data_6CQW
# 
_entry.id   6CQW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CQW         
WWPDB D_1000233252 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 6CQX unspecified 
PDB . 6CQY unspecified 
PDB . 6CQZ unspecified 
PDB . 6CQT unspecified 
PDB . 6CQU unspecified 
PDB . 6CQV unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6CQW 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bester, S.M.' 1 ? 
'Guelta, M.A.' 2 ? 
'Pegan, S.D.'  3 ? 
'Height, J.J.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Chem. Res. Toxicol.' 
_citation.journal_id_ASTM           CRTOEC 
_citation.journal_id_CSD            2140 
_citation.journal_id_ISSN           1520-5010 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            31 
_citation.language                  ? 
_citation.page_first                1405 
_citation.page_last                 1417 
_citation.title                     
'Structural Insights of Stereospecific Inhibition of Human Acetylcholinesterase by VX and Subsequent Reactivation by HI-6.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.chemrestox.8b00294 
_citation.pdbx_database_id_PubMed   30462502 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bester, S.M.'     1 ?                   
primary 'Guelta, M.A.'     2 ?                   
primary 'Cheung, J.'       3 0000-0002-1014-0707 
primary 'Winemiller, M.D.' 4 0000-0001-7433-428X 
primary 'Bae, S.Y.'        5 ?                   
primary 'Myslinski, J.'    6 ?                   
primary 'Pegan, S.D.'      7 0000-0002-2958-5319 
primary 'Height, J.J.'     8 ?                   
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6CQW 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     105.030 
_cell.length_a_esd                 ? 
_cell.length_b                     105.030 
_cell.length_b_esd                 ? 
_cell.length_c                     324.611 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6CQW 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 59447.105 2   3.1.1.7 ? ? ? 
2 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2 
?       ? ? ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   3   ?       ? ? ? 
4 non-polymer syn 'O-ETHYLMETHYLPHOSPHONIC ACID ESTER GROUP' 124.076   2   ?       ? ? ? 
5 non-polymer syn '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' 288.302   2   ? ? 
? ? 
6 water       nat water 18.015    665 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   GLU n 
1 4   ASP n 
1 5   ALA n 
1 6   GLU n 
1 7   LEU n 
1 8   LEU n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  LEU n 
1 17  ARG n 
1 18  GLY n 
1 19  ILE n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  PRO n 
1 28  VAL n 
1 29  SER n 
1 30  ALA n 
1 31  PHE n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  PRO n 
1 36  PHE n 
1 37  ALA n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  MET n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  PRO n 
1 49  PRO n 
1 50  GLU n 
1 51  PRO n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  TRP n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  VAL n 
1 60  ASP n 
1 61  ALA n 
1 62  THR n 
1 63  THR n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  CYS n 
1 69  TYR n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  ASP n 
1 74  THR n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  PHE n 
1 80  GLU n 
1 81  GLY n 
1 82  THR n 
1 83  GLU n 
1 84  MET n 
1 85  TRP n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  SER n 
1 93  GLU n 
1 94  ASP n 
1 95  CYS n 
1 96  LEU n 
1 97  TYR n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 TYR n 
1 105 PRO n 
1 106 ARG n 
1 107 PRO n 
1 108 THR n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 VAL n 
1 114 LEU n 
1 115 VAL n 
1 116 TRP n 
1 117 ILE n 
1 118 TYR n 
1 119 GLY n 
1 120 GLY n 
1 121 GLY n 
1 122 PHE n 
1 123 TYR n 
1 124 SER n 
1 125 GLY n 
1 126 ALA n 
1 127 SER n 
1 128 SER n 
1 129 LEU n 
1 130 ASP n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 ARG n 
1 136 PHE n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 MET n 
1 149 ASN n 
1 150 TYR n 
1 151 ARG n 
1 152 VAL n 
1 153 GLY n 
1 154 ALA n 
1 155 PHE n 
1 156 GLY n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 PRO n 
1 162 GLY n 
1 163 SER n 
1 164 ARG n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 ASN n 
1 170 VAL n 
1 171 GLY n 
1 172 LEU n 
1 173 LEU n 
1 174 ASP n 
1 175 GLN n 
1 176 ARG n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 GLN n 
1 181 TRP n 
1 182 VAL n 
1 183 GLN n 
1 184 GLU n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 PHE n 
1 190 GLY n 
1 191 GLY n 
1 192 ASP n 
1 193 PRO n 
1 194 THR n 
1 195 SER n 
1 196 VAL n 
1 197 THR n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 GLU n 
1 202 SER n 
1 203 ALA n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 SER n 
1 208 VAL n 
1 209 GLY n 
1 210 MET n 
1 211 HIS n 
1 212 LEU n 
1 213 LEU n 
1 214 SER n 
1 215 PRO n 
1 216 PRO n 
1 217 SER n 
1 218 ARG n 
1 219 GLY n 
1 220 LEU n 
1 221 PHE n 
1 222 HIS n 
1 223 ARG n 
1 224 ALA n 
1 225 VAL n 
1 226 LEU n 
1 227 GLN n 
1 228 SER n 
1 229 GLY n 
1 230 ALA n 
1 231 PRO n 
1 232 ASN n 
1 233 GLY n 
1 234 PRO n 
1 235 TRP n 
1 236 ALA n 
1 237 THR n 
1 238 VAL n 
1 239 GLY n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 ALA n 
