data_6CQT
# 
_entry.id   6CQT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CQT         
WWPDB D_1000233243 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          6CQU 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6CQT 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bester, S.M.' 1 ? 
'Guelta, M.A.' 2 ? 
'Pegan, S.D.'  3 ? 
'Height, J.J.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Chem. Res. Toxicol.' 
_citation.journal_id_ASTM           CRTOEC 
_citation.journal_id_CSD            2140 
_citation.journal_id_ISSN           1520-5010 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            31 
_citation.language                  ? 
_citation.page_first                1405 
_citation.page_last                 1417 
_citation.title                     
'Structural Insights of Stereospecific Inhibition of Human Acetylcholinesterase by VX and Subsequent Reactivation by HI-6.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.chemrestox.8b00294 
_citation.pdbx_database_id_PubMed   30462502 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bester, S.M.'     1 ?                   
primary 'Guelta, M.A.'     2 ?                   
primary 'Cheung, J.'       3 0000-0002-1014-0707 
primary 'Winemiller, M.D.' 4 0000-0001-7433-428X 
primary 'Bae, S.Y.'        5 ?                   
primary 'Myslinski, J.'    6 ?                   
primary 'Pegan, S.D.'      7 0000-0002-2958-5319 
primary 'Height, J.J.'     8 ?                   
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6CQT 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     104.368 
_cell.length_a_esd                 ? 
_cell.length_b                     104.368 
_cell.length_b_esd                 ? 
_cell.length_c                     323.224 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6CQT 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 59447.105 2    3.1.1.7 ? ? ? 
2 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2 
?       ? ? ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2    ?       ? ? ? 
4 non-polymer syn '2-(2-(2-(2-(2-(2-ETHOXYETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHANOL' 310.384   2    ?       ? ? ? 
5 non-polymer syn 'O-ETHYLMETHYLPHOSPHONIC ACID ESTER GROUP' 124.076   2    ?       ? ? ? 
6 water       nat water 18.015    1160 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   GLU n 
1 4   ASP n 
1 5   ALA n 
1 6   GLU n 
1 7   LEU n 
1 8   LEU n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  LEU n 
1 17  ARG n 
1 18  GLY n 
1 19  ILE n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  PRO n 
1 28  VAL n 
1 29  SER n 
1 30  ALA n 
1 31  PHE n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  PRO n 
1 36  PHE n 
1 37  ALA n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  MET n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  PRO n 
1 49  PRO n 
1 50  GLU n 
1 51  PRO n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  TRP n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  VAL n 
1 60  ASP n 
1 61  ALA n 
1 62  THR n 
1 63  THR n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  CYS n 
1 69  TYR n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  ASP n 
1 74  THR n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  PHE n 
1 80  GLU n 
1 81  GLY n 
1 82  THR n 
1 83  GLU n 
1 84  MET n 
1 85  TRP n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  SER n 
1 93  GLU n 
1 94  ASP n 
1 95  CYS n 
1 96  LEU n 
1 97  TYR n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 TYR n 
1 105 PRO n 
1 106 ARG n 
1 107 PRO n 
1 108 THR n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 VAL n 
1 114 LEU n 
1 115 VAL n 
1 116 TRP n 
1 117 ILE n 
1 118 TYR n 
1 119 GLY n 
1 120 GLY n 
1 121 GLY n 
1 122 PHE n 
1 123 TYR n 
1 124 SER n 
1 125 GLY n 
1 126 ALA n 
1 127 SER n 
1 128 SER n 
1 129 LEU n 
1 130 ASP n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 ARG n 
1 136 PHE n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 MET n 
1 149 ASN n 
1 150 TYR n 
1 151 ARG n 
1 152 VAL n 
1 153 GLY n 
1 154 ALA n 
1 155 PHE n 
1 156 GLY n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 PRO n 
1 162 GLY n 
1 163 SER n 
1 164 ARG n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 ASN n 
1 170 VAL n 
1 171 GLY n 
1 172 LEU n 
1 173 LEU n 
1 174 ASP n 
1 175 GLN n 
1 176 ARG n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 GLN n 
1 181 TRP n 
1 182 VAL n 
1 183 GLN n 
1 184 GLU n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 PHE n 
1 190 GLY n 
1 191 GLY n 
1 192 ASP n 
1 193 PRO n 
1 194 THR n 
1 195 SER n 
1 196 VAL n 
1 197 THR n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 GLU n 
1 202 SER n 
1 203 ALA n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 SER n 
1 208 VAL n 
1 209 GLY n 
1 210 MET n 
1 211 HIS n 
1 212 LEU n 
1 213 LEU n 
1 214 SER n 
1 215 PRO n 
1 216 PRO n 
1 217 SER n 
1 218 ARG n 
1 219 GLY n 
1 220 LEU n 
1 221 PHE n 
1 222 HIS n 
1 223 ARG n 
1 224 ALA n 
1 225 VAL n 
1 226 LEU n 
1 227 GLN n 
1 228 SER n 
1 229 GLY n 
1 230 ALA n 
1 231 PRO n 
1 232 ASN n 
1 233 GLY n 
1 234 PRO n 
1 235 TRP n 
1 236 ALA n 
1 237 THR n 
1 238 VAL n 
1 239 GLY n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 ALA n 
1 244 ARG n 
1 245 ARG n 
1 246 ARG n 
1 247 ALA n 
1 248 THR n 
1 249 GLN n 
1 250 LEU n 
1 251 ALA n 
1 252 HIS n 
1 253 LEU n 
1 254 VAL n 
1 255 GLY n 
1 256 CYS n 
1 257 PRO n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 GLY n 
1 263 GLY n 
1 264 ASN n 
1 265 ASP n 
1 266 THR n 
1 267 GLU n 
1 268 LEU n 
1 269 VAL n 
1 270 ALA n 
1 271 CYS n 
1 272 LEU n 
1 273 ARG n 
1 274 THR n 
1 275 ARG n 
1 276 PRO n 
1 277 ALA n 
1 278 GLN n 
1 279 VAL n 
1 280 LEU n 
1 281 VAL n 
1 282 ASN n 
1 283 HIS n 
1 284 GLU n 
1 285 TRP n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 PRO n 
1 290 GLN n 
1 291 GLU n 
1 292 SER n 
1 293 VAL n 
1 294 PHE n 
1 295 ARG n 
1 296 PHE n 
1 297 SER n 
1 298 PHE n 
1 299 VAL n 
1 300 PRO n 
1 301 VAL n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 ASP n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 ASP n 
1 310 THR n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 LEU n 
1 315 ILE n 
1 316 ASN n 
1 317 ALA n 
1 318 GLY n 
1 319 ASP n 
1 320 PHE n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 GLN n 
1 325 VAL n 
1 326 LEU n 
1 327 VAL n 
1 328 GLY n 
1 329 VAL n 
1 330 VAL n 
1 331 LYS n 
1 332 ASP n 
1 333 GLU n 
1 334 GLY n 
1 335 SER n 
1 336 TYR n 
1 337 PHE n 
1 338 LEU n 
1 339 VAL n 
1 340 TYR n 
1 341 GLY n 
1 342 ALA n 
1 343 PRO n 
1 344 GLY n 
1 345 PHE n 
1 346 SER n 
1 347 LYS n 
1 348 ASP n 
1 349 ASN n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ILE n 
1 354 SER n 
1 355 ARG n 
1 356 ALA n 
1 357 GLU n 
1 358 PHE n 
1 359 LEU n 
1 360 ALA n 
1 361 GLY n 
1 362 VAL n 
1 363 ARG n 
1 364 VAL n 
1 365 GLY n 
1 366 VAL n 
1 367 PRO n 
1 368 GLN n 
1 369 VAL n 
1 370 SER n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 VAL n 
1 378 VAL n 
1 379 LEU n 
1 380 HIS n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 TRP n 
1 385 LEU n 
1 386 HIS n 
1 387 PRO n 
1 388 GLU n 
1 389 ASP n 
1 390 PRO n 
1 391 ALA n 
1 392 ARG n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 SER n 
1 399 ASP n 
1 400 VAL n 
1 401 VAL n 
1 402 GLY n 
1 403 ASP n 
1 404 HIS n 
1 405 ASN n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 PRO n 
1 410 VAL n 
1 411 ALA n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 GLY n 
1 416 ARG n 
1 417 LEU n 
1 418 ALA n 
1 419 ALA n 
1 420 GLN n 
1 421 GLY n 
1 422 ALA n 
1 423 ARG n 
1 424 VAL n 
1 425 TYR n 
1 426 ALA n 
1 427 TYR n 
1 428 VAL n 
1 429 PHE n 
1 430 GLU n 
1 431 HIS n 
1 432 ARG n 
1 433 ALA n 
1 434 SER n 
1 435 THR n 
1 436 LEU n 
1 437 SER n 
1 438 TRP n 
1 439 PRO n 
1 440 LEU n 
1 441 TRP n 
1 442 MET n 
1 443 GLY n 
1 444 VAL n 
1 445 PRO n 
1 446 HIS n 
1 447 GLY n 
1 448 TYR n 
1 449 GLU n 
1 450 ILE n 
1 451 GLU n 
1 452 PHE n 
1 453 ILE n 
1 454 PHE n 
1 455 GLY n 
1 456 ILE n 
1 457 PRO n 
1 458 LEU n 
1 459 ASP n 
1 460 PRO n 
1 461 SER n 
1 462 ARG n 
1 463 ASN n 
1 464 TYR n 
1 465 THR n 
1 466 ALA n 
1 467 GLU n 
1 468 GLU n 
1 469 LYS n 
1 470 ILE n 
1 471 PHE n 
1 472 ALA n 
1 473 GLN n 
1 474 ARG n 
1 475 LEU n 
1 476 MET n 
1 477 ARG n 
1 478 TYR n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 ASP n 
1 488 PRO n 
1 489 ASN n 
1 490 GLU n 
1 491 PRO n 
1 492 ARG n 
1 493 ASP n 
1 494 PRO n 
1 495 LYS n 
1 496 ALA n 
1 497 PRO n 
1 498 GLN n 
1 499 TRP n 
1 500 PRO n 
1 501 PRO n 
1 502 TYR n 
1 503 THR n 
1 504 ALA n 
1 505 GLY n 
1 506 ALA n 
1 507 GLN n 
1 508 GLN n 
1 509 TYR n 
1 510 VAL n 
1 511 SER n 
1 512 LEU n 
1 513 ASP n 
1 514 LEU n 
1 515 ARG n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 VAL n 
1 520 ARG n 
1 521 ARG n 
1 522 GLY n 
1 523 LEU n 
1 524 ARG n 
1 525 ALA n 
1 526 GLN n 
1 527 ALA n 
1 528 CYS n 
1 529 ALA n 
1 530 PHE n 
1 531 TRP n 
1 532 ASN n 
1 533 ARG n 
1 534 PHE n 
1 535 LEU n 
1 536 PRO n 
1 537 LYS n 
1 538 LEU n 
1 539 LEU n 
1 540 SER n 
1 541 ALA n 
1 542 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   542 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           33 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6CQT A 1 ? 542 ? P22303 33 ? 574 ? 2 543 
2 1 6CQT B 1 ? 542 ? P22303 33 ? 574 ? 2 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
7PE non-polymer                   . '2-(2-(2-(2-(2-(2-ETHOXYETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHANOL' 
'POLYETHYLENE GLYCOL FRAGMENT' 'C14 H30 O7'     310.384 
ALA 'L-peptide linking'           y ALANINE                                                             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                                            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                                          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                                     ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE                                                            ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                                                ? 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                                           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                                     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                                             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                                           ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                                               ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                                          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                                             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                                              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                                                          ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose                            ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                                                       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                                             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                                              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                                           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                                          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                                            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                                              ? 'C5 H11 N O2'    117.146 
VX  non-polymer                   . 'O-ETHYLMETHYLPHOSPHONIC ACID ESTER GROUP'                          ? 'C3 H9 O3 P'     124.076 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CQT 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.27 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.22 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'1:1:1 ratio of DMSO, glycerol, and ethylene glycol, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-07-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6CQT 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.27 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       94496 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.0 
_reflns.pdbx_Rmerge_I_obs                0.071 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            25.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.032 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.27 
_reflns_shell.d_res_low                   2.31 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.6 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        97.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.31 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.0 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.15 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6CQT 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.273 
_refine.ls_d_res_low                             45.193 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     94419 
_refine.ls_number_reflns_R_free                  4740 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.43 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1501 
_refine.ls_R_factor_R_free                       0.1805 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1485 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4EY4 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 17.45 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.17 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8258 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         158 
_refine_hist.number_atoms_solvent             1160 
_refine_hist.number_atoms_total               9576 
_refine_hist.d_res_high                       2.273 
_refine_hist.d_res_low                        45.193 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  ? 8823  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.949  ? 12071 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 15.791 ? 5184  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.072  ? 1302  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 1582  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.2733 2.2992  . . 140 2775 95.00  . . . 0.2388 . 0.1898 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2992 2.3262  . . 138 2980 99.00  . . . 0.2137 . 0.1837 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3262 2.3546  . . 159 2955 100.00 . . . 0.2322 . 0.1745 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3546 2.3844  . . 169 2980 100.00 . . . 0.2084 . 0.1691 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3844 2.4158  . . 157 2965 100.00 . . . 0.1728 . 0.1641 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4158 2.4489  . . 153 2954 100.00 . . . 0.1830 . 0.1599 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4489 2.4838  . . 168 2990 100.00 . . . 0.2286 . 0.1627 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4838 2.5209  . . 132 2936 100.00 . . . 0.1966 . 0.1625 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5209 2.5603  . . 155 3002 100.00 . . . 0.2123 . 0.1666 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5603 2.6023  . . 157 2985 100.00 . . . 0.1828 . 0.1635 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6023 2.6471  . . 143 2969 100.00 . . . 0.2406 . 0.1637 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6471 2.6953  . . 159 2989 100.00 . . . 0.2128 . 0.1590 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6953 2.7471  . . 122 3042 100.00 . . . 0.1946 . 0.1556 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7471 2.8032  . . 147 2961 100.00 . . . 0.2017 . 0.1594 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8032 2.8641  . . 170 2951 100.00 . . . 0.1961 . 0.1553 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8641 2.9307  . . 204 2928 100.00 . . . 0.1960 . 0.1573 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9307 3.0040  . . 158 3021 100.00 . . . 0.1846 . 0.1510 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0040 3.0852  . . 178 2972 100.00 . . . 0.1951 . 0.1474 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0852 3.1760  . . 168 2983 100.00 . . . 0.1710 . 0.1434 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1760 3.2784  . . 145 2997 100.00 . . . 0.1739 . 0.1502 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2784 3.3956  . . 175 2980 100.00 . . . 0.1643 . 0.1429 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3956 3.5315  . . 155 2977 100.00 . . . 0.1923 . 0.1408 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5315 3.6921  . . 174 3026 100.00 . . . 0.1757 . 0.1377 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6921 3.8867  . . 153 2998 99.00  . . . 0.1452 . 0.1254 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8867 4.1301  . . 156 3013 99.00  . . . 0.1660 . 0.1189 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1301 4.4487  . . 154 2998 99.00  . . . 0.1397 . 0.1178 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4487 4.8959  . . 139 3069 99.00  . . . 0.1373 . 0.1139 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.8959 5.6032  . . 148 3058 99.00  . . . 0.1588 . 0.1484 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.6032 7.0551  . . 181 3069 99.00  . . . 0.1876 . 0.1728 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.0551 45.2016 . . 183 3156 97.00  . . . 0.2076 . 0.1868 . . . . . . . . . . 
# 
_struct.entry_id                     6CQT 
_struct.title                        
'Crystal Structure of Recombinant Human Acetylcholinesterase Inhibited by (-) Stereoisomer of VX' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CQT 
_struct_keywords.text            Hydrolase 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 5 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 4   ? GLU A 6   ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  AA2 MET A 41  ? ARG A 45  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  AA3 PHE A 79  ? MET A 84  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  AA4 LEU A 129 ? ASP A 133 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 134 ? ARG A 142 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  AA6 VAL A 152 ? LEU A 158 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  AA7 ASN A 169 ? VAL A 186 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  AA8 ALA A 187 ? PHE A 189 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  AA9 SER A 202 ? SER A 214 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 AB1 SER A 214 ? GLY A 219 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 AB2 GLY A 239 ? VAL A 254 ? GLY A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 AB3 ASN A 264 ? THR A 274 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 AB4 PRO A 276 ? GLU A 284 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 AB5 TRP A 285 ? LEU A 288 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 AB6 THR A 310 ? GLY A 318 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 AB7 GLY A 334 ? VAL A 339 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 AB8 SER A 354 ? VAL A 366 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 AB9 SER A 370 ? THR A 382 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 AC1 ASP A 389 ? VAL A 406 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 AC2 VAL A 406 ? GLN A 420 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 AC3 PRO A 439 ? GLY A 443 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 AC4 GLU A 449 ? PHE A 454 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 AC5 GLY A 455 ? ASP A 459 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 AC6 THR A 465 ? GLY A 486 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 AC7 ARG A 524 ? ARG A 533 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 AC8 ARG A 533 ? ALA A 541 ? ARG A 534 ALA A 542 1 ? 9  
HELX_P HELX_P27 AC9 ASP B 4   ? GLU B 6   ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 AD1 MET B 41  ? ARG B 45  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 AD2 PHE B 79  ? MET B 84  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 AD3 LEU B 129 ? ASP B 133 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 AD4 GLY B 134 ? ARG B 142 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 AD5 VAL B 152 ? LEU B 158 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 AD6 ASN B 169 ? VAL B 186 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 AD7 ALA B 187 ? PHE B 189 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 AD8 SER B 202 ? LEU B 213 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 AD9 SER B 214 ? GLY B 219 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 AE1 MET B 240 ? VAL B 254 ? MET B 241 VAL B 255 1 ? 15 
HELX_P HELX_P38 AE2 ASN B 264 ? THR B 274 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 AE3 PRO B 276 ? HIS B 283 ? PRO B 277 HIS B 284 1 ? 8  
HELX_P HELX_P40 AE4 GLU B 284 ? LEU B 288 ? GLU B 285 LEU B 289 5 ? 5  
HELX_P HELX_P41 AE5 THR B 310 ? GLY B 318 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 AE6 GLY B 334 ? VAL B 339 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 AE7 SER B 354 ? VAL B 366 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 AE8 SER B 370 ? THR B 382 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 AE9 ASP B 389 ? VAL B 406 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 AF1 VAL B 406 ? GLN B 420 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 AF2 PRO B 439 ? GLY B 443 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 AF3 GLU B 449 ? PHE B 454 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 AF4 GLY B 455 ? ASP B 459 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 AF5 THR B 465 ? GLY B 486 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 AF6 ARG B 524 ? ARG B 533 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 AF7 PHE B 534 ? SER B 540 ? PHE B 535 SER B 541 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 68  SG  ? ? ? 1_555 A CYS 95  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf2 disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 271 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf3 disulf ?    ? A CYS 408 SG  ? ? ? 1_555 A CYS 528 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf4 disulf ?    ? B CYS 68  SG  ? ? ? 1_555 B CYS 95  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf5 disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 271 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.185 ? ?               
disulf6 disulf ?    ? B CYS 408 SG  ? ? ? 1_555 B CYS 528 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
covale1 covale one  ? A SER 202 OG  ? ? ? 1_555 H VX  .   P1 ? ? A SER 203 A VX  607 1_555 ? ? ? ? ? ? ? 1.576 ? ?               
covale2 covale one  ? A ASN 349 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.305 ? N-Glycosylation 
covale3 covale one  ? B SER 202 OG  ? ? ? 1_555 J VX  .   P1 ? ? B SER 203 B VX  605 1_555 ? ? ? ? ? ? ? 1.555 ? ?               
covale4 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale5 covale one  ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale6 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale7 covale one  ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? D NAG 1   D FUC 3   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 104 A . ? TYR 105 A PRO 105 A ? PRO 106 A 1 0.62  
2 CYS 256 A . ? CYS 257 A PRO 257 A ? PRO 258 A 1 -1.36 
3 TYR 104 B . ? TYR 105 B PRO 105 B ? PRO 106 B 1 -2.31 
4 PRO 257 B . ? PRO 258 B PRO 258 B ? PRO 259 B 1 5.41  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
AA6 ? 2  ? 
AA7 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
AA6 1  2  ? parallel      
AA7 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 8   ? THR A 10  ? LEU A 9   THR A 11  
AA1 2  ARG A 15  ? ARG A 17  ? ARG A 16  ARG A 18  
AA1 3  VAL A 58  ? ASP A 60  ? VAL A 59  ASP A 61  
AA2 1  ILE A 19  ? LEU A 21  ? ILE A 20  LEU A 22  
AA2 2  VAL A 28  ? PRO A 35  ? VAL A 29  PRO A 36  
AA2 3  TYR A 97  ? PRO A 103 ? TYR A 98  PRO A 104 
AA2 4  VAL A 144 ? MET A 148 ? VAL A 145 MET A 149 
AA2 5  THR A 111 ? ILE A 117 ? THR A 112 ILE A 118 
AA2 6  GLY A 191 ? GLU A 201 ? GLY A 192 GLU A 202 
AA2 7  ARG A 223 ? GLN A 227 ? ARG A 224 GLN A 228 
AA2 8  GLN A 324 ? VAL A 330 ? GLN A 325 VAL A 331 
AA2 9  ARG A 423 ? PHE A 429 ? ARG A 424 PHE A 430 
AA2 10 GLN A 508 ? LEU A 512 ? GLN A 509 LEU A 513 
AA2 11 GLU A 518 ? ARG A 521 ? GLU A 519 ARG A 522 
AA3 1  VAL A 67  ? CYS A 68  ? VAL A 68  CYS A 69  
AA3 2  LEU A 91  ? SER A 92  ? LEU A 92  SER A 93  
AA4 1  LEU B 8   ? VAL B 11  ? LEU B 9   VAL B 12  
AA4 2  GLY B 14  ? ARG B 17  ? GLY B 15  ARG B 18  
AA4 3  VAL B 58  ? ASP B 60  ? VAL B 59  ASP B 61  
AA5 1  ILE B 19  ? LEU B 21  ? ILE B 20  LEU B 22  
AA5 2  VAL B 28  ? PRO B 35  ? VAL B 29  PRO B 36  
AA5 3  TYR B 97  ? PRO B 103 ? TYR B 98  PRO B 104 
AA5 4  VAL B 144 ? MET B 148 ? VAL B 145 MET B 149 
AA5 5  THR B 111 ? ILE B 117 ? THR B 112 ILE B 118 
AA5 6  GLY B 191 ? GLU B 201 ? GLY B 192 GLU B 202 
AA5 7  ARG B 223 ? GLN B 227 ? ARG B 224 GLN B 228 
AA5 8  GLN B 324 ? VAL B 330 ? GLN B 325 VAL B 331 
AA5 9  ARG B 423 ? PHE B 429 ? ARG B 424 PHE B 430 
AA5 10 GLN B 508 ? LEU B 512 ? GLN B 509 LEU B 513 
AA5 11 GLU B 518 ? ARG B 521 ? GLU B 519 ARG B 522 
AA6 1  VAL B 67  ? CYS B 68  ? VAL B 68  CYS B 69  
AA6 2  LEU B 91  ? SER B 92  ? LEU B 92  SER B 93  
AA7 1  VAL B 238 ? GLY B 239 ? VAL B 239 GLY B 240 
AA7 2  VAL B 301 ? VAL B 302 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 9   ? N VAL A 10  O LEU A 16  ? O LEU A 17  
AA1 2  3  N ARG A 15  ? N ARG A 16  O VAL A 59  ? O VAL A 60  
AA2 1  2  N LEU A 21  ? N LEU A 22  O VAL A 28  ? O VAL A 29  
AA2 2  3  N PHE A 31  ? N PHE A 32  O VAL A 100 ? O VAL A 101 
AA2 3  4  N ASN A 99  ? N ASN A 100 O SER A 147 ? O SER A 148 
AA2 4  5  O VAL A 146 ? O VAL A 147 N TRP A 116 ? N TRP A 117 
AA2 5  6  N VAL A 113 ? N VAL A 114 O THR A 197 ? O THR A 198 
AA2 6  7  N LEU A 198 ? N LEU A 199 O ARG A 223 ? O ARG A 224 
AA2 7  8  N LEU A 226 ? N LEU A 227 O LEU A 326 ? O LEU A 327 
AA2 8  9  N VAL A 327 ? N VAL A 328 O TYR A 425 ? O TYR A 426 
AA2 9  10 N VAL A 428 ? N VAL A 429 O LEU A 512 ? O LEU A 513 
AA2 10 11 N TYR A 509 ? N TYR A 510 O ARG A 520 ? O ARG A 521 
AA3 1  2  N VAL A 67  ? N VAL A 68  O SER A 92  ? O SER A 93  
AA4 1  2  N VAL B 9   ? N VAL B 10  O LEU B 16  ? O LEU B 17  
AA4 2  3  N ARG B 15  ? N ARG B 16  O VAL B 59  ? O VAL B 60  
AA5 1  2  N ILE B 19  ? N ILE B 20  O ALA B 30  ? O ALA B 31  
AA5 2  3  N ILE B 34  ? N ILE B 35  O LEU B 98  ? O LEU B 99  
AA5 3  4  N ASN B 99  ? N ASN B 100 O SER B 147 ? O SER B 148 
AA5 4  5  O VAL B 146 ? O VAL B 147 N LEU B 114 ? N LEU B 115 
AA5 5  6  N THR B 111 ? N THR B 112 O ASP B 192 ? O ASP B 193 
AA5 6  7  N GLY B 200 ? N GLY B 201 O GLN B 227 ? O GLN B 228 
AA5 7  8  N LEU B 226 ? N LEU B 227 O LEU B 326 ? O LEU B 327 
AA5 8  9  N VAL B 329 ? N VAL B 330 O PHE B 429 ? O PHE B 430 
AA5 9  10 N VAL B 428 ? N VAL B 429 O LEU B 512 ? O LEU B 513 
AA5 10 11 N TYR B 509 ? N TYR B 510 O ARG B 520 ? O ARG B 521 
AA6 1  2  N VAL B 67  ? N VAL B 68  O SER B 92  ? O SER B 93  
AA7 1  2  N VAL B 238 ? N VAL B 239 O VAL B 302 ? O VAL B 303 
# 
_atom_sites.entry_id                    6CQT 
_atom_sites.fract_transf_matrix[1][1]   0.009581 
_atom_sites.fract_transf_matrix[1][2]   0.005532 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011064 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003094 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 2   ? 80.631  39.624 55.976  1.00 99.76  ? 3    ARG A N   1 
ATOM   2    C CA  . ARG A 1 2   ? 79.266  39.976 56.349  1.00 100.89 ? 3    ARG A CA  1 
ATOM   3    C C   . ARG A 1 2   ? 78.300  39.818 55.181  1.00 97.41  ? 3    ARG A C   1 
ATOM   4    O O   . ARG A 1 2   ? 77.943  38.700 54.809  1.00 101.76 ? 3    ARG A O   1 
ATOM   5    C CB  . ARG A 1 2   ? 79.214  41.406 56.884  1.00 105.88 ? 3    ARG A CB  1 
ATOM   6    C CG  . ARG A 1 2   ? 79.680  41.527 58.321  1.00 113.46 ? 3    ARG A CG  1 
ATOM   7    C CD  . ARG A 1 2   ? 78.762  40.758 59.246  1.00 119.27 ? 3    ARG A CD  1 
ATOM   8    N NE  . ARG A 1 2   ? 77.379  41.198 59.102  1.00 124.25 ? 3    ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 2   ? 76.833  42.184 59.805  1.00 129.67 ? 3    ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 2   ? 77.556  42.835 60.708  1.00 131.99 ? 3    ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 2   ? 75.565  42.521 59.607  1.00 130.33 ? 3    ARG A NH2 1 
ATOM   12   N N   . GLU A 1 3   ? 77.882  40.942 54.601  1.00 89.54  ? 4    GLU A N   1 
ATOM   13   C CA  . GLU A 1 3   ? 76.882  40.943 53.544  1.00 79.69  ? 4    GLU A CA  1 
ATOM   14   C C   . GLU A 1 3   ? 77.330  41.815 52.379  1.00 69.50  ? 4    GLU A C   1 
ATOM   15   O O   . GLU A 1 3   ? 78.050  42.803 52.551  1.00 70.01  ? 4    GLU A O   1 
ATOM   16   C CB  . GLU A 1 3   ? 75.515  41.433 54.064  1.00 78.65  ? 4    GLU A CB  1 
ATOM   17   C CG  . GLU A 1 3   ? 74.838  40.472 55.045  1.00 78.54  ? 4    GLU A CG  1 
ATOM   18   C CD  . GLU A 1 3   ? 73.758  39.618 54.406  1.00 75.14  ? 4    GLU A CD  1 
ATOM   19   O OE1 . GLU A 1 3   ? 72.703  39.432 55.042  1.00 71.40  ? 4    GLU A OE1 1 
ATOM   20   O OE2 . GLU A 1 3   ? 73.966  39.126 53.280  1.00 74.32  ? 4    GLU A OE2 1 
ATOM   21   N N   . ASP A 1 4   ? 76.888  41.427 51.186  1.00 62.35  ? 5    ASP A N   1 
ATOM   22   C CA  . ASP A 1 4   ? 77.113  42.180 49.958  1.00 52.22  ? 5    ASP A CA  1 
ATOM   23   C C   . ASP A 1 4   ? 75.866  43.019 49.697  1.00 51.14  ? 5    ASP A C   1 
ATOM   24   O O   . ASP A 1 4   ? 74.799  42.474 49.393  1.00 48.35  ? 5    ASP A O   1 
ATOM   25   C CB  . ASP A 1 4   ? 77.397  41.228 48.799  1.00 49.38  ? 5    ASP A CB  1 
ATOM   26   C CG  . ASP A 1 4   ? 77.802  41.950 47.521  1.00 52.11  ? 5    ASP A CG  1 
ATOM   27   O OD1 . ASP A 1 4   ? 78.392  41.292 46.635  1.00 45.37  ? 5    ASP A OD1 1 
ATOM   28   O OD2 . ASP A 1 4   ? 77.539  43.165 47.399  1.00 55.54  ? 5    ASP A OD2 1 
ATOM   29   N N   . ALA A 1 5   ? 76.006  44.344 49.803  1.00 52.06  ? 6    ALA A N   1 
ATOM   30   C CA  . ALA A 1 5   ? 74.856  45.233 49.651  1.00 50.57  ? 6    ALA A CA  1 
ATOM   31   C C   . ALA A 1 5   ? 74.173  45.062 48.301  1.00 49.99  ? 6    ALA A C   1 
ATOM   32   O O   . ALA A 1 5   ? 72.953  45.235 48.198  1.00 47.52  ? 6    ALA A O   1 
ATOM   33   C CB  . ALA A 1 5   ? 75.287  46.688 49.844  1.00 52.65  ? 6    ALA A CB  1 
ATOM   34   N N   . GLU A 1 6   ? 74.934  44.720 47.257  1.00 47.97  ? 7    GLU A N   1 
ATOM   35   C CA  . GLU A 1 6   ? 74.331  44.520 45.946  1.00 44.01  ? 7    GLU A CA  1 
ATOM   36   C C   . GLU A 1 6   ? 73.354  43.355 45.935  1.00 40.25  ? 7    GLU A C   1 
ATOM   37   O O   . GLU A 1 6   ? 72.462  43.318 45.082  1.00 31.59  ? 7    GLU A O   1 
ATOM   38   C CB  . GLU A 1 6   ? 75.410  44.292 44.886  1.00 47.89  ? 7    GLU A CB  1 
ATOM   39   C CG  . GLU A 1 6   ? 76.331  45.482 44.675  1.00 57.30  ? 7    GLU A CG  1 
ATOM   40   C CD  . GLU A 1 6   ? 75.584  46.741 44.267  1.00 62.61  ? 7    GLU A CD  1 
ATOM   41   O OE1 . GLU A 1 6   ? 74.579  46.637 43.531  1.00 59.54  ? 7    GLU A OE1 1 
ATOM   42   O OE2 . GLU A 1 6   ? 76.003  47.838 44.692  1.00 71.24  ? 7    GLU A OE2 1 
ATOM   43   N N   . LEU A 1 7   ? 73.492  42.411 46.864  1.00 35.37  ? 8    LEU A N   1 
ATOM   44   C CA  . LEU A 1 7   ? 72.648  41.225 46.892  1.00 37.12  ? 8    LEU A CA  1 
ATOM   45   C C   . LEU A 1 7   ? 71.511  41.333 47.896  1.00 36.07  ? 8    LEU A C   1 
ATOM   46   O O   . LEU A 1 7   ? 70.807  40.344 48.129  1.00 33.79  ? 8    LEU A O   1 
ATOM   47   C CB  . LEU A 1 7   ? 73.498  39.991 47.182  1.00 36.58  ? 8    LEU A CB  1 
ATOM   48   C CG  . LEU A 1 7   ? 74.709  39.896 46.257  1.00 35.80  ? 8    LEU A CG  1 
ATOM   49   C CD1 . LEU A 1 7   ? 75.533  38.668 46.583  1.00 32.77  ? 8    LEU A CD1 1 
ATOM   50   C CD2 . LEU A 1 7   ? 74.250  39.909 44.779  1.00 31.57  ? 8    LEU A CD2 1 
ATOM   51   N N   . LEU A 1 8   ? 71.310  42.506 48.485  1.00 33.14  ? 9    LEU A N   1 
ATOM   52   C CA  . LEU A 1 8   ? 70.213  42.746 49.407  1.00 37.53  ? 9    LEU A CA  1 
ATOM   53   C C   . LEU A 1 8   ? 69.273  43.764 48.783  1.00 34.84  ? 9    LEU A C   1 
ATOM   54   O O   . LEU A 1 8   ? 69.705  44.845 48.375  1.00 40.03  ? 9    LEU A O   1 
ATOM   55   C CB  . LEU A 1 8   ? 70.727  43.244 50.760  1.00 32.70  ? 9    LEU A CB  1 
ATOM   56   C CG  . LEU A 1 8   ? 71.696  42.302 51.469  1.00 38.07  ? 9    LEU A CG  1 
ATOM   57   C CD1 . LEU A 1 8   ? 72.151  42.913 52.787  1.00 39.70  ? 9    LEU A CD1 1 
ATOM   58   C CD2 . LEU A 1 8   ? 71.069  40.919 51.662  1.00 39.83  ? 9    LEU A CD2 1 
ATOM   59   N N   . VAL A 1 9   ? 67.996  43.412 48.705  1.00 30.95  ? 10   VAL A N   1 
ATOM   60   C CA  . VAL A 1 9   ? 66.975  44.271 48.119  1.00 34.66  ? 10   VAL A CA  1 
ATOM   61   C C   . VAL A 1 9   ? 65.760  44.232 49.030  1.00 32.82  ? 10   VAL A C   1 
ATOM   62   O O   . VAL A 1 9   ? 65.425  43.182 49.587  1.00 33.98  ? 10   VAL A O   1 
ATOM   63   C CB  . VAL A 1 9   ? 66.614  43.822 46.683  1.00 36.09  ? 10   VAL A CB  1 
ATOM   64   C CG1 . VAL A 1 9   ? 65.385  44.557 46.172  1.00 36.39  ? 10   VAL A CG1 1 
ATOM   65   C CG2 . VAL A 1 9   ? 67.783  44.048 45.748  1.00 37.50  ? 10   VAL A CG2 1 
ATOM   66   N N   . THR A 1 10  ? 65.109  45.376 49.198  1.00 34.68  ? 11   THR A N   1 
ATOM   67   C CA  . THR A 1 10  ? 63.846  45.445 49.916  1.00 34.36  ? 11   THR A CA  1 
ATOM   68   C C   . THR A 1 10  ? 62.708  45.624 48.918  1.00 35.18  ? 11   THR A C   1 
ATOM   69   O O   . THR A 1 10  ? 62.745  46.533 48.083  1.00 38.12  ? 11   THR A O   1 
ATOM   70   C CB  . THR A 1 10  ? 63.853  46.592 50.929  1.00 37.87  ? 11   THR A CB  1 
ATOM   71   O OG1 . THR A 1 10  ? 64.858  46.349 51.924  1.00 38.74  ? 11   THR A OG1 1 
ATOM   72   C CG2 . THR A 1 10  ? 62.496  46.704 51.618  1.00 35.95  ? 11   THR A CG2 1 
ATOM   73   N N   . VAL A 1 11  ? 61.712  44.743 48.991  1.00 35.34  ? 12   VAL A N   1 
ATOM   74   C CA  . VAL A 1 11  ? 60.468  44.927 48.252  1.00 34.43  ? 12   VAL A CA  1 
ATOM   75   C C   . VAL A 1 11  ? 59.338  45.083 49.266  1.00 37.12  ? 12   VAL A C   1 
ATOM   76   O O   . VAL A 1 11  ? 59.593  45.216 50.468  1.00 41.77  ? 12   VAL A O   1 
ATOM   77   C CB  . VAL A 1 11  ? 60.210  43.765 47.272  1.00 36.42  ? 12   VAL A CB  1 
ATOM   78   C CG1 . VAL A 1 11  ? 61.266  43.760 46.163  1.00 29.35  ? 12   VAL A CG1 1 
ATOM   79   C CG2 . VAL A 1 11  ? 60.177  42.423 47.997  1.00 34.78  ? 12   VAL A CG2 1 
ATOM   80   N N   . ARG A 1 12  ? 58.087  45.072 48.794  1.00 43.17  ? 13   ARG A N   1 
ATOM   81   C CA  . ARG A 1 12  ? 56.948  45.333 49.676  1.00 51.62  ? 13   ARG A CA  1 
ATOM   82   C C   . ARG A 1 12  ? 56.797  44.259 50.737  1.00 43.04  ? 13   ARG A C   1 
ATOM   83   O O   . ARG A 1 12  ? 56.587  44.565 51.916  1.00 54.76  ? 13   ARG A O   1 
ATOM   84   C CB  . ARG A 1 12  ? 55.660  45.425 48.869  1.00 59.60  ? 13   ARG A CB  1 
ATOM   85   C CG  . ARG A 1 12  ? 55.785  46.288 47.675  1.00 72.80  ? 13   ARG A CG  1 
ATOM   86   C CD  . ARG A 1 12  ? 55.344  47.682 48.013  1.00 87.62  ? 13   ARG A CD  1 
ATOM   87   N NE  . ARG A 1 12  ? 56.002  48.642 47.141  1.00 99.88  ? 13   ARG A NE  1 
ATOM   88   C CZ  . ARG A 1 12  ? 56.918  49.511 47.552  1.00 108.53 ? 13   ARG A CZ  1 
ATOM   89   N NH1 . ARG A 1 12  ? 57.272  49.554 48.832  1.00 111.89 ? 13   ARG A NH1 1 
ATOM   90   N NH2 . ARG A 1 12  ? 57.472  50.345 46.684  1.00 110.61 ? 13   ARG A NH2 1 
ATOM   91   N N   . GLY A 1 13  ? 56.854  42.993 50.326  1.00 34.39  ? 14   GLY A N   1 
ATOM   92   C CA  . GLY A 1 13  ? 56.711  41.914 51.283  1.00 41.27  ? 14   GLY A CA  1 
ATOM   93   C C   . GLY A 1 13  ? 57.776  41.933 52.357  1.00 36.06  ? 14   GLY A C   1 
ATOM   94   O O   . GLY A 1 13  ? 57.539  41.475 53.474  1.00 45.19  ? 14   GLY A O   1 
ATOM   95   N N   . GLY A 1 14  ? 58.952  42.457 52.040  1.00 33.13  ? 15   GLY A N   1 
ATOM   96   C CA  . GLY A 1 14  ? 60.054  42.469 52.976  1.00 32.90  ? 15   GLY A CA  1 
ATOM   97   C C   . GLY A 1 14  ? 61.381  42.395 52.246  1.00 31.89  ? 15   GLY A C   1 
ATOM   98   O O   . GLY A 1 14  ? 61.482  42.737 51.073  1.00 32.92  ? 15   GLY A O   1 
ATOM   99   N N   . ARG A 1 15  ? 62.389  41.926 52.965  1.00 36.56  ? 16   ARG A N   1 
ATOM   100  C CA  . ARG A 1 15  ? 63.752  41.936 52.463  1.00 35.22  ? 16   ARG A CA  1 
ATOM   101  C C   . ARG A 1 15  ? 64.096  40.619 51.783  1.00 38.63  ? 16   ARG A C   1 
ATOM   102  O O   . ARG A 1 15  ? 63.602  39.551 52.159  1.00 37.63  ? 16   ARG A O   1 
ATOM   103  C CB  . ARG A 1 15  ? 64.732  42.210 53.601  1.00 38.78  ? 16   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 15  ? 64.589  43.600 54.198  1.00 42.17  ? 16   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 15  ? 65.576  43.813 55.334  1.00 42.43  ? 16   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 15  ? 65.119  43.178 56.561  1.00 52.70  ? 16   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 15  ? 65.931  42.704 57.500  1.00 59.14  ? 16   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 15  ? 67.246  42.783 57.341  1.00 58.45  ? 16   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 15  ? 65.429  42.138 58.590  1.00 58.07  ? 16   ARG A NH2 1 
ATOM   110  N N   . LEU A 1 16  ? 64.957  40.714 50.770  1.00 27.52  ? 17   LEU A N   1 
ATOM   111  C CA  . LEU A 1 16  ? 65.428  39.569 50.006  1.00 30.87  ? 17   LEU A CA  1 
ATOM   112  C C   . LEU A 1 16  ? 66.946  39.575 49.939  1.00 33.56  ? 17   LEU A C   1 
ATOM   113  O O   . LEU A 1 16  ? 67.586  40.627 50.021  1.00 33.91  ? 17   LEU A O   1 
ATOM   114  C CB  . LEU A 1 16  ? 64.893  39.562 48.570  1.00 29.95  ? 17   LEU A CB  1 
ATOM   115  C CG  . LEU A 1 16  ? 63.408  39.729 48.287  1.00 30.76  ? 17   LEU A CG  1 
ATOM   116  C CD1 . LEU A 1 16  ? 63.206  40.147 46.832  1.00 26.31  ? 17   LEU A CD1 1 
ATOM   117  C CD2 . LEU A 1 16  ? 62.678  38.431 48.618  1.00 27.35  ? 17   LEU A CD2 1 
ATOM   118  N N   . ARG A 1 17  ? 67.513  38.386 49.769  1.00 32.73  ? 18   ARG A N   1 
ATOM   119  C CA  . ARG A 1 17  ? 68.939  38.223 49.525  1.00 31.55  ? 18   ARG A CA  1 
ATOM   120  C C   . ARG A 1 17  ? 69.121  37.362 48.284  1.00 32.12  ? 18   ARG A C   1 
ATOM   121  O O   . ARG A 1 17  ? 68.488  36.308 48.163  1.00 29.33  ? 18   ARG A O   1 
ATOM   122  C CB  . ARG A 1 17  ? 69.640  37.589 50.726  1.00 30.64  ? 18   ARG A CB  1 
ATOM   123  C CG  . ARG A 1 17  ? 71.096  37.253 50.468  1.00 29.84  ? 18   ARG A CG  1 
ATOM   124  C CD  . ARG A 1 17  ? 71.732  36.596 51.691  1.00 32.65  ? 18   ARG A CD  1 
ATOM   125  N NE  . ARG A 1 17  ? 71.504  37.341 52.928  1.00 40.63  ? 18   ARG A NE  1 
ATOM   126  C CZ  . ARG A 1 17  ? 70.744  36.910 53.947  1.00 40.20  ? 18   ARG A CZ  1 
ATOM   127  N NH1 . ARG A 1 17  ? 70.115  35.746 53.897  1.00 35.56  ? 18   ARG A NH1 1 
ATOM   128  N NH2 . ARG A 1 17  ? 70.596  37.665 55.023  1.00 39.88  ? 18   ARG A NH2 1 
ATOM   129  N N   . GLY A 1 18  ? 69.971  37.815 47.358  1.00 33.29  ? 19   GLY A N   1 
ATOM   130  C CA  . GLY A 1 18  ? 70.222  37.117 46.119  1.00 28.68  ? 19   GLY A CA  1 
ATOM   131  C C   . GLY A 1 18  ? 71.625  36.546 46.041  1.00 32.69  ? 19   GLY A C   1 
ATOM   132  O O   . GLY A 1 18  ? 72.336  36.425 47.046  1.00 33.94  ? 19   GLY A O   1 
ATOM   133  N N   . ILE A 1 19  ? 72.034  36.193 44.823  1.00 30.30  ? 20   ILE A N   1 
ATOM   134  C CA  . ILE A 1 19  ? 73.356  35.624 44.595  1.00 31.36  ? 20   ILE A CA  1 
ATOM   135  C C   . ILE A 1 19  ? 74.057  36.377 43.476  1.00 33.54  ? 20   ILE A C   1 
ATOM   136  O O   . ILE A 1 19  ? 73.425  36.948 42.581  1.00 34.84  ? 20   ILE A O   1 
ATOM   137  C CB  . ILE A 1 19  ? 73.305  34.122 44.244  1.00 36.12  ? 20   ILE A CB  1 
ATOM   138  C CG1 . ILE A 1 19  ? 72.455  33.900 42.989  1.00 38.75  ? 20   ILE A CG1 1 
ATOM   139  C CG2 . ILE A 1 19  ? 72.787  33.317 45.405  1.00 34.89  ? 20   ILE A CG2 1 
ATOM   140  C CD1 . ILE A 1 19  ? 72.418  32.461 42.532  1.00 41.21  ? 20   ILE A CD1 1 
ATOM   141  N N   . ARG A 1 20  ? 75.382  36.355 43.526  1.00 33.56  ? 21   ARG A N   1 
ATOM   142  C CA  . ARG A 1 20  ? 76.221  36.871 42.453  1.00 38.74  ? 21   ARG A CA  1 
ATOM   143  C C   . ARG A 1 20  ? 76.520  35.719 41.501  1.00 36.69  ? 21   ARG A C   1 
ATOM   144  O O   . ARG A 1 20  ? 77.202  34.760 41.871  1.00 34.78  ? 21   ARG A O   1 
ATOM   145  C CB  . ARG A 1 20  ? 77.497  37.473 43.031  1.00 42.68  ? 21   ARG A CB  1 
ATOM   146  C CG  . ARG A 1 20  ? 78.504  37.992 42.020  1.00 50.04  ? 21   ARG A CG  1 
ATOM   147  C CD  . ARG A 1 20  ? 79.839  38.178 42.734  1.00 57.44  ? 21   ARG A CD  1 
ATOM   148  N NE  . ARG A 1 20  ? 80.659  39.252 42.185  1.00 59.63  ? 21   ARG A NE  1 
ATOM   149  C CZ  . ARG A 1 20  ? 81.658  39.062 41.331  1.00 64.11  ? 21   ARG A CZ  1 
ATOM   150  N NH1 . ARG A 1 20  ? 81.953  37.837 40.922  1.00 64.95  ? 21   ARG A NH1 1 
ATOM   151  N NH2 . ARG A 1 20  ? 82.362  40.094 40.887  1.00 70.38  ? 21   ARG A NH2 1 
ATOM   152  N N   . LEU A 1 21  ? 75.978  35.795 40.291  1.00 33.59  ? 22   LEU A N   1 
ATOM   153  C CA  . LEU A 1 21  ? 76.198  34.776 39.277  1.00 40.84  ? 22   LEU A CA  1 
ATOM   154  C C   . LEU A 1 21  ? 77.408  35.120 38.425  1.00 40.62  ? 22   LEU A C   1 
ATOM   155  O O   . LEU A 1 21  ? 77.586  36.270 38.010  1.00 36.42  ? 22   LEU A O   1 
ATOM   156  C CB  . LEU A 1 21  ? 74.979  34.633 38.369  1.00 43.59  ? 22   LEU A CB  1 
ATOM   157  C CG  . LEU A 1 21  ? 73.779  33.865 38.900  1.00 46.51  ? 22   LEU A CG  1 
ATOM   158  C CD1 . LEU A 1 21  ? 72.803  33.642 37.761  1.00 46.35  ? 22   LEU A CD1 1 
ATOM   159  C CD2 . LEU A 1 21  ? 74.233  32.551 39.493  1.00 40.33  ? 22   LEU A CD2 1 
ATOM   160  N N   . LYS A 1 22  ? 78.232  34.115 38.159  1.00 41.53  ? 23   LYS A N   1 
ATOM   161  C CA  . LYS A 1 22  ? 79.292  34.259 37.176  1.00 42.03  ? 23   LYS A CA  1 
ATOM   162  C C   . LYS A 1 22  ? 78.730  34.039 35.777  1.00 39.74  ? 23   LYS A C   1 
ATOM   163  O O   . LYS A 1 22  ? 77.891  33.160 35.558  1.00 40.61  ? 23   LYS A O   1 
ATOM   164  C CB  . LYS A 1 22  ? 80.424  33.269 37.450  1.00 46.12  ? 23   LYS A CB  1 
ATOM   165  C CG  . LYS A 1 22  ? 81.106  33.435 38.802  1.00 54.36  ? 23   LYS A CG  1 
ATOM   166  C CD  . LYS A 1 22  ? 82.429  32.676 38.836  1.00 64.77  ? 23   LYS A CD  1 
ATOM   167  C CE  . LYS A 1 22  ? 83.092  32.737 40.205  1.00 71.18  ? 23   LYS A CE  1 
ATOM   168  N NZ  . LYS A 1 22  ? 82.426  31.837 41.191  1.00 76.00  ? 23   LYS A NZ  1 
ATOM   169  N N   . THR A 1 23  ? 79.160  34.874 34.843  1.00 37.55  ? 24   THR A N   1 
ATOM   170  C CA  . THR A 1 23  ? 78.909  34.712 33.420  1.00 39.55  ? 24   THR A CA  1 
ATOM   171  C C   . THR A 1 23  ? 80.232  34.900 32.699  1.00 42.34  ? 24   THR A C   1 
ATOM   172  O O   . THR A 1 23  ? 81.167  35.486 33.254  1.00 44.59  ? 24   THR A O   1 
ATOM   173  C CB  . THR A 1 23  ? 77.884  35.725 32.881  1.00 38.30  ? 24   THR A CB  1 
ATOM   174  O OG1 . THR A 1 23  ? 78.562  36.938 32.524  1.00 42.15  ? 24   THR A OG1 1 
ATOM   175  C CG2 . THR A 1 23  ? 76.810  36.031 33.920  1.00 37.14  ? 24   THR A CG2 1 
ATOM   176  N N   . PRO A 1 24  ? 80.350  34.409 31.462  1.00 46.55  ? 25   PRO A N   1 
ATOM   177  C CA  . PRO A 1 24  ? 81.595  34.641 30.706  1.00 50.81  ? 25   PRO A CA  1 
ATOM   178  C C   . PRO A 1 24  ? 82.005  36.103 30.621  1.00 53.83  ? 25   PRO A C   1 
ATOM   179  O O   . PRO A 1 24  ? 83.203  36.402 30.677  1.00 63.59  ? 25   PRO A O   1 
ATOM   180  C CB  . PRO A 1 24  ? 81.269  34.064 29.323  1.00 49.48  ? 25   PRO A CB  1 
ATOM   181  C CG  . PRO A 1 24  ? 80.263  33.004 29.597  1.00 49.20  ? 25   PRO A CG  1 
ATOM   182  C CD  . PRO A 1 24  ? 79.435  33.495 30.756  1.00 45.34  ? 25   PRO A CD  1 
ATOM   183  N N   . GLY A 1 25  ? 81.052  37.023 30.505  1.00 47.30  ? 26   GLY A N   1 
ATOM   184  C CA  . GLY A 1 25  ? 81.391  38.424 30.373  1.00 45.43  ? 26   GLY A CA  1 
ATOM   185  C C   . GLY A 1 25  ? 81.420  39.202 31.669  1.00 49.29  ? 26   GLY A C   1 
ATOM   186  O O   . GLY A 1 25  ? 81.659  40.415 31.656  1.00 61.37  ? 26   GLY A O   1 
ATOM   187  N N   . GLY A 1 26  ? 81.174  38.558 32.803  1.00 37.63  ? 27   GLY A N   1 
ATOM   188  C CA  . GLY A 1 26  ? 81.211  39.261 34.068  1.00 39.17  ? 27   GLY A CA  1 
ATOM   189  C C   . GLY A 1 26  ? 80.040  38.974 34.979  1.00 38.62  ? 27   GLY A C   1 
ATOM   190  O O   . GLY A 1 26  ? 79.139  38.196 34.676  1.00 35.32  ? 27   GLY A O   1 
ATOM   191  N N   . PRO A 1 27  ? 80.035  39.621 36.139  1.00 40.30  ? 28   PRO A N   1 
ATOM   192  C CA  . PRO A 1 27  ? 79.072  39.249 37.184  1.00 33.69  ? 28   PRO A CA  1 
ATOM   193  C C   . PRO A 1 27  ? 77.672  39.749 36.875  1.00 33.62  ? 28   PRO A C   1 
ATOM   194  O O   . PRO A 1 27  ? 77.475  40.779 36.227  1.00 31.56  ? 28   PRO A O   1 
ATOM   195  C CB  . PRO A 1 27  ? 79.617  39.911 38.466  1.00 37.79  ? 28   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 27  ? 80.620  40.929 38.005  1.00 40.85  ? 28   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 27  ? 81.071  40.570 36.623  1.00 40.38  ? 28   PRO A CD  1 
ATOM   198  N N   . VAL A 1 28  ? 76.696  38.997 37.372  1.00 31.43  ? 29   VAL A N   1 
ATOM   199  C CA  . VAL A 1 28  ? 75.275  39.312 37.278  1.00 28.67  ? 29   VAL A CA  1 
ATOM   200  C C   . VAL A 1 28  ? 74.663  39.059 38.656  1.00 33.22  ? 29   VAL A C   1 
ATOM   201  O O   . VAL A 1 28  ? 75.091  38.158 39.384  1.00 31.32  ? 29   VAL A O   1 
ATOM   202  C CB  . VAL A 1 28  ? 74.604  38.452 36.178  1.00 32.11  ? 29   VAL A CB  1 
ATOM   203  C CG1 . VAL A 1 28  ? 73.116  38.279 36.420  1.00 36.93  ? 29   VAL A CG1 1 
ATOM   204  C CG2 . VAL A 1 28  ? 74.859  39.060 34.801  1.00 35.82  ? 29   VAL A CG2 1 
ATOM   205  N N   . SER A 1 29  ? 73.687  39.880 39.031  1.00 29.42  ? 30   SER A N   1 
ATOM   206  C CA  . SER A 1 29  ? 72.939  39.665 40.259  1.00 30.47  ? 30   SER A CA  1 
ATOM   207  C C   . SER A 1 29  ? 71.655  38.918 39.942  1.00 31.79  ? 30   SER A C   1 
ATOM   208  O O   . SER A 1 29  ? 70.944  39.265 38.998  1.00 30.91  ? 30   SER A O   1 
ATOM   209  C CB  . SER A 1 29  ? 72.598  40.977 40.963  1.00 26.21  ? 30   SER A CB  1 
ATOM   210  O OG  . SER A 1 29  ? 73.762  41.655 41.388  1.00 36.47  ? 30   SER A OG  1 
ATOM   211  N N   . ALA A 1 30  ? 71.363  37.889 40.734  1.00 27.60  ? 31   ALA A N   1 
ATOM   212  C CA  . ALA A 1 30  ? 70.203  37.045 40.494  1.00 27.32  ? 31   ALA A CA  1 
ATOM   213  C C   . ALA A 1 30  ? 69.422  36.879 41.786  1.00 27.34  ? 31   ALA A C   1 
ATOM   214  O O   . ALA A 1 30  ? 70.000  36.589 42.840  1.00 28.42  ? 31   ALA A O   1 
ATOM   215  C CB  . ALA A 1 30  ? 70.612  35.676 39.938  1.00 22.25  ? 31   ALA A CB  1 
ATOM   216  N N   . PHE A 1 31  ? 68.114  37.057 41.694  1.00 27.36  ? 32   PHE A N   1 
ATOM   217  C CA  . PHE A 1 31  ? 67.190  36.853 42.803  1.00 27.09  ? 32   PHE A CA  1 
ATOM   218  C C   . PHE A 1 31  ? 66.192  35.804 42.326  1.00 25.98  ? 32   PHE A C   1 
ATOM   219  O O   . PHE A 1 31  ? 65.226  36.123 41.625  1.00 27.27  ? 32   PHE A O   1 
ATOM   220  C CB  . PHE A 1 31  ? 66.525  38.166 43.200  1.00 27.65  ? 32   PHE A CB  1 
ATOM   221  C CG  . PHE A 1 31  ? 67.502  39.208 43.674  1.00 30.24  ? 32   PHE A CG  1 
ATOM   222  C CD1 . PHE A 1 31  ? 67.752  39.378 45.023  1.00 27.74  ? 32   PHE A CD1 1 
ATOM   223  C CD2 . PHE A 1 31  ? 68.189  40.000 42.764  1.00 31.74  ? 32   PHE A CD2 1 
ATOM   224  C CE1 . PHE A 1 31  ? 68.664  40.331 45.468  1.00 34.47  ? 32   PHE A CE1 1 
ATOM   225  C CE2 . PHE A 1 31  ? 69.101  40.953 43.199  1.00 31.83  ? 32   PHE A CE2 1 
ATOM   226  C CZ  . PHE A 1 31  ? 69.335  41.119 44.552  1.00 31.26  ? 32   PHE A CZ  1 
ATOM   227  N N   . LEU A 1 32  ? 66.448  34.552 42.683  1.00 23.15  ? 33   LEU A N   1 
ATOM   228  C CA  . LEU A 1 32  ? 65.696  33.416 42.175  1.00 23.32  ? 33   LEU A CA  1 
ATOM   229  C C   . LEU A 1 32  ? 64.772  32.871 43.256  1.00 24.72  ? 33   LEU A C   1 
ATOM   230  O O   . LEU A 1 32  ? 65.177  32.721 44.408  1.00 24.40  ? 33   LEU A O   1 
ATOM   231  C CB  . LEU A 1 32  ? 66.655  32.320 41.701  1.00 24.72  ? 33   LEU A CB  1 
ATOM   232  C CG  . LEU A 1 32  ? 67.769  32.829 40.784  1.00 25.38  ? 33   LEU A CG  1 
ATOM   233  C CD1 . LEU A 1 32  ? 68.778  31.733 40.488  1.00 26.91  ? 33   LEU A CD1 1 
ATOM   234  C CD2 . LEU A 1 32  ? 67.197  33.403 39.490  1.00 20.89  ? 33   LEU A CD2 1 
ATOM   235  N N   . GLY A 1 33  ? 63.537  32.562 42.885  1.00 26.95  ? 34   GLY A N   1 
ATOM   236  C CA  . GLY A 1 33  ? 62.599  32.037 43.860  1.00 27.45  ? 34   GLY A CA  1 
ATOM   237  C C   . GLY A 1 33  ? 62.011  33.075 44.791  1.00 26.41  ? 34   GLY A C   1 
ATOM   238  O O   . GLY A 1 33  ? 61.930  32.842 46.004  1.00 26.04  ? 34   GLY A O   1 
ATOM   239  N N   . ILE A 1 34  ? 61.612  34.228 44.264  1.00 24.02  ? 35   ILE A N   1 
ATOM   240  C CA  . ILE A 1 34  ? 60.917  35.258 45.032  1.00 23.44  ? 35   ILE A CA  1 
ATOM   241  C C   . ILE A 1 34  ? 59.441  34.894 45.072  1.00 26.52  ? 35   ILE A C   1 
ATOM   242  O O   . ILE A 1 34  ? 58.811  34.771 44.010  1.00 26.95  ? 35   ILE A O   1 
ATOM   243  C CB  . ILE A 1 34  ? 61.114  36.648 44.405  1.00 25.65  ? 35   ILE A CB  1 
ATOM   244  C CG1 . ILE A 1 34  ? 62.603  36.986 44.251  1.00 25.90  ? 35   ILE A CG1 1 
ATOM   245  C CG2 . ILE A 1 34  ? 60.396  37.714 45.211  1.00 25.19  ? 35   ILE A CG2 1 
ATOM   246  C CD1 . ILE A 1 34  ? 62.852  38.243 43.391  1.00 26.01  ? 35   ILE A CD1 1 
ATOM   247  N N   . PRO A 1 35  ? 58.837  34.704 46.240  1.00 25.11  ? 36   PRO A N   1 
ATOM   248  C CA  . PRO A 1 35  ? 57.387  34.407 46.271  1.00 23.11  ? 36   PRO A CA  1 
ATOM   249  C C   . PRO A 1 35  ? 56.583  35.639 45.893  1.00 29.26  ? 36   PRO A C   1 
ATOM   250  O O   . PRO A 1 35  ? 56.794  36.722 46.456  1.00 29.35  ? 36   PRO A O   1 
ATOM   251  C CB  . PRO A 1 35  ? 57.126  33.970 47.724  1.00 23.82  ? 36   PRO A CB  1 
ATOM   252  C CG  . PRO A 1 35  ? 58.293  34.485 48.535  1.00 25.37  ? 36   PRO A CG  1 
ATOM   253  C CD  . PRO A 1 35  ? 59.385  34.950 47.595  1.00 25.09  ? 36   PRO A CD  1 
ATOM   254  N N   . PHE A 1 36  ? 55.674  35.487 44.940  1.00 27.67  ? 37   PHE A N   1 
ATOM   255  C CA  . PHE A 1 36  ? 54.810  36.605 44.569  1.00 27.47  ? 37   PHE A CA  1 
ATOM   256  C C   . PHE A 1 36  ? 53.343  36.341 44.862  1.00 27.34  ? 37   PHE A C   1 
ATOM   257  O O   . PHE A 1 36  ? 52.522  37.247 44.711  1.00 32.47  ? 37   PHE A O   1 
ATOM   258  C CB  . PHE A 1 36  ? 55.020  36.994 43.095  1.00 24.05  ? 37   PHE A CB  1 
ATOM   259  C CG  . PHE A 1 36  ? 54.507  35.987 42.092  1.00 25.83  ? 37   PHE A CG  1 
ATOM   260  C CD1 . PHE A 1 36  ? 53.219  36.101 41.571  1.00 24.88  ? 37   PHE A CD1 1 
ATOM   261  C CD2 . PHE A 1 36  ? 55.335  34.988 41.600  1.00 22.17  ? 37   PHE A CD2 1 
ATOM   262  C CE1 . PHE A 1 36  ? 52.748  35.205 40.612  1.00 22.05  ? 37   PHE A CE1 1 
ATOM   263  C CE2 . PHE A 1 36  ? 54.876  34.081 40.633  1.00 23.06  ? 37   PHE A CE2 1 
ATOM   264  C CZ  . PHE A 1 36  ? 53.575  34.191 40.141  1.00 21.48  ? 37   PHE A CZ  1 
ATOM   265  N N   . ALA A 1 37  ? 53.000  35.138 45.311  1.00 26.91  ? 38   ALA A N   1 
ATOM   266  C CA  . ALA A 1 37  ? 51.642  34.831 45.723  1.00 27.25  ? 38   ALA A CA  1 
ATOM   267  C C   . ALA A 1 37  ? 51.686  33.901 46.927  1.00 28.99  ? 38   ALA A C   1 
ATOM   268  O O   . ALA A 1 37  ? 52.682  33.212 47.165  1.00 29.76  ? 38   ALA A O   1 
ATOM   269  C CB  . ALA A 1 37  ? 50.844  34.186 44.589  1.00 21.31  ? 38   ALA A CB  1 
ATOM   270  N N   . GLU A 1 38  ? 50.594  33.890 47.686  1.00 28.55  ? 39   GLU A N   1 
ATOM   271  C CA  . GLU A 1 38  ? 50.408  32.829 48.663  1.00 34.06  ? 39   GLU A CA  1 
ATOM   272  C C   . GLU A 1 38  ? 50.346  31.491 47.933  1.00 33.96  ? 39   GLU A C   1 
ATOM   273  O O   . GLU A 1 38  ? 49.790  31.415 46.832  1.00 32.00  ? 39   GLU A O   1 
ATOM   274  C CB  . GLU A 1 38  ? 49.131  33.044 49.478  1.00 35.46  ? 39   GLU A CB  1 
ATOM   275  C CG  . GLU A 1 38  ? 49.210  34.204 50.446  1.00 36.64  ? 39   GLU A CG  1 
ATOM   276  C CD  . GLU A 1 38  ? 50.380  34.069 51.399  1.00 46.84  ? 39   GLU A CD  1 
ATOM   277  O OE1 . GLU A 1 38  ? 50.521  32.991 52.015  1.00 52.37  ? 39   GLU A OE1 1 
ATOM   278  O OE2 . GLU A 1 38  ? 51.169  35.032 51.516  1.00 45.43  ? 39   GLU A OE2 1 
ATOM   279  N N   . PRO A 1 39  ? 50.922  30.432 48.492  1.00 34.94  ? 40   PRO A N   1 
ATOM   280  C CA  . PRO A 1 39  ? 50.938  29.132 47.798  1.00 31.10  ? 40   PRO A CA  1 
ATOM   281  C C   . PRO A 1 39  ? 49.529  28.640 47.525  1.00 30.47  ? 40   PRO A C   1 
ATOM   282  O O   . PRO A 1 39  ? 48.698  28.558 48.441  1.00 31.71  ? 40   PRO A O   1 
ATOM   283  C CB  . PRO A 1 39  ? 51.671  28.212 48.788  1.00 31.72  ? 40   PRO A CB  1 
ATOM   284  C CG  . PRO A 1 39  ? 52.520  29.140 49.598  1.00 34.97  ? 40   PRO A CG  1 
ATOM   285  C CD  . PRO A 1 39  ? 51.699  30.403 49.743  1.00 32.99  ? 40   PRO A CD  1 
ATOM   286  N N   . PRO A 1 40  ? 49.220  28.306 46.290  1.00 31.85  ? 41   PRO A N   1 
ATOM   287  C CA  . PRO A 1 40  ? 47.842  27.912 45.930  1.00 31.59  ? 41   PRO A CA  1 
ATOM   288  C C   . PRO A 1 40  ? 47.532  26.462 46.293  1.00 37.78  ? 41   PRO A C   1 
ATOM   289  O O   . PRO A 1 40  ? 47.176  25.641 45.445  1.00 40.11  ? 41   PRO A O   1 
ATOM   290  C CB  . PRO A 1 40  ? 47.819  28.165 44.417  1.00 28.40  ? 41   PRO A CB  1 
ATOM   291  C CG  . PRO A 1 40  ? 49.224  27.890 43.982  1.00 29.14  ? 41   PRO A CG  1 
ATOM   292  C CD  . PRO A 1 40  ? 50.118  28.333 45.123  1.00 26.43  ? 41   PRO A CD  1 
ATOM   293  N N   . MET A 1 41  ? 47.650  26.150 47.582  1.00 36.58  ? 42   MET A N   1 
ATOM   294  C CA  . MET A 1 41  ? 47.557  24.798 48.116  1.00 45.36  ? 42   MET A CA  1 
ATOM   295  C C   . MET A 1 41  ? 46.184  24.532 48.718  1.00 41.97  ? 42   MET A C   1 
ATOM   296  O O   . MET A 1 41  ? 45.487  25.447 49.162  1.00 44.54  ? 42   MET A O   1 
ATOM   297  C CB  . MET A 1 41  ? 48.610  24.566 49.206  1.00 52.81  ? 42   MET A CB  1 
ATOM   298  C CG  . MET A 1 41  ? 50.021  24.945 48.839  1.00 59.90  ? 42   MET A CG  1 
ATOM   299  S SD  . MET A 1 41  ? 50.857  23.602 47.997  1.00 68.85  ? 42   MET A SD  1 
ATOM   300  C CE  . MET A 1 41  ? 50.597  22.254 49.143  1.00 71.75  ? 42   MET A CE  1 
ATOM   301  N N   . GLY A 1 42  ? 45.828  23.248 48.766  1.00 38.01  ? 43   GLY A N   1 
ATOM   302  C CA  . GLY A 1 42  ? 44.680  22.783 49.504  1.00 34.03  ? 43   GLY A CA  1 
ATOM   303  C C   . GLY A 1 42  ? 43.399  23.487 49.110  1.00 38.99  ? 43   GLY A C   1 
ATOM   304  O O   . GLY A 1 42  ? 42.893  23.333 47.994  1.00 35.17  ? 43   GLY A O   1 
ATOM   305  N N   . PRO A 1 43  ? 42.852  24.284 50.034  1.00 39.83  ? 44   PRO A N   1 
ATOM   306  C CA  . PRO A 1 43  ? 41.642  25.062 49.712  1.00 38.99  ? 44   PRO A CA  1 
ATOM   307  C C   . PRO A 1 43  ? 41.842  26.072 48.595  1.00 40.60  ? 44   PRO A C   1 
ATOM   308  O O   . PRO A 1 43  ? 40.850  26.506 47.997  1.00 40.20  ? 44   PRO A O   1 
ATOM   309  C CB  . PRO A 1 43  ? 41.287  25.763 51.037  1.00 36.40  ? 44   PRO A CB  1 
ATOM   310  C CG  . PRO A 1 43  ? 42.332  25.370 52.030  1.00 35.04  ? 44   PRO A CG  1 
ATOM   311  C CD  . PRO A 1 43  ? 43.397  24.569 51.371  1.00 35.59  ? 44   PRO A CD  1 
ATOM   312  N N   . ARG A 1 44  ? 43.078  26.460 48.289  1.00 39.99  ? 45   ARG A N   1 
ATOM   313  C CA  . ARG A 1 44  ? 43.332  27.474 47.274  1.00 36.19  ? 45   ARG A CA  1 
ATOM   314  C C   . ARG A 1 44  ? 43.573  26.898 45.881  1.00 36.49  ? 45   ARG A C   1 
ATOM   315  O O   . ARG A 1 44  ? 43.781  27.671 44.938  1.00 30.89  ? 45   ARG A O   1 
ATOM   316  C CB  . ARG A 1 44  ? 44.525  28.337 47.682  1.00 40.72  ? 45   ARG A CB  1 
ATOM   317  C CG  . ARG A 1 44  ? 44.262  29.259 48.864  1.00 44.02  ? 45   ARG A CG  1 
ATOM   318  C CD  . ARG A 1 44  ? 45.588  29.664 49.482  1.00 55.71  ? 45   ARG A CD  1 
ATOM   319  N NE  . ARG A 1 44  ? 45.614  31.042 49.963  1.00 66.21  ? 45   ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 44  ? 45.403  31.397 51.227  1.00 79.62  ? 45   ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 44  ? 45.133  30.478 52.143  1.00 81.11  ? 45   ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 44  ? 45.454  32.678 51.571  1.00 85.58  ? 45   ARG A NH2 1 
ATOM   323  N N   . ARG A 1 45  ? 43.559  25.576 45.723  1.00 32.33  ? 46   ARG A N   1 
ATOM   324  C CA  . ARG A 1 45  ? 43.692  24.996 44.392  1.00 33.45  ? 46   ARG A CA  1 
ATOM   325  C C   . ARG A 1 45  ? 42.521  25.435 43.511  1.00 31.53  ? 46   ARG A C   1 
ATOM   326  O O   . ARG A 1 45  ? 41.372  25.477 43.957  1.00 30.47  ? 46   ARG A O   1 
ATOM   327  C CB  . ARG A 1 45  ? 43.767  23.468 44.485  1.00 28.58  ? 46   ARG A CB  1 
ATOM   328  C CG  . ARG A 1 45  ? 43.817  22.757 43.137  1.00 32.09  ? 46   ARG A CG  1 
ATOM   329  C CD  . ARG A 1 45  ? 43.667  21.246 43.281  1.00 31.01  ? 46   ARG A CD  1 
ATOM   330  N NE  . ARG A 1 45  ? 44.853  20.592 43.822  1.00 28.88  ? 46   ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 45  ? 44.903  19.299 44.139  1.00 33.11  ? 46   ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 45  ? 43.826  18.543 43.981  1.00 31.77  ? 46   ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 45  ? 46.018  18.759 44.620  1.00 27.10  ? 46   ARG A NH2 1 
ATOM   334  N N   . PHE A 1 46  ? 42.837  25.795 42.261  1.00 26.04  ? 47   PHE A N   1 
ATOM   335  C CA  . PHE A 1 46  ? 41.902  26.309 41.255  1.00 31.26  ? 47   PHE A CA  1 
ATOM   336  C C   . PHE A 1 46  ? 41.474  27.749 41.502  1.00 34.33  ? 47   PHE A C   1 
ATOM   337  O O   . PHE A 1 46  ? 40.776  28.338 40.671  1.00 30.12  ? 47   PHE A O   1 
ATOM   338  C CB  . PHE A 1 46  ? 40.638  25.458 41.157  1.00 32.22  ? 47   PHE A CB  1 
ATOM   339  C CG  . PHE A 1 46  ? 40.896  24.007 40.985  1.00 33.69  ? 47   PHE A CG  1 
ATOM   340  C CD1 . PHE A 1 46  ? 41.588  23.539 39.879  1.00 35.63  ? 47   PHE A CD1 1 
ATOM   341  C CD2 . PHE A 1 46  ? 40.409  23.101 41.904  1.00 29.88  ? 47   PHE A CD2 1 
ATOM   342  C CE1 . PHE A 1 46  ? 41.820  22.178 39.704  1.00 24.27  ? 47   PHE A CE1 1 
ATOM   343  C CE2 . PHE A 1 46  ? 40.620  21.747 41.738  1.00 28.41  ? 47   PHE A CE2 1 
ATOM   344  C CZ  . PHE A 1 46  ? 41.329  21.281 40.628  1.00 30.04  ? 47   PHE A CZ  1 
ATOM   345  N N   . LEU A 1 47  ? 41.856  28.316 42.615  1.00 25.03  ? 48   LEU A N   1 
ATOM   346  C CA  . LEU A 1 47  ? 41.402  29.666 42.886  1.00 27.57  ? 48   LEU A CA  1 
ATOM   347  C C   . LEU A 1 47  ? 42.392  30.687 42.328  1.00 31.58  ? 48   LEU A C   1 
ATOM   348  O O   . LEU A 1 47  ? 43.560  30.368 42.061  1.00 27.91  ? 48   LEU A O   1 
ATOM   349  C CB  . LEU A 1 47  ? 41.228  29.877 44.389  1.00 27.03  ? 48   LEU A CB  1 
ATOM   350  C CG  . LEU A 1 47  ? 40.050  29.144 45.047  1.00 35.28  ? 48   LEU A CG  1 
ATOM   351  C CD1 . LEU A 1 47  ? 39.832  29.634 46.486  1.00 32.79  ? 48   LEU A CD1 1 
ATOM   352  C CD2 . LEU A 1 47  ? 38.777  29.269 44.202  1.00 34.34  ? 48   LEU A CD2 1 
ATOM   353  N N   . PRO A 1 48  ? 41.945  31.926 42.110  1.00 31.44  ? 49   PRO A N   1 
ATOM   354  C CA  . PRO A 1 48  ? 42.864  32.973 41.661  1.00 25.27  ? 49   PRO A CA  1 
ATOM   355  C C   . PRO A 1 48  ? 43.990  33.159 42.655  1.00 32.09  ? 49   PRO A C   1 
ATOM   356  O O   . PRO A 1 48  ? 43.840  32.875 43.862  1.00 28.43  ? 49   PRO A O   1 
ATOM   357  C CB  . PRO A 1 48  ? 41.964  34.220 41.587  1.00 32.05  ? 49   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 48  ? 40.590  33.679 41.366  1.00 37.95  ? 49   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 48  ? 40.528  32.381 42.117  1.00 30.95  ? 49   PRO A CD  1 
ATOM   360  N N   . PRO A 1 49  ? 45.132  33.655 42.202  1.00 29.29  ? 50   PRO A N   1 
ATOM   361  C CA  . PRO A 1 49  ? 46.260  33.832 43.119  1.00 25.76  ? 50   PRO A CA  1 
ATOM   362  C C   . PRO A 1 49  ? 45.967  34.894 44.169  1.00 34.61  ? 50   PRO A C   1 
ATOM   363  O O   . PRO A 1 49  ? 45.341  35.918 43.890  1.00 36.72  ? 50   PRO A O   1 
ATOM   364  C CB  . PRO A 1 49  ? 47.418  34.287 42.201  1.00 23.98  ? 50   PRO A CB  1 
ATOM   365  C CG  . PRO A 1 49  ? 46.723  34.849 40.965  1.00 21.72  ? 50   PRO A CG  1 
ATOM   366  C CD  . PRO A 1 49  ? 45.491  33.992 40.807  1.00 23.40  ? 50   PRO A CD  1 
ATOM   367  N N   . GLU A 1 50  ? 46.481  34.731 45.365  1.00 32.76  ? 51   GLU A N   1 
ATOM   368  C CA  . GLU A 1 50  ? 46.353  35.720 46.418  1.00 41.30  ? 51   GLU A CA  1 
ATOM   369  C C   . GLU A 1 50  ? 47.697  36.381 46.526  1.00 35.35  ? 51   GLU A C   1 
ATOM   370  O O   . GLU A 1 50  ? 48.677  35.724 46.500  1.00 34.42  ? 51   GLU A O   1 
ATOM   371  C CB  . GLU A 1 50  ? 46.106  35.066 47.747  1.00 49.75  ? 51   GLU A CB  1 
ATOM   372  C CG  . GLU A 1 50  ? 44.668  34.903 48.144  1.00 73.35  ? 51   GLU A CG  1 
ATOM   373  C CD  . GLU A 1 50  ? 44.518  34.057 49.390  1.00 87.19  ? 51   GLU A CD  1 
ATOM   374  O OE1 . GLU A 1 50  ? 43.873  33.009 49.315  1.00 84.14  ? 51   GLU A OE1 1 
ATOM   375  O OE2 . GLU A 1 50  ? 45.058  34.429 50.442  1.00 93.74  ? 51   GLU A OE2 1 
ATOM   376  N N   . PRO A 1 51  ? 47.748  37.682 46.655  1.00 36.85  ? 52   PRO A N   1 
ATOM   377  C CA  . PRO A 1 51  ? 49.046  38.358 46.767  1.00 38.36  ? 52   PRO A CA  1 
ATOM   378  C C   . PRO A 1 51  ? 49.814  37.877 47.988  1.00 33.32  ? 52   PRO A C   1 
ATOM   379  O O   . PRO A 1 51  ? 49.233  37.500 49.009  1.00 35.76  ? 52   PRO A O   1 
ATOM   380  C CB  . PRO A 1 51  ? 48.669  39.841 46.895  1.00 44.68  ? 52   PRO A CB  1 
ATOM   381  C CG  . PRO A 1 51  ? 47.261  39.928 46.379  1.00 44.19  ? 52   PRO A CG  1 
ATOM   382  C CD  . PRO A 1 51  ? 46.621  38.625 46.734  1.00 37.55  ? 52   PRO A CD  1 
ATOM   383  N N   . LYS A 1 52  ? 51.137  37.873 47.861  1.00 33.79  ? 53   LYS A N   1 
ATOM   384  C CA  . LYS A 1 52  ? 51.993  37.414 48.946  1.00 34.10  ? 53   LYS A CA  1 
ATOM   385  C C   . LYS A 1 52  ? 51.886  38.352 50.143  1.00 34.55  ? 53   LYS A C   1 
ATOM   386  O O   . LYS A 1 52  ? 52.004  39.574 50.006  1.00 37.30  ? 53   LYS A O   1 
ATOM   387  C CB  . LYS A 1 52  ? 53.441  37.318 48.468  1.00 34.21  ? 53   LYS A CB  1 
ATOM   388  C CG  . LYS A 1 52  ? 54.423  36.816 49.519  1.00 40.25  ? 53   LYS A CG  1 
ATOM   389  C CD  . LYS A 1 52  ? 54.096  35.399 49.969  1.00 45.07  ? 53   LYS A CD  1 
ATOM   390  C CE  . LYS A 1 52  ? 55.146  34.874 50.938  1.00 50.21  ? 53   LYS A CE  1 
ATOM   391  N NZ  . LYS A 1 52  ? 54.768  33.556 51.533  1.00 59.78  ? 53   LYS A NZ  1 
ATOM   392  N N   . GLN A 1 53  ? 51.638  37.781 51.314  1.00 32.09  ? 54   GLN A N   1 
ATOM   393  C CA  A GLN A 1 53  ? 51.604  38.559 52.541  0.41 36.99  ? 54   GLN A CA  1 
ATOM   394  C CA  B GLN A 1 53  ? 51.603  38.581 52.524  0.59 36.89  ? 54   GLN A CA  1 
ATOM   395  C C   . GLN A 1 53  ? 53.023  38.968 52.939  1.00 36.00  ? 54   GLN A C   1 
ATOM   396  O O   . GLN A 1 53  ? 53.979  38.226 52.697  1.00 34.98  ? 54   GLN A O   1 
ATOM   397  C CB  A GLN A 1 53  ? 50.951  37.747 53.661  0.41 40.73  ? 54   GLN A CB  1 
ATOM   398  C CB  B GLN A 1 53  ? 50.907  37.824 53.653  0.59 40.82  ? 54   GLN A CB  1 
ATOM   399  C CG  A GLN A 1 53  ? 49.541  37.263 53.318  0.41 44.22  ? 54   GLN A CG  1 
ATOM   400  C CG  B GLN A 1 53  ? 49.380  37.811 53.537  0.59 45.79  ? 54   GLN A CG  1 
ATOM   401  C CD  A GLN A 1 53  ? 49.016  36.201 54.275  0.41 51.13  ? 54   GLN A CD  1 
ATOM   402  C CD  B GLN A 1 53  ? 48.756  39.174 53.794  0.59 52.09  ? 54   GLN A CD  1 
ATOM   403  O OE1 A GLN A 1 53  ? 49.648  35.882 55.283  0.41 56.57  ? 54   GLN A OE1 1 
ATOM   404  O OE1 B GLN A 1 53  ? 48.727  39.655 54.929  0.59 58.69  ? 54   GLN A OE1 1 
ATOM   405  N NE2 A GLN A 1 53  ? 47.851  35.648 53.956  0.41 55.35  ? 54   GLN A NE2 1 
ATOM   406  N NE2 B GLN A 1 53  ? 48.254  39.803 52.738  0.59 52.74  ? 54   GLN A NE2 1 
ATOM   407  N N   . PRO A 1 54  ? 53.190  40.144 53.541  1.00 40.30  ? 55   PRO A N   1 
ATOM   408  C CA  . PRO A 1 54  ? 54.531  40.583 53.947  1.00 38.86  ? 55   PRO A CA  1 
ATOM   409  C C   . PRO A 1 54  ? 55.167  39.612 54.932  1.00 40.36  ? 55   PRO A C   1 
ATOM   410  O O   . PRO A 1 54  ? 54.491  38.846 55.622  1.00 37.52  ? 55   PRO A O   1 
ATOM   411  C CB  . PRO A 1 54  ? 54.281  41.946 54.608  1.00 43.67  ? 55   PRO A CB  1 
ATOM   412  C CG  . PRO A 1 54  ? 52.943  42.383 54.109  1.00 48.58  ? 55   PRO A CG  1 
ATOM   413  C CD  . PRO A 1 54  ? 52.154  41.136 53.879  1.00 45.26  ? 55   PRO A CD  1 
ATOM   414  N N   . TRP A 1 55  ? 56.497  39.663 54.995  1.00 36.34  ? 56   TRP A N   1 
ATOM   415  C CA  . TRP A 1 55  ? 57.280  38.810 55.874  1.00 33.90  ? 56   TRP A CA  1 
ATOM   416  C C   . TRP A 1 55  ? 58.310  39.649 56.618  1.00 34.77  ? 56   TRP A C   1 
ATOM   417  O O   . TRP A 1 55  ? 58.772  40.681 56.120  1.00 35.04  ? 56   TRP A O   1 
ATOM   418  C CB  . TRP A 1 55  ? 57.987  37.688 55.087  1.00 29.87  ? 56   TRP A CB  1 
ATOM   419  C CG  . TRP A 1 55  ? 58.978  38.187 54.075  1.00 30.80  ? 56   TRP A CG  1 
ATOM   420  C CD1 . TRP A 1 55  ? 60.298  38.478 54.289  1.00 32.55  ? 56   TRP A CD1 1 
ATOM   421  C CD2 . TRP A 1 55  ? 58.727  38.458 52.687  1.00 31.10  ? 56   TRP A CD2 1 
ATOM   422  N NE1 . TRP A 1 55  ? 60.884  38.910 53.118  1.00 30.50  ? 56   TRP A NE1 1 
ATOM   423  C CE2 . TRP A 1 55  ? 59.941  38.909 52.123  1.00 30.16  ? 56   TRP A CE2 1 
ATOM   424  C CE3 . TRP A 1 55  ? 57.596  38.367 51.871  1.00 30.70  ? 56   TRP A CE3 1 
ATOM   425  C CZ2 . TRP A 1 55  ? 60.055  39.263 50.776  1.00 30.15  ? 56   TRP A CZ2 1 
ATOM   426  C CZ3 . TRP A 1 55  ? 57.711  38.717 50.528  1.00 31.74  ? 56   TRP A CZ3 1 
ATOM   427  C CH2 . TRP A 1 55  ? 58.931  39.163 49.997  1.00 31.99  ? 56   TRP A CH2 1 
ATOM   428  N N   . SER A 1 56  ? 58.660  39.204 57.819  1.00 33.67  ? 57   SER A N   1 
ATOM   429  C CA  . SER A 1 56  ? 59.788  39.774 58.539  1.00 40.96  ? 57   SER A CA  1 
ATOM   430  C C   . SER A 1 56  ? 61.051  38.961 58.258  1.00 40.40  ? 57   SER A C   1 
ATOM   431  O O   . SER A 1 56  ? 60.993  37.800 57.846  1.00 43.49  ? 57   SER A O   1 
ATOM   432  C CB  . SER A 1 56  ? 59.514  39.818 60.045  1.00 41.73  ? 57   SER A CB  1 
ATOM   433  O OG  . SER A 1 56  ? 59.523  38.515 60.593  1.00 47.35  ? 57   SER A OG  1 
ATOM   434  N N   . GLY A 1 57  ? 62.201  39.584 58.487  1.00 41.82  ? 58   GLY A N   1 
ATOM   435  C CA  . GLY A 1 57  ? 63.449  38.923 58.158  1.00 40.31  ? 58   GLY A CA  1 
ATOM   436  C C   . GLY A 1 57  ? 63.737  38.945 56.660  1.00 40.73  ? 58   GLY A C   1 
ATOM   437  O O   . GLY A 1 57  ? 63.106  39.663 55.873  1.00 36.62  ? 58   GLY A O   1 
ATOM   438  N N   . VAL A 1 58  ? 64.711  38.123 56.268  1.00 36.43  ? 59   VAL A N   1 
ATOM   439  C CA  . VAL A 1 58  ? 65.238  38.122 54.907  1.00 37.41  ? 59   VAL A CA  1 
ATOM   440  C C   . VAL A 1 58  ? 64.934  36.782 54.249  1.00 31.81  ? 59   VAL A C   1 
ATOM   441  O O   . VAL A 1 58  ? 65.291  35.723 54.782  1.00 34.28  ? 59   VAL A O   1 
ATOM   442  C CB  . VAL A 1 58  ? 66.747  38.405 54.874  1.00 36.48  ? 59   VAL A CB  1 
ATOM   443  C CG1 . VAL A 1 58  ? 67.197  38.625 53.427  1.00 29.52  ? 59   VAL A CG1 1 
ATOM   444  C CG2 . VAL A 1 58  ? 67.091  39.607 55.760  1.00 32.24  ? 59   VAL A CG2 1 
ATOM   445  N N   . VAL A 1 59  ? 64.284  36.833 53.092  1.00 27.66  ? 60   VAL A N   1 
ATOM   446  C CA  . VAL A 1 59  ? 64.019  35.651 52.279  1.00 31.04  ? 60   VAL A CA  1 
ATOM   447  C C   . VAL A 1 59  ? 65.212  35.420 51.359  1.00 32.21  ? 60   VAL A C   1 
ATOM   448  O O   . VAL A 1 59  ? 65.615  36.320 50.613  1.00 32.16  ? 60   VAL A O   1 
ATOM   449  C CB  . VAL A 1 59  ? 62.722  35.815 51.473  1.00 31.20  ? 60   VAL A CB  1 
ATOM   450  C CG1 . VAL A 1 59  ? 62.665  34.810 50.301  1.00 24.71  ? 60   VAL A CG1 1 
ATOM   451  C CG2 . VAL A 1 59  ? 61.518  35.660 52.393  1.00 30.14  ? 60   VAL A CG2 1 
ATOM   452  N N   . ASP A 1 60  ? 65.782  34.217 51.416  1.00 28.49  ? 61   ASP A N   1 
ATOM   453  C CA  . ASP A 1 60  ? 66.859  33.836 50.504  1.00 30.62  ? 61   ASP A CA  1 
ATOM   454  C C   . ASP A 1 60  ? 66.265  33.524 49.138  1.00 30.72  ? 61   ASP A C   1 
ATOM   455  O O   . ASP A 1 60  ? 65.631  32.479 48.950  1.00 28.88  ? 61   ASP A O   1 
ATOM   456  C CB  . ASP A 1 60  ? 67.643  32.642 51.040  1.00 26.13  ? 61   ASP A CB  1 
ATOM   457  C CG  . ASP A 1 60  ? 68.500  32.998 52.234  1.00 41.85  ? 61   ASP A CG  1 
ATOM   458  O OD1 . ASP A 1 60  ? 69.368  33.883 52.087  1.00 41.23  ? 61   ASP A OD1 1 
ATOM   459  O OD2 . ASP A 1 60  ? 68.307  32.398 53.315  1.00 45.46  ? 61   ASP A OD2 1 
ATOM   460  N N   . ALA A 1 61  ? 66.458  34.438 48.192  1.00 26.76  ? 62   ALA A N   1 
ATOM   461  C CA  . ALA A 1 61  ? 66.101  34.204 46.796  1.00 25.12  ? 62   ALA A CA  1 
ATOM   462  C C   . ALA A 1 61  ? 67.352  33.780 46.025  1.00 27.30  ? 62   ALA A C   1 
ATOM   463  O O   . ALA A 1 61  ? 67.888  34.505 45.188  1.00 26.78  ? 62   ALA A O   1 
ATOM   464  C CB  . ALA A 1 61  ? 65.464  35.453 46.192  1.00 24.82  ? 62   ALA A CB  1 
ATOM   465  N N   . THR A 1 62  ? 67.811  32.564 46.327  1.00 25.81  ? 63   THR A N   1 
ATOM   466  C CA  . THR A 1 62  ? 69.135  32.119 45.914  1.00 27.95  ? 63   THR A CA  1 
ATOM   467  C C   . THR A 1 62  ? 69.127  30.864 45.046  1.00 25.18  ? 63   THR A C   1 
ATOM   468  O O   . THR A 1 62  ? 70.206  30.339 44.741  1.00 29.17  ? 63   THR A O   1 
ATOM   469  C CB  . THR A 1 62  ? 70.006  31.878 47.147  1.00 31.06  ? 63   THR A CB  1 
ATOM   470  O OG1 . THR A 1 62  ? 69.401  30.863 47.954  1.00 30.01  ? 63   THR A OG1 1 
ATOM   471  C CG2 . THR A 1 62  ? 70.144  33.161 47.958  1.00 27.22  ? 63   THR A CG2 1 
ATOM   472  N N   . THR A 1 63  ? 67.958  30.360 44.655  1.00 23.88  ? 64   THR A N   1 
ATOM   473  C CA  . THR A 1 63  ? 67.876  29.237 43.727  1.00 24.20  ? 64   THR A CA  1 
ATOM   474  C C   . THR A 1 63  ? 66.441  29.138 43.232  1.00 24.13  ? 64   THR A C   1 
ATOM   475  O O   . THR A 1 63  ? 65.513  29.652 43.865  1.00 26.25  ? 64   THR A O   1 
ATOM   476  C CB  . THR A 1 63  ? 68.334  27.920 44.379  1.00 34.10  ? 64   THR A CB  1 
ATOM   477  O OG1 . THR A 1 63  ? 68.691  26.971 43.368  1.00 40.55  ? 64   THR A OG1 1 
ATOM   478  C CG2 . THR A 1 63  ? 67.243  27.325 45.238  1.00 32.23  ? 64   THR A CG2 1 
ATOM   479  N N   . PHE A 1 64  ? 66.274  28.500 42.074  1.00 24.36  ? 65   PHE A N   1 
ATOM   480  C CA  . PHE A 1 64  ? 64.949  28.324 41.498  1.00 25.57  ? 65   PHE A CA  1 
ATOM   481  C C   . PHE A 1 64  ? 64.062  27.519 42.438  1.00 26.10  ? 65   PHE A C   1 
ATOM   482  O O   . PHE A 1 64  ? 64.503  26.540 43.045  1.00 23.54  ? 65   PHE A O   1 
ATOM   483  C CB  . PHE A 1 64  ? 65.034  27.603 40.151  1.00 24.81  ? 65   PHE A CB  1 
ATOM   484  C CG  . PHE A 1 64  ? 65.613  28.428 39.040  1.00 23.65  ? 65   PHE A CG  1 
ATOM   485  C CD1 . PHE A 1 64  ? 64.974  29.578 38.600  1.00 18.92  ? 65   PHE A CD1 1 
ATOM   486  C CD2 . PHE A 1 64  ? 66.772  28.021 38.397  1.00 22.31  ? 65   PHE A CD2 1 
ATOM   487  C CE1 . PHE A 1 64  ? 65.498  30.329 37.555  1.00 24.03  ? 65   PHE A CE1 1 
ATOM   488  C CE2 . PHE A 1 64  ? 67.306  28.768 37.348  1.00 24.06  ? 65   PHE A CE2 1 
ATOM   489  C CZ  . PHE A 1 64  ? 66.670  29.922 36.929  1.00 24.64  ? 65   PHE A CZ  1 
ATOM   490  N N   . GLN A 1 65  ? 62.800  27.923 42.538  1.00 27.96  ? 66   GLN A N   1 
ATOM   491  C CA  . GLN A 1 65  ? 61.823  27.182 43.315  1.00 26.17  ? 66   GLN A CA  1 
ATOM   492  C C   . GLN A 1 65  ? 61.189  26.079 42.466  1.00 25.13  ? 66   GLN A C   1 
ATOM   493  O O   . GLN A 1 65  ? 61.523  25.886 41.292  1.00 25.55  ? 66   GLN A O   1 
ATOM   494  C CB  . GLN A 1 65  ? 60.760  28.127 43.877  1.00 22.28  ? 66   GLN A CB  1 
ATOM   495  C CG  . GLN A 1 65  ? 60.991  28.513 45.329  1.00 20.72  ? 66   GLN A CG  1 
ATOM   496  C CD  . GLN A 1 65  ? 60.465  27.456 46.278  1.00 29.49  ? 66   GLN A CD  1 
ATOM   497  O OE1 . GLN A 1 65  ? 59.990  26.404 45.845  1.00 33.41  ? 66   GLN A OE1 1 
ATOM   498  N NE2 . GLN A 1 65  ? 60.528  27.734 47.572  1.00 25.57  ? 66   GLN A NE2 1 
ATOM   499  N N   . SER A 1 66  ? 60.236  25.370 43.068  1.00 25.70  ? 67   SER A N   1 
ATOM   500  C CA  . SER A 1 66  ? 59.661  24.170 42.475  1.00 25.76  ? 67   SER A CA  1 
ATOM   501  C C   . SER A 1 66  ? 58.957  24.460 41.151  1.00 25.14  ? 67   SER A C   1 
ATOM   502  O O   . SER A 1 66  ? 58.459  25.561 40.905  1.00 23.97  ? 67   SER A O   1 
ATOM   503  C CB  . SER A 1 66  ? 58.665  23.534 43.443  1.00 25.40  ? 67   SER A CB  1 
ATOM   504  O OG  . SER A 1 66  ? 59.283  23.211 44.675  1.00 27.54  ? 67   SER A OG  1 
ATOM   505  N N   . VAL A 1 67  ? 58.915  23.442 40.301  1.00 23.68  ? 68   VAL A N   1 
ATOM   506  C CA  . VAL A 1 67  ? 58.115  23.467 39.082  1.00 22.31  ? 68   VAL A CA  1 
ATOM   507  C C   . VAL A 1 67  ? 56.653  23.222 39.439  1.00 24.54  ? 68   VAL A C   1 
ATOM   508  O O   . VAL A 1 67  ? 56.340  22.355 40.265  1.00 28.01  ? 68   VAL A O   1 
ATOM   509  C CB  . VAL A 1 67  ? 58.638  22.406 38.095  1.00 26.96  ? 68   VAL A CB  1 
ATOM   510  C CG1 . VAL A 1 67  ? 57.774  22.337 36.859  1.00 27.84  ? 68   VAL A CG1 1 
ATOM   511  C CG2 . VAL A 1 67  ? 60.093  22.687 37.736  1.00 26.78  ? 68   VAL A CG2 1 
ATOM   512  N N   . CYS A 1 68  ? 55.749  23.990 38.825  1.00 20.78  ? 69   CYS A N   1 
ATOM   513  C CA  . CYS A 1 68  ? 54.323  23.771 39.031  1.00 24.33  ? 69   CYS A CA  1 
ATOM   514  C C   . CYS A 1 68  ? 53.946  22.372 38.563  1.00 27.23  ? 69   CYS A C   1 
ATOM   515  O O   . CYS A 1 68  ? 54.417  21.903 37.522  1.00 25.05  ? 69   CYS A O   1 
ATOM   516  C CB  . CYS A 1 68  ? 53.498  24.824 38.278  1.00 24.57  ? 69   CYS A CB  1 
ATOM   517  S SG  . CYS A 1 68  ? 53.609  26.539 38.912  1.00 26.74  ? 69   CYS A SG  1 
ATOM   518  N N   . TYR A 1 69  ? 53.094  21.706 39.343  1.00 22.89  ? 70   TYR A N   1 
ATOM   519  C CA  . TYR A 1 69  ? 52.774  20.306 39.092  1.00 24.51  ? 70   TYR A CA  1 
ATOM   520  C C   . TYR A 1 69  ? 52.301  20.100 37.657  1.00 26.60  ? 70   TYR A C   1 
ATOM   521  O O   . TYR A 1 69  ? 51.450  20.840 37.153  1.00 20.02  ? 70   TYR A O   1 
ATOM   522  C CB  . TYR A 1 69  ? 51.712  19.817 40.083  1.00 27.94  ? 70   TYR A CB  1 
ATOM   523  C CG  . TYR A 1 69  ? 52.012  18.419 40.550  1.00 29.12  ? 70   TYR A CG  1 
ATOM   524  C CD1 . TYR A 1 69  ? 52.599  18.181 41.786  1.00 33.61  ? 70   TYR A CD1 1 
ATOM   525  C CD2 . TYR A 1 69  ? 51.767  17.339 39.720  1.00 32.35  ? 70   TYR A CD2 1 
ATOM   526  C CE1 . TYR A 1 69  ? 52.903  16.889 42.190  1.00 40.54  ? 70   TYR A CE1 1 
ATOM   527  C CE2 . TYR A 1 69  ? 52.066  16.059 40.108  1.00 42.01  ? 70   TYR A CE2 1 
ATOM   528  C CZ  . TYR A 1 69  ? 52.632  15.832 41.339  1.00 44.60  ? 70   TYR A CZ  1 
ATOM   529  O OH  . TYR A 1 69  ? 52.918  14.537 41.705  1.00 56.47  ? 70   TYR A OH  1 
ATOM   530  N N   . GLN A 1 70  ? 52.871  19.097 36.991  1.00 24.64  ? 71   GLN A N   1 
ATOM   531  C CA  . GLN A 1 70  ? 52.621  18.970 35.565  1.00 23.03  ? 71   GLN A CA  1 
ATOM   532  C C   . GLN A 1 70  ? 52.993  17.585 35.063  1.00 25.83  ? 71   GLN A C   1 
ATOM   533  O O   . GLN A 1 70  ? 53.805  16.867 35.657  1.00 26.53  ? 71   GLN A O   1 
ATOM   534  C CB  . GLN A 1 70  ? 53.395  20.024 34.771  1.00 20.15  ? 71   GLN A CB  1 
ATOM   535  C CG  . GLN A 1 70  ? 54.914  19.895 34.840  1.00 21.40  ? 71   GLN A CG  1 
ATOM   536  C CD  . GLN A 1 70  ? 55.598  21.116 34.240  1.00 26.79  ? 71   GLN A CD  1 
ATOM   537  O OE1 . GLN A 1 70  ? 56.305  21.021 33.238  1.00 25.07  ? 71   GLN A OE1 1 
ATOM   538  N NE2 . GLN A 1 70  ? 55.351  22.279 34.831  1.00 24.09  ? 71   GLN A NE2 1 
ATOM   539  N N   . TYR A 1 71  ? 52.384  17.241 33.935  1.00 24.03  ? 72   TYR A N   1 
ATOM   540  C CA  . TYR A 1 71  ? 52.752  16.054 33.182  1.00 26.85  ? 72   TYR A CA  1 
ATOM   541  C C   . TYR A 1 71  ? 54.226  16.093 32.784  1.00 26.73  ? 72   TYR A C   1 
ATOM   542  O O   . TYR A 1 71  ? 54.764  17.140 32.414  1.00 30.15  ? 72   TYR A O   1 
ATOM   543  C CB  . TYR A 1 71  ? 51.858  15.964 31.948  1.00 27.49  ? 72   TYR A CB  1 
ATOM   544  C CG  . TYR A 1 71  ? 52.197  14.844 31.011  1.00 27.23  ? 72   TYR A CG  1 
ATOM   545  C CD1 . TYR A 1 71  ? 51.821  13.537 31.297  1.00 25.19  ? 72   TYR A CD1 1 
ATOM   546  C CD2 . TYR A 1 71  ? 52.880  15.095 29.827  1.00 25.50  ? 72   TYR A CD2 1 
ATOM   547  C CE1 . TYR A 1 71  ? 52.126  12.507 30.430  1.00 33.41  ? 72   TYR A CE1 1 
ATOM   548  C CE2 . TYR A 1 71  ? 53.190  14.075 28.956  1.00 32.38  ? 72   TYR A CE2 1 
ATOM   549  C CZ  . TYR A 1 71  ? 52.812  12.785 29.261  1.00 35.59  ? 72   TYR A CZ  1 
ATOM   550  O OH  . TYR A 1 71  ? 53.124  11.768 28.390  1.00 40.90  ? 72   TYR A OH  1 
ATOM   551  N N   . VAL A 1 72  ? 54.886  14.942 32.873  1.00 25.76  ? 73   VAL A N   1 
ATOM   552  C CA  . VAL A 1 72  ? 56.295  14.802 32.517  1.00 26.79  ? 73   VAL A CA  1 
ATOM   553  C C   . VAL A 1 72  ? 56.374  13.935 31.266  1.00 29.04  ? 73   VAL A C   1 
ATOM   554  O O   . VAL A 1 72  ? 55.877  12.802 31.254  1.00 32.93  ? 73   VAL A O   1 
ATOM   555  C CB  . VAL A 1 72  ? 57.112  14.196 33.669  1.00 31.95  ? 73   VAL A CB  1 
ATOM   556  C CG1 . VAL A 1 72  ? 58.525  13.858 33.207  1.00 28.00  ? 73   VAL A CG1 1 
ATOM   557  C CG2 . VAL A 1 72  ? 57.152  15.160 34.850  1.00 27.73  ? 73   VAL A CG2 1 
ATOM   558  N N   . ASP A 1 73  ? 56.996  14.465 30.217  1.00 28.96  ? 74   ASP A N   1 
ATOM   559  C CA  . ASP A 1 73  ? 57.008  13.783 28.929  1.00 29.35  ? 74   ASP A CA  1 
ATOM   560  C C   . ASP A 1 73  ? 57.868  12.524 28.990  1.00 31.28  ? 74   ASP A C   1 
ATOM   561  O O   . ASP A 1 73  ? 58.977  12.535 29.528  1.00 37.68  ? 74   ASP A O   1 
ATOM   562  C CB  . ASP A 1 73  ? 57.527  14.722 27.842  1.00 34.61  ? 74   ASP A CB  1 
ATOM   563  C CG  . ASP A 1 73  ? 57.422  14.122 26.454  1.00 44.05  ? 74   ASP A CG  1 
ATOM   564  O OD1 . ASP A 1 73  ? 58.429  13.582 25.954  1.00 48.72  ? 74   ASP A OD1 1 
ATOM   565  O OD2 . ASP A 1 73  ? 56.330  14.194 25.862  1.00 49.33  ? 74   ASP A OD2 1 
ATOM   566  N N   . THR A 1 74  ? 57.342  11.427 28.437  1.00 33.73  ? 75   THR A N   1 
ATOM   567  C CA  . THR A 1 74  ? 58.042  10.146 28.442  1.00 40.13  ? 75   THR A CA  1 
ATOM   568  C C   . THR A 1 74  ? 58.118  9.525  27.049  1.00 41.89  ? 75   THR A C   1 
ATOM   569  O O   . THR A 1 74  ? 58.366  8.319  26.928  1.00 43.14  ? 75   THR A O   1 
ATOM   570  C CB  . THR A 1 74  ? 57.370  9.161  29.405  1.00 43.45  ? 75   THR A CB  1 
ATOM   571  O OG1 . THR A 1 74  ? 55.987  9.024  29.056  1.00 44.96  ? 75   THR A OG1 1 
ATOM   572  C CG2 . THR A 1 74  ? 57.487  9.650  30.847  1.00 39.27  ? 75   THR A CG2 1 
ATOM   573  N N   . LEU A 1 75  ? 57.907  10.318 25.996  1.00 33.90  ? 76   LEU A N   1 
ATOM   574  C CA  . LEU A 1 75  ? 57.935  9.771  24.642  1.00 33.90  ? 76   LEU A CA  1 
ATOM   575  C C   . LEU A 1 75  ? 59.302  9.176  24.319  1.00 31.98  ? 76   LEU A C   1 
ATOM   576  O O   . LEU A 1 75  ? 59.398  8.067  23.780  1.00 33.77  ? 76   LEU A O   1 
ATOM   577  C CB  . LEU A 1 75  ? 57.563  10.858 23.630  1.00 37.55  ? 76   LEU A CB  1 
ATOM   578  C CG  . LEU A 1 75  ? 57.587  10.462 22.149  1.00 43.09  ? 76   LEU A CG  1 
ATOM   579  C CD1 . LEU A 1 75  ? 56.634  9.311  21.891  1.00 38.36  ? 76   LEU A CD1 1 
ATOM   580  C CD2 . LEU A 1 75  ? 57.243  11.648 21.257  1.00 41.32  ? 76   LEU A CD2 1 
ATOM   581  N N   . TYR A 1 76  ? 60.374  9.897  24.647  1.00 29.65  ? 77   TYR A N   1 
ATOM   582  C CA  . TYR A 1 76  ? 61.739  9.456  24.359  1.00 38.38  ? 77   TYR A CA  1 
ATOM   583  C C   . TYR A 1 76  ? 62.564  9.606  25.631  1.00 40.92  ? 77   TYR A C   1 
ATOM   584  O O   . TYR A 1 76  ? 63.235  10.628 25.835  1.00 36.56  ? 77   TYR A O   1 
ATOM   585  C CB  . TYR A 1 76  ? 62.348  10.247 23.204  1.00 35.64  ? 77   TYR A CB  1 
ATOM   586  C CG  . TYR A 1 76  ? 61.624  10.079 21.889  1.00 36.96  ? 77   TYR A CG  1 
ATOM   587  C CD1 . TYR A 1 76  ? 61.563  8.839  21.259  1.00 40.64  ? 77   TYR A CD1 1 
ATOM   588  C CD2 . TYR A 1 76  ? 61.017  11.163 21.265  1.00 32.73  ? 77   TYR A CD2 1 
ATOM   589  C CE1 . TYR A 1 76  ? 60.905  8.683  20.050  1.00 41.97  ? 77   TYR A CE1 1 
ATOM   590  C CE2 . TYR A 1 76  ? 60.364  11.019 20.054  1.00 34.38  ? 77   TYR A CE2 1 
ATOM   591  C CZ  . TYR A 1 76  ? 60.307  9.779  19.453  1.00 39.30  ? 77   TYR A CZ  1 
ATOM   592  O OH  . TYR A 1 76  ? 59.656  9.639  18.249  1.00 39.29  ? 77   TYR A OH  1 
ATOM   593  N N   . PRO A 1 77  ? 62.539  8.601  26.507  1.00 42.01  ? 78   PRO A N   1 
ATOM   594  C CA  . PRO A 1 77  ? 63.169  8.745  27.830  1.00 45.19  ? 78   PRO A CA  1 
ATOM   595  C C   . PRO A 1 77  ? 64.679  8.903  27.721  1.00 42.27  ? 78   PRO A C   1 
ATOM   596  O O   . PRO A 1 77  ? 65.352  8.120  27.048  1.00 45.58  ? 78   PRO A O   1 
ATOM   597  C CB  . PRO A 1 77  ? 62.791  7.442  28.548  1.00 46.75  ? 78   PRO A CB  1 
ATOM   598  C CG  . PRO A 1 77  ? 61.586  6.933  27.807  1.00 50.04  ? 78   PRO A CG  1 
ATOM   599  C CD  . PRO A 1 77  ? 61.802  7.333  26.378  1.00 43.22  ? 78   PRO A CD  1 
ATOM   600  N N   . GLY A 1 78  ? 65.209  9.919  28.403  1.00 42.54  ? 79   GLY A N   1 
ATOM   601  C CA  . GLY A 1 78  ? 66.629  10.199 28.377  1.00 48.55  ? 79   GLY A CA  1 
ATOM   602  C C   . GLY A 1 78  ? 67.115  10.930 27.146  1.00 48.25  ? 79   GLY A C   1 
ATOM   603  O O   . GLY A 1 78  ? 68.322  11.182 27.029  1.00 47.28  ? 79   GLY A O   1 
ATOM   604  N N   . PHE A 1 79  ? 66.218  11.276 26.228  1.00 44.96  ? 80   PHE A N   1 
ATOM   605  C CA  . PHE A 1 79  ? 66.591  11.965 25.003  1.00 32.48  ? 80   PHE A CA  1 
ATOM   606  C C   . PHE A 1 79  ? 66.663  13.468 25.254  1.00 30.63  ? 80   PHE A C   1 
ATOM   607  O O   . PHE A 1 79  ? 65.737  14.059 25.818  1.00 37.47  ? 80   PHE A O   1 
ATOM   608  C CB  . PHE A 1 79  ? 65.580  11.623 23.907  1.00 36.16  ? 80   PHE A CB  1 
ATOM   609  C CG  . PHE A 1 79  ? 65.709  12.452 22.660  1.00 34.55  ? 80   PHE A CG  1 
ATOM   610  C CD1 . PHE A 1 79  ? 66.823  12.338 21.838  1.00 33.08  ? 80   PHE A CD1 1 
ATOM   611  C CD2 . PHE A 1 79  ? 64.684  13.303 22.282  1.00 34.83  ? 80   PHE A CD2 1 
ATOM   612  C CE1 . PHE A 1 79  ? 66.931  13.096 20.673  1.00 31.89  ? 80   PHE A CE1 1 
ATOM   613  C CE2 . PHE A 1 79  ? 64.771  14.056 21.116  1.00 34.77  ? 80   PHE A CE2 1 
ATOM   614  C CZ  . PHE A 1 79  ? 65.895  13.961 20.313  1.00 29.38  ? 80   PHE A CZ  1 
ATOM   615  N N   . GLU A 1 80  ? 67.775  14.080 24.844  1.00 33.97  ? 81   GLU A N   1 
ATOM   616  C CA  . GLU A 1 80  ? 68.011  15.492 25.139  1.00 34.48  ? 81   GLU A CA  1 
ATOM   617  C C   . GLU A 1 80  ? 66.919  16.389 24.562  1.00 33.74  ? 81   GLU A C   1 
ATOM   618  O O   . GLU A 1 80  ? 66.533  17.385 25.185  1.00 31.29  ? 81   GLU A O   1 
ATOM   619  C CB  . GLU A 1 80  ? 69.380  15.907 24.598  1.00 46.86  ? 81   GLU A CB  1 
ATOM   620  C CG  . GLU A 1 80  ? 69.647  17.405 24.606  1.00 59.59  ? 81   GLU A CG  1 
ATOM   621  C CD  . GLU A 1 80  ? 71.028  17.746 24.072  1.00 76.44  ? 81   GLU A CD  1 
ATOM   622  O OE1 . GLU A 1 80  ? 71.186  17.846 22.834  1.00 78.01  ? 81   GLU A OE1 1 
ATOM   623  O OE2 . GLU A 1 80  ? 71.958  17.909 24.891  1.00 84.31  ? 81   GLU A OE2 1 
ATOM   624  N N   . GLY A 1 81  ? 66.406  16.051 23.374  1.00 30.76  ? 82   GLY A N   1 
ATOM   625  C CA  . GLY A 1 81  ? 65.448  16.926 22.717  1.00 30.19  ? 82   GLY A CA  1 
ATOM   626  C C   . GLY A 1 81  ? 64.123  17.046 23.444  1.00 32.61  ? 82   GLY A C   1 
ATOM   627  O O   . GLY A 1 81  ? 63.410  18.040 23.275  1.00 30.42  ? 82   GLY A O   1 
ATOM   628  N N   . THR A 1 82  ? 63.763  16.044 24.245  1.00 32.23  ? 83   THR A N   1 
ATOM   629  C CA  . THR A 1 82  ? 62.568  16.129 25.080  1.00 29.77  ? 83   THR A CA  1 
ATOM   630  C C   . THR A 1 82  ? 62.884  16.431 26.539  1.00 29.16  ? 83   THR A C   1 
ATOM   631  O O   . THR A 1 82  ? 62.150  17.193 27.173  1.00 30.45  ? 83   THR A O   1 
ATOM   632  C CB  . THR A 1 82  ? 61.752  14.833 24.998  1.00 30.87  ? 83   THR A CB  1 
ATOM   633  O OG1 . THR A 1 82  ? 62.618  13.706 25.192  1.00 36.90  ? 83   THR A OG1 1 
ATOM   634  C CG2 . THR A 1 82  ? 61.060  14.717 23.644  1.00 31.68  ? 83   THR A CG2 1 
ATOM   635  N N   . GLU A 1 83  ? 63.964  15.859 27.086  1.00 28.48  ? 84   GLU A N   1 
ATOM   636  C CA  . GLU A 1 83  ? 64.277  16.076 28.496  1.00 31.07  ? 84   GLU A CA  1 
ATOM   637  C C   . GLU A 1 83  ? 64.554  17.543 28.800  1.00 34.97  ? 84   GLU A C   1 
ATOM   638  O O   . GLU A 1 83  ? 64.292  18.000 29.919  1.00 34.16  ? 84   GLU A O   1 
ATOM   639  C CB  . GLU A 1 83  ? 65.475  15.221 28.928  1.00 30.93  ? 84   GLU A CB  1 
ATOM   640  C CG  . GLU A 1 83  ? 65.258  13.710 28.883  1.00 35.17  ? 84   GLU A CG  1 
ATOM   641  C CD  . GLU A 1 83  ? 64.139  13.213 29.792  1.00 43.59  ? 84   GLU A CD  1 
ATOM   642  O OE1 . GLU A 1 83  ? 63.784  12.019 29.676  1.00 46.92  ? 84   GLU A OE1 1 
ATOM   643  O OE2 . GLU A 1 83  ? 63.613  13.994 30.618  1.00 46.76  ? 84   GLU A OE2 1 
ATOM   644  N N   . MET A 1 84  ? 65.068  18.297 27.819  1.00 27.11  ? 85   MET A N   1 
ATOM   645  C CA  . MET A 1 84  ? 65.376  19.709 28.037  1.00 24.29  ? 85   MET A CA  1 
ATOM   646  C C   . MET A 1 84  ? 64.141  20.533 28.371  1.00 25.17  ? 85   MET A C   1 
ATOM   647  O O   . MET A 1 84  ? 64.276  21.650 28.886  1.00 24.61  ? 85   MET A O   1 
ATOM   648  C CB  . MET A 1 84  ? 66.051  20.307 26.801  1.00 29.35  ? 85   MET A CB  1 
ATOM   649  C CG  . MET A 1 84  ? 65.165  20.309 25.552  1.00 31.11  ? 85   MET A CG  1 
ATOM   650  S SD  . MET A 1 84  ? 66.057  20.945 24.119  1.00 34.85  ? 85   MET A SD  1 
ATOM   651  C CE  . MET A 1 84  ? 66.162  22.678 24.571  1.00 25.96  ? 85   MET A CE  1 
ATOM   652  N N   . TRP A 1 85  ? 62.944  20.021 28.079  1.00 24.31  ? 86   TRP A N   1 
ATOM   653  C CA  . TRP A 1 85  ? 61.704  20.721 28.384  1.00 23.09  ? 86   TRP A CA  1 
ATOM   654  C C   . TRP A 1 85  ? 61.026  20.194 29.641  1.00 25.40  ? 86   TRP A C   1 
ATOM   655  O O   . TRP A 1 85  ? 60.041  20.789 30.094  1.00 22.69  ? 86   TRP A O   1 
ATOM   656  C CB  . TRP A 1 85  ? 60.731  20.622 27.196  1.00 23.92  ? 86   TRP A CB  1 
ATOM   657  C CG  . TRP A 1 85  ? 61.345  20.999 25.869  1.00 24.80  ? 86   TRP A CG  1 
ATOM   658  C CD1 . TRP A 1 85  ? 61.637  20.162 24.830  1.00 25.92  ? 86   TRP A CD1 1 
ATOM   659  C CD2 . TRP A 1 85  ? 61.739  22.314 25.447  1.00 29.67  ? 86   TRP A CD2 1 
ATOM   660  N NE1 . TRP A 1 85  ? 62.186  20.875 23.783  1.00 27.08  ? 86   TRP A NE1 1 
ATOM   661  C CE2 . TRP A 1 85  ? 62.258  22.197 24.139  1.00 27.72  ? 86   TRP A CE2 1 
ATOM   662  C CE3 . TRP A 1 85  ? 61.697  23.578 26.048  1.00 25.34  ? 86   TRP A CE3 1 
ATOM   663  C CZ2 . TRP A 1 85  ? 62.736  23.294 23.424  1.00 24.26  ? 86   TRP A CZ2 1 
ATOM   664  C CZ3 . TRP A 1 85  ? 62.171  24.667 25.337  1.00 28.30  ? 86   TRP A CZ3 1 
ATOM   665  C CH2 . TRP A 1 85  ? 62.687  24.517 24.037  1.00 29.02  ? 86   TRP A CH2 1 
ATOM   666  N N   . ASN A 1 86  ? 61.533  19.113 30.212  1.00 24.49  ? 87   ASN A N   1 
ATOM   667  C CA  . ASN A 1 86  ? 60.917  18.481 31.364  1.00 29.26  ? 87   ASN A CA  1 
ATOM   668  C C   . ASN A 1 86  ? 61.332  19.175 32.659  1.00 30.07  ? 87   ASN A C   1 
ATOM   669  O O   . ASN A 1 86  ? 62.334  19.894 32.696  1.00 22.87  ? 87   ASN A O   1 
ATOM   670  C CB  . ASN A 1 86  ? 61.296  17.004 31.400  1.00 26.12  ? 87   ASN A CB  1 
ATOM   671  C CG  . ASN A 1 86  ? 60.312  16.137 30.631  1.00 29.40  ? 87   ASN A CG  1 
ATOM   672  O OD1 . ASN A 1 86  ? 59.179  16.548 30.378  1.00 29.92  ? 87   ASN A OD1 1 
ATOM   673  N ND2 . ASN A 1 86  ? 60.731  14.928 30.277  1.00 27.07  ? 87   ASN A ND2 1 
ATOM   674  N N   . PRO A 1 87  ? 60.567  18.985 33.734  1.00 29.46  ? 88   PRO A N   1 
ATOM   675  C CA  . PRO A 1 87  ? 60.903  19.639 35.010  1.00 26.79  ? 88   PRO A CA  1 
ATOM   676  C C   . PRO A 1 87  ? 62.323  19.324 35.460  1.00 31.22  ? 88   PRO A C   1 
ATOM   677  O O   . PRO A 1 87  ? 62.763  18.173 35.435  1.00 27.07  ? 88   PRO A O   1 
ATOM   678  C CB  . PRO A 1 87  ? 59.868  19.067 35.983  1.00 23.29  ? 88   PRO A CB  1 
ATOM   679  C CG  . PRO A 1 87  ? 58.683  18.743 35.102  1.00 25.80  ? 88   PRO A CG  1 
ATOM   680  C CD  . PRO A 1 87  ? 59.271  18.281 33.791  1.00 24.66  ? 88   PRO A CD  1 
ATOM   681  N N   . ASN A 1 88  ? 63.043  20.370 35.866  1.00 25.24  ? 89   ASN A N   1 
ATOM   682  C CA  . ASN A 1 88  ? 64.382  20.227 36.425  1.00 28.38  ? 89   ASN A CA  1 
ATOM   683  C C   . ASN A 1 88  ? 64.423  20.660 37.889  1.00 30.59  ? 89   ASN A C   1 
ATOM   684  O O   . ASN A 1 88  ? 65.500  20.911 38.436  1.00 33.06  ? 89   ASN A O   1 
ATOM   685  C CB  . ASN A 1 88  ? 65.399  21.012 35.589  1.00 26.19  ? 89   ASN A CB  1 
ATOM   686  C CG  . ASN A 1 88  ? 65.188  22.516 35.669  1.00 31.09  ? 89   ASN A CG  1 
ATOM   687  O OD1 . ASN A 1 88  ? 64.109  22.993 36.032  1.00 25.25  ? 89   ASN A OD1 1 
ATOM   688  N ND2 . ASN A 1 88  ? 66.222  23.271 35.326  1.00 35.78  ? 89   ASN A ND2 1 
ATOM   689  N N   . ARG A 1 89  ? 63.257  20.784 38.515  1.00 30.94  ? 90   ARG A N   1 
ATOM   690  C CA  . ARG A 1 89  ? 63.118  20.925 39.956  1.00 31.48  ? 90   ARG A CA  1 
ATOM   691  C C   . ARG A 1 89  ? 61.948  20.049 40.379  1.00 33.94  ? 90   ARG A C   1 
ATOM   692  O O   . ARG A 1 89  ? 61.174  19.576 39.539  1.00 29.88  ? 90   ARG A O   1 
ATOM   693  C CB  . ARG A 1 89  ? 62.881  22.384 40.371  1.00 30.56  ? 90   ARG A CB  1 
ATOM   694  C CG  . ARG A 1 89  ? 64.057  23.319 40.124  1.00 36.71  ? 90   ARG A CG  1 
ATOM   695  C CD  . ARG A 1 89  ? 65.244  22.941 40.998  1.00 45.35  ? 90   ARG A CD  1 
ATOM   696  N NE  . ARG A 1 89  ? 66.193  24.041 41.139  1.00 50.74  ? 90   ARG A NE  1 
ATOM   697  C CZ  . ARG A 1 89  ? 67.218  24.253 40.321  1.00 51.31  ? 90   ARG A CZ  1 
ATOM   698  N NH1 . ARG A 1 89  ? 67.431  23.439 39.294  1.00 41.75  ? 90   ARG A NH1 1 
ATOM   699  N NH2 . ARG A 1 89  ? 68.029  25.282 40.530  1.00 55.46  ? 90   ARG A NH2 1 
ATOM   700  N N   . GLU A 1 90  ? 61.811  19.841 41.688  1.00 28.17  ? 91   GLU A N   1 
ATOM   701  C CA  . GLU A 1 90  ? 60.712  19.029 42.192  1.00 28.90  ? 91   GLU A CA  1 
ATOM   702  C C   . GLU A 1 90  ? 59.376  19.640 41.785  1.00 24.39  ? 91   GLU A C   1 
ATOM   703  O O   . GLU A 1 90  ? 59.235  20.861 41.666  1.00 27.91  ? 91   GLU A O   1 
ATOM   704  C CB  . GLU A 1 90  ? 60.777  18.892 43.721  1.00 28.97  ? 91   GLU A CB  1 
ATOM   705  C CG  . GLU A 1 90  ? 60.222  20.100 44.473  1.00 50.50  ? 91   GLU A CG  1 
ATOM   706  C CD  . GLU A 1 90  ? 59.663  19.754 45.848  1.00 68.37  ? 91   GLU A CD  1 
ATOM   707  O OE1 . GLU A 1 90  ? 59.041  20.638 46.475  1.00 73.03  ? 91   GLU A OE1 1 
ATOM   708  O OE2 . GLU A 1 90  ? 59.842  18.604 46.302  1.00 74.27  ? 91   GLU A OE2 1 
ATOM   709  N N   . LEU A 1 91  ? 58.395  18.772 41.549  1.00 26.31  ? 92   LEU A N   1 
ATOM   710  C CA  . LEU A 1 91  ? 57.037  19.213 41.267  1.00 25.74  ? 92   LEU A CA  1 
ATOM   711  C C   . LEU A 1 91  ? 56.337  19.610 42.560  1.00 30.08  ? 92   LEU A C   1 
ATOM   712  O O   . LEU A 1 91  ? 56.457  18.927 43.580  1.00 28.56  ? 92   LEU A O   1 
ATOM   713  C CB  . LEU A 1 91  ? 56.242  18.104 40.580  1.00 27.93  ? 92   LEU A CB  1 
ATOM   714  C CG  . LEU A 1 91  ? 56.714  17.587 39.221  1.00 33.30  ? 92   LEU A CG  1 
ATOM   715  C CD1 . LEU A 1 91  ? 55.674  16.624 38.641  1.00 29.94  ? 92   LEU A CD1 1 
ATOM   716  C CD2 . LEU A 1 91  ? 56.969  18.744 38.276  1.00 27.09  ? 92   LEU A CD2 1 
ATOM   717  N N   . SER A 1 92  ? 55.588  20.708 42.512  1.00 26.31  ? 93   SER A N   1 
ATOM   718  C CA  . SER A 1 92  ? 54.829  21.138 43.675  1.00 24.69  ? 93   SER A CA  1 
ATOM   719  C C   . SER A 1 92  ? 53.714  22.065 43.224  1.00 27.26  ? 93   SER A C   1 
ATOM   720  O O   . SER A 1 92  ? 53.867  22.810 42.256  1.00 28.98  ? 93   SER A O   1 
ATOM   721  C CB  . SER A 1 92  ? 55.721  21.849 44.700  1.00 23.85  ? 93   SER A CB  1 
ATOM   722  O OG  . SER A 1 92  ? 54.966  22.264 45.823  1.00 28.93  ? 93   SER A OG  1 
ATOM   723  N N   . GLU A 1 93  ? 52.585  22.005 43.933  1.00 26.66  ? 94   GLU A N   1 
ATOM   724  C CA  . GLU A 1 93  ? 51.578  23.046 43.770  1.00 29.13  ? 94   GLU A CA  1 
ATOM   725  C C   . GLU A 1 93  ? 52.030  24.356 44.397  1.00 28.56  ? 94   GLU A C   1 
ATOM   726  O O   . GLU A 1 93  ? 51.485  25.415 44.069  1.00 31.64  ? 94   GLU A O   1 
ATOM   727  C CB  . GLU A 1 93  ? 50.244  22.610 44.374  1.00 25.87  ? 94   GLU A CB  1 
ATOM   728  C CG  . GLU A 1 93  ? 49.556  21.498 43.602  1.00 28.27  ? 94   GLU A CG  1 
ATOM   729  C CD  . GLU A 1 93  ? 48.213  21.135 44.208  1.00 36.56  ? 94   GLU A CD  1 
ATOM   730  O OE1 . GLU A 1 93  ? 48.154  20.153 44.972  1.00 35.65  ? 94   GLU A OE1 1 
ATOM   731  O OE2 . GLU A 1 93  ? 47.215  21.835 43.923  1.00 34.43  ? 94   GLU A OE2 1 
ATOM   732  N N   . ASP A 1 94  ? 53.004  24.291 45.302  1.00 24.45  ? 95   ASP A N   1 
ATOM   733  C CA  . ASP A 1 94  ? 53.651  25.455 45.898  1.00 25.33  ? 95   ASP A CA  1 
ATOM   734  C C   . ASP A 1 94  ? 54.728  25.922 44.921  1.00 28.35  ? 95   ASP A C   1 
ATOM   735  O O   . ASP A 1 94  ? 55.900  25.550 45.004  1.00 27.35  ? 95   ASP A O   1 
ATOM   736  C CB  . ASP A 1 94  ? 54.203  25.086 47.274  1.00 25.06  ? 95   ASP A CB  1 
ATOM   737  C CG  . ASP A 1 94  ? 54.922  26.236 47.951  1.00 34.24  ? 95   ASP A CG  1 
ATOM   738  O OD1 . ASP A 1 94  ? 55.630  25.976 48.944  1.00 42.36  ? 95   ASP A OD1 1 
ATOM   739  O OD2 . ASP A 1 94  ? 54.834  27.385 47.464  1.00 31.23  ? 95   ASP A OD2 1 
ATOM   740  N N   . CYS A 1 95  ? 54.306  26.740 43.949  1.00 25.50  ? 96   CYS A N   1 
ATOM   741  C CA  . CYS A 1 95  ? 55.185  27.041 42.828  1.00 23.80  ? 96   CYS A CA  1 
ATOM   742  C C   . CYS A 1 95  ? 55.122  28.484 42.336  1.00 23.29  ? 96   CYS A C   1 
ATOM   743  O O   . CYS A 1 95  ? 55.725  28.786 41.300  1.00 22.94  ? 96   CYS A O   1 
ATOM   744  C CB  . CYS A 1 95  ? 54.872  26.104 41.654  1.00 21.59  ? 96   CYS A CB  1 
ATOM   745  S SG  . CYS A 1 95  ? 53.213  26.338 40.903  1.00 24.99  ? 96   CYS A SG  1 
ATOM   746  N N   . LEU A 1 96  ? 54.421  29.386 43.022  1.00 23.64  ? 97   LEU A N   1 
ATOM   747  C CA  . LEU A 1 96  ? 54.242  30.751 42.516  1.00 25.34  ? 97   LEU A CA  1 
ATOM   748  C C   . LEU A 1 96  ? 55.415  31.620 42.973  1.00 25.19  ? 97   LEU A C   1 
ATOM   749  O O   . LEU A 1 96  ? 55.342  32.385 43.936  1.00 26.95  ? 97   LEU A O   1 
ATOM   750  C CB  . LEU A 1 96  ? 52.891  31.305 42.950  1.00 21.12  ? 97   LEU A CB  1 
ATOM   751  C CG  . LEU A 1 96  ? 51.722  30.562 42.284  1.00 23.36  ? 97   LEU A CG  1 
ATOM   752  C CD1 . LEU A 1 96  ? 50.373  31.222 42.579  1.00 25.00  ? 97   LEU A CD1 1 
ATOM   753  C CD2 . LEU A 1 96  ? 51.939  30.449 40.772  1.00 19.71  ? 97   LEU A CD2 1 
ATOM   754  N N   . TYR A 1 97  ? 56.530  31.480 42.254  1.00 24.49  ? 98   TYR A N   1 
ATOM   755  C CA  . TYR A 1 97  ? 57.747  32.242 42.492  1.00 22.82  ? 98   TYR A CA  1 
ATOM   756  C C   . TYR A 1 97  ? 58.225  32.839 41.174  1.00 24.18  ? 98   TYR A C   1 
ATOM   757  O O   . TYR A 1 97  ? 57.936  32.306 40.100  1.00 21.80  ? 98   TYR A O   1 
ATOM   758  C CB  . TYR A 1 97  ? 58.842  31.358 43.116  1.00 22.71  ? 98   TYR A CB  1 
ATOM   759  C CG  . TYR A 1 97  ? 58.397  30.703 44.404  1.00 23.83  ? 98   TYR A CG  1 
ATOM   760  C CD1 . TYR A 1 97  ? 58.733  31.248 45.640  1.00 24.20  ? 98   TYR A CD1 1 
ATOM   761  C CD2 . TYR A 1 97  ? 57.608  29.556 44.380  1.00 22.58  ? 98   TYR A CD2 1 
ATOM   762  C CE1 . TYR A 1 97  ? 58.305  30.649 46.830  1.00 24.43  ? 98   TYR A CE1 1 
ATOM   763  C CE2 . TYR A 1 97  ? 57.175  28.960 45.538  1.00 21.24  ? 98   TYR A CE2 1 
ATOM   764  C CZ  . TYR A 1 97  ? 57.524  29.503 46.763  1.00 30.29  ? 98   TYR A CZ  1 
ATOM   765  O OH  . TYR A 1 97  ? 57.078  28.889 47.908  1.00 29.32  ? 98   TYR A OH  1 
ATOM   766  N N   . LEU A 1 98  ? 58.934  33.964 41.256  1.00 25.42  ? 99   LEU A N   1 
ATOM   767  C CA  . LEU A 1 98  ? 59.499  34.600 40.073  1.00 25.36  ? 99   LEU A CA  1 
ATOM   768  C C   . LEU A 1 98  ? 60.977  34.894 40.303  1.00 25.74  ? 99   LEU A C   1 
ATOM   769  O O   . LEU A 1 98  ? 61.498  34.765 41.414  1.00 27.66  ? 99   LEU A O   1 
ATOM   770  C CB  . LEU A 1 98  ? 58.730  35.878 39.686  1.00 23.72  ? 99   LEU A CB  1 
ATOM   771  C CG  . LEU A 1 98  ? 58.497  37.026 40.679  1.00 26.73  ? 99   LEU A CG  1 
ATOM   772  C CD1 . LEU A 1 98  ? 59.744  37.867 40.910  1.00 20.29  ? 99   LEU A CD1 1 
ATOM   773  C CD2 . LEU A 1 98  ? 57.352  37.909 40.183  1.00 22.79  ? 99   LEU A CD2 1 
ATOM   774  N N   . ASN A 1 99  ? 61.645  35.307 39.229  1.00 21.91  ? 100  ASN A N   1 
ATOM   775  C CA  . ASN A 1 99  ? 63.091  35.450 39.195  1.00 23.07  ? 100  ASN A CA  1 
ATOM   776  C C   . ASN A 1 99  ? 63.461  36.788 38.588  1.00 24.61  ? 100  ASN A C   1 
ATOM   777  O O   . ASN A 1 99  ? 62.872  37.202 37.585  1.00 26.37  ? 100  ASN A O   1 
ATOM   778  C CB  . ASN A 1 99  ? 63.728  34.325 38.373  1.00 21.41  ? 100  ASN A CB  1 
ATOM   779  C CG  . ASN A 1 99  ? 63.097  32.978 38.657  1.00 28.27  ? 100  ASN A CG  1 
ATOM   780  O OD1 . ASN A 1 99  ? 63.285  32.405 39.734  1.00 30.16  ? 100  ASN A OD1 1 
ATOM   781  N ND2 . ASN A 1 99  ? 62.329  32.472 37.698  1.00 24.13  ? 100  ASN A ND2 1 
ATOM   782  N N   . VAL A 1 100 ? 64.442  37.458 39.188  1.00 28.15  ? 101  VAL A N   1 
ATOM   783  C CA  . VAL A 1 100 ? 64.956  38.722 38.671  1.00 26.83  ? 101  VAL A CA  1 
ATOM   784  C C   . VAL A 1 100 ? 66.459  38.588 38.466  1.00 26.72  ? 101  VAL A C   1 
ATOM   785  O O   . VAL A 1 100 ? 67.180  38.205 39.390  1.00 24.50  ? 101  VAL A O   1 
ATOM   786  C CB  . VAL A 1 100 ? 64.656  39.900 39.614  1.00 29.57  ? 101  VAL A CB  1 
ATOM   787  C CG1 . VAL A 1 100 ? 65.305  41.194 39.064  1.00 23.39  ? 101  VAL A CG1 1 
ATOM   788  C CG2 . VAL A 1 100 ? 63.152  40.054 39.827  1.00 20.37  ? 101  VAL A CG2 1 
ATOM   789  N N   . TRP A 1 101 ? 66.921  38.894 37.255  1.00 27.37  ? 102  TRP A N   1 
ATOM   790  C CA  . TRP A 1 101 ? 68.336  39.075 36.967  1.00 22.19  ? 102  TRP A CA  1 
ATOM   791  C C   . TRP A 1 101 ? 68.594  40.543 36.677  1.00 24.83  ? 102  TRP A C   1 
ATOM   792  O O   . TRP A 1 101 ? 67.853  41.168 35.913  1.00 27.17  ? 102  TRP A O   1 
ATOM   793  C CB  . TRP A 1 101 ? 68.786  38.262 35.749  1.00 23.24  ? 102  TRP A CB  1 
ATOM   794  C CG  . TRP A 1 101 ? 68.829  36.774 35.879  1.00 24.75  ? 102  TRP A CG  1 
ATOM   795  C CD1 . TRP A 1 101 ? 69.917  36.008 36.169  1.00 21.33  ? 102  TRP A CD1 1 
ATOM   796  C CD2 . TRP A 1 101 ? 67.747  35.865 35.652  1.00 23.80  ? 102  TRP A CD2 1 
ATOM   797  N NE1 . TRP A 1 101 ? 69.574  34.677 36.158  1.00 20.73  ? 102  TRP A NE1 1 
ATOM   798  C CE2 . TRP A 1 101 ? 68.246  34.564 35.838  1.00 21.91  ? 102  TRP A CE2 1 
ATOM   799  C CE3 . TRP A 1 101 ? 66.402  36.028 35.326  1.00 21.76  ? 102  TRP A CE3 1 
ATOM   800  C CZ2 . TRP A 1 101 ? 67.447  33.432 35.706  1.00 21.45  ? 102  TRP A CZ2 1 
ATOM   801  C CZ3 . TRP A 1 101 ? 65.608  34.901 35.189  1.00 25.70  ? 102  TRP A CZ3 1 
ATOM   802  C CH2 . TRP A 1 101 ? 66.135  33.622 35.375  1.00 21.69  ? 102  TRP A CH2 1 
ATOM   803  N N   . THR A 1 102 ? 69.648  41.087 37.269  1.00 28.42  ? 103  THR A N   1 
ATOM   804  C CA  . THR A 1 102 ? 70.013  42.478 37.059  1.00 24.50  ? 103  THR A CA  1 
ATOM   805  C C   . THR A 1 102 ? 71.523  42.576 36.941  1.00 31.25  ? 103  THR A C   1 
ATOM   806  O O   . THR A 1 102 ? 72.247  41.695 37.412  1.00 30.60  ? 103  THR A O   1 
ATOM   807  C CB  . THR A 1 102 ? 69.500  43.369 38.204  1.00 35.81  ? 103  THR A CB  1 
ATOM   808  O OG1 . THR A 1 102 ? 69.459  44.735 37.779  1.00 41.12  ? 103  THR A OG1 1 
ATOM   809  C CG2 . THR A 1 102 ? 70.399  43.272 39.431  1.00 28.73  ? 103  THR A CG2 1 
ATOM   810  N N   . PRO A 1 103 ? 72.029  43.613 36.279  1.00 29.89  ? 104  PRO A N   1 
ATOM   811  C CA  . PRO A 1 103 ? 73.478  43.841 36.271  1.00 31.82  ? 104  PRO A CA  1 
ATOM   812  C C   . PRO A 1 103 ? 74.069  43.970 37.669  1.00 37.46  ? 104  PRO A C   1 
ATOM   813  O O   . PRO A 1 103 ? 73.388  44.329 38.633  1.00 33.40  ? 104  PRO A O   1 
ATOM   814  C CB  . PRO A 1 103 ? 73.634  45.171 35.493  1.00 32.51  ? 104  PRO A CB  1 
ATOM   815  C CG  . PRO A 1 103 ? 72.420  45.230 34.601  1.00 28.28  ? 104  PRO A CG  1 
ATOM   816  C CD  . PRO A 1 103 ? 71.320  44.472 35.305  1.00 29.55  ? 104  PRO A CD  1 
ATOM   817  N N   . TYR A 1 104 ? 75.350  43.672 37.745  1.00 38.00  ? 105  TYR A N   1 
ATOM   818  C CA  . TYR A 1 104 ? 76.110  43.765 38.987  1.00 33.95  ? 105  TYR A CA  1 
ATOM   819  C C   . TYR A 1 104 ? 77.294  44.691 38.731  1.00 39.90  ? 105  TYR A C   1 
ATOM   820  O O   . TYR A 1 104 ? 78.134  44.393 37.885  1.00 39.73  ? 105  TYR A O   1 
ATOM   821  C CB  . TYR A 1 104 ? 76.566  42.374 39.439  1.00 30.28  ? 105  TYR A CB  1 
ATOM   822  C CG  . TYR A 1 104 ? 77.289  42.349 40.777  1.00 35.86  ? 105  TYR A CG  1 
ATOM   823  C CD1 . TYR A 1 104 ? 76.682  41.815 41.909  1.00 38.49  ? 105  TYR A CD1 1 
ATOM   824  C CD2 . TYR A 1 104 ? 78.583  42.848 40.906  1.00 34.81  ? 105  TYR A CD2 1 
ATOM   825  C CE1 . TYR A 1 104 ? 77.338  41.789 43.138  1.00 39.79  ? 105  TYR A CE1 1 
ATOM   826  C CE2 . TYR A 1 104 ? 79.245  42.829 42.126  1.00 37.26  ? 105  TYR A CE2 1 
ATOM   827  C CZ  . TYR A 1 104 ? 78.618  42.298 43.243  1.00 41.17  ? 105  TYR A CZ  1 
ATOM   828  O OH  . TYR A 1 104 ? 79.275  42.271 44.460  1.00 40.47  ? 105  TYR A OH  1 
ATOM   829  N N   . PRO A 1 105 ? 77.370  45.822 39.455  1.00 42.66  ? 106  PRO A N   1 
ATOM   830  C CA  . PRO A 1 105 ? 76.443  46.289 40.497  1.00 41.14  ? 106  PRO A CA  1 
ATOM   831  C C   . PRO A 1 105 ? 75.111  46.760 39.912  1.00 42.41  ? 106  PRO A C   1 
ATOM   832  O O   . PRO A 1 105 ? 75.024  46.937 38.693  1.00 39.50  ? 106  PRO A O   1 
ATOM   833  C CB  . PRO A 1 105 ? 77.205  47.451 41.139  1.00 43.80  ? 106  PRO A CB  1 
ATOM   834  C CG  . PRO A 1 105 ? 78.024  48.002 40.017  1.00 46.26  ? 106  PRO A CG  1 
ATOM   835  C CD  . PRO A 1 105 ? 78.425  46.814 39.177  1.00 44.50  ? 106  PRO A CD  1 
ATOM   836  N N   . ARG A 1 106 ? 74.101  46.948 40.762  1.00 43.72  ? 107  ARG A N   1 
ATOM   837  C CA  . ARG A 1 106 ? 72.772  47.292 40.278  1.00 45.71  ? 107  ARG A CA  1 
ATOM   838  C C   . ARG A 1 106 ? 72.819  48.585 39.467  1.00 43.09  ? 107  ARG A C   1 
ATOM   839  O O   . ARG A 1 106 ? 73.641  49.465 39.735  1.00 45.90  ? 107  ARG A O   1 
ATOM   840  C CB  . ARG A 1 106 ? 71.794  47.447 41.439  1.00 44.79  ? 107  ARG A CB  1 
ATOM   841  C CG  . ARG A 1 106 ? 71.605  46.183 42.242  1.00 57.29  ? 107  ARG A CG  1 
ATOM   842  C CD  . ARG A 1 106 ? 70.166  46.011 42.693  1.00 59.55  ? 107  ARG A CD  1 
ATOM   843  N NE  . ARG A 1 106 ? 69.827  46.878 43.816  1.00 58.73  ? 107  ARG A NE  1 
ATOM   844  C CZ  . ARG A 1 106 ? 70.094  46.593 45.087  1.00 59.23  ? 107  ARG A CZ  1 
ATOM   845  N NH1 . ARG A 1 106 ? 70.712  45.462 45.403  1.00 53.76  ? 107  ARG A NH1 1 
ATOM   846  N NH2 . ARG A 1 106 ? 69.742  47.441 46.044  1.00 62.39  ? 107  ARG A NH2 1 
ATOM   847  N N   . PRO A 1 107 ? 71.956  48.715 38.463  1.00 45.01  ? 108  PRO A N   1 
ATOM   848  C CA  . PRO A 1 107 ? 71.983  49.914 37.619  1.00 47.94  ? 108  PRO A CA  1 
ATOM   849  C C   . PRO A 1 107 ? 71.801  51.186 38.433  1.00 54.66  ? 108  PRO A C   1 
ATOM   850  O O   . PRO A 1 107 ? 71.054  51.223 39.414  1.00 52.14  ? 108  PRO A O   1 
ATOM   851  C CB  . PRO A 1 107 ? 70.812  49.691 36.657  1.00 42.36  ? 108  PRO A CB  1 
ATOM   852  C CG  . PRO A 1 107 ? 70.669  48.213 36.584  1.00 42.20  ? 108  PRO A CG  1 
ATOM   853  C CD  . PRO A 1 107 ? 70.992  47.716 37.969  1.00 42.51  ? 108  PRO A CD  1 
ATOM   854  N N   . THR A 1 108 ? 72.509  52.235 38.018  1.00 64.85  ? 109  THR A N   1 
ATOM   855  C CA  . THR A 1 108 ? 72.353  53.529 38.667  1.00 77.20  ? 109  THR A CA  1 
ATOM   856  C C   . THR A 1 108 ? 71.060  54.208 38.234  1.00 75.78  ? 109  THR A C   1 
ATOM   857  O O   . THR A 1 108 ? 70.390  54.852 39.047  1.00 79.54  ? 109  THR A O   1 
ATOM   858  C CB  . THR A 1 108 ? 73.559  54.418 38.354  1.00 84.78  ? 109  THR A CB  1 
ATOM   859  O OG1 . THR A 1 108 ? 73.720  54.523 36.933  1.00 92.63  ? 109  THR A OG1 1 
ATOM   860  C CG2 . THR A 1 108 ? 74.821  53.822 38.953  1.00 81.49  ? 109  THR A CG2 1 
ATOM   861  N N   . SER A 1 109 ? 70.691  54.057 36.968  1.00 66.18  ? 110  SER A N   1 
ATOM   862  C CA  . SER A 1 109 ? 69.525  54.687 36.378  1.00 62.03  ? 110  SER A CA  1 
ATOM   863  C C   . SER A 1 109 ? 68.533  53.631 35.903  1.00 57.11  ? 110  SER A C   1 
ATOM   864  O O   . SER A 1 109 ? 68.916  52.489 35.624  1.00 52.87  ? 110  SER A O   1 
ATOM   865  C CB  . SER A 1 109 ? 69.944  55.587 35.206  1.00 67.04  ? 110  SER A CB  1 
ATOM   866  O OG  . SER A 1 109 ? 70.910  54.943 34.396  1.00 72.25  ? 110  SER A OG  1 
ATOM   867  N N   . PRO A 1 110 ? 67.247  53.978 35.807  1.00 53.71  ? 111  PRO A N   1 
ATOM   868  C CA  . PRO A 1 110 ? 66.229  52.976 35.457  1.00 49.13  ? 111  PRO A CA  1 
ATOM   869  C C   . PRO A 1 110 ? 66.531  52.287 34.133  1.00 47.31  ? 111  PRO A C   1 
ATOM   870  O O   . PRO A 1 110 ? 66.848  52.931 33.129  1.00 44.14  ? 111  PRO A O   1 
ATOM   871  C CB  . PRO A 1 110 ? 64.939  53.800 35.387  1.00 50.24  ? 111  PRO A CB  1 
ATOM   872  C CG  . PRO A 1 110 ? 65.192  54.957 36.298  1.00 51.90  ? 111  PRO A CG  1 
ATOM   873  C CD  . PRO A 1 110 ? 66.645  55.283 36.134  1.00 51.01  ? 111  PRO A CD  1 
ATOM   874  N N   . THR A 1 111 ? 66.412  50.958 34.142  1.00 40.14  ? 112  THR A N   1 
ATOM   875  C CA  . THR A 1 111 ? 66.844  50.075 33.077  1.00 37.11  ? 112  THR A CA  1 
ATOM   876  C C   . THR A 1 111 ? 65.661  49.297 32.512  1.00 35.32  ? 112  THR A C   1 
ATOM   877  O O   . THR A 1 111 ? 64.833  48.790 33.278  1.00 31.92  ? 112  THR A O   1 
ATOM   878  C CB  . THR A 1 111 ? 67.904  49.097 33.606  1.00 39.33  ? 112  THR A CB  1 
ATOM   879  O OG1 . THR A 1 111 ? 68.966  49.841 34.210  1.00 43.53  ? 112  THR A OG1 1 
ATOM   880  C CG2 . THR A 1 111 ? 68.470  48.255 32.489  1.00 37.18  ? 112  THR A CG2 1 
ATOM   881  N N   . PRO A 1 112 ? 65.548  49.195 31.186  1.00 32.60  ? 113  PRO A N   1 
ATOM   882  C CA  . PRO A 1 112 ? 64.410  48.482 30.592  1.00 34.73  ? 113  PRO A CA  1 
ATOM   883  C C   . PRO A 1 112 ? 64.323  47.038 31.059  1.00 29.57  ? 113  PRO A C   1 
ATOM   884  O O   . PRO A 1 112 ? 65.331  46.381 31.328  1.00 28.87  ? 113  PRO A O   1 
ATOM   885  C CB  . PRO A 1 112 ? 64.676  48.568 29.081  1.00 37.69  ? 113  PRO A CB  1 
ATOM   886  C CG  . PRO A 1 112 ? 66.080  49.102 28.944  1.00 44.17  ? 113  PRO A CG  1 
ATOM   887  C CD  . PRO A 1 112 ? 66.341  49.905 30.170  1.00 39.29  ? 113  PRO A CD  1 
ATOM   888  N N   . VAL A 1 113 ? 63.088  46.550 31.145  1.00 25.59  ? 114  VAL A N   1 
ATOM   889  C CA  . VAL A 1 113 ? 62.778  45.248 31.720  1.00 23.77  ? 114  VAL A CA  1 
ATOM   890  C C   . VAL A 1 113 ? 62.232  44.338 30.629  1.00 29.02  ? 114  VAL A C   1 
ATOM   891  O O   . VAL A 1 113 ? 61.317  44.722 29.889  1.00 31.54  ? 114  VAL A O   1 
ATOM   892  C CB  . VAL A 1 113 ? 61.764  45.378 32.868  1.00 26.81  ? 114  VAL A CB  1 
ATOM   893  C CG1 . VAL A 1 113 ? 61.498  44.012 33.494  1.00 24.32  ? 114  VAL A CG1 1 
ATOM   894  C CG2 . VAL A 1 113 ? 62.263  46.383 33.908  1.00 25.05  ? 114  VAL A CG2 1 
ATOM   895  N N   . LEU A 1 114 ? 62.794  43.136 30.534  1.00 27.17  ? 115  LEU A N   1 
ATOM   896  C CA  . LEU A 1 114 ? 62.235  42.048 29.740  1.00 29.37  ? 115  LEU A CA  1 
ATOM   897  C C   . LEU A 1 114 ? 61.597  41.038 30.687  1.00 27.56  ? 115  LEU A C   1 
ATOM   898  O O   . LEU A 1 114 ? 62.228  40.622 31.663  1.00 27.42  ? 115  LEU A O   1 
ATOM   899  C CB  . LEU A 1 114 ? 63.320  41.366 28.903  1.00 29.67  ? 115  LEU A CB  1 
ATOM   900  C CG  . LEU A 1 114 ? 63.809  42.003 27.600  1.00 35.06  ? 115  LEU A CG  1 
ATOM   901  C CD1 . LEU A 1 114 ? 65.184  41.453 27.231  1.00 34.32  ? 115  LEU A CD1 1 
ATOM   902  C CD2 . LEU A 1 114 ? 62.821  41.714 26.488  1.00 35.52  ? 115  LEU A CD2 1 
ATOM   903  N N   . VAL A 1 115 ? 60.353  40.649 30.408  1.00 25.36  ? 116  VAL A N   1 
ATOM   904  C CA  . VAL A 1 115 ? 59.634  39.682 31.238  1.00 26.01  ? 116  VAL A CA  1 
ATOM   905  C C   . VAL A 1 115 ? 59.319  38.458 30.387  1.00 27.96  ? 116  VAL A C   1 
ATOM   906  O O   . VAL A 1 115 ? 58.563  38.553 29.413  1.00 29.03  ? 116  VAL A O   1 
ATOM   907  C CB  . VAL A 1 115 ? 58.348  40.276 31.837  1.00 28.27  ? 116  VAL A CB  1 
ATOM   908  C CG1 . VAL A 1 115 ? 57.647  39.245 32.717  1.00 17.79  ? 116  VAL A CG1 1 
ATOM   909  C CG2 . VAL A 1 115 ? 58.658  41.534 32.633  1.00 22.64  ? 116  VAL A CG2 1 
ATOM   910  N N   . TRP A 1 116 ? 59.878  37.307 30.768  1.00 20.47  ? 117  TRP A N   1 
ATOM   911  C CA  . TRP A 1 116 ? 59.731  36.074 30.001  1.00 20.98  ? 117  TRP A CA  1 
ATOM   912  C C   . TRP A 1 116 ? 58.547  35.254 30.502  1.00 22.61  ? 117  TRP A C   1 
ATOM   913  O O   . TRP A 1 116 ? 58.375  35.076 31.712  1.00 23.42  ? 117  TRP A O   1 
ATOM   914  C CB  . TRP A 1 116 ? 61.012  35.239 30.085  1.00 22.29  ? 117  TRP A CB  1 
ATOM   915  C CG  . TRP A 1 116 ? 60.905  33.877 29.438  1.00 22.86  ? 117  TRP A CG  1 
ATOM   916  C CD1 . TRP A 1 116 ? 60.872  32.667 30.069  1.00 20.99  ? 117  TRP A CD1 1 
ATOM   917  C CD2 . TRP A 1 116 ? 60.824  33.598 28.034  1.00 20.83  ? 117  TRP A CD2 1 
ATOM   918  N NE1 . TRP A 1 116 ? 60.778  31.651 29.145  1.00 18.94  ? 117  TRP A NE1 1 
ATOM   919  C CE2 . TRP A 1 116 ? 60.748  32.195 27.889  1.00 20.09  ? 117  TRP A CE2 1 
ATOM   920  C CE3 . TRP A 1 116 ? 60.815  34.397 26.887  1.00 20.02  ? 117  TRP A CE3 1 
ATOM   921  C CZ2 . TRP A 1 116 ? 60.660  31.573 26.639  1.00 22.05  ? 117  TRP A CZ2 1 
ATOM   922  C CZ3 . TRP A 1 116 ? 60.728  33.779 25.645  1.00 23.26  ? 117  TRP A CZ3 1 
ATOM   923  C CH2 . TRP A 1 116 ? 60.653  32.380 25.533  1.00 21.48  ? 117  TRP A CH2 1 
ATOM   924  N N   . ILE A 1 117 ? 57.734  34.759 29.570  1.00 21.53  ? 118  ILE A N   1 
ATOM   925  C CA  . ILE A 1 117 ? 56.636  33.844 29.872  1.00 20.24  ? 118  ILE A CA  1 
ATOM   926  C C   . ILE A 1 117 ? 56.890  32.557 29.103  1.00 22.46  ? 118  ILE A C   1 
ATOM   927  O O   . ILE A 1 117 ? 56.838  32.545 27.864  1.00 23.40  ? 118  ILE A O   1 
ATOM   928  C CB  . ILE A 1 117 ? 55.266  34.432 29.507  1.00 24.91  ? 118  ILE A CB  1 
ATOM   929  C CG1 . ILE A 1 117 ? 55.053  35.775 30.207  1.00 25.76  ? 118  ILE A CG1 1 
ATOM   930  C CG2 . ILE A 1 117 ? 54.154  33.450 29.891  1.00 19.09  ? 118  ILE A CG2 1 
ATOM   931  C CD1 . ILE A 1 117 ? 53.678  36.379 29.956  1.00 24.96  ? 118  ILE A CD1 1 
ATOM   932  N N   . TYR A 1 118 ? 57.141  31.467 29.821  1.00 21.86  ? 119  TYR A N   1 
ATOM   933  C CA  . TYR A 1 118 ? 57.486  30.232 29.130  1.00 16.86  ? 119  TYR A CA  1 
ATOM   934  C C   . TYR A 1 118 ? 56.266  29.622 28.452  1.00 19.91  ? 119  TYR A C   1 
ATOM   935  O O   . TYR A 1 118 ? 55.114  29.882 28.817  1.00 24.51  ? 119  TYR A O   1 
ATOM   936  C CB  . TYR A 1 118 ? 58.111  29.213 30.086  1.00 20.65  ? 119  TYR A CB  1 
ATOM   937  C CG  . TYR A 1 118 ? 57.285  28.860 31.310  1.00 20.36  ? 119  TYR A CG  1 
ATOM   938  C CD1 . TYR A 1 118 ? 56.160  28.036 31.214  1.00 19.64  ? 119  TYR A CD1 1 
ATOM   939  C CD2 . TYR A 1 118 ? 57.656  29.323 32.570  1.00 19.51  ? 119  TYR A CD2 1 
ATOM   940  C CE1 . TYR A 1 118 ? 55.414  27.704 32.348  1.00 21.83  ? 119  TYR A CE1 1 
ATOM   941  C CE2 . TYR A 1 118 ? 56.921  28.997 33.703  1.00 20.94  ? 119  TYR A CE2 1 
ATOM   942  C CZ  . TYR A 1 118 ? 55.804  28.191 33.586  1.00 19.69  ? 119  TYR A CZ  1 
ATOM   943  O OH  . TYR A 1 118 ? 55.081  27.877 34.715  1.00 21.14  ? 119  TYR A OH  1 
ATOM   944  N N   . GLY A 1 119 ? 56.539  28.784 27.450  1.00 16.90  ? 120  GLY A N   1 
ATOM   945  C CA  . GLY A 1 119 ? 55.521  27.978 26.819  1.00 19.08  ? 120  GLY A CA  1 
ATOM   946  C C   . GLY A 1 119 ? 55.489  26.562 27.367  1.00 21.96  ? 120  GLY A C   1 
ATOM   947  O O   . GLY A 1 119 ? 56.093  26.241 28.393  1.00 21.57  ? 120  GLY A O   1 
ATOM   948  N N   . GLY A 1 120 ? 54.777  25.699 26.646  1.00 21.15  ? 121  GLY A N   1 
ATOM   949  C CA  . GLY A 1 120 ? 54.549  24.339 27.093  1.00 20.71  ? 121  GLY A CA  1 
ATOM   950  C C   . GLY A 1 120 ? 53.079  23.973 27.020  1.00 23.94  ? 121  GLY A C   1 
ATOM   951  O O   . GLY A 1 120 ? 52.589  23.161 27.812  1.00 26.96  ? 121  GLY A O   1 
ATOM   952  N N   . GLY A 1 121 ? 52.367  24.602 26.084  1.00 22.96  ? 122  GLY A N   1 
ATOM   953  C CA  . GLY A 1 121 ? 50.978  24.284 25.797  1.00 22.75  ? 122  GLY A CA  1 
ATOM   954  C C   . GLY A 1 121 ? 49.998  24.459 26.941  1.00 23.21  ? 122  GLY A C   1 
ATOM   955  O O   . GLY A 1 121 ? 48.923  23.855 26.919  1.00 20.11  ? 122  GLY A O   1 
ATOM   956  N N   . PHE A 1 122 ? 50.332  25.272 27.945  1.00 18.30  ? 123  PHE A N   1 
ATOM   957  C CA  . PHE A 1 122 ? 49.523  25.463 29.149  1.00 21.23  ? 123  PHE A CA  1 
ATOM   958  C C   . PHE A 1 122 ? 49.411  24.204 29.995  1.00 23.46  ? 123  PHE A C   1 
ATOM   959  O O   . PHE A 1 122 ? 48.640  24.183 30.958  1.00 25.03  ? 123  PHE A O   1 
ATOM   960  C CB  . PHE A 1 122 ? 48.111  25.968 28.827  1.00 21.30  ? 123  PHE A CB  1 
ATOM   961  C CG  . PHE A 1 122 ? 48.089  27.291 28.126  1.00 23.36  ? 123  PHE A CG  1 
ATOM   962  C CD1 . PHE A 1 122 ? 48.386  28.462 28.815  1.00 23.44  ? 123  PHE A CD1 1 
ATOM   963  C CD2 . PHE A 1 122 ? 47.766  27.364 26.778  1.00 22.12  ? 123  PHE A CD2 1 
ATOM   964  C CE1 . PHE A 1 122 ? 48.368  29.693 28.167  1.00 20.63  ? 123  PHE A CE1 1 
ATOM   965  C CE2 . PHE A 1 122 ? 47.733  28.581 26.114  1.00 17.54  ? 123  PHE A CE2 1 
ATOM   966  C CZ  . PHE A 1 122 ? 48.027  29.754 26.796  1.00 20.32  ? 123  PHE A CZ  1 
ATOM   967  N N   . TYR A 1 123 ? 50.147  23.142 29.662  1.00 16.43  ? 124  TYR A N   1 
ATOM   968  C CA  . TYR A 1 123 ? 50.175  21.954 30.502  1.00 25.65  ? 124  TYR A CA  1 
ATOM   969  C C   . TYR A 1 123 ? 51.539  21.696 31.128  1.00 26.12  ? 124  TYR A C   1 
ATOM   970  O O   . TYR A 1 123 ? 51.658  20.785 31.955  1.00 24.37  ? 124  TYR A O   1 
ATOM   971  C CB  . TYR A 1 123 ? 49.743  20.717 29.698  1.00 22.83  ? 124  TYR A CB  1 
ATOM   972  C CG  . TYR A 1 123 ? 50.776  20.222 28.703  1.00 22.60  ? 124  TYR A CG  1 
ATOM   973  C CD1 . TYR A 1 123 ? 51.756  19.308 29.083  1.00 21.15  ? 124  TYR A CD1 1 
ATOM   974  C CD2 . TYR A 1 123 ? 50.765  20.660 27.384  1.00 23.04  ? 124  TYR A CD2 1 
ATOM   975  C CE1 . TYR A 1 123 ? 52.705  18.856 28.181  1.00 21.96  ? 124  TYR A CE1 1 
ATOM   976  C CE2 . TYR A 1 123 ? 51.707  20.212 26.474  1.00 22.77  ? 124  TYR A CE2 1 
ATOM   977  C CZ  . TYR A 1 123 ? 52.671  19.310 26.879  1.00 26.35  ? 124  TYR A CZ  1 
ATOM   978  O OH  . TYR A 1 123 ? 53.603  18.862 25.976  1.00 27.33  ? 124  TYR A OH  1 
ATOM   979  N N   . SER A 1 124 ? 52.563  22.457 30.756  1.00 21.37  ? 125  SER A N   1 
ATOM   980  C CA  . SER A 1 124 ? 53.920  22.187 31.204  1.00 19.48  ? 125  SER A CA  1 
ATOM   981  C C   . SER A 1 124 ? 54.730  23.473 31.108  1.00 22.46  ? 125  SER A C   1 
ATOM   982  O O   . SER A 1 124 ? 54.239  24.510 30.653  1.00 22.05  ? 125  SER A O   1 
ATOM   983  C CB  . SER A 1 124 ? 54.558  21.075 30.369  1.00 19.89  ? 125  SER A CB  1 
ATOM   984  O OG  . SER A 1 124 ? 54.603  21.462 29.001  1.00 22.78  ? 125  SER A OG  1 
ATOM   985  N N   . GLY A 1 125 ? 55.991  23.383 31.516  1.00 20.88  ? 126  GLY A N   1 
ATOM   986  C CA  . GLY A 1 125 ? 56.898  24.510 31.457  1.00 21.18  ? 126  GLY A CA  1 
ATOM   987  C C   . GLY A 1 125 ? 57.370  24.934 32.831  1.00 21.13  ? 126  GLY A C   1 
ATOM   988  O O   . GLY A 1 125 ? 56.732  24.614 33.843  1.00 22.35  ? 126  GLY A O   1 
ATOM   989  N N   . ALA A 1 126 ? 58.482  25.661 32.878  1.00 22.14  ? 127  ALA A N   1 
ATOM   990  C CA  . ALA A 1 126 ? 59.029  26.157 34.135  1.00 23.65  ? 127  ALA A CA  1 
ATOM   991  C C   . ALA A 1 126 ? 60.038  27.247 33.824  1.00 26.62  ? 127  ALA A C   1 
ATOM   992  O O   . ALA A 1 126 ? 60.733  27.192 32.805  1.00 21.61  ? 127  ALA A O   1 
ATOM   993  C CB  . ALA A 1 126 ? 59.696  25.041 34.949  1.00 20.41  ? 127  ALA A CB  1 
ATOM   994  N N   . SER A 1 127 ? 60.115  28.240 34.712  1.00 21.63  ? 128  SER A N   1 
ATOM   995  C CA  . SER A 1 127 ? 61.088  29.305 34.519  1.00 21.77  ? 128  SER A CA  1 
ATOM   996  C C   . SER A 1 127 ? 62.506  28.865 34.857  1.00 25.21  ? 128  SER A C   1 
ATOM   997  O O   . SER A 1 127 ? 63.451  29.625 34.611  1.00 23.31  ? 128  SER A O   1 
ATOM   998  C CB  . SER A 1 127 ? 60.701  30.537 35.348  1.00 20.63  ? 128  SER A CB  1 
ATOM   999  O OG  . SER A 1 127 ? 60.765  30.260 36.738  1.00 26.11  ? 128  SER A OG  1 
ATOM   1000 N N   . SER A 1 128 ? 62.683  27.652 35.382  1.00 21.44  ? 129  SER A N   1 
ATOM   1001 C CA  . SER A 1 128 ? 63.997  27.173 35.788  1.00 21.81  ? 129  SER A CA  1 
ATOM   1002 C C   . SER A 1 128 ? 64.725  26.386 34.703  1.00 24.16  ? 129  SER A C   1 
ATOM   1003 O O   . SER A 1 128 ? 65.887  26.023 34.909  1.00 26.82  ? 129  SER A O   1 
ATOM   1004 C CB  . SER A 1 128 ? 63.874  26.308 37.052  1.00 23.34  ? 129  SER A CB  1 
ATOM   1005 O OG  . SER A 1 128 ? 62.933  25.256 36.888  1.00 24.70  ? 129  SER A OG  1 
ATOM   1006 N N   . LEU A 1 129 ? 64.086  26.111 33.565  1.00 24.12  ? 130  LEU A N   1 
ATOM   1007 C CA  . LEU A 1 129 ? 64.751  25.385 32.486  1.00 26.08  ? 130  LEU A CA  1 
ATOM   1008 C C   . LEU A 1 129 ? 66.067  26.062 32.125  1.00 24.42  ? 130  LEU A C   1 
ATOM   1009 O O   . LEU A 1 129 ? 66.159  27.293 32.100  1.00 25.68  ? 130  LEU A O   1 
ATOM   1010 C CB  . LEU A 1 129 ? 63.851  25.309 31.242  1.00 22.68  ? 130  LEU A CB  1 
ATOM   1011 C CG  . LEU A 1 129 ? 62.480  24.663 31.429  1.00 26.58  ? 130  LEU A CG  1 
ATOM   1012 C CD1 . LEU A 1 129 ? 61.762  24.412 30.106  1.00 20.30  ? 130  LEU A CD1 1 
ATOM   1013 C CD2 . LEU A 1 129 ? 62.639  23.381 32.232  1.00 30.25  ? 130  LEU A CD2 1 
ATOM   1014 N N   . ASP A 1 130 ? 67.089  25.241 31.849  1.00 23.12  ? 131  ASP A N   1 
ATOM   1015 C CA  . ASP A 1 130 ? 68.408  25.768 31.504  1.00 31.00  ? 131  ASP A CA  1 
ATOM   1016 C C   . ASP A 1 130 ? 68.348  26.721 30.320  1.00 32.42  ? 131  ASP A C   1 
ATOM   1017 O O   . ASP A 1 130 ? 69.122  27.681 30.254  1.00 32.67  ? 131  ASP A O   1 
ATOM   1018 C CB  . ASP A 1 130 ? 69.378  24.624 31.189  1.00 26.77  ? 131  ASP A CB  1 
ATOM   1019 C CG  . ASP A 1 130 ? 69.686  23.772 32.407  1.00 34.93  ? 131  ASP A CG  1 
ATOM   1020 O OD1 . ASP A 1 130 ? 69.429  24.234 33.542  1.00 34.75  ? 131  ASP A OD1 1 
ATOM   1021 O OD2 . ASP A 1 130 ? 70.189  22.643 32.231  1.00 42.20  ? 131  ASP A OD2 1 
ATOM   1022 N N   . VAL A 1 131 ? 67.428  26.484 29.384  1.00 26.08  ? 132  VAL A N   1 
ATOM   1023 C CA  . VAL A 1 131 ? 67.375  27.292 28.170  1.00 27.09  ? 132  VAL A CA  1 
ATOM   1024 C C   . VAL A 1 131 ? 66.762  28.663 28.409  1.00 22.39  ? 132  VAL A C   1 
ATOM   1025 O O   . VAL A 1 131 ? 66.869  29.532 27.537  1.00 25.80  ? 132  VAL A O   1 
ATOM   1026 C CB  . VAL A 1 131 ? 66.641  26.469 27.089  1.00 32.09  ? 132  VAL A CB  1 
ATOM   1027 C CG1 . VAL A 1 131 ? 65.137  26.419 27.351  1.00 31.45  ? 132  VAL A CG1 1 
ATOM   1028 C CG2 . VAL A 1 131 ? 66.948  26.978 25.712  1.00 35.56  ? 132  VAL A CG2 1 
ATOM   1029 N N   . TYR A 1 132 ? 66.160  28.898 29.580  1.00 21.87  ? 133  TYR A N   1 
ATOM   1030 C CA  . TYR A 1 132 ? 65.639  30.208 29.962  1.00 23.14  ? 133  TYR A CA  1 
ATOM   1031 C C   . TYR A 1 132 ? 66.562  30.945 30.933  1.00 24.88  ? 133  TYR A C   1 
ATOM   1032 O O   . TYR A 1 132 ? 66.129  31.900 31.588  1.00 27.63  ? 133  TYR A O   1 
ATOM   1033 C CB  . TYR A 1 132 ? 64.244  30.082 30.587  1.00 20.81  ? 133  TYR A CB  1 
ATOM   1034 C CG  . TYR A 1 132 ? 63.233  29.285 29.782  1.00 24.63  ? 133  TYR A CG  1 
ATOM   1035 C CD1 . TYR A 1 132 ? 63.270  29.259 28.390  1.00 21.24  ? 133  TYR A CD1 1 
ATOM   1036 C CD2 . TYR A 1 132 ? 62.247  28.549 30.422  1.00 20.68  ? 133  TYR A CD2 1 
ATOM   1037 C CE1 . TYR A 1 132 ? 62.348  28.521 27.667  1.00 21.21  ? 133  TYR A CE1 1 
ATOM   1038 C CE2 . TYR A 1 132 ? 61.326  27.813 29.710  1.00 21.08  ? 133  TYR A CE2 1 
ATOM   1039 C CZ  . TYR A 1 132 ? 61.376  27.803 28.336  1.00 22.96  ? 133  TYR A CZ  1 
ATOM   1040 O OH  . TYR A 1 132 ? 60.452  27.065 27.634  1.00 25.52  ? 133  TYR A OH  1 
ATOM   1041 N N   . ASP A 1 133 ? 67.812  30.504 31.059  1.00 24.40  ? 134  ASP A N   1 
ATOM   1042 C CA  . ASP A 1 133 ? 68.781  31.145 31.942  1.00 29.74  ? 134  ASP A CA  1 
ATOM   1043 C C   . ASP A 1 133 ? 68.990  32.600 31.538  1.00 30.60  ? 134  ASP A C   1 
ATOM   1044 O O   . ASP A 1 133 ? 69.560  32.877 30.477  1.00 28.47  ? 134  ASP A O   1 
ATOM   1045 C CB  . ASP A 1 133 ? 70.107  30.373 31.907  1.00 32.03  ? 134  ASP A CB  1 
ATOM   1046 C CG  . ASP A 1 133 ? 71.090  30.826 32.977  1.00 33.29  ? 134  ASP A CG  1 
ATOM   1047 O OD1 . ASP A 1 133 ? 70.901  31.914 33.562  1.00 28.26  ? 134  ASP A OD1 1 
ATOM   1048 O OD2 . ASP A 1 133 ? 72.071  30.091 33.216  1.00 36.22  ? 134  ASP A OD2 1 
ATOM   1049 N N   . GLY A 1 134 ? 68.552  33.535 32.382  1.00 25.54  ? 135  GLY A N   1 
ATOM   1050 C CA  . GLY A 1 134 ? 68.596  34.946 32.048  1.00 26.10  ? 135  GLY A CA  1 
ATOM   1051 C C   . GLY A 1 134 ? 69.939  35.641 32.180  1.00 29.23  ? 135  GLY A C   1 
ATOM   1052 O O   . GLY A 1 134 ? 70.036  36.831 31.868  1.00 32.08  ? 135  GLY A O   1 
ATOM   1053 N N   . ARG A 1 135 ? 70.990  34.937 32.602  1.00 27.87  ? 136  ARG A N   1 
ATOM   1054 C CA  . ARG A 1 135 ? 72.234  35.615 32.961  1.00 29.25  ? 136  ARG A CA  1 
ATOM   1055 C C   . ARG A 1 135 ? 72.970  36.178 31.745  1.00 30.45  ? 136  ARG A C   1 
ATOM   1056 O O   . ARG A 1 135 ? 73.652  37.203 31.864  1.00 28.70  ? 136  ARG A O   1 
ATOM   1057 C CB  . ARG A 1 135 ? 73.144  34.661 33.737  1.00 27.27  ? 136  ARG A CB  1 
ATOM   1058 C CG  . ARG A 1 135 ? 73.911  33.678 32.864  1.00 32.79  ? 136  ARG A CG  1 
ATOM   1059 C CD  . ARG A 1 135 ? 74.823  32.807 33.693  1.00 31.15  ? 136  ARG A CD  1 
ATOM   1060 N NE  . ARG A 1 135 ? 74.070  31.796 34.421  1.00 35.39  ? 136  ARG A NE  1 
ATOM   1061 C CZ  . ARG A 1 135 ? 74.562  31.074 35.421  1.00 39.98  ? 136  ARG A CZ  1 
ATOM   1062 N NH1 . ARG A 1 135 ? 75.813  31.262 35.826  1.00 38.34  ? 136  ARG A NH1 1 
ATOM   1063 N NH2 . ARG A 1 135 ? 73.799  30.172 36.025  1.00 40.03  ? 136  ARG A NH2 1 
ATOM   1064 N N   . PHE A 1 136 ? 72.857  35.541 30.576  1.00 26.24  ? 137  PHE A N   1 
ATOM   1065 C CA  . PHE A 1 136 ? 73.630  36.015 29.428  1.00 31.46  ? 137  PHE A CA  1 
ATOM   1066 C C   . PHE A 1 136 ? 73.010  37.255 28.799  1.00 29.46  ? 137  PHE A C   1 
ATOM   1067 O O   . PHE A 1 136 ? 73.733  38.177 28.405  1.00 31.94  ? 137  PHE A O   1 
ATOM   1068 C CB  . PHE A 1 136 ? 73.771  34.912 28.381  1.00 26.54  ? 137  PHE A CB  1 
ATOM   1069 C CG  . PHE A 1 136 ? 74.164  33.588 28.956  1.00 28.33  ? 137  PHE A CG  1 
ATOM   1070 C CD1 . PHE A 1 136 ? 75.492  33.310 29.263  1.00 35.48  ? 137  PHE A CD1 1 
ATOM   1071 C CD2 . PHE A 1 136 ? 73.209  32.621 29.190  1.00 29.69  ? 137  PHE A CD2 1 
ATOM   1072 C CE1 . PHE A 1 136 ? 75.852  32.078 29.805  1.00 36.21  ? 137  PHE A CE1 1 
ATOM   1073 C CE2 . PHE A 1 136 ? 73.555  31.394 29.729  1.00 31.34  ? 137  PHE A CE2 1 
ATOM   1074 C CZ  . PHE A 1 136 ? 74.878  31.117 30.034  1.00 34.27  ? 137  PHE A CZ  1 
ATOM   1075 N N   . LEU A 1 137 ? 71.680  37.285 28.688  1.00 26.47  ? 138  LEU A N   1 
ATOM   1076 C CA  . LEU A 1 137 ? 70.986  38.475 28.202  1.00 28.58  ? 138  LEU A CA  1 
ATOM   1077 C C   . LEU A 1 137 ? 71.316  39.685 29.055  1.00 28.80  ? 138  LEU A C   1 
ATOM   1078 O O   . LEU A 1 137 ? 71.637  40.762 28.539  1.00 31.37  ? 138  LEU A O   1 
ATOM   1079 C CB  . LEU A 1 137 ? 69.475  38.232 28.194  1.00 29.41  ? 138  LEU A CB  1 
ATOM   1080 C CG  . LEU A 1 137 ? 68.832  37.994 26.835  1.00 31.98  ? 138  LEU A CG  1 
ATOM   1081 C CD1 . LEU A 1 137 ? 67.362  37.637 27.012  1.00 27.21  ? 138  LEU A CD1 1 
ATOM   1082 C CD2 . LEU A 1 137 ? 68.998  39.221 25.960  1.00 27.62  ? 138  LEU A CD2 1 
ATOM   1083 N N   . VAL A 1 138 ? 71.229  39.522 30.374  1.00 29.12  ? 139  VAL A N   1 
ATOM   1084 C CA  . VAL A 1 138 ? 71.467  40.634 31.286  1.00 30.91  ? 139  VAL A CA  1 
ATOM   1085 C C   . VAL A 1 138 ? 72.896  41.135 31.157  1.00 33.20  ? 139  VAL A C   1 
ATOM   1086 O O   . VAL A 1 138 ? 73.145  42.345 31.107  1.00 35.65  ? 139  VAL A O   1 
ATOM   1087 C CB  . VAL A 1 138 ? 71.142  40.200 32.723  1.00 29.70  ? 139  VAL A CB  1 
ATOM   1088 C CG1 . VAL A 1 138 ? 71.663  41.228 33.709  1.00 24.79  ? 139  VAL A CG1 1 
ATOM   1089 C CG2 . VAL A 1 138 ? 69.642  40.013 32.864  1.00 27.48  ? 139  VAL A CG2 1 
ATOM   1090 N N   . GLN A 1 139 ? 73.853  40.209 31.072  1.00 28.53  ? 140  GLN A N   1 
ATOM   1091 C CA  . GLN A 1 139 ? 75.240  40.637 31.000  1.00 32.11  ? 140  GLN A CA  1 
ATOM   1092 C C   . GLN A 1 139 ? 75.566  41.210 29.622  1.00 38.82  ? 140  GLN A C   1 
ATOM   1093 O O   . GLN A 1 139 ? 76.247  42.235 29.518  1.00 36.93  ? 140  GLN A O   1 
ATOM   1094 C CB  . GLN A 1 139 ? 76.161  39.474 31.355  1.00 34.40  ? 140  GLN A CB  1 
ATOM   1095 C CG  . GLN A 1 139 ? 77.593  39.902 31.675  1.00 54.88  ? 140  GLN A CG  1 
ATOM   1096 C CD  . GLN A 1 139 ? 78.407  40.152 30.431  1.00 66.13  ? 140  GLN A CD  1 
ATOM   1097 O OE1 . GLN A 1 139 ? 78.328  39.413 29.457  1.00 73.56  ? 140  GLN A OE1 1 
ATOM   1098 N NE2 . GLN A 1 139 ? 79.215  41.196 30.472  1.00 67.27  ? 140  GLN A NE2 1 
ATOM   1099 N N   . ALA A 1 140 ? 75.072  40.591 28.562  1.00 38.84  ? 141  ALA A N   1 
ATOM   1100 C CA  . ALA A 1 140 ? 75.396  41.067 27.219  1.00 39.09  ? 141  ALA A CA  1 
ATOM   1101 C C   . ALA A 1 140 ? 74.747  42.416 26.930  1.00 38.65  ? 141  ALA A C   1 
ATOM   1102 O O   . ALA A 1 140 ? 75.369  43.285 26.309  1.00 40.44  ? 141  ALA A O   1 
ATOM   1103 C CB  . ALA A 1 140 ? 74.965  40.039 26.170  1.00 32.88  ? 141  ALA A CB  1 
ATOM   1104 N N   . GLU A 1 141 ? 73.501  42.614 27.360  1.00 35.60  ? 142  GLU A N   1 
ATOM   1105 C CA  . GLU A 1 141 ? 72.739  43.776 26.927  1.00 38.70  ? 142  GLU A CA  1 
ATOM   1106 C C   . GLU A 1 141 ? 72.297  44.694 28.054  1.00 38.47  ? 142  GLU A C   1 
ATOM   1107 O O   . GLU A 1 141 ? 71.677  45.727 27.773  1.00 37.68  ? 142  GLU A O   1 
ATOM   1108 C CB  . GLU A 1 141 ? 71.518  43.331 26.112  1.00 38.58  ? 142  GLU A CB  1 
ATOM   1109 C CG  . GLU A 1 141 ? 71.901  42.619 24.820  1.00 35.54  ? 142  GLU A CG  1 
ATOM   1110 C CD  . GLU A 1 141 ? 72.525  43.562 23.809  1.00 38.92  ? 142  GLU A CD  1 
ATOM   1111 O OE1 . GLU A 1 141 ? 73.365  43.102 23.005  1.00 41.90  ? 142  GLU A OE1 1 
ATOM   1112 O OE2 . GLU A 1 141 ? 72.181  44.766 23.823  1.00 36.36  ? 142  GLU A OE2 1 
ATOM   1113 N N   . ARG A 1 142 ? 72.607  44.358 29.309  1.00 39.61  ? 143  ARG A N   1 
