ? 2.982  22.859 -23.930 1.00 68.42  ? 108 GLY A N   1 
ATOM   525 C CA  . GLY A 1 74 ? 1.588  23.283 -24.015 1.00 77.76  ? 108 GLY A CA  1 
ATOM   526 C C   . GLY A 1 74 ? 1.350  24.706 -24.542 1.00 92.09  ? 108 GLY A C   1 
ATOM   527 O O   . GLY A 1 74 ? 2.244  25.335 -25.161 1.00 85.73  ? 108 GLY A O   1 
ATOM   528 N N   . PRO A 1 75 ? 0.119  25.218 -24.348 1.00 97.93  ? 109 PRO A N   1 
ATOM   529 C CA  . PRO A 1 75 ? -0.276 26.615 -24.701 1.00 98.15  ? 109 PRO A CA  1 
ATOM   530 C C   . PRO A 1 75 ? 0.712  27.789 -24.311 1.00 88.74  ? 109 PRO A C   1 
ATOM   531 O O   . PRO A 1 75 ? 1.196  27.812 -23.188 1.00 89.32  ? 109 PRO A O   1 
ATOM   532 C CB  . PRO A 1 75 ? -1.612 26.745 -23.957 1.00 94.87  ? 109 PRO A CB  1 
ATOM   533 C CG  . PRO A 1 75 ? -2.203 25.355 -24.078 1.00 96.54  ? 109 PRO A CG  1 
ATOM   534 C CD  . PRO A 1 75 ? -1.064 24.374 -24.040 1.00 92.91  ? 109 PRO A CD  1 
ATOM   535 N N   . ALA A 1 76 ? 0.988  28.739 -25.217 1.00 84.91  ? 110 ALA A N   1 
ATOM   536 C CA  . ALA A 1 76 ? 1.852  29.943 -24.950 1.00 95.96  ? 110 ALA A CA  1 
ATOM   537 C C   . ALA A 1 76 ? 1.085  31.191 -24.402 1.00 101.11 ? 110 ALA A C   1 
ATOM   538 O O   . ALA A 1 76 ? -0.099 31.108 -24.101 1.00 103.71 ? 110 ALA A O   1 
ATOM   539 C CB  . ALA A 1 76 ? 2.659  30.317 -26.209 1.00 88.59  ? 110 ALA A CB  1 
ATOM   540 N N   . VAL A 1 77 ? 1.780  32.328 -24.253 1.00 122.49 ? 111 VAL A N   1 
ATOM   541 C CA  . VAL A 1 77 ? 1.180  33.640 -23.861 1.00 127.54 ? 111 VAL A CA  1 
ATOM   542 C C   . VAL A 1 77 ? 1.280  34.636 -25.067 1.00 139.47 ? 111 VAL A C   1 
ATOM   543 O O   . VAL A 1 77 ? 2.345  34.738 -25.697 1.00 134.28 ? 111 VAL A O   1 
ATOM   544 C CB  . VAL A 1 77 ? 1.857  34.208 -22.545 1.00 119.51 ? 111 VAL A CB  1 
ATOM   545 C CG1 . VAL A 1 77 ? 1.427  35.644 -22.206 1.00 118.02 ? 111 VAL A CG1 1 
ATOM   546 C CG2 . VAL A 1 77 ? 1.554  33.318 -21.347 1.00 115.48 ? 111 VAL A CG2 1 
ATOM   547 N N   . ALA A 1 78 ? 0.179  35.332 -25.404 1.00 142.54 ? 112 ALA A N   1 
ATOM   548 C CA  . ALA A 1 78 ? 0.193  36.456 -26.380 1.00 130.68 ? 112 ALA A CA  1 
ATOM   549 C C   . ALA A 1 78 ? 0.402  37.816 -25.644 1.00 138.02 ? 112 ALA A C   1 
ATOM   550 O O   . ALA A 1 78 ? 0.274  37.876 -24.407 1.00 124.64 ? 112 ALA A O   1 
ATOM   551 C CB  . ALA A 1 78 ? -1.095 36.455 -27.205 1.00 116.67 ? 112 ALA A CB  1 
ATOM   552 N N   . GLU A 1 79 ? 0.768  38.882 -26.375 1.00 146.84 ? 113 GLU A N   1 
ATOM   553 C CA  . GLU A 1 79 ? 0.815  40.261 -25.803 1.00 147.52 ? 113 GLU A CA  1 
ATOM   554 C C   . GLU A 1 79 ? -0.015 41.211 -26.676 1.00 147.67 ? 113 GLU A C   1 
ATOM   555 O O   . GLU A 1 79 ? -0.755 42.047 -26.157 1.00 143.40 ? 113 GLU A O   1 
ATOM   556 C CB  . GLU A 1 79 ? 2.270  40.780 -25.560 1.00 137.98 ? 113 GLU A CB  1 