1 244 ARG n 
1 245 ARG n 
1 246 ARG n 
1 247 ALA n 
1 248 THR n 
1 249 GLN n 
1 250 LEU n 
1 251 ALA n 
1 252 HIS n 
1 253 LEU n 
1 254 VAL n 
1 255 GLY n 
1 256 CYS n 
1 257 PRO n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 GLY n 
1 263 GLY n 
1 264 ASN n 
1 265 ASP n 
1 266 THR n 
1 267 GLU n 
1 268 LEU n 
1 269 VAL n 
1 270 ALA n 
1 271 CYS n 
1 272 LEU n 
1 273 ARG n 
1 274 THR n 
1 275 ARG n 
1 276 PRO n 
1 277 ALA n 
1 278 GLN n 
1 279 VAL n 
1 280 LEU n 
1 281 VAL n 
1 282 ASN n 
1 283 HIS n 
1 284 GLU n 
1 285 TRP n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 PRO n 
1 290 GLN n 
1 291 GLU n 
1 292 SER n 
1 293 VAL n 
1 294 PHE n 
1 295 ARG n 
1 296 PHE n 
1 297 SER n 
1 298 PHE n 
1 299 VAL n 
1 300 PRO n 
1 301 VAL n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 ASP n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 ASP n 
1 310 THR n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 LEU n 
1 315 ILE n 
1 316 ASN n 
1 317 ALA n 
1 318 GLY n 
1 319 ASP n 
1 320 PHE n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 GLN n 
1 325 VAL n 
1 326 LEU n 
1 327 VAL n 
1 328 GLY n 
1 329 VAL n 
1 330 VAL n 
1 331 LYS n 
1 332 ASP n 
1 333 GLU n 
1 334 GLY n 
1 335 SER n 
1 336 TYR n 
1 337 PHE n 
1 338 LEU n 
1 339 VAL n 
1 340 TYR n 
1 341 GLY n 
1 342 ALA n 
1 343 PRO n 
1 344 GLY n 
1 345 PHE n 
1 346 SER n 
1 347 LYS n 
1 348 ASP n 
1 349 ASN n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ILE n 
1 354 SER n 
1 355 ARG n 
1 356 ALA n 
1 357 GLU n 
1 358 PHE n 
1 359 LEU n 
1 360 ALA n 
1 361 GLY n 
1 362 VAL n 
1 363 ARG n 
1 364 VAL n 
1 365 GLY n 
1 366 VAL n 
1 367 PRO n 
1 368 GLN n 
1 369 VAL n 
1 370 SER n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 VAL n 
1 378 VAL n 
1 379 LEU n 
1 380 HIS n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 TRP n 
1 385 LEU n 
1 386 HIS n 
1 387 PRO n 
1 388 GLU n 
1 389 ASP n 
1 390 PRO n 
1 391 ALA n 
1 392 ARG n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 SER n 
1 399 ASP n 
1 400 VAL n 
1 401 VAL n 
1 402 GLY n 
1 403 ASP n 
1 404 HIS n 
1 405 ASN n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 PRO n 
1 410 VAL n 
1 411 ALA n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 GLY n 
1 416 ARG n 
1 417 LEU n 
1 418 ALA n 
1 419 ALA n 
1 420 GLN n 
1 421 GLY n 
1 422 ALA n 
1 423 ARG n 
1 424 VAL n 
1 425 TYR n 
1 426 ALA n 
1 427 TYR n 
1 428 VAL n 
1 429 PHE n 
1 430 GLU n 
1 431 HIS n 
1 432 ARG n 
1 433 ALA n 
1 434 SER n 
1 435 THR n 
1 436 LEU n 
1 437 SER n 
1 438 TRP n 
1 439 PRO n 
1 440 LEU n 
1 441 TRP n 
1 442 MET n 
1 443 GLY n 
1 444 VAL n 
1 445 PRO n 
1 446 HIS n 
1 447 GLY n 
1 448 TYR n 
1 449 GLU n 
1 450 ILE n 
1 451 GLU n 
1 452 PHE n 
1 453 ILE n 
1 454 PHE n 
1 455 GLY n 
1 456 ILE n 
1 457 PRO n 
1 458 LEU n 
1 459 ASP n 
1 460 PRO n 
1 461 SER n 
1 462 ARG n 
1 463 ASN n 
1 464 TYR n 
1 465 THR n 
1 466 ALA n 
1 467 GLU n 
1 468 GLU n 
1 469 LYS n 
1 470 ILE n 
1 471 PHE n 
1 472 ALA n 
1 473 GLN n 
1 474 ARG n 
1 475 LEU n 
1 476 MET n 
1 477 ARG n 
1 478 TYR n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 ASP n 
1 488 PRO n 
1 489 ASN n 
1 490 GLU n 
1 491 PRO n 
1 492 ARG n 
1 493 ASP n 
1 494 PRO n 
1 495 LYS n 
1 496 ALA n 
1 497 PRO n 
1 498 GLN n 
1 499 TRP n 
1 500 PRO n 
1 501 PRO n 
1 502 TYR n 
1 503 THR n 
1 504 ALA n 
1 505 GLY n 
1 506 ALA n 
1 507 GLN n 
1 508 GLN n 
1 509 TYR n 
1 510 VAL n 
1 511 SER n 
1 512 LEU n 
1 513 ASP n 
1 514 LEU n 
1 515 ARG n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 VAL n 
1 520 ARG n 
1 521 ARG n 
1 522 GLY n 
1 523 LEU n 
1 524 ARG n 
1 525 ALA n 
1 526 GLN n 
1 527 ALA n 
1 528 CYS n 
1 529 ALA n 
1 530 PHE n 
1 531 TRP n 
1 532 ASN n 
1 533 ARG n 
1 534 PHE n 
1 535 LEU n 
1 536 PRO n 
1 537 LYS n 
1 538 LEU n 
1 539 LEU n 
1 540 SER n 
1 541 ALA n 
1 542 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   542 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           33 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6CQW A 1 ? 542 ? P22303 33 ? 574 ? 2 543 
2 1 6CQW B 1 ? 542 ? P22303 33 ? 574 ? 2 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                                                                        
?                                                                                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'           y ARGININE                                                                                       
?                                                                                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                                                                     
?                                                                                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                                                                
?                                                                                 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking'           y CYSTEINE                                                                                       
?                                                                                 'C3 H7 N O2 S'    121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                                                                           