ATOM   1114 C CA  . ARG A 1 142 ? 72.405  45.254 30.450  1.00 40.67  ? 143  ARG A CA  1 
ATOM   1115 C C   . ARG A 1 142 ? 70.946  45.671 30.591  1.00 37.55  ? 143  ARG A C   1 
ATOM   1116 O O   . ARG A 1 142 ? 70.633  46.842 30.802  1.00 43.79  ? 143  ARG A O   1 
ATOM   1117 C CB  . ARG A 1 142 ? 73.317  46.481 30.368  1.00 42.31  ? 143  ARG A CB  1 
ATOM   1118 C CG  . ARG A 1 142 ? 74.796  46.140 30.359  1.00 57.17  ? 143  ARG A CG  1 
ATOM   1119 C CD  . ARG A 1 142 ? 75.144  45.121 31.441  1.00 70.95  ? 143  ARG A CD  1 
ATOM   1120 N NE  . ARG A 1 142 ? 76.505  44.612 31.289  1.00 82.55  ? 143  ARG A NE  1 
ATOM   1121 C CZ  . ARG A 1 142 ? 77.548  45.031 31.998  1.00 91.15  ? 143  ARG A CZ  1 
ATOM   1122 N NH1 . ARG A 1 142 ? 77.393  45.963 32.927  1.00 95.28  ? 143  ARG A NH1 1 
ATOM   1123 N NH2 . ARG A 1 142 ? 78.749  44.511 31.782  1.00 93.21  ? 143  ARG A NH2 1 
ATOM   1124 N N   . THR A 1 143 ? 70.048  44.707 30.458  1.00 33.35  ? 144  THR A N   1 
ATOM   1125 C CA  . THR A 1 143 ? 68.657  44.890 30.827  1.00 31.31  ? 144  THR A CA  1 
ATOM   1126 C C   . THR A 1 143 ? 68.400  44.203 32.160  1.00 31.41  ? 144  THR A C   1 
ATOM   1127 O O   . THR A 1 143 ? 69.263  43.521 32.715  1.00 31.28  ? 144  THR A O   1 
ATOM   1128 C CB  . THR A 1 143 ? 67.725  44.324 29.752  1.00 36.83  ? 144  THR A CB  1 
ATOM   1129 O OG1 . THR A 1 143 ? 67.930  42.910 29.649  1.00 39.81  ? 144  THR A OG1 1 
ATOM   1130 C CG2 . THR A 1 143 ? 68.013  44.972 28.407  1.00 38.01  ? 144  THR A CG2 1 
ATOM   1131 N N   . VAL A 1 144 ? 67.196  44.398 32.679  1.00 31.09  ? 145  VAL A N   1 
ATOM   1132 C CA  . VAL A 1 144 ? 66.687  43.603 33.783  1.00 30.63  ? 145  VAL A CA  1 
ATOM   1133 C C   . VAL A 1 144 ? 65.772  42.545 33.188  1.00 32.38  ? 145  VAL A C   1 
ATOM   1134 O O   . VAL A 1 144 ? 64.951  42.846 32.313  1.00 32.97  ? 145  VAL A O   1 
ATOM   1135 C CB  . VAL A 1 144 ? 65.954  44.476 34.816  1.00 28.32  ? 145  VAL A CB  1 
ATOM   1136 C CG1 . VAL A 1 144 ? 65.370  43.614 35.930  1.00 25.02  ? 145  VAL A CG1 1 
ATOM   1137 C CG2 . VAL A 1 144 ? 66.910  45.506 35.394  1.00 24.98  ? 145  VAL A CG2 1 
ATOM   1138 N N   . LEU A 1 145 ? 65.937  41.299 33.619  1.00 31.35  ? 146  LEU A N   1 
ATOM   1139 C CA  . LEU A 1 145 ? 65.138  40.191 33.115  1.00 24.93  ? 146  LEU A CA  1 
ATOM   1140 C C   . LEU A 1 145 ? 64.331  39.607 34.261  1.00 26.19  ? 146  LEU A C   1 
ATOM   1141 O O   . LEU A 1 145 ? 64.877  39.330 35.333  1.00 26.94  ? 146  LEU A O   1 
ATOM   1142 C CB  . LEU A 1 145 ? 66.018  39.108 32.481  1.00 31.35  ? 146  LEU A CB  1 
ATOM   1143 C CG  . LEU A 1 145 ? 65.380  37.902 31.764  1.00 43.00  ? 146  LEU A CG  1 
ATOM   1144 C CD1 . LEU A 1 145 ? 64.728  36.866 32.649  1.00 51.96  ? 146  LEU A CD1 1 
ATOM   1145 C CD2 . LEU A 1 145 ? 64.347  38.370 30.788  1.00 45.94  ? 146  LEU A CD2 1 
ATOM   1146 N N   . VAL A 1 146 ? 63.038  39.416 34.029  1.00 25.91  ? 147  VAL A N   1 
ATOM   1147 C CA  . VAL A 1 146 ? 62.153  38.762 34.981  1.00 22.90  ? 147  VAL A CA  1 
ATOM   1148 C C   . VAL A 1 146 ? 61.531  37.548 34.306  1.00 24.87  ? 147  VAL A C   1 
ATOM   1149 O O   . VAL A 1 146 ? 61.197  37.595 33.117  1.00 24.86  ? 147  VAL A O   1 
ATOM   1150 C CB  . VAL A 1 146 ? 61.058  39.725 35.492  1.00 24.74  ? 147  VAL A CB  1 
ATOM   1151 C CG1 . VAL A 1 146 ? 60.220  39.062 36.584  1.00 20.33  ? 147  VAL A CG1 1 
ATOM   1152 C CG2 . VAL A 1 146 ? 61.682  41.022 36.003  1.00 23.08  ? 147  VAL A CG2 1 
ATOM   1153 N N   . SER A 1 147 ? 61.381  36.458 35.064  1.00 24.71  ? 148  SER A N   1 
ATOM   1154 C CA  . SER A 1 147 ? 60.561  35.333 34.630  1.00 26.04  ? 148  SER A CA  1 
ATOM   1155 C C   . SER A 1 147 ? 59.756  34.827 35.818  1.00 28.86  ? 148  SER A C   1 
ATOM   1156 O O   . SER A 1 147 ? 60.197  34.929 36.965  1.00 26.99  ? 148  SER A O   1 
ATOM   1157 C CB  . SER A 1 147 ? 61.400  34.193 34.019  1.00 24.44  ? 148  SER A CB  1 
ATOM   1158 O OG  . SER A 1 147 ? 62.262  33.595 34.973  1.00 25.89  ? 148  SER A OG  1 
ATOM   1159 N N   . MET A 1 148 ? 58.556  34.303 35.544  1.00 24.58  ? 149  MET A N   1 
ATOM   1160 C CA  . MET A 1 148 ? 57.705  33.785 36.608  1.00 26.10  ? 149  MET A CA  1 
ATOM   1161 C C   . MET A 1 148 ? 57.259  32.366 36.292  1.00 28.14  ? 149  MET A C   1 
ATOM   1162 O O   . MET A 1 148 ? 57.188  31.960 35.128  1.00 22.62  ? 149  MET A O   1 
ATOM   1163 C CB  . MET A 1 148 ? 56.459  34.676 36.867  1.00 16.38  ? 149  MET A CB  1 
ATOM   1164 C CG  . MET A 1 148 ? 55.220  34.404 35.988  1.00 24.70  ? 149  MET A CG  1 
ATOM   1165 S SD  . MET A 1 148 ? 55.588  34.588 34.235  1.00 28.79  ? 149  MET A SD  1 
ATOM   1166 C CE  . MET A 1 148 ? 55.845  36.339 34.035  1.00 25.51  ? 149  MET A CE  1 
ATOM   1167 N N   . ASN A 1 149 ? 56.978  31.610 37.352  1.00 23.61  ? 150  ASN A N   1 
ATOM   1168 C CA  . ASN A 1 149 ? 56.209  30.384 37.225  1.00 22.05  ? 150  ASN A CA  1 
ATOM   1169 C C   . ASN A 1 149 ? 54.722  30.702 37.314  1.00 22.24  ? 150  ASN A C   1 
ATOM   1170 O O   . ASN A 1 149 ? 54.308  31.618 38.026  1.00 24.10  ? 150  ASN A O   1 
ATOM   1171 C CB  . ASN A 1 149 ? 56.598  29.366 38.299  1.00 20.82  ? 150  ASN A CB  1 
ATOM   1172 C CG  . ASN A 1 149 ? 57.794  28.524 37.892  1.00 25.74  ? 150  ASN A CG  1 
ATOM   1173 O OD1 . ASN A 1 149 ? 58.497  28.846 36.933  1.00 25.45  ? 150  ASN A OD1 1 
ATOM   1174 N ND2 . ASN A 1 149 ? 58.028  27.438 38.616  1.00 26.79  ? 150  ASN A ND2 1 
ATOM   1175 N N   . TYR A 1 150 ? 53.926  29.958 36.556  1.00 22.54  ? 151  TYR A N   1 
ATOM   1176 C CA  . TYR A 1 150 ? 52.479  30.071 36.608  1.00 18.85  ? 151  TYR A CA  1 
ATOM   1177 C C   . TYR A 1 150 ? 51.897  28.672 36.506  1.00 20.61  ? 151  TYR A C   1 
ATOM   1178 O O   . TYR A 1 150 ? 52.495  27.777 35.898  1.00 23.70  ? 151  TYR A O   1 
ATOM   1179 C CB  . TYR A 1 150 ? 51.928  30.975 35.486  1.00 19.44  ? 151  TYR A CB  1 
ATOM   1180 C CG  . TYR A 1 150 ? 52.203  30.484 34.076  1.00 21.77  ? 151  TYR A CG  1 
ATOM   1181 C CD1 . TYR A 1 150 ? 53.354  30.866 33.393  1.00 20.48  ? 151  TYR A CD1 1 
ATOM   1182 C CD2 . TYR A 1 150 ? 51.305  29.646 33.424  1.00 24.09  ? 151  TYR A CD2 1 
ATOM   1183 C CE1 . TYR A 1 150 ? 53.605  30.423 32.096  1.00 20.29  ? 151  TYR A CE1 1 
ATOM   1184 C CE2 . TYR A 1 150 ? 51.545  29.199 32.128  1.00 21.17  ? 151  TYR A CE2 1 
ATOM   1185 C CZ  . TYR A 1 150 ? 52.696  29.589 31.471  1.00 19.47  ? 151  TYR A CZ  1 
ATOM   1186 O OH  . TYR A 1 150 ? 52.935  29.142 30.187  1.00 19.66  ? 151  TYR A OH  1 
ATOM   1187 N N   . ARG A 1 151 ? 50.730  28.489 37.112  1.00 20.03  ? 152  ARG A N   1 
ATOM   1188 C CA  . ARG A 1 151 ? 50.113  27.173 37.154  1.00 21.15  ? 152  ARG A CA  1 
ATOM   1189 C C   . ARG A 1 151 ? 49.706  26.720 35.758  1.00 22.89  ? 152  ARG A C   1 
ATOM   1190 O O   . ARG A 1 151 ? 49.209  27.507 34.947  1.00 22.63  ? 152  ARG A O   1 
ATOM   1191 C CB  . ARG A 1 151 ? 48.903  27.189 38.084  1.00 21.35  ? 152  ARG A CB  1 
ATOM   1192 C CG  . ARG A 1 151 ? 49.269  27.217 39.572  1.00 18.36  ? 152  ARG A CG  1 
ATOM   1193 C CD  . ARG A 1 151 ? 48.021  27.444 40.427  1.00 21.68  ? 152  ARG A CD  1 
ATOM   1194 N NE  . ARG A 1 151 ? 47.625  28.849 40.437  1.00 22.55  ? 152  ARG A NE  1 
ATOM   1195 C CZ  . ARG A 1 151 ? 46.521  29.315 41.011  1.00 26.32  ? 152  ARG A CZ  1 
ATOM   1196 N NH1 . ARG A 1 151 ? 45.683  28.484 41.622  1.00 21.39  ? 152  ARG A NH1 1 
ATOM   1197 N NH2 . ARG A 1 151 ? 46.252  30.615 40.971  1.00 23.50  ? 152  ARG A NH2 1 
ATOM   1198 N N   . VAL A 1 152 ? 49.924  25.436 35.483  1.00 21.11  ? 153  VAL A N   1 
ATOM   1199 C CA  . VAL A 1 152 ? 49.616  24.839 34.195  1.00 20.02  ? 153  VAL A CA  1 
ATOM   1200 C C   . VAL A 1 152 ? 48.685  23.649 34.413  1.00 25.56  ? 153  VAL A C   1 
ATOM   1201 O O   . VAL A 1 152 ? 48.415  23.236 35.542  1.00 24.15  ? 153  VAL A O   1 
ATOM   1202 C CB  . VAL A 1 152 ? 50.886  24.412 33.439  1.00 20.97  ? 153  VAL A CB  1 
ATOM   1203 C CG1 . VAL A 1 152 ? 51.722  25.633 33.081  1.00 19.19  ? 153  VAL A CG1 1 
ATOM   1204 C CG2 . VAL A 1 152 ? 51.690  23.443 34.286  1.00 18.10  ? 153  VAL A CG2 1 
ATOM   1205 N N   . GLY A 1 153 ? 48.184  23.107 33.305  1.00 25.06  ? 154  GLY A N   1 
ATOM   1206 C CA  . GLY A 1 153 ? 47.300  21.963 33.397  1.00 22.69  ? 154  GLY A CA  1 
ATOM   1207 C C   . GLY A 1 153 ? 46.025  22.301 34.147  1.00 25.89  ? 154  GLY A C   1 
ATOM   1208 O O   . GLY A 1 153 ? 45.552  23.443 34.156  1.00 25.57  ? 154  GLY A O   1 
ATOM   1209 N N   . ALA A 1 154 ? 45.460  21.283 34.798  1.00 23.78  ? 155  ALA A N   1 
ATOM   1210 C CA  . ALA A 1 154 ? 44.211  21.484 35.524  1.00 25.00  ? 155  ALA A CA  1 
ATOM   1211 C C   . ALA A 1 154 ? 44.356  22.546 36.614  1.00 28.40  ? 155  ALA A C   1 
ATOM   1212 O O   . ALA A 1 154 ? 43.439  23.348 36.830  1.00 28.03  ? 155  ALA A O   1 
ATOM   1213 C CB  . ALA A 1 154 ? 43.734  20.159 36.121  1.00 23.72  ? 155  ALA A CB  1 
ATOM   1214 N N   . PHE A 1 155 ? 45.499  22.574 37.309  1.00 20.31  ? 156  PHE A N   1 
ATOM   1215 C CA  . PHE A 1 155 ? 45.681  23.529 38.402  1.00 28.08  ? 156  PHE A CA  1 
ATOM   1216 C C   . PHE A 1 155 ? 45.648  24.970 37.917  1.00 25.03  ? 156  PHE A C   1 
ATOM   1217 O O   . PHE A 1 155 ? 45.314  25.876 38.691  1.00 24.21  ? 156  PHE A O   1 
ATOM   1218 C CB  . PHE A 1 155 ? 46.991  23.248 39.140  1.00 24.47  ? 156  PHE A CB  1 
ATOM   1219 C CG  . PHE A 1 155 ? 47.214  21.794 39.398  1.00 29.34  ? 156  PHE A CG  1 
ATOM   1220 C CD1 . PHE A 1 155 ? 47.903  21.019 38.482  1.00 30.55  ? 156  PHE A CD1 1 
ATOM   1221 C CD2 . PHE A 1 155 ? 46.652  21.181 40.510  1.00 24.22  ? 156  PHE A CD2 1 
ATOM   1222 C CE1 . PHE A 1 155 ? 48.076  19.657 38.688  1.00 24.00  ? 156  PHE A CE1 1 
ATOM   1223 C CE2 . PHE A 1 155 ? 46.819  19.818 40.733  1.00 26.51  ? 156  PHE A CE2 1 
ATOM   1224 C CZ  . PHE A 1 155 ? 47.531  19.051 39.817  1.00 28.30  ? 156  PHE A CZ  1 
ATOM   1225 N N   . GLY A 1 156 ? 45.988  25.205 36.653  1.00 21.21  ? 157  GLY A N   1 
ATOM   1226 C CA  . GLY A 1 156 ? 45.990  26.553 36.131  1.00 22.58  ? 157  GLY A CA  1 
ATOM   1227 C C   . GLY A 1 156 ? 44.783  26.894 35.284  1.00 24.26  ? 157  GLY A C   1 
ATOM   1228 O O   . GLY A 1 156 ? 44.430  28.071 35.158  1.00 28.59  ? 157  GLY A O   1 
ATOM   1229 N N   . PHE A 1 157 ? 44.141  25.890 34.686  1.00 23.08  ? 158  PHE A N   1 
ATOM   1230 C CA  . PHE A 1 157 ? 43.165  26.200 33.648  1.00 26.44  ? 158  PHE A CA  1 
ATOM   1231 C C   . PHE A 1 157 ? 41.957  25.287 33.626  1.00 26.82  ? 158  PHE A C   1 
ATOM   1232 O O   . PHE A 1 157 ? 41.139  25.421 32.705  1.00 24.81  ? 158  PHE A O   1 
ATOM   1233 C CB  . PHE A 1 157 ? 43.849  26.197 32.266  1.00 20.19  ? 158  PHE A CB  1 
ATOM   1234 C CG  . PHE A 1 157 ? 44.905  27.238 32.150  1.00 20.35  ? 158  PHE A CG  1 
ATOM   1235 C CD1 . PHE A 1 157 ? 46.232  26.913 32.342  1.00 18.99  ? 158  PHE A CD1 1 
ATOM   1236 C CD2 . PHE A 1 157 ? 44.563  28.567 31.930  1.00 21.94  ? 158  PHE A CD2 1 
ATOM   1237 C CE1 . PHE A 1 157 ? 47.224  27.886 32.272  1.00 21.51  ? 158  PHE A CE1 1 
ATOM   1238 C CE2 . PHE A 1 157 ? 45.545  29.550 31.861  1.00 25.42  ? 158  PHE A CE2 1 
ATOM   1239 C CZ  . PHE A 1 157 ? 46.880  29.206 32.039  1.00 22.86  ? 158  PHE A CZ  1 
ATOM   1240 N N   . LEU A 1 158 ? 41.804  24.373 34.581  1.00 21.38  ? 159  LEU A N   1 
ATOM   1241 C CA  . LEU A 1 158 ? 40.514  23.724 34.730  1.00 26.15  ? 159  LEU A CA  1 
ATOM   1242 C C   . LEU A 1 158 ? 39.471  24.797 34.986  1.00 27.41  ? 159  LEU A C   1 
ATOM   1243 O O   . LEU A 1 158 ? 39.656  25.667 35.840  1.00 33.41  ? 159  LEU A O   1 
ATOM   1244 C CB  . LEU A 1 158 ? 40.533  22.705 35.864  1.00 25.01  ? 159  LEU A CB  1 
ATOM   1245 C CG  . LEU A 1 158 ? 39.209  21.946 36.009  1.00 31.35  ? 159  LEU A CG  1 
ATOM   1246 C CD1 . LEU A 1 158 ? 39.455  20.467 36.243  1.00 29.29  ? 159  LEU A CD1 1 
ATOM   1247 C CD2 . LEU A 1 158 ? 38.360  22.524 37.130  1.00 28.86  ? 159  LEU A CD2 1 
ATOM   1248 N N   . ALA A 1 159 ? 38.383  24.753 34.228  1.00 30.78  ? 160  ALA A N   1 
ATOM   1249 C CA  . ALA A 1 159 ? 37.350  25.771 34.319  1.00 30.65  ? 160  ALA A CA  1 
ATOM   1250 C C   . ALA A 1 159 ? 35.989  25.109 34.416  1.00 30.39  ? 160  ALA A C   1 
ATOM   1251 O O   . ALA A 1 159 ? 35.651  24.246 33.598  1.00 30.82  ? 160  ALA A O   1 
ATOM   1252 C CB  . ALA A 1 159 ? 37.395  26.715 33.106  1.00 26.36  ? 160  ALA A CB  1 
ATOM   1253 N N   . LEU A 1 160 ? 35.214  25.503 35.422  1.00 29.44  ? 161  LEU A N   1 
ATOM   1254 C CA  . LEU A 1 160 ? 33.769  25.317 35.385  1.00 33.28  ? 161  LEU A CA  1 
ATOM   1255 C C   . LEU A 1 160 ? 33.163  26.709 35.297  1.00 36.93  ? 161  LEU A C   1 
ATOM   1256 O O   . LEU A 1 160 ? 32.873  27.336 36.325  1.00 41.39  ? 161  LEU A O   1 
ATOM   1257 C CB  . LEU A 1 160 ? 33.265  24.550 36.607  1.00 31.02  ? 161  LEU A CB  1 
ATOM   1258 C CG  . LEU A 1 160 ? 33.854  23.139 36.679  1.00 37.32  ? 161  LEU A CG  1 
ATOM   1259 C CD1 . LEU A 1 160 ? 33.756  22.620 38.097  1.00 33.01  ? 161  LEU A CD1 1 
ATOM   1260 C CD2 . LEU A 1 160 ? 33.157  22.194 35.682  1.00 36.80  ? 161  LEU A CD2 1 
ATOM   1261 N N   . PRO A 1 161 ? 32.990  27.249 34.089  1.00 35.41  ? 162  PRO A N   1 
ATOM   1262 C CA  . PRO A 1 161 ? 32.675  28.678 33.944  1.00 35.88  ? 162  PRO A CA  1 
ATOM   1263 C C   . PRO A 1 161 ? 31.440  29.076 34.733  1.00 34.66  ? 162  PRO A C   1 
ATOM   1264 O O   . PRO A 1 161 ? 30.468  28.322 34.825  1.00 33.98  ? 162  PRO A O   1 
ATOM   1265 C CB  . PRO A 1 161 ? 32.461  28.844 32.434  1.00 38.79  ? 162  PRO A CB  1 
ATOM   1266 C CG  . PRO A 1 161 ? 33.222  27.705 31.814  1.00 35.83  ? 162  PRO A CG  1 
ATOM   1267 C CD  . PRO A 1 161 ? 33.153  26.570 32.794  1.00 32.75  ? 162  PRO A CD  1 
ATOM   1268 N N   . GLY A 1 162 ? 31.491  30.274 35.309  1.00 38.32  ? 163  GLY A N   1 
ATOM   1269 C CA  . GLY A 1 162 ? 30.464  30.740 36.211  1.00 36.53  ? 163  GLY A CA  1 
ATOM   1270 C C   . GLY A 1 162 ? 30.661  30.330 37.655  1.00 42.02  ? 163  GLY A C   1 
ATOM   1271 O O   . GLY A 1 162 ? 30.074  30.954 38.548  1.00 48.28  ? 163  GLY A O   1 
ATOM   1272 N N   . SER A 1 163 ? 31.470  29.308 37.916  1.00 41.86  ? 164  SER A N   1 
ATOM   1273 C CA  . SER A 1 163 ? 31.704  28.879 39.288  1.00 39.95  ? 164  SER A CA  1 
ATOM   1274 C C   . SER A 1 163 ? 32.592  29.866 40.035  1.00 39.48  ? 164  SER A C   1 
ATOM   1275 O O   . SER A 1 163 ? 33.402  30.597 39.454  1.00 40.58  ? 164  SER A O   1 
ATOM   1276 C CB  . SER A 1 163 ? 32.361  27.500 39.325  1.00 33.67  ? 164  SER A CB  1 
ATOM   1277 O OG  . SER A 1 163 ? 33.774  27.632 39.250  1.00 45.09  ? 164  SER A OG  1 
ATOM   1278 N N   . ARG A 1 164 ? 32.447  29.860 41.351  1.00 44.76  ? 165  ARG A N   1 
ATOM   1279 C CA  . ARG A 1 164 ? 33.374  30.588 42.198  1.00 51.46  ? 165  ARG A CA  1 
ATOM   1280 C C   . ARG A 1 164 ? 34.614  29.777 42.534  1.00 40.90  ? 165  ARG A C   1 
ATOM   1281 O O   . ARG A 1 164 ? 35.687  30.356 42.731  1.00 36.91  ? 165  ARG A O   1 
ATOM   1282 C CB  . ARG A 1 164 ? 32.676  31.027 43.489  1.00 69.03  ? 165  ARG A CB  1 
ATOM   1283 C CG  . ARG A 1 164 ? 33.461  32.040 44.313  1.00 85.50  ? 165  ARG A CG  1 
ATOM   1284 C CD  . ARG A 1 164 ? 33.881  33.254 43.458  1.00 95.84  ? 165  ARG A CD  1 
ATOM   1285 N NE  . ARG A 1 164 ? 32.880  33.601 42.451  1.00 106.25 ? 165  ARG A NE  1 
ATOM   1286 C CZ  . ARG A 1 164 ? 32.742  34.814 41.906  1.00 110.80 ? 165  ARG A CZ  1 
ATOM   1287 N NH1 . ARG A 1 164 ? 33.529  35.808 42.278  1.00 110.32 ? 165  ARG A NH1 1 
ATOM   1288 N NH2 . ARG A 1 164 ? 31.804  35.030 40.992  1.00 112.57 ? 165  ARG A NH2 1 
ATOM   1289 N N   . GLU A 1 165 ? 34.444  28.487 42.667  1.00 37.05  ? 166  GLU A N   1 
ATOM   1290 C CA  . GLU A 1 165 ? 35.477  27.534 42.996  1.00 35.00  ? 166  GLU A CA  1 
ATOM   1291 C C   . GLU A 1 165 ? 36.552  27.238 41.993  1.00 36.03  ? 166  GLU A C   1 
ATOM   1292 O O   . GLU A 1 165 ? 37.633  26.925 42.350  1.00 36.22  ? 166  GLU A O   1 
ATOM   1293 C CB  . GLU A 1 165 ? 34.856  26.224 43.364  1.00 44.81  ? 166  GLU A CB  1 
ATOM   1294 C CG  . GLU A 1 165 ? 34.733  26.074 44.826  1.00 61.72  ? 166  GLU A CG  1 
ATOM   1295 C CD  . GLU A 1 165 ? 33.910  27.170 45.383  1.00 84.17  ? 166  GLU A CD  1 
ATOM   1296 O OE1 . GLU A 1 165 ? 34.435  27.927 46.224  1.00 96.04  ? 166  GLU A OE1 1 
ATOM   1297 O OE2 . GLU A 1 165 ? 32.758  27.266 44.934  1.00 90.53  ? 166  GLU A OE2 1 
ATOM   1298 N N   . ALA A 1 166 ? 36.189  27.265 40.738  1.00 31.24  ? 167  ALA A N   1 
ATOM   1299 C CA  . ALA A 1 166 ? 37.102  26.953 39.634  1.00 29.91  ? 167  ALA A CA  1 
ATOM   1300 C C   . ALA A 1 166 ? 36.750  27.831 38.441  1.00 32.28  ? 167  ALA A C   1 
ATOM   1301 O O   . ALA A 1 166 ? 36.242  27.354 37.422  1.00 27.60  ? 167  ALA A O   1 
ATOM   1302 C CB  . ALA A 1 166 ? 37.033  25.469 39.274  1.00 28.14  ? 167  ALA A CB  1 
ATOM   1303 N N   . PRO A 1 167 ? 37.023  29.136 38.535  1.00 36.03  ? 168  PRO A N   1 
ATOM   1304 C CA  . PRO A 1 167 ? 36.582  30.056 37.473  1.00 37.79  ? 168  PRO A CA  1 
ATOM   1305 C C   . PRO A 1 167 ? 37.353  29.911 36.176  1.00 38.45  ? 168  PRO A C   1 
ATOM   1306 O O   . PRO A 1 167 ? 36.894  30.415 35.143  1.00 37.26  ? 168  PRO A O   1 
ATOM   1307 C CB  . PRO A 1 167 ? 36.808  31.440 38.092  1.00 39.98  ? 168  PRO A CB  1 
ATOM   1308 C CG  . PRO A 1 167 ? 37.950  31.219 39.057  1.00 36.28  ? 168  PRO A CG  1 
ATOM   1309 C CD  . PRO A 1 167 ? 37.729  29.840 39.623  1.00 30.62  ? 168  PRO A CD  1 
ATOM   1310 N N   . GLY A 1 168 ? 38.501  29.248 36.187  1.00 33.28  ? 169  GLY A N   1 
ATOM   1311 C CA  . GLY A 1 168 ? 39.341  29.176 35.013  1.00 28.85  ? 169  GLY A CA  1 
ATOM   1312 C C   . GLY A 1 168 ? 40.288  30.358 34.908  1.00 29.03  ? 169  GLY A C   1 
ATOM   1313 O O   . GLY A 1 168 ? 40.157  31.377 35.594  1.00 29.91  ? 169  GLY A O   1 
ATOM   1314 N N   . ASN A 1 169 ? 41.278  30.200 34.034  1.00 26.88  ? 170  ASN A N   1 
ATOM   1315 C CA  . ASN A 1 169 ? 42.255  31.231 33.697  1.00 28.33  ? 170  ASN A CA  1 
ATOM   1316 C C   . ASN A 1 169 ? 43.132  31.653 34.871  1.00 23.75  ? 170  ASN A C   1 
ATOM   1317 O O   . ASN A 1 169 ? 43.813  32.680 34.779  1.00 26.41  ? 170  ASN A O   1 
ATOM   1318 C CB  . ASN A 1 169 ? 41.581  32.473 33.076  1.00 22.71  ? 170  ASN A CB  1 
ATOM   1319 C CG  . ASN A 1 169 ? 40.910  32.167 31.744  1.00 32.07  ? 170  ASN A CG  1 
ATOM   1320 O OD1 . ASN A 1 169 ? 41.465  31.495 30.864  1.00 30.04  ? 170  ASN A OD1 1 
ATOM   1321 N ND2 . ASN A 1 169 ? 39.714  32.688 31.584  1.00 20.80  ? 170  ASN A ND2 1 
ATOM   1322 N N   . VAL A 1 170 ? 43.169  30.888 35.968  1.00 21.89  ? 171  VAL A N   1 
ATOM   1323 C CA  . VAL A 1 170 ? 43.945  31.358 37.116  1.00 23.65  ? 171  VAL A CA  1 
ATOM   1324 C C   . VAL A 1 170 ? 45.440  31.342 36.797  1.00 28.62  ? 171  VAL A C   1 
ATOM   1325 O O   . VAL A 1 170 ? 46.200  32.168 37.317  1.00 30.26  ? 171  VAL A O   1 
ATOM   1326 C CB  . VAL A 1 170 ? 43.606  30.559 38.397  1.00 26.59  ? 171  VAL A CB  1 
ATOM   1327 C CG1 . VAL A 1 170 ? 42.119  30.674 38.714  1.00 25.57  ? 171  VAL A CG1 1 
ATOM   1328 C CG2 . VAL A 1 170 ? 44.026  29.092 38.290  1.00 20.85  ? 171  VAL A CG2 1 
ATOM   1329 N N   . GLY A 1 171 ? 45.881  30.447 35.909  1.00 27.17  ? 172  GLY A N   1 
ATOM   1330 C CA  . GLY A 1 171 ? 47.255  30.509 35.432  1.00 18.89  ? 172  GLY A CA  1 
ATOM   1331 C C   . GLY A 1 171 ? 47.587  31.820 34.741  1.00 21.82  ? 172  GLY A C   1 
ATOM   1332 O O   . GLY A 1 171 ? 48.717  32.304 34.832  1.00 21.93  ? 172  GLY A O   1 
ATOM   1333 N N   . LEU A 1 172 ? 46.613  32.414 34.045  1.00 22.20  ? 173  LEU A N   1 
ATOM   1334 C CA  . LEU A 1 172 ? 46.821  33.741 33.467  1.00 21.86  ? 173  LEU A CA  1 
ATOM   1335 C C   . LEU A 1 172 ? 46.847  34.820 34.543  1.00 22.92  ? 173  LEU A C   1 
ATOM   1336 O O   . LEU A 1 172 ? 47.576  35.810 34.410  1.00 24.54  ? 173  LEU A O   1 
ATOM   1337 C CB  . LEU A 1 172 ? 45.732  34.059 32.435  1.00 19.92  ? 173  LEU A CB  1 
ATOM   1338 C CG  . LEU A 1 172 ? 45.750  33.318 31.100  1.00 24.64  ? 173  LEU A CG  1 
ATOM   1339 C CD1 . LEU A 1 172 ? 44.576  33.754 30.208  1.00 21.03  ? 173  LEU A CD1 1 
ATOM   1340 C CD2 . LEU A 1 172 ? 47.088  33.554 30.403  1.00 20.14  ? 173  LEU A CD2 1 
ATOM   1341 N N   . LEU A 1 173 ? 46.058  34.652 35.605  1.00 24.73  ? 174  LEU A N   1 
ATOM   1342 C CA  . LEU A 1 173 ? 46.086  35.616 36.700  1.00 26.40  ? 174  LEU A CA  1 
ATOM   1343 C C   . LEU A 1 173 ? 47.389  35.531 37.487  1.00 26.33  ? 174  LEU A C   1 
ATOM   1344 O O   . LEU A 1 173 ? 47.859  36.549 38.008  1.00 26.56  ? 174  LEU A O   1 
ATOM   1345 C CB  . LEU A 1 173 ? 44.884  35.400 37.611  1.00 23.49  ? 174  LEU A CB  1 
ATOM   1346 C CG  . LEU A 1 173 ? 43.534  35.709 36.954  1.00 29.61  ? 174  LEU A CG  1 
ATOM   1347 C CD1 . LEU A 1 173 ? 42.372  35.314 37.852  1.00 27.02  ? 174  LEU A CD1 1 
ATOM   1348 C CD2 . LEU A 1 173 ? 43.437  37.186 36.594  1.00 29.84  ? 174  LEU A CD2 1 
ATOM   1349 N N   . ASP A 1 174 ? 47.986  34.335 37.577  1.00 23.20  ? 175  ASP A N   1 
ATOM   1350 C CA  . ASP A 1 174 ? 49.336  34.214 38.120  1.00 20.48  ? 175  ASP A CA  1 
ATOM   1351 C C   . ASP A 1 174 ? 50.313  35.095 37.349  1.00 26.72  ? 175  ASP A C   1 
ATOM   1352 O O   . ASP A 1 174 ? 51.076  35.867 37.941  1.00 25.14  ? 175  ASP A O   1 
ATOM   1353 C CB  . ASP A 1 174 ? 49.811  32.758 38.079  1.00 20.51  ? 175  ASP A CB  1 
ATOM   1354 C CG  . ASP A 1 174 ? 48.959  31.822 38.924  1.00 26.70  ? 175  ASP A CG  1 
ATOM   1355 O OD1 . ASP A 1 174 ? 48.237  32.292 39.827  1.00 25.49  ? 175  ASP A OD1 1 
ATOM   1356 O OD2 . ASP A 1 174 ? 49.054  30.594 38.703  1.00 26.52  ? 175  ASP A OD2 1 
ATOM   1357 N N   . GLN A 1 175 ? 50.300  34.985 36.017  1.00 24.63  ? 176  GLN A N   1 
ATOM   1358 C CA  . GLN A 1 175 ? 51.142  35.850 35.198  1.00 23.76  ? 176  GLN A CA  1 
ATOM   1359 C C   . GLN A 1 175 ? 50.825  37.314 35.456  1.00 23.42  ? 176  GLN A C   1 
ATOM   1360 O O   . GLN A 1 175 ? 51.736  38.138 35.613  1.00 27.31  ? 176  GLN A O   1 
ATOM   1361 C CB  . GLN A 1 175 ? 50.960  35.523 33.712  1.00 27.49  ? 176  GLN A CB  1 
ATOM   1362 C CG  . GLN A 1 175 ? 51.315  34.100 33.306  1.00 23.07  ? 176  GLN A CG  1 
ATOM   1363 C CD  . GLN A 1 175 ? 50.956  33.827 31.853  1.00 24.93  ? 176  GLN A CD  1 
ATOM   1364 O OE1 . GLN A 1 175 ? 50.643  34.753 31.098  1.00 24.38  ? 176  GLN A OE1 1 
ATOM   1365 N NE2 . GLN A 1 175 ? 50.989  32.557 31.456  1.00 19.43  ? 176  GLN A NE2 1 
ATOM   1366 N N   . ARG A 1 176 ? 49.538  37.656 35.521  1.00 22.55  ? 177  ARG A N   1 
ATOM   1367 C CA  . ARG A 1 176 ? 49.171  39.049 35.748  1.00 27.97  ? 177  ARG A CA  1 
ATOM   1368 C C   . ARG A 1 176 ? 49.682  39.542 37.093  1.00 30.70  ? 177  ARG A C   1 
ATOM   1369 O O   . ARG A 1 176 ? 50.230  40.648 37.187  1.00 30.08  ? 177  ARG A O   1 
ATOM   1370 C CB  . ARG A 1 176 ? 47.659  39.228 35.667  1.00 24.27  ? 177  ARG A CB  1 
ATOM   1371 C CG  . ARG A 1 176 ? 47.240  40.653 36.011  1.00 30.89  ? 177  ARG A CG  1 
ATOM   1372 C CD  . ARG A 1 176 ? 45.755  40.840 35.886  1.00 31.03  ? 177  ARG A CD  1 
ATOM   1373 N NE  . ARG A 1 176 ? 45.337  40.851 34.493  1.00 36.31  ? 177  ARG A NE  1 
ATOM   1374 C CZ  . ARG A 1 176 ? 44.076  40.726 34.096  1.00 38.60  ? 177  ARG A CZ  1 
ATOM   1375 N NH1 . ARG A 1 176 ? 43.113  40.565 34.998  1.00 36.77  ? 177  ARG A NH1 1 
ATOM   1376 N NH2 . ARG A 1 176 ? 43.781  40.755 32.800  1.00 33.10  ? 177  ARG A NH2 1 
ATOM   1377 N N   . LEU A 1 177 ? 49.508  38.739 38.148  1.00 25.93  ? 178  LEU A N   1 
ATOM   1378 C CA  . LEU A 1 177 ? 49.993  39.144 39.463  1.00 28.35  ? 178  LEU A CA  1 
ATOM   1379 C C   . LEU A 1 177 ? 51.500  39.369 39.429  1.00 26.29  ? 178  LEU A C   1 
ATOM   1380 O O   . LEU A 1 177 ? 52.008  40.312 40.046  1.00 31.03  ? 178  LEU A O   1 
ATOM   1381 C CB  . LEU A 1 177 ? 49.611  38.099 40.518  1.00 23.78  ? 178  LEU A CB  1 
ATOM   1382 C CG  . LEU A 1 177 ? 50.099  38.317 41.950  1.00 27.09  ? 178  LEU A CG  1 
ATOM   1383 C CD1 . LEU A 1 177 ? 49.575  39.666 42.470  1.00 24.58  ? 178  LEU A CD1 1 
ATOM   1384 C CD2 . LEU A 1 177 ? 49.628  37.180 42.877  1.00 21.96  ? 178  LEU A CD2 1 
ATOM   1385 N N   . ALA A 1 178 ? 52.226  38.537 38.677  1.00 23.22  ? 179  ALA A N   1 
ATOM   1386 C CA  . ALA A 1 178 ? 53.667  38.732 38.534  1.00 25.22  ? 179  ALA A CA  1 
ATOM   1387 C C   . ALA A 1 178 ? 53.983  40.042 37.819  1.00 27.62  ? 179  ALA A C   1 
ATOM   1388 O O   . ALA A 1 178 ? 54.967  40.712 38.152  1.00 26.68  ? 179  ALA A O   1 
ATOM   1389 C CB  . ALA A 1 178 ? 54.286  37.549 37.790  1.00 23.21  ? 179  ALA A CB  1 
ATOM   1390 N N   . LEU A 1 179 ? 53.164  40.424 36.832  1.00 25.59  ? 180  LEU A N   1 
ATOM   1391 C CA  . LEU A 1 179 ? 53.376  41.696 36.145  1.00 24.55  ? 180  LEU A CA  1 
ATOM   1392 C C   . LEU A 1 179 ? 53.062  42.880 37.055  1.00 30.17  ? 180  LEU A C   1 
ATOM   1393 O O   . LEU A 1 179 ? 53.727  43.922 36.984  1.00 31.65  ? 180  LEU A O   1 
ATOM   1394 C CB  . LEU A 1 179 ? 52.534  41.766 34.875  1.00 22.15  ? 180  LEU A CB  1 
ATOM   1395 C CG  . LEU A 1 179 ? 52.845  40.700 33.828  1.00 27.75  ? 180  LEU A CG  1 
ATOM   1396 C CD1 . LEU A 1 179 ? 51.845  40.761 32.666  1.00 26.46  ? 180  LEU A CD1 1 
ATOM   1397 C CD2 . LEU A 1 179 ? 54.303  40.831 33.378  1.00 29.25  ? 180  LEU A CD2 1 
ATOM   1398 N N   . GLN A 1 180 ? 52.034  42.749 37.895  1.00 28.03  ? 181  GLN A N   1 
ATOM   1399 C CA  . GLN A 1 180 ? 51.781  43.767 38.910  1.00 34.16  ? 181  GLN A CA  1 
ATOM   1400 C C   . GLN A 1 180 ? 52.941  43.856 39.895  1.00 34.45  ? 181  GLN A C   1 
ATOM   1401 O O   . GLN A 1 180 ? 53.310  44.953 40.334  1.00 31.72  ? 181  GLN A O   1 
ATOM   1402 C CB  . GLN A 1 180 ? 50.470  43.463 39.637  1.00 30.46  ? 181  GLN A CB  1 
ATOM   1403 C CG  . GLN A 1 180 ? 49.256  43.473 38.721  1.00 39.27  ? 181  GLN A CG  1 
ATOM   1404 C CD  . GLN A 1 180 ? 48.004  42.929 39.392  1.00 40.83  ? 181  GLN A CD  1 
ATOM   1405 O OE1 . GLN A 1 180 ? 48.081  42.177 40.359  1.00 43.86  ? 181  GLN A OE1 1 
ATOM   1406 N NE2 . GLN A 1 180 ? 46.846  43.310 38.877  1.00 36.54  ? 181  GLN A NE2 1 
ATOM   1407 N N   . TRP A 1 181 ? 53.535  42.710 40.245  1.00 30.03  ? 182  TRP A N   1 
ATOM   1408 C CA  . TRP A 1 181 ? 54.708  42.715 41.115  1.00 30.63  ? 182  TRP A CA  1 
ATOM   1409 C C   . TRP A 1 181 ? 55.852  43.491 40.477  1.00 29.25  ? 182  TRP A C   1 
ATOM   1410 O O   . TRP A 1 181 ? 56.537  44.270 41.151  1.00 29.16  ? 182  TRP A O   1 
ATOM   1411 C CB  . TRP A 1 181 ? 55.133  41.276 41.421  1.00 25.55  ? 182  TRP A CB  1 
ATOM   1412 C CG  . TRP A 1 181 ? 56.257  41.139 42.417  1.00 24.32  ? 182  TRP A CG  1 
ATOM   1413 C CD1 . TRP A 1 181 ? 56.139  40.873 43.753  1.00 24.38  ? 182  TRP A CD1 1 
ATOM   1414 C CD2 . TRP A 1 181 ? 57.663  41.237 42.150  1.00 24.43  ? 182  TRP A CD2 1 
ATOM   1415 N NE1 . TRP A 1 181 ? 57.381  40.814 44.334  1.00 26.57  ? 182  TRP A NE1 1 
ATOM   1416 C CE2 . TRP A 1 181 ? 58.334  41.034 43.374  1.00 28.56  ? 182  TRP A CE2 1 
ATOM   1417 C CE3 . TRP A 1 181 ? 58.419  41.488 40.999  1.00 23.24  ? 182  TRP A CE3 1 
ATOM   1418 C CZ2 . TRP A 1 181 ? 59.727  41.070 43.480  1.00 27.89  ? 182  TRP A CZ2 1 
ATOM   1419 C CZ3 . TRP A 1 181 ? 59.796  41.523 41.104  1.00 26.53  ? 182  TRP A CZ3 1 
ATOM   1420 C CH2 . TRP A 1 181 ? 60.438  41.316 42.336  1.00 28.04  ? 182  TRP A CH2 1 
ATOM   1421 N N   . VAL A 1 182 ? 56.065  43.293 39.172  1.00 26.60  ? 183  VAL A N   1 
ATOM   1422 C CA  . VAL A 1 182 ? 57.110  44.018 38.450  1.00 23.38  ? 183  VAL A CA  1 
ATOM   1423 C C   . VAL A 1 182 ? 56.865  45.523 38.520  1.00 28.72  ? 183  VAL A C   1 
ATOM   1424 O O   . VAL A 1 182 ? 57.772  46.304 38.834  1.00 29.08  ? 183  VAL A O   1 
ATOM   1425 C CB  . VAL A 1 182 ? 57.189  43.522 36.993  1.00 28.92  ? 183  VAL A CB  1 
ATOM   1426 C CG1 . VAL A 1 182 ? 58.058  44.447 36.154  1.00 28.49  ? 183  VAL A CG1 1 
ATOM   1427 C CG2 . VAL A 1 182 ? 57.716  42.094 36.945  1.00 25.11  ? 183  VAL A CG2 1 
ATOM   1428 N N   . GLN A 1 183 ? 55.630  45.951 38.234  1.00 27.91  ? 184  GLN A N   1 
ATOM   1429 C CA  . GLN A 1 183 ? 55.298  47.371 38.319  1.00 28.35  ? 184  GLN A CA  1 
ATOM   1430 C C   . GLN A 1 183 ? 55.612  47.939 39.700  1.00 35.81  ? 184  GLN A C   1 
ATOM   1431 O O   . GLN A 1 183 ? 56.148  49.047 39.821  1.00 34.59  ? 184  GLN A O   1 
ATOM   1432 C CB  . GLN A 1 183 ? 53.821  47.589 37.979  1.00 29.70  ? 184  GLN A CB  1 
ATOM   1433 C CG  . GLN A 1 183 ? 53.525  47.593 36.488  1.00 33.58  ? 184  GLN A CG  1 
ATOM   1434 C CD  . GLN A 1 183 ? 54.319  48.655 35.754  1.00 35.65  ? 184  GLN A CD  1 
ATOM   1435 O OE1 . GLN A 1 183 ? 54.272  49.835 36.103  1.00 37.75  ? 184  GLN A OE1 1 
ATOM   1436 N NE2 . GLN A 1 183 ? 55.069  48.237 34.745  1.00 35.54  ? 184  GLN A NE2 1 
ATOM   1437 N N   . GLU A 1 184 ? 55.296  47.193 40.753  1.00 35.30  ? 185  GLU A N   1 
ATOM   1438 C CA  . GLU A 1 184 ? 55.474  47.737 42.090  1.00 37.06  ? 185  GLU A CA  1 
ATOM   1439 C C   . GLU A 1 184 ? 56.889  47.557 42.630  1.00 33.41  ? 185  GLU A C   1 
ATOM   1440 O O   . GLU A 1 184 ? 57.296  48.320 43.510  1.00 31.61  ? 185  GLU A O   1 
ATOM   1441 C CB  . GLU A 1 184 ? 54.452  47.108 43.038  1.00 45.11  ? 185  GLU A CB  1 
ATOM   1442 C CG  . GLU A 1 184 ? 53.025  47.543 42.715  1.00 64.09  ? 185  GLU A CG  1 
ATOM   1443 C CD  . GLU A 1 184 ? 51.972  46.845 43.554  1.00 76.87  ? 185  GLU A CD  1 
ATOM   1444 O OE1 . GLU A 1 184 ? 50.771  47.090 43.311  1.00 82.52  ? 185  GLU A OE1 1 
ATOM   1445 O OE2 . GLU A 1 184 ? 52.342  46.052 44.447  1.00 79.21  ? 185  GLU A OE2 1 
ATOM   1446 N N   . ASN A 1 185 ? 57.668  46.610 42.107  1.00 29.79  ? 186  ASN A N   1 
ATOM   1447 C CA  . ASN A 1 185 ? 58.921  46.250 42.754  1.00 30.89  ? 186  ASN A CA  1 
ATOM   1448 C C   . ASN A 1 185 ? 60.168  46.350 41.888  1.00 34.24  ? 186  ASN A C   1 
ATOM   1449 O O   . ASN A 1 185 ? 61.269  46.365 42.447  1.00 32.90  ? 186  ASN A O   1 
ATOM   1450 C CB  . ASN A 1 185 ? 58.838  44.818 43.300  1.00 27.83  ? 186  ASN A CB  1 
ATOM   1451 C CG  . ASN A 1 185 ? 57.846  44.699 44.425  1.00 30.49  ? 186  ASN A CG  1 
ATOM   1452 O OD1 . ASN A 1 185 ? 57.939  45.416 45.416  1.00 32.73  ? 186  ASN A OD1 1 
ATOM   1453 N ND2 . ASN A 1 185 ? 56.867  43.819 44.265  1.00 30.83  ? 186  ASN A ND2 1 
ATOM   1454 N N   . VAL A 1 186 ? 60.045  46.417 40.561  1.00 29.87  ? 187  VAL A N   1 
ATOM   1455 C CA  . VAL A 1 186 ? 61.233  46.217 39.737  1.00 29.02  ? 187  VAL A CA  1 
ATOM   1456 C C   . VAL A 1 186 ? 62.211  47.377 39.895  1.00 30.16  ? 187  VAL A C   1 
ATOM   1457 O O   . VAL A 1 186 ? 63.424  47.199 39.721  1.00 33.11  ? 187  VAL A O   1 
ATOM   1458 C CB  . VAL A 1 186 ? 60.833  45.977 38.266  1.00 28.85  ? 187  VAL A CB  1 
ATOM   1459 C CG1 . VAL A 1 186 ? 60.651  47.296 37.520  1.00 28.20  ? 187  VAL A CG1 1 
ATOM   1460 C CG2 . VAL A 1 186 ? 61.851  45.085 37.581  1.00 26.37  ? 187  VAL A CG2 1 
ATOM   1461 N N   . ALA A 1 187 ? 61.720  48.565 40.268  1.00 29.23  ? 188  ALA A N   1 
ATOM   1462 C CA  . ALA A 1 187 ? 62.613  49.710 40.440  1.00 32.71  ? 188  ALA A CA  1 
ATOM   1463 C C   . ALA A 1 187 ? 63.621  49.480 41.559  1.00 36.68  ? 188  ALA A C   1 
ATOM   1464 O O   . ALA A 1 187 ? 64.716  50.054 41.531  1.00 35.59  ? 188  ALA A O   1 
ATOM   1465 C CB  . ALA A 1 187 ? 61.807  50.981 40.713  1.00 30.51  ? 188  ALA A CB  1 
ATOM   1466 N N   . ALA A 1 188 ? 63.275  48.655 42.552  1.00 33.04  ? 189  ALA A N   1 
ATOM   1467 C CA  . ALA A 1 188 ? 64.216  48.370 43.630  1.00 36.11  ? 189  ALA A CA  1 
ATOM   1468 C C   . ALA A 1 188 ? 65.417  47.575 43.140  1.00 33.55  ? 189  ALA A C   1 
ATOM   1469 O O   . ALA A 1 188 ? 66.451  47.561 43.813  1.00 31.32  ? 189  ALA A O   1 
ATOM   1470 C CB  . ALA A 1 188 ? 63.516  47.624 44.769  1.00 28.69  ? 189  ALA A CB  1 
ATOM   1471 N N   . PHE A 1 189 ? 65.305  46.920 41.986  1.00 33.34  ? 190  PHE A N   1 
ATOM   1472 C CA  . PHE A 1 189 ? 66.414  46.220 41.355  1.00 34.96  ? 190  PHE A CA  1 
ATOM   1473 C C   . PHE A 1 189 ? 67.110  47.063 40.294  1.00 37.98  ? 190  PHE A C   1 
ATOM   1474 O O   . PHE A 1 189 ? 68.024  46.567 39.628  1.00 39.37  ? 190  PHE A O   1 
ATOM   1475 C CB  . PHE A 1 189 ? 65.921  44.908 40.724  1.00 32.68  ? 190  PHE A CB  1 
ATOM   1476 C CG  . PHE A 1 189 ? 65.245  43.978 41.696  1.00 31.26  ? 190  PHE A CG  1 
ATOM   1477 C CD1 . PHE A 1 189 ? 63.905  44.140 42.020  1.00 31.86  ? 190  PHE A CD1 1 
ATOM   1478 C CD2 . PHE A 1 189 ? 65.949  42.936 42.282  1.00 29.54  ? 190  PHE A CD2 1 
ATOM   1479 C CE1 . PHE A 1 189 ? 63.281  43.281 42.921  1.00 30.61  ? 190  PHE A CE1 1 
ATOM   1480 C CE2 . PHE A 1 189 ? 65.332  42.074 43.176  1.00 30.01  ? 190  PHE A CE2 1 
ATOM   1481 C CZ  . PHE A 1 189 ? 63.994  42.248 43.496  1.00 26.19  ? 190  PHE A CZ  1 
ATOM   1482 N N   . GLY A 1 190 ? 66.696  48.318 40.115  1.00 34.96  ? 191  GLY A N   1 
ATOM   1483 C CA  . GLY A 1 190 ? 67.202  49.149 39.044  1.00 35.46  ? 191  GLY A CA  1 
ATOM   1484 C C   . GLY A 1 190 ? 66.402  49.090 37.760  1.00 37.78  ? 191  GLY A C   1 
ATOM   1485 O O   . GLY A 1 190 ? 66.794  49.726 36.772  1.00 35.98  ? 191  GLY A O   1 
ATOM   1486 N N   . GLY A 1 191 ? 65.296  48.348 37.739  1.00 36.73  ? 192  GLY A N   1 
ATOM   1487 C CA  . GLY A 1 191 ? 64.498  48.248 36.536  1.00 32.48  ? 192  GLY A CA  1 
ATOM   1488 C C   . GLY A 1 191 ? 63.551  49.419 36.363  1.00 33.76  ? 192  GLY A C   1 
ATOM   1489 O O   . GLY A 1 191 ? 63.181  50.104 37.318  1.00 37.14  ? 192  GLY A O   1 
ATOM   1490 N N   . ASP A 1 192 ? 63.145  49.660 35.115  1.00 37.64  ? 193  ASP A N   1 
ATOM   1491 C CA  . ASP A 1 192 ? 62.271  50.785 34.815  1.00 35.05  ? 193  ASP A CA  1 
ATOM   1492 C C   . ASP A 1 192 ? 60.862  50.275 34.580  1.00 33.80  ? 193  ASP A C   1 
ATOM   1493 O O   . ASP A 1 192 ? 60.596  49.672 33.518  1.00 32.68  ? 193  ASP A O   1 
ATOM   1494 C CB  . ASP A 1 192 ? 62.768  51.551 33.597  1.00 35.66  ? 193  ASP A CB  1 
ATOM   1495 C CG  . ASP A 1 192 ? 61.851  52.725 33.215  1.00 44.21  ? 193  ASP A CG  1 
ATOM   1496 O OD1 . ASP A 1 192 ? 60.720  52.854 33.733  1.00 49.75  ? 193  ASP A OD1 1 
ATOM   1497 O OD2 . ASP A 1 192 ? 62.289  53.551 32.389  1.00 45.85  ? 193  ASP A OD2 1 
ATOM   1498 N N   . PRO A 1 193 ? 59.914  50.538 35.478  1.00 33.76  ? 194  PRO A N   1 
ATOM   1499 C CA  . PRO A 1 193 ? 58.540  50.056 35.267  1.00 31.54  ? 194  PRO A CA  1 
ATOM   1500 C C   . PRO A 1 193 ? 57.807  50.759 34.136  1.00 38.38  ? 194  PRO A C   1 
ATOM   1501 O O   . PRO A 1 193 ? 56.748  50.270 33.715  1.00 38.55  ? 194  PRO A O   1 
ATOM   1502 C CB  . PRO A 1 193 ? 57.842  50.344 36.620  1.00 35.52  ? 194  PRO A CB  1 
ATOM   1503 C CG  . PRO A 1 193 ? 58.725  51.320 37.336  1.00 29.91  ? 194  PRO A CG  1 
ATOM   1504 C CD  . PRO A 1 193 ? 60.103  51.245 36.763  1.00 31.53  ? 194  PRO A CD  1 
ATOM   1505 N N   . THR A 1 194 ? 58.318  51.882 33.623  1.00 36.51  ? 195  THR A N   1 
ATOM   1506 C CA  . THR A 1 194 ? 57.721  52.524 32.455  1.00 35.48  ? 195  THR A CA  1 
ATOM   1507 C C   . THR A 1 194 ? 58.284  51.990 31.143  1.00 39.09  ? 195  THR A C   1 
ATOM   1508 O O   . THR A 1 194 ? 57.923  52.500 30.078  1.00 39.53  ? 195  THR A O   1 
ATOM   1509 C CB  . THR A 1 194 ? 57.913  54.047 32.511  1.00 39.87  ? 195  THR A CB  1 
ATOM   1510 O OG1 . THR A 1 194 ? 59.269  54.377 32.194  1.00 41.03  ? 195  THR A OG1 1 
ATOM   1511 C CG2 . THR A 1 194 ? 57.568  54.586 33.910  1.00 35.69  ? 195  THR A CG2 1 
ATOM   1512 N N   . SER A 1 195 ? 59.143  50.951 31.191  1.00 34.56  ? 196  SER A N   1 
ATOM   1513 C CA  . SER A 1 195 ? 59.671  50.318 29.971  1.00 39.30  ? 196  SER A CA  1 
ATOM   1514 C C   . SER A 1 195 ? 59.758  48.808 30.212  1.00 36.39  ? 196  SER A C   1 
ATOM   1515 O O   . SER A 1 195 ? 60.812  48.264 30.555  1.00 35.65  ? 196  SER A O   1 
ATOM   1516 C CB  . SER A 1 195 ? 61.024  50.907 29.575  1.00 41.58  ? 196  SER A CB  1 
ATOM   1517 O OG  . SER A 1 195 ? 61.497  50.318 28.376  1.00 46.06  ? 196  SER A OG  1 
ATOM   1518 N N   . VAL A 1 196 ? 58.632  48.125 30.020  1.00 35.11  ? 197  VAL A N   1 
ATOM   1519 C CA  . VAL A 1 196 ? 58.510  46.695 30.279  1.00 29.03  ? 197  VAL A CA  1 
ATOM   1520 C C   . VAL A 1 196 ? 58.105  46.011 28.981  1.00 29.76  ? 197  VAL A C   1 
ATOM   1521 O O   . VAL A 1 196 ? 57.054  46.325 28.409  1.00 27.92  ? 197  VAL A O   1 
ATOM   1522 C CB  . VAL A 1 196 ? 57.489  46.399 31.389  1.00 30.42  ? 197  VAL A CB  1 
ATOM   1523 C CG1 . VAL A 1 196 ? 57.286  44.886 31.537  1.00 22.66  ? 197  VAL A CG1 1 
ATOM   1524 C CG2 . VAL A 1 196 ? 57.922  47.038 32.708  1.00 29.25  ? 197  VAL A CG2 1 
ATOM   1525 N N   . THR A 1 197 ? 58.931  45.076 28.524  1.00 29.38  ? 198  THR A N   1 
ATOM   1526 C CA  . THR A 1 197 ? 58.673  44.315 27.309  1.00 25.75  ? 198  THR A CA  1 
ATOM   1527 C C   . THR A 1 197 ? 58.410  42.863 27.693  1.00 25.84  ? 198  THR A C   1 
ATOM   1528 O O   . THR A 1 197 ? 59.274  42.206 28.286  1.00 30.90  ? 198  THR A O   1 
ATOM   1529 C CB  . THR A 1 197 ? 59.856  44.403 26.344  1.00 25.96  ? 198  THR A CB  1 
ATOM   1530 O OG1 . THR A 1 197 ? 60.059  45.768 25.952  1.00 29.95  ? 198  THR A OG1 1 
ATOM   1531 C CG2 . THR A 1 197 ? 59.603  43.545 25.093  1.00 22.31  ? 198  THR A CG2 1 
ATOM   1532 N N   . LEU A 1 198 ? 57.220  42.365 27.369  1.00 23.90  ? 199  LEU A N   1 
ATOM   1533 C CA  . LEU A 1 198 ? 56.925  40.950 27.549  1.00 29.64  ? 199  LEU A CA  1 
ATOM   1534 C C   . LEU A 1 198 ? 57.421  40.157 26.353  1.00 30.22  ? 199  LEU A C   1 
ATOM   1535 O O   . LEU A 1 198 ? 57.268  40.584 25.208  1.00 29.97  ? 199  LEU A O   1 
ATOM   1536 C CB  . LEU A 1 198 ? 55.429  40.707 27.717  1.00 31.57  ? 199  LEU A CB  1 
ATOM   1537 C CG  . LEU A 1 198 ? 54.605  41.486 28.727  1.00 33.82  ? 199  LEU A CG  1 
ATOM   1538 C CD1 . LEU A 1 198 ? 53.163  40.959 28.699  1.00 25.07  ? 199  LEU A CD1 1 
ATOM   1539 C CD2 . LEU A 1 198 ? 55.257  41.371 30.107  1.00 27.31  ? 199  LEU A CD2 1 
ATOM   1540 N N   . PHE A 1 199 ? 58.016  38.997 26.611  1.00 24.78  ? 200  PHE A N   1 
ATOM   1541 C CA  . PHE A 1 199 ? 58.253  38.067 25.520  1.00 23.15  ? 200  PHE A CA  1 
ATOM   1542 C C   . PHE A 1 199 ? 57.979  36.656 26.004  1.00 23.35  ? 200  PHE A C   1 
ATOM   1543 O O   . PHE A 1 199 ? 58.083  36.350 27.196  1.00 24.28  ? 200  PHE A O   1 
ATOM   1544 C CB  . PHE A 1 199 ? 59.663  38.212 24.878  1.00 21.21  ? 200  PHE A CB  1 
ATOM   1545 C CG  . PHE A 1 199 ? 60.836  37.861 25.762  1.00 23.85  ? 200  PHE A CG  1 
ATOM   1546 C CD1 . PHE A 1 199 ? 61.920  37.187 25.211  1.00 23.55  ? 200  PHE A CD1 1 
ATOM   1547 C CD2 . PHE A 1 199 ? 60.904  38.253 27.095  1.00 23.96  ? 200  PHE A CD2 1 
ATOM   1548 C CE1 . PHE A 1 199 ? 63.032  36.875 25.972  1.00 30.33  ? 200  PHE A CE1 1 
ATOM   1549 C CE2 . PHE A 1 199 ? 62.023  37.946 27.869  1.00 23.39  ? 200  PHE A CE2 1 
ATOM   1550 C CZ  . PHE A 1 199 ? 63.085  37.253 27.306  1.00 24.55  ? 200  PHE A CZ  1 
ATOM   1551 N N   . GLY A 1 200 ? 57.562  35.818 25.066  1.00 25.35  ? 201  GLY A N   1 
ATOM   1552 C CA  . GLY A 1 200 ? 57.159  34.461 25.376  1.00 20.49  ? 201  GLY A CA  1 
ATOM   1553 C C   . GLY A 1 200 ? 57.156  33.643 24.108  1.00 22.47  ? 201  GLY A C   1 
ATOM   1554 O O   . GLY A 1 200 ? 57.133  34.183 22.998  1.00 25.49  ? 201  GLY A O   1 
ATOM   1555 N N   . GLU A 1 201 ? 57.177  32.330 24.281  1.00 20.92  ? 202  GLU A N   1 
ATOM   1556 C CA  . GLU A 1 201 ? 57.232  31.422 23.148  1.00 24.96  ? 202  GLU A CA  1 
ATOM   1557 C C   . GLU A 1 201 ? 56.102  30.408 23.264  1.00 25.81  ? 202  GLU A C   1 
ATOM   1558 O O   . GLU A 1 201 ? 55.803  29.923 24.360  1.00 18.47  ? 202  GLU A O   1 
ATOM   1559 C CB  . GLU A 1 201 ? 58.606  30.736 23.082  1.00 27.11  ? 202  GLU A CB  1 
ATOM   1560 C CG  . GLU A 1 201 ? 58.876  29.961 21.808  1.00 28.13  ? 202  GLU A CG  1 
ATOM   1561 C CD  . GLU A 1 201 ? 58.487  28.502 21.937  1.00 34.47  ? 202  GLU A CD  1 
ATOM   1562 O OE1 . GLU A 1 201 ? 58.539  27.780 20.915  1.00 32.94  ? 202  GLU A OE1 1 
ATOM   1563 O OE2 . GLU A 1 201 ? 58.135  28.081 23.068  1.00 33.10  ? 202  GLU A OE2 1 
ATOM   1564 N N   . SER A 1 202 ? 55.459  30.115 22.130  1.00 24.71  ? 203  SER A N   1 
ATOM   1565 C CA  . SER A 1 202 ? 54.379  29.123 22.042  1.00 23.23  ? 203  SER A CA  1 
ATOM   1566 C C   . SER A 1 202 ? 53.247  29.539 22.981  1.00 23.17  ? 203  SER A C   1 
ATOM   1567 O O   . SER A 1 202 ? 52.678  30.628 22.787  1.00 22.93  ? 203  SER A O   1 
ATOM   1568 C CB  . SER A 1 202 ? 54.993  27.743 22.289  1.00 24.86  ? 203  SER A CB  1 
ATOM   1569 O OG  . SER A 1 202 ? 54.155  26.717 21.805  1.00 29.87  ? 203  SER A OG  1 
ATOM   1570 N N   . ALA A 1 203 ? 52.874  28.735 23.985  1.00 19.87  ? 204  ALA A N   1 
ATOM   1571 C CA  . ALA A 1 203 ? 51.822  29.165 24.905  1.00 19.61  ? 204  ALA A CA  1 
ATOM   1572 C C   . ALA A 1 203 ? 52.215  30.435 25.654  1.00 21.98  ? 204  ALA A C   1 
ATOM   1573 O O   . ALA A 1 203 ? 51.340  31.206 26.074  1.00 21.67  ? 204  ALA A O   1 
ATOM   1574 C CB  . ALA A 1 203 ? 51.489  28.049 25.897  1.00 20.15  ? 204  ALA A CB  1 
ATOM   1575 N N   . GLY A 1 204 ? 53.517  30.669 25.831  1.00 20.33  ? 205  GLY A N   1 
ATOM   1576 C CA  . GLY A 1 204 ? 53.958  31.936 26.392  1.00 17.28  ? 205  GLY A CA  1 
ATOM   1577 C C   . GLY A 1 204 ? 53.688  33.103 25.461  1.00 22.66  ? 205  GLY A C   1 
ATOM   1578 O O   . GLY A 1 204 ? 53.344  34.199 25.911  1.00 22.91  ? 205  GLY A O   1 
ATOM   1579 N N   . ALA A 1 205 ? 53.840  32.885 24.149  1.00 17.50  ? 206  ALA A N   1 
ATOM   1580 C CA  . ALA A 1 205 ? 53.485  33.922 23.188  1.00 19.20  ? 206  ALA A CA  1 
ATOM   1581 C C   . ALA A 1 205 ? 51.979  34.152 23.166  1.00 25.73  ? 206  ALA A C   1 
ATOM   1582 O O   . ALA A 1 205 ? 51.517  35.301 23.114  1.00 23.32  ? 206  ALA A O   1 
ATOM   1583 C CB  . ALA A 1 205 ? 53.999  33.546 21.795  1.00 19.91  ? 206  ALA A CB  1 
ATOM   1584 N N   . ALA A 1 206 ? 51.198  33.068 23.196  1.00 23.42  ? 207  ALA A N   1 
ATOM   1585 C CA  . ALA A 1 206 ? 49.751  33.198 23.335  1.00 25.62  ? 207  ALA A CA  1 
ATOM   1586 C C   . ALA A 1 206 ? 49.384  33.980 24.595  1.00 28.77  ? 207  ALA A C   1 
ATOM   1587 O O   . ALA A 1 206 ? 48.488  34.835 24.569  1.00 25.61  ? 207  ALA A O   1 
ATOM   1588 C CB  . ALA A 1 206 ? 49.106  31.811 23.357  1.00 18.84  ? 207  ALA A CB  1 
ATOM   1589 N N   . SER A 1 207 ? 50.069  33.697 25.709  1.00 16.78  ? 208  SER A N   1 
ATOM   1590 C CA  . SER A 1 207 ? 49.810  34.427 26.947  1.00 22.18  ? 208  SER A CA  1 
ATOM   1591 C C   . SER A 1 207 ? 50.101  35.911 26.770  1.00 25.90  ? 208  SER A C   1 
ATOM   1592 O O   . SER A 1 207 ? 49.293  36.765 27.156  1.00 23.92  ? 208  SER A O   1 
ATOM   1593 C CB  . SER A 1 207 ? 50.657  33.849 28.084  1.00 20.66  ? 208  SER A CB  1 
ATOM   1594 O OG  . SER A 1 207 ? 50.308  32.508 28.360  1.00 24.38  ? 208  SER A OG  1 
ATOM   1595 N N   . VAL A 1 208 ? 51.260  36.234 26.183  1.00 20.94  ? 209  VAL A N   1 
ATOM   1596 C CA  . VAL A 1 208 ? 51.599  37.629 25.907  1.00 24.47  ? 209  VAL A CA  1 
ATOM   1597 C C   . VAL A 1 208 ? 50.472  38.306 25.135  1.00 25.76  ? 209  VAL A C   1 
ATOM   1598 O O   . VAL A 1 208 ? 50.029  39.410 25.480  1.00 25.90  ? 209  VAL A O   1 
ATOM   1599 C CB  . VAL A 1 208 ? 52.936  37.719 25.147  1.00 22.55  ? 209  VAL A CB  1 
ATOM   1600 C CG1 . VAL A 1 208 ? 53.147  39.128 24.604  1.00 21.32  ? 209  VAL A CG1 1 
ATOM   1601 C CG2 . VAL A 1 208 ? 54.086  37.324 26.061  1.00 22.50  ? 209  VAL A CG2 1 
ATOM   1602 N N   . GLY A 1 209 ? 49.974  37.638 24.092  1.00 23.92  ? 210  GLY A N   1 
ATOM   1603 C CA  . GLY A 1 209 ? 48.893  38.211 23.302  1.00 21.93  ? 210  GLY A CA  1 
ATOM   1604 C C   . GLY A 1 209 ? 47.610  38.391 24.096  1.00 24.52  ? 210  GLY A C   1 
ATOM   1605 O O   . GLY A 1 209 ? 46.880  39.361 23.900  1.00 24.41  ? 210  GLY A O   1 
ATOM   1606 N N   . MET A 1 210 ? 47.320  37.465 25.009  1.00 23.87  ? 211  MET A N   1 
ATOM   1607 C CA  . MET A 1 210 ? 46.118  37.617 25.824  1.00 30.06  ? 211  MET A CA  1 
ATOM   1608 C C   . MET A 1 210 ? 46.233  38.809 26.768  1.00 26.76  ? 211  MET A C   1 
ATOM   1609 O O   . MET A 1 210 ? 45.253  39.534 26.975  1.00 27.15  ? 211  MET A O   1 
ATOM   1610 C CB  . MET A 1 210 ? 45.840  36.326 26.591  1.00 28.27  ? 211  MET A CB  1 
ATOM   1611 C CG  . MET A 1 210 ? 45.282  35.234 25.687  1.00 32.42  ? 211  MET A CG  1 
ATOM   1612 S SD  . MET A 1 210 ? 45.257  33.627 26.476  1.00 35.95  ? 211  MET A SD  1 
ATOM   1613 C CE  . MET A 1 210 ? 45.196  32.554 25.037  1.00 27.61  ? 211  MET A CE  1 
ATOM   1614 N N   . HIS A 1 211 ? 47.422  39.036 27.341  1.00 22.57  ? 212  HIS A N   1 
ATOM   1615 C CA  . HIS A 1 211 ? 47.647  40.249 28.121  1.00 24.54  ? 212  HIS A CA  1 
ATOM   1616 C C   . HIS A 1 211 ? 47.466  41.500 27.270  1.00 29.75  ? 212  HIS A C   1 
ATOM   1617 O O   . HIS A 1 211 ? 46.975  42.523 27.759  1.00 33.87  ? 212  HIS A O   1 
ATOM   1618 C CB  . HIS A 1 211 ? 49.038  40.226 28.746  1.00 23.41  ? 212  HIS A CB  1 
ATOM   1619 C CG  . HIS A 1 211 ? 49.198  39.185 29.803  1.00 24.15  ? 212  HIS A CG  1 
ATOM   1620 N ND1 . HIS A 1 211 ? 48.444  39.178 30.955  1.00 29.04  ? 212  HIS A ND1 1 
ATOM   1621 C CD2 . HIS A 1 211 ? 50.008  38.103 29.876  1.00 26.55  ? 212  HIS A CD2 1 
ATOM   1622 C CE1 . HIS A 1 211 ? 48.788  38.141 31.697  1.00 27.80  ? 212  HIS A CE1 1 
ATOM   1623 N NE2 . HIS A 1 211 ? 49.736  37.473 31.066  1.00 29.95  ? 212  HIS A NE2 1 
ATOM   1624 N N   . LEU A 1 212 ? 47.856  41.437 25.991  1.00 29.34  ? 213  LEU A N   1 
ATOM   1625 C CA  . LEU A 1 212 ? 47.614  42.559 25.088  1.00 32.25  ? 213  LEU A CA  1 
ATOM   1626 C C   . LEU A 1 212 ? 46.128  42.844 24.950  1.00 34.08  ? 213  LEU A C   1 
ATOM   1627 O O   . LEU A 1 212 ? 45.716  44.003 24.820  1.00 33.58  ? 213  LEU A O   1 
ATOM   1628 C CB  . LEU A 1 212 ? 48.209  42.274 23.709  1.00 39.37  ? 213  LEU A CB  1 
ATOM   1629 C CG  . LEU A 1 212 ? 49.662  42.663 23.464  1.00 47.66  ? 213  LEU A CG  1 
ATOM   1630 C CD1 . LEU A 1 212 ? 50.084  42.231 22.067  1.00 41.83  ? 213  LEU A CD1 1 
ATOM   1631 C CD2 . LEU A 1 212 ? 49.828  44.164 23.646  1.00 49.50  ? 213  LEU A CD2 1 
ATOM   1632 N N   . LEU A 1 213 ? 45.311  41.796 24.954  1.00 31.19  ? 214  LEU A N   1 
ATOM   1633 C CA  . LEU A 1 213 ? 43.889  41.904 24.668  1.00 31.50  ? 214  LEU A CA  1 
ATOM   1634 C C   . LEU A 1 213 ? 43.040  42.049 25.928  1.00 31.69  ? 214  LEU A C   1 
ATOM   1635 O O   . LEU A 1 213 ? 41.814  42.154 25.821  1.00 38.54  ? 214  LEU A O   1 
ATOM   1636 C CB  . LEU A 1 213 ? 43.429  40.676 23.863  1.00 29.42  ? 214  LEU A CB  1 
ATOM   1637 C CG  . LEU A 1 213 ? 43.629  40.609 22.337  1.00 40.87  ? 214  LEU A CG  1 
ATOM   1638 C CD1 . LEU A 1 213 ? 44.367  41.824 21.769  1.00 38.92  ? 214  LEU A CD1 1 
ATOM   1639 C CD2 . LEU A 1 213 ? 44.301  39.305 21.913  1.00 27.34  ? 214  LEU A CD2 1 
ATOM   1640 N N   . SER A 1 214 ? 43.656  42.054 27.108  1.00 29.97  ? 215  SER A N   1 
ATOM   1641 C CA  . SER A 1 214 ? 42.929  42.171 28.367  1.00 33.47  ? 215  SER A CA  1 
ATOM   1642 C C   . SER A 1 214 ? 43.286  43.488 29.043  1.00 31.67  ? 215  SER A C   1 
ATOM   1643 O O   . SER A 1 214 ? 44.427  43.651 29.507  1.00 30.61  ? 215  SER A O   1 
ATOM   1644 C CB  . SER A 1 214 ? 43.255  40.993 29.287  1.00 34.91  ? 215  SER A CB  1 
ATOM   1645 O OG  . SER A 1 214 ? 42.413  40.999 30.425  1.00 37.05  ? 215  SER A OG  1 
ATOM   1646 N N   . PRO A 1 215 ? 42.356  44.433 29.134  1.00 35.39  ? 216  PRO A N   1 
ATOM   1647 C CA  . PRO A 1 215 ? 42.685  45.791 29.610  1.00 38.83  ? 216  PRO A CA  1 
ATOM   1648 C C   . PRO A 1 215 ? 43.405  45.812 30.952  1.00 38.45  ? 216  PRO A C   1 
ATOM   1649 O O   . PRO A 1 215 ? 44.361  46.590 31.107  1.00 38.39  ? 216  PRO A O   1 
ATOM   1650 C CB  . PRO A 1 215 ? 41.311  46.472 29.687  1.00 42.88  ? 216  PRO A CB  1 
ATOM   1651 C CG  . PRO A 1 215 ? 40.536  45.806 28.584  1.00 42.46  ? 216  PRO A CG  1 
ATOM   1652 C CD  . PRO A 1 215 ? 40.988  44.358 28.588  1.00 41.72  ? 216  PRO A CD  1 
ATOM   1653 N N   . PRO A 1 216 ? 43.010  45.004 31.954  1.00 35.79  ? 217  PRO A N   1 
ATOM   1654 C CA  . PRO A 1 216 ? 43.752  45.056 33.231  1.00 37.53  ? 217  PRO A CA  1 
ATOM   1655 C C   . PRO A 1 216 ? 45.203  44.629 33.127  1.00 42.00  ? 217  PRO A C   1 
ATOM   1656 O O   . PRO A 1 216 ? 46.007  45.041 33.967  1.00 47.47  ? 217  PRO A O   1 
ATOM   1657 C CB  . PRO A 1 216 ? 42.956  44.122 34.159  1.00 33.55  ? 217  PRO A CB  1 
ATOM   1658 C CG  . PRO A 1 216 ? 41.628  43.968 33.513  1.00 39.28  ? 217  PRO A CG  1 
ATOM   1659 C CD  . PRO A 1 216 ? 41.863  44.084 32.042  1.00 34.98  ? 217  PRO A CD  1 
ATOM   1660 N N   . SER A 1 217 ? 45.567  43.810 32.141  1.00 39.59  ? 218  SER A N   1 
ATOM   1661 C CA  . SER A 1 217 ? 46.975  43.479 31.936  1.00 36.84  ? 218  SER A CA  1 
ATOM   1662 C C   . SER A 1 217 ? 47.692  44.522 31.098  1.00 36.33  ? 218  SER A C   1 
ATOM   1663 O O   . SER A 1 217 ? 48.894  44.747 31.277  1.00 35.78  ? 218  SER A O   1 
ATOM   1664 C CB  . SER A 1 217 ? 47.116  42.121 31.243  1.00 29.81  ? 218  SER A CB  1 
ATOM   1665 O OG  . SER A 1 217 ? 46.696  41.060 32.075  1.00 33.56  ? 218  SER A OG  1 
ATOM   1666 N N   . ARG A 1 218 ? 46.952  45.165 30.204  1.00 44.21  ? 219  ARG A N   1 
ATOM   1667 C CA  . ARG A 1 218 ? 47.535  45.994 29.162  1.00 45.92  ? 219  ARG A CA  1 
ATOM   1668 C C   . ARG A 1 218 ? 48.295  47.188 29.736  1.00 42.41  ? 219  ARG A C   1 
ATOM   1669 O O   . ARG A 1 218 ? 49.313  47.612 29.173  1.00 37.90  ? 219  ARG A O   1 
ATOM   1670 C CB  . ARG A 1 218 ? 46.407  46.432 28.230  1.00 45.72  ? 219  ARG A CB  1 
ATOM   1671 C CG  . ARG A 1 218 ? 46.847  47.365 27.166  1.00 48.71  ? 219  ARG A CG  1 
ATOM   1672 C CD  . ARG A 1 218 ? 47.802  46.684 26.179  1.00 53.08  ? 219  ARG A CD  1 
ATOM   1673 N NE  . ARG A 1 218 ? 48.369  47.677 25.284  1.00 56.39  ? 219  ARG A NE  1 
ATOM   1674 C CZ  . ARG A 1 218 ? 49.605  48.169 25.429  1.00 52.73  ? 219  ARG A CZ  1 
ATOM   1675 N NH1 . ARG A 1 218 ? 50.382  47.777 26.420  1.00 47.85  ? 219  ARG A NH1 1 
ATOM   1676 N NH2 . ARG A 1 218 ? 50.053  49.089 24.594  1.00 47.52  ? 219  ARG A NH2 1 
ATOM   1677 N N   . GLY A 1 219 ? 47.827  47.735 30.852  1.00 37.60  ? 220  GLY A N   1 
ATOM   1678 C CA  . GLY A 1 219 ? 48.528  48.820 31.507  1.00 33.27  ? 220  GLY A CA  1 
ATOM   1679 C C   . GLY A 1 219 ? 49.780  48.421 32.258  1.00 34.44  ? 220  GLY A C   1 
ATOM   1680 O O   . GLY A 1 219 ? 50.411  49.288 32.868  1.00 37.04  ? 220  GLY A O   1 
ATOM   1681 N N   . LEU A 1 220 ? 50.169  47.146 32.233  1.00 29.62  ? 221  LEU A N   1 
ATOM   1682 C CA  . LEU A 1 220 ? 51.320  46.684 32.997  1.00 28.79  ? 221  LEU A CA  1 
ATOM   1683 C C   . LEU A 1 220 ? 52.582  46.536 32.158  1.00 36.19  ? 221  LEU A C   1 
ATOM   1684 O O   . LEU A 1 220 ? 53.632  46.184 32.705  1.00 34.30  ? 221  LEU A O   1 
ATOM   1685 C CB  . LEU A 1 220 ? 51.003  45.349 33.681  1.00 25.10  ? 221  LEU A CB  1 
ATOM   1686 C CG  . LEU A 1 220 ? 49.693  45.256 34.470  1.00 33.31  ? 221  LEU A CG  1 
ATOM   1687 C CD1 . LEU A 1 220 ? 49.401  43.816 34.910  1.00 28.98  ? 221  LEU A CD1 1 
ATOM   1688 C CD2 . LEU A 1 220 ? 49.714  46.223 35.654  1.00 28.40  ? 221  LEU A CD2 1 
ATOM   1689 N N   . PHE A 1 221 ? 52.514  46.793 30.853  1.00 30.54  ? 222  PHE A N   1 
ATOM   1690 C CA  . PHE A 1 221 ? 53.688  46.658 30.002  1.00 28.75  ? 222  PHE A CA  1 
ATOM   1691 C C   . PHE A 1 221 ? 53.512  47.554 28.785  1.00 32.45  ? 222  PHE A C   1 
ATOM   1692 O O   . PHE A 1 221 ? 52.447  48.133 28.560  1.00 34.32  ? 222  PHE A O   1 
ATOM   1693 C CB  . PHE A 1 221 ? 53.925  45.199 29.592  1.00 25.76  ? 222  PHE A CB  1 
ATOM   1694 C CG  . PHE A 1 221 ? 52.835  44.616 28.736  1.00 26.49  ? 222  PHE A CG  1 
ATOM   1695 C CD1 . PHE A 1 221 ? 51.629  44.216 29.294  1.00 23.67  ? 222  PHE A CD1 1 
ATOM   1696 C CD2 . PHE A 1 221 ? 53.023  44.452 27.371  1.00 29.49  ? 222  PHE A CD2 1 
ATOM   1697 C CE1 . PHE A 1 221 ? 50.625  43.671 28.505  1.00 29.63  ? 222  PHE A CE1 1 
ATOM   1698 C CE2 . PHE A 1 221 ? 52.024  43.906 26.578  1.00 33.34  ? 222  PHE A CE2 1 
ATOM   1699 C CZ  . PHE A 1 221 ? 50.824  43.514 27.147  1.00 30.89  ? 222  PHE A CZ  1 
ATOM   1700 N N   . HIS A 1 222 ? 54.572  47.656 27.995  1.00 30.91  ? 223  HIS A N   1 
ATOM   1701 C CA  . HIS A 1 222 ? 54.586  48.594 26.887  1.00 33.84  ? 223  HIS A CA  1 
ATOM   1702 C C   . HIS A 1 222 ? 54.863  47.955 25.539  1.00 33.51  ? 223  HIS A C   1 
ATOM   1703 O O   . HIS A 1 222 ? 54.427  48.500 24.529  1.00 36.45  ? 223  HIS A O   1 
ATOM   1704 C CB  . HIS A 1 222 ? 55.609  49.700 27.165  1.00 35.73  ? 223  HIS A CB  1 
ATOM   1705 C CG  . HIS A 1 222 ? 55.502  50.250 28.549  1.00 42.55  ? 223  HIS A CG  1 
ATOM   1706 N ND1 . HIS A 1 222 ? 56.060  49.623 29.643  1.00 33.85  ? 223  HIS A ND1 1 
ATOM   1707 C CD2 . HIS A 1 222 ? 54.851  51.336 29.029  1.00 45.76  ? 223  HIS A CD2 1 
ATOM   1708 C CE1 . HIS A 1 222 ? 55.772  50.308 30.733  1.00 37.75  ? 223  HIS A CE1 1 
ATOM   1709 N NE2 . HIS A 1 222 ? 55.048  51.357 30.388  1.00 46.57  ? 223  HIS A NE2 1 
ATOM   1710 N N   . ARG A 1 223 ? 55.559  46.820 25.486  1.00 36.23  ? 224  ARG A N   1 
ATOM   1711 C CA  . ARG A 1 223 ? 55.732  46.102 24.229  1.00 32.68  ? 224  ARG A CA  1 
ATOM   1712 C C   . ARG A 1 223 ? 55.655  44.611 24.440  1.00 29.38  ? 224  ARG A C   1 
ATOM   1713 O O   . ARG A 1 223 ? 55.682  44.111 25.567  1.00 27.70  ? 224  ARG A O   1 
ATOM   1714 C CB  . ARG A 1 223 ? 57.073  46.321 23.567  1.00 38.35  ? 224  ARG A CB  1 
ATOM   1715 C CG  . ARG A 1 223 ? 57.488  47.683 23.466  1.00 38.89  ? 224  ARG A CG  1 
ATOM   1716 C CD  . ARG A 1 223 ? 58.967  47.668 23.475  1.00 45.39  ? 224  ARG A CD  1 
ATOM   1717 N NE  . ARG A 1 223 ? 59.456  48.949 23.068  1.00 50.04  ? 224  ARG A NE  1 
ATOM   1718 C CZ  . ARG A 1 223 ? 59.447  50.012 23.868  1.00 63.92  ? 224  ARG A CZ  1 
ATOM   1719 N NH1 . ARG A 1 223 ? 58.973  49.943 25.097  1.00 58.51  ? 224  ARG A NH1 1 
ATOM   1720 N NH2 . ARG A 1 223 ? 59.907  51.161 23.419  1.00 78.60  ? 224  ARG A NH2 1 
ATOM   1721 N N   . ALA A 1 224 ? 55.668  43.909 23.309  1.00 26.92  ? 225  ALA A N   1 
ATOM   1722 C CA  . ALA A 1 224 ? 55.363  42.491 23.280  1.00 30.31  ? 225  ALA A CA  1 
ATOM   1723 C C   . ALA A 1 224 ? 56.192  41.816 22.199  1.00 30.03  ? 225  ALA A C   1 
ATOM   1724 O O   . ALA A 1 224 ? 56.333  42.340 21.088  1.00 26.33  ? 225  ALA A O   1 
ATOM   1725 C CB  . ALA A 1 224 ? 53.867  42.267 23.026  1.00 27.69  ? 225  ALA A CB  1 
ATOM   1726 N N   . VAL A 1 225 ? 56.744  40.655 22.539  1.00 24.41  ? 226  VAL A N   1 
ATOM   1727 C CA  . VAL A 1 225 ? 57.389  39.772 21.578  1.00 26.20  ? 226  VAL A CA  1 
ATOM   1728 C C   . VAL A 1 225 ? 56.665  38.436 21.626  1.00 27.39  ? 226  VAL A C   1 
ATOM   1729 O O   . VAL A 1 225 ? 56.516  37.848 22.702  1.00 26.15  ? 226  VAL A O   1 
ATOM   1730 C CB  . VAL A 1 225 ? 58.889  39.598 21.874  1.00 28.50  ? 226  VAL A CB  1 
ATOM   1731 C CG1 . VAL A 1 225 ? 59.560  38.755 20.780  1.00 25.76  ? 226  VAL A CG1 1 
ATOM   1732 C CG2 . VAL A 1 225 ? 59.573  40.965 22.045  1.00 24.33  ? 226  VAL A CG2 1 
ATOM   1733 N N   . LEU A 1 226 ? 56.206  37.965 20.468  1.00 28.05  ? 227  LEU A N   1 
ATOM   1734 C CA  . LEU A 1 226 ? 55.458  36.715 20.357  1.00 31.97  ? 227  LEU A CA  1 
ATOM   1735 C C   . LEU A 1 226 ? 56.244  35.765 19.465  1.00 28.20  ? 227  LEU A C   1 
ATOM   1736 O O   . LEU A 1 226 ? 56.299  35.953 18.245  1.00 28.19  ? 227  LEU A O   1 
ATOM   1737 C CB  . LEU A 1 226 ? 54.053  36.950 19.801  1.00 28.34  ? 227  LEU A CB  1 
ATOM   1738 C CG  . LEU A 1 226 ? 53.075  37.691 20.714  1.00 30.02  ? 227  LEU A CG  1 
ATOM   1739 C CD1 . LEU A 1 226 ? 53.244  39.202 20.583  1.00 31.32  ? 227  LEU A CD1 1 
ATOM   1740 C CD2 . LEU A 1 226 ? 51.639  37.276 20.414  1.00 28.70  ? 227  LEU A CD2 1 
ATOM   1741 N N   . GLN A 1 227 ? 56.849  34.751 20.075  1.00 24.64  ? 228  GLN A N   1 
ATOM   1742 C CA  . GLN A 1 227 ? 57.687  33.788 19.371  1.00 25.06  ? 228  GLN A CA  1 
ATOM   1743 C C   . GLN A 1 227 ? 56.869  32.518 19.149  1.00 18.81  ? 228  GLN A C   1 
ATOM   1744 O O   . GLN A 1 227 ? 56.481  31.850 20.113  1.00 23.29  ? 228  GLN A O   1 
ATOM   1745 C CB  . GLN A 1 227 ? 58.961  33.506 20.172  1.00 20.24  ? 228  GLN A CB  1 
ATOM   1746 C CG  . GLN A 1 227 ? 59.795  34.760 20.429  1.00 25.71  ? 228  GLN A CG  1 
ATOM   1747 C CD  . GLN A 1 227 ? 60.929  34.547 21.431  1.00 31.77  ? 228  GLN A CD  1 
ATOM   1748 O OE1 . GLN A 1 227 ? 61.372  35.492 22.088  1.00 28.17  ? 228  GLN A OE1 1 
ATOM   1749 N NE2 . GLN A 1 227 ? 61.418  33.313 21.533  1.00 28.41  ? 228  GLN A NE2 1 
ATOM   1750 N N   . SER A 1 228 ? 56.576  32.211 17.882  1.00 20.78  ? 229  SER A N   1 
ATOM   1751 C CA  . SER A 1 228 ? 55.939  30.939 17.521  1.00 19.12  ? 229  SER A CA  1 
ATOM   1752 C C   . SER A 1 228 ? 54.670  30.671 18.327  1.00 25.61  ? 229  SER A C   1 
ATOM   1753 O O   . SER A 1 228 ? 54.463  29.574 18.849  1.00 22.31  ? 229  SER A O   1 
ATOM   1754 C CB  . SER A 1 228 ? 56.917  29.766 17.659  1.00 23.66  ? 229  SER A CB  1 
ATOM   1755 O OG  . SER A 1 228 ? 58.182  30.055 17.091  1.00 29.57  ? 229  SER A OG  1 
ATOM   1756 N N   . GLY A 1 229 ? 53.814  31.676 18.428  1.00 21.77  ? 230  GLY A N   1 
ATOM   1757 C CA  . GLY A 1 229 ? 52.555  31.490 19.112  1.00 19.97  ? 230  GLY A CA  1 
ATOM   1758 C C   . GLY A 1 229 ? 51.762  32.774 19.048  1.00 25.01  ? 230  GLY A C   1 
ATOM   1759 O O   . GLY A 1 229 ? 52.311  33.860 18.855  1.00 25.54  ? 230  GLY A O   1 
ATOM   1760 N N   . ALA A 1 230 ? 50.449  32.623 19.196  1.00 19.69  ? 231  ALA A N   1 
ATOM   1761 C CA  . ALA A 1 230 ? 49.531  33.748 19.110  1.00 22.23  ? 231  ALA A CA  1 
ATOM   1762 C C   . ALA A 1 230 ? 48.280  33.380 19.887  1.00 27.49  ? 231  ALA A C   1 
ATOM   1763 O O   . ALA A 1 230 ? 47.928  32.198 19.954  1.00 26.75  ? 231  ALA A O   1 
ATOM   1764 C CB  . ALA A 1 230 ? 49.186  34.083 17.645  1.00 20.29  ? 231  ALA A CB  1 
ATOM   1765 N N   . PRO A 1 231 ? 47.601  34.353 20.500  1.00 29.69  ? 232  PRO A N   1 
ATOM   1766 C CA  . PRO A 1 231 ? 46.420  34.014 21.308  1.00 27.37  ? 232  PRO A CA  1 
ATOM   1767 C C   . PRO A 1 231 ? 45.254  33.489 20.487  1.00 29.38  ? 232  PRO A C   1 
ATOM   1768 O O   . PRO A 1 231 ? 44.374  32.830 21.054  1.00 28.86  ? 232  PRO A O   1 
ATOM   1769 C CB  . PRO A 1 231 ? 46.073  35.342 21.995  1.00 27.77  ? 232  PRO A CB  1 
ATOM   1770 C CG  . PRO A 1 231 ? 46.595  36.385 21.058  1.00 27.47  ? 232  PRO A CG  1 
ATOM   1771 C CD  . PRO A 1 231 ? 47.869  35.800 20.492  1.00 26.46  ? 232  PRO A CD  1 
ATOM   1772 N N   . ASN A 1 232 ? 45.224  33.750 19.179  1.00 21.25  ? 233  ASN A N   1 
ATOM   1773 C CA  . ASN A 1 232 ? 44.174  33.264 18.293  1.00 27.16  ? 233  ASN A CA  1 
ATOM   1774 C C   . ASN A 1 232 ? 44.468  31.885 17.707  1.00 28.34  ? 233  ASN A C   1 
ATOM   1775 O O   . ASN A 1 232 ? 43.712  31.420 16.847  1.00 25.84  ? 233  ASN A O   1 
ATOM   1776 C CB  . ASN A 1 232 ? 43.935  34.273 17.153  1.00 25.40  ? 233  ASN A CB  1 
ATOM   1777 C CG  . ASN A 1 232 ? 45.236  34.804 16.553  1.00 26.61  ? 233  ASN A CG  1 
ATOM   1778 O OD1 . ASN A 1 232 ? 46.183  35.103 17.278  1.00 28.70  ? 233  ASN A OD1 1 
ATOM   1779 N ND2 . ASN A 1 232 ? 45.280  34.935 15.229  1.00 23.58  ? 233  ASN A ND2 1 
ATOM   1780 N N   . GLY A 1 233 ? 45.539  31.224 18.134  1.00 25.44  ? 234  GLY A N   1 
ATOM   1781 C CA  . GLY A 1 233 ? 45.752  29.843 17.762  1.00 39.63  ? 234  GLY A CA  1 
ATOM   1782 C C   . GLY A 1 233 ? 44.561  28.971 18.119  1.00 40.03  ? 234  GLY A C   1 
ATOM   1783 O O   . GLY A 1 233 ? 43.895  29.183 19.136  1.00 38.57  ? 234  GLY A O   1 
ATOM   1784 N N   . PRO A 1 234 ? 44.258  27.977 17.274  1.00 32.94  ? 235  PRO A N   1 
ATOM   1785 C CA  . PRO A 1 234 ? 43.109  27.091 17.546  1.00 24.08  ? 235  PRO A CA  1 
ATOM   1786 C C   . PRO A 1 234 ? 43.291  26.201 18.768  1.00 22.34  ? 235  PRO A C   1 
ATOM   1787 O O   . PRO A 1 234 ? 42.326  25.552 19.193  1.00 25.92  ? 235  PRO A O   1 
ATOM   1788 C CB  . PRO A 1 234 ? 43.004  26.252 16.266  1.00 27.80  ? 235  PRO A CB  1 
ATOM   1789 C CG  . PRO A 1 234 ? 44.386  26.261 15.702  1.00 29.40  ? 235  PRO A CG  1 
ATOM   1790 C CD  . PRO A 1 234 ? 44.983  27.596 16.052  1.00 27.86  ? 235  PRO A CD  1 
ATOM   1791 N N   . TRP A 1 235 ? 44.491  26.150 19.333  1.00 21.73  ? 236  TRP A N   1 
ATOM   1792 C CA  . TRP A 1 235 ? 44.810  25.382 20.528  1.00 26.75  ? 236  TRP A CA  1 
ATOM   1793 C C   . TRP A 1 235 ? 44.834  26.231 21.795  1.00 27.16  ? 236  TRP A C   1 
ATOM   1794 O O   . TRP A 1 235 ? 44.861  25.672 22.897  1.00 24.77  ? 236  TRP A O   1 
ATOM   1795 C CB  . TRP A 1 235 ? 46.184  24.733 20.354  1.00 19.02  ? 236  TRP A CB  1 
ATOM   1796 C CG  . TRP A 1 235 ? 47.196  25.766 19.940  1.00 23.03  ? 236  TRP A CG  1 
ATOM   1797 C CD1 . TRP A 1 235 ? 47.489  26.159 18.661  1.00 20.73  ? 236  TRP A CD1 1 
ATOM   1798 C CD2 . TRP A 1 235 ? 48.009  26.575 20.804  1.00 17.97  ? 236  TRP A CD2 1 
ATOM   1799 N NE1 . TRP A 1 235 ? 48.449  27.148 18.677  1.00 22.29  ? 236  TRP A NE1 1 
ATOM   1800 C CE2 . TRP A 1 235 ? 48.783  27.421 19.978  1.00 20.87  ? 236  TRP A CE2 1 
ATOM   1801 C CE3 . TRP A 1 235 ? 48.163  26.659 22.193  1.00 21.49  ? 236  TRP A CE3 1 
ATOM   1802 C CZ2 . TRP A 1 235 ? 49.698  28.342 20.494  1.00 21.42  ? 236  TRP A CZ2 1 
ATOM   1803 C CZ3 . TRP A 1 235 ? 49.077  27.573 22.708  1.00 21.53  ? 236  TRP A CZ3 1 
ATOM   1804 C CH2 . TRP A 1 235 ? 49.835  28.401 21.857  1.00 23.84  ? 236  TRP A CH2 1 
ATOM   1805 N N   . ALA A 1 236 ? 44.842  27.559 21.661  1.00 25.01  ? 237  ALA A N   1 
ATOM   1806 C CA  . ALA A 1 236 ? 45.224  28.442 22.756  1.00 29.09  ? 237  ALA A CA  1 
ATOM   1807 C C   . ALA A 1 236 ? 44.059  28.854 23.647  1.00 26.46  ? 237  ALA A C   1 
ATOM   1808 O O   . ALA A 1 236 ? 44.288  29.269 24.788  1.00 28.35  ? 237  ALA A O   1 
ATOM   1809 C CB  . ALA A 1 236 ? 45.914  29.694 22.200  1.00 18.36  ? 237  ALA A CB  1 
ATOM   1810 N N   . THR A 1 237 ? 42.828  28.768 23.160  1.00 25.71  ? 238  THR A N   1 
ATOM   1811 C CA  . THR A 1 237 ? 41.653  29.015 23.979  1.00 25.41  ? 238  THR A CA  1 
ATOM   1812 C C   . THR A 1 237 ? 40.638  27.911 23.740  1.00 29.54  ? 238  THR A C   1 
ATOM   1813 O O   . THR A 1 237 ? 40.745  27.120 22.797  1.00 30.24  ? 238  THR A O   1 
ATOM   1814 C CB  . THR A 1 237 ? 40.993  30.368 23.677  1.00 23.83  ? 238  THR A CB  1 
ATOM   1815 O OG1 . THR A 1 237 ? 40.564  30.382 22.315  1.00 26.97  ? 238  THR A OG1 1 
ATOM   1816 C CG2 . THR A 1 237 ? 41.951  31.518 23.920  1.00 23.12  ? 238  THR A CG2 1 
ATOM   1817 N N   . VAL A 1 238 ? 39.624  27.890 24.596  1.00 25.10  ? 239  VAL A N   1 
ATOM   1818 C CA  . VAL A 1 238 ? 38.547  26.920 24.517  1.00 24.56  ? 239  VAL A CA  1 
ATOM   1819 C C   . VAL A 1 238 ? 37.263  27.631 24.925  1.00 28.15  ? 239  VAL A C   1 
ATOM   1820 O O   . VAL A 1 238 ? 37.288  28.594 25.698  1.00 32.30  ? 239  VAL A O   1 
ATOM   1821 C CB  . VAL A 1 238 ? 38.863  25.696 25.408  1.00 32.69  ? 239  VAL A CB  1 
ATOM   1822 C CG1 . VAL A 1 238 ? 38.675  26.034 26.903  1.00 27.03  ? 239  VAL A CG1 1 
ATOM   1823 C CG2 . VAL A 1 238 ? 38.067  24.486 24.988  1.00 34.31  ? 239  VAL A CG2 1 
ATOM   1824 N N   . GLY A 1 239 ? 36.139  27.191 24.353  1.00 30.81  ? 240  GLY A N   1 
ATOM   1825 C CA  . GLY A 1 239 ? 34.853  27.741 24.736  1.00 31.64  ? 240  GLY A CA  1 
ATOM   1826 C C   . GLY A 1 239 ? 34.409  27.278 26.115  1.00 30.28  ? 240  GLY A C   1 
ATOM   1827 O O   . GLY A 1 239 ? 34.921  26.310 26.675  1.00 29.22  ? 240  GLY A O   1 
ATOM   1828 N N   . MET A 1 240 ? 33.422  27.993 26.668  1.00 31.13  ? 241  MET A N   1 
ATOM   1829 C CA  . MET A 1 240 ? 32.938  27.695 28.014  1.00 34.94  ? 241  MET A CA  1 
ATOM   1830 C C   . MET A 1 240 ? 32.359  26.291 28.107  1.00 34.31  ? 241  MET A C   1 
ATOM   1831 O O   . MET A 1 240 ? 32.613  25.570 29.081  1.00 31.69  ? 241  MET A O   1 
ATOM   1832 C CB  . MET A 1 240 ? 31.882  28.715 28.441  1.00 35.25  ? 241  MET A CB  1 
ATOM   1833 C CG  . MET A 1 240 ? 32.417  30.050 28.919  1.00 38.63  ? 241  MET A CG  1 
ATOM   1834 S SD  . MET A 1 240 ? 31.287  31.389 28.517  1.00 50.68  ? 241  MET A SD  1 
ATOM   1835 C CE  . MET A 1 240 ? 30.601  31.733 30.101  1.00 49.51  ? 241  MET A CE  1 
ATOM   1836 N N   . GLY A 1 241 ? 31.566  25.892 27.113  1.00 30.32  ? 242  GLY A N   1 
ATOM   1837 C CA  . GLY A 1 241 ? 30.929  24.585 27.167  1.00 34.42  ? 242  GLY A CA  1 
ATOM   1838 C C   . GLY A 1 241 ? 31.928  23.444 27.120  1.00 35.54  ? 242  GLY A C   1 
ATOM   1839 O O   . GLY A 1 241 ? 31.835  22.486 27.893  1.00 36.23  ? 242  GLY A O   1 
ATOM   1840 N N   . GLU A 1 242 ? 32.909  23.540 26.215  1.00 32.62  ? 243  GLU A N   1 
ATOM   1841 C CA  . GLU A 1 242 ? 33.912  22.486 26.082  1.00 30.38  ? 243  GLU A CA  1 
ATOM   1842 C C   . GLU A 1 242 ? 34.841  22.447 27.293  1.00 29.84  ? 243  GLU A C   1 
ATOM   1843 O O   . GLU A 1 242 ? 35.282  21.369 27.709  1.00 29.11  ? 243  GLU A O   1 
ATOM   1844 C CB  . GLU A 1 242 ? 34.708  22.669 24.784  1.00 31.04  ? 243  GLU A CB  1 
ATOM   1845 C CG  . GLU A 1 242 ? 35.911  21.710 24.608  1.00 28.30  ? 243  GLU A CG  1 
ATOM   1846 C CD  . GLU A 1 242 ? 35.516  20.244 24.432  1.00 33.82  ? 243  GLU A CD  1 
ATOM   1847 O OE1 . GLU A 1 242 ? 34.318  19.945 24.263  1.00 37.28  ? 243  GLU A OE1 1 
ATOM   1848 O OE2 . GLU A 1 242 ? 36.420  19.385 24.471  1.00 35.28  ? 243  GLU A OE2 1 
ATOM   1849 N N   . ALA A 1 243 ? 35.157  23.608 27.873  1.00 27.02  ? 244  ALA A N   1 
ATOM   1850 C CA  . ALA A 1 243 ? 35.941  23.614 29.108  1.00 30.12  ? 244  ALA A CA  1 
ATOM   1851 C C   . ALA A 1 243 ? 35.189  22.914 30.232  1.00 31.25  ? 244  ALA A C   1 
ATOM   1852 O O   . ALA A 1 243 ? 35.766  22.117 30.979  1.00 29.18  ? 244  ALA A O   1 
ATOM   1853 C CB  . ALA A 1 243 ? 36.289  25.046 29.512  1.00 25.68  ? 244  ALA A CB  1 
ATOM   1854 N N   . ARG A 1 244 ? 33.890  23.184 30.352  1.00 28.20  ? 245  ARG A N   1 
ATOM   1855 C CA  . ARG A 1 244 ? 33.088  22.520 31.367  1.00 33.10  ? 245  ARG A CA  1 
ATOM   1856 C C   . ARG A 1 244 ? 33.044  21.017 31.131  1.00 32.99  ? 245  ARG A C   1 
ATOM   1857 O O   . ARG A 1 244 ? 33.186  20.225 32.069  1.00 35.67  ? 245  ARG A O   1 
ATOM   1858 C CB  . ARG A 1 244 ? 31.678  23.106 31.387  1.00 31.26  ? 245  ARG A CB  1 
ATOM   1859 C CG  . ARG A 1 244 ? 30.713  22.338 32.273  1.00 33.01  ? 245  ARG A CG  1 
ATOM   1860 C CD  . ARG A 1 244 ? 29.485  23.169 32.656  1.00 34.72  ? 245  ARG A CD  1 
ATOM   1861 N NE  . ARG A 1 244 ? 29.811  24.331 33.474  1.00 39.59  ? 245  ARG A NE  1 
ATOM   1862 C CZ  . ARG A 1 244 ? 29.804  24.325 34.810  1.00 34.97  ? 245  ARG A CZ  1 
ATOM   1863 N NH1 . ARG A 1 244 ? 29.518  23.221 35.476  1.00 35.89  ? 245  ARG A NH1 1 
ATOM   1864 N NH2 . ARG A 1 244 ? 30.106  25.427 35.471  1.00 34.74  ? 245  ARG A NH2 1 
ATOM   1865 N N   . ARG A 1 245 ? 32.838  20.609 29.877  1.00 33.95  ? 246  ARG A N   1 
ATOM   1866 C CA  . ARG A 1 245 ? 32.818  19.187 29.550  1.00 32.51  ? 246  ARG A CA  1 
ATOM   1867 C C   . ARG A 1 245 ? 34.133  18.510 29.929  1.00 32.74  ? 246  ARG A C   1 
ATOM   1868 O O   . ARG A 1 245 ? 34.130  17.419 30.512  1.00 30.21  ? 246  ARG A O   1 
ATOM   1869 C CB  . ARG A 1 245 ? 32.525  19.000 28.059  1.00 32.77  ? 246  ARG A CB  1 
ATOM   1870 C CG  . ARG A 1 245 ? 32.360  17.544 27.639  1.00 33.68  ? 246  ARG A CG  1 
ATOM   1871 C CD  . ARG A 1 245 ? 32.533  17.350 26.123  1.00 33.73  ? 246  ARG A CD  1 
ATOM   1872 N NE  . ARG A 1 245 ? 33.917  17.523 25.689  1.00 38.30  ? 246  ARG A NE  1 
ATOM   1873 C CZ  . ARG A 1 245 ? 34.887  16.632 25.900  1.00 39.46  ? 246  ARG A CZ  1 
ATOM   1874 N NH1 . ARG A 1 245 ? 34.638  15.510 26.558  1.00 37.64  ? 246  ARG A NH1 1 
ATOM   1875 N NH2 . ARG A 1 245 ? 36.114  16.873 25.464  1.00 33.80  ? 246  ARG A NH2 1 
ATOM   1876 N N   . ARG A 1 246 ? 35.271  19.144 29.621  1.00 27.87  ? 247  ARG A N   1 
ATOM   1877 C CA  . ARG A 1 246 ? 36.560  18.540 29.958  1.00 29.79  ? 247  ARG A CA  1 
ATOM   1878 C C   . ARG A 1 246 ? 36.765  18.471 31.467  1.00 34.26  ? 247  ARG A C   1 
ATOM   1879 O O   . ARG A 1 246 ? 37.220  17.446 31.989  1.00 32.12  ? 247  ARG A O   1 
ATOM   1880 C CB  . ARG A 1 246 ? 37.703  19.313 29.301  1.00 28.78  ? 247  ARG A CB  1 
ATOM   1881 C CG  . ARG A 1 246 ? 37.686  19.264 27.776  1.00 25.44  ? 247  ARG A CG  1 
ATOM   1882 C CD  . ARG A 1 246 ? 38.862  20.031 27.182  1.00 23.78  ? 247  ARG A CD  1 
ATOM   1883 N NE  . ARG A 1 246 ? 38.758  20.119 25.731  1.00 27.71  ? 247  ARG A NE  1 
ATOM   1884 C CZ  . ARG A 1 246 ? 39.668  20.687 24.947  1.00 27.60  ? 247  ARG A CZ  1 
ATOM   1885 N NH1 . ARG A 1 246 ? 40.760  21.222 25.474  1.00 24.38  ? 247  ARG A NH1 1 
ATOM   1886 N NH2 . ARG A 1 246 ? 39.484  20.716 23.632  1.00 24.61  ? 247  ARG A NH2 1 
ATOM   1887 N N   . ALA A 1 247 ? 36.443  19.553 32.182  1.00 33.31  ? 248  ALA A N   1 
ATOM   1888 C CA  . ALA A 1 247 ? 36.572  19.544 33.636  1.00 34.15  ? 248  ALA A CA  1 
ATOM   1889 C C   . ALA A 1 247 ? 35.661  18.494 34.259  1.00 36.96  ? 248  ALA A C   1 
ATOM   1890 O O   . ALA A 1 247 ? 36.068  17.770 35.173  1.00 31.98  ? 248  ALA A O   1 
ATOM   1891 C CB  . ALA A 1 247 ? 36.258  20.931 34.198  1.00 27.34  ? 248  ALA A CB  1 
ATOM   1892 N N   . THR A 1 248 ? 34.424  18.397 33.766  1.00 39.68  ? 249  THR A N   1 
ATOM   1893 C CA  . THR A 1 248 ? 33.472  17.423 34.289  1.00 39.25  ? 249  THR A CA  1 
ATOM   1894 C C   . THR A 1 248 ? 33.926  16.002 33.979  1.00 37.56  ? 249  THR A C   1 
ATOM   1895 O O   . THR A 1 248 ? 33.762  15.090 34.799  1.00 35.41  ? 249  THR A O   1 
ATOM   1896 C CB  . THR A 1 248 ? 32.093  17.680 33.685  1.00 39.94  ? 249  THR A CB  1 
ATOM   1897 O OG1 . THR A 1 248 ? 31.575  18.911 34.200  1.00 49.42  ? 249  THR A OG1 1 
ATOM   1898 C CG2 . THR A 1 248 ? 31.130  16.538 34.012  1.00 38.54  ? 249  THR A CG2 1 
ATOM   1899 N N   . GLN A 1 249 ? 34.492  15.803 32.790  1.00 35.84  ? 250  GLN A N   1 
ATOM   1900 C CA  . GLN A 1 249 ? 35.052  14.508 32.435  1.00 33.53  ? 250  GLN A CA  1 
ATOM   1901 C C   . GLN A 1 249 ? 36.225  14.135 33.334  1.00 32.45  ? 250  GLN A C   1 
ATOM   1902 O O   . GLN A 1 249 ? 36.326  12.985 33.782  1.00 32.07  ? 250  GLN A O   1 
ATOM   1903 C CB  . GLN A 1 249 ? 35.482  14.531 30.976  1.00 37.70  ? 250  GLN A CB  1 
ATOM   1904 C CG  . GLN A 1 249 ? 36.473  13.462 30.658  1.00 55.22  ? 250  GLN A CG  1 
ATOM   1905 C CD  . GLN A 1 249 ? 35.841  12.192 30.183  1.00 64.49  ? 250  GLN A CD  1 
ATOM   1906 O OE1 . GLN A 1 249 ? 34.895  11.692 30.779  1.00 71.66  ? 250  GLN A OE1 1 
ATOM   1907 N NE2 . GLN A 1 249 ? 36.377  11.648 29.106  1.00 67.16  ? 250  GLN A NE2 1 
ATOM   1908 N N   . LEU A 1 250 ? 37.130  15.080 33.600  1.00 29.51  ? 251  LEU A N   1 
ATOM   1909 C CA  . LEU A 1 250 ? 38.244  14.796 34.498  1.00 32.69  ? 251  LEU A CA  1 
ATOM   1910 C C   . LEU A 1 250 ? 37.738  14.390 35.875  1.00 35.79  ? 251  LEU A C   1 
ATOM   1911 O O   . LEU A 1 250 ? 38.181  13.382 36.441  1.00 39.27  ? 251  LEU A O   1 
ATOM   1912 C CB  . LEU A 1 250 ? 39.169  16.008 34.609  1.00 29.36  ? 251  LEU A CB  1 
ATOM   1913 C CG  . LEU A 1 250 ? 40.406  15.772 35.493  1.00 33.58  ? 251  LEU A CG  1 
ATOM   1914 C CD1 . LEU A 1 250 ? 41.469  14.977 34.732  1.00 33.54  ? 251  LEU A CD1 1 
ATOM   1915 C CD2 . LEU A 1 250 ? 40.977  17.085 36.028  1.00 29.11  ? 251  LEU A CD2 1 
ATOM   1916 N N   . ALA A 1 251 ? 36.801  15.167 36.427  1.00 33.82  ? 252  ALA A N   1 
ATOM   1917 C CA  . ALA A 1 251 ? 36.230  14.847 37.731  1.00 37.24  ? 252  ALA A CA  1 
ATOM   1918 C C   . ALA A 1 251 ? 35.639  13.445 37.735  1.00 39.46  ? 252  ALA A C   1 
ATOM   1919 O O   . ALA A 1 251 ? 35.883  12.656 38.656  1.00 37.88  ? 252  ALA A O   1 
ATOM   1920 C CB  . ALA A 1 251 ? 35.168  15.884 38.104  1.00 36.55  ? 252  ALA A CB  1 
ATOM   1921 N N   . HIS A 1 252 ? 34.877  13.108 36.694  1.00 41.48  ? 253  HIS A N   1 
ATOM   1922 C CA  . HIS A 1 252 ? 34.284  11.777 36.615  1.00 43.89  ? 253  HIS A CA  1 
ATOM   1923 C C   . HIS A 1 252 ? 35.358  10.694 36.574  1.00 41.87  ? 253  HIS A C   1 
ATOM   1924 O O   . HIS A 1 252 ? 35.181  9.612  37.143  1.00 45.51  ? 253  HIS A O   1 
ATOM   1925 C CB  . HIS A 1 252 ? 33.376  11.684 35.389  1.00 48.58  ? 253  HIS A CB  1 
ATOM   1926 C CG  . HIS A 1 252 ? 32.858  10.306 35.129  1.00 57.67  ? 253  HIS A CG  1 
ATOM   1927 N ND1 . HIS A 1 252 ? 31.670  9.846  35.656  1.00 63.28  ? 253  HIS A ND1 1 
ATOM   1928 C CD2 . HIS A 1 252 ? 33.376  9.278  34.414  1.00 61.98  ? 253  HIS A CD2 1 
ATOM   1929 C CE1 . HIS A 1 252 ? 31.475  8.598  35.271  1.00 66.75  ? 253  HIS A CE1 1 
ATOM   1930 N NE2 . HIS A 1 252 ? 32.496  8.229  34.518  1.00 68.50  ? 253  HIS A NE2 1 
ATOM   1931 N N   . LEU A 1 253 ? 36.483  10.970 35.909  1.00 41.22  ? 254  LEU A N   1 
ATOM   1932 C CA  . LEU A 1 253 ? 37.530  9.961  35.783  1.00 43.53  ? 254  LEU A CA  1 
ATOM   1933 C C   . LEU A 1 253 ? 38.254  9.715  37.103  1.00 48.11  ? 254  LEU A C   1 
ATOM   1934 O O   . LEU A 1 253 ? 38.797  8.624  37.310  1.00 47.14  ? 254  LEU A O   1 
ATOM   1935 C CB  . LEU A 1 253 ? 38.529  10.369 34.701  1.00 35.08  ? 254  LEU A CB  1 
ATOM   1936 C CG  . LEU A 1 253 ? 38.069  10.181 33.250  1.00 40.59  ? 254  LEU A CG  1 
ATOM   1937 C CD1 . LEU A 1 253 ? 39.047  10.831 32.280  1.00 31.10  ? 254  LEU A CD1 1 
ATOM   1938 C CD2 . LEU A 1 253 ? 37.904  8.705  32.936  1.00 34.57  ? 254  LEU A CD2 1 
ATOM   1939 N N   . VAL A 1 254 ? 38.278  10.700 38.004  1.00 41.30  ? 255  VAL A N   1 
ATOM   1940 C CA  . VAL A 1 254 ? 38.968  10.548 39.282  1.00 44.63  ? 255  VAL A CA  1 
ATOM   1941 C C   . VAL A 1 254 ? 37.996  10.342 40.442  1.00 47.78  ? 255  VAL A C   1 
ATOM   1942 O O   . VAL A 1 254 ? 38.407  10.395 41.602  1.00 51.18  ? 255  VAL A O   1 
ATOM   1943 C CB  . VAL A 1 254 ? 39.903  11.738 39.555  1.00 35.63  ? 255  VAL A CB  1 
ATOM   1944 C CG1 . VAL A 1 254 ? 40.944  11.855 38.447  1.00 31.19  ? 255  VAL A CG1 1 
ATOM   1945 C CG2 . VAL A 1 254 ? 39.106  13.030 39.684  1.00 32.94  ? 255  VAL A CG2 1 
ATOM   1946 N N   . GLY A 1 255 ? 36.715  10.116 40.155  1.00 46.82  ? 256  GLY A N   1 
ATOM   1947 C CA  . GLY A 1 255 ? 35.745  9.762  41.174  1.00 48.83  ? 256  GLY A CA  1 
ATOM   1948 C C   . GLY A 1 255 ? 34.869  10.882 41.693  1.00 47.12  ? 256  GLY A C   1 
ATOM   1949 O O   . GLY A 1 255 ? 34.206  10.694 42.718  1.00 55.71  ? 256  GLY A O   1 
ATOM   1950 N N   . CYS A 1 256 ? 34.828  12.027 41.021  1.00 45.43  ? 257  CYS A N   1 
ATOM   1951 C CA  . CYS A 1 256 ? 34.109  13.194 41.528  1.00 49.16  ? 257  CYS A CA  1 
ATOM   1952 C C   . CYS A 1 256 ? 32.933  13.587 40.641  1.00 57.29  ? 257  CYS A C   1 
ATOM   1953 O O   . CYS A 1 256 ? 33.099  13.763 39.439  1.00 57.42  ? 257  CYS A O   1 
ATOM   1954 C CB  . CYS A 1 256 ? 35.060  14.386 41.644  1.00 46.71  ? 257  CYS A CB  1 
ATOM   1955 S SG  . CYS A 1 256 ? 36.384  14.192 42.830  1.00 49.24  ? 257  CYS A SG  1 
ATOM   1956 N N   . PRO A 1 257 ? 31.737  13.714 41.178  1.00 78.00  ? 258  PRO A N   1 
ATOM   1957 C CA  . PRO A 1 257 ? 31.461  13.471 42.582  1.00 84.07  ? 258  PRO A CA  1 
ATOM   1958 C C   . PRO A 1 257 ? 31.015  12.021 42.729  1.00 85.01  ? 258  PRO A C   1 
ATOM   1959 O O   . PRO A 1 257 ? 31.136  11.290 41.747  1.00 81.63  ? 258  PRO A O   1 
ATOM   1960 C CB  . PRO A 1 257 ? 30.283  14.388 42.819  1.00 86.73  ? 258  PRO A CB  1 
ATOM   1961 C CG  . PRO A 1 257 ? 29.524  14.314 41.532  1.00 88.92  ? 258  PRO A CG  1 
ATOM   1962 C CD  . PRO A 1 257 ? 30.480  13.897 40.440  1.00 84.40  ? 258  PRO A CD  1 
ATOM   1963 N N   . GLY A 1 263 ? 26.360  18.533 38.899  1.00 95.90  ? 264  GLY A N   1 
ATOM   1964 C CA  . GLY A 1 263 ? 25.730  18.933 40.145  1.00 95.40  ? 264  GLY A CA  1 
ATOM   1965 C C   . GLY A 1 263 ? 26.165  20.297 40.642  1.00 88.16  ? 264  GLY A C   1 
ATOM   1966 O O   . GLY A 1 263 ? 26.417  21.202 39.841  1.00 94.43  ? 264  GLY A O   1 
ATOM   1967 N N   . ASN A 1 264 ? 26.299  20.463 41.949  1.00 75.25  ? 265  ASN A N   1 
ATOM   1968 C CA  . ASN A 1 264 ? 26.738  21.756 42.425  1.00 63.30  ? 265  ASN A CA  1 
ATOM   1969 C C   . ASN A 1 264 ? 28.239  21.853 42.198  1.00 50.49  ? 265  ASN A C   1 
ATOM   1970 O O   . ASN A 1 264 ? 29.012  21.054 42.728  1.00 43.74  ? 265  ASN A O   1 
ATOM   1971 C CB  . ASN A 1 264 ? 26.411  21.928 43.908  1.00 70.27  ? 265  ASN A CB  1 
ATOM   1972 C CG  . ASN A 1 264 ? 26.863  23.268 44.453  1.00 85.29  ? 265  ASN A CG  1 
ATOM   1973 O OD1 . ASN A 1 264 ? 27.440  24.082 43.732  1.00 76.95  ? 265  ASN A OD1 1 
ATOM   1974 N ND2 . ASN A 1 264 ? 26.600  23.505 45.733  1.00 109.88 ? 265  ASN A ND2 1 
ATOM   1975 N N   . ASP A 1 265 ? 28.646  22.842 41.410  1.00 41.68  ? 266  ASP A N   1 
ATOM   1976 C CA  . ASP A 1 265 ? 30.061  23.062 41.120  1.00 38.69  ? 266  ASP A CA  1 
ATOM   1977 C C   . ASP A 1 265 ? 30.874  23.104 42.409  1.00 38.49  ? 266  ASP A C   1 
ATOM   1978 O O   . ASP A 1 265 ? 32.026  22.659 42.436  1.00 46.46  ? 266  ASP A O   1 
ATOM   1979 C CB  . ASP A 1 265 ? 30.268  24.357 40.328  1.00 37.55  ? 266  ASP A CB  1 
ATOM   1980 C CG  . ASP A 1 265 ? 29.970  24.205 38.834  1.00 51.42  ? 266  ASP A CG  1 
ATOM   1981 O OD1 . ASP A 1 265 ? 29.887  25.245 38.149  1.00 45.11  ? 266  ASP A OD1 1 
ATOM   1982 O OD2 . ASP A 1 265 ? 29.834  23.064 38.338  1.00 44.35  ? 266  ASP A OD2 1 
ATOM   1983 N N   . THR A 1 266 ? 30.280  23.623 43.484  1.00 41.71  ? 267  THR A N   1 
ATOM   1984 C CA  . THR A 1 266 ? 30.965  23.691 44.772  1.00 41.59  ? 267  THR A CA  1 
ATOM   1985 C C   . THR A 1 266 ? 31.408  22.310 45.237  1.00 44.19  ? 267  THR A C   1 
ATOM   1986 O O   . THR A 1 266 ? 32.584  22.096 45.554  1.00 43.83  ? 267  THR A O   1 
ATOM   1987 C CB  . THR A 1 266 ? 30.044  24.339 45.808  1.00 46.65  ? 267  THR A CB  1 
ATOM   1988 O OG1 . THR A 1 266 ? 29.746  25.684 45.406  1.00 46.08  ? 267  THR A OG1 1 
ATOM   1989 C CG2 . THR A 1 266 ? 30.687  24.332 47.196  1.00 44.07  ? 267  THR A CG2 1 
ATOM   1990 N N   . GLU A 1 267 ? 30.482  21.378 45.271  1.00 42.13  ? 268  GLU A N   1 
ATOM   1991 C CA  . GLU A 1 267 ? 30.795  20.044 45.703  1.00 53.06  ? 268  GLU A CA  1 
ATOM   1992 C C   . GLU A 1 267 ? 31.781  19.325 44.812  1.00 47.23  ? 268  GLU A C   1 
ATOM   1993 O O   . GLU A 1 267 ? 32.603  18.604 45.273  1.00 49.22  ? 268  GLU A O   1 
ATOM   1994 C CB  . GLU A 1 267 ? 29.530  19.201 45.995  1.00 58.81  ? 268  GLU A CB  1 
ATOM   1995 C CG  . GLU A 1 267 ? 29.244  18.065 45.031  1.00 78.01  ? 268  GLU A CG  1 
ATOM   1996 C CD  . GLU A 1 267 ? 28.570  16.832 45.638  1.00 94.39  ? 268  GLU A CD  1 
ATOM   1997 O OE1 . GLU A 1 267 ? 28.969  16.370 46.726  1.00 98.85  ? 268  GLU A OE1 1 
ATOM   1998 O OE2 . GLU A 1 267 ? 27.635  16.301 44.997  1.00 98.20  ? 268  GLU A OE2 1 
ATOM   1999 N N   . LEU A 1 268 ? 31.673  19.511 43.524  1.00 41.55  ? 269  LEU A N   1 
ATOM   2000 C CA  . LEU A 1 268 ? 32.556  18.807 42.603  1.00 42.66  ? 269  LEU A CA  1 
ATOM   2001 C C   . LEU A 1 268 ? 33.983  19.325 42.716  1.00 40.64  ? 269  LEU A C   1 
ATOM   2002 O O   . LEU A 1 268 ? 34.938  18.540 42.684  1.00 38.98  ? 269  LEU A O   1 
ATOM   2003 C CB  . LEU A 1 268 ? 32.041  18.923 41.167  1.00 40.77  ? 269  LEU A CB  1 
ATOM   2004 C CG  . LEU A 1 268 ? 32.909  18.323 40.057  1.00 45.84  ? 269  LEU A CG  1 
ATOM   2005 C CD1 . LEU A 1 268 ? 32.018  17.748 38.966  1.00 52.92  ? 269  LEU A CD1 1 
ATOM   2006 C CD2 . LEU A 1 268 ? 33.863  19.353 39.478  1.00 45.76  ? 269  LEU A CD2 1 
ATOM   2007 N N   . VAL A 1 269 ? 34.153  20.640 42.846  1.00 36.13  ? 270  VAL A N   1 
ATOM   2008 C CA  . VAL A 1 269 ? 35.497  21.173 43.031  1.00 40.16  ? 270  VAL A CA  1 
ATOM   2009 C C   . VAL A 1 269 ? 36.047  20.749 44.388  1.00 40.64  ? 270  VAL A C   1 
ATOM   2010 O O   . VAL A 1 269 ? 37.237  20.430 44.520  1.00 35.42  ? 270  VAL A O   1 
ATOM   2011 C CB  . VAL A 1 269 ? 35.503  22.702 42.856  1.00 38.91  ? 270  VAL A CB  1 
ATOM   2012 C CG1 . VAL A 1 269 ? 36.888  23.260 43.151  1.00 38.99  ? 270  VAL A CG1 1 
ATOM   2013 C CG2 . VAL A 1 269 ? 35.085  23.072 41.438  1.00 37.35  ? 270  VAL A CG2 1 
ATOM   2014 N N   . ALA A 1 270 ? 35.190  20.720 45.413  1.00 36.00  ? 271  ALA A N   1 
ATOM   2015 C CA  . ALA A 1 270 ? 35.615  20.241 46.724  1.00 44.96  ? 271  ALA A CA  1 
ATOM   2016 C C   . ALA A 1 270 ? 36.153  18.820 46.638  1.00 42.37  ? 271  ALA A C   1 
ATOM   2017 O O   . ALA A 1 270 ? 37.174  18.496 47.254  1.00 45.53  ? 271  ALA A O   1 
ATOM   2018 C CB  . ALA A 1 270 ? 34.456  20.318 47.723  1.00 39.39  ? 271  ALA A CB  1 
ATOM   2019 N N   . CYS A 1 271 ? 35.486  17.960 45.867  1.00 37.66  ? 272  CYS A N   1 
ATOM   2020 C CA  . CYS A 1 271 ? 35.977  16.600 45.681  1.00 39.67  ? 272  CYS A CA  1 
ATOM   2021 C C   . CYS A 1 271 ? 37.292  16.590 44.904  1.00 40.94  ? 272  CYS A C   1 
ATOM   2022 O O   . CYS A 1 271 ? 38.219  15.849 45.253  1.00 41.53  ? 272  CYS A O   1 
ATOM   2023 C CB  . CYS A 1 271 ? 34.914  15.760 44.975  1.00 44.83  ? 272  CYS A CB  1 
ATOM   2024 S SG  . CYS A 1 271 ? 35.391  14.061 44.609  1.00 52.19  ? 272  CYS A SG  1 
ATOM   2025 N N   . LEU A 1 272 ? 37.392  17.406 43.849  1.00 35.73  ? 273  LEU A N   1 
ATOM   2026 C CA  . LEU A 1 272 ? 38.643  17.488 43.099  1.00 36.65  ? 273  LEU A CA  1 
ATOM   2027 C C   . LEU A 1 272 ? 39.797  17.965 43.973  1.00 35.88  ? 273  LEU A C   1 
ATOM   2028 O O   . LEU A 1 272 ? 40.948  17.582 43.741  1.00 36.46  ? 273  LEU A O   1 
ATOM   2029 C CB  . LEU A 1 272 ? 38.490  18.414 41.889  1.00 35.66  ? 273  LEU A CB  1 
ATOM   2030 C CG  . LEU A 1 272 ? 37.707  17.936 40.663  1.00 40.76  ? 273  LEU A CG  1 
ATOM   2031 C CD1 . LEU A 1 272 ? 37.545  19.074 39.675  1.00 36.82  ? 273  LEU A CD1 1 
ATOM   2032 C CD2 . LEU A 1 272 ? 38.403  16.764 39.991  1.00 37.19  ? 273  LEU A CD2 1 
ATOM   2033 N N   . ARG A 1 273 ? 39.516  18.793 44.980  1.00 32.60  ? 274  ARG A N   1 
ATOM   2034 C CA  . ARG A 1 273 ? 40.592  19.301 45.822  1.00 36.27  ? 274  ARG A CA  1 
ATOM   2035 C C   . ARG A 1 273 ? 41.167  18.220 46.725  1.00 36.05  ? 274  ARG A C   1 
ATOM   2036 O O   . ARG A 1 273 ? 42.326  18.318 47.139  1.00 38.83  ? 274  ARG A O   1 
ATOM   2037 C CB  . ARG A 1 273 ? 40.105  20.484 46.658  1.00 35.18  ? 274  ARG A CB  1 
ATOM   2038 C CG  . ARG A 1 273 ? 39.973  21.751 45.854  1.00 36.54  ? 274  ARG A CG  1 
ATOM   2039 C CD  . ARG A 1 273 ? 39.579  22.928 46.709  1.00 40.97  ? 274  ARG A CD  1 
ATOM   2040 N NE  . ARG A 1 273 ? 39.502  24.127 45.887  1.00 49.87  ? 274  ARG A NE  1 
ATOM   2041 C CZ  . ARG A 1 273 ? 38.439  24.919 45.819  1.00 47.61  ? 274  ARG A CZ  1 
ATOM   2042 N NH1 . ARG A 1 273 ? 37.359  24.643 46.536  1.00 43.56  ? 274  ARG A NH1 1 
ATOM   2043 N NH2 . ARG A 1 273 ? 38.461  25.983 45.030  1.00 40.51  ? 274  ARG A NH2 1 
ATOM   2044 N N   . THR A 1 274 ? 40.383  17.193 47.044  1.00 36.39  ? 275  THR A N   1 
ATOM   2045 C CA  . THR A 1 274 ? 40.904  16.094 47.848  1.00 40.77  ? 275  THR A CA  1 
ATOM   2046 C C   . THR A 1 274 ? 41.770  15.141 47.037  1.00 41.25  ? 275  THR A C   1 
ATOM   2047 O O   . THR A 1 274 ? 42.381  14.238 47.617  1.00 40.59  ? 275  THR A O   1 
ATOM   2048 C CB  . THR A 1 274 ? 39.762  15.304 48.488  1.00 41.73  ? 275  THR A CB  1 
ATOM   2049 O OG1 . THR A 1 274 ? 39.083  14.551 47.477  1.00 39.16  ? 275  THR A OG1 1 
ATOM   2050 C CG2 . THR A 1 274 ? 38.773  16.245 49.167  1.00 38.24  ? 275  THR A CG2 1 
ATOM   2051 N N   . ARG A 1 275 ? 41.832  15.312 45.730  1.00 35.31  ? 276  ARG A N   1 
ATOM   2052 C CA  . ARG A 1 275 ? 42.588  14.331 44.968  1.00 35.58  ? 276  ARG A CA  1 
ATOM   2053 C C   . ARG A 1 275 ? 44.063  14.715 44.927  1.00 36.70  ? 276  ARG A C   1 
ATOM   2054 O O   . ARG A 1 275 ? 44.390  15.891 44.732  1.00 35.12  ? 276  ARG A O   1 
ATOM   2055 C CB  . ARG A 1 275 ? 42.053  14.223 43.545  1.00 35.66  ? 276  ARG A CB  1 
ATOM   2056 C CG  . ARG A 1 275 ? 40.624  13.694 43.451  1.00 42.40  ? 276  ARG A CG  1 
ATOM   2057 C CD  . ARG A 1 275 ? 40.540  12.269 43.957  1.00 43.81  ? 276  ARG A CD  1 
ATOM   2058 N NE  . ARG A 1 275 ? 39.203  11.701 43.820  1.00 49.57  ? 276  ARG A NE  1 
ATOM   2059 C CZ  . ARG A 1 275 ? 38.303  11.656 44.800  1.00 60.33  ? 276  ARG A CZ  1 
ATOM   2060 N NH1 . ARG A 1 275 ? 38.593  12.152 45.995  1.00 64.39  ? 276  ARG A NH1 1 
ATOM   2061 N NH2 . ARG A 1 275 ? 37.113  11.110 44.588  1.00 64.64  ? 276  ARG A NH2 1 
ATOM   2062 N N   . PRO A 1 276 ? 44.949  13.737 45.111  1.00 34.94  ? 277  PRO A N   1 
ATOM   2063 C CA  . PRO A 1 276 ? 46.385  13.999 44.947  1.00 31.93  ? 277  PRO A CA  1 
ATOM   2064 C C   . PRO A 1 276 ? 46.673  14.617 43.585  1.00 30.41  ? 277  PRO A C   1 
ATOM   2065 O O   . PRO A 1 276 ? 46.017  14.307 42.590  1.00 29.88  ? 277  PRO A O   1 
ATOM   2066 C CB  . PRO A 1 276 ? 47.021  12.611 45.088  1.00 34.40  ? 277  PRO A CB  1 
ATOM   2067 C CG  . PRO A 1 276 ? 46.000  11.790 45.847  1.00 34.46  ? 277  PRO A CG  1 
ATOM   2068 C CD  . PRO A 1 276 ? 44.660  12.326 45.427  1.00 33.98  ? 277  PRO A CD  1 
ATOM   2069 N N   . ALA A 1 277 ? 47.656  15.519 43.557  1.00 26.95  ? 278  ALA A N   1 
ATOM   2070 C CA  . ALA A 1 277 ? 47.977  16.242 42.331  1.00 29.30  ? 278  ALA A CA  1 
ATOM   2071 C C   . ALA A 1 277 ? 48.331  15.291 41.194  1.00 33.01  ? 278  ALA A C   1 
ATOM   2072 O O   . ALA A 1 277 ? 47.920  15.503 40.045  1.00 34.87  ? 278  ALA A O   1 
ATOM   2073 C CB  . ALA A 1 277 ? 49.126  17.218 42.589  1.00 26.40  ? 278  ALA A CB  1 
ATOM   2074 N N   . GLN A 1 278 ? 49.096  14.238 41.492  1.00 35.22  ? 279  GLN A N   1 
ATOM   2075 C CA  . GLN A 1 278 ? 49.508  13.317 40.438  1.00 35.70  ? 279  GLN A CA  1 
ATOM   2076 C C   . GLN A 1 278 ? 48.318  12.567 39.847  1.00 34.22  ? 279  GLN A C   1 
ATOM   2077 O O   . GLN A 1 278 ? 48.329  12.229 38.658  1.00 33.66  ? 279  GLN A O   1 
ATOM   2078 C CB  . GLN A 1 278 ? 50.554  12.333 40.972  1.00 31.28  ? 279  GLN A CB  1 
ATOM   2079 C CG  . GLN A 1 278 ? 51.177  11.456 39.886  1.00 38.50  ? 279  GLN A CG  1 
ATOM   2080 C CD  . GLN A 1 278 ? 51.808  12.275 38.765  1.00 41.77  ? 279  GLN A CD  1 
ATOM   2081 O OE1 . GLN A 1 278 ? 52.574  13.207 39.019  1.00 40.70  ? 279  GLN A OE1 1 
ATOM   2082 N NE2 . GLN A 1 278 ? 51.481  11.933 37.517  1.00 33.69  ? 279  GLN A NE2 1 
ATOM   2083 N N   . VAL A 1 279 ? 47.284  12.311 40.653  1.00 35.87  ? 280  VAL A N   1 
ATOM   2084 C CA  . VAL A 1 279 ? 46.096  11.626 40.148  1.00 34.61  ? 280  VAL A CA  1 
ATOM   2085 C C   . VAL A 1 279 ? 45.416  12.459 39.067  1.00 34.77  ? 280  VAL A C   1 
ATOM   2086 O O   . VAL A 1 279 ? 44.985  11.928 38.036  1.00 30.90  ? 280  VAL A O   1 
ATOM   2087 C CB  . VAL A 1 279 ? 45.133  11.298 41.306  1.00 38.06  ? 280  VAL A CB  1 
ATOM   2088 C CG1 . VAL A 1 279 ? 43.738  10.967 40.774  1.00 40.31  ? 280  VAL A CG1 1 
ATOM   2089 C CG2 . VAL A 1 279 ? 45.689  10.149 42.161  1.00 32.22  ? 280  VAL A CG2 1 
ATOM   2090 N N   . LEU A 1 280 ? 45.320  13.776 39.276  1.00 30.37  ? 281  LEU A N   1 
ATOM   2091 C CA  . LEU A 1 280 ? 44.744  14.637 38.246  1.00 33.12  ? 281  LEU A CA  1 
ATOM   2092 C C   . LEU A 1 280 ? 45.601  14.619 36.987  1.00 31.25  ? 281  LEU A C   1 
ATOM   2093 O O   . LEU A 1 280 ? 45.085  14.451 35.874  1.00 35.35  ? 281  LEU A O   1 
ATOM   2094 C CB  . LEU A 1 280 ? 44.584  16.067 38.766  1.00 32.97  ? 281  LEU A CB  1 
ATOM   2095 C CG  . LEU A 1 280 ? 43.731  16.325 40.011  1.00 33.10  ? 281  LEU A CG  1 
ATOM   2096 C CD1 . LEU A 1 280 ? 43.601  17.826 40.251  1.00 30.08  ? 281  LEU A CD1 1 
ATOM   2097 C CD2 . LEU A 1 280 ? 42.356  15.680 39.898  1.00 33.23  ? 281  LEU A CD2 1 
ATOM   2098 N N   . VAL A 1 281 ? 46.919  14.772 37.150  1.00 33.48  ? 282  VAL A N   1 
ATOM   2099 C CA  . VAL A 1 281 ? 47.834  14.774 36.010  1.00 33.57  ? 282  VAL A CA  1 
ATOM   2100 C C   . VAL A 1 281 ? 47.715  13.477 35.217  1.00 32.06  ? 282  VAL A C   1 
ATOM   2101 O O   . VAL A 1 281 ? 47.732  13.489 33.981  1.00 32.98  ? 282  VAL A O   1 
ATOM   2102 C CB  . VAL A 1 281 ? 49.282  15.015 36.483  1.00 30.38  ? 282  VAL A CB  1 
ATOM   2103 C CG1 . VAL A 1 281 ? 50.283  14.634 35.383  1.00 24.19  ? 282  VAL A CG1 1 
ATOM   2104 C CG2 . VAL A 1 281 ? 49.475  16.466 36.917  1.00 26.01  ? 282  VAL A CG2 1 
ATOM   2105 N N   . ASN A 1 282 ? 47.572  12.340 35.910  1.00 31.67  ? 283  ASN A N   1 
ATOM   2106 C CA  . ASN A 1 282 ? 47.539  11.050 35.222  1.00 31.66  ? 283  ASN A CA  1 
ATOM   2107 C C   . ASN A 1 282 ? 46.328  10.887 34.312  1.00 32.83  ? 283  ASN A C   1 
ATOM   2108 O O   . ASN A 1 282 ? 46.329  9.995  33.458  1.00 33.33  ? 283  ASN A O   1 
ATOM   2109 C CB  . ASN A 1 282 ? 47.544  9.887  36.218  1.00 34.68  ? 283  ASN A CB  1 
ATOM   2110 C CG  . ASN A 1 282 ? 48.860  9.749  36.960  1.00 39.90  ? 283  ASN A CG  1 
ATOM   2111 O OD1 . ASN A 1 282 ? 49.933  10.000 36.414  1.00 43.52  ? 283  ASN A OD1 1 
ATOM   2112 N ND2 . ASN A 1 282 ? 48.783  9.281  38.196  1.00 39.21  ? 283  ASN A ND2 1 
ATOM   2113 N N   . HIS A 1 283 ? 45.286  11.695 34.486  1.00 32.88  ? 284  HIS A N   1 
ATOM   2114 C CA  . HIS A 1 283 ? 44.087  11.574 33.672  1.00 35.15  ? 284  HIS A CA  1 
ATOM   2115 C C   . HIS A 1 283 ? 43.898  12.747 32.727  1.00 30.51  ? 284  HIS A C   1 
ATOM   2116 O O   . HIS A 1 283 ? 42.917  12.770 31.978  1.00 36.77  ? 284  HIS A O   1 
ATOM   2117 C CB  . HIS A 1 283 ? 42.854  11.422 34.570  1.00 32.90  ? 284  HIS A CB  1 
ATOM   2118 C CG  . HIS A 1 283 ? 42.880  10.187 35.411  1.00 38.78  ? 284  HIS A CG  1 
ATOM   2119 N ND1 . HIS A 1 283 ? 43.584  10.106 36.593  1.00 44.06  ? 284  HIS A ND1 1 
ATOM   2120 C CD2 . HIS A 1 283 ? 42.314  8.973  35.225  1.00 37.11  ? 284  HIS A CD2 1 
ATOM   2121 C CE1 . HIS A 1 283 ? 43.435  8.900  37.108  1.00 43.95  ? 284  HIS A CE1 1 
ATOM   2122 N NE2 . HIS A 1 283 ? 42.670  8.192  36.296  1.00 43.59  ? 284  HIS A NE2 1 
ATOM   2123 N N   . GLU A 1 284 ? 44.833  13.697 32.721  1.00 26.99  ? 285  GLU A N   1 
ATOM   2124 C CA  . GLU A 1 284 ? 44.630  14.958 32.017  1.00 28.46  ? 285  GLU A CA  1 
ATOM   2125 C C   . GLU A 1 284 ? 44.419  14.756 30.516  1.00 30.95  ? 285  GLU A C   1 
ATOM   2126 O O   . GLU A 1 284 ? 43.546  15.395 29.917  1.00 27.00  ? 285  GLU A O   1 
ATOM   2127 C CB  . GLU A 1 284 ? 45.816  15.883 32.293  1.00 23.91  ? 285  GLU A CB  1 
ATOM   2128 C CG  . GLU A 1 284 ? 46.275  16.731 31.136  1.00 34.28  ? 285  GLU A CG  1 
ATOM   2129 C CD  . GLU A 1 284 ? 47.274  17.780 31.574  1.00 40.84  ? 285  GLU A CD  1 
ATOM   2130 O OE1 . GLU A 1 284 ? 47.364  18.828 30.911  1.00 43.09  ? 285  GLU A OE1 1 
ATOM   2131 O OE2 . GLU A 1 284 ? 47.938  17.567 32.606  1.00 35.90  ? 285  GLU A OE2 1 
ATOM   2132 N N   . TRP A 1 285 ? 45.200  13.881 29.885  1.00 30.70  ? 286  TRP A N   1 
ATOM   2133 C CA  . TRP A 1 285 ? 45.084  13.747 28.435  1.00 32.45  ? 286  TRP A CA  1 
ATOM   2134 C C   . TRP A 1 285 ? 43.824  13.009 28.007  1.00 34.20  ? 286  TRP A C   1 
ATOM   2135 O O   . TRP A 1 285 ? 43.463  13.072 26.829  1.00 36.69  ? 286  TRP A O   1 
ATOM   2136 C CB  . TRP A 1 285 ? 46.315  13.043 27.858  1.00 29.16  ? 286  TRP A CB  1 
ATOM   2137 C CG  . TRP A 1 285 ? 47.559  13.837 28.056  1.00 34.56  ? 286  TRP A CG  1 
ATOM   2138 C CD1 . TRP A 1 285 ? 48.483  13.682 29.051  1.00 35.70  ? 286  TRP A CD1 1 
ATOM   2139 C CD2 . TRP A 1 285 ? 48.007  14.939 27.259  1.00 31.99  ? 286  TRP A CD2 1 
ATOM   2140 N NE1 . TRP A 1 285 ? 49.484  14.613 28.916  1.00 36.79  ? 286  TRP A NE1 1 
ATOM   2141 C CE2 . TRP A 1 285 ? 49.217  15.396 27.824  1.00 33.68  ? 286  TRP A CE2 1 
ATOM   2142 C CE3 . TRP A 1 285 ? 47.507  15.580 26.118  1.00 31.75  ? 286  TRP A CE3 1 
ATOM   2143 C CZ2 . TRP A 1 285 ? 49.936  16.462 27.288  1.00 32.73  ? 286  TRP A CZ2 1 
ATOM   2144 C CZ3 . TRP A 1 285 ? 48.227  16.642 25.585  1.00 34.11  ? 286  TRP A CZ3 1 
ATOM   2145 C CH2 . TRP A 1 285 ? 49.428  17.070 26.172  1.00 35.93  ? 286  TRP A CH2 1 
ATOM   2146 N N   . HIS A 1 286 ? 43.139  12.337 28.929  1.00 34.30  ? 287  HIS A N   1 
ATOM   2147 C CA  . HIS A 1 286 ? 41.969  11.550 28.576  1.00 34.33  ? 287  HIS A CA  1 
ATOM   2148 C C   . HIS A 1 286 ? 40.736  12.397 28.292  1.00 33.80  ? 287  HIS A C   1 
ATOM   2149 O O   . HIS A 1 286 ? 39.756  11.864 27.766  1.00 32.62  ? 287  HIS A O   1 
ATOM   2150 C CB  . HIS A 1 286 ? 41.661  10.550 29.692  1.00 44.70  ? 287  HIS A CB  1 
ATOM   2151 C CG  . HIS A 1 286 ? 42.746  9.544  29.909  1.00 61.78  ? 287  HIS A CG  1 
ATOM   2152 N ND1 . HIS A 1 286 ? 43.124  9.111  31.162  1.00 71.73  ? 287  HIS A ND1 1 
ATOM   2153 C CD2 . HIS A 1 286 ? 43.539  8.888  29.030  1.00 68.41  ? 287  HIS A CD2 1 
ATOM   2154 C CE1 . HIS A 1 286 ? 44.101  8.231  31.045  1.00 74.74  ? 287  HIS A CE1 1 
ATOM   2155 N NE2 . HIS A 1 286 ? 44.372  8.077  29.761  1.00 73.77  ? 287  HIS A NE2 1 
ATOM   2156 N N   . VAL A 1 287 ? 40.751  13.697 28.606  1.00 30.67  ? 288  VAL A N   1 
ATOM   2157 C CA  . VAL A 1 287 ? 39.548  14.505 28.428  1.00 32.57  ? 288  VAL A CA  1 
ATOM   2158 C C   . VAL A 1 287 ? 39.471  15.153 27.048  1.00 34.20  ? 288  VAL A C   1 
ATOM   2159 O O   . VAL A 1 287 ? 38.451  15.779 26.727  1.00 34.55  ? 288  VAL A O   1 
ATOM   2160 C CB  . VAL A 1 287 ? 39.431  15.567 29.545  1.00 32.80  ? 288  VAL A CB  1 
ATOM   2161 C CG1 . VAL A 1 287 ? 39.533  14.903 30.916  1.00 28.24  ? 288  VAL A CG1 1 
ATOM   2162 C CG2 . VAL A 1 287 ? 40.482  16.628 29.406  1.00 27.29  ? 288  VAL A CG2 1 
ATOM   2163 N N   . LEU A 1 288 ? 40.497  15.007 26.213  1.00 33.14  ? 289  LEU A N   1 
ATOM   2164 C CA  . LEU A 1 288 ? 40.435  15.575 24.872  1.00 33.61  ? 289  LEU A CA  1 
ATOM   2165 C C   . LEU A 1 288 ? 39.399  14.826 24.033  1.00 34.41  ? 289  LEU A C   1 
ATOM   2166 O O   . LEU A 1 288 ? 39.284  13.604 24.134  1.00 37.69  ? 289  LEU A O   1 
ATOM   2167 C CB  . LEU A 1 288 ? 41.806  15.523 24.197  1.00 24.40  ? 289  LEU A CB  1 
ATOM   2168 C CG  . LEU A 1 288 ? 42.773  16.612 24.670  1.00 31.78  ? 289  LEU A CG  1 
ATOM   2169 C CD1 . LEU A 1 288 ? 44.194  16.385 24.150  1.00 29.33  ? 289  LEU A CD1 1 
ATOM   2170 C CD2 . LEU A 1 288 ? 42.241  17.993 24.289  1.00 26.28  ? 289  LEU A CD2 1 
ATOM   2171 N N   . PRO A 1 289 ? 38.639  15.531 23.186  1.00 38.47  ? 290  PRO A N   1 
ATOM   2172 C CA  . PRO A 1 289 ? 37.524  14.874 22.484  1.00 41.45  ? 290  PRO A CA  1 
ATOM   2173 C C   . PRO A 1 289 ? 37.955  13.869 21.426  1.00 37.89  ? 290  PRO A C   1 
ATOM   2174 O O   . PRO A 1 289 ? 37.128  13.042 21.026  1.00 40.82  ? 290  PRO A O   1 
ATOM   2175 C CB  . PRO A 1 289 ? 36.765  16.051 21.854  1.00 43.58  ? 290  PRO A CB  1 
ATOM   2176 C CG  . PRO A 1 289 ? 37.811  17.104 21.661  1.00 39.01  ? 290  PRO A CG  1 
ATOM   2177 C CD  . PRO A 1 289 ? 38.780  16.949 22.807  1.00 39.35  ? 290  PRO A CD  1 
ATOM   2178 N N   . GLN A 1 290 ? 39.200  13.909 20.956  1.00 33.64  ? 291  GLN A N   1 
ATOM   2179 C CA  . GLN A 1 290 ? 39.662  12.950 19.956  1.00 42.40  ? 291  GLN A CA  1 
ATOM   2180 C C   . GLN A 1 290 ? 41.181  12.872 20.006  1.00 40.87  ? 291  GLN A C   1 
ATOM   2181 O O   . GLN A 1 290 ? 41.845  13.699 20.635  1.00 36.81  ? 291  GLN A O   1 
ATOM   2182 C CB  . GLN A 1 290 ? 39.206  13.332 18.542  1.00 42.43  ? 291  GLN A CB  1 
ATOM   2183 C CG  . GLN A 1 290 ? 40.062  14.427 17.906  1.00 52.03  ? 291  GLN A CG  1 
ATOM   2184 C CD  . GLN A 1 290 ? 39.975  14.451 16.382  1.00 60.78  ? 291  GLN A CD  1 
ATOM   2185 O OE1 . GLN A 1 290 ? 38.943  14.809 15.812  1.00 64.35  ? 291  GLN A OE1 1 
ATOM   2186 N NE2 . GLN A 1 290 ? 41.070  14.081 15.717  1.00 56.76  ? 291  GLN A NE2 1 
ATOM   2187 N N   . GLU A 1 291 ? 41.722  11.859 19.331  1.00 46.11  ? 292  GLU A N   1 
ATOM   2188 C CA  A GLU A 1 291 ? 43.166  11.762 19.159  0.52 46.51  ? 292  GLU A CA  1 
ATOM   2189 C CA  B GLU A 1 291 ? 43.165  11.758 19.159  0.48 46.52  ? 292  GLU A CA  1 
ATOM   2190 C C   . GLU A 1 291 ? 43.648  12.898 18.269  1.00 39.03  ? 292  GLU A C   1 
ATOM   2191 O O   . GLU A 1 291 ? 43.040  13.197 17.237  1.00 38.31  ? 292  GLU A O   1 
ATOM   2192 C CB  A GLU A 1 291 ? 43.553  10.414 18.551  0.52 51.25  ? 292  GLU A CB  1 
ATOM   2193 C CB  B GLU A 1 291 ? 43.531  10.392 18.568  0.48 51.27  ? 292  GLU A CB  1 
ATOM   2194 C CG  A GLU A 1 291 ? 43.944  9.347  19.567  0.52 54.86  ? 292  GLU A CG  1 
ATOM   2195 C CG  B GLU A 1 291 ? 44.163  10.417 17.181  0.48 51.81  ? 292  GLU A CG  1 
ATOM   2196 C CD  A GLU A 1 291 ? 44.820  9.883  20.685  0.52 56.94  ? 292  GLU A CD  1 
ATOM   2197 C CD  B GLU A 1 291 ? 43.995  9.109  16.430  0.48 52.62  ? 292  GLU A CD  1 
ATOM   2198 O OE1 A GLU A 1 291 ? 44.435  9.715  21.861  0.52 55.85  ? 292  GLU A OE1 1 
ATOM   2199 O OE1 B GLU A 1 291 ? 44.957  8.313  16.382  0.48 46.41  ? 292  GLU A OE1 1 
ATOM   2200 O OE2 A GLU A 1 291 ? 45.883  10.477 20.393  0.52 59.00  ? 292  GLU A OE2 1 
ATOM   2201 O OE2 B GLU A 1 291 ? 42.896  8.879  15.881  0.48 58.25  ? 292  GLU A OE2 1 
ATOM   2202 N N   . SER A 1 292 ? 44.731  13.547 18.672  1.00 33.55  ? 293  SER A N   1 
ATOM   2203 C CA  . SER A 1 292 ? 45.170  14.735 17.959  1.00 37.33  ? 293  SER A CA  1 
ATOM   2204 C C   . SER A 1 292 ? 46.654  14.956 18.203  1.00 32.47  ? 293  SER A C   1 
ATOM   2205 O O   . SER A 1 292 ? 47.301  14.235 18.968  1.00 30.97  ? 293  SER A O   1 
ATOM   2206 C CB  . SER A 1 292 ? 44.361  15.958 18.400  1.00 33.68  ? 293  SER A CB  1 
ATOM   2207 O OG  . SER A 1 292 ? 44.502  16.170 19.794  1.00 41.51  ? 293  SER A OG  1 
ATOM   2208 N N   . VAL A 1 293 ? 47.187  15.968 17.524  1.00 25.70  ? 294  VAL A N   1 
ATOM   2209 C CA  . VAL A 1 293 ? 48.441  16.604 17.895  1.00 23.69  ? 294  VAL A CA  1 
ATOM   2210 C C   . VAL A 1 293 ? 48.160  18.093 18.038  1.00 23.43  ? 294  VAL A C   1 
ATOM   2211 O O   . VAL A 1 293 ? 47.189  18.621 17.493  1.00 28.21  ? 294  VAL A O   1 
ATOM   2212 C CB  . VAL A 1 293 ? 49.570  16.353 16.868  1.00 29.46  ? 294  VAL A CB  1 
ATOM   2213 C CG1 . VAL A 1 293 ? 49.962  14.880 16.871  1.00 28.49  ? 294  VAL A CG1 1 
ATOM   2214 C CG2 . VAL A 1 293 ? 49.143  16.805 15.468  1.00 29.63  ? 294  VAL A CG2 1 
ATOM   2215 N N   . PHE A 1 294 ? 49.010  18.761 18.810  1.00 27.15  ? 295  PHE A N   1 
ATOM   2216 C CA  . PHE A 1 294 ? 48.920  20.203 19.021  1.00 30.95  ? 295  PHE A CA  1 
ATOM   2217 C C   . PHE A 1 294 ? 47.593  20.607 19.672  1.00 28.12  ? 295  PHE A C   1 
ATOM   2218 O O   . PHE A 1 294 ? 47.042  21.667 19.369  1.00 27.95  ? 295  PHE A O   1 
ATOM   2219 C CB  . PHE A 1 294 ? 49.133  20.972 17.706  1.00 26.21  ? 295  PHE A CB  1 
ATOM   2220 C CG  . PHE A 1 294 ? 49.975  22.206 17.859  1.00 25.98  ? 295  PHE A CG  1 
ATOM   2221 C CD1 . PHE A 1 294 ? 51.093  22.397 17.065  1.00 20.14  ? 295  PHE A CD1 1 
ATOM   2222 C CD2 . PHE A 1 294 ? 49.658  23.168 18.810  1.00 22.57  ? 295  PHE A CD2 1 
ATOM   2223 C CE1 . PHE A 1 294 ? 51.876  23.530 17.209  1.00 19.63  ? 295  PHE A CE1 1 
ATOM   2224 C CE2 . PHE A 1 294 ? 50.435  24.302 18.960  1.00 24.79  ? 295  PHE A CE2 1 
ATOM   2225 C CZ  . PHE A 1 294 ? 51.552  24.481 18.156  1.00 22.99  ? 295  PHE A CZ  1 
ATOM   2226 N N   . ARG A 1 295 ? 47.051  19.763 20.555  1.00 21.66  ? 296  ARG A N   1 
ATOM   2227 C CA  . ARG A 1 295 ? 45.920  20.147 21.396  1.00 23.96  ? 296  ARG A CA  1 
ATOM   2228 C C   . ARG A 1 295 ? 46.165  19.744 22.839  1.00 26.62  ? 296  ARG A C   1 
ATOM   2229 O O   . ARG A 1 295 ? 46.760  18.699 23.118  1.00 25.76  ? 296  ARG A O   1 
ATOM   2230 C CB  . ARG A 1 295 ? 44.575  19.573 20.918  1.00 21.22  ? 296  ARG A CB  1 
ATOM   2231 C CG  . ARG A 1 295 ? 44.239  20.105 19.536  1.00 29.35  ? 296  ARG A CG  1 
ATOM   2232 C CD  . ARG A 1 295 ? 43.443  21.416 19.555  1.00 25.00  ? 296  ARG A CD  1 
ATOM   2233 N NE  . ARG A 1 295 ? 42.941  21.738 18.227  1.00 24.14  ? 296  ARG A NE  1 
ATOM   2234 C CZ  . ARG A 1 295 ? 43.706  22.120 17.199  1.00 26.75  ? 296  ARG A CZ  1 
ATOM   2235 N NH1 . ARG A 1 295 ? 45.022  22.273 17.321  1.00 23.16  ? 296  ARG A NH1 1 
ATOM   2236 N NH2 . ARG A 1 295 ? 43.134  22.369 16.033  1.00 25.57  ? 296  ARG A NH2 1 
ATOM   2237 N N   . PHE A 1 296 ? 45.695  20.587 23.752  1.00 23.05  ? 297  PHE A N   1 
ATOM   2238 C CA  . PHE A 1 296 ? 45.991  20.456 25.168  1.00 21.92  ? 297  PHE A CA  1 
ATOM   2239 C C   . PHE A 1 296 ? 44.710  20.633 25.967  1.00 25.26  ? 297  PHE A C   1 
ATOM   2240 O O   . PHE A 1 296 ? 43.828  21.409 25.591  1.00 25.42  ? 297  PHE A O   1 
ATOM   2241 C CB  . PHE A 1 296 ? 47.071  21.462 25.567  1.00 21.46  ? 297  PHE A CB  1 
ATOM   2242 C CG  . PHE A 1 296 ? 48.091  21.669 24.491  1.00 21.94  ? 297  PHE A CG  1 
ATOM   2243 C CD1 . PHE A 1 296 ? 49.075  20.716 24.267  1.00 22.58  ? 297  PHE A CD1 1 
ATOM   2244 C CD2 . PHE A 1 296 ? 48.047  22.788 23.672  1.00 20.30  ? 297  PHE A CD2 1 
ATOM   2245 C CE1 . PHE A 1 296 ? 50.007  20.875 23.254  1.00 22.07  ? 297  PHE A CE1 1 
ATOM   2246 C CE2 . PHE A 1 296 ? 48.977  22.956 22.643  1.00 22.47  ? 297  PHE A CE2 1 
ATOM   2247 C CZ  . PHE A 1 296 ? 49.962  21.996 22.440  1.00 23.27  ? 297  PHE A CZ  1 
ATOM   2248 N N   . SER A 1 297 ? 44.611  19.883 27.064  1.00 24.52  ? 298  SER A N   1 
ATOM   2249 C CA  . SER A 1 297 ? 43.323  19.696 27.727  1.00 27.72  ? 298  SER A CA  1 
ATOM   2250 C C   . SER A 1 297 ? 42.822  20.985 28.364  1.00 28.53  ? 298  SER A C   1 
ATOM   2251 O O   . SER A 1 297 ? 41.660  21.372 28.181  1.00 24.47  ? 298  SER A O   1 
ATOM   2252 C CB  . SER A 1 297 ? 43.437  18.592 28.775  1.00 27.56  ? 298  SER A CB  1 
ATOM   2253 O OG  . SER A 1 297 ? 43.535  17.325 28.144  1.00 31.79  ? 298  SER A OG  1 
ATOM   2254 N N   . PHE A 1 298 ? 43.675  21.659 29.122  1.00 19.71  ? 299  PHE A N   1 
ATOM   2255 C CA  . PHE A 1 298 ? 43.252  22.781 29.950  1.00 25.16  ? 299  PHE A CA  1 
ATOM   2256 C C   . PHE A 1 298 ? 44.016  24.020 29.513  1.00 27.49  ? 299  PHE A C   1 
ATOM   2257 O O   . PHE A 1 298 ? 45.226  24.126 29.747  1.00 23.03  ? 299  PHE A O   1 
ATOM   2258 C CB  . PHE A 1 298 ? 43.463  22.459 31.432  1.00 20.90  ? 299  PHE A CB  1 
ATOM   2259 C CG  . PHE A 1 298 ? 42.648  21.287 31.894  1.00 24.80  ? 299  PHE A CG  1 
ATOM   2260 C CD1 . PHE A 1 298 ? 41.270  21.402 32.022  1.00 26.38  ? 299  PHE A CD1 1 
ATOM   2261 C CD2 . PHE A 1 298 ? 43.244  20.068 32.169  1.00 21.08  ? 299  PHE A CD2 1 
ATOM   2262 C CE1 . PHE A 1 298 ? 40.497  20.324 32.428  1.00 26.62  ? 299  PHE A CE1 1 
ATOM   2263 C CE2 . PHE A 1 298 ? 42.482  18.983 32.577  1.00 26.18  ? 299  PHE A CE2 1 
ATOM   2264 C CZ  . PHE A 1 298 ? 41.105  19.110 32.707  1.00 27.77  ? 299  PHE A CZ  1 
ATOM   2265 N N   . VAL A 1 299 ? 43.303  24.940 28.872  1.00 21.24  ? 300  VAL A N   1 
ATOM   2266 C CA  . VAL A 1 299 ? 43.878  26.138 28.273  1.00 24.13  ? 300  VAL A CA  1 
ATOM   2267 C C   . VAL A 1 299 ? 42.976  27.310 28.642  1.00 27.20  ? 300  VAL A C   1 
ATOM   2268 O O   . VAL A 1 299 ? 41.882  27.092 29.186  1.00 23.09  ? 300  VAL A O   1 
ATOM   2269 C CB  . VAL A 1 299 ? 44.011  25.979 26.745  1.00 25.66  ? 300  VAL A CB  1 
ATOM   2270 C CG1 . VAL A 1 299 ? 44.924  24.809 26.401  1.00 18.15  ? 300  VAL A CG1 1 
ATOM   2271 C CG2 . VAL A 1 299 ? 42.641  25.794 26.105  1.00 19.40  ? 300  VAL A CG2 1 
ATOM   2272 N N   . PRO A 1 300 ? 43.384  28.556 28.385  1.00 23.26  ? 301  PRO A N   1 
ATOM   2273 C CA  . PRO A 1 300 ? 42.497  29.696 28.663  1.00 22.91  ? 301  PRO A CA  1 
ATOM   2274 C C   . PRO A 1 300 ? 41.098  29.520 28.080  1.00 26.59  ? 301  PRO A C   1 
ATOM   2275 O O   . PRO A 1 300 ? 40.917  28.999 26.977  1.00 26.75  ? 301  PRO A O   1 
ATOM   2276 C CB  . PRO A 1 300 ? 43.236  30.876 28.023  1.00 20.47  ? 301  PRO A CB  1 
ATOM   2277 C CG  . PRO A 1 300 ? 44.700  30.506 28.207  1.00 19.31  ? 301  PRO A CG  1 
ATOM   2278 C CD  . PRO A 1 300 ? 44.758  29.005 28.062  1.00 24.34  ? 301  PRO A CD  1 
ATOM   2279 N N   . VAL A 1 301 ? 40.102  29.955 28.840  1.00 25.42  ? 302  VAL A N   1 
ATOM   2280 C CA  . VAL A 1 301 ? 38.704  29.872 28.445  1.00 26.08  ? 302  VAL A CA  1 
ATOM   2281 C C   . VAL A 1 301 ? 38.212  31.276 28.125  1.00 28.35  ? 302  VAL A C   1 
ATOM   2282 O O   . VAL A 1 301 ? 38.560  32.239 28.820  1.00 28.97  ? 302  VAL A O   1 
ATOM   2283 C CB  . VAL A 1 301 ? 37.852  29.206 29.548  1.00 27.05  ? 302  VAL A CB  1 
ATOM   2284 C CG1 . VAL A 1 301 ? 38.054  29.915 30.885  1.00 30.55  ? 302  VAL A CG1 1 
ATOM   2285 C CG2 . VAL A 1 301 ? 36.376  29.191 29.155  1.00 25.47  ? 302  VAL A CG2 1 
ATOM   2286 N N   . VAL A 1 302 ? 37.430  31.396 27.053  1.00 27.74  ? 303  VAL A N   1 
ATOM   2287 C CA  . VAL A 1 302 ? 36.806  32.656 26.669  1.00 28.16  ? 303  VAL A CA  1 
ATOM   2288 C C   . VAL A 1 302 ? 35.466  32.732 27.394  1.00 33.59  ? 303  VAL A C   1 
ATOM   2289 O O   . VAL A 1 302 ? 34.470  32.148 26.962  1.00 35.12  ? 303  VAL A O   1 
ATOM   2290 C CB  . VAL A 1 302 ? 36.639  32.766 25.150  1.00 32.37  ? 303  VAL A CB  1 
ATOM   2291 C CG1 . VAL A 1 302 ? 36.018  34.114 24.772  1.00 30.46  ? 303  VAL A CG1 1 
ATOM   2292 C CG2 . VAL A 1 302 ? 37.983  32.559 24.446  1.00 28.97  ? 303  VAL A CG2 1 
ATOM   2293 N N   . ASP A 1 303 ? 35.433  33.458 28.509  1.00 37.77  ? 304  ASP A N   1 
ATOM   2294 C CA  . ASP A 1 303 ? 34.223  33.507 29.319  1.00 39.68  ? 304  ASP A CA  1 
ATOM   2295 C C   . ASP A 1 303 ? 33.733  34.926 29.575  1.00 39.90  ? 304  ASP A C   1 
ATOM   2296 O O   . ASP A 1 303 ? 32.825  35.113 30.391  1.00 44.53  ? 304  ASP A O   1 
ATOM   2297 C CB  . ASP A 1 303 ? 34.441  32.767 30.645  1.00 40.57  ? 304  ASP A CB  1 
ATOM   2298 C CG  . ASP A 1 303 ? 35.358  33.512 31.602  1.00 42.55  ? 304  ASP A CG  1 
ATOM   2299 O OD1 . ASP A 1 303 ? 36.080  34.438 31.176  1.00 41.78  ? 304  ASP A OD1 1 
ATOM   2300 O OD2 . ASP A 1 303 ? 35.361  33.156 32.799  1.00 55.70  ? 304  ASP A OD2 1 
ATOM   2301 N N   . GLY A 1 304 ? 34.301  35.925 28.900  1.00 37.61  ? 305  GLY A N   1 
ATOM   2302 C CA  . GLY A 1 304 ? 33.891  37.299 29.080  1.00 41.53  ? 305  GLY A CA  1 
ATOM   2303 C C   . GLY A 1 304 ? 34.646  38.057 30.150  1.00 43.71  ? 305  GLY A C   1 
ATOM   2304 O O   . GLY A 1 304 ? 34.514  39.285 30.224  1.00 49.11  ? 305  GLY A O   1 
ATOM   2305 N N   . ASP A 1 305 ? 35.455  37.408 30.964  1.00 35.45  ? 306  ASP A N   1 
ATOM   2306 C CA  . ASP A 1 305 ? 36.145  38.123 32.022  1.00 36.08  ? 306  ASP A CA  1 
ATOM   2307 C C   . ASP A 1 305 ? 37.563  38.492 31.633  1.00 33.34  ? 306  ASP A C   1 
ATOM   2308 O O   . ASP A 1 305 ? 37.780  39.572 31.183  1.00 37.03  ? 306  ASP A O   1 
ATOM   2309 C CB  . ASP A 1 305 ? 36.122  37.248 33.252  1.00 41.16  ? 306  ASP A CB  1 
ATOM   2310 C CG  . ASP A 1 305 ? 36.568  37.948 34.473  1.00 48.25  ? 306  ASP A CG  1 
ATOM   2311 O OD1 . ASP A 1 305 ? 36.847  39.123 34.434  1.00 51.44  ? 306  ASP A OD1 1 
ATOM   2312 O OD2 . ASP A 1 305 ? 36.639  37.298 35.497  1.00 52.89  ? 306  ASP A OD2 1 
ATOM   2313 N N   . PHE A 1 306 ? 38.521  37.605 31.776  1.00 27.42  ? 307  PHE A N   1 
ATOM   2314 C CA  . PHE A 1 306 ? 39.861  37.913 31.281  1.00 28.99  ? 307  PHE A CA  1 
ATOM   2315 C C   . PHE A 1 306 ? 39.829  38.290 29.806  1.00 33.80  ? 307  PHE A C   1 
ATOM   2316 O O   . PHE A 1 306 ? 40.465  39.267 29.391  1.00 31.34  ? 307  PHE A O   1 
ATOM   2317 C CB  . PHE A 1 306 ? 40.795  36.721 31.494  1.00 25.65  ? 307  PHE A CB  1 
ATOM   2318 C CG  . PHE A 1 306 ? 42.255  37.085 31.469  1.00 28.31  ? 307  PHE A CG  1 
ATOM   2319 C CD1 . PHE A 1 306 ? 42.924  37.241 30.266  1.00 28.42  ? 307  PHE A CD1 1 
ATOM   2320 C CD2 . PHE A 1 306 ? 42.959  37.257 32.649  1.00 27.86  ? 307  PHE A CD2 1 
ATOM   2321 C CE1 . PHE A 1 306 ? 44.269  37.578 30.228  1.00 26.14  ? 307  PHE A CE1 1 
ATOM   2322 C CE2 . PHE A 1 306 ? 44.314  37.581 32.626  1.00 32.80  ? 307  PHE A CE2 1 
ATOM   2323 C CZ  . PHE A 1 306 ? 44.966  37.747 31.395  1.00 28.71  ? 307  PHE A CZ  1 
ATOM   2324 N N   . LEU A 1 307 ? 39.089  37.527 29.003  1.00 33.23  ? 308  LEU A N   1 
ATOM   2325 C CA  . LEU A 1 307 ? 38.882  37.804 27.586  1.00 33.30  ? 308  LEU A CA  1 
ATOM   2326 C C   . LEU A 1 307 ? 37.408  38.123 27.396  1.00 33.94  ? 308  LEU A C   1 
ATOM   2327 O O   . LEU A 1 307 ? 36.560  37.233 27.527  1.00 35.40  ? 308  LEU A O   1 
ATOM   2328 C CB  . LEU A 1 307 ? 39.285  36.610 26.722  1.00 28.96  ? 308  LEU A CB  1 
ATOM   2329 C CG  . LEU A 1 307 ? 40.711  36.104 26.875  1.00 34.44  ? 308  LEU A CG  1 
ATOM   2330 C CD1 . LEU A 1 307 ? 40.890  34.768 26.156  1.00 31.09  ? 308  LEU A CD1 1 
ATOM   2331 C CD2 . LEU A 1 307 ? 41.668  37.153 26.341  1.00 27.65  ? 308  LEU A CD2 1 
ATOM   2332 N N   . SER A 1 308 ? 37.099  39.382 27.075  1.00 30.92  ? 309  SER A N   1 
ATOM   2333 C CA  . SER A 1 308 ? 35.704  39.753 26.860  1.00 37.86  ? 309  SER A CA  1 
ATOM   2334 C C   . SER A 1 308 ? 35.133  39.174 25.570  1.00 39.61  ? 309  SER A C   1 
ATOM   2335 O O   . SER A 1 308 ? 33.910  39.182 25.396  1.00 46.84  ? 309  SER A O   1 
ATOM   2336 C CB  . SER A 1 308 ? 35.557  41.277 26.865  1.00 38.16  ? 309  SER A CB  1 
ATOM   2337 O OG  . SER A 1 308 ? 36.248  41.856 25.773  1.00 46.32  ? 309  SER A OG  1 
ATOM   2338 N N   . ASP A 1 309 ? 35.980  38.672 24.678  1.00 38.00  ? 310  ASP A N   1 
ATOM   2339 C CA  . ASP A 1 309 ? 35.560  38.025 23.440  1.00 39.16  ? 310  ASP A CA  1 
ATOM   2340 C C   . ASP A 1 309 ? 36.700  37.107 23.013  1.00 34.47  ? 310  ASP A C   1 
ATOM   2341 O O   . ASP A 1 309 ? 37.738  37.037 23.676  1.00 35.75  ? 310  ASP A O   1 
ATOM   2342 C CB  . ASP A 1 309 ? 35.215  39.064 22.364  1.00 41.63  ? 310  ASP A CB  1 
ATOM   2343 C CG  . ASP A 1 309 ? 34.247  38.533 21.308  1.00 50.38  ? 310  ASP A CG  1 
ATOM   2344 O OD1 . ASP A 1 309 ? 34.192  37.305 21.085  1.00 53.15  ? 310  ASP A OD1 1 
ATOM   2345 O OD2 . ASP A 1 309 ? 33.540  39.358 20.691  1.00 54.94  ? 310  ASP A OD2 1 
ATOM   2346 N N   . THR A 1 310 ? 36.508  36.396 21.903  1.00 33.43  ? 311  THR A N   1 
ATOM   2347 C CA  . THR A 1 310 ? 37.588  35.566 21.390  1.00 35.58  ? 311  THR A CA  1 
ATOM   2348 C C   . THR A 1 310 ? 38.784  36.447 21.026  1.00 34.77  ? 311  THR A C   1 
ATOM   2349 O O   . THR A 1 310 ? 38.620  37.622 20.683  1.00 35.87  ? 311  THR A O   1 
ATOM   2350 C CB  . THR A 1 310 ? 37.149  34.776 20.158  1.00 38.00  ? 311  THR A CB  1 
ATOM   2351 O OG1 . THR A 1 310 ? 37.006  35.670 19.048  1.00 39.67  ? 311  THR A OG1 1 
ATOM   2352 C CG2 . THR A 1 310 ? 35.826  34.055 20.409  1.00 34.19  ? 311  THR A CG2 1 
ATOM   2353 N N   . PRO A 1 311 ? 40.003  35.912 21.112  1.00 29.63  ? 312  PRO A N   1 
ATOM   2354 C CA  . PRO A 1 311 ? 41.171  36.710 20.690  1.00 28.64  ? 312  PRO A CA  1 
ATOM   2355 C C   . PRO A 1 311 ? 41.061  37.233 19.267  1.00 29.66  ? 312  PRO A C   1 
ATOM   2356 O O   . PRO A 1 311 ? 41.473  38.369 18.990  1.00 29.55  ? 312  PRO A O   1 
ATOM   2357 C CB  . PRO A 1 311 ? 42.336  35.727 20.865  1.00 28.42  ? 312  PRO A CB  1 
ATOM   2358 C CG  . PRO A 1 311 ? 41.888  34.828 21.975  1.00 28.15  ? 312  PRO A CG  1 
ATOM   2359 C CD  . PRO A 1 311 ? 40.392  34.679 21.818  1.00 27.11  ? 312  PRO A CD  1 
ATOM   2360 N N   . GLU A 1 312 ? 40.454  36.446 18.386  1.00 38.15  ? 313  GLU A N   1 
ATOM   2361 C CA  . GLU A 1 312 ? 40.255  36.861 17.003  1.00 44.07  ? 313  GLU A CA  1 
ATOM   2362 C C   . GLU A 1 312 ? 39.411  38.139 16.923  1.00 40.42  ? 313  GLU A C   1 
ATOM   2363 O O   . GLU A 1 312 ? 39.798  39.100 16.258  1.00 45.17  ? 313  GLU A O   1 
ATOM   2364 C CB  . GLU A 1 312 ? 39.593  35.743 16.196  1.00 63.47  ? 313  GLU A CB  1 
ATOM   2365 C CG  . GLU A 1 312 ? 40.574  34.854 15.448  1.00 80.52  ? 313  GLU A CG  1 
ATOM   2366 C CD  . GLU A 1 312 ? 40.238  34.727 13.975  1.00 99.02  ? 313  GLU A CD  1 
ATOM   2367 O OE1 . GLU A 1 312 ? 40.658  33.729 13.352  1.00 108.99 ? 313  GLU A OE1 1 
ATOM   2368 O OE2 . GLU A 1 312 ? 39.554  35.625 13.440  1.00 100.53 ? 313  GLU A OE2 1 
ATOM   2369 N N   . ALA A 1 313 ? 38.263  38.148 17.600  1.00 37.72  ? 314  ALA A N   1 
ATOM   2370 C CA  . ALA A 1 313 ? 37.384  39.311 17.594  1.00 39.18  ? 314  ALA A CA  1 
ATOM   2371 C C   . ALA A 1 313 ? 38.064  40.514 18.236  1.00 43.34  ? 314  ALA A C   1 
ATOM   2372 O O   . ALA A 1 313 ? 37.905  41.649 17.773  1.00 47.12  ? 314  ALA A O   1 
ATOM   2373 C CB  . ALA A 1 313 ? 36.077  38.979 18.312  1.00 36.18  ? 314  ALA A CB  1 
ATOM   2374 N N   . LEU A 1 314 ? 38.837  40.283 19.301  1.00 39.02  ? 315  LEU A N   1 
ATOM   2375 C CA  . LEU A 1 314 ? 39.537  41.384 19.953  1.00 37.13  ? 315  LEU A CA  1 
ATOM   2376 C C   . LEU A 1 314 ? 40.651  41.932 19.067  1.00 36.19  ? 315  LEU A C   1 
ATOM   2377 O O   . LEU A 1 314 ? 40.854  43.149 18.997  1.00 39.46  ? 315  LEU A O   1 
ATOM   2378 C CB  . LEU A 1 314 ? 40.085  40.923 21.307  1.00 35.46  ? 315  LEU A CB  1 
ATOM   2379 C CG  . LEU A 1 314 ? 39.009  40.460 22.292  1.00 38.89  ? 315  LEU A CG  1 
ATOM   2380 C CD1 . LEU A 1 314 ? 39.618  39.979 23.599  1.00 35.48  ? 315  LEU A CD1 1 
ATOM   2381 C CD2 . LEU A 1 314 ? 38.013  41.579 22.545  1.00 36.62  ? 315  LEU A CD2 1 
ATOM   2382 N N   . ILE A 1 315 ? 41.384  41.050 18.385  1.00 36.62  ? 316  ILE A N   1 
ATOM   2383 C CA  . ILE A 1 315 ? 42.390  41.502 17.428  1.00 38.87  ? 316  ILE A CA  1 
ATOM   2384 C C   . ILE A 1 315 ? 41.743  42.336 16.325  1.00 43.92  ? 316  ILE A C   1 
ATOM   2385 O O   . ILE A 1 315 ? 42.259  43.393 15.942  1.00 43.33  ? 316  ILE A O   1 
ATOM   2386 C CB  . ILE A 1 315 ? 43.157  40.293 16.859  1.00 35.14  ? 316  ILE A CB  1 
ATOM   2387 C CG1 . ILE A 1 315 ? 44.096  39.716 17.920  1.00 33.16  ? 316  ILE A CG1 1 
ATOM   2388 C CG2 . ILE A 1 315 ? 43.935  40.680 15.614  1.00 34.12  ? 316  ILE A CG2 1 
ATOM   2389 C CD1 . ILE A 1 315 ? 44.520  38.289 17.651  1.00 33.67  ? 316  ILE A CD1 1 
ATOM   2390 N N   . ASN A 1 316 ? 40.590  41.893 15.818  1.00 47.36  ? 317  ASN A N   1 
ATOM   2391 C CA  . ASN A 1 316 ? 39.948  42.600 14.710  1.00 52.39  ? 317  ASN A CA  1 
ATOM   2392 C C   . ASN A 1 316 ? 39.367  43.937 15.153  1.00 55.34  ? 317  ASN A C   1 
ATOM   2393 O O   . ASN A 1 316 ? 39.390  44.910 14.392  1.00 55.75  ? 317  ASN A O   1 
ATOM   2394 C CB  . ASN A 1 316 ? 38.852  41.735 14.093  1.00 48.80  ? 317  ASN A CB  1 
ATOM   2395 C CG  . ASN A 1 316 ? 39.397  40.494 13.433  1.00 55.21  ? 317  ASN A CG  1 
ATOM   2396 O OD1 . ASN A 1 316 ? 40.554  40.456 13.019  1.00 61.79  ? 317  ASN A OD1 1 
ATOM   2397 N ND2 . ASN A 1 316 ? 38.561  39.469 13.318  1.00 59.06  ? 317  ASN A ND2 1 
ATOM   2398 N N   . ALA A 1 317 ? 38.838  44.005 16.370  1.00 58.26  ? 318  ALA A N   1 
ATOM   2399 C CA  . ALA A 1 317 ? 38.187  45.212 16.862  1.00 63.89  ? 318  ALA A CA  1 
ATOM   2400 C C   . ALA A 1 317 ? 39.138  46.165 17.573  1.00 63.49  ? 318  ALA A C   1 
ATOM   2401 O O   . ALA A 1 317 ? 38.743  47.296 17.874  1.00 68.44  ? 318  ALA A O   1 
ATOM   2402 C CB  . ALA A 1 317 ? 37.047  44.841 17.816  1.00 69.50  ? 318  ALA A CB  1 
ATOM   2403 N N   . GLY A 1 318 ? 40.369  45.746 17.845  1.00 57.04  ? 319  GLY A N   1 
ATOM   2404 C CA  . GLY A 1 318 ? 41.245  46.541 18.681  1.00 53.92  ? 319  GLY A CA  1 
ATOM   2405 C C   . GLY A 1 318 ? 41.859  47.723 17.953  1.00 56.04  ? 319  GLY A C   1 
ATOM   2406 O O   . GLY A 1 318 ? 42.060  47.715 16.739  1.00 54.77  ? 319  GLY A O   1 
ATOM   2407 N N   . ASP A 1 319 ? 42.151  48.762 18.726  1.00 54.96  ? 320  ASP A N   1 
ATOM   2408 C CA  . ASP A 1 319 ? 42.943  49.897 18.274  1.00 59.76  ? 320  ASP A CA  1 
ATOM   2409 C C   . ASP A 1 319 ? 44.316  49.784 18.921  1.00 54.32  ? 320  ASP A C   1 
ATOM   2410 O O   . ASP A 1 319 ? 44.428  49.814 20.151  1.00 54.42  ? 320  ASP A O   1 
ATOM   2411 C CB  . ASP A 1 319 ? 42.272  51.220 18.641  1.00 68.30  ? 320  ASP A CB  1 
ATOM   2412 C CG  . ASP A 1 319 ? 43.200  52.405 18.486  1.00 77.24  ? 320  ASP A CG  1 
ATOM   2413 O OD1 . ASP A 1 319 ? 43.242  53.251 19.400  1.00 86.27  ? 320  ASP A OD1 1 
ATOM   2414 O OD2 . ASP A 1 319 ? 43.890  52.493 17.450  1.00 81.20  ? 320  ASP A OD2 1 
ATOM   2415 N N   . PHE A 1 320 ? 45.356  49.646 18.097  1.00 47.57  ? 321  PHE A N   1 
ATOM   2416 C CA  . PHE A 1 320 ? 46.682  49.299 18.594  1.00 43.91  ? 321  PHE A CA  1 
ATOM   2417 C C   . PHE A 1 320 ? 47.716  50.390 18.334  1.00 44.61  ? 321  PHE A C   1 
ATOM   2418 O O   . PHE A 1 320 ? 48.915  50.095 18.282  1.00 47.44  ? 321  PHE A O   1 
ATOM   2419 C CB  . PHE A 1 320 ? 47.135  47.969 17.989  1.00 41.90  ? 321  PHE A CB  1 
ATOM   2420 C CG  . PHE A 1 320 ? 46.244  46.809 18.345  1.00 41.02  ? 321  PHE A CG  1 
ATOM   2421 C CD1 . PHE A 1 320 ? 46.392  46.149 19.559  1.00 42.24  ? 321  PHE A CD1 1 
ATOM   2422 C CD2 . PHE A 1 320 ? 45.257  46.381 17.472  1.00 36.57  ? 321  PHE A CD2 1 
ATOM   2423 C CE1 . PHE A 1 320 ? 45.569  45.082 19.892  1.00 40.76  ? 321  PHE A CE1 1 
ATOM   2424 C CE2 . PHE A 1 320 ? 44.428  45.318 17.800  1.00 39.53  ? 321  PHE A CE2 1 
ATOM   2425 C CZ  . PHE A 1 320 ? 44.585  44.666 19.010  1.00 39.63  ? 321  PHE A CZ  1 
ATOM   2426 N N   . HIS A 1 321 ? 47.285  51.641 18.181  1.00 46.63  ? 322  HIS A N   1 
ATOM   2427 C CA  . HIS A 1 321 ? 48.232  52.745 18.091  1.00 47.82  ? 322  HIS A CA  1 
ATOM   2428 C C   . HIS A 1 321 ? 49.011  52.880 19.393  1.00 54.01  ? 322  HIS A C   1 
ATOM   2429 O O   . HIS A 1 321 ? 48.470  52.686 20.485  1.00 56.71  ? 322  HIS A O   1 
ATOM   2430 C CB  . HIS A 1 321 ? 47.507  54.055 17.776  1.00 53.68  ? 322  HIS A CB  1 
ATOM   2431 C CG  . HIS A 1 321 ? 47.134  54.206 16.334  1.00 57.84  ? 322  HIS A CG  1 
ATOM   2432 N ND1 . HIS A 1 321 ? 45.904  53.829 15.838  1.00 62.61  ? 322  HIS A ND1 1 
ATOM   2433 C CD2 . HIS A 1 321 ? 47.834  54.684 15.278  1.00 57.24  ? 322  HIS A CD2 1 
ATOM   2434 C CE1 . HIS A 1 321 ? 45.861  54.071 14.540  1.00 63.63  ? 322  HIS A CE1 1 
ATOM   2435 N NE2 . HIS A 1 321 ? 47.020  54.590 14.175  1.00 64.62  ? 322  HIS A NE2 1 
ATOM   2436 N N   . GLY A 1 322 ? 50.294  53.216 19.271  1.00 54.90  ? 323  GLY A N   1 
ATOM   2437 C CA  . GLY A 1 322 ? 51.179  53.306 20.412  1.00 50.73  ? 323  GLY A CA  1 
ATOM   2438 C C   . GLY A 1 322 ? 51.833  52.002 20.816  1.00 49.58  ? 323  GLY A C   1 
ATOM   2439 O O   . GLY A 1 322 ? 52.560  51.976 21.819  1.00 47.57  ? 323  GLY A O   1 
ATOM   2440 N N   . LEU A 1 323 ? 51.603  50.924 20.072  1.00 46.90  ? 324  LEU A N   1 
ATOM   2441 C CA  . LEU A 1 323 ? 52.119  49.604 20.399  1.00 43.57  ? 324  LEU A CA  1 
ATOM   2442 C C   . LEU A 1 323 ? 53.179  49.189 19.388  1.00 39.00  ? 324  LEU A C   1 
ATOM   2443 O O   . LEU A 1 323 ? 53.004  49.373 18.179  1.00 38.65  ? 324  LEU A O   1 
ATOM   2444 C CB  . LEU A 1 323 ? 50.993  48.568 20.417  1.00 42.77  ? 324  LEU A CB  1 
ATOM   2445 C CG  . LEU A 1 323 ? 51.387  47.106 20.642  1.00 38.76  ? 324  LEU A CG  1 
ATOM   2446 C CD1 . LEU A 1 323 ? 51.925  46.897 22.055  1.00 37.25  ? 324  LEU A CD1 1 
ATOM   2447 C CD2 . LEU A 1 323 ? 50.212  46.179 20.363  1.00 33.96  ? 324  LEU A CD2 1 
ATOM   2448 N N   . GLN A 1 324 ? 54.282  48.641 19.891  1.00 38.28  ? 325  GLN A N   1 
ATOM   2449 C CA  . GLN A 1 324 ? 55.277  47.979 19.063  1.00 36.49  ? 325  GLN A CA  1 
ATOM   2450 C C   . GLN A 1 324 ? 55.295  46.500 19.414  1.00 35.15  ? 325  GLN A C   1 
ATOM   2451 O O   . GLN A 1 324 ? 55.240  46.129 20.590  1.00 34.74  ? 325  GLN A O   1 
ATOM   2452 C CB  . GLN A 1 324 ? 56.674  48.577 19.251  1.00 39.39  ? 325  GLN A CB  1 
ATOM   2453 C CG  . GLN A 1 324 ? 56.748  50.068 18.999  1.00 43.14  ? 325  GLN A CG  1 
ATOM   2454 C CD  . GLN A 1 324 ? 56.466  50.867 20.252  1.00 50.69  ? 325  GLN A CD  1 
ATOM   2455 O OE1 . GLN A 1 324 ? 57.074  50.638 21.298  1.00 46.28  ? 325  GLN A OE1 1 
ATOM   2456 N NE2 . GLN A 1 324 ? 55.530  51.804 20.158  1.00 61.14  ? 325  GLN A NE2 1 
ATOM   2457 N N   . VAL A 1 325 ? 55.360  45.659 18.389  1.00 30.72  ? 326  VAL A N   1 
ATOM   2458 C CA  . VAL A 1 325 ? 55.301  44.216 18.553  1.00 31.04  ? 326  VAL A CA  1 
ATOM   2459 C C   . VAL A 1 325 ? 56.343  43.589 17.641  1.00 34.48  ? 326  VAL A C   1 
ATOM   2460 O O   . VAL A 1 325 ? 56.571  44.057 16.519  1.00 34.08  ? 326  VAL A O   1 
ATOM   2461 C CB  . VAL A 1 325 ? 53.883  43.674 18.259  1.00 37.33  ? 326  VAL A CB  1 
ATOM   2462 C CG1 . VAL A 1 325 ? 53.873  42.176 18.251  1.00 38.82  ? 326  VAL A CG1 1 
ATOM   2463 C CG2 . VAL A 1 325 ? 52.914  44.149 19.309  1.00 45.19  ? 326  VAL A CG2 1 
ATOM   2464 N N   . LEU A 1 326 ? 56.999  42.550 18.143  1.00 30.83  ? 327  LEU A N   1 
ATOM   2465 C CA  . LEU A 1 326 ? 57.935  41.739 17.380  1.00 26.59  ? 327  LEU A CA  1 
ATOM   2466 C C   . LEU A 1 326 ? 57.414  40.308 17.385  1.00 27.00  ? 327  LEU A C   1 
ATOM   2467 O O   . LEU A 1 326 ? 57.138  39.752 18.452  1.00 29.07  ? 327  LEU A O   1 
ATOM   2468 C CB  . LEU A 1 326 ? 59.336  41.829 17.989  1.00 28.39  ? 327  LEU A CB  1 
ATOM   2469 C CG  . LEU A 1 326 ? 60.460  40.909 17.509  1.00 35.61  ? 327  LEU A CG  1 
ATOM   2470 C CD1 . LEU A 1 326 ? 60.961  41.348 16.167  1.00 40.21  ? 327  LEU A CD1 1 
ATOM   2471 C CD2 . LEU A 1 326 ? 61.598  40.898 18.528  1.00 40.66  ? 327  LEU A CD2 1 
ATOM   2472 N N   . VAL A 1 327 ? 57.233  39.726 16.197  1.00 25.59  ? 328  VAL A N   1 
ATOM   2473 C CA  . VAL A 1 327 ? 56.653  38.394 16.069  1.00 25.11  ? 328  VAL A CA  1 
ATOM   2474 C C   . VAL A 1 327 ? 57.482  37.576 15.094  1.00 24.55  ? 328  VAL A C   1 
ATOM   2475 O O   . VAL A 1 327 ? 58.177  38.107 14.226  1.00 26.59  ? 328  VAL A O   1 
ATOM   2476 C CB  . VAL A 1 327 ? 55.181  38.417 15.592  1.00 25.12  ? 328  VAL A CB  1 
ATOM   2477 C CG1 . VAL A 1 327 ? 54.332  39.254 16.509  1.00 23.12  ? 328  VAL A CG1 1 
ATOM   2478 C CG2 . VAL A 1 327 ? 55.086  38.924 14.151  1.00 25.03  ? 328  VAL A CG2 1 
ATOM   2479 N N   . GLY A 1 328 ? 57.384  36.263 15.232  1.00 23.96  ? 329  GLY A N   1 
ATOM   2480 C CA  . GLY A 1 328 ? 58.084  35.404 14.302  1.00 23.50  ? 329  GLY A CA  1 
ATOM   2481 C C   . GLY A 1 328 ? 57.794  33.952 14.579  1.00 24.60  ? 329  GLY A C   1 
ATOM   2482 O O   . GLY A 1 328 ? 57.067  33.599 15.513  1.00 26.75  ? 329  GLY A O   1 
ATOM   2483 N N   . VAL A 1 329 ? 58.387  33.113 13.734  1.00 22.54  ? 330  VAL A N   1 
ATOM   2484 C CA  . VAL A 1 329 ? 58.200  31.671 13.743  1.00 20.79  ? 330  VAL A CA  1 
ATOM   2485 C C   . VAL A 1 329 ? 59.544  31.062 13.377  1.00 24.33  ? 330  VAL A C   1 
ATOM   2486 O O   . VAL A 1 329 ? 60.427  31.737 12.839  1.00 26.55  ? 330  VAL A O   1 
ATOM   2487 C CB  . VAL A 1 329 ? 57.109  31.225 12.739  1.00 25.04  ? 330  VAL A CB  1 
ATOM   2488 C CG1 . VAL A 1 329 ? 55.766  31.874 13.062  1.00 18.41  ? 330  VAL A CG1 1 
ATOM   2489 C CG2 . VAL A 1 329 ? 57.534  31.581 11.300  1.00 18.51  ? 330  VAL A CG2 1 
ATOM   2490 N N   . VAL A 1 330 ? 59.707  29.776 13.672  1.00 21.76  ? 331  VAL A N   1 
ATOM   2491 C CA  . VAL A 1 330 ? 60.870  29.070 13.144  1.00 27.11  ? 331  VAL A CA  1 
ATOM   2492 C C   . VAL A 1 330 ? 60.487  28.449 11.807  1.00 27.63  ? 331  VAL A C   1 
ATOM   2493 O O   . VAL A 1 330 ? 59.318  28.464 11.405  1.00 26.76  ? 331  VAL A O   1 
ATOM   2494 C CB  . VAL A 1 330 ? 61.417  28.011 14.118  1.00 27.67  ? 331  VAL A CB  1 
ATOM   2495 C CG1 . VAL A 1 330 ? 61.667  28.601 15.528  1.00 18.68  ? 331  VAL A CG1 1 
ATOM   2496 C CG2 . VAL A 1 330 ? 60.460  26.821 14.179  1.00 23.08  ? 331  VAL A CG2 1 
ATOM   2497 N N   . LYS A 1 331 ? 61.471  27.880 11.118  1.00 26.88  ? 332  LYS A N   1 
ATOM   2498 C CA  . LYS A 1 331 ? 61.257  27.458 9.743   1.00 27.56  ? 332  LYS A CA  1 
ATOM   2499 C C   . LYS A 1 331 ? 60.333  26.247 9.640   1.00 32.51  ? 332  LYS A C   1 
ATOM   2500 O O   . LYS A 1 331 ? 59.605  26.117 8.653   1.00 27.38  ? 332  LYS A O   1 
ATOM   2501 C CB  . LYS A 1 331 ? 62.606  27.170 9.094   1.00 27.29  ? 332  LYS A CB  1 
ATOM   2502 C CG  . LYS A 1 331 ? 62.534  26.872 7.606   1.00 29.14  ? 332  LYS A CG  1 
ATOM   2503 C CD  . LYS A 1 331 ? 63.846  27.239 6.938   1.00 42.91  ? 332  LYS A CD  1 
ATOM   2504 C CE  . LYS A 1 331 ? 64.437  26.070 6.187   1.00 57.08  ? 332  LYS A CE  1 
ATOM   2505 N NZ  . LYS A 1 331 ? 63.514  25.557 5.137   1.00 56.15  ? 332  LYS A NZ  1 
ATOM   2506 N N   . ASP A 1 332 ? 60.334  25.356 10.635  1.00 31.07  ? 333  ASP A N   1 
ATOM   2507 C CA  . ASP A 1 332 ? 59.569  24.105 10.563  1.00 27.46  ? 333  ASP A CA  1 
ATOM   2508 C C   . ASP A 1 332 ? 58.740  23.939 11.839  1.00 26.90  ? 333  ASP A C   1 
ATOM   2509 O O   . ASP A 1 332 ? 59.022  23.083 12.678  1.00 30.56  ? 333  ASP A O   1 
ATOM   2510 C CB  . ASP A 1 332 ? 60.498  22.914 10.342  1.00 26.79  ? 333  ASP A CB  1 
ATOM   2511 C CG  . ASP A 1 332 ? 61.321  23.049 9.073   1.00 36.30  ? 333  ASP A CG  1 
ATOM   2512 O OD1 . ASP A 1 332 ? 62.504  23.448 9.154   1.00 37.19  ? 333  ASP A OD1 1 
ATOM   2513 O OD2 . ASP A 1 332 ? 60.778  22.765 7.988   1.00 41.16  ? 333  ASP A OD2 1 
ATOM   2514 N N   . GLU A 1 333 ? 57.688  24.750 11.962  1.00 26.05  ? 334  GLU A N   1 
ATOM   2515 C CA  . GLU A 1 333 ? 56.899  24.768 13.189  1.00 26.14  ? 334  GLU A CA  1 
ATOM   2516 C C   . GLU A 1 333 ? 56.247  23.416 13.473  1.00 28.74  ? 334  GLU A C   1 
ATOM   2517 O O   . GLU A 1 333 ? 56.099  23.023 14.637  1.00 28.18  ? 334  GLU A O   1 
ATOM   2518 C CB  . GLU A 1 333 ? 55.838  25.867 13.103  1.00 23.53  ? 334  GLU A CB  1 
ATOM   2519 C CG  . GLU A 1 333 ? 56.388  27.280 13.199  1.00 27.79  ? 334  GLU A CG  1 
ATOM   2520 C CD  . GLU A 1 333 ? 56.810  27.656 14.619  1.00 33.00  ? 334  GLU A CD  1 
ATOM   2521 O OE1 . GLU A 1 333 ? 56.545  26.870 15.558  1.00 30.83  ? 334  GLU A OE1 1 
ATOM   2522 O OE2 . GLU A 1 333 ? 57.412  28.739 14.794  1.00 34.89  ? 334  GLU A OE2 1 
ATOM   2523 N N   . GLY A 1 334 ? 55.859  22.683 12.427  1.00 22.24  ? 335  GLY A N   1 
ATOM   2524 C CA  . GLY A 1 334 ? 55.000  21.527 12.630  1.00 22.03  ? 335  GLY A CA  1 
ATOM   2525 C C   . GLY A 1 334 ? 55.706  20.235 12.988  1.00 26.85  ? 335  GLY A C   1 
ATOM   2526 O O   . GLY A 1 334 ? 55.110  19.371 13.642  1.00 27.06  ? 335  GLY A O   1 
ATOM   2527 N N   . SER A 1 335 ? 56.978  20.088 12.596  1.00 25.85  ? 336  SER A N   1 
ATOM   2528 C CA  . SER A 1 335 ? 57.609  18.765 12.582  1.00 30.56  ? 336  SER A CA  1 
ATOM   2529 C C   . SER A 1 335 ? 57.652  18.129 13.970  1.00 33.80  ? 336  SER A C   1 
ATOM   2530 O O   . SER A 1 335 ? 57.347  16.939 14.124  1.00 32.40  ? 336  SER A O   1 
ATOM   2531 C CB  . SER A 1 335 ? 59.019  18.861 11.995  1.00 29.93  ? 336  SER A CB  1 
ATOM   2532 O OG  . SER A 1 335 ? 59.865  19.667 12.804  1.00 36.28  ? 336  SER A OG  1 
ATOM   2533 N N   . TYR A 1 336 ? 58.023  18.907 14.991  1.00 32.23  ? 337  TYR A N   1 
ATOM   2534 C CA  . TYR A 1 336 ? 58.164  18.367 16.342  1.00 33.86  ? 337  TYR A CA  1 
ATOM   2535 C C   . TYR A 1 336 ? 56.865  17.733 16.836  1.00 34.69  ? 337  TYR A C   1 
ATOM   2536 O O   . TYR A 1 336 ? 56.886  16.714 17.537  1.00 35.01  ? 337  TYR A O   1 
ATOM   2537 C CB  . TYR A 1 336 ? 58.636  19.487 17.273  1.00 35.79  ? 337  TYR A CB  1 
ATOM   2538 C CG  . TYR A 1 336 ? 58.406  19.293 18.751  1.00 34.85  ? 337  TYR A CG  1 
ATOM   2539 C CD1 . TYR A 1 336 ? 59.251  18.497 19.507  1.00 41.86  ? 337  TYR A CD1 1 
ATOM   2540 C CD2 . TYR A 1 336 ? 57.373  19.956 19.401  1.00 40.76  ? 337  TYR A CD2 1 
ATOM   2541 C CE1 . TYR A 1 336 ? 59.058  18.338 20.864  1.00 46.23  ? 337  TYR A CE1 1 