ATOM   557 C CG  . GLU A 1 79 ? 2.934  41.642 -26.646 1.00 140.63 ? 113 GLU A CG  1 
ATOM   558 C CD  . GLU A 1 79 ? 3.039  40.930 -27.986 1.00 148.56 ? 113 GLU A CD  1 
ATOM   559 O OE1 . GLU A 1 79 ? 3.904  40.033 -28.117 1.00 142.86 ? 113 GLU A OE1 1 
ATOM   560 O OE2 . GLU A 1 79 ? 2.257  41.260 -28.910 1.00 149.57 ? 113 GLU A OE2 1 
HETATM 561 O O   . HOH B 2 .  ? 19.378 34.090 -6.544  1.00 56.40  ? 201 HOH A O   1 
HETATM 562 O O   . HOH B 2 .  ? 20.904 36.013 -15.680 1.00 55.53  ? 202 HOH A O   1 
HETATM 563 O O   . HOH B 2 .  ? 14.956 34.971 0.513   1.00 60.96  ? 203 HOH A O   1 
HETATM 564 O O   . HOH B 2 .  ? 13.106 47.958 -13.129 1.00 48.09  ? 204 HOH A O   1 
HETATM 565 O O   . HOH B 2 .  ? 10.258 44.375 -5.799  1.00 55.95  ? 205 HOH A O   1 
HETATM 566 O O   . HOH B 2 .  ? 12.028 21.198 -13.813 1.00 72.09  ? 206 HOH A O   1 
HETATM 567 O O   . HOH B 2 .  ? 18.871 44.094 -14.288 1.00 47.57  ? 207 HOH A O   1 
HETATM 568 O O   . HOH B 2 .  ? 16.682 27.940 -15.113 1.00 58.13  ? 208 HOH A O   1 
HETATM 569 O O   . HOH B 2 .  ? 16.463 39.213 -4.774  1.00 42.11  ? 209 HOH A O   1 
HETATM 570 O O   . HOH B 2 .  ? 20.840 39.938 -16.276 1.00 52.86  ? 210 HOH A O   1 
HETATM 571 O O   . HOH B 2 .  ? 7.607  29.229 -19.875 1.00 56.13  ? 211 HOH A O   1 
HETATM 572 O O   . HOH B 2 .  ? 16.393 31.103 -20.604 1.00 62.23  ? 212 HOH A O   1 
HETATM 573 O O   . HOH B 2 .  ? 15.710 28.418 -19.117 1.00 59.35  ? 213 HOH A O   1 
HETATM 574 O O   . HOH B 2 .  ? 20.248 33.317 -10.563 1.00 58.61  ? 214 HOH A O   1 
HETATM 575 O O   . HOH B 2 .  ? 7.304  23.100 -13.973 1.00 52.49  ? 215 HOH A O   1 
HETATM 576 O O   . HOH B 2 .  ? 16.943 35.424 -19.616 1.00 56.22  ? 216 HOH A O   1 
HETATM 577 O O   . HOH B 2 .  ? 22.263 37.002 -13.159 1.00 60.49  ? 217 HOH A O   1 
HETATM 578 O O   . HOH B 2 .  ? 16.652 41.089 -13.236 1.00 49.96  ? 218 HOH A O   1 
HETATM 579 O O   . HOH B 2 .  ? 9.011  22.016 -15.750 1.00 73.53  ? 219 HOH A O   1 
HETATM 580 O O   . HOH B 2 .  ? -0.965 29.025 -3.390  1.00 59.71  ? 220 HOH A O   1 
HETATM 581 O O   . HOH B 2 .  ? 18.153 43.080 -2.545  1.00 53.44  ? 221 HOH A O   1 
HETATM 582 O O   . HOH B 2 .  ? 0.636  40.069 -17.635 1.00 68.38  ? 222 HOH A O   1 
HETATM 583 O O   . HOH B 2 .  ? 4.983  31.367 -22.358 1.00 57.39  ? 223 HOH A O   1 
HETATM 584 O O   . HOH B 2 .  ? 10.214 38.271 3.936   1.00 76.56  ? 224 HOH A O   1 
HETATM 585 O O   . HOH B 2 .  ? 14.637 21.341 -7.308  1.00 75.18  ? 225 HOH A O   1 
HETATM 586 O O   . HOH B 2 .  ? 20.104 25.519 -18.297 1.00 85.35  ? 226 HOH A O   1 
HETATM 587 O O   . HOH B 2 .  ? 19.583 35.501 -4.477  1.00 51.78  ? 227 HOH A O   1 
HETATM 588 O O   . HOH B 2 .  ? 20.268 33.985 -18.959 1.00 66.58  ? 228 HOH A O   1 
HETATM 589 O O   . HOH B 2 .  ? 21.693 26.298 -20.041 1.00 80.52  ? 229 HOH A O   1 