?                                                                                 'C6 H12 O5'       164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                                                                      
?                                                                                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                                                                
?                                                                                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'             y GLYCINE                                                                                        
?                                                                                 'C2 H5 N O2'      75.067  
HI6 non-polymer                   . '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' 
'1-(2-HYDROXY-IMINOMETHYLPYRIDINIUM)-1-(4-CARBOXYAMINO)-PYRIDINIUM DIMETHYLETHER' 'C14 H16 N4 O3 2' 288.302 
HIS 'L-peptide linking'           y HISTIDINE                                                                                      
?                                                                                 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                   . WATER                                                                                          
?                                                                                 'H2 O'            18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                                                                     
?                                                                                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'           y LEUCINE                                                                                        
?                                                                                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'           y LYSINE                                                                                         
?                                                                                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'           y METHIONINE                                                                                     
?                                                                                 'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                       
?                                                                                 'C8 H15 N O6'     221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                                                                                  
?                                                                                 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'           y PROLINE                                                                                        
?                                                                                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking'           y SERINE                                                                                         
?                                                                                 'C3 H7 N O3'      105.093 
THR 'L-peptide linking'           y THREONINE                                                                                      
?                                                                                 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                                                                     
?                                                                                 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'           y TYROSINE                                                                                       
?                                                                                 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'           y VALINE                                                                                         
?                                                                                 'C5 H11 N O2'     117.146 
VX  non-polymer                   . 'O-ETHYLMETHYLPHOSPHONIC ACID ESTER GROUP'                                                     
?                                                                                 'C3 H9 O3 P'      124.076 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CQW 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.35 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.71 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'15 to 21% PEG 3350, 0.17 - 0.2M potassium nitrate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300-HS' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-07-14 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6CQW 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.278 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       95513 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.7 
_reflns.pdbx_Rmerge_I_obs                0.104 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.046 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.278 