ATOM   2542 C CE2 . TYR A 1 336 ? 57.168  19.805 20.755  1.00 44.24  ? 337  TYR A CE2 1 
ATOM   2543 C CZ  . TYR A 1 336 ? 58.013  18.992 21.486  1.00 52.44  ? 337  TYR A CZ  1 
ATOM   2544 O OH  . TYR A 1 336 ? 57.816  18.835 22.843  1.00 54.60  ? 337  TYR A OH  1 
ATOM   2545 N N   . PHE A 1 337 ? 55.726  18.300 16.456  1.00 29.54  ? 338  PHE A N   1 
ATOM   2546 C CA  . PHE A 1 337 ? 54.449  17.817 16.964  1.00 29.69  ? 338  PHE A CA  1 
ATOM   2547 C C   . PHE A 1 337 ? 53.993  16.516 16.313  1.00 31.45  ? 338  PHE A C   1 
ATOM   2548 O O   . PHE A 1 337 ? 53.206  15.783 16.925  1.00 29.48  ? 338  PHE A O   1 
ATOM   2549 C CB  . PHE A 1 337 ? 53.397  18.917 16.792  1.00 28.09  ? 338  PHE A CB  1 
ATOM   2550 C CG  . PHE A 1 337 ? 53.730  20.160 17.556  1.00 28.43  ? 338  PHE A CG  1 
ATOM   2551 C CD1 . PHE A 1 337 ? 54.485  21.170 16.972  1.00 21.92  ? 338  PHE A CD1 1 
ATOM   2552 C CD2 . PHE A 1 337 ? 53.346  20.289 18.887  1.00 27.47  ? 338  PHE A CD2 1 
ATOM   2553 C CE1 . PHE A 1 337 ? 54.829  22.307 17.694  1.00 26.38  ? 338  PHE A CE1 1 
ATOM   2554 C CE2 . PHE A 1 337 ? 53.678  21.423 19.618  1.00 27.56  ? 338  PHE A CE2 1 
ATOM   2555 C CZ  . PHE A 1 337 ? 54.424  22.434 19.025  1.00 26.52  ? 338  PHE A CZ  1 
ATOM   2556 N N   . LEU A 1 338 ? 54.499  16.191 15.116  1.00 28.12  ? 339  LEU A N   1 
ATOM   2557 C CA  . LEU A 1 338 ? 54.001  15.022 14.393  1.00 29.94  ? 339  LEU A CA  1 
ATOM   2558 C C   . LEU A 1 338 ? 54.381  13.706 15.067  1.00 31.61  ? 339  LEU A C   1 
ATOM   2559 O O   . LEU A 1 338 ? 53.637  12.724 14.953  1.00 33.37  ? 339  LEU A O   1 
ATOM   2560 C CB  . LEU A 1 338 ? 54.507  15.041 12.951  1.00 29.68  ? 339  LEU A CB  1 
ATOM   2561 C CG  . LEU A 1 338 ? 54.091  16.284 12.157  1.00 34.94  ? 339  LEU A CG  1 
ATOM   2562 C CD1 . LEU A 1 338 ? 54.710  16.284 10.772  1.00 35.81  ? 339  LEU A CD1 1 
ATOM   2563 C CD2 . LEU A 1 338 ? 52.579  16.373 12.065  1.00 30.91  ? 339  LEU A CD2 1 
ATOM   2564 N N   . VAL A 1 339 ? 55.521  13.648 15.766  1.00 28.77  ? 340  VAL A N   1 
ATOM   2565 C CA  . VAL A 1 339 ? 55.920  12.390 16.394  1.00 33.66  ? 340  VAL A CA  1 
ATOM   2566 C C   . VAL A 1 339 ? 55.127  12.100 17.656  1.00 36.10  ? 340  VAL A C   1 
ATOM   2567 O O   . VAL A 1 339 ? 55.341  11.057 18.287  1.00 34.26  ? 340  VAL A O   1 
ATOM   2568 C CB  . VAL A 1 339 ? 57.431  12.362 16.707  1.00 34.59  ? 340  VAL A CB  1 
ATOM   2569 C CG1 . VAL A 1 339 ? 58.222  12.634 15.448  1.00 31.68  ? 340  VAL A CG1 1 
ATOM   2570 C CG2 . VAL A 1 339 ? 57.786  13.362 17.807  1.00 27.98  ? 340  VAL A CG2 1 
ATOM   2571 N N   . TYR A 1 340 ? 54.201  12.980 18.035  1.00 29.59  ? 341  TYR A N   1 
ATOM   2572 C CA  . TYR A 1 340 ? 53.317  12.743 19.165  1.00 35.65  ? 341  TYR A CA  1 
ATOM   2573 C C   . TYR A 1 340 ? 51.953  12.205 18.741  1.00 39.56  ? 341  TYR A C   1 
ATOM   2574 O O   . TYR A 1 340 ? 50.969  12.391 19.464  1.00 40.85  ? 341  TYR A O   1 
ATOM   2575 C CB  . TYR A 1 340 ? 53.158  14.024 19.990  1.00 25.21  ? 341  TYR A CB  1 
ATOM   2576 C CG  . TYR A 1 340 ? 54.376  14.327 20.833  1.00 27.75  ? 341  TYR A CG  1 
ATOM   2577 C CD1 . TYR A 1 340 ? 54.472  13.855 22.142  1.00 27.59  ? 341  TYR A CD1 1 
ATOM   2578 C CD2 . TYR A 1 340 ? 55.439  15.060 20.318  1.00 25.55  ? 341  TYR A CD2 1 
ATOM   2579 C CE1 . TYR A 1 340 ? 55.589  14.118 22.922  1.00 27.32  ? 341  TYR A CE1 1 
ATOM   2580 C CE2 . TYR A 1 340 ? 56.566  15.332 21.092  1.00 28.93  ? 341  TYR A CE2 1 
ATOM   2581 C CZ  . TYR A 1 340 ? 56.632  14.855 22.393  1.00 32.63  ? 341  TYR A CZ  1 
ATOM   2582 O OH  . TYR A 1 340 ? 57.743  15.111 23.162  1.00 35.85  ? 341  TYR A OH  1 
ATOM   2583 N N   . GLY A 1 341 ? 51.867  11.545 17.587  1.00 36.61  ? 342  GLY A N   1 
ATOM   2584 C CA  . GLY A 1 341 ? 50.635  10.852 17.262  1.00 34.48  ? 342  GLY A CA  1 
ATOM   2585 C C   . GLY A 1 341 ? 50.246  10.762 15.800  1.00 36.35  ? 342  GLY A C   1 
ATOM   2586 O O   . GLY A 1 341 ? 49.308  10.035 15.463  1.00 44.11  ? 342  GLY A O   1 
ATOM   2587 N N   . ALA A 1 342 ? 50.920  11.493 14.925  1.00 32.49  ? 343  ALA A N   1 
ATOM   2588 C CA  . ALA A 1 342 ? 50.639  11.352 13.504  1.00 32.66  ? 343  ALA A CA  1 
ATOM   2589 C C   . ALA A 1 342 ? 51.105  9.974  13.047  1.00 34.64  ? 343  ALA A C   1 
ATOM   2590 O O   . ALA A 1 342 ? 52.246  9.589  13.325  1.00 31.93  ? 343  ALA A O   1 
ATOM   2591 C CB  . ALA A 1 342 ? 51.321  12.451 12.694  1.00 28.53  ? 343  ALA A CB  1 
ATOM   2592 N N   . PRO A 1 343 ? 50.253  9.195  12.382  1.00 37.00  ? 344  PRO A N   1 
ATOM   2593 C CA  . PRO A 1 343 ? 50.652  7.838  11.982  1.00 39.94  ? 344  PRO A CA  1 
ATOM   2594 C C   . PRO A 1 343 ? 51.854  7.862  11.048  1.00 38.09  ? 344  PRO A C   1 
ATOM   2595 O O   . PRO A 1 343 ? 51.920  8.659  10.110  1.00 31.82  ? 344  PRO A O   1 
ATOM   2596 C CB  . PRO A 1 343 ? 49.400  7.289  11.283  1.00 36.86  ? 344  PRO A CB  1 
ATOM   2597 C CG  . PRO A 1 343 ? 48.565  8.494  10.958  1.00 37.00  ? 344  PRO A CG  1 
ATOM   2598 C CD  . PRO A 1 343 ? 48.853  9.490  12.036  1.00 34.98  ? 344  PRO A CD  1 
ATOM   2599 N N   . GLY A 1 344 ? 52.817  6.986  11.330  1.00 40.02  ? 345  GLY A N   1 
ATOM   2600 C CA  . GLY A 1 344 ? 54.009  6.852  10.524  1.00 39.59  ? 345  GLY A CA  1 
ATOM   2601 C C   . GLY A 1 344 ? 55.164  7.752  10.908  1.00 41.42  ? 345  GLY A C   1 
ATOM   2602 O O   . GLY A 1 344 ? 56.215  7.693  10.256  1.00 44.64  ? 345  GLY A O   1 
ATOM   2603 N N   . PHE A 1 345 ? 55.019  8.578  11.937  1.00 33.37  ? 346  PHE A N   1 
ATOM   2604 C CA  . PHE A 1 345 ? 56.054  9.542  12.287  1.00 37.65  ? 346  PHE A CA  1 
ATOM   2605 C C   . PHE A 1 345 ? 56.874  9.066  13.477  1.00 41.99  ? 346  PHE A C   1 
ATOM   2606 O O   . PHE A 1 345 ? 56.335  8.521  14.445  1.00 49.64  ? 346  PHE A O   1 
ATOM   2607 C CB  . PHE A 1 345 ? 55.450  10.916 12.576  1.00 31.16  ? 346  PHE A CB  1 
ATOM   2608 C CG  . PHE A 1 345 ? 55.160  11.702 11.338  1.00 34.84  ? 346  PHE A CG  1 
ATOM   2609 C CD1 . PHE A 1 345 ? 56.109  12.569 10.815  1.00 32.05  ? 346  PHE A CD1 1 
ATOM   2610 C CD2 . PHE A 1 345 ? 53.952  11.549 10.672  1.00 33.16  ? 346  PHE A CD2 1 
ATOM   2611 C CE1 . PHE A 1 345 ? 55.853  13.284 9.657   1.00 29.56  ? 346  PHE A CE1 1 
ATOM   2612 C CE2 . PHE A 1 345 ? 53.684  12.264 9.518   1.00 37.98  ? 346  PHE A CE2 1 
ATOM   2613 C CZ  . PHE A 1 345 ? 54.638  13.134 9.008   1.00 36.34  ? 346  PHE A CZ  1 
ATOM   2614 N N   . SER A 1 346 ? 58.184  9.276  13.386  1.00 40.55  ? 347  SER A N   1 
ATOM   2615 C CA  . SER A 1 346 ? 59.116  8.923  14.444  1.00 38.10  ? 347  SER A CA  1 
ATOM   2616 C C   . SER A 1 346 ? 60.361  9.783  14.299  1.00 35.92  ? 347  SER A C   1 
ATOM   2617 O O   . SER A 1 346 ? 60.774  10.114 13.184  1.00 35.93  ? 347  SER A O   1 
ATOM   2618 C CB  . SER A 1 346 ? 59.492  7.437  14.396  1.00 37.80  ? 347  SER A CB  1 
ATOM   2619 O OG  . SER A 1 346 ? 60.471  7.133  15.375  1.00 47.28  ? 347  SER A OG  1 
ATOM   2620 N N   . LYS A 1 347 ? 60.947  10.148 15.438  1.00 32.10  ? 348  LYS A N   1 
ATOM   2621 C CA  . LYS A 1 347 ? 62.263  10.770 15.411  1.00 33.40  ? 348  LYS A CA  1 
ATOM   2622 C C   . LYS A 1 347 ? 63.343  9.799  14.948  1.00 34.12  ? 348  LYS A C   1 
ATOM   2623 O O   . LYS A 1 347 ? 64.401  10.242 14.496  1.00 32.32  ? 348  LYS A O   1 
ATOM   2624 C CB  . LYS A 1 347 ? 62.613  11.316 16.805  1.00 31.38  ? 348  LYS A CB  1 
ATOM   2625 C CG  . LYS A 1 347 ? 63.507  10.386 17.620  1.00 29.02  ? 348  LYS A CG  1 
ATOM   2626 C CD  . LYS A 1 347 ? 63.832  10.929 19.016  1.00 37.58  ? 348  LYS A CD  1 
ATOM   2627 C CE  . LYS A 1 347 ? 64.747  9.979  19.790  1.00 37.78  ? 348  LYS A CE  1 
ATOM   2628 N NZ  . LYS A 1 347 ? 66.113  9.910  19.188  1.00 46.03  ? 348  LYS A NZ  1 
ATOM   2629 N N   . ASP A 1 348 ? 63.094  8.492  15.044  1.00 33.92  ? 349  ASP A N   1 
ATOM   2630 C CA  . ASP A 1 348 ? 64.124  7.477  14.853  1.00 37.01  ? 349  ASP A CA  1 
ATOM   2631 C C   . ASP A 1 348 ? 64.125  6.852  13.462  1.00 40.10  ? 349  ASP A C   1 
ATOM   2632 O O   . ASP A 1 348 ? 64.963  5.987  13.189  1.00 44.41  ? 349  ASP A O   1 
ATOM   2633 C CB  . ASP A 1 348 ? 63.970  6.382  15.911  1.00 40.38  ? 349  ASP A CB  1 
ATOM   2634 C CG  . ASP A 1 348 ? 64.284  6.882  17.314  1.00 46.45  ? 349  ASP A CG  1 
ATOM   2635 O OD1 . ASP A 1 348 ? 65.247  7.666  17.467  1.00 43.92  ? 349  ASP A OD1 1 
ATOM   2636 O OD2 . ASP A 1 348 ? 63.565  6.496  18.260  1.00 49.36  ? 349  ASP A OD2 1 
ATOM   2637 N N   . ASN A 1 349 ? 63.282  7.335  12.569  1.00 39.33  ? 350  ASN A N   1 
ATOM   2638 C CA  . ASN A 1 349 ? 63.271  6.912  11.179  1.00 43.50  ? 350  ASN A CA  1 
ATOM   2639 C C   . ASN A 1 349 ? 62.994  8.158  10.360  1.00 43.64  ? 350  ASN A C   1 
ATOM   2640 O O   . ASN A 1 349 ? 62.813  9.192  10.917  1.00 41.85  ? 350  ASN A O   1 
ATOM   2641 C CB  . ASN A 1 349 ? 62.331  5.731  10.889  1.00 38.76  ? 350  ASN A CB  1 
ATOM   2642 C CG  . ASN A 1 349 ? 60.877  6.074  11.019  1.00 46.36  ? 350  ASN A CG  1 
ATOM   2643 O OD1 . ASN A 1 349 ? 60.478  7.143  10.676  1.00 55.91  ? 350  ASN A OD1 1 
ATOM   2644 N ND2 . ASN A 1 349 ? 60.077  5.136  11.484  1.00 67.97  ? 350  ASN A ND2 1 
ATOM   2645 N N   . GLU A 1 350 ? 62.996  8.072  9.052   1.00 38.63  ? 351  GLU A N   1 
ATOM   2646 C CA  A GLU A 1 350 ? 62.841  9.254  8.211   0.63 36.94  ? 351  GLU A CA  1 
ATOM   2647 C CA  B GLU A 1 350 ? 62.847  9.274  8.240   0.37 37.05  ? 351  GLU A CA  1 
ATOM   2648 C C   . GLU A 1 350 ? 61.391  9.701  8.068   1.00 35.03  ? 351  GLU A C   1 
ATOM   2649 O O   . GLU A 1 350 ? 61.138  10.742 7.453   1.00 33.10  ? 351  GLU A O   1 
ATOM   2650 C CB  A GLU A 1 350 ? 63.435  8.993  6.823   0.63 39.67  ? 351  GLU A CB  1 
ATOM   2651 C CB  B GLU A 1 350 ? 63.506  9.081  6.868   0.37 39.61  ? 351  GLU A CB  1 
ATOM   2652 C CG  A GLU A 1 350 ? 64.952  8.891  6.802   0.63 39.89  ? 351  GLU A CG  1 
ATOM   2653 C CG  B GLU A 1 350 ? 64.042  10.383 6.274   0.37 42.46  ? 351  GLU A CG  1 
ATOM   2654 C CD  A GLU A 1 350 ? 65.625  10.116 7.402   0.63 46.36  ? 351  GLU A CD  1 
ATOM   2655 C CD  B GLU A 1 350 ? 64.841  10.181 5.002   0.37 46.07  ? 351  GLU A CD  1 
ATOM   2656 O OE1 A GLU A 1 350 ? 65.921  10.107 8.618   0.63 51.91  ? 351  GLU A OE1 1 
ATOM   2657 O OE1 B GLU A 1 350 ? 65.614  9.199  4.932   0.37 48.85  ? 351  GLU A OE1 1 
ATOM   2658 O OE2 A GLU A 1 350 ? 65.850  11.096 6.659   0.63 46.48  ? 351  GLU A OE2 1 
ATOM   2659 O OE2 B GLU A 1 350 ? 64.694  11.007 4.074   0.37 41.66  ? 351  GLU A OE2 1 
ATOM   2660 N N   . SER A 1 351 ? 60.435  8.935  8.603   1.00 31.33  ? 352  SER A N   1 
ATOM   2661 C CA  . SER A 1 351 ? 59.015  9.307  8.606   1.00 32.37  ? 352  SER A CA  1 
ATOM   2662 C C   . SER A 1 351 ? 58.498  9.587  7.201   1.00 33.97  ? 352  SER A C   1 
ATOM   2663 O O   . SER A 1 351 ? 57.756  10.544 6.975   1.00 32.79  ? 352  SER A O   1 
ATOM   2664 C CB  . SER A 1 351 ? 58.759  10.505 9.526   1.00 28.20  ? 352  SER A CB  1 
ATOM   2665 O OG  . SER A 1 351 ? 59.044  10.181 10.874  1.00 31.65  ? 352  SER A OG  1 
ATOM   2666 N N   . LEU A 1 352 ? 58.886  8.742  6.250   1.00 37.32  ? 353  LEU A N   1 
ATOM   2667 C CA  . LEU A 1 352 ? 58.405  8.855  4.875   1.00 37.25  ? 353  LEU A CA  1 
ATOM   2668 C C   . LEU A 1 352 ? 57.070  8.130  4.786   1.00 35.50  ? 353  LEU A C   1 
ATOM   2669 O O   . LEU A 1 352 ? 57.004  6.922  4.564   1.00 42.77  ? 353  LEU A O   1 
ATOM   2670 C CB  . LEU A 1 352 ? 59.431  8.294  3.901   1.00 34.24  ? 353  LEU A CB  1 
ATOM   2671 C CG  . LEU A 1 352 ? 60.740  9.078  3.905   1.00 36.89  ? 353  LEU A CG  1 
ATOM   2672 C CD1 . LEU A 1 352 ? 61.830  8.301  3.188   1.00 35.92  ? 353  LEU A CD1 1 
ATOM   2673 C CD2 . LEU A 1 352 ? 60.543  10.437 3.262   1.00 32.97  ? 353  LEU A CD2 1 
ATOM   2674 N N   . ILE A 1 353 ? 55.993  8.886  4.949   1.00 34.28  ? 354  ILE A N   1 
ATOM   2675 C CA  . ILE A 1 353 ? 54.665  8.320  5.129   1.00 31.66  ? 354  ILE A CA  1 
ATOM   2676 C C   . ILE A 1 353 ? 54.010  8.069  3.776   1.00 34.61  ? 354  ILE A C   1 
ATOM   2677 O O   . ILE A 1 353 ? 54.383  8.643  2.752   1.00 36.17  ? 354  ILE A O   1 
ATOM   2678 C CB  . ILE A 1 353 ? 53.791  9.243  5.997   1.00 29.83  ? 354  ILE A CB  1 
ATOM   2679 C CG1 . ILE A 1 353 ? 53.667  10.610 5.324   1.00 26.48  ? 354  ILE A CG1 1 
ATOM   2680 C CG2 . ILE A 1 353 ? 54.387  9.372  7.399   1.00 27.58  ? 354  ILE A CG2 1 
ATOM   2681 C CD1 . ILE A 1 353 ? 52.688  11.546 5.990   1.00 27.10  ? 354  ILE A CD1 1 
ATOM   2682 N N   . SER A 1 354 ? 53.006  7.199  3.785   1.00 32.41  ? 355  SER A N   1 
ATOM   2683 C CA  . SER A 1 354 ? 52.195  6.917  2.618   1.00 34.48  ? 355  SER A CA  1 
ATOM   2684 C C   . SER A 1 354 ? 51.071  7.942  2.482   1.00 33.81  ? 355  SER A C   1 
ATOM   2685 O O   . SER A 1 354 ? 50.801  8.742  3.382   1.00 31.72  ? 355  SER A O   1 
ATOM   2686 C CB  . SER A 1 354 ? 51.602  5.513  2.710   1.00 38.36  ? 355  SER A CB  1 
ATOM   2687 O OG  . SER A 1 354 ? 50.610  5.462  3.724   1.00 39.85  ? 355  SER A OG  1 
ATOM   2688 N N   . ARG A 1 355 ? 50.403  7.899  1.330   1.00 34.10  ? 356  ARG A N   1 
ATOM   2689 C CA  . ARG A 1 355 ? 49.224  8.731  1.121   1.00 36.74  ? 356  ARG A CA  1 
ATOM   2690 C C   . ARG A 1 355 ? 48.161  8.455  2.176   1.00 34.29  ? 356  ARG A C   1 
ATOM   2691 O O   . ARG A 1 355 ? 47.565  9.387  2.730   1.00 33.35  ? 356  ARG A O   1 
ATOM   2692 C CB  . ARG A 1 355 ? 48.659  8.484  -0.277  1.00 38.01  ? 356  ARG A CB  1 
ATOM   2693 C CG  . ARG A 1 355 ? 47.416  9.295  -0.594  1.00 36.73  ? 356  ARG A CG  1 
ATOM   2694 C CD  . ARG A 1 355 ? 47.782  10.736 -0.837  1.00 42.18  ? 356  ARG A CD  1 
ATOM   2695 N NE  . ARG A 1 355 ? 46.633  11.547 -1.230  1.00 45.08  ? 356  ARG A NE  1 
ATOM   2696 C CZ  . ARG A 1 355 ? 46.697  12.856 -1.437  1.00 37.06  ? 356  ARG A CZ  1 
ATOM   2697 N NH1 . ARG A 1 355 ? 47.856  13.488 -1.298  1.00 32.11  ? 356  ARG A NH1 1 
ATOM   2698 N NH2 . ARG A 1 355 ? 45.611  13.531 -1.781  1.00 31.16  ? 356  ARG A NH2 1 
ATOM   2699 N N   . ALA A 1 356 ? 47.902  7.176  2.459   1.00 36.00  ? 357  ALA A N   1 
ATOM   2700 C CA  . ALA A 1 356 ? 46.882  6.830  3.441   1.00 36.23  ? 357  ALA A CA  1 
ATOM   2701 C C   . ALA A 1 356 ? 47.225  7.398  4.812   1.00 30.28  ? 357  ALA A C   1 
ATOM   2702 O O   . ALA A 1 356 ? 46.343  7.890  5.524   1.00 37.79  ? 357  ALA A O   1 
ATOM   2703 C CB  . ALA A 1 356 ? 46.711  5.311  3.511   1.00 31.88  ? 357  ALA A CB  1 
ATOM   2704 N N   . GLU A 1 357 ? 48.501  7.346  5.199   1.00 29.72  ? 358  GLU A N   1 
ATOM   2705 C CA  . GLU A 1 357 ? 48.894  7.904  6.489   1.00 29.21  ? 358  GLU A CA  1 
ATOM   2706 C C   . GLU A 1 357 ? 48.808  9.425  6.487   1.00 32.80  ? 358  GLU A C   1 
ATOM   2707 O O   . GLU A 1 357 ? 48.517  10.029 7.523   1.00 32.89  ? 358  GLU A O   1 
ATOM   2708 C CB  . GLU A 1 357 ? 50.305  7.442  6.860   1.00 31.83  ? 358  GLU A CB  1 
ATOM   2709 C CG  . GLU A 1 357 ? 50.461  5.931  6.919   1.00 39.46  ? 358  GLU A CG  1 
ATOM   2710 C CD  . GLU A 1 357 ? 51.866  5.495  7.290   1.00 44.68  ? 358  GLU A CD  1 
ATOM   2711 O OE1 . GLU A 1 357 ? 52.824  5.902  6.602   1.00 44.43  ? 358  GLU A OE1 1 
ATOM   2712 O OE2 . GLU A 1 357 ? 52.014  4.732  8.265   1.00 51.55  ? 358  GLU A OE2 1 
ATOM   2713 N N   . PHE A 1 358 ? 49.038  10.055 5.333   1.00 34.13  ? 359  PHE A N   1 
ATOM   2714 C CA  . PHE A 1 358 ? 48.869  11.500 5.222   1.00 30.22  ? 359  PHE A CA  1 
ATOM   2715 C C   . PHE A 1 358 ? 47.417  11.901 5.452   1.00 30.73  ? 359  PHE A C   1 
ATOM   2716 O O   . PHE A 1 358 ? 47.125  12.792 6.258   1.00 28.51  ? 359  PHE A O   1 
ATOM   2717 C CB  . PHE A 1 358 ? 49.347  11.972 3.847   1.00 29.92  ? 359  PHE A CB  1 
ATOM   2718 C CG  . PHE A 1 358 ? 49.037  13.411 3.559   1.00 27.38  ? 359  PHE A CG  1 
ATOM   2719 C CD1 . PHE A 1 358 ? 49.811  14.422 4.106   1.00 24.30  ? 359  PHE A CD1 1 
ATOM   2720 C CD2 . PHE A 1 358 ? 47.973  13.754 2.740   1.00 29.53  ? 359  PHE A CD2 1 
ATOM   2721 C CE1 . PHE A 1 358 ? 49.527  15.752 3.844   1.00 28.28  ? 359  PHE A CE1 1 
ATOM   2722 C CE2 . PHE A 1 358 ? 47.683  15.081 2.471   1.00 31.74  ? 359  PHE A CE2 1 
ATOM   2723 C CZ  . PHE A 1 358 ? 48.462  16.082 3.025   1.00 28.69  ? 359  PHE A CZ  1 
ATOM   2724 N N   . LEU A 1 359 ? 46.489  11.243 4.752   1.00 30.30  ? 360  LEU A N   1 
ATOM   2725 C CA  . LEU A 1 359 ? 45.074  11.558 4.914   1.00 29.64  ? 360  LEU A CA  1 
ATOM   2726 C C   . LEU A 1 359 ? 44.615  11.310 6.344   1.00 36.08  ? 360  LEU A C   1 
ATOM   2727 O O   . LEU A 1 359 ? 43.831  12.091 6.897   1.00 33.76  ? 360  LEU A O   1 
ATOM   2728 C CB  . LEU A 1 359 ? 44.241  10.742 3.926   1.00 26.92  ? 360  LEU A CB  1 
ATOM   2729 C CG  . LEU A 1 359 ? 44.610  10.978 2.458   1.00 33.66  ? 360  LEU A CG  1 
ATOM   2730 C CD1 . LEU A 1 359 ? 43.932  9.962  1.538   1.00 32.20  ? 360  LEU A CD1 1 
ATOM   2731 C CD2 . LEU A 1 359 ? 44.260  12.399 2.037   1.00 33.37  ? 360  LEU A CD2 1 
ATOM   2732 N N   . ALA A 1 360 ? 45.097  10.227 6.960   1.00 33.64  ? 361  ALA A N   1 
ATOM   2733 C CA  . ALA A 1 360 ? 44.811  9.993  8.370   1.00 33.24  ? 361  ALA A CA  1 
ATOM   2734 C C   . ALA A 1 360 ? 45.445  11.071 9.240   1.00 37.23  ? 361  ALA A C   1 
ATOM   2735 O O   . ALA A 1 360 ? 44.833  11.534 10.209  1.00 32.98  ? 361  ALA A O   1 
ATOM   2736 C CB  . ALA A 1 360 ? 45.303  8.606  8.789   1.00 29.56  ? 361  ALA A CB  1 
ATOM   2737 N N   . GLY A 1 361 ? 46.668  11.492 8.901   1.00 34.38  ? 362  GLY A N   1 
ATOM   2738 C CA  . GLY A 1 361 ? 47.334  12.519 9.686   1.00 25.69  ? 362  GLY A CA  1 
ATOM   2739 C C   . GLY A 1 361 ? 46.622  13.856 9.647   1.00 25.90  ? 362  GLY A C   1 
ATOM   2740 O O   . GLY A 1 361 ? 46.661  14.611 10.623  1.00 27.67  ? 362  GLY A O   1 
ATOM   2741 N N   . VAL A 1 362 ? 45.956  14.164 8.531   1.00 26.24  ? 363  VAL A N   1 
ATOM   2742 C CA  . VAL A 1 362 ? 45.214  15.416 8.426   1.00 27.39  ? 363  VAL A CA  1 
ATOM   2743 C C   . VAL A 1 362 ? 44.136  15.496 9.501   1.00 27.99  ? 363  VAL A C   1 
ATOM   2744 O O   . VAL A 1 362 ? 43.935  16.553 10.112  1.00 25.61  ? 363  VAL A O   1 
ATOM   2745 C CB  . VAL A 1 362 ? 44.623  15.567 7.012   1.00 27.58  ? 363  VAL A CB  1 
ATOM   2746 C CG1 . VAL A 1 362 ? 43.521  16.627 6.994   1.00 25.28  ? 363  VAL A CG1 1 
ATOM   2747 C CG2 . VAL A 1 362 ? 45.718  15.923 6.026   1.00 26.01  ? 363  VAL A CG2 1 
ATOM   2748 N N   . ARG A 1 363 ? 43.433  14.384 9.758   1.00 29.84  ? 364  ARG A N   1 
ATOM   2749 C CA  . ARG A 1 363 ? 42.387  14.394 10.781  1.00 29.40  ? 364  ARG A CA  1 
ATOM   2750 C C   . ARG A 1 363 ? 42.974  14.508 12.180  1.00 32.86  ? 364  ARG A C   1 
ATOM   2751 O O   . ARG A 1 363 ? 42.305  15.004 13.092  1.00 31.43  ? 364  ARG A O   1 
ATOM   2752 C CB  . ARG A 1 363 ? 41.520  13.131 10.711  1.00 32.78  ? 364  ARG A CB  1 
ATOM   2753 C CG  . ARG A 1 363 ? 40.804  12.861 9.383   1.00 39.01  ? 364  ARG A CG  1 
ATOM   2754 C CD  . ARG A 1 363 ? 40.244  14.122 8.733   1.00 42.99  ? 364  ARG A CD  1 
ATOM   2755 N NE  . ARG A 1 363 ? 39.094  14.720 9.422   1.00 45.42  ? 364  ARG A NE  1 
ATOM   2756 C CZ  . ARG A 1 363 ? 37.818  14.442 9.148   1.00 42.15  ? 364  ARG A CZ  1 
ATOM   2757 N NH1 . ARG A 1 363 ? 37.510  13.553 8.213   1.00 34.30  ? 364  ARG A NH1 1 
ATOM   2758 N NH2 . ARG A 1 363 ? 36.843  15.052 9.811   1.00 37.59  ? 364  ARG A NH2 1 
ATOM   2759 N N   . VAL A 1 364 ? 44.201  14.028 12.372  1.00 29.86  ? 365  VAL A N   1 
ATOM   2760 C CA  . VAL A 1 364 ? 44.865  14.155 13.663  1.00 33.88  ? 365  VAL A CA  1 
ATOM   2761 C C   . VAL A 1 364 ? 45.384  15.573 13.861  1.00 31.97  ? 365  VAL A C   1 
ATOM   2762 O O   . VAL A 1 364 ? 45.310  16.125 14.964  1.00 28.87  ? 365  VAL A O   1 
ATOM   2763 C CB  . VAL A 1 364 ? 45.990  13.107 13.769  1.00 32.13  ? 365  VAL A CB  1 
ATOM   2764 C CG1 . VAL A 1 364 ? 46.858  13.366 14.979  1.00 31.03  ? 365  VAL A CG1 1 
ATOM   2765 C CG2 . VAL A 1 364 ? 45.395  11.704 13.822  1.00 37.01  ? 365  VAL A CG2 1 
ATOM   2766 N N   . GLY A 1 365 ? 45.895  16.189 12.796  1.00 29.98  ? 366  GLY A N   1 
ATOM   2767 C CA  . GLY A 1 365 ? 46.454  17.523 12.874  1.00 28.79  ? 366  GLY A CA  1 
ATOM   2768 C C   . GLY A 1 365 ? 45.422  18.623 12.729  1.00 30.17  ? 366  GLY A C   1 
ATOM   2769 O O   . GLY A 1 365 ? 45.692  19.782 13.062  1.00 29.46  ? 366  GLY A O   1 
ATOM   2770 N N   . VAL A 1 366 ? 44.245  18.288 12.210  1.00 26.06  ? 367  VAL A N   1 
ATOM   2771 C CA  . VAL A 1 366 ? 43.151  19.255 12.151  1.00 27.25  ? 367  VAL A CA  1 
ATOM   2772 C C   . VAL A 1 366 ? 41.939  18.598 12.797  1.00 30.20  ? 367  VAL A C   1 
ATOM   2773 O O   . VAL A 1 366 ? 40.959  18.270 12.111  1.00 30.34  ? 367  VAL A O   1 
ATOM   2774 C CB  . VAL A 1 366 ? 42.867  19.715 10.712  1.00 29.83  ? 367  VAL A CB  1 
ATOM   2775 C CG1 . VAL A 1 366 ? 42.016  20.974 10.725  1.00 26.09  ? 367  VAL A CG1 1 
ATOM   2776 C CG2 . VAL A 1 366 ? 44.173  19.969 9.963   1.00 23.09  ? 367  VAL A CG2 1 
ATOM   2777 N N   . PRO A 1 367 ? 41.961  18.399 14.111  1.00 28.55  ? 368  PRO A N   1 
ATOM   2778 C CA  . PRO A 1 367 ? 40.900  17.632 14.763  1.00 26.32  ? 368  PRO A CA  1 
ATOM   2779 C C   . PRO A 1 367 ? 39.607  18.421 14.874  1.00 26.07  ? 368  PRO A C   1 
ATOM   2780 O O   . PRO A 1 367 ? 39.597  19.654 14.897  1.00 30.29  ? 368  PRO A O   1 
ATOM   2781 C CB  . PRO A 1 367 ? 41.491  17.340 16.147  1.00 27.81  ? 368  PRO A CB  1 
ATOM   2782 C CG  . PRO A 1 367 ? 42.398  18.492 16.407  1.00 30.72  ? 368  PRO A CG  1 
ATOM   2783 C CD  . PRO A 1 367 ? 42.965  18.891 15.072  1.00 28.74  ? 368  PRO A CD  1 
ATOM   2784 N N   . GLN A 1 368 ? 38.502  17.676 14.921  1.00 29.47  ? 369  GLN A N   1 
ATOM   2785 C CA  . GLN A 1 368 ? 37.177  18.235 15.196  1.00 44.31  ? 369  GLN A CA  1 
ATOM   2786 C C   . GLN A 1 368 ? 36.727  19.219 14.115  1.00 45.61  ? 369  GLN A C   1 
ATOM   2787 O O   . GLN A 1 368 ? 36.157  20.272 14.408  1.00 44.08  ? 369  GLN A O   1 
ATOM   2788 C CB  . GLN A 1 368 ? 37.142  18.896 16.575  1.00 46.23  ? 369  GLN A CB  1 
ATOM   2789 C CG  . GLN A 1 368 ? 37.597  17.989 17.703  1.00 52.02  ? 369  GLN A CG  1 
ATOM   2790 C CD  . GLN A 1 368 ? 36.584  16.913 18.022  1.00 58.74  ? 369  GLN A CD  1 
ATOM   2791 O OE1 . GLN A 1 368 ? 35.544  17.187 18.621  1.00 64.57  ? 369  GLN A OE1 1 
ATOM   2792 N NE2 . GLN A 1 368 ? 36.881  15.678 17.624  1.00 55.06  ? 369  GLN A NE2 1 
ATOM   2793 N N   . VAL A 1 369 ? 36.986  18.883 12.851  1.00 42.61  ? 370  VAL A N   1 
ATOM   2794 C CA  . VAL A 1 369 ? 36.408  19.615 11.732  1.00 35.14  ? 370  VAL A CA  1 
ATOM   2795 C C   . VAL A 1 369 ? 35.631  18.627 10.875  1.00 31.09  ? 370  VAL A C   1 
ATOM   2796 O O   . VAL A 1 369 ? 35.858  17.415 10.916  1.00 36.01  ? 370  VAL A O   1 
ATOM   2797 C CB  . VAL A 1 369 ? 37.463  20.366 10.887  1.00 31.21  ? 370  VAL A CB  1 
ATOM   2798 C CG1 . VAL A 1 369 ? 38.269  21.326 11.753  1.00 26.95  ? 370  VAL A CG1 1 
ATOM   2799 C CG2 . VAL A 1 369 ? 38.375  19.382 10.156  1.00 30.99  ? 370  VAL A CG2 1 
ATOM   2800 N N   . SER A 1 370 ? 34.693  19.162 10.097  1.00 30.52  ? 371  SER A N   1 
ATOM   2801 C CA  . SER A 1 370 ? 33.886  18.330 9.217   1.00 31.31  ? 371  SER A CA  1 
ATOM   2802 C C   . SER A 1 370 ? 34.757  17.641 8.169   1.00 28.27  ? 371  SER A C   1 
ATOM   2803 O O   . SER A 1 370 ? 35.913  18.007 7.938   1.00 28.45  ? 371  SER A O   1 
ATOM   2804 C CB  . SER A 1 370 ? 32.816  19.169 8.523   1.00 36.55  ? 371  SER A CB  1 
ATOM   2805 O OG  . SER A 1 370 ? 33.414  20.123 7.665   1.00 37.17  ? 371  SER A OG  1 
ATOM   2806 N N   . ASP A 1 371 ? 34.177  16.624 7.526   1.00 30.24  ? 372  ASP A N   1 
ATOM   2807 C CA  . ASP A 1 371 ? 34.869  15.951 6.430   1.00 36.53  ? 372  ASP A CA  1 
ATOM   2808 C C   . ASP A 1 371 ? 35.168  16.917 5.291   1.00 34.74  ? 372  ASP A C   1 
ATOM   2809 O O   . ASP A 1 371 ? 36.236  16.850 4.673   1.00 36.52  ? 372  ASP A O   1 
ATOM   2810 C CB  . ASP A 1 371 ? 34.033  14.776 5.924   1.00 39.10  ? 372  ASP A CB  1 
ATOM   2811 C CG  . ASP A 1 371 ? 33.792  13.732 6.990   1.00 50.33  ? 372  ASP A CG  1 
ATOM   2812 O OD1 . ASP A 1 371 ? 34.598  13.655 7.945   1.00 48.90  ? 372  ASP A OD1 1 
ATOM   2813 O OD2 . ASP A 1 371 ? 32.793  12.986 6.873   1.00 59.97  ? 372  ASP A OD2 1 
ATOM   2814 N N   . LEU A 1 372 ? 34.231  17.822 4.999   1.00 31.10  ? 373  LEU A N   1 
ATOM   2815 C CA  . LEU A 1 372 ? 34.442  18.806 3.941   1.00 34.64  ? 373  LEU A CA  1 
ATOM   2816 C C   . LEU A 1 372 ? 35.643  19.690 4.250   1.00 35.72  ? 373  LEU A C   1 
ATOM   2817 O O   . LEU A 1 372 ? 36.483  19.945 3.377   1.00 33.24  ? 373  LEU A O   1 
ATOM   2818 C CB  . LEU A 1 372 ? 33.184  19.654 3.761   1.00 29.33  ? 373  LEU A CB  1 
ATOM   2819 C CG  . LEU A 1 372 ? 33.248  20.697 2.647   1.00 35.53  ? 373  LEU A CG  1 
ATOM   2820 C CD1 . LEU A 1 372 ? 33.286  20.019 1.272   1.00 29.51  ? 373  LEU A CD1 1 
ATOM   2821 C CD2 . LEU A 1 372 ? 32.067  21.652 2.753   1.00 32.95  ? 373  LEU A CD2 1 
ATOM   2822 N N   . ALA A 1 373 ? 35.740  20.164 5.495   1.00 28.41  ? 374  ALA A N   1 
ATOM   2823 C CA  . ALA A 1 373 ? 36.897  20.951 5.908   1.00 30.76  ? 374  ALA A CA  1 
ATOM   2824 C C   . ALA A 1 373 ? 38.185  20.165 5.709   1.00 29.74  ? 374  ALA A C   1 
ATOM   2825 O O   . ALA A 1 373 ? 39.170  20.688 5.176   1.00 27.93  ? 374  ALA A O   1 
ATOM   2826 C CB  . ALA A 1 373 ? 36.748  21.383 7.367   1.00 24.51  ? 374  ALA A CB  1 
ATOM   2827 N N   . ALA A 1 374 ? 38.190  18.895 6.124   1.00 28.30  ? 375  ALA A N   1 
ATOM   2828 C CA  . ALA A 1 374 ? 39.361  18.052 5.909   1.00 29.36  ? 375  ALA A CA  1 
ATOM   2829 C C   . ALA A 1 374 ? 39.681  17.919 4.424   1.00 31.27  ? 375  ALA A C   1 
ATOM   2830 O O   . ALA A 1 374 ? 40.856  17.944 4.035   1.00 28.71  ? 375  ALA A O   1 
ATOM   2831 C CB  . ALA A 1 374 ? 39.144  16.677 6.542   1.00 23.56  ? 375  ALA A CB  1 
ATOM   2832 N N   . GLU A 1 375 ? 38.649  17.791 3.578   1.00 28.15  ? 376  GLU A N   1 
ATOM   2833 C CA  . GLU A 1 375 ? 38.882  17.684 2.139   1.00 34.82  ? 376  GLU A CA  1 
ATOM   2834 C C   . GLU A 1 375 ? 39.499  18.960 1.587   1.00 34.36  ? 376  GLU A C   1 
ATOM   2835 O O   . GLU A 1 375 ? 40.343  18.909 0.683   1.00 29.56  ? 376  GLU A O   1 
ATOM   2836 C CB  . GLU A 1 375 ? 37.578  17.369 1.399   1.00 36.39  ? 376  GLU A CB  1 
ATOM   2837 C CG  . GLU A 1 375 ? 37.003  15.991 1.672   1.00 49.32  ? 376  GLU A CG  1 
ATOM   2838 C CD  . GLU A 1 375 ? 37.937  14.865 1.273   1.00 64.19  ? 376  GLU A CD  1 
ATOM   2839 O OE1 . GLU A 1 375 ? 38.758  15.055 0.350   1.00 67.97  ? 376  GLU A OE1 1 
ATOM   2840 O OE2 . GLU A 1 375 ? 37.849  13.783 1.889   1.00 75.86  ? 376  GLU A OE2 1 
ATOM   2841 N N   . ALA A 1 376 ? 39.082  20.116 2.112   1.00 27.78  ? 377  ALA A N   1 
ATOM   2842 C CA  . ALA A 1 376 ? 39.703  21.374 1.715   1.00 26.33  ? 377  ALA A CA  1 
ATOM   2843 C C   . ALA A 1 376 ? 41.181  21.402 2.096   1.00 23.91  ? 377  ALA A C   1 
ATOM   2844 O O   . ALA A 1 376 ? 42.015  21.893 1.327   1.00 26.14  ? 377  ALA A O   1 
ATOM   2845 C CB  . ALA A 1 376 ? 38.955  22.552 2.346   1.00 21.39  ? 377  ALA A CB  1 
ATOM   2846 N N   . VAL A 1 377 ? 41.524  20.888 3.283   1.00 25.65  ? 378  VAL A N   1 
ATOM   2847 C CA  . VAL A 1 377 ? 42.930  20.809 3.676   1.00 24.93  ? 378  VAL A CA  1 
ATOM   2848 C C   . VAL A 1 377 ? 43.697  19.923 2.704   1.00 27.63  ? 378  VAL A C   1 
ATOM   2849 O O   . VAL A 1 377 ? 44.780  20.285 2.230   1.00 25.50  ? 378  VAL A O   1 
ATOM   2850 C CB  . VAL A 1 377 ? 43.068  20.294 5.120   1.00 25.30  ? 378  VAL A CB  1 
ATOM   2851 C CG1 . VAL A 1 377 ? 44.541  20.120 5.469   1.00 20.94  ? 378  VAL A CG1 1 
ATOM   2852 C CG2 . VAL A 1 377 ? 42.394  21.247 6.102   1.00 19.74  ? 378  VAL A CG2 1 
ATOM   2853 N N   . VAL A 1 378 ? 43.145  18.744 2.402   1.00 28.25  ? 379  VAL A N   1 
ATOM   2854 C CA  . VAL A 1 378 ? 43.811  17.807 1.503   1.00 28.98  ? 379  VAL A CA  1 
ATOM   2855 C C   . VAL A 1 378 ? 44.033  18.446 0.138   1.00 32.32  ? 379  VAL A C   1 
ATOM   2856 O O   . VAL A 1 378 ? 45.099  18.294 -0.468  1.00 33.30  ? 379  VAL A O   1 
ATOM   2857 C CB  . VAL A 1 378 ? 42.996  16.504 1.397   1.00 29.58  ? 379  VAL A CB  1 
ATOM   2858 C CG1 . VAL A 1 378 ? 43.509  15.639 0.252   1.00 27.25  ? 379  VAL A CG1 1 
ATOM   2859 C CG2 . VAL A 1 378 ? 43.054  15.737 2.706   1.00 25.38  ? 379  VAL A CG2 1 
ATOM   2860 N N   . LEU A 1 379 ? 43.038  19.184 -0.355  1.00 30.22  ? 380  LEU A N   1 
ATOM   2861 C CA  . LEU A 1 379 ? 43.164  19.843 -1.650  1.00 32.22  ? 380  LEU A CA  1 
ATOM   2862 C C   . LEU A 1 379 ? 44.336  20.812 -1.666  1.00 35.00  ? 380  LEU A C   1 
ATOM   2863 O O   . LEU A 1 379 ? 45.136  20.826 -2.609  1.00 34.22  ? 380  LEU A O   1 
ATOM   2864 C CB  . LEU A 1 379 ? 41.869  20.582 -1.993  1.00 29.67  ? 380  LEU A CB  1 
ATOM   2865 C CG  . LEU A 1 379 ? 41.981  21.561 -3.167  1.00 33.18  ? 380  LEU A CG  1 
ATOM   2866 C CD1 . LEU A 1 379 ? 42.077  20.817 -4.493  1.00 23.98  ? 380  LEU A CD1 1 
ATOM   2867 C CD2 . LEU A 1 379 ? 40.824  22.549 -3.181  1.00 33.83  ? 380  LEU A CD2 1 
ATOM   2868 N N   A HIS A 1 380 ? 44.455  21.630 -0.615  0.59 34.88  ? 381  HIS A N   1 
ATOM   2869 N N   B HIS A 1 380 ? 44.464  21.634 -0.627  0.41 34.90  ? 381  HIS A N   1 
ATOM   2870 C CA  A HIS A 1 380 ? 45.443  22.703 -0.613  0.59 34.78  ? 381  HIS A CA  1 
ATOM   2871 C CA  B HIS A 1 380 ? 45.469  22.687 -0.678  0.41 34.82  ? 381  HIS A CA  1 
ATOM   2872 C C   A HIS A 1 380 ? 46.862  22.175 -0.441  0.59 33.55  ? 381  HIS A C   1 
ATOM   2873 C C   B HIS A 1 380 ? 46.881  22.167 -0.450  0.41 33.31  ? 381  HIS A C   1 
ATOM   2874 O O   A HIS A 1 380 ? 47.802  22.744 -1.007  0.59 33.82  ? 381  HIS A O   1 
ATOM   2875 O O   B HIS A 1 380 ? 47.835  22.733 -0.995  0.41 33.90  ? 381  HIS A O   1 
ATOM   2876 C CB  A HIS A 1 380 ? 45.117  23.714 0.490   0.59 35.42  ? 381  HIS A CB  1 
ATOM   2877 C CB  B HIS A 1 380 ? 45.131  23.780 0.332   0.41 35.84  ? 381  HIS A CB  1 
ATOM   2878 C CG  A HIS A 1 380 ? 45.939  24.964 0.422   0.59 38.58  ? 381  HIS A CG  1 
ATOM   2879 C CG  B HIS A 1 380 ? 44.232  24.835 -0.224  0.41 39.78  ? 381  HIS A CG  1 
ATOM   2880 N ND1 A HIS A 1 380 ? 45.470  26.131 -0.141  0.59 41.97  ? 381  HIS A ND1 1 
ATOM   2881 N ND1 B HIS A 1 380 ? 44.713  25.956 -0.866  0.41 43.70  ? 381  HIS A ND1 1 
ATOM   2882 C CD2 A HIS A 1 380 ? 47.206  25.224 0.826   0.59 39.93  ? 381  HIS A CD2 1 
ATOM   2883 C CD2 B HIS A 1 380 ? 42.882  24.926 -0.264  0.41 42.81  ? 381  HIS A CD2 1 
ATOM   2884 C CE1 A HIS A 1 380 ? 46.409  27.059 -0.074  0.59 39.98  ? 381  HIS A CE1 1 
ATOM   2885 C CE1 B HIS A 1 380 ? 43.697  26.700 -1.264  0.41 45.80  ? 381  HIS A CE1 1 
ATOM   2886 N NE2 A HIS A 1 380 ? 47.473  26.533 0.506   0.59 41.49  ? 381  HIS A NE2 1 
ATOM   2887 N NE2 B HIS A 1 380 ? 42.576  26.099 -0.908  0.41 45.88  ? 381  HIS A NE2 1 
ATOM   2888 N N   . TYR A 1 381 ? 47.043  21.099 0.324   1.00 26.02  ? 382  TYR A N   1 
ATOM   2889 C CA  . TYR A 1 381 ? 48.370  20.612 0.669   1.00 25.36  ? 382  TYR A CA  1 
ATOM   2890 C C   . TYR A 1 381 ? 48.801  19.394 -0.133  1.00 27.93  ? 382  TYR A C   1 
ATOM   2891 O O   . TYR A 1 381 ? 49.887  18.866 0.109   1.00 34.52  ? 382  TYR A O   1 
ATOM   2892 C CB  . TYR A 1 381 ? 48.445  20.319 2.172   1.00 19.97  ? 382  TYR A CB  1 
ATOM   2893 C CG  . TYR A 1 381 ? 48.491  21.589 2.979   1.00 24.62  ? 382  TYR A CG  1 
ATOM   2894 C CD1 . TYR A 1 381 ? 49.708  22.144 3.369   1.00 20.54  ? 382  TYR A CD1 1 
ATOM   2895 C CD2 . TYR A 1 381 ? 47.319  22.253 3.331   1.00 26.27  ? 382  TYR A CD2 1 
ATOM   2896 C CE1 . TYR A 1 381 ? 49.756  23.321 4.103   1.00 21.26  ? 382  TYR A CE1 1 
ATOM   2897 C CE2 . TYR A 1 381 ? 47.357  23.429 4.065   1.00 24.23  ? 382  TYR A CE2 1 
ATOM   2898 C CZ  . TYR A 1 381 ? 48.579  23.954 4.448   1.00 24.80  ? 382  TYR A CZ  1 
ATOM   2899 O OH  . TYR A 1 381 ? 48.619  25.119 5.171   1.00 24.93  ? 382  TYR A OH  1 
ATOM   2900 N N   . THR A 1 382 ? 47.996  18.946 -1.087  1.00 27.64  ? 383  THR A N   1 
ATOM   2901 C CA  . THR A 1 382 ? 48.416  17.904 -2.011  1.00 27.43  ? 383  THR A CA  1 
ATOM   2902 C C   . THR A 1 382 ? 49.032  18.543 -3.249  1.00 31.05  ? 383  THR A C   1 
ATOM   2903 O O   . THR A 1 382 ? 48.475  19.494 -3.807  1.00 30.25  ? 383  THR A O   1 
ATOM   2904 C CB  . THR A 1 382 ? 47.228  17.022 -2.405  1.00 30.35  ? 383  THR A CB  1 
ATOM   2905 O OG1 . THR A 1 382 ? 46.791  16.267 -1.266  1.00 27.08  ? 383  THR A OG1 1 
ATOM   2906 C CG2 . THR A 1 382 ? 47.605  16.071 -3.546  1.00 23.83  ? 383  THR A CG2 1 
ATOM   2907 N N   . ASP A 1 383 ? 50.191  18.038 -3.662  1.00 29.44  ? 384  ASP A N   1 
ATOM   2908 C CA  . ASP A 1 383 ? 50.731  18.342 -4.982  1.00 29.22  ? 384  ASP A CA  1 
ATOM   2909 C C   . ASP A 1 383 ? 50.134  17.332 -5.950  1.00 27.83  ? 384  ASP A C   1 
ATOM   2910 O O   . ASP A 1 383 ? 50.524  16.162 -5.949  1.00 30.83  ? 384  ASP A O   1 
ATOM   2911 C CB  . ASP A 1 383 ? 52.256  18.278 -4.990  1.00 34.65  ? 384  ASP A CB  1 
ATOM   2912 C CG  . ASP A 1 383 ? 52.860  18.687 -6.333  1.00 37.09  ? 384  ASP A CG  1 
ATOM   2913 O OD1 . ASP A 1 383 ? 52.181  18.581 -7.383  1.00 40.11  ? 384  ASP A OD1 1 
ATOM   2914 O OD2 . ASP A 1 383 ? 54.031  19.118 -6.336  1.00 42.47  ? 384  ASP A OD2 1 
ATOM   2915 N N   . TRP A 1 384 ? 49.202  17.780 -6.786  1.00 29.54  ? 385  TRP A N   1 
ATOM   2916 C CA  . TRP A 1 384 ? 48.477  16.836 -7.626  1.00 28.57  ? 385  TRP A CA  1 
ATOM   2917 C C   . TRP A 1 384 ? 49.300  16.324 -8.804  1.00 32.59  ? 385  TRP A C   1 
ATOM   2918 O O   . TRP A 1 384 ? 48.819  15.456 -9.540  1.00 33.03  ? 385  TRP A O   1 
ATOM   2919 C CB  . TRP A 1 384 ? 47.161  17.470 -8.079  1.00 29.82  ? 385  TRP A CB  1 
ATOM   2920 C CG  . TRP A 1 384 ? 46.295  17.718 -6.872  1.00 28.57  ? 385  TRP A CG  1 
ATOM   2921 C CD1 . TRP A 1 384 ? 46.163  18.887 -6.173  1.00 26.03  ? 385  TRP A CD1 1 
ATOM   2922 C CD2 . TRP A 1 384 ? 45.500  16.748 -6.183  1.00 25.52  ? 385  TRP A CD2 1 
ATOM   2923 N NE1 . TRP A 1 384 ? 45.311  18.707 -5.105  1.00 27.06  ? 385  TRP A NE1 1 
ATOM   2924 C CE2 . TRP A 1 384 ? 44.889  17.403 -5.093  1.00 26.87  ? 385  TRP A CE2 1 
ATOM   2925 C CE3 . TRP A 1 384 ? 45.230  15.390 -6.394  1.00 32.27  ? 385  TRP A CE3 1 
ATOM   2926 C CZ2 . TRP A 1 384 ? 44.035  16.743 -4.210  1.00 29.37  ? 385  TRP A CZ2 1 
ATOM   2927 C CZ3 . TRP A 1 384 ? 44.381  14.738 -5.519  1.00 30.06  ? 385  TRP A CZ3 1 
ATOM   2928 C CH2 . TRP A 1 384 ? 43.796  15.416 -4.437  1.00 28.97  ? 385  TRP A CH2 1 
ATOM   2929 N N   . LEU A 1 385 ? 50.532  16.800 -8.978  1.00 33.04  ? 386  LEU A N   1 
ATOM   2930 C CA  . LEU A 1 385 ? 51.483  16.132 -9.857  1.00 37.54  ? 386  LEU A CA  1 
ATOM   2931 C C   . LEU A 1 385 ? 52.309  15.078 -9.136  1.00 38.32  ? 386  LEU A C   1 
ATOM   2932 O O   . LEU A 1 385 ? 52.910  14.221 -9.795  1.00 39.45  ? 386  LEU A O   1 
ATOM   2933 C CB  . LEU A 1 385 ? 52.425  17.148 -10.510 1.00 40.23  ? 386  LEU A CB  1 
ATOM   2934 C CG  . LEU A 1 385 ? 51.812  18.035 -11.596 1.00 46.73  ? 386  LEU A CG  1 
ATOM   2935 C CD1 . LEU A 1 385 ? 52.880  18.912 -12.236 1.00 53.23  ? 386  LEU A CD1 1 
ATOM   2936 C CD2 . LEU A 1 385 ? 51.102  17.195 -12.648 1.00 43.95  ? 386  LEU A CD2 1 
ATOM   2937 N N   . HIS A 1 386 ? 52.348  15.111 -7.801  1.00 28.75  ? 387  HIS A N   1 
ATOM   2938 C CA  . HIS A 1 386 ? 53.031  14.089 -7.008  1.00 35.14  ? 387  HIS A CA  1 
ATOM   2939 C C   . HIS A 1 386 ? 52.158  13.687 -5.822  1.00 38.51  ? 387  HIS A C   1 
ATOM   2940 O O   . HIS A 1 386 ? 52.533  13.876 -4.664  1.00 26.61  ? 387  HIS A O   1 
ATOM   2941 C CB  . HIS A 1 386 ? 54.400  14.610 -6.557  1.00 30.32  ? 387  HIS A CB  1 
ATOM   2942 C CG  . HIS A 1 386 ? 55.297  14.948 -7.706  1.00 37.25  ? 387  HIS A CG  1 
ATOM   2943 N ND1 . HIS A 1 386 ? 55.399  16.227 -8.225  1.00 41.71  ? 387  HIS A ND1 1 
ATOM   2944 C CD2 . HIS A 1 386 ? 56.083  14.161 -8.482  1.00 35.34  ? 387  HIS A CD2 1 
ATOM   2945 C CE1 . HIS A 1 386 ? 56.225  16.218 -9.261  1.00 38.23  ? 387  HIS A CE1 1 
ATOM   2946 N NE2 . HIS A 1 386 ? 56.656  14.977 -9.436  1.00 38.79  ? 387  HIS A NE2 1 
ATOM   2947 N N   . PRO A 1 387 ? 50.972  13.128 -6.076  1.00 38.40  ? 388  PRO A N   1 
ATOM   2948 C CA  . PRO A 1 387 ? 50.017  12.936 -4.955  1.00 29.86  ? 388  PRO A CA  1 
ATOM   2949 C C   . PRO A 1 387 ? 50.495  11.947 -3.898  1.00 34.29  ? 388  PRO A C   1 
ATOM   2950 O O   . PRO A 1 387 ? 50.012  12.008 -2.765  1.00 34.58  ? 388  PRO A O   1 
ATOM   2951 C CB  . PRO A 1 387 ? 48.738  12.392 -5.655  1.00 34.15  ? 388  PRO A CB  1 
ATOM   2952 C CG  . PRO A 1 387 ? 49.141  12.073 -7.086  1.00 28.57  ? 388  PRO A CG  1 
ATOM   2953 C CD  . PRO A 1 387 ? 50.341  12.892 -7.403  1.00 29.48  ? 388  PRO A CD  1 
ATOM   2954 N N   . GLU A 1 388 ? 51.444  11.059 -4.217  1.00 36.19  ? 389  GLU A N   1 
ATOM   2955 C CA  . GLU A 1 388 ? 51.783  9.951  -3.323  1.00 39.28  ? 389  GLU A CA  1 
ATOM   2956 C C   . GLU A 1 388 ? 53.260  9.916  -2.947  1.00 36.67  ? 389  GLU A C   1 
ATOM   2957 O O   . GLU A 1 388 ? 53.734  8.900  -2.424  1.00 44.01  ? 389  GLU A O   1 
ATOM   2958 C CB  . GLU A 1 388 ? 51.380  8.620  -3.972  1.00 40.99  ? 389  GLU A CB  1 
ATOM   2959 C CG  . GLU A 1 388 ? 49.949  8.609  -4.487  1.00 56.30  ? 389  GLU A CG  1 
ATOM   2960 C CD  . GLU A 1 388 ? 49.162  7.412  -3.996  1.00 70.02  ? 389  GLU A CD  1 
ATOM   2961 O OE1 . GLU A 1 388 ? 49.784  6.479  -3.446  1.00 78.58  ? 389  GLU A OE1 1 
ATOM   2962 O OE2 . GLU A 1 388 ? 47.922  7.401  -4.156  1.00 72.42  ? 389  GLU A OE2 1 
ATOM   2963 N N   . ASP A 1 389 ? 53.993  10.991 -3.188  1.00 34.81  ? 390  ASP A N   1 
ATOM   2964 C CA  . ASP A 1 389 ? 55.420  11.016 -2.894  1.00 34.36  ? 390  ASP A CA  1 
ATOM   2965 C C   . ASP A 1 389 ? 55.669  11.114 -1.391  1.00 33.35  ? 390  ASP A C   1 
ATOM   2966 O O   . ASP A 1 389 ? 55.313  12.128 -0.778  1.00 32.50  ? 390  ASP A O   1 
ATOM   2967 C CB  . ASP A 1 389 ? 56.080  12.185 -3.608  1.00 38.25  ? 390  ASP A CB  1 
ATOM   2968 C CG  . ASP A 1 389 ? 57.565  12.245 -3.348  1.00 48.14  ? 390  ASP A CG  1 
ATOM   2969 O OD1 . ASP A 1 389 ? 58.103  13.356 -3.167  1.00 49.95  ? 390  ASP A OD1 1 
ATOM   2970 O OD2 . ASP A 1 389 ? 58.196  11.171 -3.320  1.00 58.29  ? 390  ASP A OD2 1 
ATOM   2971 N N   . PRO A 1 390 ? 56.299  10.112 -0.770  1.00 33.77  ? 391  PRO A N   1 
ATOM   2972 C CA  . PRO A 1 390 ? 56.455  10.129 0.698   1.00 31.35  ? 391  PRO A CA  1 
ATOM   2973 C C   . PRO A 1 390 ? 57.114  11.378 1.268   1.00 33.50  ? 391  PRO A C   1 
ATOM   2974 O O   . PRO A 1 390 ? 56.613  11.942 2.250   1.00 33.17  ? 391  PRO A O   1 
ATOM   2975 C CB  . PRO A 1 390 ? 57.300  8.876  0.957   1.00 30.10  ? 391  PRO A CB  1 
ATOM   2976 C CG  . PRO A 1 390 ? 56.950  7.955  -0.183  1.00 35.49  ? 391  PRO A CG  1 
ATOM   2977 C CD  . PRO A 1 390 ? 56.764  8.847  -1.371  1.00 32.26  ? 391  PRO A CD  1 
ATOM   2978 N N   . ALA A 1 391 ? 58.232  11.823 0.689   1.00 34.48  ? 392  ALA A N   1 
ATOM   2979 C CA  . ALA A 1 391 ? 58.930  12.985 1.231   1.00 33.09  ? 392  ALA A CA  1 
ATOM   2980 C C   . ALA A 1 391 ? 58.066  14.238 1.154   1.00 29.15  ? 392  ALA A C   1 
ATOM   2981 O O   . ALA A 1 391 ? 58.023  15.031 2.103   1.00 30.31  ? 392  ALA A O   1 
ATOM   2982 C CB  . ALA A 1 391 ? 60.252  13.197 0.493   1.00 35.07  ? 392  ALA A CB  1 
ATOM   2983 N N   . ARG A 1 392 ? 57.367  14.431 0.035   1.00 26.90  ? 393  ARG A N   1 
ATOM   2984 C CA  . ARG A 1 392 ? 56.474  15.580 -0.094  1.00 29.86  ? 393  ARG A CA  1 
ATOM   2985 C C   . ARG A 1 392 ? 55.302  15.484 0.871   1.00 30.71  ? 393  ARG A C   1 
ATOM   2986 O O   . ARG A 1 392 ? 54.853  16.500 1.412   1.00 31.16  ? 393  ARG A O   1 
ATOM   2987 C CB  . ARG A 1 392 ? 55.958  15.695 -1.525  1.00 30.80  ? 393  ARG A CB  1 
ATOM   2988 C CG  . ARG A 1 392 ? 56.945  16.275 -2.513  1.00 31.60  ? 393  ARG A CG  1 
ATOM   2989 C CD  . ARG A 1 392 ? 56.336  16.222 -3.913  1.00 37.27  ? 393  ARG A CD  1 
ATOM   2990 N NE  . ARG A 1 392 ? 57.112  16.970 -4.896  1.00 44.29  ? 393  ARG A NE  1 
ATOM   2991 C CZ  . ARG A 1 392 ? 58.006  16.424 -5.713  1.00 52.52  ? 393  ARG A CZ  1 
ATOM   2992 N NH1 . ARG A 1 392 ? 58.241  15.119 -5.665  1.00 54.51  ? 393  ARG A NH1 1 
ATOM   2993 N NH2 . ARG A 1 392 ? 58.659  17.182 -6.582  1.00 55.13  ? 393  ARG A NH2 1 
ATOM   2994 N N   . LEU A 1 393 ? 54.778  14.274 1.082   1.00 29.45  ? 394  LEU A N   1 
ATOM   2995 C CA  . LEU A 1 393 ? 53.683  14.104 2.029   1.00 32.41  ? 394  LEU A CA  1 
ATOM   2996 C C   . LEU A 1 393 ? 54.134  14.395 3.456   1.00 30.27  ? 394  LEU A C   1 
ATOM   2997 O O   . LEU A 1 393 ? 53.397  15.011 4.235   1.00 25.19  ? 394  LEU A O   1 
ATOM   2998 C CB  . LEU A 1 393 ? 53.116  12.694 1.916   1.00 33.81  ? 394  LEU A CB  1 
ATOM   2999 C CG  . LEU A 1 393 ? 52.345  12.439 0.622   1.00 29.64  ? 394  LEU A CG  1 
ATOM   3000 C CD1 . LEU A 1 393 ? 52.068  10.949 0.455   1.00 26.22  ? 394  LEU A CD1 1 
ATOM   3001 C CD2 . LEU A 1 393 ? 51.058  13.279 0.604   1.00 23.65  ? 394  LEU A CD2 1 
ATOM   3002 N N   . ARG A 1 394 ? 55.345  13.963 3.814   1.00 32.87  ? 395  ARG A N   1 
ATOM   3003 C CA  . ARG A 1 394 ? 55.881  14.267 5.139   1.00 28.86  ? 395  ARG A CA  1 
ATOM   3004 C C   . ARG A 1 394 ? 56.019  15.772 5.330   1.00 31.84  ? 395  ARG A C   1 
ATOM   3005 O O   . ARG A 1 394 ? 55.620  16.319 6.364   1.00 30.22  ? 395  ARG A O   1 
ATOM   3006 C CB  . ARG A 1 394 ? 57.231  13.569 5.329   1.00 28.62  ? 395  ARG A CB  1 
ATOM   3007 C CG  . ARG A 1 394 ? 57.892  13.810 6.688   1.00 29.36  ? 395  ARG A CG  1 
ATOM   3008 C CD  . ARG A 1 394 ? 59.345  13.344 6.671   1.00 30.22  ? 395  ARG A CD  1 
ATOM   3009 N NE  . ARG A 1 394 ? 60.122  14.102 5.697   1.00 34.36  ? 395  ARG A NE  1 
ATOM   3010 C CZ  . ARG A 1 394 ? 61.272  13.698 5.168   1.00 39.42  ? 395  ARG A CZ  1 
ATOM   3011 N NH1 . ARG A 1 394 ? 61.791  12.525 5.502   1.00 37.17  ? 395  ARG A NH1 1 
ATOM   3012 N NH2 . ARG A 1 394 ? 61.898  14.466 4.289   1.00 36.44  ? 395  ARG A NH2 1 
ATOM   3013 N N   . GLU A 1 395 ? 56.573  16.460 4.329   1.00 31.93  ? 396  GLU A N   1 
ATOM   3014 C CA  . GLU A 1 395 ? 56.713  17.909 4.416   1.00 31.41  ? 396  GLU A CA  1 
ATOM   3015 C C   . GLU A 1 395 ? 55.352  18.597 4.437   1.00 28.22  ? 396  GLU A C   1 
ATOM   3016 O O   . GLU A 1 395 ? 55.161  19.582 5.158   1.00 27.36  ? 396  GLU A O   1 
ATOM   3017 C CB  . GLU A 1 395 ? 57.569  18.431 3.257   1.00 27.55  ? 396  GLU A CB  1 
ATOM   3018 C CG  . GLU A 1 395 ? 59.088  18.475 3.522   1.00 49.00  ? 396  GLU A CG  1 
ATOM   3019 C CD  . GLU A 1 395 ? 59.722  17.111 3.787   1.00 65.01  ? 396  GLU A CD  1 
ATOM   3020 O OE1 . GLU A 1 395 ? 59.687  16.649 4.949   1.00 69.15  ? 396  GLU A OE1 1 
ATOM   3021 O OE2 . GLU A 1 395 ? 60.278  16.512 2.838   1.00 66.55  ? 396  GLU A OE2 1 
ATOM   3022 N N   . ALA A 1 396 ? 54.386  18.080 3.671   1.00 24.48  ? 397  ALA A N   1 
ATOM   3023 C CA  . ALA A 1 396 ? 53.068  18.709 3.616   1.00 26.27  ? 397  ALA A CA  1 
ATOM   3024 C C   . ALA A 1 396 ? 52.339  18.609 4.953   1.00 27.78  ? 397  ALA A C   1 
ATOM   3025 O O   . ALA A 1 396 ? 51.729  19.585 5.405   1.00 27.14  ? 397  ALA A O   1 
ATOM   3026 C CB  . ALA A 1 396 ? 52.226  18.083 2.497   1.00 21.30  ? 397  ALA A CB  1 
ATOM   3027 N N   . LEU A 1 397 ? 52.377  17.442 5.602   1.00 26.39  ? 398  LEU A N   1 
ATOM   3028 C CA  . LEU A 1 397 ? 51.694  17.321 6.889   1.00 26.76  ? 398  LEU A CA  1 
ATOM   3029 C C   . LEU A 1 397 ? 52.339  18.228 7.928   1.00 28.58  ? 398  LEU A C   1 
ATOM   3030 O O   . LEU A 1 397 ? 51.644  18.845 8.746   1.00 26.11  ? 398  LEU A O   1 
ATOM   3031 C CB  . LEU A 1 397 ? 51.688  15.870 7.373   1.00 24.48  ? 398  LEU A CB  1 
ATOM   3032 C CG  . LEU A 1 397 ? 50.686  15.676 8.517   1.00 30.42  ? 398  LEU A CG  1 
ATOM   3033 C CD1 . LEU A 1 397 ? 49.278  16.047 8.052   1.00 26.66  ? 398  LEU A CD1 1 
ATOM   3034 C CD2 . LEU A 1 397 ? 50.715  14.263 9.063   1.00 31.67  ? 398  LEU A CD2 1 
ATOM   3035 N N   . SER A 1 398 ? 53.670  18.333 7.898   1.00 25.43  ? 399  SER A N   1 
ATOM   3036 C CA  . SER A 1 398 ? 54.360  19.291 8.753   1.00 28.73  ? 399  SER A CA  1 
ATOM   3037 C C   . SER A 1 398 ? 53.838  20.705 8.515   1.00 28.34  ? 399  SER A C   1 
ATOM   3038 O O   . SER A 1 398 ? 53.569  21.449 9.466   1.00 27.81  ? 399  SER A O   1 
ATOM   3039 C CB  . SER A 1 398 ? 55.868  19.211 8.505   1.00 22.65  ? 399  SER A CB  1 
ATOM   3040 O OG  . SER A 1 398 ? 56.581  20.027 9.416   1.00 31.47  ? 399  SER A OG  1 
ATOM   3041 N N   . ASP A 1 399 ? 53.673  21.085 7.242   1.00 24.05  ? 400  ASP A N   1 
ATOM   3042 C CA  . ASP A 1 399 ? 53.126  22.398 6.912   1.00 24.94  ? 400  ASP A CA  1 
ATOM   3043 C C   . ASP A 1 399 ? 51.698  22.556 7.421   1.00 24.01  ? 400  ASP A C   1 
ATOM   3044 O O   . ASP A 1 399 ? 51.333  23.620 7.930   1.00 24.57  ? 400  ASP A O   1 
ATOM   3045 C CB  . ASP A 1 399 ? 53.162  22.623 5.398   1.00 28.79  ? 400  ASP A CB  1 
ATOM   3046 C CG  . ASP A 1 399 ? 54.560  22.876 4.879   1.00 38.37  ? 400  ASP A CG  1 
ATOM   3047 O OD1 . ASP A 1 399 ? 55.399  23.385 5.651   1.00 41.99  ? 400  ASP A OD1 1 
ATOM   3048 O OD2 . ASP A 1 399 ? 54.817  22.572 3.697   1.00 46.10  ? 400  ASP A OD2 1 
ATOM   3049 N N   . VAL A 1 400 ? 50.867  21.522 7.257   1.00 23.70  ? 401  VAL A N   1 
ATOM   3050 C CA  . VAL A 1 400 ? 49.492  21.569 7.758   1.00 24.11  ? 401  VAL A CA  1 
ATOM   3051 C C   . VAL A 1 400 ? 49.479  21.929 9.236   1.00 23.04  ? 401  VAL A C   1 
ATOM   3052 O O   . VAL A 1 400 ? 48.810  22.879 9.666   1.00 21.98  ? 401  VAL A O   1 
ATOM   3053 C CB  . VAL A 1 400 ? 48.787  20.221 7.521   1.00 23.24  ? 401  VAL A CB  1 
ATOM   3054 C CG1 . VAL A 1 400 ? 47.510  20.143 8.351   1.00 20.91  ? 401  VAL A CG1 1 
ATOM   3055 C CG2 . VAL A 1 400 ? 48.490  20.018 6.034   1.00 22.57  ? 401  VAL A CG2 1 
ATOM   3056 N N   . VAL A 1 401 ? 50.225  21.169 10.034  1.00 26.12  ? 402  VAL A N   1 
ATOM   3057 C CA  . VAL A 1 401 ? 50.187  21.347 11.479  1.00 24.27  ? 402  VAL A CA  1 
ATOM   3058 C C   . VAL A 1 401 ? 50.822  22.673 11.870  1.00 25.08  ? 402  VAL A C   1 
ATOM   3059 O O   . VAL A 1 401 ? 50.315  23.379 12.749  1.00 24.78  ? 402  VAL A O   1 
ATOM   3060 C CB  . VAL A 1 401 ? 50.862  20.148 12.167  1.00 24.52  ? 402  VAL A CB  1 
ATOM   3061 C CG1 . VAL A 1 401 ? 51.012  20.385 13.686  1.00 20.61  ? 402  VAL A CG1 1 
ATOM   3062 C CG2 . VAL A 1 401 ? 50.057  18.876 11.884  1.00 22.75  ? 402  VAL A CG2 1 
ATOM   3063 N N   . GLY A 1 402 ? 51.912  23.051 11.197  1.00 28.62  ? 403  GLY A N   1 
ATOM   3064 C CA  . GLY A 1 402 ? 52.564  24.314 11.508  1.00 24.74  ? 403  GLY A CA  1 
ATOM   3065 C C   . GLY A 1 402 ? 51.765  25.526 11.065  1.00 25.57  ? 403  GLY A C   1 
ATOM   3066 O O   . GLY A 1 402 ? 51.639  26.498 11.815  1.00 26.48  ? 403  GLY A O   1 
ATOM   3067 N N   . ASP A 1 403 ? 51.227  25.497 9.837   1.00 19.00  ? 404  ASP A N   1 
ATOM   3068 C CA  . ASP A 1 403 ? 50.426  26.621 9.348   1.00 23.82  ? 404  ASP A CA  1 
ATOM   3069 C C   . ASP A 1 403 ? 49.185  26.825 10.207  1.00 20.71  ? 404  ASP A C   1 
ATOM   3070 O O   . ASP A 1 403 ? 48.881  27.946 10.630  1.00 24.56  ? 404  ASP A O   1 
ATOM   3071 C CB  . ASP A 1 403 ? 50.005  26.398 7.888   1.00 24.53  ? 404  ASP A CB  1 
ATOM   3072 C CG  . ASP A 1 403 ? 51.180  26.375 6.929   1.00 29.65  ? 404  ASP A CG  1 
ATOM   3073 O OD1 . ASP A 1 403 ? 52.289  26.791 7.330   1.00 31.64  ? 404  ASP A OD1 1 
ATOM   3074 O OD2 . ASP A 1 403 ? 50.989  25.939 5.772   1.00 27.95  ? 404  ASP A OD2 1 
ATOM   3075 N N   . HIS A 1 404 ? 48.448  25.742 10.455  1.00 22.90  ? 405  HIS A N   1 
ATOM   3076 C CA  . HIS A 1 404 ? 47.179  25.819 11.172  1.00 22.53  ? 405  HIS A CA  1 
ATOM   3077 C C   . HIS A 1 404 ? 47.379  26.306 12.606  1.00 24.41  ? 405  HIS A C   1 
ATOM   3078 O O   . HIS A 1 404 ? 46.625  27.155 13.096  1.00 19.45  ? 405  HIS A O   1 
ATOM   3079 C CB  . HIS A 1 404 ? 46.518  24.438 11.125  1.00 26.21  ? 405  HIS A CB  1 
ATOM   3080 C CG  . HIS A 1 404 ? 45.306  24.283 11.991  1.00 28.65  ? 405  HIS A CG  1 
ATOM   3081 N ND1 . HIS A 1 404 ? 44.196  25.093 11.883  1.00 28.17  ? 405  HIS A ND1 1 
ATOM   3082 C CD2 . HIS A 1 404 ? 45.014  23.372 12.951  1.00 26.82  ? 405  HIS A CD2 1 
ATOM   3083 C CE1 . HIS A 1 404 ? 43.279  24.699 12.749  1.00 23.60  ? 405  HIS A CE1 1 
ATOM   3084 N NE2 . HIS A 1 404 ? 43.753  23.661 13.414  1.00 27.70  ? 405  HIS A NE2 1 
ATOM   3085 N N   . ASN A 1 405 ? 48.412  25.816 13.282  1.00 21.66  ? 406  ASN A N   1 
ATOM   3086 C CA  . ASN A 1 405 ? 48.539  26.103 14.705  1.00 20.22  ? 406  ASN A CA  1 
ATOM   3087 C C   . ASN A 1 405 ? 49.423  27.307 15.014  1.00 23.21  ? 406  ASN A C   1 
ATOM   3088 O O   . ASN A 1 405 ? 49.226  27.950 16.051  1.00 26.40  ? 406  ASN A O   1 
ATOM   3089 C CB  . ASN A 1 405 ? 49.060  24.862 15.438  1.00 21.46  ? 406  ASN A CB  1 
ATOM   3090 C CG  . ASN A 1 405 ? 48.036  23.737 15.467  1.00 21.80  ? 406  ASN A CG  1 
ATOM   3091 O OD1 . ASN A 1 405 ? 47.016  23.839 16.144  1.00 23.70  ? 406  ASN A OD1 1 
ATOM   3092 N ND2 . ASN A 1 405 ? 48.302  22.661 14.728  1.00 22.17  ? 406  ASN A ND2 1 
ATOM   3093 N N   . VAL A 1 406 ? 50.378  27.652 14.146  1.00 22.29  ? 407  VAL A N   1 
ATOM   3094 C CA  . VAL A 1 406 ? 51.346  28.689 14.498  1.00 25.02  ? 407  VAL A CA  1 
ATOM   3095 C C   . VAL A 1 406 ? 51.466  29.787 13.441  1.00 25.47  ? 407  VAL A C   1 
ATOM   3096 O O   . VAL A 1 406 ? 51.210  30.961 13.730  1.00 27.31  ? 407  VAL A O   1 
ATOM   3097 C CB  . VAL A 1 406 ? 52.727  28.070 14.778  1.00 21.97  ? 407  VAL A CB  1 
ATOM   3098 C CG1 . VAL A 1 406 ? 53.715  29.168 15.163  1.00 22.96  ? 407  VAL A CG1 1 
ATOM   3099 C CG2 . VAL A 1 406 ? 52.631  27.045 15.890  1.00 20.07  ? 407  VAL A CG2 1 
ATOM   3100 N N   . VAL A 1 407 ? 51.878  29.429 12.220  1.00 21.87  ? 408  VAL A N   1 
ATOM   3101 C CA  . VAL A 1 407 ? 52.258  30.453 11.243  1.00 23.23  ? 408  VAL A CA  1 
ATOM   3102 C C   . VAL A 1 407 ? 51.069  31.338 10.882  1.00 23.31  ? 408  VAL A C   1 
ATOM   3103 O O   . VAL A 1 407 ? 51.187  32.568 10.825  1.00 25.26  ? 408  VAL A O   1 
ATOM   3104 C CB  . VAL A 1 407 ? 52.875  29.810 9.987   1.00 25.45  ? 408  VAL A CB  1 
ATOM   3105 C CG1 . VAL A 1 407 ? 53.312  30.903 8.975   1.00 18.97  ? 408  VAL A CG1 1 
ATOM   3106 C CG2 . VAL A 1 407 ? 54.030  28.900 10.363  1.00 22.99  ? 408  VAL A CG2 1 
ATOM   3107 N N   . CYS A 1 408 ? 49.915  30.738 10.637  1.00 20.34  ? 409  CYS A N   1 
ATOM   3108 C CA  . CYS A 1 408 ? 48.792  31.539 10.160  1.00 19.40  ? 409  CYS A CA  1 
ATOM   3109 C C   . CYS A 1 408 ? 48.116  32.326 11.285  1.00 24.32  ? 409  CYS A C   1 
ATOM   3110 O O   . CYS A 1 408 ? 47.710  33.471 11.050  1.00 27.60  ? 409  CYS A O   1 
ATOM   3111 C CB  . CYS A 1 408 ? 47.804  30.645 9.409   1.00 23.85  ? 409  CYS A CB  1 
ATOM   3112 S SG  . CYS A 1 408 ? 48.559  29.944 7.885   1.00 26.71  ? 409  CYS A SG  1 
ATOM   3113 N N   . PRO A 1 409 ? 47.992  31.797 12.515  1.00 22.88  ? 410  PRO A N   1 
ATOM   3114 C CA  . PRO A 1 409 ? 47.576  32.683 13.620  1.00 20.63  ? 410  PRO A CA  1 
ATOM   3115 C C   . PRO A 1 409 ? 48.518  33.857 13.843  1.00 20.62  ? 410  PRO A C   1 
ATOM   3116 O O   . PRO A 1 409 ? 48.051  34.982 14.064  1.00 23.32  ? 410  PRO A O   1 
ATOM   3117 C CB  . PRO A 1 409 ? 47.540  31.742 14.832  1.00 20.06  ? 410  PRO A CB  1 
ATOM   3118 C CG  . PRO A 1 409 ? 47.226  30.412 14.244  1.00 21.42  ? 410  PRO A CG  1 
ATOM   3119 C CD  . PRO A 1 409 ? 47.962  30.378 12.925  1.00 19.21  ? 410  PRO A CD  1 
ATOM   3120 N N   . VAL A 1 410 ? 49.834  33.629 13.788  1.00 16.57  ? 411  VAL A N   1 
ATOM   3121 C CA  . VAL A 1 410 ? 50.792  34.721 13.944  1.00 25.43  ? 411  VAL A CA  1 
ATOM   3122 C C   . VAL A 1 410 ? 50.654  35.732 12.806  1.00 30.75  ? 411  VAL A C   1 
ATOM   3123 O O   . VAL A 1 410 ? 50.717  36.948 13.027  1.00 30.99  ? 411  VAL A O   1 
ATOM   3124 C CB  . VAL A 1 410 ? 52.225  34.160 14.035  1.00 23.56  ? 411  VAL A CB  1 
ATOM   3125 C CG1 . VAL A 1 410 ? 53.258  35.268 13.808  1.00 22.05  ? 411  VAL A CG1 1 
ATOM   3126 C CG2 . VAL A 1 410 ? 52.451  33.488 15.386  1.00 20.32  ? 411  VAL A CG2 1 
ATOM   3127 N N   . ALA A 1 411 ? 50.463  35.250 11.573  1.00 25.50  ? 412  ALA A N   1 
ATOM   3128 C CA  . ALA A 1 411 ? 50.363  36.164 10.435  1.00 26.77  ? 412  ALA A CA  1 
ATOM   3129 C C   . ALA A 1 411 ? 49.092  37.003 10.505  1.00 27.95  ? 412  ALA A C   1 
ATOM   3130 O O   . ALA A 1 411 ? 49.114  38.203 10.202  1.00 25.96  ? 412  ALA A O   1 
ATOM   3131 C CB  . ALA A 1 411 ? 50.417  35.381 9.119   1.00 27.18  ? 412  ALA A CB  1 
ATOM   3132 N N   . GLN A 1 412 ? 47.973  36.387 10.894  1.00 23.80  ? 413  GLN A N   1 
ATOM   3133 C CA  . GLN A 1 412 ? 46.741  37.145 11.075  1.00 24.34  ? 413  GLN A CA  1 
ATOM   3134 C C   . GLN A 1 412 ? 46.911  38.216 12.139  1.00 28.69  ? 413  GLN A C   1 
ATOM   3135 O O   . GLN A 1 412 ? 46.473  39.358 11.959  1.00 27.60  ? 413  GLN A O   1 
ATOM   3136 C CB  . GLN A 1 412 ? 45.597  36.208 11.456  1.00 23.22  ? 413  GLN A CB  1 
ATOM   3137 C CG  . GLN A 1 412 ? 44.307  36.930 11.796  1.00 28.70  ? 413  GLN A CG  1 
ATOM   3138 C CD  . GLN A 1 412 ? 43.169  35.971 12.054  1.00 50.72  ? 413  GLN A CD  1 
ATOM   3139 O OE1 . GLN A 1 412 ? 43.106  35.331 13.107  1.00 60.72  ? 413  GLN A OE1 1 
ATOM   3140 N NE2 . GLN A 1 412 ? 42.265  35.856 11.091  1.00 55.52  ? 413  GLN A NE2 1 
ATOM   3141 N N   . LEU A 1 413 ? 47.532  37.859 13.264  1.00 27.72  ? 414  LEU A N   1 
ATOM   3142 C CA  . LEU A 1 413 ? 47.769  38.834 14.322  1.00 27.89  ? 414  LEU A CA  1 
ATOM   3143 C C   . LEU A 1 413 ? 48.650  39.975 13.828  1.00 25.28  ? 414  LEU A C   1 
ATOM   3144 O O   . LEU A 1 413 ? 48.340  41.152 14.040  1.00 25.73  ? 414  LEU A O   1 
ATOM   3145 C CB  . LEU A 1 413 ? 48.405  38.145 15.528  1.00 22.22  ? 414  LEU A CB  1 
ATOM   3146 C CG  . LEU A 1 413 ? 48.835  39.083 16.657  1.00 32.59  ? 414  LEU A CG  1 
ATOM   3147 C CD1 . LEU A 1 413 ? 48.282  38.601 17.979  1.00 32.92  ? 414  LEU A CD1 1 
ATOM   3148 C CD2 . LEU A 1 413 ? 50.352  39.164 16.714  1.00 37.83  ? 414  LEU A CD2 1 
ATOM   3149 N N   . ALA A 1 414 ? 49.757  39.641 13.162  1.00 25.55  ? 415  ALA A N   1 
ATOM   3150 C CA  . ALA A 1 414 ? 50.682  40.665 12.684  1.00 27.45  ? 415  ALA A CA  1 
ATOM   3151 C C   . ALA A 1 414 ? 50.022  41.577 11.660  1.00 28.92  ? 415  ALA A C   1 
ATOM   3152 O O   . ALA A 1 414 ? 50.196  42.801 11.701  1.00 30.52  ? 415  ALA A O   1 
ATOM   3153 C CB  . ALA A 1 414 ? 51.921  40.002 12.080  1.00 24.38  ? 415  ALA A CB  1 
ATOM   3154 N N   . GLY A 1 415 ? 49.261  41.001 10.731  1.00 27.70  ? 416  GLY A N   1 
ATOM   3155 C CA  . GLY A 1 415 ? 48.643  41.812 9.696   1.00 30.58  ? 416  GLY A CA  1 
ATOM   3156 C C   . GLY A 1 415 ? 47.570  42.732 10.239  1.00 30.18  ? 416  GLY A C   1 
ATOM   3157 O O   . GLY A 1 415 ? 47.466  43.890 9.829   1.00 32.14  ? 416  GLY A O   1 
ATOM   3158 N N   . ARG A 1 416 ? 46.775  42.245 11.189  1.00 29.36  ? 417  ARG A N   1 
ATOM   3159 C CA  . ARG A 1 416 ? 45.699  43.072 11.724  1.00 33.11  ? 417  ARG A CA  1 
ATOM   3160 C C   . ARG A 1 416 ? 46.228  44.139 12.675  1.00 34.60  ? 417  ARG A C   1 
ATOM   3161 O O   . ARG A 1 416 ? 45.726  45.270 12.686  1.00 37.68  ? 417  ARG A O   1 
ATOM   3162 C CB  . ARG A 1 416 ? 44.670  42.185 12.397  1.00 33.67  ? 417  ARG A CB  1 
ATOM   3163 C CG  . ARG A 1 416 ? 43.976  41.343 11.373  1.00 43.89  ? 417  ARG A CG  1 
ATOM   3164 C CD  . ARG A 1 416 ? 43.139  42.243 10.447  1.00 50.79  ? 417  ARG A CD  1 
ATOM   3165 N NE  . ARG A 1 416 ? 41.943  42.702 11.135  1.00 59.05  ? 417  ARG A NE  1 
ATOM   3166 C CZ  . ARG A 1 416 ? 40.751  42.837 10.546  1.00 64.41  ? 417  ARG A CZ  1 
ATOM   3167 N NH1 . ARG A 1 416 ? 40.600  42.551 9.270   1.00 73.68  ? 417  ARG A NH1 1 
ATOM   3168 N NH2 . ARG A 1 416 ? 39.706  43.243 11.247  1.00 63.36  ? 417  ARG A NH2 1 
ATOM   3169 N N   . LEU A 1 417 ? 47.250  43.812 13.471  1.00 32.66  ? 418  LEU A N   1 
ATOM   3170 C CA  . LEU A 1 417 ? 47.850  44.827 14.333  1.00 33.18  ? 418  LEU A CA  1 
ATOM   3171 C C   . LEU A 1 417 ? 48.519  45.921 13.503  1.00 33.57  ? 418  LEU A C   1 
ATOM   3172 O O   . LEU A 1 417 ? 48.368  47.112 13.792  1.00 36.40  ? 418  LEU A O   1 
ATOM   3173 C CB  . LEU A 1 417 ? 48.849  44.207 15.316  1.00 33.02  ? 418  LEU A CB  1 
ATOM   3174 C CG  . LEU A 1 417 ? 48.379  43.177 16.359  1.00 38.04  ? 418  LEU A CG  1 
ATOM   3175 C CD1 . LEU A 1 417 ? 49.327  43.127 17.549  1.00 27.30  ? 418  LEU A CD1 1 
ATOM   3176 C CD2 . LEU A 1 417 ? 46.926  43.363 16.789  1.00 41.78  ? 418  LEU A CD2 1 
ATOM   3177 N N   . ALA A 1 418 ? 49.261  45.529 12.464  1.00 35.57  ? 419  ALA A N   1 
ATOM   3178 C CA  . ALA A 1 418 ? 49.920  46.517 11.610  1.00 37.08  ? 419  ALA A CA  1 
ATOM   3179 C C   . ALA A 1 418 ? 48.904  47.425 10.932  1.00 35.60  ? 419  ALA A C   1 
ATOM   3180 O O   . ALA A 1 418 ? 49.127  48.634 10.811  1.00 41.76  ? 419  ALA A O   1 
ATOM   3181 C CB  . ALA A 1 418 ? 50.789  45.816 10.564  1.00 35.02  ? 419  ALA A CB  1 
ATOM   3182 N N   . ALA A 1 419 ? 47.772  46.864 10.498  1.00 36.09  ? 420  ALA A N   1 
ATOM   3183 C CA  . ALA A 1 419 ? 46.746  47.662 9.838   1.00 33.15  ? 420  ALA A CA  1 
ATOM   3184 C C   . ALA A 1 419 ? 45.993  48.570 10.800  1.00 40.25  ? 420  ALA A C   1 
ATOM   3185 O O   . ALA A 1 419 ? 45.366  49.536 10.354  1.00 45.64  ? 420  ALA A O   1 
ATOM   3186 C CB  . ALA A 1 419 ? 45.758  46.752 9.111   1.00 29.02  ? 420  ALA A CB  1 
ATOM   3187 N N   . GLN A 1 420 ? 46.044  48.302 12.104  1.00 42.03  ? 421  GLN A N   1 
ATOM   3188 C CA  . GLN A 1 420 ? 45.256  49.050 13.076  1.00 38.18  ? 421  GLN A CA  1 
ATOM   3189 C C   . GLN A 1 420 ? 46.125  49.880 14.013  1.00 42.86  ? 421  GLN A C   1 
ATOM   3190 O O   . GLN A 1 420 ? 45.731  50.159 15.148  1.00 47.01  ? 421  GLN A O   1 
ATOM   3191 C CB  . GLN A 1 420 ? 44.352  48.105 13.863  1.00 38.45  ? 421  GLN A CB  1 
ATOM   3192 C CG  . GLN A 1 420 ? 43.249  47.495 13.001  1.00 39.21  ? 421  GLN A CG  1 
ATOM   3193 C CD  . GLN A 1 420 ? 42.724  46.188 13.558  1.00 42.40  ? 421  GLN A CD  1 
ATOM   3194 O OE1 . GLN A 1 420 ? 42.288  45.315 12.812  1.00 46.73  ? 421  GLN A OE1 1 
ATOM   3195 N NE2 . GLN A 1 420 ? 42.765  46.049 14.876  1.00 47.75  ? 421  GLN A NE2 1 
ATOM   3196 N N   . GLY A 1 421 ? 47.310  50.281 13.553  1.00 44.03  ? 422  GLY A N   1 
ATOM   3197 C CA  . GLY A 1 421 ? 48.083  51.308 14.224  1.00 45.53  ? 422  GLY A CA  1 
ATOM   3198 C C   . GLY A 1 421 ? 49.338  50.851 14.936  1.00 45.95  ? 422  GLY A C   1 
ATOM   3199 O O   . GLY A 1 421 ? 50.053  51.700 15.481  1.00 47.67  ? 422  GLY A O   1 
ATOM   3200 N N   . ALA A 1 422 ? 49.641  49.561 14.959  1.00 41.30  ? 423  ALA A N   1 
ATOM   3201 C CA  . ALA A 1 422 ? 50.836  49.095 15.644  1.00 43.65  ? 423  ALA A CA  1 
ATOM   3202 C C   . ALA A 1 422 ? 52.011  48.987 14.680  1.00 37.67  ? 423  ALA A C   1 
ATOM   3203 O O   . ALA A 1 422 ? 51.839  48.733 13.485  1.00 41.27  ? 423  ALA A O   1 
ATOM   3204 C CB  . ALA A 1 422 ? 50.587  47.738 16.310  1.00 40.96  ? 423  ALA A CB  1 
ATOM   3205 N N   . ARG A 1 423 ? 53.211  49.199 15.210  1.00 33.83  ? 424  ARG A N   1 
ATOM   3206 C CA  A ARG A 1 423 ? 54.438  48.965 14.460  0.54 39.35  ? 424  ARG A CA  1 
ATOM   3207 C CA  B ARG A 1 423 ? 54.441  48.969 14.464  0.46 39.47  ? 424  ARG A CA  1 
ATOM   3208 C C   . ARG A 1 423 ? 54.902  47.538 14.725  1.00 37.07  ? 424  ARG A C   1 
ATOM   3209 O O   . ARG A 1 423 ? 55.222  47.185 15.866  1.00 32.88  ? 424  ARG A O   1 
ATOM   3210 C CB  A ARG A 1 423 ? 55.523  49.969 14.847  0.54 45.38  ? 424  ARG A CB  1 
ATOM   3211 C CB  B ARG A 1 423 ? 55.511  49.981 14.873  0.46 45.36  ? 424  ARG A CB  1 
ATOM   3212 C CG  A ARG A 1 423 ? 56.891  49.626 14.279  0.54 50.43  ? 424  ARG A CG  1 
ATOM   3213 C CG  B ARG A 1 423 ? 56.751  49.981 13.995  0.46 50.96  ? 424  ARG A CG  1 
ATOM   3214 C CD  A ARG A 1 423 ? 57.681  50.868 13.902  0.54 54.76  ? 424  ARG A CD  1 
ATOM   3215 C CD  B ARG A 1 423 ? 57.408  51.357 13.963  0.46 54.93  ? 424  ARG A CD  1 
ATOM   3216 N NE  A ARG A 1 423 ? 57.144  51.525 12.715  0.54 52.85  ? 424  ARG A NE  1 
ATOM   3217 N NE  B ARG A 1 423 ? 57.632  51.899 15.302  0.46 54.86  ? 424  ARG A NE  1 
ATOM   3218 C CZ  A ARG A 1 423 ? 57.670  52.617 12.169  0.54 59.35  ? 424  ARG A CZ  1 
ATOM   3219 C CZ  B ARG A 1 423 ? 58.760  51.750 15.990  0.46 53.20  ? 424  ARG A CZ  1 
ATOM   3220 N NH1 A ARG A 1 423 ? 58.749  53.171 12.706  0.54 62.94  ? 424  ARG A NH1 1 
ATOM   3221 N NH1 B ARG A 1 423 ? 59.773  51.074 15.466  0.46 52.26  ? 424  ARG A NH1 1 
ATOM   3222 N NH2 A ARG A 1 423 ? 57.121  53.154 11.087  0.54 60.36  ? 424  ARG A NH2 1 
ATOM   3223 N NH2 B ARG A 1 423 ? 58.874  52.279 17.202  0.46 50.52  ? 424  ARG A NH2 1 
ATOM   3224 N N   . VAL A 1 424 ? 54.928  46.720 13.673  1.00 29.87  ? 425  VAL A N   1 
ATOM   3225 C CA  . VAL A 1 424 ? 55.174  45.286 13.776  1.00 31.28  ? 425  VAL A CA  1 
ATOM   3226 C C   . VAL A 1 424 ? 56.470  44.930 13.058  1.00 35.30  ? 425  VAL A C   1 
ATOM   3227 O O   . VAL A 1 424 ? 56.711  45.379 11.931  1.00 33.89  ? 425  VAL A O   1 
ATOM   3228 C CB  . VAL A 1 424 ? 54.003  44.472 13.180  1.00 29.62  ? 425  VAL A CB  1 
ATOM   3229 C CG1 . VAL A 1 424 ? 54.244  42.975 13.352  1.00 24.22  ? 425  VAL A CG1 1 
ATOM   3230 C CG2 . VAL A 1 424 ? 52.675  44.897 13.790  1.00 27.66  ? 425  VAL A CG2 1 
ATOM   3231 N N   . TYR A 1 425 ? 57.283  44.092 13.698  1.00 28.26  ? 426  TYR A N   1 
ATOM   3232 C CA  . TYR A 1 425 ? 58.450  43.484 13.075  1.00 28.90  ? 426  TYR A CA  1 
ATOM   3233 C C   . TYR A 1 425 ? 58.280  41.972 13.077  1.00 33.97  ? 426  TYR A C   1 
ATOM   3234 O O   . TYR A 1 425 ? 57.829  41.393 14.071  1.00 36.48  ? 426  TYR A O   1 
ATOM   3235 C CB  . TYR A 1 425 ? 59.733  43.882 13.803  1.00 25.55  ? 426  TYR A CB  1 
ATOM   3236 C CG  . TYR A 1 425 ? 59.997  45.360 13.734  1.00 31.52  ? 426  TYR A CG  1 
ATOM   3237 C CD1 . TYR A 1 425 ? 59.548  46.210 14.736  1.00 27.25  ? 426  TYR A CD1 1 
ATOM   3238 C CD2 . TYR A 1 425 ? 60.677  45.914 12.651  1.00 32.94  ? 426  TYR A CD2 1 
ATOM   3239 C CE1 . TYR A 1 425 ? 59.781  47.571 14.673  1.00 35.11  ? 426  TYR A CE1 1 
ATOM   3240 C CE2 . TYR A 1 425 ? 60.916  47.272 12.578  1.00 34.04  ? 426  TYR A CE2 1 
ATOM   3241 C CZ  . TYR A 1 425 ? 60.466  48.098 13.593  1.00 38.84  ? 426  TYR A CZ  1 
ATOM   3242 O OH  . TYR A 1 425 ? 60.696  49.456 13.529  1.00 36.27  ? 426  TYR A OH  1 
ATOM   3243 N N   . ALA A 1 426 ? 58.631  41.332 11.959  1.00 31.12  ? 427  ALA A N   1 
ATOM   3244 C CA  . ALA A 1 426 ? 58.402  39.905 11.778  1.00 25.44  ? 427  ALA A CA  1 
ATOM   3245 C C   . ALA A 1 426 ? 59.681  39.205 11.338  1.00 28.54  ? 427  ALA A C   1 
ATOM   3246 O O   . ALA A 1 426 ? 60.473  39.762 10.569  1.00 33.85  ? 427  ALA A O   1 
ATOM   3247 C CB  . ALA A 1 426 ? 57.287  39.651 10.750  1.00 23.20  ? 427  ALA A CB  1 
ATOM   3248 N N   . TYR A 1 427 ? 59.866  37.971 11.812  1.00 23.71  ? 428  TYR A N   1 
ATOM   3249 C CA  . TYR A 1 427 ? 61.033  37.174 11.459  1.00 25.56  ? 428  TYR A CA  1 
ATOM   3250 C C   . TYR A 1 427 ? 60.620  35.735 11.164  1.00 28.42  ? 428  TYR A C   1 
ATOM   3251 O O   . TYR A 1 427 ? 59.574  35.257 11.609  1.00 25.34  ? 428  TYR A O   1 
ATOM   3252 C CB  . TYR A 1 427 ? 62.092  37.186 12.580  1.00 19.15  ? 428  TYR A CB  1 
ATOM   3253 C CG  . TYR A 1 427 ? 61.647  36.472 13.848  1.00 24.74  ? 428  TYR A CG  1 
ATOM   3254 C CD1 . TYR A 1 427 ? 61.776  35.092 13.977  1.00 22.45  ? 428  TYR A CD1 1 
ATOM   3255 C CD2 . TYR A 1 427 ? 61.108  37.179 14.916  1.00 22.35  ? 428  TYR A CD2 1 
ATOM   3256 C CE1 . TYR A 1 427 ? 61.369  34.435 15.121  1.00 25.64  ? 428  TYR A CE1 1 
ATOM   3257 C CE2 . TYR A 1 427 ? 60.701  36.527 16.073  1.00 27.39  ? 428  TYR A CE2 1 
ATOM   3258 C CZ  . TYR A 1 427 ? 60.830  35.154 16.162  1.00 25.63  ? 428  TYR A CZ  1 
ATOM   3259 O OH  . TYR A 1 427 ? 60.420  34.490 17.290  1.00 26.97  ? 428  TYR A OH  1 
ATOM   3260 N N   . VAL A 1 428 ? 61.470  35.042 10.410  1.00 27.71  ? 429  VAL A N   1 
ATOM   3261 C CA  . VAL A 1 428 ? 61.484  33.585 10.362  1.00 29.09  ? 429  VAL A CA  1 
ATOM   3262 C C   . VAL A 1 428 ? 62.884  33.139 10.758  1.00 28.07  ? 429  VAL A C   1 
ATOM   3263 O O   . VAL A 1 428 ? 63.875  33.575 10.158  1.00 28.08  ? 429  VAL A O   1 
ATOM   3264 C CB  . VAL A 1 428 ? 61.100  33.030 8.980   1.00 31.05  ? 429  VAL A CB  1 
ATOM   3265 C CG1 . VAL A 1 428 ? 61.240  31.509 8.977   1.00 20.80  ? 429  VAL A CG1 1 
ATOM   3266 C CG2 . VAL A 1 428 ? 59.666  33.421 8.623   1.00 27.07  ? 429  VAL A CG2 1 
ATOM   3267 N N   . PHE A 1 429 ? 62.963  32.282 11.769  1.00 25.09  ? 430  PHE A N   1 
ATOM   3268 C CA  . PHE A 1 429 ? 64.228  31.781 12.290  1.00 26.41  ? 430  PHE A CA  1 
ATOM   3269 C C   . PHE A 1 429 ? 64.602  30.514 11.528  1.00 27.76  ? 430  PHE A C   1 
ATOM   3270 O O   . PHE A 1 429 ? 63.840  29.541 11.527  1.00 25.38  ? 430  PHE A O   1 
ATOM   3271 C CB  . PHE A 1 429 ? 64.099  31.507 13.790  1.00 27.20  ? 430  PHE A CB  1 
ATOM   3272 C CG  . PHE A 1 429 ? 65.361  31.012 14.429  1.00 31.96  ? 430  PHE A CG  1 
ATOM   3273 C CD1 . PHE A 1 429 ? 66.299  31.906 14.916  1.00 26.19  ? 430  PHE A CD1 1 
ATOM   3274 C CD2 . PHE A 1 429 ? 65.607  29.653 14.549  1.00 30.14  ? 430  PHE A CD2 1 
ATOM   3275 C CE1 . PHE A 1 429 ? 67.464  31.456 15.501  1.00 30.68  ? 430  PHE A CE1 1 
ATOM   3276 C CE2 . PHE A 1 429 ? 66.769  29.197 15.142  1.00 31.49  ? 430  PHE A CE2 1 
ATOM   3277 C CZ  . PHE A 1 429 ? 67.700  30.099 15.613  1.00 29.00  ? 430  PHE A CZ  1 
ATOM   3278 N N   . GLU A 1 430 ? 65.780  30.518 10.892  1.00 23.50  ? 431  GLU A N   1 
ATOM   3279 C CA  . GLU A 1 430 ? 66.112  29.490 9.910   1.00 31.55  ? 431  GLU A CA  1 
ATOM   3280 C C   . GLU A 1 430 ? 67.440  28.795 10.176  1.00 33.94  ? 431  GLU A C   1 
ATOM   3281 O O   . GLU A 1 430 ? 67.963  28.131 9.273   1.00 34.97  ? 431  GLU A O   1 
ATOM   3282 C CB  . GLU A 1 430 ? 66.138  30.084 8.491   1.00 26.57  ? 431  GLU A CB  1 
ATOM   3283 C CG  . GLU A 1 430 ? 64.843  30.772 8.079   1.00 35.62  ? 431  GLU A CG  1 
ATOM   3284 C CD  . GLU A 1 430 ? 64.726  30.956 6.571   1.00 45.92  ? 431  GLU A CD  1 
ATOM   3285 O OE1 . GLU A 1 430 ? 63.594  30.885 6.052   1.00 52.51  ? 431  GLU A OE1 1 
ATOM   3286 O OE2 . GLU A 1 430 ? 65.763  31.162 5.904   1.00 51.16  ? 431  GLU A OE2 1 
ATOM   3287 N N   . HIS A 1 431 ? 68.014  28.933 11.366  1.00 31.67  ? 432  HIS A N   1 
ATOM   3288 C CA  . HIS A 1 431 ? 69.274  28.274 11.683  1.00 31.99  ? 432  HIS A CA  1 
ATOM   3289 C C   . HIS A 1 431 ? 69.002  27.017 12.497  1.00 32.60  ? 432  HIS A C   1 
ATOM   3290 O O   . HIS A 1 431 ? 68.365  27.077 13.554  1.00 33.17  ? 432  HIS A O   1 
ATOM   3291 C CB  . HIS A 1 431 ? 70.225  29.193 12.446  1.00 29.67  ? 432  HIS A CB  1 
ATOM   3292 C CG  . HIS A 1 431 ? 71.460  28.494 12.924  1.00 34.52  ? 432  HIS A CG  1 
ATOM   3293 N ND1 . HIS A 1 431 ? 72.445  28.055 12.065  1.00 34.65  ? 432  HIS A ND1 1 
ATOM   3294 C CD2 . HIS A 1 431 ? 71.854  28.129 14.168  1.00 31.68  ? 432  HIS A CD2 1 
ATOM   3295 C CE1 . HIS A 1 431 ? 73.400  27.463 12.761  1.00 34.90  ? 432  HIS A CE1 1 
ATOM   3296 N NE2 . HIS A 1 431 ? 73.064  27.493 14.039  1.00 35.89  ? 432  HIS A NE2 1 
ATOM   3297 N N   . ARG A 1 432 ? 69.491  25.888 12.007  1.00 31.82  ? 433  ARG A N   1 
ATOM   3298 C CA  . ARG A 1 432 ? 69.435  24.634 12.740  1.00 32.12  ? 433  ARG A CA  1 
ATOM   3299 C C   . ARG A 1 432 ? 70.706  24.504 13.570  1.00 33.66  ? 433  ARG A C   1 
ATOM   3300 O O   . ARG A 1 432 ? 71.806  24.432 13.013  1.00 31.02  ? 433  ARG A O   1 
ATOM   3301 C CB  . ARG A 1 432 ? 69.286  23.466 11.768  1.00 35.87  ? 433  ARG A CB  1 
ATOM   3302 C CG  . ARG A 1 432 ? 69.162  22.130 12.437  1.00 40.70  ? 433  ARG A CG  1 
ATOM   3303 C CD  . ARG A 1 432 ? 69.164  21.023 11.420  1.00 34.17  ? 433  ARG A CD  1 
ATOM   3304 N NE  . ARG A 1 432 ? 69.464  19.751 12.058  1.00 35.06  ? 433  ARG A NE  1 
ATOM   3305 C CZ  . ARG A 1 432 ? 68.545  18.896 12.485  1.00 36.61  ? 433  ARG A CZ  1 
ATOM   3306 N NH1 . ARG A 1 432 ? 67.252  19.172 12.337  1.00 32.67  ? 433  ARG A NH1 1 
ATOM   3307 N NH2 . ARG A 1 432 ? 68.924  17.758 13.050  1.00 36.73  ? 433  ARG A NH2 1 
ATOM   3308 N N   . ALA A 1 433 ? 70.555  24.488 14.897  1.00 30.20  ? 434  ALA A N   1 
ATOM   3309 C CA  . ALA A 1 433 ? 71.705  24.458 15.792  1.00 31.43  ? 434  ALA A CA  1 
ATOM   3310 C C   . ALA A 1 433 ? 72.593  23.254 15.504  1.00 31.52  ? 434  ALA A C   1 
ATOM   3311 O O   . ALA A 1 433 ? 72.109  22.155 15.223  1.00 32.26  ? 434  ALA A O   1 
ATOM   3312 C CB  . ALA A 1 433 ? 71.242  24.427 17.252  1.00 27.58  ? 434  ALA A CB  1 
ATOM   3313 N N   . SER A 1 434 ? 73.909  23.470 15.573  1.00 26.51  ? 435  SER A N   1 
ATOM   3314 C CA  . SER A 1 434 ? 74.854  22.381 15.356  1.00 30.15  ? 435  SER A CA  1 
ATOM   3315 C C   . SER A 1 434 ? 74.719  21.290 16.407  1.00 39.00  ? 435  SER A C   1 
ATOM   3316 O O   . SER A 1 434 ? 75.132  20.151 16.163  1.00 41.78  ? 435  SER A O   1 
ATOM   3317 C CB  . SER A 1 434 ? 76.289  22.918 15.357  1.00 33.57  ? 435  SER A CB  1 
ATOM   3318 O OG  . SER A 1 434 ? 76.674  23.345 16.657  1.00 37.49  ? 435  SER A OG  1 
ATOM   3319 N N   . THR A 1 435 ? 74.155  21.616 17.568  1.00 34.73  ? 436  THR A N   1 
ATOM   3320 C CA  . THR A 1 435 ? 74.004  20.688 18.677  1.00 34.91  ? 436  THR A CA  1 
ATOM   3321 C C   . THR A 1 435 ? 72.639  20.020 18.708  1.00 35.15  ? 436  THR A C   1 
ATOM   3322 O O   . THR A 1 435 ? 72.389  19.199 19.595  1.00 35.26  ? 436  THR A O   1 
ATOM   3323 C CB  . THR A 1 435 ? 74.235  21.420 19.999  1.00 35.49  ? 436  THR A CB  1 
ATOM   3324 O OG1 . THR A 1 435 ? 73.363  22.555 20.057  1.00 35.78  ? 436  THR A OG1 1 
ATOM   3325 C CG2 . THR A 1 435 ? 75.682  21.893 20.101  1.00 31.46  ? 436  THR A CG2 1 
ATOM   3326 N N   . LEU A 1 436 ? 71.759  20.349 17.763  1.00 28.34  ? 437  LEU A N   1 
ATOM   3327 C CA  . LEU A 1 436 ? 70.394  19.842 17.785  1.00 32.94  ? 437  LEU A CA  1 
ATOM   3328 C C   . LEU A 1 436 ? 70.376  18.318 17.753  1.00 38.53  ? 437  LEU A C   1 
ATOM   3329 O O   . LEU A 1 436 ? 71.045  17.691 16.926  1.00 35.11  ? 437  LEU A O   1 
ATOM   3330 C CB  . LEU A 1 436 ? 69.614  20.409 16.601  1.00 31.38  ? 437  LEU A CB  1 
ATOM   3331 C CG  . LEU A 1 436 ? 68.102  20.190 16.592  1.00 40.80  ? 437  LEU A CG  1 
ATOM   3332 C CD1 . LEU A 1 436 ? 67.483  20.614 17.909  1.00 35.89  ? 437  LEU A CD1 1 
ATOM   3333 C CD2 . LEU A 1 436 ? 67.491  20.963 15.444  1.00 47.40  ? 437  LEU A CD2 1 
ATOM   3334 N N   . SER A 1 437 ? 69.602  17.722 18.660  1.00 35.46  ? 438  SER A N   1 
ATOM   3335 C CA  . SER A 1 437 ? 69.542  16.271 18.771  1.00 35.55  ? 438  SER A CA  1 
ATOM   3336 C C   . SER A 1 437 ? 68.387  15.654 17.998  1.00 31.69  ? 438  SER A C   1 
ATOM   3337 O O   . SER A 1 437 ? 68.385  14.434 17.795  1.00 33.42  ? 438  SER A O   1 
ATOM   3338 C CB  . SER A 1 437 ? 69.448  15.854 20.247  1.00 40.14  ? 438  SER A CB  1 
ATOM   3339 O OG  . SER A 1 437 ? 68.341  16.474 20.881  1.00 43.98  ? 438  SER A OG  1 
ATOM   3340 N N   . TRP A 1 438 ? 67.410  16.455 17.572  1.00 31.30  ? 439  TRP A N   1 
ATOM   3341 C CA  . TRP A 1 438 ? 66.335  15.946 16.734  1.00 31.55  ? 439  TRP A CA  1 
ATOM   3342 C C   . TRP A 1 438 ? 66.872  15.607 15.341  1.00 33.38  ? 439  TRP A C   1 
ATOM   3343 O O   . TRP A 1 438 ? 67.873  16.176 14.901  1.00 33.36  ? 439  TRP A O   1 
ATOM   3344 C CB  . TRP A 1 438 ? 65.210  16.975 16.627  1.00 30.57  ? 439  TRP A CB  1 
ATOM   3345 C CG  . TRP A 1 438 ? 64.481  17.206 17.913  1.00 31.40  ? 439  TRP A CG  1 
ATOM   3346 C CD1 . TRP A 1 438 ? 64.676  18.232 18.797  1.00 30.44  ? 439  TRP A CD1 1 
ATOM   3347 C CD2 . TRP A 1 438 ? 63.433  16.396 18.462  1.00 31.42  ? 439  TRP A CD2 1 
ATOM   3348 N NE1 . TRP A 1 438 ? 63.814  18.109 19.862  1.00 30.96  ? 439  TRP A NE1 1 
ATOM   3349 C CE2 . TRP A 1 438 ? 63.038  16.993 19.681  1.00 32.29  ? 439  TRP A CE2 1 
ATOM   3350 C CE3 . TRP A 1 438 ? 62.792  15.224 18.045  1.00 26.48  ? 439  TRP A CE3 1 
ATOM   3351 C CZ2 . TRP A 1 438 ? 62.033  16.454 20.488  1.00 27.21  ? 439  TRP A CZ2 1 
ATOM   3352 C CZ3 . TRP A 1 438 ? 61.791  14.692 18.842  1.00 33.17  ? 439  TRP A CZ3 1 
ATOM   3353 C CH2 . TRP A 1 438 ? 61.423  15.307 20.054  1.00 30.84  ? 439  TRP A CH2 1 
ATOM   3354 N N   . PRO A 1 439 ? 66.231  14.681 14.629  1.00 33.83  ? 440  PRO A N   1 
ATOM   3355 C CA  . PRO A 1 439 ? 66.766  14.256 13.330  1.00 35.40  ? 440  PRO A CA  1 
ATOM   3356 C C   . PRO A 1 439 ? 66.663  15.348 12.273  1.00 35.04  ? 440  PRO A C   1 
ATOM   3357 O O   . PRO A 1 439 ? 65.949  16.345 12.416  1.00 31.32  ? 440  PRO A O   1 
ATOM   3358 C CB  . PRO A 1 439 ? 65.893  13.050 12.960  1.00 34.19  ? 440  PRO A CB  1 
ATOM   3359 C CG  . PRO A 1 439 ? 64.603  13.305 13.660  1.00 31.54  ? 440  PRO A CG  1 
ATOM   3360 C CD  . PRO A 1 439 ? 65.000  13.948 14.977  1.00 32.54  ? 440  PRO A CD  1 
ATOM   3361 N N   . LEU A 1 440 ? 67.389  15.115 11.177  1.00 30.59  ? 441  LEU A N   1 
ATOM   3362 C CA  . LEU A 1 440 ? 67.532  16.111 10.120  1.00 38.72  ? 441  LEU A CA  1 
ATOM   3363 C C   . LEU A 1 440 ? 66.214  16.416 9.421   1.00 36.49  ? 441  LEU A C   1 
ATOM   3364 O O   . LEU A 1 440 ? 66.002  17.550 8.978   1.00 37.69  ? 441  LEU A O   1 
ATOM   3365 C CB  . LEU A 1 440 ? 68.560  15.634 9.091   1.00 44.12  ? 441  LEU A CB  1 
ATOM   3366 C CG  . LEU A 1 440 ? 69.919  16.327 9.116   1.00 53.63  ? 441  LEU A CG  1 
ATOM   3367 C CD1 . LEU A 1 440 ? 70.819  15.756 8.031   1.00 57.87  ? 441  LEU A CD1 1 
ATOM   3368 C CD2 . LEU A 1 440 ? 69.738  17.825 8.931   1.00 55.66  ? 441  LEU A CD2 1 
ATOM   3369 N N   . TRP A 1 441 ? 65.326  15.428 9.288   1.00 34.47  ? 442  TRP A N   1 
ATOM   3370 C CA  . TRP A 1 441 ? 64.094  15.685 8.552   1.00 33.01  ? 442  TRP A CA  1 
ATOM   3371 C C   . TRP A 1 441 ? 63.201  16.697 9.255   1.00 36.88  ? 442  TRP A C   1 
ATOM   3372 O O   . TRP A 1 441 ? 62.330  17.283 8.604   1.00 33.93  ? 442  TRP A O   1 
ATOM   3373 C CB  . TRP A 1 441 ? 63.317  14.385 8.289   1.00 33.73  ? 442  TRP A CB  1 
ATOM   3374 C CG  . TRP A 1 441 ? 62.658  13.724 9.484   1.00 34.23  ? 442  TRP A CG  1 
ATOM   3375 C CD1 . TRP A 1 441 ? 63.123  12.640 10.174  1.00 35.39  ? 442  TRP A CD1 1 
ATOM   3376 C CD2 . TRP A 1 441 ? 61.406  14.081 10.100  1.00 31.29  ? 442  TRP A CD2 1 
ATOM   3377 N NE1 . TRP A 1 441 ? 62.248  12.305 11.181  1.00 33.68  ? 442  TRP A NE1 1 
ATOM   3378 C CE2 . TRP A 1 441 ? 61.190  13.176 11.161  1.00 29.66  ? 442  TRP A CE2 1 
ATOM   3379 C CE3 . TRP A 1 441 ? 60.449  15.073 9.856   1.00 26.92  ? 442  TRP A CE3 1 
ATOM   3380 C CZ2 . TRP A 1 441 ? 60.059  13.236 11.980  1.00 29.01  ? 442  TRP A CZ2 1 
ATOM   3381 C CZ3 . TRP A 1 441 ? 59.331  15.135 10.673  1.00 30.69  ? 442  TRP A CZ3 1 
ATOM   3382 C CH2 . TRP A 1 441 ? 59.148  14.224 11.725  1.00 29.25  ? 442  TRP A CH2 1 
ATOM   3383 N N   . MET A 1 442 ? 63.400  16.931 10.557  1.00 32.71  ? 443  MET A N   1 
ATOM   3384 C CA  . MET A 1 442 ? 62.580  17.910 11.261  1.00 31.69  ? 443  MET A CA  1 
ATOM   3385 C C   . MET A 1 442 ? 63.001  19.349 10.990  1.00 28.43  ? 443  MET A C   1 
ATOM   3386 O O   . MET A 1 442 ? 62.275  20.267 11.384  1.00 29.29  ? 443  MET A O   1 
ATOM   3387 C CB  . MET A 1 442 ? 62.602  17.651 12.767  1.00 29.13  ? 443  MET A CB  1 
ATOM   3388 C CG  . MET A 1 442 ? 61.943  16.351 13.170  1.00 35.11  ? 443  MET A CG  1 
ATOM   3389 S SD  . MET A 1 442 ? 61.737  16.232 14.952  1.00 38.77  ? 443  MET A SD  1 
ATOM   3390 C CE  . MET A 1 442 ? 61.098  14.577 15.088  1.00 45.55  ? 443  MET A CE  1 
ATOM   3391 N N   . GLY A 1 443 ? 64.136  19.564 10.328  1.00 29.54  ? 444  GLY A N   1 
ATOM   3392 C CA  . GLY A 1 443 ? 64.517  20.917 9.939   1.00 31.11  ? 444  GLY A CA  1 
ATOM   3393 C C   . GLY A 1 443 ? 64.866  21.764 11.150  1.00 34.12  ? 444  GLY A C   1 
ATOM   3394 O O   . GLY A 1 443 ? 65.641  21.355 12.026  1.00 30.21  ? 444  GLY A O   1 
ATOM   3395 N N   . VAL A 1 444 ? 64.299  22.966 11.195  1.00 27.94  ? 445  VAL A N   1 
ATOM   3396 C CA  . VAL A 1 444 ? 64.465  23.875 12.328  1.00 25.33  ? 445  VAL A CA  1 
ATOM   3397 C C   . VAL A 1 444 ? 63.192  23.786 13.161  1.00 29.13  ? 445  VAL A C   1 
ATOM   3398 O O   . VAL A 1 444 ? 62.207  24.473 12.860  1.00 28.06  ? 445  VAL A O   1 
ATOM   3399 C CB  . VAL A 1 444 ? 64.742  25.313 11.861  1.00 29.11  ? 445  VAL A CB  1 
ATOM   3400 C CG1 . VAL A 1 444 ? 64.993  26.226 13.049  1.00 27.66  ? 445  VAL A CG1 1 
ATOM   3401 C CG2 . VAL A 1 444 ? 65.931  25.342 10.892  1.00 30.96  ? 445  VAL A CG2 1 
ATOM   3402 N N   . PRO A 1 445 ? 63.156  22.957 14.197  1.00 26.86  ? 446  PRO A N   1 
ATOM   3403 C CA  . PRO A 1 445 ? 61.883  22.652 14.853  1.00 28.28  ? 446  PRO A CA  1 
ATOM   3404 C C   . PRO A 1 445 ? 61.442  23.740 15.820  1.00 25.34  ? 446  PRO A C   1 
ATOM   3405 O O   . PRO A 1 445 ? 62.216  24.598 16.249  1.00 28.65  ? 446  PRO A O   1 
ATOM   3406 C CB  . PRO A 1 445 ? 62.167  21.344 15.606  1.00 25.37  ? 446  PRO A CB  1 
ATOM   3407 C CG  . PRO A 1 445 ? 63.536  20.902 15.159  1.00 29.81  ? 446  PRO A CG  1 
ATOM   3408 C CD  . PRO A 1 445 ? 64.251  22.148 14.740  1.00 26.54  ? 446  PRO A CD  1 
ATOM   3409 N N   . HIS A 1 446 ? 60.152  23.685 16.135  1.00 24.75  ? 447  HIS A N   1 
ATOM   3410 C CA  . HIS A 1 446 ? 59.554  24.519 17.166  1.00 29.53  ? 447  HIS A CA  1 
ATOM   3411 C C   . HIS A 1 446 ? 60.407  24.525 18.428  1.00 29.48  ? 447  HIS A C   1 
ATOM   3412 O O   . HIS A 1 446 ? 60.843  23.473 18.905  1.00 24.34  ? 447  HIS A O   1 
ATOM   3413 C CB  . HIS A 1 446 ? 58.150  23.996 17.482  1.00 26.44  ? 447  HIS A CB  1 
ATOM   3414 C CG  . HIS A 1 446 ? 57.417  24.801 18.505  1.00 26.97  ? 447  HIS A CG  1 
ATOM   3415 N ND1 . HIS A 1 446 ? 56.690  25.929 18.183  1.00 27.51  ? 447  HIS A ND1 1 
ATOM   3416 C CD2 . HIS A 1 446 ? 57.296  24.642 19.844  1.00 22.23  ? 447  HIS A CD2 1 
ATOM   3417 C CE1 . HIS A 1 446 ? 56.151  26.426 19.281  1.00 27.96  ? 447  HIS A CE1 1 
ATOM   3418 N NE2 . HIS A 1 446 ? 56.505  25.666 20.303  1.00 30.63  ? 447  HIS A NE2 1 
ATOM   3419 N N   . GLY A 1 447 ? 60.663  25.723 18.952  1.00 26.34  ? 448  GLY A N   1 
ATOM   3420 C CA  . GLY A 1 447 ? 61.339  25.881 20.217  1.00 22.85  ? 448  GLY A CA  1 
ATOM   3421 C C   . GLY A 1 447 ? 62.836  26.094 20.143  1.00 28.92  ? 448  GLY A C   1 
ATOM   3422 O O   . GLY A 1 447 ? 63.453  26.386 21.175  1.00 25.54  ? 448  GLY A O   1 
ATOM   3423 N N   . TYR A 1 448 ? 63.450  25.978 18.967  1.00 24.75  ? 449  TYR A N   1 
ATOM   3424 C CA  . TYR A 1 448 ? 64.904  25.927 18.919  1.00 25.79  ? 449  TYR A CA  1 
ATOM   3425 C C   . TYR A 1 448 ? 65.537  27.236 18.468  1.00 27.26  ? 449  TYR A C   1 
ATOM   3426 O O   . TYR A 1 448 ? 66.739  27.274 18.198  1.00 31.42  ? 449  TYR A O   1 
ATOM   3427 C CB  . TYR A 1 448 ? 65.341  24.722 18.082  1.00 23.98  ? 449  TYR A CB  1 
ATOM   3428 C CG  . TYR A 1 448 ? 65.098  23.507 18.937  1.00 26.48  ? 449  TYR A CG  1 
ATOM   3429 C CD1 . TYR A 1 448 ? 66.005  23.155 19.928  1.00 25.33  ? 449  TYR A CD1 1 
ATOM   3430 C CD2 . TYR A 1 448 ? 63.907  22.791 18.851  1.00 24.93  ? 449  TYR A CD2 1 
ATOM   3431 C CE1 . TYR A 1 448 ? 65.767  22.082 20.771  1.00 24.55  ? 449  TYR A CE1 1 
ATOM   3432 C CE2 . TYR A 1 448 ? 63.661  21.710 19.692  1.00 27.44  ? 449  TYR A CE2 1 
ATOM   3433 C CZ  . TYR A 1 448 ? 64.595  21.369 20.651  1.00 27.32  ? 449  TYR A CZ  1 
ATOM   3434 O OH  . TYR A 1 448 ? 64.368  20.303 21.491  1.00 30.83  ? 449  TYR A OH  1 
ATOM   3435 N N   . GLU A 1 449 ? 64.767  28.322 18.445  1.00 24.89  ? 450  GLU A N   1 
ATOM   3436 C CA  . GLU A 1 449 ? 65.341  29.657 18.480  1.00 26.80  ? 450  GLU A CA  1 
ATOM   3437 C C   . GLU A 1 449 ? 65.589  30.147 19.907  1.00 26.18  ? 450  GLU A C   1 
ATOM   3438 O O   . GLU A 1 449 ? 66.422  31.040 20.104  1.00 25.62  ? 450  GLU A O   1 
ATOM   3439 C CB  . GLU A 1 449 ? 64.423  30.644 17.746  1.00 28.58  ? 450  GLU A CB  1 
ATOM   3440 C CG  . GLU A 1 449 ? 63.374  31.347 18.618  1.00 28.67  ? 450  GLU A CG  1 
ATOM   3441 C CD  . GLU A 1 449 ? 62.200  30.455 19.018  1.00 33.82  ? 450  GLU A CD  1 
ATOM   3442 O OE1 . GLU A 1 449 ? 62.308  29.215 18.915  1.00 27.93  ? 450  GLU A OE1 1 
ATOM   3443 O OE2 . GLU A 1 449 ? 61.157  31.006 19.438  1.00 41.31  ? 450  GLU A OE2 1 
ATOM   3444 N N   . ILE A 1 450 ? 64.921  29.557 20.905  1.00 23.48  ? 451  ILE A N   1 
ATOM   3445 C CA  . ILE A 1 450 ? 64.963  30.092 22.269  1.00 26.22  ? 451  ILE A CA  1 
ATOM   3446 C C   . ILE A 1 450 ? 66.394  30.148 22.795  1.00 27.11  ? 451  ILE A C   1 
ATOM   3447 O O   . ILE A 1 450 ? 66.831  31.166 23.347  1.00 26.72  ? 451  ILE A O   1 
ATOM   3448 C CB  . ILE A 1 450 ? 64.064  29.265 23.204  1.00 24.77  ? 451  ILE A CB  1 
ATOM   3449 C CG1 . ILE A 1 450 ? 62.591  29.406 22.808  1.00 21.83  ? 451  ILE A CG1 1 
ATOM   3450 C CG2 . ILE A 1 450 ? 64.270  29.711 24.648  1.00 21.88  ? 451  ILE A CG2 1 
ATOM   3451 C CD1 . ILE A 1 450 ? 61.684  28.475 23.575  1.00 18.19  ? 451  ILE A CD1 1 
ATOM   3452 N N   . GLU A 1 451 ? 67.143  29.051 22.643  1.00 22.76  ? 452  GLU A N   1 
ATOM   3453 C CA  . GLU A 1 451 ? 68.494  28.999 23.196  1.00 27.03  ? 452  GLU A CA  1 
ATOM   3454 C C   . GLU A 1 451 ? 69.389  30.098 22.625  1.00 25.16  ? 452  GLU A C   1 
ATOM   3455 O O   . GLU A 1 451 ? 70.322  30.546 23.299  1.00 28.72  ? 452  GLU A O   1 
ATOM   3456 C CB  . GLU A 1 451 ? 69.106  27.620 22.944  1.00 28.64  ? 452  GLU A CB  1 
ATOM   3457 C CG  . GLU A 1 451 ? 69.196  27.239 21.465  1.00 30.02  ? 452  GLU A CG  1 
ATOM   3458 C CD  . GLU A 1 451 ? 69.210  25.733 21.257  1.00 35.48  ? 452  GLU A CD  1 
ATOM   3459 O OE1 . GLU A 1 451 ? 68.179  25.088 21.542  1.00 36.51  ? 452  GLU A OE1 1 
ATOM   3460 O OE2 . GLU A 1 451 ? 70.248  25.184 20.830  1.00 35.30  ? 452  GLU A OE2 1 
ATOM   3461 N N   . PHE A 1 452 ? 69.119  30.552 21.396  1.00 22.49  ? 453  PHE A N   1 
ATOM   3462 C CA  . PHE A 1 452 ? 69.907  31.634 20.815  1.00 24.91  ? 453  PHE A CA  1 
ATOM   3463 C C   . PHE A 1 452 ? 69.464  32.995 21.331  1.00 27.59  ? 453  PHE A C   1 
ATOM   3464 O O   . PHE A 1 452 ? 70.295  33.890 21.517  1.00 34.49  ? 453  PHE A O   1 
ATOM   3465 C CB  . PHE A 1 452 ? 69.820  31.597 19.283  1.00 24.42  ? 453  PHE A CB  1 
ATOM   3466 C CG  . PHE A 1 452 ? 70.573  30.456 18.680  1.00 28.22  ? 453  PHE A CG  1 
ATOM   3467 C CD1 . PHE A 1 452 ? 69.957  29.234 18.466  1.00 29.13  ? 453  PHE A CD1 1 
ATOM   3468 C CD2 . PHE A 1 452 ? 71.919  30.587 18.388  1.00 25.10  ? 453  PHE A CD2 1 
ATOM   3469 C CE1 . PHE A 1 452 ? 70.670  28.168 17.933  1.00 33.01  ? 453  PHE A CE1 1 
ATOM   3470 C CE2 . PHE A 1 452 ? 72.636  29.528 17.862  1.00 26.18  ? 453  PHE A CE2 1 
ATOM   3471 C CZ  . PHE A 1 452 ? 72.015  28.317 17.636  1.00 25.86  ? 453  PHE A CZ  1 
ATOM   3472 N N   . ILE A 1 453 ? 68.159  33.177 21.531  1.00 26.13  ? 454  ILE A N   1 
ATOM   3473 C CA  . ILE A 1 453 ? 67.654  34.436 22.073  1.00 25.90  ? 454  ILE A CA  1 
ATOM   3474 C C   . ILE A 1 453 ? 68.219  34.677 23.468  1.00 23.84  ? 454  ILE A C   1 
ATOM   3475 O O   . ILE A 1 453 ? 68.570  35.808 23.825  1.00 29.04  ? 454  ILE A O   1 
ATOM   3476 C CB  . ILE A 1 453 ? 66.112  34.433 22.078  1.00 29.11  ? 454  ILE A CB  1 
ATOM   3477 C CG1 . ILE A 1 453 ? 65.560  34.236 20.657  1.00 26.78  ? 454  ILE A CG1 1 
ATOM   3478 C CG2 . ILE A 1 453 ? 65.570  35.710 22.705  1.00 23.12  ? 454  ILE A CG2 1 
ATOM   3479 C CD1 . ILE A 1 453 ? 66.119  35.202 19.653  1.00 35.85  ? 454  ILE A CD1 1 
ATOM   3480 N N   . PHE A 1 454 ? 68.328  33.623 24.273  1.00 20.51  ? 455  PHE A N   1 
ATOM   3481 C CA  . PHE A 1 454 ? 68.861  33.744 25.626  1.00 22.04  ? 455  PHE A CA  1 
ATOM   3482 C C   . PHE A 1 454 ? 70.381  33.650 25.688  1.00 27.60  ? 455  PHE A C   1 
ATOM   3483 O O   . PHE A 1 454 ? 70.941  33.730 26.786  1.00 29.51  ? 455  PHE A O   1 
ATOM   3484 C CB  . PHE A 1 454 ? 68.243  32.677 26.540  1.00 23.00  ? 455  PHE A CB  1 
ATOM   3485 C CG  . PHE A 1 454 ? 66.884  33.046 27.076  1.00 24.40  ? 455  PHE A CG  1 
ATOM   3486 C CD1 . PHE A 1 454 ? 65.742  32.848 26.314  1.00 25.77  ? 455  PHE A CD1 1 
ATOM   3487 C CD2 . PHE A 1 454 ? 66.749  33.586 28.346  1.00 23.53  ? 455  PHE A CD2 1 
ATOM   3488 C CE1 . PHE A 1 454 ? 64.488  33.185 26.810  1.00 28.00  ? 455  PHE A CE1 1 
ATOM   3489 C CE2 . PHE A 1 454 ? 65.501  33.925 28.847  1.00 26.73  ? 455  PHE A CE2 1 
ATOM   3490 C CZ  . PHE A 1 454 ? 64.366  33.724 28.077  1.00 21.67  ? 455  PHE A CZ  1 
ATOM   3491 N N   . GLY A 1 455 ? 71.061  33.472 24.552  1.00 24.37  ? 456  GLY A N   1 
ATOM   3492 C CA  . GLY A 1 455 ? 72.514  33.459 24.540  1.00 23.46  ? 456  GLY A CA  1 
ATOM   3493 C C   . GLY A 1 455 ? 73.165  32.243 25.153  1.00 29.50  ? 456  GLY A C   1 
ATOM   3494 O O   . GLY A 1 455 ? 74.329  32.312 25.558  1.00 27.70  ? 456  GLY A O   1 
ATOM   3495 N N   . ILE A 1 456 ? 72.451  31.124 25.217  1.00 29.46  ? 457  ILE A N   1 
ATOM   3496 C CA  . ILE A 1 456 ? 72.973  29.858 25.731  1.00 29.05  ? 457  ILE A CA  1 
ATOM   3497 C C   . ILE A 1 456 ? 74.265  29.421 25.034  1.00 31.77  ? 457  ILE A C   1 
ATOM   3498 O O   . ILE A 1 456 ? 75.119  28.802 25.689  1.00 29.46  ? 457  ILE A O   1 
ATOM   3499 C CB  . ILE A 1 456 ? 71.893  28.767 25.636  1.00 25.26  ? 457  ILE A CB  1 
ATOM   3500 C CG1 . ILE A 1 456 ? 70.622  29.248 26.338  1.00 26.16  ? 457  ILE A CG1 1 
ATOM   3501 C CG2 . ILE A 1 456 ? 72.349  27.487 26.308  1.00 24.84  ? 457  ILE A CG2 1 
ATOM   3502 C CD1 . ILE A 1 456 ? 70.856  29.634 27.797  1.00 20.97  ? 457  ILE A CD1 1 
ATOM   3503 N N   . PRO A 1 457 ? 74.474  29.693 23.737  1.00 26.11  ? 458  PRO A N   1 
ATOM   3504 C CA  . PRO A 1 457 ? 75.769  29.329 23.131  1.00 28.98  ? 458  PRO A CA  1 
ATOM   3505 C C   . PRO A 1 457 ? 76.982  29.921 23.832  1.00 32.25  ? 458  PRO A C   1 
ATOM   3506 O O   . PRO A 1 457 ? 78.083  29.376 23.686  1.00 34.19  ? 458  PRO A O   1 
ATOM   3507 C CB  . PRO A 1 457 ? 75.640  29.847 21.691  1.00 25.52  ? 458  PRO A CB  1 
ATOM   3508 C CG  . PRO A 1 457 ? 74.197  29.653 21.389  1.00 28.34  ? 458  PRO A CG  1 
ATOM   3509 C CD  . PRO A 1 457 ? 73.482  30.025 22.688  1.00 22.35  ? 458  PRO A CD  1 
ATOM   3510 N N   . LEU A 1 458 ? 76.822  31.004 24.595  1.00 33.78  ? 459  LEU A N   1 
ATOM   3511 C CA  . LEU A 1 458 ? 77.936  31.598 25.323  1.00 34.40  ? 459  LEU A CA  1 
ATOM   3512 C C   . LEU A 1 458 ? 78.315  30.820 26.578  1.00 37.45  ? 459  LEU A C   1 
ATOM   3513 O O   . LEU A 1 458 ? 79.337  31.138 27.196  1.00 36.15  ? 459  LEU A O   1 
ATOM   3514 C CB  . LEU A 1 458 ? 77.602  33.043 25.700  1.00 37.03  ? 459  LEU A CB  1 
ATOM   3515 C CG  . LEU A 1 458 ? 77.200  33.920 24.514  1.00 39.41  ? 459  LEU A CG  1 
ATOM   3516 C CD1 . LEU A 1 458 ? 76.847  35.311 24.980  1.00 38.83  ? 459  LEU A CD1 1 
ATOM   3517 C CD2 . LEU A 1 458 ? 78.331  33.967 23.488  1.00 41.04  ? 459  LEU A CD2 1 
ATOM   3518 N N   . ASP A 1 459 ? 77.523  29.831 26.974  1.00 35.73  ? 460  ASP A N   1 
ATOM   3519 C CA  . ASP A 1 459 ? 77.882  28.981 28.106  1.00 36.47  ? 460  ASP A CA  1 
ATOM   3520 C C   . ASP A 1 459 ? 79.145  28.205 27.759  1.00 44.87  ? 460  ASP A C   1 
ATOM   3521 O O   . ASP A 1 459 ? 79.141  27.448 26.779  1.00 39.86  ? 460  ASP A O   1 
ATOM   3522 C CB  . ASP A 1 459 ? 76.736  28.025 28.443  1.00 40.34  ? 460  ASP A CB  1 
ATOM   3523 C CG  . ASP A 1 459 ? 77.006  27.176 29.687  1.00 41.55  ? 460  ASP A CG  1 
ATOM   3524 O OD1 . ASP A 1 459 ? 78.176  26.895 30.002  1.00 44.80  ? 460  ASP A OD1 1 
ATOM   3525 O OD2 . ASP A 1 459 ? 76.030  26.768 30.348  1.00 48.39  ? 460  ASP A OD2 1 
ATOM   3526 N N   . PRO A 1 460 ? 80.228  28.342 28.532  1.00 51.48  ? 461  PRO A N   1 
ATOM   3527 C CA  . PRO A 1 460 ? 81.478  27.652 28.172  1.00 53.45  ? 461  PRO A CA  1 
ATOM   3528 C C   . PRO A 1 460 ? 81.358  26.137 28.136  1.00 54.13  ? 461  PRO A C   1 
ATOM   3529 O O   . PRO A 1 460 ? 82.043  25.494 27.331  1.00 59.19  ? 461  PRO A O   1 
ATOM   3530 C CB  . PRO A 1 460 ? 82.461  28.118 29.258  1.00 60.11  ? 461  PRO A CB  1 
ATOM   3531 C CG  . PRO A 1 460 ? 81.599  28.591 30.390  1.00 60.84  ? 461  PRO A CG  1 
ATOM   3532 C CD  . PRO A 1 460 ? 80.370  29.160 29.748  1.00 52.73  ? 461  PRO A CD  1 
ATOM   3533 N N   . SER A 1 461 ? 80.494  25.546 28.964  1.00 50.83  ? 462  SER A N   1 
ATOM   3534 C CA  . SER A 1 461 ? 80.382  24.092 29.014  1.00 51.60  ? 462  SER A CA  1 
ATOM   3535 C C   . SER A 1 461 ? 79.693  23.499 27.791  1.00 52.62  ? 462  SER A C   1 
ATOM   3536 O O   . SER A 1 461 ? 79.750  22.279 27.604  1.00 56.02  ? 462  SER A O   1 
ATOM   3537 C CB  . SER A 1 461 ? 79.629  23.666 30.272  1.00 50.12  ? 462  SER A CB  1 
ATOM   3538 O OG  . SER A 1 461 ? 78.270  24.052 30.196  1.00 56.82  ? 462  SER A OG  1 
ATOM   3539 N N   . ARG A 1 462 ? 79.042  24.311 26.968  1.00 47.79  ? 463  ARG A N   1 
ATOM   3540 C CA  . ARG A 1 462 ? 78.380  23.801 25.777  1.00 49.46  ? 463  ARG A CA  1 
ATOM   3541 C C   . ARG A 1 462 ? 79.303  23.910 24.565  1.00 45.32  ? 463  ARG A C   1 
ATOM   3542 O O   . ARG A 1 462 ? 80.321  24.606 24.592  1.00 47.64  ? 463  ARG A O   1 
ATOM   3543 C CB  . ARG A 1 462 ? 77.066  24.544 25.546  1.00 48.50  ? 463  ARG A CB  1 
ATOM   3544 C CG  . ARG A 1 462 ? 75.994  24.091 26.523  1.00 48.92  ? 463  ARG A CG  1 
ATOM   3545 C CD  . ARG A 1 462 ? 74.840  25.057 26.640  1.00 47.42  ? 463  ARG A CD  1 
ATOM   3546 N NE  . ARG A 1 462 ? 74.088  24.801 27.866  1.00 51.73  ? 463  ARG A NE  1 
ATOM   3547 C CZ  . ARG A 1 462 ? 73.084  23.936 27.966  1.00 56.87  ? 463  ARG A CZ  1 
ATOM   3548 N NH1 . ARG A 1 462 ? 72.689  23.247 26.904  1.00 61.48  ? 463  ARG A NH1 1 
ATOM   3549 N NH2 . ARG A 1 462 ? 72.469  23.765 29.128  1.00 57.44  ? 463  ARG A NH2 1 
ATOM   3550 N N   . ASN A 1 463 ? 79.023  23.166 23.505  1.00 40.81  ? 464  ASN A N   1 
ATOM   3551 C CA  . ASN A 1 463 ? 79.938  23.136 22.356  1.00 46.49  ? 464  ASN A CA  1 
ATOM   3552 C C   . ASN A 1 463 ? 79.588  23.893 21.081  1.00 40.92  ? 464  ASN A C   1 
ATOM   3553 O O   . ASN A 1 463 ? 80.098  23.560 20.011  1.00 43.67  ? 464  ASN A O   1 
ATOM   3554 C CB  . ASN A 1 463 ? 80.273  21.682 22.000  1.00 58.35  ? 464  ASN A CB  1 
ATOM   3555 C CG  . ASN A 1 463 ? 81.170  21.023 23.029  1.00 74.46  ? 464  ASN A CG  1 
ATOM   3556 O OD1 . ASN A 1 463 ? 82.372  21.280 23.079  1.00 71.12  ? 464  ASN A OD1 1 
ATOM   3557 N ND2 . ASN A 1 463 ? 80.587  20.166 23.860  1.00 100.13 ? 464  ASN A ND2 1 
ATOM   3558 N N   . TYR A 1 464 ? 78.712  24.883 21.166  1.00 33.79  ? 465  TYR A N   1 
ATOM   3559 C CA  . TYR A 1 464 ? 78.299  25.572 19.951  1.00 32.00  ? 465  TYR A CA  1 
ATOM   3560 C C   . TYR A 1 464 ? 79.527  26.080 19.197  1.00 34.36  ? 465  TYR A C   1 
ATOM   3561 O O   . TYR A 1 464 ? 80.613  26.235 19.764  1.00 37.17  ? 465  TYR A O   1 
ATOM   3562 C CB  . TYR A 1 464 ? 77.373  26.748 20.270  1.00 26.96  ? 465  TYR A CB  1 
ATOM   3563 C CG  . TYR A 1 464 ? 76.014  26.370 20.816  1.00 33.68  ? 465  TYR A CG  1 
ATOM   3564 C CD1 . TYR A 1 464 ? 75.843  26.088 22.167  1.00 28.94  ? 465  TYR A CD1 1 
ATOM   3565 C CD2 . TYR A 1 464 ? 74.898  26.313 19.985  1.00 30.43  ? 465  TYR A CD2 1 
ATOM   3566 C CE1 . TYR A 1 464 ? 74.605  25.754 22.679  1.00 32.57  ? 465  TYR A CE1 1 
ATOM   3567 C CE2 . TYR A 1 464 ? 73.651  25.977 20.487  1.00 35.23  ? 465  TYR A CE2 1 
ATOM   3568 C CZ  . TYR A 1 464 ? 73.511  25.700 21.838  1.00 39.17  ? 465  TYR A CZ  1 
ATOM   3569 O OH  . TYR A 1 464 ? 72.275  25.367 22.345  1.00 40.16  ? 465  TYR A OH  1 
ATOM   3570 N N   . THR A 1 465 ? 79.349  26.348 17.903  1.00 34.58  ? 466  THR A N   1 
ATOM   3571 C CA  . THR A 1 465 ? 80.447  26.915 17.131  1.00 34.98  ? 466  THR A CA  1 
ATOM   3572 C C   . THR A 1 465 ? 80.610  28.397 17.450  1.00 33.29  ? 466  THR A C   1 
ATOM   3573 O O   . THR A 1 465 ? 79.700  29.054 17.964  1.00 34.38  ? 466  THR A O   1 
ATOM   3574 C CB  . THR A 1 465 ? 80.223  26.761 15.626  1.00 35.13  ? 466  THR A CB  1 
ATOM   3575 O OG1 . THR A 1 465 ? 79.151  27.623 15.217  1.00 34.15  ? 466  THR A OG1 1 
ATOM   3576 C CG2 . THR A 1 465 ? 79.892  25.316 15.271  1.00 32.67  ? 466  THR A CG2 1 
ATOM   3577 N N   . ALA A 1 466 ? 81.791  28.922 17.119  1.00 32.70  ? 467  ALA A N   1 
ATOM   3578 C CA  . ALA A 1 466 ? 82.043  30.350 17.282  1.00 35.98  ? 467  ALA A CA  1 
ATOM   3579 C C   . ALA A 1 466 ? 81.056  31.181 16.470  1.00 38.49  ? 467  ALA A C   1 
ATOM   3580 O O   . ALA A 1 466 ? 80.611  32.245 16.921  1.00 40.19  ? 467  ALA A O   1 
ATOM   3581 C CB  . ALA A 1 466 ? 83.483  30.672 16.880  1.00 34.87  ? 467  ALA A CB  1 
ATOM   3582 N N   . GLU A 1 467 ? 80.698  30.704 15.272  1.00 32.82  ? 468  GLU A N   1 
ATOM   3583 C CA  . GLU A 1 467 ? 79.701  31.386 14.451  1.00 36.00  ? 468  GLU A CA  1 
ATOM   3584 C C   . GLU A 1 467 ? 78.363  31.478 15.167  1.00 32.81  ? 468  GLU A C   1 
ATOM   3585 O O   . GLU A 1 467 ? 77.668  32.498 15.079  1.00 32.85  ? 468  GLU A O   1 
ATOM   3586 C CB  . GLU A 1 467 ? 79.514  30.648 13.127  1.00 44.80  ? 468  GLU A CB  1 
ATOM   3587 C CG  . GLU A 1 467 ? 80.315  31.162 11.962  1.00 61.09  ? 468  GLU A CG  1 
ATOM   3588 C CD  . GLU A 1 467 ? 79.752  30.657 10.644  1.00 74.68  ? 468  GLU A CD  1 
ATOM   3589 O OE1 . GLU A 1 467 ? 79.451  31.489 9.760   1.00 81.24  ? 468  GLU A OE1 1 
ATOM   3590 O OE2 . GLU A 1 467 ? 79.586  29.424 10.507  1.00 73.28  ? 468  GLU A OE2 1 
ATOM   3591 N N   . GLU A 1 468 ? 77.962  30.404 15.844  1.00 33.34  ? 469  GLU A N   1 
ATOM   3592 C CA  . GLU A 1 468 ? 76.684  30.419 16.544  1.00 35.85  ? 469  GLU A CA  1 
ATOM   3593 C C   . GLU A 1 468 ? 76.700  31.382 17.729  1.00 31.92  ? 469  GLU A C   1 
ATOM   3594 O O   . GLU A 1 468 ? 75.658  31.950 18.074  1.00 27.32  ? 469  GLU A O   1 
ATOM   3595 C CB  . GLU A 1 468 ? 76.323  28.996 16.973  1.00 33.57  ? 469  GLU A CB  1 
ATOM   3596 C CG  . GLU A 1 468 ? 75.929  28.130 15.774  1.00 36.22  ? 469  GLU A CG  1 
ATOM   3597 C CD  . GLU A 1 468 ? 75.710  26.670 16.114  1.00 33.84  ? 469  GLU A CD  1 
ATOM   3598 O OE1 . GLU A 1 468 ? 76.566  26.079 16.803  1.00 37.90  ? 469  GLU A OE1 1 
ATOM   3599 O OE2 . GLU A 1 468 ? 74.682  26.108 15.679  1.00 39.99  ? 469  GLU A OE2 1 
ATOM   3600 N N   . LYS A 1 469 ? 77.866  31.607 18.340  1.00 27.26  ? 470  LYS A N   1 
ATOM   3601 C CA  . LYS A 1 469 ? 77.948  32.582 19.425  1.00 29.90  ? 470  LYS A CA  1 
ATOM   3602 C C   . LYS A 1 469 ? 77.787  34.005 18.907  1.00 31.66  ? 470  LYS A C   1 
ATOM   3603 O O   . LYS A 1 469 ? 77.082  34.815 19.519  1.00 32.18  ? 470  LYS A O   1 
ATOM   3604 C CB  . LYS A 1 469 ? 79.266  32.420 20.177  1.00 28.66  ? 470  LYS A CB  1 
ATOM   3605 C CG  . LYS A 1 469 ? 79.394  31.048 20.799  1.00 28.76  ? 470  LYS A CG  1 
ATOM   3606 C CD  . LYS A 1 469 ? 80.784  30.791 21.346  1.00 33.21  ? 470  LYS A CD  1 
ATOM   3607 C CE  . LYS A 1 469 ? 81.017  29.305 21.506  1.00 30.30  ? 470  LYS A CE  1 
ATOM   3608 N NZ  . LYS A 1 469 ? 82.163  28.995 22.384  1.00 31.61  ? 470  LYS A NZ  1 
ATOM   3609 N N   . ILE A 1 470 ? 78.441  34.327 17.788  1.00 33.96  ? 471  ILE A N   1 
ATOM   3610 C CA  . ILE A 1 470 ? 78.218  35.612 17.128  1.00 33.71  ? 471  ILE A CA  1 
ATOM   3611 C C   . ILE A 1 470 ? 76.740  35.785 16.805  1.00 33.03  ? 471  ILE A C   1 
ATOM   3612 O O   . ILE A 1 470 ? 76.139  36.834 17.067  1.00 36.54  ? 471  ILE A O   1 
ATOM   3613 C CB  . ILE A 1 470 ? 79.082  35.713 15.856  1.00 38.15  ? 471  ILE A CB  1 
ATOM   3614 C CG1 . ILE A 1 470 ? 80.566  35.661 16.214  1.00 42.85  ? 471  ILE A CG1 1 
ATOM   3615 C CG2 . ILE A 1 470 ? 78.741  36.976 15.067  1.00 34.57  ? 471  ILE A CG2 1 
ATOM   3616 C CD1 . ILE A 1 470 ? 80.990  36.741 17.178  1.00 46.66  ? 471  ILE A CD1 1 
ATOM   3617 N N   . PHE A 1 471 ? 76.131  34.744 16.242  1.00 34.52  ? 472  PHE A N   1 
ATOM   3618 C CA  . PHE A 1 471 ? 74.718  34.792 15.893  1.00 28.03  ? 472  PHE A CA  1 
ATOM   3619 C C   . PHE A 1 471 ? 73.852  35.027 17.130  1.00 25.77  ? 472  PHE A C   1 
ATOM   3620 O O   . PHE A 1 471 ? 72.954  35.875 17.120  1.00 29.39  ? 472  PHE A O   1 
ATOM   3621 C CB  . PHE A 1 471 ? 74.338  33.491 15.189  1.00 30.32  ? 472  PHE A CB  1 
ATOM   3622 C CG  . PHE A 1 471 ? 72.901  33.415 14.767  1.00 30.58  ? 472  PHE A CG  1 
ATOM   3623 C CD1 . PHE A 1 471 ? 72.314  34.454 14.063  1.00 28.87  ? 472  PHE A CD1 1 
ATOM   3624 C CD2 . PHE A 1 471 ? 72.144  32.286 15.049  1.00 33.29  ? 472  PHE A CD2 1 
ATOM   3625 C CE1 . PHE A 1 471 ? 70.985  34.385 13.664  1.00 23.73  ? 472  PHE A CE1 1 
ATOM   3626 C CE2 . PHE A 1 471 ? 70.808  32.204 14.649  1.00 31.81  ? 472  PHE A CE2 1 
ATOM   3627 C CZ  . PHE A 1 471 ? 70.231  33.259 13.949  1.00 28.73  ? 472  PHE A CZ  1 
ATOM   3628 N N   . ALA A 1 472 ? 74.115  34.288 18.209  1.00 28.17  ? 473  ALA A N   1 
ATOM   3629 C CA  . ALA A 1 472 ? 73.385  34.509 19.458  1.00 27.53  ? 473  ALA A CA  1 
ATOM   3630 C C   . ALA A 1 472 ? 73.515  35.951 19.929  1.00 27.28  ? 473  ALA A C   1 
ATOM   3631 O O   . ALA A 1 472 ? 72.531  36.571 20.346  1.00 32.27  ? 473  ALA A O   1 
ATOM   3632 C CB  . ALA A 1 472 ? 73.893  33.555 20.540  1.00 24.04  ? 473  ALA A CB  1 
ATOM   3633 N N   . GLN A 1 473 ? 74.727  36.500 19.864  1.00 24.30  ? 474  GLN A N   1 
ATOM   3634 C CA  . GLN A 1 473 ? 74.947  37.874 20.298  1.00 28.22  ? 474  GLN A CA  1 
ATOM   3635 C C   . GLN A 1 473 ? 74.145  38.855 19.453  1.00 31.22  ? 474  GLN A C   1 
ATOM   3636 O O   . GLN A 1 473 ? 73.619  39.848 19.973  1.00 30.26  ? 474  GLN A O   1 
ATOM   3637 C CB  . GLN A 1 473 ? 76.441  38.194 20.249  1.00 29.37  ? 474  GLN A CB  1 
ATOM   3638 C CG  . GLN A 1 473 ? 77.167  37.802 21.525  1.00 33.65  ? 474  GLN A CG  1 
ATOM   3639 C CD  . GLN A 1 473 ? 78.685  37.715 21.366  1.00 39.82  ? 474  GLN A CD  1 
ATOM   3640 O OE1 . GLN A 1 473 ? 79.214  37.707 20.259  1.00 43.31  ? 474  GLN A OE1 1 
ATOM   3641 N NE2 . GLN A 1 473 ? 79.383  37.675 22.488  1.00 40.49  ? 474  GLN A NE2 1 
ATOM   3642 N N   . ARG A 1 474 ? 74.015  38.584 18.150  1.00 25.61  ? 475  ARG A N   1 
ATOM   3643 C CA  . ARG A 1 474 ? 73.255  39.483 17.293  1.00 29.46  ? 475  ARG A CA  1 
ATOM   3644 C C   . ARG A 1 474 ? 71.761  39.420 17.606  1.00 27.42  ? 475  ARG A C   1 
ATOM   3645 O O   . ARG A 1 474 ? 71.076  40.448 17.576  1.00 31.37  ? 475  ARG A O   1 
ATOM   3646 C CB  . ARG A 1 474 ? 73.523  39.170 15.820  1.00 36.31  ? 475  ARG A CB  1 
ATOM   3647 C CG  . ARG A 1 474 ? 72.683  40.000 14.877  1.00 48.72  ? 475  ARG A CG  1 
ATOM   3648 C CD  . ARG A 1 474 ? 73.173  39.960 13.424  1.00 47.89  ? 475  ARG A CD  1 
ATOM   3649 N NE  . ARG A 1 474 ? 73.514  38.619 12.983  1.00 43.91  ? 475  ARG A NE  1 
ATOM   3650 C CZ  . ARG A 1 474 ? 72.843  37.971 12.030  1.00 40.62  ? 475  ARG A CZ  1 
ATOM   3651 N NH1 . ARG A 1 474 ? 71.779  38.525 11.467  1.00 33.40  ? 475  ARG A NH1 1 
ATOM   3652 N NH2 . ARG A 1 474 ? 73.208  36.749 11.682  1.00 40.44  ? 475  ARG A NH2 1 
ATOM   3653 N N   . LEU A 1 475 ? 71.237  38.233 17.925  1.00 26.76  ? 476  LEU A N   1 
ATOM   3654 C CA  . LEU A 1 475 ? 69.818  38.139 18.258  1.00 27.46  ? 476  LEU A CA  1 
ATOM   3655 C C   . LEU A 1 475 ? 69.517  38.779 19.612  1.00 29.97  ? 476  LEU A C   1 
ATOM   3656 O O   . LEU A 1 475 ? 68.492  39.454 19.770  1.00 32.65  ? 476  LEU A O   1 
ATOM   3657 C CB  . LEU A 1 475 ? 69.356  36.682 18.229  1.00 27.20  ? 476  LEU A CB  1 
ATOM   3658 C CG  . LEU A 1 475 ? 69.527  35.989 16.875  1.00 35.60  ? 476  LEU A CG  1 
ATOM   3659 C CD1 . LEU A 1 475 ? 68.786  34.668 16.851  1.00 36.13  ? 476  LEU A CD1 1 
ATOM   3660 C CD2 . LEU A 1 475 ? 69.063  36.880 15.742  1.00 33.53  ? 476  LEU A CD2 1 
ATOM   3661 N N   . MET A 1 476 ? 70.384  38.572 20.603  1.00 26.60  ? 477  MET A N   1 
ATOM   3662 C CA  . MET A 1 476 ? 70.235  39.295 21.866  1.00 29.45  ? 477  MET A CA  1 
ATOM   3663 C C   . MET A 1 476 ? 70.161  40.792 21.623  1.00 32.56  ? 477  MET A C   1 
ATOM   3664 O O   . MET A 1 476 ? 69.365  41.502 22.256  1.00 27.25  ? 477  MET A O   1 
ATOM   3665 C CB  . MET A 1 476 ? 71.416  38.978 22.776  1.00 27.24  ? 477  MET A CB  1 
ATOM   3666 C CG  . MET A 1 476 ? 71.416  37.582 23.335  1.00 39.82  ? 477  MET A CG  1 
ATOM   3667 S SD  . MET A 1 476 ? 72.881  37.347 24.346  1.00 50.05  ? 477  MET A SD  1 
ATOM   3668 C CE  . MET A 1 476 ? 72.163  36.514 25.682  1.00 44.21  ? 477  MET A CE  1 
ATOM   3669 N N   . ARG A 1 477 ? 70.981  41.285 20.695  1.00 25.81  ? 478  ARG A N   1 
ATOM   3670 C CA  . ARG A 1 477 ? 71.015  42.705 20.391  1.00 30.37  ? 478  ARG A CA  1 
ATOM   3671 C C   . ARG A 1 477 ? 69.708  43.171 19.750  1.00 35.02  ? 478  ARG A C   1 
ATOM   3672 O O   . ARG A 1 477 ? 69.187  44.236 20.103  1.00 31.99  ? 478  ARG A O   1 
ATOM   3673 C CB  . ARG A 1 477 ? 72.213  42.988 19.487  1.00 33.06  ? 478  ARG A CB  1 
ATOM   3674 C CG  . ARG A 1 477 ? 72.354  44.424 19.078  1.00 34.31  ? 478  ARG A CG  1 
ATOM   3675 C CD  . ARG A 1 477 ? 72.394  45.288 20.316  1.00 44.44  ? 478  ARG A CD  1 
ATOM   3676 N NE  . ARG A 1 477 ? 73.560  45.011 21.147  1.00 50.72  ? 478  ARG A NE  1 
ATOM   3677 C CZ  . ARG A 1 477 ? 74.785  45.451 20.880  1.00 56.58  ? 478  ARG A CZ  1 
ATOM   3678 N NH1 . ARG A 1 477 ? 75.002  46.184 19.797  1.00 57.29  ? 478  ARG A NH1 1 
ATOM   3679 N NH2 . ARG A 1 477 ? 75.793  45.156 21.691  1.00 60.19  ? 478  ARG A NH2 1 
ATOM   3680 N N   . TYR A 1 478 ? 69.175  42.393 18.796  1.00 34.91  ? 479  TYR A N   1 
ATOM   3681 C CA  . TYR A 1 478 ? 67.874  42.708 18.208  1.00 30.25  ? 479  TYR A CA  1 
ATOM   3682 C C   . TYR A 1 478 ? 66.794  42.782 19.278  1.00 29.39  ? 479  TYR A C   1 
ATOM   3683 O O   . TYR A 1 478 ? 66.021  43.745 19.336  1.00 28.52  ? 479  TYR A O   1 
ATOM   3684 C CB  . TYR A 1 478 ? 67.476  41.649 17.178  1.00 28.19  ? 479  TYR A CB  1 
ATOM   3685 C CG  . TYR A 1 478 ? 68.260  41.622 15.887  1.00 29.71  ? 479  TYR A CG  1 
ATOM   3686 C CD1 . TYR A 1 478 ? 68.720  42.791 15.289  1.00 33.57  ? 479  TYR A CD1 1 
ATOM   3687 C CD2 . TYR A 1 478 ? 68.517  40.414 15.254  1.00 29.14  ? 479  TYR A CD2 1 
ATOM   3688 C CE1 . TYR A 1 478 ? 69.423  42.751 14.102  1.00 33.60  ? 479  TYR A CE1 1 
ATOM   3689 C CE2 . TYR A 1 478 ? 69.216  40.363 14.069  1.00 35.78  ? 479  TYR A CE2 1 
ATOM   3690 C CZ  . TYR A 1 478 ? 69.666  41.529 13.497  1.00 35.58  ? 479  TYR A CZ  1 
ATOM   3691 O OH  . TYR A 1 478 ? 70.368  41.464 12.320  1.00 40.14  ? 479  TYR A OH  1 
ATOM   3692 N N   . TRP A 1 479 ? 66.711  41.747 20.117  1.00 25.43  ? 480  TRP A N   1 
ATOM   3693 C CA  . TRP A 1 479 ? 65.660  41.681 21.125  1.00 32.01  ? 480  TRP A CA  1 
ATOM   3694 C C   . TRP A 1 479 ? 65.781  42.830 22.121  1.00 30.40  ? 480  TRP A C   1 
ATOM   3695 O O   . TRP A 1 479 ? 64.787  43.487 22.452  1.00 27.62  ? 480  TRP A O   1 
ATOM   3696 C CB  . TRP A 1 479 ? 65.710  40.326 21.842  1.00 27.28  ? 480  TRP A CB  1 
ATOM   3697 C CG  . TRP A 1 479 ? 64.695  39.316 21.358  1.00 25.13  ? 480  TRP A CG  1 
ATOM   3698 C CD1 . TRP A 1 479 ? 63.713  38.717 22.106  1.00 26.05  ? 480  TRP A CD1 1 
ATOM   3699 C CD2 . TRP A 1 479 ? 64.564  38.782 20.028  1.00 20.32  ? 480  TRP A CD2 1 
ATOM   3700 N NE1 . TRP A 1 479 ? 62.983  37.851 21.326  1.00 24.76  ? 480  TRP A NE1 1 
ATOM   3701 C CE2 . TRP A 1 479 ? 63.484  37.870 20.049  1.00 20.88  ? 480  TRP A CE2 1 
ATOM   3702 C CE3 . TRP A 1 479 ? 65.253  38.985 18.826  1.00 25.17  ? 480  TRP A CE3 1 
ATOM   3703 C CZ2 . TRP A 1 479 ? 63.074  37.168 18.912  1.00 21.09  ? 480  TRP A CZ2 1 
ATOM   3704 C CZ3 . TRP A 1 479 ? 64.849  38.283 17.699  1.00 26.88  ? 480  TRP A CZ3 1 
ATOM   3705 C CH2 . TRP A 1 479 ? 63.768  37.383 17.751  1.00 25.12  ? 480  TRP A CH2 1 
ATOM   3706 N N   . ALA A 1 480 ? 66.997  43.096 22.604  1.00 30.32  ? 481  ALA A N   1 
ATOM   3707 C CA  . ALA A 1 480 ? 67.169  44.165 23.583  1.00 29.68  ? 481  ALA A CA  1 
ATOM   3708 C C   . ALA A 1 480 ? 66.979  45.534 22.944  1.00 34.26  ? 481  ALA A C   1 
ATOM   3709 O O   . ALA A 1 480 ? 66.409  46.437 23.570  1.00 32.55  ? 481  ALA A O   1 
ATOM   3710 C CB  . ALA A 1 480 ? 68.540  44.062 24.251  1.00 26.14  ? 481  ALA A CB  1 
ATOM   3711 N N   . ASN A 1 481 ? 67.454  45.711 21.701  1.00 30.02  ? 482  ASN A N   1 
ATOM   3712 C CA  . ASN A 1 481 ? 67.142  46.934 20.963  1.00 34.94  ? 482  ASN A CA  1 
ATOM   3713 C C   . ASN A 1 481 ? 65.640  47.172 20.913  1.00 33.87  ? 482  ASN A C   1 
ATOM   3714 O O   . ASN A 1 481 ? 65.172  48.298 21.121  1.00 32.37  ? 482  ASN A O   1 
ATOM   3715 C CB  . ASN A 1 481 ? 67.691  46.868 19.536  1.00 34.32  ? 482  ASN A CB  1 
ATOM   3716 C CG  . ASN A 1 481 ? 69.164  47.218 19.447  1.00 34.66  ? 482  ASN A CG  1 
ATOM   3717 O OD1 . ASN A 1 481 ? 69.781  47.636 20.426  1.00 35.58  ? 482  ASN A OD1 1 
ATOM   3718 N ND2 . ASN A 1 481 ? 69.730  47.069 18.255  1.00 35.11  ? 482  ASN A ND2 1 
ATOM   3719 N N   . PHE A 1 482 ? 64.868  46.122 20.630  1.00 30.19  ? 483  PHE A N   1 
ATOM   3720 C CA  . PHE A 1 482 ? 63.423  46.281 20.562  1.00 32.60  ? 483  PHE A CA  1 
ATOM   3721 C C   . PHE A 1 482 ? 62.849  46.651 21.923  1.00 35.24  ? 483  PHE A C   1 
ATOM   3722 O O   . PHE A 1 482 ? 61.982  47.527 22.019  1.00 33.49  ? 483  PHE A O   1 
ATOM   3723 C CB  . PHE A 1 482 ? 62.768  45.006 20.030  1.00 26.71  ? 483  PHE A CB  1 
ATOM   3724 C CG  . PHE A 1 482 ? 61.272  45.065 20.034  1.00 29.45  ? 483  PHE A CG  1 
ATOM   3725 C CD1 . PHE A 1 482 ? 60.590  45.716 19.016  1.00 27.00  ? 483  PHE A CD1 1 
ATOM   3726 C CD2 . PHE A 1 482 ? 60.546  44.498 21.068  1.00 24.64  ? 483  PHE A CD2 1 
ATOM   3727 C CE1 . PHE A 1 482 ? 59.210  45.787 19.023  1.00 27.32  ? 483  PHE A CE1 1 
ATOM   3728 C CE2 . PHE A 1 482 ? 59.165  44.565 21.080  1.00 27.53  ? 483  PHE A CE2 1 
ATOM   3729 C CZ  . PHE A 1 482 ? 58.497  45.209 20.057  1.00 27.56  ? 483  PHE A CZ  1 
ATOM   3730 N N   . ALA A 1 483 ? 63.321  45.995 22.989  1.00 30.67  ? 484  ALA A N   1 
ATOM   3731 C CA  . ALA A 1 483 ? 62.839  46.323 24.328  1.00 28.82  ? 484  ALA A CA  1 
ATOM   3732 C C   . ALA A 1 483 ? 63.143  47.772 24.685  1.00 32.41  ? 484  ALA A C   1 
ATOM   3733 O O   . ALA A 1 483 ? 62.296  48.471 25.253  1.00 33.21  ? 484  ALA A O   1 
ATOM   3734 C CB  . ALA A 1 483 ? 63.458  45.377 25.356  1.00 31.75  ? 484  ALA A CB  1 
ATOM   3735 N N   . ARG A 1 484 ? 64.342  48.249 24.344  1.00 33.17  ? 485  ARG A N   1 
ATOM   3736 C CA  . ARG A 1 484 ? 64.719  49.614 24.694  1.00 34.38  ? 485  ARG A CA  1 
ATOM   3737 C C   . ARG A 1 484 ? 63.937  50.644 23.882  1.00 38.26  ? 485  ARG A C   1 
ATOM   3738 O O   . ARG A 1 484 ? 63.481  51.651 24.434  1.00 40.77  ? 485  ARG A O   1 
ATOM   3739 C CB  . ARG A 1 484 ? 66.224  49.814 24.499  1.00 36.16  ? 485  ARG A CB  1 
ATOM   3740 C CG  . ARG A 1 484 ? 67.088  49.170 25.577  1.00 40.14  ? 485  ARG A CG  1 
ATOM   3741 C CD  . ARG A 1 484 ? 68.565  49.479 25.365  1.00 39.13  ? 485  ARG A CD  1 
ATOM   3742 N NE  . ARG A 1 484 ? 69.105  48.765 24.212  1.00 36.53  ? 485  ARG A NE  1 
ATOM   3743 C CZ  . ARG A 1 484 ? 69.848  47.665 24.290  1.00 36.57  ? 485  ARG A CZ  1 
ATOM   3744 N NH1 . ARG A 1 484 ? 70.155  47.147 25.474  1.00 31.92  ? 485  ARG A NH1 1 
ATOM   3745 N NH2 . ARG A 1 484 ? 70.287  47.083 23.181  1.00 35.11  ? 485  ARG A NH2 1 
ATOM   3746 N N   . THR A 1 485 ? 63.766  50.412 22.575  1.00 36.47  ? 486  THR A N   1 
ATOM   3747 C CA  . THR A 1 485 ? 63.283  51.446 21.667  1.00 37.00  ? 486  THR A CA  1 
ATOM   3748 C C   . THR A 1 485 ? 62.044  51.076 20.865  1.00 37.21  ? 486  THR A C   1 
ATOM   3749 O O   . THR A 1 485 ? 61.527  51.938 20.146  1.00 33.64  ? 486  THR A O   1 
ATOM   3750 C CB  . THR A 1 485 ? 64.380  51.837 20.661  1.00 36.97  ? 486  THR A CB  1 
ATOM   3751 O OG1 . THR A 1 485 ? 64.494  50.808 19.666  1.00 34.72  ? 486  THR A OG1 1 
ATOM   3752 C CG2 . THR A 1 485 ? 65.723  52.017 21.359  1.00 32.70  ? 486  THR A CG2 1 
ATOM   3753 N N   . GLY A 1 486 ? 61.561  49.837 20.940  1.00 35.57  ? 487  GLY A N   1 
ATOM   3754 C CA  . GLY A 1 486 ? 60.501  49.423 20.037  1.00 27.52  ? 487  GLY A CA  1 
ATOM   3755 C C   . GLY A 1 486 ? 60.952  49.165 18.618  1.00 34.76  ? 487  GLY A C   1 
ATOM   3756 O O   . GLY A 1 486 ? 60.110  48.967 17.733  1.00 32.00  ? 487  GLY A O   1 
ATOM   3757 N N   . ASP A 1 487 ? 62.258  49.156 18.375  1.00 34.44  ? 488  ASP A N   1 
ATOM   3758 C CA  . ASP A 1 487 ? 62.820  48.973 17.046  1.00 36.06  ? 488  ASP A CA  1 
ATOM   3759 C C   . ASP A 1 487 ? 64.048  48.080 17.167  1.00 33.66  ? 488  ASP A C   1 
ATOM   3760 O O   . ASP A 1 487 ? 65.027  48.453 17.828  1.00 38.82  ? 488  ASP A O   1 
ATOM   3761 C CB  . ASP A 1 487 ? 63.172  50.333 16.432  1.00 37.93  ? 488  ASP A CB  1 
ATOM   3762 C CG  . ASP A 1 487 ? 63.652  50.238 14.988  1.00 37.10  ? 488  ASP A CG  1 
ATOM   3763 O OD1 . ASP A 1 487 ? 64.068  49.146 14.543  1.00 33.46  ? 488  ASP A OD1 1 
ATOM   3764 O OD2 . ASP A 1 487 ? 63.624  51.281 14.295  1.00 44.27  ? 488  ASP A OD2 1 
ATOM   3765 N N   . PRO A 1 488 ? 64.042  46.897 16.549  1.00 36.35  ? 489  PRO A N   1 
ATOM   3766 C CA  . PRO A 1 488 ? 65.211  46.010 16.654  1.00 37.76  ? 489  PRO A CA  1 
ATOM   3767 C C   . PRO A 1 488 ? 66.444  46.536 15.936  1.00 41.60  ? 489  PRO A C   1 
ATOM   3768 O O   . PRO A 1 488 ? 67.540  46.012 16.174  1.00 38.32  ? 489  PRO A O   1 
ATOM   3769 C CB  . PRO A 1 488 ? 64.717  44.702 16.022  1.00 35.75  ? 489  PRO A CB  1 
ATOM   3770 C CG  . PRO A 1 488 ? 63.678  45.146 15.037  1.00 36.45  ? 489  PRO A CG  1 
ATOM   3771 C CD  . PRO A 1 488 ? 62.999  46.343 15.665  1.00 35.04  ? 489  PRO A CD  1 
ATOM   3772 N N   . ASN A 1 489 ? 66.306  47.552 15.084  1.00 36.83  ? 490  ASN A N   1 
ATOM   3773 C CA  . ASN A 1 489 ? 67.429  48.061 14.309  1.00 43.05  ? 490  ASN A CA  1 
ATOM   3774 C C   . ASN A 1 489 ? 68.345  48.930 15.165  1.00 47.45  ? 490  ASN A C   1 
ATOM   3775 O O   . ASN A 1 489 ? 67.923  49.527 16.160  1.00 50.76  ? 490  ASN A O   1 
ATOM   3776 C CB  . ASN A 1 489 ? 66.934  48.863 13.107  1.00 36.17  ? 490  ASN A CB  1 
ATOM   3777 C CG  . ASN A 1 489 ? 66.297  47.987 12.051  1.00 40.18  ? 490  ASN A CG  1 
ATOM   3778 O OD1 . ASN A 1 489 ? 66.993  47.295 11.307  1.00 45.01  ? 490  ASN A OD1 1 
ATOM   3779 N ND2 . ASN A 1 489 ? 64.969  48.018 11.971  1.00 33.87  ? 490  ASN A ND2 1 
ATOM   3780 N N   . GLU A 1 490 ? 69.620  48.960 14.813  1.00 70.09  ? 491  GLU A N   1 
ATOM   3781 C CA  . GLU A 1 490 ? 70.646  49.716 15.544  1.00 88.09  ? 491  GLU A CA  1 
ATOM   3782 C C   . GLU A 1 490 ? 70.693  51.228 15.307  1.00 93.54  ? 491  GLU A C   1 
ATOM   3783 O O   . GLU A 1 490 ? 70.772  51.700 14.188  1.00 97.75  ? 491  GLU A O   1 
ATOM   3784 C CB  . GLU A 1 490 ? 72.029  49.138 15.261  1.00 96.78  ? 491  GLU A CB  1 
ATOM   3785 C CG  . GLU A 1 490 ? 72.329  47.797 15.910  1.00 102.12 ? 491  GLU A CG  1 
ATOM   3786 C CD  . GLU A 1 490 ? 72.653  47.904 17.383  1.00 107.16 ? 491  GLU A CD  1 
ATOM   3787 O OE1 . GLU A 1 490 ? 73.091  46.925 17.968  1.00 108.96 ? 491  GLU A OE1 1 
ATOM   3788 O OE2 . GLU A 1 490 ? 72.467  48.969 17.971  1.00 102.87 ? 491  GLU A OE2 1 
ATOM   3789 N N   . PRO A 1 491 ? 70.654  51.986 16.380  1.00 97.62  ? 492  PRO A N   1 
ATOM   3790 C CA  . PRO A 1 491 ? 70.668  53.443 16.289  1.00 104.54 ? 492  PRO A CA  1 
ATOM   3791 C C   . PRO A 1 491 ? 71.855  53.944 15.473  1.00 111.66 ? 492  PRO A C   1 
ATOM   3792 O O   . PRO A 1 491 ? 71.648  54.577 14.438  1.00 114.42 ? 492  PRO A O   1 
ATOM   3793 C CB  . PRO A 1 491 ? 70.782  53.885 17.753  1.00 104.42 ? 492  PRO A CB  1 
ATOM   3794 C CG  . PRO A 1 491 ? 70.345  52.700 18.554  1.00 99.45  ? 492  PRO A CG  1 
ATOM   3795 C CD  . PRO A 1 491 ? 70.775  51.514 17.769  1.00 95.71  ? 492  PRO A CD  1 
ATOM   3796 N N   . ALA A 1 496 ? 74.843  48.409 7.619   1.00 93.90  ? 497  ALA A N   1 
ATOM   3797 C CA  . ALA A 1 496 ? 73.986  47.492 8.380   1.00 92.09  ? 497  ALA A CA  1 
ATOM   3798 C C   . ALA A 1 496 ? 72.629  47.163 7.732   1.00 89.06  ? 497  ALA A C   1 
ATOM   3799 O O   . ALA A 1 496 ? 71.811  48.043 7.518   1.00 92.15  ? 497  ALA A O   1 
ATOM   3800 C CB  . ALA A 1 496 ? 73.777  48.019 9.783   1.00 91.40  ? 497  ALA A CB  1 
ATOM   3801 N N   . PRO A 1 497 ? 72.404  45.821 7.441   1.00 82.85  ? 498  PRO A N   1 
ATOM   3802 C CA  . PRO A 1 497 ? 71.104  45.538 6.816   1.00 82.71  ? 498  PRO A CA  1 
ATOM   3803 C C   . PRO A 1 497 ? 70.007  45.934 7.765   1.00 77.65  ? 498  PRO A C   1 
ATOM   3804 O O   . PRO A 1 497 ? 70.078  45.682 8.946   1.00 90.24  ? 498  PRO A O   1 
ATOM   3805 C CB  . PRO A 1 497 ? 71.114  44.034 6.645   1.00 80.71  ? 498  PRO A CB  1 
ATOM   3806 C CG  . PRO A 1 497 ? 72.523  43.698 6.520   1.00 77.82  ? 498  PRO A CG  1 
ATOM   3807 C CD  . PRO A 1 497 ? 73.116  44.488 7.604   1.00 78.73  ? 498  PRO A CD  1 
ATOM   3808 N N   . GLN A 1 498 ? 68.993  46.565 7.238   1.00 57.52  ? 499  GLN A N   1 
ATOM   3809 C CA  . GLN A 1 498 ? 67.935  47.077 8.039   1.00 55.03  ? 499  GLN A CA  1 
ATOM   3810 C C   . GLN A 1 498 ? 66.751  46.114 8.072   1.00 54.68  ? 499  GLN A C   1 
ATOM   3811 O O   . GLN A 1 498 ? 66.512  45.394 7.138   1.00 52.20  ? 499  GLN A O   1 
ATOM   3812 C CB  . GLN A 1 498 ? 67.577  48.432 7.447   1.00 58.90  ? 499  GLN A CB  1 
ATOM   3813 C CG  . GLN A 1 498 ? 67.320  49.575 8.403   1.00 65.64  ? 499  GLN A CG  1 
ATOM   3814 C CD  . GLN A 1 498 ? 68.380  49.802 9.454   1.00 69.37  ? 499  GLN A CD  1 
ATOM   3815 O OE1 . GLN A 1 498 ? 69.526  49.439 9.307   1.00 72.46  ? 499  GLN A OE1 1 
ATOM   3816 N NE2 . GLN A 1 498 ? 67.987  50.447 10.510  1.00 66.15  ? 499  GLN A NE2 1 
ATOM   3817 N N   . TRP A 1 499 ? 66.031  46.106 9.175   1.00 52.93  ? 500  TRP A N   1 
ATOM   3818 C CA  . TRP A 1 499 ? 64.862  45.249 9.371   1.00 37.20  ? 500  TRP A CA  1 
ATOM   3819 C C   . TRP A 1 499 ? 63.601  46.073 9.174   1.00 37.14  ? 500  TRP A C   1 
ATOM   3820 O O   . TRP A 1 499 ? 63.255  46.886 10.052  1.00 43.69  ? 500  TRP A O   1 
ATOM   3821 C CB  . TRP A 1 499 ? 64.907  44.646 10.768  1.00 43.02  ? 500  TRP A CB  1 
ATOM   3822 C CG  . TRP A 1 499 ? 63.854  43.616 11.124  1.00 33.75  ? 500  TRP A CG  1 
ATOM   3823 C CD1 . TRP A 1 499 ? 62.635  43.413 10.533  1.00 33.84  ? 500  TRP A CD1 1 
ATOM   3824 C CD2 . TRP A 1 499 ? 63.952  42.648 12.173  1.00 33.88  ? 500  TRP A CD2 1 
ATOM   3825 N NE1 . TRP A 1 499 ? 61.971  42.381 11.154  1.00 33.27  ? 500  TRP A NE1 1 
ATOM   3826 C CE2 . TRP A 1 499 ? 62.759  41.896 12.166  1.00 35.08  ? 500  TRP A CE2 1 
ATOM   3827 C CE3 . TRP A 1 499 ? 64.936  42.348 13.124  1.00 33.67  ? 500  TRP A CE3 1 
ATOM   3828 C CZ2 . TRP A 1 499 ? 62.534  40.857 13.064  1.00 30.98  ? 500  TRP A CZ2 1 
ATOM   3829 C CZ3 . TRP A 1 499 ? 64.712  41.324 14.007  1.00 32.50  ? 500  TRP A CZ3 1 
ATOM   3830 C CH2 . TRP A 1 499 ? 63.522  40.590 13.977  1.00 31.29  ? 500  TRP A CH2 1 
ATOM   3831 N N   . PRO A 1 500 ? 62.882  45.917 8.073   1.00 39.49  ? 501  PRO A N   1 
ATOM   3832 C CA  . PRO A 1 500 ? 61.737  46.785 7.803   1.00 36.75  ? 501  PRO A CA  1 
ATOM   3833 C C   . PRO A 1 500 ? 60.519  46.344 8.589   1.00 34.84  ? 501  PRO A C   1 
ATOM   3834 O O   . PRO A 1 500 ? 60.374  45.155 8.896   1.00 32.82  ? 501  PRO A O   1 
ATOM   3835 C CB  . PRO A 1 500 ? 61.487  46.596 6.277   1.00 36.69  ? 501  PRO A CB  1 
ATOM   3836 C CG  . PRO A 1 500 ? 62.073  45.245 5.967   1.00 39.23  ? 501  PRO A CG  1 
ATOM   3837 C CD  . PRO A 1 500 ? 63.168  44.971 6.967   1.00 37.86  ? 501  PRO A CD  1 
ATOM   3838 N N   . PRO A 1 501 ? 59.637  47.264 8.958   1.00 35.65  ? 502  PRO A N   1 
ATOM   3839 C CA  . PRO A 1 501 ? 58.401  46.858 9.643   1.00 34.06  ? 502  PRO A CA  1 
ATOM   3840 C C   . PRO A 1 501 ? 57.524  45.987 8.755   1.00 38.44  ? 502  PRO A C   1 
ATOM   3841 O O   . PRO A 1 501 ? 57.516  46.108 7.527   1.00 35.90  ? 502  PRO A O   1 
ATOM   3842 C CB  . PRO A 1 501 ? 57.699  48.186 9.976   1.00 35.92  ? 502  PRO A CB  1 
ATOM   3843 C CG  . PRO A 1 501 ? 58.611  49.280 9.553   1.00 38.55  ? 502  PRO A CG  1 
ATOM   3844 C CD  . PRO A 1 501 ? 59.913  48.707 9.092   1.00 38.42  ? 502  PRO A CD  1 
ATOM   3845 N N   . TYR A 1 502 ? 56.788  45.086 9.401   1.00 38.57  ? 503  TYR A N   1 
ATOM   3846 C CA  . TYR A 1 502 ? 55.804  44.262 8.719   1.00 34.23  ? 503  TYR A CA  1 
ATOM   3847 C C   . TYR A 1 502 ? 54.514  45.050 8.519   1.00 37.68  ? 503  TYR A C   1 
ATOM   3848 O O   . TYR A 1 502 ? 54.049  45.751 9.423   1.00 37.41  ? 503  TYR A O   1 
ATOM   3849 C CB  . TYR A 1 502 ? 55.535  42.993 9.534   1.00 31.54  ? 503  TYR A CB  1 
ATOM   3850 C CG  . TYR A 1 502 ? 54.529  42.050 8.922   1.00 26.59  ? 503  TYR A CG  1 
ATOM   3851 C CD1 . TYR A 1 502 ? 54.943  40.997 8.114   1.00 24.90  ? 503  TYR A CD1 1 
ATOM   3852 C CD2 . TYR A 1 502 ? 53.167  42.204 9.156   1.00 32.99  ? 503  TYR A CD2 1 
ATOM   3853 C CE1 . TYR A 1 502 ? 54.030  40.128 7.549   1.00 28.24  ? 503  TYR A CE1 1 
ATOM   3854 C CE2 . TYR A 1 502 ? 52.241  41.340 8.588   1.00 32.71  ? 503  TYR A CE2 1 
ATOM   3855 C CZ  . TYR A 1 502 ? 52.680  40.301 7.792   1.00 32.63  ? 503  TYR A CZ  1 
ATOM   3856 O OH  . TYR A 1 502 ? 51.772  39.431 7.233   1.00 36.19  ? 503  TYR A OH  1 
ATOM   3857 N N   . THR A 1 503 ? 53.939  44.943 7.322   1.00 37.80  ? 504  THR A N   1 
ATOM   3858 C CA  . THR A 1 503 ? 52.681  45.602 6.991   1.00 38.39  ? 504  THR A CA  1 
ATOM   3859 C C   . THR A 1 503 ? 51.773  44.619 6.264   1.00 38.97  ? 504  THR A C   1 
ATOM   3860 O O   . THR A 1 503 ? 52.234  43.648 5.661   1.00 37.71  ? 504  THR A O   1 
ATOM   3861 C CB  . THR A 1 503 ? 52.886  46.838 6.114   1.00 40.06  ? 504  THR A CB  1 
ATOM   3862 O OG1 . THR A 1 503 ? 53.523  46.441 4.894   1.00 38.88  ? 504  THR A OG1 1 
ATOM   3863 C CG2 . THR A 1 503 ? 53.746  47.880 6.829   1.00 37.52  ? 504  THR A CG2 1 
ATOM   3864 N N   . ALA A 1 504 ? 50.468  44.890 6.313   1.00 40.91  ? 505  ALA A N   1 
ATOM   3865 C CA  . ALA A 1 504 ? 49.510  43.952 5.737   1.00 42.02  ? 505  ALA A CA  1 
ATOM   3866 C C   . ALA A 1 504 ? 49.654  43.847 4.223   1.00 42.47  ? 505  ALA A C   1 
ATOM   3867 O O   . ALA A 1 504 ? 49.337  42.802 3.645   1.00 45.12  ? 505  ALA A O   1 
ATOM   3868 C CB  . ALA A 1 504 ? 48.085  44.356 6.113   1.00 43.12  ? 505  ALA A CB  1 
ATOM   3869 N N   . GLY A 1 505 ? 50.135  44.901 3.568   1.00 42.42  ? 506  GLY A N   1 
ATOM   3870 C CA  . GLY A 1 505 ? 50.328  44.874 2.130   1.00 37.14  ? 506  GLY A CA  1 
ATOM   3871 C C   . GLY A 1 505 ? 51.633  44.224 1.713   1.00 42.10  ? 506  GLY A C   1 
ATOM   3872 O O   . GLY A 1 505 ? 51.630  43.151 1.103   1.00 42.86  ? 506  GLY A O   1 
ATOM   3873 N N   . ALA A 1 506 ? 52.761  44.858 2.050   1.00 39.03  ? 507  ALA A N   1 
ATOM   3874 C CA  . ALA A 1 506 ? 54.055  44.340 1.615   1.00 35.49  ? 507  ALA A CA  1 
ATOM   3875 C C   . ALA A 1 506 ? 54.441  43.064 2.358   1.00 35.99  ? 507  ALA A C   1 
ATOM   3876 O O   . ALA A 1 506 ? 55.151  42.218 1.799   1.00 36.20  ? 507  ALA A O   1 
ATOM   3877 C CB  . ALA A 1 506 ? 55.132  45.412 1.786   1.00 33.77  ? 507  ALA A CB  1 
ATOM   3878 N N   . GLN A 1 507 ? 54.000  42.914 3.611   1.00 34.32  ? 508  GLN A N   1 
ATOM   3879 C CA  . GLN A 1 507 ? 54.173  41.677 4.381   1.00 34.39  ? 508  GLN A CA  1 
ATOM   3880 C C   . GLN A 1 507 ? 55.644  41.282 4.518   1.00 35.76  ? 508  GLN A C   1 
ATOM   3881 O O   . GLN A 1 507 ? 55.995  40.100 4.467   1.00 30.77  ? 508  GLN A O   1 
ATOM   3882 C CB  . GLN A 1 507 ? 53.366  40.525 3.772   1.00 31.91  ? 508  GLN A CB  1 
ATOM   3883 C CG  . GLN A 1 507 ? 51.865  40.757 3.706   1.00 38.32  ? 508  GLN A CG  1 
ATOM   3884 C CD  . GLN A 1 507 ? 51.165  39.759 2.787   1.00 42.21  ? 508  GLN A CD  1 
ATOM   3885 O OE1 . GLN A 1 507 ? 51.170  38.552 3.039   1.00 39.07  ? 508  GLN A OE1 1 
ATOM   3886 N NE2 . GLN A 1 507 ? 50.573  40.261 1.708   1.00 40.85  ? 508  GLN A NE2 1 
ATOM   3887 N N   . GLN A 1 508 ? 56.510  42.267 4.722   1.00 28.05  ? 509  GLN A N   1 
ATOM   3888 C CA  . GLN A 1 508 ? 57.940  41.996 4.781   1.00 32.88  ? 509  GLN A CA  1 
ATOM   3889 C C   . GLN A 1 508 ? 58.363  41.434 6.134   1.00 34.43  ? 509  GLN A C   1 
ATOM   3890 O O   . GLN A 1 508 ? 57.935  41.912 7.191   1.00 31.40  ? 509  GLN A O   1 
ATOM   3891 C CB  . GLN A 1 508 ? 58.732  43.262 4.488   1.00 34.23  ? 509  GLN A CB  1 
ATOM   3892 C CG  . GLN A 1 508 ? 58.451  43.849 3.126   1.00 39.20  ? 509  GLN A CG  1 
ATOM   3893 C CD  . GLN A 1 508 ? 59.068  45.215 2.967   1.00 40.97  ? 509  GLN A CD  1 
ATOM   3894 O OE1 . GLN A 1 508 ? 58.538  46.205 3.460   1.00 44.41  ? 509  GLN A OE1 1 
ATOM   3895 N NE2 . GLN A 1 508 ? 60.194  45.273 2.277   1.00 46.36  ? 509  GLN A NE2 1 
ATOM   3896 N N   . TYR A 1 509 ? 59.213  40.408 6.088   1.00 31.10  ? 510  TYR A N   1 
ATOM   3897 C CA  . TYR A 1 509 ? 59.854  39.853 7.271   1.00 31.49  ? 510  TYR A CA  1 
ATOM   3898 C C   . TYR A 1 509 ? 61.323  39.616 6.944   1.00 35.16  ? 510  TYR A C   1 
ATOM   3899 O O   . TYR A 1 509 ? 61.747  39.730 5.790   1.00 33.56  ? 510  TYR A O   1 
ATOM   3900 C CB  . TYR A 1 509 ? 59.179  38.554 7.719   1.00 27.70  ? 510  TYR A CB  1 
ATOM   3901 C CG  . TYR A 1 509 ? 59.372  37.409 6.751   1.00 28.24  ? 510  TYR A CG  1 
ATOM   3902 C CD1 . TYR A 1 509 ? 58.515  37.228 5.670   1.00 25.84  ? 510  TYR A CD1 1 
ATOM   3903 C CD2 . TYR A 1 509 ? 60.416  36.513 6.916   1.00 31.36  ? 510  TYR A CD2 1 
ATOM   3904 C CE1 . TYR A 1 509 ? 58.693  36.183 4.790   1.00 30.93  ? 510  TYR A CE1 1 
ATOM   3905 C CE2 . TYR A 1 509 ? 60.609  35.472 6.034   1.00 31.96  ? 510  TYR A CE2 1 
ATOM   3906 C CZ  . TYR A 1 509 ? 59.742  35.305 4.979   1.00 37.48  ? 510  TYR A CZ  1 
ATOM   3907 O OH  . TYR A 1 509 ? 59.936  34.258 4.108   1.00 39.05  ? 510  TYR A OH  1 
ATOM   3908 N N   . VAL A 1 510 ? 62.107  39.278 7.966   1.00 32.60  ? 511  VAL A N   1 
ATOM   3909 C CA  . VAL A 1 510 ? 63.515  38.962 7.763   1.00 33.66  ? 511  VAL A CA  1 
ATOM   3910 C C   . VAL A 1 510 ? 63.772  37.521 8.175   1.00 32.40  ? 511  VAL A C   1 
ATOM   3911 O O   . VAL A 1 510 ? 63.123  36.975 9.073   1.00 35.64  ? 511  VAL A O   1 
ATOM   3912 C CB  . VAL A 1 510 ? 64.466  39.912 8.527   1.00 33.80  ? 511  VAL A CB  1 
ATOM   3913 C CG1 . VAL A 1 510 ? 64.317  41.346 8.027   1.00 31.64  ? 511  VAL A CG1 1 
ATOM   3914 C CG2 . VAL A 1 510 ? 64.239  39.816 10.033  1.00 29.76  ? 511  VAL A CG2 1 
ATOM   3915 N N   . SER A 1 511 ? 64.733  36.907 7.502   1.00 35.11  ? 512  SER A N   1 
ATOM   3916 C CA  . SER A 1 511 ? 65.240  35.603 7.893   1.00 34.11  ? 512  SER A CA  1 
ATOM   3917 C C   . SER A 1 511 ? 66.386  35.815 8.869   1.00 34.24  ? 512  SER A C   1 
ATOM   3918 O O   . SER A 1 511 ? 67.264  36.650 8.632   1.00 31.50  ? 512  SER A O   1 
ATOM   3919 C CB  . SER A 1 511 ? 65.716  34.818 6.671   1.00 34.08  ? 512  SER A CB  1 
ATOM   3920 O OG  . SER A 1 511 ? 66.709  35.553 5.976   1.00 45.67  ? 512  SER A OG  1 
ATOM   3921 N N   . LEU A 1 512 ? 66.362  35.085 9.976   1.00 30.56  ? 513  LEU A N   1 
ATOM   3922 C CA  . LEU A 1 512 ? 67.435  35.119 10.957  1.00 31.67  ? 513  LEU A CA  1 
ATOM   3923 C C   . LEU A 1 512 ? 68.197  33.802 10.864  1.00 34.22  ? 513  LEU A C   1 
ATOM   3924 O O   . LEU A 1 512 ? 67.647  32.734 11.158  1.00 29.75  ? 513  LEU A O   1 
ATOM   3925 C CB  . LEU A 1 512 ? 66.900  35.375 12.362  1.00 34.21  ? 513  LEU A CB  1 
ATOM   3926 C CG  . LEU A 1 512 ? 65.979  36.580 12.567  1.00 34.95  ? 513  LEU A CG  1 
ATOM   3927 C CD1 . LEU A 1 512 ? 65.250  36.408 13.885  1.00 31.89  ? 513  LEU A CD1 1 
ATOM   3928 C CD2 . LEU A 1 512 ? 66.762  37.888 12.539  1.00 31.34  ? 513  LEU A CD2 1 
ATOM   3929 N N   . ASP A 1 513 ? 69.446  33.885 10.422  1.00 32.53  ? 514  ASP A N   1 
ATOM   3930 C CA  . ASP A 1 513 ? 70.342  32.746 10.311  1.00 33.54  ? 514  ASP A CA  1 
ATOM   3931 C C   . ASP A 1 513 ? 71.758  33.296 10.390  1.00 35.95  ? 514  ASP A C   1 
ATOM   3932 O O   . ASP A 1 513 ? 71.961  34.468 10.723  1.00 36.73  ? 514  ASP A O   1 
ATOM   3933 C CB  . ASP A 1 513 ? 70.071  31.957 9.026   1.00 43.56  ? 514  ASP A CB  1 
ATOM   3934 C CG  . ASP A 1 513 ? 70.144  32.821 7.774   1.00 51.39  ? 514  ASP A CG  1 
ATOM   3935 O OD1 . ASP A 1 513 ? 69.695  32.338 6.721   1.00 58.55  ? 514  ASP A OD1 1 
ATOM   3936 O OD2 . ASP A 1 513 ? 70.647  33.965 7.831   1.00 55.90  ? 514  ASP A OD2 1 
ATOM   3937 N N   . LEU A 1 514 ? 72.743  32.463 10.063  1.00 37.39  ? 515  LEU A N   1 
ATOM   3938 C CA  . LEU A 1 514 ? 74.128  32.910 10.145  1.00 39.98  ? 515  LEU A CA  1 
ATOM   3939 C C   . LEU A 1 514 ? 74.478  33.952 9.088   1.00 42.29  ? 515  LEU A C   1 
ATOM   3940 O O   . LEU A 1 514 ? 75.470  34.671 9.252   1.00 48.88  ? 515  LEU A O   1 
ATOM   3941 C CB  . LEU A 1 514 ? 75.067  31.712 10.043  1.00 41.50  ? 515  LEU A CB  1 
ATOM   3942 C CG  . LEU A 1 514 ? 74.893  30.658 11.136  1.00 46.37  ? 515  LEU A CG  1 
ATOM   3943 C CD1 . LEU A 1 514 ? 75.898  29.528 10.938  1.00 43.13  ? 515  LEU A CD1 1 
ATOM   3944 C CD2 . LEU A 1 514 ? 74.997  31.295 12.530  1.00 41.69  ? 515  LEU A CD2 1 
ATOM   3945 N N   . ARG A 1 515 ? 73.693  34.055 8.020   1.00 39.68  ? 516  ARG A N   1 
ATOM   3946 C CA  . ARG A 1 515 ? 73.914  35.065 7.001   1.00 47.15  ? 516  ARG A CA  1 
ATOM   3947 C C   . ARG A 1 515 ? 73.331  36.391 7.465   1.00 43.99  ? 516  ARG A C   1 
ATOM   3948 O O   . ARG A 1 515 ? 72.548  36.441 8.415   1.00 45.52  ? 516  ARG A O   1 
ATOM   3949 C CB  . ARG A 1 515 ? 73.274  34.631 5.684   1.00 45.26  ? 516  ARG A CB  1 
ATOM   3950 C CG  . ARG A 1 515 ? 73.439  33.161 5.337   1.00 53.52  ? 516  ARG A CG  1 
ATOM   3951 C CD  . ARG A 1 515 ? 72.731  32.852 4.027   1.00 63.86  ? 516  ARG A CD  1 
ATOM   3952 N NE  . ARG A 1 515 ? 71.532  33.674 3.855   1.00 73.83  ? 516  ARG A NE  1 
ATOM   3953 C CZ  . ARG A 1 515 ? 70.296  33.271 4.132   1.00 72.91  ? 516  ARG A CZ  1 
ATOM   3954 N NH1 . ARG A 1 515 ? 70.088  32.046 4.595   1.00 77.03  ? 516  ARG A NH1 1 
ATOM   3955 N NH2 . ARG A 1 515 ? 69.265  34.088 3.951   1.00 64.29  ? 516  ARG A NH2 1 
ATOM   3956 N N   . PRO A 1 516 ? 73.711  37.495 6.824   1.00 44.29  ? 517  PRO A N   1 
ATOM   3957 C CA  . PRO A 1 516 ? 73.064  38.776 7.127   1.00 43.99  ? 517  PRO A CA  1 
ATOM   3958 C C   . PRO A 1 516 ? 71.569  38.716 6.856   1.00 43.03  ? 517  PRO A C   1 
ATOM   3959 O O   . PRO A 1 516 ? 71.077  37.857 6.119   1.00 40.65  ? 517  PRO A O   1 
ATOM   3960 C CB  . PRO A 1 516 ? 73.756  39.774 6.187   1.00 47.14  ? 517  PRO A CB  1 
ATOM   3961 C CG  . PRO A 1 516 ? 74.953  39.083 5.640   1.00 46.62  ? 517  PRO A CG  1 
ATOM   3962 C CD  . PRO A 1 516 ? 74.956  37.652 6.051   1.00 47.19  ? 517  PRO A CD  1 
ATOM   3963 N N   . LEU A 1 517 ? 70.846  39.652 7.474   1.00 38.71  ? 518  LEU A N   1 
ATOM   3964 C CA  . LEU A 1 517 ? 69.400  39.730 7.291   1.00 43.15  ? 518  LEU A CA  1 
ATOM   3965 C C   . LEU A 1 517 ? 69.047  39.767 5.813   1.00 45.92  ? 518  LEU A C   1 
ATOM   3966 O O   . LEU A 1 517 ? 69.680  40.470 5.021   1.00 38.58  ? 518  LEU A O   1 
ATOM   3967 C CB  . LEU A 1 517 ? 68.828  40.969 7.980   1.00 42.34  ? 518  LEU A CB  1 
ATOM   3968 C CG  . LEU A 1 517 ? 68.852  40.996 9.503   1.00 43.24  ? 518  LEU A CG  1 
ATOM   3969 C CD1 . LEU A 1 517 ? 68.207  42.266 10.012  1.00 43.75  ? 518  LEU A CD1 1 
ATOM   3970 C CD2 . LEU A 1 517 ? 68.133  39.789 10.031  1.00 43.01  ? 518  LEU A CD2 1 