HETATM 590 O O   . HOH B 2 .  ? 3.742  41.703 -3.058  1.00 70.06  ? 230 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  35  ?   ?   ?   A . n 
A 1 2  SER 2  36  ?   ?   ?   A . n 
A 1 3  HIS 3  37  ?   ?   ?   A . n 
A 1 4  MET 4  38  ?   ?   ?   A . n 
A 1 5  TYR 5  39  ?   ?   ?   A . n 
A 1 6  ALA 6  40  ?   ?   ?   A . n 
A 1 7  ASN 7  41  41  ASN ASN A . n 
A 1 8  PRO 8  42  42  PRO PRO A . n 
A 1 9  VAL 9  43  43  VAL VAL A . n 
A 1 10 TRP 10 44  44  TRP TRP A . n 
A 1 11 THR 11 45  45  THR THR A . n 
A 1 12 ALA 12 46  46  ALA ALA A . n 
A 1 13 LEU 13 47  47  LEU LEU A . n 
A 1 14 PHE 14 48  48  PHE PHE A . n 
A 1 15 ASP 15 49  49  ASP ASP A . n 
A 1 16 TYR 16 50  50  TYR TYR A . n 
A 1 17 GLU 17 51  51  GLU GLU A . n 
A 1 18 PRO 18 52  52  PRO PRO A . n 
A 1 19 SER 19 53  53  SER SER A . n 
A 1 20 GLY 20 54  54  GLY GLY A . n 
A 1 21 GLN 21 55  55  GLN GLN A . n 
A 1 22 ASP 22 56  56  ASP ASP A . n 
A 1 23 GLU 23 57  57  GLU GLU A . n 
A 1 24 LEU 24 58  58  LEU LEU A . n 
A 1 25 ALA 25 59  59  ALA ALA A . n 
A 1 26 LEU 26 60  60  LEU LEU A . n 
A 1 27 ARG 27 61  61  ARG ARG A . n 
A 1 28 LYS 28 62  62  LYS LYS A . n 
A 1 29 GLY 29 63  63  GLY GLY A . n 
A 1 30 ASP 30 64  64  ASP ASP A . n 
A 1 31 ARG 31 65  65  ARG ARG A . n 
A 1 32 VAL 32 66  66  VAL VAL A . n 
A 1 33 GLU 33 67  67  GLU GLU A . n 
A 1 34 VAL 34 68  68  VAL VAL A . n 
A 1 35 LEU 35 69  69  LEU LEU A . n 
A 1 36 SER 36 70  70  SER SER A . n 
A 1 37 ARG 37 71  71  ARG ARG A . n 
A 1 38 ASP 38 72  72  ASP ASP A . n 
A 1 39 ALA 39 73  73  ALA ALA A . n 
A 1 40 ALA 40 74  74  ALA ALA A . n 
A 1 41 ILE 41 75  75  ILE ILE A . n 
A 1 42 SER 42 76  76  SER SER A . n 
A 1 43 GLY 43 77  77  GLY GLY A . n 
A 1 44 ASP 44 78  78  ASP ASP A . n 
A 1 45 GLU 45 79  79  GLU GLU A . n 
A 1 46 GLY 46 80  80  GLY GLY A . n 
A 1 47 TRP 47 81  81  TRP TRP A . n 
A 1 48 TRP 48 82  82  TRP TRP A . n 
A 1 49 ALA 49 83  83  ALA ALA A . n 
A 1 50 GLY 50 84  84  GLY GLY A . n 
A 1 51 GLN 51 85  85  GLN GLN A . n 
A 1 52 VAL 52 86  86  VAL VAL A . n 
A 1 53 GLY 53 87  87  GLY GLY A . n 
A 1 54 GLY 54 88  88  GLY GLY A . n 
A 1 55 GLN 55 89  89  GLN GLN A . n 
A 1 56 VAL 56 90  90  VAL VAL A . n 
A 1 57 GLY 57 91  91  GLY GLY A . n 
A 1 58 ILE 58 92  92  ILE ILE A . n 
A 1 59 PHE 59 93  93  PHE PHE A . n 
A 1 60 PRO 60 94  94  PRO PRO A . n 
A 1 61 SER 61 95  95  SER SER A . n 
A 1 62 ASN 62 96  96  ASN ASN A . n 
A 1 63 TYR 63 97  97  TYR TYR A . n 
A 1 64 VAL 64 98  98  VAL VAL A . n 
A 1 65 SER 65 99  99  SER SER A . n 
A 1 66 ARG 66 100 100 ARG ARG A . n 
A 1 67 GLY 67 101 101 GLY GLY A . n 
A 1 68 GLY 68 102 102 GLY GLY A . n 
A 1 69 GLY 69 103 103 GLY GLY A . n 
A 1 70 PRO 70 104 104 PRO PRO A . n 
A 1 71 PRO 71 105 105 PRO PRO A . n 
A 1 72 PRO 72 106 106 PRO PRO A . n 
A 1 73 PRO 73 107 107 PRO PRO A . n 