_reflns_shell.d_res_low                   2.32 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           9059 
_reflns_shell.percent_possible_all        93.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.427 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.208 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6CQW 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.278 
_refine.ls_d_res_low                             39.674 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     95442 
_refine.ls_number_reflns_R_free                  4748 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.42 
_refine.ls_percent_reflns_R_free                 4.97 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1723 
_refine.ls_R_factor_R_free                       0.1987 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1709 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4EY4 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.98 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.23 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8269 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         172 
_refine_hist.number_atoms_solvent             665 
_refine_hist.number_atoms_total               9106 
_refine_hist.d_res_high                       2.278 
_refine_hist.d_res_low                        39.674 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 8839  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.721  ? 12108 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 14.381 ? 5177  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.046  ? 1302  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 1592  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.2776 2.3035  . . 129 2649 89.00  . . . 0.3747 . 0.2775 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3035 2.3306  . . 130 2991 97.00  . . . 0.2877 . 0.2496 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3306 2.3590  . . 154 2945 100.00 . . . 0.2708 . 0.2410 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3590 2.3889  . . 142 3045 100.00 . . . 0.3068 . 0.2320 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3889 2.4203  . . 146 2980 100.00 . . . 0.2611 . 0.2244 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4203 2.4535  . . 181 2975 100.00 . . . 0.2641 . 0.2137 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4535 2.4885  . . 139 3020 100.00 . . . 0.2274 . 0.2106 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4885 2.5257  . . 141 3032 100.00 . . . 0.2409 . 0.2035 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5257 2.5651  . . 158 3014 100.00 . . . 0.2412 . 0.2057 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5651 2.6072  . . 152 2980 100.00 . . . 0.2405 . 0.1995 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6072 2.6521  . . 148 3013 100.00 . . . 0.2427 . 0.2028 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6521 2.7003  . . 163 3025 100.00 . . . 0.2319 . 0.1951 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7003 2.7522  . . 153 3034 100.00 . . . 0.2550 . 0.1998 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7522 2.8084  . . 142 2997 100.00 . . . 0.2548 . 0.1971 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8084 2.8695  . . 179 3003 100.00 . . . 0.2239 . 0.2024 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8695 2.9362  . . 205 2981 100.00 . . . 0.2308 . 0.1970 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9362 3.0096  . . 153 3029 100.00 . . . 0.2505 . 0.1860 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0096 3.0909  . . 183 2993 100.00 . . . 0.2057 . 0.1815 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0909 3.1819  . . 166 3043 100.00 . . . 0.2312 . 0.1835 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1819 3.2845  . . 159 3013 100.00 . . . 0.2074 . 0.1827 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2845 3.4018  . . 162 3016 100.00 . . . 0.2015 . 0.1750 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4018 3.5380  . . 189 3023 100.00 . . . 0.1949 . 0.1708 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5380 3.6989  . . 140 3055 100.00 . . . 0.1912 . 0.1673 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6989 3.8937  . . 172 3061 100.00 . . . 0.1676 . 0.1460 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8937 4.1374  . . 179 3017 100.00 . . . 0.1555 . 0.1363 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1374 4.4565  . . 163 3070 100.00 . . . 0.1520 . 0.1331 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4565 4.9042  . . 145 3097 99.00  . . . 0.1541 . 0.1254 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9042 5.6122  . . 146 3120 100.00 . . . 0.1664 . 0.1512 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.6122 7.0643  . . 156 3182 100.00 . . . 0.2053 . 0.1771 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.0643 39.6799 . . 173 3291 99.00  . . . 0.1859 . 0.1737 . . . . . . . . . . 
# 
_struct.entry_id                     6CQW 
_struct.title                        'Crystal Structure of Recombinant Human Acetylcholinesterase in Complex with VX(-) and HI-6' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CQW 
_struct_keywords.text            Hydrolase 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 3 ? 
J N N 4 ? 
K N N 5 ? 
L N N 6 ? 