ATOM   3971 N N   . GLU A 1 518 ? 68.028  38.996 5.453   1.00 43.71  ? 519  GLU A N   1 
ATOM   3972 C CA  . GLU A 1 518 ? 67.471  38.974 4.111   1.00 45.25  ? 519  GLU A CA  1 
ATOM   3973 C C   . GLU A 1 518 ? 65.983  39.276 4.226   1.00 41.47  ? 519  GLU A C   1 
ATOM   3974 O O   . GLU A 1 518 ? 65.276  38.634 5.011   1.00 32.91  ? 519  GLU A O   1 
ATOM   3975 C CB  . GLU A 1 518 ? 67.720  37.614 3.449   1.00 50.05  ? 519  GLU A CB  1 
ATOM   3976 C CG  . GLU A 1 518 ? 67.264  37.489 2.014   1.00 65.83  ? 519  GLU A CG  1 
ATOM   3977 C CD  . GLU A 1 518 ? 67.334  36.052 1.516   1.00 77.46  ? 519  GLU A CD  1 
ATOM   3978 O OE1 . GLU A 1 518 ? 66.347  35.575 0.913   1.00 77.86  ? 519  GLU A OE1 1 
ATOM   3979 O OE2 . GLU A 1 518 ? 68.372  35.393 1.744   1.00 82.96  ? 519  GLU A OE2 1 
ATOM   3980 N N   . VAL A 1 519 ? 65.520  40.274 3.484   1.00 38.19  ? 520  VAL A N   1 
ATOM   3981 C CA  . VAL A 1 519 ? 64.121  40.684 3.529   1.00 35.71  ? 520  VAL A CA  1 
ATOM   3982 C C   . VAL A 1 519 ? 63.337  39.838 2.538   1.00 37.63  ? 520  VAL A C   1 
ATOM   3983 O O   . VAL A 1 519 ? 63.741  39.689 1.378   1.00 42.53  ? 520  VAL A O   1 
ATOM   3984 C CB  . VAL A 1 519 ? 63.975  42.183 3.215   1.00 38.00  ? 520  VAL A CB  1 
ATOM   3985 C CG1 . VAL A 1 519 ? 62.509  42.584 3.205   1.00 33.38  ? 520  VAL A CG1 1 
ATOM   3986 C CG2 . VAL A 1 519 ? 64.749  43.018 4.219   1.00 35.57  ? 520  VAL A CG2 1 
ATOM   3987 N N   . ARG A 1 520 ? 62.221  39.275 2.993   1.00 36.04  ? 521  ARG A N   1 
ATOM   3988 C CA  . ARG A 1 520 ? 61.326  38.487 2.159   1.00 35.94  ? 521  ARG A CA  1 
ATOM   3989 C C   . ARG A 1 520 ? 59.900  38.984 2.359   1.00 37.28  ? 521  ARG A C   1 
ATOM   3990 O O   . ARG A 1 520 ? 59.632  39.831 3.211   1.00 34.96  ? 521  ARG A O   1 
ATOM   3991 C CB  . ARG A 1 520 ? 61.435  36.995 2.490   1.00 36.15  ? 521  ARG A CB  1 
ATOM   3992 C CG  . ARG A 1 520 ? 62.819  36.443 2.237   1.00 43.83  ? 521  ARG A CG  1 
ATOM   3993 C CD  . ARG A 1 520 ? 62.940  35.008 2.679   1.00 47.15  ? 521  ARG A CD  1 
ATOM   3994 N NE  . ARG A 1 520 ? 64.340  34.609 2.739   1.00 51.96  ? 521  ARG A NE  1 
ATOM   3995 C CZ  . ARG A 1 520 ? 64.776  33.520 3.360   1.00 55.24  ? 521  ARG A CZ  1 
ATOM   3996 N NH1 . ARG A 1 520 ? 63.916  32.720 3.973   1.00 54.58  ? 521  ARG A NH1 1 
ATOM   3997 N NH2 . ARG A 1 520 ? 66.071  33.235 3.371   1.00 61.81  ? 521  ARG A NH2 1 
ATOM   3998 N N   . ARG A 1 521 ? 58.977  38.452 1.563   1.00 36.20  ? 522  ARG A N   1 
ATOM   3999 C CA  . ARG A 1 521 ? 57.578  38.849 1.627   1.00 37.36  ? 522  ARG A CA  1 
ATOM   4000 C C   . ARG A 1 521 ? 56.683  37.636 1.835   1.00 36.62  ? 522  ARG A C   1 
ATOM   4001 O O   . ARG A 1 521 ? 56.876  36.593 1.204   1.00 35.67  ? 522  ARG A O   1 
ATOM   4002 C CB  . ARG A 1 521 ? 57.150  39.581 0.357   1.00 36.87  ? 522  ARG A CB  1 
ATOM   4003 C CG  . ARG A 1 521 ? 58.049  40.707 -0.045  1.00 40.66  ? 522  ARG A CG  1 
ATOM   4004 C CD  . ARG A 1 521 ? 57.349  41.527 -1.147  1.00 44.73  ? 522  ARG A CD  1 
ATOM   4005 N NE  . ARG A 1 521 ? 55.962  41.818 -0.786  1.00 41.93  ? 522  ARG A NE  1 
ATOM   4006 C CZ  . ARG A 1 521 ? 54.892  41.503 -1.524  1.00 50.15  ? 522  ARG A CZ  1 
ATOM   4007 N NH1 . ARG A 1 521 ? 55.018  40.895 -2.700  1.00 51.52  ? 522  ARG A NH1 1 
ATOM   4008 N NH2 . ARG A 1 521 ? 53.678  41.814 -1.086  1.00 45.84  ? 522  ARG A NH2 1 
ATOM   4009 N N   . GLY A 1 522 ? 55.704  37.780 2.727   1.00 36.68  ? 523  GLY A N   1 
ATOM   4010 C CA  . GLY A 1 522 ? 54.678  36.770 2.881   1.00 30.84  ? 523  GLY A CA  1 
ATOM   4011 C C   . GLY A 1 522 ? 54.994  35.712 3.915   1.00 32.41  ? 523  GLY A C   1 
ATOM   4012 O O   . GLY A 1 522 ? 55.914  34.910 3.739   1.00 37.39  ? 523  GLY A O   1 
ATOM   4013 N N   . LEU A 1 523 ? 54.241  35.710 5.013   1.00 32.84  ? 524  LEU A N   1 
ATOM   4014 C CA  . LEU A 1 523 ? 54.307  34.627 5.993   1.00 30.77  ? 524  LEU A CA  1 
ATOM   4015 C C   . LEU A 1 523 ? 53.362  33.527 5.511   1.00 30.62  ? 524  LEU A C   1 
ATOM   4016 O O   . LEU A 1 523 ? 52.218  33.401 5.953   1.00 32.64  ? 524  LEU A O   1 
ATOM   4017 C CB  . LEU A 1 523 ? 53.954  35.142 7.384   1.00 27.06  ? 524  LEU A CB  1 
ATOM   4018 C CG  . LEU A 1 523 ? 54.927  36.151 8.015   1.00 36.00  ? 524  LEU A CG  1 
ATOM   4019 C CD1 . LEU A 1 523 ? 54.344  36.783 9.276   1.00 35.12  ? 524  LEU A CD1 1 
ATOM   4020 C CD2 . LEU A 1 523 ? 56.254  35.481 8.336   1.00 35.20  ? 524  LEU A CD2 1 
ATOM   4021 N N   . ARG A 1 524 ? 53.865  32.732 4.568   1.00 35.71  ? 525  ARG A N   1 
ATOM   4022 C CA  A ARG A 1 524 ? 53.104  31.687 3.876   0.64 37.42  ? 525  ARG A CA  1 
ATOM   4023 C CA  B ARG A 1 524 ? 53.089  31.676 3.920   0.36 36.54  ? 525  ARG A CA  1 
ATOM   4024 C C   . ARG A 1 524 ? 51.710  32.193 3.499   1.00 32.85  ? 525  ARG A C   1 
ATOM   4025 O O   . ARG A 1 524 ? 50.670  31.682 3.915   1.00 30.38  ? 525  ARG A O   1 
ATOM   4026 C CB  A ARG A 1 524 ? 53.074  30.399 4.700   0.64 34.72  ? 525  ARG A CB  1 
ATOM   4027 C CB  B ARG A 1 524 ? 52.980  30.460 4.844   0.36 33.70  ? 525  ARG A CB  1 
ATOM   4028 C CG  A ARG A 1 524 ? 54.362  29.597 4.466   0.64 33.06  ? 525  ARG A CG  1 
ATOM   4029 C CG  B ARG A 1 524 ? 54.310  30.096 5.488   0.36 30.91  ? 525  ARG A CG  1 
ATOM   4030 C CD  A ARG A 1 524 ? 54.433  28.261 5.169   0.64 32.11  ? 525  ARG A CD  1 
ATOM   4031 C CD  B ARG A 1 524 ? 54.351  28.657 5.950   0.36 32.66  ? 525  ARG A CD  1 
ATOM   4032 N NE  A ARG A 1 524 ? 53.372  27.339 4.784   0.64 34.34  ? 525  ARG A NE  1 
ATOM   4033 N NE  B ARG A 1 524 ? 55.707  28.235 6.299   0.36 33.54  ? 525  ARG A NE  1 
ATOM   4034 C CZ  A ARG A 1 524 ? 53.345  26.633 3.659   0.64 30.84  ? 525  ARG A CZ  1 
ATOM   4035 C CZ  B ARG A 1 524 ? 56.041  26.988 6.619   0.36 31.80  ? 525  ARG A CZ  1 
ATOM   4036 N NH1 A ARG A 1 524 ? 54.318  26.737 2.762   0.64 32.32  ? 525  ARG A NH1 1 
ATOM   4037 N NH1 B ARG A 1 524 ? 55.115  26.037 6.641   0.36 31.67  ? 525  ARG A NH1 1 
ATOM   4038 N NH2 A ARG A 1 524 ? 52.329  25.820 3.433   0.64 22.74  ? 525  ARG A NH2 1 
ATOM   4039 N NH2 B ARG A 1 524 ? 57.299  26.692 6.914   0.36 29.32  ? 525  ARG A NH2 1 
ATOM   4040 N N   . ALA A 1 525 ? 51.733  33.226 2.652   1.00 31.64  ? 526  ALA A N   1 
ATOM   4041 C CA  . ALA A 1 525 ? 50.535  33.997 2.335   1.00 31.87  ? 526  ALA A CA  1 
ATOM   4042 C C   . ALA A 1 525 ? 49.462  33.162 1.639   1.00 34.10  ? 526  ALA A C   1 
ATOM   4043 O O   . ALA A 1 525 ? 48.270  33.316 1.931   1.00 30.57  ? 526  ALA A O   1 
ATOM   4044 C CB  . ALA A 1 525 ? 50.920  35.198 1.472   1.00 36.24  ? 526  ALA A CB  1 
ATOM   4045 N N   . GLN A 1 526 ? 49.847  32.297 0.696   1.00 30.80  ? 527  GLN A N   1 
ATOM   4046 C CA  . GLN A 1 526 ? 48.826  31.505 0.012   1.00 30.58  ? 527  GLN A CA  1 
ATOM   4047 C C   . GLN A 1 526 ? 48.164  30.520 0.970   1.00 28.03  ? 527  GLN A C   1 
ATOM   4048 O O   . GLN A 1 526 ? 46.938  30.366 0.963   1.00 32.90  ? 527  GLN A O   1 
ATOM   4049 C CB  . GLN A 1 526 ? 49.422  30.763 -1.188  1.00 29.83  ? 527  GLN A CB  1 
ATOM   4050 C CG  . GLN A 1 526 ? 50.324  31.595 -2.091  1.00 38.87  ? 527  GLN A CG  1 
ATOM   4051 C CD  . GLN A 1 526 ? 49.615  32.778 -2.737  1.00 44.80  ? 527  GLN A CD  1 
ATOM   4052 O OE1 . GLN A 1 526 ? 48.406  32.745 -2.978  1.00 39.95  ? 527  GLN A OE1 1 
ATOM   4053 N NE2 . GLN A 1 526 ? 50.377  33.832 -3.027  1.00 46.97  ? 527  GLN A NE2 1 
ATOM   4054 N N   . ALA A 1 527 ? 48.957  29.849 1.807   1.00 28.74  ? 528  ALA A N   1 
ATOM   4055 C CA  . ALA A 1 527 ? 48.388  28.917 2.775   1.00 32.85  ? 528  ALA A CA  1 
ATOM   4056 C C   . ALA A 1 527 ? 47.553  29.643 3.821   1.00 30.91  ? 528  ALA A C   1 
ATOM   4057 O O   . ALA A 1 527 ? 46.455  29.194 4.171   1.00 33.38  ? 528  ALA A O   1 
ATOM   4058 C CB  . ALA A 1 527 ? 49.499  28.112 3.454   1.00 31.52  ? 528  ALA A CB  1 
ATOM   4059 N N   . CYS A 1 528 ? 48.054  30.766 4.332   1.00 26.21  ? 529  CYS A N   1 
ATOM   4060 C CA  . CYS A 1 528 ? 47.363  31.427 5.428   1.00 26.28  ? 529  CYS A CA  1 
ATOM   4061 C C   . CYS A 1 528 ? 46.094  32.130 4.972   1.00 27.46  ? 529  CYS A C   1 
ATOM   4062 O O   . CYS A 1 528 ? 45.200  32.349 5.794   1.00 29.96  ? 529  CYS A O   1 
ATOM   4063 C CB  . CYS A 1 528 ? 48.313  32.394 6.124   1.00 27.71  ? 529  CYS A CB  1 
ATOM   4064 S SG  . CYS A 1 528 ? 49.572  31.500 7.060   1.00 30.02  ? 529  CYS A SG  1 
ATOM   4065 N N   . ALA A 1 529 ? 45.985  32.469 3.682   1.00 22.48  ? 530  ALA A N   1 
ATOM   4066 C CA  . ALA A 1 529 ? 44.706  32.927 3.155   1.00 23.57  ? 530  ALA A CA  1 
ATOM   4067 C C   . ALA A 1 529 ? 43.660  31.830 3.268   1.00 25.96  ? 530  ALA A C   1 
ATOM   4068 O O   . ALA A 1 529 ? 42.475  32.109 3.484   1.00 26.29  ? 530  ALA A O   1 
ATOM   4069 C CB  . ALA A 1 529 ? 44.856  33.375 1.697   1.00 24.72  ? 530  ALA A CB  1 
ATOM   4070 N N   . PHE A 1 530 ? 44.080  30.577 3.131   1.00 27.62  ? 531  PHE A N   1 
ATOM   4071 C CA  . PHE A 1 530 ? 43.148  29.473 3.298   1.00 25.75  ? 531  PHE A CA  1 
ATOM   4072 C C   . PHE A 1 530 ? 42.705  29.349 4.753   1.00 23.96  ? 531  PHE A C   1 
ATOM   4073 O O   . PHE A 1 530 ? 41.504  29.295 5.040   1.00 24.75  ? 531  PHE A O   1 
ATOM   4074 C CB  . PHE A 1 530 ? 43.789  28.179 2.793   1.00 26.48  ? 531  PHE A CB  1 
ATOM   4075 C CG  . PHE A 1 530 ? 43.158  26.939 3.345   1.00 30.34  ? 531  PHE A CG  1 
ATOM   4076 C CD1 . PHE A 1 530 ? 43.679  26.328 4.479   1.00 31.60  ? 531  PHE A CD1 1 
ATOM   4077 C CD2 . PHE A 1 530 ? 42.027  26.398 2.751   1.00 31.15  ? 531  PHE A CD2 1 
ATOM   4078 C CE1 . PHE A 1 530 ? 43.092  25.187 5.008   1.00 32.17  ? 531  PHE A CE1 1 
ATOM   4079 C CE2 . PHE A 1 530 ? 41.427  25.251 3.273   1.00 33.80  ? 531  PHE A CE2 1 
ATOM   4080 C CZ  . PHE A 1 530 ? 41.965  24.644 4.406   1.00 32.22  ? 531  PHE A CZ  1 
ATOM   4081 N N   . TRP A 1 531 ? 43.663  29.324 5.689   1.00 22.80  ? 532  TRP A N   1 
ATOM   4082 C CA  . TRP A 1 531 ? 43.327  29.142 7.098   1.00 26.61  ? 532  TRP A CA  1 
ATOM   4083 C C   . TRP A 1 531 ? 42.619  30.364 7.676   1.00 28.96  ? 532  TRP A C   1 
ATOM   4084 O O   . TRP A 1 531 ? 41.719  30.226 8.510   1.00 31.66  ? 532  TRP A O   1 
ATOM   4085 C CB  . TRP A 1 531 ? 44.589  28.829 7.916   1.00 24.89  ? 532  TRP A CB  1 
ATOM   4086 C CG  . TRP A 1 531 ? 45.210  27.503 7.586   1.00 27.49  ? 532  TRP A CG  1 
ATOM   4087 C CD1 . TRP A 1 531 ? 46.333  27.283 6.842   1.00 27.35  ? 532  TRP A CD1 1 
ATOM   4088 C CD2 . TRP A 1 531 ? 44.725  26.209 7.971   1.00 24.28  ? 532  TRP A CD2 1 
ATOM   4089 N NE1 . TRP A 1 531 ? 46.582  25.934 6.743   1.00 25.97  ? 532  TRP A NE1 1 
ATOM   4090 C CE2 . TRP A 1 531 ? 45.607  25.254 7.426   1.00 25.50  ? 532  TRP A CE2 1 
ATOM   4091 C CE3 . TRP A 1 531 ? 43.632  25.766 8.727   1.00 23.25  ? 532  TRP A CE3 1 
ATOM   4092 C CZ2 . TRP A 1 531 ? 45.434  23.883 7.618   1.00 24.65  ? 532  TRP A CZ2 1 
ATOM   4093 C CZ3 . TRP A 1 531 ? 43.460  24.407 8.910   1.00 24.25  ? 532  TRP A CZ3 1 
ATOM   4094 C CH2 . TRP A 1 531 ? 44.359  23.482 8.363   1.00 24.93  ? 532  TRP A CH2 1 
ATOM   4095 N N   . ASN A 1 532 ? 43.006  31.566 7.253   1.00 27.55  ? 533  ASN A N   1 
ATOM   4096 C CA  . ASN A 1 532 ? 42.526  32.787 7.892   1.00 27.77  ? 533  ASN A CA  1 
ATOM   4097 C C   . ASN A 1 532 ? 41.336  33.432 7.200   1.00 29.52  ? 533  ASN A C   1 
ATOM   4098 O O   . ASN A 1 532 ? 40.566  34.129 7.863   1.00 35.56  ? 533  ASN A O   1 
ATOM   4099 C CB  . ASN A 1 532 ? 43.655  33.822 7.987   1.00 28.83  ? 533  ASN A CB  1 
ATOM   4100 C CG  . ASN A 1 532 ? 44.771  33.379 8.919   1.00 29.63  ? 533  ASN A CG  1 
ATOM   4101 O OD1 . ASN A 1 532 ? 44.548  32.578 9.822   1.00 26.75  ? 533  ASN A OD1 1 
ATOM   4102 N ND2 . ASN A 1 532 ? 45.974  33.905 8.707   1.00 27.04  ? 533  ASN A ND2 1 
ATOM   4103 N N   . ARG A 1 533 ? 41.164  33.242 5.892   1.00 26.68  ? 534  ARG A N   1 
ATOM   4104 C CA  . ARG A 1 533 ? 40.075  33.886 5.170   1.00 32.39  ? 534  ARG A CA  1 
ATOM   4105 C C   . ARG A 1 533 ? 38.994  32.914 4.726   1.00 35.31  ? 534  ARG A C   1 
ATOM   4106 O O   . ARG A 1 533 ? 37.806  33.179 4.925   1.00 36.81  ? 534  ARG A O   1 
ATOM   4107 C CB  . ARG A 1 533 ? 40.619  34.639 3.948   1.00 33.92  ? 534  ARG A CB  1 
ATOM   4108 C CG  . ARG A 1 533 ? 41.617  35.714 4.302   1.00 36.46  ? 534  ARG A CG  1 
ATOM   4109 C CD  . ARG A 1 533 ? 42.333  36.244 3.074   1.00 41.30  ? 534  ARG A CD  1 
ATOM   4110 N NE  . ARG A 1 533 ? 43.386  37.176 3.456   1.00 43.01  ? 534  ARG A NE  1 
ATOM   4111 C CZ  . ARG A 1 533 ? 43.236  38.495 3.491   1.00 53.73  ? 534  ARG A CZ  1 
ATOM   4112 N NH1 . ARG A 1 533 ? 42.077  39.047 3.152   1.00 52.01  ? 534  ARG A NH1 1 
ATOM   4113 N NH2 . ARG A 1 533 ? 44.251  39.264 3.861   1.00 59.65  ? 534  ARG A NH2 1 
ATOM   4114 N N   . PHE A 1 534 ? 39.370  31.784 4.133   1.00 33.84  ? 535  PHE A N   1 
ATOM   4115 C CA  . PHE A 1 534 ? 38.365  30.913 3.546   1.00 31.23  ? 535  PHE A CA  1 
ATOM   4116 C C   . PHE A 1 534 ? 37.787  29.905 4.532   1.00 29.79  ? 535  PHE A C   1 
ATOM   4117 O O   . PHE A 1 534 ? 36.563  29.806 4.670   1.00 29.95  ? 535  PHE A O   1 
ATOM   4118 C CB  . PHE A 1 534 ? 38.938  30.157 2.348   1.00 28.84  ? 535  PHE A CB  1 
ATOM   4119 C CG  . PHE A 1 534 ? 38.030  29.067 1.863   1.00 30.46  ? 535  PHE A CG  1 
ATOM   4120 C CD1 . PHE A 1 534 ? 38.304  27.741 2.151   1.00 34.23  ? 535  PHE A CD1 1 
ATOM   4121 C CD2 . PHE A 1 534 ? 36.870  29.376 1.171   1.00 32.37  ? 535  PHE A CD2 1 
ATOM   4122 C CE1 . PHE A 1 534 ? 37.460  26.725 1.725   1.00 32.17  ? 535  PHE A CE1 1 
ATOM   4123 C CE2 . PHE A 1 534 ? 36.004  28.371 0.738   1.00 34.17  ? 535  PHE A CE2 1 
ATOM   4124 C CZ  . PHE A 1 534 ? 36.302  27.037 1.018   1.00 36.56  ? 535  PHE A CZ  1 
ATOM   4125 N N   . LEU A 1 535 ? 38.643  29.115 5.185   1.00 28.52  ? 536  LEU A N   1 
ATOM   4126 C CA  . LEU A 1 535 ? 38.150  28.043 6.044   1.00 33.21  ? 536  LEU A CA  1 
ATOM   4127 C C   . LEU A 1 535 ? 37.157  28.498 7.109   1.00 36.14  ? 536  LEU A C   1 
ATOM   4128 O O   . LEU A 1 535 ? 36.167  27.771 7.337   1.00 34.55  ? 536  LEU A O   1 
ATOM   4129 C CB  . LEU A 1 535 ? 39.329  27.302 6.690   1.00 33.09  ? 536  LEU A CB  1 
ATOM   4130 C CG  . LEU A 1 535 ? 38.919  26.016 7.421   1.00 36.42  ? 536  LEU A CG  1 
ATOM   4131 C CD1 . LEU A 1 535 ? 38.376  24.992 6.438   1.00 30.73  ? 536  LEU A CD1 1 
ATOM   4132 C CD2 . LEU A 1 535 ? 40.093  25.440 8.189   1.00 35.55  ? 536  LEU A CD2 1 
ATOM   4133 N N   . PRO A 1 536 ? 37.319  29.647 7.782   1.00 31.57  ? 537  PRO A N   1 
ATOM   4134 C CA  . PRO A 1 536 ? 36.248  30.052 8.724   1.00 33.51  ? 537  PRO A CA  1 
ATOM   4135 C C   . PRO A 1 536 ? 34.898  30.220 8.057   1.00 40.29  ? 537  PRO A C   1 
ATOM   4136 O O   . PRO A 1 536 ? 33.873  29.900 8.667   1.00 40.81  ? 537  PRO A O   1 
ATOM   4137 C CB  . PRO A 1 536 ? 36.770  31.393 9.305   1.00 29.92  ? 537  PRO A CB  1 
ATOM   4138 C CG  . PRO A 1 536 ? 38.246  31.429 8.983   1.00 33.04  ? 537  PRO A CG  1 
ATOM   4139 C CD  . PRO A 1 536 ? 38.406  30.645 7.718   1.00 30.67  ? 537  PRO A CD  1 
ATOM   4140 N N   . LYS A 1 537 ? 34.877  30.701 6.806   1.00 39.37  ? 538  LYS A N   1 
ATOM   4141 C CA  . LYS A 1 537 ? 33.614  30.773 6.073   1.00 37.43  ? 538  LYS A CA  1 
ATOM   4142 C C   . LYS A 1 537 ? 33.033  29.386 5.849   1.00 39.41  ? 538  LYS A C   1 
ATOM   4143 O O   . LYS A 1 537 ? 31.822  29.185 5.981   1.00 44.89  ? 538  LYS A O   1 
ATOM   4144 C CB  . LYS A 1 537 ? 33.822  31.491 4.736   1.00 43.33  ? 538  LYS A CB  1 
ATOM   4145 C CG  . LYS A 1 537 ? 34.257  32.947 4.864   1.00 44.25  ? 538  LYS A CG  1 
ATOM   4146 C CD  . LYS A 1 537 ? 34.347  33.608 3.497   1.00 48.57  ? 538  LYS A CD  1 
ATOM   4147 C CE  . LYS A 1 537 ? 34.526  35.116 3.603   1.00 52.46  ? 538  LYS A CE  1 
ATOM   4148 N NZ  . LYS A 1 537 ? 35.878  35.501 4.092   1.00 59.17  ? 538  LYS A NZ  1 
ATOM   4149 N N   . LEU A 1 538 ? 33.885  28.412 5.520   1.00 43.33  ? 539  LEU A N   1 
ATOM   4150 C CA  . LEU A 1 538 ? 33.404  27.047 5.337   1.00 45.79  ? 539  LEU A CA  1 
ATOM   4151 C C   . LEU A 1 538 ? 32.841  26.485 6.636   1.00 35.35  ? 539  LEU A C   1 
ATOM   4152 O O   . LEU A 1 538 ? 31.776  25.857 6.639   1.00 41.49  ? 539  LEU A O   1 
ATOM   4153 C CB  . LEU A 1 538 ? 34.531  26.158 4.803   1.00 43.48  ? 539  LEU A CB  1 
ATOM   4154 C CG  . LEU A 1 538 ? 34.174  24.717 4.420   1.00 47.25  ? 539  LEU A CG  1 
ATOM   4155 C CD1 . LEU A 1 538 ? 35.040  24.251 3.265   1.00 50.90  ? 539  LEU A CD1 1 
ATOM   4156 C CD2 . LEU A 1 538 ? 34.341  23.773 5.607   1.00 40.84  ? 539  LEU A CD2 1 
ATOM   4157 N N   . LEU A 1 539 ? 33.542  26.699 7.752   1.00 38.57  ? 540  LEU A N   1 
ATOM   4158 C CA  . LEU A 1 539 ? 33.083  26.157 9.028   1.00 44.11  ? 540  LEU A CA  1 
ATOM   4159 C C   . LEU A 1 539 ? 31.747  26.762 9.453   1.00 50.49  ? 540  LEU A C   1 
ATOM   4160 O O   . LEU A 1 539 ? 30.949  26.089 10.114  1.00 55.87  ? 540  LEU A O   1 
ATOM   4161 C CB  . LEU A 1 539 ? 34.150  26.378 10.101  1.00 42.79  ? 540  LEU A CB  1 
ATOM   4162 C CG  . LEU A 1 539 ? 35.473  25.642 9.845   1.00 45.32  ? 540  LEU A CG  1 
ATOM   4163 C CD1 . LEU A 1 539 ? 36.526  25.965 10.903  1.00 41.72  ? 540  LEU A CD1 1 
ATOM   4164 C CD2 . LEU A 1 539 ? 35.246  24.139 9.762   1.00 44.40  ? 540  LEU A CD2 1 
ATOM   4165 N N   . SER A 1 540 ? 31.471  28.010 9.060   1.00 54.60  ? 541  SER A N   1 
ATOM   4166 C CA  . SER A 1 540 ? 30.178  28.618 9.365   1.00 59.38  ? 541  SER A CA  1 
ATOM   4167 C C   . SER A 1 540 ? 29.058  27.984 8.545   1.00 68.10  ? 541  SER A C   1 
ATOM   4168 O O   . SER A 1 540 ? 28.049  27.530 9.098   1.00 72.30  ? 541  SER A O   1 
ATOM   4169 C CB  . SER A 1 540 ? 30.228  30.125 9.107   1.00 59.06  ? 541  SER A CB  1 
ATOM   4170 O OG  . SER A 1 540 ? 31.354  30.724 9.717   1.00 63.81  ? 541  SER A OG  1 
ATOM   4171 N N   . ALA A 1 541 ? 29.217  27.950 7.226   1.00 73.34  ? 542  ALA A N   1 
ATOM   4172 C CA  . ALA A 1 541 ? 28.150  27.523 6.324   1.00 80.03  ? 542  ALA A CA  1 
ATOM   4173 C C   . ALA A 1 541 ? 28.041  26.003 6.216   1.00 80.25  ? 542  ALA A C   1 
ATOM   4174 O O   . ALA A 1 541 ? 28.487  25.269 7.096   1.00 79.02  ? 542  ALA A O   1 
ATOM   4175 C CB  . ALA A 1 541 ? 28.364  28.131 4.943   1.00 80.84  ? 542  ALA A CB  1 
ATOM   4176 N N   . GLU B 1 3   ? 101.979 35.090 69.832  1.00 105.14 ? 4    GLU B N   1 
ATOM   4177 C CA  . GLU B 1 3   ? 102.069 34.474 68.513  1.00 100.43 ? 4    GLU B CA  1 
ATOM   4178 C C   . GLU B 1 3   ? 100.944 34.963 67.608  1.00 84.90  ? 4    GLU B C   1 
ATOM   4179 O O   . GLU B 1 3   ? 99.785  35.016 68.022  1.00 92.56  ? 4    GLU B O   1 
ATOM   4180 C CB  . GLU B 1 3   ? 102.030 32.949 68.629  1.00 107.56 ? 4    GLU B CB  1 
ATOM   4181 C CG  . GLU B 1 3   ? 102.316 32.216 67.330  1.00 110.04 ? 4    GLU B CG  1 
ATOM   4182 C CD  . GLU B 1 3   ? 103.745 32.404 66.849  1.00 114.35 ? 4    GLU B CD  1 
ATOM   4183 O OE1 . GLU B 1 3   ? 104.589 32.884 67.636  1.00 118.56 ? 4    GLU B OE1 1 
ATOM   4184 O OE2 . GLU B 1 3   ? 104.027 32.065 65.680  1.00 113.25 ? 4    GLU B OE2 1 
ATOM   4185 N N   . ASP B 1 4   ? 101.285 35.318 66.372  1.00 63.32  ? 5    ASP B N   1 
ATOM   4186 C CA  . ASP B 1 4   ? 100.327 35.898 65.432  1.00 50.94  ? 5    ASP B CA  1 
ATOM   4187 C C   . ASP B 1 4   ? 99.780  34.789 64.540  1.00 49.34  ? 5    ASP B C   1 
ATOM   4188 O O   . ASP B 1 4   ? 100.447 34.344 63.602  1.00 50.48  ? 5    ASP B O   1 
ATOM   4189 C CB  . ASP B 1 4   ? 100.975 37.006 64.609  1.00 46.20  ? 5    ASP B CB  1 
ATOM   4190 C CG  . ASP B 1 4   ? 99.953  37.872 63.895  1.00 46.19  ? 5    ASP B CG  1 
ATOM   4191 O OD1 . ASP B 1 4   ? 98.780  37.449 63.795  1.00 46.94  ? 5    ASP B OD1 1 
ATOM   4192 O OD2 . ASP B 1 4   ? 100.318 38.977 63.438  1.00 45.07  ? 5    ASP B OD2 1 
ATOM   4193 N N   . ALA B 1 5   ? 98.548  34.360 64.827  1.00 45.23  ? 6    ALA B N   1 
ATOM   4194 C CA  . ALA B 1 5   ? 97.900  33.319 64.039  1.00 39.84  ? 6    ALA B CA  1 
ATOM   4195 C C   . ALA B 1 5   ? 97.653  33.747 62.600  1.00 40.47  ? 6    ALA B C   1 
ATOM   4196 O O   . ALA B 1 5   ? 97.483  32.886 61.732  1.00 42.27  ? 6    ALA B O   1 
ATOM   4197 C CB  . ALA B 1 5   ? 96.578  32.917 64.695  1.00 40.70  ? 6    ALA B CB  1 
ATOM   4198 N N   . GLU B 1 6   ? 97.623  35.052 62.325  1.00 42.23  ? 7    GLU B N   1 
ATOM   4199 C CA  . GLU B 1 6   ? 97.417  35.512 60.957  1.00 40.43  ? 7    GLU B CA  1 
ATOM   4200 C C   . GLU B 1 6   ? 98.551  35.075 60.040  1.00 40.39  ? 7    GLU B C   1 
ATOM   4201 O O   . GLU B 1 6   ? 98.353  34.940 58.827  1.00 40.76  ? 7    GLU B O   1 
ATOM   4202 C CB  . GLU B 1 6   ? 97.279  37.034 60.932  1.00 41.30  ? 7    GLU B CB  1 
ATOM   4203 C CG  . GLU B 1 6   ? 96.033  37.546 61.627  1.00 39.97  ? 7    GLU B CG  1 
ATOM   4204 C CD  . GLU B 1 6   ? 94.764  37.025 60.981  1.00 43.20  ? 7    GLU B CD  1 
ATOM   4205 O OE1 . GLU B 1 6   ? 94.752  36.847 59.741  1.00 42.65  ? 7    GLU B OE1 1 
ATOM   4206 O OE2 . GLU B 1 6   ? 93.782  36.791 61.713  1.00 47.78  ? 7    GLU B OE2 1 
ATOM   4207 N N   . LEU B 1 7   ? 99.737  34.844 60.597  1.00 37.20  ? 8    LEU B N   1 
ATOM   4208 C CA  . LEU B 1 7   ? 100.919 34.511 59.821  1.00 33.78  ? 8    LEU B CA  1 
ATOM   4209 C C   . LEU B 1 7   ? 101.212 33.018 59.804  1.00 34.56  ? 8    LEU B C   1 
ATOM   4210 O O   . LEU B 1 7   ? 102.253 32.605 59.283  1.00 33.85  ? 8    LEU B O   1 
ATOM   4211 C CB  . LEU B 1 7   ? 102.121 35.279 60.361  1.00 36.07  ? 8    LEU B CB  1 
ATOM   4212 C CG  . LEU B 1 7   ? 101.853 36.784 60.449  1.00 37.19  ? 8    LEU B CG  1 
ATOM   4213 C CD1 . LEU B 1 7   ? 102.988 37.489 61.146  1.00 34.99  ? 8    LEU B CD1 1 
ATOM   4214 C CD2 . LEU B 1 7   ? 101.626 37.366 59.055  1.00 32.52  ? 8    LEU B CD2 1 
ATOM   4215 N N   . LEU B 1 8   ? 100.319 32.203 60.350  1.00 33.26  ? 9    LEU B N   1 
ATOM   4216 C CA  . LEU B 1 8   ? 100.453 30.754 60.327  1.00 35.23  ? 9    LEU B CA  1 
ATOM   4217 C C   . LEU B 1 8   ? 99.436  30.201 59.344  1.00 33.04  ? 9    LEU B C   1 
ATOM   4218 O O   . LEU B 1 8   ? 98.235  30.455 59.479  1.00 37.27  ? 9    LEU B O   1 
ATOM   4219 C CB  . LEU B 1 8   ? 100.246 30.157 61.719  1.00 31.61  ? 9    LEU B CB  1 
ATOM   4220 C CG  . LEU B 1 8   ? 101.213 30.666 62.788  1.00 36.73  ? 9    LEU B CG  1 
ATOM   4221 C CD1 . LEU B 1 8   ? 100.794 30.182 64.186  1.00 35.60  ? 9    LEU B CD1 1 
ATOM   4222 C CD2 . LEU B 1 8   ? 102.661 30.282 62.450  1.00 37.43  ? 9    LEU B CD2 1 
ATOM   4223 N N   . VAL B 1 9   ? 99.916  29.461 58.351  1.00 30.22  ? 10   VAL B N   1 
ATOM   4224 C CA  . VAL B 1 9   ? 99.067  28.846 57.340  1.00 33.64  ? 10   VAL B CA  1 
ATOM   4225 C C   . VAL B 1 9   ? 99.504  27.400 57.173  1.00 31.77  ? 10   VAL B C   1 
ATOM   4226 O O   . VAL B 1 9   ? 100.701 27.093 57.211  1.00 33.70  ? 10   VAL B O   1 
ATOM   4227 C CB  . VAL B 1 9   ? 99.140  29.600 55.993  1.00 36.80  ? 10   VAL B CB  1 
ATOM   4228 C CG1 . VAL B 1 9   ? 98.294  28.906 54.937  1.00 38.27  ? 10   VAL B CG1 1 
ATOM   4229 C CG2 . VAL B 1 9   ? 98.685  31.043 56.164  1.00 43.32  ? 10   VAL B CG2 1 
ATOM   4230 N N   . THR B 1 10  ? 98.534  26.510 57.015  1.00 30.55  ? 11   THR B N   1 
ATOM   4231 C CA  . THR B 1 10  ? 98.794  25.133 56.626  1.00 32.15  ? 11   THR B CA  1 
ATOM   4232 C C   . THR B 1 10  ? 98.386  24.968 55.165  1.00 31.63  ? 11   THR B C   1 
ATOM   4233 O O   . THR B 1 10  ? 97.235  25.233 54.804  1.00 34.09  ? 11   THR B O   1 
ATOM   4234 C CB  . THR B 1 10  ? 98.031  24.163 57.530  1.00 33.39  ? 11   THR B CB  1 
ATOM   4235 O OG1 . THR B 1 10  ? 98.487  24.316 58.878  1.00 36.41  ? 11   THR B OG1 1 
ATOM   4236 C CG2 . THR B 1 10  ? 98.256  22.725 57.098  1.00 27.14  ? 11   THR B CG2 1 
ATOM   4237 N N   . VAL B 1 11  ? 99.336  24.575 54.320  1.00 27.05  ? 12   VAL B N   1 
ATOM   4238 C CA  . VAL B 1 11  ? 99.002  24.193 52.952  1.00 29.02  ? 12   VAL B CA  1 
ATOM   4239 C C   . VAL B 1 11  ? 99.100  22.677 52.869  1.00 29.00  ? 12   VAL B C   1 
ATOM   4240 O O   . VAL B 1 11  ? 99.346  22.011 53.880  1.00 32.58  ? 12   VAL B O   1 
ATOM   4241 C CB  . VAL B 1 11  ? 99.907  24.888 51.915  1.00 25.21  ? 12   VAL B CB  1 
ATOM   4242 C CG1 . VAL B 1 11  ? 99.673  26.395 51.932  1.00 25.91  ? 12   VAL B CG1 1 
ATOM   4243 C CG2 . VAL B 1 11  ? 101.376 24.559 52.164  1.00 26.77  ? 12   VAL B CG2 1 
ATOM   4244 N N   . ARG B 1 12  ? 98.905  22.120 51.671  1.00 28.80  ? 13   ARG B N   1 
ATOM   4245 C CA  . ARG B 1 12  ? 98.812  20.668 51.541  1.00 35.51  ? 13   ARG B CA  1 
ATOM   4246 C C   . ARG B 1 12  ? 100.112 19.983 51.947  1.00 34.64  ? 13   ARG B C   1 
ATOM   4247 O O   . ARG B 1 12  ? 100.090 18.893 52.527  1.00 36.04  ? 13   ARG B O   1 
ATOM   4248 C CB  . ARG B 1 12  ? 98.418  20.288 50.115  1.00 38.43  ? 13   ARG B CB  1 
ATOM   4249 C CG  . ARG B 1 12  ? 96.958  20.568 49.808  1.00 48.87  ? 13   ARG B CG  1 
ATOM   4250 C CD  . ARG B 1 12  ? 96.480  19.864 48.548  1.00 57.45  ? 13   ARG B CD  1 
ATOM   4251 N NE  . ARG B 1 12  ? 95.153  20.336 48.158  1.00 63.79  ? 13   ARG B NE  1 
ATOM   4252 C CZ  . ARG B 1 12  ? 94.407  19.787 47.205  1.00 65.91  ? 13   ARG B CZ  1 
ATOM   4253 N NH1 . ARG B 1 12  ? 94.847  18.729 46.538  1.00 64.44  ? 13   ARG B NH1 1 
ATOM   4254 N NH2 . ARG B 1 12  ? 93.214  20.294 46.927  1.00 68.08  ? 13   ARG B NH2 1 
ATOM   4255 N N   . GLY B 1 13  ? 101.253 20.608 51.665  1.00 32.29  ? 14   GLY B N   1 
ATOM   4256 C CA  . GLY B 1 13  ? 102.520 20.006 52.035  1.00 30.43  ? 14   GLY B CA  1 
ATOM   4257 C C   . GLY B 1 13  ? 102.936 20.187 53.482  1.00 33.35  ? 14   GLY B C   1 
ATOM   4258 O O   . GLY B 1 13  ? 103.879 19.523 53.919  1.00 35.54  ? 14   GLY B O   1 
ATOM   4259 N N   . GLY B 1 14  ? 102.276 21.068 54.233  1.00 29.92  ? 15   GLY B N   1 
ATOM   4260 C CA  . GLY B 1 14  ? 102.614 21.272 55.624  1.00 33.17  ? 15   GLY B CA  1 
ATOM   4261 C C   . GLY B 1 14  ? 102.447 22.726 56.020  1.00 33.57  ? 15   GLY B C   1 
ATOM   4262 O O   . GLY B 1 14  ? 101.770 23.499 55.343  1.00 27.16  ? 15   GLY B O   1 
ATOM   4263 N N   . ARG B 1 15  ? 103.097 23.094 57.121  1.00 30.59  ? 16   ARG B N   1 
ATOM   4264 C CA  . ARG B 1 15  ? 102.867 24.375 57.770  1.00 30.20  ? 16   ARG B CA  1 
ATOM   4265 C C   . ARG B 1 15  ? 103.873 25.433 57.334  1.00 28.71  ? 16   ARG B C   1 
ATOM   4266 O O   . ARG B 1 15  ? 105.026 25.134 57.019  1.00 33.77  ? 16   ARG B O   1 
ATOM   4267 C CB  . ARG B 1 15  ? 102.915 24.199 59.285  1.00 27.72  ? 16   ARG B CB  1 
ATOM   4268 C CG  . ARG B 1 15  ? 102.039 23.062 59.763  1.00 34.54  ? 16   ARG B CG  1 
ATOM   4269 C CD  . ARG B 1 15  ? 101.940 23.046 61.295  1.00 40.24  ? 16   ARG B CD  1 
ATOM   4270 N NE  . ARG B 1 15  ? 103.059 22.352 61.920  1.00 51.64  ? 16   ARG B NE  1 
ATOM   4271 C CZ  . ARG B 1 15  ? 103.620 22.736 63.074  1.00 58.92  ? 16   ARG B CZ  1 
ATOM   4272 N NH1 . ARG B 1 15  ? 103.179 23.808 63.710  1.00 59.50  ? 16   ARG B NH1 1 
ATOM   4273 N NH2 . ARG B 1 15  ? 104.638 22.055 63.576  1.00 59.42  ? 16   ARG B NH2 1 
ATOM   4274 N N   . LEU B 1 16  ? 103.414 26.686 57.337  1.00 29.74  ? 17   LEU B N   1 
ATOM   4275 C CA  . LEU B 1 16  ? 104.196 27.841 56.920  1.00 28.43  ? 17   LEU B CA  1 
ATOM   4276 C C   . LEU B 1 16  ? 104.074 28.955 57.952  1.00 28.04  ? 17   LEU B C   1 
ATOM   4277 O O   . LEU B 1 16  ? 103.042 29.101 58.609  1.00 30.94  ? 17   LEU B O   1 
ATOM   4278 C CB  . LEU B 1 16  ? 103.718 28.397 55.564  1.00 26.62  ? 17   LEU B CB  1 
ATOM   4279 C CG  . LEU B 1 16  ? 103.501 27.484 54.361  1.00 33.14  ? 17   LEU B CG  1 
ATOM   4280 C CD1 . LEU B 1 16  ? 102.776 28.238 53.247  1.00 29.20  ? 17   LEU B CD1 1 
ATOM   4281 C CD2 . LEU B 1 16  ? 104.836 26.926 53.879  1.00 38.88  ? 17   LEU B CD2 1 
ATOM   4282 N N   . ARG B 1 17  ? 105.130 29.758 58.064  1.00 28.37  ? 18   ARG B N   1 
ATOM   4283 C CA  A ARG B 1 17  ? 105.136 30.954 58.896  0.43 30.84  ? 18   ARG B CA  1 
ATOM   4284 C CA  B ARG B 1 17  ? 105.136 30.955 58.898  0.57 30.93  ? 18   ARG B CA  1 
ATOM   4285 C C   . ARG B 1 17  ? 105.523 32.141 58.026  1.00 30.02  ? 18   ARG B C   1 
ATOM   4286 O O   . ARG B 1 17  ? 106.606 32.149 57.432  1.00 31.02  ? 18   ARG B O   1 
ATOM   4287 C CB  A ARG B 1 17  ? 106.102 30.799 60.072  0.43 32.27  ? 18   ARG B CB  1 
ATOM   4288 C CB  B ARG B 1 17  ? 106.104 30.809 60.077  0.57 31.72  ? 18   ARG B CB  1 
ATOM   4289 C CG  A ARG B 1 17  ? 106.627 32.107 60.627  0.43 37.01  ? 18   ARG B CG  1 
ATOM   4290 C CG  B ARG B 1 17  ? 106.013 31.938 61.094  0.57 39.16  ? 18   ARG B CG  1 
ATOM   4291 C CD  A ARG B 1 17  ? 107.480 31.861 61.858  0.43 44.65  ? 18   ARG B CD  1 
ATOM   4292 C CD  B ARG B 1 17  ? 107.083 31.820 62.187  0.57 45.05  ? 18   ARG B CD  1 
ATOM   4293 N NE  A ARG B 1 17  ? 108.449 30.788 61.647  0.43 45.62  ? 18   ARG B NE  1 
ATOM   4294 N NE  B ARG B 1 17  ? 107.223 30.460 62.702  0.57 41.17  ? 18   ARG B NE  1 
ATOM   4295 C CZ  A ARG B 1 17  ? 109.707 30.982 61.270  0.43 44.86  ? 18   ARG B CZ  1 
ATOM   4296 C CZ  B ARG B 1 17  ? 106.518 29.965 63.712  0.57 49.49  ? 18   ARG B CZ  1 
ATOM   4297 N NH1 A ARG B 1 17  ? 110.159 32.212 61.064  0.43 42.61  ? 18   ARG B NH1 1 
ATOM   4298 N NH1 B ARG B 1 17  ? 105.618 30.721 64.329  0.57 56.52  ? 18   ARG B NH1 1 
ATOM   4299 N NH2 A ARG B 1 17  ? 110.514 29.944 61.108  0.43 47.60  ? 18   ARG B NH2 1 
ATOM   4300 N NH2 B ARG B 1 17  ? 106.715 28.714 64.107  0.57 48.34  ? 18   ARG B NH2 1 
ATOM   4301 N N   . GLY B 1 18  ? 104.641 33.137 57.950  1.00 29.66  ? 19   GLY B N   1 
ATOM   4302 C CA  . GLY B 1 18  ? 104.852 34.319 57.140  1.00 31.44  ? 19   GLY B CA  1 
ATOM   4303 C C   . GLY B 1 18  ? 105.308 35.516 57.952  1.00 31.08  ? 19   GLY B C   1 
ATOM   4304 O O   . GLY B 1 18  ? 105.722 35.399 59.110  1.00 31.15  ? 19   GLY B O   1 
ATOM   4305 N N   . ILE B 1 19  ? 105.232 36.693 57.332  1.00 32.46  ? 20   ILE B N   1 
ATOM   4306 C CA  . ILE B 1 19  ? 105.686 37.929 57.961  1.00 31.97  ? 20   ILE B CA  1 
ATOM   4307 C C   . ILE B 1 19  ? 104.667 39.031 57.699  1.00 31.61  ? 20   ILE B C   1 
ATOM   4308 O O   . ILE B 1 19  ? 104.081 39.110 56.614  1.00 31.25  ? 20   ILE B O   1 
ATOM   4309 C CB  . ILE B 1 19  ? 107.083 38.344 57.454  1.00 29.71  ? 20   ILE B CB  1 
ATOM   4310 C CG1 . ILE B 1 19  ? 107.550 39.626 58.149  1.00 34.20  ? 20   ILE B CG1 1 
ATOM   4311 C CG2 . ILE B 1 19  ? 107.074 38.547 55.936  1.00 24.32  ? 20   ILE B CG2 1 
ATOM   4312 C CD1 . ILE B 1 19  ? 108.976 40.018 57.815  1.00 37.88  ? 20   ILE B CD1 1 
ATOM   4313 N N   . ARG B 1 20  ? 104.453 39.877 58.705  1.00 34.28  ? 21   ARG B N   1 
ATOM   4314 C CA  . ARG B 1 20  ? 103.618 41.064 58.581  1.00 31.94  ? 21   ARG B CA  1 
ATOM   4315 C C   . ARG B 1 20  ? 104.472 42.223 58.076  1.00 28.42  ? 21   ARG B C   1 
ATOM   4316 O O   . ARG B 1 20  ? 105.530 42.508 58.640  1.00 34.51  ? 21   ARG B O   1 
ATOM   4317 C CB  . ARG B 1 20  ? 102.980 41.394 59.935  1.00 34.52  ? 21   ARG B CB  1 
ATOM   4318 C CG  . ARG B 1 20  ? 102.008 42.556 59.921  1.00 40.95  ? 21   ARG B CG  1 
ATOM   4319 C CD  . ARG B 1 20  ? 101.291 42.732 61.268  1.00 42.20  ? 21   ARG B CD  1 
ATOM   4320 N NE  . ARG B 1 20  ? 102.163 42.563 62.431  1.00 48.77  ? 21   ARG B NE  1 
ATOM   4321 C CZ  . ARG B 1 20  ? 103.035 43.470 62.864  1.00 56.89  ? 21   ARG B CZ  1 
ATOM   4322 N NH1 . ARG B 1 20  ? 103.176 44.627 62.227  1.00 58.36  ? 21   ARG B NH1 1 
ATOM   4323 N NH2 . ARG B 1 20  ? 103.774 43.214 63.936  1.00 55.83  ? 21   ARG B NH2 1 
ATOM   4324 N N   . LEU B 1 21  ? 104.028 42.867 56.996  1.00 25.16  ? 22   LEU B N   1 
ATOM   4325 C CA  . LEU B 1 21  ? 104.745 43.969 56.368  1.00 29.30  ? 22   LEU B CA  1 
ATOM   4326 C C   . LEU B 1 21  ? 103.985 45.275 56.558  1.00 37.74  ? 22   LEU B C   1 
ATOM   4327 O O   . LEU B 1 21  ? 102.764 45.285 56.729  1.00 43.29  ? 22   LEU B O   1 
ATOM   4328 C CB  . LEU B 1 21  ? 104.940 43.724 54.868  1.00 31.39  ? 22   LEU B CB  1 
ATOM   4329 C CG  . LEU B 1 21  ? 105.605 42.443 54.359  1.00 32.53  ? 22   LEU B CG  1 
ATOM   4330 C CD1 . LEU B 1 21  ? 105.526 42.401 52.837  1.00 27.54  ? 22   LEU B CD1 1 
ATOM   4331 C CD2 . LEU B 1 21  ? 107.046 42.370 54.818  1.00 31.64  ? 22   LEU B CD2 1 
ATOM   4332 N N   . LYS B 1 22  ? 104.720 46.385 56.494  1.00 34.69  ? 23   LYS B N   1 
ATOM   4333 C CA  . LYS B 1 22  ? 104.142 47.721 56.596  1.00 34.34  ? 23   LYS B CA  1 
ATOM   4334 C C   . LYS B 1 22  ? 103.974 48.349 55.218  1.00 32.89  ? 23   LYS B C   1 
ATOM   4335 O O   . LYS B 1 22  ? 104.831 48.191 54.343  1.00 36.10  ? 23   LYS B O   1 
ATOM   4336 C CB  . LYS B 1 22  ? 105.014 48.645 57.448  1.00 35.76  ? 23   LYS B CB  1 
ATOM   4337 C CG  . LYS B 1 22  ? 105.271 48.186 58.865  1.00 44.65  ? 23   LYS B CG  1 
ATOM   4338 C CD  . LYS B 1 22  ? 105.996 49.280 59.652  1.00 50.93  ? 23   LYS B CD  1 
ATOM   4339 C CE  . LYS B 1 22  ? 107.136 49.885 58.842  1.00 54.23  ? 23   LYS B CE  1 
ATOM   4340 N NZ  . LYS B 1 22  ? 107.897 50.907 59.619  1.00 56.01  ? 23   LYS B NZ  1 
ATOM   4341 N N   . THR B 1 23  ? 102.872 49.066 55.037  1.00 30.16  ? 24   THR B N   1 
ATOM   4342 C CA  . THR B 1 23  ? 102.653 49.942 53.896  1.00 30.96  ? 24   THR B CA  1 
ATOM   4343 C C   . THR B 1 23  ? 102.080 51.242 54.430  1.00 30.12  ? 24   THR B C   1 
ATOM   4344 O O   . THR B 1 23  ? 101.571 51.281 55.556  1.00 29.42  ? 24   THR B O   1 
ATOM   4345 C CB  . THR B 1 23  ? 101.684 49.355 52.850  1.00 31.31  ? 24   THR B CB  1 
ATOM   4346 O OG1 . THR B 1 23  ? 100.330 49.626 53.238  1.00 32.05  ? 24   THR B OG1 1 
ATOM   4347 C CG2 . THR B 1 23  ? 101.877 47.864 52.689  1.00 28.85  ? 24   THR B CG2 1 
ATOM   4348 N N   . PRO B 1 24  ? 102.137 52.324 53.646  1.00 30.96  ? 25   PRO B N   1 
ATOM   4349 C CA  . PRO B 1 24  ? 101.482 53.569 54.083  1.00 33.63  ? 25   PRO B CA  1 
ATOM   4350 C C   . PRO B 1 24  ? 99.987  53.417 54.306  1.00 35.00  ? 25   PRO B C   1 
ATOM   4351 O O   . PRO B 1 24  ? 99.407  54.202 55.063  1.00 37.62  ? 25   PRO B O   1 
ATOM   4352 C CB  . PRO B 1 24  ? 101.780 54.551 52.941  1.00 39.06  ? 25   PRO B CB  1 
ATOM   4353 C CG  . PRO B 1 24  ? 102.956 53.975 52.234  1.00 35.12  ? 25   PRO B CG  1 
ATOM   4354 C CD  . PRO B 1 24  ? 102.837 52.494 52.360  1.00 32.75  ? 25   PRO B CD  1 
ATOM   4355 N N   . GLY B 1 25  ? 99.343  52.437 53.680  1.00 33.46  ? 26   GLY B N   1 
ATOM   4356 C CA  . GLY B 1 25  ? 97.937  52.190 53.922  1.00 39.54  ? 26   GLY B CA  1 
ATOM   4357 C C   . GLY B 1 25  ? 97.629  51.179 55.007  1.00 37.86  ? 26   GLY B C   1 
ATOM   4358 O O   . GLY B 1 25  ? 96.458  50.827 55.189  1.00 35.98  ? 26   GLY B O   1 
ATOM   4359 N N   . GLY B 1 26  ? 98.635  50.703 55.740  1.00 33.07  ? 27   GLY B N   1 
ATOM   4360 C CA  . GLY B 1 26  ? 98.434  49.667 56.727  1.00 31.78  ? 27   GLY B CA  1 
ATOM   4361 C C   . GLY B 1 26  ? 99.123  48.379 56.345  1.00 30.79  ? 27   GLY B C   1 
ATOM   4362 O O   . GLY B 1 26  ? 99.791  48.271 55.318  1.00 35.08  ? 27   GLY B O   1 
ATOM   4363 N N   . PRO B 1 27  ? 98.974  47.360 57.178  1.00 30.18  ? 28   PRO B N   1 
ATOM   4364 C CA  . PRO B 1 27  ? 99.781  46.145 57.023  1.00 28.34  ? 28   PRO B CA  1 
ATOM   4365 C C   . PRO B 1 27  ? 99.204  45.173 56.004  1.00 30.07  ? 28   PRO B C   1 
ATOM   4366 O O   . PRO B 1 27  ? 98.026  45.214 55.656  1.00 33.33  ? 28   PRO B O   1 
ATOM   4367 C CB  . PRO B 1 27  ? 99.776  45.529 58.432  1.00 27.94  ? 28   PRO B CB  1 
ATOM   4368 C CG  . PRO B 1 27  ? 98.447  45.978 59.014  1.00 33.09  ? 28   PRO B CG  1 
ATOM   4369 C CD  . PRO B 1 27  ? 98.007  47.237 58.296  1.00 29.21  ? 28   PRO B CD  1 
ATOM   4370 N N   . VAL B 1 28  ? 100.076 44.296 55.516  1.00 26.54  ? 29   VAL B N   1 
ATOM   4371 C CA  . VAL B 1 28  ? 99.675  43.166 54.693  1.00 26.45  ? 29   VAL B CA  1 
ATOM   4372 C C   . VAL B 1 28  ? 100.398 41.936 55.224  1.00 33.96  ? 29   VAL B C   1 
ATOM   4373 O O   . VAL B 1 28  ? 101.406 42.040 55.928  1.00 31.58  ? 29   VAL B O   1 
ATOM   4374 C CB  . VAL B 1 28  ? 99.976  43.378 53.189  1.00 32.32  ? 29   VAL B CB  1 
ATOM   4375 C CG1 . VAL B 1 28  ? 99.490  44.745 52.727  1.00 28.68  ? 29   VAL B CG1 1 
ATOM   4376 C CG2 . VAL B 1 28  ? 101.449 43.207 52.916  1.00 30.52  ? 29   VAL B CG2 1 
ATOM   4377 N N   . SER B 1 29  ? 99.851  40.766 54.904  1.00 30.27  ? 30   SER B N   1 
ATOM   4378 C CA  . SER B 1 29  ? 100.471 39.493 55.240  1.00 26.89  ? 30   SER B CA  1 
ATOM   4379 C C   . SER B 1 29  ? 101.258 39.005 54.034  1.00 28.85  ? 30   SER B C   1 
ATOM   4380 O O   . SER B 1 29  ? 100.742 39.013 52.914  1.00 27.52  ? 30   SER B O   1 
ATOM   4381 C CB  . SER B 1 29  ? 99.423  38.444 55.627  1.00 27.22  ? 30   SER B CB  1 
ATOM   4382 O OG  . SER B 1 29  ? 98.533  38.934 56.615  1.00 35.66  ? 30   SER B OG  1 
ATOM   4383 N N   . ALA B 1 30  ? 102.495 38.567 54.258  1.00 29.56  ? 31   ALA B N   1 
ATOM   4384 C CA  . ALA B 1 30  ? 103.325 38.044 53.180  1.00 29.38  ? 31   ALA B CA  1 
ATOM   4385 C C   . ALA B 1 30  ? 103.867 36.672 53.555  1.00 28.79  ? 31   ALA B C   1 
ATOM   4386 O O   . ALA B 1 30  ? 104.272 36.443 54.699  1.00 27.63  ? 31   ALA B O   1 
ATOM   4387 C CB  . ALA B 1 30  ? 104.486 38.992 52.859  1.00 28.12  ? 31   ALA B CB  1 
ATOM   4388 N N   . PHE B 1 31  ? 103.876 35.763 52.580  1.00 23.55  ? 32   PHE B N   1 
ATOM   4389 C CA  . PHE B 1 31  ? 104.446 34.425 52.731  1.00 22.55  ? 32   PHE B CA  1 
ATOM   4390 C C   . PHE B 1 31  ? 105.422 34.231 51.576  1.00 23.31  ? 32   PHE B C   1 
ATOM   4391 O O   . PHE B 1 31  ? 105.014 33.960 50.442  1.00 26.92  ? 32   PHE B O   1 
ATOM   4392 C CB  . PHE B 1 31  ? 103.353 33.355 52.763  1.00 25.22  ? 32   PHE B CB  1 
ATOM   4393 C CG  . PHE B 1 31  ? 102.294 33.613 53.808  1.00 26.31  ? 32   PHE B CG  1 
ATOM   4394 C CD1 . PHE B 1 31  ? 101.279 34.531 53.565  1.00 26.38  ? 32   PHE B CD1 1 
ATOM   4395 C CD2 . PHE B 1 31  ? 102.336 32.978 55.041  1.00 22.19  ? 32   PHE B CD2 1 
ATOM   4396 C CE1 . PHE B 1 31  ? 100.310 34.806 54.515  1.00 26.55  ? 32   PHE B CE1 1 
ATOM   4397 C CE2 . PHE B 1 31  ? 101.364 33.251 56.011  1.00 27.77  ? 32   PHE B CE2 1 
ATOM   4398 C CZ  . PHE B 1 31  ? 100.350 34.168 55.743  1.00 23.71  ? 32   PHE B CZ  1 
ATOM   4399 N N   . LEU B 1 32  ? 106.709 34.382 51.862  1.00 21.91  ? 33   LEU B N   1 
ATOM   4400 C CA  . LEU B 1 32  ? 107.740 34.463 50.836  1.00 25.84  ? 33   LEU B CA  1 
ATOM   4401 C C   . LEU B 1 32  ? 108.585 33.198 50.844  1.00 25.89  ? 33   LEU B C   1 
ATOM   4402 O O   . LEU B 1 32  ? 108.915 32.674 51.910  1.00 24.67  ? 33   LEU B O   1 
ATOM   4403 C CB  . LEU B 1 32  ? 108.620 35.690 51.074  1.00 25.85  ? 33   LEU B CB  1 
ATOM   4404 C CG  . LEU B 1 32  ? 107.832 36.975 51.303  1.00 26.80  ? 33   LEU B CG  1 
ATOM   4405 C CD1 . LEU B 1 32  ? 108.791 38.132 51.588  1.00 22.59  ? 33   LEU B CD1 1 
ATOM   4406 C CD2 . LEU B 1 32  ? 106.914 37.250 50.085  1.00 25.80  ? 33   LEU B CD2 1 
ATOM   4407 N N   . GLY B 1 33  ? 108.939 32.714 49.660  1.00 23.65  ? 34   GLY B N   1 
ATOM   4408 C CA  . GLY B 1 33  ? 109.793 31.545 49.578  1.00 20.87  ? 34   GLY B CA  1 
ATOM   4409 C C   . GLY B 1 33  ? 109.103 30.240 49.904  1.00 23.83  ? 34   GLY B C   1 
ATOM   4410 O O   . GLY B 1 33  ? 109.691 29.381 50.566  1.00 27.68  ? 34   GLY B O   1 
ATOM   4411 N N   . ILE B 1 34  ? 107.859 30.071 49.466  1.00 27.16  ? 35   ILE B N   1 
ATOM   4412 C CA  . ILE B 1 34  ? 107.139 28.813 49.648  1.00 23.47  ? 35   ILE B CA  1 
ATOM   4413 C C   . ILE B 1 34  ? 107.608 27.823 48.588  1.00 23.04  ? 35   ILE B C   1 
ATOM   4414 O O   . ILE B 1 34  ? 107.479 28.100 47.385  1.00 24.97  ? 35   ILE B O   1 
ATOM   4415 C CB  . ILE B 1 34  ? 105.619 29.009 49.547  1.00 25.17  ? 35   ILE B CB  1 
ATOM   4416 C CG1 . ILE B 1 34  ? 105.128 30.059 50.543  1.00 22.20  ? 35   ILE B CG1 1 
ATOM   4417 C CG2 . ILE B 1 34  ? 104.903 27.668 49.746  1.00 23.00  ? 35   ILE B CG2 1 
ATOM   4418 C CD1 . ILE B 1 34  ? 103.668 30.451 50.325  1.00 23.67  ? 35   ILE B CD1 1 
ATOM   4419 N N   . PRO B 1 35  ? 108.131 26.661 48.974  1.00 26.76  ? 36   PRO B N   1 
ATOM   4420 C CA  . PRO B 1 35  ? 108.560 25.675 47.969  1.00 24.47  ? 36   PRO B CA  1 
ATOM   4421 C C   . PRO B 1 35  ? 107.353 25.039 47.292  1.00 26.37  ? 36   PRO B C   1 
ATOM   4422 O O   . PRO B 1 35  ? 106.456 24.519 47.961  1.00 26.03  ? 36   PRO B O   1 
ATOM   4423 C CB  . PRO B 1 35  ? 109.346 24.645 48.788  1.00 22.76  ? 36   PRO B CB  1 
ATOM   4424 C CG  . PRO B 1 35  ? 108.761 24.761 50.196  1.00 23.72  ? 36   PRO B CG  1 
ATOM   4425 C CD  . PRO B 1 35  ? 108.331 26.199 50.361  1.00 23.71  ? 36   PRO B CD  1 
ATOM   4426 N N   . PHE B 1 36  ? 107.324 25.084 45.961  1.00 22.41  ? 37   PHE B N   1 
ATOM   4427 C CA  . PHE B 1 36  ? 106.251 24.418 45.230  1.00 25.50  ? 37   PHE B CA  1 
ATOM   4428 C C   . PHE B 1 36  ? 106.745 23.264 44.372  1.00 24.82  ? 37   PHE B C   1 
ATOM   4429 O O   . PHE B 1 36  ? 105.924 22.524 43.829  1.00 27.39  ? 37   PHE B O   1 
ATOM   4430 C CB  . PHE B 1 36  ? 105.445 25.419 44.378  1.00 24.87  ? 37   PHE B CB  1 
ATOM   4431 C CG  . PHE B 1 36  ? 106.192 26.010 43.198  1.00 24.99  ? 37   PHE B CG  1 
ATOM   4432 C CD1 . PHE B 1 36  ? 106.125 25.411 41.945  1.00 23.08  ? 37   PHE B CD1 1 
ATOM   4433 C CD2 . PHE B 1 36  ? 106.890 27.203 43.326  1.00 23.39  ? 37   PHE B CD2 1 
ATOM   4434 C CE1 . PHE B 1 36  ? 106.790 25.962 40.848  1.00 22.49  ? 37   PHE B CE1 1 
ATOM   4435 C CE2 . PHE B 1 36  ? 107.556 27.766 42.236  1.00 23.46  ? 37   PHE B CE2 1 
ATOM   4436 C CZ  . PHE B 1 36  ? 107.504 27.141 40.991  1.00 23.16  ? 37   PHE B CZ  1 
ATOM   4437 N N   . ALA B 1 37  ? 108.056 23.059 44.271  1.00 24.15  ? 38   ALA B N   1 
ATOM   4438 C CA  . ALA B 1 37  ? 108.591 21.933 43.519  1.00 23.57  ? 38   ALA B CA  1 
ATOM   4439 C C   . ALA B 1 37  ? 109.778 21.344 44.261  1.00 26.75  ? 38   ALA B C   1 
ATOM   4440 O O   . ALA B 1 37  ? 110.429 22.026 45.059  1.00 25.50  ? 38   ALA B O   1 
ATOM   4441 C CB  . ALA B 1 37  ? 109.028 22.343 42.100  1.00 20.23  ? 38   ALA B CB  1 
ATOM   4442 N N   . GLU B 1 38  ? 110.041 20.065 44.006  1.00 22.77  ? 39   GLU B N   1 
ATOM   4443 C CA  . GLU B 1 38  ? 111.321 19.498 44.395  1.00 25.99  ? 39   GLU B CA  1 
ATOM   4444 C C   . GLU B 1 38  ? 112.435 20.276 43.698  1.00 29.38  ? 39   GLU B C   1 
ATOM   4445 O O   . GLU B 1 38  ? 112.270 20.692 42.542  1.00 23.33  ? 39   GLU B O   1 
ATOM   4446 C CB  . GLU B 1 38  ? 111.403 18.015 44.026  1.00 29.06  ? 39   GLU B CB  1 
ATOM   4447 C CG  . GLU B 1 38  ? 110.669 17.078 44.983  1.00 35.82  ? 39   GLU B CG  1 
ATOM   4448 C CD  . GLU B 1 38  ? 111.029 17.318 46.443  1.00 42.54  ? 39   GLU B CD  1 
ATOM   4449 O OE1 . GLU B 1 38  ? 112.186 17.053 46.822  1.00 49.90  ? 39   GLU B OE1 1 
ATOM   4450 O OE2 . GLU B 1 38  ? 110.152 17.759 47.214  1.00 42.75  ? 39   GLU B OE2 1 
ATOM   4451 N N   . PRO B 1 39  ? 113.552 20.525 44.371  1.00 27.91  ? 40   PRO B N   1 
ATOM   4452 C CA  . PRO B 1 39  ? 114.642 21.287 43.749  1.00 26.96  ? 40   PRO B CA  1 
ATOM   4453 C C   . PRO B 1 39  ? 115.144 20.596 42.494  1.00 31.56  ? 40   PRO B C   1 
ATOM   4454 O O   . PRO B 1 39  ? 115.536 19.419 42.529  1.00 30.45  ? 40   PRO B O   1 
ATOM   4455 C CB  . PRO B 1 39  ? 115.716 21.317 44.844  1.00 29.32  ? 40   PRO B CB  1 
ATOM   4456 C CG  . PRO B 1 39  ? 114.917 21.231 46.127  1.00 30.68  ? 40   PRO B CG  1 
ATOM   4457 C CD  . PRO B 1 39  ? 113.790 20.285 45.807  1.00 28.85  ? 40   PRO B CD  1 
ATOM   4458 N N   . PRO B 1 40  ? 115.143 21.264 41.399  1.00 27.85  ? 41   PRO B N   1 
ATOM   4459 C CA  . PRO B 1 40  ? 115.526 20.622 40.128  1.00 27.59  ? 41   PRO B CA  1 
ATOM   4460 C C   . PRO B 1 40  ? 117.042 20.544 39.956  1.00 33.12  ? 41   PRO B C   1 
ATOM   4461 O O   . PRO B 1 40  ? 117.625 21.130 39.045  1.00 34.98  ? 41   PRO B O   1 
ATOM   4462 C CB  . PRO B 1 40  ? 114.849 21.530 39.094  1.00 25.49  ? 41   PRO B CB  1 
ATOM   4463 C CG  . PRO B 1 40  ? 114.881 22.885 39.718  1.00 29.42  ? 41   PRO B CG  1 
ATOM   4464 C CD  . PRO B 1 40  ? 114.805 22.688 41.224  1.00 23.45  ? 41   PRO B CD  1 
ATOM   4465 N N   . MET B 1 41  ? 117.690 19.803 40.854  1.00 36.57  ? 42   MET B N   1 
ATOM   4466 C CA  . MET B 1 41  ? 119.141 19.724 40.966  1.00 41.16  ? 42   MET B CA  1 
ATOM   4467 C C   . MET B 1 41  ? 119.673 18.427 40.373  1.00 38.72  ? 42   MET B C   1 
ATOM   4468 O O   . MET B 1 41  ? 118.954 17.431 40.243  1.00 34.82  ? 42   MET B O   1 
ATOM   4469 C CB  . MET B 1 41  ? 119.587 19.787 42.431  1.00 45.66  ? 42   MET B CB  1 
ATOM   4470 C CG  . MET B 1 41  ? 118.844 20.765 43.298  1.00 51.48  ? 42   MET B CG  1 
ATOM   4471 S SD  . MET B 1 41  ? 119.610 22.383 43.287  1.00 59.91  ? 42   MET B SD  1 
ATOM   4472 C CE  . MET B 1 41  ? 121.269 21.980 43.825  1.00 58.43  ? 42   MET B CE  1 
ATOM   4473 N N   . GLY B 1 42  ? 120.970 18.440 40.069  1.00 35.77  ? 43   GLY B N   1 
ATOM   4474 C CA  . GLY B 1 42  ? 121.683 17.254 39.662  1.00 31.23  ? 43   GLY B CA  1 
ATOM   4475 C C   . GLY B 1 42  ? 121.006 16.544 38.509  1.00 34.75  ? 43   GLY B C   1 
ATOM   4476 O O   . GLY B 1 42  ? 120.874 17.082 37.403  1.00 29.94  ? 43   GLY B O   1 
ATOM   4477 N N   . PRO B 1 43  ? 120.538 15.316 38.757  1.00 35.64  ? 44   PRO B N   1 
ATOM   4478 C CA  . PRO B 1 43  ? 119.878 14.553 37.686  1.00 32.34  ? 44   PRO B CA  1 
ATOM   4479 C C   . PRO B 1 43  ? 118.551 15.146 37.249  1.00 33.91  ? 44   PRO B C   1 
ATOM   4480 O O   . PRO B 1 43  ? 118.047 14.761 36.183  1.00 32.79  ? 44   PRO B O   1 
ATOM   4481 C CB  . PRO B 1 43  ? 119.698 13.156 38.303  1.00 33.85  ? 44   PRO B CB  1 
ATOM   4482 C CG  . PRO B 1 43  ? 119.696 13.388 39.788  1.00 34.84  ? 44   PRO B CG  1 
ATOM   4483 C CD  . PRO B 1 43  ? 120.593 14.576 40.034  1.00 32.88  ? 44   PRO B CD  1 
ATOM   4484 N N   . ARG B 1 44  ? 117.981 16.078 38.015  1.00 31.94  ? 45   ARG B N   1 
ATOM   4485 C CA  . ARG B 1 44  ? 116.723 16.721 37.648  1.00 32.49  ? 45   ARG B CA  1 
ATOM   4486 C C   . ARG B 1 44  ? 116.909 17.992 36.826  1.00 30.83  ? 45   ARG B C   1 
ATOM   4487 O O   . ARG B 1 44  ? 115.911 18.592 36.413  1.00 24.80  ? 45   ARG B O   1 
ATOM   4488 C CB  . ARG B 1 44  ? 115.901 17.042 38.900  1.00 37.24  ? 45   ARG B CB  1 
ATOM   4489 C CG  . ARG B 1 44  ? 115.525 15.818 39.721  1.00 50.19  ? 45   ARG B CG  1 
ATOM   4490 C CD  . ARG B 1 44  ? 114.190 16.023 40.407  1.00 60.92  ? 45   ARG B CD  1 
ATOM   4491 N NE  . ARG B 1 44  ? 114.234 15.723 41.836  1.00 69.23  ? 45   ARG B NE  1 
ATOM   4492 C CZ  . ARG B 1 44  ? 113.671 14.657 42.398  1.00 72.93  ? 45   ARG B CZ  1 
ATOM   4493 N NH1 . ARG B 1 44  ? 113.014 13.777 41.653  1.00 71.37  ? 45   ARG B NH1 1 
ATOM   4494 N NH2 . ARG B 1 44  ? 113.761 14.473 43.708  1.00 76.45  ? 45   ARG B NH2 1 
ATOM   4495 N N   . ARG B 1 45  ? 118.145 18.430 36.598  1.00 28.23  ? 46   ARG B N   1 
ATOM   4496 C CA  . ARG B 1 45  ? 118.366 19.564 35.711  1.00 26.74  ? 46   ARG B CA  1 
ATOM   4497 C C   . ARG B 1 45  ? 117.829 19.236 34.322  1.00 24.40  ? 46   ARG B C   1 
ATOM   4498 O O   . ARG B 1 45  ? 118.025 18.130 33.814  1.00 27.69  ? 46   ARG B O   1 
ATOM   4499 C CB  . ARG B 1 45  ? 119.855 19.905 35.649  1.00 27.75  ? 46   ARG B CB  1 
ATOM   4500 C CG  . ARG B 1 45  ? 120.184 21.133 34.811  1.00 26.41  ? 46   ARG B CG  1 
ATOM   4501 C CD  . ARG B 1 45  ? 121.683 21.271 34.614  1.00 26.32  ? 46   ARG B CD  1 
ATOM   4502 N NE  . ARG B 1 45  ? 122.360 21.868 35.761  1.00 23.04  ? 46   ARG B NE  1 
ATOM   4503 C CZ  . ARG B 1 45  ? 123.676 22.034 35.831  1.00 30.72  ? 46   ARG B CZ  1 
ATOM   4504 N NH1 . ARG B 1 45  ? 124.441 21.636 34.823  1.00 29.41  ? 46   ARG B NH1 1 
ATOM   4505 N NH2 . ARG B 1 45  ? 124.228 22.591 36.898  1.00 24.33  ? 46   ARG B NH2 1 
ATOM   4506 N N   . PHE B 1 46  ? 117.116 20.194 33.729  1.00 20.58  ? 47   PHE B N   1 
ATOM   4507 C CA  . PHE B 1 46  ? 116.464 20.134 32.414  1.00 28.68  ? 47   PHE B CA  1 
ATOM   4508 C C   . PHE B 1 46  ? 115.170 19.325 32.437  1.00 29.53  ? 47   PHE B C   1 
ATOM   4509 O O   . PHE B 1 46  ? 114.492 19.254 31.401  1.00 28.98  ? 47   PHE B O   1 
ATOM   4510 C CB  . PHE B 1 46  ? 117.352 19.550 31.299  1.00 24.52  ? 47   PHE B CB  1 
ATOM   4511 C CG  . PHE B 1 46  ? 118.717 20.163 31.218  1.00 27.26  ? 47   PHE B CG  1 
ATOM   4512 C CD1 . PHE B 1 46  ? 118.871 21.519 30.980  1.00 28.25  ? 47   PHE B CD1 1 
ATOM   4513 C CD2 . PHE B 1 46  ? 119.851 19.379 31.364  1.00 27.67  ? 47   PHE B CD2 1 
ATOM   4514 C CE1 . PHE B 1 46  ? 120.130 22.084 30.898  1.00 21.13  ? 47   PHE B CE1 1 
ATOM   4515 C CE2 . PHE B 1 46  ? 121.113 19.934 31.281  1.00 24.13  ? 47   PHE B CE2 1 
ATOM   4516 C CZ  . PHE B 1 46  ? 121.252 21.291 31.048  1.00 24.81  ? 47   PHE B CZ  1 
ATOM   4517 N N   . LEU B 1 47  ? 114.804 18.709 33.552  1.00 25.93  ? 48   LEU B N   1 
ATOM   4518 C CA  . LEU B 1 47  ? 113.620 17.864 33.545  1.00 28.62  ? 48   LEU B CA  1 
ATOM   4519 C C   . LEU B 1 47  ? 112.391 18.624 34.043  1.00 27.08  ? 48   LEU B C   1 
ATOM   4520 O O   . LEU B 1 47  ? 112.510 19.664 34.697  1.00 24.84  ? 48   LEU B O   1 
ATOM   4521 C CB  . LEU B 1 47  ? 113.849 16.626 34.406  1.00 27.36  ? 48   LEU B CB  1 
ATOM   4522 C CG  . LEU B 1 47  ? 114.818 15.575 33.871  1.00 29.92  ? 48   LEU B CG  1 
ATOM   4523 C CD1 . LEU B 1 47  ? 115.017 14.509 34.940  1.00 28.32  ? 48   LEU B CD1 1 
ATOM   4524 C CD2 . LEU B 1 47  ? 114.334 14.984 32.538  1.00 25.36  ? 48   LEU B CD2 1 
ATOM   4525 N N   . PRO B 1 48  ? 111.195 18.132 33.724  1.00 27.89  ? 49   PRO B N   1 
ATOM   4526 C CA  . PRO B 1 48  ? 109.981 18.782 34.212  1.00 24.32  ? 49   PRO B CA  1 
ATOM   4527 C C   . PRO B 1 48  ? 109.973 18.847 35.729  1.00 28.12  ? 49   PRO B C   1 
ATOM   4528 O O   . PRO B 1 48  ? 110.512 17.958 36.412  1.00 25.18  ? 49   PRO B O   1 
ATOM   4529 C CB  . PRO B 1 48  ? 108.858 17.874 33.685  1.00 25.60  ? 49   PRO B CB  1 
ATOM   4530 C CG  . PRO B 1 48  ? 109.423 17.321 32.424  1.00 29.27  ? 49   PRO B CG  1 
ATOM   4531 C CD  . PRO B 1 48  ? 110.893 17.111 32.695  1.00 27.36  ? 49   PRO B CD  1 
ATOM   4532 N N   . PRO B 1 49  ? 109.319 19.847 36.292  1.00 26.22  ? 50   PRO B N   1 
ATOM   4533 C CA  . PRO B 1 49  ? 109.290 19.963 37.753  1.00 23.79  ? 50   PRO B CA  1 
ATOM   4534 C C   . PRO B 1 49  ? 108.454 18.856 38.378  1.00 29.92  ? 50   PRO B C   1 
ATOM   4535 O O   . PRO B 1 49  ? 107.478 18.379 37.798  1.00 32.85  ? 50   PRO B O   1 
ATOM   4536 C CB  . PRO B 1 49  ? 108.619 21.334 38.000  1.00 20.89  ? 50   PRO B CB  1 
ATOM   4537 C CG  . PRO B 1 49  ? 107.772 21.558 36.754  1.00 20.96  ? 50   PRO B CG  1 
ATOM   4538 C CD  . PRO B 1 49  ? 108.528 20.901 35.621  1.00 19.00  ? 50   PRO B CD  1 
ATOM   4539 N N   . GLU B 1 50  ? 108.860 18.444 39.577  1.00 34.05  ? 51   GLU B N   1 
ATOM   4540 C CA  . GLU B 1 50  ? 108.048 17.536 40.388  1.00 39.35  ? 51   GLU B CA  1 
ATOM   4541 C C   . GLU B 1 50  ? 107.440 18.285 41.561  1.00 30.72  ? 51   GLU B C   1 
ATOM   4542 O O   . GLU B 1 50  ? 108.088 19.173 42.128  1.00 28.04  ? 51   GLU B O   1 
ATOM   4543 C CB  . GLU B 1 50  ? 108.869 16.371 40.930  1.00 45.00  ? 51   GLU B CB  1 
ATOM   4544 C CG  . GLU B 1 50  ? 109.110 15.265 39.940  1.00 67.05  ? 51   GLU B CG  1 
ATOM   4545 C CD  . GLU B 1 50  ? 110.329 14.467 40.315  1.00 84.67  ? 51   GLU B CD  1 
ATOM   4546 O OE1 . GLU B 1 50  ? 111.297 15.095 40.783  1.00 86.38  ? 51   GLU B OE1 1 
ATOM   4547 O OE2 . GLU B 1 50  ? 110.319 13.227 40.169  1.00 92.50  ? 51   GLU B OE2 1 
ATOM   4548 N N   . PRO B 1 51  ? 106.215 17.943 41.953  1.00 30.73  ? 52   PRO B N   1 
ATOM   4549 C CA  . PRO B 1 51  ? 105.600 18.604 43.109  1.00 31.93  ? 52   PRO B CA  1 
ATOM   4550 C C   . PRO B 1 51  ? 106.460 18.438 44.353  1.00 30.33  ? 52   PRO B C   1 
ATOM   4551 O O   . PRO B 1 51  ? 107.063 17.385 44.576  1.00 29.51  ? 52   PRO B O   1 
ATOM   4552 C CB  . PRO B 1 51  ? 104.253 17.884 43.261  1.00 34.66  ? 52   PRO B CB  1 
ATOM   4553 C CG  . PRO B 1 51  ? 103.993 17.264 41.923  1.00 32.65  ? 52   PRO B CG  1 
ATOM   4554 C CD  . PRO B 1 51  ? 105.338 16.921 41.359  1.00 30.52  ? 52   PRO B CD  1 
ATOM   4555 N N   . LYS B 1 52  ? 106.529 19.504 45.150  1.00 27.20  ? 53   LYS B N   1 
ATOM   4556 C CA  . LYS B 1 52  ? 107.226 19.452 46.428  1.00 28.67  ? 53   LYS B CA  1 
ATOM   4557 C C   . LYS B 1 52  ? 106.587 18.411 47.339  1.00 33.11  ? 53   LYS B C   1 
ATOM   4558 O O   . LYS B 1 52  ? 105.371 18.418 47.548  1.00 34.84  ? 53   LYS B O   1 
ATOM   4559 C CB  . LYS B 1 52  ? 107.191 20.830 47.092  1.00 29.09  ? 53   LYS B CB  1 
ATOM   4560 C CG  . LYS B 1 52  ? 107.756 20.875 48.509  1.00 27.77  ? 53   LYS B CG  1 
ATOM   4561 C CD  . LYS B 1 52  ? 109.267 20.716 48.505  1.00 30.28  ? 53   LYS B CD  1 
ATOM   4562 C CE  . LYS B 1 52  ? 109.847 20.946 49.887  1.00 31.89  ? 53   LYS B CE  1 
ATOM   4563 N NZ  . LYS B 1 52  ? 111.338 20.926 49.863  1.00 34.38  ? 53   LYS B NZ  1 
ATOM   4564 N N   . GLN B 1 53  ? 107.410 17.513 47.879  1.00 32.69  ? 54   GLN B N   1 
ATOM   4565 C CA  A GLN B 1 53  ? 106.922 16.499 48.802  0.38 36.32  ? 54   GLN B CA  1 
ATOM   4566 C CA  B GLN B 1 53  ? 106.895 16.508 48.792  0.62 36.28  ? 54   GLN B CA  1 
ATOM   4567 C C   . GLN B 1 53  ? 106.578 17.135 50.151  1.00 36.24  ? 54   GLN B C   1 
ATOM   4568 O O   . GLN B 1 53  ? 107.184 18.133 50.543  1.00 33.48  ? 54   GLN B O   1 
ATOM   4569 C CB  A GLN B 1 53  ? 107.974 15.406 48.993  0.38 39.19  ? 54   GLN B CB  1 
ATOM   4570 C CB  B GLN B 1 53  ? 107.893 15.363 48.960  0.62 39.00  ? 54   GLN B CB  1 
ATOM   4571 C CG  A GLN B 1 53  ? 108.454 14.763 47.690  0.38 41.96  ? 54   GLN B CG  1 
ATOM   4572 C CG  B GLN B 1 53  ? 107.927 14.390 47.779  0.62 42.97  ? 54   GLN B CG  1 
ATOM   4573 C CD  A GLN B 1 53  ? 109.799 14.066 47.834  0.38 45.44  ? 54   GLN B CD  1 
ATOM   4574 C CD  B GLN B 1 53  ? 106.619 13.633 47.597  0.62 47.31  ? 54   GLN B CD  1 
ATOM   4575 O OE1 A GLN B 1 53  ? 110.271 13.822 48.945  0.38 46.09  ? 54   GLN B OE1 1 
ATOM   4576 O OE1 B GLN B 1 53  ? 105.916 13.816 46.601  0.62 45.96  ? 54   GLN B OE1 1 
ATOM   4577 N NE2 A GLN B 1 53  ? 110.427 13.752 46.704  0.38 47.12  ? 54   GLN B NE2 1 
ATOM   4578 N NE2 B GLN B 1 53  ? 106.292 12.771 48.556  0.62 48.54  ? 54   GLN B NE2 1 
ATOM   4579 N N   . PRO B 1 54  ? 105.610 16.573 50.879  1.00 34.49  ? 55   PRO B N   1 
ATOM   4580 C CA  . PRO B 1 54  ? 105.233 17.147 52.179  1.00 35.43  ? 55   PRO B CA  1 
ATOM   4581 C C   . PRO B 1 54  ? 106.397 17.192 53.159  1.00 36.30  ? 55   PRO B C   1 
ATOM   4582 O O   . PRO B 1 54  ? 107.291 16.345 53.146  1.00 37.51  ? 55   PRO B O   1 
ATOM   4583 C CB  . PRO B 1 54  ? 104.134 16.202 52.682  1.00 35.27  ? 55   PRO B CB  1 
ATOM   4584 C CG  . PRO B 1 54  ? 103.580 15.575 51.455  1.00 40.73  ? 55   PRO B CG  1 
ATOM   4585 C CD  . PRO B 1 54  ? 104.716 15.474 50.475  1.00 34.29  ? 55   PRO B CD  1 
ATOM   4586 N N   . TRP B 1 55  ? 106.361 18.194 54.030  1.00 32.31  ? 56   TRP B N   1 
ATOM   4587 C CA  . TRP B 1 55  ? 107.398 18.416 55.023  1.00 34.23  ? 56   TRP B CA  1 
ATOM   4588 C C   . TRP B 1 55  ? 106.786 18.413 56.418  1.00 35.91  ? 56   TRP B C   1 
ATOM   4589 O O   . TRP B 1 55  ? 105.593 18.680 56.601  1.00 38.20  ? 56   TRP B O   1 
ATOM   4590 C CB  . TRP B 1 55  ? 108.127 19.748 54.780  1.00 30.12  ? 56   TRP B CB  1 
ATOM   4591 C CG  . TRP B 1 55  ? 107.205 20.941 54.832  1.00 31.77  ? 56   TRP B CG  1 
ATOM   4592 C CD1 . TRP B 1 55  ? 106.812 21.628 55.947  1.00 33.14  ? 56   TRP B CD1 1 
ATOM   4593 C CD2 . TRP B 1 55  ? 106.545 21.562 53.723  1.00 29.66  ? 56   TRP B CD2 1 
ATOM   4594 N NE1 . TRP B 1 55  ? 105.955 22.643 55.601  1.00 31.93  ? 56   TRP B NE1 1 
ATOM   4595 C CE2 . TRP B 1 55  ? 105.776 22.628 54.241  1.00 31.44  ? 56   TRP B CE2 1 
ATOM   4596 C CE3 . TRP B 1 55  ? 106.529 21.321 52.344  1.00 28.79  ? 56   TRP B CE3 1 
ATOM   4597 C CZ2 . TRP B 1 55  ? 105.001 23.455 53.428  1.00 30.74  ? 56   TRP B CZ2 1 
ATOM   4598 C CZ3 . TRP B 1 55  ? 105.757 22.153 51.528  1.00 28.95  ? 56   TRP B CZ3 1 
ATOM   4599 C CH2 . TRP B 1 55  ? 105.005 23.205 52.076  1.00 30.67  ? 56   TRP B CH2 1 
ATOM   4600 N N   . SER B 1 56  ? 107.615 18.102 57.404  1.00 38.03  ? 57   SER B N   1 
ATOM   4601 C CA  . SER B 1 56  ? 107.233 18.262 58.797  1.00 40.68  ? 57   SER B CA  1 
ATOM   4602 C C   . SER B 1 56  ? 107.796 19.576 59.323  1.00 38.53  ? 57   SER B C   1 
ATOM   4603 O O   . SER B 1 56  ? 108.674 20.191 58.713  1.00 45.78  ? 57   SER B O   1 
ATOM   4604 C CB  . SER B 1 56  ? 107.717 17.083 59.648  1.00 44.93  ? 57   SER B CB  1 
ATOM   4605 O OG  . SER B 1 56  ? 109.105 16.859 59.484  1.00 52.57  ? 57   SER B OG  1 
ATOM   4606 N N   . GLY B 1 57  ? 107.256 20.016 60.453  1.00 41.06  ? 58   GLY B N   1 
ATOM   4607 C CA  . GLY B 1 57  ? 107.648 21.297 61.001  1.00 39.54  ? 58   GLY B CA  1 
ATOM   4608 C C   . GLY B 1 57  ? 107.069 22.458 60.210  1.00 42.19  ? 58   GLY B C   1 
ATOM   4609 O O   . GLY B 1 57  ? 106.129 22.321 59.417  1.00 39.50  ? 58   GLY B O   1 
ATOM   4610 N N   . VAL B 1 58  ? 107.664 23.625 60.424  1.00 37.85  ? 59   VAL B N   1 
ATOM   4611 C CA  . VAL B 1 58  ? 107.153 24.881 59.895  1.00 35.04  ? 59   VAL B CA  1 
ATOM   4612 C C   . VAL B 1 58  ? 108.192 25.452 58.941  1.00 37.44  ? 59   VAL B C   1 
ATOM   4613 O O   . VAL B 1 58  ? 109.314 25.765 59.357  1.00 44.60  ? 59   VAL B O   1 
ATOM   4614 C CB  . VAL B 1 58  ? 106.840 25.875 61.026  1.00 36.32  ? 59   VAL B CB  1 
ATOM   4615 C CG1 . VAL B 1 58  ? 106.200 27.149 60.469  1.00 31.41  ? 59   VAL B CG1 1 
ATOM   4616 C CG2 . VAL B 1 58  ? 105.959 25.210 62.093  1.00 33.24  ? 59   VAL B CG2 1 
ATOM   4617 N N   . VAL B 1 59  ? 107.828 25.571 57.663  1.00 30.78  ? 60   VAL B N   1 
ATOM   4618 C CA  . VAL B 1 59  ? 108.670 26.285 56.712  1.00 30.06  ? 60   VAL B CA  1 
ATOM   4619 C C   . VAL B 1 59  ? 108.659 27.766 57.063  1.00 32.81  ? 60   VAL B C   1 
ATOM   4620 O O   . VAL B 1 59  ? 107.596 28.366 57.270  1.00 35.35  ? 60   VAL B O   1 
ATOM   4621 C CB  . VAL B 1 59  ? 108.191 26.060 55.269  1.00 33.85  ? 60   VAL B CB  1 
ATOM   4622 C CG1 . VAL B 1 59  ? 108.724 27.170 54.352  1.00 31.72  ? 60   VAL B CG1 1 
ATOM   4623 C CG2 . VAL B 1 59  ? 108.641 24.704 54.761  1.00 31.33  ? 60   VAL B CG2 1 
ATOM   4624 N N   . ASP B 1 60  ? 109.844 28.362 57.148  1.00 31.30  ? 61   ASP B N   1 
ATOM   4625 C CA  . ASP B 1 60  ? 109.960 29.788 57.408  1.00 36.02  ? 61   ASP B CA  1 
ATOM   4626 C C   . ASP B 1 60  ? 109.727 30.533 56.098  1.00 37.96  ? 61   ASP B C   1 
ATOM   4627 O O   . ASP B 1 60  ? 110.553 30.470 55.182  1.00 38.19  ? 61   ASP B O   1 
ATOM   4628 C CB  . ASP B 1 60  ? 111.327 30.105 58.001  1.00 54.90  ? 61   ASP B CB  1 
ATOM   4629 C CG  . ASP B 1 60  ? 111.658 31.575 57.946  1.00 69.97  ? 61   ASP B CG  1 
ATOM   4630 O OD1 . ASP B 1 60  ? 112.764 31.918 57.491  1.00 75.45  ? 61   ASP B OD1 1 
ATOM   4631 O OD2 . ASP B 1 60  ? 110.813 32.387 58.366  1.00 76.71  ? 61   ASP B OD2 1 
ATOM   4632 N N   . ALA B 1 61  ? 108.595 31.224 55.999  1.00 31.97  ? 62   ALA B N   1 
ATOM   4633 C CA  . ALA B 1 61  ? 108.258 31.935 54.775  1.00 29.70  ? 62   ALA B CA  1 
ATOM   4634 C C   . ALA B 1 61  ? 108.311 33.443 54.991  1.00 27.58  ? 62   ALA B C   1 
ATOM   4635 O O   . ALA B 1 61  ? 107.381 34.160 54.620  1.00 28.79  ? 62   ALA B O   1 
ATOM   4636 C CB  . ALA B 1 61  ? 106.872 31.513 54.278  1.00 33.01  ? 62   ALA B CB  1 
ATOM   4637 N N   . THR B 1 62  ? 109.390 33.935 55.597  1.00 30.72  ? 63   THR B N   1 
ATOM   4638 C CA  . THR B 1 62  ? 109.505 35.345 55.941  1.00 31.16  ? 63   THR B CA  1 
ATOM   4639 C C   . THR B 1 62  ? 110.449 36.114 55.029  1.00 29.91  ? 63   THR B C   1 
ATOM   4640 O O   . THR B 1 62  ? 110.596 37.329 55.202  1.00 30.72  ? 63   THR B O   1 
ATOM   4641 C CB  . THR B 1 62  ? 109.969 35.506 57.394  1.00 33.95  ? 63   THR B CB  1 
ATOM   4642 O OG1 . THR B 1 62  ? 111.262 34.909 57.549  1.00 31.46  ? 63   THR B OG1 1 
ATOM   4643 C CG2 . THR B 1 62  ? 108.971 34.855 58.370  1.00 27.24  ? 63   THR B CG2 1 
ATOM   4644 N N   . THR B 1 63  ? 111.088 35.455 54.064  1.00 29.32  ? 64   THR B N   1 
ATOM   4645 C CA  . THR B 1 63  ? 112.052 36.138 53.213  1.00 28.82  ? 64   THR B CA  1 
ATOM   4646 C C   . THR B 1 63  ? 112.090 35.471 51.842  1.00 26.47  ? 64   THR B C   1 
ATOM   4647 O O   . THR B 1 63  ? 111.753 34.291 51.700  1.00 27.43  ? 64   THR B O   1 
ATOM   4648 C CB  . THR B 1 63  ? 113.444 36.155 53.874  1.00 39.25  ? 64   THR B CB  1 
ATOM   4649 O OG1 . THR B 1 63  ? 114.306 37.058 53.169  1.00 56.26  ? 64   THR B OG1 1 
ATOM   4650 C CG2 . THR B 1 63  ? 114.061 34.766 53.885  1.00 28.68  ? 64   THR B CG2 1 
ATOM   4651 N N   . PHE B 1 64  ? 112.475 36.250 50.828  1.00 24.41  ? 65   PHE B N   1 
ATOM   4652 C CA  . PHE B 1 64  ? 112.554 35.719 49.471  1.00 31.22  ? 65   PHE B CA  1 
ATOM   4653 C C   . PHE B 1 64  ? 113.600 34.617 49.386  1.00 31.11  ? 65   PHE B C   1 
ATOM   4654 O O   . PHE B 1 64  ? 114.637 34.664 50.051  1.00 29.42  ? 65   PHE B O   1 
ATOM   4655 C CB  . PHE B 1 64  ? 112.901 36.821 48.466  1.00 27.08  ? 65   PHE B CB  1 
ATOM   4656 C CG  . PHE B 1 64  ? 111.779 37.781 48.187  1.00 27.96  ? 65   PHE B CG  1 
ATOM   4657 C CD1 . PHE B 1 64  ? 110.611 37.350 47.572  1.00 25.35  ? 65   PHE B CD1 1 
ATOM   4658 C CD2 . PHE B 1 64  ? 111.911 39.129 48.502  1.00 24.16  ? 65   PHE B CD2 1 
ATOM   4659 C CE1 . PHE B 1 64  ? 109.580 38.242 47.301  1.00 25.70  ? 65   PHE B CE1 1 
ATOM   4660 C CE2 . PHE B 1 64  ? 110.886 40.028 48.233  1.00 23.51  ? 65   PHE B CE2 1 
ATOM   4661 C CZ  . PHE B 1 64  ? 109.720 39.588 47.638  1.00 21.81  ? 65   PHE B CZ  1 
ATOM   4662 N N   . GLN B 1 65  ? 113.330 33.626 48.546  1.00 30.43  ? 66   GLN B N   1 
ATOM   4663 C CA  . GLN B 1 65  ? 114.287 32.567 48.291  1.00 31.69  ? 66   GLN B CA  1 
ATOM   4664 C C   . GLN B 1 65  ? 115.201 32.939 47.124  1.00 26.87  ? 66   GLN B C   1 
ATOM   4665 O O   . GLN B 1 65  ? 115.074 34.001 46.508  1.00 24.62  ? 66   GLN B O   1 
ATOM   4666 C CB  . GLN B 1 65  ? 113.566 31.246 48.023  1.00 30.29  ? 66   GLN B CB  1 
ATOM   4667 C CG  . GLN B 1 65  ? 113.444 30.352 49.257  1.00 33.44  ? 66   GLN B CG  1 
ATOM   4668 C CD  . GLN B 1 65  ? 114.769 29.716 49.652  1.00 41.37  ? 66   GLN B CD  1 
ATOM   4669 O OE1 . GLN B 1 65  ? 115.784 29.878 48.964  1.00 44.20  ? 66   GLN B OE1 1 
ATOM   4670 N NE2 . GLN B 1 65  ? 114.766 28.990 50.766  1.00 37.24  ? 66   GLN B NE2 1 
ATOM   4671 N N   . SER B 1 66  ? 116.110 32.020 46.804  1.00 22.06  ? 67   SER B N   1 
ATOM   4672 C CA  . SER B 1 66  ? 117.146 32.244 45.807  1.00 28.92  ? 67   SER B CA  1 
ATOM   4673 C C   . SER B 1 66  ? 116.563 32.532 44.426  1.00 28.34  ? 67   SER B C   1 
ATOM   4674 O O   . SER B 1 66  ? 115.442 32.132 44.100  1.00 26.63  ? 67   SER B O   1 
ATOM   4675 C CB  . SER B 1 66  ? 118.050 31.014 45.728  1.00 31.38  ? 67   SER B CB  1 
ATOM   4676 O OG  . SER B 1 66  ? 118.508 30.641 47.014  1.00 32.30  ? 67   SER B OG  1 
ATOM   4677 N N   . VAL B 1 67  ? 117.357 33.229 43.611  1.00 28.39  ? 68   VAL B N   1 
ATOM   4678 C CA  . VAL B 1 67  ? 117.039 33.536 42.219  1.00 24.30  ? 68   VAL B CA  1 
ATOM   4679 C C   . VAL B 1 67  ? 117.531 32.390 41.344  1.00 19.80  ? 68   VAL B C   1 
ATOM   4680 O O   . VAL B 1 67  ? 118.637 31.874 41.547  1.00 24.67  ? 68   VAL B O   1 
ATOM   4681 C CB  . VAL B 1 67  ? 117.688 34.873 41.804  1.00 26.90  ? 68   VAL B CB  1 
ATOM   4682 C CG1 . VAL B 1 67  ? 117.456 35.176 40.310  1.00 21.92  ? 68   VAL B CG1 1 
ATOM   4683 C CG2 . VAL B 1 67  ? 117.180 36.009 42.680  1.00 25.68  ? 68   VAL B CG2 1 
ATOM   4684 N N   . CYS B 1 68  ? 116.716 31.971 40.379  1.00 21.01  ? 69   CYS B N   1 
ATOM   4685 C CA  . CYS B 1 68  ? 117.170 30.931 39.460  1.00 22.74  ? 69   CYS B CA  1 
ATOM   4686 C C   . CYS B 1 68  ? 118.401 31.408 38.700  1.00 26.45  ? 69   CYS B C   1 
ATOM   4687 O O   . CYS B 1 68  ? 118.494 32.576 38.314  1.00 24.19  ? 69   CYS B O   1 
ATOM   4688 C CB  . CYS B 1 68  ? 116.058 30.530 38.478  1.00 17.47  ? 69   CYS B CB  1 
ATOM   4689 S SG  . CYS B 1 68  ? 114.539 29.806 39.221  1.00 27.07  ? 69   CYS B SG  1 
ATOM   4690 N N   . TYR B 1 69  ? 119.352 30.491 38.499  1.00 23.43  ? 70   TYR B N   1 
ATOM   4691 C CA  . TYR B 1 69  ? 120.616 30.825 37.849  1.00 27.54  ? 70   TYR B CA  1 
ATOM   4692 C C   . TYR B 1 69  ? 120.392 31.520 36.512  1.00 27.90  ? 70   TYR B C   1 
ATOM   4693 O O   . TYR B 1 69  ? 119.623 31.049 35.669  1.00 21.55  ? 70   TYR B O   1 
ATOM   4694 C CB  . TYR B 1 69  ? 121.461 29.567 37.644  1.00 31.60  ? 70   TYR B CB  1 
ATOM   4695 C CG  . TYR B 1 69  ? 122.685 29.535 38.524  1.00 39.52  ? 70   TYR B CG  1 
ATOM   4696 C CD1 . TYR B 1 69  ? 122.707 28.792 39.695  1.00 43.48  ? 70   TYR B CD1 1 
ATOM   4697 C CD2 . TYR B 1 69  ? 123.819 30.281 38.192  1.00 39.67  ? 70   TYR B CD2 1 
ATOM   4698 C CE1 . TYR B 1 69  ? 123.830 28.773 40.503  1.00 42.64  ? 70   TYR B CE1 1 
ATOM   4699 C CE2 . TYR B 1 69  ? 124.945 30.273 39.003  1.00 45.26  ? 70   TYR B CE2 1 
ATOM   4700 C CZ  . TYR B 1 69  ? 124.940 29.514 40.156  1.00 50.05  ? 70   TYR B CZ  1 
ATOM   4701 O OH  . TYR B 1 69  ? 126.044 29.483 40.976  1.00 70.70  ? 70   TYR B OH  1 
ATOM   4702 N N   . GLN B 1 70  ? 121.072 32.649 36.325  1.00 22.84  ? 71   GLN B N   1 
ATOM   4703 C CA  . GLN B 1 70  ? 120.842 33.467 35.146  1.00 26.40  ? 71   GLN B CA  1 
ATOM   4704 C C   . GLN B 1 70  ? 122.032 34.384 34.921  1.00 27.50  ? 71   GLN B C   1 
ATOM   4705 O O   . GLN B 1 70  ? 122.813 34.666 35.834  1.00 27.41  ? 71   GLN B O   1 
ATOM   4706 C CB  . GLN B 1 70  ? 119.561 34.294 35.278  1.00 21.18  ? 71   GLN B CB  1 
ATOM   4707 C CG  . GLN B 1 70  ? 119.581 35.283 36.451  1.00 24.73  ? 71   GLN B CG  1 
ATOM   4708 C CD  . GLN B 1 70  ? 118.207 35.851 36.726  1.00 21.78  ? 71   GLN B CD  1 
ATOM   4709 O OE1 . GLN B 1 70  ? 117.952 37.038 36.519  1.00 21.44  ? 71   GLN B OE1 1 
ATOM   4710 N NE2 . GLN B 1 70  ? 117.301 34.995 37.166  1.00 20.99  ? 71   GLN B NE2 1 
ATOM   4711 N N   . TYR B 1 71  ? 122.149 34.838 33.678  1.00 23.17  ? 72   TYR B N   1 
ATOM   4712 C CA  . TYR B 1 71  ? 123.105 35.872 33.323  1.00 21.29  ? 72   TYR B CA  1 
ATOM   4713 C C   . TYR B 1 71  ? 122.819 37.156 34.095  1.00 25.82  ? 72   TYR B C   1 
ATOM   4714 O O   . TYR B 1 71  ? 121.662 37.509 34.338  1.00 29.25  ? 72   TYR B O   1 
ATOM   4715 C CB  . TYR B 1 71  ? 123.036 36.116 31.811  1.00 25.81  ? 72   TYR B CB  1 
ATOM   4716 C CG  . TYR B 1 71  ? 123.761 37.343 31.326  1.00 29.91  ? 72   TYR B CG  1 
ATOM   4717 C CD1 . TYR B 1 71  ? 125.113 37.286 31.005  1.00 29.71  ? 72   TYR B CD1 1 
ATOM   4718 C CD2 . TYR B 1 71  ? 123.089 38.549 31.147  1.00 32.74  ? 72   TYR B CD2 1 
ATOM   4719 C CE1 . TYR B 1 71  ? 125.786 38.402 30.550  1.00 32.17  ? 72   TYR B CE1 1 
ATOM   4720 C CE2 . TYR B 1 71  ? 123.752 39.673 30.686  1.00 27.84  ? 72   TYR B CE2 1 
ATOM   4721 C CZ  . TYR B 1 71  ? 125.099 39.592 30.391  1.00 36.36  ? 72   TYR B CZ  1 
ATOM   4722 O OH  . TYR B 1 71  ? 125.773 40.702 29.936  1.00 42.34  ? 72   TYR B OH  1 
ATOM   4723 N N   . VAL B 1 72  ? 123.882 37.856 34.488  1.00 23.95  ? 73   VAL B N   1 
ATOM   4724 C CA  . VAL B 1 72  ? 123.780 39.131 35.190  1.00 28.69  ? 73   VAL B CA  1 
ATOM   4725 C C   . VAL B 1 72  ? 124.254 40.231 34.250  1.00 30.28  ? 73   VAL B C   1 
ATOM   4726 O O   . VAL B 1 72  ? 125.371 40.168 33.725  1.00 31.06  ? 73   VAL B O   1 
ATOM   4727 C CB  . VAL B 1 72  ? 124.595 39.129 36.497  1.00 32.42  ? 73   VAL B CB  1 
ATOM   4728 C CG1 . VAL B 1 72  ? 124.602 40.514 37.130  1.00 30.44  ? 73   VAL B CG1 1 
ATOM   4729 C CG2 . VAL B 1 72  ? 124.038 38.109 37.475  1.00 28.12  ? 73   VAL B CG2 1 
ATOM   4730 N N   . ASP B 1 73  ? 123.400 41.231 34.033  1.00 28.25  ? 74   ASP B N   1 
ATOM   4731 C CA  . ASP B 1 73  ? 123.732 42.345 33.150  1.00 27.07  ? 74   ASP B CA  1 
ATOM   4732 C C   . ASP B 1 73  ? 124.911 43.139 33.700  1.00 29.80  ? 74   ASP B C   1 
ATOM   4733 O O   . ASP B 1 73  ? 124.934 43.501 34.877  1.00 40.99  ? 74   ASP B O   1 
ATOM   4734 C CB  . ASP B 1 73  ? 122.517 43.260 32.998  1.00 37.19  ? 74   ASP B CB  1 
ATOM   4735 C CG  . ASP B 1 73  ? 122.607 44.167 31.779  1.00 36.76  ? 74   ASP B CG  1 
ATOM   4736 O OD1 . ASP B 1 73  ? 123.507 45.020 31.718  1.00 38.95  ? 74   ASP B OD1 1 
ATOM   4737 O OD2 . ASP B 1 73  ? 121.757 44.037 30.888  1.00 50.94  ? 74   ASP B OD2 1 
ATOM   4738 N N   . THR B 1 74  ? 125.901 43.409 32.841  1.00 32.98  ? 75   THR B N   1 
ATOM   4739 C CA  . THR B 1 74  ? 127.048 44.226 33.221  1.00 39.09  ? 75   THR B CA  1 
ATOM   4740 C C   . THR B 1 74  ? 127.281 45.371 32.236  1.00 39.78  ? 75   THR B C   1 
ATOM   4741 O O   . THR B 1 74  ? 128.382 45.934 32.198  1.00 38.05  ? 75   THR B O   1 
ATOM   4742 C CB  . THR B 1 74  ? 128.317 43.374 33.351  1.00 42.25  ? 75   THR B CB  1 
ATOM   4743 O OG1 . THR B 1 74  ? 128.560 42.667 32.128  1.00 44.78  ? 75   THR B OG1 1 
ATOM   4744 C CG2 . THR B 1 74  ? 128.177 42.374 34.495  1.00 41.63  ? 75   THR B CG2 1 
ATOM   4745 N N   . LEU B 1 75  ? 126.261 45.736 31.454  1.00 40.33  ? 76   LEU B N   1 
ATOM   4746 C CA  . LEU B 1 75  ? 126.415 46.805 30.468  1.00 37.34  ? 76   LEU B CA  1 
ATOM   4747 C C   . LEU B 1 75  ? 126.775 48.131 31.128  1.00 38.18  ? 76   LEU B C   1 
ATOM   4748 O O   . LEU B 1 75  ? 127.668 48.846 30.655  1.00 36.69  ? 76   LEU B O   1 
ATOM   4749 C CB  . LEU B 1 75  ? 125.131 46.956 29.647  1.00 36.68  ? 76   LEU B CB  1 
ATOM   4750 C CG  . LEU B 1 75  ? 125.223 48.014 28.536  1.00 40.52  ? 76   LEU B CG  1 
ATOM   4751 C CD1 . LEU B 1 75  ? 126.449 47.775 27.671  1.00 38.02  ? 76   LEU B CD1 1 
ATOM   4752 C CD2 . LEU B 1 75  ? 123.955 48.065 27.681  1.00 36.34  ? 76   LEU B CD2 1 
ATOM   4753 N N   . TYR B 1 76  ? 126.085 48.484 32.214  1.00 31.01  ? 77   TYR B N   1 
ATOM   4754 C CA  . TYR B 1 76  ? 126.325 49.724 32.951  1.00 33.90  ? 77   TYR B CA  1 
ATOM   4755 C C   . TYR B 1 76  ? 126.414 49.385 34.434  1.00 35.05  ? 77   TYR B C   1 
ATOM   4756 O O   . TYR B 1 76  ? 125.432 49.534 35.177  1.00 37.65  ? 77   TYR B O   1 
ATOM   4757 C CB  . TYR B 1 76  ? 125.225 50.754 32.685  1.00 31.38  ? 77   TYR B CB  1 
ATOM   4758 C CG  . TYR B 1 76  ? 125.065 51.153 31.235  1.00 37.99  ? 77   TYR B CG  1 
ATOM   4759 C CD1 . TYR B 1 76  ? 126.071 51.832 30.564  1.00 39.28  ? 77   TYR B CD1 1 
ATOM   4760 C CD2 . TYR B 1 76  ? 123.899 50.859 30.539  1.00 36.19  ? 77   TYR B CD2 1 
ATOM   4761 C CE1 . TYR B 1 76  ? 125.923 52.200 29.239  1.00 43.46  ? 77   TYR B CE1 1 
ATOM   4762 C CE2 . TYR B 1 76  ? 123.741 51.223 29.216  1.00 36.32  ? 77   TYR B CE2 1 
ATOM   4763 C CZ  . TYR B 1 76  ? 124.753 51.892 28.569  1.00 43.05  ? 77   TYR B CZ  1 
ATOM   4764 O OH  . TYR B 1 76  ? 124.598 52.257 27.248  1.00 43.81  ? 77   TYR B OH  1 
ATOM   4765 N N   . PRO B 1 77  ? 127.572 48.920 34.897  1.00 39.03  ? 78   PRO B N   1 
ATOM   4766 C CA  . PRO B 1 77  ? 127.698 48.493 36.298  1.00 41.56  ? 78   PRO B CA  1 
ATOM   4767 C C   . PRO B 1 77  ? 127.324 49.599 37.275  1.00 39.91  ? 78   PRO B C   1 
ATOM   4768 O O   . PRO B 1 77  ? 127.781 50.738 37.158  1.00 41.94  ? 78   PRO B O   1 
ATOM   4769 C CB  . PRO B 1 77  ? 129.180 48.118 36.420  1.00 39.26  ? 78   PRO B CB  1 
ATOM   4770 C CG  . PRO B 1 77  ? 129.607 47.793 35.032  1.00 42.56  ? 78   PRO B CG  1 
ATOM   4771 C CD  . PRO B 1 77  ? 128.810 48.700 34.134  1.00 43.94  ? 78   PRO B CD  1 
ATOM   4772 N N   . GLY B 1 78  ? 126.488 49.250 38.250  1.00 40.48  ? 79   GLY B N   1 
ATOM   4773 C CA  . GLY B 1 78  ? 126.058 50.184 39.267  1.00 40.50  ? 79   GLY B CA  1 
ATOM   4774 C C   . GLY B 1 78  ? 124.984 51.157 38.835  1.00 43.20  ? 79   GLY B C   1 
ATOM   4775 O O   . GLY B 1 78  ? 124.550 51.977 39.652  1.00 44.02  ? 79   GLY B O   1 
ATOM   4776 N N   . PHE B 1 79  ? 124.542 51.097 37.582  1.00 39.54  ? 80   PHE B N   1 
ATOM   4777 C CA  . PHE B 1 79  ? 123.525 52.010 37.082  1.00 29.94  ? 80   PHE B CA  1 
ATOM   4778 C C   . PHE B 1 79  ? 122.140 51.490 37.458  1.00 28.38  ? 80   PHE B C   1 
ATOM   4779 O O   . PHE B 1 79  ? 121.839 50.307 37.266  1.00 31.12  ? 80   PHE B O   1 
ATOM   4780 C CB  . PHE B 1 79  ? 123.678 52.162 35.565  1.00 31.73  ? 80   PHE B CB  1 
ATOM   4781 C CG  . PHE B 1 79  ? 122.565 52.925 34.903  1.00 33.75  ? 80   PHE B CG  1 
ATOM   4782 C CD1 . PHE B 1 79  ? 121.789 52.321 33.921  1.00 36.19  ? 80   PHE B CD1 1 
ATOM   4783 C CD2 . PHE B 1 79  ? 122.300 54.245 35.250  1.00 33.78  ? 80   PHE B CD2 1 
ATOM   4784 C CE1 . PHE B 1 79  ? 120.755 53.025 33.298  1.00 35.85  ? 80   PHE B CE1 1 
ATOM   4785 C CE2 . PHE B 1 79  ? 121.270 54.959 34.644  1.00 32.10  ? 80   PHE B CE2 1 
ATOM   4786 C CZ  . PHE B 1 79  ? 120.496 54.356 33.665  1.00 30.52  ? 80   PHE B CZ  1 
ATOM   4787 N N   . GLU B 1 80  ? 121.298 52.374 38.002  1.00 28.64  ? 81   GLU B N   1 
ATOM   4788 C CA  . GLU B 1 80  ? 120.002 51.945 38.520  1.00 33.33  ? 81   GLU B CA  1 
ATOM   4789 C C   . GLU B 1 80  ? 119.125 51.335 37.430  1.00 33.85  ? 81   GLU B C   1 
ATOM   4790 O O   . GLU B 1 80  ? 118.391 50.372 37.682  1.00 28.32  ? 81   GLU B O   1 
ATOM   4791 C CB  . GLU B 1 80  ? 119.280 53.124 39.169  1.00 43.42  ? 81   GLU B CB  1 
ATOM   4792 C CG  . GLU B 1 80  ? 117.869 52.787 39.625  1.00 59.59  ? 81   GLU B CG  1 
ATOM   4793 C CD  . GLU B 1 80  ? 117.049 54.015 39.968  1.00 76.14  ? 81   GLU B CD  1 
ATOM   4794 O OE1 . GLU B 1 80  ? 116.029 53.866 40.672  1.00 85.28  ? 81   GLU B OE1 1 
ATOM   4795 O OE2 . GLU B 1 80  ? 117.420 55.126 39.533  1.00 79.63  ? 81   GLU B OE2 1 
ATOM   4796 N N   . GLY B 1 81  ? 119.183 51.884 36.211  1.00 28.64  ? 82   GLY B N   1 
ATOM   4797 C CA  . GLY B 1 81  ? 118.268 51.447 35.166  1.00 30.58  ? 82   GLY B CA  1 
ATOM   4798 C C   . GLY B 1 81  ? 118.446 49.995 34.777  1.00 29.93  ? 82   GLY B C   1 
ATOM   4799 O O   . GLY B 1 81  ? 117.490 49.340 34.352  1.00 31.38  ? 82   GLY B O   1 
ATOM   4800 N N   . THR B 1 82  ? 119.661 49.471 34.919  1.00 29.37  ? 83   THR B N   1 
ATOM   4801 C CA  . THR B 1 82  ? 119.925 48.057 34.688  1.00 26.70  ? 83   THR B CA  1 
ATOM   4802 C C   . THR B 1 82  ? 119.957 47.242 35.978  1.00 30.52  ? 83   THR B C   1 
ATOM   4803 O O   . THR B 1 82  ? 119.459 46.113 35.997  1.00 31.45  ? 83   THR B O   1 
ATOM   4804 C CB  . THR B 1 82  ? 121.248 47.884 33.939  1.00 29.67  ? 83   THR B CB  1 
ATOM   4805 O OG1 . THR B 1 82  ? 122.274 48.641 34.596  1.00 30.37  ? 83   THR B OG1 1 
ATOM   4806 C CG2 . THR B 1 82  ? 121.121 48.365 32.487  1.00 29.99  ? 83   THR B CG2 1 
ATOM   4807 N N   . GLU B 1 83  ? 120.515 47.788 37.066  1.00 26.53  ? 84   GLU B N   1 
ATOM   4808 C CA  . GLU B 1 83  ? 120.651 46.995 38.287  1.00 29.72  ? 84   GLU B CA  1 
ATOM   4809 C C   . GLU B 1 83  ? 119.302 46.604 38.870  1.00 26.56  ? 84   GLU B C   1 
ATOM   4810 O O   . GLU B 1 83  ? 119.186 45.547 39.495  1.00 28.28  ? 84   GLU B O   1 
ATOM   4811 C CB  . GLU B 1 83  ? 121.473 47.747 39.339  1.00 33.01  ? 84   GLU B CB  1 
ATOM   4812 C CG  . GLU B 1 83  ? 122.931 47.989 38.962  1.00 39.99  ? 84   GLU B CG  1 
ATOM   4813 C CD  . GLU B 1 83  ? 123.760 46.713 38.821  1.00 46.59  ? 84   GLU B CD  1 
ATOM   4814 O OE1 . GLU B 1 83  ? 124.962 46.840 38.489  1.00 46.82  ? 84   GLU B OE1 1 
ATOM   4815 O OE2 . GLU B 1 83  ? 123.232 45.594 39.047  1.00 41.48  ? 84   GLU B OE2 1 
ATOM   4816 N N   . MET B 1 84  ? 118.268 47.424 38.666  1.00 27.58  ? 85   MET B N   1 
ATOM   4817 C CA  . MET B 1 84  ? 116.959 47.110 39.225  1.00 26.36  ? 85   MET B CA  1 
ATOM   4818 C C   . MET B 1 84  ? 116.369 45.832 38.632  1.00 29.97  ? 85   MET B C   1 
ATOM   4819 O O   . MET B 1 84  ? 115.373 45.325 39.161  1.00 28.31  ? 85   MET B O   1 
ATOM   4820 C CB  . MET B 1 84  ? 115.984 48.263 38.982  1.00 27.42  ? 85   MET B CB  1 
ATOM   4821 C CG  . MET B 1 84  ? 115.654 48.445 37.483  1.00 29.20  ? 85   MET B CG  1 
ATOM   4822 S SD  . MET B 1 84  ? 114.773 49.938 37.004  1.00 34.45  ? 85   MET B SD  1 
ATOM   4823 C CE  . MET B 1 84  ? 113.098 49.436 37.360  1.00 28.00  ? 85   MET B CE  1 
ATOM   4824 N N   . TRP B 1 85  ? 116.941 45.310 37.540  1.00 25.89  ? 86   TRP B N   1 
ATOM   4825 C CA  . TRP B 1 85  ? 116.482 44.061 36.943  1.00 26.99  ? 86   TRP B CA  1 
ATOM   4826 C C   . TRP B 1 85  ? 117.387 42.874 37.266  1.00 27.12  ? 86   TRP B C   1 
ATOM   4827 O O   . TRP B 1 85  ? 116.996 41.731 37.009  1.00 22.95  ? 86   TRP B O   1 
ATOM   4828 C CB  . TRP B 1 85  ? 116.368 44.208 35.417  1.00 22.73  ? 86   TRP B CB  1 
ATOM   4829 C CG  . TRP B 1 85  ? 115.552 45.383 34.975  1.00 24.94  ? 86   TRP B CG  1 
ATOM   4830 C CD1 . TRP B 1 85  ? 116.006 46.510 34.349  1.00 26.32  ? 86   TRP B CD1 1 
ATOM   4831 C CD2 . TRP B 1 85  ? 114.137 45.551 35.124  1.00 23.73  ? 86   TRP B CD2 1 
ATOM   4832 N NE1 . TRP B 1 85  ? 114.960 47.365 34.094  1.00 23.42  ? 86   TRP B NE1 1 
ATOM   4833 C CE2 . TRP B 1 85  ? 113.801 46.802 34.561  1.00 24.56  ? 86   TRP B CE2 1 
ATOM   4834 C CE3 . TRP B 1 85  ? 113.120 44.764 35.672  1.00 22.40  ? 86   TRP B CE3 1 
ATOM   4835 C CZ2 . TRP B 1 85  ? 112.490 47.287 34.536  1.00 21.82  ? 86   TRP B CZ2 1 
ATOM   4836 C CZ3 . TRP B 1 85  ? 111.815 45.242 35.642  1.00 22.02  ? 86   TRP B CZ3 1 
ATOM   4837 C CH2 . TRP B 1 85  ? 111.512 46.493 35.081  1.00 21.41  ? 86   TRP B CH2 1 
ATOM   4838 N N   . ASN B 1 86  ? 118.576 43.115 37.818  1.00 24.27  ? 87   ASN B N   1 
ATOM   4839 C CA  . ASN B 1 86  ? 119.522 42.054 38.129  1.00 26.60  ? 87   ASN B CA  1 
ATOM   4840 C C   . ASN B 1 86  ? 119.123 41.305 39.400  1.00 25.65  ? 87   ASN B C   1 
ATOM   4841 O O   . ASN B 1 86  ? 118.378 41.830 40.231  1.00 24.81  ? 87   ASN B O   1 
ATOM   4842 C CB  . ASN B 1 86  ? 120.921 42.643 38.286  1.00 25.22  ? 87   ASN B CB  1 
ATOM   4843 C CG  . ASN B 1 86  ? 121.643 42.784 36.954  1.00 32.63  ? 87   ASN B CG  1 
ATOM   4844 O OD1 . ASN B 1 86  ? 121.322 42.086 35.986  1.00 27.48  ? 87   ASN B OD1 1 
ATOM   4845 N ND2 . ASN B 1 86  ? 122.626 43.679 36.900  1.00 29.56  ? 87   ASN B ND2 1 
ATOM   4846 N N   . PRO B 1 87  ? 119.616 40.078 39.578  1.00 25.75  ? 88   PRO B N   1 
ATOM   4847 C CA  . PRO B 1 87  ? 119.283 39.314 40.790  1.00 27.46  ? 88   PRO B CA  1 
ATOM   4848 C C   . PRO B 1 87  ? 119.606 40.089 42.058  1.00 32.07  ? 88   PRO B C   1 
ATOM   4849 O O   . PRO B 1 87  ? 120.693 40.654 42.203  1.00 27.20  ? 88   PRO B O   1 
ATOM   4850 C CB  . PRO B 1 87  ? 120.157 38.061 40.666  1.00 24.40  ? 88   PRO B CB  1 
ATOM   4851 C CG  . PRO B 1 87  ? 120.355 37.895 39.176  1.00 26.52  ? 88   PRO B CG  1 
ATOM   4852 C CD  . PRO B 1 87  ? 120.453 39.299 38.642  1.00 24.63  ? 88   PRO B CD  1 
ATOM   4853 N N   . ASN B 1 88  ? 118.647 40.123 42.984  1.00 29.67  ? 89   ASN B N   1 
ATOM   4854 C CA  . ASN B 1 88  ? 118.854 40.749 44.281  1.00 31.62  ? 89   ASN B CA  1 
ATOM   4855 C C   . ASN B 1 88  ? 118.874 39.724 45.408  1.00 34.49  ? 89   ASN B C   1 
ATOM   4856 O O   . ASN B 1 88  ? 118.778 40.099 46.582  1.00 35.07  ? 89   ASN B O   1 
ATOM   4857 C CB  . ASN B 1 88  ? 117.790 41.823 44.538  1.00 31.09  ? 89   ASN B CB  1 
ATOM   4858 C CG  . ASN B 1 88  ? 116.391 41.246 44.662  1.00 31.22  ? 89   ASN B CG  1 
ATOM   4859 O OD1 . ASN B 1 88  ? 116.116 40.130 44.211  1.00 28.73  ? 89   ASN B OD1 1 
ATOM   4860 N ND2 . ASN B 1 88  ? 115.495 42.011 45.273  1.00 30.96  ? 89   ASN B ND2 1 
ATOM   4861 N N   . ARG B 1 89  ? 118.956 38.436 45.068  1.00 31.23  ? 90   ARG B N   1 
ATOM   4862 C CA  . ARG B 1 89  ? 119.335 37.367 45.984  1.00 28.32  ? 90   ARG B CA  1 
ATOM   4863 C C   . ARG B 1 89  ? 120.350 36.470 45.305  1.00 30.35  ? 90   ARG B C   1 
ATOM   4864 O O   . ARG B 1 89  ? 120.567 36.540 44.093  1.00 30.04  ? 90   ARG B O   1 
ATOM   4865 C CB  . ARG B 1 89  ? 118.152 36.503 46.448  1.00 27.42  ? 90   ARG B CB  1 
ATOM   4866 C CG  . ARG B 1 89  ? 117.136 37.300 47.196  1.00 22.90  ? 90   ARG B CG  1 
ATOM   4867 C CD  . ARG B 1 89  ? 117.587 37.510 48.657  1.00 31.99  ? 90   ARG B CD  1 
ATOM   4868 N NE  . ARG B 1 89  ? 116.583 38.211 49.444  1.00 36.45  ? 90   ARG B NE  1 
ATOM   4869 C CZ  . ARG B 1 89  ? 116.154 39.458 49.204  1.00 35.16  ? 90   ARG B CZ  1 
ATOM   4870 N NH1 . ARG B 1 89  ? 116.666 40.198 48.244  1.00 35.27  ? 90   ARG B NH1 1 
ATOM   4871 N NH2 . ARG B 1 89  ? 115.218 39.987 49.978  1.00 33.32  ? 90   ARG B NH2 1 
ATOM   4872 N N   . GLU B 1 90  ? 120.941 35.603 46.115  1.00 24.31  ? 91   GLU B N   1 
ATOM   4873 C CA  . GLU B 1 90  ? 121.903 34.629 45.627  1.00 32.93  ? 91   GLU B CA  1 
ATOM   4874 C C   . GLU B 1 90  ? 121.294 33.755 44.534  1.00 30.53  ? 91   GLU B C   1 
ATOM   4875 O O   . GLU B 1 90  ? 120.110 33.399 44.572  1.00 27.01  ? 91   GLU B O   1 
ATOM   4876 C CB  . GLU B 1 90  ? 122.387 33.762 46.792  1.00 39.43  ? 91   GLU B CB  1 
ATOM   4877 C CG  . GLU B 1 90  ? 123.451 32.741 46.440  1.00 61.19  ? 91   GLU B CG  1 
ATOM   4878 C CD  . GLU B 1 90  ? 123.888 31.939 47.646  1.00 83.03  ? 91   GLU B CD  1 
ATOM   4879 O OE1 . GLU B 1 90  ? 125.067 31.529 47.689  1.00 87.02  ? 91   GLU B OE1 1 
ATOM   4880 O OE2 . GLU B 1 90  ? 123.046 31.720 48.544  1.00 88.16  ? 91   GLU B OE2 1 
ATOM   4881 N N   . LEU B 1 91  ? 122.129 33.400 43.559  1.00 24.21  ? 92   LEU B N   1 
ATOM   4882 C CA  . LEU B 1 91  ? 121.737 32.494 42.492  1.00 25.73  ? 92   LEU B CA  1 
ATOM   4883 C C   . LEU B 1 91  ? 121.782 31.053 42.977  1.00 26.30  ? 92   LEU B C   1 
ATOM   4884 O O   . LEU B 1 91  ? 122.684 30.661 43.718  1.00 26.91  ? 92   LEU B O   1 
ATOM   4885 C CB  . LEU B 1 91  ? 122.668 32.648 41.287  1.00 29.39  ? 92   LEU B CB  1 
ATOM   4886 C CG  . LEU B 1 91  ? 122.775 34.030 40.641  1.00 29.82  ? 92   LEU B CG  1 
ATOM   4887 C CD1 . LEU B 1 91  ? 123.806 34.020 39.512  1.00 30.38  ? 92   LEU B CD1 1 
ATOM   4888 C CD2 . LEU B 1 91  ? 121.418 34.479 40.132  1.00 25.75  ? 92   LEU B CD2 1 
ATOM   4889 N N   . SER B 1 92  ? 120.814 30.257 42.534  1.00 22.82  ? 93   SER B N   1 
ATOM   4890 C CA  . SER B 1 92  ? 120.820 28.841 42.858  1.00 26.71  ? 93   SER B CA  1 
ATOM   4891 C C   . SER B 1 92  ? 119.924 28.118 41.867  1.00 22.90  ? 93   SER B C   1 
ATOM   4892 O O   . SER B 1 92  ? 118.966 28.692 41.343  1.00 24.48  ? 93   SER B O   1 
ATOM   4893 C CB  . SER B 1 92  ? 120.346 28.588 44.298  1.00 26.88  ? 93   SER B CB  1 
ATOM   4894 O OG  . SER B 1 92  ? 120.177 27.202 44.541  1.00 29.38  ? 93   SER B OG  1 
ATOM   4895 N N   . GLU B 1 93  ? 120.260 26.856 41.600  1.00 27.21  ? 94   GLU B N   1 
ATOM   4896 C CA  . GLU B 1 93  ? 119.330 25.999 40.878  1.00 25.35  ? 94   GLU B CA  1 
ATOM   4897 C C   . GLU B 1 93  ? 118.166 25.571 41.762  1.00 27.83  ? 94   GLU B C   1 
ATOM   4898 O O   . GLU B 1 93  ? 117.107 25.214 41.242  1.00 27.51  ? 94   GLU B O   1 
ATOM   4899 C CB  . GLU B 1 93  ? 120.050 24.771 40.326  1.00 23.95  ? 94   GLU B CB  1 
ATOM   4900 C CG  . GLU B 1 93  ? 120.858 25.051 39.072  1.00 25.83  ? 94   GLU B CG  1 
ATOM   4901 C CD  . GLU B 1 93  ? 121.441 23.789 38.478  1.00 27.38  ? 94   GLU B CD  1 
ATOM   4902 O OE1 . GLU B 1 93  ? 122.534 23.372 38.923  1.00 28.93  ? 94   GLU B OE1 1 
ATOM   4903 O OE2 . GLU B 1 93  ? 120.796 23.208 37.584  1.00 24.82  ? 94   GLU B OE2 1 
ATOM   4904 N N   . ASP B 1 94  ? 118.337 25.603 43.083  1.00 22.33  ? 95   ASP B N   1 
ATOM   4905 C CA  . ASP B 1 94  ? 117.241 25.372 44.024  1.00 25.16  ? 95   ASP B CA  1 
ATOM   4906 C C   . ASP B 1 94  ? 116.492 26.694 44.167  1.00 20.89  ? 95   ASP B C   1 
ATOM   4907 O O   . ASP B 1 94  ? 116.736 27.501 45.065  1.00 22.35  ? 95   ASP B O   1 
ATOM   4908 C CB  . ASP B 1 94  ? 117.799 24.851 45.346  1.00 22.61  ? 95   ASP B CB  1 
ATOM   4909 C CG  . ASP B 1 94  ? 116.743 24.673 46.437  1.00 26.13  ? 95   ASP B CG  1 
ATOM   4910 O OD1 . ASP B 1 94  ? 115.514 24.811 46.221  1.00 27.72  ? 95   ASP B OD1 1 
ATOM   4911 O OD2 . ASP B 1 94  ? 117.186 24.303 47.537  1.00 29.68  ? 95   ASP B OD2 1 
ATOM   4912 N N   . CYS B 1 95  ? 115.561 26.927 43.246  1.00 20.96  ? 96   CYS B N   1 
ATOM   4913 C CA  . CYS B 1 95  ? 114.931 28.234 43.131  1.00 21.96  ? 96   CYS B CA  1 
ATOM   4914 C C   . CYS B 1 95  ? 113.423 28.166 42.930  1.00 19.00  ? 96   CYS B C   1 
ATOM   4915 O O   . CYS B 1 95  ? 112.795 29.211 42.741  1.00 23.01  ? 96   CYS B O   1 
ATOM   4916 C CB  . CYS B 1 95  ? 115.549 29.022 41.975  1.00 22.83  ? 96   CYS B CB  1 
ATOM   4917 S SG  . CYS B 1 95  ? 115.282 28.259 40.343  1.00 24.60  ? 96   CYS B SG  1 
ATOM   4918 N N   . LEU B 1 96  ? 112.819 26.979 42.951  1.00 22.68  ? 97   LEU B N   1 
ATOM   4919 C CA  . LEU B 1 96  ? 111.395 26.861 42.630  1.00 22.46  ? 97   LEU B CA  1 
ATOM   4920 C C   . LEU B 1 96  ? 110.580 27.170 43.890  1.00 23.30  ? 97   LEU B C   1 
ATOM   4921 O O   . LEU B 1 96  ? 110.097 26.288 44.603  1.00 20.84  ? 97   LEU B O   1 
ATOM   4922 C CB  . LEU B 1 96  ? 111.095 25.480 42.049  1.00 21.63  ? 97   LEU B CB  1 
ATOM   4923 C CG  . LEU B 1 96  ? 111.738 25.256 40.667  1.00 23.63  ? 97   LEU B CG  1 
ATOM   4924 C CD1 . LEU B 1 96  ? 111.293 23.958 39.940  1.00 17.28  ? 97   LEU B CD1 1 
ATOM   4925 C CD2 . LEU B 1 96  ? 111.513 26.486 39.781  1.00 19.31  ? 97   LEU B CD2 1 
ATOM   4926 N N   . TYR B 1 97  ? 110.442 28.468 44.164  1.00 21.45  ? 98   TYR B N   1 
ATOM   4927 C CA  . TYR B 1 97  ? 109.651 28.974 45.275  1.00 22.23  ? 98   TYR B CA  1 
ATOM   4928 C C   . TYR B 1 97  ? 108.671 30.017 44.757  1.00 21.86  ? 98   TYR B C   1 
ATOM   4929 O O   . TYR B 1 97  ? 108.883 30.628 43.710  1.00 19.88  ? 98   TYR B O   1 
ATOM   4930 C CB  . TYR B 1 97  ? 110.552 29.572 46.374  1.00 22.22  ? 98   TYR B CB  1 
ATOM   4931 C CG  . TYR B 1 97  ? 111.545 28.567 46.902  1.00 25.24  ? 98   TYR B CG  1 
ATOM   4932 C CD1 . TYR B 1 97  ? 111.292 27.863 48.074  1.00 25.56  ? 98   TYR B CD1 1 
ATOM   4933 C CD2 . TYR B 1 97  ? 112.726 28.298 46.213  1.00 24.69  ? 98   TYR B CD2 1 
ATOM   4934 C CE1 . TYR B 1 97  ? 112.197 26.927 48.558  1.00 25.89  ? 98   TYR B CE1 1 
ATOM   4935 C CE2 . TYR B 1 97  ? 113.629 27.362 46.680  1.00 26.24  ? 98   TYR B CE2 1 
ATOM   4936 C CZ  . TYR B 1 97  ? 113.357 26.682 47.857  1.00 28.30  ? 98   TYR B CZ  1 
ATOM   4937 O OH  . TYR B 1 97  ? 114.253 25.754 48.326  1.00 26.75  ? 98   TYR B OH  1 
ATOM   4938 N N   . LEU B 1 98  ? 107.577 30.206 45.491  1.00 19.71  ? 99   LEU B N   1 
ATOM   4939 C CA  . LEU B 1 98  ? 106.592 31.218 45.139  1.00 23.03  ? 99   LEU B CA  1 
ATOM   4940 C C   . LEU B 1 98  ? 106.228 32.023 46.384  1.00 22.52  ? 99   LEU B C   1 
ATOM   4941 O O   . LEU B 1 98  ? 106.569 31.654 47.510  1.00 24.49  ? 99   LEU B O   1 
ATOM   4942 C CB  . LEU B 1 98  ? 105.345 30.588 44.482  1.00 19.58  ? 99   LEU B CB  1 
ATOM   4943 C CG  . LEU B 1 98  ? 104.520 29.523 45.218  1.00 24.17  ? 99   LEU B CG  1 
ATOM   4944 C CD1 . LEU B 1 98  ? 103.639 30.118 46.326  1.00 18.51  ? 99   LEU B CD1 1 
ATOM   4945 C CD2 . LEU B 1 98  ? 103.671 28.713 44.218  1.00 17.97  ? 99   LEU B CD2 1 
ATOM   4946 N N   . ASN B 1 99  ? 105.523 33.136 46.170  1.00 23.12  ? 100  ASN B N   1 
ATOM   4947 C CA  . ASN B 1 99  ? 105.207 34.075 47.236  1.00 22.12  ? 100  ASN B CA  1 
ATOM   4948 C C   . ASN B 1 99  ? 103.730 34.441 47.185  1.00 27.45  ? 100  ASN B C   1 
ATOM   4949 O O   . ASN B 1 99  ? 103.147 34.548 46.102  1.00 26.51  ? 100  ASN B O   1 
ATOM   4950 C CB  . ASN B 1 99  ? 106.053 35.359 47.118  1.00 21.12  ? 100  ASN B CB  1 
ATOM   4951 C CG  . ASN B 1 99  ? 107.464 35.097 46.621  1.00 23.74  ? 100  ASN B CG  1 
ATOM   4952 O OD1 . ASN B 1 99  ? 108.297 34.579 47.371  1.00 29.13  ? 100  ASN B OD1 1 
ATOM   4953 N ND2 . ASN B 1 99  ? 107.744 35.439 45.379  1.00 18.22  ? 100  ASN B ND2 1 
ATOM   4954 N N   . VAL B 1 100 ? 103.133 34.647 48.360  1.00 25.02  ? 101  VAL B N   1 
ATOM   4955 C CA  . VAL B 1 100 ? 101.728 35.027 48.493  1.00 21.20  ? 101  VAL B CA  1 
ATOM   4956 C C   . VAL B 1 100 ? 101.643 36.265 49.378  1.00 28.61  ? 101  VAL B C   1 
ATOM   4957 O O   . VAL B 1 100 ? 102.162 36.265 50.500  1.00 26.53  ? 101  VAL B O   1 
ATOM   4958 C CB  . VAL B 1 100 ? 100.880 33.890 49.098  1.00 21.51  ? 101  VAL B CB  1 
ATOM   4959 C CG1 . VAL B 1 100 ? 99.408  34.296 49.161  1.00 21.74  ? 101  VAL B CG1 1 
ATOM   4960 C CG2 . VAL B 1 100 ? 101.064 32.594 48.318  1.00 17.73  ? 101  VAL B CG2 1 
ATOM   4961 N N   . TRP B 1 101 ? 100.997 37.314 48.876  1.00 22.08  ? 102  TRP B N   1 
ATOM   4962 C CA  . TRP B 1 101 ? 100.634 38.478 49.672  1.00 24.51  ? 102  TRP B CA  1 
ATOM   4963 C C   . TRP B 1 101 ? 99.120  38.496 49.831  1.00 28.33  ? 102  TRP B C   1 
ATOM   4964 O O   . TRP B 1 101 ? 98.392  38.259 48.863  1.00 25.45  ? 102  TRP B O   1 
ATOM   4965 C CB  . TRP B 1 101 ? 101.080 39.794 49.011  1.00 22.46  ? 102  TRP B CB  1 
ATOM   4966 C CG  . TRP B 1 101 ? 102.567 40.095 48.936  1.00 27.92  ? 102  TRP B CG  1 
ATOM   4967 C CD1 . TRP B 1 101 ? 103.291 40.875 49.797  1.00 32.80  ? 102  TRP B CD1 1 
ATOM   4968 C CD2 . TRP B 1 101 ? 103.485 39.681 47.911  1.00 23.83  ? 102  TRP B CD2 1 
ATOM   4969 N NE1 . TRP B 1 101 ? 104.601 40.949 49.385  1.00 29.46  ? 102  TRP B NE1 1 
ATOM   4970 C CE2 . TRP B 1 101 ? 104.746 40.224 48.231  1.00 28.48  ? 102  TRP B CE2 1 
ATOM   4971 C CE3 . TRP B 1 101 ? 103.365 38.888 46.766  1.00 25.94  ? 102  TRP B CE3 1 
ATOM   4972 C CZ2 . TRP B 1 101 ? 105.880 40.003 47.443  1.00 26.82  ? 102  TRP B CZ2 1 
ATOM   4973 C CZ3 . TRP B 1 101 ? 104.492 38.676 45.979  1.00 29.32  ? 102  TRP B CZ3 1 
ATOM   4974 C CH2 . TRP B 1 101 ? 105.730 39.228 46.323  1.00 25.35  ? 102  TRP B CH2 1 
ATOM   4975 N N   . THR B 1 102 ? 98.644  38.762 51.042  1.00 25.40  ? 103  THR B N   1 
ATOM   4976 C CA  . THR B 1 102 ? 97.221  38.907 51.314  1.00 25.83  ? 103  THR B CA  1 
ATOM   4977 C C   . THR B 1 102 ? 97.013  40.124 52.198  1.00 27.74  ? 103  THR B C   1 
ATOM   4978 O O   . THR B 1 102 ? 97.963  40.625 52.806  1.00 29.11  ? 103  THR B O   1 
ATOM   4979 C CB  . THR B 1 102 ? 96.617  37.673 52.014  1.00 28.73  ? 103  THR B CB  1 
ATOM   4980 O OG1 . THR B 1 102 ? 96.979  37.684 53.402  1.00 33.55  ? 103  THR B OG1 1 
ATOM   4981 C CG2 . THR B 1 102 ? 97.108  36.384 51.391  1.00 27.04  ? 103  THR B CG2 1 
ATOM   4982 N N   . PRO B 1 103 ? 95.787  40.637 52.273  1.00 27.41  ? 104  PRO B N   1 
ATOM   4983 C CA  . PRO B 1 103 ? 95.477  41.642 53.296  1.00 30.13  ? 104  PRO B CA  1 
ATOM   4984 C C   . PRO B 1 103 ? 95.758  41.137 54.708  1.00 34.29  ? 104  PRO B C   1 
ATOM   4985 O O   . PRO B 1 103 ? 95.880  39.935 54.959  1.00 34.51  ? 104  PRO B O   1 
ATOM   4986 C CB  . PRO B 1 103 ? 93.974  41.905 53.090  1.00 26.49  ? 104  PRO B CB  1 
ATOM   4987 C CG  . PRO B 1 103 ? 93.781  41.674 51.604  1.00 28.96  ? 104  PRO B CG  1 
ATOM   4988 C CD  . PRO B 1 103 ? 94.697  40.517 51.278  1.00 26.53  ? 104  PRO B CD  1 
ATOM   4989 N N   . TYR B 1 104 ? 95.875  42.086 55.627  1.00 29.21  ? 105  TYR B N   1 
ATOM   4990 C CA  . TYR B 1 104 ? 96.000  41.777 57.053  1.00 26.08  ? 105  TYR B CA  1 
ATOM   4991 C C   . TYR B 1 104 ? 94.838  42.435 57.798  1.00 38.19  ? 105  TYR B C   1 
ATOM   4992 O O   . TYR B 1 104 ? 94.624  43.642 57.664  1.00 37.08  ? 105  TYR B O   1 
ATOM   4993 C CB  . TYR B 1 104 ? 97.348  42.256 57.610  1.00 26.92  ? 105  TYR B CB  1 
ATOM   4994 C CG  . TYR B 1 104 ? 97.593  41.820 59.040  1.00 29.46  ? 105  TYR B CG  1 
ATOM   4995 C CD1 . TYR B 1 104 ? 97.001  42.492 60.109  1.00 28.59  ? 105  TYR B CD1 1 
ATOM   4996 C CD2 . TYR B 1 104 ? 98.400  40.724 59.322  1.00 29.39  ? 105  TYR B CD2 1 
ATOM   4997 C CE1 . TYR B 1 104 ? 97.210  42.086 61.418  1.00 29.58  ? 105  TYR B CE1 1 
ATOM   4998 C CE2 . TYR B 1 104 ? 98.617  40.310 60.627  1.00 31.71  ? 105  TYR B CE2 1 
ATOM   4999 C CZ  . TYR B 1 104 ? 98.020  40.995 61.670  1.00 37.50  ? 105  TYR B CZ  1 
ATOM   5000 O OH  . TYR B 1 104 ? 98.235  40.585 62.971  1.00 35.84  ? 105  TYR B OH  1 
ATOM   5001 N N   . PRO B 1 105 ? 94.064  41.649 58.574  1.00 36.01  ? 106  PRO B N   1 
ATOM   5002 C CA  . PRO B 1 105 ? 94.179  40.195 58.757  1.00 34.68  ? 106  PRO B CA  1 
ATOM   5003 C C   . PRO B 1 105 ? 93.814  39.438 57.487  1.00 33.76  ? 106  PRO B C   1 
ATOM   5004 O O   . PRO B 1 105 ? 93.205  40.035 56.600  1.00 32.60  ? 106  PRO B O   1 
ATOM   5005 C CB  . PRO B 1 105 ? 93.169  39.887 59.877  1.00 32.81  ? 106  PRO B CB  1 
ATOM   5006 C CG  . PRO B 1 105 ? 92.401  41.140 60.110  1.00 36.53  ? 106  PRO B CG  1 
ATOM   5007 C CD  . PRO B 1 105 ? 92.806  42.174 59.118  1.00 33.93  ? 106  PRO B CD  1 
ATOM   5008 N N   . ARG B 1 106 ? 94.195  38.166 57.403  1.00 37.41  ? 107  ARG B N   1 
ATOM   5009 C CA  . ARG B 1 106 ? 93.942  37.397 56.194  1.00 43.51  ? 107  ARG B CA  1 
ATOM   5010 C C   . ARG B 1 106 ? 92.457  37.445 55.852  1.00 35.98  ? 107  ARG B C   1 
ATOM   5011 O O   . ARG B 1 106 ? 91.612  37.404 56.754  1.00 39.96  ? 107  ARG B O   1 
ATOM   5012 C CB  . ARG B 1 106 ? 94.389  35.941 56.362  1.00 44.08  ? 107  ARG B CB  1 
ATOM   5013 C CG  . ARG B 1 106 ? 95.886  35.757 56.578  1.00 45.78  ? 107  ARG B CG  1 
ATOM   5014 C CD  . ARG B 1 106 ? 96.399  34.467 55.939  1.00 43.26  ? 107  ARG B CD  1 
ATOM   5015 N NE  . ARG B 1 106 ? 95.555  33.304 56.222  1.00 42.96  ? 107  ARG B NE  1 
ATOM   5016 C CZ  . ARG B 1 106 ? 95.694  32.510 57.281  1.00 48.61  ? 107  ARG B CZ  1 
ATOM   5017 N NH1 . ARG B 1 106 ? 96.637  32.754 58.183  1.00 48.31  ? 107  ARG B NH1 1 
ATOM   5018 N NH2 . ARG B 1 106 ? 94.886  31.471 57.441  1.00 51.93  ? 107  ARG B NH2 1 
ATOM   5019 N N   . PRO B 1 107 ? 92.104  37.558 54.573  1.00 34.67  ? 108  PRO B N   1 
ATOM   5020 C CA  . PRO B 1 107 ? 90.686  37.570 54.209  1.00 36.55  ? 108  PRO B CA  1 
ATOM   5021 C C   . PRO B 1 107 ? 90.010  36.292 54.673  1.00 36.77  ? 108  PRO B C   1 
ATOM   5022 O O   . PRO B 1 107 ? 90.608  35.213 54.686  1.00 39.35  ? 108  PRO B O   1 
ATOM   5023 C CB  . PRO B 1 107 ? 90.703  37.666 52.677  1.00 34.38  ? 108  PRO B CB  1 
ATOM   5024 C CG  . PRO B 1 107 ? 92.084  38.116 52.311  1.00 31.79  ? 108  PRO B CG  1 
ATOM   5025 C CD  . PRO B 1 107 ? 92.987  37.608 53.395  1.00 33.26  ? 108  PRO B CD  1 
ATOM   5026 N N   . THR B 1 108 ? 88.756  36.428 55.085  1.00 35.89  ? 109  THR B N   1 
ATOM   5027 C CA  . THR B 1 108 ? 87.940  35.276 55.430  1.00 52.40  ? 109  THR B CA  1 
ATOM   5028 C C   . THR B 1 108 ? 86.812  35.047 54.433  1.00 55.75  ? 109  THR B C   1 
ATOM   5029 O O   . THR B 1 108 ? 85.996  34.142 54.635  1.00 58.93  ? 109  THR B O   1 
ATOM   5030 C CB  . THR B 1 108 ? 87.381  35.425 56.848  1.00 51.66  ? 109  THR B CB  1 
ATOM   5031 O OG1 . THR B 1 108 ? 86.752  36.705 56.992  1.00 51.88  ? 109  THR B OG1 1 
ATOM   5032 C CG2 . THR B 1 108 ? 88.498  35.274 57.878  1.00 51.68  ? 109  THR B CG2 1 
ATOM   5033 N N   . SER B 1 109 ? 86.748  35.848 53.370  1.00 50.91  ? 110  SER B N   1 
ATOM   5034 C CA  . SER B 1 109 ? 85.896  35.664 52.211  1.00 46.65  ? 110  SER B CA  1 
ATOM   5035 C C   . SER B 1 109 ? 86.763  35.504 50.969  1.00 40.12  ? 110  SER B C   1 
ATOM   5036 O O   . SER B 1 109 ? 87.794  36.174 50.850  1.00 34.10  ? 110  SER B O   1 
ATOM   5037 C CB  . SER B 1 109 ? 84.944  36.855 52.019  1.00 45.65  ? 110  SER B CB  1 
ATOM   5038 O OG  . SER B 1 109 ? 84.180  37.093 53.186  1.00 64.55  ? 110  SER B OG  1 
ATOM   5039 N N   . PRO B 1 110 ? 86.384  34.628 50.041  1.00 38.09  ? 111  PRO B N   1 
ATOM   5040 C CA  . PRO B 1 110 ? 87.214  34.399 48.846  1.00 39.38  ? 111  PRO B CA  1 
ATOM   5041 C C   . PRO B 1 110 ? 87.540  35.691 48.112  1.00 37.78  ? 111  PRO B C   1 
ATOM   5042 O O   . PRO B 1 110 ? 86.642  36.425 47.691  1.00 38.31  ? 111  PRO B O   1 
ATOM   5043 C CB  . PRO B 1 110 ? 86.349  33.463 47.991  1.00 37.81  ? 111  PRO B CB  1 
ATOM   5044 C CG  . PRO B 1 110 ? 85.433  32.787 48.983  1.00 37.65  ? 111  PRO B CG  1 
ATOM   5045 C CD  . PRO B 1 110 ? 85.149  33.831 50.026  1.00 32.90  ? 111  PRO B CD  1 
ATOM   5046 N N   . THR B 1 111 ? 88.830  35.982 47.983  1.00 33.87  ? 112  THR B N   1 
ATOM   5047 C CA  . THR B 1 111 ? 89.395  37.202 47.436  1.00 35.81  ? 112  THR B CA  1 
ATOM   5048 C C   . THR B 1 111 ? 89.999  36.935 46.058  1.00 33.11  ? 112  THR B C   1 
ATOM   5049 O O   . THR B 1 111 ? 90.665  35.912 45.872  1.00 31.31  ? 112  THR B O   1 
ATOM   5050 C CB  . THR B 1 111 ? 90.472  37.739 48.389  1.00 36.62  ? 112  THR B CB  1 
ATOM   5051 O OG1 . THR B 1 111 ? 89.894  37.950 49.680  1.00 39.06  ? 112  THR B OG1 1 
ATOM   5052 C CG2 . THR B 1 111 ? 91.059  39.042 47.901  1.00 34.08  ? 112  THR B CG2 1 
ATOM   5053 N N   . PRO B 1 112 ? 89.767  37.805 45.072  1.00 41.41  ? 113  PRO B N   1 
ATOM   5054 C CA  . PRO B 1 112 ? 90.323  37.563 43.730  1.00 33.97  ? 113  PRO B CA  1 
ATOM   5055 C C   . PRO B 1 112 ? 91.843  37.524 43.752  1.00 26.83  ? 113  PRO B C   1 
ATOM   5056 O O   . PRO B 1 112 ? 92.497  38.243 44.513  1.00 27.53  ? 113  PRO B O   1 
ATOM   5057 C CB  . PRO B 1 112 ? 89.806  38.750 42.908  1.00 35.14  ? 113  PRO B CB  1 
ATOM   5058 C CG  . PRO B 1 112 ? 89.485  39.804 43.924  1.00 42.93  ? 113  PRO B CG  1 
ATOM   5059 C CD  . PRO B 1 112 ? 88.972  39.044 45.116  1.00 42.36  ? 113  PRO B CD  1 
ATOM   5060 N N   . VAL B 1 113 ? 92.401  36.664 42.900  1.00 24.22  ? 114  VAL B N   1 
ATOM   5061 C CA  . VAL B 1 113 ? 93.824  36.340 42.899  1.00 19.30  ? 114  VAL B CA  1 
ATOM   5062 C C   . VAL B 1 113 ? 94.470  36.896 41.639  1.00 23.75  ? 114  VAL B C   1 
ATOM   5063 O O   . VAL B 1 113 ? 93.980  36.666 40.527  1.00 22.86  ? 114  VAL B O   1 
ATOM   5064 C CB  . VAL B 1 113 ? 94.054  34.821 42.991  1.00 22.94  ? 114  VAL B CB  1 
ATOM   5065 C CG1 . VAL B 1 113 ? 95.550  34.509 43.025  1.00 20.20  ? 114  VAL B CG1 1 
ATOM   5066 C CG2 . VAL B 1 113 ? 93.337  34.242 44.216  1.00 23.65  ? 114  VAL B CG2 1 
ATOM   5067 N N   . LEU B 1 114 ? 95.575  37.611 41.814  1.00 23.74  ? 115  LEU B N   1 
ATOM   5068 C CA  . LEU B 1 114 ? 96.456  38.003 40.724  1.00 23.15  ? 115  LEU B CA  1 
ATOM   5069 C C   . LEU B 1 114 ? 97.715  37.152 40.790  1.00 22.72  ? 115  LEU B C   1 
ATOM   5070 O O   . LEU B 1 114 ? 98.298  36.984 41.867  1.00 25.20  ? 115  LEU B O   1 
ATOM   5071 C CB  . LEU B 1 114 ? 96.819  39.487 40.813  1.00 23.99  ? 115  LEU B CB  1 
ATOM   5072 C CG  . LEU B 1 114 ? 95.748  40.464 40.329  1.00 33.53  ? 115  LEU B CG  1 
ATOM   5073 C CD1 . LEU B 1 114 ? 96.002  41.850 40.890  1.00 32.11  ? 115  LEU B CD1 1 
ATOM   5074 C CD2 . LEU B 1 114 ? 95.732  40.505 38.797  1.00 36.65  ? 115  LEU B CD2 1 
ATOM   5075 N N   . VAL B 1 115 ? 98.121  36.600 39.651  1.00 20.36  ? 116  VAL B N   1 
ATOM   5076 C CA  . VAL B 1 115 ? 99.340  35.804 39.564  1.00 20.33  ? 116  VAL B CA  1 
ATOM   5077 C C   . VAL B 1 115 ? 100.287 36.507 38.606  1.00 20.43  ? 116  VAL B C   1 
ATOM   5078 O O   . VAL B 1 115 ? 99.969  36.673 37.424  1.00 23.44  ? 116  VAL B O   1 
ATOM   5079 C CB  . VAL B 1 115 ? 99.066  34.362 39.114  1.00 21.96  ? 116  VAL B CB  1 
ATOM   5080 C CG1 . VAL B 1 115 ? 100.370 33.565 39.084  1.00 18.30  ? 116  VAL B CG1 1 
ATOM   5081 C CG2 . VAL B 1 115 ? 98.079  33.703 40.048  1.00 17.48  ? 116  VAL B CG2 1 
ATOM   5082 N N   . TRP B 1 116 ? 101.443 36.915 39.118  1.00 17.46  ? 117  TRP B N   1 
ATOM   5083 C CA  . TRP B 1 116 ? 102.440 37.659 38.362  1.00 21.61  ? 117  TRP B CA  1 
ATOM   5084 C C   . TRP B 1 116 ? 103.492 36.709 37.807  1.00 23.05  ? 117  TRP B C   1 
ATOM   5085 O O   . TRP B 1 116 ? 104.008 35.855 38.536  1.00 16.47  ? 117  TRP B O   1 
ATOM   5086 C CB  . TRP B 1 116 ? 103.105 38.710 39.252  1.00 19.25  ? 117  TRP B CB  1 
ATOM   5087 C CG  . TRP B 1 116 ? 104.250 39.406 38.601  1.00 21.04  ? 117  TRP B CG  1 
ATOM   5088 C CD1 . TRP B 1 116 ? 105.575 39.267 38.899  1.00 18.29  ? 117  TRP B CD1 1 
ATOM   5089 C CD2 . TRP B 1 116 ? 104.174 40.353 37.529  1.00 18.30  ? 117  TRP B CD2 1 
ATOM   5090 N NE1 . TRP B 1 116 ? 106.329 40.075 38.084  1.00 18.89  ? 117  TRP B NE1 1 
ATOM   5091 C CE2 . TRP B 1 116 ? 105.493 40.754 37.234  1.00 18.85  ? 117  TRP B CE2 1 
ATOM   5092 C CE3 . TRP B 1 116 ? 103.116 40.910 36.798  1.00 19.81  ? 117  TRP B CE3 1 
ATOM   5093 C CZ2 . TRP B 1 116 ? 105.787 41.686 36.234  1.00 16.35  ? 117  TRP B CZ2 1 
ATOM   5094 C CZ3 . TRP B 1 116 ? 103.407 41.837 35.808  1.00 21.93  ? 117  TRP B CZ3 1 
ATOM   5095 C CH2 . TRP B 1 116 ? 104.733 42.216 35.538  1.00 20.02  ? 117  TRP B CH2 1 
ATOM   5096 N N   . ILE B 1 117 ? 103.804 36.858 36.520  1.00 18.96  ? 118  ILE B N   1 
ATOM   5097 C CA  . ILE B 1 117 ? 104.862 36.100 35.858  1.00 18.02  ? 118  ILE B CA  1 
ATOM   5098 C C   . ILE B 1 117 ? 105.867 37.113 35.335  1.00 17.86  ? 118  ILE B C   1 
ATOM   5099 O O   . ILE B 1 117 ? 105.548 37.893 34.428  1.00 20.42  ? 118  ILE B O   1 
ATOM   5100 C CB  . ILE B 1 117 ? 104.324 35.226 34.716  1.00 22.56  ? 118  ILE B CB  1 
ATOM   5101 C CG1 . ILE B 1 117 ? 103.244 34.272 35.228  1.00 20.46  ? 118  ILE B CG1 1 
ATOM   5102 C CG2 . ILE B 1 117 ? 105.467 34.445 34.059  1.00 17.38  ? 118  ILE B CG2 1 
ATOM   5103 C CD1 . ILE B 1 117 ? 102.674 33.369 34.133  1.00 20.56  ? 118  ILE B CD1 1 
ATOM   5104 N N   . TYR B 1 118 ? 107.076 37.115 35.900  1.00 14.53  ? 119  TYR B N   1 
ATOM   5105 C CA  . TYR B 1 118 ? 108.042 38.136 35.520  1.00 17.69  ? 119  TYR B CA  1 
ATOM   5106 C C   . TYR B 1 118 ? 108.560 37.907 34.102  1.00 19.23  ? 119  TYR B C   1 
ATOM   5107 O O   . TYR B 1 118 ? 108.483 36.807 33.543  1.00 17.98  ? 119  TYR B O   1 
ATOM   5108 C CB  . TYR B 1 118 ? 109.223 38.188 36.496  1.00 20.72  ? 119  TYR B CB  1 
ATOM   5109 C CG  . TYR B 1 118 ? 109.968 36.880 36.726  1.00 20.74  ? 119  TYR B CG  1 
ATOM   5110 C CD1 . TYR B 1 118 ? 110.823 36.353 35.759  1.00 16.59  ? 119  TYR B CD1 1 
ATOM   5111 C CD2 . TYR B 1 118 ? 109.844 36.199 37.933  1.00 19.41  ? 119  TYR B CD2 1 
ATOM   5112 C CE1 . TYR B 1 118 ? 111.518 35.168 35.985  1.00 19.35  ? 119  TYR B CE1 1 
ATOM   5113 C CE2 . TYR B 1 118 ? 110.527 35.019 38.169  1.00 20.29  ? 119  TYR B CE2 1 
ATOM   5114 C CZ  . TYR B 1 118 ? 111.356 34.505 37.195  1.00 23.51  ? 119  TYR B CZ  1 
ATOM   5115 O OH  . TYR B 1 118 ? 112.027 33.331 37.452  1.00 20.24  ? 119  TYR B OH  1 
ATOM   5116 N N   . GLY B 1 119 ? 109.090 38.978 33.520  1.00 17.50  ? 120  GLY B N   1 
ATOM   5117 C CA  . GLY B 1 119 ? 109.794 38.914 32.262  1.00 20.68  ? 120  GLY B CA  1 
ATOM   5118 C C   . GLY B 1 119 ? 111.298 38.888 32.449  1.00 21.73  ? 120  GLY B C   1 
ATOM   5119 O O   . GLY B 1 119 ? 111.816 38.682 33.555  1.00 24.44  ? 120  GLY B O   1 
ATOM   5120 N N   . GLY B 1 120 ? 112.010 39.112 31.345  1.00 20.88  ? 121  GLY B N   1 
ATOM   5121 C CA  . GLY B 1 120 ? 113.456 38.991 31.323  1.00 20.45  ? 121  GLY B CA  1 
ATOM   5122 C C   . GLY B 1 120 ? 113.942 38.090 30.202  1.00 22.39  ? 121  GLY B C   1 
ATOM   5123 O O   . GLY B 1 120 ? 114.955 37.396 30.343  1.00 23.30  ? 121  GLY B O   1 
ATOM   5124 N N   . GLY B 1 121 ? 113.206 38.076 29.091  1.00 20.67  ? 122  GLY B N   1 
ATOM   5125 C CA  . GLY B 1 121 ? 113.619 37.378 27.887  1.00 22.89  ? 122  GLY B CA  1 
ATOM   5126 C C   . GLY B 1 121 ? 113.740 35.874 27.998  1.00 22.50  ? 122  GLY B C   1 
ATOM   5127 O O   . GLY B 1 121 ? 114.392 35.262 27.150  1.00 19.37  ? 122  GLY B O   1 
ATOM   5128 N N   . PHE B 1 122 ? 113.132 35.256 29.012  1.00 16.93  ? 123  PHE B N   1 
ATOM   5129 C CA  . PHE B 1 122 ? 113.302 33.841 29.329  1.00 19.05  ? 123  PHE B CA  1 
ATOM   5130 C C   . PHE B 1 122 ? 114.742 33.488 29.706  1.00 21.87  ? 123  PHE B C   1 
ATOM   5131 O O   . PHE B 1 122 ? 115.064 32.303 29.844  1.00 21.07  ? 123  PHE B O   1 
ATOM   5132 C CB  . PHE B 1 122 ? 112.830 32.925 28.183  1.00 15.23  ? 123  PHE B CB  1 
ATOM   5133 C CG  . PHE B 1 122 ? 111.348 33.015 27.878  1.00 19.19  ? 123  PHE B CG  1 
ATOM   5134 C CD1 . PHE B 1 122 ? 110.404 32.507 28.765  1.00 18.78  ? 123  PHE B CD1 1 
ATOM   5135 C CD2 . PHE B 1 122 ? 110.904 33.587 26.687  1.00 19.79  ? 123  PHE B CD2 1 
ATOM   5136 C CE1 . PHE B 1 122 ? 109.029 32.576 28.478  1.00 16.80  ? 123  PHE B CE1 1 
ATOM   5137 C CE2 . PHE B 1 122 ? 109.545 33.662 26.391  1.00 19.04  ? 123  PHE B CE2 1 
ATOM   5138 C CZ  . PHE B 1 122 ? 108.600 33.152 27.295  1.00 16.23  ? 123  PHE B CZ  1 
ATOM   5139 N N   . TYR B 1 123 ? 115.625 34.482 29.879  1.00 18.26  ? 124  TYR B N   1 
ATOM   5140 C CA  . TYR B 1 123 ? 116.989 34.230 30.331  1.00 19.00  ? 124  TYR B CA  1 
ATOM   5141 C C   . TYR B 1 123 ? 117.289 34.806 31.707  1.00 22.46  ? 124  TYR B C   1 
ATOM   5142 O O   . TYR B 1 123 ? 118.384 34.568 32.226  1.00 22.72  ? 124  TYR B O   1 
ATOM   5143 C CB  . TYR B 1 123 ? 118.019 34.796 29.331  1.00 18.13  ? 124  TYR B CB  1 
ATOM   5144 C CG  . TYR B 1 123 ? 118.138 36.310 29.322  1.00 23.85  ? 124  TYR B CG  1 
ATOM   5145 C CD1 . TYR B 1 123 ? 119.000 36.980 30.200  1.00 24.84  ? 124  TYR B CD1 1 
ATOM   5146 C CD2 . TYR B 1 123 ? 117.402 37.070 28.421  1.00 23.29  ? 124  TYR B CD2 1 
ATOM   5147 C CE1 . TYR B 1 123 ? 119.099 38.364 30.192  1.00 20.43  ? 124  TYR B CE1 1 
ATOM   5148 C CE2 . TYR B 1 123 ? 117.497 38.448 28.402  1.00 23.11  ? 124  TYR B CE2 1 
ATOM   5149 C CZ  . TYR B 1 123 ? 118.343 39.089 29.285  1.00 27.26  ? 124  TYR B CZ  1 
ATOM   5150 O OH  . TYR B 1 123 ? 118.420 40.460 29.248  1.00 31.00  ? 124  TYR B OH  1 
ATOM   5151 N N   . SER B 1 124 ? 116.373 35.573 32.293  1.00 22.11  ? 125  SER B N   1 
ATOM   5152 C CA  . SER B 1 124 ? 116.640 36.270 33.544  1.00 24.21  ? 125  SER B CA  1 
ATOM   5153 C C   . SER B 1 124 ? 115.310 36.565 34.228  1.00 22.35  ? 125  SER B C   1 
ATOM   5154 O O   . SER B 1 124 ? 114.237 36.275 33.694  1.00 20.02  ? 125  SER B O   1 
ATOM   5155 C CB  . SER B 1 124 ? 117.429 37.561 33.298  1.00 22.81  ? 125  SER B CB  1 
ATOM   5156 O OG  . SER B 1 124 ? 116.681 38.460 32.486  1.00 24.44  ? 125  SER B OG  1 
ATOM   5157 N N   . GLY B 1 125 ? 115.393 37.167 35.412  1.00 21.17  ? 126  GLY B N   1 
ATOM   5158 C CA  . GLY B 1 125 ? 114.213 37.571 36.150  1.00 19.25  ? 126  GLY B CA  1 
ATOM   5159 C C   . GLY B 1 125 ? 114.068 36.874 37.486  1.00 20.76  ? 126  GLY B C   1 
ATOM   5160 O O   . GLY B 1 125 ? 114.655 35.808 37.705  1.00 22.18  ? 126  GLY B O   1 
ATOM   5161 N N   . ALA B 1 126 ? 113.270 37.461 38.376  1.00 18.78  ? 127  ALA B N   1 
ATOM   5162 C CA  . ALA B 1 126 ? 113.104 36.950 39.729  1.00 22.54  ? 127  ALA B CA  1 
ATOM   5163 C C   . ALA B 1 126 ? 111.848 37.566 40.329  1.00 24.44  ? 127  ALA B C   1 
ATOM   5164 O O   . ALA B 1 126 ? 111.537 38.730 40.069  1.00 24.46  ? 127  ALA B O   1 
ATOM   5165 C CB  . ALA B 1 126 ? 114.323 37.273 40.606  1.00 20.13  ? 127  ALA B CB  1 
ATOM   5166 N N   . SER B 1 127 ? 111.128 36.780 41.128  1.00 21.24  ? 128  SER B N   1 
ATOM   5167 C CA  . SER B 1 127 ? 109.946 37.314 41.793  1.00 26.30  ? 128  SER B CA  1 
ATOM   5168 C C   . SER B 1 127 ? 110.292 38.236 42.956  1.00 23.85  ? 128  SER B C   1 
ATOM   5169 O O   . SER B 1 127 ? 109.389 38.881 43.505  1.00 24.06  ? 128  SER B O   1 
ATOM   5170 C CB  . SER B 1 127 ? 109.056 36.165 42.272  1.00 26.68  ? 128  SER B CB  1 
ATOM   5171 O OG  . SER B 1 127 ? 109.751 35.317 43.172  1.00 26.73  ? 128  SER B OG  1 
ATOM   5172 N N   . SER B 1 128 ? 111.570 38.335 43.320  1.00 22.88  ? 129  SER B N   1 
ATOM   5173 C CA  . SER B 1 128 ? 112.024 39.087 44.485  1.00 24.13  ? 129  SER B CA  1 
ATOM   5174 C C   . SER B 1 128 ? 112.454 40.503 44.150  1.00 25.45  ? 129  SER B C   1 
ATOM   5175 O O   . SER B 1 128 ? 112.847 41.247 45.058  1.00 25.58  ? 129  SER B O   1 
ATOM   5176 C CB  . SER B 1 128 ? 113.189 38.354 45.155  1.00 24.66  ? 129  SER B CB  1 
ATOM   5177 O OG  . SER B 1 128 ? 114.247 38.134 44.233  1.00 24.31  ? 129  SER B OG  1 
ATOM   5178 N N   . LEU B 1 129 ? 112.409 40.894 42.878  1.00 26.98  ? 130  LEU B N   1 
ATOM   5179 C CA  . LEU B 1 129 ? 112.790 42.248 42.502  1.00 24.70  ? 130  LEU B CA  1 
ATOM   5180 C C   . LEU B 1 129 ? 111.924 43.265 43.235  1.00 26.80  ? 130  LEU B C   1 
ATOM   5181 O O   . LEU B 1 129 ? 110.716 43.070 43.392  1.00 22.23  ? 130  LEU B O   1 
ATOM   5182 C CB  . LEU B 1 129 ? 112.637 42.448 40.993  1.00 24.92  ? 130  LEU B CB  1 
ATOM   5183 C CG  . LEU B 1 129 ? 113.408 41.522 40.054  1.00 30.88  ? 130  LEU B CG  1 
ATOM   5184 C CD1 . LEU B 1 129 ? 113.376 42.005 38.600  1.00 25.05  ? 130  LEU B CD1 1 
ATOM   5185 C CD2 . LEU B 1 129 ? 114.836 41.375 40.558  1.00 30.52  ? 130  LEU B CD2 1 
ATOM   5186 N N   . ASP B 1 130 ? 112.557 44.360 43.677  1.00 23.77  ? 131  ASP B N   1 
ATOM   5187 C CA  . ASP B 1 130 ? 111.832 45.413 44.386  1.00 25.72  ? 131  ASP B CA  1 
ATOM   5188 C C   . ASP B 1 130 ? 110.603 45.869 43.617  1.00 31.54  ? 131  ASP B C   1 
ATOM   5189 O O   . ASP B 1 130 ? 109.548 46.123 44.211  1.00 29.28  ? 131  ASP B O   1 
ATOM   5190 C CB  . ASP B 1 130 ? 112.738 46.622 44.638  1.00 29.77  ? 131  ASP B CB  1 
ATOM   5191 C CG  . ASP B 1 130 ? 113.819 46.347 45.656  1.00 33.61  ? 131  ASP B CG  1 
ATOM   5192 O OD1 . ASP B 1 130 ? 113.763 45.295 46.332  1.00 32.92  ? 131  ASP B OD1 1 
ATOM   5193 O OD2 . ASP B 1 130 ? 114.715 47.202 45.790  1.00 39.90  ? 131  ASP B OD2 1 
ATOM   5194 N N   . VAL B 1 131 ? 110.714 45.967 42.289  1.00 25.52  ? 132  VAL B N   1 
ATOM   5195 C CA  . VAL B 1 131 ? 109.643 46.555 41.496  1.00 24.89  ? 132  VAL B CA  1 
ATOM   5196 C C   . VAL B 1 131 ? 108.448 45.621 41.355  1.00 24.28  ? 132  VAL B C   1 
ATOM   5197 O O   . VAL B 1 131 ? 107.391 46.057 40.887  1.00 26.58  ? 132  VAL B O   1 
ATOM   5198 C CB  . VAL B 1 131 ? 110.249 47.025 40.148  1.00 31.46  ? 132  VAL B CB  1 
ATOM   5199 C CG1 . VAL B 1 131 ? 110.743 45.852 39.304  1.00 25.26  ? 132  VAL B CG1 1 
ATOM   5200 C CG2 . VAL B 1 131 ? 109.304 47.929 39.373  1.00 34.31  ? 132  VAL B CG2 1 
ATOM   5201 N N   . TYR B 1 132 ? 108.561 44.360 41.793  1.00 19.65  ? 133  TYR B N   1 
ATOM   5202 C CA  . TYR B 1 132 ? 107.428 43.436 41.845  1.00 20.63  ? 133  TYR B CA  1 
ATOM   5203 C C   . TYR B 1 132 ? 106.859 43.256 43.247  1.00 27.56  ? 133  TYR B C   1 
ATOM   5204 O O   . TYR B 1 132 ? 106.117 42.294 43.478  1.00 28.64  ? 133  TYR B O   1 
ATOM   5205 C CB  . TYR B 1 132 ? 107.809 42.052 41.315  1.00 19.94  ? 133  TYR B CB  1 
ATOM   5206 C CG  . TYR B 1 132 ? 108.505 42.038 39.973  1.00 27.26  ? 133  TYR B CG  1 
ATOM   5207 C CD1 . TYR B 1 132 ? 109.431 41.047 39.664  1.00 20.81  ? 133  TYR B CD1 1 
ATOM   5208 C CD2 . TYR B 1 132 ? 108.226 42.998 39.015  1.00 26.17  ? 133  TYR B CD2 1 
ATOM   5209 C CE1 . TYR B 1 132 ? 110.071 41.018 38.441  1.00 23.34  ? 133  TYR B CE1 1 
ATOM   5210 C CE2 . TYR B 1 132 ? 108.862 42.972 37.770  1.00 29.17  ? 133  TYR B CE2 1 
ATOM   5211 C CZ  . TYR B 1 132 ? 109.782 41.978 37.493  1.00 24.55  ? 133  TYR B CZ  1 
ATOM   5212 O OH  . TYR B 1 132 ? 110.395 41.982 36.258  1.00 24.86  ? 133  TYR B OH  1 
ATOM   5213 N N   . ASP B 1 133 ? 107.215 44.129 44.188  1.00 29.08  ? 134  ASP B N   1 
ATOM   5214 C CA  . ASP B 1 133 ? 106.716 44.045 45.558  1.00 27.08  ? 134  ASP B CA  1 
ATOM   5215 C C   . ASP B 1 133 ? 105.194 44.132 45.585  1.00 26.91  ? 134  ASP B C   1 
ATOM   5216 O O   . ASP B 1 133 ? 104.625 45.175 45.256  1.00 24.95  ? 134  ASP B O   1 
ATOM   5217 C CB  . ASP B 1 133 ? 107.331 45.164 46.398  1.00 28.19  ? 134  ASP B CB  1 
ATOM   5218 C CG  . ASP B 1 133 ? 106.998 45.046 47.880  1.00 36.00  ? 134  ASP B CG  1 
ATOM   5219 O OD1 . ASP B 1 133 ? 106.149 44.209 48.256  1.00 33.57  ? 134  ASP B OD1 1 
ATOM   5220 O OD2 . ASP B 1 133 ? 107.584 45.817 48.672  1.00 39.59  ? 134  ASP B OD2 1 
ATOM   5221 N N   . GLY B 1 134 ? 104.529 43.055 45.999  1.00 22.57  ? 135  GLY B N   1 
ATOM   5222 C CA  . GLY B 1 134 ? 103.079 42.985 45.948  1.00 24.15  ? 135  GLY B CA  1 
ATOM   5223 C C   . GLY B 1 134 ? 102.307 43.698 47.043  1.00 26.66  ? 135  GLY B C   1 
ATOM   5224 O O   . GLY B 1 134 ? 101.074 43.699 46.994  1.00 25.62  ? 135  GLY B O   1 
ATOM   5225 N N   . ARG B 1 135 ? 102.979 44.340 48.008  1.00 23.70  ? 136  ARG B N   1 
ATOM   5226 C CA  . ARG B 1 135 ? 102.286 44.806 49.210  1.00 28.42  ? 136  ARG B CA  1 
ATOM   5227 C C   . ARG B 1 135 ? 101.326 45.962 48.928  1.00 27.84  ? 136  ARG B C   1 
ATOM   5228 O O   . ARG B 1 135 ? 100.279 46.063 49.582  1.00 26.61  ? 136  ARG B O   1 
ATOM   5229 C CB  . ARG B 1 135 ? 103.301 45.215 50.284  1.00 25.12  ? 136  ARG B CB  1 
ATOM   5230 C CG  . ARG B 1 135 ? 103.990 46.556 50.021  1.00 26.77  ? 136  ARG B CG  1 
ATOM   5231 C CD  . ARG B 1 135 ? 105.007 46.892 51.096  1.00 28.50  ? 136  ARG B CD  1 
ATOM   5232 N NE  . ARG B 1 135 ? 106.208 46.072 50.990  1.00 29.46  ? 136  ARG B NE  1 
ATOM   5233 C CZ  . ARG B 1 135 ? 107.083 45.888 51.975  1.00 37.57  ? 136  ARG B CZ  1 
ATOM   5234 N NH1 . ARG B 1 135 ? 106.885 46.449 53.168  1.00 34.95  ? 136  ARG B NH1 1 
ATOM   5235 N NH2 . ARG B 1 135 ? 108.150 45.122 51.775  1.00 28.61  ? 136  ARG B NH2 1 
ATOM   5236 N N   . PHE B 1 136 ? 101.651 46.837 47.972  1.00 25.57  ? 137  PHE B N   1 
ATOM   5237 C CA  . PHE B 1 136 ? 100.807 48.009 47.740  1.00 27.64  ? 137  PHE B CA  1 
ATOM   5238 C C   . PHE B 1 136 ? 99.526  47.641 47.003  1.00 27.88  ? 137  PHE B C   1 
ATOM   5239 O O   . PHE B 1 136 ? 98.452  48.175 47.310  1.00 26.51  ? 137  PHE B O   1 
ATOM   5240 C CB  . PHE B 1 136 ? 101.578 49.073 46.965  1.00 26.12  ? 137  PHE B CB  1 
ATOM   5241 C CG  . PHE B 1 136 ? 102.882 49.450 47.593  1.00 31.41  ? 137  PHE B CG  1 
ATOM   5242 C CD1 . PHE B 1 136 ? 104.076 48.959 47.090  1.00 29.82  ? 137  PHE B CD1 1 
ATOM   5243 C CD2 . PHE B 1 136 ? 102.917 50.283 48.700  1.00 32.95  ? 137  PHE B CD2 1 
ATOM   5244 C CE1 . PHE B 1 136 ? 105.282 49.304 47.676  1.00 28.37  ? 137  PHE B CE1 1 
ATOM   5245 C CE2 . PHE B 1 136 ? 104.120 50.630 49.290  1.00 31.37  ? 137  PHE B CE2 1 
ATOM   5246 C CZ  . PHE B 1 136 ? 105.303 50.141 48.778  1.00 29.48  ? 137  PHE B CZ  1 
ATOM   5247 N N   . LEU B 1 137 ? 99.622  46.741 46.021  1.00 24.91  ? 138  LEU B N   1 
ATOM   5248 C CA  . LEU B 1 137 ? 98.443  46.303 45.280  1.00 29.66  ? 138  LEU B CA  1 
ATOM   5249 C C   . LEU B 1 137 ? 97.472  45.588 46.198  1.00 28.40  ? 138  LEU B C   1 
ATOM   5250 O O   . LEU B 1 137 ? 96.257  45.815 46.151  1.00 28.74  ? 138  LEU B O   1 
ATOM   5251 C CB  . LEU B 1 137 ? 98.855  45.365 44.145  1.00 25.70  ? 138  LEU B CB  1 
ATOM   5252 C CG  . LEU B 1 137 ? 98.661  45.829 42.710  1.00 33.97  ? 138  LEU B CG  1 
ATOM   5253 C CD1 . LEU B 1 137 ? 99.166  44.742 41.763  1.00 29.19  ? 138  LEU B CD1 1 
ATOM   5254 C CD2 . LEU B 1 137 ? 97.206  46.164 42.458  1.00 26.94  ? 138  LEU B CD2 1 
ATOM   5255 N N   . VAL B 1 138 ? 98.005  44.697 47.026  1.00 22.31  ? 139  VAL B N   1 
ATOM   5256 C CA  . VAL B 1 138 ? 97.186  43.895 47.922  1.00 25.37  ? 139  VAL B CA  1 
ATOM   5257 C C   . VAL B 1 138 ? 96.487  44.781 48.949  1.00 27.66  ? 139  VAL B C   1 
ATOM   5258 O O   . VAL B 1 138 ? 95.308  44.582 49.262  1.00 29.44  ? 139  VAL B O   1 
ATOM   5259 C CB  . VAL B 1 138 ? 98.075  42.821 48.574  1.00 27.73  ? 139  VAL B CB  1 
ATOM   5260 C CG1 . VAL B 1 138 ? 97.515  42.373 49.904  1.00 28.61  ? 139  VAL B CG1 1 
ATOM   5261 C CG2 . VAL B 1 138 ? 98.282  41.660 47.592  1.00 22.29  ? 139  VAL B CG2 1 
ATOM   5262 N N   . GLN B 1 139 ? 97.186  45.792 49.467  1.00 28.31  ? 140  GLN B N   1 
ATOM   5263 C CA  . GLN B 1 139 ? 96.558  46.662 50.458  1.00 29.17  ? 140  GLN B CA  1 
ATOM   5264 C C   . GLN B 1 139 ? 95.535  47.586 49.807  1.00 29.38  ? 140  GLN B C   1 
ATOM   5265 O O   . GLN B 1 139 ? 94.433  47.773 50.338  1.00 29.15  ? 140  GLN B O   1 
ATOM   5266 C CB  . GLN B 1 139 ? 97.623  47.471 51.207  1.00 24.42  ? 140  GLN B CB  1 
ATOM   5267 C CG  . GLN B 1 139 ? 97.107  48.337 52.385  1.00 25.87  ? 140  GLN B CG  1 
ATOM   5268 C CD  . GLN B 1 139 ? 96.275  49.548 51.958  1.00 30.85  ? 140  GLN B CD  1 
ATOM   5269 O OE1 . GLN B 1 139 ? 96.672  50.319 51.092  1.00 34.23  ? 140  GLN B OE1 1 
ATOM   5270 N NE2 . GLN B 1 139 ? 95.111  49.702 52.568  1.00 28.85  ? 140  GLN B NE2 1 
ATOM   5271 N N   . ALA B 1 140 ? 95.875  48.168 48.656  1.00 28.60  ? 141  ALA B N   1 
ATOM   5272 C CA  . ALA B 1 140 ? 94.995  49.163 48.051  1.00 32.52  ? 141  ALA B CA  1 
ATOM   5273 C C   . ALA B 1 140 ? 93.749  48.522 47.452  1.00 32.32  ? 141  ALA B C   1 
ATOM   5274 O O   . ALA B 1 140 ? 92.643  49.059 47.583  1.00 31.53  ? 141  ALA B O   1 
ATOM   5275 C CB  . ALA B 1 140 ? 95.749  49.953 46.984  1.00 29.61  ? 141  ALA B CB  1 
ATOM   5276 N N   . GLU B 1 141 ? 93.903  47.379 46.792  1.00 24.69  ? 142  GLU B N   1 
ATOM   5277 C CA  . GLU B 1 141 ? 92.826  46.804 46.004  1.00 27.85  ? 142  GLU B CA  1 
ATOM   5278 C C   . GLU B 1 141 ? 92.272  45.513 46.583  1.00 30.82  ? 142  GLU B C   1 
ATOM   5279 O O   . GLU B 1 141 ? 91.304  44.973 46.037  1.00 30.99  ? 142  GLU B O   1 
ATOM   5280 C CB  . GLU B 1 141 ? 93.295  46.588 44.558  1.00 22.75  ? 142  GLU B CB  1 
ATOM   5281 C CG  . GLU B 1 141 ? 93.505  47.911 43.807  1.00 24.43  ? 142  GLU B CG  1 
ATOM   5282 C CD  . GLU B 1 141 ? 92.246  48.773 43.787  1.00 30.72  ? 142  GLU B CD  1 
ATOM   5283 O OE1 . GLU B 1 141 ? 92.357  50.018 43.770  1.00 32.73  ? 142  GLU B OE1 1 
ATOM   5284 O OE2 . GLU B 1 141 ? 91.139  48.201 43.795  1.00 30.15  ? 142  GLU B OE2 1 
ATOM   5285 N N   . ARG B 1 142 ? 92.847  45.017 47.680  1.00 29.43  ? 143  ARG B N   1 
ATOM   5286 C CA  . ARG B 1 142 ? 92.325  43.864 48.413  1.00 26.91  ? 143  ARG B CA  1 
ATOM   5287 C C   . ARG B 1 142 ? 92.169  42.653 47.493  1.00 26.59  ? 143  ARG B C   1 
ATOM   5288 O O   . ARG B 1 142 ? 91.092  42.087 47.317  1.00 30.43  ? 143  ARG B O   1 
ATOM   5289 C CB  . ARG B 1 142 ? 91.022  44.228 49.132  1.00 28.13  ? 143  ARG B CB  1 
ATOM   5290 C CG  . ARG B 1 142 ? 91.264  45.323 50.175  1.00 41.20  ? 143  ARG B CG  1 
ATOM   5291 C CD  . ARG B 1 142 ? 90.123  45.509 51.150  1.00 46.90  ? 143  ARG B CD  1 
ATOM   5292 N NE  . ARG B 1 142 ? 89.819  44.301 51.914  1.00 57.04  ? 143  ARG B NE  1 
ATOM   5293 C CZ  . ARG B 1 142 ? 90.431  43.945 53.041  1.00 55.50  ? 143  ARG B CZ  1 
ATOM   5294 N NH1 . ARG B 1 142 ? 91.409  44.691 53.543  1.00 40.32  ? 143  ARG B NH1 1 
ATOM   5295 N NH2 . ARG B 1 142 ? 90.070  42.828 53.659  1.00 55.16  ? 143  ARG B NH2 1 
ATOM   5296 N N   . THR B 1 143 ? 93.286  42.290 46.887  1.00 28.19  ? 144  THR B N   1 
ATOM   5297 C CA  . THR B 1 143 ? 93.459  41.053 46.151  1.00 26.61  ? 144  THR B CA  1 
ATOM   5298 C C   . THR B 1 143 ? 94.456  40.179 46.899  1.00 25.78  ? 144  THR B C   1 
ATOM   5299 O O   . THR B 1 143 ? 95.166  40.633 47.795  1.00 31.02  ? 144  THR B O   1 
ATOM   5300 C CB  . THR B 1 143 ? 93.968  41.326 44.729  1.00 32.99  ? 144  THR B CB  1 
ATOM   5301 O OG1 . THR B 1 143 ? 95.106  42.192 44.798  1.00 38.38  ? 144  THR B OG1 1 
ATOM   5302 C CG2 . THR B 1 143 ? 92.897  41.989 43.889  1.00 31.30  ? 144  THR B CG2 1 
ATOM   5303 N N   . VAL B 1 144 ? 94.499  38.914 46.528  1.00 25.09  ? 145  VAL B N   1 
ATOM   5304 C CA  . VAL B 1 144 ? 95.625  38.059 46.867  1.00 23.17  ? 145  VAL B CA  1 
ATOM   5305 C C   . VAL B 1 144 ? 96.570  38.075 45.676  1.00 27.53  ? 145  VAL B C   1 
ATOM   5306 O O   . VAL B 1 144 ? 96.132  37.931 44.528  1.00 29.25  ? 145  VAL B O   1 
ATOM   5307 C CB  . VAL B 1 144 ? 95.154  36.633 47.191  1.00 24.42  ? 145  VAL B CB  1 
ATOM   5308 C CG1 . VAL B 1 144 ? 96.345  35.692 47.319  1.00 20.46  ? 145  VAL B CG1 1 
ATOM   5309 C CG2 . VAL B 1 144 ? 94.318  36.634 48.470  1.00 24.96  ? 145  VAL B CG2 1 
ATOM   5310 N N   . LEU B 1 145 ? 97.858  38.295 45.929  1.00 22.76  ? 146  LEU B N   1 
ATOM   5311 C CA  . LEU B 1 145 ? 98.842  38.314 44.859  1.00 22.90  ? 146  LEU B CA  1 
ATOM   5312 C C   . LEU B 1 145 ? 99.822  37.168 45.039  1.00 24.05  ? 146  LEU B C   1 
ATOM   5313 O O   . LEU B 1 145 ? 100.380 36.986 46.125  1.00 25.35  ? 146  LEU B O   1 
ATOM   5314 C CB  . LEU B 1 145 ? 99.610  39.633 44.786  1.00 22.77  ? 146  LEU B CB  1 
ATOM   5315 C CG  . LEU B 1 145 ? 100.434 39.591 43.487  1.00 34.17  ? 146  LEU B CG  1 
ATOM   5316 C CD1 . LEU B 1 145 ? 100.081 40.741 42.572  1.00 39.61  ? 146  LEU B CD1 1 
ATOM   5317 C CD2 . LEU B 1 145 ? 101.926 39.547 43.750  1.00 35.04  ? 146  LEU B CD2 1 
ATOM   5318 N N   . VAL B 1 146 ? 100.024 36.407 43.969  1.00 23.76  ? 147  VAL B N   1 
ATOM   5319 C CA  . VAL B 1 146 ? 100.985 35.314 43.935  1.00 23.04  ? 147  VAL B CA  1 
ATOM   5320 C C   . VAL B 1 146 ? 101.997 35.608 42.837  1.00 23.30  ? 147  VAL B C   1 
ATOM   5321 O O   . VAL B 1 146 ? 101.633 36.087 41.757  1.00 21.95  ? 147  VAL B O   1 
ATOM   5322 C CB  . VAL B 1 146 ? 100.295 33.955 43.691  1.00 21.87  ? 147  VAL B CB  1 
ATOM   5323 C CG1 . VAL B 1 146 ? 101.323 32.826 43.667  1.00 19.53  ? 147  VAL B CG1 1 
ATOM   5324 C CG2 . VAL B 1 146 ? 99.229  33.690 44.752  1.00 17.74  ? 147  VAL B CG2 1 
ATOM   5325 N N   . SER B 1 147 ? 103.267 35.333 43.121  1.00 20.38  ? 148  SER B N   1 
ATOM   5326 C CA  . SER B 1 147 ? 104.308 35.346 42.104  1.00 23.77  ? 148  SER B CA  1 
ATOM   5327 C C   . SER B 1 147 ? 105.210 34.144 42.328  1.00 22.19  ? 148  SER B C   1 
ATOM   5328 O O   . SER B 1 147 ? 105.424 33.717 43.467  1.00 23.19  ? 148  SER B O   1 
ATOM   5329 C CB  . SER B 1 147 ? 105.133 36.641 42.134  1.00 20.45  ? 148  SER B CB  1 
ATOM   5330 O OG  . SER B 1 147 ? 105.896 36.727 43.328  1.00 25.00  ? 148  SER B OG  1 
ATOM   5331 N N   . MET B 1 148 ? 105.728 33.590 41.234  1.00 17.84  ? 149  MET B N   1 
ATOM   5332 C CA  . MET B 1 148 ? 106.573 32.409 41.323  1.00 21.75  ? 149  MET B CA  1 
ATOM   5333 C C   . MET B 1 148 ? 107.897 32.654 40.616  1.00 21.63  ? 149  MET B C   1 
ATOM   5334 O O   . MET B 1 148 ? 107.996 33.480 39.704  1.00 20.34  ? 149  MET B O   1 
ATOM   5335 C CB  . MET B 1 148 ? 105.889 31.165 40.727  1.00 18.74  ? 149  MET B CB  1 
ATOM   5336 C CG  . MET B 1 148 ? 106.112 30.993 39.218  1.00 22.63  ? 149  MET B CG  1 
ATOM   5337 S SD  . MET B 1 148 ? 105.287 32.272 38.265  1.00 21.39  ? 149  MET B SD  1 
ATOM   5338 C CE  . MET B 1 148 ? 103.574 31.766 38.403  1.00 19.77  ? 149  MET B CE  1 
ATOM   5339 N N   . ASN B 1 149 ? 108.922 31.945 41.077  1.00 20.52  ? 150  ASN B N   1 
ATOM   5340 C CA  . ASN B 1 149 ? 110.160 31.808 40.328  1.00 21.09  ? 150  ASN B CA  1 
ATOM   5341 C C   . ASN B 1 149 ? 110.023 30.632 39.366  1.00 21.62  ? 150  ASN B C   1 
ATOM   5342 O O   . ASN B 1 149 ? 109.409 29.615 39.695  1.00 22.43  ? 150  ASN B O   1 
ATOM   5343 C CB  . ASN B 1 149 ? 111.344 31.590 41.272  1.00 20.53  ? 150  ASN B CB  1 
ATOM   5344 C CG  . ASN B 1 149 ? 111.967 32.900 41.760  1.00 26.16  ? 150  ASN B CG  1 
ATOM   5345 O OD1 . ASN B 1 149 ? 111.462 33.991 41.492  1.00 24.57  ? 150  ASN B OD1 1 
ATOM   5346 N ND2 . ASN B 1 149 ? 113.074 32.788 42.485  1.00 26.80  ? 150  ASN B ND2 1 
ATOM   5347 N N   . TYR B 1 150 ? 110.570 30.786 38.165  1.00 18.55  ? 151  TYR B N   1 
ATOM   5348 C CA  . TYR B 1 150 ? 110.596 29.702 37.197  1.00 18.68  ? 151  TYR B CA  1 
ATOM   5349 C C   . TYR B 1 150 ? 111.957 29.696 36.524  1.00 20.67  ? 151  TYR B C   1 
ATOM   5350 O O   . TYR B 1 150 ? 112.596 30.743 36.384  1.00 21.31  ? 151  TYR B O   1 
ATOM   5351 C CB  . TYR B 1 150 ? 109.473 29.830 36.153  1.00 22.32  ? 151  TYR B CB  1 
ATOM   5352 C CG  . TYR B 1 150 ? 109.561 31.074 35.295  1.00 19.70  ? 151  TYR B CG  1 
ATOM   5353 C CD1 . TYR B 1 150 ? 108.955 32.261 35.697  1.00 19.01  ? 151  TYR B CD1 1 
ATOM   5354 C CD2 . TYR B 1 150 ? 110.246 31.062 34.083  1.00 19.72  ? 151  TYR B CD2 1 
ATOM   5355 C CE1 . TYR B 1 150 ? 109.025 33.402 34.923  1.00 18.66  ? 151  TYR B CE1 1 
ATOM   5356 C CE2 . TYR B 1 150 ? 110.328 32.209 33.292  1.00 18.42  ? 151  TYR B CE2 1 
ATOM   5357 C CZ  . TYR B 1 150 ? 109.718 33.371 33.718  1.00 21.53  ? 151  TYR B CZ  1 
ATOM   5358 O OH  . TYR B 1 150 ? 109.791 34.511 32.947  1.00 20.21  ? 151  TYR B OH  1 
ATOM   5359 N N   . ARG B 1 151 ? 112.395 28.510 36.108  1.00 20.11  ? 152  ARG B N   1 
ATOM   5360 C CA  . ARG B 1 151 ? 113.723 28.380 35.520  1.00 20.71  ? 152  ARG B CA  1 
ATOM   5361 C C   . ARG B 1 151 ? 113.833 29.167 34.219  1.00 22.60  ? 152  ARG B C   1 
ATOM   5362 O O   . ARG B 1 151 ? 112.895 29.219 33.417  1.00 20.42  ? 152  ARG B O   1 
ATOM   5363 C CB  . ARG B 1 151 ? 114.061 26.906 35.289  1.00 20.05  ? 152  ARG B CB  1 
ATOM   5364 C CG  . ARG B 1 151 ? 114.394 26.154 36.589  1.00 21.72  ? 152  ARG B CG  1 
ATOM   5365 C CD  . ARG B 1 151 ? 114.481 24.655 36.355  1.00 19.46  ? 152  ARG B CD  1 
ATOM   5366 N NE  . ARG B 1 151 ? 113.159 24.041 36.217  1.00 22.25  ? 152  ARG B NE  1 
ATOM   5367 C CZ  . ARG B 1 151 ? 112.970 22.759 35.918  1.00 22.02  ? 152  ARG B CZ  1 
ATOM   5368 N NH1 . ARG B 1 151 ? 114.019 21.969 35.727  1.00 23.44  ? 152  ARG B NH1 1 
ATOM   5369 N NH2 . ARG B 1 151 ? 111.744 22.265 35.819  1.00 20.61  ? 152  ARG B NH2 1 
ATOM   5370 N N   . VAL B 1 152 ? 114.993 29.799 34.025  1.00 19.19  ? 153  VAL B N   1 
ATOM   5371 C CA  . VAL B 1 152 ? 115.275 30.603 32.844  1.00 19.63  ? 153  VAL B CA  1 
ATOM   5372 C C   . VAL B 1 152 ? 116.563 30.096 32.205  1.00 19.83  ? 153  VAL B C   1 
ATOM   5373 O O   . VAL B 1 152 ? 117.272 29.255 32.760  1.00 18.10  ? 153  VAL B O   1 
ATOM   5374 C CB  . VAL B 1 152 ? 115.386 32.105 33.172  1.00 21.17  ? 153  VAL B CB  1 
ATOM   5375 C CG1 . VAL B 1 152 ? 114.033 32.649 33.633  1.00 20.88  ? 153  VAL B CG1 1 
ATOM   5376 C CG2 . VAL B 1 152 ? 116.451 32.337 34.235  1.00 16.16  ? 153  VAL B CG2 1 
ATOM   5377 N N   . GLY B 1 153 ? 116.851 30.617 31.014  1.00 21.19  ? 154  GLY B N   1 
ATOM   5378 C CA  . GLY B 1 153 ? 118.054 30.221 30.307  1.00 20.80  ? 154  GLY B CA  1 
ATOM   5379 C C   . GLY B 1 153 ? 118.028 28.744 29.965  1.00 23.74  ? 154  GLY B C   1 
ATOM   5380 O O   . GLY B 1 153 ? 116.967 28.125 29.808  1.00 20.25  ? 154  GLY B O   1 
ATOM   5381 N N   . ALA B 1 154 ? 119.224 28.160 29.864  1.00 22.74  ? 155  ALA B N   1 
ATOM   5382 C CA  . ALA B 1 154 ? 119.325 26.742 29.529  1.00 25.21  ? 155  ALA B CA  1 
ATOM   5383 C C   . ALA B 1 154 ? 118.566 25.874 30.530  1.00 23.56  ? 155  ALA B C   1 
ATOM   5384 O O   . ALA B 1 154 ? 117.941 24.879 30.149  1.00 20.95  ? 155  ALA B O   1 
ATOM   5385 C CB  . ALA B 1 154 ? 120.795 26.324 29.460  1.00 22.79  ? 155  ALA B CB  1 
ATOM   5386 N N   . PHE B 1 155 ? 118.600 26.240 31.818  1.00 18.69  ? 156  PHE B N   1 
ATOM   5387 C CA  . PHE B 1 155 ? 117.963 25.417 32.848  1.00 18.34  ? 156  PHE B CA  1 
ATOM   5388 C C   . PHE B 1 155 ? 116.461 25.312 32.648  1.00 19.32  ? 156  PHE B C   1 
ATOM   5389 O O   . PHE B 1 155 ? 115.844 24.331 33.086  1.00 25.69  ? 156  PHE B O   1 
ATOM   5390 C CB  . PHE B 1 155 ? 118.273 25.975 34.241  1.00 18.38  ? 156  PHE B CB  1 
ATOM   5391 C CG  . PHE B 1 155 ? 119.704 26.382 34.404  1.00 26.91  ? 156  PHE B CG  1 
ATOM   5392 C CD1 . PHE B 1 155 ? 120.105 27.675 34.101  1.00 25.84  ? 156  PHE B CD1 1 
ATOM   5393 C CD2 . PHE B 1 155 ? 120.666 25.456 34.789  1.00 23.02  ? 156  PHE B CD2 1 
ATOM   5394 C CE1 . PHE B 1 155 ? 121.429 28.056 34.214  1.00 23.68  ? 156  PHE B CE1 1 
ATOM   5395 C CE2 . PHE B 1 155 ? 122.008 25.830 34.900  1.00 28.53  ? 156  PHE B CE2 1 
ATOM   5396 C CZ  . PHE B 1 155 ? 122.387 27.139 34.608  1.00 26.49  ? 156  PHE B CZ  1 
ATOM   5397 N N   . GLY B 1 156 ? 115.853 26.306 32.013  1.00 20.74  ? 157  GLY B N   1 
ATOM   5398 C CA  . GLY B 1 156 ? 114.423 26.274 31.807  1.00 16.42  ? 157  GLY B CA  1 