A 1 74 GLY 74 108 108 GLY GLY A . n 
A 1 75 PRO 75 109 109 PRO PRO A . n 
A 1 76 ALA 76 110 110 ALA ALA A . n 
A 1 77 VAL 77 111 111 VAL VAL A . n 
A 1 78 ALA 78 112 112 ALA ALA A . n 
A 1 79 GLU 79 113 113 GLU GLU A . n 
A 1 80 GLU 80 114 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  201 20 HOH HOH A . 
B 2 HOH 2  202 28 HOH HOH A . 
B 2 HOH 3  203 14 HOH HOH A . 
B 2 HOH 4  204 10 HOH HOH A . 
B 2 HOH 5  205 12 HOH HOH A . 
B 2 HOH 6  206 24 HOH HOH A . 
B 2 HOH 7  207 2  HOH HOH A . 
B 2 HOH 8  208 7  HOH HOH A . 
B 2 HOH 9  209 1  HOH HOH A . 
B 2 HOH 10 210 6  HOH HOH A . 
B 2 HOH 11 211 22 HOH HOH A . 
B 2 HOH 12 212 27 HOH HOH A . 
B 2 HOH 13 213 5  HOH HOH A . 
B 2 HOH 14 214 13 HOH HOH A . 
B 2 HOH 15 215 17 HOH HOH A . 
B 2 HOH 16 216 0  HOH HOH A . 
B 2 HOH 17 217 16 HOH HOH A . 
B 2 HOH 18 218 3  HOH HOH A . 
B 2 HOH 19 219 23 HOH HOH A . 
B 2 HOH 20 220 11 HOH HOH A . 
B 2 HOH 21 221 15 HOH HOH A . 
B 2 HOH 22 222 18 HOH HOH A . 
B 2 HOH 23 223 21 HOH HOH A . 
B 2 HOH 24 224 8  HOH HOH A . 
B 2 HOH 25 225 4  HOH HOH A . 
B 2 HOH 26 226 29 HOH HOH A . 
B 2 HOH 27 227 19 HOH HOH A . 
B 2 HOH 28 228 25 HOH HOH A . 
B 2 HOH 29 229 26 HOH HOH A . 
B 2 HOH 30 230 9  HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B 
2 1,2 A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 1810 ? 
2 MORE         -16  ? 
2 'SSA (A^2)'  8170 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 6_564 x,-y+1,-z-1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 59.0000000000 0.0000000000 0.0000000000 -1.0000000000 -42.1800000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-09-19 
2 'Structure model' 1 1 2019-12-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Author supporting evidence' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            pdbx_audit_support 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    2 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_audit_support.funding_organization' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC   ? ? ? 5.8.0189 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS      ? ? ? .        2 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? ARP/wARP ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? MOLREP   ? ? ? .        4 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 35  ? A GLY 1  
2 1 Y 1 A SER 36  ? A SER 2  
3 1 Y 1 A HIS 37  ? A HIS 3  
4 1 Y 1 A MET 38  ? A MET 4  
5 1 Y 1 A TYR 39  ? A TYR 5  
6 1 Y 1 A ALA 40  ? A ALA 6  
7 1 Y 1 A GLU 114 ? A GLU 80 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of Dental and Craniofacial Research (NIH/NIDCR)' 'United States' 
'NIDCR DE018381' 1 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)'         'United States' R01EB013685 2 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#