M N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 4   ? GLU A 6   ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  AA2 MET A 41  ? ARG A 45  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  AA3 PHE A 79  ? MET A 84  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  AA4 LEU A 129 ? ASP A 133 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 134 ? ARG A 142 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  AA6 VAL A 152 ? LEU A 158 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  AA7 ASN A 169 ? VAL A 186 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  AA8 ALA A 187 ? PHE A 189 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  AA9 SER A 202 ? SER A 214 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 AB1 SER A 214 ? GLY A 219 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 AB2 MET A 240 ? VAL A 254 ? MET A 241 VAL A 255 1 ? 15 
HELX_P HELX_P12 AB3 ASN A 264 ? THR A 274 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 AB4 PRO A 276 ? GLU A 284 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 AB5 TRP A 285 ? LEU A 288 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 AB6 THR A 310 ? GLY A 318 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 AB7 GLY A 334 ? VAL A 339 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 AB8 SER A 354 ? VAL A 366 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 AB9 SER A 370 ? THR A 382 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 AC1 ASP A 389 ? VAL A 406 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 AC2 VAL A 406 ? GLN A 420 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 AC3 PRO A 439 ? GLY A 443 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 AC4 GLU A 449 ? PHE A 454 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 AC5 GLY A 455 ? ASP A 459 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 AC6 THR A 465 ? ARG A 484 ? THR A 466 ARG A 485 1 ? 20 
HELX_P HELX_P25 AC7 ARG A 524 ? ARG A 533 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 AC8 ARG A 533 ? ALA A 541 ? ARG A 534 ALA A 542 1 ? 9  
HELX_P HELX_P27 AC9 ASP B 4   ? GLU B 6   ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 AD1 MET B 41  ? ARG B 45  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 AD2 PHE B 79  ? MET B 84  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 AD3 LEU B 129 ? ASP B 133 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 AD4 GLY B 134 ? ARG B 142 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 AD5 VAL B 152 ? LEU B 158 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 AD6 ASN B 169 ? VAL B 186 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 AD7 ALA B 187 ? PHE B 189 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 AD8 SER B 202 ? LEU B 213 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 AD9 SER B 214 ? GLY B 219 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 AE1 GLY B 239 ? VAL B 254 ? GLY B 240 VAL B 255 1 ? 16 
HELX_P HELX_P38 AE2 ASN B 264 ? THR B 274 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 AE3 PRO B 276 ? GLU B 284 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P40 AE4 TRP B 285 ? LEU B 288 ? TRP B 286 LEU B 289 5 ? 4  
HELX_P HELX_P41 AE5 THR B 310 ? GLY B 318 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 AE6 GLY B 334 ? VAL B 339 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 AE7 SER B 354 ? VAL B 366 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 AE8 SER B 370 ? TYR B 381 ? SER B 371 TYR B 382 1 ? 12 
HELX_P HELX_P45 AE9 ASP B 389 ? VAL B 406 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 AF1 VAL B 406 ? GLN B 420 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 AF2 PRO B 439 ? GLY B 443 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 AF3 GLU B 449 ? PHE B 454 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 AF4 GLY B 455 ? ASP B 459 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 AF5 THR B 465 ? GLY B 486 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 AF6 ARG B 524 ? ARG B 533 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 AF7 PHE B 534 ? SER B 540 ? PHE B 535 SER B 541 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 68  SG  ? ? ? 1_555 A CYS 95  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf2  disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 271 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf3  disulf ?    ? A CYS 408 SG  ? ? ? 1_555 A CYS 528 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf4  disulf ?    ? B CYS 68  SG  ? ? ? 1_555 B CYS 95  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf5  disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 271 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf6  disulf ?    ? B CYS 408 SG  ? ? ? 1_555 B CYS 528 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
covale1  covale one  ? A SER 202 OG  ? ? ? 1_555 G VX  .   P1 ? ? A SER 203 A VX  606 1_555 ? ? ? ? ? ? ? 1.402 ? ?               
covale2  covale one  ? A ASN 264 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 265 A NAG 604 1_555 ? ? ? ? ? ? ? 1.437 ? N-Glycosylation 
covale3  covale one  ? A ASN 349 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.369 ? N-Glycosylation 
covale4  covale one  ? A ASN 463 ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 464 A NAG 605 1_555 ? ? ? ? ? ? ? 1.435 ? N-Glycosylation 
covale5  covale one  ? B SER 202 OG  ? ? ? 1_555 J VX  .   P1 ? ? B SER 203 B VX  605 1_555 ? ? ? ? ? ? ? 1.400 ? ?               