ATOM   5399 C C   . GLY B 1 156 ? 114.007 25.928 30.394  1.00 23.19  ? 157  GLY B C   1 
ATOM   5400 O O   . GLY B 1 156 ? 112.882 25.468 30.181  1.00 22.85  ? 157  GLY B O   1 
ATOM   5401 N N   . PHE B 1 157 ? 114.880 26.150 29.403  1.00 17.90  ? 158  PHE B N   1 
ATOM   5402 C CA  . PHE B 1 157 ? 114.411 26.026 28.029  1.00 19.11  ? 158  PHE B CA  1 
ATOM   5403 C C   . PHE B 1 157 ? 115.404 25.385 27.075  1.00 21.11  ? 158  PHE B C   1 
ATOM   5404 O O   . PHE B 1 157 ? 115.148 25.385 25.862  1.00 24.16  ? 158  PHE B O   1 
ATOM   5405 C CB  . PHE B 1 157 ? 113.967 27.400 27.503  1.00 17.18  ? 158  PHE B CB  1 
ATOM   5406 C CG  . PHE B 1 157 ? 112.884 28.016 28.342  1.00 21.24  ? 158  PHE B CG  1 
ATOM   5407 C CD1 . PHE B 1 157 ? 111.549 27.664 28.149  1.00 18.72  ? 158  PHE B CD1 1 
ATOM   5408 C CD2 . PHE B 1 157 ? 113.201 28.897 29.363  1.00 18.97  ? 158  PHE B CD2 1 
ATOM   5409 C CE1 . PHE B 1 157 ? 110.547 28.204 28.956  1.00 18.01  ? 158  PHE B CE1 1 
ATOM   5410 C CE2 . PHE B 1 157 ? 112.212 29.442 30.170  1.00 19.56  ? 158  PHE B CE2 1 
ATOM   5411 C CZ  . PHE B 1 157 ? 110.887 29.098 29.972  1.00 17.86  ? 158  PHE B CZ  1 
ATOM   5412 N N   . LEU B 1 158 ? 116.510 24.822 27.562  1.00 23.38  ? 159  LEU B N   1 
ATOM   5413 C CA  . LEU B 1 158 ? 117.341 24.007 26.684  1.00 26.74  ? 159  LEU B CA  1 
ATOM   5414 C C   . LEU B 1 158 ? 116.526 22.806 26.232  1.00 28.61  ? 159  LEU B C   1 
ATOM   5415 O O   . LEU B 1 158 ? 115.854 22.162 27.041  1.00 24.29  ? 159  LEU B O   1 
ATOM   5416 C CB  . LEU B 1 158 ? 118.627 23.560 27.383  1.00 26.05  ? 159  LEU B CB  1 
ATOM   5417 C CG  . LEU B 1 158 ? 119.678 22.922 26.468  1.00 30.38  ? 159  LEU B CG  1 
ATOM   5418 C CD1 . LEU B 1 158 ? 121.081 23.407 26.785  1.00 27.67  ? 159  LEU B CD1 1 
ATOM   5419 C CD2 . LEU B 1 158 ? 119.609 21.399 26.530  1.00 28.86  ? 159  LEU B CD2 1 
ATOM   5420 N N   . ALA B 1 159 ? 116.556 22.529 24.931  1.00 26.58  ? 160  ALA B N   1 
ATOM   5421 C CA  . ALA B 1 159 ? 115.710 21.488 24.366  1.00 26.42  ? 160  ALA B CA  1 
ATOM   5422 C C   . ALA B 1 159 ? 116.473 20.689 23.323  1.00 28.20  ? 160  ALA B C   1 
ATOM   5423 O O   . ALA B 1 159 ? 117.032 21.256 22.381  1.00 24.81  ? 160  ALA B O   1 
ATOM   5424 C CB  . ALA B 1 159 ? 114.441 22.083 23.740  1.00 20.82  ? 160  ALA B CB  1 
ATOM   5425 N N   . LEU B 1 160 ? 116.503 19.372 23.510  1.00 31.51  ? 161  LEU B N   1 
ATOM   5426 C CA  . LEU B 1 160 ? 116.825 18.419 22.454  1.00 32.97  ? 161  LEU B CA  1 
ATOM   5427 C C   . LEU B 1 160 ? 115.506 17.738 22.113  1.00 39.51  ? 161  LEU B C   1 
ATOM   5428 O O   . LEU B 1 160 ? 115.135 16.737 22.745  1.00 38.23  ? 161  LEU B O   1 
ATOM   5429 C CB  . LEU B 1 160 ? 117.877 17.402 22.903  1.00 29.98  ? 161  LEU B CB  1 
ATOM   5430 C CG  . LEU B 1 160 ? 119.271 17.968 23.186  1.00 36.80  ? 161  LEU B CG  1 
ATOM   5431 C CD1 . LEU B 1 160 ? 120.152 16.912 23.822  1.00 42.02  ? 161  LEU B CD1 1 
ATOM   5432 C CD2 . LEU B 1 160 ? 119.921 18.490 21.905  1.00 32.01  ? 161  LEU B CD2 1 
ATOM   5433 N N   . PRO B 1 161 ? 114.743 18.268 21.155  1.00 39.23  ? 162  PRO B N   1 
ATOM   5434 C CA  . PRO B 1 161 ? 113.357 17.818 20.978  1.00 37.60  ? 162  PRO B CA  1 
ATOM   5435 C C   . PRO B 1 161 ? 113.275 16.339 20.637  1.00 35.46  ? 162  PRO B C   1 
ATOM   5436 O O   . PRO B 1 161 ? 114.069 15.814 19.853  1.00 32.38  ? 162  PRO B O   1 
ATOM   5437 C CB  . PRO B 1 161 ? 112.847 18.698 19.832  1.00 37.88  ? 162  PRO B CB  1 
ATOM   5438 C CG  . PRO B 1 161 ? 113.687 19.940 19.929  1.00 34.19  ? 162  PRO B CG  1 
ATOM   5439 C CD  . PRO B 1 161 ? 115.054 19.434 20.311  1.00 34.81  ? 162  PRO B CD  1 
ATOM   5440 N N   . GLY B 1 162 ? 112.302 15.666 21.250  1.00 38.44  ? 163  GLY B N   1 
ATOM   5441 C CA  . GLY B 1 162 ? 112.188 14.232 21.175  1.00 44.82  ? 163  GLY B CA  1 
ATOM   5442 C C   . GLY B 1 162 ? 112.868 13.488 22.305  1.00 47.09  ? 163  GLY B C   1 
ATOM   5443 O O   . GLY B 1 162 ? 112.522 12.331 22.562  1.00 47.05  ? 163  GLY B O   1 
ATOM   5444 N N   . SER B 1 163 ? 113.820 14.117 22.987  1.00 43.11  ? 164  SER B N   1 
ATOM   5445 C CA  . SER B 1 163 ? 114.533 13.461 24.071  1.00 42.55  ? 164  SER B CA  1 
ATOM   5446 C C   . SER B 1 163 ? 113.737 13.549 25.366  1.00 40.25  ? 164  SER B C   1 
ATOM   5447 O O   . SER B 1 163 ? 112.979 14.496 25.598  1.00 42.15  ? 164  SER B O   1 
ATOM   5448 C CB  . SER B 1 163 ? 115.907 14.097 24.283  1.00 45.72  ? 164  SER B CB  1 
ATOM   5449 O OG  . SER B 1 163 ? 115.795 15.267 25.082  1.00 45.48  ? 164  SER B OG  1 
ATOM   5450 N N   . ARG B 1 164 ? 113.926 12.551 26.219  1.00 40.28  ? 165  ARG B N   1 
ATOM   5451 C CA  . ARG B 1 164 ? 113.348 12.589 27.551  1.00 46.01  ? 165  ARG B CA  1 
ATOM   5452 C C   . ARG B 1 164 ? 114.234 13.308 28.559  1.00 40.50  ? 165  ARG B C   1 
ATOM   5453 O O   . ARG B 1 164 ? 113.728 13.765 29.589  1.00 39.14  ? 165  ARG B O   1 
ATOM   5454 C CB  . ARG B 1 164 ? 113.058 11.166 28.036  1.00 57.76  ? 165  ARG B CB  1 
ATOM   5455 C CG  . ARG B 1 164 ? 111.711 10.641 27.568  1.00 74.10  ? 165  ARG B CG  1 
ATOM   5456 C CD  . ARG B 1 164 ? 110.577 11.428 28.212  1.00 85.96  ? 165  ARG B CD  1 
ATOM   5457 N NE  . ARG B 1 164 ? 110.455 11.120 29.634  1.00 93.89  ? 165  ARG B NE  1 
ATOM   5458 C CZ  . ARG B 1 164 ? 109.749 10.101 30.114  1.00 99.20  ? 165  ARG B CZ  1 
ATOM   5459 N NH1 . ARG B 1 164 ? 109.098 9.298  29.282  1.00 101.60 ? 165  ARG B NH1 1 
ATOM   5460 N NH2 . ARG B 1 164 ? 109.692 9.885  31.422  1.00 99.02  ? 165  ARG B NH2 1 
ATOM   5461 N N   . GLU B 1 165 ? 115.533 13.435 28.279  1.00 38.45  ? 166  GLU B N   1 
ATOM   5462 C CA  . GLU B 1 165 ? 116.450 14.062 29.219  1.00 39.41  ? 166  GLU B CA  1 
ATOM   5463 C C   . GLU B 1 165 ? 116.455 15.577 29.131  1.00 32.16  ? 166  GLU B C   1 
ATOM   5464 O O   . GLU B 1 165 ? 116.791 16.237 30.115  1.00 39.12  ? 166  GLU B O   1 
ATOM   5465 C CB  . GLU B 1 165 ? 117.873 13.539 29.008  1.00 41.89  ? 166  GLU B CB  1 
ATOM   5466 C CG  . GLU B 1 165 ? 118.043 12.054 29.287  1.00 54.49  ? 166  GLU B CG  1 
ATOM   5467 C CD  . GLU B 1 165 ? 117.989 11.205 28.026  1.00 74.14  ? 166  GLU B CD  1 
ATOM   5468 O OE1 . GLU B 1 165 ? 117.861 11.780 26.923  1.00 76.79  ? 166  GLU B OE1 1 
ATOM   5469 O OE2 . GLU B 1 165 ? 118.077 9.962  28.138  1.00 82.88  ? 166  GLU B OE2 1 
ATOM   5470 N N   . ALA B 1 166 ? 116.098 16.147 27.978  1.00 31.68  ? 167  ALA B N   1 
ATOM   5471 C CA  . ALA B 1 166 ? 115.982 17.600 27.829  1.00 29.58  ? 167  ALA B CA  1 
ATOM   5472 C C   . ALA B 1 166 ? 114.812 17.912 26.914  1.00 30.63  ? 167  ALA B C   1 
ATOM   5473 O O   . ALA B 1 166 ? 114.987 18.281 25.743  1.00 29.61  ? 167  ALA B O   1 
ATOM   5474 C CB  . ALA B 1 166 ? 117.286 18.195 27.297  1.00 29.07  ? 167  ALA B CB  1 
ATOM   5475 N N   . PRO B 1 167 ? 113.587 17.770 27.417  1.00 30.63  ? 168  PRO B N   1 
ATOM   5476 C CA  . PRO B 1 167 ? 112.417 17.905 26.520  1.00 31.03  ? 168  PRO B CA  1 
ATOM   5477 C C   . PRO B 1 167 ? 112.119 19.334 26.110  1.00 31.64  ? 168  PRO B C   1 
ATOM   5478 O O   . PRO B 1 167 ? 111.469 19.540 25.083  1.00 34.27  ? 168  PRO B O   1 
ATOM   5479 C CB  . PRO B 1 167 ? 111.246 17.332 27.365  1.00 30.19  ? 168  PRO B CB  1 
ATOM   5480 C CG  . PRO B 1 167 ? 111.709 17.501 28.814  1.00 28.55  ? 168  PRO B CG  1 
ATOM   5481 C CD  . PRO B 1 167 ? 113.212 17.404 28.805  1.00 23.94  ? 168  PRO B CD  1 
ATOM   5482 N N   . GLY B 1 168 ? 112.588 20.322 26.861  1.00 32.41  ? 169  GLY B N   1 
ATOM   5483 C CA  . GLY B 1 168 ? 112.257 21.705 26.588  1.00 34.60  ? 169  GLY B CA  1 
ATOM   5484 C C   . GLY B 1 168 ? 111.027 22.177 27.350  1.00 30.18  ? 169  GLY B C   1 
ATOM   5485 O O   . GLY B 1 168 ? 110.216 21.391 27.836  1.00 28.82  ? 169  GLY B O   1 
ATOM   5486 N N   . ASN B 1 169 ? 110.916 23.501 27.461  1.00 24.41  ? 170  ASN B N   1 
ATOM   5487 C CA  . ASN B 1 169 ? 109.769 24.197 28.043  1.00 20.20  ? 170  ASN B CA  1 
ATOM   5488 C C   . ASN B 1 169 ? 109.546 23.875 29.523  1.00 19.45  ? 170  ASN B C   1 
ATOM   5489 O O   . ASN B 1 169 ? 108.447 24.095 30.038  1.00 22.08  ? 170  ASN B O   1 
ATOM   5490 C CB  . ASN B 1 169 ? 108.474 23.916 27.260  1.00 16.98  ? 170  ASN B CB  1 
ATOM   5491 C CG  . ASN B 1 169 ? 108.553 24.368 25.812  1.00 26.02  ? 170  ASN B CG  1 
ATOM   5492 O OD1 . ASN B 1 169 ? 109.191 25.366 25.503  1.00 24.06  ? 170  ASN B OD1 1 
ATOM   5493 N ND2 . ASN B 1 169 ? 107.847 23.668 24.928  1.00 21.48  ? 170  ASN B ND2 1 
ATOM   5494 N N   . VAL B 1 170 ? 110.554 23.381 30.247  1.00 20.79  ? 171  VAL B N   1 
ATOM   5495 C CA  . VAL B 1 170 ? 110.286 23.017 31.638  1.00 21.39  ? 171  VAL B CA  1 
ATOM   5496 C C   . VAL B 1 170 ? 110.084 24.262 32.504  1.00 19.71  ? 171  VAL B C   1 
ATOM   5497 O O   . VAL B 1 170 ? 109.383 24.210 33.520  1.00 21.31  ? 171  VAL B O   1 
ATOM   5498 C CB  . VAL B 1 170 ? 111.389 22.089 32.189  1.00 24.12  ? 171  VAL B CB  1 
ATOM   5499 C CG1 . VAL B 1 170 ? 111.489 20.828 31.335  1.00 18.70  ? 171  VAL B CG1 1 
ATOM   5500 C CG2 . VAL B 1 170 ? 112.734 22.796 32.270  1.00 17.35  ? 171  VAL B CG2 1 
ATOM   5501 N N   . GLY B 1 171 ? 110.653 25.403 32.110  1.00 18.32  ? 172  GLY B N   1 
ATOM   5502 C CA  . GLY B 1 171 ? 110.351 26.641 32.812  1.00 17.39  ? 172  GLY B CA  1 
ATOM   5503 C C   . GLY B 1 171 ? 108.888 27.038 32.712  1.00 22.09  ? 172  GLY B C   1 
ATOM   5504 O O   . GLY B 1 171 ? 108.340 27.644 33.638  1.00 23.24  ? 172  GLY B O   1 
ATOM   5505 N N   . LEU B 1 172 ? 108.235 26.704 31.594  1.00 20.18  ? 173  LEU B N   1 
ATOM   5506 C CA  . LEU B 1 172 ? 106.795 26.937 31.485  1.00 21.99  ? 173  LEU B CA  1 
ATOM   5507 C C   . LEU B 1 172 ? 106.010 25.952 32.340  1.00 20.69  ? 173  LEU B C   1 
ATOM   5508 O O   . LEU B 1 172 ? 104.950 26.295 32.877  1.00 21.29  ? 173  LEU B O   1 
ATOM   5509 C CB  . LEU B 1 172 ? 106.333 26.847 30.031  1.00 21.02  ? 173  LEU B CB  1 
ATOM   5510 C CG  . LEU B 1 172 ? 106.707 27.950 29.045  1.00 22.16  ? 173  LEU B CG  1 
ATOM   5511 C CD1 . LEU B 1 172 ? 106.500 27.456 27.622  1.00 16.41  ? 173  LEU B CD1 1 
ATOM   5512 C CD2 . LEU B 1 172 ? 105.887 29.204 29.330  1.00 21.16  ? 173  LEU B CD2 1 
ATOM   5513 N N   . LEU B 1 173 ? 106.498 24.714 32.455  1.00 17.05  ? 174  LEU B N   1 
ATOM   5514 C CA  . LEU B 1 173 ? 105.884 23.768 33.380  1.00 21.01  ? 174  LEU B CA  1 
ATOM   5515 C C   . LEU B 1 173 ? 106.113 24.176 34.830  1.00 23.13  ? 174  LEU B C   1 
ATOM   5516 O O   . LEU B 1 173 ? 105.271 23.887 35.686  1.00 23.63  ? 174  LEU B O   1 
ATOM   5517 C CB  . LEU B 1 173 ? 106.398 22.351 33.126  1.00 21.54  ? 174  LEU B CB  1 
ATOM   5518 C CG  . LEU B 1 173 ? 106.109 21.762 31.739  1.00 28.36  ? 174  LEU B CG  1 
ATOM   5519 C CD1 . LEU B 1 173 ? 106.840 20.426 31.561  1.00 20.80  ? 174  LEU B CD1 1 
ATOM   5520 C CD2 . LEU B 1 173 ? 104.592 21.629 31.491  1.00 21.42  ? 174  LEU B CD2 1 
ATOM   5521 N N   . ASP B 1 174 ? 107.234 24.853 35.127  1.00 22.01  ? 175  ASP B N   1 
ATOM   5522 C CA  . ASP B 1 174 ? 107.393 25.460 36.452  1.00 20.73  ? 175  ASP B CA  1 
ATOM   5523 C C   . ASP B 1 174 ? 106.243 26.412 36.736  1.00 20.05  ? 175  ASP B C   1 
ATOM   5524 O O   . ASP B 1 174 ? 105.592 26.328 37.785  1.00 22.16  ? 175  ASP B O   1 
ATOM   5525 C CB  . ASP B 1 174 ? 108.722 26.220 36.569  1.00 18.21  ? 175  ASP B CB  1 
ATOM   5526 C CG  . ASP B 1 174 ? 109.933 25.321 36.443  1.00 21.81  ? 175  ASP B CG  1 
ATOM   5527 O OD1 . ASP B 1 174 ? 109.775 24.105 36.670  1.00 22.74  ? 175  ASP B OD1 1 
ATOM   5528 O OD2 . ASP B 1 174 ? 111.053 25.850 36.187  1.00 25.53  ? 175  ASP B OD2 1 
ATOM   5529 N N   . GLN B 1 175 ? 105.966 27.324 35.797  1.00 21.10  ? 176  GLN B N   1 
ATOM   5530 C CA  . GLN B 1 175 ? 104.833 28.230 35.950  1.00 20.88  ? 176  GLN B CA  1 
ATOM   5531 C C   . GLN B 1 175 ? 103.532 27.457 36.108  1.00 22.54  ? 176  GLN B C   1 
ATOM   5532 O O   . GLN B 1 175 ? 102.711 27.776 36.977  1.00 23.09  ? 176  GLN B O   1 
ATOM   5533 C CB  . GLN B 1 175 ? 104.748 29.167 34.748  1.00 18.90  ? 176  GLN B CB  1 
ATOM   5534 C CG  . GLN B 1 175 ? 105.986 30.012 34.530  1.00 18.40  ? 176  GLN B CG  1 
ATOM   5535 C CD  . GLN B 1 175 ? 105.953 30.775 33.207  1.00 24.47  ? 176  GLN B CD  1 
ATOM   5536 O OE1 . GLN B 1 175 ? 104.898 30.910 32.575  1.00 22.76  ? 176  GLN B OE1 1 
ATOM   5537 N NE2 . GLN B 1 175 ? 107.103 31.256 32.783  1.00 14.83  ? 176  GLN B NE2 1 
ATOM   5538 N N   . ARG B 1 176 ? 103.335 26.431 35.276  1.00 19.69  ? 177  ARG B N   1 
ATOM   5539 C CA  . ARG B 1 176 ? 102.110 25.646 35.345  1.00 24.21  ? 177  ARG B CA  1 
ATOM   5540 C C   . ARG B 1 176 ? 101.951 24.972 36.696  1.00 24.62  ? 177  ARG B C   1 
ATOM   5541 O O   . ARG B 1 176 ? 100.858 24.980 37.273  1.00 23.18  ? 177  ARG B O   1 
ATOM   5542 C CB  . ARG B 1 176 ? 102.091 24.598 34.240  1.00 15.98  ? 177  ARG B CB  1 
ATOM   5543 C CG  . ARG B 1 176 ? 100.759 23.865 34.157  1.00 20.57  ? 177  ARG B CG  1 
ATOM   5544 C CD  . ARG B 1 176 ? 100.834 22.824 33.047  1.00 24.28  ? 177  ARG B CD  1 
ATOM   5545 N NE  . ARG B 1 176 ? 100.456 23.416 31.775  1.00 31.43  ? 177  ARG B NE  1 
ATOM   5546 C CZ  . ARG B 1 176 ? 100.578 22.795 30.600  1.00 29.48  ? 177  ARG B CZ  1 
ATOM   5547 N NH1 . ARG B 1 176 ? 101.075 21.569 30.552  1.00 33.65  ? 177  ARG B NH1 1 
ATOM   5548 N NH2 . ARG B 1 176 ? 100.221 23.414 29.486  1.00 29.06  ? 177  ARG B NH2 1 
ATOM   5549 N N   . LEU B 1 177 ? 103.025 24.370 37.214  1.00 24.24  ? 178  LEU B N   1 
ATOM   5550 C CA  . LEU B 1 177 ? 102.948 23.742 38.526  1.00 24.38  ? 178  LEU B CA  1 
ATOM   5551 C C   . LEU B 1 177 ? 102.588 24.768 39.603  1.00 22.72  ? 178  LEU B C   1 
ATOM   5552 O O   . LEU B 1 177 ? 101.794 24.478 40.503  1.00 22.31  ? 178  LEU B O   1 
ATOM   5553 C CB  . LEU B 1 177 ? 104.271 23.036 38.840  1.00 19.33  ? 178  LEU B CB  1 
ATOM   5554 C CG  . LEU B 1 177 ? 104.418 22.352 40.207  1.00 25.48  ? 178  LEU B CG  1 
ATOM   5555 C CD1 . LEU B 1 177 ? 103.359 21.267 40.390  1.00 22.80  ? 178  LEU B CD1 1 
ATOM   5556 C CD2 . LEU B 1 177 ? 105.811 21.752 40.350  1.00 25.72  ? 178  LEU B CD2 1 
ATOM   5557 N N   . ALA B 1 178 ? 103.135 25.986 39.505  1.00 21.38  ? 179  ALA B N   1 
ATOM   5558 C CA  . ALA B 1 178 ? 102.764 27.047 40.443  1.00 21.71  ? 179  ALA B CA  1 
ATOM   5559 C C   . ALA B 1 178 ? 101.283 27.397 40.329  1.00 23.43  ? 179  ALA B C   1 
ATOM   5560 O O   . ALA B 1 178 ? 100.619 27.661 41.341  1.00 22.89  ? 179  ALA B O   1 
ATOM   5561 C CB  . ALA B 1 178 ? 103.629 28.289 40.208  1.00 15.67  ? 179  ALA B CB  1 
ATOM   5562 N N   . LEU B 1 179 ? 100.746 27.400 39.104  1.00 22.95  ? 180  LEU B N   1 
ATOM   5563 C CA  . LEU B 1 179 ? 99.318  27.653 38.917  1.00 23.67  ? 180  LEU B CA  1 
ATOM   5564 C C   . LEU B 1 179 ? 98.472  26.532 39.510  1.00 24.07  ? 180  LEU B C   1 
ATOM   5565 O O   . LEU B 1 179 ? 97.401  26.789 40.073  1.00 25.70  ? 180  LEU B O   1 
ATOM   5566 C CB  . LEU B 1 179 ? 98.998  27.835 37.432  1.00 19.83  ? 180  LEU B CB  1 
ATOM   5567 C CG  . LEU B 1 179 ? 99.626  29.078 36.793  1.00 24.75  ? 180  LEU B CG  1 
ATOM   5568 C CD1 . LEU B 1 179 ? 99.257  29.202 35.315  1.00 22.21  ? 180  LEU B CD1 1 
ATOM   5569 C CD2 . LEU B 1 179 ? 99.192  30.302 37.562  1.00 26.92  ? 180  LEU B CD2 1 
ATOM   5570 N N   . GLN B 1 180 ? 98.928  25.283 39.385  1.00 21.11  ? 181  GLN B N   1 
ATOM   5571 C CA  . GLN B 1 180 ? 98.218  24.182 40.028  1.00 21.70  ? 181  GLN B CA  1 
ATOM   5572 C C   . GLN B 1 180 ? 98.312  24.296 41.541  1.00 23.13  ? 181  GLN B C   1 
ATOM   5573 O O   . GLN B 1 180 ? 97.350  23.998 42.260  1.00 23.04  ? 181  GLN B O   1 
ATOM   5574 C CB  . GLN B 1 180 ? 98.780  22.842 39.553  1.00 21.85  ? 181  GLN B CB  1 
ATOM   5575 C CG  . GLN B 1 180 ? 98.500  22.552 38.093  1.00 38.27  ? 181  GLN B CG  1 
ATOM   5576 C CD  . GLN B 1 180 ? 99.383  21.452 37.514  1.00 42.95  ? 181  GLN B CD  1 
ATOM   5577 O OE1 . GLN B 1 180 ? 100.534 21.305 37.907  1.00 46.10  ? 181  GLN B OE1 1 
ATOM   5578 N NE2 . GLN B 1 180 ? 98.845  20.683 36.584  1.00 41.62  ? 181  GLN B NE2 1 
ATOM   5579 N N   . TRP B 1 181 ? 99.462  24.747 42.040  1.00 18.52  ? 182  TRP B N   1 
ATOM   5580 C CA  . TRP B 1 181 ? 99.605  24.979 43.468  1.00 23.06  ? 182  TRP B CA  1 
ATOM   5581 C C   . TRP B 1 181 ? 98.596  26.017 43.949  1.00 24.56  ? 182  TRP B C   1 
ATOM   5582 O O   . TRP B 1 181 ? 97.991  25.859 45.015  1.00 22.83  ? 182  TRP B O   1 
ATOM   5583 C CB  . TRP B 1 181 ? 101.037 25.422 43.762  1.00 17.54  ? 182  TRP B CB  1 
ATOM   5584 C CG  . TRP B 1 181 ? 101.379 25.478 45.209  1.00 23.68  ? 182  TRP B CG  1 
ATOM   5585 C CD1 . TRP B 1 181 ? 101.990 24.507 45.947  1.00 25.10  ? 182  TRP B CD1 1 
ATOM   5586 C CD2 . TRP B 1 181 ? 101.123 26.563 46.109  1.00 22.80  ? 182  TRP B CD2 1 
ATOM   5587 N NE1 . TRP B 1 181 ? 102.145 24.930 47.247  1.00 27.51  ? 182  TRP B NE1 1 
ATOM   5588 C CE2 . TRP B 1 181 ? 101.619 26.189 47.373  1.00 20.00  ? 182  TRP B CE2 1 
ATOM   5589 C CE3 . TRP B 1 181 ? 100.531 27.823 45.965  1.00 19.25  ? 182  TRP B CE3 1 
ATOM   5590 C CZ2 . TRP B 1 181 ? 101.530 27.020 48.487  1.00 25.43  ? 182  TRP B CZ2 1 
ATOM   5591 C CZ3 . TRP B 1 181 ? 100.452 28.653 47.078  1.00 22.58  ? 182  TRP B CZ3 1 
ATOM   5592 C CH2 . TRP B 1 181 ? 100.945 28.248 48.321  1.00 18.50  ? 182  TRP B CH2 1 
ATOM   5593 N N   . VAL B 1 182 ? 98.389  27.076 43.158  1.00 26.90  ? 183  VAL B N   1 
ATOM   5594 C CA  . VAL B 1 182 ? 97.406  28.102 43.502  1.00 26.66  ? 183  VAL B CA  1 
ATOM   5595 C C   . VAL B 1 182 ? 96.008  27.499 43.578  1.00 26.13  ? 183  VAL B C   1 
ATOM   5596 O O   . VAL B 1 182 ? 95.259  27.749 44.531  1.00 27.05  ? 183  VAL B O   1 
ATOM   5597 C CB  . VAL B 1 182 ? 97.472  29.267 42.494  1.00 24.85  ? 183  VAL B CB  1 
ATOM   5598 C CG1 . VAL B 1 182 ? 96.265  30.188 42.644  1.00 20.20  ? 183  VAL B CG1 1 
ATOM   5599 C CG2 . VAL B 1 182 ? 98.762  30.054 42.683  1.00 16.37  ? 183  VAL B CG2 1 
ATOM   5600 N N   . GLN B 1 183 ? 95.641  26.676 42.587  1.00 21.09  ? 184  GLN B N   1 
ATOM   5601 C CA  . GLN B 1 183 ? 94.332  26.022 42.629  1.00 23.53  ? 184  GLN B CA  1 
ATOM   5602 C C   . GLN B 1 183 ? 94.153  25.211 43.907  1.00 24.26  ? 184  GLN B C   1 
ATOM   5603 O O   . GLN B 1 183 ? 93.073  25.221 44.512  1.00 26.67  ? 184  GLN B O   1 
ATOM   5604 C CB  . GLN B 1 183 ? 94.134  25.124 41.405  1.00 22.87  ? 184  GLN B CB  1 
ATOM   5605 C CG  . GLN B 1 183 ? 93.858  25.898 40.110  1.00 28.81  ? 184  GLN B CG  1 
ATOM   5606 C CD  . GLN B 1 183 ? 92.651  26.811 40.236  1.00 28.60  ? 184  GLN B CD  1 
ATOM   5607 O OE1 . GLN B 1 183 ? 91.539  26.346 40.457  1.00 31.56  ? 184  GLN B OE1 1 
ATOM   5608 N NE2 . GLN B 1 183 ? 92.870  28.115 40.121  1.00 22.98  ? 184  GLN B NE2 1 
ATOM   5609 N N   . GLU B 1 184 ? 95.199  24.513 44.347  1.00 23.30  ? 185  GLU B N   1 
ATOM   5610 C CA  . GLU B 1 184 ? 95.042  23.627 45.492  1.00 27.40  ? 185  GLU B CA  1 
ATOM   5611 C C   . GLU B 1 184 ? 95.201  24.333 46.835  1.00 30.22  ? 185  GLU B C   1 
ATOM   5612 O O   . GLU B 1 184 ? 94.673  23.845 47.834  1.00 28.15  ? 185  GLU B O   1 
ATOM   5613 C CB  . GLU B 1 184 ? 96.041  22.474 45.401  1.00 31.57  ? 185  GLU B CB  1 
ATOM   5614 C CG  . GLU B 1 184 ? 95.826  21.596 44.176  1.00 49.26  ? 185  GLU B CG  1 
ATOM   5615 C CD  . GLU B 1 184 ? 96.836  20.470 44.069  1.00 62.40  ? 185  GLU B CD  1 
ATOM   5616 O OE1 . GLU B 1 184 ? 97.562  20.220 45.056  1.00 67.48  ? 185  GLU B OE1 1 
ATOM   5617 O OE2 . GLU B 1 184 ? 96.902  19.834 42.996  1.00 65.68  ? 185  GLU B OE2 1 
ATOM   5618 N N   . ASN B 1 185 ? 95.903  25.463 46.894  1.00 26.21  ? 186  ASN B N   1 
ATOM   5619 C CA  . ASN B 1 185 ? 96.291  26.015 48.186  1.00 28.65  ? 186  ASN B CA  1 
ATOM   5620 C C   . ASN B 1 185 ? 95.891  27.460 48.437  1.00 29.28  ? 186  ASN B C   1 
ATOM   5621 O O   . ASN B 1 185 ? 95.977  27.897 49.588  1.00 29.30  ? 186  ASN B O   1 
ATOM   5622 C CB  . ASN B 1 185 ? 97.812  25.904 48.374  1.00 21.93  ? 186  ASN B CB  1 
ATOM   5623 C CG  . ASN B 1 185 ? 98.282  24.474 48.392  1.00 26.66  ? 186  ASN B CG  1 
ATOM   5624 O OD1 . ASN B 1 185 ? 98.003  23.741 49.334  1.00 29.70  ? 186  ASN B OD1 1 
ATOM   5625 N ND2 . ASN B 1 185 ? 98.994  24.062 47.347  1.00 22.62  ? 186  ASN B ND2 1 
ATOM   5626 N N   . VAL B 1 186 ? 95.479  28.222 47.420  1.00 24.03  ? 187  VAL B N   1 
ATOM   5627 C CA  . VAL B 1 186 ? 95.324  29.654 47.632  1.00 20.78  ? 187  VAL B CA  1 
ATOM   5628 C C   . VAL B 1 186 ? 94.154  29.961 48.556  1.00 24.93  ? 187  VAL B C   1 
ATOM   5629 O O   . VAL B 1 186 ? 94.153  31.012 49.208  1.00 26.18  ? 187  VAL B O   1 
ATOM   5630 C CB  . VAL B 1 186 ? 95.195  30.403 46.286  1.00 23.95  ? 187  VAL B CB  1 
ATOM   5631 C CG1 . VAL B 1 186 ? 93.774  30.313 45.732  1.00 20.08  ? 187  VAL B CG1 1 
ATOM   5632 C CG2 . VAL B 1 186 ? 95.630  31.852 46.443  1.00 18.91  ? 187  VAL B CG2 1 
ATOM   5633 N N   . ALA B 1 187 ? 93.172  29.055 48.667  1.00 21.81  ? 188  ALA B N   1 
ATOM   5634 C CA  . ALA B 1 187 ? 92.058  29.301 49.578  1.00 26.22  ? 188  ALA B CA  1 
ATOM   5635 C C   . ALA B 1 187 ? 92.514  29.314 51.032  1.00 32.24  ? 188  ALA B C   1 
ATOM   5636 O O   . ALA B 1 187 ? 91.882  29.964 51.872  1.00 31.30  ? 188  ALA B O   1 
ATOM   5637 C CB  . ALA B 1 187 ? 90.955  28.258 49.376  1.00 23.21  ? 188  ALA B CB  1 
ATOM   5638 N N   . ALA B 1 188 ? 93.605  28.609 51.352  1.00 32.37  ? 189  ALA B N   1 
ATOM   5639 C CA  . ALA B 1 188 ? 94.120  28.641 52.718  1.00 32.99  ? 189  ALA B CA  1 
ATOM   5640 C C   . ALA B 1 188 ? 94.598  30.030 53.114  1.00 31.06  ? 189  ALA B C   1 
ATOM   5641 O O   . ALA B 1 188 ? 94.742  30.304 54.308  1.00 29.44  ? 189  ALA B O   1 
ATOM   5642 C CB  . ALA B 1 188 ? 95.256  27.631 52.889  1.00 25.75  ? 189  ALA B CB  1 
ATOM   5643 N N   . PHE B 1 189 ? 94.845  30.905 52.142  1.00 28.12  ? 190  PHE B N   1 
ATOM   5644 C CA  . PHE B 1 189 ? 95.230  32.286 52.390  1.00 27.22  ? 190  PHE B CA  1 
ATOM   5645 C C   . PHE B 1 189 ? 94.064  33.255 52.244  1.00 26.93  ? 190  PHE B C   1 
ATOM   5646 O O   . PHE B 1 189 ? 94.260  34.465 52.392  1.00 28.30  ? 190  PHE B O   1 
ATOM   5647 C CB  . PHE B 1 189 ? 96.357  32.703 51.432  1.00 25.49  ? 190  PHE B CB  1 
ATOM   5648 C CG  . PHE B 1 189 ? 97.579  31.834 51.510  1.00 25.58  ? 190  PHE B CG  1 
ATOM   5649 C CD1 . PHE B 1 189 ? 97.631  30.623 50.833  1.00 22.27  ? 190  PHE B CD1 1 
ATOM   5650 C CD2 . PHE B 1 189 ? 98.684  32.233 52.254  1.00 26.72  ? 190  PHE B CD2 1 
ATOM   5651 C CE1 . PHE B 1 189 ? 98.758  29.819 50.902  1.00 25.54  ? 190  PHE B CE1 1 
ATOM   5652 C CE2 . PHE B 1 189 ? 99.818  31.434 52.329  1.00 25.55  ? 190  PHE B CE2 1 
ATOM   5653 C CZ  . PHE B 1 189 ? 99.856  30.225 51.648  1.00 23.49  ? 190  PHE B CZ  1 
ATOM   5654 N N   . GLY B 1 190 ? 92.862  32.756 51.957  1.00 27.45  ? 191  GLY B N   1 
ATOM   5655 C CA  . GLY B 1 190 ? 91.729  33.604 51.660  1.00 28.93  ? 191  GLY B CA  1 
ATOM   5656 C C   . GLY B 1 190 ? 91.558  33.943 50.194  1.00 33.40  ? 191  GLY B C   1 
ATOM   5657 O O   . GLY B 1 190 ? 90.647  34.711 49.853  1.00 31.36  ? 191  GLY B O   1 
ATOM   5658 N N   . GLY B 1 191 ? 92.404  33.406 49.318  1.00 30.10  ? 192  GLY B N   1 
ATOM   5659 C CA  . GLY B 1 191 ? 92.247  33.652 47.898  1.00 30.23  ? 192  GLY B CA  1 
ATOM   5660 C C   . GLY B 1 191 ? 91.188  32.756 47.284  1.00 30.52  ? 192  GLY B C   1 
ATOM   5661 O O   . GLY B 1 191 ? 90.898  31.669 47.775  1.00 32.69  ? 192  GLY B O   1 
ATOM   5662 N N   . ASP B 1 192 ? 90.609  33.228 46.180  1.00 30.02  ? 193  ASP B N   1 
ATOM   5663 C CA  . ASP B 1 192 ? 89.534  32.510 45.513  1.00 29.40  ? 193  ASP B CA  1 
ATOM   5664 C C   . ASP B 1 192 ? 90.074  31.815 44.274  1.00 33.34  ? 193  ASP B C   1 
ATOM   5665 O O   . ASP B 1 192 ? 90.371  32.492 43.278  1.00 31.66  ? 193  ASP B O   1 
ATOM   5666 C CB  . ASP B 1 192 ? 88.411  33.477 45.143  1.00 29.30  ? 193  ASP B CB  1 
ATOM   5667 C CG  . ASP B 1 192 ? 87.294  32.819 44.357  1.00 36.31  ? 193  ASP B CG  1 
ATOM   5668 O OD1 . ASP B 1 192 ? 86.432  33.565 43.853  1.00 43.51  ? 193  ASP B OD1 1 
ATOM   5669 O OD2 . ASP B 1 192 ? 87.272  31.575 44.225  1.00 44.70  ? 193  ASP B OD2 1 
ATOM   5670 N N   . PRO B 1 193 ? 90.198  30.484 44.267  1.00 29.85  ? 194  PRO B N   1 
ATOM   5671 C CA  . PRO B 1 193 ? 90.743  29.803 43.080  1.00 27.27  ? 194  PRO B CA  1 
ATOM   5672 C C   . PRO B 1 193 ? 89.837  29.865 41.857  1.00 31.92  ? 194  PRO B C   1 
ATOM   5673 O O   . PRO B 1 193 ? 90.305  29.549 40.754  1.00 26.25  ? 194  PRO B O   1 
ATOM   5674 C CB  . PRO B 1 193 ? 90.930  28.358 43.558  1.00 25.54  ? 194  PRO B CB  1 
ATOM   5675 C CG  . PRO B 1 193 ? 89.887  28.189 44.625  1.00 28.41  ? 194  PRO B CG  1 
ATOM   5676 C CD  . PRO B 1 193 ? 89.814  29.533 45.326  1.00 26.72  ? 194  PRO B CD  1 
ATOM   5677 N N   . THR B 1 194 ? 88.570  30.258 41.998  1.00 31.01  ? 195  THR B N   1 
ATOM   5678 C CA  . THR B 1 194 ? 87.709  30.424 40.832  1.00 31.73  ? 195  THR B CA  1 
ATOM   5679 C C   . THR B 1 194 ? 87.852  31.796 40.182  1.00 34.45  ? 195  THR B C   1 
ATOM   5680 O O   . THR B 1 194 ? 87.161  32.069 39.194  1.00 37.32  ? 195  THR B O   1 
ATOM   5681 C CB  . THR B 1 194 ? 86.236  30.192 41.195  1.00 29.10  ? 195  THR B CB  1 
ATOM   5682 O OG1 . THR B 1 194 ? 85.770  31.266 42.022  1.00 33.55  ? 195  THR B OG1 1 
ATOM   5683 C CG2 . THR B 1 194 ? 86.052  28.855 41.930  1.00 24.73  ? 195  THR B CG2 1 
ATOM   5684 N N   . SER B 1 195 ? 88.740  32.665 40.701  1.00 27.55  ? 196  SER B N   1 
ATOM   5685 C CA  . SER B 1 195 ? 88.947  34.009 40.148  1.00 30.64  ? 196  SER B CA  1 
ATOM   5686 C C   . SER B 1 195 ? 90.451  34.298 40.137  1.00 30.37  ? 196  SER B C   1 
ATOM   5687 O O   . SER B 1 195 ? 90.976  35.046 40.969  1.00 31.53  ? 196  SER B O   1 
ATOM   5688 C CB  . SER B 1 195 ? 88.175  35.063 40.942  1.00 33.88  ? 196  SER B CB  1 
ATOM   5689 O OG  . SER B 1 195 ? 88.405  36.359 40.414  1.00 41.41  ? 196  SER B OG  1 
ATOM   5690 N N   . VAL B 1 196 ? 91.149  33.702 39.175  1.00 24.46  ? 197  VAL B N   1 
ATOM   5691 C CA  . VAL B 1 196 ? 92.590  33.851 39.033  1.00 19.84  ? 197  VAL B CA  1 
ATOM   5692 C C   . VAL B 1 196 ? 92.867  34.609 37.744  1.00 26.50  ? 197  VAL B C   1 
ATOM   5693 O O   . VAL B 1 196 ? 92.466  34.174 36.655  1.00 22.05  ? 197  VAL B O   1 
ATOM   5694 C CB  . VAL B 1 196 ? 93.306  32.491 39.041  1.00 23.43  ? 197  VAL B CB  1 
ATOM   5695 C CG1 . VAL B 1 196 ? 94.804  32.676 38.774  1.00 20.36  ? 197  VAL B CG1 1 
ATOM   5696 C CG2 . VAL B 1 196 ? 93.083  31.788 40.369  1.00 23.78  ? 197  VAL B CG2 1 
ATOM   5697 N N   . THR B 1 197 ? 93.555  35.740 37.866  1.00 21.13  ? 198  THR B N   1 
ATOM   5698 C CA  . THR B 1 197 ? 93.970  36.540 36.726  1.00 20.68  ? 198  THR B CA  1 
ATOM   5699 C C   . THR B 1 197 ? 95.487  36.457 36.617  1.00 24.03  ? 198  THR B C   1 
ATOM   5700 O O   . THR B 1 197 ? 96.200  36.810 37.561  1.00 22.45  ? 198  THR B O   1 
ATOM   5701 C CB  . THR B 1 197 ? 93.515  37.992 36.880  1.00 23.92  ? 198  THR B CB  1 
ATOM   5702 O OG1 . THR B 1 197 ? 92.086  38.049 36.986  1.00 23.27  ? 198  THR B OG1 1 
ATOM   5703 C CG2 . THR B 1 197 ? 93.963  38.832 35.681  1.00 20.58  ? 198  THR B CG2 1 
ATOM   5704 N N   . LEU B 1 198 ? 95.980  35.973 35.484  1.00 25.16  ? 199  LEU B N   1 
ATOM   5705 C CA  . LEU B 1 198 ? 97.408  36.035 35.214  1.00 27.83  ? 199  LEU B CA  1 
ATOM   5706 C C   . LEU B 1 198 ? 97.776  37.390 34.640  1.00 24.30  ? 199  LEU B C   1 
ATOM   5707 O O   . LEU B 1 198 ? 97.059  37.935 33.799  1.00 26.34  ? 199  LEU B O   1 
ATOM   5708 C CB  . LEU B 1 198 ? 97.843  34.963 34.216  1.00 27.42  ? 199  LEU B CB  1 
ATOM   5709 C CG  . LEU B 1 198 ? 97.477  33.504 34.377  1.00 25.46  ? 199  LEU B CG  1 
ATOM   5710 C CD1 . LEU B 1 198 ? 98.129  32.692 33.244  1.00 19.32  ? 199  LEU B CD1 1 
ATOM   5711 C CD2 . LEU B 1 198 ? 97.900  33.035 35.757  1.00 24.35  ? 199  LEU B CD2 1 
ATOM   5712 N N   . PHE B 1 199 ? 98.900  37.938 35.089  1.00 18.32  ? 200  PHE B N   1 
ATOM   5713 C CA  . PHE B 1 199 ? 99.471  39.093 34.419  1.00 19.00  ? 200  PHE B CA  1 
ATOM   5714 C C   . PHE B 1 199 ? 100.984 38.970 34.416  1.00 22.22  ? 200  PHE B C   1 
ATOM   5715 O O   . PHE B 1 199 ? 101.581 38.356 35.302  1.00 22.67  ? 200  PHE B O   1 
ATOM   5716 C CB  . PHE B 1 199 ? 98.996  40.449 35.010  1.00 21.81  ? 200  PHE B CB  1 
ATOM   5717 C CG  . PHE B 1 199 ? 99.454  40.763 36.417  1.00 22.41  ? 200  PHE B CG  1 
ATOM   5718 C CD1 . PHE B 1 199 ? 99.870  42.053 36.723  1.00 21.35  ? 200  PHE B CD1 1 
ATOM   5719 C CD2 . PHE B 1 199 ? 99.389  39.830 37.439  1.00 20.95  ? 200  PHE B CD2 1 
ATOM   5720 C CE1 . PHE B 1 199 ? 100.259 42.397 38.009  1.00 25.07  ? 200  PHE B CE1 1 
ATOM   5721 C CE2 . PHE B 1 199 ? 99.783  40.168 38.733  1.00 22.77  ? 200  PHE B CE2 1 
ATOM   5722 C CZ  . PHE B 1 199 ? 100.213 41.451 39.019  1.00 23.01  ? 200  PHE B CZ  1 
ATOM   5723 N N   . GLY B 1 200 ? 101.585 39.519 33.372  1.00 23.83  ? 201  GLY B N   1 
ATOM   5724 C CA  . GLY B 1 200 ? 103.013 39.417 33.177  1.00 21.61  ? 201  GLY B CA  1 
ATOM   5725 C C   . GLY B 1 200 ? 103.456 40.411 32.134  1.00 19.03  ? 201  GLY B C   1 
ATOM   5726 O O   . GLY B 1 200 ? 102.645 40.934 31.363  1.00 23.08  ? 201  GLY B O   1 
ATOM   5727 N N   . GLU B 1 201 ? 104.760 40.670 32.126  1.00 21.21  ? 202  GLU B N   1 
ATOM   5728 C CA  . GLU B 1 201 ? 105.340 41.678 31.253  1.00 22.16  ? 202  GLU B CA  1 
ATOM   5729 C C   . GLU B 1 201 ? 106.462 41.056 30.432  1.00 22.41  ? 202  GLU B C   1 
ATOM   5730 O O   . GLU B 1 201 ? 107.214 40.215 30.936  1.00 19.30  ? 202  GLU B O   1 
ATOM   5731 C CB  . GLU B 1 201 ? 105.839 42.865 32.079  1.00 18.58  ? 202  GLU B CB  1 
ATOM   5732 C CG  . GLU B 1 201 ? 106.334 44.063 31.284  1.00 23.07  ? 202  GLU B CG  1 
ATOM   5733 C CD  . GLU B 1 201 ? 107.813 43.985 30.987  1.00 32.46  ? 202  GLU B CD  1 
ATOM   5734 O OE1 . GLU B 1 201 ? 108.464 43.046 31.489  1.00 30.26  ? 202  GLU B OE1 1 
ATOM   5735 O OE2 . GLU B 1 201 ? 108.322 44.854 30.244  1.00 36.51  ? 202  GLU B OE2 1 
ATOM   5736 N N   . SER B 1 202 ? 106.558 41.469 29.163  1.00 19.11  ? 203  SER B N   1 
ATOM   5737 C CA  . SER B 1 202 ? 107.584 41.014 28.229  1.00 24.01  ? 203  SER B CA  1 
ATOM   5738 C C   . SER B 1 202 ? 107.546 39.490 28.101  1.00 22.16  ? 203  SER B C   1 
ATOM   5739 O O   . SER B 1 202 ? 106.523 38.937 27.682  1.00 22.75  ? 203  SER B O   1 
ATOM   5740 C CB  . SER B 1 202 ? 108.959 41.525 28.670  1.00 25.13  ? 203  SER B CB  1 
ATOM   5741 O OG  . SER B 1 202 ? 109.841 41.618 27.565  1.00 28.94  ? 203  SER B OG  1 
ATOM   5742 N N   . ALA B 1 203 ? 108.625 38.784 28.459  1.00 17.37  ? 204  ALA B N   1 
ATOM   5743 C CA  . ALA B 1 203 ? 108.554 37.322 28.436  1.00 18.38  ? 204  ALA B CA  1 
ATOM   5744 C C   . ALA B 1 203 ? 107.503 36.777 29.402  1.00 19.38  ? 204  ALA B C   1 
ATOM   5745 O O   . ALA B 1 203 ? 106.995 35.669 29.190  1.00 22.33  ? 204  ALA B O   1 
ATOM   5746 C CB  . ALA B 1 203 ? 109.921 36.704 28.749  1.00 14.45  ? 204  ALA B CB  1 
ATOM   5747 N N   . GLY B 1 204 ? 107.164 37.521 30.457  1.00 21.14  ? 205  GLY B N   1 
ATOM   5748 C CA  . GLY B 1 204 ? 106.046 37.122 31.299  1.00 16.46  ? 205  GLY B CA  1 
ATOM   5749 C C   . GLY B 1 204 ? 104.712 37.220 30.581  1.00 19.09  ? 205  GLY B C   1 
ATOM   5750 O O   . GLY B 1 204 ? 103.829 36.378 30.773  1.00 20.74  ? 205  GLY B O   1 
ATOM   5751 N N   . ALA B 1 205 ? 104.547 38.247 29.743  1.00 17.88  ? 206  ALA B N   1 
ATOM   5752 C CA  . ALA B 1 205 ? 103.340 38.347 28.929  1.00 19.54  ? 206  ALA B CA  1 
ATOM   5753 C C   . ALA B 1 205 ? 103.295 37.231 27.894  1.00 23.16  ? 206  ALA B C   1 
ATOM   5754 O O   . ALA B 1 205 ? 102.231 36.653 27.634  1.00 21.24  ? 206  ALA B O   1 
ATOM   5755 C CB  . ALA B 1 205 ? 103.274 39.717 28.249  1.00 15.04  ? 206  ALA B CB  1 
ATOM   5756 N N   . ALA B 1 206 ? 104.444 36.920 27.291  1.00 20.80  ? 207  ALA B N   1 
ATOM   5757 C CA  . ALA B 1 206 ? 104.511 35.801 26.364  1.00 20.92  ? 207  ALA B CA  1 
ATOM   5758 C C   . ALA B 1 206 ? 104.135 34.497 27.058  1.00 23.00  ? 207  ALA B C   1 
ATOM   5759 O O   . ALA B 1 206 ? 103.412 33.668 26.487  1.00 25.76  ? 207  ALA B O   1 
ATOM   5760 C CB  . ALA B 1 206 ? 105.912 35.716 25.753  1.00 14.65  ? 207  ALA B CB  1 
ATOM   5761 N N   . SER B 1 207 ? 104.613 34.301 28.295  1.00 16.92  ? 208  SER B N   1 
ATOM   5762 C CA  . SER B 1 207 ? 104.243 33.115 29.064  1.00 14.98  ? 208  SER B CA  1 
ATOM   5763 C C   . SER B 1 207 ? 102.739 33.061 29.301  1.00 20.55  ? 208  SER B C   1 
ATOM   5764 O O   . SER B 1 207 ? 102.116 31.998 29.160  1.00 19.48  ? 208  SER B O   1 
ATOM   5765 C CB  . SER B 1 207 ? 104.989 33.097 30.402  1.00 17.34  ? 208  SER B CB  1 
ATOM   5766 O OG  . SER B 1 207 ? 106.398 33.026 30.235  1.00 18.86  ? 208  SER B OG  1 
ATOM   5767 N N   . VAL B 1 208 ? 102.141 34.196 29.677  1.00 18.97  ? 209  VAL B N   1 
ATOM   5768 C CA  . VAL B 1 208 ? 100.690 34.257 29.848  1.00 20.27  ? 209  VAL B CA  1 
ATOM   5769 C C   . VAL B 1 208 ? 99.987  33.802 28.573  1.00 19.47  ? 209  VAL B C   1 
ATOM   5770 O O   . VAL B 1 208 ? 99.053  32.991 28.609  1.00 21.08  ? 209  VAL B O   1 
ATOM   5771 C CB  . VAL B 1 208 ? 100.254 35.679 30.248  1.00 20.71  ? 209  VAL B CB  1 
ATOM   5772 C CG1 . VAL B 1 208 ? 98.736  35.801 30.172  1.00 19.36  ? 209  VAL B CG1 1 
ATOM   5773 C CG2 . VAL B 1 208 ? 100.743 36.020 31.648  1.00 20.36  ? 209  VAL B CG2 1 
ATOM   5774 N N   . GLY B 1 209 ? 100.426 34.326 27.426  1.00 19.22  ? 210  GLY B N   1 
ATOM   5775 C CA  . GLY B 1 209 ? 99.816  33.937 26.163  1.00 16.82  ? 210  GLY B CA  1 
ATOM   5776 C C   . GLY B 1 209 ? 99.960  32.455 25.882  1.00 19.06  ? 210  GLY B C   1 
ATOM   5777 O O   . GLY B 1 209 ? 99.041  31.820 25.365  1.00 26.59  ? 210  GLY B O   1 
ATOM   5778 N N   . MET B 1 210 ? 101.097 31.874 26.259  1.00 20.35  ? 211  MET B N   1 
ATOM   5779 C CA  . MET B 1 210 ? 101.306 30.450 26.016  1.00 20.48  ? 211  MET B CA  1 
ATOM   5780 C C   . MET B 1 210 ? 100.419 29.595 26.908  1.00 23.48  ? 211  MET B C   1 
ATOM   5781 O O   . MET B 1 210 ? 99.966  28.521 26.489  1.00 22.59  ? 211  MET B O   1 
ATOM   5782 C CB  . MET B 1 210 ? 102.782 30.103 26.207  1.00 20.63  ? 211  MET B CB  1 
ATOM   5783 C CG  . MET B 1 210 ? 103.641 30.733 25.109  1.00 32.24  ? 211  MET B CG  1 
ATOM   5784 S SD  . MET B 1 210 ? 105.395 30.416 25.258  1.00 35.28  ? 211  MET B SD  1 
ATOM   5785 C CE  . MET B 1 210 ? 106.056 31.714 24.201  1.00 27.34  ? 211  MET B CE  1 
ATOM   5786 N N   . HIS B 1 211 ? 100.161 30.049 28.143  1.00 19.72  ? 212  HIS B N   1 
ATOM   5787 C CA  . HIS B 1 211 ? 99.192  29.350 28.982  1.00 21.64  ? 212  HIS B CA  1 
ATOM   5788 C C   . HIS B 1 211 ? 97.782  29.472 28.420  1.00 22.38  ? 212  HIS B C   1 
ATOM   5789 O O   . HIS B 1 211 ? 96.982  28.540 28.556  1.00 23.07  ? 212  HIS B O   1 
ATOM   5790 C CB  . HIS B 1 211 ? 99.251  29.871 30.424  1.00 17.85  ? 212  HIS B CB  1 
ATOM   5791 C CG  . HIS B 1 211 ? 100.518 29.511 31.134  1.00 21.60  ? 212  HIS B CG  1 
ATOM   5792 N ND1 . HIS B 1 211 ? 100.862 28.206 31.422  1.00 19.31  ? 212  HIS B ND1 1 
ATOM   5793 C CD2 . HIS B 1 211 ? 101.534 30.279 31.596  1.00 20.17  ? 212  HIS B CD2 1 
ATOM   5794 C CE1 . HIS B 1 211 ? 102.035 28.186 32.029  1.00 22.09  ? 212  HIS B CE1 1 
ATOM   5795 N NE2 . HIS B 1 211 ? 102.464 29.430 32.146  1.00 21.77  ? 212  HIS B NE2 1 
ATOM   5796 N N   . LEU B 1 212 ? 97.462  30.604 27.785  1.00 21.14  ? 213  LEU B N   1 
ATOM   5797 C CA  . LEU B 1 212 ? 96.181  30.737 27.096  1.00 24.31  ? 213  LEU B CA  1 
ATOM   5798 C C   . LEU B 1 212 ? 96.031  29.719 25.973  1.00 26.77  ? 213  LEU B C   1 
ATOM   5799 O O   . LEU B 1 212 ? 94.915  29.280 25.681  1.00 27.51  ? 213  LEU B O   1 
ATOM   5800 C CB  . LEU B 1 212 ? 96.026  32.146 26.524  1.00 28.05  ? 213  LEU B CB  1 
ATOM   5801 C CG  . LEU B 1 212 ? 95.526  33.251 27.451  1.00 37.92  ? 213  LEU B CG  1 
ATOM   5802 C CD1 . LEU B 1 212 ? 95.614  34.605 26.747  1.00 38.63  ? 213  LEU B CD1 1 
ATOM   5803 C CD2 . LEU B 1 212 ? 94.096  32.956 27.889  1.00 35.60  ? 213  LEU B CD2 1 
ATOM   5804 N N   . LEU B 1 213 ? 97.131  29.345 25.321  1.00 23.17  ? 214  LEU B N   1 
ATOM   5805 C CA  . LEU B 1 213 ? 97.074  28.507 24.130  1.00 27.21  ? 214  LEU B CA  1 
ATOM   5806 C C   . LEU B 1 213 ? 97.397  27.047 24.411  1.00 26.36  ? 214  LEU B C   1 
ATOM   5807 O O   . LEU B 1 213 ? 97.464  26.250 23.472  1.00 28.84  ? 214  LEU B O   1 
ATOM   5808 C CB  . LEU B 1 213 ? 98.018  29.059 23.053  1.00 24.20  ? 214  LEU B CB  1 
ATOM   5809 C CG  . LEU B 1 213 ? 97.857  30.556 22.774  1.00 21.94  ? 214  LEU B CG  1 
ATOM   5810 C CD1 . LEU B 1 213 ? 98.951  31.073 21.849  1.00 19.49  ? 214  LEU B CD1 1 
ATOM   5811 C CD2 . LEU B 1 213 ? 96.476  30.811 22.170  1.00 20.91  ? 214  LEU B CD2 1 
ATOM   5812 N N   . SER B 1 214 ? 97.598  26.681 25.671  1.00 25.53  ? 215  SER B N   1 
ATOM   5813 C CA  . SER B 1 214 ? 97.922  25.305 26.045  1.00 25.97  ? 215  SER B CA  1 
ATOM   5814 C C   . SER B 1 214 ? 96.798  24.763 26.914  1.00 29.64  ? 215  SER B C   1 
ATOM   5815 O O   . SER B 1 214 ? 96.609  25.247 28.046  1.00 28.01  ? 215  SER B O   1 
ATOM   5816 C CB  . SER B 1 214 ? 99.258  25.240 26.783  1.00 24.30  ? 215  SER B CB  1 
ATOM   5817 O OG  . SER B 1 214 ? 99.666  23.898 26.980  1.00 24.90  ? 215  SER B OG  1 
ATOM   5818 N N   . PRO B 1 215 ? 96.034  23.782 26.438  1.00 31.03  ? 216  PRO B N   1 
ATOM   5819 C CA  . PRO B 1 215 ? 94.804  23.364 27.140  1.00 30.20  ? 216  PRO B CA  1 
ATOM   5820 C C   . PRO B 1 215 ? 95.040  22.945 28.585  1.00 32.26  ? 216  PRO B C   1 
ATOM   5821 O O   . PRO B 1 215 ? 94.217  23.282 29.451  1.00 29.51  ? 216  PRO B O   1 
ATOM   5822 C CB  . PRO B 1 215 ? 94.293  22.197 26.281  1.00 35.22  ? 216  PRO B CB  1 
ATOM   5823 C CG  . PRO B 1 215 ? 94.745  22.568 24.893  1.00 33.88  ? 216  PRO B CG  1 
ATOM   5824 C CD  . PRO B 1 215 ? 96.113  23.210 25.080  1.00 30.98  ? 216  PRO B CD  1 
ATOM   5825 N N   . PRO B 1 216 ? 96.119  22.220 28.917  1.00 31.00  ? 217  PRO B N   1 
ATOM   5826 C CA  . PRO B 1 216 ? 96.330  21.891 30.343  1.00 32.73  ? 217  PRO B CA  1 
ATOM   5827 C C   . PRO B 1 216 ? 96.542  23.109 31.237  1.00 33.38  ? 217  PRO B C   1 
ATOM   5828 O O   . PRO B 1 216 ? 96.290  23.014 32.442  1.00 33.95  ? 217  PRO B O   1 
ATOM   5829 C CB  . PRO B 1 216 ? 97.569  20.982 30.327  1.00 27.30  ? 217  PRO B CB  1 
ATOM   5830 C CG  . PRO B 1 216 ? 97.587  20.408 28.953  1.00 27.79  ? 217  PRO B CG  1 
ATOM   5831 C CD  . PRO B 1 216 ? 97.102  21.518 28.068  1.00 25.92  ? 217  PRO B CD  1 
ATOM   5832 N N   . SER B 1 217 ? 96.992  24.247 30.700  1.00 33.94  ? 218  SER B N   1 
ATOM   5833 C CA  . SER B 1 217 ? 97.078  25.459 31.514  1.00 33.15  ? 218  SER B CA  1 
ATOM   5834 C C   . SER B 1 217 ? 95.757  26.215 31.571  1.00 33.10  ? 218  SER B C   1 
ATOM   5835 O O   . SER B 1 217 ? 95.494  26.916 32.552  1.00 29.56  ? 218  SER B O   1 
ATOM   5836 C CB  . SER B 1 217 ? 98.151  26.406 30.972  1.00 25.46  ? 218  SER B CB  1 
ATOM   5837 O OG  . SER B 1 217 ? 99.462  25.914 31.168  1.00 24.98  ? 218  SER B OG  1 
ATOM   5838 N N   . ARG B 1 218 ? 94.916  26.072 30.544  1.00 37.87  ? 219  ARG B N   1 
ATOM   5839 C CA  A ARG B 1 218 ? 93.752  26.941 30.416  0.68 40.23  ? 219  ARG B CA  1 
ATOM   5840 C CA  B ARG B 1 218 ? 93.739  26.928 30.411  0.32 39.92  ? 219  ARG B CA  1 
ATOM   5841 C C   . ARG B 1 218 ? 92.765  26.757 31.566  1.00 37.52  ? 219  ARG B C   1 
ATOM   5842 O O   . ARG B 1 218 ? 92.066  27.707 31.937  1.00 35.78  ? 219  ARG B O   1 
ATOM   5843 C CB  A ARG B 1 218 ? 93.072  26.694 29.069  0.68 41.65  ? 219  ARG B CB  1 
ATOM   5844 C CB  B ARG B 1 218 ? 93.031  26.645 29.088  0.32 41.50  ? 219  ARG B CB  1 
ATOM   5845 C CG  A ARG B 1 218 ? 91.986  27.695 28.729  0.68 41.59  ? 219  ARG B CG  1 
ATOM   5846 C CG  B ARG B 1 218 ? 93.515  27.509 27.957  0.32 39.61  ? 219  ARG B CG  1 
ATOM   5847 C CD  A ARG B 1 218 ? 92.526  29.118 28.713  0.68 41.43  ? 219  ARG B CD  1 
ATOM   5848 C CD  B ARG B 1 218 ? 93.458  28.973 28.349  0.32 40.17  ? 219  ARG B CD  1 
ATOM   5849 N NE  A ARG B 1 218 ? 91.457  30.093 28.522  0.68 37.63  ? 219  ARG B NE  1 
ATOM   5850 N NE  B ARG B 1 218 ? 92.107  29.523 28.310  0.32 40.63  ? 219  ARG B NE  1 
ATOM   5851 C CZ  A ARG B 1 218 ? 90.847  30.736 29.510  0.68 33.07  ? 219  ARG B CZ  1 
ATOM   5852 C CZ  B ARG B 1 218 ? 91.504  29.950 27.204  0.32 39.98  ? 219  ARG B CZ  1 
ATOM   5853 N NH1 A ARG B 1 218 ? 91.203  30.515 30.769  0.68 22.26  ? 219  ARG B NH1 1 
ATOM   5854 N NH1 B ARG B 1 218 ? 92.122  29.885 26.030  0.32 30.35  ? 219  ARG B NH1 1 
ATOM   5855 N NH2 A ARG B 1 218 ? 89.880  31.601 29.237  0.68 37.33  ? 219  ARG B NH2 1 
ATOM   5856 N NH2 B ARG B 1 218 ? 90.275  30.440 27.274  0.32 42.72  ? 219  ARG B NH2 1 
ATOM   5857 N N   . GLY B 1 219 ? 92.690  25.567 32.140  1.00 32.56  ? 220  GLY B N   1 
ATOM   5858 C CA  . GLY B 1 219 ? 91.786  25.397 33.256  1.00 27.03  ? 220  GLY B CA  1 
ATOM   5859 C C   . GLY B 1 219 ? 92.254  25.965 34.576  1.00 33.88  ? 220  GLY B C   1 
ATOM   5860 O O   . GLY B 1 219 ? 91.548  25.825 35.576  1.00 38.17  ? 220  GLY B O   1 
ATOM   5861 N N   . LEU B 1 220 ? 93.417  26.617 34.619  1.00 29.49  ? 221  LEU B N   1 
ATOM   5862 C CA  . LEU B 1 220 ? 94.014  27.055 35.873  1.00 25.55  ? 221  LEU B CA  1 
ATOM   5863 C C   . LEU B 1 220 ? 93.863  28.544 36.129  1.00 30.32  ? 221  LEU B C   1 
ATOM   5864 O O   . LEU B 1 220 ? 94.363  29.035 37.146  1.00 33.60  ? 221  LEU B O   1 
ATOM   5865 C CB  . LEU B 1 220 ? 95.500  26.684 35.907  1.00 20.48  ? 221  LEU B CB  1 
ATOM   5866 C CG  . LEU B 1 220 ? 95.864  25.239 35.580  1.00 27.05  ? 221  LEU B CG  1 
ATOM   5867 C CD1 . LEU B 1 220 ? 97.379  25.088 35.450  1.00 26.80  ? 221  LEU B CD1 1 
ATOM   5868 C CD2 . LEU B 1 220 ? 95.279  24.307 36.640  1.00 23.56  ? 221  LEU B CD2 1 
ATOM   5869 N N   . PHE B 1 221 ? 93.200  29.275 35.241  1.00 25.52  ? 222  PHE B N   1 
ATOM   5870 C CA  . PHE B 1 221 ? 93.030  30.709 35.425  1.00 26.33  ? 222  PHE B CA  1 
ATOM   5871 C C   . PHE B 1 221 ? 91.849  31.153 34.581  1.00 26.62  ? 222  PHE B C   1 
ATOM   5872 O O   . PHE B 1 221 ? 91.311  30.393 33.774  1.00 25.70  ? 222  PHE B O   1 
ATOM   5873 C CB  . PHE B 1 221 ? 94.303  31.487 35.059  1.00 21.68  ? 222  PHE B CB  1 
ATOM   5874 C CG  . PHE B 1 221 ? 94.690  31.379 33.608  1.00 25.12  ? 222  PHE B CG  1 
ATOM   5875 C CD1 . PHE B 1 221 ? 95.296  30.227 33.118  1.00 23.21  ? 222  PHE B CD1 1 
ATOM   5876 C CD2 . PHE B 1 221 ? 94.472  32.438 32.738  1.00 26.36  ? 222  PHE B CD2 1 
ATOM   5877 C CE1 . PHE B 1 221 ? 95.662  30.127 31.781  1.00 23.42  ? 222  PHE B CE1 1 
ATOM   5878 C CE2 . PHE B 1 221 ? 94.842  32.349 31.400  1.00 31.43  ? 222  PHE B CE2 1 
ATOM   5879 C CZ  . PHE B 1 221 ? 95.436  31.191 30.920  1.00 26.26  ? 222  PHE B CZ  1 
ATOM   5880 N N   . HIS B 1 222 ? 91.458  32.398 34.768  1.00 21.65  ? 223  HIS B N   1 
ATOM   5881 C CA  . HIS B 1 222 ? 90.219  32.875 34.191  1.00 30.43  ? 223  HIS B CA  1 
ATOM   5882 C C   . HIS B 1 222 ? 90.381  34.104 33.314  1.00 28.40  ? 223  HIS B C   1 
ATOM   5883 O O   . HIS B 1 222 ? 89.599  34.265 32.378  1.00 33.56  ? 223  HIS B O   1 
ATOM   5884 C CB  . HIS B 1 222 ? 89.214  33.133 35.328  1.00 35.67  ? 223  HIS B CB  1 
ATOM   5885 C CG  . HIS B 1 222 ? 89.089  31.961 36.253  1.00 43.42  ? 223  HIS B CG  1 
ATOM   5886 N ND1 . HIS B 1 222 ? 89.978  31.729 37.283  1.00 36.13  ? 223  HIS B ND1 1 
ATOM   5887 C CD2 . HIS B 1 222 ? 88.237  30.907 36.248  1.00 42.61  ? 223  HIS B CD2 1 
ATOM   5888 C CE1 . HIS B 1 222 ? 89.658  30.602 37.892  1.00 36.88  ? 223  HIS B CE1 1 
ATOM   5889 N NE2 . HIS B 1 222 ? 88.602  30.087 37.288  1.00 44.22  ? 223  HIS B NE2 1 
ATOM   5890 N N   . ARG B 1 223 ? 91.369  34.963 33.569  1.00 23.85  ? 224  ARG B N   1 
ATOM   5891 C CA  . ARG B 1 223 ? 91.660  36.081 32.677  1.00 26.24  ? 224  ARG B CA  1 
ATOM   5892 C C   . ARG B 1 223 ? 93.155  36.309 32.597  1.00 23.41  ? 224  ARG B C   1 
ATOM   5893 O O   . ARG B 1 223 ? 93.935  35.754 33.373  1.00 23.10  ? 224  ARG B O   1 
ATOM   5894 C CB  . ARG B 1 223 ? 91.040  37.396 33.120  1.00 32.32  ? 224  ARG B CB  1 
ATOM   5895 C CG  . ARG B 1 223 ? 89.634  37.341 33.496  1.00 37.45  ? 224  ARG B CG  1 
ATOM   5896 C CD  . ARG B 1 223 ? 89.484  38.196 34.701  1.00 46.85  ? 224  ARG B CD  1 
ATOM   5897 N NE  . ARG B 1 223 ? 88.086  38.447 34.944  1.00 56.13  ? 224  ARG B NE  1 
ATOM   5898 C CZ  . ARG B 1 223 ? 87.370  37.755 35.815  1.00 68.67  ? 224  ARG B CZ  1 
ATOM   5899 N NH1 . ARG B 1 223 ? 87.938  36.773 36.505  1.00 64.88  ? 224  ARG B NH1 1 
ATOM   5900 N NH2 . ARG B 1 223 ? 86.089  38.033 35.983  1.00 78.69  ? 224  ARG B NH2 1 
ATOM   5901 N N   . ALA B 1 224 ? 93.535  37.195 31.677  1.00 21.10  ? 225  ALA B N   1 
ATOM   5902 C CA  . ALA B 1 224 ? 94.928  37.362 31.299  1.00 22.65  ? 225  ALA B CA  1 
ATOM   5903 C C   . ALA B 1 224 ? 95.233  38.827 31.031  1.00 23.30  ? 225  ALA B C   1 
ATOM   5904 O O   . ALA B 1 224 ? 94.423  39.552 30.442  1.00 19.23  ? 225  ALA B O   1 
ATOM   5905 C CB  . ALA B 1 224 ? 95.258  36.518 30.059  1.00 21.22  ? 225  ALA B CB  1 
ATOM   5906 N N   . VAL B 1 225 ? 96.408  39.254 31.477  1.00 20.97  ? 226  VAL B N   1 
ATOM   5907 C CA  . VAL B 1 225 ? 96.940  40.577 31.182  1.00 23.23  ? 226  VAL B CA  1 
ATOM   5908 C C   . VAL B 1 225 ? 98.312  40.374 30.566  1.00 21.76  ? 226  VAL B C   1 
ATOM   5909 O O   . VAL B 1 225 ? 99.161  39.693 31.152  1.00 23.80  ? 226  VAL B O   1 
ATOM   5910 C CB  . VAL B 1 225 ? 97.042  41.456 32.438  1.00 24.04  ? 226  VAL B CB  1 
ATOM   5911 C CG1 . VAL B 1 225 ? 97.523  42.869 32.081  1.00 18.36  ? 226  VAL B CG1 1 
ATOM   5912 C CG2 . VAL B 1 225 ? 95.709  41.458 33.214  1.00 17.97  ? 226  VAL B CG2 1 
ATOM   5913 N N   . LEU B 1 226 ? 98.519  40.940 29.382  1.00 21.27  ? 227  LEU B N   1 
ATOM   5914 C CA  . LEU B 1 226 ? 99.778  40.821 28.655  1.00 23.53  ? 227  LEU B CA  1 
ATOM   5915 C C   . LEU B 1 226 ? 100.347 42.222 28.481  1.00 23.71  ? 227  LEU B C   1 
ATOM   5916 O O   . LEU B 1 226 ? 99.845  43.007 27.670  1.00 29.00  ? 227  LEU B O   1 
ATOM   5917 C CB  . LEU B 1 226 ? 99.581  40.132 27.302  1.00 22.39  ? 227  LEU B CB  1 
ATOM   5918 C CG  . LEU B 1 226 ? 99.182  38.655 27.273  1.00 25.97  ? 227  LEU B CG  1 
ATOM   5919 C CD1 . LEU B 1 226 ? 97.687  38.466 27.546  1.00 22.23  ? 227  LEU B CD1 1 
ATOM   5920 C CD2 . LEU B 1 226 ? 99.577  37.998 25.943  1.00 19.90  ? 227  LEU B CD2 1 
ATOM   5921 N N   . GLN B 1 227 ? 101.387 42.537 29.247  1.00 21.53  ? 228  GLN B N   1 
ATOM   5922 C CA  . GLN B 1 227 ? 102.018 43.853 29.227  1.00 18.63  ? 228  GLN B CA  1 
ATOM   5923 C C   . GLN B 1 227 ? 103.279 43.772 28.371  1.00 18.63  ? 228  GLN B C   1 
ATOM   5924 O O   . GLN B 1 227 ? 104.231 43.070 28.726  1.00 19.21  ? 228  GLN B O   1 
ATOM   5925 C CB  . GLN B 1 227 ? 102.343 44.316 30.650  1.00 17.16  ? 228  GLN B CB  1 
ATOM   5926 C CG  . GLN B 1 227 ? 101.121 44.399 31.576  1.00 20.68  ? 228  GLN B CG  1 
ATOM   5927 C CD  . GLN B 1 227 ? 101.478 44.607 33.057  1.00 28.23  ? 228  GLN B CD  1 
ATOM   5928 O OE1 . GLN B 1 227 ? 100.687 44.274 33.940  1.00 25.49  ? 228  GLN B OE1 1 
ATOM   5929 N NE2 . GLN B 1 227 ? 102.654 45.174 33.327  1.00 23.73  ? 228  GLN B NE2 1 
ATOM   5930 N N   . SER B 1 228 ? 103.285 44.480 27.239  1.00 20.52  ? 229  SER B N   1 
ATOM   5931 C CA  . SER B 1 228 ? 104.494 44.627 26.419  1.00 22.46  ? 229  SER B CA  1 
ATOM   5932 C C   . SER B 1 228 ? 105.068 43.274 26.001  1.00 24.49  ? 229  SER B C   1 
ATOM   5933 O O   . SER B 1 228 ? 106.276 43.042 26.089  1.00 22.10  ? 229  SER B O   1 
ATOM   5934 C CB  . SER B 1 228 ? 105.567 45.438 27.153  1.00 23.33  ? 229  SER B CB  1 
ATOM   5935 O OG  . SER B 1 228 ? 105.136 46.757 27.426  1.00 27.91  ? 229  SER B OG  1 
ATOM   5936 N N   . GLY B 1 229 ? 104.211 42.369 25.555  1.00 18.54  ? 230  GLY B N   1 
ATOM   5937 C CA  . GLY B 1 229 ? 104.692 41.064 25.145  1.00 17.87  ? 230  GLY B CA  1 
ATOM   5938 C C   . GLY B 1 229 ? 103.545 40.199 24.681  1.00 23.23  ? 230  GLY B C   1 
ATOM   5939 O O   . GLY B 1 229 ? 102.379 40.439 25.012  1.00 25.11  ? 230  GLY B O   1 
ATOM   5940 N N   . ALA B 1 230 ? 103.902 39.178 23.910  1.00 22.96  ? 231  ALA B N   1 
ATOM   5941 C CA  . ALA B 1 230 ? 102.914 38.314 23.288  1.00 25.95  ? 231  ALA B CA  1 
ATOM   5942 C C   . ALA B 1 230 ? 103.594 37.018 22.858  1.00 24.46  ? 231  ALA B C   1 
ATOM   5943 O O   . ALA B 1 230 ? 104.781 37.027 22.511  1.00 23.82  ? 231  ALA B O   1 
ATOM   5944 C CB  . ALA B 1 230 ? 102.252 39.026 22.105  1.00 21.91  ? 231  ALA B CB  1 
ATOM   5945 N N   . PRO B 1 231 ? 102.891 35.883 22.889  1.00 24.41  ? 232  PRO B N   1 
ATOM   5946 C CA  . PRO B 1 231 ? 103.557 34.605 22.585  1.00 23.56  ? 232  PRO B CA  1 
ATOM   5947 C C   . PRO B 1 231 ? 103.939 34.457 21.127  1.00 25.76  ? 232  PRO B C   1 
ATOM   5948 O O   . PRO B 1 231 ? 104.807 33.629 20.821  1.00 23.70  ? 232  PRO B O   1 
ATOM   5949 C CB  . PRO B 1 231 ? 102.516 33.555 23.002  1.00 20.60  ? 232  PRO B CB  1 
ATOM   5950 C CG  . PRO B 1 231 ? 101.200 34.267 22.843  1.00 21.50  ? 232  PRO B CG  1 
ATOM   5951 C CD  . PRO B 1 231 ? 101.463 35.705 23.215  1.00 21.91  ? 232  PRO B CD  1 
ATOM   5952 N N   . ASN B 1 232 ? 103.325 35.232 20.225  1.00 23.79  ? 233  ASN B N   1 
ATOM   5953 C CA  . ASN B 1 232 ? 103.669 35.254 18.807  1.00 26.88  ? 233  ASN B CA  1 
ATOM   5954 C C   . ASN B 1 232 ? 104.818 36.211 18.479  1.00 26.84  ? 233  ASN B C   1 
ATOM   5955 O O   . ASN B 1 232 ? 105.082 36.458 17.299  1.00 23.92  ? 233  ASN B O   1 
ATOM   5956 C CB  . ASN B 1 232 ? 102.433 35.621 17.969  1.00 25.06  ? 233  ASN B CB  1 
ATOM   5957 C CG  . ASN B 1 232 ? 101.647 36.775 18.570  1.00 28.65  ? 233  ASN B CG  1 
ATOM   5958 O OD1 . ASN B 1 232 ? 101.460 36.842 19.783  1.00 33.84  ? 233  ASN B OD1 1 
ATOM   5959 N ND2 . ASN B 1 232 ? 101.198 37.695 17.727  1.00 22.06  ? 233  ASN B ND2 1 
ATOM   5960 N N   . GLY B 1 233 ? 105.503 36.762 19.478  1.00 32.37  ? 234  GLY B N   1 
ATOM   5961 C CA  . GLY B 1 233 ? 106.687 37.549 19.217  1.00 41.82  ? 234  GLY B CA  1 
ATOM   5962 C C   . GLY B 1 233 ? 107.769 36.737 18.523  1.00 42.41  ? 234  GLY B C   1 
ATOM   5963 O O   . GLY B 1 233 ? 107.958 35.551 18.810  1.00 44.09  ? 234  GLY B O   1 
ATOM   5964 N N   . PRO B 1 234 ? 108.496 37.364 17.588  1.00 33.13  ? 235  PRO B N   1 
ATOM   5965 C CA  . PRO B 1 234 ? 109.560 36.642 16.859  1.00 28.28  ? 235  PRO B CA  1 
ATOM   5966 C C   . PRO B 1 234 ? 110.678 36.126 17.758  1.00 27.09  ? 235  PRO B C   1 
ATOM   5967 O O   . PRO B 1 234 ? 111.480 35.289 17.325  1.00 30.04  ? 235  PRO B O   1 
ATOM   5968 C CB  . PRO B 1 234 ? 110.093 37.692 15.874  1.00 24.08  ? 235  PRO B CB  1 
ATOM   5969 C CG  . PRO B 1 234 ? 109.647 39.019 16.443  1.00 29.17  ? 235  PRO B CG  1 
ATOM   5970 C CD  . PRO B 1 234 ? 108.356 38.759 17.147  1.00 26.49  ? 235  PRO B CD  1 
ATOM   5971 N N   . TRP B 1 235 ? 110.758 36.607 18.991  1.00 22.24  ? 236  TRP B N   1 
ATOM   5972 C CA  . TRP B 1 235 ? 111.757 36.194 19.965  1.00 24.87  ? 236  TRP B CA  1 
ATOM   5973 C C   . TRP B 1 235 ? 111.234 35.158 20.951  1.00 24.14  ? 236  TRP B C   1 
ATOM   5974 O O   . TRP B 1 235 ? 112.035 34.552 21.670  1.00 23.66  ? 236  TRP B O   1 
ATOM   5975 C CB  . TRP B 1 235 ? 112.227 37.421 20.744  1.00 22.35  ? 236  TRP B CB  1 
ATOM   5976 C CG  . TRP B 1 235 ? 111.043 38.192 21.247  1.00 24.39  ? 236  TRP B CG  1 
ATOM   5977 C CD1 . TRP B 1 235 ? 110.373 39.190 20.588  1.00 22.10  ? 236  TRP B CD1 1 
ATOM   5978 C CD2 . TRP B 1 235 ? 110.355 38.000 22.491  1.00 16.36  ? 236  TRP B CD2 1 
ATOM   5979 N NE1 . TRP B 1 235 ? 109.324 39.641 21.358  1.00 20.68  ? 236  TRP B NE1 1 
ATOM   5980 C CE2 . TRP B 1 235 ? 109.293 38.928 22.529  1.00 19.63  ? 236  TRP B CE2 1 
ATOM   5981 C CE3 . TRP B 1 235 ? 110.541 37.140 23.581  1.00 19.05  ? 236  TRP B CE3 1 
ATOM   5982 C CZ2 . TRP B 1 235 ? 108.416 39.018 23.611  1.00 21.20  ? 236  TRP B CZ2 1 
ATOM   5983 C CZ3 . TRP B 1 235 ? 109.667 37.230 24.660  1.00 19.22  ? 236  TRP B CZ3 1 
ATOM   5984 C CH2 . TRP B 1 235 ? 108.619 38.164 24.667  1.00 20.87  ? 236  TRP B CH2 1 
ATOM   5985 N N   . ALA B 1 236 ? 109.917 34.947 21.007  1.00 21.66  ? 237  ALA B N   1 
ATOM   5986 C CA  . ALA B 1 236 ? 109.308 34.226 22.118  1.00 24.28  ? 237  ALA B CA  1 
ATOM   5987 C C   . ALA B 1 236 ? 109.324 32.714 21.952  1.00 24.55  ? 237  ALA B C   1 
ATOM   5988 O O   . ALA B 1 236 ? 109.191 32.002 22.953  1.00 20.58  ? 237  ALA B O   1 
ATOM   5989 C CB  . ALA B 1 236 ? 107.863 34.694 22.328  1.00 17.42  ? 237  ALA B CB  1 
ATOM   5990 N N   . THR B 1 237 ? 109.463 32.205 20.727  1.00 21.65  ? 238  THR B N   1 
ATOM   5991 C CA  . THR B 1 237 ? 109.553 30.768 20.506  1.00 20.96  ? 238  THR B CA  1 
ATOM   5992 C C   . THR B 1 237 ? 110.656 30.465 19.503  1.00 21.49  ? 238  THR B C   1 
ATOM   5993 O O   . THR B 1 237 ? 111.122 31.336 18.765  1.00 24.63  ? 238  THR B O   1 
ATOM   5994 C CB  . THR B 1 237 ? 108.238 30.154 19.995  1.00 26.17  ? 238  THR B CB  1 
ATOM   5995 O OG1 . THR B 1 237 ? 107.896 30.741 18.734  1.00 22.84  ? 238  THR B OG1 1 
ATOM   5996 C CG2 . THR B 1 237 ? 107.100 30.363 20.990  1.00 23.11  ? 238  THR B CG2 1 
ATOM   5997 N N   . VAL B 1 238 ? 111.053 29.201 19.479  1.00 20.75  ? 239  VAL B N   1 
ATOM   5998 C CA  . VAL B 1 238 ? 112.049 28.694 18.552  1.00 22.17  ? 239  VAL B CA  1 
ATOM   5999 C C   . VAL B 1 238 ? 111.529 27.380 17.987  1.00 25.55  ? 239  VAL B C   1 
ATOM   6000 O O   . VAL B 1 238 ? 110.771 26.658 18.644  1.00 25.40  ? 239  VAL B O   1 
ATOM   6001 C CB  . VAL B 1 238 ? 113.422 28.515 19.248  1.00 29.33  ? 239  VAL B CB  1 
ATOM   6002 C CG1 . VAL B 1 238 ? 113.394 27.342 20.230  1.00 26.70  ? 239  VAL B CG1 1 
ATOM   6003 C CG2 . VAL B 1 238 ? 114.516 28.345 18.243  1.00 39.12  ? 239  VAL B CG2 1 
ATOM   6004 N N   . GLY B 1 239 ? 111.899 27.092 16.740  1.00 29.28  ? 240  GLY B N   1 
ATOM   6005 C CA  . GLY B 1 239 ? 111.577 25.807 16.163  1.00 24.94  ? 240  GLY B CA  1 
ATOM   6006 C C   . GLY B 1 239 ? 112.474 24.705 16.703  1.00 30.28  ? 240  GLY B C   1 
ATOM   6007 O O   . GLY B 1 239 ? 113.525 24.953 17.298  1.00 27.20  ? 240  GLY B O   1 
ATOM   6008 N N   . MET B 1 240 ? 112.047 23.459 16.475  1.00 27.92  ? 241  MET B N   1 
ATOM   6009 C CA  . MET B 1 240 ? 112.780 22.311 17.002  1.00 31.50  ? 241  MET B CA  1 
ATOM   6010 C C   . MET B 1 240 ? 114.199 22.242 16.449  1.00 31.62  ? 241  MET B C   1 
ATOM   6011 O O   . MET B 1 240 ? 115.148 21.974 17.196  1.00 31.16  ? 241  MET B O   1 
ATOM   6012 C CB  . MET B 1 240 ? 112.030 21.015 16.689  1.00 34.21  ? 241  MET B CB  1 
ATOM   6013 C CG  . MET B 1 240 ? 110.699 20.882 17.402  1.00 40.46  ? 241  MET B CG  1 
ATOM   6014 S SD  . MET B 1 240 ? 109.922 19.274 17.138  1.00 40.95  ? 241  MET B SD  1 
ATOM   6015 C CE  . MET B 1 240 ? 109.687 19.302 15.359  1.00 42.07  ? 241  MET B CE  1 
ATOM   6016 N N   . GLY B 1 241 ? 114.362 22.460 15.141  1.00 30.59  ? 242  GLY B N   1 
ATOM   6017 C CA  . GLY B 1 241 ? 115.691 22.368 14.549  1.00 26.55  ? 242  GLY B CA  1 
ATOM   6018 C C   . GLY B 1 241 ? 116.665 23.365 15.152  1.00 32.10  ? 242  GLY B C   1 
ATOM   6019 O O   . GLY B 1 241 ? 117.797 23.019 15.503  1.00 30.49  ? 242  GLY B O   1 
ATOM   6020 N N   . GLU B 1 242 ? 116.231 24.620 15.290  1.00 29.47  ? 243  GLU B N   1 
ATOM   6021 C CA  . GLU B 1 242 ? 117.109 25.646 15.838  1.00 32.24  ? 243  GLU B CA  1 
ATOM   6022 C C   . GLU B 1 242 ? 117.363 25.432 17.329  1.00 29.03  ? 243  GLU B C   1 
ATOM   6023 O O   . GLU B 1 242 ? 118.467 25.708 17.812  1.00 27.62  ? 243  GLU B O   1 
ATOM   6024 C CB  . GLU B 1 242 ? 116.517 27.033 15.563  1.00 29.86  ? 243  GLU B CB  1 
ATOM   6025 C CG  . GLU B 1 242 ? 117.279 28.201 16.192  1.00 32.51  ? 243  GLU B CG  1 
ATOM   6026 C CD  . GLU B 1 242 ? 118.676 28.397 15.631  1.00 33.93  ? 243  GLU B CD  1 
ATOM   6027 O OE1 . GLU B 1 242 ? 119.048 27.704 14.663  1.00 39.20  ? 243  GLU B OE1 1 
ATOM   6028 O OE2 . GLU B 1 242 ? 119.408 29.258 16.164  1.00 33.00  ? 243  GLU B OE2 1 
ATOM   6029 N N   . ALA B 1 243 ? 116.375 24.914 18.066  1.00 29.61  ? 244  ALA B N   1 
ATOM   6030 C CA  . ALA B 1 243 ? 116.605 24.596 19.475  1.00 32.17  ? 244  ALA B CA  1 
ATOM   6031 C C   . ALA B 1 243 ? 117.652 23.500 19.628  1.00 32.85  ? 244  ALA B C   1 
ATOM   6032 O O   . ALA B 1 243 ? 118.538 23.592 20.488  1.00 28.36  ? 244  ALA B O   1 
ATOM   6033 C CB  . ALA B 1 243 ? 115.297 24.182 20.144  1.00 25.76  ? 244  ALA B CB  1 
ATOM   6034 N N   . ARG B 1 244 ? 117.570 22.455 18.800  1.00 29.30  ? 245  ARG B N   1 
ATOM   6035 C CA  . ARG B 1 244 ? 118.582 21.406 18.849  1.00 27.99  ? 245  ARG B CA  1 
ATOM   6036 C C   . ARG B 1 244 ? 119.960 21.958 18.511  1.00 25.17  ? 245  ARG B C   1 
ATOM   6037 O O   . ARG B 1 244 ? 120.947 21.619 19.172  1.00 25.95  ? 245  ARG B O   1 
ATOM   6038 C CB  . ARG B 1 244 ? 118.220 20.262 17.901  1.00 24.95  ? 245  ARG B CB  1 
ATOM   6039 C CG  . ARG B 1 244 ? 119.328 19.224 17.746  1.00 31.36  ? 245  ARG B CG  1 
ATOM   6040 C CD  . ARG B 1 244 ? 118.797 17.876 17.224  1.00 32.50  ? 245  ARG B CD  1 
ATOM   6041 N NE  . ARG B 1 244 ? 117.737 17.316 18.055  1.00 40.65  ? 245  ARG B NE  1 
ATOM   6042 C CZ  . ARG B 1 244 ? 117.931 16.331 18.936  1.00 36.37  ? 245  ARG B CZ  1 
ATOM   6043 N NH1 . ARG B 1 244 ? 119.136 15.824 19.106  1.00 31.95  ? 245  ARG B NH1 1 
ATOM   6044 N NH2 . ARG B 1 244 ? 116.925 15.867 19.659  1.00 38.14  ? 245  ARG B NH2 1 
ATOM   6045 N N   . ARG B 1 245 ? 120.046 22.811 17.486  1.00 24.30  ? 246  ARG B N   1 
ATOM   6046 C CA  . ARG B 1 245 ? 121.339 23.378 17.117  1.00 27.02  ? 246  ARG B CA  1 
ATOM   6047 C C   . ARG B 1 245 ? 121.920 24.210 18.256  1.00 25.51  ? 246  ARG B C   1 
ATOM   6048 O O   . ARG B 1 245 ? 123.131 24.182 18.499  1.00 29.85  ? 246  ARG B O   1 
ATOM   6049 C CB  . ARG B 1 245 ? 121.214 24.230 15.851  1.00 26.73  ? 246  ARG B CB  1 
ATOM   6050 C CG  . ARG B 1 245 ? 122.545 24.824 15.408  1.00 29.22  ? 246  ARG B CG  1 
ATOM   6051 C CD  . ARG B 1 245 ? 122.381 25.977 14.421  1.00 34.32  ? 246  ARG B CD  1 
ATOM   6052 N NE  . ARG B 1 245 ? 121.951 27.215 15.072  1.00 37.63  ? 246  ARG B NE  1 
ATOM   6053 C CZ  . ARG B 1 245 ? 122.714 27.945 15.885  1.00 38.43  ? 246  ARG B CZ  1 
ATOM   6054 N NH1 . ARG B 1 245 ? 123.959 27.567 16.151  1.00 36.33  ? 246  ARG B NH1 1 
ATOM   6055 N NH2 . ARG B 1 245 ? 122.234 29.057 16.430  1.00 32.72  ? 246  ARG B NH2 1 
ATOM   6056 N N   . ARG B 1 246 ? 121.074 24.960 18.963  1.00 23.26  ? 247  ARG B N   1 
ATOM   6057 C CA  . ARG B 1 246 ? 121.564 25.790 20.060  1.00 31.88  ? 247  ARG B CA  1 
ATOM   6058 C C   . ARG B 1 246 ? 122.015 24.945 21.241  1.00 32.87  ? 247  ARG B C   1 
ATOM   6059 O O   . ARG B 1 246 ? 123.075 25.196 21.827  1.00 26.18  ? 247  ARG B O   1 
ATOM   6060 C CB  . ARG B 1 246 ? 120.480 26.764 20.495  1.00 28.07  ? 247  ARG B CB  1 
ATOM   6061 C CG  . ARG B 1 246 ? 120.349 27.931 19.551  1.00 28.63  ? 247  ARG B CG  1 
ATOM   6062 C CD  . ARG B 1 246 ? 119.116 28.748 19.908  1.00 28.24  ? 247  ARG B CD  1 
ATOM   6063 N NE  . ARG B 1 246 ? 118.762 29.666 18.844  1.00 28.34  ? 247  ARG B NE  1 
ATOM   6064 C CZ  . ARG B 1 246 ? 117.989 30.748 18.996  1.00 31.10  ? 247  ARG B CZ  1 
ATOM   6065 N NH1 . ARG B 1 246 ? 117.448 31.052 20.173  1.00 23.08  ? 247  ARG B NH1 1 
ATOM   6066 N NH2 . ARG B 1 246 ? 117.722 31.505 17.940  1.00 25.35  ? 247  ARG B NH2 1 
ATOM   6067 N N   . ALA B 1 247 ? 121.201 23.956 21.625  1.00 30.23  ? 248  ALA B N   1 
ATOM   6068 C CA  . ALA B 1 247 ? 121.581 23.060 22.712  1.00 26.87  ? 248  ALA B CA  1 
ATOM   6069 C C   . ALA B 1 247 ? 122.876 22.328 22.392  1.00 33.05  ? 248  ALA B C   1 
ATOM   6070 O O   . ALA B 1 247 ? 123.731 22.148 23.267  1.00 30.94  ? 248  ALA B O   1 
ATOM   6071 C CB  . ALA B 1 247 ? 120.455 22.064 22.985  1.00 22.70  ? 248  ALA B CB  1 
ATOM   6072 N N   . THR B 1 248 ? 123.048 21.918 21.132  1.00 28.25  ? 249  THR B N   1 
ATOM   6073 C CA  . THR B 1 248 ? 124.242 21.174 20.747  1.00 30.21  ? 249  THR B CA  1 
ATOM   6074 C C   . THR B 1 248 ? 125.466 22.084 20.700  1.00 33.03  ? 249  THR B C   1 
ATOM   6075 O O   . THR B 1 248 ? 126.575 21.663 21.053  1.00 30.36  ? 249  THR B O   1 
ATOM   6076 C CB  . THR B 1 248 ? 124.015 20.488 19.396  1.00 33.98  ? 249  THR B CB  1 
ATOM   6077 O OG1 . THR B 1 248 ? 122.917 19.572 19.507  1.00 36.76  ? 249  THR B OG1 1 
ATOM   6078 C CG2 . THR B 1 248 ? 125.264 19.727 18.945  1.00 33.39  ? 249  THR B CG2 1 
ATOM   6079 N N   . GLN B 1 249 ? 125.287 23.341 20.279  1.00 31.28  ? 250  GLN B N   1 
ATOM   6080 C CA  . GLN B 1 249 ? 126.407 24.281 20.295  1.00 31.71  ? 250  GLN B CA  1 
ATOM   6081 C C   . GLN B 1 249 ? 126.819 24.621 21.723  1.00 34.54  ? 250  GLN B C   1 
ATOM   6082 O O   . GLN B 1 249 ? 128.012 24.798 22.004  1.00 28.98  ? 250  GLN B O   1 
ATOM   6083 C CB  . GLN B 1 249 ? 126.046 25.549 19.518  1.00 35.07  ? 250  GLN B CB  1 
ATOM   6084 C CG  . GLN B 1 249 ? 127.174 26.580 19.432  1.00 44.22  ? 250  GLN B CG  1 
ATOM   6085 C CD  . GLN B 1 249 ? 128.318 26.144 18.533  1.00 62.48  ? 250  GLN B CD  1 
ATOM   6086 O OE1 . GLN B 1 249 ? 128.286 25.064 17.936  1.00 69.97  ? 250  GLN B OE1 1 
ATOM   6087 N NE2 . GLN B 1 249 ? 129.342 26.986 18.432  1.00 70.66  ? 250  GLN B NE2 1 
ATOM   6088 N N   . LEU B 1 250 ? 125.850 24.714 22.641  1.00 25.56  ? 251  LEU B N   1 
ATOM   6089 C CA  . LEU B 1 250 ? 126.186 24.952 24.042  1.00 30.40  ? 251  LEU B CA  1 
ATOM   6090 C C   . LEU B 1 250 ? 127.041 23.818 24.594  1.00 26.48  ? 251  LEU B C   1 
ATOM   6091 O O   . LEU B 1 250 ? 128.072 24.057 25.234  1.00 32.10  ? 251  LEU B O   1 
ATOM   6092 C CB  . LEU B 1 250 ? 124.917 25.130 24.881  1.00 24.01  ? 251  LEU B CB  1 
ATOM   6093 C CG  . LEU B 1 250 ? 125.193 25.480 26.351  1.00 27.55  ? 251  LEU B CG  1 
ATOM   6094 C CD1 . LEU B 1 250 ? 125.802 26.880 26.493  1.00 24.97  ? 251  LEU B CD1 1 
ATOM   6095 C CD2 . LEU B 1 250 ? 123.948 25.349 27.204  1.00 23.82  ? 251  LEU B CD2 1 
ATOM   6096 N N   . ALA B 1 251 ? 126.633 22.571 24.339  1.00 31.42  ? 252  ALA B N   1 
ATOM   6097 C CA  . ALA B 1 251 ? 127.425 21.420 24.763  1.00 32.71  ? 252  ALA B CA  1 
ATOM   6098 C C   . ALA B 1 251 ? 128.861 21.520 24.259  1.00 35.06  ? 252  ALA B C   1 
ATOM   6099 O O   . ALA B 1 251 ? 129.817 21.304 25.013  1.00 35.24  ? 252  ALA B O   1 
ATOM   6100 C CB  . ALA B 1 251 ? 126.770 20.130 24.267  1.00 30.93  ? 252  ALA B CB  1 
ATOM   6101 N N   . HIS B 1 252 ? 129.030 21.861 22.980  1.00 32.93  ? 253  HIS B N   1 
ATOM   6102 C CA  . HIS B 1 252 ? 130.372 21.969 22.419  1.00 34.28  ? 253  HIS B CA  1 
ATOM   6103 C C   . HIS B 1 252 ? 131.169 23.079 23.096  1.00 31.39  ? 253  HIS B C   1 
ATOM   6104 O O   . HIS B 1 252 ? 132.365 22.922 23.358  1.00 32.75  ? 253  HIS B O   1 
ATOM   6105 C CB  . HIS B 1 252 ? 130.297 22.211 20.909  1.00 40.65  ? 253  HIS B CB  1 
ATOM   6106 C CG  . HIS B 1 252 ? 131.583 22.704 20.318  1.00 53.66  ? 253  HIS B CG  1 
ATOM   6107 N ND1 . HIS B 1 252 ? 131.820 24.037 20.058  1.00 59.14  ? 253  HIS B ND1 1 
ATOM   6108 C CD2 . HIS B 1 252 ? 132.710 22.045 19.959  1.00 59.02  ? 253  HIS B CD2 1 
ATOM   6109 C CE1 . HIS B 1 252 ? 133.034 24.177 19.554  1.00 62.19  ? 253  HIS B CE1 1 
ATOM   6110 N NE2 . HIS B 1 252 ? 133.595 22.983 19.485  1.00 62.46  ? 253  HIS B NE2 1 
ATOM   6111 N N   . LEU B 1 253 ? 130.525 24.211 23.382  1.00 33.06  ? 254  LEU B N   1 
ATOM   6112 C CA  . LEU B 1 253 ? 131.231 25.335 23.985  1.00 34.43  ? 254  LEU B CA  1 
ATOM   6113 C C   . LEU B 1 253 ? 131.685 25.053 25.412  1.00 36.05  ? 254  LEU B C   1 
ATOM   6114 O O   . LEU B 1 253 ? 132.643 25.681 25.872  1.00 34.07  ? 254  LEU B O   1 
ATOM   6115 C CB  . LEU B 1 253 ? 130.346 26.581 23.967  1.00 31.43  ? 254  LEU B CB  1 
ATOM   6116 C CG  . LEU B 1 253 ? 130.070 27.195 22.594  1.00 31.52  ? 254  LEU B CG  1 
ATOM   6117 C CD1 . LEU B 1 253 ? 128.984 28.263 22.698  1.00 31.92  ? 254  LEU B CD1 1 
ATOM   6118 C CD2 . LEU B 1 253 ? 131.363 27.737 21.979  1.00 30.29  ? 254  LEU B CD2 1 
ATOM   6119 N N   . VAL B 1 254 ? 131.025 24.140 26.125  1.00 31.98  ? 255  VAL B N   1 
ATOM   6120 C CA  . VAL B 1 254 ? 131.411 23.819 27.494  1.00 31.72  ? 255  VAL B CA  1 
ATOM   6121 C C   . VAL B 1 254 ? 132.167 22.495 27.579  1.00 35.52  ? 255  VAL B C   1 
ATOM   6122 O O   . VAL B 1 254 ? 132.346 21.957 28.675  1.00 34.09  ? 255  VAL B O   1 
ATOM   6123 C CB  . VAL B 1 254 ? 130.192 23.829 28.434  1.00 31.26  ? 255  VAL B CB  1 
ATOM   6124 C CG1 . VAL B 1 254 ? 129.454 25.157 28.320  1.00 27.74  ? 255  VAL B CG1 1 
ATOM   6125 C CG2 . VAL B 1 254 ? 129.258 22.667 28.126  1.00 30.44  ? 255  VAL B CG2 1 
ATOM   6126 N N   . GLY B 1 255 ? 132.624 21.962 26.445  1.00 33.61  ? 256  GLY B N   1 
ATOM   6127 C CA  . GLY B 1 255 ? 133.486 20.796 26.451  1.00 34.59  ? 256  GLY B CA  1 
ATOM   6128 C C   . GLY B 1 255 ? 132.796 19.451 26.496  1.00 34.56  ? 256  GLY B C   1 
ATOM   6129 O O   . GLY B 1 255 ? 133.422 18.468 26.898  1.00 42.76  ? 256  GLY B O   1 
ATOM   6130 N N   . CYS B 1 256 ? 131.557 19.387 26.076  1.00 34.36  ? 257  CYS B N   1 
ATOM   6131 C CA  . CYS B 1 256 ? 130.811 18.153 26.065  1.00 42.61  ? 257  CYS B CA  1 
ATOM   6132 C C   . CYS B 1 256 ? 130.655 17.585 24.670  1.00 60.11  ? 257  CYS B C   1 
ATOM   6133 O O   . CYS B 1 256 ? 130.627 18.314 23.727  1.00 58.73  ? 257  CYS B O   1 
ATOM   6134 C CB  . CYS B 1 256 ? 129.437 18.385 26.678  1.00 38.37  ? 257  CYS B CB  1 
ATOM   6135 S SG  . CYS B 1 256 ? 129.484 18.723 28.437  1.00 42.10  ? 257  CYS B SG  1 
ATOM   6136 N N   . PRO B 1 257 ? 130.538 16.206 24.559  1.00 78.76  ? 258  PRO B N   1 
ATOM   6137 C CA  . PRO B 1 257 ? 130.361 15.686 23.187  1.00 88.05  ? 258  PRO B CA  1 
ATOM   6138 C C   . PRO B 1 257 ? 129.136 16.279 22.507  1.00 98.05  ? 258  PRO B C   1 
ATOM   6139 O O   . PRO B 1 257 ? 128.488 17.038 23.168  1.00 99.57  ? 258  PRO B O   1 
ATOM   6140 C CB  . PRO B 1 257 ? 130.116 14.218 23.416  1.00 85.53  ? 258  PRO B CB  1 
ATOM   6141 C CG  . PRO B 1 257 ? 129.576 14.122 24.783  1.00 80.45  ? 258  PRO B CG  1 
ATOM   6142 C CD  . PRO B 1 257 ? 130.524 14.993 25.479  1.00 77.86  ? 258  PRO B CD  1 
ATOM   6143 N N   . PRO B 1 258 ? 128.777 15.997 21.189  1.00 104.66 ? 259  PRO B N   1 
ATOM   6144 C CA  . PRO B 1 258 ? 129.561 14.986 20.463  1.00 107.27 ? 259  PRO B CA  1 
ATOM   6145 C C   . PRO B 1 258 ? 131.046 15.201 20.325  1.00 108.49 ? 259  PRO B C   1 
ATOM   6146 O O   . PRO B 1 258 ? 131.625 14.388 19.617  1.00 109.23 ? 259  PRO B O   1 
ATOM   6147 C CB  . PRO B 1 258 ? 128.940 14.997 19.067  1.00 106.05 ? 259  PRO B CB  1 
ATOM   6148 C CG  . PRO B 1 258 ? 127.543 15.440 19.276  1.00 103.37 ? 259  PRO B CG  1 
ATOM   6149 C CD  . PRO B 1 258 ? 127.768 16.572 20.184  1.00 103.99 ? 259  PRO B CD  1 
ATOM   6150 N N   . GLY B 1 263 ? 126.728 10.990 17.663  1.00 94.40  ? 264  GLY B N   1 
ATOM   6151 C CA  . GLY B 1 263 ? 125.901 11.800 18.541  1.00 97.92  ? 264  GLY B CA  1 
ATOM   6152 C C   . GLY B 1 263 ? 124.847 11.006 19.292  1.00 97.62  ? 264  GLY B C   1 
ATOM   6153 O O   . GLY B 1 263 ? 124.395 9.962  18.822  1.00 109.96 ? 264  GLY B O   1 
ATOM   6154 N N   . ASN B 1 264 ? 124.447 11.506 20.463  1.00 80.59  ? 265  ASN B N   1 
ATOM   6155 C CA  . ASN B 1 264 ? 123.477 10.805 21.301  1.00 64.13  ? 265  ASN B CA  1 
ATOM   6156 C C   . ASN B 1 264 ? 122.990 11.758 22.382  1.00 54.14  ? 265  ASN B C   1 
ATOM   6157 O O   . ASN B 1 264 ? 123.792 12.228 23.197  1.00 49.14  ? 265  ASN B O   1 
ATOM   6158 C CB  . ASN B 1 264 ? 124.097 9.552  21.916  1.00 69.89  ? 265  ASN B CB  1 
ATOM   6159 C CG  . ASN B 1 264 ? 123.203 8.909  22.951  1.00 77.69  ? 265  ASN B CG  1 
ATOM   6160 O OD1 . ASN B 1 264 ? 123.344 9.155  24.148  1.00 78.52  ? 265  ASN B OD1 1 
ATOM   6161 N ND2 . ASN B 1 264 ? 122.266 8.087  22.495  1.00 85.88  ? 265  ASN B ND2 1 
ATOM   6162 N N   . ASP B 1 265 ? 121.681 12.028 22.402  1.00 44.57  ? 266  ASP B N   1 
ATOM   6163 C CA  . ASP B 1 265 ? 121.136 13.019 23.326  1.00 41.22  ? 266  ASP B CA  1 
ATOM   6164 C C   . ASP B 1 265 ? 121.373 12.642 24.786  1.00 43.83  ? 266  ASP B C   1 
ATOM   6165 O O   . ASP B 1 265 ? 121.591 13.525 25.624  1.00 37.78  ? 266  ASP B O   1 
ATOM   6166 C CB  . ASP B 1 265 ? 119.637 13.213 23.077  1.00 38.73  ? 266  ASP B CB  1 
ATOM   6167 C CG  . ASP B 1 265 ? 119.345 13.909 21.756  1.00 49.18  ? 266  ASP B CG  1 
ATOM   6168 O OD1 . ASP B 1 265 ? 120.283 14.474 21.152  1.00 47.95  ? 266  ASP B OD1 1 
ATOM   6169 O OD2 . ASP B 1 265 ? 118.168 13.902 21.329  1.00 50.32  ? 266  ASP B OD2 1 
ATOM   6170 N N   . THR B 1 266 ? 121.329 11.350 25.113  1.00 42.82  ? 267  THR B N   1 
ATOM   6171 C CA  . THR B 1 266 ? 121.501 10.933 26.501  1.00 44.75  ? 267  THR B CA  1 
ATOM   6172 C C   . THR B 1 266 ? 122.885 11.305 27.023  1.00 46.14  ? 267  THR B C   1 
ATOM   6173 O O   . THR B 1 266 ? 123.019 11.848 28.126  1.00 45.91  ? 267  THR B O   1 
ATOM   6174 C CB  . THR B 1 266 ? 121.256 9.428  26.631  1.00 48.82  ? 267  THR B CB  1 
ATOM   6175 O OG1 . THR B 1 266 ? 119.919 9.127  26.214  1.00 52.52  ? 267  THR B OG1 1 
ATOM   6176 C CG2 . THR B 1 266 ? 121.447 8.970  28.075  1.00 39.97  ? 267  THR B CG2 1 
ATOM   6177 N N   . GLU B 1 267 ? 123.932 11.020 26.240  1.00 43.22  ? 268  GLU B N   1 
ATOM   6178 C CA  . GLU B 1 267 ? 125.289 11.349 26.670  1.00 44.50  ? 268  GLU B CA  1 
ATOM   6179 C C   . GLU B 1 267 ? 125.520 12.855 26.680  1.00 38.49  ? 268  GLU B C   1 
ATOM   6180 O O   . GLU B 1 267 ? 126.223 13.379 27.553  1.00 40.92  ? 268  GLU B O   1 
ATOM   6181 C CB  . GLU B 1 267 ? 126.311 10.658 25.767  1.00 58.50  ? 268  GLU B CB  1 
ATOM   6182 C CG  . GLU B 1 267 ? 126.205 9.142  25.760  1.00 76.64  ? 268  GLU B CG  1 
ATOM   6183 C CD  . GLU B 1 267 ? 127.071 8.507  24.697  1.00 95.59  ? 268  GLU B CD  1 
ATOM   6184 O OE1 . GLU B 1 267 ? 126.690 7.433  24.185  1.00 102.28 ? 268  GLU B OE1 1 
ATOM   6185 O OE2 . GLU B 1 267 ? 128.132 9.083  24.381  1.00 100.75 ? 268  GLU B OE2 1 
ATOM   6186 N N   . LEU B 1 268 ? 124.940 13.564 25.713  1.00 33.63  ? 269  LEU B N   1 
ATOM   6187 C CA  . LEU B 1 268 ? 125.075 15.014 25.659  1.00 36.40  ? 269  LEU B CA  1 
ATOM   6188 C C   . LEU B 1 268 ? 124.496 15.661 26.914  1.00 39.40  ? 269  LEU B C   1 
ATOM   6189 O O   . LEU B 1 268 ? 125.131 16.526 27.530  1.00 38.48  ? 269  LEU B O   1 
ATOM   6190 C CB  . LEU B 1 268 ? 124.392 15.534 24.391  1.00 36.20  ? 269  LEU B CB  1 
ATOM   6191 C CG  . LEU B 1 268 ? 124.597 16.954 23.861  1.00 42.54  ? 269  LEU B CG  1 
ATOM   6192 C CD1 . LEU B 1 268 ? 124.031 17.051 22.458  1.00 41.06  ? 269  LEU B CD1 1 
ATOM   6193 C CD2 . LEU B 1 268 ? 123.900 17.974 24.726  1.00 45.23  ? 269  LEU B CD2 1 
ATOM   6194 N N   . VAL B 1 269 ? 123.293 15.247 27.316  1.00 33.89  ? 270  VAL B N   1 
ATOM   6195 C CA  . VAL B 1 269 ? 122.665 15.866 28.479  1.00 30.75  ? 270  VAL B CA  1 
ATOM   6196 C C   . VAL B 1 269 ? 123.357 15.421 29.760  1.00 33.45  ? 270  VAL B C   1 
ATOM   6197 O O   . VAL B 1 269 ? 123.524 16.216 30.693  1.00 33.67  ? 270  VAL B O   1 
ATOM   6198 C CB  . VAL B 1 269 ? 121.156 15.566 28.506  1.00 32.06  ? 270  VAL B CB  1 
ATOM   6199 C CG1 . VAL B 1 269 ? 120.497 16.238 29.704  1.00 28.29  ? 270  VAL B CG1 1 
ATOM   6200 C CG2 . VAL B 1 269 ? 120.512 16.064 27.233  1.00 28.58  ? 270  VAL B CG2 1 
ATOM   6201 N N   . ALA B 1 270 ? 123.790 14.157 29.821  1.00 33.79  ? 271  ALA B N   1 
ATOM   6202 C CA  . ALA B 1 270 ? 124.539 13.697 30.985  1.00 37.98  ? 271  ALA B CA  1 
ATOM   6203 C C   . ALA B 1 270 ? 125.802 14.526 31.188  1.00 42.22  ? 271  ALA B C   1 
ATOM   6204 O O   . ALA B 1 270 ? 126.133 14.896 32.321  1.00 44.29  ? 271  ALA B O   1 
ATOM   6205 C CB  . ALA B 1 270 ? 124.885 12.212 30.846  1.00 33.22  ? 271  ALA B CB  1 
ATOM   6206 N N   . CYS B 1 271 ? 126.517 14.840 30.102  1.00 33.07  ? 272  CYS B N   1 
ATOM   6207 C CA  . CYS B 1 271 ? 127.704 15.680 30.238  1.00 37.74  ? 272  CYS B CA  1 
ATOM   6208 C C   . CYS B 1 271 ? 127.332 17.096 30.671  1.00 38.23  ? 272  CYS B C   1 
ATOM   6209 O O   . CYS B 1 271 ? 127.995 17.679 31.537  1.00 34.04  ? 272  CYS B O   1 
ATOM   6210 C CB  . CYS B 1 271 ? 128.495 15.705 28.929  1.00 41.93  ? 272  CYS B CB  1 
ATOM   6211 S SG  . CYS B 1 271 ? 130.029 16.686 29.011  1.00 45.33  ? 272  CYS B SG  1 
ATOM   6212 N N   . LEU B 1 272 ? 126.280 17.669 30.079  1.00 29.81  ? 273  LEU B N   1 
ATOM   6213 C CA  . LEU B 1 272 ? 125.823 18.985 30.515  1.00 31.88  ? 273  LEU B CA  1 
ATOM   6214 C C   . LEU B 1 272 ? 125.443 18.999 31.991  1.00 35.33  ? 273  LEU B C   1 
ATOM   6215 O O   . LEU B 1 272 ? 125.637 20.012 32.671  1.00 34.04  ? 273  LEU B O   1 
ATOM   6216 C CB  . LEU B 1 272 ? 124.631 19.452 29.685  1.00 27.29  ? 273  LEU B CB  1 
ATOM   6217 C CG  . LEU B 1 272 ? 124.811 19.857 28.224  1.00 39.46  ? 273  LEU B CG  1 
ATOM   6218 C CD1 . LEU B 1 272 ? 123.447 19.884 27.566  1.00 32.73  ? 273  LEU B CD1 1 
ATOM   6219 C CD2 . LEU B 1 272 ? 125.517 21.208 28.124  1.00 32.61  ? 273  LEU B CD2 1 
ATOM   6220 N N   . ARG B 1 273 ? 124.901 17.896 32.504  1.00 31.13  ? 274  ARG B N   1 
ATOM   6221 C CA  . ARG B 1 273 ? 124.499 17.878 33.901  1.00 30.61  ? 274  ARG B CA  1 
ATOM   6222 C C   . ARG B 1 273 ? 125.699 17.868 34.843  1.00 34.03  ? 274  ARG B C   1 
ATOM   6223 O O   . ARG B 1 273 ? 125.538 18.199 36.019  1.00 30.62  ? 274  ARG B O   1 
ATOM   6224 C CB  . ARG B 1 273 ? 123.570 16.688 34.174  1.00 31.21  ? 274  ARG B CB  1 
ATOM   6225 C CG  . ARG B 1 273 ? 122.153 16.893 33.606  1.00 37.89  ? 274  ARG B CG  1 
ATOM   6226 C CD  . ARG B 1 273 ? 121.095 16.032 34.304  1.00 41.85  ? 274  ARG B CD  1 
ATOM   6227 N NE  . ARG B 1 273 ? 120.740 14.848 33.526  1.00 53.82  ? 274  ARG B NE  1 
ATOM   6228 C CZ  . ARG B 1 273 ? 119.605 14.695 32.846  1.00 51.48  ? 274  ARG B CZ  1 
ATOM   6229 N NH1 . ARG B 1 273 ? 118.671 15.644 32.844  1.00 35.92  ? 274  ARG B NH1 1 
ATOM   6230 N NH2 . ARG B 1 273 ? 119.395 13.573 32.171  1.00 56.99  ? 274  ARG B NH2 1 
ATOM   6231 N N   . THR B 1 274 ? 126.900 17.536 34.357  1.00 30.36  ? 275  THR B N   1 
ATOM   6232 C CA  . THR B 1 274 ? 128.075 17.591 35.223  1.00 34.85  ? 275  THR B CA  1 
ATOM   6233 C C   . THR B 1 274 ? 128.663 18.993 35.344  1.00 31.65  ? 275  THR B C   1 
ATOM   6234 O O   . THR B 1 274 ? 129.538 19.202 36.187  1.00 33.91  ? 275  THR B O   1 
ATOM   6235 C CB  . THR B 1 274 ? 129.171 16.635 34.730  1.00 39.44  ? 275  THR B CB  1 
ATOM   6236 O OG1 . THR B 1 274 ? 129.750 17.144 33.522  1.00 37.44  ? 275  THR B OG1 1 
ATOM   6237 C CG2 . THR B 1 274 ? 128.613 15.246 34.478  1.00 38.93  ? 275  THR B CG2 1 
ATOM   6238 N N   . ARG B 1 275 ? 128.207 19.947 34.551  1.00 29.86  ? 276  ARG B N   1 
ATOM   6239 C CA  . ARG B 1 275 ? 128.772 21.294 34.545  1.00 33.07  ? 276  ARG B CA  1 
ATOM   6240 C C   . ARG B 1 275 ? 128.153 22.161 35.631  1.00 34.71  ? 276  ARG B C   1 
ATOM   6241 O O   . ARG B 1 275 ? 126.928 22.173 35.793  1.00 29.18  ? 276  ARG B O   1 
ATOM   6242 C CB  . ARG B 1 275 ? 128.552 21.971 33.201  1.00 37.72  ? 276  ARG B CB  1 
ATOM   6243 C CG  . ARG B 1 275 ? 129.219 21.243 32.072  1.00 29.91  ? 276  ARG B CG  1 
ATOM   6244 C CD  . ARG B 1 275 ? 130.724 21.305 32.243  1.00 36.35  ? 276  ARG B CD  1 
ATOM   6245 N NE  . ARG B 1 275 ? 131.437 20.909 31.048  1.00 36.12  ? 276  ARG B NE  1 
ATOM   6246 C CZ  . ARG B 1 275 ? 132.125 19.767 30.951  1.00 38.83  ? 276  ARG B CZ  1 
ATOM   6247 N NH1 . ARG B 1 275 ? 132.167 18.917 31.954  1.00 35.85  ? 276  ARG B NH1 1 
ATOM   6248 N NH2 . ARG B 1 275 ? 132.755 19.462 29.830  1.00 40.91  ? 276  ARG B NH2 1 
ATOM   6249 N N   . PRO B 1 276 ? 128.996 22.895 36.359  1.00 35.58  ? 277  PRO B N   1 
ATOM   6250 C CA  . PRO B 1 276 ? 128.486 23.975 37.213  1.00 28.12  ? 277  PRO B CA  1 
ATOM   6251 C C   . PRO B 1 276 ? 127.523 24.866 36.445  1.00 30.63  ? 277  PRO B C   1 
ATOM   6252 O O   . PRO B 1 276 ? 127.732 25.168 35.269  1.00 26.70  ? 277  PRO B O   1 
ATOM   6253 C CB  . PRO B 1 276 ? 129.751 24.738 37.622  1.00 28.99  ? 277  PRO B CB  1 
ATOM   6254 C CG  . PRO B 1 276 ? 130.872 23.756 37.464  1.00 35.14  ? 277  PRO B CG  1 
ATOM   6255 C CD  . PRO B 1 276 ? 130.461 22.736 36.444  1.00 33.01  ? 277  PRO B CD  1 
ATOM   6256 N N   . ALA B 1 277 ? 126.456 25.287 37.130  1.00 26.94  ? 278  ALA B N   1 
ATOM   6257 C CA  . ALA B 1 277 ? 125.424 26.102 36.498  1.00 28.77  ? 278  ALA B CA  1 
ATOM   6258 C C   . ALA B 1 277 ? 126.008 27.349 35.851  1.00 28.50  ? 278  ALA B C   1 
ATOM   6259 O O   . ALA B 1 277 ? 125.612 27.731 34.741  1.00 31.48  ? 278  ALA B O   1 
ATOM   6260 C CB  . ALA B 1 277 ? 124.364 26.487 37.532  1.00 23.71  ? 278  ALA B CB  1 
ATOM   6261 N N   . GLN B 1 278 ? 126.961 27.993 36.529  1.00 27.65  ? 279  GLN B N   1 
ATOM   6262 C CA  . GLN B 1 278 ? 127.534 29.232 36.015  1.00 31.07  ? 279  GLN B CA  1 
ATOM   6263 C C   . GLN B 1 278 ? 128.257 29.017 34.688  1.00 26.10  ? 279  GLN B C   1 
ATOM   6264 O O   . GLN B 1 278 ? 128.325 29.937 33.868  1.00 25.54  ? 279  GLN B O   1 
ATOM   6265 C CB  . GLN B 1 278 ? 128.479 29.853 37.052  1.00 30.63  ? 279  GLN B CB  1 
ATOM   6266 C CG  . GLN B 1 278 ? 129.028 31.211 36.620  1.00 34.61  ? 279  GLN B CG  1 
ATOM   6267 C CD  . GLN B 1 278 ? 127.974 32.325 36.686  1.00 44.42  ? 279  GLN B CD  1 
ATOM   6268 O OE1 . GLN B 1 278 ? 127.757 33.036 35.712  1.00 43.99  ? 279  GLN B OE1 1 
ATOM   6269 N NE2 . GLN B 1 278 ? 127.335 32.475 37.829  1.00 45.84  ? 279  GLN B NE2 1 
ATOM   6270 N N   . VAL B 1 279 ? 128.801 27.819 34.459  1.00 29.97  ? 280  VAL B N   1 
ATOM   6271 C CA  . VAL B 1 279 ? 129.487 27.543 33.197  1.00 29.87  ? 280  VAL B CA  1 
ATOM   6272 C C   . VAL B 1 279 ? 128.513 27.619 32.027  1.00 31.24  ? 280  VAL B C   1 
ATOM   6273 O O   . VAL B 1 279 ? 128.829 28.190 30.975  1.00 31.91  ? 280  VAL B O   1 
ATOM   6274 C CB  . VAL B 1 279 ? 130.198 26.178 33.259  1.00 35.03  ? 280  VAL B CB  1 
ATOM   6275 C CG1 . VAL B 1 279 ? 130.723 25.789 31.877  1.00 29.03  ? 280  VAL B CG1 1 
ATOM   6276 C CG2 . VAL B 1 279 ? 131.338 26.230 34.246  1.00 29.55  ? 280  VAL B CG2 1 
ATOM   6277 N N   . LEU B 1 280 ? 127.310 27.060 32.188  1.00 29.07  ? 281  LEU B N   1 
ATOM   6278 C CA  . LEU B 1 280 ? 126.320 27.154 31.119  1.00 31.12  ? 281  LEU B CA  1 
ATOM   6279 C C   . LEU B 1 280 ? 125.913 28.599 30.882  1.00 30.89  ? 281  LEU B C   1 
ATOM   6280 O O   . LEU B 1 280 ? 125.773 29.033 29.730  1.00 30.34  ? 281  LEU B O   1 
ATOM   6281 C CB  . LEU B 1 280 ? 125.093 26.305 31.444  1.00 25.04  ? 281  LEU B CB  1 
ATOM   6282 C CG  . LEU B 1 280 ? 125.302 24.853 31.865  1.00 30.78  ? 281  LEU B CG  1 
ATOM   6283 C CD1 . LEU B 1 280 ? 123.961 24.110 31.872  1.00 28.52  ? 281  LEU B CD1 1 
ATOM   6284 C CD2 . LEU B 1 280 ? 126.348 24.163 30.982  1.00 25.85  ? 281  LEU B CD2 1 
ATOM   6285 N N   . VAL B 1 281 ? 125.727 29.353 31.966  1.00 25.27  ? 282  VAL B N   1 
ATOM   6286 C CA  . VAL B 1 281 ? 125.413 30.773 31.860  1.00 28.00  ? 282  VAL B CA  1 
ATOM   6287 C C   . VAL B 1 281 ? 126.481 31.500 31.055  1.00 27.84  ? 282  VAL B C   1 
ATOM   6288 O O   . VAL B 1 281 ? 126.168 32.317 30.182  1.00 25.61  ? 282  VAL B O   1 
ATOM   6289 C CB  . VAL B 1 281 ? 125.255 31.383 33.266  1.00 32.93  ? 282  VAL B CB  1 
ATOM   6290 C CG1 . VAL B 1 281 ? 125.133 32.894 33.176  1.00 28.61  ? 282  VAL B CG1 1 
ATOM   6291 C CG2 . VAL B 1 281 ? 124.049 30.780 33.965  1.00 30.16  ? 282  VAL B CG2 1 
ATOM   6292 N N   . ASN B 1 282 ? 127.754 31.200 31.315  1.00 24.52  ? 283  ASN B N   1 
ATOM   6293 C CA  . ASN B 1 282 ? 128.834 31.954 30.689  1.00 25.31  ? 283  ASN B CA  1 
ATOM   6294 C C   . ASN B 1 282 ? 128.907 31.781 29.176  1.00 31.38  ? 283  ASN B C   1 
ATOM   6295 O O   . ASN B 1 282 ? 129.593 32.569 28.520  1.00 33.90  ? 283  ASN B O   1 
ATOM   6296 C CB  . ASN B 1 282 ? 130.180 31.566 31.308  1.00 26.65  ? 283  ASN B CB  1 
ATOM   6297 C CG  . ASN B 1 282 ? 130.326 32.059 32.732  1.00 42.66  ? 283  ASN B CG  1 
ATOM   6298 O OD1 . ASN B 1 282 ? 129.608 32.956 33.169  1.00 38.97  ? 283  ASN B OD1 1 
ATOM   6299 N ND2 . ASN B 1 282 ? 131.293 31.504 33.449  1.00 32.87  ? 283  ASN B ND2 1 
ATOM   6300 N N   . HIS B 1 283 ? 128.232 30.786 28.604  1.00 32.65  ? 284  HIS B N   1 
ATOM   6301 C CA  . HIS B 1 283 ? 128.279 30.555 27.165  1.00 29.59  ? 284  HIS B CA  1 
ATOM   6302 C C   . HIS B 1 283 ? 126.928 30.762 26.502  1.00 31.71  ? 284  HIS B C   1 
ATOM   6303 O O   . HIS B 1 283 ? 126.793 30.524 25.299  1.00 35.00  ? 284  HIS B O   1 
ATOM   6304 C CB  . HIS B 1 283 ? 128.806 29.149 26.889  1.00 27.21  ? 284  HIS B CB  1 
ATOM   6305 C CG  . HIS B 1 283 ? 130.265 29.002 27.183  1.00 34.29  ? 284  HIS B CG  1 
ATOM   6306 N ND1 . HIS B 1 283 ? 131.244 29.504 26.344  1.00 33.37  ? 284  HIS B ND1 1 
ATOM   6307 C CD2 . HIS B 1 283 ? 130.914 28.449 28.239  1.00 34.36  ? 284  HIS B CD2 1 
ATOM   6308 C CE1 . HIS B 1 283 ? 132.434 29.250 26.861  1.00 36.06  ? 284  HIS B CE1 1 
ATOM   6309 N NE2 . HIS B 1 283 ? 132.262 28.610 28.009  1.00 41.20  ? 284  HIS B NE2 1 
ATOM   6310 N N   . GLU B 1 284 ? 125.944 31.255 27.258  1.00 33.17  ? 285  GLU B N   1 
ATOM   6311 C CA  . GLU B 1 284 ? 124.565 31.296 26.790  1.00 33.18  ? 285  GLU B CA  1 
ATOM   6312 C C   . GLU B 1 284 ? 124.425 32.123 25.517  1.00 34.24  ? 285  GLU B C   1 
ATOM   6313 O O   . GLU B 1 284 ? 123.797 31.685 24.545  1.00 33.76  ? 285  GLU B O   1 
ATOM   6314 C CB  . GLU B 1 284 ? 123.681 31.855 27.898  1.00 31.84  ? 285  GLU B CB  1 
ATOM   6315 C CG  . GLU B 1 284 ? 122.218 31.856 27.584  1.00 37.41  ? 285  GLU B CG  1 
ATOM   6316 C CD  . GLU B 1 284 ? 121.410 32.477 28.702  1.00 42.08  ? 285  GLU B CD  1 
ATOM   6317 O OE1 . GLU B 1 284 ? 120.459 33.222 28.399  1.00 43.67  ? 285  GLU B OE1 1 
ATOM   6318 O OE2 . GLU B 1 284 ? 121.740 32.231 29.883  1.00 42.86  ? 285  GLU B OE2 1 
ATOM   6319 N N   . TRP B 1 285 ? 125.002 33.326 25.500  1.00 26.40  ? 286  TRP B N   1 
ATOM   6320 C CA  . TRP B 1 285 ? 124.766 34.236 24.387  1.00 26.76  ? 286  TRP B CA  1 
ATOM   6321 C C   . TRP B 1 285 ? 125.479 33.808 23.116  1.00 29.76  ? 286  TRP B C   1 
ATOM   6322 O O   . TRP B 1 285 ? 125.113 34.272 22.031  1.00 35.22  ? 286  TRP B O   1 
ATOM   6323 C CB  . TRP B 1 285 ? 125.183 35.654 24.768  1.00 26.23  ? 286  TRP B CB  1 
ATOM   6324 C CG  . TRP B 1 285 ? 124.350 36.205 25.885  1.00 32.75  ? 286  TRP B CG  1 
ATOM   6325 C CD1 . TRP B 1 285 ? 124.661 36.212 27.218  1.00 31.27  ? 286  TRP B CD1 1 
ATOM   6326 C CD2 . TRP B 1 285 ? 123.036 36.778 25.778  1.00 31.15  ? 286  TRP B CD2 1 
ATOM   6327 N NE1 . TRP B 1 285 ? 123.639 36.782 27.938  1.00 35.81  ? 286  TRP B NE1 1 
ATOM   6328 C CE2 . TRP B 1 285 ? 122.624 37.133 27.082  1.00 32.75  ? 286  TRP B CE2 1 
ATOM   6329 C CE3 . TRP B 1 285 ? 122.171 37.040 24.705  1.00 30.12  ? 286  TRP B CE3 1 
ATOM   6330 C CZ2 . TRP B 1 285 ? 121.386 37.735 27.344  1.00 26.98  ? 286  TRP B CZ2 1 
ATOM   6331 C CZ3 . TRP B 1 285 ? 120.932 37.640 24.972  1.00 28.96  ? 286  TRP B CZ3 1 
ATOM   6332 C CH2 . TRP B 1 285 ? 120.556 37.978 26.281  1.00 29.94  ? 286  TRP B CH2 1 
ATOM   6333 N N   . HIS B 1 286 ? 126.466 32.925 23.220  1.00 28.01  ? 287  HIS B N   1 
ATOM   6334 C CA  . HIS B 1 286 ? 127.284 32.559 22.077  1.00 33.84  ? 287  HIS B CA  1 
ATOM   6335 C C   . HIS B 1 286 ? 126.644 31.503 21.186  1.00 33.36  ? 287  HIS B C   1 
ATOM   6336 O O   . HIS B 1 286 ? 127.240 31.144 20.168  1.00 32.87  ? 287  HIS B O   1 
ATOM   6337 C CB  . HIS B 1 286 ? 128.658 32.090 22.564  1.00 37.56  ? 287  HIS B CB  1 
ATOM   6338 C CG  . HIS B 1 286 ? 129.452 33.174 23.225  1.00 58.09  ? 287  HIS B CG  1 
ATOM   6339 N ND1 . HIS B 1 286 ? 129.668 33.218 24.586  1.00 70.72  ? 287  HIS B ND1 1 
ATOM   6340 C CD2 . HIS B 1 286 ? 130.059 34.271 22.712  1.00 64.20  ? 287  HIS B CD2 1 
ATOM   6341 C CE1 . HIS B 1 286 ? 130.386 34.288 24.881  1.00 73.73  ? 287  HIS B CE1 1 
ATOM   6342 N NE2 . HIS B 1 286 ? 130.635 34.944 23.762  1.00 72.46  ? 287  HIS B NE2 1 
ATOM   6343 N N   . VAL B 1 287 ? 125.449 31.002 21.522  1.00 31.52  ? 288  VAL B N   1 
ATOM   6344 C CA  . VAL B 1 287 ? 124.764 30.064 20.637  1.00 29.57  ? 288  VAL B CA  1 
ATOM   6345 C C   . VAL B 1 287 ? 123.788 30.756 19.694  1.00 30.99  ? 288  VAL B C   1 
ATOM   6346 O O   . VAL B 1 287 ? 123.200 30.089 18.831  1.00 32.30  ? 288  VAL B O   1 
ATOM   6347 C CB  . VAL B 1 287 ? 124.017 28.965 21.423  1.00 32.08  ? 288  VAL B CB  1 
ATOM   6348 C CG1 . VAL B 1 287 ? 124.962 28.261 22.389  1.00 33.57  ? 288  VAL B CG1 1 
ATOM   6349 C CG2 . VAL B 1 287 ? 122.815 29.544 22.147  1.00 21.97  ? 288  VAL B CG2 1 
ATOM   6350 N N   . LEU B 1 288 ? 123.598 32.067 19.824  1.00 29.70  ? 289  LEU B N   1 
ATOM   6351 C CA  . LEU B 1 288 ? 122.714 32.768 18.903  1.00 30.33  ? 289  LEU B CA  1 
ATOM   6352 C C   . LEU B 1 288 ? 123.337 32.795 17.507  1.00 30.33  ? 289  LEU B C   1 
ATOM   6353 O O   . LEU B 1 288 ? 124.557 32.914 17.372  1.00 31.44  ? 289  LEU B O   1 
ATOM   6354 C CB  . LEU B 1 288 ? 122.429 34.193 19.385  1.00 24.78  ? 289  LEU B CB  1 
ATOM   6355 C CG  . LEU B 1 288 ? 121.449 34.324 20.558  1.00 27.56  ? 289  LEU B CG  1 
ATOM   6356 C CD1 . LEU B 1 288 ? 121.445 35.749 21.117  1.00 23.41  ? 289  LEU B CD1 1 
ATOM   6357 C CD2 . LEU B 1 288 ? 120.042 33.909 20.135  1.00 22.98  ? 289  LEU B CD2 1 
ATOM   6358 N N   . PRO B 1 289 ? 122.527 32.681 16.452  1.00 30.65  ? 290  PRO B N   1 
ATOM   6359 C CA  . PRO B 1 289 ? 123.104 32.572 15.104  1.00 33.65  ? 290  PRO B CA  1 
ATOM   6360 C C   . PRO B 1 289 ? 123.811 33.830 14.631  1.00 35.21  ? 290  PRO B C   1 
ATOM   6361 O O   . PRO B 1 289 ? 124.730 33.727 13.813  1.00 44.32  ? 290  PRO B O   1 
ATOM   6362 C CB  . PRO B 1 289 ? 121.888 32.244 14.229  1.00 32.58  ? 290  PRO B CB  1 
ATOM   6363 C CG  . PRO B 1 289 ? 120.722 32.803 14.981  1.00 32.87  ? 290  PRO B CG  1 
ATOM   6364 C CD  . PRO B 1 289 ? 121.056 32.612 16.438  1.00 29.56  ? 290  PRO B CD  1 
ATOM   6365 N N   . GLN B 1 290 ? 123.430 35.010 15.112  1.00 36.32  ? 291  GLN B N   1 
ATOM   6366 C CA  . GLN B 1 290 ? 124.092 36.231 14.675  1.00 42.45  ? 291  GLN B CA  1 
ATOM   6367 C C   . GLN B 1 290 ? 124.027 37.276 15.778  1.00 41.68  ? 291  GLN B C   1 
ATOM   6368 O O   . GLN B 1 290 ? 123.291 37.136 16.756  1.00 45.95  ? 291  GLN B O   1 
ATOM   6369 C CB  . GLN B 1 290 ? 123.460 36.789 13.395  1.00 43.41  ? 291  GLN B CB  1 
ATOM   6370 C CG  . GLN B 1 290 ? 122.106 37.448 13.620  1.00 50.21  ? 291  GLN B CG  1 
ATOM   6371 C CD  . GLN B 1 290 ? 121.671 38.311 12.446  1.00 59.27  ? 291  GLN B CD  1 
ATOM   6372 O OE1 . GLN B 1 290 ? 121.169 37.804 11.441  1.00 62.89  ? 291  GLN B OE1 1 
ATOM   6373 N NE2 . GLN B 1 290 ? 121.862 39.623 12.571  1.00 55.35  ? 291  GLN B NE2 1 
ATOM   6374 N N   . GLU B 1 291 ? 124.812 38.338 15.599  1.00 39.93  ? 292  GLU B N   1 
ATOM   6375 C CA  . GLU B 1 291 ? 124.708 39.501 16.467  1.00 43.06  ? 292  GLU B CA  1 
ATOM   6376 C C   . GLU B 1 291 ? 123.342 40.153 16.282  1.00 34.52  ? 292  GLU B C   1 
ATOM   6377 O O   . GLU B 1 291 ? 122.857 40.303 15.159  1.00 38.61  ? 292  GLU B O   1 
ATOM   6378 C CB  . GLU B 1 291 ? 125.825 40.497 16.155  1.00 58.68  ? 292  GLU B CB  1 
ATOM   6379 C CG  . GLU B 1 291 ? 126.612 40.960 17.373  1.00 74.95  ? 292  GLU B CG  1 
ATOM   6380 C CD  . GLU B 1 291 ? 127.455 39.856 17.990  1.00 84.89  ? 292  GLU B CD  1 
ATOM   6381 O OE1 . GLU B 1 291 ? 128.256 39.234 17.259  1.00 87.10  ? 292  GLU B OE1 1 
ATOM   6382 O OE2 . GLU B 1 291 ? 127.314 39.609 19.208  1.00 89.11  ? 292  GLU B OE2 1 
ATOM   6383 N N   . SER B 1 292 ? 122.711 40.528 17.390  1.00 30.71  ? 293  SER B N   1 
ATOM   6384 C CA  . SER B 1 292 ? 121.323 40.960 17.336  1.00 32.49  ? 293  SER B CA  1 
ATOM   6385 C C   . SER B 1 292 ? 120.976 41.736 18.597  1.00 32.72  ? 293  SER B C   1 
ATOM   6386 O O   . SER B 1 292 ? 121.745 41.785 19.558  1.00 29.64  ? 293  SER B O   1 
ATOM   6387 C CB  . SER B 1 292 ? 120.386 39.762 17.174  1.00 32.68  ? 293  SER B CB  1 
ATOM   6388 O OG  . SER B 1 292 ? 120.528 38.879 18.269  1.00 32.27  ? 293  SER B OG  1 
ATOM   6389 N N   . VAL B 1 293 ? 119.801 42.354 18.574  1.00 32.20  ? 294  VAL B N   1 
ATOM   6390 C CA  . VAL B 1 293 ? 119.152 42.811 19.793  1.00 24.18  ? 294  VAL B CA  1 
ATOM   6391 C C   . VAL B 1 293 ? 117.796 42.130 19.862  1.00 25.17  ? 294  VAL B C   1 
ATOM   6392 O O   . VAL B 1 293 ? 117.240 41.706 18.842  1.00 24.22  ? 294  VAL B O   1 
ATOM   6393 C CB  . VAL B 1 293 ? 119.004 44.349 19.869  1.00 26.71  ? 294  VAL B CB  1 
ATOM   6394 C CG1 . VAL B 1 293 ? 120.375 45.012 19.902  1.00 26.02  ? 294  VAL B CG1 1 
ATOM   6395 C CG2 . VAL B 1 293 ? 118.156 44.872 18.707  1.00 25.79  ? 294  VAL B CG2 1 
ATOM   6396 N N   . PHE B 1 294 ? 117.286 41.989 21.082  1.00 24.85  ? 295  PHE B N   1 
ATOM   6397 C CA  . PHE B 1 294 ? 115.960 41.422 21.311  1.00 23.78  ? 295  PHE B CA  1 
ATOM   6398 C C   . PHE B 1 294 ? 115.890 39.969 20.834  1.00 24.88  ? 295  PHE B C   1 
ATOM   6399 O O   . PHE B 1 294 ? 114.882 39.527 20.276  1.00 25.48  ? 295  PHE B O   1 
ATOM   6400 C CB  . PHE B 1 294 ? 114.878 42.281 20.645  1.00 22.45  ? 295  PHE B CB  1 
ATOM   6401 C CG  . PHE B 1 294 ? 113.629 42.436 21.470  1.00 22.78  ? 295  PHE B CG  1 
ATOM   6402 C CD1 . PHE B 1 294 ? 113.120 43.694 21.747  1.00 21.15  ? 295  PHE B CD1 1 
ATOM   6403 C CD2 . PHE B 1 294 ? 112.955 41.325 21.955  1.00 16.19  ? 295  PHE B CD2 1 
ATOM   6404 C CE1 . PHE B 1 294 ? 111.970 43.841 22.497  1.00 19.69  ? 295  PHE B CE1 1 
ATOM   6405 C CE2 . PHE B 1 294 ? 111.805 41.461 22.699  1.00 19.26  ? 295  PHE B CE2 1 
ATOM   6406 C CZ  . PHE B 1 294 ? 111.311 42.720 22.978  1.00 24.93  ? 295  PHE B CZ  1 
ATOM   6407 N N   . ARG B 1 295 ? 116.978 39.221 21.039  1.00 21.88  ? 296  ARG B N   1 
ATOM   6408 C CA  . ARG B 1 295 ? 116.997 37.776 20.825  1.00 25.06  ? 296  ARG B CA  1 
ATOM   6409 C C   . ARG B 1 295 ? 117.657 37.076 22.001  1.00 23.32  ? 296  ARG B C   1 
ATOM   6410 O O   . ARG B 1 295 ? 118.673 37.540 22.527  1.00 24.54  ? 296  ARG B O   1 
ATOM   6411 C CB  . ARG B 1 295 ? 117.703 37.368 19.515  1.00 21.89  ? 296  ARG B CB  1 
ATOM   6412 C CG  . ARG B 1 295 ? 116.974 37.892 18.272  1.00 24.62  ? 296  ARG B CG  1 
ATOM   6413 C CD  . ARG B 1 295 ? 115.638 37.125 18.003  1.00 25.09  ? 296  ARG B CD  1 
ATOM   6414 N NE  . ARG B 1 295 ? 114.995 37.573 16.775  1.00 27.05  ? 296  ARG B NE  1 
ATOM   6415 C CZ  . ARG B 1 295 ? 114.197 38.645 16.692  1.00 28.77  ? 296  ARG B CZ  1 
ATOM   6416 N NH1 . ARG B 1 295 ? 113.923 39.378 17.757  1.00 19.50  ? 296  ARG B NH1 1 
ATOM   6417 N NH2 . ARG B 1 295 ? 113.673 38.985 15.521  1.00 28.16  ? 296  ARG B NH2 1 
ATOM   6418 N N   . PHE B 1 296 ? 117.081 35.940 22.390  1.00 23.81  ? 297  PHE B N   1 
ATOM   6419 C CA  . PHE B 1 296 ? 117.503 35.195 23.566  1.00 23.11  ? 297  PHE B CA  1 
ATOM   6420 C C   . PHE B 1 296 ? 117.661 33.729 23.205  1.00 26.65  ? 297  PHE B C   1 
ATOM   6421 O O   . PHE B 1 296 ? 116.913 33.200 22.375  1.00 25.31  ? 297  PHE B O   1 
ATOM   6422 C CB  . PHE B 1 296 ? 116.491 35.393 24.689  1.00 21.97  ? 297  PHE B CB  1 
ATOM   6423 C CG  . PHE B 1 296 ? 115.850 36.736 24.641  1.00 19.94  ? 297  PHE B CG  1 
ATOM   6424 C CD1 . PHE B 1 296 ? 116.580 37.871 24.976  1.00 24.22  ? 297  PHE B CD1 1 
ATOM   6425 C CD2 . PHE B 1 296 ? 114.554 36.880 24.204  1.00 16.93  ? 297  PHE B CD2 1 
ATOM   6426 C CE1 . PHE B 1 296 ? 116.010 39.146 24.890  1.00 20.13  ? 297  PHE B CE1 1 
ATOM   6427 C CE2 . PHE B 1 296 ? 113.968 38.143 24.122  1.00 24.29  ? 297  PHE B CE2 1 
ATOM   6428 C CZ  . PHE B 1 296 ? 114.698 39.280 24.465  1.00 23.23  ? 297  PHE B CZ  1 
ATOM   6429 N N   . SER B 1 297 ? 118.638 33.079 23.837  1.00 24.64  ? 298  SER B N   1 
ATOM   6430 C CA  . SER B 1 297 ? 119.121 31.796 23.334  1.00 29.72  ? 298  SER B CA  1 
ATOM   6431 C C   . SER B 1 297 ? 118.121 30.673 23.584  1.00 26.97  ? 298  SER B C   1 
ATOM   6432 O O   . SER B 1 297 ? 117.829 29.879 22.681  1.00 24.00  ? 298  SER B O   1 
ATOM   6433 C CB  . SER B 1 297 ? 120.468 31.472 23.970  1.00 28.30  ? 298  SER B CB  1 
ATOM   6434 O OG  . SER B 1 297 ? 121.459 32.345 23.457  1.00 29.18  ? 298  SER B OG  1 
ATOM   6435 N N   . PHE B 1 298 ? 117.589 30.588 24.800  1.00 20.90  ? 299  PHE B N   1 
ATOM   6436 C CA  . PHE B 1 298 ? 116.774 29.451 25.218  1.00 21.99  ? 299  PHE B CA  1 
ATOM   6437 C C   . PHE B 1 298 ? 115.384 29.945 25.581  1.00 22.50  ? 299  PHE B C   1 
ATOM   6438 O O   . PHE B 1 298 ? 115.175 30.500 26.664  1.00 21.77  ? 299  PHE B O   1 
ATOM   6439 C CB  . PHE B 1 298 ? 117.450 28.709 26.367  1.00 20.00  ? 299  PHE B CB  1 
ATOM   6440 C CG  . PHE B 1 298 ? 118.775 28.150 25.975  1.00 24.65  ? 299  PHE B CG  1 
ATOM   6441 C CD1 . PHE B 1 298 ? 118.838 27.074 25.095  1.00 23.50  ? 299  PHE B CD1 1 
ATOM   6442 C CD2 . PHE B 1 298 ? 119.957 28.716 26.437  1.00 25.82  ? 299  PHE B CD2 1 
ATOM   6443 C CE1 . PHE B 1 298 ? 120.057 26.553 24.686  1.00 22.06  ? 299  PHE B CE1 1 
ATOM   6444 C CE2 . PHE B 1 298 ? 121.192 28.203 26.037  1.00 25.53  ? 299  PHE B CE2 1 
ATOM   6445 C CZ  . PHE B 1 298 ? 121.242 27.118 25.156  1.00 26.47  ? 299  PHE B CZ  1 
ATOM   6446 N N   . VAL B 1 299 ? 114.445 29.731 24.665  1.00 22.45  ? 300  VAL B N   1 
ATOM   6447 C CA  . VAL B 1 299 ? 113.075 30.219 24.795  1.00 19.64  ? 300  VAL B CA  1 
ATOM   6448 C C   . VAL B 1 299 ? 112.134 29.039 24.565  1.00 23.23  ? 300  VAL B C   1 
ATOM   6449 O O   . VAL B 1 299 ? 112.601 27.947 24.211  1.00 22.97  ? 300  VAL B O   1 
ATOM   6450 C CB  . VAL B 1 299 ? 112.814 31.371 23.810  1.00 20.29  ? 300  VAL B CB  1 
ATOM   6451 C CG1 . VAL B 1 299 ? 113.783 32.508 24.075  1.00 16.23  ? 300  VAL B CG1 1 
ATOM   6452 C CG2 . VAL B 1 299 ? 112.930 30.878 22.366  1.00 16.64  ? 300  VAL B CG2 1 
ATOM   6453 N N   . PRO B 1 300 ? 110.826 29.188 24.777  1.00 22.96  ? 301  PRO B N   1 
ATOM   6454 C CA  . PRO B 1 300 ? 109.906 28.080 24.494  1.00 21.17  ? 301  PRO B CA  1 
ATOM   6455 C C   . PRO B 1 300 ? 110.068 27.510 23.088  1.00 24.74  ? 301  PRO B C   1 
ATOM   6456 O O   . PRO B 1 300 ? 110.277 28.234 22.111  1.00 23.04  ? 301  PRO B O   1 
ATOM   6457 C CB  . PRO B 1 300 ? 108.530 28.718 24.687  1.00 21.56  ? 301  PRO B CB  1 
ATOM   6458 C CG  . PRO B 1 300 ? 108.772 29.702 25.802  1.00 23.37  ? 301  PRO B CG  1 
ATOM   6459 C CD  . PRO B 1 300 ? 110.159 30.264 25.541  1.00 18.35  ? 301  PRO B CD  1 
ATOM   6460 N N   . VAL B 1 301 ? 109.985 26.190 22.995  1.00 23.55  ? 302  VAL B N   1 
ATOM   6461 C CA  . VAL B 1 301 ? 110.128 25.479 21.733  1.00 29.39  ? 302  VAL B CA  1 
ATOM   6462 C C   . VAL B 1 301 ? 108.754 24.978 21.302  1.00 29.68  ? 302  VAL B C   1 
ATOM   6463 O O   . VAL B 1 301 ? 107.960 24.516 22.131  1.00 25.62  ? 302  VAL B O   1 
ATOM   6464 C CB  . VAL B 1 301 ? 111.142 24.321 21.846  1.00 26.55  ? 302  VAL B CB  1 
ATOM   6465 C CG1 . VAL B 1 301 ? 110.691 23.289 22.869  1.00 24.69  ? 302  VAL B CG1 1 
ATOM   6466 C CG2 . VAL B 1 301 ? 111.370 23.666 20.480  1.00 30.60  ? 302  VAL B CG2 1 
ATOM   6467 N N   . VAL B 1 302 ? 108.468 25.102 20.008  1.00 24.87  ? 303  VAL B N   1 
ATOM   6468 C CA  . VAL B 1 302 ? 107.234 24.590 19.416  1.00 25.52  ? 303  VAL B CA  1 
ATOM   6469 C C   . VAL B 1 302 ? 107.512 23.159 18.968  1.00 30.72  ? 303  VAL B C   1 
ATOM   6470 O O   . VAL B 1 302 ? 108.096 22.928 17.909  1.00 35.87  ? 303  VAL B O   1 
ATOM   6471 C CB  . VAL B 1 302 ? 106.760 25.458 18.247  1.00 27.15  ? 303  VAL B CB  1 
ATOM   6472 C CG1 . VAL B 1 302 ? 105.496 24.872 17.641  1.00 28.47  ? 303  VAL B CG1 1 
ATOM   6473 C CG2 . VAL B 1 302 ? 106.521 26.893 18.704  1.00 25.41  ? 303  VAL B CG2 1 
ATOM   6474 N N   . ASP B 1 303 ? 107.078 22.186 19.766  1.00 31.37  ? 304  ASP B N   1 
ATOM   6475 C CA  . ASP B 1 303 ? 107.359 20.790 19.457  1.00 34.05  ? 304  ASP B CA  1 
ATOM   6476 C C   . ASP B 1 303 ? 106.112 19.915 19.472  1.00 35.02  ? 304  ASP B C   1 
ATOM   6477 O O   . ASP B 1 303 ? 106.237 18.685 19.495  1.00 37.09  ? 304  ASP B O   1 
ATOM   6478 C CB  . ASP B 1 303 ? 108.402 20.228 20.432  1.00 36.01  ? 304  ASP B CB  1 
ATOM   6479 C CG  . ASP B 1 303 ? 107.879 20.119 21.855  1.00 40.23  ? 304  ASP B CG  1 
ATOM   6480 O OD1 . ASP B 1 303 ? 106.814 20.698 22.161  1.00 36.17  ? 304  ASP B OD1 1 
ATOM   6481 O OD2 . ASP B 1 303 ? 108.546 19.451 22.674  1.00 47.13  ? 304  ASP B OD2 1 
ATOM   6482 N N   . GLY B 1 304 ? 104.957 20.527 19.499  1.00 30.59  ? 305  GLY B N   1 
ATOM   6483 C CA  . GLY B 1 304 ? 103.715 19.815 19.528  1.00 33.86  ? 305  GLY B CA  1 
ATOM   6484 C C   . GLY B 1 304 ? 103.190 19.361 20.867  1.00 38.82  ? 305  GLY B C   1 
ATOM   6485 O O   . GLY B 1 304 ? 102.132 18.816 20.910  1.00 36.14  ? 305  GLY B O   1 
ATOM   6486 N N   . ASP B 1 305 ? 103.911 19.599 21.963  1.00 30.06  ? 306  ASP B N   1 
ATOM   6487 C CA  . ASP B 1 305 ? 103.419 19.153 23.274  1.00 30.87  ? 306  ASP B CA  1 
ATOM   6488 C C   . ASP B 1 305 ? 102.807 20.317 24.049  1.00 35.93  ? 306  ASP B C   1 
ATOM   6489 O O   . ASP B 1 305 ? 101.593 20.510 23.995  1.00 31.67  ? 306  ASP B O   1 
ATOM   6490 C CB  . ASP B 1 305 ? 104.550 18.517 24.084  1.00 35.43  ? 306  ASP B CB  1 
ATOM   6491 C CG  . ASP B 1 305 ? 104.091 18.035 25.447  1.00 44.36  ? 306  ASP B CG  1 
ATOM   6492 O OD1 . ASP B 1 305 ? 102.891 18.185 25.758  1.00 45.73  ? 306  ASP B OD1 1 
ATOM   6493 O OD2 . ASP B 1 305 ? 104.930 17.507 26.206  1.00 49.66  ? 306  ASP B OD2 1 
ATOM   6494 N N   . PHE B 1 306 ? 103.616 21.113 24.744  1.00 31.44  ? 307  PHE B N   1 
ATOM   6495 C CA  . PHE B 1 306 ? 103.036 22.271 25.421  1.00 28.36  ? 307  PHE B CA  1 
ATOM   6496 C C   . PHE B 1 306 ? 102.276 23.150 24.432  1.00 31.93  ? 307  PHE B C   1 
ATOM   6497 O O   . PHE B 1 306 ? 101.181 23.639 24.732  1.00 31.36  ? 307  PHE B O   1 
ATOM   6498 C CB  . PHE B 1 306 ? 104.127 23.077 26.138  1.00 24.13  ? 307  PHE B CB  1 
ATOM   6499 C CG  . PHE B 1 306 ? 103.589 24.123 27.095  1.00 23.40  ? 307  PHE B CG  1 
ATOM   6500 C CD1 . PHE B 1 306 ? 103.628 23.917 28.471  1.00 18.17  ? 307  PHE B CD1 1 
ATOM   6501 C CD2 . PHE B 1 306 ? 103.046 25.306 26.617  1.00 20.70  ? 307  PHE B CD2 1 
ATOM   6502 C CE1 . PHE B 1 306 ? 103.123 24.877 29.350  1.00 20.88  ? 307  PHE B CE1 1 
ATOM   6503 C CE2 . PHE B 1 306 ? 102.543 26.269 27.487  1.00 21.00  ? 307  PHE B CE2 1 
ATOM   6504 C CZ  . PHE B 1 306 ? 102.582 26.055 28.852  1.00 16.88  ? 307  PHE B CZ  1 
ATOM   6505 N N   . LEU B 1 307 ? 102.840 23.344 23.241  1.00 28.39  ? 308  LEU B N   1 
ATOM   6506 C CA  . LEU B 1 307 ? 102.209 24.085 22.152  1.00 29.70  ? 308  LEU B CA  1 
ATOM   6507 C C   . LEU B 1 307 ? 102.044 23.133 20.974  1.00 33.92  ? 308  LEU B C   1 
ATOM   6508 O O   . LEU B 1 307 ? 103.037 22.690 20.386  1.00 31.60  ? 308  LEU B O   1 
ATOM   6509 C CB  . LEU B 1 307 ? 103.053 25.293 21.750  1.00 29.18  ? 308  LEU B CB  1 
ATOM   6510 C CG  . LEU B 1 307 ? 103.292 26.367 22.809  1.00 37.60  ? 308  LEU B CG  1 
ATOM   6511 C CD1 . LEU B 1 307 ? 104.394 27.316 22.354  1.00 34.73  ? 308  LEU B CD1 1 
ATOM   6512 C CD2 . LEU B 1 307 ? 101.997 27.124 23.091  1.00 31.81  ? 308  LEU B CD2 1 
ATOM   6513 N N   . SER B 1 308 ? 100.795 22.823 20.619  1.00 31.12  ? 309  SER B N   1 
ATOM   6514 C CA  . SER B 1 308 ? 100.564 21.893 19.520  1.00 38.35  ? 309  SER B CA  1 
ATOM   6515 C C   . SER B 1 308 ? 100.870 22.505 18.161  1.00 35.18  ? 309  SER B C   1 
ATOM   6516 O O   . SER B 1 308 ? 100.941 21.772 17.171  1.00 43.40  ? 309  SER B O   1 
ATOM   6517 C CB  . SER B 1 308 ? 99.121  21.387 19.555  1.00 39.71  ? 309  SER B CB  1 
ATOM   6518 O OG  . SER B 1 308 ? 98.208  22.457 19.408  1.00 47.57  ? 309  SER B OG  1 
ATOM   6519 N N   . ASP B 1 309 ? 101.057 23.818 18.095  1.00 34.33  ? 310  ASP B N   1 
ATOM   6520 C CA  . ASP B 1 309 ? 101.365 24.521 16.857  1.00 29.17  ? 310  ASP B CA  1 
ATOM   6521 C C   . ASP B 1 309 ? 102.003 25.845 17.253  1.00 29.60  ? 310  ASP B C   1 
ATOM   6522 O O   . ASP B 1 309 ? 102.147 26.145 18.441  1.00 30.59  ? 310  ASP B O   1 
ATOM   6523 C CB  . ASP B 1 309 ? 100.104 24.711 16.008  1.00 30.25  ? 310  ASP B CB  1 
ATOM   6524 C CG  . ASP B 1 309 ? 100.403 24.796 14.515  1.00 47.70  ? 310  ASP B CG  1 
ATOM   6525 O OD1 . ASP B 1 309 ? 101.520 25.222 14.146  1.00 50.61  ? 310  ASP B OD1 1 
ATOM   6526 O OD2 . ASP B 1 309 ? 99.512  24.437 13.712  1.00 48.74  ? 310  ASP B OD2 1 
ATOM   6527 N N   . THR B 1 310 ? 102.399 26.638 16.260  1.00 28.86  ? 311  THR B N   1 
ATOM   6528 C CA  . THR B 1 310 ? 102.951 27.948 16.573  1.00 29.11  ? 311  THR B CA  1 
ATOM   6529 C C   . THR B 1 310 ? 101.891 28.792 17.281  1.00 30.75  ? 311  THR B C   1 
ATOM   6530 O O   . THR B 1 310 ? 100.693 28.637 17.025  1.00 30.64  ? 311  THR B O   1 
ATOM   6531 C CB  . THR B 1 310 ? 103.424 28.669 15.310  1.00 34.91  ? 311  THR B CB  1 
ATOM   6532 O OG1 . THR B 1 310 ? 102.292 29.057 14.526  1.00 38.39  ? 311  THR B OG1 1 
ATOM   6533 C CG2 . THR B 1 310 ? 104.323 27.765 14.474  1.00 33.48  ? 311  THR B CG2 1 
ATOM   6534 N N   . PRO B 1 311 ? 102.299 29.680 18.195  1.00 30.74  ? 312  PRO B N   1 
ATOM   6535 C CA  . PRO B 1 311 ? 101.313 30.586 18.803  1.00 26.76  ? 312  PRO B CA  1 
ATOM   6536 C C   . PRO B 1 311 ? 100.509 31.348 17.766  1.00 31.75  ? 312  PRO B C   1 
ATOM   6537 O O   . PRO B 1 311 ? 99.296  31.515 17.932  1.00 30.77  ? 312  PRO B O   1 
ATOM   6538 C CB  . PRO B 1 311 ? 102.177 31.518 19.663  1.00 24.60  ? 312  PRO B CB  1 
ATOM   6539 C CG  . PRO B 1 311 ? 103.379 30.682 20.007  1.00 27.37  ? 312  PRO B CG  1 
ATOM   6540 C CD  . PRO B 1 311 ? 103.647 29.864 18.766  1.00 25.58  ? 312  PRO B CD  1 
ATOM   6541 N N   . GLU B 1 312 ? 101.169 31.770 16.692  1.00 33.02  ? 313  GLU B N   1 
ATOM   6542 C CA  . GLU B 1 312 ? 100.498 32.485 15.616  1.00 38.61  ? 313  GLU B CA  1 
ATOM   6543 C C   . GLU B 1 312 ? 99.351  31.639 15.067  1.00 36.51  ? 313  GLU B C   1 
ATOM   6544 O O   . GLU B 1 312 ? 98.218  32.110 14.965  1.00 37.77  ? 313  GLU B O   1 
ATOM   6545 C CB  . GLU B 1 312 ? 101.485 32.826 14.499  1.00 47.95  ? 313  GLU B CB  1 
ATOM   6546 C CG  . GLU B 1 312 ? 101.291 34.209 13.899  1.00 67.26  ? 313  GLU B CG  1 
ATOM   6547 C CD  . GLU B 1 312 ? 101.520 34.232 12.401  1.00 82.97  ? 313  GLU B CD  1 
ATOM   6548 O OE1 . GLU B 1 312 ? 100.596 34.632 11.662  1.00 87.80  ? 313  GLU B OE1 1 
ATOM   6549 O OE2 . GLU B 1 312 ? 102.625 33.850 11.961  1.00 89.64  ? 313  GLU B OE2 1 
ATOM   6550 N N   . ALA B 1 313 ? 99.647  30.389 14.717  1.00 34.24  ? 314  ALA B N   1 
ATOM   6551 C CA  . ALA B 1 313 ? 98.626  29.492 14.191  1.00 33.54  ? 314  ALA B CA  1 
ATOM   6552 C C   . ALA B 1 313 ? 97.528  29.250 15.217  1.00 40.34  ? 314  ALA B C   1 
ATOM   6553 O O   . ALA B 1 313 ? 96.338  29.241 14.875  1.00 40.24  ? 314  ALA B O   1 
ATOM   6554 C CB  . ALA B 1 313 ? 99.257  28.169 13.761  1.00 26.76  ? 314  ALA B CB  1 
ATOM   6555 N N   . LEU B 1 314 ? 97.908  29.050 16.483  1.00 36.10  ? 315  LEU B N   1 
ATOM   6556 C CA  . LEU B 1 314 ? 96.915  28.814 17.525  1.00 34.70  ? 315  LEU B CA  1 
ATOM   6557 C C   . LEU B 1 314 ? 96.069  30.052 17.786  1.00 35.48  ? 315  LEU B C   1 
ATOM   6558 O O   . LEU B 1 314 ? 94.906  29.925 18.179  1.00 43.97  ? 315  LEU B O   1 
ATOM   6559 C CB  . LEU B 1 314 ? 97.596  28.363 18.816  1.00 32.97  ? 315  LEU B CB  1 
ATOM   6560 C CG  . LEU B 1 314 ? 98.291  27.001 18.790  1.00 37.09  ? 315  LEU B CG  1 
ATOM   6561 C CD1 . LEU B 1 314 ? 99.001  26.750 20.111  1.00 32.72  ? 315  LEU B CD1 1 
ATOM   6562 C CD2 . LEU B 1 314 ? 97.287  25.898 18.490  1.00 35.94  ? 315  LEU B CD2 1 
ATOM   6563 N N   . ILE B 1 315 ? 96.635  31.249 17.597  1.00 30.60  ? 316  ILE B N   1 
ATOM   6564 C CA  . ILE B 1 315 ? 95.873  32.486 17.739  1.00 33.06  ? 316  ILE B CA  1 
ATOM   6565 C C   . ILE B 1 315 ? 94.886  32.655 16.590  1.00 45.83  ? 316  ILE B C   1 
ATOM   6566 O O   . ILE B 1 315 ? 93.829  33.276 16.765  1.00 45.36  ? 316  ILE B O   1 
ATOM   6567 C CB  . ILE B 1 315 ? 96.833  33.687 17.840  1.00 30.61  ? 316  ILE B CB  1 
ATOM   6568 C CG1 . ILE B 1 315 ? 97.562  33.681 19.184  1.00 28.83  ? 316  ILE B CG1 1 
ATOM   6569 C CG2 . ILE B 1 315 ? 96.099  35.004 17.698  1.00 29.26  ? 316  ILE B CG2 1 
ATOM   6570 C CD1 . ILE B 1 315 ? 98.767  34.594 19.201  1.00 28.93  ? 316  ILE B CD1 1 
ATOM   6571 N N   . ASN B 1 316 ? 95.149  32.024 15.443  1.00 44.14  ? 317  ASN B N   1 
ATOM   6572 C CA  . ASN B 1 316 ? 94.241  32.130 14.307  1.00 42.35  ? 317  ASN B CA  1 
ATOM   6573 C C   . ASN B 1 316 ? 93.115  31.103 14.353  1.00 37.88  ? 317  ASN B C   1 
ATOM   6574 O O   . ASN B 1 316 ? 92.017  31.380 13.862  1.00 46.72  ? 317  ASN B O   1 
ATOM   6575 C CB  . ASN B 1 316 ? 95.019  31.986 12.997  1.00 44.79  ? 317  ASN B CB  1 
ATOM   6576 C CG  . ASN B 1 316 ? 95.912  33.175 12.719  1.00 47.79  ? 317  ASN B CG  1 
ATOM   6577 O OD1 . ASN B 1 316 ? 95.735  34.246 13.298  1.00 53.03  ? 317  ASN B OD1 1 
ATOM   6578 N ND2 . ASN B 1 316 ? 96.883  32.991 11.836  1.00 49.39  ? 317  ASN B ND2 1 
ATOM   6579 N N   . ALA B 1 317 ? 93.348  29.932 14.943  1.00 34.38  ? 318  ALA B N   1 
ATOM   6580 C CA  . ALA B 1 317 ? 92.382  28.840 14.920  1.00 38.37  ? 318  ALA B CA  1 
ATOM   6581 C C   . ALA B 1 317 ? 91.443  28.821 16.121  1.00 46.54  ? 318  ALA B C   1 
ATOM   6582 O O   . ALA B 1 317 ? 90.487  28.038 16.128  1.00 52.76  ? 318  ALA B O   1 
ATOM   6583 C CB  . ALA B 1 317 ? 93.114  27.495 14.848  1.00 40.66  ? 318  ALA B CB  1 
ATOM   6584 N N   . GLY B 1 318 ? 91.680  29.650 17.125  1.00 53.48  ? 319  GLY B N   1 
ATOM   6585 C CA  . GLY B 1 318 ? 91.020  29.496 18.402  1.00 45.66  ? 319  GLY B CA  1 
ATOM   6586 C C   . GLY B 1 318 ? 89.686  30.208 18.484  1.00 42.03  ? 319  GLY B C   1 
ATOM   6587 O O   . GLY B 1 318 ? 89.445  31.225 17.833  1.00 36.85  ? 319  GLY B O   1 
ATOM   6588 N N   . ASP B 1 319 ? 88.812  29.626 19.288  1.00 37.80  ? 320  ASP B N   1 
ATOM   6589 C CA  . ASP B 1 319 ? 87.566  30.248 19.698  1.00 38.66  ? 320  ASP B CA  1 
ATOM   6590 C C   . ASP B 1 319 ? 87.831  30.883 21.056  1.00 31.93  ? 320  ASP B C   1 
ATOM   6591 O O   . ASP B 1 319 ? 88.091  30.180 22.036  1.00 30.77  ? 320  ASP B O   1 
ATOM   6592 C CB  . ASP B 1 319 ? 86.450  29.205 19.753  1.00 41.19  ? 320  ASP B CB  1 
ATOM   6593 C CG  . ASP B 1 319 ? 85.136  29.766 20.264  1.00 47.40  ? 320  ASP B CG  1 
ATOM   6594 O OD1 . ASP B 1 319 ? 84.170  28.978 20.370  1.00 46.15  ? 320  ASP B OD1 1 
ATOM   6595 O OD2 . ASP B 1 319 ? 85.065  30.979 20.568  1.00 46.72  ? 320  ASP B OD2 1 
ATOM   6596 N N   . PHE B 1 320 ? 87.786  32.212 21.116  1.00 29.52  ? 321  PHE B N   1 
ATOM   6597 C CA  . PHE B 1 320 ? 88.118  32.907 22.350  1.00 30.86  ? 321  PHE B CA  1 
ATOM   6598 C C   . PHE B 1 320 ? 86.912  33.581 22.992  1.00 31.25  ? 321  PHE B C   1 
ATOM   6599 O O   . PHE B 1 320 ? 87.084  34.478 23.822  1.00 29.67  ? 321  PHE B O   1 
ATOM   6600 C CB  . PHE B 1 320 ? 89.244  33.909 22.098  1.00 29.87  ? 321  PHE B CB  1 
ATOM   6601 C CG  . PHE B 1 320 ? 90.531  33.257 21.683  1.00 30.53  ? 321  PHE B CG  1 
ATOM   6602 C CD1 . PHE B 1 320 ? 91.374  32.698 22.631  1.00 30.27  ? 321  PHE B CD1 1 
ATOM   6603 C CD2 . PHE B 1 320 ? 90.881  33.169 20.344  1.00 29.69  ? 321  PHE B CD2 1 
ATOM   6604 C CE1 . PHE B 1 320 ? 92.552  32.082 22.250  1.00 30.75  ? 321  PHE B CE1 1 
ATOM   6605 C CE2 . PHE B 1 320 ? 92.060  32.558 19.958  1.00 29.09  ? 321  PHE B CE2 1 
ATOM   6606 C CZ  . PHE B 1 320 ? 92.894  32.012 20.906  1.00 28.74  ? 321  PHE B CZ  1 
ATOM   6607 N N   . HIS B 1 321 ? 85.696  33.159 22.634  1.00 28.31  ? 322  HIS B N   1 
ATOM   6608 C CA  . HIS B 1 321 ? 84.517  33.594 23.372  1.00 30.24  ? 322  HIS B CA  1 
ATOM   6609 C C   . HIS B 1 321 ? 84.630  33.194 24.838  1.00 33.44  ? 322  HIS B C   1 
ATOM   6610 O O   . HIS B 1 321 ? 85.040  32.077 25.166  1.00 32.82  ? 322  HIS B O   1 
ATOM   6611 C CB  . HIS B 1 321 ? 83.248  32.992 22.765  1.00 31.12  ? 322  HIS B CB  1 
ATOM   6612 C CG  . HIS B 1 321 ? 82.854  33.613 21.464  1.00 31.27  ? 322  HIS B CG  1 
ATOM   6613 N ND1 . HIS B 1 321 ? 83.297  33.140 20.246  1.00 31.59  ? 322  HIS B ND1 1 
ATOM   6614 C CD2 . HIS B 1 321 ? 82.078  34.687 21.191  1.00 32.21  ? 322  HIS B CD2 1 
ATOM   6615 C CE1 . HIS B 1 321 ? 82.802  33.891 19.280  1.00 35.41  ? 322  HIS B CE1 1 
ATOM   6616 N NE2 . HIS B 1 321 ? 82.059  34.838 19.826  1.00 35.07  ? 322  HIS B NE2 1 
ATOM   6617 N N   . GLY B 1 322 ? 84.260  34.117 25.724  1.00 30.88  ? 323  GLY B N   1 
ATOM   6618 C CA  . GLY B 1 322 ? 84.381  33.900 27.150  1.00 28.63  ? 323  GLY B CA  1 
ATOM   6619 C C   . GLY B 1 322 ? 85.697  34.352 27.745  1.00 34.56  ? 323  GLY B C   1 
ATOM   6620 O O   . GLY B 1 322 ? 85.881  34.243 28.965  1.00 37.27  ? 323  GLY B O   1 
ATOM   6621 N N   . LEU B 1 323 ? 86.618  34.847 26.927  1.00 32.75  ? 324  LEU B N   1 
ATOM   6622 C CA  . LEU B 1 323 ? 87.894  35.358 27.404  1.00 31.98  ? 324  LEU B CA  1 
ATOM   6623 C C   . LEU B 1 323 ? 87.847  36.879 27.489  1.00 27.66  ? 324  LEU B C   1 
ATOM   6624 O O   . LEU B 1 323 ? 87.312  37.545 26.594  1.00 29.51  ? 324  LEU B O   1 
ATOM   6625 C CB  . LEU B 1 323 ? 89.031  34.919 26.475  1.00 32.28  ? 324  LEU B CB  1 
ATOM   6626 C CG  . LEU B 1 323 ? 90.460  35.321 26.842  1.00 34.70  ? 324  LEU B CG  1 
ATOM   6627 C CD1 . LEU B 1 323 ? 90.861  34.720 28.185  1.00 30.22  ? 324  LEU B CD1 1 
ATOM   6628 C CD2 . LEU B 1 323 ? 91.422  34.892 25.745  1.00 33.07  ? 324  LEU B CD2 1 
ATOM   6629 N N   . GLN B 1 324 ? 88.386  37.420 28.577  1.00 23.57  ? 325  GLN B N   1 
ATOM   6630 C CA  . GLN B 1 324 ? 88.710  38.837 28.680  1.00 27.91  ? 325  GLN B CA  1 
ATOM   6631 C C   . GLN B 1 324 ? 90.217  38.971 28.829  1.00 28.55  ? 325  GLN B C   1 
ATOM   6632 O O   . GLN B 1 324 ? 90.823  38.274 29.648  1.00 22.78  ? 325  GLN B O   1 
ATOM   6633 C CB  . GLN B 1 324 ? 88.010  39.506 29.867  1.00 30.21  ? 325  GLN B CB  1 
ATOM   6634 C CG  . GLN B 1 324 ? 86.493  39.520 29.773  1.00 36.84  ? 325  GLN B CG  1 
ATOM   6635 C CD  . GLN B 1 324 ? 85.879  38.270 30.364  1.00 45.56  ? 325  GLN B CD  1 
ATOM   6636 O OE1 . GLN B 1 324 ? 86.267  37.826 31.446  1.00 49.76  ? 325  GLN B OE1 1 
ATOM   6637 N NE2 . GLN B 1 324 ? 84.928  37.686 29.649  1.00 49.34  ? 325  GLN B NE2 1 
ATOM   6638 N N   . VAL B 1 325 ? 90.820  39.854 28.040  1.00 26.88  ? 326  VAL B N   1 
ATOM   6639 C CA  . VAL B 1 325 ? 92.252  40.098 28.115  1.00 27.78  ? 326  VAL B CA  1 
ATOM   6640 C C   . VAL B 1 325 ? 92.506  41.594 28.148  1.00 28.16  ? 326  VAL B C   1 
ATOM   6641 O O   . VAL B 1 325 ? 91.793  42.376 27.509  1.00 24.31  ? 326  VAL B O   1 
ATOM   6642 C CB  . VAL B 1 325 ? 93.028  39.448 26.947  1.00 31.85  ? 326  VAL B CB  1 
ATOM   6643 C CG1 . VAL B 1 325 ? 93.129  37.952 27.154  1.00 42.10  ? 326  VAL B CG1 1 
ATOM   6644 C CG2 . VAL B 1 325 ? 92.357  39.761 25.618  1.00 35.13  ? 326  VAL B CG2 1 
ATOM   6645 N N   . LEU B 1 326 ? 93.522  41.982 28.909  1.00 23.61  ? 327  LEU B N   1 
ATOM   6646 C CA  . LEU B 1 326 ? 94.038  43.338 28.948  1.00 23.75  ? 327  LEU B CA  1 
ATOM   6647 C C   . LEU B 1 326 ? 95.445  43.311 28.370  1.00 20.25  ? 327  LEU B C   1 
ATOM   6648 O O   . LEU B 1 326 ? 96.282  42.521 28.815  1.00 23.39  ? 327  LEU B O   1 
ATOM   6649 C CB  . LEU B 1 326 ? 94.036  43.871 30.385  1.00 26.01  ? 327  LEU B CB  1 
ATOM   6650 C CG  . LEU B 1 326 ? 94.663  45.241 30.664  1.00 32.06  ? 327  LEU B CG  1 
ATOM   6651 C CD1 . LEU B 1 326 ? 93.933  46.299 29.884  1.00 34.30  ? 327  LEU B CD1 1 
ATOM   6652 C CD2 . LEU B 1 326 ? 94.605  45.546 32.151  1.00 31.64  ? 327  LEU B CD2 1 
ATOM   6653 N N   . VAL B 1 327 ? 95.697  44.134 27.352  1.00 21.01  ? 328  VAL B N   1 
ATOM   6654 C CA  . VAL B 1 327 ? 96.990  44.139 26.676  1.00 21.20  ? 328  VAL B CA  1 
ATOM   6655 C C   . VAL B 1 327 ? 97.442  45.575 26.469  1.00 22.86  ? 328  VAL B C   1 
ATOM   6656 O O   . VAL B 1 327 ? 96.628  46.499 26.382  1.00 22.97  ? 328  VAL B O   1 
ATOM   6657 C CB  . VAL B 1 327 ? 96.958  43.390 25.322  1.00 22.33  ? 328  VAL B CB  1 
ATOM   6658 C CG1 . VAL B 1 327 ? 96.365  41.997 25.484  1.00 21.77  ? 328  VAL B CG1 1 
ATOM   6659 C CG2 . VAL B 1 327 ? 96.181  44.189 24.282  1.00 18.28  ? 328  VAL B CG2 1 
ATOM   6660 N N   . GLY B 1 328 ? 98.751  45.763 26.381  1.00 19.95  ? 329  GLY B N   1 
ATOM   6661 C CA  . GLY B 1 328 ? 99.235  47.102 26.113  1.00 20.91  ? 329  GLY B CA  1 
ATOM   6662 C C   . GLY B 1 328 ? 100.735 47.130 25.943  1.00 22.95  ? 329  GLY B C   1 
ATOM   6663 O O   . GLY B 1 328 ? 101.424 46.116 26.075  1.00 22.00  ? 329  GLY B O   1 
ATOM   6664 N N   . VAL B 1 329 ? 101.228 48.331 25.641  1.00 19.41  ? 330  VAL B N   1 
ATOM   6665 C CA  . VAL B 1 329 ? 102.636 48.579 25.373  1.00 19.89  ? 330  VAL B CA  1 
ATOM   6666 C C   . VAL B 1 329 ? 102.994 49.921 25.994  1.00 21.91  ? 330  VAL B C   1 
ATOM   6667 O O   . VAL B 1 329 ? 102.121 50.716 26.347  1.00 25.32  ? 330  VAL B O   1 
ATOM   6668 C CB  . VAL B 1 329 ? 102.943 48.593 23.856  1.00 21.37  ? 330  VAL B CB  1 
ATOM   6669 C CG1 . VAL B 1 329 ? 102.610 47.245 23.222  1.00 19.54  ? 330  VAL B CG1 1 
ATOM   6670 C CG2 . VAL B 1 329 ? 102.151 49.700 23.176  1.00 17.74  ? 330  VAL B CG2 1 
ATOM   6671 N N   . VAL B 1 330 ? 104.297 50.173 26.129  1.00 23.57  ? 331  VAL B N   1 
ATOM   6672 C CA  . VAL B 1 330 ? 104.751 51.508 26.508  1.00 26.61  ? 331  VAL B CA  1 
ATOM   6673 C C   . VAL B 1 330 ? 104.966 52.320 25.237  1.00 26.68  ? 331  VAL B C   1 
ATOM   6674 O O   . VAL B 1 330 ? 104.967 51.775 24.124  1.00 25.93  ? 331  VAL B O   1 
ATOM   6675 C CB  . VAL B 1 330 ? 106.031 51.474 27.364  1.00 27.14  ? 331  VAL B CB  1 
ATOM   6676 C CG1 . VAL B 1 330 ? 105.796 50.702 28.671  1.00 22.46  ? 331  VAL B CG1 1 
ATOM   6677 C CG2 . VAL B 1 330 ? 107.197 50.883 26.569  1.00 18.45  ? 331  VAL B CG2 1 
ATOM   6678 N N   . LYS B 1 331 ? 105.170 53.627 25.398  1.00 27.03  ? 332  LYS B N   1 
ATOM   6679 C CA  . LYS B 1 331 ? 105.267 54.516 24.244  1.00 27.13  ? 332  LYS B CA  1 
ATOM   6680 C C   . LYS B 1 331 ? 106.502 54.228 23.395  1.00 27.21  ? 332  LYS B C   1 
ATOM   6681 O O   . LYS B 1 331 ? 106.470 54.442 22.182  1.00 28.47  ? 332  LYS B O   1 
ATOM   6682 C CB  . LYS B 1 331 ? 105.268 55.971 24.719  1.00 29.62  ? 332  LYS B CB  1 
ATOM   6683 C CG  . LYS B 1 331 ? 105.038 57.027 23.629  1.00 26.71  ? 332  LYS B CG  1 
ATOM   6684 C CD  . LYS B 1 331 ? 105.019 58.423 24.256  1.00 38.36  ? 332  LYS B CD  1 
ATOM   6685 C CE  . LYS B 1 331 ? 104.651 59.509 23.256  1.00 41.99  ? 332  LYS B CE  1 
ATOM   6686 N NZ  . LYS B 1 331 ? 105.727 59.749 22.257  1.00 52.44  ? 332  LYS B NZ  1 
ATOM   6687 N N   . ASP B 1 332 ? 107.594 53.738 24.001  1.00 27.03  ? 333  ASP B N   1 
ATOM   6688 C CA  . ASP B 1 332 ? 108.880 53.592 23.310  1.00 29.26  ? 333  ASP B CA  1 
ATOM   6689 C C   . ASP B 1 332 ? 109.472 52.207 23.597  1.00 29.80  ? 333  ASP B C   1 
ATOM   6690 O O   . ASP B 1 332 ? 110.477 52.077 24.298  1.00 33.28  ? 333  ASP B O   1 
ATOM   6691 C CB  . ASP B 1 332 ? 109.844 54.709 23.728  1.00 27.29  ? 333  ASP B CB  1 
ATOM   6692 C CG  . ASP B 1 332 ? 109.283 56.092 23.448  1.00 33.37  ? 333  ASP B CG  1 
ATOM   6693 O OD1 . ASP B 1 332 ? 109.292 56.502 22.268  1.00 37.58  ? 333  ASP B OD1 1 
ATOM   6694 O OD2 . ASP B 1 332 ? 108.835 56.769 24.404  1.00 34.51  ? 333  ASP B OD2 1 
ATOM   6695 N N   . GLU B 1 333 ? 108.863 51.174 23.008  1.00 28.33  ? 334  GLU B N   1 
ATOM   6696 C CA  . GLU B 1 333 ? 109.241 49.801 23.335  1.00 27.18  ? 334  GLU B CA  1 
ATOM   6697 C C   . GLU B 1 333 ? 110.683 49.491 22.943  1.00 27.64  ? 334  GLU B C   1 
ATOM   6698 O O   . GLU B 1 333 ? 111.382 48.763 23.658  1.00 28.49  ? 334  GLU B O   1 
ATOM   6699 C CB  . GLU B 1 333 ? 108.276 48.818 22.665  1.00 25.88  ? 334  GLU B CB  1 
ATOM   6700 C CG  . GLU B 1 333 ? 106.890 48.760 23.309  1.00 27.31  ? 334  GLU B CG  1 
ATOM   6701 C CD  . GLU B 1 333 ? 106.878 47.978 24.625  1.00 32.97  ? 334  GLU B CD  1 
ATOM   6702 O OE1 . GLU B 1 333 ? 105.849 48.024 25.343  1.00 32.06  ? 334  GLU B OE1 1 
ATOM   6703 O OE2 . GLU B 1 333 ? 107.892 47.309 24.933  1.00 30.83  ? 334  GLU B OE2 1 
ATOM   6704 N N   . GLY B 1 334 ? 111.155 50.041 21.817  1.00 25.78  ? 335  GLY B N   1 
ATOM   6705 C CA  . GLY B 1 334 ? 112.434 49.609 21.270  1.00 20.21  ? 335  GLY B CA  1 
ATOM   6706 C C   . GLY B 1 334 ? 113.667 50.263 21.868  1.00 24.92  ? 335  GLY B C   1 
ATOM   6707 O O   . GLY B 1 334 ? 114.762 49.704 21.748  1.00 22.80  ? 335  GLY B O   1 
ATOM   6708 N N   . SER B 1 335 ? 113.522 51.420 22.520  1.00 23.60  ? 336  SER B N   1 
ATOM   6709 C CA  . SER B 1 335 ? 114.686 52.263 22.795  1.00 29.40  ? 336  SER B CA  1 
ATOM   6710 C C   . SER B 1 335 ? 115.681 51.578 23.732  1.00 30.63  ? 336  SER B C   1 
ATOM   6711 O O   . SER B 1 335 ? 116.894 51.614 23.500  1.00 34.41  ? 336  SER B O   1 
ATOM   6712 C CB  . SER B 1 335 ? 114.236 53.611 23.369  1.00 31.27  ? 336  SER B CB  1 
ATOM   6713 O OG  . SER B 1 335 ? 113.540 53.452 24.596  1.00 33.50  ? 336  SER B OG  1 
ATOM   6714 N N   . TYR B 1 336 ? 115.185 50.951 24.800  1.00 30.75  ? 337  TYR B N   1 
ATOM   6715 C CA  . TYR B 1 336 ? 116.063 50.277 25.757  1.00 40.52  ? 337  TYR B CA  1 
ATOM   6716 C C   . TYR B 1 336 ? 116.913 49.205 25.077  1.00 38.40  ? 337  TYR B C   1 
ATOM   6717 O O   . TYR B 1 336 ? 118.110 49.075 25.363  1.00 36.47  ? 337  TYR B O   1 
ATOM   6718 C CB  . TYR B 1 336 ? 115.206 49.697 26.893  1.00 40.98  ? 337  TYR B CB  1 
ATOM   6719 C CG  . TYR B 1 336 ? 115.794 48.586 27.744  1.00 41.27  ? 337  TYR B CG  1 
ATOM   6720 C CD1 . TYR B 1 336 ? 115.528 47.253 27.457  1.00 42.63  ? 337  TYR B CD1 1 
ATOM   6721 C CD2 . TYR B 1 336 ? 116.556 48.868 28.868  1.00 53.17  ? 337  TYR B CD2 1 
ATOM   6722 C CE1 . TYR B 1 336 ? 116.030 46.232 28.240  1.00 46.81  ? 337  TYR B CE1 1 
ATOM   6723 C CE2 . TYR B 1 336 ? 117.067 47.850 29.664  1.00 56.22  ? 337  TYR B CE2 1 
ATOM   6724 C CZ  . TYR B 1 336 ? 116.801 46.532 29.341  1.00 57.54  ? 337  TYR B CZ  1 
ATOM   6725 O OH  . TYR B 1 336 ? 117.302 45.509 30.120  1.00 57.80  ? 337  TYR B OH  1 
ATOM   6726 N N   . PHE B 1 337 ? 116.326 48.454 24.144  1.00 28.80  ? 338  PHE B N   1 
ATOM   6727 C CA  . PHE B 1 337 ? 117.050 47.346 23.532  1.00 29.20  ? 338  PHE B CA  1 
ATOM   6728 C C   . PHE B 1 337 ? 118.187 47.800 22.620  1.00 29.63  ? 338  PHE B C   1 
ATOM   6729 O O   . PHE B 1 337 ? 119.116 47.023 22.384  1.00 28.61  ? 338  PHE B O   1 
ATOM   6730 C CB  . PHE B 1 337 ? 116.059 46.455 22.783  1.00 25.33  ? 338  PHE B CB  1 
ATOM   6731 C CG  . PHE B 1 337 ? 115.038 45.831 23.689  1.00 26.78  ? 338  PHE B CG  1 
ATOM   6732 C CD1 . PHE B 1 337 ? 113.828 46.463 23.936  1.00 23.40  ? 338  PHE B CD1 1 
ATOM   6733 C CD2 . PHE B 1 337 ? 115.317 44.639 24.347  1.00 28.03  ? 338  PHE B CD2 1 
ATOM   6734 C CE1 . PHE B 1 337 ? 112.892 45.901 24.809  1.00 27.11  ? 338  PHE B CE1 1 
ATOM   6735 C CE2 . PHE B 1 337 ? 114.389 44.066 25.214  1.00 27.33  ? 338  PHE B CE2 1 
ATOM   6736 C CZ  . PHE B 1 337 ? 113.174 44.701 25.445  1.00 23.00  ? 338  PHE B CZ  1 
ATOM   6737 N N   . LEU B 1 338 ? 118.168 49.047 22.142  1.00 28.14  ? 339  LEU B N   1 
ATOM   6738 C CA  . LEU B 1 338 ? 119.146 49.455 21.140  1.00 30.46  ? 339  LEU B CA  1 
ATOM   6739 C C   . LEU B 1 338 ? 120.558 49.580 21.709  1.00 30.92  ? 339  LEU B C   1 
ATOM   6740 O O   . LEU B 1 338 ? 121.533 49.415 20.969  1.00 29.16  ? 339  LEU B O   1 
ATOM   6741 C CB  . LEU B 1 338 ? 118.714 50.771 20.495  1.00 27.98  ? 339  LEU B CB  1 
ATOM   6742 C CG  . LEU B 1 338 ? 117.409 50.664 19.706  1.00 32.06  ? 339  LEU B CG  1 
ATOM   6743 C CD1 . LEU B 1 338 ? 116.975 52.021 19.196  1.00 32.95  ? 339  LEU B CD1 1 
ATOM   6744 C CD2 . LEU B 1 338 ? 117.560 49.677 18.559  1.00 28.80  ? 339  LEU B CD2 1 
ATOM   6745 N N   . VAL B 1 339 ? 120.702 49.865 23.004  1.00 33.23  ? 340  VAL B N   1 
ATOM   6746 C CA  . VAL B 1 339 ? 122.029 50.094 23.566  1.00 36.19  ? 340  VAL B CA  1 
ATOM   6747 C C   . VAL B 1 339 ? 122.740 48.769 23.798  1.00 33.82  ? 340  VAL B C   1 
ATOM   6748 O O   . VAL B 1 339 ? 123.898 48.743 24.230  1.00 39.32  ? 340  VAL B O   1 
ATOM   6749 C CB  . VAL B 1 339 ? 121.961 50.910 24.867  1.00 36.95  ? 340  VAL B CB  1 
ATOM   6750 C CG1 . VAL B 1 339 ? 121.361 52.278 24.587  1.00 38.59  ? 340  VAL B CG1 1 
ATOM   6751 C CG2 . VAL B 1 339 ? 121.159 50.163 25.927  1.00 31.62  ? 340  VAL B CG2 1 
ATOM   6752 N N   . TYR B 1 340 ? 122.069 47.661 23.500  1.00 30.47  ? 341  TYR B N   1 
ATOM   6753 C CA  . TYR B 1 340 ? 122.679 46.349 23.654  1.00 35.52  ? 341  TYR B CA  1 
ATOM   6754 C C   . TYR B 1 340 ? 123.261 45.808 22.353  1.00 37.78  ? 341  TYR B C   1 
ATOM   6755 O O   . TYR B 1 340 ? 123.509 44.606 22.255  1.00 41.43  ? 341  TYR B O   1 
ATOM   6756 C CB  . TYR B 1 340 ? 121.671 45.365 24.247  1.00 33.02  ? 341  TYR B CB  1 
ATOM   6757 C CG  . TYR B 1 340 ? 121.467 45.595 25.729  1.00 33.04  ? 341  TYR B CG  1 
ATOM   6758 C CD1 . TYR B 1 340 ? 122.254 44.938 26.672  1.00 31.43  ? 341  TYR B CD1 1 
ATOM   6759 C CD2 . TYR B 1 340 ? 120.519 46.504 26.184  1.00 31.69  ? 341  TYR B CD2 1 
ATOM   6760 C CE1 . TYR B 1 340 ? 122.080 45.161 28.032  1.00 29.73  ? 341  TYR B CE1 1 
ATOM   6761 C CE2 . TYR B 1 340 ? 120.340 46.735 27.537  1.00 36.75  ? 341  TYR B CE2 1 
ATOM   6762 C CZ  . TYR B 1 340 ? 121.123 46.062 28.455  1.00 35.94  ? 341  TYR B CZ  1 
ATOM   6763 O OH  . TYR B 1 340 ? 120.943 46.301 29.794  1.00 37.47  ? 341  TYR B OH  1 
ATOM   6764 N N   . GLY B 1 341 ? 123.509 46.660 21.361  1.00 38.74  ? 342  GLY B N   1 
ATOM   6765 C CA  . GLY B 1 341 ? 124.177 46.166 20.169  1.00 40.13  ? 342  GLY B CA  1 
ATOM   6766 C C   . GLY B 1 341 ? 123.963 46.938 18.883  1.00 35.49  ? 342  GLY B C   1 
ATOM   6767 O O   . GLY B 1 341 ? 124.679 46.709 17.906  1.00 38.08  ? 342  GLY B O   1 
ATOM   6768 N N   . ALA B 1 342 ? 122.985 47.831 18.853  1.00 34.35  ? 343  ALA B N   1 
ATOM   6769 C CA  . ALA B 1 342 ? 122.780 48.662 17.673  1.00 31.97  ? 343  ALA B CA  1 
ATOM   6770 C C   . ALA B 1 342 ? 123.928 49.658 17.543  1.00 35.20  ? 343  ALA B C   1 
ATOM   6771 O O   . ALA B 1 342 ? 124.236 50.372 18.508  1.00 33.61  ? 343  ALA B O   1 
ATOM   6772 C CB  . ALA B 1 342 ? 121.443 49.390 17.753  1.00 32.22  ? 343  ALA B CB  1 
ATOM   6773 N N   . PRO B 1 343 ? 124.591 49.727 16.388  1.00 34.09  ? 344  PRO B N   1 
ATOM   6774 C CA  . PRO B 1 343 ? 125.768 50.599 16.264  1.00 36.33  ? 344  PRO B CA  1 
ATOM   6775 C C   . PRO B 1 343 ? 125.418 52.068 16.472  1.00 40.47  ? 344  PRO B C   1 
ATOM   6776 O O   . PRO B 1 343 ? 124.416 52.573 15.956  1.00 35.80  ? 344  PRO B O   1 
ATOM   6777 C CB  . PRO B 1 343 ? 126.269 50.334 14.836  1.00 32.47  ? 344  PRO B CB  1 
ATOM   6778 C CG  . PRO B 1 343 ? 125.232 49.476 14.175  1.00 36.21  ? 344  PRO B CG  1 
ATOM   6779 C CD  . PRO B 1 343 ? 124.439 48.809 15.253  1.00 27.22  ? 344  PRO B CD  1 
ATOM   6780 N N   . GLY B 1 344 ? 126.255 52.749 17.253  1.00 40.57  ? 345  GLY B N   1 
ATOM   6781 C CA  . GLY B 1 344 ? 126.103 54.162 17.521  1.00 37.32  ? 345  GLY B CA  1 
ATOM   6782 C C   . GLY B 1 344 ? 125.188 54.519 18.674  1.00 38.26  ? 345  GLY B C   1 
ATOM   6783 O O   . GLY B 1 344 ? 125.021 55.711 18.958  1.00 45.32  ? 345  GLY B O   1 
ATOM   6784 N N   . PHE B 1 345 ? 124.586 53.542 19.344  1.00 30.64  ? 346  PHE B N   1 
ATOM   6785 C CA  . PHE B 1 345 ? 123.668 53.830 20.438  1.00 36.76  ? 346  PHE B CA  1 
ATOM   6786 C C   . PHE B 1 345 ? 124.370 53.741 21.787  1.00 43.13  ? 346  PHE B C   1 
ATOM   6787 O O   . PHE B 1 345 ? 125.289 52.940 21.985  1.00 44.13  ? 346  PHE B O   1 
ATOM   6788 C CB  . PHE B 1 345 ? 122.469 52.883 20.415  1.00 29.81  ? 346  PHE B CB  1 
ATOM   6789 C CG  . PHE B 1 345 ? 121.440 53.254 19.393  1.00 37.48  ? 346  PHE B CG  1 
ATOM   6790 C CD1 . PHE B 1 345 ? 120.331 54.008 19.751  1.00 34.80  ? 346  PHE B CD1 1 
ATOM   6791 C CD2 . PHE B 1 345 ? 121.593 52.874 18.064  1.00 30.98  ? 346  PHE B CD2 1 
ATOM   6792 C CE1 . PHE B 1 345 ? 119.386 54.368 18.805  1.00 29.34  ? 346  PHE B CE1 1 
ATOM   6793 C CE2 . PHE B 1 345 ? 120.649 53.224 17.117  1.00 30.90  ? 346  PHE B CE2 1 
ATOM   6794 C CZ  . PHE B 1 345 ? 119.546 53.973 17.485  1.00 31.20  ? 346  PHE B CZ  1 
ATOM   6795 N N   . SER B 1 346 ? 123.927 54.587 22.712  1.00 41.05  ? 347  SER B N   1 
ATOM   6796 C CA  . SER B 1 346 ? 124.433 54.590 24.076  1.00 38.76  ? 347  SER B CA  1 
ATOM   6797 C C   . SER B 1 346 ? 123.463 55.370 24.946  1.00 34.39  ? 347  SER B C   1 
ATOM   6798 O O   . SER B 1 346 ? 122.831 56.323 24.487  1.00 35.61  ? 347  SER B O   1 
ATOM   6799 C CB  . SER B 1 346 ? 125.835 55.208 24.162  1.00 40.49  ? 347  SER B CB  1 
ATOM   6800 O OG  . SER B 1 346 ? 126.269 55.275 25.510  1.00 49.20  ? 347  SER B OG  1 
ATOM   6801 N N   . LYS B 1 347 ? 123.356 54.967 26.212  1.00 33.62  ? 348  LYS B N   1 
ATOM   6802 C CA  . LYS B 1 347 ? 122.541 55.748 27.133  1.00 33.38  ? 348  LYS B CA  1 
ATOM   6803 C C   . LYS B 1 347 ? 123.214 57.058 27.514  1.00 34.81  ? 348  LYS B C   1 
ATOM   6804 O O   . LYS B 1 347 ? 122.544 57.974 28.004  1.00 39.80  ? 348  LYS B O   1 
ATOM   6805 C CB  . LYS B 1 347 ? 122.233 54.940 28.396  1.00 32.28  ? 348  LYS B CB  1 
ATOM   6806 C CG  . LYS B 1 347 ? 123.328 55.000 29.469  1.00 26.68  ? 348  LYS B CG  1 
ATOM   6807 C CD  . LYS B 1 347 ? 122.886 54.297 30.738  1.00 29.23  ? 348  LYS B CD  1 
ATOM   6808 C CE  . LYS B 1 347 ? 123.903 54.460 31.856  1.00 31.09  ? 348  LYS B CE  1 
ATOM   6809 N NZ  . LYS B 1 347 ? 124.024 55.886 32.292  1.00 35.78  ? 348  LYS B NZ  1 
ATOM   6810 N N   . ASP B 1 348 ? 124.520 57.168 27.299  1.00 32.07  ? 349  ASP B N   1 
ATOM   6811 C CA  . ASP B 1 348 ? 125.286 58.311 27.761  1.00 35.57  ? 349  ASP B CA  1 
ATOM   6812 C C   . ASP B 1 348 ? 125.507 59.358 26.683  1.00 39.63  ? 349  ASP B C   1 
ATOM   6813 O O   . ASP B 1 348 ? 126.232 60.326 26.925  1.00 42.65  ? 349  ASP B O   1 
ATOM   6814 C CB  . ASP B 1 348 ? 126.624 57.839 28.332  1.00 34.32  ? 349  ASP B CB  1 
ATOM   6815 C CG  . ASP B 1 348 ? 126.448 57.037 29.602  1.00 40.25  ? 349  ASP B CG  1 
ATOM   6816 O OD1 . ASP B 1 348 ? 125.668 57.476 30.473  1.00 42.17  ? 349  ASP B OD1 1 
ATOM   6817 O OD2 . ASP B 1 348 ? 127.063 55.957 29.716  1.00 42.61  ? 349  ASP B OD2 1 
ATOM   6818 N N   . ASN B 1 349 ? 124.920 59.206 25.498  1.00 38.83  ? 350  ASN B N   1 
ATOM   6819 C CA  . ASN B 1 349 ? 124.832 60.355 24.597  1.00 34.89  ? 350  ASN B CA  1 
ATOM   6820 C C   . ASN B 1 349 ? 123.462 60.394 23.944  1.00 35.54  ? 350  ASN B C   1 
ATOM   6821 O O   . ASN B 1 349 ? 122.533 59.667 24.316  1.00 37.78  ? 350  ASN B O   1 
ATOM   6822 C CB  . ASN B 1 349 ? 125.902 60.401 23.495  1.00 33.56  ? 350  ASN B CB  1 
ATOM   6823 C CG  . ASN B 1 349 ? 125.880 59.164 22.581  1.00 39.65  ? 350  ASN B CG  1 
ATOM   6824 O OD1 . ASN B 1 349 ? 124.817 58.644 22.177  1.00 41.46  ? 350  ASN B OD1 1 
ATOM   6825 N ND2 . ASN B 1 349 ? 127.077 58.719 22.183  1.00 49.14  ? 350  ASN B ND2 1 
ATOM   6826 N N   . GLU B 1 350 ? 123.361 61.247 22.927  1.00 33.65  ? 351  GLU B N   1 
ATOM   6827 C CA  . GLU B 1 350 ? 122.093 61.429 22.249  1.00 42.45  ? 351  GLU B CA  1 
ATOM   6828 C C   . GLU B 1 350 ? 121.807 60.342 21.225  1.00 40.77  ? 351  GLU B C   1 
ATOM   6829 O O   . GLU B 1 350 ? 120.677 60.280 20.732  1.00 38.61  ? 351  GLU B O   1 
ATOM   6830 C CB  . GLU B 1 350 ? 122.039 62.802 21.576  1.00 51.62  ? 351  GLU B CB  1 
ATOM   6831 C CG  . GLU B 1 350 ? 121.843 63.973 22.534  1.00 61.11  ? 351  GLU B CG  1 
ATOM   6832 C CD  . GLU B 1 350 ? 120.558 63.860 23.342  1.00 74.80  ? 351  GLU B CD  1 
ATOM   6833 O OE1 . GLU B 1 350 ? 120.613 63.359 24.485  1.00 72.81  ? 351  GLU B OE1 1 
ATOM   6834 O OE2 . GLU B 1 350 ? 119.490 64.266 22.832  1.00 83.86  ? 351  GLU B OE2 1 
ATOM   6835 N N   . SER B 1 351 ? 122.792 59.500 20.901  1.00 36.21  ? 352  SER B N   1 
ATOM   6836 C CA  . SER B 1 351 ? 122.616 58.385 19.970  1.00 33.04  ? 352  SER B CA  1 
ATOM   6837 C C   . SER B 1 351 ? 122.052 58.862 18.632  1.00 38.39  ? 352  SER B C   1 
ATOM   6838 O O   . SER B 1 351 ? 121.161 58.245 18.047  1.00 36.77  ? 352  SER B O   1 
ATOM   6839 C CB  . SER B 1 351 ? 121.742 57.294 20.587  1.00 34.48  ? 352  SER B CB  1 
ATOM   6840 O OG  . SER B 1 351 ? 122.383 56.718 21.716  1.00 35.24  ? 352  SER B OG  1 
ATOM   6841 N N   . LEU B 1 352 ? 122.584 59.980 18.145  1.00 35.72  ? 353  LEU B N   1 
ATOM   6842 C CA  . LEU B 1 352 ? 122.190 60.532 16.850  1.00 40.86  ? 353  LEU B CA  1 
ATOM   6843 C C   . LEU B 1 352 ? 122.993 59.824 15.771  1.00 39.51  ? 353  LEU B C   1 
ATOM   6844 O O   . LEU B 1 352 ? 124.091 60.236 15.407  1.00 48.17  ? 353  LEU B O   1 
ATOM   6845 C CB  . LEU B 1 352 ? 122.399 62.038 16.821  1.00 38.36  ? 353  LEU B CB  1 
ATOM   6846 C CG  . LEU B 1 352 ? 121.564 62.751 17.879  1.00 39.60  ? 353  LEU B CG  1 
ATOM   6847 C CD1 . LEU B 1 352 ? 122.112 64.148 18.134  1.00 36.67  ? 353  LEU B CD1 1 
ATOM   6848 C CD2 . LEU B 1 352 ? 120.094 62.763 17.433  1.00 39.54  ? 353  LEU B CD2 1 
ATOM   6849 N N   . ILE B 1 353 ? 122.420 58.743 15.252  1.00 37.57  ? 354  ILE B N   1 
ATOM   6850 C CA  . ILE B 1 353 ? 123.153 57.841 14.380  1.00 34.91  ? 354  ILE B CA  1 
ATOM   6851 C C   . ILE B 1 353 ? 123.139 58.357 12.945  1.00 35.85  ? 354  ILE B C   1 
ATOM   6852 O O   . ILE B 1 353 ? 122.295 59.163 12.543  1.00 39.02  ? 354  ILE B O   1 
ATOM   6853 C CB  . ILE B 1 353 ? 122.571 56.422 14.466  1.00 34.78  ? 354  ILE B CB  1 
ATOM   6854 C CG1 . ILE B 1 353 ? 121.076 56.451 14.133  1.00 34.39  ? 354  ILE B CG1 1 
ATOM   6855 C CG2 . ILE B 1 353 ? 122.802 55.847 15.859  1.00 29.97  ? 354  ILE B CG2 1 
ATOM   6856 C CD1 . ILE B 1 353 ? 120.481 55.091 13.859  1.00 28.86  ? 354  ILE B CD1 1 
ATOM   6857 N N   . SER B 1 354 ? 124.103 57.879 12.166  1.00 38.33  ? 355  SER B N   1 
ATOM   6858 C CA  . SER B 1 354 ? 124.155 58.161 10.745  1.00 40.23  ? 355  SER B CA  1 
ATOM   6859 C C   . SER B 1 354 ? 123.283 57.170 9.981   1.00 38.09  ? 355  SER B C   1 
ATOM   6860 O O   . SER B 1 354 ? 122.833 56.150 10.507  1.00 31.74  ? 355  SER B O   1 
ATOM   6861 C CB  . SER B 1 354 ? 125.591 58.089 10.232  1.00 39.80  ? 355  SER B CB  1 
ATOM   6862 O OG  . SER B 1 354 ? 126.069 56.756 10.307  1.00 40.07  ? 355  SER B OG  1 
ATOM   6863 N N   . ARG B 1 355 ? 123.059 57.481 8.706   1.00 39.74  ? 356  ARG B N   1 
ATOM   6864 C CA  . ARG B 1 355 ? 122.278 56.593 7.858   1.00 38.31  ? 356  ARG B CA  1 
ATOM   6865 C C   . ARG B 1 355 ? 122.936 55.222 7.739   1.00 34.04  ? 356  ARG B C   1 
ATOM   6866 O O   . ARG B 1 355 ? 122.257 54.188 7.778   1.00 31.52  ? 356  ARG B O   1 
ATOM   6867 C CB  . ARG B 1 355 ? 122.113 57.217 6.483   1.00 42.11  ? 356  ARG B CB  1 
ATOM   6868 C CG  . ARG B 1 355 ? 121.421 56.299 5.514   1.00 45.17  ? 356  ARG B CG  1 
ATOM   6869 C CD  . ARG B 1 355 ? 120.007 56.819 5.237   1.00 48.77  ? 356  ARG B CD  1 
ATOM   6870 N NE  . ARG B 1 355 ? 119.218 55.935 4.396   1.00 44.49  ? 356  ARG B NE  1 
ATOM   6871 C CZ  . ARG B 1 355 ? 117.958 55.566 4.676   1.00 39.23  ? 356  ARG B CZ  1 
ATOM   6872 N NH1 . ARG B 1 355 ? 117.342 55.983 5.767   1.00 34.94  ? 356  ARG B NH1 1 
ATOM   6873 N NH2 . ARG B 1 355 ? 117.317 54.753 3.857   1.00 33.29  ? 356  ARG B NH2 1 
ATOM   6874 N N   . ALA B 1 356 ? 124.260 55.204 7.574   1.00 33.77  ? 357  ALA B N   1 
ATOM   6875 C CA  . ALA B 1 356 ? 124.999 53.944 7.548   1.00 38.46  ? 357  ALA B CA  1 
ATOM   6876 C C   . ALA B 1 356 ? 124.772 53.141 8.822   1.00 36.28  ? 357  ALA B C   1 
ATOM   6877 O O   . ALA B 1 356 ? 124.551 51.926 8.763   1.00 39.98  ? 357  ALA B O   1 
ATOM   6878 C CB  . ALA B 1 356 ? 126.491 54.222 7.346   1.00 36.75  ? 357  ALA B CB  1 
ATOM   6879 N N   . GLU B 1 357 ? 124.824 53.799 9.985   1.00 34.31  ? 358  GLU B N   1 
ATOM   6880 C CA  . GLU B 1 357 ? 124.557 53.102 11.242  1.00 35.47  ? 358  GLU B CA  1 
ATOM   6881 C C   . GLU B 1 357 ? 123.117 52.613 11.295  1.00 34.75  ? 358  GLU B C   1 
ATOM   6882 O O   . GLU B 1 357 ? 122.835 51.524 11.812  1.00 29.60  ? 358  GLU B O   1 
ATOM   6883 C CB  . GLU B 1 357 ? 124.848 54.021 12.427  1.00 36.87  ? 358  GLU B CB  1 
ATOM   6884 C CG  . GLU B 1 357 ? 126.329 54.185 12.728  1.00 42.81  ? 358  GLU B CG  1 
ATOM   6885 C CD  . GLU B 1 357 ? 126.616 55.346 13.664  1.00 47.64  ? 358  GLU B CD  1 
ATOM   6886 O OE1 . GLU B 1 357 ? 125.896 56.365 13.599  1.00 50.23  ? 358  GLU B OE1 1 
ATOM   6887 O OE2 . GLU B 1 357 ? 127.555 55.232 14.480  1.00 54.15  ? 358  GLU B OE2 1 
ATOM   6888 N N   . PHE B 1 358 ? 122.194 53.408 10.760  1.00 37.05  ? 359  PHE B N   1 
ATOM   6889 C CA  . PHE B 1 358 ? 120.798 52.998 10.706  1.00 33.00  ? 359  PHE B CA  1 
ATOM   6890 C C   . PHE B 1 358 ? 120.618 51.750 9.848   1.00 32.96  ? 359  PHE B C   1 
ATOM   6891 O O   . PHE B 1 358 ? 119.896 50.821 10.231  1.00 27.42  ? 359  PHE B O   1 
ATOM   6892 C CB  . PHE B 1 358 ? 119.958 54.152 10.168  1.00 36.91  ? 359  PHE B CB  1 
ATOM   6893 C CG  . PHE B 1 358 ? 118.559 53.766 9.832   1.00 31.36  ? 359  PHE B CG  1 
ATOM   6894 C CD1 . PHE B 1 358 ? 118.204 53.509 8.521   1.00 26.71  ? 359  PHE B CD1 1 
ATOM   6895 C CD2 . PHE B 1 358 ? 117.597 53.666 10.822  1.00 26.65  ? 359  PHE B CD2 1 
ATOM   6896 C CE1 . PHE B 1 358 ? 116.913 53.150 8.186   1.00 26.64  ? 359  PHE B CE1 1 
ATOM   6897 C CE2 . PHE B 1 358 ? 116.292 53.307 10.503  1.00 28.66  ? 359  PHE B CE2 1 
ATOM   6898 C CZ  . PHE B 1 358 ? 115.951 53.049 9.165   1.00 30.35  ? 359  PHE B CZ  1 
ATOM   6899 N N   . LEU B 1 359 ? 121.262 51.709 8.679   1.00 29.96  ? 360  LEU B N   1 
ATOM   6900 C CA  . LEU B 1 359 ? 121.153 50.536 7.818   1.00 31.24  ? 360  LEU B CA  1 
ATOM   6901 C C   . LEU B 1 359 ? 121.773 49.308 8.477   1.00 34.81  ? 360  LEU B C   1 
ATOM   6902 O O   . LEU B 1 359 ? 121.218 48.205 8.402   1.00 36.79  ? 360  LEU B O   1 
ATOM   6903 C CB  . LEU B 1 359 ? 121.803 50.816 6.460   1.00 27.38  ? 360  LEU B CB  1 
ATOM   6904 C CG  . LEU B 1 359 ? 121.201 51.975 5.656   1.00 34.17  ? 360  LEU B CG  1 
ATOM   6905 C CD1 . LEU B 1 359 ? 122.035 52.313 4.401   1.00 31.30  ? 360  LEU B CD1 1 
ATOM   6906 C CD2 . LEU B 1 359 ? 119.737 51.680 5.302   1.00 30.46  ? 360  LEU B CD2 1 
ATOM   6907 N N   . ALA B 1 360 ? 122.922 49.479 9.132   1.00 31.50  ? 361  ALA B N   1 
ATOM   6908 C CA  . ALA B 1 360 ? 123.509 48.370 9.875   1.00 35.89  ? 361  ALA B CA  1 
ATOM   6909 C C   . ALA B 1 360 ? 122.608 47.947 11.030  1.00 37.25  ? 361  ALA B C   1 
ATOM   6910 O O   . ALA B 1 360 ? 122.463 46.750 11.309  1.00 37.35  ? 361  ALA B O   1 
ATOM   6911 C CB  . ALA B 1 360 ? 124.897 48.758 10.384  1.00 36.23  ? 361  ALA B CB  1 
ATOM   6912 N N   . GLY B 1 361 ? 121.982 48.916 11.703  1.00 33.53  ? 362  GLY B N   1 
ATOM   6913 C CA  . GLY B 1 361 ? 121.102 48.590 12.816  1.00 25.49  ? 362  GLY B CA  1 
ATOM   6914 C C   . GLY B 1 361 ? 119.895 47.764 12.412  1.00 30.33  ? 362  GLY B C   1 
ATOM   6915 O O   . GLY B 1 361 ? 119.380 46.976 13.214  1.00 30.11  ? 362  GLY B O   1 
ATOM   6916 N N   . VAL B 1 362 ? 119.426 47.925 11.171  1.00 28.87  ? 363  VAL B N   1 
ATOM   6917 C CA  . VAL B 1 362 ? 118.269 47.160 10.711  1.00 27.96  ? 363  VAL B CA  1 
ATOM   6918 C C   . VAL B 1 362 ? 118.588 45.669 10.685  1.00 25.51  ? 363  VAL B C   1 
ATOM   6919 O O   . VAL B 1 362 ? 117.755 44.839 11.063  1.00 28.79  ? 363  VAL B O   1 
ATOM   6920 C CB  . VAL B 1 362 ? 117.802 47.674 9.336   1.00 29.42  ? 363  VAL B CB  1 
ATOM   6921 C CG1 . VAL B 1 362 ? 116.889 46.657 8.654   1.00 22.89  ? 363  VAL B CG1 1 
ATOM   6922 C CG2 . VAL B 1 362 ? 117.076 49.001 9.499   1.00 28.49  ? 363  VAL B CG2 1 
ATOM   6923 N N   . ARG B 1 363 ? 119.799 45.305 10.251  1.00 24.72  ? 364  ARG B N   1 
ATOM   6924 C CA  . ARG B 1 363 ? 120.190 43.897 10.265  1.00 31.02  ? 364  ARG B CA  1 
ATOM   6925 C C   . ARG B 1 363 ? 120.383 43.375 11.686  1.00 30.41  ? 364  ARG B C   1 
ATOM   6926 O O   . ARG B 1 363 ? 120.168 42.185 11.939  1.00 32.02  ? 364  ARG B O   1 
ATOM   6927 C CB  . ARG B 1 363 ? 121.472 43.677 9.457   1.00 30.15  ? 364  ARG B CB  1 
ATOM   6928 C CG  . ARG B 1 363 ? 121.464 44.247 8.039   1.00 36.39  ? 364  ARG B CG  1 
ATOM   6929 C CD  . ARG B 1 363 ? 120.142 44.010 7.308   1.00 40.16  ? 364  ARG B CD  1 
ATOM   6930 N NE  . ARG B 1 363 ? 119.832 42.601 7.055   1.00 39.46  ? 364  ARG B NE  1 
ATOM   6931 C CZ  . ARG B 1 363 ? 120.190 41.935 5.957   1.00 41.96  ? 364  ARG B CZ  1 
ATOM   6932 N NH1 . ARG B 1 363 ? 120.897 42.537 5.003   1.00 35.92  ? 364  ARG B NH1 1 
ATOM   6933 N NH2 . ARG B 1 363 ? 119.848 40.658 5.813   1.00 36.33  ? 364  ARG B NH2 1 
ATOM   6934 N N   . VAL B 1 364 ? 120.794 44.237 12.620  1.00 27.23  ? 365  VAL B N   1 
ATOM   6935 C CA  . VAL B 1 364 ? 120.913 43.817 14.015  1.00 26.96  ? 365  VAL B CA  1 
ATOM   6936 C C   . VAL B 1 364 ? 119.534 43.684 14.653  1.00 31.73  ? 365  VAL B C   1 
ATOM   6937 O O   . VAL B 1 364 ? 119.269 42.738 15.410  1.00 26.29  ? 365  VAL B O   1 
ATOM   6938 C CB  . VAL B 1 364 ? 121.809 44.800 14.792  1.00 28.45  ? 365  VAL B CB  1 
ATOM   6939 C CG1 . VAL B 1 364 ? 121.822 44.464 16.271  1.00 26.51  ? 365  VAL B CG1 1 
ATOM   6940 C CG2 . VAL B 1 364 ? 123.236 44.776 14.235  1.00 29.44  ? 365  VAL B CG2 1 
ATOM   6941 N N   . GLY B 1 365 ? 118.627 44.620 14.346  1.00 33.12  ? 366  GLY B N   1 
ATOM   6942 C CA  . GLY B 1 365 ? 117.308 44.621 14.956  1.00 27.00  ? 366  GLY B CA  1 
ATOM   6943 C C   . GLY B 1 365 ? 116.293 43.737 14.268  1.00 28.15  ? 366  GLY B C   1 
ATOM   6944 O O   . GLY B 1 365 ? 115.260 43.421 14.866  1.00 26.96  ? 366  GLY B O   1 
ATOM   6945 N N   . VAL B 1 366 ? 116.546 43.349 13.021  1.00 26.78  ? 367  VAL B N   1 
ATOM   6946 C CA  . VAL B 1 366 ? 115.698 42.383 12.325  1.00 28.77  ? 367  VAL B CA  1 
ATOM   6947 C C   . VAL B 1 366 ? 116.600 41.253 11.847  1.00 25.78  ? 367  VAL B C   1 
ATOM   6948 O O   . VAL B 1 366 ? 116.831 41.103 10.638  1.00 28.70  ? 367  VAL B O   1 
ATOM   6949 C CB  . VAL B 1 366 ? 114.929 43.026 11.159  1.00 30.66  ? 367  VAL B CB  1 
ATOM   6950 C CG1 . VAL B 1 366 ? 113.845 42.071 10.645  1.00 26.48  ? 367  VAL B CG1 1 
ATOM   6951 C CG2 . VAL B 1 366 ? 114.319 44.346 11.596  1.00 24.99  ? 367  VAL B CG2 1 
ATOM   6952 N N   . PRO B 1 367 ? 117.122 40.438 12.754  1.00 28.70  ? 368  PRO B N   1 
ATOM   6953 C CA  . PRO B 1 367 ? 118.143 39.460 12.379  1.00 26.27  ? 368  PRO B CA  1 
ATOM   6954 C C   . PRO B 1 367 ? 117.552 38.284 11.621  1.00 25.24  ? 368  PRO B C   1 
ATOM   6955 O O   . PRO B 1 367 ? 116.370 37.957 11.741  1.00 28.82  ? 368  PRO B O   1 
ATOM   6956 C CB  . PRO B 1 367 ? 118.694 39.008 13.732  1.00 25.08  ? 368  PRO B CB  1 
ATOM   6957 C CG  . PRO B 1 367 ? 117.523 39.133 14.647  1.00 26.20  ? 368  PRO B CG  1 
ATOM   6958 C CD  . PRO B 1 367 ? 116.745 40.328 14.178  1.00 27.24  ? 368  PRO B CD  1 
ATOM   6959 N N   . GLN B 1 368 ? 118.411 37.647 10.826  1.00 28.27  ? 369  GLN B N   1 
ATOM   6960 C CA  . GLN B 1 368 ? 118.083 36.392 10.154  1.00 43.50  ? 369  GLN B CA  1 
ATOM   6961 C C   . GLN B 1 368 ? 116.964 36.544 9.121   1.00 44.26  ? 369  GLN B C   1 
ATOM   6962 O O   . GLN B 1 368 ? 116.150 35.634 8.947   1.00 43.55  ? 369  GLN B O   1 
ATOM   6963 C CB  . GLN B 1 368 ? 117.704 35.308 11.172  1.00 46.97  ? 369  GLN B CB  1 
ATOM   6964 C CG  . GLN B 1 368 ? 118.774 35.025 12.210  1.00 48.27  ? 369  GLN B CG  1 
ATOM   6965 C CD  . GLN B 1 368 ? 119.928 34.226 11.643  1.00 50.31  ? 369  GLN B CD  1 
ATOM   6966 O OE1 . GLN B 1 368 ? 119.842 33.005 11.506  1.00 56.35  ? 369  GLN B OE1 1 
ATOM   6967 N NE2 . GLN B 1 368 ? 121.016 34.909 11.309  1.00 43.46  ? 369  GLN B NE2 1 
ATOM   6968 N N   . VAL B 1 369 ? 116.890 37.680 8.428   1.00 40.41  ? 370  VAL B N   1 
ATOM   6969 C CA  . VAL B 1 369 ? 115.971 37.812 7.305   1.00 32.91  ? 370  VAL B CA  1 
ATOM   6970 C C   . VAL B 1 369 ? 116.786 38.095 6.054   1.00 38.24  ? 370  VAL B C   1 
ATOM   6971 O O   . VAL B 1 369 ? 117.937 38.537 6.116   1.00 38.64  ? 370  VAL B O   1 
ATOM   6972 C CB  . VAL B 1 369 ? 114.890 38.900 7.517   1.00 27.97  ? 370  VAL B CB  1 
ATOM   6973 C CG1 . VAL B 1 369 ? 114.083 38.615 8.779   1.00 24.94  ? 370  VAL B CG1 1 
ATOM   6974 C CG2 . VAL B 1 369 ? 115.504 40.302 7.544   1.00 23.22  ? 370  VAL B CG2 1 
ATOM   6975 N N   . SER B 1 370 ? 116.175 37.815 4.905   1.00 40.08  ? 371  SER B N   1 
ATOM   6976 C CA  . SER B 1 370 ? 116.839 38.034 3.629   1.00 32.91  ? 371  SER B CA  1 
ATOM   6977 C C   . SER B 1 370 ? 117.133 39.519 3.423   1.00 30.18  ? 371  SER B C   1 
ATOM   6978 O O   . SER B 1 370 ? 116.547 40.398 4.069   1.00 30.63  ? 371  SER B O   1 
ATOM   6979 C CB  . SER B 1 370 ? 115.974 37.507 2.483   1.00 34.70  ? 371  SER B CB  1 
ATOM   6980 O OG  . SER B 1 370 ? 114.701 38.132 2.483   1.00 35.93  ? 371  SER B OG  1 
ATOM   6981 N N   . ASP B 1 371 ? 118.067 39.793 2.509   1.00 35.87  ? 372  ASP B N   1 
ATOM   6982 C CA  . ASP B 1 371 ? 118.340 41.171 2.118   1.00 37.66  ? 372  ASP B CA  1 
ATOM   6983 C C   . ASP B 1 371 ? 117.075 41.862 1.632   1.00 34.26  ? 372  ASP B C   1 
ATOM   6984 O O   . ASP B 1 371 ? 116.835 43.032 1.952   1.00 33.68  ? 372  ASP B O   1 
ATOM   6985 C CB  . ASP B 1 371 ? 119.418 41.208 1.033   1.00 44.01  ? 372  ASP B CB  1 
ATOM   6986 C CG  . ASP B 1 371 ? 120.790 40.853 1.565   1.00 55.68  ? 372  ASP B CG  1 
ATOM   6987 O OD1 . ASP B 1 371 ? 120.994 40.954 2.794   1.00 54.81  ? 372  ASP B OD1 1 
ATOM   6988 O OD2 . ASP B 1 371 ? 121.667 40.480 0.754   1.00 61.85  ? 372  ASP B OD2 1 
ATOM   6989 N N   . LEU B 1 372 ? 116.242 41.146 0.873   1.00 34.15  ? 373  LEU B N   1 
ATOM   6990 C CA  . LEU B 1 372 ? 115.008 41.739 0.370   1.00 37.30  ? 373  LEU B CA  1 
ATOM   6991 C C   . LEU B 1 372 ? 114.095 42.165 1.512   1.00 36.05  ? 373  LEU B C   1 
ATOM   6992 O O   . LEU B 1 372 ? 113.509 43.255 1.476   1.00 31.61  ? 373  LEU B O   1 
ATOM   6993 C CB  . LEU B 1 372 ? 114.288 40.753 -0.551  1.00 33.04  ? 373  LEU B CB  1 
ATOM   6994 C CG  . LEU B 1 372 ? 113.010 41.289 -1.199  1.00 38.37  ? 373  LEU B CG  1 
ATOM   6995 C CD1 . LEU B 1 372 ? 113.331 42.460 -2.133  1.00 38.03  ? 373  LEU B CD1 1 
ATOM   6996 C CD2 . LEU B 1 372 ? 112.279 40.184 -1.946  1.00 37.18  ? 373  LEU B CD2 1 
ATOM   6997 N N   . ALA B 1 373 ? 113.959 41.318 2.537   1.00 33.93  ? 374  ALA B N   1 
ATOM   6998 C CA  . ALA B 1 373 ? 113.138 41.678 3.690   1.00 32.00  ? 374  ALA B CA  1 
ATOM   6999 C C   . ALA B 1 373 ? 113.705 42.896 4.406   1.00 26.87  ? 374  ALA B C   1 
ATOM   7000 O O   . ALA B 1 373 ? 112.955 43.789 4.820   1.00 28.25  ? 374  ALA B O   1 
ATOM   7001 C CB  . ALA B 1 373 ? 113.024 40.494 4.653   1.00 31.00  ? 374  ALA B CB  1 
ATOM   7002 N N   . ALA B 1 374 ? 115.030 42.950 4.561   1.00 28.22  ? 375  ALA B N   1 
ATOM   7003 C CA  . ALA B 1 374 ? 115.657 44.120 5.166   1.00 31.42  ? 375  ALA B CA  1 
ATOM   7004 C C   . ALA B 1 374 ? 115.397 45.374 4.337   1.00 31.20  ? 375  ALA B C   1 
ATOM   7005 O O   . ALA B 1 374 ? 115.118 46.443 4.891   1.00 28.40  ? 375  ALA B O   1 
ATOM   7006 C CB  . ALA B 1 374 ? 117.158 43.885 5.334   1.00 25.91  ? 375  ALA B CB  1 
ATOM   7007 N N   . GLU B 1 375 ? 115.482 45.262 3.007   1.00 27.03  ? 376  GLU B N   1 
ATOM   7008 C CA  . GLU B 1 375 ? 115.195 46.411 2.150   1.00 30.22  ? 376  GLU B CA  1 
ATOM   7009 C C   . GLU B 1 375 ? 113.763 46.890 2.335   1.00 31.87  ? 376  GLU B C   1 
ATOM   7010 O O   . GLU B 1 375 ? 113.494 48.096 2.297   1.00 32.22  ? 376  GLU B O   1 
ATOM   7011 C CB  . GLU B 1 375 ? 115.440 46.068 0.679   1.00 41.69  ? 376  GLU B CB  1 
ATOM   7012 C CG  . GLU B 1 375 ? 116.848 45.610 0.333   1.00 57.32  ? 376  GLU B CG  1 
ATOM   7013 C CD  . GLU B 1 375 ? 117.880 46.720 0.395   1.00 72.73  ? 376  GLU B CD  1 
ATOM   7014 O OE1 . GLU B 1 375 ? 117.506 47.882 0.666   1.00 73.26  ? 376  GLU B OE1 1 
ATOM   7015 O OE2 . GLU B 1 375 ? 119.073 46.425 0.163   1.00 82.07  ? 376  GLU B OE2 1 
ATOM   7016 N N   . ALA B 1 376 ? 112.828 45.956 2.528   1.00 26.99  ? 377  ALA B N   1 
ATOM   7017 C CA  . ALA B 1 376 ? 111.443 46.337 2.782   1.00 28.36  ? 377  ALA B CA  1 
ATOM   7018 C C   . ALA B 1 376 ? 111.313 47.109 4.091   1.00 26.81  ? 377  ALA B C   1 
ATOM   7019 O O   . ALA B 1 376 ? 110.543 48.075 4.175   1.00 25.80  ? 377  ALA B O   1 
ATOM   7020 C CB  . ALA B 1 376 ? 110.546 45.098 2.798   1.00 22.87  ? 377  ALA B CB  1 
ATOM   7021 N N   . VAL B 1 377 ? 112.053 46.695 5.126   1.00 23.93  ? 378  VAL B N   1 
ATOM   7022 C CA  . VAL B 1 377 ? 112.039 47.432 6.391   1.00 22.45  ? 378  VAL B CA  1 
ATOM   7023 C C   . VAL B 1 377 ? 112.553 48.848 6.178   1.00 24.47  ? 378  VAL B C   1 
ATOM   7024 O O   . VAL B 1 377 ? 111.945 49.827 6.625   1.00 29.31  ? 378  VAL B O   1 
ATOM   7025 C CB  . VAL B 1 377 ? 112.870 46.699 7.461   1.00 25.22  ? 378  VAL B CB  1 
ATOM   7026 C CG1 . VAL B 1 377 ? 112.886 47.506 8.756   1.00 21.00  ? 378  VAL B CG1 1 
ATOM   7027 C CG2 . VAL B 1 377 ? 112.324 45.304 7.711   1.00 21.89  ? 378  VAL B CG2 1 
ATOM   7028 N N   . VAL B 1 378 ? 113.689 48.969 5.491   1.00 24.98  ? 379  VAL B N   1 
ATOM   7029 C CA  . VAL B 1 378 ? 114.291 50.271 5.232   1.00 27.36  ? 379  VAL B CA  1 
ATOM   7030 C C   . VAL B 1 378 ? 113.330 51.160 4.453   1.00 33.46  ? 379  VAL B C   1 
ATOM   7031 O O   . VAL B 1 378 ? 113.228 52.364 4.715   1.00 33.95  ? 379  VAL B O   1 
ATOM   7032 C CB  . VAL B 1 378 ? 115.632 50.084 4.495   1.00 31.49  ? 379  VAL B CB  1 
ATOM   7033 C CG1 . VAL B 1 378 ? 116.100 51.396 3.854   1.00 25.91  ? 379  VAL B CG1 1 
ATOM   7034 C CG2 . VAL B 1 378 ? 116.687 49.515 5.450   1.00 27.91  ? 379  VAL B CG2 1 
ATOM   7035 N N   . LEU B 1 379 ? 112.599 50.580 3.497   1.00 28.97  ? 380  LEU B N   1 
ATOM   7036 C CA  . LEU B 1 379 ? 111.627 51.358 2.734   1.00 29.18  ? 380  LEU B CA  1 
ATOM   7037 C C   . LEU B 1 379 ? 110.561 51.952 3.644   1.00 29.81  ? 380  LEU B C   1 
ATOM   7038 O O   . LEU B 1 379 ? 110.259 53.148 3.573   1.00 32.72  ? 380  LEU B O   1 
ATOM   7039 C CB  . LEU B 1 379 ? 110.964 50.487 1.666   1.00 29.46  ? 380  LEU B CB  1 
ATOM   7040 C CG  . LEU B 1 379 ? 109.750 51.129 0.981   1.00 34.54  ? 380  LEU B CG  1 
ATOM   7041 C CD1 . LEU B 1 379 ? 110.187 52.165 -0.073  1.00 31.10  ? 380  LEU B CD1 1 
ATOM   7042 C CD2 . LEU B 1 379 ? 108.840 50.081 0.358   1.00 37.67  ? 380  LEU B CD2 1 
ATOM   7043 N N   . HIS B 1 380 ? 109.985 51.126 4.515   1.00 27.29  ? 381  HIS B N   1 
ATOM   7044 C CA  A HIS B 1 380 ? 108.859 51.565 5.331   0.61 29.88  ? 381  HIS B CA  1 
ATOM   7045 C CA  B HIS B 1 380 ? 108.857 51.596 5.305   0.39 30.05  ? 381  HIS B CA  1 
ATOM   7046 C C   . HIS B 1 380 ? 109.288 52.555 6.405   1.00 29.67  ? 381  HIS B C   1 
ATOM   7047 O O   . HIS B 1 380 ? 108.517 53.448 6.771   1.00 29.89  ? 381  HIS B O   1 
ATOM   7048 C CB  A HIS B 1 380 ? 108.175 50.354 5.972   0.61 32.34  ? 381  HIS B CB  1 
ATOM   7049 C CB  B HIS B 1 380 ? 108.092 50.405 5.875   0.39 32.54  ? 381  HIS B CB  1 
ATOM   7050 C CG  A HIS B 1 380 ? 106.903 50.688 6.688   0.61 34.73  ? 381  HIS B CG  1 
ATOM   7051 C CG  B HIS B 1 380 ? 107.379 49.610 4.829   0.39 35.77  ? 381  HIS B CG  1 
ATOM   7052 N ND1 A HIS B 1 380 ? 105.659 50.504 6.123   0.61 37.40  ? 381  HIS B ND1 1 
ATOM   7053 N ND1 B HIS B 1 380 ? 108.022 48.695 4.023   0.39 38.48  ? 381  HIS B ND1 1 
ATOM   7054 C CD2 A HIS B 1 380 ? 106.683 51.205 7.921   0.61 36.25  ? 381  HIS B CD2 1 
ATOM   7055 C CD2 B HIS B 1 380 ? 106.086 49.621 4.428   0.39 37.04  ? 381  HIS B CD2 1 
ATOM   7056 C CE1 A HIS B 1 380 ? 104.728 50.887 6.978   0.61 34.34  ? 381  HIS B CE1 1 
ATOM   7057 C CE1 B HIS B 1 380 ? 107.153 48.163 3.184   0.39 33.94  ? 381  HIS B CE1 1 
ATOM   7058 N NE2 A HIS B 1 380 ? 105.323 51.321 8.075   0.61 36.83  ? 381  HIS B NE2 1 
ATOM   7059 N NE2 B HIS B 1 380 ? 105.971 48.707 3.410   0.39 39.34  ? 381  HIS B NE2 1 
ATOM   7060 N N   . TYR B 1 381 ? 110.508 52.422 6.917   1.00 29.09  ? 382  TYR B N   1 
ATOM   7061 C CA  . TYR B 1 381 ? 110.940 53.230 8.051   1.00 25.11  ? 382  TYR B CA  1 
ATOM   7062 C C   . TYR B 1 381 ? 111.812 54.412 7.668   1.00 28.78  ? 382  TYR B C   1 
ATOM   7063 O O   . TYR B 1 381 ? 112.261 55.143 8.555   1.00 31.92  ? 382  TYR B O   1 
ATOM   7064 C CB  . TYR B 1 381 ? 111.660 52.346 9.066   1.00 22.36  ? 382  TYR B CB  1 
ATOM   7065 C CG  . TYR B 1 381 ? 110.665 51.552 9.863   1.00 26.42  ? 382  TYR B CG  1 
ATOM   7066 C CD1 . TYR B 1 381 ? 110.150 52.045 11.060  1.00 21.95  ? 382  TYR B CD1 1 
ATOM   7067 C CD2 . TYR B 1 381 ? 110.197 50.330 9.397   1.00 24.43  ? 382  TYR B CD2 1 
ATOM   7068 C CE1 . TYR B 1 381 ? 109.211 51.324 11.786  1.00 22.33  ? 382  TYR B CE1 1 
ATOM   7069 C CE2 . TYR B 1 381 ? 109.263 49.602 10.111  1.00 24.79  ? 382  TYR B CE2 1 
ATOM   7070 C CZ  . TYR B 1 381 ? 108.775 50.097 11.306  1.00 28.61  ? 382  TYR B CZ  1 
ATOM   7071 O OH  . TYR B 1 381 ? 107.842 49.354 11.998  1.00 24.05  ? 382  TYR B OH  1 
ATOM   7072 N N   . THR B 1 382 ? 112.048 54.631 6.380   1.00 27.81  ? 383  THR B N   1 
ATOM   7073 C CA  . THR B 1 382 ? 112.765 55.812 5.928   1.00 31.12  ? 383  THR B CA  1 
ATOM   7074 C C   . THR B 1 382 ? 111.759 56.908 5.609   1.00 32.74  ? 383  THR B C   1 
ATOM   7075 O O   . THR B 1 382 ? 110.729 56.646 4.978   1.00 31.01  ? 383  THR B O   1 
ATOM   7076 C CB  . THR B 1 382 ? 113.617 55.491 4.697   1.00 31.20  ? 383  THR B CB  1 
ATOM   7077 O OG1 . THR B 1 382 ? 114.651 54.564 5.055   1.00 31.59  ? 383  THR B OG1 1 
ATOM   7078 C CG2 . THR B 1 382 ? 114.248 56.757 4.110   1.00 27.81  ? 383  THR B CG2 1 
ATOM   7079 N N   . ASP B 1 383 ? 112.039 58.125 6.070   1.00 33.42  ? 384  ASP B N   1 
ATOM   7080 C CA  . ASP B 1 383 ? 111.348 59.313 5.573   1.00 33.25  ? 384  ASP B CA  1 
ATOM   7081 C C   . ASP B 1 383 ? 112.115 59.789 4.345   1.00 31.56  ? 384  ASP B C   1 
ATOM   7082 O O   . ASP B 1 383 ? 113.197 60.370 4.467   1.00 29.75  ? 384  ASP B O   1 
ATOM   7083 C CB  . ASP B 1 383 ? 111.273 60.401 6.643   1.00 33.42  ? 384  ASP B CB  1 
ATOM   7084 C CG  . ASP B 1 383 ? 110.514 61.646 6.174   1.00 39.09  ? 384  ASP B CG  1 
ATOM   7085 O OD1 . ASP B 1 383 ? 110.409 61.895 4.951   1.00 40.73  ? 384  ASP B OD1 1 
ATOM   7086 O OD2 . ASP B 1 383 ? 110.017 62.391 7.041   1.00 44.55  ? 384  ASP B OD2 1 
ATOM   7087 N N   . TRP B 1 384 ? 111.558 59.551 3.159   1.00 30.02  ? 385  TRP B N   1 
ATOM   7088 C CA  . TRP B 1 384 ? 112.344 59.822 1.962   1.00 30.37  ? 385  TRP B CA  1 
ATOM   7089 C C   . TRP B 1 384 ? 112.459 61.308 1.641   1.00 35.88  ? 385  TRP B C   1 
ATOM   7090 O O   . TRP B 1 384 ? 113.132 61.658 0.664   1.00 35.69  ? 385  TRP B O   1 
ATOM   7091 C CB  . TRP B 1 384 ? 111.770 59.021 0.791   1.00 32.76  ? 385  TRP B CB  1 
ATOM   7092 C CG  . TRP B 1 384 ? 111.970 57.554 1.047   1.00 30.67  ? 385  TRP B CG  1 
ATOM   7093 C CD1 . TRP B 1 384 ? 111.064 56.676 1.574   1.00 29.40  ? 385  TRP B CD1 1 
ATOM   7094 C CD2 . TRP B 1 384 ? 113.182 56.817 0.860   1.00 29.25  ? 385  TRP B CD2 1 
ATOM   7095 N NE1 . TRP B 1 384 ? 111.635 55.427 1.702   1.00 29.82  ? 385  TRP B NE1 1 
ATOM   7096 C CE2 . TRP B 1 384 ? 112.933 55.489 1.265   1.00 31.83  ? 385  TRP B CE2 1 
ATOM   7097 C CE3 . TRP B 1 384 ? 114.453 57.149 0.378   1.00 30.16  ? 385  TRP B CE3 1 
ATOM   7098 C CZ2 . TRP B 1 384 ? 113.910 54.496 1.210   1.00 31.49  ? 385  TRP B CZ2 1 
ATOM   7099 C CZ3 . TRP B 1 384 ? 115.418 56.161 0.314   1.00 30.93  ? 385  TRP B CZ3 1 
ATOM   7100 C CH2 . TRP B 1 384 ? 115.142 54.850 0.731   1.00 32.45  ? 385  TRP B CH2 1 
ATOM   7101 N N   . LEU B 1 385 ? 111.853 62.186 2.442   1.00 34.24  ? 386  LEU B N   1 
ATOM   7102 C CA  . LEU B 1 385 ? 112.187 63.606 2.394   1.00 39.49  ? 386  LEU B CA  1 
ATOM   7103 C C   . LEU B 1 385 ? 113.286 63.990 3.384   1.00 40.18  ? 386  LEU B C   1 
ATOM   7104 O O   . LEU B 1 385 ? 113.867 65.075 3.249   1.00 37.58  ? 386  LEU B O   1 
ATOM   7105 C CB  . LEU B 1 385 ? 110.938 64.456 2.656   1.00 40.65  ? 386  LEU B CB  1 
ATOM   7106 C CG  . LEU B 1 385 ? 109.894 64.486 1.536   1.00 41.79  ? 386  LEU B CG  1 
ATOM   7107 C CD1 . LEU B 1 385 ? 108.645 65.239 1.975   1.00 47.94  ? 386  LEU B CD1 1 
ATOM   7108 C CD2 . LEU B 1 385 ? 110.480 65.108 0.289   1.00 40.95  ? 386  LEU B CD2 1 
ATOM   7109 N N   . HIS B 1 386 ? 113.580 63.137 4.368   1.00 32.14  ? 387  HIS B N   1 
ATOM   7110 C CA  . HIS B 1 386 ? 114.690 63.357 5.300   1.00 39.18  ? 387  HIS B CA  1 
ATOM   7111 C C   . HIS B 1 386 ? 115.427 62.037 5.517   1.00 34.83  ? 387  HIS B C   1 
ATOM   7112 O O   . HIS B 1 386 ? 115.497 61.520 6.636   1.00 32.98  ? 387  HIS B O   1 
ATOM   7113 C CB  . HIS B 1 386 ? 114.188 63.923 6.627   1.00 33.08  ? 387  HIS B CB  1 
ATOM   7114 C CG  . HIS B 1 386 ? 113.317 65.125 6.469   1.00 37.12  ? 387  HIS B CG  1 
ATOM   7115 N ND1 . HIS B 1 386 ? 113.832 66.397 6.266   1.00 42.36  ? 387  HIS B ND1 1 
ATOM   7116 C CD2 . HIS B 1 386 ? 111.966 65.258 6.486   1.00 36.95  ? 387  HIS B CD2 1 
ATOM   7117 C CE1 . HIS B 1 386 ? 112.833 67.259 6.148   1.00 40.38  ? 387  HIS B CE1 1 
ATOM   7118 N NE2 . HIS B 1 386 ? 111.692 66.594 6.277   1.00 41.01  ? 387  HIS B NE2 1 
ATOM   7119 N N   . PRO B 1 387 ? 115.991 61.454 4.453   1.00 37.72  ? 388  PRO B N   1 
ATOM   7120 C CA  . PRO B 1 387 ? 116.553 60.098 4.581   1.00 30.76  ? 388  PRO B CA  1 
ATOM   7121 C C   . PRO B 1 387 ? 117.743 60.010 5.521   1.00 39.85  ? 388  PRO B C   1 
ATOM   7122 O O   . PRO B 1 387 ? 118.027 58.915 6.017   1.00 29.93  ? 388  PRO B O   1 
ATOM   7123 C CB  . PRO B 1 387 ? 116.943 59.744 3.140   1.00 31.39  ? 388  PRO B CB  1 
ATOM   7124 C CG  . PRO B 1 387 ? 117.148 61.067 2.461   1.00 32.83  ? 388  PRO B CG  1 
ATOM   7125 C CD  . PRO B 1 387 ? 116.160 62.003 3.092   1.00 32.80  ? 388  PRO B CD  1 
ATOM   7126 N N   . GLU B 1 388 ? 118.432 61.116 5.810   1.00 36.66  ? 389  GLU B N   1 
ATOM   7127 C CA  . GLU B 1 388 ? 119.677 61.058 6.571   1.00 37.64  ? 389  GLU B CA  1 
ATOM   7128 C C   . GLU B 1 388 ? 119.629 61.833 7.884   1.00 38.85  ? 389  GLU B C   1 
ATOM   7129 O O   . GLU B 1 388 ? 120.675 62.032 8.509   1.00 39.37  ? 389  GLU B O   1 
ATOM   7130 C CB  . GLU B 1 388 ? 120.835 61.567 5.711   1.00 44.08  ? 389  GLU B CB  1 
ATOM   7131 C CG  . GLU B 1 388 ? 120.863 60.974 4.318   1.00 55.76  ? 389  GLU B CG  1 
ATOM   7132 C CD  . GLU B 1 388 ? 122.217 60.404 3.950   1.00 70.03  ? 389  GLU B CD  1 
ATOM   7133 O OE1 . GLU B 1 388 ? 123.182 60.613 4.716   1.00 76.73  ? 389  GLU B OE1 1 
ATOM   7134 O OE2 . GLU B 1 388 ? 122.315 59.740 2.895   1.00 73.99  ? 389  GLU B OE2 1 
ATOM   7135 N N   . ASP B 1 389 ? 118.458 62.260 8.326   1.00 37.60  ? 390  ASP B N   1 
ATOM   7136 C CA  . ASP B 1 389 ? 118.357 63.055 9.543   1.00 38.26  ? 390  ASP B CA  1 
ATOM   7137 C C   . ASP B 1 389 ? 118.616 62.195 10.775  1.00 34.44  ? 390  ASP B C   1 
ATOM   7138 O O   . ASP B 1 389 ? 117.816 61.292 11.062  1.00 31.66  ? 390  ASP B O   1 
ATOM   7139 C CB  . ASP B 1 389 ? 116.979 63.705 9.616   1.00 44.77  ? 390  ASP B CB  1 
ATOM   7140 C CG  . ASP B 1 389 ? 116.811 64.566 10.851  1.00 51.27  ? 390  ASP B CG  1 
ATOM   7141 O OD1 . ASP B 1 389 ? 117.819 65.123 11.326  1.00 56.97  ? 390  ASP B OD1 1 
ATOM   7142 O OD2 . ASP B 1 389 ? 115.671 64.684 11.346  1.00 55.22  ? 390  ASP B OD2 1 
ATOM   7143 N N   . PRO B 1 390 ? 119.689 62.441 11.537  1.00 36.56  ? 391  PRO B N   1 
ATOM   7144 C CA  . PRO B 1 390 ? 120.017 61.550 12.673  1.00 35.18  ? 391  PRO B CA  1 
ATOM   7145 C C   . PRO B 1 390 ? 118.909 61.351 13.696  1.00 33.29  ? 391  PRO B C   1 
ATOM   7146 O O   . PRO B 1 390 ? 118.682 60.215 14.127  1.00 32.43  ? 391  PRO B O   1 
ATOM   7147 C CB  . PRO B 1 390 ? 121.247 62.225 13.306  1.00 33.34  ? 391  PRO B CB  1 
ATOM   7148 C CG  . PRO B 1 390 ? 121.797 63.136 12.251  1.00 37.84  ? 391  PRO B CG  1 
ATOM   7149 C CD  . PRO B 1 390 ? 120.681 63.512 11.339  1.00 35.16  ? 391  PRO B CD  1 
ATOM   7150 N N   . ALA B 1 391 ? 118.220 62.416 14.112  1.00 33.58  ? 392  ALA B N   1 
ATOM   7151 C CA  . ALA B 1 391 ? 117.164 62.240 15.107  1.00 36.37  ? 392  ALA B CA  1 
ATOM   7152 C C   . ALA B 1 391 ? 116.045 61.354 14.571  1.00 35.25  ? 392  ALA B C   1 
ATOM   7153 O O   . ALA B 1 391 ? 115.544 60.477 15.282  1.00 33.49  ? 392  ALA B O   1 
ATOM   7154 C CB  . ALA B 1 391 ? 116.622 63.601 15.543  1.00 35.26  ? 392  ALA B CB  1 
ATOM   7155 N N   . ARG B 1 392 ? 115.656 61.551 13.307  1.00 35.01  ? 393  ARG B N   1 
ATOM   7156 C CA  . ARG B 1 392 ? 114.625 60.699 12.720  1.00 33.66  ? 393  ARG B CA  1 
ATOM   7157 C C   . ARG B 1 392 ? 115.101 59.263 12.580  1.00 26.41  ? 393  ARG B C   1 
ATOM   7158 O O   . ARG B 1 392 ? 114.318 58.328 12.768  1.00 33.61  ? 393  ARG B O   1 
ATOM   7159 C CB  . ARG B 1 392 ? 114.197 61.239 11.360  1.00 32.60  ? 393  ARG B CB  1 
ATOM   7160 C CG  . ARG B 1 392 ? 113.345 62.466 11.427  1.00 38.26  ? 393  ARG B CG  1 
ATOM   7161 C CD  . ARG B 1 392 ? 113.168 63.026 10.033  1.00 40.31  ? 393  ARG B CD  1 
ATOM   7162 N NE  . ARG B 1 392 ? 112.002 63.887 9.946   1.00 35.28  ? 393  ARG B NE  1 
ATOM   7163 C CZ  . ARG B 1 392 ? 112.075 65.206 9.835   1.00 42.21  ? 393  ARG B CZ  1 
ATOM   7164 N NH1 . ARG B 1 392 ? 113.260 65.800 9.805   1.00 43.97  ? 393  ARG B NH1 1 
ATOM   7165 N NH2 . ARG B 1 392 ? 110.970 65.929 9.757   1.00 50.07  ? 393  ARG B NH2 1 
ATOM   7166 N N   . LEU B 1 393 ? 116.379 59.067 12.248  1.00 33.87  ? 394  LEU B N   1 
ATOM   7167 C CA  . LEU B 1 393 ? 116.925 57.717 12.152  1.00 31.06  ? 394  LEU B CA  1 
ATOM   7168 C C   . LEU B 1 393 ? 116.921 57.026 13.510  1.00 27.78  ? 394  LEU B C   1 
ATOM   7169 O O   . LEU B 1 393 ? 116.548 55.852 13.623  1.00 29.23  ? 394  LEU B O   1 
ATOM   7170 C CB  . LEU B 1 393 ? 118.335 57.762 11.559  1.00 28.12  ? 394  LEU B CB  1 
ATOM   7171 C CG  . LEU B 1 393 ? 118.388 58.333 10.141  1.00 32.65  ? 394  LEU B CG  1 
ATOM   7172 C CD1 . LEU B 1 393 ? 119.791 58.800 9.745   1.00 29.65  ? 394  LEU B CD1 1 
ATOM   7173 C CD2 . LEU B 1 393 ? 117.822 57.309 9.156   1.00 29.16  ? 394  LEU B CD2 1 
ATOM   7174 N N   . ARG B 1 394 ? 117.324 57.748 14.559  1.00 28.36  ? 395  ARG B N   1 
ATOM   7175 C CA  . ARG B 1 394 ? 117.271 57.188 15.907  1.00 27.43  ? 395  ARG B CA  1 
ATOM   7176 C C   . ARG B 1 394 ? 115.858 56.740 16.251  1.00 24.36  ? 395  ARG B C   1 
ATOM   7177 O O   . ARG B 1 394 ? 115.643 55.608 16.697  1.00 27.60  ? 395  ARG B O   1 
ATOM   7178 C CB  . ARG B 1 394 ? 117.772 58.216 16.924  1.00 29.46  ? 395  ARG B CB  1 
ATOM   7179 C CG  . ARG B 1 394 ? 117.831 57.693 18.358  1.00 30.20  ? 395  ARG B CG  1 
ATOM   7180 C CD  . ARG B 1 394 ? 118.124 58.822 19.325  1.00 29.84  ? 395  ARG B CD  1 
ATOM   7181 N NE  . ARG B 1 394 ? 117.060 59.821 19.303  1.00 34.30  ? 395  ARG B NE  1 
ATOM   7182 C CZ  . ARG B 1 394 ? 117.226 61.101 19.619  1.00 37.45  ? 395  ARG B CZ  1 
ATOM   7183 N NH1 . ARG B 1 394 ? 118.421 61.555 19.978  1.00 38.51  ? 395  ARG B NH1 1 
ATOM   7184 N NH2 . ARG B 1 394 ? 116.196 61.931 19.566  1.00 34.24  ? 395  ARG B NH2 1 
ATOM   7185 N N   . GLU B 1 395 ? 114.877 57.616 16.026  1.00 30.69  ? 396  GLU B N   1 
ATOM   7186 C CA  . GLU B 1 395 ? 113.489 57.266 16.314  1.00 28.22  ? 396  GLU B CA  1 
ATOM   7187 C C   . GLU B 1 395 ? 113.019 56.108 15.442  1.00 28.24  ? 396  GLU B C   1 
ATOM   7188 O O   . GLU B 1 395 ? 112.294 55.225 15.912  1.00 23.81  ? 396  GLU B O   1 
ATOM   7189 C CB  . GLU B 1 395 ? 112.583 58.487 16.121  1.00 31.24  ? 396  GLU B CB  1 
ATOM   7190 C CG  . GLU B 1 395 ? 112.404 59.373 17.353  1.00 57.33  ? 396  GLU B CG  1 
ATOM   7191 C CD  . GLU B 1 395 ? 113.667 59.947 17.904  1.00 73.36  ? 396  GLU B CD  1 
ATOM   7192 O OE1 . GLU B 1 395 ? 114.282 59.313 18.718  1.00 73.48  ? 396  GLU B OE1 1 
ATOM   7193 O OE2 . GLU B 1 395 ? 114.032 61.045 17.541  1.00 81.25  ? 396  GLU B OE2 1 
ATOM   7194 N N   . ALA B 1 396 ? 113.433 56.088 14.172  1.00 25.19  ? 397  ALA B N   1 
ATOM   7195 C CA  . ALA B 1 396 ? 112.960 55.051 13.260  1.00 27.20  ? 397  ALA B CA  1 
ATOM   7196 C C   . ALA B 1 396 ? 113.451 53.669 13.677  1.00 24.09  ? 397  ALA B C   1 
ATOM   7197 O O   . ALA B 1 396 ? 112.670 52.710 13.695  1.00 27.18  ? 397  ALA B O   1 
ATOM   7198 C CB  . ALA B 1 396 ? 113.389 55.371 11.825  1.00 23.44  ? 397  ALA B CB  1 
ATOM   7199 N N   . LEU B 1 397 ? 114.737 53.540 14.015  1.00 22.20  ? 398  LEU B N   1 
ATOM   7200 C CA  . LEU B 1 397 ? 115.248 52.233 14.422  1.00 25.81  ? 398  LEU B CA  1 
ATOM   7201 C C   . LEU B 1 397 ? 114.624 51.778 15.740  1.00 26.65  ? 398  LEU B C   1 
ATOM   7202 O O   . LEU B 1 397 ? 114.384 50.580 15.939  1.00 24.35  ? 398  LEU B O   1 
ATOM   7203 C CB  . LEU B 1 397 ? 116.770 52.265 14.538  1.00 24.48  ? 398  LEU B CB  1 
ATOM   7204 C CG  . LEU B 1 397 ? 117.385 50.874 14.733  1.00 30.80  ? 398  LEU B CG  1 
ATOM   7205 C CD1 . LEU B 1 397 ? 117.120 50.005 13.502  1.00 26.93  ? 398  LEU B CD1 1 
ATOM   7206 C CD2 . LEU B 1 397 ? 118.876 50.955 15.030  1.00 32.46  ? 398  LEU B CD2 1 
ATOM   7207 N N   . SER B 1 398 ? 114.363 52.716 16.653  1.00 24.60  ? 399  SER B N   1 
ATOM   7208 C CA  . SER B 1 398 ? 113.593 52.379 17.846  1.00 26.53  ? 399  SER B CA  1 
ATOM   7209 C C   . SER B 1 398 ? 112.220 51.839 17.465  1.00 28.57  ? 399  SER B C   1 
ATOM   7210 O O   . SER B 1 398 ? 111.748 50.850 18.041  1.00 25.35  ? 399  SER B O   1 
ATOM   7211 C CB  . SER B 1 398 ? 113.457 53.606 18.752  1.00 26.24  ? 399  SER B CB  1 
ATOM   7212 O OG  . SER B 1 398 ? 112.675 53.313 19.904  1.00 33.32  ? 399  SER B OG  1 
ATOM   7213 N N   . ASP B 1 399 ? 111.571 52.468 16.483  1.00 28.63  ? 400  ASP B N   1 
ATOM   7214 C CA  . ASP B 1 399 ? 110.290 51.961 16.001  1.00 29.40  ? 400  ASP B CA  1 
ATOM   7215 C C   . ASP B 1 399 ? 110.437 50.584 15.364  1.00 26.91  ? 400  ASP B C   1 
ATOM   7216 O O   . ASP B 1 399 ? 109.592 49.708 15.578  1.00 22.61  ? 400  ASP B O   1 
ATOM   7217 C CB  . ASP B 1 399 ? 109.670 52.945 15.008  1.00 35.48  ? 400  ASP B CB  1 
ATOM   7218 C CG  . ASP B 1 399 ? 109.056 54.153 15.693  1.00 41.21  ? 400  ASP B CG  1 
ATOM   7219 O OD1 . ASP B 1 399 ? 108.624 54.017 16.859  1.00 42.84  ? 400  ASP B OD1 1 
ATOM   7220 O OD2 . ASP B 1 399 ? 109.002 55.233 15.069  1.00 42.89  ? 400  ASP B OD2 1 
ATOM   7221 N N   . VAL B 1 400 ? 111.494 50.371 14.574  1.00 26.74  ? 401  VAL B N   1 
ATOM   7222 C CA  . VAL B 1 400 ? 111.688 49.062 13.949  1.00 26.28  ? 401  VAL B CA  1 
ATOM   7223 C C   . VAL B 1 400 ? 111.729 47.976 15.014  1.00 25.94  ? 401  VAL B C   1 
ATOM   7224 O O   . VAL B 1 400 ? 111.028 46.960 14.925  1.00 24.96  ? 401  VAL B O   1 
ATOM   7225 C CB  . VAL B 1 400 ? 112.968 49.040 13.093  1.00 25.55  ? 401  VAL B CB  1 
ATOM   7226 C CG1 . VAL B 1 400 ? 113.291 47.613 12.684  1.00 19.75  ? 401  VAL B CG1 1 
ATOM   7227 C CG2 . VAL B 1 400 ? 112.824 49.907 11.852  1.00 23.53  ? 401  VAL B CG2 1 
ATOM   7228 N N   . VAL B 1 401 ? 112.543 48.184 16.046  1.00 27.41  ? 402  VAL B N   1 
ATOM   7229 C CA  . VAL B 1 401 ? 112.752 47.141 17.042  1.00 26.91  ? 402  VAL B CA  1 
ATOM   7230 C C   . VAL B 1 401 ? 111.500 46.950 17.890  1.00 25.23  ? 402  VAL B C   1 
ATOM   7231 O O   . VAL B 1 401 ? 111.094 45.815 18.168  1.00 23.98  ? 402  VAL B O   1 
ATOM   7232 C CB  . VAL B 1 401 ? 113.993 47.468 17.892  1.00 26.08  ? 402  VAL B CB  1 
ATOM   7233 C CG1 . VAL B 1 401 ? 114.083 46.536 19.094  1.00 24.20  ? 402  VAL B CG1 1 
ATOM   7234 C CG2 . VAL B 1 401 ? 115.250 47.347 17.030  1.00 22.60  ? 402  VAL B CG2 1 
ATOM   7235 N N   . GLY B 1 402 ? 110.848 48.048 18.281  1.00 24.85  ? 403  GLY B N   1 
ATOM   7236 C CA  . GLY B 1 402 ? 109.652 47.934 19.105  1.00 23.70  ? 403  GLY B CA  1 
ATOM   7237 C C   . GLY B 1 402 ? 108.448 47.390 18.353  1.00 27.99  ? 403  GLY B C   1 
ATOM   7238 O O   . GLY B 1 402 ? 107.670 46.604 18.904  1.00 27.15  ? 403  GLY B O   1 
ATOM   7239 N N   . ASP B 1 403 ? 108.260 47.817 17.098  1.00 22.76  ? 404  ASP B N   1 
ATOM   7240 C CA  . ASP B 1 403 ? 107.156 47.298 16.290  1.00 20.27  ? 404  ASP B CA  1 
ATOM   7241 C C   . ASP B 1 403 ? 107.316 45.807 16.042  1.00 22.02  ? 404  ASP B C   1 
ATOM   7242 O O   . ASP B 1 403 ? 106.388 45.019 16.260  1.00 24.66  ? 404  ASP B O   1 
ATOM   7243 C CB  . ASP B 1 403 ? 107.087 48.018 14.935  1.00 24.63  ? 404  ASP B CB  1 
ATOM   7244 C CG  . ASP B 1 403 ? 106.701 49.472 15.056  1.00 32.54  ? 404  ASP B CG  1 
ATOM   7245 O OD1 . ASP B 1 403 ? 106.160 49.857 16.112  1.00 35.22  ? 404  ASP B OD1 1 
ATOM   7246 O OD2 . ASP B 1 403 ? 106.944 50.231 14.092  1.00 34.14  ? 404  ASP B OD2 1 
ATOM   7247 N N   . HIS B 1 404 ? 108.484 45.418 15.536  1.00 19.81  ? 405  HIS B N   1 
ATOM   7248 C CA  . HIS B 1 404 ? 108.744 44.034 15.157  1.00 23.36  ? 405  HIS B CA  1 
ATOM   7249 C C   . HIS B 1 404 ? 108.623 43.093 16.354  1.00 24.18  ? 405  HIS B C   1 
ATOM   7250 O O   . HIS B 1 404 ? 108.040 42.008 16.247  1.00 22.40  ? 405  HIS B O   1 
ATOM   7251 C CB  . HIS B 1 404 ? 110.134 43.973 14.521  1.00 20.77  ? 405  HIS B CB  1 
ATOM   7252 C CG  . HIS B 1 404 ? 110.664 42.598 14.284  1.00 25.10  ? 405  HIS B CG  1 
ATOM   7253 N ND1 . HIS B 1 404 ? 109.984 41.641 13.565  1.00 25.21  ? 405  HIS B ND1 1 
ATOM   7254 C CD2 . HIS B 1 404 ? 111.846 42.036 14.633  1.00 27.48  ? 405  HIS B CD2 1 
ATOM   7255 C CE1 . HIS B 1 404 ? 110.718 40.542 13.493  1.00 20.83  ? 405  HIS B CE1 1 
ATOM   7256 N NE2 . HIS B 1 404 ? 111.854 40.756 14.134  1.00 26.25  ? 405  HIS B NE2 1 
ATOM   7257 N N   . ASN B 1 405 ? 109.140 43.500 17.507  1.00 19.27  ? 406  ASN B N   1 
ATOM   7258 C CA  . ASN B 1 405 ? 109.222 42.592 18.642  1.00 22.55  ? 406  ASN B CA  1 
ATOM   7259 C C   . ASN B 1 405 ? 108.057 42.705 19.616  1.00 24.17  ? 406  ASN B C   1 
ATOM   7260 O O   . ASN B 1 405 ? 107.723 41.706 20.260  1.00 24.80  ? 406  ASN B O   1 
ATOM   7261 C CB  . ASN B 1 405 ? 110.545 42.807 19.396  1.00 20.81  ? 406  ASN B CB  1 
ATOM   7262 C CG  . ASN B 1 405 ? 111.746 42.370 18.580  1.00 23.06  ? 406  ASN B CG  1 
ATOM   7263 O OD1 . ASN B 1 405 ? 111.939 41.178 18.344  1.00 25.30  ? 406  ASN B OD1 1 
ATOM   7264 N ND2 . ASN B 1 405 ? 112.552 43.331 18.132  1.00 19.16  ? 406  ASN B ND2 1 
ATOM   7265 N N   . VAL B 1 406 ? 107.416 43.872 19.745  1.00 18.92  ? 407  VAL B N   1 
ATOM   7266 C CA  . VAL B 1 406 ? 106.407 44.039 20.791  1.00 21.26  ? 407  VAL B CA  1 
ATOM   7267 C C   . VAL B 1 406 ? 105.072 44.535 20.246  1.00 22.36  ? 407  VAL B C   1 
ATOM   7268 O O   . VAL B 1 406 ? 104.048 43.856 20.387  1.00 24.15  ? 407  VAL B O   1 
ATOM   7269 C CB  . VAL B 1 406 ? 106.904 44.989 21.899  1.00 23.64  ? 407  VAL B CB  1 
ATOM   7270 C CG1 . VAL B 1 406 ? 105.841 45.122 22.987  1.00 20.25  ? 407  VAL B CG1 1 
ATOM   7271 C CG2 . VAL B 1 406 ? 108.212 44.485 22.488  1.00 20.98  ? 407  VAL B CG2 1 
ATOM   7272 N N   . VAL B 1 407 ? 105.067 45.729 19.641  1.00 19.94  ? 408  VAL B N   1 
ATOM   7273 C CA  . VAL B 1 407 ? 103.805 46.392 19.307  1.00 24.03  ? 408  VAL B CA  1 
ATOM   7274 C C   . VAL B 1 407 ? 102.995 45.563 18.315  1.00 25.14  ? 408  VAL B C   1 
ATOM   7275 O O   . VAL B 1 407 ? 101.790 45.345 18.494  1.00 22.47  ? 408  VAL B O   1 
ATOM   7276 C CB  . VAL B 1 407 ? 104.061 47.807 18.756  1.00 24.38  ? 408  VAL B CB  1 
ATOM   7277 C CG1 . VAL B 1 407 ? 102.729 48.488 18.439  1.00 18.71  ? 408  VAL B CG1 1 
ATOM   7278 C CG2 . VAL B 1 407 ? 104.871 48.628 19.746  1.00 17.37  ? 408  VAL B CG2 1 
ATOM   7279 N N   . CYS B 1 408 ? 103.626 45.116 17.247  1.00 16.19  ? 409  CYS B N   1 
ATOM   7280 C CA  . CYS B 1 408 ? 102.831 44.437 16.231  1.00 19.91  ? 409  CYS B CA  1 
ATOM   7281 C C   . CYS B 1 408 ? 102.449 43.012 16.636  1.00 23.33  ? 409  CYS B C   1 
ATOM   7282 O O   . CYS B 1 408 ? 101.339 42.568 16.306  1.00 21.30  ? 409  CYS B O   1 
ATOM   7283 C CB  . CYS B 1 408 ? 103.567 44.470 14.892  1.00 20.41  ? 409  CYS B CB  1 
ATOM   7284 S SG  . CYS B 1 408 ? 103.799 46.185 14.324  1.00 25.25  ? 409  CYS B SG  1 
ATOM   7285 N N   . PRO B 1 409 ? 103.302 42.254 17.342  1.00 23.51  ? 410  PRO B N   1 
ATOM   7286 C CA  . PRO B 1 409 ? 102.791 40.995 17.914  1.00 23.39  ? 410  PRO B CA  1 
ATOM   7287 C C   . PRO B 1 409 ? 101.625 41.213 18.865  1.00 22.49  ? 410  PRO B C   1 
ATOM   7288 O O   . PRO B 1 409 ? 100.653 40.450 18.821  1.00 21.28  ? 410  PRO B O   1 
ATOM   7289 C CB  . PRO B 1 409 ? 104.021 40.407 18.622  1.00 20.79  ? 410  PRO B CB  1 
ATOM   7290 C CG  . PRO B 1 409 ? 105.175 40.932 17.833  1.00 20.25  ? 410  PRO B CG  1 
ATOM   7291 C CD  . PRO B 1 409 ? 104.772 42.343 17.473  1.00 17.96  ? 410  PRO B CD  1 
ATOM   7292 N N   . VAL B 1 410 ? 101.682 42.248 19.709  1.00 20.64  ? 411  VAL B N   1 
ATOM   7293 C CA  . VAL B 1 410 ? 100.563 42.538 20.603  1.00 21.08  ? 411  VAL B CA  1 
ATOM   7294 C C   . VAL B 1 410 ? 99.324  42.932 19.805  1.00 25.25  ? 411  VAL B C   1 
ATOM   7295 O O   . VAL B 1 410 ? 98.209  42.489 20.110  1.00 24.54  ? 411  VAL B O   1 
ATOM   7296 C CB  . VAL B 1 410 ? 100.956 43.623 21.626  1.00 21.84  ? 411  VAL B CB  1 
ATOM   7297 C CG1 . VAL B 1 410 ? 99.722  44.159 22.345  1.00 21.30  ? 411  VAL B CG1 1 
ATOM   7298 C CG2 . VAL B 1 410 ? 101.938 43.055 22.651  1.00 15.91  ? 411  VAL B CG2 1 
ATOM   7299 N N   . ALA B 1 411 ? 99.497  43.752 18.760  1.00 21.62  ? 412  ALA B N   1 
ATOM   7300 C CA  . ALA B 1 411 ? 98.348  44.178 17.962  1.00 23.56  ? 412  ALA B CA  1 
ATOM   7301 C C   . ALA B 1 411 ? 97.708  43.000 17.238  1.00 21.17  ? 412  ALA B C   1 
ATOM   7302 O O   . ALA B 1 411 ? 96.478  42.919 17.132  1.00 25.06  ? 412  ALA B O   1 
ATOM   7303 C CB  . ALA B 1 411 ? 98.764  45.260 16.958  1.00 23.27  ? 412  ALA B CB  1 
ATOM   7304 N N   . GLN B 1 412 ? 98.523  42.079 16.729  1.00 26.43  ? 413  GLN B N   1 
ATOM   7305 C CA  . GLN B 1 412 ? 97.979  40.899 16.064  1.00 24.30  ? 413  GLN B CA  1 
ATOM   7306 C C   . GLN B 1 412 ? 97.188  40.043 17.041  1.00 25.46  ? 413  GLN B C   1 
ATOM   7307 O O   . GLN B 1 412 ? 96.060  39.631 16.750  1.00 24.55  ? 413  GLN B O   1 
ATOM   7308 C CB  . GLN B 1 412 ? 99.105  40.085 15.436  1.00 21.72  ? 413  GLN B CB  1 
ATOM   7309 C CG  . GLN B 1 412 ? 98.652  38.774 14.827  1.00 28.80  ? 413  GLN B CG  1 
ATOM   7310 C CD  . GLN B 1 412 ? 99.775  38.080 14.087  1.00 42.44  ? 413  GLN B CD  1 
ATOM   7311 O OE1 . GLN B 1 412 ? 100.704 37.548 14.700  1.00 46.95  ? 413  GLN B OE1 1 
ATOM   7312 N NE2 . GLN B 1 412 ? 99.706  38.094 12.764  1.00 45.92  ? 413  GLN B NE2 1 
ATOM   7313 N N   . LEU B 1 413 ? 97.769  39.762 18.209  1.00 24.50  ? 414  LEU B N   1 
ATOM   7314 C CA  . LEU B 1 413 ? 97.044  39.023 19.237  1.00 22.08  ? 414  LEU B CA  1 
ATOM   7315 C C   . LEU B 1 413 ? 95.726  39.714 19.575  1.00 21.78  ? 414  LEU B C   1 
ATOM   7316 O O   . LEU B 1 413 ? 94.668  39.077 19.612  1.00 21.34  ? 414  LEU B O   1 
ATOM   7317 C CB  . LEU B 1 413 ? 97.921  38.870 20.483  1.00 21.55  ? 414  LEU B CB  1 
ATOM   7318 C CG  . LEU B 1 413 ? 97.296  38.169 21.701  1.00 29.72  ? 414  LEU B CG  1 
ATOM   7319 C CD1 . LEU B 1 413 ? 98.322  37.333 22.426  1.00 28.57  ? 414  LEU B CD1 1 
ATOM   7320 C CD2 . LEU B 1 413 ? 96.709  39.194 22.664  1.00 35.04  ? 414  LEU B CD2 1 
ATOM   7321 N N   . ALA B 1 414 ? 95.775  41.028 19.807  1.00 19.73  ? 415  ALA B N   1 
ATOM   7322 C CA  . ALA B 1 414 ? 94.575  41.765 20.199  1.00 23.03  ? 415  ALA B CA  1 
ATOM   7323 C C   . ALA B 1 414 ? 93.494  41.680 19.126  1.00 27.49  ? 415  ALA B C   1 
ATOM   7324 O O   . ALA B 1 414 ? 92.316  41.441 19.427  1.00 27.83  ? 415  ALA B O   1 
ATOM   7325 C CB  . ALA B 1 414 ? 94.939  43.222 20.490  1.00 16.80  ? 415  ALA B CB  1 
ATOM   7326 N N   . GLY B 1 415 ? 93.877  41.866 17.862  1.00 28.55  ? 416  GLY B N   1 
ATOM   7327 C CA  . GLY B 1 415 ? 92.889  41.854 16.792  1.00 24.29  ? 416  GLY B CA  1 
ATOM   7328 C C   . GLY B 1 415 ? 92.294  40.480 16.547  1.00 24.42  ? 416  GLY B C   1 
ATOM   7329 O O   . GLY B 1 415 ? 91.085  40.348 16.344  1.00 33.39  ? 416  GLY B O   1 
ATOM   7330 N N   . ARG B 1 416 ? 93.130  39.437 16.560  1.00 24.75  ? 417  ARG B N   1 
ATOM   7331 C CA  . ARG B 1 416 ? 92.609  38.088 16.345  1.00 24.23  ? 417  ARG B CA  1 
ATOM   7332 C C   . ARG B 1 416 ? 91.708  37.651 17.493  1.00 31.24  ? 417  ARG B C   1 
ATOM   7333 O O   . ARG B 1 416 ? 90.625  37.103 17.258  1.00 33.81  ? 417  ARG B O   1 
ATOM   7334 C CB  . ARG B 1 416 ? 93.754  37.094 16.167  1.00 26.69  ? 417  ARG B CB  1 
ATOM   7335 C CG  . ARG B 1 416 ? 94.709  37.448 15.046  1.00 34.80  ? 417  ARG B CG  1 
ATOM   7336 C CD  . ARG B 1 416 ? 93.972  37.806 13.774  1.00 39.90  ? 417  ARG B CD  1 
ATOM   7337 N NE  . ARG B 1 416 ? 93.741  36.639 12.935  1.00 55.13  ? 417  ARG B NE  1 
ATOM   7338 C CZ  . ARG B 1 416 ? 92.548  36.228 12.523  1.00 64.92  ? 417  ARG B CZ  1 
ATOM   7339 N NH1 . ARG B 1 416 ? 91.450  36.893 12.862  1.00 69.57  ? 417  ARG B NH1 1 
ATOM   7340 N NH2 . ARG B 1 416 ? 92.460  35.153 11.755  1.00 63.87  ? 417  ARG B NH2 1 
ATOM   7341 N N   . LEU B 1 417 ? 92.130  37.887 18.741  1.00 23.13  ? 418  LEU B N   1 
ATOM   7342 C CA  . LEU B 1 417 ? 91.292  37.504 19.876  1.00 28.77  ? 418  LEU B CA  1 
ATOM   7343 C C   . LEU B 1 417 ? 89.951  38.225 19.832  1.00 23.43  ? 418  LEU B C   1 
ATOM   7344 O O   . LEU B 1 417 ? 88.895  37.602 19.994  1.00 29.86  ? 418  LEU B O   1 
ATOM   7345 C CB  . LEU B 1 417 ? 92.003  37.784 21.204  1.00 24.75  ? 418  LEU B CB  1 
ATOM   7346 C CG  . LEU B 1 417 ? 93.280  37.005 21.538  1.00 35.24  ? 418  LEU B CG  1 
ATOM   7347 C CD1 . LEU B 1 417 ? 93.656  37.160 23.012  1.00 32.33  ? 418  LEU B CD1 1 
ATOM   7348 C CD2 . LEU B 1 417 ? 93.156  35.555 21.169  1.00 40.27  ? 418  LEU B CD2 1 
ATOM   7349 N N   . ALA B 1 418 ? 89.977  39.545 19.615  1.00 23.35  ? 419  ALA B N   1 
ATOM   7350 C CA  . ALA B 1 418 ? 88.738  40.323 19.569  1.00 25.30  ? 419  ALA B CA  1 
ATOM   7351 C C   . ALA B 1 418 ? 87.826  39.847 18.446  1.00 34.02  ? 419  ALA B C   1 
ATOM   7352 O O   . ALA B 1 418 ? 86.614  39.691 18.641  1.00 38.29  ? 419  ALA B O   1 
ATOM   7353 C CB  . ALA B 1 418 ? 89.047  41.813 19.401  1.00 21.15  ? 419  ALA B CB  1 
ATOM   7354 N N   . ALA B 1 419 ? 88.390  39.625 17.254  1.00 34.12  ? 420  ALA B N   1 
ATOM   7355 C CA  . ALA B 1 419 ? 87.575  39.172 16.130  1.00 37.93  ? 420  ALA B CA  1 
ATOM   7356 C C   . ALA B 1 419 ? 87.038  37.766 16.344  1.00 38.60  ? 420  ALA B C   1 
ATOM   7357 O O   . ALA B 1 419 ? 86.082  37.373 15.671  1.00 41.88  ? 420  ALA B O   1 
ATOM   7358 C CB  . ALA B 1 419 ? 88.376  39.222 14.824  1.00 28.97  ? 420  ALA B CB  1 
ATOM   7359 N N   . GLN B 1 420 ? 87.625  37.003 17.265  1.00 36.03  ? 421  GLN B N   1 
ATOM   7360 C CA  . GLN B 1 420 ? 87.208  35.629 17.509  1.00 32.72  ? 421  GLN B CA  1 
ATOM   7361 C C   . GLN B 1 420 ? 86.566  35.443 18.879  1.00 32.10  ? 421  GLN B C   1 
ATOM   7362 O O   . GLN B 1 420 ? 86.589  34.335 19.426  1.00 33.76  ? 421  GLN B O   1 
ATOM   7363 C CB  . GLN B 1 420 ? 88.394  34.685 17.321  1.00 26.51  ? 421  GLN B CB  1 
ATOM   7364 C CG  . GLN B 1 420 ? 88.780  34.572 15.852  1.00 37.96  ? 421  GLN B CG  1 
ATOM   7365 C CD  . GLN B 1 420 ? 90.242  34.233 15.638  1.00 43.39  ? 421  GLN B CD  1 
ATOM   7366 O OE1 . GLN B 1 420 ? 90.940  34.919 14.899  1.00 42.30  ? 421  GLN B OE1 1 
ATOM   7367 N NE2 . GLN B 1 420 ? 90.707  33.171 16.275  1.00 46.90  ? 421  GLN B NE2 1 
ATOM   7368 N N   . GLY B 1 421 ? 85.991  36.506 19.442  1.00 29.65  ? 422  GLY B N   1 
ATOM   7369 C CA  . GLY B 1 421 ? 85.041  36.389 20.531  1.00 32.31  ? 422  GLY B CA  1 
ATOM   7370 C C   . GLY B 1 421 ? 85.529  36.844 21.884  1.00 33.05  ? 422  GLY B C   1 
ATOM   7371 O O   . GLY B 1 421 ? 84.730  36.863 22.827  1.00 32.96  ? 422  GLY B O   1 
ATOM   7372 N N   . ALA B 1 422 ? 86.805  37.194 22.025  1.00 30.21  ? 423  ALA B N   1 
ATOM   7373 C CA  . ALA B 1 422 ? 87.307  37.701 23.292  1.00 30.96  ? 423  ALA B CA  1 
ATOM   7374 C C   . ALA B 1 422 ? 86.932  39.168 23.466  1.00 27.93  ? 423  ALA B C   1 
ATOM   7375 O O   . ALA B 1 422 ? 86.776  39.910 22.494  1.00 26.08  ? 423  ALA B O   1 
ATOM   7376 C CB  . ALA B 1 422 ? 88.826  37.540 23.375  1.00 29.62  ? 423  ALA B CB  1 
ATOM   7377 N N   . ARG B 1 423 ? 86.780  39.584 24.720  1.00 26.94  ? 424  ARG B N   1 
ATOM   7378 C CA  . ARG B 1 423 ? 86.670  41.000 25.039  1.00 29.65  ? 424  ARG B CA  1 
ATOM   7379 C C   . ARG B 1 423 ? 88.058  41.513 25.408  1.00 29.87  ? 424  ARG B C   1 
ATOM   7380 O O   . ARG B 1 423 ? 88.663  41.043 26.379  1.00 29.34  ? 424  ARG B O   1 
ATOM   7381 C CB  . ARG B 1 423 ? 85.671  41.254 26.168  1.00 27.53  ? 424  ARG B CB  1 
ATOM   7382 C CG  . ARG B 1 423 ? 85.270  42.725 26.268  1.00 33.73  ? 424  ARG B CG  1 
ATOM   7383 C CD  . ARG B 1 423 ? 83.965  42.941 27.031  1.00 52.75  ? 424  ARG B CD  1 
ATOM   7384 N NE  . ARG B 1 423 ? 84.168  42.973 28.480  1.00 61.77  ? 424  ARG B NE  1 
ATOM   7385 C CZ  . ARG B 1 423 ? 83.643  42.100 29.335  1.00 59.54  ? 424  ARG B CZ  1 
ATOM   7386 N NH1 . ARG B 1 423 ? 82.865  41.121 28.896  1.00 57.48  ? 424  ARG B NH1 1 
ATOM   7387 N NH2 . ARG B 1 423 ? 83.887  42.214 30.632  1.00 61.18  ? 424  ARG B NH2 1 
ATOM   7388 N N   . VAL B 1 424 ? 88.555  42.473 24.631  1.00 30.53  ? 425  VAL B N   1 
ATOM   7389 C CA  . VAL B 1 424 ? 89.936  42.936 24.704  1.00 25.28  ? 425  VAL B CA  1 
ATOM   7390 C C   . VAL B 1 424 ? 89.949  44.404 25.104  1.00 26.33  ? 425  VAL B C   1 
ATOM   7391 O O   . VAL B 1 424 ? 89.213  45.214 24.529  1.00 28.19  ? 425  VAL B O   1 
ATOM   7392 C CB  . VAL B 1 424 ? 90.661  42.750 23.359  1.00 22.80  ? 425  VAL B CB  1 
ATOM   7393 C CG1 . VAL B 1 424 ? 92.118  43.208 23.462  1.00 17.47  ? 425  VAL B CG1 1 
ATOM   7394 C CG2 . VAL B 1 424 ? 90.564  41.298 22.892  1.00 20.36  ? 425  VAL B CG2 1 
ATOM   7395 N N   . TYR B 1 425 ? 90.806  44.747 26.062  1.00 21.29  ? 426  TYR B N   1 
ATOM   7396 C CA  . TYR B 1 425 ? 91.118  46.132 26.396  1.00 25.56  ? 426  TYR B CA  1 
ATOM   7397 C C   . TYR B 1 425 ? 92.590  46.398 26.100  1.00 28.93  ? 426  TYR B C   1 
ATOM   7398 O O   . TYR B 1 425 ? 93.456  45.613 26.501  1.00 33.35  ? 426  TYR B O   1 
ATOM   7399 C CB  . TYR B 1 425 ? 90.792  46.426 27.866  1.00 20.17  ? 426  TYR B CB  1 
ATOM   7400 C CG  . TYR B 1 425 ? 89.325  46.243 28.175  1.00 22.28  ? 426  TYR B CG  1 
ATOM   7401 C CD1 . TYR B 1 425 ? 88.424  47.300 28.035  1.00 21.77  ? 426  TYR B CD1 1 
ATOM   7402 C CD2 . TYR B 1 425 ? 88.830  45.008 28.573  1.00 24.39  ? 426  TYR B CD2 1 
ATOM   7403 C CE1 . TYR B 1 425 ? 87.065  47.129 28.301  1.00 21.56  ? 426  TYR B CE1 1 
ATOM   7404 C CE2 . TYR B 1 425 ? 87.478  44.826 28.846  1.00 23.18  ? 426  TYR B CE2 1 
ATOM   7405 C CZ  . TYR B 1 425 ? 86.605  45.886 28.707  1.00 24.21  ? 426  TYR B CZ  1 
ATOM   7406 O OH  . TYR B 1 425 ? 85.271  45.698 28.972  1.00 26.57  ? 426  TYR B OH  1 
ATOM   7407 N N   . ALA B 1 426 ? 92.870  47.498 25.397  1.00 25.13  ? 427  ALA B N   1 
ATOM   7408 C CA  . ALA B 1 426 ? 94.226  47.848 24.990  1.00 25.83  ? 427  ALA B CA  1 
ATOM   7409 C C   . ALA B 1 426 ? 94.616  49.223 25.522  1.00 27.73  ? 427  ALA B C   1 
ATOM   7410 O O   . ALA B 1 426 ? 93.782  50.129 25.622  1.00 22.99  ? 427  ALA B O   1 
ATOM   7411 C CB  . ALA B 1 426 ? 94.371  47.833 23.456  1.00 19.99  ? 427  ALA B CB  1 
ATOM   7412 N N   . TYR B 1 427 ? 95.901  49.375 25.848  1.00 22.72  ? 428  TYR B N   1 
ATOM   7413 C CA  . TYR B 1 427 ? 96.430  50.631 26.362  1.00 22.11  ? 428  TYR B CA  1 
ATOM   7414 C C   . TYR B 1 427 ? 97.795  50.912 25.746  1.00 23.00  ? 428  TYR B C   1 
ATOM   7415 O O   . TYR B 1 427 ? 98.504  50.005 25.306  1.00 19.80  ? 428  TYR B O   1 
ATOM   7416 C CB  . TYR B 1 427 ? 96.565  50.618 27.903  1.00 21.30  ? 428  TYR B CB  1 
ATOM   7417 C CG  . TYR B 1 427 ? 97.610  49.649 28.416  1.00 23.14  ? 428  TYR B CG  1 
ATOM   7418 C CD1 . TYR B 1 427 ? 98.961  49.997 28.438  1.00 20.82  ? 428  TYR B CD1 1 
ATOM   7419 C CD2 . TYR B 1 427 ? 97.249  48.383 28.878  1.00 19.19  ? 428  TYR B CD2 1 
ATOM   7420 C CE1 . TYR B 1 427 ? 99.920  49.117 28.885  1.00 21.57  ? 428  TYR B CE1 1 
ATOM   7421 C CE2 . TYR B 1 427 ? 98.211  47.490 29.337  1.00 19.51  ? 428  TYR B CE2 1 
ATOM   7422 C CZ  . TYR B 1 427 ? 99.544  47.867 29.338  1.00 23.35  ? 428  TYR B CZ  1 
ATOM   7423 O OH  . TYR B 1 427 ? 100.516 46.994 29.772  1.00 25.89  ? 428  TYR B OH  1 
ATOM   7424 N N   . VAL B 1 428 ? 98.170  52.186 25.749  1.00 23.09  ? 429  VAL B N   1 
ATOM   7425 C CA  . VAL B 1 428 ? 99.552  52.603 25.545  1.00 22.71  ? 429  VAL B CA  1 
ATOM   7426 C C   . VAL B 1 428 ? 99.944  53.432 26.755  1.00 25.78  ? 429  VAL B C   1 
ATOM   7427 O O   . VAL B 1 428 ? 99.272  54.419 27.080  1.00 28.21  ? 429  VAL B O   1 
ATOM   7428 C CB  . VAL B 1 428 ? 99.748  53.401 24.247  1.00 28.40  ? 429  VAL B CB  1 
ATOM   7429 C CG1 . VAL B 1 428 ? 101.205 53.851 24.127  1.00 24.19  ? 429  VAL B CG1 1 
ATOM   7430 C CG2 . VAL B 1 428 ? 99.370  52.555 23.049  1.00 27.76  ? 429  VAL B CG2 1 
ATOM   7431 N N   . PHE B 1 429 ? 101.013 53.021 27.431  1.00 26.28  ? 430  PHE B N   1 
ATOM   7432 C CA  . PHE B 1 429 ? 101.481 53.693 28.636  1.00 27.15  ? 430  PHE B CA  1 
ATOM   7433 C C   . PHE B 1 429 ? 102.428 54.814 28.224  1.00 29.10  ? 430  PHE B C   1 
ATOM   7434 O O   . PHE B 1 429 ? 103.458 54.559 27.592  1.00 24.10  ? 430  PHE B O   1 
ATOM   7435 C CB  . PHE B 1 429 ? 102.167 52.693 29.564  1.00 25.61  ? 430  PHE B CB  1 
ATOM   7436 C CG  . PHE B 1 429 ? 102.636 53.286 30.855  1.00 30.24  ? 430  PHE B CG  1 
ATOM   7437 C CD1 . PHE B 1 429 ? 101.786 53.355 31.947  1.00 31.05  ? 430  PHE B CD1 1 
ATOM   7438 C CD2 . PHE B 1 429 ? 103.933 53.755 30.985  1.00 29.03  ? 430  PHE B CD2 1 
ATOM   7439 C CE1 . PHE B 1 429 ? 102.215 53.895 33.146  1.00 32.63  ? 430  PHE B CE1 1 
ATOM   7440 C CE2 . PHE B 1 429 ? 104.369 54.298 32.178  1.00 34.32  ? 430  PHE B CE2 1 
ATOM   7441 C CZ  . PHE B 1 429 ? 103.509 54.370 33.261  1.00 31.26  ? 430  PHE B CZ  1 
ATOM   7442 N N   . GLU B 1 430 ? 102.082 56.055 28.572  1.00 26.92  ? 431  GLU B N   1 
ATOM   7443 C CA  . GLU B 1 430 ? 102.773 57.199 27.992  1.00 31.67  ? 431  GLU B CA  1 
ATOM   7444 C C   . GLU B 1 430 ? 103.368 58.140 29.027  1.00 35.28  ? 431  GLU B C   1 
ATOM   7445 O O   . GLU B 1 430 ? 103.746 59.260 28.672  1.00 37.10  ? 431  GLU B O   1 
ATOM   7446 C CB  . GLU B 1 430 ? 101.829 57.985 27.072  1.00 26.94  ? 431  GLU B CB  1 
ATOM   7447 C CG  . GLU B 1 430 ? 101.281 57.158 25.924  1.00 36.52  ? 431  GLU B CG  1 
ATOM   7448 C CD  . GLU B 1 430 ? 100.807 58.011 24.762  1.00 46.68  ? 431  GLU B CD  1 
ATOM   7449 O OE1 . GLU B 1 430 ? 101.223 57.739 23.619  1.00 58.42  ? 431  GLU B OE1 1 
ATOM   7450 O OE2 . GLU B 1 430 ? 100.030 58.959 24.993  1.00 49.83  ? 431  GLU B OE2 1 
ATOM   7451 N N   . HIS B 1 431 ? 103.462 57.732 30.288  1.00 34.00  ? 432  HIS B N   1 
ATOM   7452 C CA  . HIS B 1 431 ? 104.040 58.580 31.321  1.00 31.51  ? 432  HIS B CA  1 
ATOM   7453 C C   . HIS B 1 431 ? 105.485 58.182 31.589  1.00 31.20  ? 432  HIS B C   1 
ATOM   7454 O O   . HIS B 1 431 ? 105.773 57.020 31.888  1.00 34.36  ? 432  HIS B O   1 
ATOM   7455 C CB  . HIS B 1 431 ? 103.246 58.513 32.623  1.00 28.66  ? 432  HIS B CB  1 
ATOM   7456 C CG  . HIS B 1 431 ? 103.884 59.283 33.734  1.00 32.47  ? 432  HIS B CG  1 
ATOM   7457 N ND1 . HIS B 1 431 ? 103.969 60.658 33.728  1.00 34.50  ? 432  HIS B ND1 1 
ATOM   7458 C CD2 . HIS B 1 431 ? 104.507 58.872 34.865  1.00 29.06  ? 432  HIS B CD2 1 
ATOM   7459 C CE1 . HIS B 1 431 ? 104.593 61.063 34.820  1.00 34.45  ? 432  HIS B CE1 1 
ATOM   7460 N NE2 . HIS B 1 431 ? 104.932 59.999 35.525  1.00 32.24  ? 432  HIS B NE2 1 
ATOM   7461 N N   . ARG B 1 432 ? 106.384 59.154 31.498  1.00 29.69  ? 433  ARG B N   1 
ATOM   7462 C CA  . ARG B 1 432 ? 107.782 58.957 31.846  1.00 32.13  ? 433  ARG B CA  1 
ATOM   7463 C C   . ARG B 1 432 ? 107.964 59.296 33.322  1.00 34.72  ? 433  ARG B C   1 
ATOM   7464 O O   . ARG B 1 432 ? 107.684 60.423 33.744  1.00 34.93  ? 433  ARG B O   1 
ATOM   7465 C CB  . ARG B 1 432 ? 108.680 59.823 30.961  1.00 34.45  ? 433  ARG B CB  1 
ATOM   7466 C CG  . ARG B 1 432 ? 110.153 59.644 31.231  1.00 42.18  ? 433  ARG B CG  1 
ATOM   7467 C CD  . ARG B 1 432 ? 111.020 60.479 30.305  1.00 36.15  ? 433  ARG B CD  1 
ATOM   7468 N NE  . ARG B 1 432 ? 112.363 60.621 30.860  1.00 36.24  ? 433  ARG B NE  1 
ATOM   7469 C CZ  . ARG B 1 432 ? 113.425 59.927 30.464  1.00 36.20  ? 433  ARG B CZ  1 
ATOM   7470 N NH1 . ARG B 1 432 ? 113.322 59.038 29.481  1.00 33.53  ? 433  ARG B NH1 1 
ATOM   7471 N NH2 . ARG B 1 432 ? 114.600 60.135 31.047  1.00 35.07  ? 433  ARG B NH2 1 
ATOM   7472 N N   . ALA B 1 433 ? 108.408 58.315 34.105  1.00 30.75  ? 434  ALA B N   1 
ATOM   7473 C CA  . ALA B 1 433 ? 108.555 58.512 35.541  1.00 31.11  ? 434  ALA B CA  1 
ATOM   7474 C C   . ALA B 1 433 ? 109.501 59.670 35.831  1.00 34.34  ? 434  ALA B C   1 
ATOM   7475 O O   . ALA B 1 433 ? 110.535 59.826 35.177  1.00 32.20  ? 434  ALA B O   1 
ATOM   7476 C CB  . ALA B 1 433 ? 109.070 57.231 36.199  1.00 25.06  ? 434  ALA B CB  1 
ATOM   7477 N N   . SER B 1 434 ? 109.135 60.498 36.817  1.00 32.82  ? 435  SER B N   1 
ATOM   7478 C CA  . SER B 1 434 ? 109.992 61.617 37.194  1.00 34.33  ? 435  SER B CA  1 
ATOM   7479 C C   . SER B 1 434 ? 111.340 61.143 37.718  1.00 37.90  ? 435  SER B C   1 
ATOM   7480 O O   . SER B 1 434 ? 112.304 61.914 37.716  1.00 35.91  ? 435  SER B O   1 
ATOM   7481 C CB  . SER B 1 434 ? 109.308 62.480 38.255  1.00 40.72  ? 435  SER B CB  1 
ATOM   7482 O OG  . SER B 1 434 ? 109.213 61.779 39.490  1.00 40.83  ? 435  SER B OG  1 
ATOM   7483 N N   . THR B 1 435 ? 111.416 59.894 38.165  1.00 37.01  ? 436  THR B N   1 
ATOM   7484 C CA  . THR B 1 435 ? 112.610 59.301 38.746  1.00 37.29  ? 436  THR B CA  1 
ATOM   7485 C C   . THR B 1 435 ? 113.428 58.501 37.739  1.00 33.19  ? 436  THR B C   1 
ATOM   7486 O O   . THR B 1 435 ? 114.451 57.921 38.114  1.00 37.59  ? 436  THR B O   1 
ATOM   7487 C CB  . THR B 1 435 ? 112.206 58.387 39.906  1.00 38.99  ? 436  THR B CB  1 
ATOM   7488 O OG1 . THR B 1 435 ? 111.180 57.486 39.455  1.00 35.86  ? 436  THR B OG1 1 
ATOM   7489 C CG2 . THR B 1 435 ? 111.671 59.206 41.070  1.00 38.34  ? 436  THR B CG2 1 
ATOM   7490 N N   . LEU B 1 436 ? 112.991 58.441 36.484  1.00 29.31  ? 437  LEU B N   1 
ATOM   7491 C CA  . LEU B 1 436 ? 113.621 57.573 35.499  1.00 30.96  ? 437  LEU B CA  1 
ATOM   7492 C C   . LEU B 1 436 ? 115.091 57.934 35.311  1.00 35.72  ? 437  LEU B C   1 
ATOM   7493 O O   . LEU B 1 436 ? 115.437 59.103 35.114  1.00 33.63  ? 437  LEU B O   1 
ATOM   7494 C CB  . LEU B 1 436 ? 112.871 57.678 34.174  1.00 31.26  ? 437  LEU B CB  1 
ATOM   7495 C CG  . LEU B 1 436 ? 113.175 56.638 33.096  1.00 36.69  ? 437  LEU B CG  1 
ATOM   7496 C CD1 . LEU B 1 436 ? 112.949 55.243 33.634  1.00 26.44  ? 437  LEU B CD1 1 
ATOM   7497 C CD2 . LEU B 1 436 ? 112.307 56.884 31.873  1.00 38.86  ? 437  LEU B CD2 1 
ATOM   7498 N N   . SER B 1 437 ? 115.959 56.924 35.385  1.00 33.96  ? 438  SER B N   1 
ATOM   7499 C CA  . SER B 1 437 ? 117.396 57.142 35.269  1.00 33.71  ? 438  SER B CA  1 
ATOM   7500 C C   . SER B 1 437 ? 117.914 57.028 33.840  1.00 32.96  ? 438  SER B C   1 
ATOM   7501 O O   . SER B 1 437 ? 119.035 57.474 33.575  1.00 34.46  ? 438  SER B O   1 
ATOM   7502 C CB  . SER B 1 437 ? 118.156 56.154 36.161  1.00 34.54  ? 438  SER B CB  1 
ATOM   7503 O OG  . SER B 1 437 ? 117.839 54.810 35.825  1.00 36.95  ? 438  SER B OG  1 
ATOM   7504 N N   . TRP B 1 438 ? 117.140 56.442 32.925  1.00 31.13  ? 439  TRP B N   1 
ATOM   7505 C CA  . TRP B 1 438 ? 117.549 56.356 31.528  1.00 33.54  ? 439  TRP B CA  1 
ATOM   7506 C C   . TRP B 1 438 ? 117.457 57.729 30.867  1.00 35.29  ? 439  TRP B C   1 
ATOM   7507 O O   . TRP B 1 438 ? 116.690 58.588 31.308  1.00 34.97  ? 439  TRP B O   1 
ATOM   7508 C CB  . TRP B 1 438 ? 116.672 55.360 30.771  1.00 32.62  ? 439  TRP B CB  1 
ATOM   7509 C CG  . TRP B 1 438 ? 116.841 53.944 31.193  1.00 30.04  ? 439  TRP B CG  1 
ATOM   7510 C CD1 . TRP B 1 438 ? 116.051 53.248 32.068  1.00 28.48  ? 439  TRP B CD1 1 
ATOM   7511 C CD2 . TRP B 1 438 ? 117.855 53.031 30.754  1.00 30.63  ? 439  TRP B CD2 1 
ATOM   7512 N NE1 . TRP B 1 438 ? 116.512 51.962 32.202  1.00 25.46  ? 439  TRP B NE1 1 
ATOM   7513 C CE2 . TRP B 1 438 ? 117.619 51.800 31.408  1.00 32.93  ? 439  TRP B CE2 1 
ATOM   7514 C CE3 . TRP B 1 438 ? 118.946 53.135 29.884  1.00 26.67  ? 439  TRP B CE3 1 
ATOM   7515 C CZ2 . TRP B 1 438 ? 118.435 50.680 31.216  1.00 26.34  ? 439  TRP B CZ2 1 
ATOM   7516 C CZ3 . TRP B 1 438 ? 119.755 52.020 29.693  1.00 27.46  ? 439  TRP B CZ3 1 
ATOM   7517 C CH2 . TRP B 1 438 ? 119.489 50.807 30.355  1.00 28.17  ? 439  TRP B CH2 1 
ATOM   7518 N N   . PRO B 1 439 ? 118.221 57.960 29.797  1.00 34.28  ? 440  PRO B N   1 
ATOM   7519 C CA  . PRO B 1 439 ? 118.240 59.292 29.187  1.00 35.42  ? 440  PRO B CA  1 
ATOM   7520 C C   . PRO B 1 439 ? 116.908 59.648 28.542  1.00 36.99  ? 440  PRO B C   1 
ATOM   7521 O O   . PRO B 1 439 ? 116.059 58.799 28.259  1.00 33.37  ? 440  PRO B O   1 
ATOM   7522 C CB  . PRO B 1 439 ? 119.353 59.188 28.139  1.00 37.11  ? 440  PRO B CB  1 
ATOM   7523 C CG  . PRO B 1 439 ? 119.373 57.750 27.776  1.00 35.41  ? 440  PRO B CG  1 
ATOM   7524 C CD  . PRO B 1 439 ? 119.103 57.027 29.072  1.00 33.76  ? 440  PRO B CD  1 
ATOM   7525 N N   . LEU B 1 440 ? 116.755 60.948 28.291  1.00 37.87  ? 441  LEU B N   1 
ATOM   7526 C CA  A LEU B 1 440 ? 115.492 61.468 27.783  0.64 41.03  ? 441  LEU B CA  1 
ATOM   7527 C CA  B LEU B 1 440 ? 115.493 61.475 27.781  0.36 41.17  ? 441  LEU B CA  1 
ATOM   7528 C C   . LEU B 1 440 ? 115.168 60.950 26.388  1.00 38.99  ? 441  LEU B C   1 
ATOM   7529 O O   . LEU B 1 440 ? 113.990 60.767 26.059  1.00 37.67  ? 441  LEU B O   1 
ATOM   7530 C CB  A LEU B 1 440 ? 115.528 62.994 27.780  0.64 45.82  ? 441  LEU B CB  1 
ATOM   7531 C CB  B LEU B 1 440 ? 115.534 63.003 27.766  0.36 45.74  ? 441  LEU B CB  1 
ATOM   7532 C CG  A LEU B 1 440 ? 114.707 63.649 28.885  0.64 49.24  ? 441  LEU B CG  1 
ATOM   7533 C CG  B LEU B 1 440 ? 114.330 63.685 27.113  0.36 48.71  ? 441  LEU B CG  1 
ATOM   7534 C CD1 A LEU B 1 440 ? 115.023 65.130 28.958  0.64 53.67  ? 441  LEU B CD1 1 
ATOM   7535 C CD1 B LEU B 1 440 ? 113.047 63.319 27.848  0.36 50.25  ? 441  LEU B CD1 1 
ATOM   7536 C CD2 A LEU B 1 440 ? 113.228 63.425 28.623  0.64 51.86  ? 441  LEU B CD2 1 
ATOM   7537 C CD2 B LEU B 1 440 ? 114.512 65.192 27.054  0.36 51.90  ? 441  LEU B CD2 1 
ATOM   7538 N N   . TRP B 1 441 ? 116.182 60.709 25.552  1.00 35.70  ? 442  TRP B N   1 
ATOM   7539 C CA  . TRP B 1 441 ? 115.880 60.267 24.196  1.00 35.70  ? 442  TRP B CA  1 
ATOM   7540 C C   . TRP B 1 441 ? 115.206 58.901 24.168  1.00 33.65  ? 442  TRP B C   1 
ATOM   7541 O O   . TRP B 1 441 ? 114.568 58.562 23.167  1.00 31.32  ? 442  TRP B O   1 
ATOM   7542 C CB  . TRP B 1 441 ? 117.144 60.268 23.323  1.00 34.91  ? 442  TRP B CB  1 
ATOM   7543 C CG  . TRP B 1 441 ? 118.169 59.209 23.618  1.00 32.54  ? 442  TRP B CG  1 
ATOM   7544 C CD1 . TRP B 1 441 ? 119.342 59.370 24.300  1.00 35.34  ? 442  TRP B CD1 1 
ATOM   7545 C CD2 . TRP B 1 441 ? 118.134 57.836 23.201  1.00 29.28  ? 442  TRP B CD2 1 
ATOM   7546 N NE1 . TRP B 1 441 ? 120.034 58.182 24.343  1.00 26.01  ? 442  TRP B NE1 1 
ATOM   7547 C CE2 . TRP B 1 441 ? 119.312 57.224 23.680  1.00 28.44  ? 442  TRP B CE2 1 
ATOM   7548 C CE3 . TRP B 1 441 ? 117.222 57.066 22.468  1.00 26.12  ? 442  TRP B CE3 1 
ATOM   7549 C CZ2 . TRP B 1 441 ? 119.597 55.877 23.460  1.00 30.65  ? 442  TRP B CZ2 1 
ATOM   7550 C CZ3 . TRP B 1 441 ? 117.504 55.729 22.252  1.00 29.41  ? 442  TRP B CZ3 1 
ATOM   7551 C CH2 . TRP B 1 441 ? 118.684 55.146 22.747  1.00 31.63  ? 442  TRP B CH2 1 
ATOM   7552 N N   . MET B 1 442 ? 115.307 58.119 25.245  1.00 30.96  ? 443  MET B N   1 
ATOM   7553 C CA  . MET B 1 442 ? 114.643 56.823 25.277  1.00 31.95  ? 443  MET B CA  1 
ATOM   7554 C C   . MET B 1 442 ? 113.145 56.922 25.536  1.00 28.94  ? 443  MET B C   1 
ATOM   7555 O O   . MET B 1 442 ? 112.449 55.911 25.398  1.00 26.49  ? 443  MET B O   1 
ATOM   7556 C CB  . MET B 1 442 ? 115.288 55.919 26.325  1.00 30.50  ? 443  MET B CB  1 
ATOM   7557 C CG  . MET B 1 442 ? 116.703 55.511 25.969  1.00 37.50  ? 443  MET B CG  1 
ATOM   7558 S SD  . MET B 1 442 ? 117.313 54.189 27.021  1.00 40.22  ? 443  MET B SD  1 
ATOM   7559 C CE  . MET B 1 442 ? 118.974 54.022 26.410  1.00 46.00  ? 443  MET B CE  1 
ATOM   7560 N N   . GLY B 1 443 ? 112.634 58.102 25.890  1.00 27.52  ? 444  GLY B N   1 
ATOM   7561 C CA  . GLY B 1 443 ? 111.192 58.268 26.016  1.00 28.46  ? 444  GLY B CA  1 
ATOM   7562 C C   . GLY B 1 443 ? 110.651 57.487 27.202  1.00 32.75  ? 444  GLY B C   1 
ATOM   7563 O O   . GLY B 1 443 ? 111.176 57.572 28.317  1.00 28.26  ? 444  GLY B O   1 
ATOM   7564 N N   . VAL B 1 444 ? 109.578 56.735 26.968  1.00 29.07  ? 445  VAL B N   1 
ATOM   7565 C CA  . VAL B 1 444 ? 109.014 55.836 27.974  1.00 26.53  ? 445  VAL B CA  1 
ATOM   7566 C C   . VAL B 1 444 ? 109.494 54.429 27.646  1.00 24.99  ? 445  VAL B C   1 
ATOM   7567 O O   . VAL B 1 444 ? 108.879 53.744 26.819  1.00 25.17  ? 445  VAL B O   1 
ATOM   7568 C CB  . VAL B 1 444 ? 107.480 55.912 28.009  1.00 29.75  ? 445  VAL B CB  1 
ATOM   7569 C CG1 . VAL B 1 444 ? 106.931 55.090 29.171  1.00 27.02  ? 445  VAL B CG1 1 
ATOM   7570 C CG2 . VAL B 1 444 ? 107.024 57.362 28.116  1.00 32.64  ? 445  VAL B CG2 1 
ATOM   7571 N N   . PRO B 1 445 ? 110.577 53.958 28.252  1.00 29.30  ? 446  PRO B N   1 
ATOM   7572 C CA  . PRO B 1 445 ? 111.194 52.713 27.795  1.00 25.73  ? 446  PRO B CA  1 
ATOM   7573 C C   . PRO B 1 445 ? 110.446 51.487 28.293  1.00 28.10  ? 446  PRO B C   1 
ATOM   7574 O O   . PRO B 1 445 ? 109.639 51.537 29.225  1.00 24.91  ? 446  PRO B O   1 
ATOM   7575 C CB  . PRO B 1 445 ? 112.608 52.765 28.395  1.00 23.17  ? 446  PRO B CB  1 
ATOM   7576 C CG  . PRO B 1 445 ? 112.756 54.165 28.977  1.00 24.10  ? 446  PRO B CG  1 
ATOM   7577 C CD  . PRO B 1 445 ? 111.354 54.577 29.332  1.00 27.72  ? 446  PRO B CD  1 
ATOM   7578 N N   . HIS B 1 446 ? 110.742 50.375 27.629  1.00 26.71  ? 447  HIS B N   1 
ATOM   7579 C CA  . HIS B 1 446 ? 110.223 49.070 28.004  1.00 28.05  ? 447  HIS B CA  1 
ATOM   7580 C C   . HIS B 1 446 ? 110.441 48.796 29.489  1.00 28.40  ? 447  HIS B C   1 
ATOM   7581 O O   . HIS B 1 446 ? 111.539 48.987 30.017  1.00 24.35  ? 447  HIS B O   1 
ATOM   7582 C CB  . HIS B 1 446 ? 110.922 48.013 27.149  1.00 28.23  ? 447  HIS B CB  1 
ATOM   7583 C CG  . HIS B 1 446 ? 110.558 46.604 27.488  1.00 35.26  ? 447  HIS B CG  1 
ATOM   7584 N ND1 . HIS B 1 446 ? 109.470 45.963 26.934  1.00 31.16  ? 447  HIS B ND1 1 
ATOM   7585 C CD2 . HIS B 1 446 ? 111.159 45.698 28.296  1.00 27.86  ? 447  HIS B CD2 1 
ATOM   7586 C CE1 . HIS B 1 446 ? 109.413 44.725 27.391  1.00 29.13  ? 447  HIS B CE1 1 
ATOM   7587 N NE2 . HIS B 1 446 ? 110.424 44.540 28.222  1.00 30.73  ? 447  HIS B NE2 1 
ATOM   7588 N N   . GLY B 1 447 ? 109.378 48.365 30.165  1.00 24.49  ? 448  GLY B N   1 
ATOM   7589 C CA  . GLY B 1 447 ? 109.448 47.966 31.553  1.00 24.07  ? 448  GLY B CA  1 
ATOM   7590 C C   . GLY B 1 447 ? 109.052 49.025 32.562  1.00 27.47  ? 448  GLY B C   1 
ATOM   7591 O O   . GLY B 1 447 ? 108.902 48.700 33.746  1.00 24.85  ? 448  GLY B O   1 
ATOM   7592 N N   . TYR B 1 448 ? 108.858 50.273 32.146  1.00 23.63  ? 449  TYR B N   1 
ATOM   7593 C CA  . TYR B 1 448 ? 108.720 51.344 33.120  1.00 27.59  ? 449  TYR B CA  1 
ATOM   7594 C C   . TYR B 1 448 ? 107.272 51.724 33.390  1.00 26.80  ? 449  TYR B C   1 
ATOM   7595 O O   . TYR B 1 448 ? 107.011 52.771 33.991  1.00 29.72  ? 449  TYR B O   1 
ATOM   7596 C CB  . TYR B 1 448 ? 109.593 52.527 32.698  1.00 23.91  ? 449  TYR B CB  1 
ATOM   7597 C CG  . TYR B 1 448 ? 110.996 52.099 32.994  1.00 24.20  ? 449  TYR B CG  1 
ATOM   7598 C CD1 . TYR B 1 448 ? 111.477 52.135 34.298  1.00 23.13  ? 449  TYR B CD1 1 
ATOM   7599 C CD2 . TYR B 1 448 ? 111.787 51.513 32.013  1.00 21.38  ? 449  TYR B CD2 1 
ATOM   7600 C CE1 . TYR B 1 448 ? 112.740 51.679 34.601  1.00 25.44  ? 449  TYR B CE1 1 
ATOM   7601 C CE2 . TYR B 1 448 ? 113.048 51.048 32.304  1.00 24.52  ? 449  TYR B CE2 1 
ATOM   7602 C CZ  . TYR B 1 448 ? 113.522 51.137 33.600  1.00 28.36  ? 449  TYR B CZ  1 
ATOM   7603 O OH  . TYR B 1 448 ? 114.779 50.666 33.899  1.00 29.62  ? 449  TYR B OH  1 
ATOM   7604 N N   . GLU B 1 449 ? 106.332 50.857 33.015  1.00 26.38  ? 450  GLU B N   1 
ATOM   7605 C CA  . GLU B 1 449 ? 104.985 50.918 33.558  1.00 23.09  ? 450  GLU B CA  1 
ATOM   7606 C C   . GLU B 1 449 ? 104.808 50.016 34.778  1.00 25.13  ? 450  GLU B C   1 
ATOM   7607 O O   . GLU B 1 449 ? 103.879 50.240 35.567  1.00 25.28  ? 450  GLU B O   1 
ATOM   7608 C CB  . GLU B 1 449 ? 103.966 50.535 32.478  1.00 21.88  ? 450  GLU B CB  1 
ATOM   7609 C CG  . GLU B 1 449 ? 103.610 49.046 32.422  1.00 26.84  ? 450  GLU B CG  1 
ATOM   7610 C CD  . GLU B 1 449 ? 104.705 48.168 31.822  1.00 31.35  ? 450  GLU B CD  1 
ATOM   7611 O OE1 . GLU B 1 449 ? 104.393 47.017 31.452  1.00 35.29  ? 450  GLU B OE1 1 
ATOM   7612 O OE2 . GLU B 1 449 ? 105.873 48.613 31.721  1.00 32.57  ? 450  GLU B OE2 1 
ATOM   7613 N N   . ILE B 1 450 ? 105.693 49.027 34.963  1.00 23.92  ? 451  ILE B N   1 
ATOM   7614 C CA  . ILE B 1 450 ? 105.515 48.026 36.018  1.00 24.84  ? 451  ILE B CA  1 
ATOM   7615 C C   . ILE B 1 450 ? 105.469 48.685 37.393  1.00 27.52  ? 451  ILE B C   1 
ATOM   7616 O O   . ILE B 1 450 ? 104.613 48.365 38.228  1.00 23.84  ? 451  ILE B O   1 
ATOM   7617 C CB  . ILE B 1 450 ? 106.635 46.970 35.957  1.00 25.06  ? 451  ILE B CB  1 
ATOM   7618 C CG1 . ILE B 1 450 ? 106.622 46.215 34.627  1.00 25.57  ? 451  ILE B CG1 1 
ATOM   7619 C CG2 . ILE B 1 450 ? 106.518 46.005 37.142  1.00 18.87  ? 451  ILE B CG2 1 
ATOM   7620 C CD1 . ILE B 1 450 ? 107.843 45.307 34.437  1.00 18.77  ? 451  ILE B CD1 1 
ATOM   7621 N N   . GLU B 1 451 ? 106.405 49.600 37.659  1.00 22.15  ? 452  GLU B N   1 
ATOM   7622 C CA  . GLU B 1 451 ? 106.463 50.224 38.978  1.00 26.94  ? 452  GLU B CA  1 
ATOM   7623 C C   . GLU B 1 451 ? 105.172 50.959 39.310  1.00 25.98  ? 452  GLU B C   1 
ATOM   7624 O O   . GLU B 1 451 ? 104.817 51.084 40.488  1.00 29.22  ? 452  GLU B O   1 
ATOM   7625 C CB  . GLU B 1 451 ? 107.657 51.177 39.063  1.00 23.11  ? 452  GLU B CB  1 
ATOM   7626 C CG  . GLU B 1 451 ? 107.650 52.279 38.011  1.00 27.62  ? 452  GLU B CG  1 
ATOM   7627 C CD  . GLU B 1 451 ? 109.031 52.879 37.805  1.00 35.87  ? 452  GLU B CD  1 
ATOM   7628 O OE1 . GLU B 1 451 ? 109.249 54.039 38.212  1.00 36.83  ? 452  GLU B OE1 1 
ATOM   7629 O OE2 . GLU B 1 451 ? 109.905 52.175 37.256  1.00 34.08  ? 452  GLU B OE2 1 
ATOM   7630 N N   . PHE B 1 452 ? 104.452 51.440 38.295  1.00 24.27  ? 453  PHE B N   1 
ATOM   7631 C CA  . PHE B 1 452 ? 103.180 52.102 38.558  1.00 26.18  ? 453  PHE B CA  1 
ATOM   7632 C C   . PHE B 1 452 ? 102.056 51.089 38.782  1.00 29.90  ? 453  PHE B C   1 
ATOM   7633 O O   . PHE B 1 452 ? 101.224 51.276 39.680  1.00 25.92  ? 453  PHE B O   1 
ATOM   7634 C CB  . PHE B 1 452 ? 102.855 53.064 37.413  1.00 23.93  ? 453  PHE B CB  1 
ATOM   7635 C CG  . PHE B 1 452 ? 103.727 54.289 37.408  1.00 28.12  ? 453  PHE B CG  1 
ATOM   7636 C CD1 . PHE B 1 452 ? 104.897 54.323 36.669  1.00 26.18  ? 453  PHE B CD1 1 
ATOM   7637 C CD2 . PHE B 1 452 ? 103.396 55.391 38.183  1.00 30.51  ? 453  PHE B CD2 1 
ATOM   7638 C CE1 . PHE B 1 452 ? 105.713 55.446 36.683  1.00 29.00  ? 453  PHE B CE1 1 
ATOM   7639 C CE2 . PHE B 1 452 ? 104.209 56.518 38.207  1.00 28.80  ? 453  PHE B CE2 1 
ATOM   7640 C CZ  . PHE B 1 452 ? 105.368 56.542 37.461  1.00 27.79  ? 453  PHE B CZ  1 
ATOM   7641 N N   . ILE B 1 453 ? 102.032 50.007 37.992  1.00 21.32  ? 454  ILE B N   1 
ATOM   7642 C CA  . ILE B 1 453 ? 101.035 48.956 38.183  1.00 21.88  ? 454  ILE B CA  1 
ATOM   7643 C C   . ILE B 1 453 ? 101.126 48.376 39.588  1.00 25.64  ? 454  ILE B C   1 
ATOM   7644 O O   . ILE B 1 453 ? 100.109 48.032 40.201  1.00 26.96  ? 454  ILE B O   1 
ATOM   7645 C CB  . ILE B 1 453 ? 101.202 47.851 37.125  1.00 25.34  ? 454  ILE B CB  1 
ATOM   7646 C CG1 . ILE B 1 453 ? 101.148 48.425 35.704  1.00 32.50  ? 454  ILE B CG1 1 
ATOM   7647 C CG2 . ILE B 1 453 ? 100.156 46.753 37.337  1.00 23.32  ? 454  ILE B CG2 1 
ATOM   7648 C CD1 . ILE B 1 453 ? 99.886  49.189 35.411  1.00 39.22  ? 454  ILE B CD1 1 
ATOM   7649 N N   . PHE B 1 454 ? 102.341 48.245 40.117  1.00 23.50  ? 455  PHE B N   1 
ATOM   7650 C CA  . PHE B 1 454 ? 102.538 47.700 41.454  1.00 23.59  ? 455  PHE B CA  1 
ATOM   7651 C C   . PHE B 1 454 ? 102.462 48.755 42.550  1.00 25.42  ? 455  PHE B C   1 
ATOM   7652 O O   . PHE B 1 454 ? 102.653 48.419 43.723  1.00 24.60  ? 455  PHE B O   1 
ATOM   7653 C CB  . PHE B 1 454 ? 103.878 46.959 41.532  1.00 20.74  ? 455  PHE B CB  1 
ATOM   7654 C CG  . PHE B 1 454 ? 103.815 45.543 41.025  1.00 23.60  ? 455  PHE B CG  1 
ATOM   7655 C CD1 . PHE B 1 454 ? 103.923 45.268 39.669  1.00 22.09  ? 455  PHE B CD1 1 
ATOM   7656 C CD2 . PHE B 1 454 ? 103.628 44.487 41.905  1.00 24.05  ? 455  PHE B CD2 1 
ATOM   7657 C CE1 . PHE B 1 454 ? 103.854 43.964 39.198  1.00 23.35  ? 455  PHE B CE1 1 
ATOM   7658 C CE2 . PHE B 1 454 ? 103.561 43.179 41.441  1.00 28.09  ? 455  PHE B CE2 1 
ATOM   7659 C CZ  . PHE B 1 454 ? 103.681 42.917 40.084  1.00 28.33  ? 455  PHE B CZ  1 
ATOM   7660 N N   . GLY B 1 455 ? 102.182 50.012 42.204  1.00 26.07  ? 456  GLY B N   1 
ATOM   7661 C CA  . GLY B 1 455 ? 102.012 51.039 43.216  1.00 21.48  ? 456  GLY B CA  1 
ATOM   7662 C C   . GLY B 1 455 ? 103.271 51.415 43.966  1.00 27.87  ? 456  GLY B C   1 
ATOM   7663 O O   . GLY B 1 455 ? 103.183 51.958 45.072  1.00 24.42  ? 456  GLY B O   1 
ATOM   7664 N N   . ILE B 1 456 ? 104.441 51.142 43.397  1.00 26.18  ? 457  ILE B N   1 
ATOM   7665 C CA  . ILE B 1 456 ? 105.724 51.529 43.984  1.00 27.86  ? 457  ILE B CA  1 
ATOM   7666 C C   . ILE B 1 456 ? 105.773 53.022 44.321  1.00 32.61  ? 457  ILE B C   1 
ATOM   7667 O O   . ILE B 1 456 ? 106.373 53.390 45.342  1.00 31.26  ? 457  ILE B O   1 
ATOM   7668 C CB  . ILE B 1 456 ? 106.886 51.141 43.053  1.00 31.28  ? 457  ILE B CB  1 
ATOM   7669 C CG1 . ILE B 1 456 ? 106.805 49.653 42.693  1.00 23.88  ? 457  ILE B CG1 1 
ATOM   7670 C CG2 . ILE B 1 456 ? 108.231 51.474 43.694  1.00 26.99  ? 457  ILE B CG2 1 
ATOM   7671 C CD1 . ILE B 1 456 ? 106.794 48.732 43.909  1.00 23.92  ? 457  ILE B CD1 1 
ATOM   7672 N N   . PRO B 1 457 ? 105.175 53.936 43.510  1.00 29.69  ? 458  PRO B N   1 
ATOM   7673 C CA  . PRO B 1 457 ? 105.174 55.354 43.903  1.00 30.94  ? 458  PRO B CA  1 
ATOM   7674 C C   . PRO B 1 457 ? 104.619 55.641 45.292  1.00 29.98  ? 458  PRO B C   1 
ATOM   7675 O O   . PRO B 1 457 ? 104.922 56.693 45.858  1.00 32.50  ? 458  PRO B O   1 
ATOM   7676 C CB  . PRO B 1 457 ? 104.313 56.010 42.817  1.00 29.75  ? 458  PRO B CB  1 
ATOM   7677 C CG  . PRO B 1 457 ? 104.627 55.215 41.604  1.00 27.59  ? 458  PRO B CG  1 
ATOM   7678 C CD  . PRO B 1 457 ? 104.752 53.782 42.101  1.00 27.97  ? 458  PRO B CD  1 
ATOM   7679 N N   . LEU B 1 458 ? 103.820 54.730 45.857  1.00 31.19  ? 459  LEU B N   1 
ATOM   7680 C CA  . LEU B 1 458 ? 103.261 54.966 47.185  1.00 30.15  ? 459  LEU B CA  1 
ATOM   7681 C C   . LEU B 1 458 ? 104.298 54.819 48.291  1.00 33.31  ? 459  LEU B C   1 
ATOM   7682 O O   . LEU B 1 458 ? 104.051 55.274 49.412  1.00 33.71  ? 459  LEU B O   1 
ATOM   7683 C CB  . LEU B 1 458 ? 102.089 54.017 47.449  1.00 34.77  ? 459  LEU B CB  1 
ATOM   7684 C CG  . LEU B 1 458 ? 100.885 54.241 46.534  1.00 44.33  ? 459  LEU B CG  1 
ATOM   7685 C CD1 . LEU B 1 458 ? 99.834  53.175 46.764  1.00 48.61  ? 459  LEU B CD1 1 
ATOM   7686 C CD2 . LEU B 1 458 ? 100.306 55.628 46.777  1.00 44.67  ? 459  LEU B CD2 1 
ATOM   7687 N N   . ASP B 1 459 ? 105.435 54.185 48.009  1.00 35.12  ? 460  ASP B N   1 
ATOM   7688 C CA  . ASP B 1 459 ? 106.531 54.068 48.964  1.00 36.42  ? 460  ASP B CA  1 
ATOM   7689 C C   . ASP B 1 459 ? 107.024 55.464 49.328  1.00 41.35  ? 460  ASP B C   1 
ATOM   7690 O O   . ASP B 1 459 ? 107.573 56.169 48.473  1.00 35.57  ? 460  ASP B O   1 
ATOM   7691 C CB  . ASP B 1 459 ? 107.669 53.227 48.375  1.00 37.93  ? 460  ASP B CB  1 
ATOM   7692 C CG  . ASP B 1 459 ? 108.736 52.861 49.402  1.00 43.15  ? 460  ASP B CG  1 
ATOM   7693 O OD1 . ASP B 1 459 ? 108.913 53.591 50.403  1.00 43.27  ? 460  ASP B OD1 1 
ATOM   7694 O OD2 . ASP B 1 459 ? 109.410 51.833 49.198  1.00 42.36  ? 460  ASP B OD2 1 
ATOM   7695 N N   . PRO B 1 460 ? 106.851 55.901 50.579  1.00 43.20  ? 461  PRO B N   1 
ATOM   7696 C CA  . PRO B 1 460 ? 107.272 57.264 50.940  1.00 50.29  ? 461  PRO B CA  1 
ATOM   7697 C C   . PRO B 1 460 ? 108.776 57.467 50.909  1.00 50.82  ? 461  PRO B C   1 
ATOM   7698 O O   . PRO B 1 460 ? 109.222 58.619 50.856  1.00 58.25  ? 461  PRO B O   1 
ATOM   7699 C CB  . PRO B 1 460 ? 106.713 57.444 52.359  1.00 50.03  ? 461  PRO B CB  1 
ATOM   7700 C CG  . PRO B 1 460 ? 106.604 56.054 52.896  1.00 50.45  ? 461  PRO B CG  1 
ATOM   7701 C CD  . PRO B 1 460 ? 106.259 55.178 51.716  1.00 42.84  ? 461  PRO B CD  1 
ATOM   7702 N N   . SER B 1 461 ? 109.569 56.396 50.943  1.00 43.95  ? 462  SER B N   1 
ATOM   7703 C CA  . SER B 1 461 ? 111.019 56.512 50.883  1.00 41.96  ? 462  SER B CA  1 
ATOM   7704 C C   . SER B 1 461 ? 111.537 56.694 49.460  1.00 49.39  ? 462  SER B C   1 
ATOM   7705 O O   . SER B 1 461 ? 112.755 56.750 49.268  1.00 54.04  ? 462  SER B O   1 
ATOM   7706 C CB  . SER B 1 461 ? 111.675 55.281 51.516  1.00 42.42  ? 462  SER B CB  1 
ATOM   7707 O OG  . SER B 1 461 ? 111.554 54.152 50.668  1.00 53.51  ? 462  SER B OG  1 
ATOM   7708 N N   . ARG B 1 462 ? 110.659 56.766 48.463  1.00 47.48  ? 463  ARG B N   1 
ATOM   7709 C CA  . ARG B 1 462 ? 111.042 57.074 47.091  1.00 43.69  ? 463  ARG B CA  1 
ATOM   7710 C C   . ARG B 1 462 ? 110.585 58.493 46.747  1.00 47.24  ? 463  ARG B C   1 
ATOM   7711 O O   . ARG B 1 462 ? 109.745 59.058 47.441  1.00 49.22  ? 463  ARG B O   1 
ATOM   7712 C CB  . ARG B 1 462 ? 110.446 56.055 46.125  1.00 40.98  ? 463  ARG B CB  1 
ATOM   7713 C CG  . ARG B 1 462 ? 110.610 54.640 46.588  1.00 44.98  ? 463  ARG B CG  1 
ATOM   7714 C CD  . ARG B 1 462 ? 110.868 53.705 45.426  1.00 47.62  ? 463  ARG B CD  1 
ATOM   7715 N NE  . ARG B 1 462 ? 111.174 52.367 45.916  1.00 52.69  ? 463  ARG B NE  1 
ATOM   7716 C CZ  . ARG B 1 462 ? 112.014 51.525 45.326  1.00 54.88  ? 463  ARG B CZ  1 
ATOM   7717 N NH1 . ARG B 1 462 ? 112.644 51.880 44.216  1.00 53.83  ? 463  ARG B NH1 1 
ATOM   7718 N NH2 . ARG B 1 462 ? 112.232 50.328 45.855  1.00 61.18  ? 463  ARG B NH2 1 
ATOM   7719 N N   . ASN B 1 463 ? 111.120 59.033 45.686  1.00 51.95  ? 464  ASN B N   1 
ATOM   7720 C CA  . ASN B 1 463 ? 110.841 60.387 45.314  1.00 57.44  ? 464  ASN B CA  1 
ATOM   7721 C C   . ASN B 1 463 ? 109.782 60.632 44.286  1.00 45.57  ? 464  ASN B C   1 
ATOM   7722 O O   . ASN B 1 463 ? 109.881 61.557 43.520  1.00 43.26  ? 464  ASN B O   1 
ATOM   7723 C CB  . ASN B 1 463 ? 112.143 61.037 44.882  1.00 78.17  ? 464  ASN B CB  1 
ATOM   7724 C CG  . ASN B 1 463 ? 113.282 60.702 45.795  1.00 102.77 ? 464  ASN B CG  1 
ATOM   7725 O OD1 . ASN B 1 463 ? 114.328 60.244 45.360  1.00 107.18 ? 464  ASN B OD1 1 
ATOM   7726 N ND2 . ASN B 1 463 ? 113.087 60.922 47.076  1.00 125.70 ? 464  ASN B ND2 1 
ATOM   7727 N N   . TYR B 1 464 ? 108.749 59.827 44.258  1.00 36.95  ? 465  TYR B N   1 
ATOM   7728 C CA  . TYR B 1 464 ? 107.742 60.130 43.242  1.00 37.10  ? 465  TYR B CA  1 
ATOM   7729 C C   . TYR B 1 464 ? 106.902 61.342 43.659  1.00 40.46  ? 465  TYR B C   1 
ATOM   7730 O O   . TYR B 1 464 ? 106.838 61.706 44.833  1.00 39.88  ? 465  TYR B O   1 
ATOM   7731 C CB  . TYR B 1 464 ? 106.827 58.928 43.008  1.00 30.31  ? 465  TYR B CB  1 
ATOM   7732 C CG  . TYR B 1 464 ? 107.498 57.742 42.354  1.00 28.64  ? 465  TYR B CG  1 
ATOM   7733 C CD1 . TYR B 1 464 ? 108.185 56.796 43.114  1.00 23.82  ? 465  TYR B CD1 1 
ATOM   7734 C CD2 . TYR B 1 464 ? 107.425 57.554 40.975  1.00 26.68  ? 465  TYR B CD2 1 
ATOM   7735 C CE1 . TYR B 1 464 ? 108.801 55.705 42.512  1.00 34.00  ? 465  TYR B CE1 1 
ATOM   7736 C CE2 . TYR B 1 464 ? 108.028 56.470 40.370  1.00 32.94  ? 465  TYR B CE2 1 
ATOM   7737 C CZ  . TYR B 1 464 ? 108.715 55.547 41.138  1.00 35.14  ? 465  TYR B CZ  1 
ATOM   7738 O OH  . TYR B 1 464 ? 109.313 54.471 40.523  1.00 36.96  ? 465  TYR B OH  1 
ATOM   7739 N N   . THR B 1 465 ? 106.242 61.968 42.682  1.00 37.34  ? 466  THR B N   1 
ATOM   7740 C CA  . THR B 1 465 ? 105.413 63.136 42.966  1.00 39.29  ? 466  THR B CA  1 
ATOM   7741 C C   . THR B 1 465 ? 104.027 62.723 43.459  1.00 40.21  ? 466  THR B C   1 
ATOM   7742 O O   . THR B 1 465 ? 103.594 61.577 43.305  1.00 40.27  ? 466  THR B O   1 
ATOM   7743 C CB  . THR B 1 465 ? 105.254 64.017 41.728  1.00 39.47  ? 466  THR B CB  1 
ATOM   7744 O OG1 . THR B 1 465 ? 104.387 63.362 40.794  1.00 43.01  ? 466  THR B OG1 1 
ATOM   7745 C CG2 . THR B 1 465 ? 106.603 64.270 41.074  1.00 41.00  ? 466  THR B CG2 1 
ATOM   7746 N N   . ALA B 1 466 ? 103.316 63.697 44.040  1.00 38.90  ? 467  ALA B N   1 
ATOM   7747 C CA  . ALA B 1 466 ? 101.949 63.459 44.498  1.00 40.34  ? 467  ALA B CA  1 
ATOM   7748 C C   . ALA B 1 466 ? 101.037 63.061 43.340  1.00 38.94  ? 467  ALA B C   1 
ATOM   7749 O O   . ALA B 1 466 ? 100.147 62.216 43.499  1.00 40.54  ? 467  ALA B O   1 
ATOM   7750 C CB  . ALA B 1 466 ? 101.413 64.705 45.208  1.00 32.93  ? 467  ALA B CB  1 
ATOM   7751 N N   . GLU B 1 467 ? 101.250 63.653 42.164  1.00 38.35  ? 468  GLU B N   1 
ATOM   7752 C CA  . GLU B 1 467 ? 100.451 63.302 40.995  1.00 38.99  ? 468  GLU B CA  1 
ATOM   7753 C C   . GLU B 1 467 ? 100.744 61.882 40.528  1.00 35.84  ? 468  GLU B C   1 
ATOM   7754 O O   . GLU B 1 467 ? 99.842  61.189 40.039  1.00 35.57  ? 468  GLU B O   1 
ATOM   7755 C CB  . GLU B 1 467 ? 100.709 64.294 39.856  1.00 45.22  ? 468  GLU B CB  1 
ATOM   7756 C CG  . GLU B 1 467 ? 100.334 65.749 40.155  1.00 64.01  ? 468  GLU B CG  1 
ATOM   7757 C CD  . GLU B 1 467 ? 101.234 66.407 41.199  1.00 79.69  ? 468  GLU B CD  1 
ATOM   7758 O OE1 . GLU B 1 467 ? 100.700 67.101 42.093  1.00 86.92  ? 468  GLU B OE1 1 
ATOM   7759 O OE2 . GLU B 1 467 ? 102.470 66.222 41.135  1.00 80.49  ? 468  GLU B OE2 1 
ATOM   7760 N N   . GLU B 1 468 ? 101.990 61.435 40.673  1.00 31.46  ? 469  GLU B N   1 
ATOM   7761 C CA  . GLU B 1 468 ? 102.351 60.090 40.240  1.00 31.89  ? 469  GLU B CA  1 
ATOM   7762 C C   . GLU B 1 468 ? 101.785 59.021 41.169  1.00 32.69  ? 469  GLU B C   1 
ATOM   7763 O O   . GLU B 1 468 ? 101.505 57.903 40.721  1.00 33.84  ? 469  GLU B O   1 
ATOM   7764 C CB  . GLU B 1 468 ? 103.872 59.976 40.133  1.00 31.60  ? 469  GLU B CB  1 
ATOM   7765 C CG  . GLU B 1 468 ? 104.423 60.678 38.895  1.00 36.95  ? 469  GLU B CG  1 
ATOM   7766 C CD  . GLU B 1 468 ? 105.939 60.641 38.807  1.00 39.09  ? 469  GLU B CD  1 
ATOM   7767 O OE1 . GLU B 1 468 ? 106.610 60.814 39.847  1.00 37.12  ? 469  GLU B OE1 1 
ATOM   7768 O OE2 . GLU B 1 468 ? 106.459 60.431 37.690  1.00 39.77  ? 469  GLU B OE2 1 
ATOM   7769 N N   . LYS B 1 469 ? 101.605 59.341 42.456  1.00 31.48  ? 470  LYS B N   1 
ATOM   7770 C CA  . LYS B 1 469 ? 100.967 58.399 43.373  1.00 33.08  ? 470  LYS B CA  1 
ATOM   7771 C C   . LYS B 1 469 ? 99.490  58.230 43.039  1.00 32.96  ? 470  LYS B C   1 
ATOM   7772 O O   . LYS B 1 469 ? 98.968  57.109 43.023  1.00 32.38  ? 470  LYS B O   1 
ATOM   7773 C CB  . LYS B 1 469 ? 101.146 58.869 44.819  1.00 31.51  ? 470  LYS B CB  1 
ATOM   7774 C CG  . LYS B 1 469 ? 102.595 58.904 45.261  1.00 35.73  ? 470  LYS B CG  1 
ATOM   7775 C CD  . LYS B 1 469 ? 102.761 59.507 46.640  1.00 40.37  ? 470  LYS B CD  1 
ATOM   7776 C CE  . LYS B 1 469 ? 104.232 59.741 46.940  1.00 42.07  ? 470  LYS B CE  1 
ATOM   7777 N NZ  . LYS B 1 469 ? 104.431 60.395 48.264  1.00 50.74  ? 470  LYS B NZ  1 
ATOM   7778 N N   . ILE B 1 470 ? 98.799  59.340 42.773  1.00 31.35  ? 471  ILE B N   1 
ATOM   7779 C CA  . ILE B 1 470 ? 97.414  59.273 42.318  1.00 33.94  ? 471  ILE B CA  1 
ATOM   7780 C C   . ILE B 1 470 ? 97.317  58.472 41.023  1.00 32.56  ? 471  ILE B C   1 
ATOM   7781 O O   . ILE B 1 470 ? 96.420  57.635 40.856  1.00 34.42  ? 471  ILE B O   1 
ATOM   7782 C CB  . ILE B 1 470 ? 96.853  60.699 42.158  1.00 35.62  ? 471  ILE B CB  1 
ATOM   7783 C CG1 . ILE B 1 470 ? 96.677  61.349 43.532  1.00 37.05  ? 471  ILE B CG1 1 
ATOM   7784 C CG2 . ILE B 1 470 ? 95.548  60.700 41.379  1.00 30.98  ? 471  ILE B CG2 1 
ATOM   7785 C CD1 . ILE B 1 470 ? 96.496  62.858 43.467  1.00 42.88  ? 471  ILE B CD1 1 
ATOM   7786 N N   . PHE B 1 471 ? 98.249  58.704 40.097  1.00 27.01  ? 472  PHE B N   1 
ATOM   7787 C CA  . PHE B 1 471 ? 98.310  57.915 38.868  1.00 29.06  ? 472  PHE B CA  1 
ATOM   7788 C C   . PHE B 1 471 ? 98.465  56.428 39.179  1.00 33.39  ? 472  PHE B C   1 
ATOM   7789 O O   . PHE B 1 471 ? 97.735  55.588 38.637  1.00 31.03  ? 472  PHE B O   1 
ATOM   7790 C CB  . PHE B 1 471 ? 99.465  58.423 37.999  1.00 27.33  ? 472  PHE B CB  1 
ATOM   7791 C CG  . PHE B 1 471 ? 99.603  57.730 36.666  1.00 28.02  ? 472  PHE B CG  1 
ATOM   7792 C CD1 . PHE B 1 471 ? 98.512  57.568 35.825  1.00 26.49  ? 472  PHE B CD1 1 
ATOM   7793 C CD2 . PHE B 1 471 ? 100.847 57.288 36.232  1.00 30.68  ? 472  PHE B CD2 1 
ATOM   7794 C CE1 . PHE B 1 471 ? 98.654  56.947 34.583  1.00 28.92  ? 472  PHE B CE1 1 
ATOM   7795 C CE2 . PHE B 1 471 ? 100.999 56.667 34.994  1.00 30.04  ? 472  PHE B CE2 1 
ATOM   7796 C CZ  . PHE B 1 471 ? 99.901  56.497 34.167  1.00 27.11  ? 472  PHE B CZ  1 
ATOM   7797 N N   . ALA B 1 472 ? 99.410  56.085 40.060  1.00 27.46  ? 473  ALA B N   1 
ATOM   7798 C CA  . ALA B 1 472 ? 99.607  54.686 40.426  1.00 27.96  ? 473  ALA B CA  1 
ATOM   7799 C C   . ALA B 1 472 ? 98.323  54.075 40.974  1.00 30.04  ? 473  ALA B C   1 
ATOM   7800 O O   . ALA B 1 472 ? 97.951  52.954 40.604  1.00 24.96  ? 473  ALA B O   1 
ATOM   7801 C CB  . ALA B 1 472 ? 100.739 54.566 41.446  1.00 24.83  ? 473  ALA B CB  1 
ATOM   7802 N N   . GLN B 1 473 ? 97.622  54.807 41.845  1.00 27.13  ? 474  GLN B N   1 
ATOM   7803 C CA  . GLN B 1 473 ? 96.364  54.306 42.389  1.00 29.17  ? 474  GLN B CA  1 
ATOM   7804 C C   . GLN B 1 473 ? 95.328  54.089 41.291  1.00 30.33  ? 474  GLN B C   1 
ATOM   7805 O O   . GLN B 1 473 ? 94.591  53.096 41.318  1.00 26.86  ? 474  GLN B O   1 
ATOM   7806 C CB  . GLN B 1 473 ? 95.844  55.265 43.462  1.00 27.68  ? 474  GLN B CB  1 
ATOM   7807 C CG  . GLN B 1 473 ? 96.809  55.407 44.632  1.00 26.81  ? 474  GLN B CG  1 
ATOM   7808 C CD  . GLN B 1 473 ? 96.359  56.426 45.655  1.00 37.22  ? 474  GLN B CD  1 
ATOM   7809 O OE1 . GLN B 1 473 ? 96.009  57.557 45.314  1.00 40.30  ? 474  GLN B OE1 1 
ATOM   7810 N NE2 . GLN B 1 473 ? 96.376  56.033 46.923  1.00 29.22  ? 474  GLN B NE2 1 
ATOM   7811 N N   . ARG B 1 474 ? 95.265  54.999 40.311  1.00 27.59  ? 475  ARG B N   1 
ATOM   7812 C CA  . ARG B 1 474 ? 94.383  54.806 39.158  1.00 32.89  ? 475  ARG B CA  1 
ATOM   7813 C C   . ARG B 1 474 ? 94.687  53.498 38.437  1.00 27.64  ? 475  ARG B C   1 
ATOM   7814 O O   . ARG B 1 474 ? 93.774  52.748 38.072  1.00 28.06  ? 475  ARG B O   1 
ATOM   7815 C CB  . ARG B 1 474 ? 94.522  55.968 38.172  1.00 39.41  ? 475  ARG B CB  1 
ATOM   7816 C CG  . ARG B 1 474 ? 93.765  57.236 38.502  1.00 48.06  ? 475  ARG B CG  1 
ATOM   7817 C CD  . ARG B 1 474 ? 93.996  58.260 37.384  1.00 47.17  ? 475  ARG B CD  1 
ATOM   7818 N NE  . ARG B 1 474 ? 93.583  57.730 36.086  1.00 36.19  ? 475  ARG B NE  1 
ATOM   7819 C CZ  . ARG B 1 474 ? 94.159  58.034 34.924  1.00 34.13  ? 475  ARG B CZ  1 
ATOM   7820 N NH1 . ARG B 1 474 ? 95.196  58.864 34.882  1.00 32.86  ? 475  ARG B NH1 1 
ATOM   7821 N NH2 . ARG B 1 474 ? 93.707  57.493 33.799  1.00 29.09  ? 475  ARG B NH2 1 
ATOM   7822 N N   . LEU B 1 475 ? 95.971  53.223 38.197  1.00 22.89  ? 476  LEU B N   1 
ATOM   7823 C CA  . LEU B 1 475 ? 96.350  52.039 37.433  1.00 26.04  ? 476  LEU B CA  1 
ATOM   7824 C C   . LEU B 1 475 ? 96.064  50.760 38.214  1.00 30.04  ? 476  LEU B C   1 
ATOM   7825 O O   . LEU B 1 475 ? 95.554  49.781 37.654  1.00 24.06  ? 476  LEU B O   1 
ATOM   7826 C CB  . LEU B 1 475 ? 97.828  52.117 37.049  1.00 26.54  ? 476  LEU B CB  1 
ATOM   7827 C CG  . LEU B 1 475 ? 98.228  53.187 36.027  1.00 36.50  ? 476  LEU B CG  1 
ATOM   7828 C CD1 . LEU B 1 475 ? 99.667  52.989 35.611  1.00 42.12  ? 476  LEU B CD1 1 
ATOM   7829 C CD2 . LEU B 1 475 ? 97.315  53.152 34.807  1.00 33.40  ? 476  LEU B CD2 1 
ATOM   7830 N N   . MET B 1 476 ? 96.404  50.743 39.507  1.00 27.63  ? 477  MET B N   1 
ATOM   7831 C CA  . MET B 1 476 ? 96.071  49.591 40.338  1.00 27.18  ? 477  MET B CA  1 
ATOM   7832 C C   . MET B 1 476 ? 94.571  49.328 40.319  1.00 23.48  ? 477  MET B C   1 
ATOM   7833 O O   . MET B 1 476 ? 94.135  48.173 40.339  1.00 28.23  ? 477  MET B O   1 
ATOM   7834 C CB  . MET B 1 476 ? 96.558  49.805 41.774  1.00 24.75  ? 477  MET B CB  1 
ATOM   7835 C CG  . MET B 1 476 ? 98.070  49.875 41.935  1.00 31.38  ? 477  MET B CG  1 
ATOM   7836 S SD  . MET B 1 476 ? 98.589  49.733 43.662  1.00 33.51  ? 477  MET B SD  1 
ATOM   7837 C CE  . MET B 1 476 ? 97.913  51.247 44.341  1.00 33.96  ? 477  MET B CE  1 
ATOM   7838 N N   . ARG B 1 477 ? 93.767  50.392 40.260  1.00 23.78  ? 478  ARG B N   1 
ATOM   7839 C CA  . ARG B 1 477 ? 92.316  50.236 40.233  1.00 27.95  ? 478  ARG B CA  1 
ATOM   7840 C C   . ARG B 1 477 ? 91.845  49.641 38.908  1.00 29.52  ? 478  ARG B C   1 
ATOM   7841 O O   . ARG B 1 477 ? 90.974  48.761 38.896  1.00 26.13  ? 478  ARG B O   1 
ATOM   7842 C CB  . ARG B 1 477 ? 91.647  51.588 40.491  1.00 28.69  ? 478  ARG B CB  1 
ATOM   7843 C CG  . ARG B 1 477 ? 90.119  51.572 40.466  1.00 28.00  ? 478  ARG B CG  1 
ATOM   7844 C CD  . ARG B 1 477 ? 89.553  50.609 41.502  1.00 30.60  ? 478  ARG B CD  1 
ATOM   7845 N NE  . ARG B 1 477 ? 89.858  51.045 42.863  1.00 35.41  ? 478  ARG B NE  1 
ATOM   7846 C CZ  . ARG B 1 477 ? 89.140  51.931 43.551  1.00 38.03  ? 478  ARG B CZ  1 
ATOM   7847 N NH1 . ARG B 1 477 ? 88.060  52.483 43.016  1.00 30.73  ? 478  ARG B NH1 1 
ATOM   7848 N NH2 . ARG B 1 477 ? 89.499  52.260 44.784  1.00 40.28  ? 478  ARG B NH2 1 
ATOM   7849 N N   . TYR B 1 478 ? 92.401  50.113 37.783  1.00 22.57  ? 479  TYR B N   1 
ATOM   7850 C CA  . TYR B 1 478 ? 92.096  49.511 36.485  1.00 26.92  ? 479  TYR B CA  1 
ATOM   7851 C C   . TYR B 1 478 ? 92.408  48.023 36.488  1.00 26.22  ? 479  TYR B C   1 
ATOM   7852 O O   . TYR B 1 478 ? 91.573  47.198 36.098  1.00 25.21  ? 479  TYR B O   1 
ATOM   7853 C CB  . TYR B 1 478 ? 92.897  50.183 35.365  1.00 22.67  ? 479  TYR B CB  1 
ATOM   7854 C CG  . TYR B 1 478 ? 92.496  51.601 35.034  1.00 31.28  ? 479  TYR B CG  1 
ATOM   7855 C CD1 . TYR B 1 478 ? 91.163  51.978 34.979  1.00 31.93  ? 479  TYR B CD1 1 
ATOM   7856 C CD2 . TYR B 1 478 ? 93.462  52.558 34.751  1.00 32.90  ? 479  TYR B CD2 1 
ATOM   7857 C CE1 . TYR B 1 478 ? 90.803  53.288 34.661  1.00 30.15  ? 479  TYR B CE1 1 
ATOM   7858 C CE2 . TYR B 1 478 ? 93.112  53.857 34.438  1.00 28.51  ? 479  TYR B CE2 1 
ATOM   7859 C CZ  . TYR B 1 478 ? 91.790  54.220 34.393  1.00 31.29  ? 479  TYR B CZ  1 
ATOM   7860 O OH  . TYR B 1 478 ? 91.482  55.524 34.075  1.00 34.04  ? 479  TYR B OH  1 
ATOM   7861 N N   . TRP B 1 479 ? 93.629  47.671 36.901  1.00 26.30  ? 480  TRP B N   1 
ATOM   7862 C CA  . TRP B 1 479 ? 94.083  46.287 36.832  1.00 21.97  ? 480  TRP B CA  1 
ATOM   7863 C C   . TRP B 1 479 ? 93.252  45.390 37.737  1.00 25.38  ? 480  TRP B C   1 
ATOM   7864 O O   . TRP B 1 479 ? 92.896  44.269 37.357  1.00 24.40  ? 480  TRP B O   1 
ATOM   7865 C CB  . TRP B 1 479 ? 95.562  46.212 37.220  1.00 18.33  ? 480  TRP B CB  1 
ATOM   7866 C CG  . TRP B 1 479 ? 96.521  46.090 36.064  1.00 19.35  ? 480  TRP B CG  1 
ATOM   7867 C CD1 . TRP B 1 479 ? 97.402  45.071 35.842  1.00 23.06  ? 480  TRP B CD1 1 
ATOM   7868 C CD2 . TRP B 1 479 ? 96.710  47.022 34.987  1.00 22.21  ? 480  TRP B CD2 1 
ATOM   7869 N NE1 . TRP B 1 479 ? 98.123  45.305 34.692  1.00 24.72  ? 480  TRP B NE1 1 
ATOM   7870 C CE2 . TRP B 1 479 ? 97.719  46.497 34.150  1.00 23.23  ? 480  TRP B CE2 1 
ATOM   7871 C CE3 . TRP B 1 479 ? 96.125  48.246 34.649  1.00 22.40  ? 480  TRP B CE3 1 
ATOM   7872 C CZ2 . TRP B 1 479 ? 98.149  47.150 32.991  1.00 23.13  ? 480  TRP B CZ2 1 
ATOM   7873 C CZ3 . TRP B 1 479 ? 96.559  48.896 33.500  1.00 23.83  ? 480  TRP B CZ3 1 
ATOM   7874 C CH2 . TRP B 1 479 ? 97.561  48.346 32.686  1.00 23.47  ? 480  TRP B CH2 1 
ATOM   7875 N N   . ALA B 1 480 ? 92.937  45.867 38.942  1.00 22.69  ? 481  ALA B N   1 
ATOM   7876 C CA  . ALA B 1 480 ? 92.162  45.061 39.876  1.00 25.77  ? 481  ALA B CA  1 
ATOM   7877 C C   . ALA B 1 480 ? 90.690  45.009 39.481  1.00 27.46  ? 481  ALA B C   1 
ATOM   7878 O O   . ALA B 1 480 ? 90.039  43.977 39.673  1.00 24.54  ? 481  ALA B O   1 
ATOM   7879 C CB  . ALA B 1 480 ? 92.322  45.601 41.296  1.00 19.36  ? 481  ALA B CB  1 
ATOM   7880 N N   . ASN B 1 481 ? 90.148  46.111 38.943  1.00 26.90  ? 482  ASN B N   1 
ATOM   7881 C CA  . ASN B 1 481 ? 88.811  46.063 38.353  1.00 28.79  ? 482  ASN B CA  1 
ATOM   7882 C C   . ASN B 1 481 ? 88.734  44.971 37.296  1.00 30.12  ? 482  ASN B C   1 
ATOM   7883 O O   . ASN B 1 481 ? 87.778  44.188 37.259  1.00 26.27  ? 482  ASN B O   1 
ATOM   7884 C CB  . ASN B 1 481 ? 88.445  47.410 37.729  1.00 29.70  ? 482  ASN B CB  1 
ATOM   7885 C CG  . ASN B 1 481 ? 87.898  48.399 38.732  1.00 33.13  ? 482  ASN B CG  1 
ATOM   7886 O OD1 . ASN B 1 481 ? 87.743  48.092 39.918  1.00 34.06  ? 482  ASN B OD1 1 
ATOM   7887 N ND2 . ASN B 1 481 ? 87.598  49.605 38.257  1.00 26.28  ? 482  ASN B ND2 1 
ATOM   7888 N N   . PHE B 1 482 ? 89.745  44.907 36.424  1.00 24.37  ? 483  PHE B N   1 
ATOM   7889 C CA  . PHE B 1 482 ? 89.765  43.880 35.392  1.00 27.02  ? 483  PHE B CA  1 
ATOM   7890 C C   . PHE B 1 482 ? 89.882  42.491 36.004  1.00 25.54  ? 483  PHE B C   1 
ATOM   7891 O O   . PHE B 1 482 ? 89.221  41.548 35.556  1.00 27.11  ? 483  PHE B O   1 
ATOM   7892 C CB  . PHE B 1 482 ? 90.912  44.131 34.411  1.00 24.44  ? 483  PHE B CB  1 
ATOM   7893 C CG  . PHE B 1 482 ? 91.064  43.050 33.382  1.00 26.02  ? 483  PHE B CG  1 
ATOM   7894 C CD1 . PHE B 1 482 ? 90.253  43.027 32.257  1.00 26.79  ? 483  PHE B CD1 1 
ATOM   7895 C CD2 . PHE B 1 482 ? 91.994  42.041 33.550  1.00 24.46  ? 483  PHE B CD2 1 
ATOM   7896 C CE1 . PHE B 1 482 ? 90.383  42.022 31.305  1.00 23.21  ? 483  PHE B CE1 1 
ATOM   7897 C CE2 . PHE B 1 482 ? 92.121  41.033 32.607  1.00 22.92  ? 483  PHE B CE2 1 
ATOM   7898 C CZ  . PHE B 1 482 ? 91.312  41.028 31.482  1.00 19.50  ? 483  PHE B CZ  1 
ATOM   7899 N N   . ALA B 1 483 ? 90.722  42.342 37.028  1.00 21.87  ? 484  ALA B N   1 
ATOM   7900 C CA  . ALA B 1 483 ? 90.833  41.050 37.695  1.00 26.25  ? 484  ALA B CA  1 
ATOM   7901 C C   . ALA B 1 483 ? 89.502  40.630 38.307  1.00 28.19  ? 484  ALA B C   1 
ATOM   7902 O O   . ALA B 1 483 ? 89.132  39.452 38.261  1.00 32.03  ? 484  ALA B O   1 
ATOM   7903 C CB  . ALA B 1 483 ? 91.928  41.101 38.761  1.00 22.84  ? 484  ALA B CB  1 
ATOM   7904 N N   . ARG B 1 484 ? 88.752  41.585 38.857  1.00 30.12  ? 485  ARG B N   1 
ATOM   7905 C CA  . ARG B 1 484 ? 87.508  41.246 39.536  1.00 27.13  ? 485  ARG B CA  1 
ATOM   7906 C C   . ARG B 1 484 ? 86.370  40.963 38.564  1.00 28.92  ? 485  ARG B C   1 
ATOM   7907 O O   . ARG B 1 484 ? 85.546  40.082 38.827  1.00 29.20  ? 485  ARG B O   1 
ATOM   7908 C CB  . ARG B 1 484 ? 87.099  42.366 40.492  1.00 25.58  ? 485  ARG B CB  1 
ATOM   7909 C CG  . ARG B 1 484 ? 87.828  42.351 41.823  1.00 24.83  ? 485  ARG B CG  1 
ATOM   7910 C CD  . ARG B 1 484 ? 87.332  43.468 42.745  1.00 27.52  ? 485  ARG B CD  1 
ATOM   7911 N NE  . ARG B 1 484 ? 87.627  44.805 42.237  1.00 30.19  ? 485  ARG B NE  1 
ATOM   7912 C CZ  . ARG B 1 484 ? 88.625  45.565 42.689  1.00 32.92  ? 485  ARG B CZ  1 
ATOM   7913 N NH1 . ARG B 1 484 ? 89.431  45.112 43.638  1.00 25.77  ? 485  ARG B NH1 1 
ATOM   7914 N NH2 . ARG B 1 484 ? 88.831  46.773 42.182  1.00 26.74  ? 485  ARG B NH2 1 
ATOM   7915 N N   . THR B 1 485 ? 86.294  41.698 37.447  1.00 24.54  ? 486  THR B N   1 
ATOM   7916 C CA  . THR B 1 485 ? 85.112  41.658 36.591  1.00 25.80  ? 486  THR B CA  1 
ATOM   7917 C C   . THR B 1 485 ? 85.386  41.431 35.113  1.00 25.45  ? 486  THR B C   1 
ATOM   7918 O O   . THR B 1 485 ? 84.422  41.284 34.351  1.00 31.70  ? 486  THR B O   1 
ATOM   7919 C CB  . THR B 1 485 ? 84.316  42.968 36.699  1.00 27.11  ? 486  THR B CB  1 
ATOM   7920 O OG1 . THR B 1 485 ? 85.088  44.031 36.128  1.00 28.74  ? 486  THR B OG1 1 
ATOM   7921 C CG2 . THR B 1 485 ? 83.974  43.294 38.150  1.00 23.81  ? 486  THR B CG2 1 
ATOM   7922 N N   . GLY B 1 486 ? 86.639  41.425 34.672  1.00 22.26  ? 487  GLY B N   1 
ATOM   7923 C CA  . GLY B 1 486 ? 86.909  41.398 33.250  1.00 24.18  ? 487  GLY B CA  1 
ATOM   7924 C C   . GLY B 1 486 ? 86.715  42.721 32.544  1.00 25.72  ? 487  GLY B C   1 
ATOM   7925 O O   . GLY B 1 486 ? 86.706  42.751 31.309  1.00 26.82  ? 487  GLY B O   1 
ATOM   7926 N N   . ASP B 1 487 ? 86.563  43.818 33.290  1.00 31.10  ? 488  ASP B N   1 
ATOM   7927 C CA  . ASP B 1 487 ? 86.347  45.158 32.751  1.00 31.78  ? 488  ASP B CA  1 
ATOM   7928 C C   . ASP B 1 487 ? 87.074  46.161 33.643  1.00 28.86  ? 488  ASP B C   1 
ATOM   7929 O O   . ASP B 1 487 ? 86.769  46.256 34.838  1.00 31.63  ? 488  ASP B O   1 
ATOM   7930 C CB  . ASP B 1 487 ? 84.844  45.463 32.679  1.00 36.63  ? 488  ASP B CB  1 
ATOM   7931 C CG  . ASP B 1 487 ? 84.529  46.837 32.080  1.00 38.11  ? 488  ASP B CG  1 
ATOM   7932 O OD1 . ASP B 1 487 ? 83.344  47.070 31.762  1.00 37.78  ? 488  ASP B OD1 1 
ATOM   7933 O OD2 . ASP B 1 487 ? 85.438  47.681 31.922  1.00 39.56  ? 488  ASP B OD2 1 
ATOM   7934 N N   . PRO B 1 488 ? 88.031  46.927 33.109  1.00 30.46  ? 489  PRO B N   1 
ATOM   7935 C CA  . PRO B 1 488 ? 88.775  47.865 33.968  1.00 27.35  ? 489  PRO B CA  1 
ATOM   7936 C C   . PRO B 1 488 ? 87.973  49.084 34.396  1.00 30.83  ? 489  PRO B C   1 
ATOM   7937 O O   . PRO B 1 488 ? 88.405  49.778 35.326  1.00 32.23  ? 489  PRO B O   1 
ATOM   7938 C CB  . PRO B 1 488 ? 89.972  48.269 33.097  1.00 28.78  ? 489  PRO B CB  1 
ATOM   7939 C CG  . PRO B 1 488 ? 89.461  48.116 31.678  1.00 29.70  ? 489  PRO B CG  1 
ATOM   7940 C CD  . PRO B 1 488 ? 88.515  46.935 31.713  1.00 28.55  ? 489  PRO B CD  1 
ATOM   7941 N N   . ASN B 1 489 ? 86.825  49.356 33.771  1.00 30.24  ? 490  ASN B N   1 
ATOM   7942 C CA  . ASN B 1 489 ? 86.077  50.582 34.027  1.00 33.41  ? 490  ASN B CA  1 
ATOM   7943 C C   . ASN B 1 489 ? 85.358  50.551 35.377  1.00 35.83  ? 490  ASN B C   1 
ATOM   7944 O O   . ASN B 1 489 ? 85.117  49.494 35.964  1.00 31.18  ? 490  ASN B O   1 
ATOM   7945 C CB  . ASN B 1 489 ? 85.044  50.835 32.923  1.00 29.32  ? 490  ASN B CB  1 
ATOM   7946 C CG  . ASN B 1 489 ? 85.678  51.039 31.559  1.00 32.53  ? 490  ASN B CG  1 
ATOM   7947 O OD1 . ASN B 1 489 ? 86.084  52.145 31.232  1.00 30.90  ? 490  ASN B OD1 1 
ATOM   7948 N ND2 . ASN B 1 489 ? 85.711  49.993 30.740  1.00 23.10  ? 490  ASN B ND2 1 
ATOM   7949 N N   . GLU B 1 490 ? 84.978  51.744 35.835  1.00 54.00  ? 491  GLU B N   1 
ATOM   7950 C CA  . GLU B 1 490 ? 84.247  52.051 37.056  1.00 71.56  ? 491  GLU B CA  1 
ATOM   7951 C C   . GLU B 1 490 ? 83.084  52.984 36.752  1.00 87.60  ? 491  GLU B C   1 
ATOM   7952 O O   . GLU B 1 490 ? 83.189  53.835 35.863  1.00 94.31  ? 491  GLU B O   1 
ATOM   7953 C CB  . GLU B 1 490 ? 85.164  52.733 38.078  1.00 75.98  ? 491  GLU B CB  1 
ATOM   7954 C CG  . GLU B 1 490 ? 85.565  51.887 39.256  1.00 80.41  ? 491  GLU B CG  1 
ATOM   7955 C CD  . GLU B 1 490 ? 86.524  52.617 40.162  1.00 79.98  ? 491  GLU B CD  1 
ATOM   7956 O OE1 . GLU B 1 490 ? 86.622  52.235 41.341  1.00 84.47  ? 491  GLU B OE1 1 
ATOM   7957 O OE2 . GLU B 1 490 ? 87.178  53.574 39.693  1.00 80.86  ? 491  GLU B OE2 1 
ATOM   7958 N N   . PRO B 1 491 ? 81.966  52.866 37.495  1.00 98.84  ? 492  PRO B N   1 
ATOM   7959 C CA  . PRO B 1 491 ? 80.792  53.752 37.431  1.00 99.67  ? 492  PRO B CA  1 
ATOM   7960 C C   . PRO B 1 491 ? 81.100  55.229 37.161  1.00 97.07  ? 492  PRO B C   1 
ATOM   7961 O O   . PRO B 1 491 ? 80.871  55.699 36.044  1.00 94.07  ? 492  PRO B O   1 
ATOM   7962 C CB  . PRO B 1 491 ? 80.179  53.590 38.821  1.00 98.32  ? 492  PRO B CB  1 
ATOM   7963 C CG  . PRO B 1 491 ? 80.449  52.161 39.156  1.00 99.18  ? 492  PRO B CG  1 
ATOM   7964 C CD  . PRO B 1 491 ? 81.745  51.766 38.454  1.00 101.34 ? 492  PRO B CD  1 
ATOM   7965 N N   . ALA B 1 496 ? 83.245  59.320 34.856  1.00 72.98  ? 497  ALA B N   1 
ATOM   7966 C CA  . ALA B 1 496 ? 84.628  59.039 34.488  1.00 78.15  ? 497  ALA B CA  1 
ATOM   7967 C C   . ALA B 1 496 ? 84.728  58.569 33.041  1.00 82.18  ? 497  ALA B C   1 
ATOM   7968 O O   . ALA B 1 496 ? 83.979  57.684 32.617  1.00 87.05  ? 497  ALA B O   1 
ATOM   7969 C CB  . ALA B 1 496 ? 85.226  58.003 35.427  1.00 79.82  ? 497  ALA B CB  1 
ATOM   7970 N N   . PRO B 1 497 ? 85.697  59.198 32.267  1.00 80.86  ? 498  PRO B N   1 
ATOM   7971 C CA  . PRO B 1 497 ? 85.762  58.716 30.876  1.00 74.51  ? 498  PRO B CA  1 
ATOM   7972 C C   . PRO B 1 497 ? 85.929  57.201 30.806  1.00 54.98  ? 498  PRO B C   1 
ATOM   7973 O O   . PRO B 1 497 ? 86.652  56.623 31.618  1.00 53.36  ? 498  PRO B O   1 
ATOM   7974 C CB  . PRO B 1 497 ? 87.007  59.406 30.312  1.00 82.91  ? 498  PRO B CB  1 
ATOM   7975 C CG  . PRO B 1 497 ? 87.057  60.701 31.025  1.00 86.38  ? 498  PRO B CG  1 
ATOM   7976 C CD  . PRO B 1 497 ? 86.753  60.297 32.432  1.00 85.05  ? 498  PRO B CD  1 
ATOM   7977 N N   . GLN B 1 498 ? 85.264  56.572 29.843  1.00 44.88  ? 499  GLN B N   1 
ATOM   7978 C CA  . GLN B 1 498 ? 85.343  55.152 29.679  1.00 41.96  ? 499  GLN B CA  1 
ATOM   7979 C C   . GLN B 1 498 ? 86.394  54.562 28.786  1.00 38.96  ? 499  GLN B C   1 
ATOM   7980 O O   . GLN B 1 498 ? 86.732  55.103 27.767  1.00 37.17  ? 499  GLN B O   1 
ATOM   7981 C CB  . GLN B 1 498 ? 83.993  54.619 29.226  1.00 39.44  ? 499  GLN B CB  1 
ATOM   7982 C CG  . GLN B 1 498 ? 82.885  54.809 30.219  1.00 44.58  ? 499  GLN B CG  1 
ATOM   7983 C CD  . GLN B 1 498 ? 82.950  53.859 31.385  1.00 52.47  ? 499  GLN B CD  1 
ATOM   7984 O OE1 . GLN B 1 498 ? 82.703  52.683 31.250  1.00 50.83  ? 499  GLN B OE1 1 
ATOM   7985 N NE2 . GLN B 1 498 ? 83.225  54.380 32.534  1.00 57.31  ? 499  GLN B NE2 1 
ATOM   7986 N N   . TRP B 1 499 ? 86.873  53.410 29.208  1.00 29.23  ? 500  TRP B N   1 
ATOM   7987 C CA  . TRP B 1 499 ? 87.836  52.652 28.431  1.00 25.24  ? 500  TRP B CA  1 
ATOM   7988 C C   . TRP B 1 499 ? 87.053  51.695 27.538  1.00 31.51  ? 500  TRP B C   1 
ATOM   7989 O O   . TRP B 1 499 ? 86.426  50.760 28.057  1.00 31.27  ? 500  TRP B O   1 
ATOM   7990 C CB  . TRP B 1 499 ? 88.762  51.899 29.373  1.00 22.77  ? 500  TRP B CB  1 
ATOM   7991 C CG  . TRP B 1 499 ? 89.928  51.193 28.767  1.00 26.94  ? 500  TRP B CG  1 
ATOM   7992 C CD1 . TRP B 1 499 ? 90.088  50.800 27.463  1.00 24.75  ? 500  TRP B CD1 1 
ATOM   7993 C CD2 . TRP B 1 499 ? 91.112  50.790 29.457  1.00 23.94  ? 500  TRP B CD2 1 
ATOM   7994 N NE1 . TRP B 1 499 ? 91.301  50.170 27.309  1.00 22.28  ? 500  TRP B NE1 1 
ATOM   7995 C CE2 . TRP B 1 499 ? 91.947  50.148 28.520  1.00 25.65  ? 500  TRP B CE2 1 
ATOM   7996 C CE3 . TRP B 1 499 ? 91.551  50.915 30.780  1.00 25.55  ? 500  TRP B CE3 1 
ATOM   7997 C CZ2 . TRP B 1 499 ? 93.196  49.635 28.863  1.00 24.05  ? 500  TRP B CZ2 1 
ATOM   7998 C CZ3 . TRP B 1 499 ? 92.787  50.397 31.124  1.00 24.62  ? 500  TRP B CZ3 1 
ATOM   7999 C CH2 . TRP B 1 499 ? 93.598  49.766 30.166  1.00 24.15  ? 500  TRP B CH2 1 
ATOM   8000 N N   . PRO B 1 500 ? 87.014  51.903 26.225  1.00 29.28  ? 501  PRO B N   1 
ATOM   8001 C CA  . PRO B 1 500 ? 86.216  51.029 25.359  1.00 29.06  ? 501  PRO B CA  1 
ATOM   8002 C C   . PRO B 1 500 ? 87.008  49.798 24.962  1.00 27.49  ? 501  PRO B C   1 
ATOM   8003 O O   . PRO B 1 500 ? 88.247  49.830 24.942  1.00 30.41  ? 501  PRO B O   1 
ATOM   8004 C CB  . PRO B 1 500 ? 85.929  51.918 24.140  1.00 33.69  ? 501  PRO B CB  1 
ATOM   8005 C CG  . PRO B 1 500 ? 87.166  52.762 24.034  1.00 32.50  ? 501  PRO B CG  1 
ATOM   8006 C CD  . PRO B 1 500 ? 87.632  53.008 25.468  1.00 30.50  ? 501  PRO B CD  1 
ATOM   8007 N N   . PRO B 1 501 ? 86.336  48.693 24.643  1.00 28.89  ? 502  PRO B N   1 
ATOM   8008 C CA  . PRO B 1 501 ? 87.062  47.499 24.192  1.00 29.41  ? 502  PRO B CA  1 
ATOM   8009 C C   . PRO B 1 501 ? 87.763  47.730 22.859  1.00 29.03  ? 502  PRO B C   1 
ATOM   8010 O O   . PRO B 1 501 ? 87.343  48.549 22.040  1.00 26.04  ? 502  PRO B O   1 
ATOM   8011 C CB  . PRO B 1 501 ? 85.960  46.437 24.063  1.00 33.09  ? 502  PRO B CB  1 
ATOM   8012 C CG  . PRO B 1 501 ? 84.840  46.933 24.949  1.00 30.75  ? 502  PRO B CG  1 
ATOM   8013 C CD  . PRO B 1 501 ? 84.898  48.433 24.843  1.00 27.83  ? 502  PRO B CD  1 
ATOM   8014 N N   . TYR B 1 502 ? 88.858  46.997 22.658  1.00 25.67  ? 503  TYR B N   1 
ATOM   8015 C CA  . TYR B 1 502 ? 89.571  46.988 21.386  1.00 26.66  ? 503  TYR B CA  1 
ATOM   8016 C C   . TYR B 1 502 ? 88.902  46.000 20.437  1.00 29.05  ? 503  TYR B C   1 
ATOM   8017 O O   . TYR B 1 502 ? 88.593  44.870 20.828  1.00 28.41  ? 503  TYR B O   1 
ATOM   8018 C CB  . TYR B 1 502 ? 91.039  46.606 21.610  1.00 24.12  ? 503  TYR B CB  1 
ATOM   8019 C CG  . TYR B 1 502 ? 91.913  46.559 20.368  1.00 26.58  ? 503  TYR B CG  1 
ATOM   8020 C CD1 . TYR B 1 502 ? 91.957  45.424 19.561  1.00 28.04  ? 503  TYR B CD1 1 
ATOM   8021 C CD2 . TYR B 1 502 ? 92.720  47.639 20.020  1.00 24.68  ? 503  TYR B CD2 1 
ATOM   8022 C CE1 . TYR B 1 502 ? 92.764  45.375 18.430  1.00 27.18  ? 503  TYR B CE1 1 
ATOM   8023 C CE2 . TYR B 1 502 ? 93.532  47.597 18.891  1.00 26.56  ? 503  TYR B CE2 1 
ATOM   8024 C CZ  . TYR B 1 502 ? 93.553  46.464 18.103  1.00 29.45  ? 503  TYR B CZ  1 
ATOM   8025 O OH  . TYR B 1 502 ? 94.356  46.424 16.979  1.00 33.98  ? 503  TYR B OH  1 
ATOM   8026 N N   . THR B 1 503 ? 88.664  46.432 19.199  1.00 27.04  ? 504  THR B N   1 
ATOM   8027 C CA  . THR B 1 503 ? 88.081  45.592 18.160  1.00 28.28  ? 504  THR B CA  1 
ATOM   8028 C C   . THR B 1 503 ? 88.957  45.661 16.916  1.00 31.68  ? 504  THR B C   1 
ATOM   8029 O O   . THR B 1 503 ? 89.710  46.617 16.720  1.00 30.92  ? 504  THR B O   1 
ATOM   8030 C CB  . THR B 1 503 ? 86.645  46.022 17.811  1.00 31.82  ? 504  THR B CB  1 
ATOM   8031 O OG1 . THR B 1 503 ? 86.643  47.390 17.380  1.00 35.36  ? 504  THR B OG1 1 
ATOM   8032 C CG2 . THR B 1 503 ? 85.727  45.880 19.025  1.00 30.73  ? 504  THR B CG2 1 
ATOM   8033 N N   . ALA B 1 504 ? 88.856  44.636 16.067  1.00 35.25  ? 505  ALA B N   1 
ATOM   8034 C CA  . ALA B 1 504 ? 89.700  44.600 14.875  1.00 38.07  ? 505  ALA B CA  1 
ATOM   8035 C C   . ALA B 1 504 ? 89.395  45.759 13.931  1.00 36.28  ? 505  ALA B C   1 
ATOM   8036 O O   . ALA B 1 504 ? 90.298  46.252 13.241  1.00 32.98  ? 505  ALA B O   1 
ATOM   8037 C CB  . ALA B 1 504 ? 89.536  43.265 14.147  1.00 34.77  ? 505  ALA B CB  1 
ATOM   8038 N N   . GLY B 1 505 ? 88.143  46.207 13.886  1.00 34.05  ? 506  GLY B N   1 
ATOM   8039 C CA  . GLY B 1 505 ? 87.773  47.337 13.053  1.00 33.09  ? 506  GLY B CA  1 
ATOM   8040 C C   . GLY B 1 505 ? 88.144  48.687 13.642  1.00 38.73  ? 506  GLY B C   1 
ATOM   8041 O O   . GLY B 1 505 ? 88.970  49.410 13.075  1.00 34.38  ? 506  GLY B O   1 
ATOM   8042 N N   . ALA B 1 506 ? 87.552  49.037 14.789  1.00 35.16  ? 507  ALA B N   1 
ATOM   8043 C CA  . ALA B 1 506 ? 87.769  50.370 15.345  1.00 29.45  ? 507  ALA B CA  1 
ATOM   8044 C C   . ALA B 1 506 ? 89.157  50.509 15.959  1.00 30.14  ? 507  ALA B C   1 
ATOM   8045 O O   . ALA B 1 506 ? 89.714  51.615 15.974  1.00 29.74  ? 507  ALA B O   1 
ATOM   8046 C CB  . ALA B 1 506 ? 86.687  50.695 16.377  1.00 27.19  ? 507  ALA B CB  1 
ATOM   8047 N N   . GLN B 1 507 ? 89.721  49.412 16.473  1.00 26.44  ? 508  GLN B N   1 
ATOM   8048 C CA  . GLN B 1 507 ? 91.098  49.383 16.979  1.00 29.23  ? 508  GLN B CA  1 
ATOM   8049 C C   . GLN B 1 507 ? 91.327  50.421 18.078  1.00 30.13  ? 508  GLN B C   1 
ATOM   8050 O O   . GLN B 1 507 ? 92.370  51.073 18.136  1.00 28.41  ? 508  GLN B O   1 
ATOM   8051 C CB  . GLN B 1 507 ? 92.103  49.574 15.840  1.00 26.72  ? 508  GLN B CB  1 
ATOM   8052 C CG  . GLN B 1 507 ? 91.959  48.571 14.707  1.00 32.48  ? 508  GLN B CG  1 
ATOM   8053 C CD  . GLN B 1 507 ? 92.806  48.935 13.494  1.00 33.27  ? 508  GLN B CD  1 
ATOM   8054 O OE1 . GLN B 1 507 ? 94.030  49.023 13.583  1.00 32.57  ? 508  GLN B OE1 1 
ATOM   8055 N NE2 . GLN B 1 507 ? 92.151  49.169 12.360  1.00 31.73  ? 508  GLN B NE2 1 
ATOM   8056 N N   . GLN B 1 508 ? 90.347  50.582 18.962  1.00 29.23  ? 509  GLN B N   1 
ATOM   8057 C CA  . GLN B 1 508 ? 90.429  51.625 19.976  1.00 28.05  ? 509  GLN B CA  1 
ATOM   8058 C C   . GLN B 1 508 ? 91.256  51.173 21.170  1.00 26.95  ? 509  GLN B C   1 
ATOM   8059 O O   . GLN B 1 508 ? 91.166  50.025 21.616  1.00 27.96  ? 509  GLN B O   1 
ATOM   8060 C CB  . GLN B 1 508 ? 89.032  52.041 20.436  1.00 29.27  ? 509  GLN B CB  1 
ATOM   8061 C CG  . GLN B 1 508 ? 88.245  52.781 19.374  1.00 31.37  ? 509  GLN B CG  1 
ATOM   8062 C CD  . GLN B 1 508 ? 86.806  53.037 19.791  1.00 36.90  ? 509  GLN B CD  1 
ATOM   8063 O OE1 . GLN B 1 508 ? 86.412  54.176 20.030  1.00 38.68  ? 509  GLN B OE1 1 
ATOM   8064 N NE2 . GLN B 1 508 ? 86.014  51.973 19.874  1.00 35.04  ? 509  GLN B NE2 1 
ATOM   8065 N N   . TYR B 1 509 ? 92.075  52.092 21.673  1.00 26.33  ? 510  TYR B N   1 
ATOM   8066 C CA  . TYR B 1 509 ? 92.865  51.895 22.879  1.00 25.34  ? 510  TYR B CA  1 
ATOM   8067 C C   . TYR B 1 509 ? 92.864  53.213 23.642  1.00 30.85  ? 510  TYR B C   1 
ATOM   8068 O O   . TYR B 1 509 ? 92.407  54.240 23.130  1.00 31.07  ? 510  TYR B O   1 
ATOM   8069 C CB  . TYR B 1 509 ? 94.294  51.441 22.544  1.00 24.61  ? 510  TYR B CB  1 
ATOM   8070 C CG  . TYR B 1 509 ? 95.128  52.513 21.864  1.00 27.04  ? 510  TYR B CG  1 
ATOM   8071 C CD1 . TYR B 1 509 ? 95.113  52.672 20.479  1.00 23.36  ? 510  TYR B CD1 1 
ATOM   8072 C CD2 . TYR B 1 509 ? 95.919  53.375 22.613  1.00 25.20  ? 510  TYR B CD2 1 
ATOM   8073 C CE1 . TYR B 1 509 ? 95.880  53.655 19.865  1.00 25.01  ? 510  TYR B CE1 1 
ATOM   8074 C CE2 . TYR B 1 509 ? 96.676  54.355 22.014  1.00 32.13  ? 510  TYR B CE2 1 
ATOM   8075 C CZ  . TYR B 1 509 ? 96.659  54.492 20.645  1.00 32.75  ? 510  TYR B CZ  1 
ATOM   8076 O OH  . TYR B 1 509 ? 97.426  55.478 20.075  1.00 40.10  ? 510  TYR B OH  1 
ATOM   8077 N N   . VAL B 1 510 ? 93.370  53.196 24.878  1.00 23.56  ? 511  VAL B N   1 
ATOM   8078 C CA  . VAL B 1 510 ? 93.474  54.430 25.648  1.00 24.64  ? 511  VAL B CA  1 
ATOM   8079 C C   . VAL B 1 510 ? 94.929  54.701 25.987  1.00 26.97  ? 511  VAL B C   1 
ATOM   8080 O O   . VAL B 1 510 ? 95.749  53.786 26.112  1.00 28.16  ? 511  VAL B O   1 
ATOM   8081 C CB  . VAL B 1 510 ? 92.622  54.420 26.940  1.00 25.26  ? 511  VAL B CB  1 
ATOM   8082 C CG1 . VAL B 1 510 ? 91.148  54.261 26.611  1.00 23.32  ? 511  VAL B CG1 1 
ATOM   8083 C CG2 . VAL B 1 510 ? 93.101  53.334 27.911  1.00 22.97  ? 511  VAL B CG2 1 
ATOM   8084 N N   . SER B 1 511 ? 95.245  55.986 26.138  1.00 29.81  ? 512  SER B N   1 
ATOM   8085 C CA  . SER B 1 511 ? 96.543  56.405 26.643  1.00 26.14  ? 512  SER B CA  1 
ATOM   8086 C C   . SER B 1 511 ? 96.496  56.463 28.165  1.00 29.38  ? 512  SER B C   1 
ATOM   8087 O O   . SER B 1 511 ? 95.565  57.029 28.744  1.00 28.70  ? 512  SER B O   1 
ATOM   8088 C CB  . SER B 1 511 ? 96.934  57.769 26.072  1.00 30.67  ? 512  SER B CB  1 
ATOM   8089 O OG  . SER B 1 511 ? 95.972  58.753 26.410  1.00 39.02  ? 512  SER B OG  1 
ATOM   8090 N N   . LEU B 1 512 ? 97.497  55.874 28.809  1.00 26.51  ? 513  LEU B N   1 
ATOM   8091 C CA  . LEU B 1 512 ? 97.633  55.929 30.259  1.00 26.81  ? 513  LEU B CA  1 
ATOM   8092 C C   . LEU B 1 512 ? 98.737  56.927 30.584  1.00 28.61  ? 513  LEU B C   1 
ATOM   8093 O O   . LEU B 1 512 ? 99.915  56.666 30.311  1.00 30.09  ? 513  LEU B O   1 
ATOM   8094 C CB  . LEU B 1 512 ? 97.942  54.545 30.835  1.00 26.57  ? 513  LEU B CB  1 
ATOM   8095 C CG  . LEU B 1 512 ? 96.904  53.443 30.579  1.00 26.25  ? 513  LEU B CG  1 
ATOM   8096 C CD1 . LEU B 1 512 ? 97.358  52.089 31.138  1.00 23.52  ? 513  LEU B CD1 1 
ATOM   8097 C CD2 . LEU B 1 512 ? 95.557  53.830 31.172  1.00 25.56  ? 513  LEU B CD2 1 
ATOM   8098 N N   . ASP B 1 513 ? 98.356  58.074 31.134  1.00 25.63  ? 514  ASP B N   1 
ATOM   8099 C CA  . ASP B 1 513 ? 99.324  59.035 31.652  1.00 29.15  ? 514  ASP B CA  1 
ATOM   8100 C C   . ASP B 1 513 ? 98.639  59.858 32.742  1.00 34.87  ? 514  ASP B C   1 
ATOM   8101 O O   . ASP B 1 513 ? 97.587  59.472 33.262  1.00 38.33  ? 514  ASP B O   1 
ATOM   8102 C CB  . ASP B 1 513 ? 99.913  59.892 30.515  1.00 35.69  ? 514  ASP B CB  1 
ATOM   8103 C CG  . ASP B 1 513 ? 98.862  60.687 29.759  1.00 44.29  ? 514  ASP B CG  1 
ATOM   8104 O OD1 . ASP B 1 513 ? 97.705  60.783 30.220  1.00 50.24  ? 514  ASP B OD1 1 
ATOM   8105 O OD2 . ASP B 1 513 ? 99.205  61.239 28.696  1.00 51.29  ? 514  ASP B OD2 1 
ATOM   8106 N N   . LEU B 1 514 ? 99.233  61.000 33.089  1.00 35.05  ? 515  LEU B N   1 
ATOM   8107 C CA  . LEU B 1 514 ? 98.683  61.817 34.163  1.00 35.54  ? 515  LEU B CA  1 
ATOM   8108 C C   . LEU B 1 514 ? 97.363  62.472 33.778  1.00 38.22  ? 515  LEU B C   1 
ATOM   8109 O O   . LEU B 1 514 ? 96.597  62.851 34.668  1.00 47.81  ? 515  LEU B O   1 
ATOM   8110 C CB  . LEU B 1 514 ? 99.697  62.882 34.581  1.00 34.80  ? 515  LEU B CB  1 
ATOM   8111 C CG  . LEU B 1 514 ? 101.063 62.358 35.030  1.00 36.49  ? 515  LEU B CG  1 
ATOM   8112 C CD1 . LEU B 1 514 ? 101.964 63.517 35.452  1.00 36.87  ? 515  LEU B CD1 1 
ATOM   8113 C CD2 . LEU B 1 514 ? 100.916 61.349 36.166  1.00 35.88  ? 515  LEU B CD2 1 
ATOM   8114 N N   . ARG B 1 515 ? 97.076  62.602 32.487  1.00 38.36  ? 516  ARG B N   1 
ATOM   8115 C CA  . ARG B 1 515 ? 95.815  63.162 32.026  1.00 37.38  ? 516  ARG B CA  1 
ATOM   8116 C C   . ARG B 1 515 ? 94.718  62.106 32.077  1.00 38.94  ? 516  ARG B C   1 
ATOM   8117 O O   . ARG B 1 515 ? 95.000  60.907 32.125  1.00 34.77  ? 516  ARG B O   1 
ATOM   8118 C CB  . ARG B 1 515 ? 95.957  63.682 30.597  1.00 38.16  ? 516  ARG B CB  1 
ATOM   8119 C CG  . ARG B 1 515 ? 97.051  64.708 30.394  1.00 46.05  ? 516  ARG B CG  1 
ATOM   8120 C CD  . ARG B 1 515 ? 97.314  64.919 28.911  1.00 54.64  ? 516  ARG B CD  1 
ATOM   8121 N NE  . ARG B 1 515 ? 97.489  63.652 28.202  1.00 60.69  ? 516  ARG B NE  1 
ATOM   8122 C CZ  . ARG B 1 515 ? 96.726  63.245 27.190  1.00 64.06  ? 516  ARG B CZ  1 
ATOM   8123 N NH1 . ARG B 1 515 ? 95.733  64.009 26.752  1.00 66.06  ? 516  ARG B NH1 1 
ATOM   8124 N NH2 . ARG B 1 515 ? 96.963  62.076 26.607  1.00 59.80  ? 516  ARG B NH2 1 
ATOM   8125 N N   . PRO B 1 516 ? 93.451  62.523 32.062  1.00 41.07  ? 517  PRO B N   1 
ATOM   8126 C CA  . PRO B 1 516 ? 92.364  61.544 31.966  1.00 39.37  ? 517  PRO B CA  1 
ATOM   8127 C C   . PRO B 1 516 ? 92.493  60.717 30.695  1.00 37.91  ? 517  PRO B C   1 
ATOM   8128 O O   . PRO B 1 516 ? 93.154  61.115 29.732  1.00 35.06  ? 517  PRO B O   1 
ATOM   8129 C CB  . PRO B 1 516 ? 91.101  62.412 31.940  1.00 42.18  ? 517  PRO B CB  1 
ATOM   8130 C CG  . PRO B 1 516 ? 91.518  63.706 32.558  1.00 45.21  ? 517  PRO B CG  1 
ATOM   8131 C CD  . PRO B 1 516 ? 92.946  63.903 32.177  1.00 39.05  ? 517  PRO B CD  1 
ATOM   8132 N N   . LEU B 1 517 ? 91.850  59.546 30.706  1.00 35.20  ? 518  LEU B N   1 
ATOM   8133 C CA  . LEU B 1 517 ? 91.918  58.641 29.566  1.00 37.54  ? 518  LEU B CA  1 
ATOM   8134 C C   . LEU B 1 517 ? 91.595  59.372 28.272  1.00 37.02  ? 518  LEU B C   1 
ATOM   8135 O O   . LEU B 1 517 ? 90.662  60.174 28.206  1.00 36.31  ? 518  LEU B O   1 
ATOM   8136 C CB  . LEU B 1 517 ? 90.942  57.478 29.738  1.00 36.85  ? 518  LEU B CB  1 
ATOM   8137 C CG  . LEU B 1 517 ? 91.170  56.452 30.839  1.00 38.68  ? 518  LEU B CG  1 
ATOM   8138 C CD1 . LEU B 1 517 ? 90.105  55.371 30.723  1.00 33.61  ? 518  LEU B CD1 1 
ATOM   8139 C CD2 . LEU B 1 517 ? 92.561  55.854 30.737  1.00 37.92  ? 518  LEU B CD2 1 
ATOM   8140 N N   . GLU B 1 518 ? 92.384  59.096 27.243  1.00 41.77  ? 519  GLU B N   1 
ATOM   8141 C CA  . GLU B 1 518 ? 92.110  59.558 25.891  1.00 42.46  ? 519  GLU B CA  1 
ATOM   8142 C C   . GLU B 1 518 ? 91.992  58.333 24.999  1.00 33.46  ? 519  GLU B C   1 
ATOM   8143 O O   . GLU B 1 518 ? 92.873  57.469 25.014  1.00 32.74  ? 519  GLU B O   1 
ATOM   8144 C CB  . GLU B 1 518 ? 93.216  60.493 25.398  1.00 48.10  ? 519  GLU B CB  1 
ATOM   8145 C CG  . GLU B 1 518 ? 92.916  61.189 24.086  1.00 63.85  ? 519  GLU B CG  1 
ATOM   8146 C CD  . GLU B 1 518 ? 94.119  61.936 23.543  1.00 75.57  ? 519  GLU B CD  1 
ATOM   8147 O OE1 . GLU B 1 518 ? 94.495  61.692 22.376  1.00 75.93  ? 519  GLU B OE1 1 
ATOM   8148 O OE2 . GLU B 1 518 ? 94.696  62.758 24.287  1.00 82.83  ? 519  GLU B OE2 1 
ATOM   8149 N N   . VAL B 1 519 ? 90.895  58.239 24.254  1.00 32.39  ? 520  VAL B N   1 
ATOM   8150 C CA  . VAL B 1 519 ? 90.667  57.115 23.353  1.00 30.31  ? 520  VAL B CA  1 
ATOM   8151 C C   . VAL B 1 519 ? 91.292  57.438 22.005  1.00 31.98  ? 520  VAL B C   1 
ATOM   8152 O O   . VAL B 1 519 ? 91.056  58.513 21.443  1.00 34.48  ? 520  VAL B O   1 
ATOM   8153 C CB  . VAL B 1 519 ? 89.166  56.819 23.202  1.00 35.20  ? 520  VAL B CB  1 
ATOM   8154 C CG1 . VAL B 1 519 ? 88.956  55.642 22.248  1.00 34.61  ? 520  VAL B CG1 1 
ATOM   8155 C CG2 . VAL B 1 519 ? 88.537  56.529 24.549  1.00 34.21  ? 520  VAL B CG2 1 
ATOM   8156 N N   . ARG B 1 520 ? 92.087  56.506 21.484  1.00 33.28  ? 521  ARG B N   1 
ATOM   8157 C CA  . ARG B 1 520 ? 92.733  56.646 20.187  1.00 35.57  ? 521  ARG B CA  1 
ATOM   8158 C C   . ARG B 1 520 ? 92.496  55.383 19.372  1.00 31.28  ? 521  ARG B C   1 
ATOM   8159 O O   . ARG B 1 520 ? 92.037  54.365 19.892  1.00 33.40  ? 521  ARG B O   1 
ATOM   8160 C CB  . ARG B 1 520 ? 94.233  56.919 20.342  1.00 34.40  ? 521  ARG B CB  1 
ATOM   8161 C CG  . ARG B 1 520 ? 94.516  58.144 21.178  1.00 39.55  ? 521  ARG B CG  1 
ATOM   8162 C CD  . ARG B 1 520 ? 95.991  58.390 21.316  1.00 43.23  ? 521  ARG B CD  1 
ATOM   8163 N NE  . ARG B 1 520 ? 96.256  59.461 22.269  1.00 49.82  ? 521  ARG B NE  1 
ATOM   8164 C CZ  . ARG B 1 520 ? 97.427  59.645 22.865  1.00 51.27  ? 521  ARG B CZ  1 
ATOM   8165 N NH1 . ARG B 1 520 ? 98.434  58.823 22.602  1.00 51.36  ? 521  ARG B NH1 1 
ATOM   8166 N NH2 . ARG B 1 520 ? 97.589  60.642 23.725  1.00 49.38  ? 521  ARG B NH2 1 
ATOM   8167 N N   . ARG B 1 521 ? 92.810  55.460 18.079  1.00 30.77  ? 522  ARG B N   1 
ATOM   8168 C CA  . ARG B 1 521 ? 92.620  54.354 17.150  1.00 32.28  ? 522  ARG B CA  1 
ATOM   8169 C C   . ARG B 1 521 ? 93.961  53.891 16.600  1.00 32.95  ? 522  ARG B C   1 
ATOM   8170 O O   . ARG B 1 521 ? 94.794  54.712 16.202  1.00 38.94  ? 522  ARG B O   1 
ATOM   8171 C CB  . ARG B 1 521 ? 91.714  54.747 15.977  1.00 32.69  ? 522  ARG B CB  1 
ATOM   8172 C CG  . ARG B 1 521 ? 90.270  55.064 16.334  1.00 38.59  ? 522  ARG B CG  1 
ATOM   8173 C CD  . ARG B 1 521 ? 89.390  55.114 15.077  1.00 36.10  ? 522  ARG B CD  1 
ATOM   8174 N NE  . ARG B 1 521 ? 89.358  53.819 14.400  1.00 39.97  ? 522  ARG B NE  1 
ATOM   8175 C CZ  . ARG B 1 521 ? 89.571  53.635 13.100  1.00 40.87  ? 522  ARG B CZ  1 
ATOM   8176 N NH1 . ARG B 1 521 ? 89.814  54.671 12.305  1.00 40.63  ? 522  ARG B NH1 1 
ATOM   8177 N NH2 . ARG B 1 521 ? 89.521  52.408 12.591  1.00 35.04  ? 522  ARG B NH2 1 
ATOM   8178 N N   . GLY B 1 522 ? 94.161  52.575 16.571  1.00 31.70  ? 523  GLY B N   1 
ATOM   8179 C CA  . GLY B 1 522 ? 95.297  51.990 15.880  1.00 29.43  ? 523  GLY B CA  1 
ATOM   8180 C C   . GLY B 1 522 ? 96.571  51.847 16.687  1.00 30.37  ? 523  GLY B C   1 
ATOM   8181 O O   . GLY B 1 522 ? 97.179  52.842 17.092  1.00 29.08  ? 523  GLY B O   1 
ATOM   8182 N N   . LEU B 1 523 ? 96.982  50.602 16.929  1.00 31.72  ? 524  LEU B N   1 
ATOM   8183 C CA  . LEU B 1 523 ? 98.288  50.307 17.520  1.00 30.81  ? 524  LEU B CA  1 
ATOM   8184 C C   . LEU B 1 523 ? 99.292  50.222 16.375  1.00 27.84  ? 524  LEU B C   1 
ATOM   8185 O O   . LEU B 1 523 ? 99.628  49.144 15.877  1.00 30.79  ? 524  LEU B O   1 
ATOM   8186 C CB  . LEU B 1 523 ? 98.243  49.013 18.328  1.00 24.25  ? 524  LEU B CB  1 
ATOM   8187 C CG  . LEU B 1 523 ? 97.288  48.949 19.526  1.00 29.44  ? 524  LEU B CG  1 
ATOM   8188 C CD1 . LEU B 1 523 ? 97.110  47.511 20.010  1.00 25.29  ? 524  LEU B CD1 1 
ATOM   8189 C CD2 . LEU B 1 523 ? 97.799  49.823 20.651  1.00 26.10  ? 524  LEU B CD2 1 
ATOM   8190 N N   . ARG B 1 524 ? 99.773  51.390 15.954  1.00 26.41  ? 525  ARG B N   1 
ATOM   8191 C CA  A ARG B 1 524 ? 100.707 51.496 14.836  0.66 27.61  ? 525  ARG B CA  1 
ATOM   8192 C CA  B ARG B 1 524 ? 100.686 51.530 14.818  0.34 27.48  ? 525  ARG B CA  1 
ATOM   8193 C C   . ARG B 1 524 ? 100.201 50.689 13.636  1.00 26.16  ? 525  ARG B C   1 
ATOM   8194 O O   . ARG B 1 524 ? 100.867 49.781 13.142  1.00 27.05  ? 525  ARG B O   1 
ATOM   8195 C CB  A ARG B 1 524 ? 102.104 51.034 15.259  0.66 27.73  ? 525  ARG B CB  1 
ATOM   8196 C CB  B ARG B 1 524 ? 102.113 51.181 15.225  0.34 27.66  ? 525  ARG B CB  1 
ATOM   8197 C CG  A ARG B 1 524 ? 102.673 51.744 16.484  0.66 28.05  ? 525  ARG B CG  1 
ATOM   8198 C CG  B ARG B 1 524 ? 102.539 51.902 16.492  0.34 27.77  ? 525  ARG B CG  1 
ATOM   8199 C CD  A ARG B 1 524 ? 103.534 52.912 16.066  0.66 26.39  ? 525  ARG B CD  1 
ATOM   8200 C CD  B ARG B 1 524 ? 104.036 52.083 16.582  0.34 26.01  ? 525  ARG B CD  1 
ATOM   8201 N NE  A ARG B 1 524 ? 104.607 52.465 15.187  0.66 32.75  ? 525  ARG B NE  1 
ATOM   8202 N NE  B ARG B 1 524 ? 104.422 52.679 17.855  0.34 23.67  ? 525  ARG B NE  1 
ATOM   8203 C CZ  A ARG B 1 524 ? 105.290 53.259 14.371  0.66 33.56  ? 525  ARG B CZ  1 
ATOM   8204 C CZ  B ARG B 1 524 ? 105.654 53.078 18.148  0.34 27.54  ? 525  ARG B CZ  1 
ATOM   8205 N NH1 A ARG B 1 524 ? 105.014 54.555 14.314  0.66 33.17  ? 525  ARG B NH1 1 
ATOM   8206 N NH1 B ARG B 1 524 ? 106.625 52.938 17.254  0.34 22.02  ? 525  ARG B NH1 1 
ATOM   8207 N NH2 A ARG B 1 524 ? 106.245 52.752 13.609  0.66 20.05  ? 525  ARG B NH2 1 
ATOM   8208 N NH2 B ARG B 1 524 ? 105.920 53.605 19.335  0.34 30.42  ? 525  ARG B NH2 1 
ATOM   8209 N N   . ALA B 1 525 ? 98.990  51.027 13.193  1.00 24.68  ? 526  ALA B N   1 
ATOM   8210 C CA  . ALA B 1 525 ? 98.282  50.214 12.207  1.00 28.39  ? 526  ALA B CA  1 
ATOM   8211 C C   . ALA B 1 525 ? 99.035  50.124 10.881  1.00 27.35  ? 526  ALA B C   1 
ATOM   8212 O O   . ALA B 1 525 ? 99.139  49.042 10.293  1.00 30.93  ? 526  ALA B O   1 
ATOM   8213 C CB  . ALA B 1 525 ? 96.874  50.773 11.991  1.00 26.62  ? 526  ALA B CB  1 
ATOM   8214 N N   . GLN B 1 526 ? 99.551  51.250 10.378  1.00 26.16  ? 527  GLN B N   1 
ATOM   8215 C CA  . GLN B 1 526 ? 100.284 51.201 9.112   1.00 28.39  ? 527  GLN B CA  1 
ATOM   8216 C C   . GLN B 1 526 ? 101.543 50.351 9.235   1.00 30.20  ? 527  GLN B C   1 
ATOM   8217 O O   . GLN B 1 526 ? 101.844 49.540 8.351   1.00 31.94  ? 527  GLN B O   1 
ATOM   8218 C CB  . GLN B 1 526 ? 100.643 52.611 8.631   1.00 29.43  ? 527  GLN B CB  1 
ATOM   8219 C CG  . GLN B 1 526 ? 99.513  53.630 8.714   1.00 35.47  ? 527  GLN B CG  1 
ATOM   8220 C CD  . GLN B 1 526 ? 98.273  53.221 7.932   1.00 41.69  ? 527  GLN B CD  1 
ATOM   8221 O OE1 . GLN B 1 526 ? 98.357  52.512 6.928   1.00 35.94  ? 527  GLN B OE1 1 
ATOM   8222 N NE2 . GLN B 1 526 ? 97.110  53.673 8.396   1.00 46.20  ? 527  GLN B NE2 1 
ATOM   8223 N N   . ALA B 1 527 ? 102.295 50.518 10.323  1.00 30.82  ? 528  ALA B N   1 
ATOM   8224 C CA  . ALA B 1 527 ? 103.513 49.733 10.493  1.00 29.51  ? 528  ALA B CA  1 
ATOM   8225 C C   . ALA B 1 527 ? 103.192 48.264 10.730  1.00 28.60  ? 528  ALA B C   1 
ATOM   8226 O O   . ALA B 1 527 ? 103.868 47.379 10.195  1.00 28.94  ? 528  ALA B O   1 
ATOM   8227 C CB  . ALA B 1 527 ? 104.344 50.289 11.649  1.00 32.17  ? 528  ALA B CB  1 
ATOM   8228 N N   . CYS B 1 528 ? 102.157 47.983 11.521  1.00 22.15  ? 529  CYS B N   1 
ATOM   8229 C CA  . CYS B 1 528 ? 101.866 46.595 11.862  1.00 25.07  ? 529  CYS B CA  1 
ATOM   8230 C C   . CYS B 1 528 ? 101.202 45.834 10.719  1.00 25.51  ? 529  CYS B C   1 
ATOM   8231 O O   . CYS B 1 528 ? 101.317 44.606 10.663  1.00 26.12  ? 529  CYS B O   1 
ATOM   8232 C CB  . CYS B 1 528 ? 101.019 46.545 13.126  1.00 26.01  ? 529  CYS B CB  1 
ATOM   8233 S SG  . CYS B 1 528 ? 101.984 47.057 14.577  1.00 30.06  ? 529  CYS B SG  1 
ATOM   8234 N N   . ALA B 1 529 ? 100.539 46.527 9.790   1.00 23.63  ? 530  ALA B N   1 
ATOM   8235 C CA  . ALA B 1 529 ? 100.109 45.852 8.571   1.00 23.18  ? 530  ALA B CA  1 
ATOM   8236 C C   . ALA B 1 529 ? 101.305 45.307 7.804   1.00 24.82  ? 530  ALA B C   1 
ATOM   8237 O O   . ALA B 1 529 ? 101.206 44.262 7.153   1.00 23.06  ? 530  ALA B O   1 
ATOM   8238 C CB  . ALA B 1 529 ? 99.292  46.800 7.693   1.00 20.61  ? 530  ALA B CB  1 
ATOM   8239 N N   . PHE B 1 530 ? 102.447 45.988 7.881   1.00 24.62  ? 531  PHE B N   1 
ATOM   8240 C CA  . PHE B 1 530 ? 103.627 45.504 7.180   1.00 22.75  ? 531  PHE B CA  1 
ATOM   8241 C C   . PHE B 1 530 ? 104.194 44.259 7.862   1.00 24.14  ? 531  PHE B C   1 
ATOM   8242 O O   . PHE B 1 530 ? 104.433 43.241 7.205   1.00 26.45  ? 531  PHE B O   1 
ATOM   8243 C CB  . PHE B 1 530 ? 104.669 46.626 7.077   1.00 21.14  ? 531  PHE B CB  1 
ATOM   8244 C CG  . PHE B 1 530 ? 106.092 46.139 6.973   1.00 27.13  ? 531  PHE B CG  1 
ATOM   8245 C CD1 . PHE B 1 530 ? 106.866 46.043 8.098   1.00 24.82  ? 531  PHE B CD1 1 
ATOM   8246 C CD2 . PHE B 1 530 ? 106.645 45.766 5.748   1.00 34.96  ? 531  PHE B CD2 1 
ATOM   8247 C CE1 . PHE B 1 530 ? 108.165 45.592 8.042   1.00 26.95  ? 531  PHE B CE1 1 
ATOM   8248 C CE2 . PHE B 1 530 ? 107.973 45.304 5.679   1.00 36.15  ? 531  PHE B CE2 1 
ATOM   8249 C CZ  . PHE B 1 530 ? 108.728 45.225 6.846   1.00 31.39  ? 531  PHE B CZ  1 
ATOM   8250 N N   . TRP B 1 531 ? 104.376 44.312 9.189   1.00 20.30  ? 532  TRP B N   1 
ATOM   8251 C CA  . TRP B 1 531 ? 104.920 43.167 9.926   1.00 23.30  ? 532  TRP B CA  1 
ATOM   8252 C C   . TRP B 1 531 ? 103.953 41.990 9.970   1.00 26.94  ? 532  TRP B C   1 
ATOM   8253 O O   . TRP B 1 531 ? 104.378 40.830 9.897   1.00 27.17  ? 532  TRP B O   1 
ATOM   8254 C CB  . TRP B 1 531 ? 105.275 43.565 11.360  1.00 21.12  ? 532  TRP B CB  1 
ATOM   8255 C CG  . TRP B 1 531 ? 106.323 44.603 11.448  1.00 26.02  ? 532  TRP B CG  1 
ATOM   8256 C CD1 . TRP B 1 531 ? 106.142 45.925 11.718  1.00 25.95  ? 532  TRP B CD1 1 
ATOM   8257 C CD2 . TRP B 1 531 ? 107.729 44.416 11.261  1.00 22.65  ? 532  TRP B CD2 1 
ATOM   8258 N NE1 . TRP B 1 531 ? 107.351 46.574 11.717  1.00 29.04  ? 532  TRP B NE1 1 
ATOM   8259 C CE2 . TRP B 1 531 ? 108.343 45.670 11.441  1.00 24.49  ? 532  TRP B CE2 1 
ATOM   8260 C CE3 . TRP B 1 531 ? 108.531 43.307 10.965  1.00 22.28  ? 532  TRP B CE3 1 
ATOM   8261 C CZ2 . TRP B 1 531 ? 109.721 45.852 11.332  1.00 25.87  ? 532  TRP B CZ2 1 
ATOM   8262 C CZ3 . TRP B 1 531 ? 109.905 43.488 10.857  1.00 21.25  ? 532  TRP B CZ3 1 
ATOM   8263 C CH2 . TRP B 1 531 ? 110.484 44.754 11.038  1.00 21.59  ? 532  TRP B CH2 1 
ATOM   8264 N N   . ASN B 1 532 ? 102.661 42.253 10.139  1.00 23.81  ? 533  ASN B N   1 
ATOM   8265 C CA  . ASN B 1 532 ? 101.721 41.155 10.344  1.00 27.08  ? 533  ASN B CA  1 
ATOM   8266 C C   . ASN B 1 532 ? 101.070 40.648 9.064   1.00 28.81  ? 533  ASN B C   1 
ATOM   8267 O O   . ASN B 1 532 ? 100.684 39.474 9.004   1.00 32.07  ? 533  ASN B O   1 
ATOM   8268 C CB  . ASN B 1 532 ? 100.641 41.560 11.357  1.00 22.27  ? 533  ASN B CB  1 
ATOM   8269 C CG  . ASN B 1 532 ? 101.224 41.973 12.705  1.00 21.91  ? 533  ASN B CG  1 
ATOM   8270 O OD1 . ASN B 1 532 ? 102.340 41.594 13.050  1.00 23.71  ? 533  ASN B OD1 1 
ATOM   8271 N ND2 . ASN B 1 532 ? 100.457 42.732 13.480  1.00 18.18  ? 533  ASN B ND2 1 
ATOM   8272 N N   . ARG B 1 533 ? 100.939 41.477 8.031   1.00 26.42  ? 534  ARG B N   1 
ATOM   8273 C CA  . ARG B 1 533 ? 100.245 41.054 6.824   1.00 32.04  ? 534  ARG B CA  1 
ATOM   8274 C C   . ARG B 1 533 ? 101.175 40.826 5.647   1.00 34.93  ? 534  ARG B C   1 
ATOM   8275 O O   . ARG B 1 533 ? 101.052 39.810 4.958   1.00 32.60  ? 534  ARG B O   1 
ATOM   8276 C CB  . ARG B 1 533 ? 99.166  42.071 6.436   1.00 30.65  ? 534  ARG B CB  1 
ATOM   8277 C CG  . ARG B 1 533 ? 98.182  42.343 7.539   1.00 31.08  ? 534  ARG B CG  1 
ATOM   8278 C CD  . ARG B 1 533 ? 97.193  43.417 7.142   1.00 33.85  ? 534  ARG B CD  1 
ATOM   8279 N NE  . ARG B 1 533 ? 96.277  43.701 8.235   1.00 40.80  ? 534  ARG B NE  1 
ATOM   8280 C CZ  . ARG B 1 533 ? 95.118  43.078 8.415   1.00 53.17  ? 534  ARG B CZ  1 
ATOM   8281 N NH1 . ARG B 1 533 ? 94.727  42.139 7.561   1.00 54.02  ? 534  ARG B NH1 1 
ATOM   8282 N NH2 . ARG B 1 533 ? 94.346  43.402 9.444   1.00 56.58  ? 534  ARG B NH2 1 
ATOM   8283 N N   . PHE B 1 534 ? 102.114 41.734 5.392   1.00 30.10  ? 535  PHE B N   1 
ATOM   8284 C CA  . PHE B 1 534 ? 102.867 41.580 4.158   1.00 27.77  ? 535  PHE B CA  1 
ATOM   8285 C C   . PHE B 1 534 ? 104.174 40.819 4.348   1.00 27.69  ? 535  PHE B C   1 
ATOM   8286 O O   . PHE B 1 534 ? 104.468 39.903 3.578   1.00 26.92  ? 535  PHE B O   1 
ATOM   8287 C CB  . PHE B 1 534 ? 103.157 42.937 3.517   1.00 25.57  ? 535  PHE B CB  1 
ATOM   8288 C CG  . PHE B 1 534 ? 104.078 42.841 2.341   1.00 27.29  ? 535  PHE B CG  1 
ATOM   8289 C CD1 . PHE B 1 534 ? 105.435 43.073 2.488   1.00 29.10  ? 535  PHE B CD1 1 
ATOM   8290 C CD2 . PHE B 1 534 ? 103.602 42.414 1.107   1.00 24.19  ? 535  PHE B CD2 1 
ATOM   8291 C CE1 . PHE B 1 534 ? 106.296 42.938 1.399   1.00 31.73  ? 535  PHE B CE1 1 
ATOM   8292 C CE2 . PHE B 1 534 ? 104.455 42.276 0.027   1.00 28.39  ? 535  PHE B CE2 1 
ATOM   8293 C CZ  . PHE B 1 534 ? 105.801 42.540 0.169   1.00 29.21  ? 535  PHE B CZ  1 
ATOM   8294 N N   . LEU B 1 535 ? 104.972 41.196 5.344   1.00 32.64  ? 536  LEU B N   1 
ATOM   8295 C CA  . LEU B 1 535 ? 106.289 40.580 5.513   1.00 35.27  ? 536  LEU B CA  1 
ATOM   8296 C C   . LEU B 1 535 ? 106.235 39.061 5.591   1.00 37.68  ? 536  LEU B C   1 
ATOM   8297 O O   . LEU B 1 535 ? 107.132 38.418 5.021   1.00 38.59  ? 536  LEU B O   1 
ATOM   8298 C CB  . LEU B 1 535 ? 107.001 41.158 6.746   1.00 32.07  ? 536  LEU B CB  1 
ATOM   8299 C CG  . LEU B 1 535 ? 108.489 40.786 6.843   1.00 40.00  ? 536  LEU B CG  1 
ATOM   8300 C CD1 . LEU B 1 535 ? 109.224 41.155 5.557   1.00 42.99  ? 536  LEU B CD1 1 
ATOM   8301 C CD2 . LEU B 1 535 ? 109.167 41.437 8.032   1.00 36.32  ? 536  LEU B CD2 1 
ATOM   8302 N N   . PRO B 1 536 ? 105.248 38.424 6.239   1.00 36.51  ? 537  PRO B N   1 
ATOM   8303 C CA  . PRO B 1 536 ? 105.199 36.954 6.181   1.00 39.25  ? 537  PRO B CA  1 
ATOM   8304 C C   . PRO B 1 536 ? 105.048 36.406 4.772   1.00 38.15  ? 537  PRO B C   1 
ATOM   8305 O O   . PRO B 1 536 ? 105.652 35.375 4.453   1.00 39.21  ? 537  PRO B O   1 
ATOM   8306 C CB  . PRO B 1 536 ? 103.986 36.614 7.059   1.00 36.13  ? 537  PRO B CB  1 
ATOM   8307 C CG  . PRO B 1 536 ? 103.897 37.739 8.014   1.00 33.84  ? 537  PRO B CG  1 
ATOM   8308 C CD  . PRO B 1 536 ? 104.272 38.952 7.210   1.00 34.63  ? 537  PRO B CD  1 
ATOM   8309 N N   . LYS B 1 537 ? 104.247 37.055 3.921   1.00 39.70  ? 538  LYS B N   1 
ATOM   8310 C CA  . LYS B 1 537 ? 104.134 36.615 2.532   1.00 35.08  ? 538  LYS B CA  1 
ATOM   8311 C C   . LYS B 1 537 ? 105.476 36.707 1.820   1.00 34.16  ? 538  LYS B C   1 
ATOM   8312 O O   . LYS B 1 537 ? 105.824 35.838 1.013   1.00 41.93  ? 538  LYS B O   1 
ATOM   8313 C CB  . LYS B 1 537 ? 103.084 37.448 1.796   1.00 34.50  ? 538  LYS B CB  1 
ATOM   8314 C CG  . LYS B 1 537 ? 101.664 37.285 2.319   1.00 36.78  ? 538  LYS B CG  1 
ATOM   8315 C CD  . LYS B 1 537 ? 100.706 38.182 1.553   1.00 42.52  ? 538  LYS B CD  1 
ATOM   8316 C CE  . LYS B 1 537 ? 99.256  37.932 1.944   1.00 48.50  ? 538  LYS B CE  1 
ATOM   8317 N NZ  . LYS B 1 537 ? 98.981  38.317 3.354   1.00 59.77  ? 538  LYS B NZ  1 
ATOM   8318 N N   . LEU B 1 538 ? 106.247 37.754 2.112   1.00 39.90  ? 539  LEU B N   1 
ATOM   8319 C CA  . LEU B 1 538 ? 107.539 37.925 1.458   1.00 43.07  ? 539  LEU B CA  1 
ATOM   8320 C C   . LEU B 1 538 ? 108.518 36.838 1.877   1.00 44.80  ? 539  LEU B C   1 
ATOM   8321 O O   . LEU B 1 538 ? 109.246 36.294 1.038   1.00 46.24  ? 539  LEU B O   1 
ATOM   8322 C CB  . LEU B 1 538 ? 108.096 39.316 1.771   1.00 36.43  ? 539  LEU B CB  1 
ATOM   8323 C CG  . LEU B 1 538 ? 109.424 39.739 1.143   1.00 42.80  ? 539  LEU B CG  1 
ATOM   8324 C CD1 . LEU B 1 538 ? 109.400 41.219 0.798   1.00 46.01  ? 539  LEU B CD1 1 
ATOM   8325 C CD2 . LEU B 1 538 ? 110.570 39.444 2.087   1.00 40.70  ? 539  LEU B CD2 1 
ATOM   8326 N N   . LEU B 1 539 ? 108.543 36.501 3.170   1.00 48.43  ? 540  LEU B N   1 
ATOM   8327 C CA  . LEU B 1 539 ? 109.515 35.534 3.673   1.00 49.97  ? 540  LEU B CA  1 
ATOM   8328 C C   . LEU B 1 539 ? 109.273 34.133 3.119   1.00 55.08  ? 540  LEU B C   1 
ATOM   8329 O O   . LEU B 1 539 ? 110.232 33.380 2.913   1.00 63.90  ? 540  LEU B O   1 
ATOM   8330 C CB  . LEU B 1 539 ? 109.490 35.517 5.202   1.00 46.68  ? 540  LEU B CB  1 
ATOM   8331 C CG  . LEU B 1 539 ? 109.946 36.819 5.867   1.00 49.62  ? 540  LEU B CG  1 
ATOM   8332 C CD1 . LEU B 1 539 ? 109.722 36.797 7.371   1.00 47.99  ? 540  LEU B CD1 1 
ATOM   8333 C CD2 . LEU B 1 539 ? 111.406 37.087 5.551   1.00 50.36  ? 540  LEU B CD2 1 
ATOM   8334 N N   . SER B 1 540 ? 108.018 33.766 2.862   1.00 50.20  ? 541  SER B N   1 
ATOM   8335 C CA  . SER B 1 540 ? 107.698 32.434 2.363   1.00 55.13  ? 541  SER B CA  1 
ATOM   8336 C C   . SER B 1 540 ? 107.687 32.344 0.841   1.00 61.36  ? 541  SER B C   1 
ATOM   8337 O O   . SER B 1 540 ? 107.434 31.260 0.304   1.00 67.77  ? 541  SER B O   1 
ATOM   8338 C CB  . SER B 1 540 ? 106.344 31.977 2.914   1.00 59.50  ? 541  SER B CB  1 
ATOM   8339 O OG  . SER B 1 540 ? 105.285 32.747 2.378   1.00 68.07  ? 541  SER B OG  1 
ATOM   8340 N N   . ALA B 1 541 ? 107.957 33.439 0.134   1.00 61.75  ? 542  ALA B N   1 
ATOM   8341 C CA  . ALA B 1 541 ? 107.947 33.420 -1.330  1.00 66.20  ? 542  ALA B CA  1 
ATOM   8342 C C   . ALA B 1 541 ? 109.210 34.043 -1.919  1.00 66.80  ? 542  ALA B C   1 
ATOM   8343 O O   . ALA B 1 541 ? 110.305 33.880 -1.382  1.00 72.23  ? 542  ALA B O   1 
ATOM   8344 C CB  . ALA B 1 541 ? 106.713 34.138 -1.857  1.00 63.78  ? 542  ALA B CB  1 
HETATM 8345 C C1  . NAG C 2 .   ? 58.888  4.598  11.475  1.00 56.17  ? 1    NAG C C1  1 
HETATM 8346 C C2  . NAG C 2 .   ? 58.274  3.444  10.692  1.00 67.29  ? 1    NAG C C2  1 
HETATM 8347 C C3  . NAG C 2 .   ? 56.787  3.306  10.997  1.00 72.80  ? 1    NAG C C3  1 
HETATM 8348 C C4  . NAG C 2 .   ? 56.536  3.305  12.500  1.00 76.70  ? 1    NAG C C4  1 
HETATM 8349 C C5  . NAG C 2 .   ? 57.254  4.468  13.174  1.00 71.18  ? 1    NAG C C5  1 
HETATM 8350 C C6  . NAG C 2 .   ? 57.065  4.423  14.686  1.00 76.84  ? 1    NAG C C6  1 
HETATM 8351 C C7  . NAG C 2 .   ? 59.330  2.909  8.573   1.00 75.84  ? 1    NAG C C7  1 
HETATM 8352 C C8  . NAG C 2 .   ? 59.414  1.465  8.971   1.00 74.22  ? 1    NAG C C8  1 
HETATM 8353 N N2  . NAG C 2 .   ? 58.472  3.649  9.270   1.00 71.57  ? 1    NAG C N2  1 
HETATM 8354 O O3  . NAG C 2 .   ? 56.295  2.087  10.429  1.00 75.44  ? 1    NAG C O3  1 
HETATM 8355 O O4  . NAG C 2 .   ? 55.129  3.404  12.748  1.00 84.41  ? 1    NAG C O4  1 
HETATM 8356 O O5  . NAG C 2 .   ? 58.645  4.410  12.867  1.00 60.81  ? 1    NAG C O5  1 
HETATM 8357 O O6  . NAG C 2 .   ? 57.187  3.071  15.143  1.00 83.48  ? 1    NAG C O6  1 
HETATM 8358 O O7  . NAG C 2 .   ? 60.005  3.374  7.670   1.00 79.94  ? 1    NAG C O7  1 
HETATM 8359 C C1  . NAG C 2 .   ? 54.744  2.348  13.646  1.00 91.59  ? 2    NAG C C1  1 
HETATM 8360 C C2  . NAG C 2 .   ? 53.352  2.633  14.199  1.00 92.15  ? 2    NAG C C2  1 
HETATM 8361 C C3  . NAG C 2 .   ? 52.903  1.527  15.146  1.00 99.87  ? 2    NAG C C3  1 
HETATM 8362 C C4  . NAG C 2 .   ? 53.106  0.154  14.516  1.00 104.04 ? 2    NAG C C4  1 
HETATM 8363 C C5  . NAG C 2 .   ? 54.512  0.017  13.945  1.00 103.55 ? 2    NAG C C5  1 
HETATM 8364 C C6  . NAG C 2 .   ? 54.691  -1.327 13.250  1.00 104.95 ? 2    NAG C C6  1 
HETATM 8365 C C7  . NAG C 2 .   ? 52.843  5.002  14.319  1.00 74.01  ? 2    NAG C C7  1 
HETATM 8366 C C8  . NAG C 2 .   ? 52.988  6.270  15.108  1.00 72.01  ? 2    NAG C C8  1 
HETATM 8367 N N2  . NAG C 2 .   ? 53.344  3.909  14.887  1.00 84.30  ? 2    NAG C N2  1 
HETATM 8368 O O3  . NAG C 2 .   ? 51.519  1.705  15.466  1.00 99.83  ? 2    NAG C O3  1 
HETATM 8369 O O4  . NAG C 2 .   ? 52.891  -0.861 15.504  1.00 105.01 ? 2    NAG C O4  1 
HETATM 8370 O O5  . NAG C 2 .   ? 54.751  1.070  13.014  1.00 99.08  ? 2    NAG C O5  1 
HETATM 8371 O O6  . NAG C 2 .   ? 54.371  -1.192 11.860  1.00 106.12 ? 2    NAG C O6  1 
HETATM 8372 O O7  . NAG C 2 .   ? 52.300  4.976  13.227  1.00 66.76  ? 2    NAG C O7  1 
HETATM 8373 C C1  . FUC C 2 .   ? 58.047  3.050  16.296  1.00 85.98  ? 3    FUC C C1  1 
HETATM 8374 C C2  . FUC C 2 .   ? 58.111  1.634  16.856  1.00 90.64  ? 3    FUC C C2  1 
HETATM 8375 C C3  . FUC C 2 .   ? 58.830  0.698  15.892  1.00 95.07  ? 3    FUC C C3  1 
HETATM 8376 C C4  . FUC C 2 .   ? 60.154  1.298  15.433  1.00 91.87  ? 3    FUC C C4  1 
HETATM 8377 C C5  . FUC C 2 .   ? 59.966  2.734  14.958  1.00 84.73  ? 3    FUC C C5  1 
HETATM 8378 C C6  . FUC C 2 .   ? 61.301  3.359  14.570  1.00 80.50  ? 3    FUC C C6  1 
HETATM 8379 O O2  . FUC C 2 .   ? 56.783  1.151  17.088  1.00 90.41  ? 3    FUC C O2  1 
HETATM 8380 O O3  . FUC C 2 .   ? 59.074  -0.557 16.538  1.00 101.21 ? 3    FUC C O3  1 
HETATM 8381 O O4  . FUC C 2 .   ? 61.091  1.271  16.515  1.00 93.28  ? 3    FUC C O4  1 
HETATM 8382 O O5  . FUC C 2 .   ? 59.365  3.503  15.997  1.00 83.50  ? 3    FUC C O5  1 
HETATM 8383 C C1  . NAG D 2 .   ? 127.507 57.954 21.566  1.00 46.93  ? 1    NAG D C1  1 
HETATM 8384 C C2  . NAG D 2 .   ? 128.359 58.433 20.397  1.00 65.43  ? 1    NAG D C2  1 
HETATM 8385 C C3  . NAG D 2 .   ? 128.690 57.282 19.455  1.00 70.04  ? 1    NAG D C3  1 
HETATM 8386 C C4  . NAG D 2 .   ? 129.226 56.082 20.227  1.00 71.31  ? 1    NAG D C4  1 
HETATM 8387 C C5  . NAG D 2 .   ? 128.322 55.743 21.406  1.00 61.47  ? 1    NAG D C5  1 
HETATM 8388 C C6  . NAG D 2 .   ? 128.897 54.592 22.222  1.00 68.75  ? 1    NAG D C6  1 
HETATM 8389 C C7  . NAG D 2 .   ? 128.260 60.634 19.380  1.00 80.13  ? 1    NAG D C7  1 
HETATM 8390 C C8  . NAG D 2 .   ? 129.201 61.163 20.421  1.00 79.41  ? 1    NAG D C8  1 
HETATM 8391 N N2  . NAG D 2 .   ? 127.665 59.481 19.674  1.00 72.75  ? 1    NAG D N2  1 
HETATM 8392 O O3  . NAG D 2 .   ? 129.668 57.712 18.501  1.00 71.25  ? 1    NAG D O3  1 
HETATM 8393 O O4  . NAG D 2 .   ? 129.313 54.952 19.352  1.00 79.96  ? 1    NAG D O4  1 
HETATM 8394 O O5  . NAG D 2 .   ? 128.178 56.891 22.240  1.00 45.80  ? 1    NAG D O5  1 
HETATM 8395 O O6  . NAG D 2 .   ? 130.296 54.810 22.435  1.00 77.73  ? 1    NAG D O6  1 
HETATM 8396 O O7  . NAG D 2 .   ? 128.054 61.222 18.331  1.00 83.33  ? 1    NAG D O7  1 
HETATM 8397 C C1  . NAG D 2 .   ? 130.683 54.516 19.296  1.00 92.41  ? 2    NAG D C1  1 
HETATM 8398 C C2  . NAG D 2 .   ? 130.746 53.111 18.710  1.00 97.96  ? 2    NAG D C2  1 
HETATM 8399 C C3  . NAG D 2 .   ? 132.186 52.620 18.622  1.00 103.60 ? 2    NAG D C3  1 
HETATM 8400 C C4  . NAG D 2 .   ? 133.079 53.662 17.959  1.00 106.60 ? 2    NAG D C4  1 
HETATM 8401 C C5  . NAG D 2 .   ? 132.876 55.035 18.589  1.00 106.05 ? 2    NAG D C5  1 
HETATM 8402 C C6  . NAG D 2 .   ? 133.712 56.092 17.877  1.00 108.39 ? 2    NAG D C6  1 
HETATM 8403 C C7  . NAG D 2 .   ? 128.957 51.498 19.002  1.00 94.77  ? 2    NAG D C7  1 
HETATM 8404 C C8  . NAG D 2 .   ? 127.887 51.085 19.968  1.00 92.34  ? 2    NAG D C8  1 
HETATM 8405 N N2  . NAG D 2 .   ? 129.961 52.200 19.520  1.00 96.73  ? 2    NAG D N2  1 
HETATM 8406 O O3  . NAG D 2 .   ? 132.231 51.404 17.866  1.00 103.95 ? 2    NAG D O3  1 
HETATM 8407 O O4  . NAG D 2 .   ? 134.450 53.272 18.095  1.00 106.93 ? 2    NAG D O4  1 
HETATM 8408 O O5  . NAG D 2 .   ? 131.498 55.392 18.518  1.00 100.47 ? 2    NAG D O5  1 
HETATM 8409 O O6  . NAG D 2 .   ? 134.730 56.572 18.762  1.00 109.96 ? 2    NAG D O6  1 
HETATM 8410 O O7  . NAG D 2 .   ? 128.911 51.209 17.818  1.00 96.22  ? 2    NAG D O7  1 
HETATM 8411 C C1  . FUC D 2 .   ? 130.612 54.478 23.799  1.00 81.44  ? 3    FUC D C1  1 
HETATM 8412 C C2  . FUC D 2 .   ? 132.094 54.727 24.053  1.00 85.68  ? 3    FUC D C2  1 
HETATM 8413 C C3  . FUC D 2 .   ? 132.416 56.216 23.995  1.00 89.01  ? 3    FUC D C3  1 
HETATM 8414 C C4  . FUC D 2 .   ? 131.444 57.018 24.852  1.00 87.48  ? 3    FUC D C4  1 
HETATM 8415 C C5  . FUC D 2 .   ? 130.002 56.632 24.550  1.00 83.27  ? 3    FUC D C5  1 
HETATM 8416 C C6  . FUC D 2 .   ? 129.034 57.380 25.459  1.00 80.73  ? 3    FUC D C6  1 
HETATM 8417 O O2  . FUC D 2 .   ? 132.870 54.033 23.070  1.00 84.40  ? 3    FUC D O2  1 
HETATM 8418 O O3  . FUC D 2 .   ? 133.753 56.433 24.459  1.00 92.65  ? 3    FUC D O3  1 
HETATM 8419 O O4  . FUC D 2 .   ? 131.722 56.782 26.237  1.00 90.33  ? 3    FUC D O4  1 
HETATM 8420 O O5  . FUC D 2 .   ? 129.838 55.228 24.733  1.00 81.49  ? 3    FUC D O5  1 
HETATM 8421 C C1  . NAG E 3 .   ? 25.989  23.947 46.375  1.00 80.58  ? 604  NAG A C1  1 
HETATM 8422 C C2  . NAG E 3 .   ? 24.686  24.685 46.574  1.00 93.86  ? 604  NAG A C2  1 
HETATM 8423 C C3  . NAG E 3 .   ? 24.888  25.931 47.408  1.00 101.52 ? 604  NAG A C3  1 
HETATM 8424 C C4  . NAG E 3 .   ? 25.711  25.665 48.653  1.00 101.43 ? 604  NAG A C4  1 
HETATM 8425 C C5  . NAG E 3 .   ? 26.923  24.810 48.336  1.00 98.45  ? 604  NAG A C5  1 
HETATM 8426 C C6  . NAG E 3 .   ? 27.634  24.399 49.613  1.00 100.28 ? 604  NAG A C6  1 
HETATM 8427 C C7  . NAG E 3 .   ? 22.934  24.542 44.875  1.00 108.44 ? 604  NAG A C7  1 
HETATM 8428 C C8  . NAG E 3 .   ? 22.515  23.192 45.356  1.00 107.10 ? 604  NAG A C8  1 
HETATM 8429 N N2  . NAG E 3 .   ? 24.107  25.018 45.293  1.00 103.45 ? 604  NAG A N2  1 
HETATM 8430 O O3  . NAG E 3 .   ? 23.604  26.360 47.863  1.00 108.39 ? 604  NAG A O3  1 
HETATM 8431 O O4  . NAG E 3 .   ? 26.125  26.918 49.220  1.00 100.78 ? 604  NAG A O4  1 
HETATM 8432 O O5  . NAG E 3 .   ? 26.531  23.648 47.643  1.00 90.98  ? 604  NAG A O5  1 
HETATM 8433 O O6  . NAG E 3 .   ? 27.146  23.136 50.050  1.00 100.00 ? 604  NAG A O6  1 
HETATM 8434 O O7  . NAG E 3 .   ? 22.244  25.179 44.124  1.00 111.40 ? 604  NAG A O7  1 
HETATM 8435 C C21 . 7PE F 4 .   ? 27.922  36.938 32.763  1.00 73.38  ? 605  7PE A C21 1 
HETATM 8436 C C20 . 7PE F 4 .   ? 28.089  35.714 31.865  1.00 77.53  ? 605  7PE A C20 1 
HETATM 8437 O O19 . 7PE F 4 .   ? 28.518  34.627 32.635  1.00 78.01  ? 605  7PE A O19 1 
HETATM 8438 C C18 . 7PE F 4 .   ? 29.721  34.063 32.198  1.00 68.33  ? 605  7PE A C18 1 
HETATM 8439 C C17 . 7PE F 4 .   ? 30.477  33.486 33.393  1.00 63.97  ? 605  7PE A C17 1 
HETATM 8440 O O16 . 7PE F 4 .   ? 31.779  33.996 33.412  1.00 63.48  ? 605  7PE A O16 1 
HETATM 8441 C C15 . 7PE F 4 .   ? 32.108  34.669 34.594  1.00 62.26  ? 605  7PE A C15 1 
HETATM 8442 C C14 . 7PE F 4 .   ? 33.148  35.746 34.294  1.00 66.44  ? 605  7PE A C14 1 
HETATM 8443 O O13 . 7PE F 4 .   ? 33.173  36.674 35.340  1.00 66.33  ? 605  7PE A O13 1 
HETATM 8444 C C12 . 7PE F 4 .   ? 32.361  37.793 35.124  1.00 69.32  ? 605  7PE A C12 1 
HETATM 8445 C C11 . 7PE F 4 .   ? 32.867  38.561 33.905  1.00 71.26  ? 605  7PE A C11 1 
HETATM 8446 O O10 . 7PE F 4 .   ? 31.912  39.510 33.523  1.00 74.03  ? 605  7PE A O10 1 
HETATM 8447 C C9  . 7PE F 4 .   ? 31.972  39.860 32.170  1.00 75.80  ? 605  7PE A C9  1 
HETATM 8448 C C8  . 7PE F 4 .   ? 30.596  39.672 31.535  1.00 76.79  ? 605  7PE A C8  1 
HETATM 8449 O O7  . 7PE F 4 .   ? 30.746  39.371 30.177  1.00 76.57  ? 605  7PE A O7  1 
HETATM 8450 C C6  . 7PE F 4 .   ? 29.959  38.298 29.744  1.00 74.02  ? 605  7PE A C6  1 
HETATM 8451 C C5  . 7PE F 4 .   ? 30.317  37.954 28.300  1.00 75.85  ? 605  7PE A C5  1 
HETATM 8452 O O4  . 7PE F 4 .   ? 30.810  36.646 28.241  1.00 78.77  ? 605  7PE A O4  1 
HETATM 8453 C C3  . 7PE F 4 .   ? 30.469  35.965 27.068  1.00 76.31  ? 605  7PE A C3  1 
HETATM 8454 C C2  . 7PE F 4 .   ? 31.740  35.484 26.371  1.00 68.77  ? 605  7PE A C2  1 
HETATM 8455 O O1  . 7PE F 4 .   ? 31.745  35.937 25.045  1.00 69.46  ? 605  7PE A O1  1 
HETATM 8456 C C1  . NAG G 3 .   ? 79.966  18.656 24.599  1.00 86.26  ? 606  NAG A C1  1 
HETATM 8457 C C2  . NAG G 3 .   ? 79.678  18.397 26.075  1.00 100.46 ? 606  NAG A C2  1 
HETATM 8458 C C3  . NAG G 3 .   ? 80.960  18.373 26.895  1.00 104.45 ? 606  NAG A C3  1 
HETATM 8459 C C4  . NAG G 3 .   ? 81.955  17.411 26.267  1.00 101.10 ? 606  NAG A C4  1 
HETATM 8460 C C5  . NAG G 3 .   ? 82.175  17.770 24.804  1.00 96.25  ? 606  NAG A C5  1 
HETATM 8461 C C6  . NAG G 3 .   ? 83.158  16.806 24.150  1.00 93.85  ? 606  NAG A C6  1 
HETATM 8462 C C7  . NAG G 3 .   ? 77.463  19.329 26.411  1.00 114.76 ? 606  NAG A C7  1 
HETATM 8463 C C8  . NAG G 3 .   ? 77.021  18.767 25.093  1.00 115.09 ? 606  NAG A C8  1 
HETATM 8464 N N2  . NAG G 3 .   ? 78.778  19.411 26.591  1.00 109.73 ? 606  NAG A N2  1 
HETATM 8465 O O3  . NAG G 3 .   ? 80.667  17.957 28.233  1.00 108.78 ? 606  NAG A O3  1 
HETATM 8466 O O4  . NAG G 3 .   ? 83.200  17.480 26.971  1.00 100.35 ? 606  NAG A O4  1 
HETATM 8467 O O5  . NAG G 3 .   ? 80.936  17.736 24.095  1.00 90.28  ? 606  NAG A O5  1 
HETATM 8468 O O6  . NAG G 3 .   ? 84.360  16.749 24.927  1.00 87.72  ? 606  NAG A O6  1 
HETATM 8469 O O7  . NAG G 3 .   ? 76.668  19.689 27.263  1.00 115.75 ? 606  NAG A O7  1 
HETATM 8470 P P1  . VX  H 5 .   ? 53.537  25.502 22.596  1.00 24.62  ? 607  VX  A P1  1 
HETATM 8471 O O1  . VX  H 5 .   ? 53.528  25.776 24.081  1.00 21.69  ? 607  VX  A O1  1 
HETATM 8472 O O2  . VX  H 5 .   ? 54.455  24.169 22.289  1.00 26.44  ? 607  VX  A O2  1 
HETATM 8473 C C1  . VX  H 5 .   ? 51.796  25.204 22.010  1.00 27.35  ? 607  VX  A C1  1 
HETATM 8474 C C2  . VX  H 5 .   ? 54.832  23.356 23.364  1.00 29.79  ? 607  VX  A C2  1 
HETATM 8475 C C3  . VX  H 5 .   ? 53.759  22.296 23.601  1.00 32.06  ? 607  VX  A C3  1 
HETATM 8476 C C21 . 7PE I 4 .   ? 103.198 21.805 14.047  1.00 80.55  ? 604  7PE B C21 1 
HETATM 8477 C C20 . 7PE I 4 .   ? 104.620 21.795 14.553  1.00 80.69  ? 604  7PE B C20 1 
HETATM 8478 O O19 . 7PE I 4 .   ? 104.635 20.999 15.681  1.00 76.48  ? 604  7PE B O19 1 
HETATM 8479 C C18 . 7PE I 4 .   ? 105.296 19.796 15.532  1.00 73.56  ? 604  7PE B C18 1 
HETATM 8480 C C17 . 7PE I 4 .   ? 104.651 18.760 16.430  1.00 73.39  ? 604  7PE B C17 1 
HETATM 8481 O O16 . 7PE I 4 .   ? 104.395 17.580 15.745  1.00 79.54  ? 604  7PE B O16 1 
HETATM 8482 C C15 . 7PE I 4 .   ? 104.077 16.493 16.557  1.00 79.88  ? 604  7PE B C15 1 
HETATM 8483 C C14 . 7PE I 4 .   ? 102.830 16.783 17.376  1.00 82.41  ? 604  7PE B C14 1 
HETATM 8484 O O13 . 7PE I 4 .   ? 102.559 15.753 18.268  1.00 87.23  ? 604  7PE B O13 1 
HETATM 8485 C C12 . 7PE I 4 .   ? 103.424 15.682 19.354  1.00 88.24  ? 604  7PE B C12 1 
HETATM 8486 C C11 . 7PE I 4 .   ? 102.682 14.918 20.432  1.00 90.28  ? 604  7PE B C11 1 
HETATM 8487 O O10 . 7PE I 4 .   ? 102.871 15.521 21.660  1.00 89.53  ? 604  7PE B O10 1 
HETATM 8488 C C9  . 7PE I 4 .   ? 103.784 14.852 22.458  1.00 86.72  ? 604  7PE B C9  1 
HETATM 8489 C C8  . 7PE I 4 .   ? 105.010 15.729 22.569  1.00 86.07  ? 604  7PE B C8  1 
HETATM 8490 O O7  . 7PE I 4 .   ? 106.133 15.038 22.177  1.00 84.32  ? 604  7PE B O7  1 
HETATM 8491 C C6  . 7PE I 4 .   ? 107.263 15.542 22.784  1.00 84.90  ? 604  7PE B C6  1 
HETATM 8492 C C5  . 7PE I 4 .   ? 107.983 16.412 21.788  1.00 86.02  ? 604  7PE B C5  1 
HETATM 8493 O O4  . 7PE I 4 .   ? 108.369 15.630 20.727  1.00 88.58  ? 604  7PE B O4  1 
HETATM 8494 C C3  . 7PE I 4 .   ? 109.224 16.277 19.852  1.00 91.01  ? 604  7PE B C3  1 
HETATM 8495 C C2  . 7PE I 4 .   ? 109.440 15.396 18.638  1.00 90.23  ? 604  7PE B C2  1 
HETATM 8496 O O1  . 7PE I 4 .   ? 108.386 15.634 17.767  1.00 91.68  ? 604  7PE B O1  1 
HETATM 8497 P P1  . VX  J 5 .   ? 111.231 40.921 27.565  1.00 25.99  ? 605  VX  B P1  1 
HETATM 8498 O O1  . VX  J 5 .   ? 111.382 39.851 28.619  1.00 22.21  ? 605  VX  B O1  1 
HETATM 8499 O O2  . VX  J 5 .   ? 112.280 42.153 27.878  1.00 32.51  ? 605  VX  B O2  1 
HETATM 8500 C C1  . VX  J 5 .   ? 111.603 40.200 25.890  1.00 26.38  ? 605  VX  B C1  1 
HETATM 8501 C C2  . VX  J 5 .   ? 113.350 41.913 28.747  1.00 33.15  ? 605  VX  B C2  1 
HETATM 8502 C C3  . VX  J 5 .   ? 114.440 41.137 28.011  1.00 32.75  ? 605  VX  B C3  1 
HETATM 8503 O O   . HOH K 6 .   ? 59.588  17.648 6.815   1.00 53.90  ? 701  HOH A O   1 
HETATM 8504 O O   . HOH K 6 .   ? 68.464  23.204 22.507  1.00 61.11  ? 702  HOH A O   1 
HETATM 8505 O O   . HOH K 6 .   ? 73.815  26.764 29.742  1.00 50.97  ? 703  HOH A O   1 
HETATM 8506 O O   . HOH K 6 .   ? 57.450  20.216 24.703  1.00 59.06  ? 704  HOH A O   1 
HETATM 8507 O O   . HOH K 6 .   ? 29.051  20.844 38.104  1.00 51.90  ? 705  HOH A O   1 
HETATM 8508 O O   . HOH K 6 .   ? 74.648  39.322 51.019  1.00 43.08  ? 706  HOH A O   1 
HETATM 8509 O O   . HOH K 6 .   ? 40.698  21.753 14.749  1.00 47.91  ? 707  HOH A O   1 
HETATM 8510 O O   . HOH K 6 .   ? 46.307  20.827 30.183  1.00 31.48  ? 708  HOH A O   1 
HETATM 8511 O O   . HOH K 6 .   ? 51.436  52.852 17.208  1.00 53.03  ? 709  HOH A O   1 
HETATM 8512 O O   . HOH K 6 .   ? 80.507  44.444 38.128  1.00 44.31  ? 710  HOH A O   1 
HETATM 8513 O O   . HOH K 6 .   ? 40.481  33.848 10.955  1.00 52.02  ? 711  HOH A O   1 
HETATM 8514 O O   . HOH K 6 .   ? 54.778  11.994 26.646  1.00 41.11  ? 712  HOH A O   1 
HETATM 8515 O O   . HOH K 6 .   ? 55.455  19.531 -4.430  1.00 41.98  ? 713  HOH A O   1 
HETATM 8516 O O   . HOH K 6 .   ? 59.110  25.714 5.634   1.00 62.21  ? 714  HOH A O   1 
HETATM 8517 O O   . HOH K 6 .   ? 74.349  40.953 22.316  1.00 31.90  ? 715  HOH A O   1 
HETATM 8518 O O   . HOH K 6 .   ? 61.440  41.482 55.797  1.00 29.91  ? 716  HOH A O   1 
HETATM 8519 O O   . HOH K 6 .   ? 38.602  14.172 13.452  1.00 48.28  ? 717  HOH A O   1 
HETATM 8520 O O   . HOH K 6 .   ? 68.501  25.887 35.124  1.00 31.72  ? 718  HOH A O   1 
HETATM 8521 O O   . HOH K 6 .   ? 36.777  34.854 35.927  1.00 53.56  ? 719  HOH A O   1 
HETATM 8522 O O   . HOH K 6 .   ? 24.166  22.099 40.404  1.00 30.00  ? 720  HOH A O   1 
HETATM 8523 O O   . HOH K 6 .   ? 50.767  3.769  10.195  1.00 67.42  ? 721  HOH A O   1 
HETATM 8524 O O   . HOH K 6 .   ? 53.301  22.546 1.712   1.00 61.48  ? 722  HOH A O   1 
HETATM 8525 O O   . HOH K 6 .   ? 63.635  49.325 9.664   1.00 61.72  ? 723  HOH A O   1 
HETATM 8526 O O   . HOH K 6 .   ? 69.988  32.597 55.165  1.00 28.96  ? 724  HOH A O   1 
HETATM 8527 O O   . HOH K 6 .   ? 83.411  42.278 41.535  1.00 49.00  ? 725  HOH A O   1 
HETATM 8528 O O   . HOH K 6 .   ? 70.158  34.900 29.108  1.00 30.20  ? 726  HOH A O   1 
HETATM 8529 O O   . HOH K 6 .   ? 40.719  31.605 12.003  1.00 51.11  ? 727  HOH A O   1 
HETATM 8530 O O   . HOH K 6 .   ? 82.796  25.175 24.937  1.00 35.77  ? 728  HOH A O   1 
HETATM 8531 O O   . HOH K 6 .   ? 59.079  28.486 6.760   1.00 47.14  ? 729  HOH A O   1 
HETATM 8532 O O   . HOH K 6 .   ? 44.719  31.314 12.012  1.00 29.52  ? 730  HOH A O   1 
HETATM 8533 O O   . HOH K 6 .   ? 54.984  45.148 34.587  1.00 31.41  ? 731  HOH A O   1 
HETATM 8534 O O   . HOH K 6 .   ? 58.950  21.000 8.001   1.00 56.73  ? 732  HOH A O   1 
HETATM 8535 O O   . HOH K 6 .   ? 59.964  5.859  7.133   1.00 51.54  ? 733  HOH A O   1 
HETATM 8536 O O   . HOH K 6 .   ? 54.689  25.489 9.092   1.00 41.76  ? 734  HOH A O   1 
HETATM 8537 O O   . HOH K 6 .   ? 78.034  44.936 35.170  1.00 51.47  ? 735  HOH A O   1 
HETATM 8538 O O   . HOH K 6 .   ? 29.532  23.412 5.686   1.00 77.36  ? 736  HOH A O   1 
HETATM 8539 O O   . HOH K 6 .   ? 46.847  20.373 15.271  1.00 32.81  ? 737  HOH A O   1 
HETATM 8540 O O   . HOH K 6 .   ? 43.146  40.857 37.544  1.00 50.06  ? 738  HOH A O   1 
HETATM 8541 O O   . HOH K 6 .   ? 71.396  43.426 11.018  1.00 44.24  ? 739  HOH A O   1 
HETATM 8542 O O   . HOH K 6 .   ? 60.073  31.938 17.134  1.00 21.35  ? 740  HOH A O   1 
HETATM 8543 O O   . HOH K 6 .   ? 55.017  20.024 -8.542  1.00 52.47  ? 741  HOH A O   1 
HETATM 8544 O O   . HOH K 6 .   ? 49.190  39.455 7.423   1.00 36.84  ? 742  HOH A O   1 
HETATM 8545 O O   . HOH K 6 .   ? 60.535  11.927 26.250  1.00 37.26  ? 743  HOH A O   1 
HETATM 8546 O O   . HOH K 6 .   ? 51.848  37.254 5.179   1.00 31.37  ? 744  HOH A O   1 
HETATM 8547 O O   . HOH K 6 .   ? 69.051  27.668 40.573  1.00 40.16  ? 745  HOH A O   1 
HETATM 8548 O O   . HOH K 6 .   ? 66.093  26.437 22.298  1.00 25.57  ? 746  HOH A O   1 
HETATM 8549 O O   . HOH K 6 .   ? 59.383  42.822 9.475   1.00 30.12  ? 747  HOH A O   1 
HETATM 8550 O O   . HOH K 6 .   ? 70.833  22.258 20.586  1.00 35.93  ? 748  HOH A O   1 
HETATM 8551 O O   . HOH K 6 .   ? 62.870  52.108 27.073  1.00 35.32  ? 749  HOH A O   1 
HETATM 8552 O O   . HOH K 6 .   ? 54.852  51.453 11.475  1.00 67.16  ? 750  HOH A O   1 
HETATM 8553 O O   . HOH K 6 .   ? 63.709  32.111 33.386  1.00 23.70  ? 751  HOH A O   1 
HETATM 8554 O O   . HOH K 6 .   ? 33.790  21.508 10.804  1.00 49.90  ? 752  HOH A O   1 
HETATM 8555 O O   . HOH K 6 .   ? 45.301  25.647 41.404  1.00 23.54  ? 753  HOH A O   1 
HETATM 8556 O O   . HOH K 6 .   ? 76.422  42.878 35.072  1.00 48.49  ? 754  HOH A O   1 
HETATM 8557 O O   . HOH K 6 .   ? 59.741  28.253 18.638  1.00 29.82  ? 755  HOH A O   1 
HETATM 8558 O O   . HOH K 6 .   ? 66.480  29.255 33.813  1.00 29.97  ? 756  HOH A O   1 
HETATM 8559 O O   . HOH K 6 .   ? 83.350  23.710 23.283  1.00 64.34  ? 757  HOH A O   1 
HETATM 8560 O O   . HOH K 6 .   ? 69.507  35.755 6.271   1.00 30.13  ? 758  HOH A O   1 
HETATM 8561 O O   . HOH K 6 .   ? 49.940  18.754 46.307  1.00 28.95  ? 759  HOH A O   1 
HETATM 8562 O O   . HOH K 6 .   ? 42.920  32.410 13.624  1.00 42.07  ? 760  HOH A O   1 
HETATM 8563 O O   . HOH K 6 .   ? 31.740  22.117 7.270   1.00 62.21  ? 761  HOH A O   1 
HETATM 8564 O O   . HOH K 6 .   ? 56.890  21.118 27.732  1.00 27.51  ? 762  HOH A O   1 
HETATM 8565 O O   . HOH K 6 .   ? 52.737  7.076  -0.795  1.00 46.77  ? 763  HOH A O   1 
HETATM 8566 O O   . HOH K 6 .   ? 57.802  24.567 46.554  1.00 29.65  ? 764  HOH A O   1 
HETATM 8567 O O   . HOH K 6 .   ? 56.830  18.593 31.634  1.00 32.16  ? 765  HOH A O   1 
HETATM 8568 O O   . HOH K 6 .   ? 50.163  18.889 33.148  1.00 24.52  ? 766  HOH A O   1 
HETATM 8569 O O   . HOH K 6 .   ? 57.331  34.012 1.694   1.00 31.03  ? 767  HOH A O   1 
HETATM 8570 O O   . HOH K 6 .   ? 64.843  20.085 31.880  1.00 33.85  ? 768  HOH A O   1 
HETATM 8571 O O   . HOH K 6 .   ? 43.806  7.128  5.461   1.00 44.20  ? 769  HOH A O   1 
HETATM 8572 O O   . HOH K 6 .   ? 73.149  52.290 35.444  1.00 75.24  ? 770  HOH A O   1 
HETATM 8573 O O   . HOH K 6 .   ? 33.064  30.849 25.121  1.00 37.52  ? 771  HOH A O   1 
HETATM 8574 O O   . HOH K 6 .   ? 47.279  31.894 46.109  1.00 29.68  ? 772  HOH A O   1 
HETATM 8575 O O   . HOH K 6 .   ? 72.464  48.992 20.628  1.00 30.00  ? 773  HOH A O   1 
HETATM 8576 O O   . HOH K 6 .   ? 61.285  11.362 28.913  1.00 50.85  ? 774  HOH A O   1 
HETATM 8577 O O   . HOH K 6 .   ? 50.125  26.349 0.386   1.00 57.67  ? 775  HOH A O   1 
HETATM 8578 O O   . HOH K 6 .   ? 63.276  31.220 47.630  1.00 29.06  ? 776  HOH A O   1 
HETATM 8579 O O   . HOH K 6 .   ? 48.655  12.761 20.728  1.00 15.24  ? 777  HOH A O   1 
HETATM 8580 O O   . HOH K 6 .   ? 57.444  25.656 23.927  1.00 26.26  ? 778  HOH A O   1 
HETATM 8581 O O   . HOH K 6 .   ? 38.024  35.025 29.446  1.00 33.21  ? 779  HOH A O   1 
HETATM 8582 O O   . HOH K 6 .   ? 37.886  19.555 49.597  1.00 39.72  ? 780  HOH A O   1 
HETATM 8583 O O   . HOH K 6 .   ? 54.682  31.544 46.568  1.00 25.47  ? 781  HOH A O   1 
HETATM 8584 O O   . HOH K 6 .   ? 38.336  26.933 48.805  1.00 51.95  ? 782  HOH A O   1 
HETATM 8585 O O   . HOH K 6 .   ? 50.728  5.869  -1.015  1.00 58.23  ? 783  HOH A O   1 
HETATM 8586 O O   . HOH K 6 .   ? 60.899  5.948  23.119  1.00 59.80  ? 784  HOH A O   1 
HETATM 8587 O O   . HOH K 6 .   ? 39.099  16.357 11.857  1.00 34.21  ? 785  HOH A O   1 
HETATM 8588 O O   . HOH K 6 .   ? 26.619  24.730 41.264  1.00 45.76  ? 786  HOH A O   1 
HETATM 8589 O O   . HOH K 6 .   ? 58.122  5.808  27.835  1.00 57.74  ? 787  HOH A O   1 
HETATM 8590 O O   . HOH K 6 .   ? 76.476  43.622 23.782  1.00 61.15  ? 788  HOH A O   1 
HETATM 8591 O O   . HOH K 6 .   ? 58.697  25.667 29.105  1.00 19.64  ? 789  HOH A O   1 
HETATM 8592 O O   . HOH K 6 .   ? 33.831  18.390 22.130  1.00 43.53  ? 790  HOH A O   1 
HETATM 8593 O O   . HOH K 6 .   ? 40.532  28.545 10.238  1.00 50.56  ? 791  HOH A O   1 
HETATM 8594 O O   . HOH K 6 .   ? 60.759  13.764 -3.185  1.00 55.57  ? 792  HOH A O   1 
HETATM 8595 O O   . HOH K 6 .   ? 66.500  13.609 5.958   1.00 58.52  ? 793  HOH A O   1 
HETATM 8596 O O   . HOH K 6 .   ? 78.750  27.488 12.176  1.00 51.66  ? 794  HOH A O   1 
HETATM 8597 O O   . HOH K 6 .   ? 76.260  47.530 36.378  1.00 60.43  ? 795  HOH A O   1 
HETATM 8598 O O   . HOH K 6 .   ? 51.487  15.434 -2.736  1.00 29.84  ? 796  HOH A O   1 
HETATM 8599 O O   . HOH K 6 .   ? 46.382  31.304 -4.015  1.00 30.76  ? 797  HOH A O   1 
HETATM 8600 O O   . HOH K 6 .   ? 74.016  35.060 48.649  1.00 53.03  ? 798  HOH A O   1 
HETATM 8601 O O   . HOH K 6 .   ? 46.436  47.442 23.421  1.00 62.58  ? 799  HOH A O   1 
HETATM 8602 O O   . HOH K 6 .   ? 38.114  22.939 32.017  1.00 24.26  ? 800  HOH A O   1 
HETATM 8603 O O   . HOH K 6 .   ? 48.728  31.170 52.876  1.00 56.37  ? 801  HOH A O   1 
HETATM 8604 O O   . HOH K 6 .   ? 62.076  50.402 11.405  1.00 48.51  ? 802  HOH A O   1 
HETATM 8605 O O   . HOH K 6 .   ? 81.280  27.426 25.122  1.00 63.88  ? 803  HOH A O   1 
HETATM 8606 O O   . HOH K 6 .   ? 31.715  20.643 23.985  1.00 43.28  ? 804  HOH A O   1 
HETATM 8607 O O   . HOH K 6 .   ? 54.252  47.822 11.160  1.00 31.08  ? 805  HOH A O   1 
HETATM 8608 O O   . HOH K 6 .   ? 47.320  9.933  17.303  1.00 51.17  ? 806  HOH A O   1 
HETATM 8609 O O   . HOH K 6 .   ? 40.789  24.670 21.634  1.00 30.64  ? 807  HOH A O   1 
HETATM 8610 O O   . HOH K 6 .   ? 71.349  47.111 49.323  1.00 57.14  ? 808  HOH A O   1 
HETATM 8611 O O   . HOH K 6 .   ? 61.108  23.911 5.551   1.00 47.50  ? 809  HOH A O   1 
HETATM 8612 O O   . HOH K 6 .   ? 53.191  9.472  15.868  1.00 33.38  ? 810  HOH A O   1 
HETATM 8613 O O   . HOH K 6 .   ? 58.771  22.861 28.880  1.00 24.89  ? 811  HOH A O   1 
HETATM 8614 O O   . HOH K 6 .   ? 55.743  17.376 26.748  1.00 44.01  ? 812  HOH A O   1 
HETATM 8615 O O   . HOH K 6 .   ? 47.181  22.563 28.683  1.00 23.12  ? 813  HOH A O   1 
HETATM 8616 O O   . HOH K 6 .   ? 42.360  31.120 20.408  1.00 29.52  ? 814  HOH A O   1 
HETATM 8617 O O   . HOH K 6 .   ? 47.269  16.677 21.371  1.00 33.36  ? 815  HOH A O   1 
HETATM 8618 O O   . HOH K 6 .   ? 58.860  28.479 25.939  1.00 21.75  ? 816  HOH A O   1 
HETATM 8619 O O   . HOH K 6 .   ? 58.582  21.728 14.997  1.00 23.04  ? 817  HOH A O   1 
HETATM 8620 O O   . HOH K 6 .   ? 40.222  25.111 30.159  1.00 21.29  ? 818  HOH A O   1 
HETATM 8621 O O   . HOH K 6 .   ? 60.115  53.857 23.068  1.00 65.23  ? 819  HOH A O   1 
HETATM 8622 O O   . HOH K 6 .   ? 81.292  32.605 25.983  1.00 42.99  ? 820  HOH A O   1 
HETATM 8623 O O   . HOH K 6 .   ? 57.013  26.406 9.614   1.00 34.14  ? 821  HOH A O   1 
HETATM 8624 O O   . HOH K 6 .   ? 53.698  29.222 45.793  1.00 22.51  ? 822  HOH A O   1 
HETATM 8625 O O   . HOH K 6 .   ? 61.500  15.868 34.685  1.00 35.06  ? 823  HOH A O   1 
HETATM 8626 O O   . HOH K 6 .   ? 46.694  13.746 -9.340  1.00 38.34  ? 824  HOH A O   1 
HETATM 8627 O O   . HOH K 6 .   ? 61.510  47.060 27.877  1.00 30.19  ? 825  HOH A O   1 
HETATM 8628 O O   . HOH K 6 .   ? 61.439  29.866 49.048  1.00 28.93  ? 826  HOH A O   1 
HETATM 8629 O O   . HOH K 6 .   ? 70.805  41.153 56.042  1.00 55.72  ? 827  HOH A O   1 
HETATM 8630 O O   . HOH K 6 .   ? 57.573  30.130 7.004   1.00 37.01  ? 828  HOH A O   1 
HETATM 8631 O O   . HOH K 6 .   ? 61.102  16.869 39.042  1.00 45.99  ? 829  HOH A O   1 
HETATM 8632 O O   . HOH K 6 .   ? 45.756  35.932 4.104   1.00 35.56  ? 830  HOH A O   1 
HETATM 8633 O O   . HOH K 6 .   ? 68.185  25.590 15.866  1.00 34.08  ? 831  HOH A O   1 
HETATM 8634 O O   . HOH K 6 .   ? 44.195  23.015 23.209  1.00 22.59  ? 832  HOH A O   1 
HETATM 8635 O O   . HOH K 6 .   ? 50.336  10.818 9.441   1.00 36.82  ? 833  HOH A O   1 
HETATM 8636 O O   . HOH K 6 .   ? 32.365  17.270 47.676  1.00 56.24  ? 834  HOH A O   1 
HETATM 8637 O O   . HOH K 6 .   ? 62.252  42.241 59.230  1.00 54.27  ? 835  HOH A O   1 
HETATM 8638 O O   . HOH K 6 .   ? 82.317  30.215 24.855  1.00 46.06  ? 836  HOH A O   1 
HETATM 8639 O O   . HOH K 6 .   ? 39.406  41.296 26.869  1.00 39.13  ? 837  HOH A O   1 
HETATM 8640 O O   . HOH K 6 .   ? 83.967  35.676 33.231  1.00 54.84  ? 838  HOH A O   1 
HETATM 8641 O O   . HOH K 6 .   ? 50.461  2.888  4.729   1.00 51.14  ? 839  HOH A O   1 
HETATM 8642 O O   . HOH K 6 .   ? 61.980  30.313 40.995  1.00 18.82  ? 840  HOH A O   1 
HETATM 8643 O O   . HOH K 6 .   ? 64.371  29.092 46.326  1.00 27.28  ? 841  HOH A O   1 
HETATM 8644 O O   . HOH K 6 .   ? 81.836  25.979 22.237  1.00 37.70  ? 842  HOH A O   1 
HETATM 8645 O O   . HOH K 6 .   ? 55.436  51.727 39.833  1.00 55.94  ? 843  HOH A O   1 
HETATM 8646 O O   . HOH K 6 .   ? 71.464  43.929 42.568  1.00 30.00  ? 844  HOH A O   1 
HETATM 8647 O O   . HOH K 6 .   ? 70.082  36.739 9.649   1.00 35.58  ? 845  HOH A O   1 
HETATM 8648 O O   . HOH K 6 .   ? 49.753  25.096 41.926  1.00 33.20  ? 846  HOH A O   1 
HETATM 8649 O O   . HOH K 6 .   ? 68.685  50.130 21.834  1.00 44.32  ? 847  HOH A O   1 
HETATM 8650 O O   . HOH K 6 .   ? 47.461  24.419 42.944  1.00 31.69  ? 848  HOH A O   1 
HETATM 8651 O O   . HOH K 6 .   ? 57.668  19.676 -7.287  1.00 59.76  ? 849  HOH A O   1 
HETATM 8652 O O   . HOH K 6 .   ? 36.975  22.887 48.654  1.00 59.53  ? 850  HOH A O   1 
HETATM 8653 O O   . HOH K 6 .   ? 40.062  27.847 38.029  1.00 28.15  ? 851  HOH A O   1 
HETATM 8654 O O   . HOH K 6 .   ? 50.426  23.364 37.725  1.00 21.05  ? 852  HOH A O   1 
HETATM 8655 O O   . HOH K 6 .   ? 56.333  54.653 29.311  1.00 46.81  ? 853  HOH A O   1 
HETATM 8656 O O   . HOH K 6 .   ? 34.522  42.870 23.837  1.00 49.98  ? 854  HOH A O   1 
HETATM 8657 O O   . HOH K 6 .   ? 66.459  12.752 9.304   1.00 40.30  ? 855  HOH A O   1 
HETATM 8658 O O   . HOH K 6 .   ? 66.918  49.155 46.050  1.00 50.72  ? 856  HOH A O   1 
HETATM 8659 O O   . HOH K 6 .   ? 31.307  37.666 22.904  1.00 65.63  ? 857  HOH A O   1 
HETATM 8660 O O   . HOH K 6 .   ? 79.003  26.764 23.367  1.00 31.54  ? 858  HOH A O   1 
HETATM 8661 O O   . HOH K 6 .   ? 59.383  17.291 26.848  1.00 31.09  ? 859  HOH A O   1 
HETATM 8662 O O   . HOH K 6 .   ? 40.178  21.413 18.048  1.00 49.75  ? 860  HOH A O   1 
HETATM 8663 O O   . HOH K 6 .   ? 50.045  47.655 3.996   1.00 53.36  ? 861  HOH A O   1 
HETATM 8664 O O   . HOH K 6 .   ? 66.275  47.777 48.387  1.00 42.60  ? 862  HOH A O   1 
HETATM 8665 O O   . HOH K 6 .   ? 60.731  26.001 38.619  1.00 26.11  ? 863  HOH A O   1 
HETATM 8666 O O   . HOH K 6 .   ? 60.059  10.352 -1.411  1.00 49.64  ? 864  HOH A O   1 
HETATM 8667 O O   . HOH K 6 .   ? 57.680  43.230 55.809  1.00 39.91  ? 865  HOH A O   1 
HETATM 8668 O O   . HOH K 6 .   ? 58.985  16.050 41.725  1.00 37.10  ? 866  HOH A O   1 
HETATM 8669 O O   . HOH K 6 .   ? 39.553  37.930 2.736   1.00 61.07  ? 867  HOH A O   1 
HETATM 8670 O O   . HOH K 6 .   ? 58.193  32.406 32.561  1.00 21.41  ? 868  HOH A O   1 
HETATM 8671 O O   . HOH K 6 .   ? 67.078  19.808 7.731   1.00 51.27  ? 869  HOH A O   1 
HETATM 8672 O O   . HOH K 6 .   ? 33.337  32.399 37.317  1.00 38.28  ? 870  HOH A O   1 
HETATM 8673 O O   . HOH K 6 .   ? 58.593  52.503 27.363  1.00 39.16  ? 871  HOH A O   1 
HETATM 8674 O O   . HOH K 6 .   ? 53.933  14.226 36.578  1.00 25.19  ? 872  HOH A O   1 
HETATM 8675 O O   . HOH K 6 .   ? 77.600  34.117 12.795  1.00 41.85  ? 873  HOH A O   1 
HETATM 8676 O O   . HOH K 6 .   ? 40.605  12.976 -0.011  1.00 63.69  ? 874  HOH A O   1 
HETATM 8677 O O   . HOH K 6 .   ? 29.150  20.462 35.115  1.00 52.57  ? 875  HOH A O   1 
HETATM 8678 O O   . HOH K 6 .   ? 46.483  20.881 47.107  1.00 34.38  ? 876  HOH A O   1 
HETATM 8679 O O   . HOH K 6 .   ? 51.791  49.801 10.889  1.00 50.22  ? 877  HOH A O   1 
HETATM 8680 O O   . HOH K 6 .   ? 66.984  12.027 17.425  1.00 36.63  ? 878  HOH A O   1 
HETATM 8681 O O   . HOH K 6 .   ? 52.731  26.378 29.190  1.00 16.53  ? 879  HOH A O   1 
HETATM 8682 O O   . HOH K 6 .   ? 76.544  21.854 23.704  1.00 44.80  ? 880  HOH A O   1 
HETATM 8683 O O   . HOH K 6 .   ? 40.955  28.224 32.059  1.00 23.42  ? 881  HOH A O   1 
HETATM 8684 O O   . HOH K 6 .   ? 57.772  23.934 7.209   1.00 43.20  ? 882  HOH A O   1 
HETATM 8685 O O   . HOH K 6 .   ? 68.084  50.342 18.852  1.00 69.77  ? 883  HOH A O   1 
HETATM 8686 O O   . HOH K 6 .   ? 43.692  20.779 46.996  1.00 30.68  ? 884  HOH A O   1 
HETATM 8687 O O   . HOH K 6 .   ? 81.550  44.704 31.517  1.00 50.19  ? 885  HOH A O   1 
HETATM 8688 O O   . HOH K 6 .   ? 48.267  50.562 22.330  1.00 67.52  ? 886  HOH A O   1 
HETATM 8689 O O   . HOH K 6 .   ? 63.881  29.627 3.541   1.00 48.70  ? 887  HOH A O   1 
HETATM 8690 O O   . HOH K 6 .   ? 59.584  48.630 45.928  1.00 59.32  ? 888  HOH A O   1 
HETATM 8691 O O   . HOH K 6 .   ? 37.880  44.081 26.374  1.00 61.48  ? 889  HOH A O   1 
HETATM 8692 O O   . HOH K 6 .   ? 68.920  12.754 10.936  1.00 40.80  ? 890  HOH A O   1 
HETATM 8693 O O   . HOH K 6 .   ? 82.665  23.418 18.836  1.00 62.88  ? 891  HOH A O   1 
HETATM 8694 O O   . HOH K 6 .   ? 56.195  25.717 36.391  1.00 23.87  ? 892  HOH A O   1 
HETATM 8695 O O   . HOH K 6 .   ? 45.610  13.012 21.621  1.00 54.16  ? 893  HOH A O   1 
HETATM 8696 O O   . HOH K 6 .   ? 56.115  45.030 5.202   1.00 31.10  ? 894  HOH A O   1 
HETATM 8697 O O   . HOH K 6 .   ? 49.604  30.294 17.595  1.00 41.55  ? 895  HOH A O   1 
HETATM 8698 O O   . HOH K 6 .   ? 67.657  42.390 52.237  1.00 36.22  ? 896  HOH A O   1 
HETATM 8699 O O   . HOH K 6 .   ? 40.623  40.300 33.669  1.00 50.05  ? 897  HOH A O   1 
HETATM 8700 O O   . HOH K 6 .   ? 31.865  15.720 30.655  1.00 48.60  ? 898  HOH A O   1 
HETATM 8701 O O   . HOH K 6 .   ? 44.398  17.023 34.898  1.00 50.44  ? 899  HOH A O   1 
HETATM 8702 O O   . HOH K 6 .   ? 38.640  35.033 32.971  1.00 34.41  ? 900  HOH A O   1 
HETATM 8703 O O   . HOH K 6 .   ? 44.396  28.377 11.828  1.00 30.60  ? 901  HOH A O   1 
HETATM 8704 O O   . HOH K 6 .   ? 74.123  46.807 24.194  1.00 50.41  ? 902  HOH A O   1 
HETATM 8705 O O   . HOH K 6 .   ? 52.634  40.050 45.173  1.00 40.67  ? 903  HOH A O   1 
HETATM 8706 O O   . HOH K 6 .   ? 36.149  25.320 22.212  1.00 33.06  ? 904  HOH A O   1 
HETATM 8707 O O   . HOH K 6 .   ? 54.978  11.012 33.272  1.00 37.12  ? 905  HOH A O   1 
HETATM 8708 O O   . HOH K 6 .   ? 46.413  11.535 30.940  1.00 40.48  ? 906  HOH A O   1 
HETATM 8709 O O   . HOH K 6 .   ? 50.125  35.308 5.652   1.00 29.11  ? 907  HOH A O   1 
HETATM 8710 O O   . HOH K 6 .   ? 64.348  23.083 7.012   1.00 46.01  ? 908  HOH A O   1 
HETATM 8711 O O   . HOH K 6 .   ? 59.011  49.439 40.410  1.00 31.20  ? 909  HOH A O   1 
HETATM 8712 O O   . HOH K 6 .   ? 57.237  39.504 46.901  1.00 39.34  ? 910  HOH A O   1 
HETATM 8713 O O   . HOH K 6 .   ? 31.236  36.769 32.089  1.00 28.70  ? 911  HOH A O   1 
HETATM 8714 O O   . HOH K 6 .   ? 34.422  23.878 46.819  1.00 48.64  ? 912  HOH A O   1 
HETATM 8715 O O   . HOH K 6 .   ? 64.230  13.714 2.810   1.00 65.81  ? 913  HOH A O   1 
HETATM 8716 O O   . HOH K 6 .   ? 57.012  5.951  8.128   1.00 46.68  ? 914  HOH A O   1 
HETATM 8717 O O   . HOH K 6 .   ? 41.418  12.970 5.630   1.00 37.90  ? 915  HOH A O   1 
HETATM 8718 O O   . HOH K 6 .   ? 57.798  48.544 6.048   1.00 45.94  ? 916  HOH A O   1 
HETATM 8719 O O   . HOH K 6 .   ? 48.461  29.096 51.244  1.00 49.63  ? 917  HOH A O   1 
HETATM 8720 O O   . HOH K 6 .   ? 49.057  16.411 45.893  1.00 49.33  ? 918  HOH A O   1 
HETATM 8721 O O   . HOH K 6 .   ? 45.651  40.764 39.444  1.00 58.10  ? 919  HOH A O   1 
HETATM 8722 O O   . HOH K 6 .   ? 49.528  47.407 7.329   1.00 44.20  ? 920  HOH A O   1 
HETATM 8723 O O   . HOH K 6 .   ? 46.692  18.620 34.973  1.00 24.29  ? 921  HOH A O   1 
HETATM 8724 O O   . HOH K 6 .   ? 32.344  14.294 27.793  1.00 45.25  ? 922  HOH A O   1 
HETATM 8725 O O   . HOH K 6 .   ? 62.494  56.390 32.795  1.00 58.64  ? 923  HOH A O   1 
HETATM 8726 O O   . HOH K 6 .   ? 34.265  31.570 34.985  1.00 38.24  ? 924  HOH A O   1 
HETATM 8727 O O   . HOH K 6 .   ? 54.734  52.452 35.001  1.00 48.76  ? 925  HOH A O   1 
HETATM 8728 O O   . HOH K 6 .   ? 62.723  13.472 33.304  1.00 50.36  ? 926  HOH A O   1 
HETATM 8729 O O   . HOH K 6 .   ? 78.472  36.341 29.428  1.00 54.69  ? 927  HOH A O   1 
HETATM 8730 O O   . HOH K 6 .   ? 58.987  21.866 32.626  1.00 28.37  ? 928  HOH A O   1 
HETATM 8731 O O   . HOH K 6 .   ? 75.828  35.737 12.316  1.00 35.54  ? 929  HOH A O   1 
HETATM 8732 O O   . HOH K 6 .   ? 39.220  6.216  35.785  1.00 59.07  ? 930  HOH A O   1 
HETATM 8733 O O   . HOH K 6 .   ? 53.182  10.627 -6.475  1.00 40.50  ? 931  HOH A O   1 
HETATM 8734 O O   . HOH K 6 .   ? 55.591  19.139 0.518   1.00 41.35  ? 932  HOH A O   1 
HETATM 8735 O O   . HOH K 6 .   ? 45.812  45.145 36.903  1.00 45.65  ? 933  HOH A O   1 
HETATM 8736 O O   . HOH K 6 .   ? 42.947  9.813  11.566  1.00 43.57  ? 934  HOH A O   1 
HETATM 8737 O O   . HOH K 6 .   ? 70.717  25.722 9.391   1.00 39.77  ? 935  HOH A O   1 
HETATM 8738 O O   . HOH K 6 .   ? 65.247  6.798  20.597  1.00 58.96  ? 936  HOH A O   1 
HETATM 8739 O O   . HOH K 6 .   ? 46.330  27.106 51.382  1.00 50.10  ? 937  HOH A O   1 
HETATM 8740 O O   . HOH K 6 .   ? 62.151  22.818 44.509  1.00 46.53  ? 938  HOH A O   1 
HETATM 8741 O O   . HOH K 6 .   ? 67.523  45.249 51.604  1.00 46.89  ? 939  HOH A O   1 
HETATM 8742 O O   . HOH K 6 .   ? 66.612  22.377 31.825  1.00 33.90  ? 940  HOH A O   1 
HETATM 8743 O O   . HOH K 6 .   ? 51.159  11.437 34.208  1.00 50.66  ? 941  HOH A O   1 
HETATM 8744 O O   . HOH K 6 .   ? 41.556  22.479 22.613  1.00 26.46  ? 942  HOH A O   1 
HETATM 8745 O O   . HOH K 6 .   ? 45.051  30.459 44.928  1.00 33.26  ? 943  HOH A O   1 
HETATM 8746 O O   . HOH K 6 .   ? 37.160  32.842 42.419  1.00 38.48  ? 944  HOH A O   1 
HETATM 8747 O O   . HOH K 6 .   ? 77.972  31.349 39.014  1.00 64.12  ? 945  HOH A O   1 
HETATM 8748 O O   . HOH K 6 .   ? 51.955  17.120 -0.953  1.00 36.45  ? 946  HOH A O   1 
HETATM 8749 O O   . HOH K 6 .   ? 55.260  31.659 49.381  1.00 37.24  ? 947  HOH A O   1 
HETATM 8750 O O   . HOH K 6 .   ? 28.222  27.348 39.283  1.00 55.63  ? 948  HOH A O   1 
HETATM 8751 O O   . HOH K 6 .   ? 61.375  28.487 38.971  1.00 53.61  ? 949  HOH A O   1 
HETATM 8752 O O   . HOH K 6 .   ? 57.331  28.855 8.872   1.00 63.63  ? 950  HOH A O   1 
HETATM 8753 O O   . HOH K 6 .   ? 52.430  19.983 46.033  1.00 36.01  ? 951  HOH A O   1 
HETATM 8754 O O   . HOH K 6 .   ? 72.230  42.686 16.096  1.00 45.74  ? 952  HOH A O   1 
HETATM 8755 O O   . HOH K 6 .   ? 57.998  36.274 -1.474  1.00 30.00  ? 953  HOH A O   1 
HETATM 8756 O O   . HOH K 6 .   ? 45.363  30.013 -1.472  1.00 52.45  ? 954  HOH A O   1 
HETATM 8757 O O   . HOH K 6 .   ? 76.668  37.659 27.809  1.00 45.82  ? 955  HOH A O   1 
HETATM 8758 O O   . HOH K 6 .   ? 65.595  36.001 58.078  1.00 46.35  ? 956  HOH A O   1 
HETATM 8759 O O   . HOH K 6 .   ? 39.340  22.743 29.325  1.00 31.20  ? 957  HOH A O   1 
HETATM 8760 O O   . HOH K 6 .   ? 64.606  52.202 38.786  1.00 62.89  ? 958  HOH A O   1 
HETATM 8761 O O   . HOH K 6 .   ? 56.232  23.167 9.561   1.00 39.56  ? 959  HOH A O   1 
HETATM 8762 O O   . HOH K 6 .   ? 42.284  26.012 37.228  1.00 65.30  ? 960  HOH A O   1 
HETATM 8763 O O   . HOH K 6 .   ? 70.058  48.247 28.190  1.00 50.07  ? 961  HOH A O   1 
HETATM 8764 O O   . HOH K 6 .   ? 54.486  33.879 1.390   1.00 42.30  ? 962  HOH A O   1 
HETATM 8765 O O   . HOH K 6 .   ? 48.758  4.947  0.748   1.00 39.75  ? 963  HOH A O   1 
HETATM 8766 O O   . HOH K 6 .   ? 38.795  41.710 29.441  1.00 57.60  ? 964  HOH A O   1 
HETATM 8767 O O   . HOH K 6 .   ? 28.733  18.262 41.851  1.00 56.19  ? 965  HOH A O   1 
HETATM 8768 O O   . HOH K 6 .   ? 60.860  54.889 29.774  1.00 56.03  ? 966  HOH A O   1 
HETATM 8769 O O   . HOH K 6 .   ? 31.647  15.655 8.690   1.00 52.35  ? 967  HOH A O   1 
HETATM 8770 O O   . HOH K 6 .   ? 54.294  35.929 55.215  1.00 67.77  ? 968  HOH A O   1 
HETATM 8771 O O   . HOH K 6 .   ? 66.555  23.492 29.247  1.00 32.42  ? 969  HOH A O   1 
HETATM 8772 O O   . HOH K 6 .   ? 67.197  55.817 32.611  1.00 61.59  ? 970  HOH A O   1 
HETATM 8773 O O   . HOH K 6 .   ? 70.003  12.435 23.810  1.00 45.16  ? 971  HOH A O   1 
HETATM 8774 O O   . HOH K 6 .   ? 64.822  52.862 30.976  1.00 44.21  ? 972  HOH A O   1 
HETATM 8775 O O   . HOH K 6 .   ? 56.420  42.346 47.471  1.00 46.74  ? 973  HOH A O   1 
HETATM 8776 O O   . HOH K 6 .   ? 49.214  19.872 35.470  1.00 23.04  ? 974  HOH A O   1 
HETATM 8777 O O   . HOH K 6 .   ? 46.991  18.243 28.022  1.00 30.85  ? 975  HOH A O   1 
HETATM 8778 O O   . HOH K 6 .   ? 51.798  39.115 56.867  1.00 57.21  ? 976  HOH A O   1 
HETATM 8779 O O   . HOH K 6 .   ? 79.443  38.505 46.690  1.00 56.72  ? 977  HOH A O   1 
HETATM 8780 O O   . HOH K 6 .   ? 40.380  12.858 3.165   1.00 53.85  ? 978  HOH A O   1 
HETATM 8781 O O   . HOH K 6 .   ? 42.646  37.728 8.801   1.00 68.83  ? 979  HOH A O   1 
HETATM 8782 O O   . HOH K 6 .   ? 56.750  15.966 43.805  1.00 45.44  ? 980  HOH A O   1 
HETATM 8783 O O   . HOH K 6 .   ? 51.002  50.704 29.015  1.00 52.18  ? 981  HOH A O   1 
HETATM 8784 O O   . HOH K 6 .   ? 69.018  19.376 21.465  1.00 37.76  ? 982  HOH A O   1 
HETATM 8785 O O   . HOH K 6 .   ? 72.165  19.823 13.333  1.00 47.39  ? 983  HOH A O   1 
HETATM 8786 O O   . HOH K 6 .   ? 35.573  41.612 15.902  1.00 53.52  ? 984  HOH A O   1 
HETATM 8787 O O   . HOH K 6 .   ? 54.085  43.811 45.389  1.00 52.87  ? 985  HOH A O   1 
HETATM 8788 O O   . HOH K 6 .   ? 53.826  52.695 32.773  1.00 48.31  ? 986  HOH A O   1 
HETATM 8789 O O   . HOH K 6 .   ? 66.742  52.004 17.364  1.00 56.14  ? 987  HOH A O   1 
HETATM 8790 O O   . HOH K 6 .   ? 76.810  34.948 45.756  1.00 41.70  ? 988  HOH A O   1 
HETATM 8791 O O   . HOH K 6 .   ? 41.242  44.530 24.083  1.00 50.05  ? 989  HOH A O   1 
HETATM 8792 O O   . HOH K 6 .   ? 61.294  48.025 2.742   1.00 62.05  ? 990  HOH A O   1 
HETATM 8793 O O   . HOH K 6 .   ? 37.658  20.781 21.252  1.00 54.04  ? 991  HOH A O   1 
HETATM 8794 O O   . HOH K 6 .   ? 32.237  25.432 23.974  1.00 33.52  ? 992  HOH A O   1 
HETATM 8795 O O   . HOH K 6 .   ? 35.991  41.894 30.479  1.00 49.17  ? 993  HOH A O   1 
HETATM 8796 O O   . HOH K 6 .   ? 67.493  41.723 1.732   1.00 41.76  ? 994  HOH A O   1 
HETATM 8797 O O   . HOH K 6 .   ? 68.763  43.103 54.758  1.00 45.05  ? 995  HOH A O   1 
HETATM 8798 O O   . HOH K 6 .   ? 57.479  40.811 -4.438  1.00 60.83  ? 996  HOH A O   1 
HETATM 8799 O O   . HOH K 6 .   ? 55.633  19.616 47.103  1.00 63.45  ? 997  HOH A O   1 
HETATM 8800 O O   . HOH K 6 .   ? 53.674  12.608 34.355  1.00 31.46  ? 998  HOH A O   1 
HETATM 8801 O O   . HOH K 6 .   ? 72.416  21.552 33.953  1.00 61.55  ? 999  HOH A O   1 
HETATM 8802 O O   . HOH K 6 .   ? 68.434  20.885 33.947  1.00 53.79  ? 1000 HOH A O   1 
HETATM 8803 O O   . HOH K 6 .   ? 31.179  12.936 4.318   1.00 73.59  ? 1001 HOH A O   1 
HETATM 8804 O O   . HOH K 6 .   ? 55.688  27.671 51.446  1.00 61.67  ? 1002 HOH A O   1 
HETATM 8805 O O   . HOH K 6 .   ? 25.437  26.385 8.089   1.00 77.36  ? 1003 HOH A O   1 
HETATM 8806 O O   . HOH K 6 .   ? 57.692  21.409 5.810   1.00 39.74  ? 1004 HOH A O   1 
HETATM 8807 O O   . HOH K 6 .   ? 64.551  37.727 -0.790  1.00 61.83  ? 1005 HOH A O   1 
HETATM 8808 O O   . HOH K 6 .   ? 55.495  23.173 50.119  1.00 63.88  ? 1006 HOH A O   1 
HETATM 8809 O O   . HOH K 6 .   ? 33.495  29.308 11.634  1.00 59.26  ? 1007 HOH A O   1 
HETATM 8810 O O   . HOH K 6 .   ? 79.162  42.246 34.150  1.00 55.97  ? 1008 HOH A O   1 
HETATM 8811 O O   . HOH K 6 .   ? 59.190  46.413 53.248  1.00 54.87  ? 1009 HOH A O   1 
HETATM 8812 O O   . HOH K 6 .   ? 63.439  24.751 45.280  1.00 48.59  ? 1010 HOH A O   1 
HETATM 8813 O O   . HOH K 6 .   ? 77.942  38.715 24.976  1.00 51.75  ? 1011 HOH A O   1 
HETATM 8814 O O   . HOH K 6 .   ? 40.436  49.088 14.541  1.00 54.72  ? 1012 HOH A O   1 
HETATM 8815 O O   . HOH K 6 .   ? 42.777  12.366 -1.774  1.00 45.07  ? 1013 HOH A O   1 
HETATM 8816 O O   . HOH K 6 .   ? 35.727  15.561 13.354  1.00 51.87  ? 1014 HOH A O   1 
HETATM 8817 O O   . HOH K 6 .   ? 57.624  18.646 28.760  1.00 32.08  ? 1015 HOH A O   1 
HETATM 8818 O O   . HOH K 6 .   ? 68.094  25.449 7.770   1.00 57.05  ? 1016 HOH A O   1 
HETATM 8819 O O   . HOH K 6 .   ? 48.042  40.458 5.161   1.00 50.04  ? 1017 HOH A O   1 
HETATM 8820 O O   . HOH K 6 .   ? 40.399  33.376 18.622  1.00 55.97  ? 1018 HOH A O   1 
HETATM 8821 O O   . HOH K 6 .   ? 52.113  48.078 2.689   1.00 54.98  ? 1019 HOH A O   1 
HETATM 8822 O O   . HOH K 6 .   ? 43.417  45.700 26.008  1.00 58.86  ? 1020 HOH A O   1 
HETATM 8823 O O   . HOH K 6 .   ? 49.164  6.958  15.064  1.00 63.20  ? 1021 HOH A O   1 
HETATM 8824 O O   . HOH K 6 .   ? 80.284  35.000 42.180  1.00 62.00  ? 1022 HOH A O   1 
HETATM 8825 O O   . HOH K 6 .   ? 60.563  43.384 -0.164  1.00 51.36  ? 1023 HOH A O   1 
HETATM 8826 O O   . HOH K 6 .   ? 50.761  14.057 44.111  1.00 39.43  ? 1024 HOH A O   1 
HETATM 8827 O O   . HOH K 6 .   ? 72.227  29.529 9.173   1.00 45.20  ? 1025 HOH A O   1 
HETATM 8828 O O   . HOH K 6 .   ? 69.038  13.908 28.344  1.00 56.31  ? 1026 HOH A O   1 
HETATM 8829 O O   . HOH K 6 .   ? 54.962  3.859  7.569   1.00 67.68  ? 1027 HOH A O   1 
HETATM 8830 O O   . HOH K 6 .   ? 57.741  23.815 3.644   1.00 71.02  ? 1028 HOH A O   1 
HETATM 8831 O O   . HOH K 6 .   ? 63.143  5.430  7.409   1.00 56.61  ? 1029 HOH A O   1 
HETATM 8832 O O   . HOH K 6 .   ? 69.460  25.291 37.763  1.00 53.54  ? 1030 HOH A O   1 
HETATM 8833 O O   . HOH K 6 .   ? 41.454  11.526 24.957  1.00 62.47  ? 1031 HOH A O   1 
HETATM 8834 O O   . HOH K 6 .   ? 84.089  27.028 16.189  1.00 45.13  ? 1032 HOH A O   1 
HETATM 8835 O O   . HOH K 6 .   ? 30.024  31.634 5.267   1.00 56.99  ? 1033 HOH A O   1 
HETATM 8836 O O   . HOH K 6 .   ? 77.285  39.736 16.967  1.00 47.14  ? 1034 HOH A O   1 
HETATM 8837 O O   . HOH K 6 .   ? 82.530  28.919 13.452  1.00 47.98  ? 1035 HOH A O   1 
HETATM 8838 O O   . HOH K 6 .   ? 60.289  15.040 -8.204  1.00 63.44  ? 1036 HOH A O   1 
HETATM 8839 O O   . HOH K 6 .   ? 31.263  17.579 6.009   1.00 43.51  ? 1037 HOH A O   1 
HETATM 8840 O O   . HOH K 6 .   ? 71.491  28.520 42.512  1.00 45.87  ? 1038 HOH A O   1 
HETATM 8841 O O   . HOH K 6 .   ? 66.919  8.478  21.881  1.00 62.50  ? 1039 HOH A O   1 
HETATM 8842 O O   . HOH K 6 .   ? 62.395  38.086 61.826  1.00 50.05  ? 1040 HOH A O   1 
HETATM 8843 O O   . HOH K 6 .   ? 56.695  8.263  17.695  1.00 57.95  ? 1041 HOH A O   1 
HETATM 8844 O O   . HOH K 6 .   ? 73.312  22.639 23.572  1.00 56.15  ? 1042 HOH A O   1 
HETATM 8845 O O   . HOH K 6 .   ? 47.712  42.102 1.013   1.00 53.76  ? 1043 HOH A O   1 
HETATM 8846 O O   . HOH K 6 .   ? 55.584  5.084  2.402   1.00 50.34  ? 1044 HOH A O   1 
HETATM 8847 O O   . HOH K 6 .   ? 39.255  10.504 24.811  1.00 67.32  ? 1045 HOH A O   1 
HETATM 8848 O O   . HOH K 6 .   ? 51.522  16.919 19.417  1.00 57.29  ? 1046 HOH A O   1 
HETATM 8849 O O   . HOH K 6 .   ? 47.574  36.155 3.169   1.00 35.89  ? 1047 HOH A O   1 
HETATM 8850 O O   . HOH K 6 .   ? 50.575  23.287 40.453  1.00 27.32  ? 1048 HOH A O   1 
HETATM 8851 O O   . HOH K 6 .   ? 73.697  49.267 46.341  1.00 69.68  ? 1049 HOH A O   1 
HETATM 8852 O O   . HOH K 6 .   ? 60.218  49.528 43.796  1.00 50.18  ? 1050 HOH A O   1 
HETATM 8853 O O   . HOH K 6 .   ? 41.408  11.001 14.041  1.00 53.20  ? 1051 HOH A O   1 
HETATM 8854 O O   . HOH K 6 .   ? 57.475  36.376 58.675  1.00 46.26  ? 1052 HOH A O   1 
HETATM 8855 O O   . HOH K 6 .   ? 56.571  31.827 3.155   1.00 54.71  ? 1053 HOH A O   1 
HETATM 8856 O O   . HOH K 6 .   ? 77.695  30.208 7.428   1.00 59.45  ? 1054 HOH A O   1 
HETATM 8857 O O   . HOH K 6 .   ? 72.427  41.253 9.734   1.00 47.38  ? 1055 HOH A O   1 
HETATM 8858 O O   . HOH K 6 .   ? 67.748  44.738 4.271   1.00 57.85  ? 1056 HOH A O   1 
HETATM 8859 O O   . HOH K 6 .   ? 53.729  49.761 45.200  1.00 67.87  ? 1057 HOH A O   1 
HETATM 8860 O O   . HOH K 6 .   ? 81.919  36.658 36.126  1.00 57.95  ? 1058 HOH A O   1 
HETATM 8861 O O   . HOH K 6 .   ? 59.679  19.050 8.391   1.00 46.54  ? 1059 HOH A O   1 
HETATM 8862 O O   . HOH K 6 .   ? 72.119  27.469 31.363  1.00 58.40  ? 1060 HOH A O   1 
HETATM 8863 O O   . HOH K 6 .   ? 43.949  10.549 -2.688  1.00 47.47  ? 1061 HOH A O   1 
HETATM 8864 O O   . HOH K 6 .   ? 58.339  6.716  17.978  1.00 49.77  ? 1062 HOH A O   1 
HETATM 8865 O O   . HOH K 6 .   ? 47.452  35.639 6.430   1.00 38.49  ? 1063 HOH A O   1 
HETATM 8866 O O   . HOH K 6 .   ? 77.927  32.902 7.290   1.00 62.98  ? 1064 HOH A O   1 
HETATM 8867 O O   . HOH K 6 .   ? 37.486  29.596 21.738  1.00 53.74  ? 1065 HOH A O   1 
HETATM 8868 O O   . HOH K 6 .   ? 58.739  26.192 49.824  1.00 42.88  ? 1066 HOH A O   1 
HETATM 8869 O O   . HOH K 6 .   ? 36.824  12.831 26.097  1.00 51.38  ? 1067 HOH A O   1 
HETATM 8870 O O   . HOH K 6 .   ? 60.413  48.856 48.285  1.00 57.95  ? 1068 HOH A O   1 
HETATM 8871 O O   . HOH K 6 .   ? 55.414  44.928 -1.640  1.00 56.12  ? 1069 HOH A O   1 
HETATM 8872 O O   . HOH K 6 .   ? 67.618  53.142 39.428  1.00 74.79  ? 1070 HOH A O   1 
HETATM 8873 O O   . HOH K 6 .   ? 39.641  11.656 6.584   1.00 60.48  ? 1071 HOH A O   1 
HETATM 8874 O O   . HOH K 6 .   ? 53.482  8.895  19.920  1.00 49.64  ? 1072 HOH A O   1 
HETATM 8875 O O   . HOH K 6 .   ? 61.675  41.077 -0.769  1.00 52.62  ? 1073 HOH A O   1 
HETATM 8876 O O   . HOH K 6 .   ? 75.259  28.664 38.560  1.00 58.14  ? 1074 HOH A O   1 
HETATM 8877 O O   . HOH K 6 .   ? 35.791  30.903 46.618  1.00 70.68  ? 1075 HOH A O   1 
HETATM 8878 O O   . HOH K 6 .   ? 46.415  38.365 56.900  1.00 76.30  ? 1076 HOH A O   1 
HETATM 8879 O O   . HOH K 6 .   ? 45.731  38.540 39.558  1.00 46.22  ? 1077 HOH A O   1 
HETATM 8880 O O   . HOH K 6 .   ? 73.171  48.496 26.762  1.00 55.83  ? 1078 HOH A O   1 
HETATM 8881 O O   . HOH K 6 .   ? 39.569  38.347 36.609  1.00 72.71  ? 1079 HOH A O   1 
HETATM 8882 O O   . HOH K 6 .   ? 54.290  25.086 -0.111  1.00 56.12  ? 1080 HOH A O   1 
HETATM 8883 O O   . HOH K 6 .   ? 41.201  16.948 20.455  1.00 43.40  ? 1081 HOH A O   1 
HETATM 8884 O O   . HOH K 6 .   ? 47.400  38.328 3.368   1.00 41.44  ? 1082 HOH A O   1 
HETATM 8885 O O   . HOH K 6 .   ? 51.767  10.104 21.741  1.00 63.02  ? 1083 HOH A O   1 
HETATM 8886 O O   . HOH K 6 .   ? 53.515  32.945 -0.141  1.00 48.31  ? 1084 HOH A O   1 
HETATM 8887 O O   . HOH K 6 .   ? 72.461  26.790 33.383  1.00 66.37  ? 1085 HOH A O   1 
HETATM 8888 O O   . HOH K 6 .   ? 61.006  55.259 36.026  1.00 59.76  ? 1086 HOH A O   1 
HETATM 8889 O O   . HOH K 6 .   ? 43.146  14.489 50.856  1.00 68.19  ? 1087 HOH A O   1 
HETATM 8890 O O   . HOH K 6 .   ? 36.284  12.479 48.384  1.00 68.26  ? 1088 HOH A O   1 
HETATM 8891 O O   . HOH K 6 .   ? 41.105  9.029  43.195  1.00 63.00  ? 1089 HOH A O   1 
HETATM 8892 O O   . HOH K 6 .   ? 54.775  54.414 22.369  1.00 62.81  ? 1090 HOH A O   1 
HETATM 8893 O O   . HOH K 6 .   ? 42.351  36.725 45.150  1.00 66.60  ? 1091 HOH A O   1 
HETATM 8894 O O   . HOH K 6 .   ? 66.631  9.253  12.204  1.00 56.53  ? 1092 HOH A O   1 
HETATM 8895 O O   . HOH K 6 .   ? 69.005  37.346 57.951  1.00 49.76  ? 1093 HOH A O   1 
HETATM 8896 O O   . HOH K 6 .   ? 19.913  27.562 43.734  1.00 55.04  ? 1094 HOH A O   1 
HETATM 8897 O O   . HOH K 6 .   ? 69.716  52.331 31.439  1.00 65.59  ? 1095 HOH A O   1 
HETATM 8898 O O   . HOH K 6 .   ? 68.915  9.462  21.037  1.00 62.86  ? 1096 HOH A O   1 
HETATM 8899 O O   . HOH K 6 .   ? 74.324  16.838 17.027  1.00 68.68  ? 1097 HOH A O   1 
HETATM 8900 O O   . HOH K 6 .   ? 60.310  36.635 -0.981  1.00 57.20  ? 1098 HOH A O   1 
HETATM 8901 O O   . HOH K 6 .   ? 40.926  15.542 -2.234  1.00 30.00  ? 1099 HOH A O   1 
HETATM 8902 O O   . HOH K 6 .   ? 63.320  20.754 44.608  1.00 74.20  ? 1100 HOH A O   1 
HETATM 8903 O O   . HOH K 6 .   ? 57.956  4.527  2.325   1.00 72.01  ? 1101 HOH A O   1 
HETATM 8904 O O   . HOH K 6 .   ? 79.836  31.119 33.621  1.00 66.06  ? 1102 HOH A O   1 
HETATM 8905 O O   . HOH K 6 .   ? 32.685  8.381  39.150  1.00 67.48  ? 1103 HOH A O   1 
HETATM 8906 O O   . HOH K 6 .   ? 61.229  34.565 56.720  1.00 53.60  ? 1104 HOH A O   1 
HETATM 8907 O O   . HOH K 6 .   ? 76.844  38.059 12.270  1.00 69.52  ? 1105 HOH A O   1 
HETATM 8908 O O   . HOH K 6 .   ? 52.324  29.740 0.981   1.00 35.77  ? 1106 HOH A O   1 
HETATM 8909 O O   . HOH K 6 .   ? 69.808  22.573 25.082  1.00 56.26  ? 1107 HOH A O   1 
HETATM 8910 O O   . HOH K 6 .   ? 41.133  10.973 22.808  1.00 55.52  ? 1108 HOH A O   1 
HETATM 8911 O O   . HOH K 6 .   ? 81.856  31.598 32.855  1.00 71.25  ? 1109 HOH A O   1 
HETATM 8912 O O   . HOH K 6 .   ? 52.138  17.131 23.334  1.00 45.58  ? 1110 HOH A O   1 
HETATM 8913 O O   . HOH K 6 .   ? 53.617  32.559 -2.879  1.00 55.12  ? 1111 HOH A O   1 
HETATM 8914 O O   . HOH K 6 .   ? 54.772  5.865  -3.785  1.00 30.00  ? 1112 HOH A O   1 
HETATM 8915 O O   . HOH K 6 .   ? 65.772  42.297 62.056  1.00 67.01  ? 1113 HOH A O   1 
HETATM 8916 O O   . HOH K 6 .   ? 55.908  13.060 38.004  1.00 44.23  ? 1114 HOH A O   1 
HETATM 8917 O O   . HOH K 6 .   ? 44.450  17.676 49.832  1.00 60.97  ? 1115 HOH A O   1 
HETATM 8918 O O   . HOH K 6 .   ? 63.083  18.659 5.487   1.00 61.78  ? 1116 HOH A O   1 
HETATM 8919 O O   . HOH K 6 .   ? 45.780  7.745  39.121  1.00 48.99  ? 1117 HOH A O   1 
HETATM 8920 O O   . HOH K 6 .   ? 61.660  43.711 56.717  1.00 52.02  ? 1118 HOH A O   1 
HETATM 8921 O O   . HOH K 6 .   ? 33.026  33.653 8.754   1.00 60.08  ? 1119 HOH A O   1 
HETATM 8922 O O   . HOH K 6 .   ? 41.585  10.753 47.182  1.00 70.79  ? 1120 HOH A O   1 
HETATM 8923 O O   . HOH K 6 .   ? 57.780  34.244 53.209  1.00 45.82  ? 1121 HOH A O   1 
HETATM 8924 O O   . HOH K 6 .   ? 59.257  24.747 23.263  1.00 46.59  ? 1122 HOH A O   1 
HETATM 8925 O O   . HOH K 6 .   ? 39.600  17.205 -2.316  1.00 30.00  ? 1123 HOH A O   1 
HETATM 8926 O O   . HOH K 6 .   ? 63.873  26.643 47.310  1.00 24.18  ? 1124 HOH A O   1 
HETATM 8927 O O   . HOH K 6 .   ? 40.918  7.943  41.236  1.00 60.70  ? 1125 HOH A O   1 
HETATM 8928 O O   . HOH K 6 .   ? 56.863  32.721 54.255  1.00 62.46  ? 1126 HOH A O   1 
HETATM 8929 O O   . HOH K 6 .   ? 41.589  6.822  39.371  1.00 66.35  ? 1127 HOH A O   1 
HETATM 8930 O O   . HOH K 6 .   ? 65.346  49.770 52.675  1.00 64.84  ? 1128 HOH A O   1 
HETATM 8931 O O   . HOH K 6 .   ? 69.204  28.393 34.429  1.00 38.85  ? 1129 HOH A O   1 
HETATM 8932 O O   . HOH K 6 .   ? 32.055  19.565 12.436  1.00 54.74  ? 1130 HOH A O   1 
HETATM 8933 O O   . HOH K 6 .   ? 49.591  15.310 21.485  1.00 43.68  ? 1131 HOH A O   1 
HETATM 8934 O O   . HOH K 6 .   ? 50.130  47.116 39.798  1.00 64.78  ? 1132 HOH A O   1 
HETATM 8935 O O   . HOH K 6 .   ? 84.894  27.038 23.601  1.00 54.06  ? 1133 HOH A O   1 
HETATM 8936 O O   . HOH K 6 .   ? 77.745  46.113 53.871  0.5  67.39  ? 1134 HOH A O   1 
HETATM 8937 O O   . HOH K 6 .   ? 40.647  19.064 50.213  1.00 55.13  ? 1135 HOH A O   1 
HETATM 8938 O O   . HOH K 6 .   ? 44.109  37.510 40.916  1.00 50.15  ? 1136 HOH A O   1 
HETATM 8939 O O   . HOH K 6 .   ? 61.666  1.913  11.696  1.00 67.11  ? 1137 HOH A O   1 
HETATM 8940 O O   . HOH K 6 .   ? 44.532  43.503 7.772   1.00 52.05  ? 1138 HOH A O   1 
HETATM 8941 O O   . HOH K 6 .   ? 70.949  14.364 14.394  1.00 57.27  ? 1139 HOH A O   1 
HETATM 8942 O O   . HOH K 6 .   ? 48.164  50.886 28.186  1.00 62.70  ? 1140 HOH A O   1 
HETATM 8943 O O   . HOH K 6 .   ? 45.772  10.072 -5.278  1.00 60.98  ? 1141 HOH A O   1 
HETATM 8944 O O   . HOH K 6 .   ? 42.069  20.789 50.469  1.00 53.20  ? 1142 HOH A O   1 
HETATM 8945 O O   . HOH K 6 .   ? 45.454  28.328 -3.485  1.00 72.61  ? 1143 HOH A O   1 
HETATM 8946 O O   . HOH K 6 .   ? 53.478  18.368 22.397  1.00 40.21  ? 1144 HOH A O   1 
HETATM 8947 O O   . HOH K 6 .   ? 35.248  6.032  36.639  1.00 68.06  ? 1145 HOH A O   1 
HETATM 8948 O O   . HOH K 6 .   ? 31.783  13.057 32.042  1.00 49.69  ? 1146 HOH A O   1 
HETATM 8949 O O   . HOH K 6 .   ? 63.977  17.203 38.714  1.00 48.75  ? 1147 HOH A O   1 
HETATM 8950 O O   . HOH K 6 .   ? 43.745  47.270 22.647  1.00 64.37  ? 1148 HOH A O   1 
HETATM 8951 O O   . HOH K 6 .   ? 78.312  19.876 17.904  1.00 60.37  ? 1149 HOH A O   1 
HETATM 8952 O O   . HOH K 6 .   ? 50.230  43.095 44.271  1.00 61.76  ? 1150 HOH A O   1 
HETATM 8953 O O   . HOH K 6 .   ? 41.654  9.099  6.569   1.00 49.60  ? 1151 HOH A O   1 
HETATM 8954 O O   . HOH K 6 .   ? 52.188  42.468 43.805  1.00 53.21  ? 1152 HOH A O   1 
HETATM 8955 O O   . HOH K 6 .   ? 44.861  6.651  0.515   1.00 57.71  ? 1153 HOH A O   1 
HETATM 8956 O O   . HOH K 6 .   ? 41.795  4.689  35.740  1.00 70.66  ? 1154 HOH A O   1 
HETATM 8957 O O   . HOH K 6 .   ? 51.431  17.714 21.345  1.00 47.51  ? 1155 HOH A O   1 
HETATM 8958 O O   . HOH K 6 .   ? 41.115  47.863 33.242  1.00 65.66  ? 1156 HOH A O   1 
HETATM 8959 O O   . HOH K 6 .   ? 46.901  21.664 51.891  1.00 57.69  ? 1157 HOH A O   1 
HETATM 8960 O O   . HOH K 6 .   ? 39.712  28.375 19.363  1.00 54.36  ? 1158 HOH A O   1 
HETATM 8961 O O   . HOH K 6 .   ? 42.600  51.742 14.066  1.00 78.56  ? 1159 HOH A O   1 
HETATM 8962 O O   . HOH K 6 .   ? 41.814  48.366 22.362  1.00 60.93  ? 1160 HOH A O   1 
HETATM 8963 O O   . HOH K 6 .   ? 41.891  50.743 10.322  1.00 69.56  ? 1161 HOH A O   1 
HETATM 8964 O O   . HOH K 6 .   ? 33.157  18.202 13.898  1.00 64.19  ? 1162 HOH A O   1 
HETATM 8965 O O   . HOH K 6 .   ? 49.540  56.697 20.222  1.00 63.87  ? 1163 HOH A O   1 
HETATM 8966 O O   . HOH K 6 .   ? 65.331  16.659 33.264  1.00 53.04  ? 1164 HOH A O   1 
HETATM 8967 O O   . HOH K 6 .   ? 57.908  54.078 22.338  1.00 70.89  ? 1165 HOH A O   1 
HETATM 8968 O O   . HOH K 6 .   ? 80.435  37.709 26.927  1.00 68.41  ? 1166 HOH A O   1 
HETATM 8969 O O   . HOH K 6 .   ? 83.314  32.542 13.413  1.00 63.90  ? 1167 HOH A O   1 
HETATM 8970 O O   . HOH K 6 .   ? 46.904  37.750 7.270   1.00 43.74  ? 1168 HOH A O   1 
HETATM 8971 O O   . HOH K 6 .   ? 45.584  16.966 48.256  1.00 46.28  ? 1169 HOH A O   1 
HETATM 8972 O O   . HOH K 6 .   ? 85.018  40.373 43.449  1.00 63.38  ? 1170 HOH A O   1 
HETATM 8973 O O   . HOH K 6 .   ? 74.825  37.237 50.206  1.00 56.63  ? 1171 HOH A O   1 
HETATM 8974 O O   . HOH K 6 .   ? 31.314  25.039 13.670  1.00 67.35  ? 1172 HOH A O   1 
HETATM 8975 O O   . HOH K 6 .   ? 52.328  21.660 -0.285  1.00 76.78  ? 1173 HOH A O   1 
HETATM 8976 O O   . HOH K 6 .   ? 54.635  40.396 47.488  1.00 56.30  ? 1174 HOH A O   1 
HETATM 8977 O O   . HOH K 6 .   ? 54.716  8.442  25.461  1.00 59.89  ? 1175 HOH A O   1 
HETATM 8978 O O   . HOH K 6 .   ? 55.338  40.873 58.660  1.00 61.87  ? 1176 HOH A O   1 
HETATM 8979 O O   . HOH K 6 .   ? 73.626  15.728 18.873  1.00 59.94  ? 1177 HOH A O   1 
HETATM 8980 O O   . HOH K 6 .   ? 77.949  30.190 32.919  1.00 57.62  ? 1178 HOH A O   1 
HETATM 8981 O O   . HOH K 6 .   ? 34.545  15.389 48.454  1.00 62.98  ? 1179 HOH A O   1 
HETATM 8982 O O   . HOH K 6 .   ? 66.724  5.532  29.419  1.00 66.03  ? 1180 HOH A O   1 
HETATM 8983 O O   . HOH K 6 .   ? 64.170  17.002 40.864  1.00 66.70  ? 1181 HOH A O   1 
HETATM 8984 O O   . HOH K 6 .   ? 46.315  14.953 48.427  1.00 58.94  ? 1182 HOH A O   1 
HETATM 8985 O O   . HOH K 6 .   ? 47.884  52.387 10.316  1.00 62.57  ? 1183 HOH A O   1 
HETATM 8986 O O   . HOH K 6 .   ? 47.781  20.129 49.756  1.00 57.71  ? 1184 HOH A O   1 
HETATM 8987 O O   . HOH K 6 .   ? 58.771  22.584 23.727  1.00 54.83  ? 1185 HOH A O   1 
HETATM 8988 O O   . HOH K 6 .   ? 34.861  34.669 38.121  1.00 58.41  ? 1186 HOH A O   1 
HETATM 8989 O O   . HOH K 6 .   ? 61.732  51.519 44.560  1.00 50.12  ? 1187 HOH A O   1 
HETATM 8990 O O   . HOH K 6 .   ? 70.770  12.313 19.903  1.00 69.87  ? 1188 HOH A O   1 
HETATM 8991 O O   . HOH K 6 .   ? 40.085  35.707 35.014  1.00 44.54  ? 1189 HOH A O   1 
HETATM 8992 O O   . HOH K 6 .   ? 41.647  29.073 14.638  1.00 71.79  ? 1190 HOH A O   1 
HETATM 8993 O O   . HOH K 6 .   ? 60.816  53.931 27.307  1.00 51.26  ? 1191 HOH A O   1 
HETATM 8994 O O   . HOH K 6 .   ? 52.871  25.717 51.591  1.00 58.75  ? 1192 HOH A O   1 
HETATM 8995 O O   . HOH K 6 .   ? 76.773  42.418 19.195  1.00 54.38  ? 1193 HOH A O   1 
HETATM 8996 O O   . HOH K 6 .   ? 77.882  37.878 50.123  1.00 72.22  ? 1194 HOH A O   1 
HETATM 8997 O O   . HOH K 6 .   ? 69.182  21.407 21.983  1.00 35.16  ? 1195 HOH A O   1 
HETATM 8998 O O   . HOH K 6 .   ? 45.225  6.100  34.323  1.00 69.50  ? 1196 HOH A O   1 
HETATM 8999 O O   . HOH K 6 .   ? 40.379  19.233 19.682  1.00 44.59  ? 1197 HOH A O   1 
HETATM 9000 O O   . HOH K 6 .   ? 77.137  40.758 23.163  1.00 43.93  ? 1198 HOH A O   1 
HETATM 9001 O O   . HOH K 6 .   ? 72.036  50.722 25.872  1.00 67.50  ? 1199 HOH A O   1 
HETATM 9002 O O   . HOH K 6 .   ? 32.739  15.669 2.112   1.00 55.10  ? 1200 HOH A O   1 
HETATM 9003 O O   . HOH K 6 .   ? 57.053  11.328 -7.046  1.00 68.27  ? 1201 HOH A O   1 
HETATM 9004 O O   . HOH K 6 .   ? 37.867  27.476 20.173  1.00 58.34  ? 1202 HOH A O   1 
HETATM 9005 O O   . HOH K 6 .   ? 53.860  10.956 42.966  1.00 77.41  ? 1203 HOH A O   1 
HETATM 9006 O O   . HOH K 6 .   ? 43.655  41.583 0.613   1.00 60.45  ? 1204 HOH A O   1 
HETATM 9007 O O   . HOH K 6 .   ? 51.400  21.705 -2.263  1.00 58.08  ? 1205 HOH A O   1 
HETATM 9008 O O   . HOH K 6 .   ? 68.861  22.832 27.715  1.00 36.07  ? 1206 HOH A O   1 
HETATM 9009 O O   . HOH K 6 .   ? 80.267  48.015 34.682  1.00 68.58  ? 1207 HOH A O   1 
HETATM 9010 O O   . HOH K 6 .   ? 36.744  34.421 40.450  1.00 44.90  ? 1208 HOH A O   1 
HETATM 9011 O O   . HOH K 6 .   ? 66.550  5.570  9.589   1.00 63.36  ? 1209 HOH A O   1 
HETATM 9012 O O   . HOH K 6 .   ? 76.918  25.729 12.419  1.00 59.18  ? 1210 HOH A O   1 
HETATM 9013 O O   . HOH K 6 .   ? 76.265  38.588 9.665   1.00 54.99  ? 1211 HOH A O   1 
HETATM 9014 O O   . HOH K 6 .   ? 49.477  31.852 -6.706  1.00 59.51  ? 1212 HOH A O   1 
HETATM 9015 O O   . HOH K 6 .   ? 74.566  48.446 34.255  1.00 77.65  ? 1213 HOH A O   1 
HETATM 9016 O O   . HOH K 6 .   ? 77.009  19.268 22.326  1.00 63.72  ? 1214 HOH A O   1 
HETATM 9017 O O   . HOH K 6 .   ? 58.355  52.027 41.336  1.00 51.44  ? 1215 HOH A O   1 
HETATM 9018 O O   . HOH K 6 .   ? 68.414  18.726 30.038  1.00 53.09  ? 1216 HOH A O   1 
HETATM 9019 O O   . HOH K 6 .   ? 38.269  23.601 21.079  1.00 54.07  ? 1217 HOH A O   1 
HETATM 9020 O O   . HOH K 6 .   ? 58.260  24.107 25.356  1.00 41.36  ? 1218 HOH A O   1 
HETATM 9021 O O   . HOH K 6 .   ? 35.552  36.788 14.928  1.00 51.20  ? 1219 HOH A O   1 
HETATM 9022 O O   . HOH K 6 .   ? 50.316  12.307 25.528  1.00 58.92  ? 1220 HOH A O   1 
HETATM 9023 O O   . HOH K 6 .   ? 39.484  37.900 8.934   1.00 67.10  ? 1221 HOH A O   1 
HETATM 9024 O O   . HOH K 6 .   ? 75.255  40.646 9.905   1.00 47.51  ? 1222 HOH A O   1 
HETATM 9025 O O   . HOH K 6 .   ? 30.778  16.051 3.666   1.00 57.13  ? 1223 HOH A O   1 
HETATM 9026 O O   . HOH K 6 .   ? 54.281  19.022 -1.834  1.00 41.80  ? 1224 HOH A O   1 
HETATM 9027 O O   . HOH K 6 .   ? 35.220  29.941 21.376  1.00 58.87  ? 1225 HOH A O   1 
HETATM 9028 O O   . HOH K 6 .   ? 40.971  38.275 7.347   1.00 60.85  ? 1226 HOH A O   1 
HETATM 9029 O O   . HOH K 6 .   ? 67.014  23.077 7.940   1.00 51.23  ? 1227 HOH A O   1 
HETATM 9030 O O   . HOH K 6 .   ? 36.757  10.693 5.169   1.00 75.08  ? 1228 HOH A O   1 
HETATM 9031 O O   . HOH K 6 .   ? 75.838  42.319 17.234  1.00 57.33  ? 1229 HOH A O   1 
HETATM 9032 O O   . HOH K 6 .   ? 34.049  25.153 49.430  1.00 58.91  ? 1230 HOH A O   1 
HETATM 9033 O O   . HOH K 6 .   ? 52.764  52.850 12.394  1.00 71.07  ? 1231 HOH A O   1 
HETATM 9034 O O   . HOH K 6 .   ? 41.929  49.135 7.851   1.00 66.35  ? 1232 HOH A O   1 
HETATM 9035 O O   . HOH K 6 .   ? 26.690  14.365 39.914  1.00 62.14  ? 1233 HOH A O   1 
HETATM 9036 O O   . HOH K 6 .   ? 57.209  10.265 34.467  1.00 51.43  ? 1234 HOH A O   1 
HETATM 9037 O O   . HOH K 6 .   ? 24.198  15.823 41.461  1.00 70.10  ? 1235 HOH A O   1 
HETATM 9038 O O   . HOH K 6 .   ? 64.018  20.472 6.115   1.00 46.70  ? 1236 HOH A O   1 
HETATM 9039 O O   . HOH K 6 .   ? 44.929  38.030 8.010   1.00 50.04  ? 1237 HOH A O   1 
HETATM 9040 O O   . HOH K 6 .   ? 40.304  30.713 50.211  1.00 56.15  ? 1238 HOH A O   1 
HETATM 9041 O O   . HOH K 6 .   ? 59.891  15.308 37.150  1.00 48.84  ? 1239 HOH A O   1 
HETATM 9042 O O   . HOH K 6 .   ? 33.944  31.224 22.682  1.00 50.30  ? 1240 HOH A O   1 
HETATM 9043 O O   . HOH K 6 .   ? 38.659  35.012 38.697  1.00 44.76  ? 1241 HOH A O   1 
HETATM 9044 O O   . HOH K 6 .   ? 69.628  50.634 28.754  1.00 62.01  ? 1242 HOH A O   1 
HETATM 9045 O O   . HOH K 6 .   ? 61.465  11.126 33.379  1.00 59.99  ? 1243 HOH A O   1 
HETATM 9046 O O   . HOH K 6 .   ? 26.440  28.598 39.657  1.00 64.36  ? 1244 HOH A O   1 
HETATM 9047 O O   . HOH K 6 .   ? 56.086  53.306 25.752  1.00 69.88  ? 1245 HOH A O   1 
HETATM 9048 O O   . HOH K 6 .   ? 38.255  11.243 12.127  1.00 66.77  ? 1246 HOH A O   1 
HETATM 9049 O O   . HOH K 6 .   ? 68.714  45.803 54.192  1.00 58.87  ? 1247 HOH A O   1 
HETATM 9050 O O   . HOH K 6 .   ? 47.168  5.181  9.030   1.00 68.23  ? 1248 HOH A O   1 
HETATM 9051 O O   . HOH K 6 .   ? 24.571  14.407 38.478  1.00 73.10  ? 1249 HOH A O   1 
HETATM 9052 O O   . HOH K 6 .   ? 66.868  52.457 27.360  1.00 60.15  ? 1250 HOH A O   1 
HETATM 9053 O O   . HOH K 6 .   ? 53.945  4.939  -0.054  1.00 49.37  ? 1251 HOH A O   1 
HETATM 9054 O O   . HOH K 6 .   ? 43.067  6.171  2.859   1.00 58.26  ? 1252 HOH A O   1 
HETATM 9055 O O   . HOH K 6 .   ? 39.851  26.153 13.252  1.00 59.41  ? 1253 HOH A O   1 
HETATM 9056 O O   . HOH K 6 .   ? 83.426  24.956 15.193  1.00 64.19  ? 1254 HOH A O   1 
HETATM 9057 O O   . HOH K 6 .   ? 48.639  9.869  28.852  1.00 58.52  ? 1255 HOH A O   1 
HETATM 9058 O O   . HOH K 6 .   ? 64.737  45.091 0.666   1.00 30.00  ? 1256 HOH A O   1 
HETATM 9059 O O   . HOH K 6 .   ? 50.779  13.768 24.091  1.00 69.40  ? 1257 HOH A O   1 
HETATM 9060 O O   . HOH K 6 .   ? 40.088  9.899  3.690   1.00 66.09  ? 1258 HOH A O   1 
HETATM 9061 O O   . HOH K 6 .   ? 39.681  37.582 39.571  1.00 60.36  ? 1259 HOH A O   1 
HETATM 9062 O O   . HOH K 6 .   ? 40.795  49.173 27.064  1.00 66.02  ? 1260 HOH A O   1 
HETATM 9063 O O   . HOH K 6 .   ? 59.947  53.844 39.887  1.00 60.39  ? 1261 HOH A O   1 
HETATM 9064 O O   . HOH K 6 .   ? 40.212  37.513 42.454  1.00 73.09  ? 1262 HOH A O   1 
HETATM 9065 O O   . HOH K 6 .   ? 40.050  50.418 11.728  1.00 75.27  ? 1263 HOH A O   1 
HETATM 9066 O O   . HOH L 6 .   ? 89.208  30.530 25.349  1.00 58.30  ? 701  HOH B O   1 
HETATM 9067 O O   . HOH L 6 .   ? 116.479 43.660 31.071  1.00 69.66  ? 702  HOH B O   1 
HETATM 9068 O O   . HOH L 6 .   ? 125.143 42.853 29.957  1.00 47.47  ? 703  HOH B O   1 
HETATM 9069 O O   . HOH L 6 .   ? 106.044 55.845 19.561  1.00 64.94  ? 704  HOH B O   1 
HETATM 9070 O O   . HOH L 6 .   ? 112.406 33.816 -0.509  1.00 61.69  ? 705  HOH B O   1 
HETATM 9071 O O   . HOH L 6 .   ? 127.955 32.054 39.985  1.00 50.29  ? 706  HOH B O   1 
HETATM 9072 O O   . HOH L 6 .   ? 113.972 57.592 20.209  1.00 57.44  ? 707  HOH B O   1 
HETATM 9073 O O   . HOH L 6 .   ? 131.325 31.173 24.671  1.00 41.20  ? 708  HOH B O   1 
HETATM 9074 O O   . HOH L 6 .   ? 110.936 27.584 60.928  1.00 59.08  ? 709  HOH B O   1 
HETATM 9075 O O   . HOH L 6 .   ? 127.734 22.794 17.351  1.00 54.61  ? 710  HOH B O   1 
HETATM 9076 O O   . HOH L 6 .   ? 102.407 40.488 63.633  1.00 52.15  ? 711  HOH B O   1 
HETATM 9077 O O   . HOH L 6 .   ? 94.433  44.598 15.400  1.00 33.89  ? 712  HOH B O   1 
HETATM 9078 O O   . HOH L 6 .   ? 109.589 55.900 12.808  1.00 55.66  ? 713  HOH B O   1 
HETATM 9079 O O   . HOH L 6 .   ? 105.378 53.167 9.668   1.00 66.83  ? 714  HOH B O   1 
HETATM 9080 O O   . HOH L 6 .   ? 118.317 64.583 20.710  1.00 64.22  ? 715  HOH B O   1 
HETATM 9081 O O   . HOH L 6 .   ? 108.328 20.007 28.586  1.00 54.73  ? 716  HOH B O   1 
HETATM 9082 O O   . HOH L 6 .   ? 110.537 13.858 51.396  1.00 73.72  ? 717  HOH B O   1 
HETATM 9083 O O   . HOH L 6 .   ? 105.610 22.828 22.495  1.00 35.09  ? 718  HOH B O   1 
HETATM 9084 O O   . HOH L 6 .   ? 129.023 53.243 14.628  1.00 60.40  ? 719  HOH B O   1 
HETATM 9085 O O   . HOH L 6 .   ? 115.830 36.671 51.246  1.00 39.83  ? 720  HOH B O   1 
HETATM 9086 O O   . HOH L 6 .   ? 95.597  48.416 15.416  1.00 29.28  ? 721  HOH B O   1 
HETATM 9087 O O   . HOH L 6 .   ? 111.703 35.908 -0.977  1.00 79.66  ? 722  HOH B O   1 
HETATM 9088 O O   . HOH L 6 .   ? 110.562 62.867 41.290  1.00 47.62  ? 723  HOH B O   1 
HETATM 9089 O O   . HOH L 6 .   ? 94.104  51.806 43.780  1.00 28.44  ? 724  HOH B O   1 
HETATM 9090 O O   . HOH L 6 .   ? 136.738 52.402 17.523  1.00 76.37  ? 725  HOH B O   1 
HETATM 9091 O O   . HOH L 6 .   ? 114.027 37.922 12.675  1.00 50.06  ? 726  HOH B O   1 
HETATM 9092 O O   . HOH L 6 .   ? 93.850  27.874 19.208  1.00 55.43  ? 727  HOH B O   1 
HETATM 9093 O O   . HOH L 6 .   ? 108.693 19.416 25.200  1.00 54.91  ? 728  HOH B O   1 
HETATM 9094 O O   . HOH L 6 .   ? 101.592 37.394 11.208  1.00 50.14  ? 729  HOH B O   1 
HETATM 9095 O O   . HOH L 6 .   ? 104.082 40.545 14.590  1.00 28.04  ? 730  HOH B O   1 
HETATM 9096 O O   . HOH L 6 .   ? 115.208 42.529 17.259  1.00 29.53  ? 731  HOH B O   1 
HETATM 9097 O O   . HOH L 6 .   ? 112.220 40.252 35.792  1.00 19.81  ? 732  HOH B O   1 
HETATM 9098 O O   . HOH L 6 .   ? 109.370 50.290 47.157  1.00 47.21  ? 733  HOH B O   1 
HETATM 9099 O O   . HOH L 6 .   ? 89.487  27.351 20.250  1.00 75.42  ? 734  HOH B O   1 
HETATM 9100 O O   . HOH L 6 .   ? 88.245  35.564 30.635  1.00 41.43  ? 735  HOH B O   1 
HETATM 9101 O O   . HOH L 6 .   ? 112.595 43.125 47.046  1.00 36.70  ? 736  HOH B O   1 
HETATM 9102 O O   . HOH L 6 .   ? 116.347 40.947 33.036  1.00 24.09  ? 737  HOH B O   1 
HETATM 9103 O O   . HOH L 6 .   ? 98.285  22.376 60.550  1.00 52.03  ? 738  HOH B O   1 
HETATM 9104 O O   . HOH L 6 .   ? 102.241 46.116 45.019  1.00 23.27  ? 739  HOH B O   1 
HETATM 9105 O O   . HOH L 6 .   ? 128.574 56.184 10.144  1.00 45.90  ? 740  HOH B O   1 
HETATM 9106 O O   . HOH L 6 .   ? 120.646 33.367 31.948  1.00 20.49  ? 741  HOH B O   1 
HETATM 9107 O O   . HOH L 6 .   ? 129.021 54.666 28.623  1.00 64.05  ? 742  HOH B O   1 
HETATM 9108 O O   . HOH L 6 .   ? 104.378 20.708 58.403  1.00 32.05  ? 743  HOH B O   1 
HETATM 9109 O O   . HOH L 6 .   ? 107.101 14.833 44.130  1.00 56.84  ? 744  HOH B O   1 
HETATM 9110 O O   . HOH L 6 .   ? 127.527 38.836 34.272  1.00 40.90  ? 745  HOH B O   1 
HETATM 9111 O O   . HOH L 6 .   ? 118.935 65.129 13.672  1.00 47.18  ? 746  HOH B O   1 
HETATM 9112 O O   . HOH L 6 .   ? 92.002  22.435 47.767  1.00 62.82  ? 747  HOH B O   1 
HETATM 9113 O O   . HOH L 6 .   ? 111.461 24.262 45.903  1.00 22.10  ? 748  HOH B O   1 
HETATM 9114 O O   . HOH L 6 .   ? 106.844 39.183 43.027  1.00 27.09  ? 749  HOH B O   1 
HETATM 9115 O O   . HOH L 6 .   ? 95.644  40.970 5.415   1.00 53.50  ? 750  HOH B O   1 
HETATM 9116 O O   . HOH L 6 .   ? 81.999  49.234 31.192  1.00 46.96  ? 751  HOH B O   1 
HETATM 9117 O O   . HOH L 6 .   ? 115.573 54.291 37.014  1.00 39.61  ? 752  HOH B O   1 
HETATM 9118 O O   . HOH L 6 .   ? 118.601 31.902 27.122  1.00 28.96  ? 753  HOH B O   1 
HETATM 9119 O O   . HOH L 6 .   ? 109.790 61.796 9.580   1.00 37.66  ? 754  HOH B O   1 
HETATM 9120 O O   . HOH L 6 .   ? 100.490 56.571 21.389  1.00 59.62  ? 755  HOH B O   1 
HETATM 9121 O O   . HOH L 6 .   ? 132.797 29.525 32.600  1.00 40.73  ? 756  HOH B O   1 
HETATM 9122 O O   . HOH L 6 .   ? 84.329  36.941 25.422  1.00 45.15  ? 757  HOH B O   1 
HETATM 9123 O O   . HOH L 6 .   ? 95.468  28.896 39.531  1.00 22.92  ? 758  HOH B O   1 
HETATM 9124 O O   . HOH L 6 .   ? 108.484 65.229 9.243   1.00 57.62  ? 759  HOH B O   1 
HETATM 9125 O O   . HOH L 6 .   ? 134.633 27.114 24.909  1.00 29.23  ? 760  HOH B O   1 
HETATM 9126 O O   . HOH L 6 .   ? 107.742 13.820 52.534  1.00 58.33  ? 761  HOH B O   1 
HETATM 9127 O O   . HOH L 6 .   ? 116.679 11.777 21.823  1.00 45.80  ? 762  HOH B O   1 
HETATM 9128 O O   . HOH L 6 .   ? 100.729 17.702 54.800  1.00 47.66  ? 763  HOH B O   1 
HETATM 9129 O O   . HOH L 6 .   ? 129.041 10.974 22.769  1.00 70.97  ? 764  HOH B O   1 
HETATM 9130 O O   . HOH L 6 .   ? 91.021  41.373 55.936  1.00 52.60  ? 765  HOH B O   1 
HETATM 9131 O O   . HOH L 6 .   ? 114.362 33.656 39.223  1.00 25.94  ? 766  HOH B O   1 
HETATM 9132 O O   . HOH L 6 .   ? 114.749 66.076 13.407  1.00 48.82  ? 767  HOH B O   1 
HETATM 9133 O O   . HOH L 6 .   ? 113.317 38.924 51.563  1.00 37.51  ? 768  HOH B O   1 
HETATM 9134 O O   . HOH L 6 .   ? 100.305 54.988 57.435  1.00 48.61  ? 769  HOH B O   1 
HETATM 9135 O O   . HOH L 6 .   ? 118.165 23.352 37.253  1.00 26.84  ? 770  HOH B O   1 
HETATM 9136 O O   . HOH L 6 .   ? 109.227 41.532 44.969  1.00 29.61  ? 771  HOH B O   1 
HETATM 9137 O O   . HOH L 6 .   ? 121.588 29.677 30.614  1.00 27.23  ? 772  HOH B O   1 
HETATM 9138 O O   . HOH L 6 .   ? 84.312  46.966 36.170  1.00 46.51  ? 773  HOH B O   1 
HETATM 9139 O O   . HOH L 6 .   ? 87.003  43.383 22.365  1.00 24.38  ? 774  HOH B O   1 
HETATM 9140 O O   . HOH L 6 .   ? 119.143 45.508 32.052  1.00 55.78  ? 775  HOH B O   1 
HETATM 9141 O O   . HOH L 6 .   ? 107.238 57.938 46.317  1.00 32.94  ? 776  HOH B O   1 
HETATM 9142 O O   . HOH L 6 .   ? 92.480  44.629 56.417  1.00 32.39  ? 777  HOH B O   1 
HETATM 9143 O O   . HOH L 6 .   ? 106.627 33.228 18.819  1.00 29.00  ? 778  HOH B O   1 
HETATM 9144 O O   . HOH L 6 .   ? 119.922 41.558 31.174  1.00 51.10  ? 779  HOH B O   1 
HETATM 9145 O O   . HOH L 6 .   ? 117.827 12.449 34.849  1.00 46.27  ? 780  HOH B O   1 
HETATM 9146 O O   . HOH L 6 .   ? 111.644 19.220 40.391  1.00 28.79  ? 781  HOH B O   1 
HETATM 9147 O O   . HOH L 6 .   ? 113.762 24.646 44.196  1.00 23.02  ? 782  HOH B O   1 
HETATM 9148 O O   . HOH L 6 .   ? 106.608 39.365 10.193  1.00 44.97  ? 783  HOH B O   1 
HETATM 9149 O O   . HOH L 6 .   ? 85.056  30.872 38.034  1.00 63.30  ? 784  HOH B O   1 
HETATM 9150 O O   . HOH L 6 .   ? 111.102 42.628 31.197  1.00 35.41  ? 785  HOH B O   1 
HETATM 9151 O O   . HOH L 6 .   ? 112.125 27.057 56.587  1.00 49.19  ? 786  HOH B O   1 
HETATM 9152 O O   . HOH L 6 .   ? 97.381  55.490 16.681  1.00 35.81  ? 787  HOH B O   1 
HETATM 9153 O O   . HOH L 6 .   ? 103.592 33.857 63.721  1.00 30.00  ? 788  HOH B O   1 
HETATM 9154 O O   . HOH L 6 .   ? 108.966 49.815 36.366  1.00 23.85  ? 789  HOH B O   1 
HETATM 9155 O O   . HOH L 6 .   ? 130.161 23.633 16.637  1.00 67.06  ? 790  HOH B O   1 
HETATM 9156 O O   . HOH L 6 .   ? 99.245  26.522 60.224  1.00 33.55  ? 791  HOH B O   1 
HETATM 9157 O O   . HOH L 6 .   ? 90.805  49.263 24.318  1.00 22.37  ? 792  HOH B O   1 
HETATM 9158 O O   . HOH L 6 .   ? 111.956 55.287 38.105  1.00 37.06  ? 793  HOH B O   1 
HETATM 9159 O O   . HOH L 6 .   ? 103.091 47.484 29.138  1.00 23.14  ? 794  HOH B O   1 
HETATM 9160 O O   . HOH L 6 .   ? 86.278  38.013 40.519  1.00 39.33  ? 795  HOH B O   1 
HETATM 9161 O O   . HOH L 6 .   ? 117.128 12.112 32.227  1.00 49.09  ? 796  HOH B O   1 
HETATM 9162 O O   . HOH L 6 .   ? 107.767 55.723 33.162  1.00 43.68  ? 797  HOH B O   1 
HETATM 9163 O O   . HOH L 6 .   ? 116.875 10.642 24.683  1.00 68.43  ? 798  HOH B O   1 
HETATM 9164 O O   . HOH L 6 .   ? 89.020  56.637 33.965  1.00 51.67  ? 799  HOH B O   1 
HETATM 9165 O O   . HOH L 6 .   ? 114.279 20.495 29.006  1.00 26.88  ? 800  HOH B O   1 
HETATM 9166 O O   . HOH L 6 .   ? 107.633 17.470 26.087  1.00 48.68  ? 801  HOH B O   1 
HETATM 9167 O O   . HOH L 6 .   ? 106.726 29.839 16.466  1.00 52.82  ? 802  HOH B O   1 
HETATM 9168 O O   . HOH L 6 .   ? 107.336 60.768 47.323  1.00 46.16  ? 803  HOH B O   1 
HETATM 9169 O O   . HOH L 6 .   ? 102.607 45.935 59.926  1.00 38.39  ? 804  HOH B O   1 
HETATM 9170 O O   . HOH L 6 .   ? 121.279 39.627 9.440   1.00 47.08  ? 805  HOH B O   1 
HETATM 9171 O O   . HOH L 6 .   ? 114.241 35.129 44.189  1.00 28.49  ? 806  HOH B O   1 
HETATM 9172 O O   . HOH L 6 .   ? 95.664  44.708 54.425  1.00 27.54  ? 807  HOH B O   1 
HETATM 9173 O O   . HOH L 6 .   ? 95.499  60.265 28.611  1.00 35.04  ? 808  HOH B O   1 
HETATM 9174 O O   . HOH L 6 .   ? 123.845 24.180 41.158  1.00 35.58  ? 809  HOH B O   1 
HETATM 9175 O O   . HOH L 6 .   ? 111.810 28.606 52.076  1.00 34.83  ? 810  HOH B O   1 
HETATM 9176 O O   . HOH L 6 .   ? 111.228 14.267 30.522  1.00 43.49  ? 811  HOH B O   1 
HETATM 9177 O O   . HOH L 6 .   ? 119.733 8.983  22.896  1.00 60.20  ? 812  HOH B O   1 
HETATM 9178 O O   . HOH L 6 .   ? 87.691  49.250 19.432  1.00 29.00  ? 813  HOH B O   1 
HETATM 9179 O O   . HOH L 6 .   ? 125.636 44.218 17.363  1.00 48.33  ? 814  HOH B O   1 
HETATM 9180 O O   . HOH L 6 .   ? 105.290 18.657 61.764  1.00 65.65  ? 815  HOH B O   1 
HETATM 9181 O O   . HOH L 6 .   ? 112.569 22.899 48.440  1.00 35.87  ? 816  HOH B O   1 
HETATM 9182 O O   . HOH L 6 .   ? 89.033  48.673 45.464  1.00 42.36  ? 817  HOH B O   1 
HETATM 9183 O O   . HOH L 6 .   ? 95.184  52.426 50.201  1.00 38.51  ? 818  HOH B O   1 
HETATM 9184 O O   . HOH L 6 .   ? 124.568 45.064 10.889  1.00 42.89  ? 819  HOH B O   1 
HETATM 9185 O O   . HOH L 6 .   ? 117.539 29.288 35.584  1.00 22.56  ? 820  HOH B O   1 
HETATM 9186 O O   . HOH L 6 .   ? 122.081 17.167 18.521  1.00 55.76  ? 821  HOH B O   1 
HETATM 9187 O O   . HOH L 6 .   ? 116.167 33.026 26.970  1.00 25.43  ? 822  HOH B O   1 
HETATM 9188 O O   . HOH L 6 .   ? 86.043  49.035 41.840  1.00 44.46  ? 823  HOH B O   1 
HETATM 9189 O O   . HOH L 6 .   ? 127.429 55.331 32.354  1.00 46.45  ? 824  HOH B O   1 
HETATM 9190 O O   . HOH L 6 .   ? 108.100 59.385 24.064  1.00 42.07  ? 825  HOH B O   1 
HETATM 9191 O O   . HOH L 6 .   ? 97.259  20.993 34.370  1.00 42.90  ? 826  HOH B O   1 
HETATM 9192 O O   . HOH L 6 .   ? 115.071 60.504 -0.901  1.00 36.10  ? 827  HOH B O   1 
HETATM 9193 O O   . HOH L 6 .   ? 112.492 50.569 25.405  1.00 27.53  ? 828  HOH B O   1 
HETATM 9194 O O   . HOH L 6 .   ? 102.284 26.306 62.998  1.00 42.70  ? 829  HOH B O   1 
HETATM 9195 O O   . HOH L 6 .   ? 127.929 35.051 32.585  1.00 37.54  ? 830  HOH B O   1 
HETATM 9196 O O   . HOH L 6 .   ? 97.633  62.147 38.713  1.00 46.33  ? 831  HOH B O   1 
HETATM 9197 O O   . HOH L 6 .   ? 116.804 22.602 35.021  1.00 22.57  ? 832  HOH B O   1 
HETATM 9198 O O   . HOH L 6 .   ? 84.207  26.513 19.150  1.00 50.21  ? 833  HOH B O   1 
HETATM 9199 O O   . HOH L 6 .   ? 85.409  41.399 20.624  1.00 40.44  ? 834  HOH B O   1 
HETATM 9200 O O   . HOH L 6 .   ? 106.905 47.333 29.457  1.00 32.24  ? 835  HOH B O   1 
HETATM 9201 O O   . HOH L 6 .   ? 103.474 21.411 44.418  1.00 33.93  ? 836  HOH B O   1 
HETATM 9202 O O   . HOH L 6 .   ? 123.620 41.900 21.573  1.00 33.24  ? 837  HOH B O   1 
HETATM 9203 O O   . HOH L 6 .   ? 124.875 49.607 21.077  1.00 35.69  ? 838  HOH B O   1 
HETATM 9204 O O   . HOH L 6 .   ? 117.577 44.144 41.501  1.00 32.25  ? 839  HOH B O   1 
HETATM 9205 O O   . HOH L 6 .   ? 114.880 34.626 21.167  1.00 21.41  ? 840  HOH B O   1 
HETATM 9206 O O   . HOH L 6 .   ? 87.928  39.056 54.884  1.00 59.75  ? 841  HOH B O   1 
HETATM 9207 O O   . HOH L 6 .   ? 83.567  47.851 28.653  1.00 38.88  ? 842  HOH B O   1 
HETATM 9208 O O   . HOH L 6 .   ? 87.355  56.416 18.712  1.00 52.58  ? 843  HOH B O   1 
HETATM 9209 O O   . HOH L 6 .   ? 95.462  58.317 31.275  1.00 31.41  ? 844  HOH B O   1 
HETATM 9210 O O   . HOH L 6 .   ? 125.632 25.550 15.268  1.00 46.42  ? 845  HOH B O   1 
HETATM 9211 O O   . HOH L 6 .   ? 111.779 31.810 52.922  1.00 39.63  ? 846  HOH B O   1 
HETATM 9212 O O   . HOH L 6 .   ? 123.289 28.599 28.590  1.00 42.44  ? 847  HOH B O   1 
HETATM 9213 O O   . HOH L 6 .   ? 124.294 46.940 33.655  1.00 37.45  ? 848  HOH B O   1 
HETATM 9214 O O   . HOH L 6 .   ? 101.593 22.482 49.654  1.00 33.06  ? 849  HOH B O   1 
HETATM 9215 O O   . HOH L 6 .   ? 114.672 58.959 7.295   1.00 35.17  ? 850  HOH B O   1 
HETATM 9216 O O   . HOH L 6 .   ? 110.125 52.254 20.141  1.00 28.98  ? 851  HOH B O   1 
HETATM 9217 O O   . HOH L 6 .   ? 115.010 49.700 44.624  1.00 53.65  ? 852  HOH B O   1 
HETATM 9218 O O   . HOH L 6 .   ? 114.922 26.492 23.330  1.00 24.71  ? 853  HOH B O   1 
HETATM 9219 O O   . HOH L 6 .   ? 123.024 18.886 36.966  1.00 28.44  ? 854  HOH B O   1 
HETATM 9220 O O   . HOH L 6 .   ? 114.463 24.949 50.975  1.00 49.62  ? 855  HOH B O   1 
HETATM 9221 O O   . HOH L 6 .   ? 105.913 40.298 21.826  1.00 38.06  ? 856  HOH B O   1 
HETATM 9222 O O   . HOH L 6 .   ? 128.284 11.997 28.800  1.00 55.26  ? 857  HOH B O   1 
HETATM 9223 O O   . HOH L 6 .   ? 108.679 41.692 33.955  1.00 20.26  ? 858  HOH B O   1 
HETATM 9224 O O   . HOH L 6 .   ? 112.424 25.032 25.437  1.00 22.16  ? 859  HOH B O   1 
HETATM 9225 O O   . HOH L 6 .   ? 93.611  22.781 33.146  1.00 49.34  ? 860  HOH B O   1 
HETATM 9226 O O   . HOH L 6 .   ? 107.228 42.339 50.009  1.00 40.33  ? 861  HOH B O   1 
HETATM 9227 O O   . HOH L 6 .   ? 122.803 14.743 20.005  1.00 49.05  ? 862  HOH B O   1 
HETATM 9228 O O   . HOH L 6 .   ? 99.775  21.404 46.256  1.00 39.58  ? 863  HOH B O   1 
HETATM 9229 O O   . HOH L 6 .   ? 92.894  33.010 55.464  1.00 46.82  ? 864  HOH B O   1 
HETATM 9230 O O   . HOH L 6 .   ? 93.917  28.448 56.210  1.00 52.20  ? 865  HOH B O   1 
HETATM 9231 O O   . HOH L 6 .   ? 122.592 25.875 42.763  1.00 31.40  ? 866  HOH B O   1 
HETATM 9232 O O   . HOH L 6 .   ? 106.793 35.825 38.690  1.00 19.98  ? 867  HOH B O   1 
HETATM 9233 O O   . HOH L 6 .   ? 117.805 24.365 23.066  1.00 27.03  ? 868  HOH B O   1 
HETATM 9234 O O   . HOH L 6 .   ? 110.542 15.186 36.099  1.00 51.21  ? 869  HOH B O   1 
HETATM 9235 O O   . HOH L 6 .   ? 92.115  36.079 59.247  1.00 45.62  ? 870  HOH B O   1 
HETATM 9236 O O   . HOH L 6 .   ? 121.377 57.519 32.058  1.00 39.88  ? 871  HOH B O   1 
HETATM 9237 O O   . HOH L 6 .   ? 122.507 20.569 39.120  1.00 33.64  ? 872  HOH B O   1 
HETATM 9238 O O   . HOH L 6 .   ? 87.062  30.923 26.710  1.00 60.39  ? 873  HOH B O   1 
HETATM 9239 O O   . HOH L 6 .   ? 106.688 41.323 13.900  1.00 25.55  ? 874  HOH B O   1 
HETATM 9240 O O   . HOH L 6 .   ? 111.581 58.893 12.750  1.00 40.43  ? 875  HOH B O   1 
HETATM 9241 O O   . HOH L 6 .   ? 97.091  22.380 16.846  1.00 48.08  ? 876  HOH B O   1 
HETATM 9242 O O   . HOH L 6 .   ? 83.629  37.599 37.239  1.00 55.83  ? 877  HOH B O   1 
HETATM 9243 O O   . HOH L 6 .   ? 119.660 39.103 35.465  1.00 28.65  ? 878  HOH B O   1 
HETATM 9244 O O   . HOH L 6 .   ? 91.847  51.557 46.610  1.00 40.82  ? 879  HOH B O   1 
HETATM 9245 O O   . HOH L 6 .   ? 103.060 17.579 56.121  1.00 40.95  ? 880  HOH B O   1 
HETATM 9246 O O   . HOH L 6 .   ? 103.437 38.169 14.767  1.00 42.36  ? 881  HOH B O   1 
HETATM 9247 O O   . HOH L 6 .   ? 110.854 33.488 47.006  1.00 24.76  ? 882  HOH B O   1 
HETATM 9248 O O   . HOH L 6 .   ? 99.715  52.159 4.500   1.00 31.61  ? 883  HOH B O   1 
HETATM 9249 O O   . HOH L 6 .   ? 110.777 17.778 22.976  1.00 49.75  ? 884  HOH B O   1 
HETATM 9250 O O   . HOH L 6 .   ? 106.629 51.696 21.264  1.00 32.45  ? 885  HOH B O   1 
HETATM 9251 O O   . HOH L 6 .   ? 117.638 28.063 47.700  1.00 29.21  ? 886  HOH B O   1 
HETATM 9252 O O   . HOH L 6 .   ? 92.818  45.014 13.154  1.00 39.61  ? 887  HOH B O   1 
HETATM 9253 O O   . HOH L 6 .   ? 118.880 40.492 8.814   1.00 34.55  ? 888  HOH B O   1 
HETATM 9254 O O   . HOH L 6 .   ? 125.900 50.714 24.142  1.00 55.78  ? 889  HOH B O   1 
HETATM 9255 O O   . HOH L 6 .   ? 113.174 32.883 17.621  1.00 36.42  ? 890  HOH B O   1 
HETATM 9256 O O   . HOH L 6 .   ? 117.092 25.503 38.442  1.00 26.42  ? 891  HOH B O   1 
HETATM 9257 O O   . HOH L 6 .   ? 122.160 54.980 38.632  1.00 40.11  ? 892  HOH B O   1 
HETATM 9258 O O   . HOH L 6 .   ? 112.481 57.220 44.014  1.00 52.05  ? 893  HOH B O   1 
HETATM 9259 O O   . HOH L 6 .   ? 108.424 54.809 19.807  1.00 42.53  ? 894  HOH B O   1 
HETATM 9260 O O   . HOH L 6 .   ? 97.946  47.379 14.463  1.00 29.75  ? 895  HOH B O   1 
HETATM 9261 O O   . HOH L 6 .   ? 116.777 39.057 38.096  1.00 21.62  ? 896  HOH B O   1 
HETATM 9262 O O   . HOH L 6 .   ? 109.010 67.178 5.630   1.00 61.02  ? 897  HOH B O   1 
HETATM 9263 O O   . HOH L 6 .   ? 99.924  36.907 5.607   1.00 59.08  ? 898  HOH B O   1 
HETATM 9264 O O   . HOH L 6 .   ? 113.710 46.304 41.218  1.00 28.54  ? 899  HOH B O   1 
HETATM 9265 O O   . HOH L 6 .   ? 89.276  28.531 33.183  1.00 45.18  ? 900  HOH B O   1 
HETATM 9266 O O   . HOH L 6 .   ? 120.106 34.578 25.950  1.00 26.31  ? 901  HOH B O   1 
HETATM 9267 O O   . HOH L 6 .   ? 89.004  42.941 45.616  1.00 42.64  ? 902  HOH B O   1 
HETATM 9268 O O   . HOH L 6 .   ? 83.629  50.391 27.896  1.00 46.14  ? 903  HOH B O   1 
HETATM 9269 O O   . HOH L 6 .   ? 91.299  37.572 39.658  1.00 27.56  ? 904  HOH B O   1 
HETATM 9270 O O   . HOH L 6 .   ? 102.622 62.213 31.787  1.00 44.11  ? 905  HOH B O   1 
HETATM 9271 O O   . HOH L 6 .   ? 112.536 18.426 49.302  1.00 57.61  ? 906  HOH B O   1 
HETATM 9272 O O   . HOH L 6 .   ? 104.053 23.144 48.544  1.00 27.61  ? 907  HOH B O   1 
HETATM 9273 O O   . HOH L 6 .   ? 101.573 19.643 32.565  1.00 51.68  ? 908  HOH B O   1 
HETATM 9274 O O   . HOH L 6 .   ? 122.154 51.507 14.560  1.00 32.79  ? 909  HOH B O   1 
HETATM 9275 O O   . HOH L 6 .   ? 92.182  49.258 51.204  1.00 32.41  ? 910  HOH B O   1 
HETATM 9276 O O   . HOH L 6 .   ? 112.215 35.765 31.776  1.00 16.07  ? 911  HOH B O   1 
HETATM 9277 O O   . HOH L 6 .   ? 125.582 34.816 36.417  1.00 28.59  ? 912  HOH B O   1 
HETATM 9278 O O   . HOH L 6 .   ? 83.567  38.241 27.226  1.00 53.58  ? 913  HOH B O   1 
HETATM 9279 O O   . HOH L 6 .   ? 120.418 30.729 32.965  1.00 26.46  ? 914  HOH B O   1 
HETATM 9280 O O   . HOH L 6 .   ? 125.635 50.235 6.759   1.00 38.82  ? 915  HOH B O   1 
HETATM 9281 O O   . HOH L 6 .   ? 91.093  30.571 54.530  1.00 44.93  ? 916  HOH B O   1 
HETATM 9282 O O   . HOH L 6 .   ? 111.930 61.827 33.719  1.00 42.70  ? 917  HOH B O   1 
HETATM 9283 O O   . HOH L 6 .   ? 125.599 13.258 34.583  1.00 42.35  ? 918  HOH B O   1 
HETATM 9284 O O   . HOH L 6 .   ? 99.713  18.973 22.398  1.00 47.89  ? 919  HOH B O   1 
HETATM 9285 O O   . HOH L 6 .   ? 99.212  61.878 46.164  1.00 50.53  ? 920  HOH B O   1 
HETATM 9286 O O   . HOH L 6 .   ? 118.096 63.919 5.437   1.00 39.94  ? 921  HOH B O   1 
HETATM 9287 O O   . HOH L 6 .   ? 123.089 37.636 43.347  1.00 40.72  ? 922  HOH B O   1 
HETATM 9288 O O   . HOH L 6 .   ? 85.608  29.730 23.650  1.00 49.10  ? 923  HOH B O   1 
HETATM 9289 O O   . HOH L 6 .   ? 113.978 42.519 49.549  1.00 51.34  ? 924  HOH B O   1 
HETATM 9290 O O   . HOH L 6 .   ? 119.516 21.128 14.230  1.00 44.60  ? 925  HOH B O   1 
HETATM 9291 O O   . HOH L 6 .   ? 118.863 50.229 1.565   1.00 57.72  ? 926  HOH B O   1 
HETATM 9292 O O   . HOH L 6 .   ? 115.559 22.987 49.482  1.00 36.81  ? 927  HOH B O   1 
HETATM 9293 O O   . HOH L 6 .   ? 120.237 39.558 21.234  1.00 35.02  ? 928  HOH B O   1 
HETATM 9294 O O   . HOH L 6 .   ? 98.653  23.856 22.443  1.00 35.76  ? 929  HOH B O   1 
HETATM 9295 O O   . HOH L 6 .   ? 113.218 37.168 0.230   1.00 61.54  ? 930  HOH B O   1 
HETATM 9296 O O   . HOH L 6 .   ? 135.219 23.183 23.436  1.00 52.97  ? 931  HOH B O   1 
HETATM 9297 O O   . HOH L 6 .   ? 123.035 40.991 40.582  1.00 32.24  ? 932  HOH B O   1 
HETATM 9298 O O   . HOH L 6 .   ? 90.346  24.517 43.958  1.00 30.00  ? 933  HOH B O   1 
HETATM 9299 O O   . HOH L 6 .   ? 88.701  26.762 40.620  1.00 51.92  ? 934  HOH B O   1 
HETATM 9300 O O   . HOH L 6 .   ? 101.550 20.574 27.895  1.00 45.66  ? 935  HOH B O   1 
HETATM 9301 O O   . HOH L 6 .   ? 118.563 62.259 26.182  1.00 40.80  ? 936  HOH B O   1 
HETATM 9302 O O   . HOH L 6 .   ? 97.362  39.631 12.097  1.00 68.50  ? 937  HOH B O   1 
HETATM 9303 O O   . HOH L 6 .   ? 107.342 54.551 11.640  1.00 62.77  ? 938  HOH B O   1 
HETATM 9304 O O   . HOH L 6 .   ? 114.743 41.011 35.351  1.00 26.01  ? 939  HOH B O   1 
HETATM 9305 O O   . HOH L 6 .   ? 87.909  27.436 38.203  1.00 52.25  ? 940  HOH B O   1 
HETATM 9306 O O   . HOH L 6 .   ? 113.264 29.005 15.055  1.00 38.15  ? 941  HOH B O   1 
HETATM 9307 O O   . HOH L 6 .   ? 97.127  45.668 10.184  1.00 51.43  ? 942  HOH B O   1 
HETATM 9308 O O   . HOH L 6 .   ? 109.409 43.014 50.237  1.00 44.09  ? 943  HOH B O   1 
HETATM 9309 O O   . HOH L 6 .   ? 113.943 25.367 13.669  1.00 34.62  ? 944  HOH B O   1 
HETATM 9310 O O   . HOH L 6 .   ? 105.458 15.669 19.426  1.00 45.90  ? 945  HOH B O   1 
HETATM 9311 O O   . HOH L 6 .   ? 92.703  26.718 47.010  1.00 31.19  ? 946  HOH B O   1 
HETATM 9312 O O   . HOH L 6 .   ? 88.311  30.813 48.776  1.00 52.58  ? 947  HOH B O   1 
HETATM 9313 O O   . HOH L 6 .   ? 93.950  26.643 24.928  1.00 56.08  ? 948  HOH B O   1 
HETATM 9314 O O   . HOH L 6 .   ? 120.256 29.378 12.614  1.00 48.92  ? 949  HOH B O   1 
HETATM 9315 O O   . HOH L 6 .   ? 86.241  34.556 37.988  1.00 51.30  ? 950  HOH B O   1 
HETATM 9316 O O   . HOH L 6 .   ? 96.146  30.308 61.978  1.00 48.07  ? 951  HOH B O   1 
HETATM 9317 O O   . HOH L 6 .   ? 95.807  27.230 57.753  1.00 43.18  ? 952  HOH B O   1 
HETATM 9318 O O   . HOH L 6 .   ? 109.408 23.308 15.244  1.00 53.67  ? 953  HOH B O   1 
HETATM 9319 O O   . HOH L 6 .   ? 127.481 34.104 26.824  1.00 62.16  ? 954  HOH B O   1 
HETATM 9320 O O   . HOH L 6 .   ? 109.991 45.151 54.045  1.00 47.77  ? 955  HOH B O   1 
HETATM 9321 O O   . HOH L 6 .   ? 118.943 62.727 29.062  1.00 36.66  ? 956  HOH B O   1 
HETATM 9322 O O   . HOH L 6 .   ? 122.661 12.666 33.841  1.00 50.77  ? 957  HOH B O   1 
HETATM 9323 O O   . HOH L 6 .   ? 86.750  42.629 16.367  1.00 42.00  ? 958  HOH B O   1 
HETATM 9324 O O   . HOH L 6 .   ? 125.120 56.141 34.992  1.00 65.42  ? 959  HOH B O   1 
HETATM 9325 O O   . HOH L 6 .   ? 98.394  50.750 48.697  1.00 50.69  ? 960  HOH B O   1 
HETATM 9326 O O   . HOH L 6 .   ? 119.582 44.194 33.792  1.00 29.70  ? 961  HOH B O   1 
HETATM 9327 O O   . HOH L 6 .   ? 113.208 68.724 9.709   1.00 66.08  ? 962  HOH B O   1 
HETATM 9328 O O   . HOH L 6 .   ? 94.874  26.476 22.121  1.00 47.31  ? 963  HOH B O   1 
HETATM 9329 O O   . HOH L 6 .   ? 101.546 49.591 57.950  1.00 28.18  ? 964  HOH B O   1 
HETATM 9330 O O   . HOH L 6 .   ? 125.450 62.854 21.636  1.00 75.56  ? 965  HOH B O   1 
HETATM 9331 O O   . HOH L 6 .   ? 106.516 21.090 25.381  1.00 31.84  ? 966  HOH B O   1 
HETATM 9332 O O   . HOH L 6 .   ? 124.840 34.526 43.690  1.00 37.66  ? 967  HOH B O   1 
HETATM 9333 O O   . HOH L 6 .   ? 117.170 27.098 21.997  1.00 27.79  ? 968  HOH B O   1 
HETATM 9334 O O   . HOH L 6 .   ? 124.471 43.117 40.030  1.00 41.55  ? 969  HOH B O   1 
HETATM 9335 O O   . HOH L 6 .   ? 125.268 23.276 16.696  1.00 38.81  ? 970  HOH B O   1 
HETATM 9336 O O   . HOH L 6 .   ? 98.086  65.964 42.810  1.00 69.81  ? 971  HOH B O   1 
HETATM 9337 O O   . HOH L 6 .   ? 102.114 19.708 36.010  1.00 72.45  ? 972  HOH B O   1 
HETATM 9338 O O   . HOH L 6 .   ? 115.545 35.797 14.497  1.00 48.91  ? 973  HOH B O   1 
HETATM 9339 O O   . HOH L 6 .   ? 105.505 45.221 60.532  1.00 50.92  ? 974  HOH B O   1 
HETATM 9340 O O   . HOH L 6 .   ? 96.029  29.013 11.955  1.00 53.06  ? 975  HOH B O   1 
HETATM 9341 O O   . HOH L 6 .   ? 107.636 46.049 56.246  1.00 35.90  ? 976  HOH B O   1 
HETATM 9342 O O   . HOH L 6 .   ? 115.383 44.867 43.011  1.00 31.85  ? 977  HOH B O   1 
HETATM 9343 O O   . HOH L 6 .   ? 98.255  44.694 13.426  1.00 56.36  ? 978  HOH B O   1 
HETATM 9344 O O   . HOH L 6 .   ? 125.470 58.293 17.602  1.00 51.16  ? 979  HOH B O   1 
HETATM 9345 O O   . HOH L 6 .   ? 110.287 56.088 18.153  1.00 43.78  ? 980  HOH B O   1 
HETATM 9346 O O   . HOH L 6 .   ? 107.282 57.784 20.520  1.00 55.32  ? 981  HOH B O   1 
HETATM 9347 O O   . HOH L 6 .   ? 91.027  53.841 38.057  1.00 48.08  ? 982  HOH B O   1 
HETATM 9348 O O   . HOH L 6 .   ? 117.818 16.092 42.624  1.00 45.70  ? 983  HOH B O   1 
HETATM 9349 O O   . HOH L 6 .   ? 132.033 33.035 35.871  1.00 45.31  ? 984  HOH B O   1 
HETATM 9350 O O   . HOH L 6 .   ? 114.139 61.672 34.420  1.00 56.45  ? 985  HOH B O   1 
HETATM 9351 O O   . HOH L 6 .   ? 107.962 50.768 18.764  1.00 53.06  ? 986  HOH B O   1 
HETATM 9352 O O   . HOH L 6 .   ? 113.047 18.730 37.737  1.00 37.22  ? 987  HOH B O   1 
HETATM 9353 O O   . HOH L 6 .   ? 101.712 27.109 60.358  1.00 29.36  ? 988  HOH B O   1 
HETATM 9354 O O   . HOH L 6 .   ? 93.101  58.205 16.993  1.00 45.09  ? 989  HOH B O   1 
HETATM 9355 O O   . HOH L 6 .   ? 121.288 11.545 30.520  1.00 52.72  ? 990  HOH B O   1 
HETATM 9356 O O   . HOH L 6 .   ? 85.502  45.831 40.428  1.00 39.10  ? 991  HOH B O   1 
HETATM 9357 O O   . HOH L 6 .   ? 90.402  59.209 33.281  1.00 52.36  ? 992  HOH B O   1 
HETATM 9358 O O   . HOH L 6 .   ? 96.418  53.183 47.775  1.00 45.55  ? 993  HOH B O   1 
HETATM 9359 O O   . HOH L 6 .   ? 117.245 31.873 15.024  1.00 51.53  ? 994  HOH B O   1 
HETATM 9360 O O   . HOH L 6 .   ? 88.796  60.348 24.372  1.00 44.84  ? 995  HOH B O   1 
HETATM 9361 O O   . HOH L 6 .   ? 95.953  60.868 36.957  1.00 44.41  ? 996  HOH B O   1 
HETATM 9362 O O   . HOH L 6 .   ? 126.958 58.364 15.542  1.00 68.43  ? 997  HOH B O   1 
HETATM 9363 O O   . HOH L 6 .   ? 115.199 47.620 48.705  1.00 62.94  ? 998  HOH B O   1 
HETATM 9364 O O   . HOH L 6 .   ? 110.852 60.832 49.693  1.00 61.83  ? 999  HOH B O   1 
HETATM 9365 O O   . HOH L 6 .   ? 110.352 15.178 24.348  1.00 64.97  ? 1000 HOH B O   1 
HETATM 9366 O O   . HOH L 6 .   ? 96.027  23.190 21.315  1.00 44.57  ? 1001 HOH B O   1 
HETATM 9367 O O   . HOH L 6 .   ? 113.397 57.841 9.163   1.00 30.28  ? 1002 HOH B O   1 
HETATM 9368 O O   . HOH L 6 .   ? 103.732 20.854 46.980  1.00 39.25  ? 1003 HOH B O   1 
HETATM 9369 O O   . HOH L 6 .   ? 106.292 33.363 6.571   1.00 53.76  ? 1004 HOH B O   1 
HETATM 9370 O O   . HOH L 6 .   ? 87.140  31.007 15.936  1.00 50.48  ? 1005 HOH B O   1 
HETATM 9371 O O   . HOH L 6 .   ? 93.546  21.523 50.390  1.00 66.70  ? 1006 HOH B O   1 
HETATM 9372 O O   . HOH L 6 .   ? 126.477 36.358 34.390  1.00 31.10  ? 1007 HOH B O   1 
HETATM 9373 O O   . HOH L 6 .   ? 82.179  43.128 33.601  1.00 48.98  ? 1008 HOH B O   1 
HETATM 9374 O O   . HOH L 6 .   ? 118.342 27.760 37.766  1.00 33.49  ? 1009 HOH B O   1 
HETATM 9375 O O   . HOH L 6 .   ? 125.813 57.614 6.673   1.00 41.72  ? 1010 HOH B O   1 
HETATM 9376 O O   . HOH L 6 .   ? 101.703 50.051 5.391   1.00 44.48  ? 1011 HOH B O   1 
HETATM 9377 O O   . HOH L 6 .   ? 127.827 27.482 39.370  1.00 34.96  ? 1012 HOH B O   1 
HETATM 9378 O O   . HOH L 6 .   ? 95.565  23.110 53.461  1.00 49.43  ? 1013 HOH B O   1 
HETATM 9379 O O   . HOH L 6 .   ? 91.988  61.329 20.735  1.00 54.54  ? 1014 HOH B O   1 
HETATM 9380 O O   . HOH L 6 .   ? 103.885 19.058 28.579  1.00 54.44  ? 1015 HOH B O   1 
HETATM 9381 O O   . HOH L 6 .   ? 84.401  48.858 21.416  1.00 42.52  ? 1016 HOH B O   1 
HETATM 9382 O O   . HOH L 6 .   ? 86.487  36.509 44.540  1.00 44.11  ? 1017 HOH B O   1 
HETATM 9383 O O   . HOH L 6 .   ? 125.493 61.232 12.920  1.00 51.58  ? 1018 HOH B O   1 
HETATM 9384 O O   . HOH L 6 .   ? 131.610 34.830 28.349  1.00 74.27  ? 1019 HOH B O   1 
HETATM 9385 O O   . HOH L 6 .   ? 102.802 62.946 48.020  1.00 60.83  ? 1020 HOH B O   1 
HETATM 9386 O O   . HOH L 6 .   ? 114.090 35.601 4.992   1.00 53.47  ? 1021 HOH B O   1 
HETATM 9387 O O   . HOH L 6 .   ? 107.169 36.796 61.393  1.00 48.45  ? 1022 HOH B O   1 
HETATM 9388 O O   . HOH L 6 .   ? 133.667 16.602 30.328  1.00 41.04  ? 1023 HOH B O   1 
HETATM 9389 O O   . HOH L 6 .   ? 115.477 33.336 18.872  1.00 24.12  ? 1024 HOH B O   1 
HETATM 9390 O O   . HOH L 6 .   ? 84.460  48.105 15.382  1.00 65.04  ? 1025 HOH B O   1 
HETATM 9391 O O   . HOH L 6 .   ? 123.381 60.457 8.099   1.00 55.52  ? 1026 HOH B O   1 
HETATM 9392 O O   . HOH L 6 .   ? 95.467  29.167 59.594  1.00 49.12  ? 1027 HOH B O   1 
HETATM 9393 O O   . HOH L 6 .   ? 112.333 22.736 12.873  1.00 43.08  ? 1028 HOH B O   1 
HETATM 9394 O O   . HOH L 6 .   ? 119.053 41.479 34.027  1.00 25.83  ? 1029 HOH B O   1 
HETATM 9395 O O   . HOH L 6 .   ? 120.947 58.971 35.435  1.00 59.59  ? 1030 HOH B O   1 
HETATM 9396 O O   . HOH L 6 .   ? 103.814 21.205 35.485  1.00 39.47  ? 1031 HOH B O   1 
HETATM 9397 O O   . HOH L 6 .   ? 93.602  25.501 50.174  1.00 36.91  ? 1032 HOH B O   1 
HETATM 9398 O O   . HOH L 6 .   ? 104.130 51.851 21.095  1.00 50.50  ? 1033 HOH B O   1 
HETATM 9399 O O   . HOH L 6 .   ? 120.277 37.386 7.724   1.00 62.11  ? 1034 HOH B O   1 
HETATM 9400 O O   . HOH L 6 .   ? 126.505 24.939 40.175  1.00 37.18  ? 1035 HOH B O   1 
HETATM 9401 O O   . HOH L 6 .   ? 90.554  46.687 10.215  1.00 44.44  ? 1036 HOH B O   1 
HETATM 9402 O O   . HOH L 6 .   ? 89.548  54.922 46.319  1.00 56.44  ? 1037 HOH B O   1 
HETATM 9403 O O   . HOH L 6 .   ? 125.586 31.646 43.949  1.00 55.95  ? 1038 HOH B O   1 
HETATM 9404 O O   . HOH L 6 .   ? 88.844  57.568 12.651  1.00 53.13  ? 1039 HOH B O   1 
HETATM 9405 O O   . HOH L 6 .   ? 118.539 53.296 1.434   1.00 41.50  ? 1040 HOH B O   1 
HETATM 9406 O O   . HOH L 6 .   ? 82.382  38.796 22.332  1.00 55.13  ? 1041 HOH B O   1 
HETATM 9407 O O   . HOH L 6 .   ? 120.104 35.379 49.073  1.00 42.41  ? 1042 HOH B O   1 
HETATM 9408 O O   . HOH L 6 .   ? 122.134 59.487 30.658  1.00 62.90  ? 1043 HOH B O   1 
HETATM 9409 O O   . HOH L 6 .   ? 85.215  45.692 14.704  1.00 50.27  ? 1044 HOH B O   1 
HETATM 9410 O O   . HOH L 6 .   ? 95.444  23.939 51.043  1.00 32.73  ? 1045 HOH B O   1 
HETATM 9411 O O   . HOH L 6 .   ? 104.148 32.450 16.265  1.00 36.73  ? 1046 HOH B O   1 
HETATM 9412 O O   . HOH L 6 .   ? 105.321 61.950 30.738  1.00 43.71  ? 1047 HOH B O   1 
HETATM 9413 O O   . HOH L 6 .   ? 113.120 28.893 54.505  1.00 55.17  ? 1048 HOH B O   1 
HETATM 9414 O O   . HOH L 6 .   ? 98.779  19.449 55.511  1.00 60.34  ? 1049 HOH B O   1 
HETATM 9415 O O   . HOH L 6 .   ? 120.238 47.065 5.700   1.00 43.50  ? 1050 HOH B O   1 
HETATM 9416 O O   . HOH L 6 .   ? 110.607 17.662 56.738  1.00 52.19  ? 1051 HOH B O   1 
HETATM 9417 O O   . HOH L 6 .   ? 97.776  59.424 47.053  1.00 61.68  ? 1052 HOH B O   1 
HETATM 9418 O O   . HOH L 6 .   ? 90.098  31.761 11.450  1.00 69.27  ? 1053 HOH B O   1 
HETATM 9419 O O   . HOH L 6 .   ? 97.741  53.759 13.985  1.00 38.12  ? 1054 HOH B O   1 
HETATM 9420 O O   . HOH L 6 .   ? 94.688  45.994 11.128  1.00 32.91  ? 1055 HOH B O   1 
HETATM 9421 O O   . HOH L 6 .   ? 119.411 37.270 1.284   1.00 50.52  ? 1056 HOH B O   1 
HETATM 9422 O O   . HOH L 6 .   ? 126.092 30.248 16.902  1.00 55.92  ? 1057 HOH B O   1 
HETATM 9423 O O   . HOH L 6 .   ? 99.842  54.454 17.009  1.00 54.43  ? 1058 HOH B O   1 
HETATM 9424 O O   . HOH L 6 .   ? 117.097 38.602 -0.708  1.00 45.64  ? 1059 HOH B O   1 
HETATM 9425 O O   . HOH L 6 .   ? 91.446  40.009 12.796  1.00 46.96  ? 1060 HOH B O   1 
HETATM 9426 O O   . HOH L 6 .   ? 117.032 26.854 50.572  1.00 64.83  ? 1061 HOH B O   1 
HETATM 9427 O O   . HOH L 6 .   ? 102.989 53.836 20.380  1.00 55.13  ? 1062 HOH B O   1 
HETATM 9428 O O   . HOH L 6 .   ? 101.195 60.521 22.199  1.00 66.63  ? 1063 HOH B O   1 
HETATM 9429 O O   . HOH L 6 .   ? 125.052 61.260 19.654  1.00 63.76  ? 1064 HOH B O   1 
HETATM 9430 O O   . HOH L 6 .   ? 97.528  42.139 12.566  1.00 43.72  ? 1065 HOH B O   1 
HETATM 9431 O O   . HOH L 6 .   ? 93.461  57.792 41.850  1.00 46.39  ? 1066 HOH B O   1 
HETATM 9432 O O   . HOH L 6 .   ? 112.673 56.156 21.229  1.00 50.70  ? 1067 HOH B O   1 
HETATM 9433 O O   . HOH L 6 .   ? 118.631 25.402 12.572  1.00 48.50  ? 1068 HOH B O   1 
HETATM 9434 O O   . HOH L 6 .   ? 122.254 45.366 5.039   1.00 58.34  ? 1069 HOH B O   1 
HETATM 9435 O O   . HOH L 6 .   ? 120.266 36.165 16.715  1.00 44.89  ? 1070 HOH B O   1 
HETATM 9436 O O   . HOH L 6 .   ? 107.143 56.907 16.973  1.00 61.79  ? 1071 HOH B O   1 
HETATM 9437 O O   . HOH L 6 .   ? 85.084  42.371 18.028  1.00 59.14  ? 1072 HOH B O   1 
HETATM 9438 O O   . HOH L 6 .   ? 117.651 31.101 51.184  1.00 63.03  ? 1073 HOH B O   1 
HETATM 9439 O O   . HOH L 6 .   ? 115.146 18.124 16.427  1.00 56.62  ? 1074 HOH B O   1 
HETATM 9440 O O   . HOH L 6 .   ? 120.518 54.860 1.717   1.00 45.24  ? 1075 HOH B O   1 
HETATM 9441 O O   . HOH L 6 .   ? 116.910 44.918 45.748  1.00 58.25  ? 1076 HOH B O   1 
HETATM 9442 O O   . HOH L 6 .   ? 113.440 34.442 7.800   1.00 54.17  ? 1077 HOH B O   1 
HETATM 9443 O O   . HOH L 6 .   ? 106.041 39.624 61.446  1.00 47.41  ? 1078 HOH B O   1 
HETATM 9444 O O   . HOH L 6 .   ? 103.434 65.628 38.165  1.00 55.48  ? 1079 HOH B O   1 
HETATM 9445 O O   . HOH L 6 .   ? 85.596  29.657 46.130  1.00 62.69  ? 1080 HOH B O   1 
HETATM 9446 O O   . HOH L 6 .   ? 127.255 51.761 25.571  1.00 56.93  ? 1081 HOH B O   1 
HETATM 9447 O O   . HOH L 6 .   ? 83.577  39.115 17.882  1.00 60.11  ? 1082 HOH B O   1 
HETATM 9448 O O   . HOH L 6 .   ? 103.300 15.626 46.721  1.00 69.35  ? 1083 HOH B O   1 
HETATM 9449 O O   . HOH L 6 .   ? 104.756 34.587 14.742  1.00 62.40  ? 1084 HOH B O   1 
HETATM 9450 O O   . HOH L 6 .   ? 109.961 17.720 52.076  1.00 60.11  ? 1085 HOH B O   1 
HETATM 9451 O O   . HOH L 6 .   ? 106.544 44.581 64.729  1.00 62.15  ? 1086 HOH B O   1 
HETATM 9452 O O   . HOH L 6 .   ? 96.483  25.150 14.481  1.00 59.53  ? 1087 HOH B O   1 
HETATM 9453 O O   . HOH L 6 .   ? 119.824 42.897 47.750  1.00 57.90  ? 1088 HOH B O   1 
HETATM 9454 O O   . HOH L 6 .   ? 110.042 23.664 62.581  1.00 51.63  ? 1089 HOH B O   1 
HETATM 9455 O O   . HOH L 6 .   ? 99.887  51.518 50.649  1.00 46.78  ? 1090 HOH B O   1 
HETATM 9456 O O   . HOH L 6 .   ? 101.936 53.290 11.910  1.00 35.39  ? 1091 HOH B O   1 
HETATM 9457 O O   . HOH L 6 .   ? 107.155 41.946 61.358  1.00 62.79  ? 1092 HOH B O   1 
HETATM 9458 O O   . HOH L 6 .   ? 110.621 46.877 48.767  1.00 68.22  ? 1093 HOH B O   1 
HETATM 9459 O O   . HOH L 6 .   ? 125.708 44.141 24.560  1.00 65.25  ? 1094 HOH B O   1 
HETATM 9460 O O   . HOH L 6 .   ? 81.239  35.214 25.516  1.00 51.22  ? 1095 HOH B O   1 
HETATM 9461 O O   . HOH L 6 .   ? 127.856 33.046 17.642  1.00 63.79  ? 1096 HOH B O   1 
HETATM 9462 O O   . HOH L 6 .   ? 98.565  17.457 46.391  1.00 69.92  ? 1097 HOH B O   1 
HETATM 9463 O O   . HOH L 6 .   ? 106.649 15.304 37.264  1.00 71.79  ? 1098 HOH B O   1 
HETATM 9464 O O   . HOH L 6 .   ? 104.942 66.499 44.228  1.00 51.35  ? 1099 HOH B O   1 
HETATM 9465 O O   . HOH L 6 .   ? 99.255  25.781 10.762  1.00 55.07  ? 1100 HOH B O   1 
HETATM 9466 O O   . HOH L 6 .   ? 93.343  33.630 62.358  1.00 55.18  ? 1101 HOH B O   1 
HETATM 9467 O O   . HOH L 6 .   ? 94.961  57.601 14.687  1.00 62.01  ? 1102 HOH B O   1 
HETATM 9468 O O   . HOH L 6 .   ? 86.348  35.790 12.822  1.00 61.85  ? 1103 HOH B O   1 
HETATM 9469 O O   . HOH L 6 .   ? 129.680 51.396 31.093  1.00 67.56  ? 1104 HOH B O   1 
HETATM 9470 O O   . HOH L 6 .   ? 120.937 43.714 43.354  1.00 55.45  ? 1105 HOH B O   1 
HETATM 9471 O O   . HOH L 6 .   ? 83.490  32.403 44.716  1.00 69.93  ? 1106 HOH B O   1 
HETATM 9472 O O   . HOH L 6 .   ? 126.401 46.667 23.803  1.00 59.82  ? 1107 HOH B O   1 
HETATM 9473 O O   . HOH L 6 .   ? 90.913  22.819 45.124  1.00 69.64  ? 1108 HOH B O   1 
HETATM 9474 O O   . HOH L 6 .   ? 111.528 21.396 53.117  1.00 41.24  ? 1109 HOH B O   1 
HETATM 9475 O O   . HOH L 6 .   ? 111.609 40.393 54.518  1.00 61.94  ? 1110 HOH B O   1 
HETATM 9476 O O   . HOH L 6 .   ? 108.010 49.336 50.849  1.00 75.26  ? 1111 HOH B O   1 
HETATM 9477 O O   . HOH L 6 .   ? 123.497 19.730 41.820  1.00 30.00  ? 1112 HOH B O   1 
HETATM 9478 O O   . HOH L 6 .   ? 122.180 50.751 41.663  1.00 62.40  ? 1113 HOH B O   1 
HETATM 9479 O O   . HOH L 6 .   ? 120.077 58.259 0.896   1.00 30.00  ? 1114 HOH B O   1 
HETATM 9480 O O   . HOH L 6 .   ? 120.674 27.045 47.850  1.00 55.94  ? 1115 HOH B O   1 
HETATM 9481 O O   . HOH L 6 .   ? 86.885  52.166 10.536  1.00 67.42  ? 1116 HOH B O   1 
HETATM 9482 O O   . HOH L 6 .   ? 99.338  63.749 24.929  1.00 62.59  ? 1117 HOH B O   1 
HETATM 9483 O O   . HOH L 6 .   ? 83.525  53.937 21.751  1.00 67.90  ? 1118 HOH B O   1 
HETATM 9484 O O   . HOH L 6 .   ? 119.678 10.548 20.127  1.00 66.53  ? 1119 HOH B O   1 
HETATM 9485 O O   . HOH L 6 .   ? 112.056 14.513 37.548  1.00 56.76  ? 1120 HOH B O   1 
HETATM 9486 O O   . HOH L 6 .   ? 109.867 48.017 46.988  1.00 62.21  ? 1121 HOH B O   1 
HETATM 9487 O O   . HOH L 6 .   ? 111.648 23.500 52.032  1.00 64.65  ? 1122 HOH B O   1 
HETATM 9488 O O   . HOH L 6 .   ? 114.518 50.221 -0.149  1.00 40.99  ? 1123 HOH B O   1 
HETATM 9489 O O   . HOH L 6 .   ? 89.023  51.462 48.055  1.00 56.50  ? 1124 HOH B O   1 
HETATM 9490 O O   . HOH L 6 .   ? 96.425  47.220 11.239  1.00 37.54  ? 1125 HOH B O   1 
HETATM 9491 O O   . HOH L 6 .   ? 111.504 44.495 31.985  1.00 60.94  ? 1126 HOH B O   1 
HETATM 9492 O O   . HOH L 6 .   ? 100.241 19.875 42.320  1.00 63.43  ? 1127 HOH B O   1 
HETATM 9493 O O   . HOH L 6 .   ? 127.019 34.746 18.877  1.00 63.86  ? 1128 HOH B O   1 
HETATM 9494 O O   . HOH L 6 .   ? 122.003 44.985 42.191  1.00 63.77  ? 1129 HOH B O   1 
HETATM 9495 O O   . HOH L 6 .   ? 90.503  27.735 22.076  1.00 56.90  ? 1130 HOH B O   1 
HETATM 9496 O O   . HOH L 6 .   ? 100.781 63.699 30.530  1.00 59.68  ? 1131 HOH B O   1 
HETATM 9497 O O   . HOH L 6 .   ? 107.847 39.086 12.634  1.00 58.70  ? 1132 HOH B O   1 
HETATM 9498 O O   . HOH L 6 .   ? 98.446  54.237 12.007  1.00 54.95  ? 1133 HOH B O   1 
HETATM 9499 O O   . HOH L 6 .   ? 119.300 12.364 18.426  1.00 53.59  ? 1134 HOH B O   1 
HETATM 9500 O O   . HOH L 6 .   ? 121.191 41.616 22.993  1.00 46.55  ? 1135 HOH B O   1 
HETATM 9501 O O   . HOH L 6 .   ? 101.514 60.924 50.124  1.00 63.95  ? 1136 HOH B O   1 
HETATM 9502 O O   . HOH L 6 .   ? 123.868 38.918 20.278  1.00 59.53  ? 1137 HOH B O   1 
HETATM 9503 O O   . HOH L 6 .   ? 118.744 39.284 51.986  1.00 63.27  ? 1138 HOH B O   1 
HETATM 9504 O O   . HOH L 6 .   ? 119.562 47.323 3.516   1.00 51.41  ? 1139 HOH B O   1 
HETATM 9505 O O   . HOH L 6 .   ? 122.771 18.037 43.060  1.00 55.21  ? 1140 HOH B O   1 
HETATM 9506 O O   . HOH L 6 .   ? 109.315 32.744 16.097  1.00 56.65  ? 1141 HOH B O   1 
HETATM 9507 O O   . HOH L 6 .   ? 96.423  66.351 34.348  1.00 64.97  ? 1142 HOH B O   1 
HETATM 9508 O O   . HOH L 6 .   ? 117.557 34.579 4.621   1.00 66.37  ? 1143 HOH B O   1 
HETATM 9509 O O   . HOH L 6 .   ? 108.220 44.736 58.064  1.00 61.01  ? 1144 HOH B O   1 
HETATM 9510 O O   . HOH L 6 .   ? 96.064  43.413 13.651  1.00 42.51  ? 1145 HOH B O   1 
HETATM 9511 O O   . HOH L 6 .   ? 101.403 20.203 64.200  1.00 74.00  ? 1146 HOH B O   1 
HETATM 9512 O O   . HOH L 6 .   ? 91.696  25.746 52.239  1.00 50.58  ? 1147 HOH B O   1 
HETATM 9513 O O   . HOH L 6 .   ? 100.414 53.800 19.120  1.00 59.61  ? 1148 HOH B O   1 
HETATM 9514 O O   . HOH L 6 .   ? 113.211 53.419 37.692  1.00 46.06  ? 1149 HOH B O   1 
HETATM 9515 O O   . HOH L 6 .   ? 116.432 61.136 37.872  1.00 66.15  ? 1150 HOH B O   1 
HETATM 9516 O O   . HOH L 6 .   ? 118.291 61.251 33.072  1.00 49.92  ? 1151 HOH B O   1 
HETATM 9517 O O   . HOH L 6 .   ? 99.702  59.044 19.267  1.00 69.00  ? 1152 HOH B O   1 
HETATM 9518 O O   . HOH L 6 .   ? 110.978 19.028 61.622  1.00 64.83  ? 1153 HOH B O   1 
HETATM 9519 O O   . HOH L 6 .   ? 105.208 19.212 35.133  1.00 49.36  ? 1154 HOH B O   1 
HETATM 9520 O O   . HOH L 6 .   ? 109.749 31.243 5.772   1.00 69.87  ? 1155 HOH B O   1 
HETATM 9521 O O   . HOH L 6 .   ? 89.086  57.869 18.492  1.00 45.81  ? 1156 HOH B O   1 
HETATM 9522 O O   . HOH L 6 .   ? 124.871 54.942 4.028   1.00 53.35  ? 1157 HOH B O   1 
HETATM 9523 O O   . HOH L 6 .   ? 125.613 40.198 26.366  1.00 69.48  ? 1158 HOH B O   1 
HETATM 9524 O O   . HOH L 6 .   ? 98.774  18.950 33.417  1.00 54.95  ? 1159 HOH B O   1 
HETATM 9525 O O   . HOH L 6 .   ? 111.038 22.748 57.719  1.00 55.92  ? 1160 HOH B O   1 
HETATM 9526 O O   . HOH L 6 .   ? 86.810  49.382 44.421  1.00 60.46  ? 1161 HOH B O   1 
HETATM 9527 O O   . HOH L 6 .   ? 105.232 52.690 55.507  1.00 53.99  ? 1162 HOH B O   1 
HETATM 9528 O O   . HOH L 6 .   ? 115.735 48.793 42.687  1.00 77.49  ? 1163 HOH B O   1 
HETATM 9529 O O   . HOH L 6 .   ? 105.225 64.031 37.309  1.00 69.86  ? 1164 HOH B O   1 
HETATM 9530 O O   . HOH L 6 .   ? 118.506 42.759 26.418  1.00 39.88  ? 1165 HOH B O   1 
HETATM 9531 O O   . HOH L 6 .   ? 118.830 34.591 6.702   1.00 71.51  ? 1166 HOH B O   1 
HETATM 9532 O O   . HOH L 6 .   ? 133.891 26.915 30.805  1.00 45.71  ? 1167 HOH B O   1 
HETATM 9533 O O   . HOH L 6 .   ? 114.091 52.703 48.473  1.00 61.33  ? 1168 HOH B O   1 
HETATM 9534 O O   . HOH L 6 .   ? 118.930 42.351 24.326  1.00 60.98  ? 1169 HOH B O   1 
HETATM 9535 O O   . HOH L 6 .   ? 125.460 47.331 42.078  1.00 63.32  ? 1170 HOH B O   1 
HETATM 9536 O O   . HOH L 6 .   ? 106.647 50.856 52.610  1.00 55.44  ? 1171 HOH B O   1 
HETATM 9537 O O   . HOH L 6 .   ? 126.778 35.937 38.893  1.00 52.26  ? 1172 HOH B O   1 
HETATM 9538 O O   . HOH L 6 .   ? 99.455  69.340 39.467  1.00 73.84  ? 1173 HOH B O   1 
HETATM 9539 O O   . HOH L 6 .   ? 109.060 56.038 10.111  1.00 74.03  ? 1174 HOH B O   1 
HETATM 9540 O O   . HOH L 6 .   ? 111.546 22.265 59.693  1.00 62.94  ? 1175 HOH B O   1 
HETATM 9541 O O   . HOH L 6 .   ? 108.741 18.429 63.434  1.00 70.81  ? 1176 HOH B O   1 
HETATM 9542 O O   . HOH L 6 .   ? 113.708 44.991 31.558  1.00 55.75  ? 1177 HOH B O   1 
HETATM 9543 O O   . HOH L 6 .   ? 122.599 39.534 45.168  1.00 55.71  ? 1178 HOH B O   1 
HETATM 9544 O O   . HOH L 6 .   ? 108.560 64.975 44.631  1.00 57.43  ? 1179 HOH B O   1 
HETATM 9545 O O   . HOH L 6 .   ? 133.253 25.430 29.623  1.00 65.27  ? 1180 HOH B O   1 
HETATM 9546 O O   . HOH L 6 .   ? 91.947  55.144 42.904  1.00 52.06  ? 1181 HOH B O   1 
HETATM 9547 O O   . HOH L 6 .   ? 93.620  19.487 28.991  1.00 59.74  ? 1182 HOH B O   1 
HETATM 9548 O O   . HOH L 6 .   ? 102.867 20.347 66.354  1.00 67.56  ? 1183 HOH B O   1 
HETATM 9549 O O   . HOH L 6 .   ? 101.291 20.671 47.944  1.00 43.18  ? 1184 HOH B O   1 
HETATM 9550 O O   . HOH L 6 .   ? 124.412 41.957 11.191  1.00 60.84  ? 1185 HOH B O   1 
HETATM 9551 O O   . HOH L 6 .   ? 136.934 22.512 21.072  1.00 55.67  ? 1186 HOH B O   1 
HETATM 9552 O O   . HOH L 6 .   ? 114.980 20.138 49.735  1.00 56.53  ? 1187 HOH B O   1 
HETATM 9553 O O   . HOH L 6 .   ? 122.657 61.670 27.509  1.00 68.12  ? 1188 HOH B O   1 
HETATM 9554 O O   . HOH L 6 .   ? 106.646 18.961 64.146  1.00 66.29  ? 1189 HOH B O   1 
HETATM 9555 O O   . HOH L 6 .   ? 130.068 35.698 36.940  1.00 71.82  ? 1190 HOH B O   1 
HETATM 9556 O O   . HOH L 6 .   ? 111.247 60.116 22.461  1.00 60.44  ? 1191 HOH B O   1 
HETATM 9557 O O   . HOH L 6 .   ? 88.537  31.623 51.838  1.00 62.87  ? 1192 HOH B O   1 
HETATM 9558 O O   . HOH L 6 .   ? 93.179  32.748 60.507  1.00 69.16  ? 1193 HOH B O   1 
HETATM 9559 O O   . HOH L 6 .   ? 87.585  45.450 46.879  1.00 52.65  ? 1194 HOH B O   1 
HETATM 9560 O O   . HOH L 6 .   ? 116.831 67.367 3.348   1.00 72.44  ? 1195 HOH B O   1 
HETATM 9561 O O   . HOH L 6 .   ? 104.184 37.793 12.087  1.00 59.46  ? 1196 HOH B O   1 
HETATM 9562 O O   . HOH L 6 .   ? 112.774 11.130 33.162  1.00 67.93  ? 1197 HOH B O   1 
HETATM 9563 O O   . HOH L 6 .   ? 95.577  22.383 60.253  1.00 57.10  ? 1198 HOH B O   1 
HETATM 9564 O O   . HOH L 6 .   ? 108.830 48.506 55.645  1.00 62.03  ? 1199 HOH B O   1 
HETATM 9565 O O   . HOH L 6 .   ? 109.864 43.144 47.319  1.00 39.23  ? 1200 HOH B O   1 
HETATM 9566 O O   . HOH L 6 .   ? 108.620 57.307 8.034   1.00 48.75  ? 1201 HOH B O   1 
HETATM 9567 O O   . HOH L 6 .   ? 85.759  52.131 12.603  1.00 68.09  ? 1202 HOH B O   1 
HETATM 9568 O O   . HOH L 6 .   ? 129.573 12.940 31.264  1.00 53.47  ? 1203 HOH B O   1 
HETATM 9569 O O   . HOH L 6 .   ? 115.806 63.991 23.704  1.00 60.29  ? 1204 HOH B O   1 
HETATM 9570 O O   . HOH L 6 .   ? 98.446  54.453 50.595  1.00 55.79  ? 1205 HOH B O   1 
HETATM 9571 O O   . HOH L 6 .   ? 113.020 51.385 40.471  1.00 41.46  ? 1206 HOH B O   1 
HETATM 9572 O O   . HOH L 6 .   ? 100.852 21.611 43.670  1.00 42.17  ? 1207 HOH B O   1 
HETATM 9573 O O   . HOH L 6 .   ? 96.744  27.296 60.977  1.00 65.65  ? 1208 HOH B O   1 
HETATM 9574 O O   . HOH L 6 .   ? 127.259 35.493 16.227  1.00 68.71  ? 1209 HOH B O   1 
HETATM 9575 O O   . HOH L 6 .   ? 102.376 33.497 4.939   1.00 71.16  ? 1210 HOH B O   1 
HETATM 9576 O O   . HOH L 6 .   ? 125.413 63.639 14.311  1.00 70.91  ? 1211 HOH B O   1 
HETATM 9577 O O   . HOH L 6 .   ? 113.512 49.053 41.803  1.00 37.96  ? 1212 HOH B O   1 
HETATM 9578 O O   . HOH L 6 .   ? 127.797 51.212 10.688  1.00 55.83  ? 1213 HOH B O   1 
HETATM 9579 O O   . HOH L 6 .   ? 126.519 54.444 37.459  1.00 76.90  ? 1214 HOH B O   1 
HETATM 9580 O O   . HOH L 6 .   ? 105.943 20.798 27.922  1.00 37.23  ? 1215 HOH B O   1 
HETATM 9581 O O   . HOH L 6 .   ? 92.943  61.974 35.841  1.00 55.81  ? 1216 HOH B O   1 
HETATM 9582 O O   . HOH L 6 .   ? 121.955 20.256 15.317  1.00 44.25  ? 1217 HOH B O   1 
HETATM 9583 O O   . HOH L 6 .   ? 118.311 33.497 49.612  1.00 47.62  ? 1218 HOH B O   1 
HETATM 9584 O O   . HOH L 6 .   ? 113.717 62.261 41.293  1.00 62.78  ? 1219 HOH B O   1 
HETATM 9585 O O   . HOH L 6 .   ? 117.634 42.802 -2.335  1.00 50.96  ? 1220 HOH B O   1 
HETATM 9586 O O   . HOH L 6 .   ? 96.829  58.161 17.341  1.00 67.42  ? 1221 HOH B O   1 
HETATM 9587 O O   . HOH L 6 .   ? 134.380 18.325 22.754  1.00 56.22  ? 1222 HOH B O   1 
HETATM 9588 O O   . HOH L 6 .   ? 117.995 49.149 42.133  1.00 64.46  ? 1223 HOH B O   1 
HETATM 9589 O O   . HOH L 6 .   ? 123.261 44.031 2.071   1.00 70.07  ? 1224 HOH B O   1 
HETATM 9590 O O   . HOH L 6 .   ? 106.131 14.476 56.362  1.00 53.08  ? 1225 HOH B O   1 
HETATM 9591 O O   . HOH L 6 .   ? 93.695  53.290 46.179  1.00 35.09  ? 1226 HOH B O   1 
HETATM 9592 O O   . HOH L 6 .   ? 100.341 40.110 67.179  1.00 65.01  ? 1227 HOH B O   1 
HETATM 9593 O O   . HOH L 6 .   ? 107.253 36.475 13.984  1.00 53.40  ? 1228 HOH B O   1 
HETATM 9594 O O   . HOH L 6 .   ? 91.190  44.450 7.369   1.00 61.47  ? 1229 HOH B O   1 
HETATM 9595 O O   . HOH L 6 .   ? 108.463 27.597 14.913  1.00 57.56  ? 1230 HOH B O   1 
HETATM 9596 O O   . HOH L 6 .   ? 126.137 30.085 13.358  1.00 67.49  ? 1231 HOH B O   1 
HETATM 9597 O O   . HOH L 6 .   ? 91.056  60.715 35.635  1.00 51.98  ? 1232 HOH B O   1 
HETATM 9598 O O   . HOH L 6 .   ? 115.269 36.429 -1.021  1.00 63.69  ? 1233 HOH B O   1 
HETATM 9599 O O   . HOH L 6 .   ? 110.743 65.715 13.710  1.00 58.35  ? 1234 HOH B O   1 
HETATM 9600 O O   . HOH L 6 .   ? 119.949 23.290 12.163  1.00 63.17  ? 1235 HOH B O   1 
HETATM 9601 O O   . HOH L 6 .   ? 109.042 14.813 29.111  1.00 52.03  ? 1236 HOH B O   1 
HETATM 9602 O O   . HOH L 6 .   ? 112.890 42.752 32.722  1.00 38.36  ? 1237 HOH B O   1 
HETATM 9603 O O   . HOH L 6 .   ? 117.429 15.126 14.724  1.00 69.00  ? 1238 HOH B O   1 
HETATM 9604 O O   . HOH L 6 .   ? 118.028 35.166 15.600  1.00 50.27  ? 1239 HOH B O   1 
HETATM 9605 O O   . HOH L 6 .   ? 85.385  33.776 13.945  1.00 67.05  ? 1240 HOH B O   1 
HETATM 9606 O O   . HOH L 6 .   ? 95.639  41.283 13.050  1.00 50.74  ? 1241 HOH B O   1 
HETATM 9607 O O   . HOH L 6 .   ? 88.139  32.066 12.787  1.00 72.63  ? 1242 HOH B O   1 
HETATM 9608 O O   . HOH L 6 .   ? 108.394 60.640 26.720  1.00 64.19  ? 1243 HOH B O   1 
HETATM 9609 O O   . HOH L 6 .   ? 101.092 71.003 40.921  1.00 70.22  ? 1244 HOH B O   1 
HETATM 9610 O O   . HOH L 6 .   ? 96.591  38.745 10.182  1.00 65.81  ? 1245 HOH B O   1 
HETATM 9611 O O   . HOH L 6 .   ? 110.659 61.654 23.815  1.00 75.17  ? 1246 HOH B O   1 
HETATM 9612 O O   . HOH L 6 .   ? 93.139  41.937 13.132  1.00 55.49  ? 1247 HOH B O   1 
HETATM 9613 O O   . HOH L 6 .   ? 107.882 25.199 14.461  1.00 60.48  ? 1248 HOH B O   1 
HETATM 9614 O O   . HOH L 6 .   ? 100.818 17.671 44.727  1.00 62.17  ? 1249 HOH B O   1 
HETATM 9615 O O   . HOH L 6 .   ? 111.082 59.375 10.391  1.00 36.91  ? 1250 HOH B O   1 
HETATM 9616 O O   . HOH L 6 .   ? 90.225  25.075 47.537  1.00 57.14  ? 1251 HOH B O   1 
HETATM 9617 O O   . HOH L 6 .   ? 122.296 17.720 15.823  1.00 58.17  ? 1252 HOH B O   1 
HETATM 9618 O O   . HOH L 6 .   ? 110.433 31.055 14.644  1.00 59.52  ? 1253 HOH B O   1 
HETATM 9619 O O   . HOH L 6 .   ? 110.489 13.361 33.619  1.00 65.58  ? 1254 HOH B O   1 
HETATM 9620 O O   . HOH L 6 .   ? 82.843  40.829 23.611  1.00 78.70  ? 1255 HOH B O   1 
HETATM 9621 O O   . HOH L 6 .   ? 124.227 38.660 41.139  1.00 43.75  ? 1256 HOH B O   1 
HETATM 9622 O O   . HOH L 6 .   ? 112.254 25.934 52.167  1.00 43.33  ? 1257 HOH B O   1 
HETATM 9623 O O   . HOH L 6 .   ? 88.127  34.052 11.887  1.00 74.54  ? 1258 HOH B O   1 
HETATM 9624 O O   . HOH L 6 .   ? 86.368  28.784 15.602  1.00 61.74  ? 1259 HOH B O   1 
HETATM 9625 O O   . HOH L 6 .   ? 107.834 17.187 29.270  1.00 41.00  ? 1260 HOH B O   1 
HETATM 9626 O O   . HOH L 6 .   ? 92.967  25.778 54.650  1.00 58.87  ? 1261 HOH B O   1 
HETATM 9627 O O   . HOH L 6 .   ? 126.511 45.992 12.657  1.00 55.37  ? 1262 HOH B O   1 
HETATM 9628 O O   . HOH L 6 .   ? 90.842  55.468 41.059  1.00 55.46  ? 1263 HOH B O   1 
HETATM 9629 O O   . HOH L 6 .   ? 132.117 31.338 21.512  1.00 58.50  ? 1264 HOH B O   1 
HETATM 9630 O O   . HOH L 6 .   ? 84.955  33.759 35.411  1.00 59.61  ? 1265 HOH B O   1 
HETATM 9631 O O   . HOH L 6 .   ? 128.408 37.618 26.435  1.00 66.87  ? 1266 HOH B O   1 
HETATM 9632 O O   . HOH L 6 .   ? 92.643  28.079 22.042  1.00 64.27  ? 1267 HOH B O   1 
HETATM 9633 O O   . HOH L 6 .   ? 111.441 37.115 11.668  1.00 54.21  ? 1268 HOH B O   1 
HETATM 9634 O O   . HOH L 6 .   ? 111.565 40.927 52.308  1.00 59.88  ? 1269 HOH B O   1 
HETATM 9635 O O   . HOH L 6 .   ? 91.609  25.434 26.195  1.00 55.64  ? 1270 HOH B O   1 
HETATM 9636 O O   . HOH L 6 .   ? 119.252 64.260 2.680   1.00 66.72  ? 1271 HOH B O   1 
HETATM 9637 O O   . HOH L 6 .   ? 124.255 21.301 15.181  1.00 46.77  ? 1272 HOH B O   1 
HETATM 9638 O O   . HOH L 6 .   ? 120.601 61.767 30.567  1.00 65.12  ? 1273 HOH B O   1 
HETATM 9639 O O   . HOH L 6 .   ? 98.726  26.315 62.954  1.00 62.12  ? 1274 HOH B O   1 
HETATM 9640 O O   . HOH L 6 .   ? 98.298  56.698 5.128   1.00 73.44  ? 1275 HOH B O   1 
HETATM 9641 O O   . HOH L 6 .   ? 128.667 39.614 36.866  1.00 56.14  ? 1276 HOH B O   1 
HETATM 9642 O O   . HOH L 6 .   ? 85.794  41.627 13.903  1.00 62.72  ? 1277 HOH B O   1 
HETATM 9643 O O   . HOH L 6 .   ? 94.617  21.646 39.340  1.00 68.40  ? 1278 HOH B O   1 
HETATM 9644 O O   . HOH L 6 .   ? 110.371 60.645 14.702  1.00 63.93  ? 1279 HOH B O   1 
HETATM 9645 O O   . HOH L 6 .   ? 105.670 16.863 30.797  1.00 61.89  ? 1280 HOH B O   1 
HETATM 9646 O O   . HOH L 6 .   ? 126.793 43.668 14.912  1.00 44.53  ? 1281 HOH B O   1 
HETATM 9647 O O   . HOH L 6 .   ? 119.593 62.698 0.297   1.00 62.98  ? 1282 HOH B O   1 
HETATM 9648 O O   . HOH L 6 .   ? 123.731 40.716 25.202  1.00 53.35  ? 1283 HOH B O   1 
HETATM 9649 O O   . HOH L 6 .   ? 88.782  40.706 11.670  1.00 52.67  ? 1284 HOH B O   1 
HETATM 9650 O O   . HOH L 6 .   ? 86.581  41.493 45.740  1.00 57.85  ? 1285 HOH B O   1 
HETATM 9651 O O   . HOH L 6 .   ? 132.235 49.381 32.152  1.00 58.68  ? 1286 HOH B O   1 
HETATM 9652 O O   . HOH L 6 .   ? 83.963  43.856 22.532  1.00 50.44  ? 1287 HOH B O   1 
HETATM 9653 O O   . HOH L 6 .   ? 124.468 65.376 20.619  1.00 57.20  ? 1288 HOH B O   1 
HETATM 9654 O O   . HOH L 6 .   ? 125.193 24.695 12.295  1.00 50.35  ? 1289 HOH B O   1 
HETATM 9655 O O   . HOH L 6 .   ? 106.771 60.181 54.886  1.00 52.56  ? 1290 HOH B O   1 
HETATM 9656 O O   . HOH L 6 .   ? 96.082  64.458 40.175  1.00 64.22  ? 1291 HOH B O   1 
HETATM 9657 O O   . HOH L 6 .   ? 87.704  27.839 47.886  1.00 67.96  ? 1292 HOH B O   1 
HETATM 9658 O O   . HOH L 6 .   ? 82.830  46.251 21.458  1.00 56.82  ? 1293 HOH B O   1 
HETATM 9659 O O   . HOH L 6 .   ? 123.693 65.733 10.559  1.00 65.89  ? 1294 HOH B O   1 
HETATM 9660 O O   . HOH L 6 .   ? 122.860 48.243 3.362   1.00 56.57  ? 1295 HOH B O   1 
HETATM 9661 O O   . HOH L 6 .   ? 110.707 42.971 56.126  1.00 66.73  ? 1296 HOH B O   1 
HETATM 9662 O O   . HOH L 6 .   ? 135.225 28.841 21.143  1.00 66.84  ? 1297 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ARG A 2   ? 1.2046 1.4410 1.1447 -0.0987 -0.2372 -0.0349 3   ARG A N   
2    C CA  . ARG A 2   ? 1.2400 1.4475 1.1457 -0.0963 -0.2304 -0.0380 3   ARG A CA  
3    C C   . ARG A 2   ? 1.1972 1.3966 1.1072 -0.0914 -0.2175 -0.0359 3   ARG A C   
4    O O   . ARG A 2   ? 1.2451 1.4535 1.1680 -0.0793 -0.2136 -0.0275 3   ARG A O   
5    C CB  . ARG A 2   ? 1.3191 1.5053 1.1986 -0.1096 -0.2326 -0.0496 3   ARG A CB  
6    C CG  . ARG A 2   ? 1.4209 1.6074 1.2828 -0.1118 -0.2438 -0.0525 3   ARG A CG  
7    C CD  . ARG A 2   ? 1.5049 1.6832 1.3435 -0.0997 -0.2426 -0.0483 3   ARG A CD  
8    N NE  . ARG A 2   ? 1.5850 1.7379 1.3982 -0.0968 -0.2311 -0.0535 3   ARG A NE  
9    C CZ  . ARG A 2   ? 1.6716 1.8020 1.4532 -0.1013 -0.2298 -0.0647 3   ARG A CZ  
10   N NH1 . ARG A 2   ? 1.7052 1.8345 1.4755 -0.1100 -0.2394 -0.0717 3   ARG A NH1 
11   N NH2 . ARG A 2   ? 1.6937 1.8030 1.4551 -0.0966 -0.2188 -0.0698 3   ARG A NH2 
12   N N   . GLU A 3   ? 1.1074 1.2884 1.0064 -0.1010 -0.2115 -0.0434 4   GLU A N   
13   C CA  . GLU A 3   ? 0.9865 1.1565 0.8850 -0.0973 -0.2000 -0.0424 4   GLU A CA  
14   C C   . GLU A 3   ? 0.8531 1.0222 0.7653 -0.1100 -0.1965 -0.0459 4   GLU A C   
15   O O   . GLU A 3   ? 0.8625 1.0263 0.7714 -0.1236 -0.2016 -0.0520 4   GLU A O   
16   C CB  . GLU A 3   ? 0.9954 1.1351 0.8577 -0.0936 -0.1947 -0.0483 4   GLU A CB  
17   C CG  . GLU A 3   ? 0.9985 1.1395 0.8463 -0.0809 -0.1946 -0.0431 4   GLU A CG  
18   C CD  . GLU A 3   ? 0.9541 1.0956 0.8054 -0.0694 -0.1845 -0.0361 4   GLU A CD  
19   O OE1 . GLU A 3   ? 0.9186 1.0472 0.7471 -0.0617 -0.1789 -0.0366 4   GLU A OE1 
20   O OE2 . GLU A 3   ? 0.9304 1.0835 0.8098 -0.0657 -0.1792 -0.0307 4   GLU A OE2 
21   N N   . ASP A 4   ? 0.7560 0.9301 0.6828 -0.1060 -0.1875 -0.0416 5   ASP A N   
22   C CA  . ASP A 4   ? 0.6254 0.7962 0.5625 -0.1173 -0.1819 -0.0435 5   ASP A CA  
23   C C   . ASP A 4   ? 0.6337 0.7644 0.5451 -0.1145 -0.1725 -0.0485 5   ASP A C   
24   O O   . ASP A 4   ? 0.6022 0.7239 0.5111 -0.0996 -0.1623 -0.0455 5   ASP A O   
25   C CB  . ASP A 4   ? 0.5696 0.7668 0.5400 -0.1104 -0.1741 -0.0363 5   ASP A CB  
26   C CG  . ASP A 4   ? 0.5996 0.7980 0.5824 -0.1232 -0.1676 -0.0373 5   ASP A CG  
27   O OD1 . ASP A 4   ? 0.4948 0.7222 0.5068 -0.1218 -0.1632 -0.0332 5   ASP A OD1 
28   O OD2 . ASP A 4   ? 0.6591 0.8293 0.6219 -0.1347 -0.1671 -0.0422 5   ASP A OD2 
29   N N   . ALA A 5   ? 0.6594 0.7661 0.5527 -0.1287 -0.1767 -0.0561 6   ALA A N   
30   C CA  . ALA A 5   ? 0.6623 0.7287 0.5303 -0.1249 -0.1699 -0.0621 6   ALA A CA  
31   C C   . ALA A 5   ? 0.6530 0.7135 0.5328 -0.1175 -0.1570 -0.0568 6   ALA A C   
32   O O   . ALA A 5   ? 0.6347 0.6711 0.4998 -0.1057 -0.1493 -0.0589 6   ALA A O   
33   C CB  . ALA A 5   ? 0.7036 0.7439 0.5530 -0.1430 -0.1781 -0.0707 6   ALA A CB  
34   N N   . GLU A 6   ? 0.6106 0.6949 0.5170 -0.1243 -0.1544 -0.0503 7   GLU A N   
35   C CA  . GLU A 6   ? 0.5584 0.6388 0.4749 -0.1183 -0.1425 -0.0452 7   GLU A CA  
36   C C   . GLU A 6   ? 0.5070 0.5940 0.4285 -0.0977 -0.1342 -0.0411 7   GLU A C   
37   O O   . GLU A 6   ? 0.4017 0.4759 0.3225 -0.0900 -0.1248 -0.0388 7   GLU A O   
38   C CB  . GLU A 6   ? 0.5886 0.6982 0.5326 -0.1299 -0.1408 -0.0400 7   GLU A CB  
39   C CG  . GLU A 6   ? 0.7112 0.8147 0.6514 -0.1533 -0.1474 -0.0425 7   GLU A CG  
40   C CD  . GLU A 6   ? 0.8017 0.8604 0.7167 -0.1591 -0.1458 -0.0451 7   GLU A CD  
41   O OE1 . GLU A 6   ? 0.7696 0.8123 0.6805 -0.1479 -0.1366 -0.0423 7   GLU A OE1 
42   O OE2 . GLU A 6   ? 0.9231 0.9616 0.8220 -0.1749 -0.1547 -0.0501 7   GLU A OE2 
43   N N   . LEU A 7   ? 0.4378 0.5432 0.3631 -0.0894 -0.1383 -0.0395 8   LEU A N   
44   C CA  . LEU A 7   ? 0.4559 0.5682 0.3863 -0.0719 -0.1316 -0.0345 8   LEU A CA  
45   C C   . LEU A 7   ? 0.4582 0.5497 0.3626 -0.0622 -0.1304 -0.0381 8   LEU A C   
46   O O   . LEU A 7   ? 0.4268 0.5244 0.3326 -0.0496 -0.1258 -0.0336 8   LEU A O   
47   C CB  . LEU A 7   ? 0.4305 0.5762 0.3830 -0.0682 -0.1368 -0.0287 8   LEU A CB  
48   C CG  . LEU A 7   ? 0.4027 0.5745 0.3830 -0.0774 -0.1378 -0.0269 8   LEU A CG  
49   C CD1 . LEU A 7   ? 0.3457 0.5503 0.3493 -0.0710 -0.1440 -0.0223 8   LEU A CD1 
50   C CD2 . LEU A 7   ? 0.3475 0.5148 0.3373 -0.0759 -0.1255 -0.0250 8   LEU A CD2 
51   N N   . LEU A 8   ? 0.4373 0.5043 0.3177 -0.0683 -0.1341 -0.0466 9   LEU A N   
52   C CA  . LEU A 8   ? 0.5078 0.5555 0.3626 -0.0590 -0.1316 -0.0525 9   LEU A CA  
53   C C   . LEU A 8   ? 0.4879 0.5053 0.3305 -0.0561 -0.1249 -0.0582 9   LEU A C   
54   O O   . LEU A 8   ? 0.5611 0.5609 0.3989 -0.0671 -0.1289 -0.0626 9   LEU A O   
55   C CB  . LEU A 8   ? 0.4548 0.4986 0.2891 -0.0665 -0.1424 -0.0597 9   LEU A CB  
56   C CG  . LEU A 8   ? 0.5096 0.5827 0.3543 -0.0695 -0.1517 -0.0536 9   LEU A CG  
57   C CD1 . LEU A 8   ? 0.5401 0.6071 0.3613 -0.0780 -0.1631 -0.0615 9   LEU A CD1 
58   C CD2 . LEU A 8   ? 0.5244 0.6129 0.3760 -0.0555 -0.1464 -0.0448 9   LEU A CD2 
59   N N   . VAL A 9   ? 0.4420 0.4536 0.2803 -0.0416 -0.1155 -0.0577 10  VAL A N   
60   C CA  . VAL A 9   ? 0.5010 0.4860 0.3298 -0.0354 -0.1093 -0.0627 10  VAL A CA  
61   C C   . VAL A 9   ? 0.4859 0.4641 0.2970 -0.0219 -0.1040 -0.0691 10  VAL A C   
62   O O   . VAL A 9   ? 0.4931 0.4912 0.3067 -0.0153 -0.1005 -0.0645 10  VAL A O   
63   C CB  . VAL A 9   ? 0.5105 0.5011 0.3595 -0.0314 -0.1017 -0.0542 10  VAL A CB  
64   C CG1 . VAL A 9   ? 0.5257 0.4915 0.3653 -0.0219 -0.0959 -0.0583 10  VAL A CG1 
65   C CG2 . VAL A 9   ? 0.5215 0.5178 0.3853 -0.0458 -0.1058 -0.0496 10  VAL A CG2 
66   N N   . THR A 10  ? 0.5249 0.4751 0.3176 -0.0180 -0.1035 -0.0798 11  THR A N   
67   C CA  . THR A 10  ? 0.5276 0.4724 0.3053 -0.0036 -0.0965 -0.0875 11  THR A CA  
68   C C   . THR A 10  ? 0.5385 0.4739 0.3245 0.0084  -0.0882 -0.0864 11  THR A C   
69   O O   . THR A 10  ? 0.5834 0.4956 0.3696 0.0062  -0.0910 -0.0881 11  THR A O   
70   C CB  . THR A 10  ? 0.5892 0.5101 0.3395 -0.0049 -0.1018 -0.1029 11  THR A CB  
71   O OG1 . THR A 10  ? 0.5994 0.5317 0.3410 -0.0161 -0.1101 -0.1036 11  THR A OG1 
72   C CG2 . THR A 10  ? 0.5707 0.4886 0.3067 0.0113  -0.0930 -0.1125 11  THR A CG2 
73   N N   . VAL A 11  ? 0.5320 0.4859 0.3248 0.0200  -0.0789 -0.0826 12  VAL A N   
74   C CA  . VAL A 11  ? 0.5205 0.4682 0.3195 0.0331  -0.0712 -0.0832 12  VAL A CA  
75   C C   . VAL A 11  ? 0.5586 0.5085 0.3431 0.0460  -0.0645 -0.0938 12  VAL A C   
76   O O   . VAL A 11  ? 0.6232 0.5741 0.3898 0.0437  -0.0664 -0.1014 12  VAL A O   
77   C CB  . VAL A 11  ? 0.5307 0.5000 0.3532 0.0347  -0.0656 -0.0697 12  VAL A CB  
78   C CG1 . VAL A 11  ? 0.4374 0.4040 0.2736 0.0229  -0.0710 -0.0615 12  VAL A CG1 
79   C CG2 . VAL A 11  ? 0.4990 0.4967 0.3256 0.0347  -0.0619 -0.0631 12  VAL A CG2 
80   N N   . ARG A 12  ? 0.6319 0.5844 0.4240 0.0596  -0.0565 -0.0947 13  ARG A N   
81   C CA  . ARG A 12  ? 0.7414 0.6981 0.5217 0.0731  -0.0490 -0.1063 13  ARG A CA  
82   C C   . ARG A 12  ? 0.6247 0.6105 0.4001 0.0711  -0.0431 -0.1032 13  ARG A C   
83   O O   . ARG A 12  ? 0.7794 0.7663 0.5350 0.0738  -0.0410 -0.1141 13  ARG A O   
84   C CB  . ARG A 12  ? 0.8371 0.7964 0.6312 0.0876  -0.0421 -0.1062 13  ARG A CB  
85   C CG  . ARG A 12  ? 1.0111 0.9434 0.8115 0.0885  -0.0486 -0.1051 13  ARG A CG  
86   C CD  . ARG A 12  ? 1.2139 1.1168 0.9986 0.0993  -0.0515 -0.1212 13  ARG A CD  
87   N NE  . ARG A 12  ? 1.3815 1.2500 1.1635 0.0930  -0.0620 -0.1198 13  ARG A NE  
88   C CZ  . ARG A 12  ? 1.5060 1.3473 1.2704 0.0836  -0.0710 -0.1267 13  ARG A CZ  
89   N NH1 . ARG A 12  ? 1.5531 1.3978 1.3006 0.0805  -0.0710 -0.1366 13  ARG A NH1 
90   N NH2 . ARG A 12  ? 1.5432 1.3538 1.3057 0.0761  -0.0803 -0.1236 13  ARG A NH2 
91   N N   . GLY A 13  ? 0.5021 0.5106 0.2942 0.0666  -0.0405 -0.0885 14  GLY A N   
92   C CA  . GLY A 13  ? 0.5825 0.6162 0.3694 0.0635  -0.0360 -0.0832 14  GLY A CA  
93   C C   . GLY A 13  ? 0.5233 0.5549 0.2918 0.0532  -0.0437 -0.0852 14  GLY A C   
94   O O   . GLY A 13  ? 0.6391 0.6851 0.3928 0.0521  -0.0404 -0.0862 14  GLY A O   
95   N N   . GLY A 14  ? 0.4918 0.5067 0.2604 0.0444  -0.0542 -0.0855 15  GLY A N   
96   C CA  . GLY A 14  ? 0.4940 0.5083 0.2477 0.0335  -0.0633 -0.0867 15  GLY A CA  
97   C C   . GLY A 14  ? 0.4778 0.4880 0.2458 0.0223  -0.0734 -0.0789 15  GLY A C   
98   O O   . GLY A 14  ? 0.4891 0.4893 0.2723 0.0223  -0.0738 -0.0766 15  GLY A O   
99   N N   . ARG A 15  ? 0.5353 0.5555 0.2984 0.0126  -0.0817 -0.0747 16  ARG A N   
100  C CA  . ARG A 15  ? 0.5141 0.5341 0.2899 0.0013  -0.0921 -0.0693 16  ARG A CA  
101  C C   . ARG A 15  ? 0.5419 0.5830 0.3427 0.0007  -0.0917 -0.0543 16  ARG A C   
102  O O   . ARG A 15  ? 0.5236 0.5802 0.3258 0.0052  -0.0877 -0.0467 16  ARG A O   
103  C CB  . ARG A 15  ? 0.5649 0.5852 0.3234 -0.0087 -0.1031 -0.0739 16  ARG A CB  
104  C CG  . ARG A 15  ? 0.6243 0.6200 0.3578 -0.0100 -0.1054 -0.0904 16  ARG A CG  
105  C CD  . ARG A 15  ? 0.6332 0.6304 0.3486 -0.0212 -0.1173 -0.0948 16  ARG A CD  
106  N NE  . ARG A 15  ? 0.7649 0.7760 0.4615 -0.0178 -0.1150 -0.0948 16  ARG A NE  
107  C CZ  . ARG A 15  ? 0.8452 0.8695 0.5321 -0.0263 -0.1249 -0.0908 16  ARG A CZ  
108  N NH1 . ARG A 15  ? 0.8319 0.8597 0.5292 -0.0379 -0.1378 -0.0872 16  ARG A NH1 
109  N NH2 . ARG A 15  ? 0.8346 0.8703 0.5016 -0.0237 -0.1222 -0.0899 16  ARG A NH2 
110  N N   . LEU A 16  ? 0.3951 0.4359 0.2148 -0.0055 -0.0959 -0.0503 17  LEU A N   
111  C CA  . LEU A 16  ? 0.4229 0.4824 0.2676 -0.0058 -0.0960 -0.0383 17  LEU A CA  
112  C C   . LEU A 16  ? 0.4502 0.5190 0.3059 -0.0167 -0.1067 -0.0361 17  LEU A C   
113  O O   . LEU A 16  ? 0.4607 0.5187 0.3091 -0.0257 -0.1126 -0.0433 17  LEU A O   
114  C CB  . LEU A 16  ? 0.4070 0.4624 0.2686 -0.0014 -0.0881 -0.0354 17  LEU A CB  
115  C CG  . LEU A 16  ? 0.4220 0.4684 0.2784 0.0092  -0.0779 -0.0379 17  LEU A CG  
116  C CD1 . LEU A 16  ? 0.3643 0.4016 0.2339 0.0100  -0.0742 -0.0369 17  LEU A CD1 
117  C CD2 . LEU A 16  ? 0.3719 0.4350 0.2323 0.0159  -0.0724 -0.0301 17  LEU A CD2 
118  N N   . ARG A 17  ? 0.4267 0.5161 0.3009 -0.0159 -0.1095 -0.0265 18  ARG A N   
119  C CA  . ARG A 17  ? 0.4008 0.5054 0.2925 -0.0241 -0.1186 -0.0238 18  ARG A CA  
120  C C   . ARG A 17  ? 0.3945 0.5123 0.3137 -0.0202 -0.1139 -0.0168 18  ARG A C   
121  O O   . ARG A 17  ? 0.3555 0.4783 0.2805 -0.0111 -0.1092 -0.0104 18  ARG A O   
122  C CB  . ARG A 17  ? 0.3861 0.5049 0.2732 -0.0259 -0.1296 -0.0201 18  ARG A CB  
123  C CG  . ARG A 17  ? 0.3613 0.5013 0.2713 -0.0320 -0.1394 -0.0167 18  ARG A CG  
124  C CD  . ARG A 17  ? 0.3941 0.5476 0.2991 -0.0325 -0.1519 -0.0121 18  ARG A CD  
125  N NE  . ARG A 17  ? 0.5095 0.6507 0.3836 -0.0377 -0.1567 -0.0183 18  ARG A NE  
126  C CZ  . ARG A 17  ? 0.5131 0.6492 0.3650 -0.0329 -0.1563 -0.0157 18  ARG A CZ  
127  N NH1 . ARG A 17  ? 0.4512 0.5920 0.3079 -0.0237 -0.1517 -0.0061 18  ARG A NH1 
128  N NH2 . ARG A 17  ? 0.5221 0.6480 0.3452 -0.0382 -0.1601 -0.0233 18  ARG A NH2 
129  N N   . GLY A 18  ? 0.4022 0.5255 0.3371 -0.0278 -0.1148 -0.0184 19  GLY A N   
130  C CA  . GLY A 18  ? 0.3311 0.4678 0.2908 -0.0250 -0.1097 -0.0139 19  GLY A CA  
131  C C   . GLY A 18  ? 0.3655 0.5285 0.3480 -0.0288 -0.1173 -0.0115 19  GLY A C   
132  O O   . GLY A 18  ? 0.3787 0.5516 0.3592 -0.0315 -0.1277 -0.0111 19  GLY A O   
133  N N   . ILE A 19  ? 0.3234 0.4996 0.3281 -0.0288 -0.1122 -0.0102 20  ILE A N   
134  C CA  . ILE A 19  ? 0.3186 0.5238 0.3491 -0.0307 -0.1178 -0.0093 20  ILE A CA  
135  C C   . ILE A 19  ? 0.3391 0.5535 0.3819 -0.0423 -0.1134 -0.0130 20  ILE A C   
136  O O   . ILE A 19  ? 0.3630 0.5622 0.3987 -0.0453 -0.1046 -0.0140 20  ILE A O   
137  C CB  . ILE A 19  ? 0.3681 0.5866 0.4177 -0.0171 -0.1160 -0.0043 20  ILE A CB  
138  C CG1 . ILE A 19  ? 0.4035 0.6129 0.4560 -0.0126 -0.1034 -0.0042 20  ILE A CG1 
139  C CG2 . ILE A 19  ? 0.3589 0.5701 0.3968 -0.0080 -0.1221 0.0011  20  ILE A CG2 
140  C CD1 . ILE A 19  ? 0.4251 0.6450 0.4957 -0.0002 -0.1015 -0.0009 20  ILE A CD1 
141  N N   . ARG A 20  ? 0.3240 0.5653 0.3859 -0.0491 -0.1200 -0.0144 21  ARG A N   
142  C CA  . ARG A 20  ? 0.3784 0.6370 0.4566 -0.0610 -0.1157 -0.0171 21  ARG A CA  
143  C C   . ARG A 20  ? 0.3355 0.6181 0.4405 -0.0509 -0.1092 -0.0163 21  ARG A C   
144  O O   . ARG A 20  ? 0.2968 0.6029 0.4218 -0.0421 -0.1153 -0.0157 21  ARG A O   
145  C CB  . ARG A 20  ? 0.4191 0.6976 0.5051 -0.0747 -0.1261 -0.0198 21  ARG A CB  
146  C CG  . ARG A 20  ? 0.4981 0.8005 0.6028 -0.0895 -0.1221 -0.0223 21  ARG A CG  
147  C CD  . ARG A 20  ? 0.5774 0.9079 0.6970 -0.0991 -0.1338 -0.0243 21  ARG A CD  
148  N NE  . ARG A 20  ? 0.6021 0.9388 0.7249 -0.1192 -0.1314 -0.0266 21  ARG A NE  
149  C CZ  . ARG A 20  ? 0.6406 1.0061 0.7890 -0.1230 -0.1247 -0.0275 21  ARG A CZ  
150  N NH1 . ARG A 20  ? 0.6352 1.0242 0.8082 -0.1068 -0.1201 -0.0276 21  ARG A NH1 
151  N NH2 . ARG A 20  ? 0.7190 1.0882 0.8670 -0.1429 -0.1226 -0.0285 21  ARG A NH2 
152  N N   . LEU A 21  ? 0.2988 0.5741 0.4032 -0.0512 -0.0975 -0.0167 22  LEU A N   
153  C CA  . LEU A 21  ? 0.3763 0.6720 0.5032 -0.0424 -0.0901 -0.0176 22  LEU A CA  
154  C C   . LEU A 21  ? 0.3561 0.6834 0.5039 -0.0543 -0.0865 -0.0217 22  LEU A C   
155  O O   . LEU A 21  ? 0.3077 0.6301 0.4459 -0.0713 -0.0838 -0.0221 22  LEU A O   
156  C CB  . LEU A 21  ? 0.4227 0.6962 0.5374 -0.0372 -0.0794 -0.0162 22  LEU A CB  
157  C CG  . LEU A 21  ? 0.4710 0.7224 0.5736 -0.0227 -0.0799 -0.0125 22  LEU A CG  
158  C CD1 . LEU A 21  ? 0.4750 0.7136 0.5726 -0.0189 -0.0693 -0.0120 22  LEU A CD1 
159  C CD2 . LEU A 21  ? 0.3817 0.6490 0.5016 -0.0095 -0.0865 -0.0114 22  LEU A CD2 
160  N N   . LYS A 22  ? 0.3473 0.7071 0.5236 -0.0454 -0.0864 -0.0246 23  LYS A N   
161  C CA  . LYS A 22  ? 0.3344 0.7291 0.5333 -0.0545 -0.0799 -0.0295 23  LYS A CA  
162  C C   . LYS A 22  ? 0.3076 0.6979 0.5044 -0.0530 -0.0657 -0.0312 23  LYS A C   
163  O O   . LYS A 22  ? 0.3249 0.7001 0.5181 -0.0380 -0.0625 -0.0306 23  LYS A O   
164  C CB  . LYS A 22  ? 0.3700 0.7870 0.5951 -0.0420 -0.0830 -0.0321 23  LYS A CB  
165  C CG  . LYS A 22  ? 0.4732 0.8923 0.7001 -0.0430 -0.0969 -0.0297 23  LYS A CG  
166  C CD  . LYS A 22  ? 0.5860 1.0327 0.8421 -0.0348 -0.0991 -0.0325 23  LYS A CD  
167  C CE  . LYS A 22  ? 0.6656 1.1146 0.9242 -0.0347 -0.1144 -0.0296 23  LYS A CE  
168  N NZ  . LYS A 22  ? 0.7361 1.1651 0.9864 -0.0188 -0.1243 -0.0245 23  LYS A NZ  
169  N N   . THR A 23  ? 0.2761 0.6779 0.4727 -0.0702 -0.0579 -0.0327 24  THR A N   
170  C CA  . THR A 23  ? 0.2999 0.7062 0.4967 -0.0718 -0.0444 -0.0349 24  THR A CA  
171  C C   . THR A 23  ? 0.3182 0.7577 0.5328 -0.0820 -0.0374 -0.0392 24  THR A C   
172  O O   . THR A 23  ? 0.3414 0.7914 0.5614 -0.0920 -0.0428 -0.0386 24  THR A O   
173  C CB  . THR A 23  ? 0.3067 0.6765 0.4721 -0.0834 -0.0398 -0.0294 24  THR A CB  
174  O OG1 . THR A 23  ? 0.3545 0.7320 0.5150 -0.1067 -0.0385 -0.0279 24  THR A OG1 
175  C CG2 . THR A 23  ? 0.3132 0.6429 0.4551 -0.0774 -0.0483 -0.0243 24  THR A CG2 
176  N N   . PRO A 24  ? 0.3650 0.8177 0.5861 -0.0793 -0.0249 -0.0436 25  PRO A N   
177  C CA  . PRO A 24  ? 0.4054 0.8863 0.6388 -0.0892 -0.0168 -0.0474 25  PRO A CA  
178  C C   . PRO A 24  ? 0.4485 0.9280 0.6688 -0.1152 -0.0171 -0.0423 25  PRO A C   
179  O O   . PRO A 24  ? 0.5603 1.0625 0.7932 -0.1234 -0.0169 -0.0439 25  PRO A O   
180  C CB  . PRO A 24  ? 0.3873 0.8736 0.6193 -0.0847 -0.0032 -0.0521 25  PRO A CB  
181  C CG  . PRO A 24  ? 0.3894 0.8586 0.6215 -0.0639 -0.0063 -0.0535 25  PRO A CG  
182  C CD  . PRO A 24  ? 0.3532 0.7975 0.5721 -0.0652 -0.0183 -0.0463 25  PRO A CD  
183  N N   . GLY A 25  ? 0.3833 0.8353 0.5784 -0.1286 -0.0184 -0.0359 26  GLY A N   
184  C CA  . GLY A 25  ? 0.3678 0.8114 0.5471 -0.1538 -0.0195 -0.0304 26  GLY A CA  
185  C C   . GLY A 25  ? 0.4253 0.8511 0.5965 -0.1611 -0.0335 -0.0269 26  GLY A C   
186  O O   . GLY A 25  ? 0.5879 1.0004 0.7435 -0.1822 -0.0361 -0.0223 26  GLY A O   
187  N N   . GLY A 26  ? 0.2763 0.6986 0.4549 -0.1445 -0.0431 -0.0288 27  GLY A N   
188  C CA  . GLY A 26  ? 0.3048 0.7102 0.4735 -0.1508 -0.0566 -0.0265 27  GLY A CA  
189  C C   . GLY A 26  ? 0.3125 0.6885 0.4665 -0.1368 -0.0650 -0.0251 27  GLY A C   
190  O O   . GLY A 26  ? 0.2765 0.6390 0.4265 -0.1198 -0.0599 -0.0248 27  GLY A O   
191  N N   . PRO A 27  ? 0.3442 0.7019 0.4852 -0.1417 -0.0767 -0.0239 28  PRO A N   
192  C CA  . PRO A 27  ? 0.2753 0.6037 0.4012 -0.1246 -0.0836 -0.0230 28  PRO A CA  
193  C C   . PRO A 27  ? 0.2991 0.5828 0.3955 -0.1217 -0.0793 -0.0196 28  PRO A C   
194  O O   . PRO A 27  ? 0.2847 0.5496 0.3650 -0.1364 -0.0762 -0.0174 28  PRO A O   
195  C CB  . PRO A 27  ? 0.3301 0.6556 0.4500 -0.1338 -0.0972 -0.0239 28  PRO A CB  
196  C CG  . PRO A 27  ? 0.3626 0.7027 0.4867 -0.1586 -0.0972 -0.0243 28  PRO A CG  
197  C CD  . PRO A 27  ? 0.3425 0.7077 0.4842 -0.1606 -0.0836 -0.0242 28  PRO A CD  
198  N N   . VAL A 28  ? 0.2791 0.5463 0.3689 -0.1025 -0.0799 -0.0190 29  VAL A N   
199  C CA  . VAL A 28  ? 0.2653 0.4937 0.3302 -0.0958 -0.0768 -0.0165 29  VAL A CA  
200  C C   . VAL A 28  ? 0.3322 0.5442 0.3856 -0.0839 -0.0846 -0.0168 29  VAL A C   
201  O O   . VAL A 28  ? 0.2972 0.5283 0.3643 -0.0749 -0.0895 -0.0174 29  VAL A O   
202  C CB  . VAL A 28  ? 0.3060 0.5371 0.3770 -0.0848 -0.0663 -0.0151 29  VAL A CB  
203  C CG1 . VAL A 28  ? 0.3836 0.5836 0.4362 -0.0714 -0.0651 -0.0129 29  VAL A CG1 
204  C CG2 . VAL A 28  ? 0.3520 0.5869 0.4219 -0.0991 -0.0583 -0.0138 29  VAL A CG2 
205  N N   . SER A 29  ? 0.3044 0.4813 0.3320 -0.0839 -0.0860 -0.0166 30  SER A N   
206  C CA  . SER A 29  ? 0.3277 0.4887 0.3415 -0.0724 -0.0910 -0.0175 30  SER A CA  
207  C C   . SER A 29  ? 0.3494 0.4992 0.3594 -0.0567 -0.0838 -0.0149 30  SER A C   
208  O O   . SER A 29  ? 0.3452 0.4805 0.3487 -0.0568 -0.0772 -0.0136 30  SER A O   
209  C CB  . SER A 29  ? 0.2924 0.4231 0.2805 -0.0801 -0.0968 -0.0208 30  SER A CB  
210  O OG  . SER A 29  ? 0.4187 0.5583 0.4086 -0.0957 -0.1049 -0.0234 30  SER A OG  
211  N N   . ALA A 30  ? 0.2927 0.4495 0.3065 -0.0441 -0.0859 -0.0136 31  ALA A N   
212  C CA  . ALA A 30  ? 0.2921 0.4416 0.3043 -0.0305 -0.0796 -0.0107 31  ALA A CA  
213  C C   . ALA A 30  ? 0.3019 0.4389 0.2981 -0.0225 -0.0832 -0.0103 31  ALA A C   
214  O O   . ALA A 30  ? 0.3124 0.4585 0.3088 -0.0225 -0.0909 -0.0102 31  ALA A O   
215  C CB  . ALA A 30  ? 0.2124 0.3852 0.2478 -0.0230 -0.0769 -0.0084 31  ALA A CB  
216  N N   . PHE A 31  ? 0.3129 0.4312 0.2956 -0.0161 -0.0777 -0.0100 32  PHE A N   
217  C CA  . PHE A 31  ? 0.3177 0.4264 0.2852 -0.0082 -0.0785 -0.0098 32  PHE A CA  
218  C C   . PHE A 31  ? 0.3008 0.4116 0.2746 0.0019  -0.0716 -0.0051 32  PHE A C   
219  O O   . PHE A 31  ? 0.3222 0.4219 0.2918 0.0048  -0.0653 -0.0055 32  PHE A O   
220  C CB  . PHE A 31  ? 0.3398 0.4253 0.2855 -0.0101 -0.0783 -0.0155 32  PHE A CB  
221  C CG  . PHE A 31  ? 0.3769 0.4573 0.3148 -0.0215 -0.0860 -0.0206 32  PHE A CG  
222  C CD1 . PHE A 31  ? 0.3499 0.4294 0.2748 -0.0228 -0.0928 -0.0239 32  PHE A CD1 
223  C CD2 . PHE A 31  ? 0.3954 0.4722 0.3382 -0.0324 -0.0867 -0.0216 32  PHE A CD2 
224  C CE1 . PHE A 31  ? 0.4394 0.5137 0.3566 -0.0345 -0.1008 -0.0290 32  PHE A CE1 
225  C CE2 . PHE A 31  ? 0.4007 0.4725 0.3364 -0.0450 -0.0944 -0.0259 32  PHE A CE2 
226  C CZ  . PHE A 31  ? 0.3980 0.4683 0.3213 -0.0458 -0.1017 -0.0300 32  PHE A CZ  
227  N N   . LEU A 32  ? 0.2570 0.3815 0.2411 0.0068  -0.0739 -0.0005 33  LEU A N   
228  C CA  . LEU A 32  ? 0.2556 0.3827 0.2478 0.0145  -0.0688 0.0043  33  LEU A CA  
229  C C   . LEU A 32  ? 0.2791 0.4016 0.2585 0.0199  -0.0690 0.0081  33  LEU A C   
230  O O   . LEU A 32  ? 0.2765 0.4022 0.2486 0.0190  -0.0756 0.0095  33  LEU A O   
231  C CB  . LEU A 32  ? 0.2608 0.4043 0.2742 0.0164  -0.0716 0.0068  33  LEU A CB  
232  C CG  . LEU A 32  ? 0.2610 0.4153 0.2879 0.0097  -0.0714 0.0025  33  LEU A CG  
233  C CD1 . LEU A 32  ? 0.2664 0.4404 0.3157 0.0136  -0.0745 0.0033  33  LEU A CD1 
234  C CD2 . LEU A 32  ? 0.2072 0.3537 0.2327 0.0069  -0.0630 0.0005  33  LEU A CD2 
235  N N   . GLY A 33  ? 0.3101 0.4270 0.2869 0.0245  -0.0621 0.0101  34  GLY A N   
236  C CA  . GLY A 33  ? 0.3208 0.4363 0.2860 0.0280  -0.0609 0.0141  34  GLY A CA  
237  C C   . GLY A 33  ? 0.3166 0.4249 0.2618 0.0275  -0.0595 0.0091  34  GLY A C   
238  O O   . GLY A 33  ? 0.3155 0.4260 0.2480 0.0271  -0.0623 0.0110  34  GLY A O   
239  N N   . ILE A 34  ? 0.2911 0.3899 0.2318 0.0277  -0.0556 0.0025  35  ILE A N   
240  C CA  . ILE A 34  ? 0.2928 0.3827 0.2152 0.0296  -0.0534 -0.0042 35  ILE A CA  
241  C C   . ILE A 34  ? 0.3314 0.4245 0.2516 0.0361  -0.0454 -0.0026 35  ILE A C   
242  O O   . ILE A 34  ? 0.3336 0.4263 0.2643 0.0391  -0.0409 -0.0011 35  ILE A O   
243  C CB  . ILE A 34  ? 0.3267 0.4019 0.2458 0.0277  -0.0540 -0.0116 35  ILE A CB  
244  C CG1 . ILE A 34  ? 0.3285 0.4034 0.2521 0.0188  -0.0615 -0.0125 35  ILE A CG1 
245  C CG2 . ILE A 34  ? 0.3312 0.3946 0.2314 0.0316  -0.0524 -0.0202 35  ILE A CG2 
246  C CD1 . ILE A 34  ? 0.3356 0.3952 0.2575 0.0142  -0.0623 -0.0174 35  ILE A CD1 
247  N N   . PRO A 35  ? 0.3164 0.4145 0.2231 0.0378  -0.0433 -0.0028 36  PRO A N   
248  C CA  . PRO A 35  ? 0.2889 0.3942 0.1950 0.0431  -0.0347 -0.0018 36  PRO A CA  
249  C C   . PRO A 35  ? 0.3706 0.4677 0.2735 0.0498  -0.0300 -0.0112 36  PRO A C   
250  O O   . PRO A 35  ? 0.3796 0.4664 0.2690 0.0511  -0.0318 -0.0202 36  PRO A O   
251  C CB  . PRO A 35  ? 0.3003 0.4145 0.1904 0.0413  -0.0338 0.0001  36  PRO A CB  
252  C CG  . PRO A 35  ? 0.3262 0.4339 0.2038 0.0369  -0.0419 -0.0037 36  PRO A CG  
253  C CD  . PRO A 35  ? 0.3219 0.4201 0.2113 0.0345  -0.0481 -0.0055 36  PRO A CD  
254  N N   . PHE A 36  ? 0.3453 0.4458 0.2602 0.0542  -0.0252 -0.0094 37  PHE A N   
255  C CA  . PHE A 36  ? 0.3457 0.4390 0.2589 0.0624  -0.0218 -0.0175 37  PHE A CA  
256  C C   . PHE A 36  ? 0.3381 0.4473 0.2534 0.0692  -0.0135 -0.0183 37  PHE A C   
257  O O   . PHE A 36  ? 0.4043 0.5105 0.3189 0.0782  -0.0105 -0.0260 37  PHE A O   
258  C CB  . PHE A 36  ? 0.3023 0.3843 0.2270 0.0625  -0.0246 -0.0162 37  PHE A CB  
259  C CG  . PHE A 36  ? 0.3159 0.4088 0.2566 0.0618  -0.0220 -0.0081 37  PHE A CG  
260  C CD1 . PHE A 36  ? 0.2996 0.3987 0.2470 0.0688  -0.0176 -0.0088 37  PHE A CD1 
261  C CD2 . PHE A 36  ? 0.2655 0.3618 0.2151 0.0547  -0.0247 -0.0009 37  PHE A CD2 
262  C CE1 . PHE A 36  ? 0.2561 0.3644 0.2174 0.0671  -0.0161 -0.0019 37  PHE A CE1 
263  C CE2 . PHE A 36  ? 0.2699 0.3736 0.2327 0.0539  -0.0228 0.0051  37  PHE A CE2 
264  C CZ  . PHE A 36  ? 0.2463 0.3557 0.2142 0.0593  -0.0186 0.0048  37  PHE A CZ  
265  N N   . ALA A 37  ? 0.3262 0.4524 0.2440 0.0649  -0.0100 -0.0106 38  ALA A N   
266  C CA  . ALA A 37  ? 0.3236 0.4690 0.2429 0.0688  -0.0015 -0.0108 38  ALA A CA  
267  C C   . ALA A 37  ? 0.3449 0.5031 0.2535 0.0615  0.0007  -0.0050 38  ALA A C   
268  O O   . ALA A 37  ? 0.3577 0.5102 0.2629 0.0539  -0.0055 0.0021  38  ALA A O   
269  C CB  . ALA A 37  ? 0.2391 0.3936 0.1770 0.0692  0.0008  -0.0046 38  ALA A CB  
270  N N   . GLU A 38  ? 0.3349 0.5115 0.2383 0.0640  0.0093  -0.0078 39  GLU A N   
271  C CA  . GLU A 38  ? 0.4028 0.5942 0.2972 0.0550  0.0123  0.0008  39  GLU A CA  
272  C C   . GLU A 38  ? 0.3958 0.5901 0.3044 0.0472  0.0099  0.0144  39  GLU A C   
273  O O   . GLU A 38  ? 0.3645 0.5610 0.2903 0.0502  0.0111  0.0150  39  GLU A O   
274  C CB  . GLU A 38  ? 0.4146 0.6297 0.3030 0.0582  0.0237  -0.0048 39  GLU A CB  
275  C CG  . GLU A 38  ? 0.4364 0.6491 0.3065 0.0651  0.0264  -0.0189 39  GLU A CG  
276  C CD  . GLU A 38  ? 0.5765 0.7774 0.4257 0.0573  0.0196  -0.0165 39  GLU A CD  
277  O OE1 . GLU A 38  ? 0.6463 0.8555 0.4879 0.0466  0.0189  -0.0048 39  GLU A OE1 
278  O OE2 . GLU A 38  ? 0.5677 0.7503 0.4080 0.0613  0.0139  -0.0258 39  GLU A OE2 
279  N N   . PRO A 39  ? 0.4113 0.6037 0.3126 0.0375  0.0055  0.0252  40  PRO A N   
280  C CA  . PRO A 39  ? 0.3591 0.5496 0.2730 0.0305  0.0020  0.0374  40  PRO A CA  
281  C C   . PRO A 39  ? 0.3417 0.5511 0.2651 0.0279  0.0102  0.0408  40  PRO A C   
282  O O   . PRO A 39  ? 0.3543 0.5822 0.2685 0.0244  0.0178  0.0415  40  PRO A O   
283  C CB  . PRO A 39  ? 0.3734 0.5589 0.2730 0.0216  -0.0041 0.0477  40  PRO A CB  
284  C CG  . PRO A 39  ? 0.4219 0.6010 0.3059 0.0249  -0.0074 0.0400  40  PRO A CG  
285  C CD  . PRO A 39  ? 0.3948 0.5834 0.2755 0.0329  0.0016  0.0265  40  PRO A CD  
286  N N   . PRO A 40  ? 0.3538 0.5611 0.2951 0.0287  0.0090  0.0427  41  PRO A N   
287  C CA  . PRO A 40  ? 0.3401 0.5674 0.2928 0.0260  0.0160  0.0451  41  PRO A CA  
288  C C   . PRO A 40  ? 0.4177 0.6497 0.3682 0.0122  0.0155  0.0587  41  PRO A C   
289  O O   . PRO A 40  ? 0.4435 0.6741 0.4065 0.0070  0.0134  0.0647  41  PRO A O   
290  C CB  . PRO A 40  ? 0.2965 0.5158 0.2669 0.0318  0.0127  0.0417  41  PRO A CB  
291  C CG  . PRO A 40  ? 0.3144 0.5096 0.2833 0.0309  0.0035  0.0439  41  PRO A CG  
292  C CD  . PRO A 40  ? 0.2879 0.4764 0.2400 0.0318  0.0014  0.0417  41  PRO A CD  
293  N N   . MET A 41  ? 0.4070 0.6434 0.3396 0.0055  0.0170  0.0639  42  MET A N   
294  C CA  . MET A 41  ? 0.5210 0.7563 0.4461 -0.0088 0.0145  0.0786  42  MET A CA  
295  C C   . MET A 41  ? 0.4693 0.7332 0.3922 -0.0176 0.0253  0.0822  42  MET A C   
296  O O   . MET A 41  ? 0.4950 0.7811 0.4163 -0.0117 0.0351  0.0726  42  MET A O   
297  C CB  . MET A 41  ? 0.6268 0.8486 0.5312 -0.0123 0.0080  0.0841  42  MET A CB  
298  C CG  . MET A 41  ? 0.7238 0.9228 0.6295 -0.0039 -0.0019 0.0796  42  MET A CG  
299  S SD  . MET A 41  ? 0.8415 1.0163 0.7580 -0.0078 -0.0142 0.0902  42  MET A SD  
300  C CE  . MET A 41  ? 0.8846 1.0577 0.7837 -0.0230 -0.0175 0.1078  42  MET A CE  
301  N N   . GLY A 42  ? 0.4197 0.6827 0.3420 -0.0321 0.0231  0.0961  43  GLY A N   
302  C CA  . GLY A 42  ? 0.3623 0.6515 0.2791 -0.0451 0.0323  0.1030  43  GLY A CA  
303  C C   . GLY A 42  ? 0.4087 0.7304 0.3422 -0.0399 0.0439  0.0931  43  GLY A C   
304  O O   . GLY A 42  ? 0.3527 0.6772 0.3065 -0.0386 0.0428  0.0918  43  GLY A O   
305  N N   . PRO A 43  ? 0.4136 0.7613 0.3386 -0.0363 0.0549  0.0853  44  PRO A N   
306  C CA  . PRO A 43  ? 0.3860 0.7669 0.3286 -0.0281 0.0659  0.0739  44  PRO A CA  
307  C C   . PRO A 43  ? 0.4041 0.7748 0.3639 -0.0095 0.0622  0.0609  44  PRO A C   
308  O O   . PRO A 43  ? 0.3849 0.7785 0.3642 -0.0030 0.0675  0.0541  44  PRO A O   
309  C CB  . PRO A 43  ? 0.3507 0.7554 0.2770 -0.0256 0.0773  0.0661  44  PRO A CB  
310  C CG  . PRO A 43  ? 0.3501 0.7326 0.2487 -0.0334 0.0715  0.0740  44  PRO A CG  
311  C CD  . PRO A 43  ? 0.3690 0.7153 0.2678 -0.0376 0.0568  0.0850  44  PRO A CD  
312  N N   . ARG A 44  ? 0.4091 0.7476 0.3627 -0.0013 0.0528  0.0577  45  ARG A N   
313  C CA  . ARG A 44  ? 0.3605 0.6875 0.3271 0.0148  0.0490  0.0463  45  ARG A CA  
314  C C   . ARG A 44  ? 0.3647 0.6746 0.3470 0.0128  0.0402  0.0516  45  ARG A C   
315  O O   . ARG A 44  ? 0.2938 0.5936 0.2861 0.0243  0.0365  0.0437  45  ARG A O   
316  C CB  . ARG A 44  ? 0.4307 0.7345 0.3821 0.0239  0.0443  0.0388  45  ARG A CB  
317  C CG  . ARG A 44  ? 0.4725 0.7910 0.4092 0.0303  0.0528  0.0283  45  ARG A CG  
318  C CD  . ARG A 44  ? 0.6355 0.9291 0.5523 0.0321  0.0461  0.0258  45  ARG A CD  
319  N NE  . ARG A 44  ? 0.7711 1.0650 0.6795 0.0452  0.0498  0.0098  45  ARG A NE  
320  C CZ  . ARG A 44  ? 0.9428 1.2500 0.8324 0.0451  0.0570  0.0038  45  ARG A CZ  
321  N NH1 . ARG A 44  ? 0.9606 1.2836 0.8376 0.0316  0.0616  0.0137  45  ARG A NH1 
322  N NH2 . ARG A 44  ? 1.0219 1.3256 0.9041 0.0581  0.0594  -0.0123 45  ARG A NH2 
323  N N   . ARG A 45  ? 0.3135 0.6184 0.2967 -0.0017 0.0365  0.0644  46  ARG A N   
324  C CA  . ARG A 45  ? 0.3277 0.6180 0.3251 -0.0037 0.0289  0.0678  46  ARG A CA  
325  C C   . ARG A 45  ? 0.2894 0.6019 0.3068 0.0012  0.0328  0.0621  46  ARG A C   
326  O O   . ARG A 45  ? 0.2636 0.6072 0.2869 -0.0018 0.0412  0.0617  46  ARG A O   
327  C CB  . ARG A 45  ? 0.2706 0.5511 0.2641 -0.0206 0.0242  0.0819  46  ARG A CB  
328  C CG  . ARG A 45  ? 0.3155 0.5813 0.3226 -0.0238 0.0167  0.0846  46  ARG A CG  
329  C CD  . ARG A 45  ? 0.3060 0.5630 0.3094 -0.0411 0.0125  0.0980  46  ARG A CD  
330  N NE  . ARG A 45  ? 0.2933 0.5221 0.2818 -0.0438 0.0047  0.1049  46  ARG A NE  
331  C CZ  . ARG A 45  ? 0.3540 0.5689 0.3351 -0.0578 -0.0007 0.1174  46  ARG A CZ  
332  N NH1 . ARG A 45  ? 0.3313 0.5581 0.3179 -0.0720 0.0015  0.1244  46  ARG A NH1 
333  N NH2 . ARG A 45  ? 0.2907 0.4795 0.2593 -0.0579 -0.0091 0.1234  46  ARG A NH2 
334  N N   . PHE A 46  ? 0.2213 0.5192 0.2490 0.0090  0.0265  0.0575  47  PHE A N   
335  C CA  . PHE A 46  ? 0.2761 0.5898 0.3220 0.0156  0.0272  0.0521  47  PHE A CA  
336  C C   . PHE A 46  ? 0.3092 0.6370 0.3582 0.0318  0.0323  0.0404  47  PHE A C   
337  O O   . PHE A 46  ? 0.2474 0.5859 0.3110 0.0402  0.0313  0.0354  47  PHE A O   
338  C CB  . PHE A 46  ? 0.2751 0.6158 0.3335 0.0037  0.0307  0.0584  47  PHE A CB  
339  C CG  . PHE A 46  ? 0.2996 0.6259 0.3544 -0.0132 0.0255  0.0698  47  PHE A CG  
340  C CD1 . PHE A 46  ? 0.3325 0.6321 0.3892 -0.0143 0.0163  0.0710  47  PHE A CD1 
341  C CD2 . PHE A 46  ? 0.2488 0.5884 0.2980 -0.0284 0.0299  0.0792  47  PHE A CD2 
342  C CE1 . PHE A 46  ? 0.1950 0.4786 0.2484 -0.0286 0.0108  0.0803  47  PHE A CE1 
343  C CE2 . PHE A 46  ? 0.2374 0.5597 0.2825 -0.0442 0.0238  0.0901  47  PHE A CE2 
344  C CZ  . PHE A 46  ? 0.2668 0.5601 0.3145 -0.0435 0.0139  0.0901  47  PHE A CZ  
345  N N   . LEU A 47  ? 0.1963 0.5235 0.2313 0.0365  0.0369  0.0360  48  LEU A N   
346  C CA  . LEU A 47  ? 0.2237 0.5627 0.2611 0.0525  0.0416  0.0236  48  LEU A CA  
347  C C   . LEU A 47  ? 0.2865 0.5952 0.3182 0.0642  0.0344  0.0167  48  LEU A C   
348  O O   . LEU A 47  ? 0.2520 0.5339 0.2747 0.0592  0.0277  0.0209  48  LEU A O   
349  C CB  . LEU A 47  ? 0.2161 0.5711 0.2399 0.0522  0.0510  0.0200  48  LEU A CB  
350  C CG  . LEU A 47  ? 0.3061 0.6986 0.3357 0.0419  0.0607  0.0248  48  LEU A CG  
351  C CD1 . LEU A 47  ? 0.2733 0.6841 0.2886 0.0448  0.0712  0.0179  48  LEU A CD1 
352  C CD2 . LEU A 47  ? 0.2764 0.6967 0.3315 0.0464  0.0627  0.0223  48  LEU A CD2 
353  N N   . PRO A 48  ? 0.2817 0.5939 0.3190 0.0797  0.0351  0.0061  49  PRO A N   
354  C CA  . PRO A 48  ? 0.2162 0.4982 0.2458 0.0895  0.0282  -0.0001 49  PRO A CA  
355  C C   . PRO A 48  ? 0.3155 0.5794 0.3245 0.0870  0.0282  -0.0021 49  PRO A C   
356  O O   . PRO A 48  ? 0.2676 0.5454 0.2670 0.0830  0.0350  -0.0026 49  PRO A O   
357  C CB  . PRO A 48  ? 0.2957 0.5884 0.3336 0.1069  0.0302  -0.0113 49  PRO A CB  
358  C CG  . PRO A 48  ? 0.3521 0.6803 0.4095 0.1058  0.0350  -0.0088 49  PRO A CG  
359  C CD  . PRO A 48  ? 0.2593 0.6038 0.3127 0.0890  0.0412  0.0000  49  PRO A CD  
360  N N   . PRO A 49  ? 0.2924 0.5269 0.2936 0.0883  0.0206  -0.0033 50  PRO A N   
361  C CA  . PRO A 49  ? 0.2592 0.4775 0.2419 0.0852  0.0193  -0.0051 50  PRO A CA  
362  C C   . PRO A 49  ? 0.3738 0.5959 0.3455 0.0952  0.0242  -0.0171 50  PRO A C   
363  O O   . PRO A 49  ? 0.3986 0.6211 0.3755 0.1082  0.0249  -0.0262 50  PRO A O   
364  C CB  . PRO A 49  ? 0.2471 0.4363 0.2278 0.0851  0.0102  -0.0049 50  PRO A CB  
365  C CG  . PRO A 49  ? 0.2143 0.4026 0.2083 0.0929  0.0076  -0.0067 50  PRO A CG  
366  C CD  . PRO A 49  ? 0.2216 0.4375 0.2300 0.0907  0.0126  -0.0019 50  PRO A CD  
367  N N   . GLU A 50  ? 0.3549 0.5794 0.3105 0.0895  0.0273  -0.0173 51  GLU A N   
368  C CA  . GLU A 50  ? 0.4681 0.6915 0.4098 0.0989  0.0309  -0.0304 51  GLU A CA  
369  C C   . GLU A 50  ? 0.4079 0.6012 0.3341 0.0976  0.0229  -0.0339 51  GLU A C   
370  O O   . GLU A 50  ? 0.4009 0.5845 0.3222 0.0867  0.0175  -0.0253 51  GLU A O   
371  C CB  . GLU A 50  ? 0.5704 0.8186 0.5014 0.0940  0.0404  -0.0307 51  GLU A CB  
372  C CG  . GLU A 50  ? 0.8527 1.1354 0.7990 0.0957  0.0500  -0.0297 51  GLU A CG  
373  C CD  . GLU A 50  ? 1.0227 1.3273 0.9629 0.0808  0.0562  -0.0192 51  GLU A CD  
374  O OE1 . GLU A 50  ? 0.9891 1.2982 0.9095 0.0776  0.0605  -0.0223 51  GLU A OE1 
375  O OE2 . GLU A 50  ? 1.0973 1.4133 1.0511 0.0717  0.0562  -0.0078 51  GLU A OE2 
376  N N   . PRO A 51  ? 0.4343 0.6124 0.3535 0.1087  0.0212  -0.0467 52  PRO A N   
377  C CA  . PRO A 51  ? 0.4678 0.6168 0.3728 0.1060  0.0128  -0.0501 52  PRO A CA  
378  C C   . PRO A 51  ? 0.4093 0.5606 0.2962 0.0961  0.0128  -0.0484 52  PRO A C   
379  O O   . PRO A 51  ? 0.4361 0.6077 0.3148 0.0953  0.0205  -0.0500 52  PRO A O   
380  C CB  . PRO A 51  ? 0.5547 0.6896 0.4534 0.1203  0.0125  -0.0656 52  PRO A CB  
381  C CG  . PRO A 51  ? 0.5364 0.6902 0.4525 0.1320  0.0183  -0.0680 52  PRO A CG  
382  C CD  . PRO A 51  ? 0.4386 0.6257 0.3625 0.1244  0.0266  -0.0591 52  PRO A CD  
383  N N   . LYS A 52  ? 0.4238 0.5556 0.3047 0.0881  0.0039  -0.0446 53  LYS A N   
384  C CA  . LYS A 52  ? 0.4328 0.5654 0.2975 0.0786  0.0013  -0.0419 53  LYS A CA  
385  C C   . LYS A 52  ? 0.4466 0.5762 0.2898 0.0835  0.0039  -0.0558 53  LYS A C   
386  O O   . LYS A 52  ? 0.4895 0.6002 0.3274 0.0908  0.0010  -0.0676 53  LYS A O   
387  C CB  . LYS A 52  ? 0.4397 0.5543 0.3059 0.0704  -0.0094 -0.0363 53  LYS A CB  
388  C CG  . LYS A 52  ? 0.5207 0.6364 0.3724 0.0609  -0.0144 -0.0324 53  LYS A CG  
389  C CD  . LYS A 52  ? 0.5748 0.7097 0.4280 0.0548  -0.0113 -0.0203 53  LYS A CD  
390  C CE  . LYS A 52  ? 0.6448 0.7787 0.4841 0.0459  -0.0187 -0.0147 53  LYS A CE  
391  N NZ  . LYS A 52  ? 0.7619 0.9113 0.5980 0.0395  -0.0164 -0.0025 53  LYS A NZ  
392  N N   . GLN A 53  ? 0.4142 0.5615 0.2437 0.0790  0.0091  -0.0546 54  GLN A N   
393  C CA  A GLN A 53  ? 0.4845 0.6306 0.2904 0.0821  0.0118  -0.0680 54  GLN A CA  
394  C CA  B GLN A 53  ? 0.4833 0.6290 0.2894 0.0823  0.0117  -0.0682 54  GLN A CA  
395  C C   . GLN A 53  ? 0.4843 0.6085 0.2750 0.0747  0.0004  -0.0698 54  GLN A C   
396  O O   . GLN A 53  ? 0.4709 0.5917 0.2664 0.0647  -0.0076 -0.0577 54  GLN A O   
397  C CB  A GLN A 53  ? 0.5267 0.7001 0.3207 0.0771  0.0208  -0.0645 54  GLN A CB  
398  C CB  B GLN A 53  ? 0.5280 0.7011 0.3220 0.0780  0.0211  -0.0655 54  GLN A CB  
399  C CG  A GLN A 53  ? 0.5567 0.7564 0.3670 0.0820  0.0324  -0.0618 54  GLN A CG  
400  C CG  B GLN A 53  ? 0.5788 0.7768 0.3841 0.0871  0.0342  -0.0700 54  GLN A CG  
401  C CD  A GLN A 53  ? 0.6384 0.8655 0.4387 0.0721  0.0403  -0.0531 54  GLN A CD  
402  C CD  B GLN A 53  ? 0.6617 0.8560 0.4613 0.1027  0.0395  -0.0905 54  GLN A CD  
403  O OE1 A GLN A 53  ? 0.7149 0.9410 0.4934 0.0628  0.0374  -0.0499 54  GLN A OE1 
404  O OE1 B GLN A 53  ? 0.7517 0.9492 0.5289 0.1043  0.0436  -0.1022 54  GLN A OE1 
405  N NE2 A GLN A 53  ? 0.6783 0.9304 0.4942 0.0731  0.0497  -0.0487 54  GLN A NE2 
406  N NE2 B GLN A 53  ? 0.6662 0.8527 0.4850 0.1147  0.0388  -0.0953 54  GLN A NE2 
407  N N   . PRO A 54  ? 0.5496 0.6590 0.3225 0.0796  -0.0011 -0.0855 55  PRO A N   
408  C CA  . PRO A 54  ? 0.5430 0.6324 0.3011 0.0713  -0.0126 -0.0880 55  PRO A CA  
409  C C   . PRO A 54  ? 0.5620 0.6646 0.3067 0.0591  -0.0159 -0.0783 55  PRO A C   
410  O O   . PRO A 54  ? 0.5210 0.6454 0.2590 0.0575  -0.0082 -0.0737 55  PRO A O   
411  C CB  . PRO A 54  ? 0.6156 0.6898 0.3539 0.0796  -0.0112 -0.1083 55  PRO A CB  
412  C CG  . PRO A 54  ? 0.6719 0.7518 0.4220 0.0949  -0.0013 -0.1161 55  PRO A CG  
413  C CD  . PRO A 54  ? 0.6144 0.7246 0.3805 0.0936  0.0073  -0.1027 55  PRO A CD  
414  N N   . TRP A 55  ? 0.5168 0.6063 0.2575 0.0500  -0.0282 -0.0749 56  TRP A N   
415  C CA  . TRP A 55  ? 0.4867 0.5856 0.2155 0.0389  -0.0349 -0.0653 56  TRP A CA  
416  C C   . TRP A 55  ? 0.5096 0.5933 0.2181 0.0331  -0.0452 -0.0749 56  TRP A C   
417  O O   . TRP A 55  ? 0.5189 0.5824 0.2300 0.0344  -0.0502 -0.0842 56  TRP A O   
418  C CB  . TRP A 55  ? 0.4269 0.5303 0.1778 0.0327  -0.0416 -0.0476 56  TRP A CB  
419  C CG  . TRP A 55  ? 0.4386 0.5260 0.2057 0.0310  -0.0503 -0.0482 56  TRP A CG  
420  C CD1 . TRP A 55  ? 0.4647 0.5439 0.2280 0.0230  -0.0624 -0.0487 56  TRP A CD1 
421  C CD2 . TRP A 55  ? 0.4376 0.5174 0.2267 0.0361  -0.0476 -0.0479 56  TRP A CD2 
422  N NE1 . TRP A 55  ? 0.4362 0.5043 0.2182 0.0222  -0.0664 -0.0488 56  TRP A NE1 
423  C CE2 . TRP A 55  ? 0.4274 0.4945 0.2240 0.0302  -0.0575 -0.0481 56  TRP A CE2 
424  C CE3 . TRP A 55  ? 0.4267 0.5104 0.2294 0.0445  -0.0381 -0.0473 56  TRP A CE3 
425  C CZ2 . TRP A 55  ? 0.4243 0.4819 0.2395 0.0317  -0.0575 -0.0472 56  TRP A CZ2 
426  C CZ3 . TRP A 55  ? 0.4372 0.5103 0.2584 0.0469  -0.0393 -0.0464 56  TRP A CZ3 
427  C CH2 . TRP A 55  ? 0.4432 0.5029 0.2694 0.0402  -0.0486 -0.0463 56  TRP A CH2 
428  N N   . SER A 56  ? 0.4997 0.5929 0.1868 0.0256  -0.0489 -0.0721 57  SER A N   
429  C CA  . SER A 56  ? 0.6018 0.6838 0.2708 0.0175  -0.0612 -0.0782 57  SER A CA  
430  C C   . SER A 56  ? 0.5887 0.6742 0.2720 0.0081  -0.0745 -0.0629 57  SER A C   
431  O O   . SER A 56  ? 0.6182 0.7161 0.3182 0.0077  -0.0739 -0.0475 57  SER A O   
432  C CB  . SER A 56  ? 0.6200 0.7103 0.2552 0.0143  -0.0591 -0.0847 57  SER A CB  
433  O OG  . SER A 56  ? 0.6861 0.7932 0.3196 0.0074  -0.0596 -0.0675 57  SER A OG  
434  N N   . GLY A 57  ? 0.6123 0.6871 0.2896 0.0008  -0.0870 -0.0680 58  GLY A N   
435  C CA  . GLY A 57  ? 0.5856 0.6661 0.2800 -0.0067 -0.0998 -0.0555 58  GLY A CA  
436  C C   . GLY A 57  ? 0.5818 0.6576 0.3083 -0.0043 -0.0993 -0.0514 58  GLY A C   
437  O O   . GLY A 57  ? 0.5314 0.5953 0.2646 0.0019  -0.0913 -0.0590 58  GLY A O   
438  N N   . VAL A 58  ? 0.5174 0.6034 0.2634 -0.0087 -0.1082 -0.0392 59  VAL A N   
439  C CA  . VAL A 58  ? 0.5204 0.6050 0.2958 -0.0085 -0.1092 -0.0358 59  VAL A CA  
440  C C   . VAL A 58  ? 0.4382 0.5356 0.2348 -0.0033 -0.1051 -0.0219 59  VAL A C   
441  O O   . VAL A 58  ? 0.4653 0.5746 0.2626 -0.0046 -0.1112 -0.0111 59  VAL A O   
442  C CB  . VAL A 58  ? 0.5049 0.5923 0.2888 -0.0181 -0.1230 -0.0358 59  VAL A CB  
443  C CG1 . VAL A 58  ? 0.4081 0.4939 0.2195 -0.0189 -0.1215 -0.0348 59  VAL A CG1 
444  C CG2 . VAL A 58  ? 0.4638 0.5385 0.2225 -0.0254 -0.1293 -0.0490 59  VAL A CG2 
445  N N   . VAL A 59  ? 0.3816 0.4748 0.1944 0.0025  -0.0957 -0.0220 60  VAL A N   
446  C CA  . VAL A 59  ? 0.4142 0.5168 0.2484 0.0069  -0.0919 -0.0105 60  VAL A CA  
447  C C   . VAL A 59  ? 0.4191 0.5267 0.2779 0.0039  -0.0989 -0.0068 60  VAL A C   
448  O O   . VAL A 59  ? 0.4185 0.5190 0.2845 0.0010  -0.0988 -0.0134 60  VAL A O   
449  C CB  . VAL A 59  ? 0.4163 0.5137 0.2555 0.0142  -0.0789 -0.0129 60  VAL A CB  
450  C CG1 . VAL A 59  ? 0.3235 0.4273 0.1879 0.0172  -0.0763 -0.0034 60  VAL A CG1 
451  C CG2 . VAL A 59  ? 0.4081 0.5089 0.2280 0.0178  -0.0712 -0.0140 60  VAL A CG2 
452  N N   . ASP A 60  ? 0.3639 0.4836 0.2352 0.0044  -0.1051 0.0037  61  ASP A N   
453  C CA  . ASP A 60  ? 0.3790 0.5077 0.2767 0.0036  -0.1104 0.0068  61  ASP A CA  
454  C C   . ASP A 60  ? 0.3750 0.5017 0.2905 0.0088  -0.1005 0.0082  61  ASP A C   
455  O O   . ASP A 60  ? 0.3493 0.4779 0.2700 0.0141  -0.0968 0.0155  61  ASP A O   
456  C CB  . ASP A 60  ? 0.3153 0.4566 0.2211 0.0047  -0.1212 0.0168  61  ASP A CB  
457  C CG  . ASP A 60  ? 0.5175 0.6634 0.4094 -0.0015 -0.1336 0.0155  61  ASP A CG  
458  O OD1 . ASP A 60  ? 0.5072 0.6559 0.4036 -0.0078 -0.1384 0.0083  61  ASP A OD1 
459  O OD2 . ASP A 60  ? 0.5683 0.7151 0.4438 -0.0013 -0.1389 0.0221  61  ASP A OD2 
460  N N   . ALA A 61  ? 0.3240 0.4458 0.2470 0.0060  -0.0969 0.0014  62  ALA A N   
461  C CA  . ALA A 61  ? 0.2977 0.4190 0.2378 0.0094  -0.0890 0.0025  62  ALA A CA  
462  C C   . ALA A 61  ? 0.3127 0.4481 0.2765 0.0071  -0.0936 0.0042  62  ALA A C   
463  O O   . ALA A 61  ? 0.3031 0.4392 0.2752 0.0017  -0.0923 -0.0003 62  ALA A O   
464  C CB  . ALA A 61  ? 0.3014 0.4079 0.2335 0.0080  -0.0823 -0.0049 62  ALA A CB  
465  N N   . THR A 62  ? 0.2863 0.4333 0.2610 0.0113  -0.0993 0.0109  63  THR A N   
466  C CA  . THR A 62  ? 0.3001 0.4643 0.2974 0.0107  -0.1058 0.0114  63  THR A CA  
467  C C   . THR A 62  ? 0.2560 0.4269 0.2736 0.0187  -0.1031 0.0157  63  THR A C   
468  O O   . THR A 62  ? 0.2944 0.4814 0.3326 0.0208  -0.1084 0.0156  63  THR A O   
469  C CB  . THR A 62  ? 0.3376 0.5111 0.3316 0.0091  -0.1187 0.0142  63  THR A CB  
470  O OG1 . THR A 62  ? 0.3292 0.4976 0.3135 0.0153  -0.1217 0.0224  63  THR A OG1 
471  C CG2 . THR A 62  ? 0.2977 0.4648 0.2716 0.0000  -0.1222 0.0083  63  THR A CG2 
472  N N   . THR A 63  ? 0.2449 0.4047 0.2578 0.0236  -0.0953 0.0186  64  THR A N   
473  C CA  . THR A 63  ? 0.2421 0.4049 0.2724 0.0303  -0.0924 0.0211  64  THR A CA  
474  C C   . THR A 63  ? 0.2487 0.3982 0.2699 0.0319  -0.0827 0.0224  64  THR A C   
475  O O   . THR A 63  ? 0.2849 0.4250 0.2875 0.0300  -0.0797 0.0232  64  THR A O   
476  C CB  . THR A 63  ? 0.3637 0.5305 0.4014 0.0370  -0.1020 0.0282  64  THR A CB  
477  O OG1 . THR A 63  ? 0.4365 0.6087 0.4956 0.0438  -0.1008 0.0273  64  THR A OG1 
478  C CG2 . THR A 63  ? 0.3508 0.5038 0.3701 0.0384  -0.1024 0.0363  64  THR A CG2 
479  N N   . PHE A 64  ? 0.2467 0.3970 0.2817 0.0356  -0.0776 0.0217  65  PHE A N   
480  C CA  . PHE A 64  ? 0.2676 0.4075 0.2966 0.0367  -0.0694 0.0230  65  PHE A CA  
481  C C   . PHE A 64  ? 0.2806 0.4127 0.2982 0.0388  -0.0713 0.0308  65  PHE A C   
482  O O   . PHE A 64  ? 0.2470 0.3796 0.2678 0.0417  -0.0789 0.0365  65  PHE A O   
483  C CB  . PHE A 64  ? 0.2516 0.3942 0.2969 0.0400  -0.0654 0.0208  65  PHE A CB  
484  C CG  . PHE A 64  ? 0.2319 0.3819 0.2851 0.0361  -0.0607 0.0137  65  PHE A CG  
485  C CD1 . PHE A 64  ? 0.1777 0.3211 0.2201 0.0310  -0.0548 0.0113  65  PHE A CD1 
486  C CD2 . PHE A 64  ? 0.2041 0.3680 0.2757 0.0378  -0.0620 0.0097  65  PHE A CD2 
487  C CE1 . PHE A 64  ? 0.2392 0.3875 0.2865 0.0257  -0.0510 0.0064  65  PHE A CE1 
488  C CE2 . PHE A 64  ? 0.2212 0.3941 0.2989 0.0323  -0.0567 0.0037  65  PHE A CE2 
489  C CZ  . PHE A 64  ? 0.2360 0.3999 0.3003 0.0254  -0.0515 0.0029  65  PHE A CZ  
490  N N   . GLN A 65  ? 0.3107 0.4362 0.3154 0.0371  -0.0646 0.0314  66  GLN A N   
491  C CA  . GLN A 65  ? 0.2932 0.4141 0.2872 0.0372  -0.0643 0.0389  66  GLN A CA  
492  C C   . GLN A 65  ? 0.2781 0.3949 0.2817 0.0390  -0.0616 0.0425  66  GLN A C   
493  O O   . GLN A 65  ? 0.2786 0.3960 0.2961 0.0411  -0.0599 0.0384  66  GLN A O   
494  C CB  . GLN A 65  ? 0.2499 0.3696 0.2272 0.0350  -0.0580 0.0368  66  GLN A CB  
495  C CG  . GLN A 65  ? 0.2353 0.3563 0.1956 0.0326  -0.0623 0.0379  66  GLN A CG  
496  C CD  . GLN A 65  ? 0.3498 0.4705 0.3004 0.0309  -0.0645 0.0478  66  GLN A CD  
497  O OE1 . GLN A 65  ? 0.3979 0.5160 0.3556 0.0312  -0.0636 0.0541  66  GLN A OE1 
498  N NE2 . GLN A 65  ? 0.3054 0.4279 0.2381 0.0280  -0.0675 0.0494  66  GLN A NE2 
499  N N   . SER A 66  ? 0.2896 0.4025 0.2843 0.0370  -0.0608 0.0500  67  SER A N   
500  C CA  . SER A 66  ? 0.2902 0.3968 0.2918 0.0370  -0.0604 0.0548  67  SER A CA  
501  C C   . SER A 66  ? 0.2794 0.3870 0.2888 0.0372  -0.0526 0.0491  67  SER A C   
502  O O   . SER A 66  ? 0.2643 0.3767 0.2698 0.0366  -0.0465 0.0440  67  SER A O   
503  C CB  . SER A 66  ? 0.2911 0.3948 0.2792 0.0320  -0.0602 0.0644  67  SER A CB  
504  O OG  . SER A 66  ? 0.3221 0.4239 0.3004 0.0310  -0.0683 0.0711  67  SER A OG  
505  N N   . VAL A 67  ? 0.2594 0.3611 0.2792 0.0382  -0.0537 0.0499  68  VAL A N   
506  C CA  . VAL A 67  ? 0.2402 0.3420 0.2654 0.0371  -0.0476 0.0461  68  VAL A CA  
507  C C   . VAL A 67  ? 0.2708 0.3735 0.2883 0.0319  -0.0437 0.0520  68  VAL A C   
508  O O   . VAL A 67  ? 0.3181 0.4163 0.3298 0.0283  -0.0470 0.0603  68  VAL A O   
509  C CB  . VAL A 67  ? 0.2973 0.3920 0.3350 0.0398  -0.0507 0.0437  68  VAL A CB  
510  C CG1 . VAL A 67  ? 0.3075 0.4017 0.3486 0.0376  -0.0453 0.0400  68  VAL A CG1 
511  C CG2 . VAL A 67  ? 0.2902 0.3895 0.3377 0.0451  -0.0533 0.0369  68  VAL A CG2 
512  N N   . CYS A 68  ? 0.2209 0.3304 0.2383 0.0311  -0.0370 0.0481  69  CYS A N   
513  C CA  . CYS A 68  ? 0.2652 0.3802 0.2790 0.0264  -0.0328 0.0526  69  CYS A CA  
514  C C   . CYS A 68  ? 0.3028 0.4099 0.3217 0.0217  -0.0357 0.0576  69  CYS A C   
515  O O   . CYS A 68  ? 0.2750 0.3745 0.3022 0.0235  -0.0380 0.0535  69  CYS A O   
516  C CB  . CYS A 68  ? 0.2646 0.3884 0.2806 0.0282  -0.0268 0.0469  69  CYS A CB  
517  S SG  . CYS A 68  ? 0.2930 0.4226 0.3005 0.0335  -0.0235 0.0410  69  CYS A SG  
518  N N   . TYR A 69  ? 0.2493 0.3582 0.2623 0.0149  -0.0354 0.0660  70  TYR A N   
519  C CA  . TYR A 69  ? 0.2728 0.3703 0.2881 0.0086  -0.0397 0.0721  70  TYR A CA  
520  C C   . TYR A 69  ? 0.2965 0.3928 0.3216 0.0078  -0.0383 0.0665  70  TYR A C   
521  O O   . TYR A 69  ? 0.2077 0.3175 0.2356 0.0073  -0.0327 0.0630  70  TYR A O   
522  C CB  . TYR A 69  ? 0.3172 0.4207 0.3239 -0.0013 -0.0379 0.0824  70  TYR A CB  
523  C CG  . TYR A 69  ? 0.3398 0.4246 0.3419 -0.0072 -0.0461 0.0921  70  TYR A CG  
524  C CD1 . TYR A 69  ? 0.4024 0.4814 0.3931 -0.0080 -0.0509 0.0999  70  TYR A CD1 
525  C CD2 . TYR A 69  ? 0.3835 0.4539 0.3915 -0.0117 -0.0503 0.0933  70  TYR A CD2 
526  C CE1 . TYR A 69  ? 0.4987 0.5572 0.4845 -0.0128 -0.0602 0.1098  70  TYR A CE1 
527  C CE2 . TYR A 69  ? 0.5147 0.5635 0.5181 -0.0164 -0.0592 0.1020  70  TYR A CE2 
528  C CZ  . TYR A 69  ? 0.5533 0.5956 0.5457 -0.0167 -0.0644 0.1108  70  TYR A CZ  
529  O OH  . TYR A 69  ? 0.7137 0.7314 0.7007 -0.0210 -0.0748 0.1206  70  TYR A OH  
530  N N   . GLN A 70  ? 0.2754 0.3554 0.3055 0.0084  -0.0440 0.0652  71  GLN A N   
531  C CA  . GLN A 70  ? 0.2530 0.3313 0.2906 0.0084  -0.0429 0.0578  71  GLN A CA  
532  C C   . GLN A 70  ? 0.2944 0.3523 0.3349 0.0071  -0.0496 0.0574  71  GLN A C   
533  O O   . GLN A 70  ? 0.3084 0.3521 0.3477 0.0100  -0.0558 0.0607  71  GLN A O   
534  C CB  . GLN A 70  ? 0.2131 0.2976 0.2548 0.0165  -0.0398 0.0479  71  GLN A CB  
535  C CG  . GLN A 70  ? 0.2305 0.3073 0.2754 0.0241  -0.0435 0.0438  71  GLN A CG  
536  C CD  . GLN A 70  ? 0.2946 0.3813 0.3421 0.0292  -0.0395 0.0358  71  GLN A CD  
537  O OE1 . GLN A 70  ? 0.2714 0.3564 0.3246 0.0323  -0.0392 0.0281  71  GLN A OE1 
538  N NE2 . GLN A 70  ? 0.2588 0.3555 0.3010 0.0294  -0.0361 0.0372  71  GLN A NE2 
539  N N   . TYR A 71  ? 0.2710 0.3269 0.3150 0.0031  -0.0489 0.0528  72  TYR A N   
540  C CA  . TYR A 71  ? 0.3126 0.3484 0.3594 0.0032  -0.0546 0.0485  72  TYR A CA  
541  C C   . TYR A 71  ? 0.3112 0.3410 0.3634 0.0150  -0.0561 0.0394  72  TYR A C   
542  O O   . TYR A 71  ? 0.3490 0.3927 0.4038 0.0207  -0.0512 0.0332  72  TYR A O   
543  C CB  . TYR A 71  ? 0.3190 0.3580 0.3675 -0.0029 -0.0527 0.0431  72  TYR A CB  
544  C CG  . TYR A 71  ? 0.3220 0.3406 0.3719 -0.0027 -0.0578 0.0358  72  TYR A CG  
545  C CD1 . TYR A 71  ? 0.3041 0.3017 0.3511 -0.0100 -0.0649 0.0411  72  TYR A CD1 
546  C CD2 . TYR A 71  ? 0.2988 0.3184 0.3518 0.0041  -0.0555 0.0231  72  TYR A CD2 
547  C CE1 . TYR A 71  ? 0.4153 0.3913 0.4628 -0.0091 -0.0701 0.0329  72  TYR A CE1 
548  C CE2 . TYR A 71  ? 0.3918 0.3933 0.4452 0.0051  -0.0595 0.0144  72  TYR A CE2 
549  C CZ  . TYR A 71  ? 0.4408 0.4196 0.4918 -0.0008 -0.0670 0.0187  72  TYR A CZ  
550  O OH  . TYR A 71  ? 0.5151 0.4730 0.5657 0.0010  -0.0715 0.0086  72  TYR A OH  
551  N N   . VAL A 72  ? 0.3051 0.3144 0.3593 0.0186  -0.0634 0.0388  73  VAL A N   
552  C CA  . VAL A 72  ? 0.3169 0.3221 0.3790 0.0308  -0.0654 0.0294  73  VAL A CA  
553  C C   . VAL A 72  ? 0.3488 0.3404 0.4142 0.0324  -0.0669 0.0185  73  VAL A C   
554  O O   . VAL A 72  ? 0.4062 0.3765 0.4683 0.0276  -0.0732 0.0213  73  VAL A O   
555  C CB  . VAL A 72  ? 0.3859 0.3790 0.4489 0.0367  -0.0737 0.0363  73  VAL A CB  
556  C CG1 . VAL A 72  ? 0.3333 0.3227 0.4078 0.0503  -0.0768 0.0255  73  VAL A CG1 
557  C CG2 . VAL A 72  ? 0.3291 0.3375 0.3872 0.0354  -0.0717 0.0449  73  VAL A CG2 
558  N N   . ASP A 73  ? 0.3422 0.3453 0.4127 0.0383  -0.0613 0.0061  74  ASP A N   
559  C CA  . ASP A 73  ? 0.3500 0.3437 0.4215 0.0391  -0.0610 -0.0061 74  ASP A CA  
560  C C   . ASP A 73  ? 0.3797 0.3516 0.4572 0.0488  -0.0686 -0.0118 74  ASP A C   
561  O O   . ASP A 73  ? 0.4570 0.4317 0.5430 0.0596  -0.0709 -0.0129 74  ASP A O   
562  C CB  . ASP A 73  ? 0.4092 0.4230 0.4829 0.0423  -0.0524 -0.0174 74  ASP A CB  
563  C CG  . ASP A 73  ? 0.5318 0.5386 0.6032 0.0415  -0.0510 -0.0304 74  ASP A CG  
564  O OD1 . ASP A 73  ? 0.5901 0.5930 0.6680 0.0511  -0.0509 -0.0424 74  ASP A OD1 
565  O OD2 . ASP A 73  ? 0.6016 0.6080 0.6648 0.0315  -0.0501 -0.0292 74  ASP A OD2 
566  N N   . THR A 74  ? 0.4195 0.3689 0.4930 0.0451  -0.0734 -0.0157 75  THR A N   
567  C CA  . THR A 74  ? 0.5078 0.4310 0.5859 0.0548  -0.0819 -0.0218 75  THR A CA  
568  C C   . THR A 74  ? 0.5335 0.4471 0.6111 0.0574  -0.0804 -0.0392 75  THR A C   
569  O O   . THR A 74  ? 0.5583 0.4439 0.6368 0.0630  -0.0884 -0.0450 75  THR A O   
570  C CB  . THR A 74  ? 0.5615 0.4568 0.6327 0.0474  -0.0927 -0.0079 75  THR A CB  
571  O OG1 . THR A 74  ? 0.5854 0.4763 0.6465 0.0310  -0.0919 -0.0033 75  THR A OG1 
572  C CG2 . THR A 74  ? 0.5060 0.4096 0.5767 0.0466  -0.0948 0.0081  75  THR A CG2 
573  N N   . LEU A 75  ? 0.4264 0.3608 0.5010 0.0534  -0.0709 -0.0476 76  LEU A N   
574  C CA  . LEU A 75  ? 0.4300 0.3569 0.5012 0.0545  -0.0689 -0.0645 76  LEU A CA  
575  C C   . LEU A 75  ? 0.4036 0.3257 0.4857 0.0721  -0.0693 -0.0801 76  LEU A C   
576  O O   . LEU A 75  ? 0.4348 0.3328 0.5155 0.0768  -0.0742 -0.0917 76  LEU A O   
577  C CB  . LEU A 75  ? 0.4696 0.4225 0.5345 0.0471  -0.0588 -0.0692 76  LEU A CB  
578  C CG  . LEU A 75  ? 0.5430 0.4930 0.6013 0.0468  -0.0554 -0.0870 76  LEU A CG  
579  C CD1 . LEU A 75  ? 0.4959 0.4165 0.5452 0.0384  -0.0639 -0.0881 76  LEU A CD1 
580  C CD2 . LEU A 75  ? 0.5144 0.4908 0.5649 0.0388  -0.0464 -0.0883 76  LEU A CD2 
581  N N   . TYR A 76  ? 0.3625 0.3079 0.4561 0.0820  -0.0643 -0.0813 77  TYR A N   
582  C CA  . TYR A 76  ? 0.4672 0.4161 0.5748 0.0996  -0.0636 -0.0965 77  TYR A CA  
583  C C   . TYR A 76  ? 0.4933 0.4476 0.6141 0.1092  -0.0689 -0.0868 77  TYR A C   
584  O O   . TYR A 76  ? 0.4256 0.4094 0.5541 0.1112  -0.0624 -0.0854 77  TYR A O   
585  C CB  . TYR A 76  ? 0.4216 0.4012 0.5312 0.1013  -0.0505 -0.1111 77  TYR A CB  
586  C CG  . TYR A 76  ? 0.4447 0.4198 0.5399 0.0924  -0.0458 -0.1217 77  TYR A CG  
587  C CD1 . TYR A 76  ? 0.5010 0.4504 0.5930 0.0976  -0.0504 -0.1357 77  TYR A CD1 
588  C CD2 . TYR A 76  ? 0.3881 0.3836 0.4720 0.0792  -0.0377 -0.1182 77  TYR A CD2 
589  C CE1 . TYR A 76  ? 0.5240 0.4695 0.6012 0.0887  -0.0467 -0.1461 77  TYR A CE1 
590  C CE2 . TYR A 76  ? 0.4149 0.4071 0.4844 0.0708  -0.0345 -0.1274 77  TYR A CE2 
591  C CZ  . TYR A 76  ? 0.4864 0.4545 0.5524 0.0750  -0.0388 -0.1415 77  TYR A CZ  
592  O OH  . TYR A 76  ? 0.4925 0.4576 0.5427 0.0658  -0.0362 -0.1512 77  TYR A OH  
593  N N   . PRO A 77  ? 0.5161 0.4414 0.6386 0.1143  -0.0815 -0.0794 78  PRO A N   
594  C CA  . PRO A 77  ? 0.5524 0.4809 0.6839 0.1210  -0.0884 -0.0671 78  PRO A CA  
595  C C   . PRO A 77  ? 0.5013 0.4519 0.6530 0.1387  -0.0862 -0.0791 78  PRO A C   
596  O O   . PRO A 77  ? 0.5420 0.4861 0.7035 0.1525  -0.0872 -0.0955 78  PRO A O   
597  C CB  . PRO A 77  ? 0.5873 0.4748 0.7140 0.1224  -0.1034 -0.0584 78  PRO A CB  
598  C CG  . PRO A 77  ? 0.6411 0.5076 0.7525 0.1092  -0.1029 -0.0605 78  PRO A CG  
599  C CD  . PRO A 77  ? 0.5476 0.4338 0.6608 0.1111  -0.0910 -0.0797 78  PRO A CD  
600  N N   . GLY A 78  ? 0.4935 0.4712 0.6517 0.1384  -0.0833 -0.0714 79  GLY A N   
601  C CA  . GLY A 78  ? 0.5538 0.5583 0.7326 0.1527  -0.0810 -0.0812 79  GLY A CA  
602  C C   . GLY A 78  ? 0.5376 0.5739 0.7216 0.1522  -0.0662 -0.0971 79  GLY A C   
603  O O   . GLY A 78  ? 0.5103 0.5734 0.7127 0.1630  -0.0628 -0.1065 79  GLY A O   
604  N N   . PHE A 79  ? 0.5015 0.5369 0.6698 0.1393  -0.0577 -0.1000 80  PHE A N   
605  C CA  . PHE A 79  ? 0.3339 0.3974 0.5029 0.1365  -0.0438 -0.1138 80  PHE A CA  
606  C C   . PHE A 79  ? 0.3020 0.3937 0.4683 0.1252  -0.0366 -0.1044 80  PHE A C   
607  O O   . PHE A 79  ? 0.3955 0.4797 0.5487 0.1132  -0.0385 -0.0893 80  PHE A O   
608  C CB  . PHE A 79  ? 0.3916 0.4393 0.5432 0.1275  -0.0398 -0.1204 80  PHE A CB  
609  C CG  . PHE A 79  ? 0.3642 0.4386 0.5098 0.1202  -0.0259 -0.1308 80  PHE A CG  
610  C CD1 . PHE A 79  ? 0.3342 0.4309 0.4918 0.1301  -0.0177 -0.1493 80  PHE A CD1 
611  C CD2 . PHE A 79  ? 0.3730 0.4498 0.5005 0.1033  -0.0215 -0.1223 80  PHE A CD2 
612  C CE1 . PHE A 79  ? 0.3136 0.4350 0.4630 0.1214  -0.0047 -0.1579 80  PHE A CE1 
613  C CE2 . PHE A 79  ? 0.3677 0.4663 0.4871 0.0956  -0.0100 -0.1303 80  PHE A CE2 
614  C CZ  . PHE A 79  ? 0.2889 0.4096 0.4179 0.1037  -0.0014 -0.1476 80  PHE A CZ  
615  N N   . GLU A 80  ? 0.3291 0.4534 0.5083 0.1291  -0.0284 -0.1137 81  GLU A N   
616  C CA  . GLU A 80  ? 0.3275 0.4771 0.5055 0.1188  -0.0228 -0.1051 81  GLU A CA  
617  C C   . GLU A 80  ? 0.3261 0.4734 0.4824 0.1017  -0.0164 -0.0987 81  GLU A C   
618  O O   . GLU A 80  ? 0.2965 0.4470 0.4454 0.0923  -0.0170 -0.0856 81  GLU A O   
619  C CB  . GLU A 80  ? 0.4664 0.6523 0.6616 0.1240  -0.0142 -0.1178 81  GLU A CB  
620  C CG  . GLU A 80  ? 0.6202 0.8320 0.8118 0.1106  -0.0070 -0.1112 81  GLU A CG  
621  C CD  . GLU A 80  ? 0.8148 1.0648 1.0246 0.1140  0.0017  -0.1236 81  GLU A CD  
622  O OE1 . GLU A 80  ? 0.8312 1.0959 1.0368 0.1101  0.0129  -0.1354 81  GLU A OE1 
623  O OE2 . GLU A 80  ? 0.9028 1.1697 1.1308 0.1200  -0.0027 -0.1216 81  GLU A OE2 
624  N N   . GLY A 81  ? 0.2939 0.4354 0.4395 0.0981  -0.0110 -0.1080 82  GLY A N   
625  C CA  . GLY A 81  ? 0.2929 0.4351 0.4191 0.0828  -0.0055 -0.1025 82  GLY A CA  
626  C C   . GLY A 81  ? 0.3350 0.4552 0.4487 0.0751  -0.0128 -0.0869 82  GLY A C   
627  O O   . GLY A 81  ? 0.3102 0.4343 0.4113 0.0638  -0.0100 -0.0787 82  GLY A O   
628  N N   . THR A 82  ? 0.3367 0.4341 0.4537 0.0811  -0.0223 -0.0824 83  THR A N   
629  C CA  . THR A 82  ? 0.3145 0.3949 0.4216 0.0735  -0.0286 -0.0671 83  THR A CA  
630  C C   . THR A 82  ? 0.3043 0.3858 0.4178 0.0765  -0.0344 -0.0552 83  THR A C   
631  O O   . THR A 82  ? 0.3233 0.4051 0.4284 0.0685  -0.0349 -0.0432 83  THR A O   
632  C CB  . THR A 82  ? 0.3394 0.3919 0.4415 0.0738  -0.0356 -0.0679 83  THR A CB  
633  O OG1 . THR A 82  ? 0.4155 0.4569 0.5298 0.0873  -0.0410 -0.0761 83  THR A OG1 
634  C CG2 . THR A 82  ? 0.3545 0.4044 0.4448 0.0665  -0.0310 -0.0765 83  THR A CG2 
635  N N   . GLU A 83  ? 0.2903 0.3731 0.4185 0.0884  -0.0390 -0.0588 84  GLU A N   
636  C CA  . GLU A 83  ? 0.3216 0.4046 0.4544 0.0910  -0.0459 -0.0472 84  GLU A CA  
637  C C   . GLU A 83  ? 0.3641 0.4694 0.4952 0.0844  -0.0406 -0.0423 84  GLU A C   
638  O O   . GLU A 83  ? 0.3561 0.4592 0.4826 0.0812  -0.0448 -0.0306 84  GLU A O   
639  C CB  . GLU A 83  ? 0.3140 0.3967 0.4644 0.1060  -0.0528 -0.0527 84  GLU A CB  
640  C CG  . GLU A 83  ? 0.3768 0.4310 0.5286 0.1141  -0.0612 -0.0558 84  GLU A CG  
641  C CD  . GLU A 83  ? 0.4970 0.5238 0.6353 0.1069  -0.0698 -0.0404 84  GLU A CD  
642  O OE1 . GLU A 83  ? 0.5489 0.5489 0.6850 0.1100  -0.0767 -0.0418 84  GLU A OE1 
643  O OE2 . GLU A 83  ? 0.5384 0.5702 0.6680 0.0978  -0.0697 -0.0274 84  GLU A OE2 
644  N N   . MET A 84  ? 0.2570 0.3829 0.3901 0.0815  -0.0314 -0.0511 85  MET A N   
645  C CA  . MET A 84  ? 0.2160 0.3603 0.3466 0.0742  -0.0270 -0.0467 85  MET A CA  
646  C C   . MET A 84  ? 0.2359 0.3710 0.3495 0.0637  -0.0267 -0.0355 85  MET A C   
647  O O   . MET A 84  ? 0.2272 0.3708 0.3372 0.0587  -0.0258 -0.0299 85  MET A O   
648  C CB  . MET A 84  ? 0.2721 0.4379 0.4052 0.0706  -0.0170 -0.0574 85  MET A CB  
649  C CG  . MET A 84  ? 0.3012 0.4606 0.4203 0.0636  -0.0111 -0.0613 85  MET A CG  
650  S SD  . MET A 84  ? 0.3395 0.5253 0.4594 0.0584  0.0008  -0.0734 85  MET A SD  
651  C CE  . MET A 84  ? 0.2257 0.4224 0.3382 0.0464  0.0025  -0.0623 85  MET A CE  
652  N N   . TRP A 85  ? 0.2338 0.3522 0.3375 0.0605  -0.0278 -0.0328 86  TRP A N   
653  C CA  . TRP A 85  ? 0.2250 0.3371 0.3152 0.0521  -0.0277 -0.0229 86  TRP A CA  
654  C C   . TRP A 85  ? 0.2598 0.3580 0.3474 0.0529  -0.0347 -0.0126 86  TRP A C   
655  O O   . TRP A 85  ? 0.2292 0.3255 0.3075 0.0471  -0.0343 -0.0046 86  TRP A O   
656  C CB  . TRP A 85  ? 0.2403 0.3475 0.3212 0.0462  -0.0241 -0.0260 86  TRP A CB  
657  C CG  . TRP A 85  ? 0.2474 0.3672 0.3278 0.0443  -0.0172 -0.0362 86  TRP A CG  
658  C CD1 . TRP A 85  ? 0.2611 0.3803 0.3436 0.0468  -0.0147 -0.0475 86  TRP A CD1 
659  C CD2 . TRP A 85  ? 0.3057 0.4399 0.3815 0.0385  -0.0117 -0.0360 86  TRP A CD2 
660  N NE1 . TRP A 85  ? 0.2716 0.4067 0.3508 0.0425  -0.0071 -0.0542 86  TRP A NE1 
661  C CE2 . TRP A 85  ? 0.2782 0.4219 0.3531 0.0368  -0.0056 -0.0465 86  TRP A CE2 
662  C CE3 . TRP A 85  ? 0.2511 0.3895 0.3221 0.0341  -0.0117 -0.0281 86  TRP A CE3 
663  C CZ2 . TRP A 85  ? 0.2316 0.3895 0.3006 0.0294  0.0005  -0.0477 86  TRP A CZ2 
664  C CZ3 . TRP A 85  ? 0.2867 0.4363 0.3524 0.0275  -0.0066 -0.0297 86  TRP A CZ3 
665  C CH2 . TRP A 85  ? 0.2929 0.4525 0.3574 0.0245  -0.0005 -0.0387 86  TRP A CH2 
666  N N   . ASN A 86  ? 0.2486 0.3377 0.3440 0.0600  -0.0410 -0.0126 87  ASN A N   
667  C CA  . ASN A 86  ? 0.3155 0.3898 0.4065 0.0593  -0.0482 -0.0019 87  ASN A CA  
668  C C   . ASN A 86  ? 0.3236 0.4052 0.4135 0.0599  -0.0510 0.0058  87  ASN A C   
669  O O   . ASN A 86  ? 0.2255 0.3216 0.3217 0.0628  -0.0494 0.0018  87  ASN A O   
670  C CB  . ASN A 86  ? 0.2790 0.3365 0.3770 0.0666  -0.0554 -0.0044 87  ASN A CB  
671  C CG  . ASN A 86  ? 0.3279 0.3690 0.4203 0.0621  -0.0557 -0.0064 87  ASN A CG  
672  O OD1 . ASN A 86  ? 0.3373 0.3794 0.4203 0.0526  -0.0521 -0.0024 87  ASN A OD1 
673  N ND2 . ASN A 86  ? 0.3016 0.3270 0.4000 0.0690  -0.0608 -0.0130 87  ASN A ND2 
674  N N   . PRO A 87  ? 0.3219 0.3945 0.4030 0.0561  -0.0550 0.0168  88  PRO A N   
675  C CA  . PRO A 87  ? 0.2873 0.3662 0.3643 0.0560  -0.0578 0.0237  88  PRO A CA  
676  C C   . PRO A 87  ? 0.3386 0.4211 0.4266 0.0645  -0.0644 0.0215  88  PRO A C   
677  O O   . PRO A 87  ? 0.2870 0.3588 0.3827 0.0712  -0.0709 0.0207  88  PRO A O   
678  C CB  . PRO A 87  ? 0.2507 0.3175 0.3167 0.0506  -0.0616 0.0353  88  PRO A CB  
679  C CG  . PRO A 87  ? 0.2854 0.3466 0.3483 0.0447  -0.0573 0.0343  88  PRO A CG  
680  C CD  . PRO A 87  ? 0.2683 0.3272 0.3413 0.0497  -0.0562 0.0232  88  PRO A CD  
681  N N   . ASN A 88  ? 0.2573 0.3551 0.3467 0.0645  -0.0633 0.0202  89  ASN A N   
682  C CA  . ASN A 88  ? 0.2907 0.3964 0.3911 0.0716  -0.0702 0.0188  89  ASN A CA  
683  C C   . ASN A 88  ? 0.3219 0.4281 0.4122 0.0689  -0.0761 0.0281  89  ASN A C   
684  O O   . ASN A 88  ? 0.3473 0.4642 0.4447 0.0725  -0.0816 0.0273  89  ASN A O   
685  C CB  . ASN A 88  ? 0.2523 0.3782 0.3647 0.0729  -0.0648 0.0082  89  ASN A CB  
686  C CG  . ASN A 88  ? 0.3144 0.4499 0.4171 0.0641  -0.0589 0.0086  89  ASN A CG  
687  O OD1 . ASN A 88  ? 0.2481 0.3754 0.3358 0.0582  -0.0565 0.0142  89  ASN A OD1 
688  N ND2 . ASN A 88  ? 0.3649 0.5180 0.4765 0.0631  -0.0567 0.0022  89  ASN A ND2 
689  N N   . ARG A 89  ? 0.3348 0.4319 0.4088 0.0621  -0.0747 0.0362  90  ARG A N   
690  C CA  . ARG A 89  ? 0.3468 0.4415 0.4079 0.0592  -0.0803 0.0457  90  ARG A CA  
691  C C   . ARG A 89  ? 0.3870 0.4661 0.4366 0.0548  -0.0815 0.0553  90  ARG A C   
692  O O   . ARG A 89  ? 0.3373 0.4093 0.3886 0.0528  -0.0771 0.0538  90  ARG A O   
693  C CB  . ARG A 89  ? 0.3352 0.4406 0.3855 0.0535  -0.0747 0.0441  90  ARG A CB  
694  C CG  . ARG A 89  ? 0.4052 0.5251 0.4645 0.0550  -0.0746 0.0362  90  ARG A CG  
695  C CD  . ARG A 89  ? 0.5111 0.6357 0.5764 0.0595  -0.0856 0.0389  90  ARG A CD  
696  N NE  . ARG A 89  ? 0.5729 0.7128 0.6420 0.0573  -0.0861 0.0333  90  ARG A NE  
697  C CZ  . ARG A 89  ? 0.5697 0.7236 0.6562 0.0597  -0.0851 0.0252  90  ARG A CZ  
698  N NH1 . ARG A 89  ? 0.4432 0.5983 0.5449 0.0657  -0.0828 0.0207  90  ARG A NH1 
699  N NH2 . ARG A 89  ? 0.6171 0.7847 0.7056 0.0553  -0.0860 0.0212  90  ARG A NH2 
700  N N   . GLU A 90  ? 0.3197 0.3943 0.3565 0.0518  -0.0876 0.0655  91  GLU A N   
701  C CA  . GLU A 90  ? 0.3374 0.3989 0.3617 0.0451  -0.0885 0.0760  91  GLU A CA  
702  C C   . GLU A 90  ? 0.2804 0.3481 0.2981 0.0378  -0.0770 0.0742  91  GLU A C   
703  O O   . GLU A 90  ? 0.3213 0.4021 0.3370 0.0373  -0.0698 0.0680  91  GLU A O   
704  C CB  . GLU A 90  ? 0.3445 0.4034 0.3527 0.0414  -0.0957 0.0874  91  GLU A CB  
705  C CG  . GLU A 90  ? 0.6176 0.6904 0.6108 0.0353  -0.0884 0.0871  91  GLU A CG  
706  C CD  . GLU A 90  ? 0.8520 0.9212 0.8245 0.0275  -0.0917 0.0996  91  GLU A CD  
707  O OE1 . GLU A 90  ? 0.9118 0.9922 0.8706 0.0224  -0.0845 0.0987  91  GLU A OE1 
708  O OE2 . GLU A 90  ? 0.9328 0.9874 0.9016 0.0264  -0.1014 0.1102  91  GLU A OE2 
709  N N   . LEU A 91  ? 0.3091 0.3667 0.3240 0.0323  -0.0760 0.0797  92  LEU A N   
710  C CA  . LEU A 91  ? 0.3009 0.3665 0.3107 0.0250  -0.0663 0.0795  92  LEU A CA  
711  C C   . LEU A 91  ? 0.3586 0.4323 0.3520 0.0181  -0.0637 0.0873  92  LEU A C   
712  O O   . LEU A 91  ? 0.3453 0.4113 0.3284 0.0143  -0.0702 0.0976  92  LEU A O   
713  C CB  . LEU A 91  ? 0.3315 0.3850 0.3447 0.0198  -0.0670 0.0826  92  LEU A CB  
714  C CG  . LEU A 91  ? 0.3979 0.4424 0.4251 0.0255  -0.0686 0.0738  92  LEU A CG  
715  C CD1 . LEU A 91  ? 0.3591 0.3924 0.3860 0.0178  -0.0686 0.0769  92  LEU A CD1 
716  C CD2 . LEU A 91  ? 0.3118 0.3710 0.3466 0.0303  -0.0612 0.0620  92  LEU A CD2 
717  N N   . SER A 92  ? 0.3066 0.3959 0.2970 0.0167  -0.0542 0.0823  93  SER A N   
718  C CA  . SER A 92  ? 0.2876 0.3876 0.2628 0.0109  -0.0497 0.0873  93  SER A CA  
719  C C   . SER A 92  ? 0.3143 0.4299 0.2917 0.0105  -0.0390 0.0808  93  SER A C   
720  O O   . SER A 92  ? 0.3319 0.4500 0.3190 0.0163  -0.0362 0.0716  93  SER A O   
721  C CB  . SER A 92  ? 0.2794 0.3825 0.2445 0.0143  -0.0530 0.0862  93  SER A CB  
722  O OG  . SER A 92  ? 0.3455 0.4595 0.2941 0.0088  -0.0479 0.0897  93  SER A OG  
723  N N   . GLU A 93  ? 0.3057 0.4327 0.2743 0.0034  -0.0333 0.0861  94  GLU A N   
724  C CA  . GLU A 93  ? 0.3305 0.4758 0.3008 0.0053  -0.0234 0.0791  94  GLU A CA  
725  C C   . GLU A 93  ? 0.3242 0.4750 0.2861 0.0122  -0.0210 0.0711  94  GLU A C   
726  O O   . GLU A 93  ? 0.3587 0.5195 0.3239 0.0176  -0.0148 0.0626  94  GLU A O   
727  C CB  . GLU A 93  ? 0.2858 0.4462 0.2508 -0.0041 -0.0171 0.0860  94  GLU A CB  
728  C CG  . GLU A 93  ? 0.3141 0.4711 0.2888 -0.0121 -0.0184 0.0921  94  GLU A CG  
729  C CD  . GLU A 93  ? 0.4141 0.5901 0.3848 -0.0232 -0.0116 0.0990  94  GLU A CD  
730  O OE1 . GLU A 93  ? 0.4081 0.5781 0.3682 -0.0341 -0.0147 0.1107  94  GLU A OE1 
731  O OE2 . GLU A 93  ? 0.3775 0.5750 0.3558 -0.0212 -0.0033 0.0930  94  GLU A OE2 
732  N N   . ASP A 94  ? 0.2781 0.4218 0.2291 0.0121  -0.0269 0.0739  95  ASP A N   
733  C CA  . ASP A 94  ? 0.2917 0.4369 0.2337 0.0175  -0.0270 0.0662  95  ASP A CA  
734  C C   . ASP A 94  ? 0.3294 0.4647 0.2832 0.0240  -0.0318 0.0592  95  ASP A C   
735  O O   . ASP A 94  ? 0.3190 0.4455 0.2746 0.0247  -0.0399 0.0612  95  ASP A O   
736  C CB  . ASP A 94  ? 0.2948 0.4379 0.2195 0.0130  -0.0323 0.0732  95  ASP A CB  
737  C CG  . ASP A 94  ? 0.4144 0.5584 0.3284 0.0172  -0.0337 0.0650  95  ASP A CG  
738  O OD1 . ASP A 94  ? 0.5227 0.6633 0.4236 0.0142  -0.0405 0.0699  95  ASP A OD1 
739  O OD2 . ASP A 94  ? 0.3742 0.5202 0.2923 0.0232  -0.0293 0.0539  95  ASP A OD2 
740  N N   . CYS A 95  ? 0.2894 0.4275 0.2521 0.0285  -0.0267 0.0512  96  CYS A N   
741  C CA  . CYS A 95  ? 0.2668 0.3967 0.2410 0.0323  -0.0301 0.0459  96  CYS A CA  
742  C C   . CYS A 95  ? 0.2603 0.3904 0.2345 0.0371  -0.0266 0.0363  96  CYS A C   
743  O O   . CYS A 95  ? 0.2548 0.3793 0.2376 0.0387  -0.0284 0.0325  96  CYS A O   
744  C CB  . CYS A 95  ? 0.2353 0.3622 0.2229 0.0309  -0.0302 0.0487  96  CYS A CB  
745  S SG  . CYS A 95  ? 0.2731 0.4101 0.2661 0.0305  -0.0222 0.0473  96  CYS A SG  
746  N N   . LEU A 96  ? 0.2662 0.4018 0.2304 0.0395  -0.0219 0.0320  97  LEU A N   
747  C CA  . LEU A 96  ? 0.2889 0.4210 0.2528 0.0450  -0.0196 0.0230  97  LEU A CA  
748  C C   . LEU A 96  ? 0.2931 0.4157 0.2485 0.0451  -0.0244 0.0178  97  LEU A C   
749  O O   . LEU A 96  ? 0.3198 0.4420 0.2621 0.0468  -0.0236 0.0128  97  LEU A O   
750  C CB  . LEU A 96  ? 0.2336 0.3760 0.1930 0.0493  -0.0126 0.0194  97  LEU A CB  
751  C CG  . LEU A 96  ? 0.2542 0.4079 0.2253 0.0484  -0.0084 0.0241  97  LEU A CG  
752  C CD1 . LEU A 96  ? 0.2704 0.4383 0.2411 0.0542  -0.0013 0.0191  97  LEU A CD1 
753  C CD2 . LEU A 96  ? 0.2063 0.3525 0.1900 0.0485  -0.0113 0.0245  97  LEU A CD2 
754  N N   . TYR A 97  ? 0.2837 0.3999 0.2470 0.0427  -0.0295 0.0184  98  TYR A N   
755  C CA  . TYR A 97  ? 0.2663 0.3757 0.2251 0.0408  -0.0347 0.0140  98  TYR A CA  
756  C C   . TYR A 97  ? 0.2829 0.3856 0.2503 0.0400  -0.0354 0.0108  98  TYR A C   
757  O O   . TYR A 97  ? 0.2485 0.3532 0.2266 0.0403  -0.0333 0.0133  98  TYR A O   
758  C CB  . TYR A 97  ? 0.2633 0.3760 0.2237 0.0373  -0.0412 0.0188  98  TYR A CB  
759  C CG  . TYR A 97  ? 0.2794 0.3973 0.2287 0.0365  -0.0415 0.0240  98  TYR A CG  
760  C CD1 . TYR A 97  ? 0.2895 0.4071 0.2230 0.0350  -0.0444 0.0214  98  TYR A CD1 
761  C CD2 . TYR A 97  ? 0.2608 0.3833 0.2137 0.0359  -0.0390 0.0315  98  TYR A CD2 
762  C CE1 . TYR A 97  ? 0.2948 0.4180 0.2155 0.0330  -0.0443 0.0268  98  TYR A CE1 
763  C CE2 . TYR A 97  ? 0.2462 0.3734 0.1873 0.0332  -0.0390 0.0375  98  TYR A CE2 
764  C CZ  . TYR A 97  ? 0.3661 0.4942 0.2907 0.0318  -0.0414 0.0354  98  TYR A CZ  
765  O OH  . TYR A 97  ? 0.3566 0.4901 0.2672 0.0279  -0.0411 0.0421  98  TYR A OH  
766  N N   . LEU A 98  ? 0.3034 0.3979 0.2645 0.0379  -0.0384 0.0053  99  LEU A N   
767  C CA  . LEU A 98  ? 0.3030 0.3910 0.2697 0.0346  -0.0394 0.0032  99  LEU A CA  
768  C C   . LEU A 98  ? 0.3073 0.3957 0.2749 0.0279  -0.0450 0.0015  99  LEU A C   
769  O O   . LEU A 98  ? 0.3323 0.4241 0.2946 0.0267  -0.0491 0.0011  99  LEU A O   
770  C CB  . LEU A 98  ? 0.2895 0.3641 0.2478 0.0376  -0.0377 -0.0013 99  LEU A CB  
771  C CG  . LEU A 98  ? 0.3365 0.4000 0.2792 0.0402  -0.0391 -0.0079 99  LEU A CG  
772  C CD1 . LEU A 98  ? 0.2605 0.3140 0.1965 0.0326  -0.0452 -0.0116 99  LEU A CD1 
773  C CD2 . LEU A 98  ? 0.2916 0.3442 0.2302 0.0473  -0.0367 -0.0113 99  LEU A CD2 
774  N N   . ASN A 99  ? 0.2573 0.3438 0.2312 0.0227  -0.0455 0.0007  100 ASN A N   
775  C CA  . ASN A 99  ? 0.2681 0.3607 0.2478 0.0151  -0.0499 -0.0005 100 ASN A CA  
776  C C   . ASN A 99  ? 0.2938 0.3744 0.2670 0.0076  -0.0510 -0.0037 100 ASN A C   
777  O O   . ASN A 99  ? 0.3195 0.3914 0.2908 0.0077  -0.0478 -0.0029 100 ASN A O   
778  C CB  . ASN A 99  ? 0.2360 0.3438 0.2336 0.0147  -0.0486 0.0022  100 ASN A CB  
779  C CG  . ASN A 99  ? 0.3191 0.4328 0.3223 0.0221  -0.0472 0.0062  100 ASN A CG  
780  O OD1 . ASN A 99  ? 0.3421 0.4599 0.3440 0.0245  -0.0512 0.0084  100 ASN A OD1 
781  N ND2 . ASN A 99  ? 0.2653 0.3782 0.2732 0.0249  -0.0423 0.0078  100 ASN A ND2 
782  N N   . VAL A 100 ? 0.3405 0.4198 0.3092 0.0003  -0.0564 -0.0066 101 VAL A N   
783  C CA  . VAL A 100 ? 0.3302 0.3971 0.2922 -0.0097 -0.0587 -0.0089 101 VAL A CA  
784  C C   . VAL A 100 ? 0.3191 0.4030 0.2933 -0.0204 -0.0616 -0.0088 101 VAL A C   
785  O O   . VAL A 100 ? 0.2854 0.3815 0.2640 -0.0211 -0.0664 -0.0099 101 VAL A O   
786  C CB  . VAL A 100 ? 0.3784 0.4242 0.3211 -0.0102 -0.0632 -0.0141 101 VAL A CB  
787  C CG1 . VAL A 100 ? 0.3080 0.3378 0.2431 -0.0227 -0.0671 -0.0157 101 VAL A CG1 
788  C CG2 . VAL A 100 ? 0.2696 0.3022 0.2024 0.0018  -0.0596 -0.0155 101 VAL A CG2 
789  N N   . TRP A 101 ? 0.3245 0.4113 0.3043 -0.0288 -0.0589 -0.0073 102 TRP A N   
790  C CA  . TRP A 101 ? 0.2499 0.3530 0.2401 -0.0415 -0.0610 -0.0080 102 TRP A CA  
791  C C   . TRP A 101 ? 0.2946 0.3783 0.2704 -0.0551 -0.0641 -0.0085 102 TRP A C   
792  O O   . TRP A 101 ? 0.3346 0.3985 0.2992 -0.0558 -0.0618 -0.0064 102 TRP A O   
793  C CB  . TRP A 101 ? 0.2503 0.3750 0.2579 -0.0428 -0.0545 -0.0063 102 TRP A CB  
794  C CG  . TRP A 101 ? 0.2570 0.4017 0.2816 -0.0314 -0.0524 -0.0063 102 TRP A CG  
795  C CD1 . TRP A 101 ? 0.1991 0.3691 0.2422 -0.0308 -0.0546 -0.0080 102 TRP A CD1 
796  C CD2 . TRP A 101 ? 0.2464 0.3865 0.2714 -0.0192 -0.0484 -0.0044 102 TRP A CD2 
797  N NE1 . TRP A 101 ? 0.1853 0.3633 0.2391 -0.0182 -0.0527 -0.0073 102 TRP A NE1 
798  C CE2 . TRP A 101 ? 0.2100 0.3698 0.2525 -0.0120 -0.0487 -0.0050 102 TRP A CE2 
799  C CE3 . TRP A 101 ? 0.2307 0.3523 0.2437 -0.0137 -0.0453 -0.0024 102 TRP A CE3 
800  C CZ2 . TRP A 101 ? 0.2034 0.3620 0.2497 -0.0011 -0.0460 -0.0033 102 TRP A CZ2 
801  C CZ3 . TRP A 101 ? 0.2778 0.4023 0.2962 -0.0034 -0.0421 -0.0008 102 TRP A CZ3 
802  C CH2 . TRP A 101 ? 0.2162 0.3576 0.2502 0.0021  -0.0425 -0.0011 102 TRP A CH2 
803  N N   . THR A 102 ? 0.3383 0.4271 0.3144 -0.0664 -0.0701 -0.0110 103 THR A N   
804  C CA  . THR A 102 ? 0.2999 0.3689 0.2620 -0.0818 -0.0744 -0.0113 103 THR A CA  
805  C C   . THR A 102 ? 0.3727 0.4663 0.3483 -0.0981 -0.0768 -0.0116 103 THR A C   
806  O O   . THR A 102 ? 0.3487 0.4715 0.3424 -0.0949 -0.0777 -0.0132 103 THR A O   
807  C CB  . THR A 102 ? 0.4598 0.5000 0.4010 -0.0793 -0.0815 -0.0159 103 THR A CB  
808  O OG1 . THR A 102 ? 0.5426 0.5533 0.4666 -0.0909 -0.0852 -0.0156 103 THR A OG1 
809  C CG2 . THR A 102 ? 0.3645 0.4181 0.3089 -0.0835 -0.0887 -0.0202 103 THR A CG2 
810  N N   . PRO A 103 ? 0.3611 0.4451 0.3293 -0.1158 -0.0780 -0.0096 104 PRO A N   
811  C CA  . PRO A 103 ? 0.3733 0.4819 0.3540 -0.1338 -0.0808 -0.0102 104 PRO A CA  
812  C C   . PRO A 103 ? 0.4431 0.5562 0.4241 -0.1355 -0.0904 -0.0152 104 PRO A C   
813  O O   . PRO A 103 ? 0.4059 0.4934 0.3696 -0.1279 -0.0959 -0.0185 104 PRO A O   
814  C CB  . PRO A 103 ? 0.3954 0.4803 0.3594 -0.1536 -0.0822 -0.0063 104 PRO A CB  
815  C CG  . PRO A 103 ? 0.3540 0.4151 0.3055 -0.1444 -0.0768 -0.0021 104 PRO A CG  
816  C CD  . PRO A 103 ? 0.3724 0.4270 0.3233 -0.1207 -0.0760 -0.0052 104 PRO A CD  
817  N N   . TYR A 104 ? 0.4316 0.5795 0.4328 -0.1456 -0.0923 -0.0161 105 TYR A N   
818  C CA  . TYR A 104 ? 0.3757 0.5341 0.3801 -0.1498 -0.1026 -0.0203 105 TYR A CA  
819  C C   . TYR A 104 ? 0.4466 0.6151 0.4543 -0.1752 -0.1069 -0.0202 105 TYR A C   
820  O O   . TYR A 104 ? 0.4265 0.6280 0.4550 -0.1844 -0.1014 -0.0181 105 TYR A O   
821  C CB  . TYR A 104 ? 0.3086 0.5042 0.3379 -0.1360 -0.1026 -0.0213 105 TYR A CB  
822  C CG  . TYR A 104 ? 0.3743 0.5818 0.4066 -0.1381 -0.1146 -0.0247 105 TYR A CG  
823  C CD1 . TYR A 104 ? 0.4138 0.6116 0.4370 -0.1227 -0.1195 -0.0260 105 TYR A CD1 
824  C CD2 . TYR A 104 ? 0.3495 0.5798 0.3934 -0.1567 -0.1211 -0.0263 105 TYR A CD2 
825  C CE1 . TYR A 104 ? 0.4266 0.6351 0.4500 -0.1252 -0.1313 -0.0286 105 TYR A CE1 
826  C CE2 . TYR A 104 ? 0.3758 0.6178 0.4220 -0.1592 -0.1333 -0.0293 105 TYR A CE2 
827  C CZ  . TYR A 104 ? 0.4330 0.6633 0.4681 -0.1430 -0.1387 -0.0304 105 TYR A CZ  
828  O OH  . TYR A 104 ? 0.4203 0.6621 0.4554 -0.1459 -0.1516 -0.0329 105 TYR A OH  
829  N N   . PRO A 105 ? 0.4977 0.6385 0.4847 -0.1874 -0.1166 -0.0229 106 PRO A N   
830  C CA  . PRO A 105 ? 0.5000 0.6022 0.4611 -0.1776 -0.1231 -0.0273 106 PRO A CA  
831  C C   . PRO A 105 ? 0.5364 0.5986 0.4765 -0.1689 -0.1177 -0.0255 106 PRO A C   
832  O O   . PRO A 105 ? 0.4995 0.5596 0.4416 -0.1750 -0.1110 -0.0200 106 PRO A O   
833  C CB  . PRO A 105 ? 0.5424 0.6311 0.4907 -0.1987 -0.1347 -0.0312 106 PRO A CB  
834  C CG  . PRO A 105 ? 0.5671 0.6667 0.5238 -0.2213 -0.1319 -0.0260 106 PRO A CG  
835  C CD  . PRO A 105 ? 0.5195 0.6647 0.5065 -0.2146 -0.1214 -0.0220 106 PRO A CD  
836  N N   . ARG A 106 ? 0.5691 0.6022 0.4897 -0.1547 -0.1205 -0.0302 107 ARG A N   
837  C CA  . ARG A 106 ? 0.6111 0.6106 0.5152 -0.1429 -0.1157 -0.0292 107 ARG A CA  
838  C C   . ARG A 106 ? 0.5937 0.5616 0.4821 -0.1593 -0.1184 -0.0264 107 ARG A C   
839  O O   . ARG A 106 ? 0.6349 0.5933 0.5157 -0.1784 -0.1265 -0.0282 107 ARG A O   
840  C CB  . ARG A 106 ? 0.6137 0.5891 0.4991 -0.1272 -0.1190 -0.0365 107 ARG A CB  
841  C CG  . ARG A 106 ? 0.7592 0.7616 0.6560 -0.1115 -0.1164 -0.0376 107 ARG A CG  
842  C CD  . ARG A 106 ? 0.7986 0.7821 0.6820 -0.0914 -0.1122 -0.0408 107 ARG A CD  
843  N NE  . ARG A 106 ? 0.8053 0.7617 0.6647 -0.0901 -0.1189 -0.0501 107 ARG A NE  
844  C CZ  . ARG A 106 ? 0.8102 0.7762 0.6641 -0.0882 -0.1238 -0.0553 107 ARG A CZ  
845  N NH1 . ARG A 106 ? 0.7234 0.7243 0.5949 -0.0871 -0.1240 -0.0509 107 ARG A NH1 
846  N NH2 . ARG A 106 ? 0.8670 0.8068 0.6968 -0.0871 -0.1292 -0.0651 107 ARG A NH2 
847  N N   . PRO A 107 ? 0.6256 0.5760 0.5084 -0.1532 -0.1126 -0.0213 108 PRO A N   
848  C CA  . PRO A 107 ? 0.6789 0.5972 0.5454 -0.1689 -0.1160 -0.0166 108 PRO A CA  
849  C C   . PRO A 107 ? 0.7871 0.6614 0.6282 -0.1737 -0.1271 -0.0232 108 PRO A C   
850  O O   . PRO A 107 ? 0.7640 0.6223 0.5948 -0.1573 -0.1296 -0.0315 108 PRO A O   
851  C CB  . PRO A 107 ? 0.6134 0.5192 0.4769 -0.1546 -0.1091 -0.0113 108 PRO A CB  
852  C CG  . PRO A 107 ? 0.5906 0.5362 0.4766 -0.1400 -0.0998 -0.0107 108 PRO A CG  
853  C CD  . PRO A 107 ? 0.5871 0.5488 0.4792 -0.1334 -0.1032 -0.0184 108 PRO A CD  
854  N N   . THR A 108 ? 0.9263 0.7811 0.7566 -0.1971 -0.1337 -0.0199 109 THR A N   
855  C CA  . THR A 108 ? 1.1074 0.9144 0.9115 -0.2032 -0.1453 -0.0262 109 THR A CA  
856  C C   . THR A 108 ? 1.1115 0.8721 0.8958 -0.1892 -0.1467 -0.0254 109 THR A C   
857  O O   . THR A 108 ? 1.1770 0.9023 0.9429 -0.1779 -0.1531 -0.0349 109 THR A O   
858  C CB  . THR A 108 ? 1.2074 1.0077 1.0063 -0.2350 -0.1528 -0.0220 109 THR A CB  
859  O OG1 . THR A 108 ? 1.3046 1.1080 1.1067 -0.2477 -0.1477 -0.0095 109 THR A OG1 
860  C CG2 . THR A 108 ? 1.1433 0.9901 0.9627 -0.2474 -0.1533 -0.0247 109 THR A CG2 
861  N N   . SER A 109 ? 0.9884 0.7498 0.7763 -0.1889 -0.1410 -0.0148 110 SER A N   
862  C CA  . SER A 109 ? 0.9551 0.6754 0.7263 -0.1770 -0.1433 -0.0117 110 SER A CA  
863  C C   . SER A 109 ? 0.8805 0.6236 0.6659 -0.1542 -0.1328 -0.0090 110 SER A C   
864  O O   . SER A 109 ? 0.8045 0.5927 0.6114 -0.1538 -0.1235 -0.0059 110 SER A O   
865  C CB  . SER A 109 ? 1.0311 0.7264 0.7896 -0.1998 -0.1482 0.0003  110 SER A CB  
866  O OG  . SER A 109 ? 1.0771 0.8149 0.8531 -0.2177 -0.1404 0.0092  110 SER A OG  
867  N N   . PRO A 110 ? 0.8511 0.5641 0.6255 -0.1346 -0.1347 -0.0107 111 PRO A N   
868  C CA  . PRO A 110 ? 0.7811 0.5163 0.5691 -0.1128 -0.1254 -0.0091 111 PRO A CA  
869  C C   . PRO A 110 ? 0.7447 0.5074 0.5456 -0.1219 -0.1180 0.0031  111 PRO A C   
870  O O   . PRO A 110 ? 0.7134 0.4593 0.5044 -0.1380 -0.1214 0.0126  111 PRO A O   
871  C CB  . PRO A 110 ? 0.8148 0.5074 0.5867 -0.0954 -0.1315 -0.0114 111 PRO A CB  
872  C CG  . PRO A 110 ? 0.8553 0.5092 0.6075 -0.1002 -0.1421 -0.0207 111 PRO A CG  
873  C CD  . PRO A 110 ? 0.8434 0.5014 0.5934 -0.1298 -0.1458 -0.0158 111 PRO A CD  
874  N N   . THR A 111 ? 0.6331 0.4374 0.4547 -0.1115 -0.1079 0.0024  112 THR A N   
875  C CA  . THR A 111 ? 0.5783 0.4166 0.4152 -0.1189 -0.0994 0.0105  112 THR A CA  
876  C C   . THR A 111 ? 0.5504 0.3974 0.3942 -0.0997 -0.0933 0.0130  112 THR A C   
877  O O   . THR A 111 ? 0.5041 0.3557 0.3532 -0.0801 -0.0913 0.0064  112 THR A O   
878  C CB  . THR A 111 ? 0.5851 0.4668 0.4425 -0.1245 -0.0937 0.0068  112 THR A CB  
879  O OG1 . THR A 111 ? 0.6424 0.5175 0.4941 -0.1423 -0.1005 0.0040  112 THR A OG1 
880  C CG2 . THR A 111 ? 0.5409 0.4575 0.4141 -0.1329 -0.0849 0.0134  112 THR A CG2 
881  N N   . PRO A 112 ? 0.5153 0.3651 0.3582 -0.1058 -0.0903 0.0223  113 PRO A N   
882  C CA  . PRO A 112 ? 0.5378 0.3953 0.3865 -0.0889 -0.0857 0.0247  113 PRO A CA  
883  C C   . PRO A 112 ? 0.4524 0.3484 0.3226 -0.0768 -0.0768 0.0193  113 PRO A C   
884  O O   . PRO A 112 ? 0.4296 0.3541 0.3131 -0.0845 -0.0722 0.0170  113 PRO A O   
885  C CB  . PRO A 112 ? 0.5763 0.4360 0.4198 -0.1034 -0.0838 0.0355  113 PRO A CB  
886  C CG  . PRO A 112 ? 0.6586 0.5214 0.4982 -0.1284 -0.0848 0.0382  113 PRO A CG  
887  C CD  . PRO A 112 ? 0.6067 0.4471 0.4390 -0.1293 -0.0927 0.0315  113 PRO A CD  
888  N N   . VAL A 113 ? 0.4007 0.2970 0.2746 -0.0576 -0.0749 0.0177  114 VAL A N   
889  C CA  . VAL A 113 ? 0.3620 0.2879 0.2533 -0.0446 -0.0680 0.0130  114 VAL A CA  
890  C C   . VAL A 113 ? 0.4199 0.3629 0.3198 -0.0404 -0.0621 0.0179  114 VAL A C   
891  O O   . VAL A 113 ? 0.4597 0.3869 0.3516 -0.0355 -0.0648 0.0224  114 VAL A O   
892  C CB  . VAL A 113 ? 0.4051 0.3199 0.2937 -0.0269 -0.0702 0.0061  114 VAL A CB  
893  C CG1 . VAL A 113 ? 0.3581 0.3030 0.2630 -0.0163 -0.0633 0.0028  114 VAL A CG1 
894  C CG2 . VAL A 113 ? 0.3939 0.2876 0.2704 -0.0312 -0.0767 0.0000  114 VAL A CG2 
895  N N   . LEU A 114 ? 0.3806 0.3552 0.2966 -0.0419 -0.0551 0.0167  115 LEU A N   
896  C CA  . LEU A 114 ? 0.3991 0.3920 0.3249 -0.0356 -0.0492 0.0188  115 LEU A CA  
897  C C   . LEU A 114 ? 0.3677 0.3742 0.3053 -0.0206 -0.0465 0.0141  115 LEU A C   
898  O O   . LEU A 114 ? 0.3595 0.3778 0.3047 -0.0201 -0.0457 0.0099  115 LEU A O   
899  C CB  . LEU A 114 ? 0.3916 0.4091 0.3267 -0.0476 -0.0431 0.0198  115 LEU A CB  
900  C CG  . LEU A 114 ? 0.4650 0.4776 0.3895 -0.0634 -0.0428 0.0259  115 LEU A CG  
901  C CD1 . LEU A 114 ? 0.4421 0.4836 0.3783 -0.0759 -0.0362 0.0237  115 LEU A CD1 
902  C CD2 . LEU A 114 ? 0.4737 0.4829 0.3929 -0.0588 -0.0416 0.0303  115 LEU A CD2 
903  N N   . VAL A 115 ? 0.3398 0.3452 0.2787 -0.0093 -0.0456 0.0154  116 VAL A N   
904  C CA  . VAL A 115 ? 0.3402 0.3587 0.2893 0.0033  -0.0427 0.0122  116 VAL A CA  
905  C C   . VAL A 115 ? 0.3554 0.3918 0.3150 0.0048  -0.0379 0.0142  116 VAL A C   
906  O O   . VAL A 115 ? 0.3717 0.4035 0.3278 0.0060  -0.0385 0.0177  116 VAL A O   
907  C CB  . VAL A 115 ? 0.3758 0.3798 0.3186 0.0157  -0.0457 0.0107  116 VAL A CB  
908  C CG1 . VAL A 115 ? 0.2341 0.2547 0.1870 0.0261  -0.0418 0.0081  116 VAL A CG1 
909  C CG2 . VAL A 115 ? 0.3157 0.2984 0.2461 0.0147  -0.0510 0.0071  116 VAL A CG2 
910  N N   . TRP A 116 ? 0.2501 0.3055 0.2221 0.0052  -0.0341 0.0119  117 TRP A N   
911  C CA  . TRP A 116 ? 0.2483 0.3189 0.2302 0.0062  -0.0299 0.0124  117 TRP A CA  
912  C C   . TRP A 116 ? 0.2657 0.3404 0.2530 0.0166  -0.0291 0.0127  117 TRP A C   
913  O O   . TRP A 116 ? 0.2748 0.3509 0.2640 0.0219  -0.0297 0.0114  117 TRP A O   
914  C CB  . TRP A 116 ? 0.2553 0.3429 0.2485 0.0018  -0.0270 0.0093  117 TRP A CB  
915  C CG  . TRP A 116 ? 0.2546 0.3558 0.2583 0.0045  -0.0231 0.0080  117 TRP A CG  
916  C CD1 . TRP A 116 ? 0.2244 0.3344 0.2389 0.0110  -0.0225 0.0064  117 TRP A CD1 
917  C CD2 . TRP A 116 ? 0.2280 0.3331 0.2305 0.0002  -0.0199 0.0079  117 TRP A CD2 
918  N NE1 . TRP A 116 ? 0.1938 0.3112 0.2145 0.0116  -0.0195 0.0046  117 TRP A NE1 
919  C CE2 . TRP A 116 ? 0.2114 0.3272 0.2248 0.0051  -0.0174 0.0048  117 TRP A CE2 
920  C CE3 . TRP A 116 ? 0.2232 0.3226 0.2147 -0.0078 -0.0195 0.0103  117 TRP A CE3 
921  C CZ2 . TRP A 116 ? 0.2342 0.3556 0.2480 0.0026  -0.0140 0.0026  117 TRP A CZ2 
922  C CZ3 . TRP A 116 ? 0.2620 0.3688 0.2531 -0.0109 -0.0159 0.0090  117 TRP A CZ3 
923  C CH2 . TRP A 116 ? 0.2319 0.3500 0.2343 -0.0054 -0.0130 0.0044  117 TRP A CH2 
924  N N   . ILE A 117 ? 0.2505 0.3280 0.2394 0.0181  -0.0279 0.0146  118 ILE A N   
925  C CA  . ILE A 117 ? 0.2298 0.3140 0.2253 0.0252  -0.0270 0.0153  118 ILE A CA  
926  C C   . ILE A 117 ? 0.2516 0.3464 0.2552 0.0224  -0.0242 0.0142  118 ILE A C   
927  O O   . ILE A 117 ? 0.2645 0.3594 0.2651 0.0181  -0.0237 0.0145  118 ILE A O   
928  C CB  . ILE A 117 ? 0.2923 0.3706 0.2834 0.0303  -0.0294 0.0178  118 ILE A CB  
929  C CG1 . ILE A 117 ? 0.3104 0.3754 0.2930 0.0346  -0.0326 0.0173  118 ILE A CG1 
930  C CG2 . ILE A 117 ? 0.2121 0.3014 0.2117 0.0359  -0.0280 0.0186  118 ILE A CG2 
931  C CD1 . ILE A 117 ? 0.3025 0.3629 0.2831 0.0425  -0.0357 0.0189  118 ILE A CD1 
932  N N   . TYR A 118 ? 0.2387 0.3409 0.2510 0.0249  -0.0230 0.0130  119 TYR A N   
933  C CA  . TYR A 118 ? 0.1705 0.2797 0.1904 0.0232  -0.0211 0.0106  119 TYR A CA  
934  C C   . TYR A 118 ? 0.2090 0.3185 0.2292 0.0239  -0.0213 0.0121  119 TYR A C   
935  O O   . TYR A 118 ? 0.2680 0.3765 0.2866 0.0270  -0.0228 0.0155  119 TYR A O   
936  C CB  . TYR A 118 ? 0.2139 0.3277 0.2428 0.0262  -0.0215 0.0095  119 TYR A CB  
937  C CG  . TYR A 118 ? 0.2107 0.3231 0.2397 0.0305  -0.0232 0.0135  119 TYR A CG  
938  C CD1 . TYR A 118 ? 0.2008 0.3136 0.2319 0.0314  -0.0232 0.0160  119 TYR A CD1 
939  C CD2 . TYR A 118 ? 0.2011 0.3127 0.2274 0.0323  -0.0248 0.0146  119 TYR A CD2 
940  C CE1 . TYR A 118 ? 0.2282 0.3423 0.2589 0.0335  -0.0239 0.0202  119 TYR A CE1 
941  C CE2 . TYR A 118 ? 0.2197 0.3318 0.2442 0.0352  -0.0256 0.0182  119 TYR A CE2 
942  C CZ  . TYR A 118 ? 0.2024 0.3164 0.2293 0.0355  -0.0247 0.0213  119 TYR A CZ  
943  O OH  . TYR A 118 ? 0.2206 0.3374 0.2450 0.0366  -0.0245 0.0253  119 TYR A OH  
944  N N   . GLY A 119 ? 0.1688 0.2816 0.1918 0.0210  -0.0198 0.0087  120 GLY A N   
945  C CA  . GLY A 119 ? 0.1959 0.3092 0.2198 0.0205  -0.0207 0.0091  120 GLY A CA  
946  C C   . GLY A 119 ? 0.2296 0.3430 0.2620 0.0225  -0.0212 0.0080  120 GLY A C   
947  O O   . GLY A 119 ? 0.2230 0.3361 0.2603 0.0255  -0.0216 0.0085  120 GLY A O   
948  N N   . GLY A 120 ? 0.2192 0.3319 0.2524 0.0201  -0.0221 0.0069  121 GLY A N   
949  C CA  . GLY A 120 ? 0.2128 0.3218 0.2522 0.0206  -0.0239 0.0069  121 GLY A CA  
950  C C   . GLY A 120 ? 0.2535 0.3635 0.2927 0.0173  -0.0263 0.0111  121 GLY A C   
951  O O   . GLY A 120 ? 0.2910 0.3990 0.3343 0.0165  -0.0280 0.0149  121 GLY A O   
952  N N   . GLY A 121 ? 0.2412 0.3554 0.2756 0.0147  -0.0268 0.0113  122 GLY A N   
953  C CA  . GLY A 121 ? 0.2367 0.3554 0.2725 0.0110  -0.0298 0.0145  122 GLY A CA  
954  C C   . GLY A 121 ? 0.2382 0.3646 0.2792 0.0125  -0.0301 0.0211  122 GLY A C   
955  O O   . GLY A 121 ? 0.1956 0.3278 0.2408 0.0081  -0.0322 0.0239  122 GLY A O   
956  N N   . PHE A 122 ? 0.1756 0.3036 0.2163 0.0178  -0.0279 0.0233  123 PHE A N   
957  C CA  . PHE A 122 ? 0.2086 0.3453 0.2529 0.0198  -0.0267 0.0283  123 PHE A CA  
958  C C   . PHE A 122 ? 0.2361 0.3714 0.2839 0.0155  -0.0268 0.0317  123 PHE A C   
959  O O   . PHE A 122 ? 0.2521 0.3968 0.3023 0.0148  -0.0253 0.0363  123 PHE A O   
960  C CB  . PHE A 122 ? 0.2037 0.3536 0.2518 0.0202  -0.0280 0.0306  123 PHE A CB  
961  C CG  . PHE A 122 ? 0.2315 0.3807 0.2753 0.0254  -0.0295 0.0291  123 PHE A CG  
962  C CD1 . PHE A 122 ? 0.2344 0.3814 0.2746 0.0325  -0.0279 0.0287  123 PHE A CD1 
963  C CD2 . PHE A 122 ? 0.2167 0.3656 0.2582 0.0225  -0.0332 0.0282  123 PHE A CD2 
964  C CE1 . PHE A 122 ? 0.2023 0.3444 0.2371 0.0368  -0.0306 0.0281  123 PHE A CE1 
965  C CE2 . PHE A 122 ? 0.1616 0.3075 0.1972 0.0265  -0.0359 0.0283  123 PHE A CE2 
966  C CZ  . PHE A 122 ? 0.1994 0.3408 0.2318 0.0337  -0.0349 0.0286  123 PHE A CZ  
967  N N   . TYR A 123 ? 0.1510 0.2745 0.1987 0.0125  -0.0287 0.0294  124 TYR A N   
968  C CA  . TYR A 123 ? 0.2694 0.3866 0.3188 0.0088  -0.0303 0.0335  124 TYR A CA  
969  C C   . TYR A 123 ? 0.2794 0.3858 0.3273 0.0133  -0.0311 0.0324  124 TYR A C   
970  O O   . TYR A 123 ? 0.2596 0.3587 0.3075 0.0112  -0.0336 0.0370  124 TYR A O   
971  C CB  . TYR A 123 ? 0.2355 0.3450 0.2867 0.0015  -0.0339 0.0324  124 TYR A CB  
972  C CG  . TYR A 123 ? 0.2375 0.3338 0.2875 0.0036  -0.0355 0.0241  124 TYR A CG  
973  C CD1 . TYR A 123 ? 0.2238 0.3054 0.2746 0.0062  -0.0379 0.0225  124 TYR A CD1 
974  C CD2 . TYR A 123 ? 0.2429 0.3420 0.2905 0.0035  -0.0348 0.0177  124 TYR A CD2 
975  C CE1 . TYR A 123 ? 0.2369 0.3092 0.2882 0.0096  -0.0385 0.0133  124 TYR A CE1 
976  C CE2 . TYR A 123 ? 0.2432 0.3331 0.2889 0.0052  -0.0349 0.0090  124 TYR A CE2 
977  C CZ  . TYR A 123 ? 0.2917 0.3692 0.3402 0.0088  -0.0363 0.0061  124 TYR A CZ  
978  O OH  . TYR A 123 ? 0.3063 0.3773 0.3546 0.0119  -0.0356 -0.0041 124 TYR A OH  
979  N N   . SER A 124 ? 0.2197 0.3255 0.2666 0.0188  -0.0296 0.0269  125 SER A N   
980  C CA  . SER A 124 ? 0.1977 0.2965 0.2459 0.0232  -0.0310 0.0248  125 SER A CA  
981  C C   . SER A 124 ? 0.2341 0.3386 0.2805 0.0272  -0.0283 0.0211  125 SER A C   
982  O O   . SER A 124 ? 0.2283 0.3385 0.2711 0.0268  -0.0260 0.0205  125 SER A O   
983  C CB  . SER A 124 ? 0.2050 0.2935 0.2573 0.0236  -0.0334 0.0190  125 SER A CB  
984  O OG  . SER A 124 ? 0.2408 0.3327 0.2921 0.0227  -0.0308 0.0119  125 SER A OG  
985  N N   . GLY A 125 ? 0.2139 0.3164 0.2631 0.0310  -0.0295 0.0189  126 GLY A N   
986  C CA  . GLY A 125 ? 0.2162 0.3241 0.2643 0.0329  -0.0276 0.0155  126 GLY A CA  
987  C C   . GLY A 125 ? 0.2159 0.3251 0.2619 0.0351  -0.0295 0.0190  126 GLY A C   
988  O O   . GLY A 125 ? 0.2330 0.3406 0.2757 0.0348  -0.0310 0.0249  126 GLY A O   
989  N N   . ALA A 126 ? 0.2270 0.3401 0.2742 0.0363  -0.0294 0.0155  127 ALA A N   
990  C CA  . ALA A 126 ? 0.2465 0.3612 0.2907 0.0376  -0.0320 0.0179  127 ALA A CA  
991  C C   . ALA A 126 ? 0.2824 0.4021 0.3269 0.0360  -0.0310 0.0133  127 ALA A C   
992  O O   . ALA A 126 ? 0.2154 0.3397 0.2661 0.0348  -0.0291 0.0084  127 ALA A O   
993  C CB  . ALA A 126 ? 0.2042 0.3172 0.2541 0.0407  -0.0373 0.0204  127 ALA A CB  
994  N N   . SER A 127 ? 0.2219 0.3410 0.2587 0.0351  -0.0321 0.0145  128 SER A N   
995  C CA  . SER A 127 ? 0.2231 0.3452 0.2590 0.0317  -0.0322 0.0107  128 SER A CA  
996  C C   . SER A 127 ? 0.2602 0.3914 0.3064 0.0322  -0.0357 0.0086  128 SER A C   
997  O O   . SER A 127 ? 0.2334 0.3707 0.2816 0.0278  -0.0357 0.0053  128 SER A O   
998  C CB  . SER A 127 ? 0.2149 0.3306 0.2383 0.0306  -0.0331 0.0115  128 SER A CB  
999  O OG  . SER A 127 ? 0.2853 0.4016 0.3052 0.0329  -0.0367 0.0139  128 SER A OG  
1000 N N   . SER A 128 ? 0.2096 0.3421 0.2628 0.0371  -0.0393 0.0107  129 SER A N   
1001 C CA  . SER A 128 ? 0.2074 0.3493 0.2721 0.0396  -0.0443 0.0091  129 SER A CA  
1002 C C   . SER A 128 ? 0.2291 0.3796 0.3092 0.0426  -0.0424 0.0034  129 SER A C   
1003 O O   . SER A 128 ? 0.2548 0.4166 0.3478 0.0460  -0.0461 0.0006  129 SER A O   
1004 C CB  . SER A 128 ? 0.2289 0.3660 0.2919 0.0441  -0.0510 0.0152  129 SER A CB  
1005 O OG  . SER A 128 ? 0.2497 0.3772 0.3116 0.0466  -0.0505 0.0190  129 SER A OG  
1006 N N   . LEU A 129 ? 0.2300 0.3768 0.3095 0.0420  -0.0369 0.0009  130 LEU A N   
1007 C CA  . LEU A 129 ? 0.2479 0.4030 0.3401 0.0449  -0.0341 -0.0064 130 LEU A CA  
1008 C C   . LEU A 129 ? 0.2177 0.3913 0.3190 0.0418  -0.0320 -0.0122 130 LEU A C   
1009 O O   . LEU A 129 ? 0.2354 0.4115 0.3289 0.0338  -0.0300 -0.0111 130 LEU A O   
1010 C CB  . LEU A 129 ? 0.2089 0.3581 0.2948 0.0419  -0.0281 -0.0087 130 LEU A CB  
1011 C CG  . LEU A 129 ? 0.2659 0.3998 0.3441 0.0430  -0.0297 -0.0035 130 LEU A CG  
1012 C CD1 . LEU A 129 ? 0.1888 0.3193 0.2633 0.0404  -0.0251 -0.0071 130 LEU A CD1 
1013 C CD2 . LEU A 129 ? 0.3123 0.4396 0.3973 0.0498  -0.0360 -0.0010 130 LEU A CD2 
1014 N N   . ASP A 130 ? 0.1912 0.3778 0.3095 0.0481  -0.0327 -0.0185 131 ASP A N   
1015 C CA  . ASP A 130 ? 0.2792 0.4890 0.4097 0.0450  -0.0302 -0.0246 131 ASP A CA  
1016 C C   . ASP A 130 ? 0.2978 0.5136 0.4206 0.0343  -0.0214 -0.0277 131 ASP A C   
1017 O O   . ASP A 130 ? 0.2958 0.5254 0.4202 0.0259  -0.0196 -0.0286 131 ASP A O   
1018 C CB  . ASP A 130 ? 0.2136 0.4382 0.3654 0.0555  -0.0311 -0.0329 131 ASP A CB  
1019 C CG  . ASP A 130 ? 0.3155 0.5354 0.4762 0.0659  -0.0419 -0.0290 131 ASP A CG  
1020 O OD1 . ASP A 130 ? 0.3190 0.5308 0.4704 0.0630  -0.0481 -0.0205 131 ASP A OD1 
1021 O OD2 . ASP A 130 ? 0.4013 0.6247 0.5772 0.0773  -0.0446 -0.0345 131 ASP A OD2 
1022 N N   . VAL A 131 ? 0.2242 0.4293 0.3375 0.0332  -0.0165 -0.0286 132 VAL A N   
1023 C CA  . VAL A 131 ? 0.2383 0.4485 0.3426 0.0231  -0.0089 -0.0308 132 VAL A CA  
1024 C C   . VAL A 131 ? 0.1886 0.3865 0.2757 0.0135  -0.0100 -0.0230 132 VAL A C   
1025 O O   . VAL A 131 ? 0.2336 0.4347 0.3121 0.0034  -0.0053 -0.0230 132 VAL A O   
1026 C CB  . VAL A 131 ? 0.3052 0.5087 0.4054 0.0259  -0.0047 -0.0351 132 VAL A CB  
1027 C CG1 . VAL A 131 ? 0.3095 0.4899 0.3956 0.0265  -0.0082 -0.0277 132 VAL A CG1 
1028 C CG2 . VAL A 131 ? 0.3471 0.5624 0.4417 0.0168  0.0036  -0.0400 132 VAL A CG2 
1029 N N   . TYR A 132 ? 0.1887 0.3725 0.2697 0.0163  -0.0162 -0.0165 133 TYR A N   
1030 C CA  . TYR A 132 ? 0.2140 0.3853 0.2798 0.0094  -0.0180 -0.0107 133 TYR A CA  
1031 C C   . TYR A 132 ? 0.2333 0.4105 0.3017 0.0055  -0.0222 -0.0100 133 TYR A C   
1032 O O   . TYR A 132 ? 0.2766 0.4405 0.3325 0.0023  -0.0255 -0.0060 133 TYR A O   
1033 C CB  . TYR A 132 ? 0.1940 0.3470 0.2497 0.0148  -0.0211 -0.0053 133 TYR A CB  
1034 C CG  . TYR A 132 ? 0.2450 0.3922 0.2988 0.0182  -0.0185 -0.0054 133 TYR A CG  
1035 C CD1 . TYR A 132 ? 0.2011 0.3526 0.2531 0.0139  -0.0135 -0.0089 133 TYR A CD1 
1036 C CD2 . TYR A 132 ? 0.1983 0.3365 0.2511 0.0245  -0.0212 -0.0020 133 TYR A CD2 
1037 C CE1 . TYR A 132 ? 0.2035 0.3495 0.2529 0.0163  -0.0121 -0.0095 133 TYR A CE1 
1038 C CE2 . TYR A 132 ? 0.2053 0.3387 0.2568 0.0261  -0.0197 -0.0021 133 TYR A CE2 
1039 C CZ  . TYR A 132 ? 0.2285 0.3654 0.2784 0.0223  -0.0155 -0.0061 133 TYR A CZ  
1040 O OH  . TYR A 132 ? 0.2635 0.3953 0.3111 0.0231  -0.0149 -0.0067 133 TYR A OH  
1041 N N   . ASP A 133 ? 0.2151 0.4124 0.2998 0.0063  -0.0227 -0.0145 134 ASP A N   
1042 C CA  . ASP A 133 ? 0.2782 0.4845 0.3673 0.0016  -0.0276 -0.0143 134 ASP A CA  
1043 C C   . ASP A 133 ? 0.2942 0.4970 0.3715 -0.0126 -0.0258 -0.0128 134 ASP A C   
1044 O O   . ASP A 133 ? 0.2620 0.4774 0.3423 -0.0210 -0.0200 -0.0154 134 ASP A O   
1045 C CB  . ASP A 133 ? 0.2905 0.5237 0.4026 0.0053  -0.0279 -0.0201 134 ASP A CB  
1046 C CG  . ASP A 133 ? 0.3003 0.5449 0.4195 0.0021  -0.0351 -0.0196 134 ASP A CG  
1047 O OD1 . ASP A 133 ? 0.2454 0.4780 0.3503 -0.0062 -0.0384 -0.0158 134 ASP A OD1 
1048 O OD2 . ASP A 133 ? 0.3236 0.5896 0.4631 0.0081  -0.0379 -0.0235 134 ASP A OD2 
1049 N N   . GLY A 134 ? 0.2408 0.4258 0.3037 -0.0158 -0.0309 -0.0089 135 GLY A N   
1050 C CA  . GLY A 134 ? 0.2564 0.4304 0.3050 -0.0286 -0.0308 -0.0069 135 GLY A CA  
1051 C C   . GLY A 134 ? 0.2889 0.4781 0.3438 -0.0412 -0.0327 -0.0087 135 GLY A C   
1052 O O   . GLY A 134 ? 0.3329 0.5111 0.3750 -0.0539 -0.0332 -0.0065 135 GLY A O   
1053 N N   . ARG A 135 ? 0.2566 0.4712 0.3313 -0.0386 -0.0343 -0.0124 136 ARG A N   
1054 C CA  . ARG A 135 ? 0.2662 0.4970 0.3480 -0.0506 -0.0379 -0.0139 136 ARG A CA  
1055 C C   . ARG A 135 ? 0.2752 0.5217 0.3601 -0.0658 -0.0310 -0.0150 136 ARG A C   
1056 O O   . ARG A 135 ? 0.2537 0.5023 0.3346 -0.0812 -0.0336 -0.0139 136 ARG A O   
1057 C CB  . ARG A 135 ? 0.2253 0.4815 0.3294 -0.0423 -0.0426 -0.0174 136 ARG A CB  
1058 C CG  . ARG A 135 ? 0.2771 0.5641 0.4048 -0.0377 -0.0362 -0.0228 136 ARG A CG  
1059 C CD  . ARG A 135 ? 0.2409 0.5513 0.3914 -0.0281 -0.0429 -0.0260 136 ARG A CD  
1060 N NE  . ARG A 135 ? 0.3004 0.5953 0.4490 -0.0117 -0.0479 -0.0237 136 ARG A NE  
1061 C CZ  . ARG A 135 ? 0.3513 0.6554 0.5124 -0.0020 -0.0569 -0.0234 136 ARG A CZ  
1062 N NH1 . ARG A 135 ? 0.3160 0.6467 0.4941 -0.0062 -0.0623 -0.0260 136 ARG A NH1 
1063 N NH2 . ARG A 135 ? 0.3592 0.6462 0.5154 0.0109  -0.0611 -0.0199 136 ARG A NH2 
1064 N N   . PHE A 136 ? 0.2163 0.4738 0.3069 -0.0632 -0.0223 -0.0171 137 PHE A N   
1065 C CA  . PHE A 136 ? 0.2751 0.5518 0.3683 -0.0786 -0.0147 -0.0183 137 PHE A CA  
1066 C C   . PHE A 136 ? 0.2675 0.5172 0.3348 -0.0926 -0.0140 -0.0115 137 PHE A C   
1067 O O   . PHE A 136 ? 0.2981 0.5544 0.3613 -0.1111 -0.0129 -0.0094 137 PHE A O   
1068 C CB  . PHE A 136 ? 0.2010 0.4998 0.3077 -0.0711 -0.0053 -0.0243 137 PHE A CB  
1069 C CG  . PHE A 136 ? 0.2095 0.5272 0.3398 -0.0538 -0.0072 -0.0307 137 PHE A CG  
1070 C CD1 . PHE A 136 ? 0.2803 0.6326 0.4351 -0.0543 -0.0080 -0.0363 137 PHE A CD1 
1071 C CD2 . PHE A 136 ? 0.2330 0.5337 0.3613 -0.0371 -0.0091 -0.0308 137 PHE A CD2 
1072 C CE1 . PHE A 136 ? 0.2773 0.6445 0.4540 -0.0368 -0.0115 -0.0417 137 PHE A CE1 
1073 C CE2 . PHE A 136 ? 0.2431 0.5565 0.3912 -0.0214 -0.0122 -0.0356 137 PHE A CE2 
1074 C CZ  . PHE A 136 ? 0.2615 0.6071 0.4336 -0.0203 -0.0138 -0.0410 137 PHE A CZ  
1075 N N   . LEU A 137 ? 0.2452 0.4650 0.2954 -0.0845 -0.0153 -0.0077 138 LEU A N   
1076 C CA  . LEU A 137 ? 0.2901 0.4803 0.3155 -0.0948 -0.0170 -0.0008 138 LEU A CA  
1077 C C   . LEU A 137 ? 0.3018 0.4753 0.3172 -0.1055 -0.0252 0.0020  138 LEU A C   
1078 O O   . LEU A 137 ? 0.3419 0.5057 0.3443 -0.1228 -0.0259 0.0065  138 LEU A O   
1079 C CB  . LEU A 137 ? 0.3137 0.4773 0.3266 -0.0810 -0.0187 0.0019  138 LEU A CB  
1080 C CG  . LEU A 137 ? 0.3498 0.5107 0.3544 -0.0816 -0.0127 0.0041  138 LEU A CG  
1081 C CD1 . LEU A 137 ? 0.2992 0.4387 0.2961 -0.0668 -0.0155 0.0059  138 LEU A CD1 
1082 C CD2 . LEU A 137 ? 0.3049 0.4535 0.2910 -0.0998 -0.0128 0.0105  138 LEU A CD2 
1083 N N   . VAL A 138 ? 0.3062 0.4746 0.3258 -0.0959 -0.0319 -0.0005 139 VAL A N   
1084 C CA  . VAL A 138 ? 0.3386 0.4888 0.3469 -0.1046 -0.0404 0.0006  139 VAL A CA  
1085 C C   . VAL A 138 ? 0.3573 0.5296 0.3745 -0.1237 -0.0407 -0.0002 139 VAL A C   
1086 O O   . VAL A 138 ? 0.3991 0.5538 0.4015 -0.1401 -0.0449 0.0032  139 VAL A O   
1087 C CB  . VAL A 138 ? 0.3239 0.4693 0.3352 -0.0903 -0.0466 -0.0028 139 VAL A CB  
1088 C CG1 . VAL A 138 ? 0.2687 0.4022 0.2712 -0.1004 -0.0554 -0.0039 139 VAL A CG1 
1089 C CG2 . VAL A 138 ? 0.3083 0.4286 0.3072 -0.0751 -0.0465 -0.0012 139 VAL A CG2 
1090 N N   . GLN A 139 ? 0.2769 0.4883 0.3189 -0.1221 -0.0365 -0.0047 140 GLN A N   
1091 C CA  . GLN A 139 ? 0.3091 0.5477 0.3631 -0.1400 -0.0366 -0.0060 140 GLN A CA  
1092 C C   . GLN A 139 ? 0.3942 0.6389 0.4416 -0.1585 -0.0288 -0.0021 140 GLN A C   
1093 O O   . GLN A 139 ? 0.3729 0.6166 0.4136 -0.1797 -0.0312 0.0010  140 GLN A O   
1094 C CB  . GLN A 139 ? 0.3139 0.5946 0.3987 -0.1308 -0.0350 -0.0126 140 GLN A CB  
1095 C CG  . GLN A 139 ? 0.5578 0.8690 0.6585 -0.1469 -0.0382 -0.0148 140 GLN A CG  
1096 C CD  . GLN A 139 ? 0.6883 1.0276 0.7968 -0.1644 -0.0283 -0.0147 140 GLN A CD  
1097 O OE1 . GLN A 139 ? 0.7832 1.1254 0.8864 -0.1868 -0.0300 -0.0117 140 GLN A OE1 
1098 N NE2 . GLN A 139 ? 0.6921 1.0517 0.8121 -0.1550 -0.0179 -0.0182 140 GLN A NE2 
1099 N N   . ALA A 140 ? 0.3930 0.6426 0.4400 -0.1520 -0.0198 -0.0020 141 ALA A N   
1100 C CA  . ALA A 140 ? 0.3962 0.6541 0.4352 -0.1700 -0.0118 0.0019  141 ALA A CA  
1101 C C   . ALA A 140 ? 0.4150 0.6304 0.4230 -0.1837 -0.0172 0.0114  141 ALA A C   
1102 O O   . ALA A 140 ? 0.4401 0.6575 0.4390 -0.2066 -0.0158 0.0165  141 ALA A O   
1103 C CB  . ALA A 140 ? 0.3113 0.5830 0.3550 -0.1590 -0.0015 -0.0011 141 ALA A CB  
1104 N N   . GLU A 141 ? 0.3948 0.5716 0.3863 -0.1703 -0.0237 0.0140  142 GLU A N   
1105 C CA  . GLU A 141 ? 0.4575 0.5927 0.4203 -0.1791 -0.0288 0.0226  142 GLU A CA  
1106 C C   . GLU A 141 ? 0.4716 0.5697 0.4205 -0.1768 -0.0407 0.0235  142 GLU A C   
1107 O O   . GLU A 141 ? 0.4821 0.5423 0.4072 -0.1828 -0.0466 0.0301  142 GLU A O   
1108 C CB  . GLU A 141 ? 0.4641 0.5850 0.4167 -0.1661 -0.0255 0.0254  142 GLU A CB  
1109 C CG  . GLU A 141 ? 0.4130 0.5647 0.3725 -0.1714 -0.0140 0.0248  142 GLU A CG  
1110 C CD  . GLU A 141 ? 0.4609 0.6125 0.4053 -0.1974 -0.0115 0.0325  142 GLU A CD  
1111 O OE1 . GLU A 141 ? 0.4831 0.6711 0.4379 -0.2074 -0.0012 0.0300  142 GLU A OE1 
1112 O OE2 . GLU A 141 ? 0.4484 0.5632 0.3700 -0.2080 -0.0200 0.0411  142 GLU A OE2 
1113 N N   . ARG A 142 ? 0.4786 0.5858 0.4404 -0.1682 -0.0449 0.0168  143 ARG A N   
1114 C CA  . ARG A 142 ? 0.5067 0.5831 0.4554 -0.1685 -0.0558 0.0156  143 ARG A CA  
1115 C C   . ARG A 142 ? 0.4877 0.5226 0.4164 -0.1541 -0.0604 0.0176  143 ARG A C   
1116 O O   . ARG A 142 ? 0.5859 0.5839 0.4941 -0.1604 -0.0684 0.0200  143 ARG A O   
1117 C CB  . ARG A 142 ? 0.5342 0.6009 0.4725 -0.1944 -0.0612 0.0193  143 ARG A CB  
1118 C CG  . ARG A 142 ? 0.7000 0.8115 0.6605 -0.2093 -0.0574 0.0166  143 ARG A CG  
1119 C CD  . ARG A 142 ? 0.8573 0.9973 0.8410 -0.1936 -0.0582 0.0082  143 ARG A CD  
1120 N NE  . ARG A 142 ? 0.9794 1.1681 0.9890 -0.2039 -0.0538 0.0052  143 ARG A NE  
1121 C CZ  . ARG A 142 ? 1.0804 1.2842 1.0986 -0.2177 -0.0601 0.0028  143 ARG A CZ  
1122 N NH1 . ARG A 142 ? 1.1494 1.3207 1.1501 -0.2232 -0.0713 0.0026  143 ARG A NH1 
1123 N NH2 . ARG A 142 ? 1.0815 1.3339 1.1263 -0.2254 -0.0555 -0.0002 143 ARG A NH2 
1124 N N   . THR A 143 ? 0.4302 0.4713 0.3655 -0.1347 -0.0555 0.0161  144 THR A N   
1125 C CA  . THR A 143 ? 0.4188 0.4295 0.3413 -0.1177 -0.0594 0.0159  144 THR A CA  
1126 C C   . THR A 143 ? 0.4141 0.4329 0.3463 -0.1014 -0.0608 0.0088  144 THR A C   
1127 O O   . THR A 143 ? 0.3978 0.4445 0.3464 -0.1024 -0.0595 0.0049  144 THR A O   
1128 C CB  . THR A 143 ? 0.4887 0.5003 0.4104 -0.1086 -0.0537 0.0200  144 THR A CB  
1129 O OG1 . THR A 143 ? 0.5079 0.5544 0.4505 -0.1001 -0.0459 0.0164  144 THR A OG1 
1130 C CG2 . THR A 143 ? 0.5099 0.5147 0.4198 -0.1260 -0.0524 0.0279  144 THR A CG2 
1131 N N   . VAL A 144 ? 0.4214 0.4165 0.3432 -0.0865 -0.0638 0.0072  145 VAL A N   
1132 C CA  . VAL A 144 ? 0.4103 0.4140 0.3395 -0.0698 -0.0632 0.0018  145 VAL A CA  
1133 C C   . VAL A 144 ? 0.4256 0.4410 0.3635 -0.0564 -0.0566 0.0039  145 VAL A C   
1134 O O   . VAL A 144 ? 0.4406 0.4414 0.3705 -0.0540 -0.0558 0.0079  145 VAL A O   
1135 C CB  . VAL A 144 ? 0.3965 0.3703 0.3091 -0.0622 -0.0698 -0.0026 145 VAL A CB  
1136 C CG1 . VAL A 144 ? 0.3489 0.3341 0.2675 -0.0461 -0.0681 -0.0075 145 VAL A CG1 
1137 C CG2 . VAL A 144 ? 0.3618 0.3225 0.2647 -0.0770 -0.0772 -0.0054 145 VAL A CG2 
1138 N N   . LEU A 145 ? 0.3987 0.4395 0.3527 -0.0485 -0.0529 0.0017  146 LEU A N   
1139 C CA  . LEU A 145 ? 0.3107 0.3628 0.2736 -0.0370 -0.0471 0.0032  146 LEU A CA  
1140 C C   . LEU A 145 ? 0.3265 0.3781 0.2904 -0.0226 -0.0479 0.0006  146 LEU A C   
1141 O O   . LEU A 145 ? 0.3318 0.3920 0.2996 -0.0218 -0.0505 -0.0023 146 LEU A O   
1142 C CB  . LEU A 145 ? 0.3762 0.4577 0.3571 -0.0405 -0.0418 0.0030  146 LEU A CB  
1143 C CG  . LEU A 145 ? 0.5168 0.6099 0.5070 -0.0312 -0.0359 0.0038  146 LEU A CG  
1144 C CD1 . LEU A 145 ? 0.6264 0.7242 0.6235 -0.0174 -0.0361 0.0025  146 LEU A CD1 
1145 C CD2 . LEU A 145 ? 0.5637 0.6401 0.5418 -0.0307 -0.0348 0.0076  146 LEU A CD2 
1146 N N   . VAL A 146 ? 0.3268 0.3703 0.2872 -0.0123 -0.0458 0.0020  147 VAL A N   
1147 C CA  . VAL A 146 ? 0.2872 0.3337 0.2492 0.0003  -0.0449 0.0004  147 VAL A CA  
1148 C C   . VAL A 146 ? 0.3039 0.3640 0.2770 0.0063  -0.0399 0.0033  147 VAL A C   
1149 O O   . VAL A 146 ? 0.3046 0.3625 0.2776 0.0044  -0.0378 0.0059  147 VAL A O   
1150 C CB  . VAL A 146 ? 0.3222 0.3476 0.2702 0.0078  -0.0473 -0.0018 147 VAL A CB  
1151 C CG1 . VAL A 146 ? 0.2634 0.2963 0.2127 0.0190  -0.0452 -0.0039 147 VAL A CG1 
1152 C CG2 . VAL A 146 ? 0.3119 0.3184 0.2467 0.0008  -0.0531 -0.0055 147 VAL A CG2 
1153 N N   . SER A 147 ? 0.2950 0.3678 0.2759 0.0126  -0.0386 0.0031  148 SER A N   
1154 C CA  . SER A 147 ? 0.3063 0.3876 0.2953 0.0188  -0.0348 0.0056  148 SER A CA  
1155 C C   . SER A 147 ? 0.3419 0.4253 0.3292 0.0266  -0.0347 0.0060  148 SER A C   
1156 O O   . SER A 147 ? 0.3193 0.4034 0.3027 0.0267  -0.0373 0.0044  148 SER A O   
1157 C CB  . SER A 147 ? 0.2763 0.3732 0.2791 0.0161  -0.0329 0.0060  148 SER A CB  
1158 O OG  . SER A 147 ? 0.2892 0.3958 0.2987 0.0167  -0.0355 0.0051  148 SER A OG  
1159 N N   . MET A 148 ? 0.2863 0.3718 0.2758 0.0322  -0.0317 0.0082  149 MET A N   
1160 C CA  . MET A 148 ? 0.3045 0.3947 0.2925 0.0379  -0.0305 0.0092  149 MET A CA  
1161 C C   . MET A 148 ? 0.3238 0.4239 0.3216 0.0388  -0.0283 0.0133  149 MET A C   
1162 O O   . MET A 148 ? 0.2512 0.3527 0.2556 0.0371  -0.0272 0.0142  149 MET A O   
1163 C CB  . MET A 148 ? 0.1861 0.2701 0.1661 0.0442  -0.0290 0.0072  149 MET A CB  
1164 C CG  . MET A 148 ? 0.2882 0.3763 0.2740 0.0480  -0.0264 0.0095  149 MET A CG  
1165 S SD  . MET A 148 ? 0.3408 0.4230 0.3299 0.0429  -0.0279 0.0112  149 MET A SD  
1166 C CE  . MET A 148 ? 0.3098 0.3727 0.2866 0.0426  -0.0318 0.0084  149 MET A CE  
1167 N N   . ASN A 149 ? 0.2646 0.3705 0.2619 0.0405  -0.0282 0.0159  150 ASN A N   
1168 C CA  . ASN A 149 ? 0.2407 0.3530 0.2443 0.0409  -0.0264 0.0204  150 ASN A CA  
1169 C C   . ASN A 149 ? 0.2425 0.3589 0.2436 0.0442  -0.0226 0.0209  150 ASN A C   
1170 O O   . ASN A 149 ? 0.2689 0.3847 0.2620 0.0478  -0.0213 0.0179  150 ASN A O   
1171 C CB  . ASN A 149 ? 0.2240 0.3397 0.2273 0.0398  -0.0288 0.0247  150 ASN A CB  
1172 C CG  . ASN A 149 ? 0.2837 0.3984 0.2959 0.0383  -0.0328 0.0253  150 ASN A CG  
1173 O OD1 . ASN A 149 ? 0.2783 0.3924 0.2962 0.0374  -0.0328 0.0213  150 ASN A OD1 
1174 N ND2 . ASN A 149 ? 0.2964 0.4116 0.3100 0.0381  -0.0362 0.0302  150 ASN A ND2 
1175 N N   . TYR A 150 ? 0.2423 0.3634 0.2508 0.0432  -0.0211 0.0237  151 TYR A N   
1176 C CA  . TYR A 150 ? 0.1922 0.3220 0.2019 0.0458  -0.0178 0.0246  151 TYR A CA  
1177 C C   . TYR A 150 ? 0.2099 0.3468 0.2264 0.0411  -0.0172 0.0302  151 TYR A C   
1178 O O   . TYR A 150 ? 0.2494 0.3808 0.2704 0.0374  -0.0197 0.0317  151 TYR A O   
1179 C CB  . TYR A 150 ? 0.1999 0.3272 0.2116 0.0491  -0.0181 0.0218  151 TYR A CB  
1180 C CG  . TYR A 150 ? 0.2286 0.3524 0.2459 0.0451  -0.0201 0.0228  151 TYR A CG  
1181 C CD1 . TYR A 150 ? 0.2164 0.3306 0.2311 0.0427  -0.0221 0.0205  151 TYR A CD1 
1182 C CD2 . TYR A 150 ? 0.2532 0.3846 0.2776 0.0427  -0.0197 0.0255  151 TYR A CD2 
1183 C CE1 . TYR A 150 ? 0.2133 0.3261 0.2315 0.0387  -0.0228 0.0204  151 TYR A CE1 
1184 C CE2 . TYR A 150 ? 0.2164 0.3441 0.2437 0.0388  -0.0215 0.0252  151 TYR A CE2 
1185 C CZ  . TYR A 150 ? 0.1991 0.3178 0.2229 0.0372  -0.0226 0.0224  151 TYR A CZ  
1186 O OH  . TYR A 150 ? 0.2016 0.3186 0.2268 0.0331  -0.0234 0.0212  151 TYR A OH  
1187 N N   . ARG A 151 ? 0.1984 0.3474 0.2154 0.0410  -0.0137 0.0326  152 ARG A N   
1188 C CA  . ARG A 151 ? 0.2087 0.3642 0.2308 0.0344  -0.0133 0.0388  152 ARG A CA  
1189 C C   . ARG A 151 ? 0.2281 0.3828 0.2590 0.0318  -0.0152 0.0388  152 ARG A C   
1190 O O   . ARG A 151 ? 0.2226 0.3806 0.2566 0.0356  -0.0149 0.0354  152 ARG A O   
1191 C CB  . ARG A 151 ? 0.2058 0.3786 0.2269 0.0336  -0.0082 0.0412  152 ARG A CB  
1192 C CG  . ARG A 151 ? 0.1712 0.3455 0.1809 0.0329  -0.0065 0.0429  152 ARG A CG  
1193 C CD  . ARG A 151 ? 0.2068 0.4019 0.2150 0.0329  0.0004  0.0432  152 ARG A CD  
1194 N NE  . ARG A 151 ? 0.2159 0.4170 0.2240 0.0433  0.0037  0.0343  152 ARG A NE  
1195 C CZ  . ARG A 151 ? 0.2564 0.4776 0.2659 0.0472  0.0102  0.0311  152 ARG A CZ  
1196 N NH1 . ARG A 151 ? 0.1872 0.4274 0.1982 0.0396  0.0151  0.0369  152 ARG A NH1 
1197 N NH2 . ARG A 151 ? 0.2204 0.4428 0.2297 0.0586  0.0118  0.0220  152 ARG A NH2 
1198 N N   . VAL A 152 ? 0.2065 0.3552 0.2403 0.0254  -0.0178 0.0425  153 VAL A N   
1199 C CA  . VAL A 152 ? 0.1914 0.3375 0.2317 0.0218  -0.0201 0.0417  153 VAL A CA  
1200 C C   . VAL A 152 ? 0.2587 0.4100 0.3026 0.0133  -0.0204 0.0478  153 VAL A C   
1201 O O   . VAL A 152 ? 0.2404 0.3961 0.2810 0.0097  -0.0190 0.0534  153 VAL A O   
1202 C CB  . VAL A 152 ? 0.2085 0.3395 0.2488 0.0222  -0.0234 0.0382  153 VAL A CB  
1203 C CG1 . VAL A 152 ? 0.1879 0.3161 0.2251 0.0280  -0.0228 0.0328  153 VAL A CG1 
1204 C CG2 . VAL A 152 ? 0.1758 0.2976 0.2144 0.0206  -0.0261 0.0416  153 VAL A CG2 
1205 N N   . GLY A 153 ? 0.2507 0.4014 0.3000 0.0088  -0.0227 0.0469  154 GLY A N   
1206 C CA  . GLY A 153 ? 0.2185 0.3726 0.2712 -0.0012 -0.0240 0.0524  154 GLY A CA  
1207 C C   . GLY A 153 ? 0.2501 0.4271 0.3063 -0.0038 -0.0196 0.0566  154 GLY A C   
1208 O O   . GLY A 153 ? 0.2403 0.4318 0.2993 0.0034  -0.0162 0.0533  154 GLY A O   
1209 N N   . ALA A 154 ? 0.2224 0.4027 0.2785 -0.0143 -0.0195 0.0640  155 ALA A N   
1210 C CA  . ALA A 154 ? 0.2277 0.4340 0.2882 -0.0187 -0.0142 0.0681  155 ALA A CA  
1211 C C   . ALA A 154 ? 0.2688 0.4860 0.3242 -0.0099 -0.0082 0.0662  155 ALA A C   
1212 O O   . ALA A 154 ? 0.2542 0.4950 0.3157 -0.0056 -0.0030 0.0637  155 ALA A O   
1213 C CB  . ALA A 154 ? 0.2125 0.4180 0.2709 -0.0339 -0.0152 0.0776  155 ALA A CB  
1214 N N   . PHE A 155 ? 0.1755 0.3762 0.2201 -0.0065 -0.0092 0.0667  156 PHE A N   
1215 C CA  . PHE A 155 ? 0.2736 0.4826 0.3108 0.0006  -0.0042 0.0645  156 PHE A CA  
1216 C C   . PHE A 155 ? 0.2320 0.4464 0.2728 0.0134  -0.0023 0.0552  156 PHE A C   
1217 O O   . PHE A 155 ? 0.2183 0.4455 0.2561 0.0198  0.0029  0.0516  156 PHE A O   
1218 C CB  . PHE A 155 ? 0.2383 0.4278 0.2635 0.0013  -0.0076 0.0668  156 PHE A CB  
1219 C CG  . PHE A 155 ? 0.3056 0.4819 0.3272 -0.0096 -0.0125 0.0760  156 PHE A CG  
1220 C CD1 . PHE A 155 ? 0.3266 0.4822 0.3518 -0.0104 -0.0194 0.0756  156 PHE A CD1 
1221 C CD2 . PHE A 155 ? 0.2405 0.4251 0.2546 -0.0194 -0.0101 0.0851  156 PHE A CD2 
1222 C CE1 . PHE A 155 ? 0.2500 0.3900 0.2719 -0.0195 -0.0250 0.0836  156 PHE A CE1 
1223 C CE2 . PHE A 155 ? 0.2763 0.4452 0.2857 -0.0303 -0.0159 0.0949  156 PHE A CE2 
1224 C CZ  . PHE A 155 ? 0.3055 0.4505 0.3192 -0.0297 -0.0239 0.0940  156 PHE A CZ  
1225 N N   . GLY A 156 ? 0.1855 0.3891 0.2312 0.0170  -0.0066 0.0512  157 GLY A N   
1226 C CA  . GLY A 156 ? 0.2020 0.4067 0.2493 0.0279  -0.0064 0.0439  157 GLY A CA  
1227 C C   . GLY A 156 ? 0.2140 0.4348 0.2728 0.0300  -0.0065 0.0424  157 GLY A C   
1228 O O   . GLY A 156 ? 0.2663 0.4929 0.3271 0.0401  -0.0057 0.0374  157 GLY A O   
1229 N N   . PHE A 157 ? 0.1944 0.4216 0.2608 0.0208  -0.0085 0.0466  158 PHE A N   
1230 C CA  . PHE A 157 ? 0.2291 0.4692 0.3063 0.0225  -0.0110 0.0450  158 PHE A CA  
1231 C C   . PHE A 157 ? 0.2233 0.4845 0.3112 0.0122  -0.0103 0.0498  158 PHE A C   
1232 O O   . PHE A 157 ? 0.1905 0.4637 0.2884 0.0122  -0.0137 0.0489  158 PHE A O   
1233 C CB  . PHE A 157 ? 0.1573 0.3783 0.2316 0.0225  -0.0173 0.0427  158 PHE A CB  
1234 C CG  . PHE A 157 ? 0.1680 0.3720 0.2332 0.0314  -0.0180 0.0383  158 PHE A CG  
1235 C CD1 . PHE A 157 ? 0.1600 0.3451 0.2164 0.0295  -0.0183 0.0377  158 PHE A CD1 
1236 C CD2 . PHE A 157 ? 0.1866 0.3943 0.2527 0.0418  -0.0188 0.0348  158 PHE A CD2 
1237 C CE1 . PHE A 157 ? 0.1989 0.3707 0.2477 0.0359  -0.0189 0.0339  158 PHE A CE1 
1238 C CE2 . PHE A 157 ? 0.2398 0.4298 0.2962 0.0482  -0.0199 0.0314  158 PHE A CE2 
1239 C CZ  . PHE A 157 ? 0.2158 0.3891 0.2637 0.0443  -0.0196 0.0310  158 PHE A CZ  
1240 N N   . LEU A 158 ? 0.1533 0.4197 0.2393 0.0023  -0.0068 0.0554  159 LEU A N   
1241 C CA  . LEU A 158 ? 0.2015 0.4936 0.2986 -0.0080 -0.0048 0.0601  159 LEU A CA  
1242 C C   . LEU A 158 ? 0.2033 0.5263 0.3119 0.0020  0.0000  0.0558  159 LEU A C   
1243 O O   . LEU A 158 ? 0.2793 0.6066 0.3835 0.0122  0.0054  0.0519  159 LEU A O   
1244 C CB  . LEU A 158 ? 0.1891 0.4817 0.2795 -0.0206 -0.0012 0.0678  159 LEU A CB  
1245 C CG  . LEU A 158 ? 0.2567 0.5762 0.3581 -0.0347 0.0009  0.0738  159 LEU A CG  
1246 C CD1 . LEU A 158 ? 0.2392 0.5411 0.3327 -0.0522 -0.0026 0.0829  159 LEU A CD1 
1247 C CD2 . LEU A 158 ? 0.2123 0.5658 0.3186 -0.0323 0.0108  0.0736  159 LEU A CD2 
1248 N N   . ALA A 159 ? 0.2338 0.5782 0.3576 -0.0002 -0.0025 0.0558  160 ALA A N   
1249 C CA  . ALA A 159 ? 0.2171 0.5922 0.3552 0.0113  0.0005  0.0510  160 ALA A CA  
1250 C C   . ALA A 159 ? 0.1960 0.6075 0.3512 0.0001  0.0029  0.0550  160 ALA A C   
1251 O O   . ALA A 159 ? 0.1998 0.6110 0.3602 -0.0124 -0.0032 0.0592  160 ALA A O   
1252 C CB  . ALA A 159 ? 0.1644 0.5309 0.3063 0.0239  -0.0072 0.0460  160 ALA A CB  
1253 N N   . LEU A 160 ? 0.1710 0.6135 0.3340 0.0039  0.0118  0.0531  161 LEU A N   
1254 C CA  . LEU A 160 ? 0.2064 0.6757 0.3825 -0.0011 0.0136  0.0526  161 LEU A CA  
1255 C C   . LEU A 160 ? 0.2471 0.7254 0.4307 0.0195  0.0143  0.0427  161 LEU A C   
1256 O O   . LEU A 160 ? 0.2995 0.7909 0.4821 0.0280  0.0227  0.0373  161 LEU A O   
1257 C CB  . LEU A 160 ? 0.1719 0.6610 0.3459 -0.0152 0.0229  0.0577  161 LEU A CB  
1258 C CG  . LEU A 160 ? 0.2589 0.7346 0.4246 -0.0368 0.0207  0.0690  161 LEU A CG  
1259 C CD1 . LEU A 160 ? 0.2040 0.6902 0.3600 -0.0479 0.0302  0.0745  161 LEU A CD1 
1260 C CD2 . LEU A 160 ? 0.2483 0.7265 0.4234 -0.0520 0.0130  0.0736  161 LEU A CD2 
1261 N N   . PRO A 161 ? 0.2286 0.6983 0.4185 0.0280  0.0051  0.0399  162 PRO A N   
1262 C CA  . PRO A 161 ? 0.2332 0.7024 0.4277 0.0489  0.0036  0.0312  162 PRO A CA  
1263 C C   . PRO A 161 ? 0.2033 0.7035 0.4102 0.0545  0.0111  0.0259  162 PRO A C   
1264 O O   . PRO A 161 ? 0.1826 0.7080 0.4004 0.0426  0.0134  0.0291  162 PRO A O   
1265 C CB  . PRO A 161 ? 0.2714 0.7306 0.4717 0.0509  -0.0085 0.0322  162 PRO A CB  
1266 C CG  . PRO A 161 ? 0.2418 0.6855 0.4340 0.0345  -0.0132 0.0395  162 PRO A CG  
1267 C CD  . PRO A 161 ? 0.1987 0.6558 0.3898 0.0182  -0.0052 0.0447  162 PRO A CD  
1268 N N   . GLY A 162 ? 0.2512 0.7489 0.4560 0.0725  0.0146  0.0173  163 GLY A N   
1269 C CA  . GLY A 162 ? 0.2158 0.7416 0.4305 0.0797  0.0228  0.0105  163 GLY A CA  
1270 C C   . GLY A 162 ? 0.2848 0.8222 0.4894 0.0725  0.0350  0.0102  163 GLY A C   
1271 O O   . GLY A 162 ? 0.3571 0.9123 0.5649 0.0817  0.0427  0.0022  163 GLY A O   
1272 N N   . SER A 163 ? 0.2904 0.8176 0.4824 0.0563  0.0367  0.0187  164 SER A N   
1273 C CA  . SER A 163 ? 0.2671 0.8035 0.4472 0.0481  0.0473  0.0200  164 SER A CA  
1274 C C   . SER A 163 ? 0.2718 0.7911 0.4371 0.0628  0.0509  0.0122  164 SER A C   
1275 O O   . SER A 163 ? 0.2961 0.7893 0.4564 0.0748  0.0444  0.0089  164 SER A O   
1276 C CB  . SER A 163 ? 0.1939 0.7210 0.3643 0.0265  0.0465  0.0324  164 SER A CB  
1277 O OG  . SER A 163 ? 0.3533 0.8507 0.5093 0.0300  0.0433  0.0339  164 SER A OG  
1278 N N   . ARG A 164 ? 0.3367 0.8705 0.4936 0.0605  0.0612  0.0093  165 ARG A N   
1279 C CA  . ARG A 164 ? 0.4328 0.9503 0.5721 0.0705  0.0651  0.0028  165 ARG A CA  
1280 C C   . ARG A 164 ? 0.3113 0.8102 0.4327 0.0575  0.0651  0.0121  165 ARG A C   
1281 O O   . ARG A 164 ? 0.2727 0.7491 0.3806 0.0662  0.0638  0.0083  165 ARG A O   
1282 C CB  . ARG A 164 ? 0.6485 1.1891 0.7850 0.0746  0.0760  -0.0058 165 ARG A CB  
1283 C CG  . ARG A 164 ? 0.8684 1.3923 0.9878 0.0885  0.0792  -0.0161 165 ARG A CG  
1284 C CD  . ARG A 164 ? 1.0067 1.5052 1.1294 0.1086  0.0705  -0.0243 165 ARG A CD  
1285 N NE  . ARG A 164 ? 1.1281 1.6363 1.2725 0.1165  0.0648  -0.0262 165 ARG A NE  
1286 C CZ  . ARG A 164 ? 1.1883 1.6830 1.3387 0.1357  0.0587  -0.0352 165 ARG A CZ  
1287 N NH1 . ARG A 164 ? 1.1950 1.6651 1.3314 0.1488  0.0577  -0.0437 165 ARG A NH1 
1288 N NH2 . ARG A 164 ? 1.2008 1.7056 1.3707 0.1412  0.0530  -0.0352 165 ARG A NH2 
1289 N N   . GLU A 165 ? 0.2601 0.7667 0.3811 0.0368  0.0658  0.0243  166 GLU A N   
1290 C CA  . GLU A 165 ? 0.2453 0.7362 0.3485 0.0235  0.0664  0.0340  166 GLU A CA  
1291 C C   . GLU A 165 ? 0.2668 0.7317 0.3706 0.0211  0.0569  0.0405  166 GLU A C   
1292 O O   . GLU A 165 ? 0.2861 0.7195 0.3705 0.0157  0.0534  0.0452  166 GLU A O   
1293 C CB  . GLU A 165 ? 0.3652 0.8722 0.4652 0.0012  0.0708  0.0449  166 GLU A CB  
1294 C CG  . GLU A 165 ? 0.5734 1.1040 0.6678 0.0008  0.0810  0.0397  166 GLU A CG  
1295 C CD  . GLU A 165 ? 0.8411 1.4011 0.9559 0.0053  0.0837  0.0332  166 GLU A CD  
1296 O OE1 . GLU A 165 ? 0.9845 1.5662 1.0985 0.0095  0.0923  0.0257  166 GLU A OE1 
1297 O OE2 . GLU A 165 ? 0.9154 1.4773 1.0470 0.0044  0.0770  0.0355  166 GLU A OE2 
1298 N N   . ALA A 166 ? 0.2009 0.6651 0.3212 0.0242  0.0493  0.0401  167 ALA A N   
1299 C CA  . ALA A 166 ? 0.1977 0.6252 0.3134 0.0222  0.0378  0.0439  167 ALA A CA  
1300 C C   . ALA A 166 ? 0.2228 0.6509 0.3529 0.0364  0.0313  0.0373  167 ALA A C   
1301 O O   . ALA A 166 ? 0.1574 0.5913 0.3001 0.0305  0.0252  0.0410  167 ALA A O   
1302 C CB  . ALA A 166 ? 0.1768 0.5996 0.2930 0.0012  0.0339  0.0556  167 ALA A CB  
1303 N N   . PRO A 167 ? 0.2739 0.6940 0.4011 0.0551  0.0313  0.0277  168 PRO A N   
1304 C CA  . PRO A 167 ? 0.2930 0.7112 0.4318 0.0691  0.0242  0.0221  168 PRO A CA  
1305 C C   . PRO A 167 ? 0.3123 0.7012 0.4474 0.0668  0.0133  0.0260  168 PRO A C   
1306 O O   . PRO A 167 ? 0.2941 0.6831 0.4387 0.0740  0.0061  0.0243  168 PRO A O   
1307 C CB  . PRO A 167 ? 0.3260 0.7357 0.4575 0.0878  0.0270  0.0112  168 PRO A CB  
1308 C CG  . PRO A 167 ? 0.2916 0.6839 0.4030 0.0827  0.0313  0.0123  168 PRO A CG  
1309 C CD  . PRO A 167 ? 0.2149 0.6230 0.3254 0.0633  0.0367  0.0216  168 PRO A CD  
1310 N N   . GLY A 168 ? 0.2618 0.6219 0.3809 0.0566  0.0113  0.0308  169 GLY A N   
1311 C CA  . GLY A 168 ? 0.2177 0.5480 0.3304 0.0548  0.0022  0.0327  169 GLY A CA  
1312 C C   . GLY A 168 ? 0.2328 0.5367 0.3336 0.0674  -0.0008 0.0270  169 GLY A C   
1313 O O   . GLY A 168 ? 0.2433 0.5508 0.3425 0.0798  0.0026  0.0205  169 GLY A O   
1314 N N   . ASN A 169 ? 0.2176 0.4942 0.3094 0.0633  -0.0070 0.0291  170 ASN A N   
1315 C CA  . ASN A 169 ? 0.2487 0.4987 0.3290 0.0715  -0.0110 0.0253  170 ASN A CA  
1316 C C   . ASN A 169 ? 0.1990 0.4370 0.2665 0.0746  -0.0065 0.0218  170 ASN A C   
1317 O O   . ASN A 169 ? 0.2422 0.4607 0.3007 0.0819  -0.0094 0.0176  170 ASN A O   
1318 C CB  . ASN A 169 ? 0.1747 0.4271 0.2610 0.0852  -0.0159 0.0213  170 ASN A CB  
1319 C CG  . ASN A 169 ? 0.2876 0.5473 0.3836 0.0821  -0.0229 0.0252  170 ASN A CG  
1320 O OD1 . ASN A 169 ? 0.2537 0.5270 0.3606 0.0916  -0.0268 0.0237  170 ASN A OD1 
1321 N ND2 . ASN A 169 ? 0.1490 0.4001 0.2411 0.0691  -0.0250 0.0297  170 ASN A ND2 
1322 N N   . VAL A 170 ? 0.1730 0.4208 0.2379 0.0679  -0.0004 0.0238  171 VAL A N   
1323 C CA  . VAL A 170 ? 0.2030 0.4409 0.2546 0.0710  0.0031  0.0202  171 VAL A CA  
1324 C C   . VAL A 170 ? 0.2793 0.4888 0.3194 0.0672  -0.0018 0.0212  171 VAL A C   
1325 O O   . VAL A 170 ? 0.3082 0.5038 0.3377 0.0722  -0.0021 0.0165  171 VAL A O   
1326 C CB  . VAL A 170 ? 0.2350 0.4907 0.2843 0.0640  0.0104  0.0231  171 VAL A CB  
1327 C CG1 . VAL A 170 ? 0.2070 0.4955 0.2692 0.0678  0.0164  0.0211  171 VAL A CG1 
1328 C CG2 . VAL A 170 ? 0.1645 0.4151 0.2126 0.0492  0.0086  0.0323  171 VAL A CG2 
1329 N N   . GLY A 171 ? 0.2628 0.4642 0.3054 0.0586  -0.0057 0.0262  172 GLY A N   
1330 C CA  . GLY A 171 ? 0.1681 0.3467 0.2028 0.0562  -0.0099 0.0260  172 GLY A CA  
1331 C C   . GLY A 171 ? 0.2112 0.3761 0.2418 0.0635  -0.0136 0.0214  172 GLY A C   
1332 O O   . GLY A 171 ? 0.2210 0.3695 0.2427 0.0632  -0.0154 0.0194  172 GLY A O   
1333 N N   . LEU A 172 ? 0.2117 0.3830 0.2487 0.0695  -0.0155 0.0204  173 LEU A N   
1334 C CA  . LEU A 172 ? 0.2145 0.3703 0.2459 0.0769  -0.0201 0.0171  173 LEU A CA  
1335 C C   . LEU A 172 ? 0.2318 0.3827 0.2564 0.0863  -0.0182 0.0109  173 LEU A C   
1336 O O   . LEU A 172 ? 0.2625 0.3927 0.2772 0.0889  -0.0219 0.0081  173 LEU A O   
1337 C CB  . LEU A 172 ? 0.1844 0.3479 0.2245 0.0818  -0.0244 0.0184  173 LEU A CB  
1338 C CG  . LEU A 172 ? 0.2434 0.4064 0.2864 0.0733  -0.0284 0.0233  173 LEU A CG  
1339 C CD1 . LEU A 172 ? 0.1918 0.3642 0.2430 0.0791  -0.0339 0.0246  173 LEU A CD1 
1340 C CD2 . LEU A 172 ? 0.1979 0.3384 0.2290 0.0675  -0.0312 0.0238  173 LEU A CD2 
1341 N N   . LEU A 173 ? 0.2470 0.4166 0.2759 0.0905  -0.0124 0.0083  174 LEU A N   
1342 C CA  . LEU A 173 ? 0.2721 0.4379 0.2930 0.0994  -0.0099 0.0007  174 LEU A CA  
1343 C C   . LEU A 173 ? 0.2807 0.4321 0.2878 0.0929  -0.0092 -0.0001 174 LEU A C   
1344 O O   . LEU A 173 ? 0.2921 0.4285 0.2885 0.0982  -0.0106 -0.0064 174 LEU A O   
1345 C CB  . LEU A 173 ? 0.2233 0.4170 0.2522 0.1048  -0.0026 -0.0024 174 LEU A CB  
1346 C CG  . LEU A 173 ? 0.2898 0.5010 0.3344 0.1140  -0.0036 -0.0036 174 LEU A CG  
1347 C CD1 . LEU A 173 ? 0.2422 0.4874 0.2971 0.1168  0.0050  -0.0061 174 LEU A CD1 
1348 C CD2 . LEU A 173 ? 0.2996 0.4931 0.3412 0.1284  -0.0095 -0.0102 174 LEU A CD2 
1349 N N   . ASP A 174 ? 0.2397 0.3946 0.2472 0.0818  -0.0082 0.0060  175 ASP A N   
1350 C CA  . ASP A 174 ? 0.2133 0.3547 0.2102 0.0757  -0.0097 0.0063  175 ASP A CA  
1351 C C   . ASP A 174 ? 0.3017 0.4208 0.2929 0.0754  -0.0156 0.0043  175 ASP A C   
1352 O O   . ASP A 174 ? 0.2896 0.3956 0.2701 0.0761  -0.0173 -0.0001 175 ASP A O   
1353 C CB  . ASP A 174 ? 0.2106 0.3572 0.2114 0.0655  -0.0095 0.0136  175 ASP A CB  
1354 C CG  . ASP A 174 ? 0.2816 0.4476 0.2853 0.0626  -0.0043 0.0173  175 ASP A CG  
1355 O OD1 . ASP A 174 ? 0.2635 0.4410 0.2638 0.0678  0.0004  0.0134  175 ASP A OD1 
1356 O OD2 . ASP A 174 ? 0.2766 0.4458 0.2851 0.0546  -0.0050 0.0240  175 ASP A OD2 
1357 N N   . GLN A 175 ? 0.2746 0.3894 0.2718 0.0730  -0.0188 0.0078  176 GLN A N   
1358 C CA  . GLN A 175 ? 0.2723 0.3674 0.2630 0.0710  -0.0239 0.0071  176 GLN A CA  
1359 C C   . GLN A 175 ? 0.2753 0.3565 0.2581 0.0798  -0.0266 0.0014  176 GLN A C   
1360 O O   . GLN A 175 ? 0.3341 0.3972 0.3064 0.0775  -0.0298 -0.0013 176 GLN A O   
1361 C CB  . GLN A 175 ? 0.3176 0.4125 0.3142 0.0674  -0.0264 0.0117  176 GLN A CB  
1362 C CG  . GLN A 175 ? 0.2560 0.3608 0.2597 0.0591  -0.0245 0.0158  176 GLN A CG  
1363 C CD  . GLN A 175 ? 0.2779 0.3835 0.2857 0.0562  -0.0268 0.0188  176 GLN A CD  
1364 O OE1 . GLN A 175 ? 0.2751 0.3722 0.2790 0.0590  -0.0307 0.0191  176 GLN A OE1 
1365 N NE2 . GLN A 175 ? 0.2032 0.3174 0.2176 0.0504  -0.0254 0.0211  176 GLN A NE2 
1366 N N   . ARG A 176 ? 0.2597 0.3494 0.2478 0.0902  -0.0256 -0.0009 177 ARG A N   
1367 C CA  . ARG A 176 ? 0.3356 0.4103 0.3169 0.1010  -0.0289 -0.0073 177 ARG A CA  
1368 C C   . ARG A 176 ? 0.3762 0.4440 0.3463 0.1028  -0.0267 -0.0148 177 ARG A C   
1369 O O   . ARG A 176 ? 0.3801 0.4242 0.3385 0.1044  -0.0316 -0.0192 177 ARG A O   
1370 C CB  . ARG A 176 ? 0.2799 0.3700 0.2721 0.1135  -0.0278 -0.0095 177 ARG A CB  
1371 C CG  . ARG A 176 ? 0.3711 0.4454 0.3573 0.1275  -0.0313 -0.0178 177 ARG A CG  
1372 C CD  . ARG A 176 ? 0.3622 0.4547 0.3622 0.1416  -0.0307 -0.0206 177 ARG A CD  
1373 N NE  . ARG A 176 ? 0.4274 0.5176 0.4348 0.1416  -0.0377 -0.0133 177 ARG A NE  
1374 C CZ  . ARG A 176 ? 0.4442 0.5552 0.4671 0.1507  -0.0385 -0.0127 177 ARG A CZ  
1375 N NH1 . ARG A 176 ? 0.4084 0.5461 0.4426 0.1601  -0.0314 -0.0192 177 ARG A NH1 
1376 N NH2 . ARG A 176 ? 0.3744 0.4815 0.4017 0.1495  -0.0463 -0.0055 177 ARG A NH2 
1377 N N   . LEU A 177 ? 0.3087 0.3959 0.2805 0.1016  -0.0201 -0.0159 178 LEU A N   
1378 C CA  . LEU A 177 ? 0.3453 0.4276 0.3044 0.1024  -0.0182 -0.0230 178 LEU A CA  
1379 C C   . LEU A 177 ? 0.3291 0.3918 0.2779 0.0921  -0.0234 -0.0218 178 LEU A C   
1380 O O   . LEU A 177 ? 0.3990 0.4449 0.3349 0.0935  -0.0262 -0.0287 178 LEU A O   
1381 C CB  . LEU A 177 ? 0.2784 0.3856 0.2395 0.1001  -0.0107 -0.0219 178 LEU A CB  
1382 C CG  . LEU A 177 ? 0.3258 0.4317 0.2719 0.0992  -0.0084 -0.0281 178 LEU A CG  
1383 C CD1 . LEU A 177 ? 0.3001 0.3961 0.2376 0.1120  -0.0081 -0.0407 178 LEU A CD1 
1384 C CD2 . LEU A 177 ? 0.2519 0.3834 0.1993 0.0952  -0.0012 -0.0245 178 LEU A CD2 
1385 N N   . ALA A 178 ? 0.2873 0.3527 0.2423 0.0819  -0.0248 -0.0137 179 ALA A N   
1386 C CA  . ALA A 178 ? 0.3194 0.3709 0.2680 0.0720  -0.0294 -0.0126 179 ALA A CA  
1387 C C   . ALA A 178 ? 0.3605 0.3875 0.3015 0.0719  -0.0354 -0.0148 179 ALA A C   
1388 O O   . ALA A 178 ? 0.3569 0.3689 0.2879 0.0661  -0.0394 -0.0177 179 ALA A O   
1389 C CB  . ALA A 178 ? 0.2871 0.3490 0.2459 0.0630  -0.0290 -0.0048 179 ALA A CB  
1390 N N   . LEU A 179 ? 0.3350 0.3570 0.2802 0.0775  -0.0371 -0.0128 180 LEU A N   
1391 C CA  . LEU A 179 ? 0.3338 0.3293 0.2698 0.0775  -0.0440 -0.0135 180 LEU A CA  
1392 C C   . LEU A 179 ? 0.4147 0.3924 0.3392 0.0869  -0.0466 -0.0230 180 LEU A C   
1393 O O   . LEU A 179 ? 0.4463 0.3978 0.3584 0.0829  -0.0528 -0.0252 180 LEU A O   
1394 C CB  . LEU A 179 ? 0.3014 0.2962 0.2439 0.0816  -0.0464 -0.0080 180 LEU A CB  
1395 C CG  . LEU A 179 ? 0.3648 0.3736 0.3160 0.0720  -0.0445 0.0001  180 LEU A CG  
1396 C CD1 . LEU A 179 ? 0.3463 0.3562 0.3027 0.0769  -0.0474 0.0049  180 LEU A CD1 
1397 C CD2 . LEU A 179 ? 0.3894 0.3880 0.3340 0.0577  -0.0466 0.0030  180 LEU A CD2 
1398 N N   . GLN A 180 ? 0.3818 0.3732 0.3098 0.0992  -0.0417 -0.0291 181 GLN A N   
1399 C CA  . GLN A 180 ? 0.4680 0.4453 0.3844 0.1088  -0.0427 -0.0405 181 GLN A CA  
1400 C C   . GLN A 180 ? 0.4783 0.4486 0.3819 0.0993  -0.0433 -0.0447 181 GLN A C   
1401 O O   . GLN A 180 ? 0.4568 0.4023 0.3461 0.1004  -0.0484 -0.0524 181 GLN A O   
1402 C CB  . GLN A 180 ? 0.4109 0.4114 0.3350 0.1228  -0.0354 -0.0466 181 GLN A CB  
1403 C CG  . GLN A 180 ? 0.5148 0.5242 0.4532 0.1334  -0.0360 -0.0436 181 GLN A CG  
1404 C CD  . GLN A 180 ? 0.5200 0.5612 0.4700 0.1442  -0.0273 -0.0480 181 GLN A CD  
1405 O OE1 . GLN A 180 ? 0.5523 0.6131 0.5011 0.1398  -0.0198 -0.0494 181 GLN A OE1 
1406 N NE2 . GLN A 180 ? 0.4600 0.5073 0.4212 0.1577  -0.0286 -0.0498 181 GLN A NE2 
1407 N N   . TRP A 181 ? 0.4139 0.4049 0.3223 0.0897  -0.0392 -0.0396 182 TRP A N   
1408 C CA  . TRP A 181 ? 0.4263 0.4132 0.3242 0.0799  -0.0412 -0.0421 182 TRP A CA  
1409 C C   . TRP A 181 ? 0.4190 0.3822 0.3103 0.0690  -0.0491 -0.0403 182 TRP A C   
1410 O O   . TRP A 181 ? 0.4279 0.3743 0.3055 0.0647  -0.0537 -0.0468 182 TRP A O   
1411 C CB  . TRP A 181 ? 0.3506 0.3631 0.2571 0.0725  -0.0371 -0.0351 182 TRP A CB  
1412 C CG  . TRP A 181 ? 0.3379 0.3509 0.2352 0.0638  -0.0397 -0.0370 182 TRP A CG  
1413 C CD1 . TRP A 181 ? 0.3384 0.3613 0.2267 0.0656  -0.0371 -0.0415 182 TRP A CD1 
1414 C CD2 . TRP A 181 ? 0.3419 0.3478 0.2386 0.0513  -0.0458 -0.0341 182 TRP A CD2 
1415 N NE1 . TRP A 181 ? 0.3692 0.3899 0.2506 0.0556  -0.0424 -0.0414 182 TRP A NE1 
1416 C CE2 . TRP A 181 ? 0.3952 0.4068 0.2831 0.0469  -0.0477 -0.0371 182 TRP A CE2 
1417 C CE3 . TRP A 181 ? 0.3278 0.3251 0.2302 0.0428  -0.0496 -0.0293 182 TRP A CE3 
1418 C CZ2 . TRP A 181 ? 0.3876 0.3975 0.2747 0.0351  -0.0540 -0.0357 182 TRP A CZ2 
1419 C CZ3 . TRP A 181 ? 0.3697 0.3667 0.2715 0.0306  -0.0545 -0.0282 182 TRP A CZ3 
1420 C CH2 . TRP A 181 ? 0.3887 0.3926 0.2840 0.0272  -0.0570 -0.0315 182 TRP A CH2 
1421 N N   . VAL A 182 ? 0.3829 0.3450 0.2829 0.0632  -0.0507 -0.0317 183 VAL A N   
1422 C CA  . VAL A 182 ? 0.3508 0.2928 0.2446 0.0510  -0.0573 -0.0287 183 VAL A CA  
1423 C C   . VAL A 182 ? 0.4347 0.3433 0.3133 0.0553  -0.0641 -0.0351 183 VAL A C   
1424 O O   . VAL A 182 ? 0.4496 0.3390 0.3161 0.0459  -0.0699 -0.0383 183 VAL A O   
1425 C CB  . VAL A 182 ? 0.4152 0.3640 0.3195 0.0452  -0.0566 -0.0188 183 VAL A CB  
1426 C CG1 . VAL A 182 ? 0.4200 0.3466 0.3158 0.0327  -0.0631 -0.0153 183 VAL A CG1 
1427 C CG2 . VAL A 182 ? 0.3530 0.3303 0.2710 0.0393  -0.0513 -0.0139 183 VAL A CG2 
1428 N N   . GLN A 183 ? 0.4268 0.3276 0.3061 0.0697  -0.0642 -0.0372 184 GLN A N   
1429 C CA  . GLN A 183 ? 0.4485 0.3149 0.3137 0.0769  -0.0715 -0.0441 184 GLN A CA  
1430 C C   . GLN A 183 ? 0.5513 0.4068 0.4027 0.0787  -0.0726 -0.0564 184 GLN A C   
1431 O O   . GLN A 183 ? 0.5516 0.3750 0.3876 0.0738  -0.0806 -0.0609 184 GLN A O   
1432 C CB  . GLN A 183 ? 0.4633 0.3299 0.3351 0.0957  -0.0709 -0.0459 184 GLN A CB  
1433 C CG  . GLN A 183 ? 0.5121 0.3738 0.3901 0.0939  -0.0749 -0.0347 184 GLN A CG  
1434 C CD  . GLN A 183 ? 0.5552 0.3809 0.4185 0.0825  -0.0849 -0.0300 184 GLN A CD  
1435 O OE1 . GLN A 183 ? 0.5973 0.3903 0.4467 0.0874  -0.0923 -0.0366 184 GLN A OE1 
1436 N NE2 . GLN A 183 ? 0.5513 0.3823 0.4168 0.0665  -0.0852 -0.0189 184 GLN A NE2 
1437 N N   . GLU A 184 ? 0.5352 0.4160 0.3902 0.0844  -0.0651 -0.0619 185 GLU A N   
1438 C CA  . GLU A 184 ? 0.5657 0.4372 0.4054 0.0872  -0.0657 -0.0747 185 GLU A CA  
1439 C C   . GLU A 184 ? 0.5217 0.3940 0.3539 0.0697  -0.0689 -0.0737 185 GLU A C   
1440 O O   . GLU A 184 ? 0.5104 0.3646 0.3261 0.0678  -0.0732 -0.0837 185 GLU A O   
1441 C CB  . GLU A 184 ? 0.6572 0.5555 0.5012 0.1008  -0.0562 -0.0813 185 GLU A CB  
1442 C CG  . GLU A 184 ? 0.8960 0.7927 0.7464 0.1200  -0.0540 -0.0862 185 GLU A CG  
1443 C CD  . GLU A 184 ? 1.0447 0.9740 0.9021 0.1318  -0.0432 -0.0916 185 GLU A CD  
1444 O OE1 . GLU A 184 ? 1.1114 1.0465 0.9777 0.1478  -0.0405 -0.0956 185 GLU A OE1 
1445 O OE2 . GLU A 184 ? 1.0685 1.0185 0.9227 0.1247  -0.0378 -0.0915 185 GLU A OE2 
1446 N N   . ASN A 185 ? 0.4651 0.3573 0.3093 0.0572  -0.0675 -0.0625 186 ASN A N   
1447 C CA  . ASN A 185 ? 0.4772 0.3784 0.3183 0.0431  -0.0699 -0.0619 186 ASN A CA  
1448 C C   . ASN A 185 ? 0.5196 0.4163 0.3651 0.0258  -0.0752 -0.0539 186 ASN A C   
1449 O O   . ASN A 185 ? 0.5029 0.4026 0.3445 0.0138  -0.0794 -0.0552 186 ASN A O   
1450 C CB  . ASN A 185 ? 0.4231 0.3593 0.2751 0.0446  -0.0629 -0.0576 186 ASN A CB  
1451 C CG  . ASN A 185 ? 0.4565 0.4010 0.3010 0.0574  -0.0573 -0.0659 186 ASN A CG  
1452 O OD1 . ASN A 185 ? 0.4947 0.4265 0.3223 0.0588  -0.0598 -0.0766 186 ASN A OD1 
1453 N ND2 . ASN A 185 ? 0.4496 0.4157 0.3059 0.0660  -0.0495 -0.0617 186 ASN A ND2 
1454 N N   . VAL A 186 ? 0.4633 0.3551 0.3167 0.0234  -0.0753 -0.0458 187 VAL A N   
1455 C CA  . VAL A 186 ? 0.4481 0.3461 0.3086 0.0064  -0.0776 -0.0375 187 VAL A CA  
1456 C C   . VAL A 186 ? 0.4755 0.3485 0.3220 -0.0078 -0.0863 -0.0407 187 VAL A C   
1457 O O   . VAL A 186 ? 0.5073 0.3915 0.3590 -0.0236 -0.0884 -0.0369 187 VAL A O   
1458 C CB  . VAL A 186 ? 0.4419 0.3421 0.3120 0.0066  -0.0750 -0.0282 187 VAL A CB  
1459 C CG1 . VAL A 186 ? 0.4499 0.3149 0.3067 0.0037  -0.0818 -0.0271 187 VAL A CG1 
1460 C CG2 . VAL A 186 ? 0.3975 0.3224 0.2819 -0.0061 -0.0721 -0.0205 187 VAL A CG2 
1461 N N   . ALA A 187 ? 0.4807 0.3203 0.3096 -0.0024 -0.0918 -0.0485 188 ALA A N   
1462 C CA  . ALA A 187 ? 0.5393 0.3507 0.3528 -0.0170 -0.1012 -0.0519 188 ALA A CA  
1463 C C   . ALA A 187 ? 0.5857 0.4111 0.3970 -0.0268 -0.1036 -0.0573 188 ALA A C   
1464 O O   . ALA A 187 ? 0.5767 0.3928 0.3826 -0.0448 -0.1105 -0.0568 188 ALA A O   
1465 C CB  . ALA A 187 ? 0.5314 0.3017 0.3259 -0.0067 -0.1072 -0.0609 188 ALA A CB  
1466 N N   . ALA A 188 ? 0.5308 0.3789 0.3457 -0.0163 -0.0985 -0.0620 189 ALA A N   
1467 C CA  . ALA A 188 ? 0.5657 0.4285 0.3779 -0.0251 -0.1018 -0.0661 189 ALA A CA  
1468 C C   . ALA A 188 ? 0.5176 0.4092 0.3480 -0.0397 -0.1019 -0.0566 189 ALA A C   
1469 O O   . ALA A 188 ? 0.4865 0.3876 0.3159 -0.0511 -0.1075 -0.0587 189 ALA A O   
1470 C CB  . ALA A 188 ? 0.4664 0.3470 0.2765 -0.0110 -0.0964 -0.0717 189 ALA A CB  
1471 N N   . PHE A 189 ? 0.5043 0.4110 0.3515 -0.0390 -0.0962 -0.0469 190 PHE A N   
1472 C CA  . PHE A 189 ? 0.5096 0.4435 0.3753 -0.0516 -0.0953 -0.0391 190 PHE A CA  
1473 C C   . PHE A 189 ? 0.5528 0.4731 0.4171 -0.0683 -0.0987 -0.0345 190 PHE A C   
1474 O O   . PHE A 189 ? 0.5572 0.5014 0.4373 -0.0794 -0.0968 -0.0285 190 PHE A O   
1475 C CB  . PHE A 189 ? 0.4659 0.4259 0.3501 -0.0414 -0.0865 -0.0322 190 PHE A CB  
1476 C CG  . PHE A 189 ? 0.4425 0.4170 0.3284 -0.0272 -0.0829 -0.0345 190 PHE A CG  
1477 C CD1 . PHE A 189 ? 0.4576 0.4191 0.3338 -0.0127 -0.0793 -0.0383 190 PHE A CD1 
1478 C CD2 . PHE A 189 ? 0.4077 0.4095 0.3052 -0.0286 -0.0834 -0.0324 190 PHE A CD2 
1479 C CE1 . PHE A 189 ? 0.4366 0.4133 0.3134 -0.0017 -0.0753 -0.0396 190 PHE A CE1 
1480 C CE2 . PHE A 189 ? 0.4100 0.4234 0.3068 -0.0173 -0.0807 -0.0328 190 PHE A CE2 
1481 C CZ  . PHE A 189 ? 0.3694 0.3706 0.2552 -0.0048 -0.0762 -0.0363 190 PHE A CZ  
1482 N N   . GLY A 190 ? 0.5333 0.4160 0.3790 -0.0704 -0.1037 -0.0373 191 GLY A N   
1483 C CA  . GLY A 190 ? 0.5468 0.4123 0.3881 -0.0866 -0.1072 -0.0312 191 GLY A CA  
1484 C C   . GLY A 190 ? 0.5778 0.4362 0.4214 -0.0807 -0.1024 -0.0234 191 GLY A C   
1485 O O   . GLY A 190 ? 0.5611 0.4060 0.3998 -0.0949 -0.1049 -0.0166 191 GLY A O   
1486 N N   . GLY A 191 ? 0.5593 0.4270 0.4093 -0.0613 -0.0960 -0.0236 192 GLY A N   
1487 C CA  . GLY A 191 ? 0.5063 0.3691 0.3587 -0.0555 -0.0924 -0.0163 192 GLY A CA  
1488 C C   . GLY A 191 ? 0.5423 0.3638 0.3766 -0.0478 -0.0985 -0.0180 192 GLY A C   
1489 O O   . GLY A 191 ? 0.5967 0.3959 0.4184 -0.0402 -0.1033 -0.0272 192 GLY A O   
1490 N N   . ASP A 192 ? 0.5957 0.4063 0.4280 -0.0493 -0.0988 -0.0094 193 ASP A N   
1491 C CA  . ASP A 192 ? 0.5820 0.3518 0.3978 -0.0417 -0.1064 -0.0093 193 ASP A CA  
1492 C C   . ASP A 192 ? 0.5612 0.3382 0.3847 -0.0198 -0.1022 -0.0094 193 ASP A C   
1493 O O   . ASP A 192 ? 0.5390 0.3314 0.3711 -0.0202 -0.0982 -0.0007 193 ASP A O   
1494 C CB  . ASP A 192 ? 0.6006 0.3487 0.4056 -0.0596 -0.1120 0.0016  193 ASP A CB  
1495 C CG  . ASP A 192 ? 0.7302 0.4322 0.5174 -0.0511 -0.1218 0.0032  193 ASP A CG  
1496 O OD1 . ASP A 192 ? 0.8040 0.4956 0.5907 -0.0290 -0.1230 -0.0041 193 ASP A OD1 
1497 O OD2 . ASP A 192 ? 0.7643 0.4402 0.5376 -0.0672 -0.1289 0.0121  193 ASP A OD2 
1498 N N   . PRO A 193 ? 0.5654 0.3319 0.3855 -0.0010 -0.1031 -0.0192 194 PRO A N   
1499 C CA  . PRO A 193 ? 0.5305 0.3079 0.3601 0.0195  -0.0990 -0.0195 194 PRO A CA  
1500 C C   . PRO A 193 ? 0.6276 0.3797 0.4510 0.0242  -0.1057 -0.0122 194 PRO A C   
1501 O O   . PRO A 193 ? 0.6218 0.3875 0.4555 0.0383  -0.1027 -0.0101 194 PRO A O   
1502 C CB  . PRO A 193 ? 0.5841 0.3557 0.4097 0.0366  -0.0985 -0.0335 194 PRO A CB  
1503 C CG  . PRO A 193 ? 0.5280 0.2719 0.3364 0.0261  -0.1057 -0.0403 194 PRO A CG  
1504 C CD  . PRO A 193 ? 0.5475 0.2952 0.3554 0.0016  -0.1075 -0.0314 194 PRO A CD  
1505 N N   . THR A 194 ? 0.6218 0.3374 0.4282 0.0123  -0.1155 -0.0077 195 THR A N   
1506 C CA  . THR A 194 ? 0.6196 0.3100 0.4183 0.0145  -0.1233 0.0018  195 THR A CA  
1507 C C   . THR A 194 ? 0.6590 0.3656 0.4606 -0.0029 -0.1205 0.0158  195 THR A C   
1508 O O   . THR A 194 ? 0.6744 0.3607 0.4669 -0.0049 -0.1274 0.0257  195 THR A O   
1509 C CB  . THR A 194 ? 0.7004 0.3381 0.4765 0.0103  -0.1366 0.0009  195 THR A CB  
1510 O OG1 . THR A 194 ? 0.7215 0.3503 0.4872 -0.0168 -0.1391 0.0075  195 THR A OG1 
1511 C CG2 . THR A 194 ? 0.6544 0.2761 0.4256 0.0252  -0.1387 -0.0156 195 THR A CG2 
1512 N N   . SER A 195 ? 0.5854 0.3287 0.3992 -0.0149 -0.1107 0.0167  196 SER A N   
1513 C CA  . SER A 195 ? 0.6369 0.4009 0.4553 -0.0298 -0.1061 0.0276  196 SER A CA  
1514 C C   . SER A 195 ? 0.5776 0.3877 0.4174 -0.0257 -0.0941 0.0243  196 SER A C   
1515 O O   . SER A 195 ? 0.5584 0.3904 0.4057 -0.0371 -0.0886 0.0221  196 SER A O   
1516 C CB  . SER A 195 ? 0.6733 0.4266 0.4801 -0.0557 -0.1089 0.0335  196 SER A CB  
1517 O OG  . SER A 195 ? 0.7214 0.4966 0.5319 -0.0695 -0.1034 0.0431  196 SER A OG  
1518 N N   . VAL A 196 ? 0.5532 0.3777 0.4032 -0.0093 -0.0908 0.0240  197 VAL A N   
151