covale6  covale one  ? B ASN 349 ND2 ? ? ? 1_555 D NAG .   C1 ? ? B ASN 350 D NAG 1   1_555 ? ? ? ? ? ? ? 1.569 ? N-Glycosylation 
covale7  covale one  ? B ASN 463 ND2 ? ? ? 1_555 I NAG .   C1 ? ? B ASN 464 B NAG 604 1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale8  covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale9  covale one  ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale10 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.440 ? ?               
covale11 covale one  ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? D NAG 1   D FUC 3   1_555 ? ? ? ? ? ? ? 1.433 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 104 A . ? TYR 105 A PRO 105 A ? PRO 106 A 1 3.65  
2 CYS 256 A . ? CYS 257 A PRO 257 A ? PRO 258 A 1 -5.79 
3 TYR 104 B . ? TYR 105 B PRO 105 B ? PRO 106 B 1 -1.53 
4 PRO 257 B . ? PRO 258 B PRO 258 B ? PRO 259 B 1 12.00 
5 ALA 496 B . ? ALA 497 B PRO 497 B ? PRO 498 B 1 -1.97 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
AA5 ? 3  ? 
AA6 ? 11 ? 
AA7 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? parallel      
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA6 3  4  ? anti-parallel 
AA6 4  5  ? parallel      
AA6 5  6  ? parallel      
AA6 6  7  ? parallel      
AA6 7  8  ? parallel      
AA6 8  9  ? parallel      
AA6 9  10 ? parallel      
AA6 10 11 ? anti-parallel 
AA7 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 8   ? VAL A 11  ? LEU A 9   VAL A 12  
AA1 2  GLY A 14  ? ARG A 17  ? GLY A 15  ARG A 18  
AA1 3  VAL A 58  ? ASP A 60  ? VAL A 59  ASP A 61  
AA2 1  ILE A 19  ? THR A 23  ? ILE A 20  THR A 24  
AA2 2  GLY A 26  ? PRO A 35  ? GLY A 27  PRO A 36  
AA2 3  TYR A 97  ? PRO A 103 ? TYR A 98  PRO A 104 
AA2 4  VAL A 144 ? MET A 148 ? VAL A 145 MET A 149 
AA2 5  THR A 111 ? ILE A 117 ? THR A 112 ILE A 118 
AA2 6  GLY A 191 ? GLU A 201 ? GLY A 192 GLU A 202 
AA2 7  ARG A 223 ? GLN A 227 ? ARG A 224 GLN A 228 
AA2 8  GLN A 324 ? VAL A 330 ? GLN A 325 VAL A 331 
AA2 9  ARG A 423 ? PHE A 429 ? ARG A 424 PHE A 430 
AA2 10 GLN A 508 ? LEU A 512 ? GLN A 509 LEU A 513 
AA2 11 GLU A 518 ? ARG A 521 ? GLU A 519 ARG A 522 
AA3 1  VAL A 67  ? CYS A 68  ? VAL A 68  CYS A 69  
AA3 2  LEU A 91  ? SER A 92  ? LEU A 92  SER A 93  
AA4 1  VAL A 238 ? GLY A 239 ? VAL A 239 GLY A 240 
AA4 2  VAL A 301 ? VAL A 302 ? VAL A 302 VAL A 303 
AA5 1  LEU B 8   ? VAL B 11  ? LEU B 9   VAL B 12  
AA5 2  GLY B 14  ? ARG B 17  ? GLY B 15  ARG B 18  
AA5 3  VAL B 58  ? ASP B 60  ? VAL B 59  ASP B 61  
AA6 1  ILE B 19  ? LEU B 21  ? ILE B 20  LEU B 22  
AA6 2  VAL B 28  ? PRO B 35  ? VAL B 29  PRO B 36  
AA6 3  TYR B 97  ? PRO B 103 ? TYR B 98  PRO B 104 
AA6 4  VAL B 144 ? MET B 148 ? VAL B 145 MET B 149 
AA6 5  THR B 111 ? ILE B 117 ? THR B 112 ILE B 118 
AA6 6  GLY B 191 ? GLU B 201 ? GLY B 192 GLU B 202 
AA6 7  ARG B 223 ? GLN B 227 ? ARG B 224 GLN B 228 
AA6 8  GLN B 324 ? VAL B 330 ? GLN B 325 VAL B 331 
AA6 9  ARG B 423 ? PHE B 429 ? ARG B 424 PHE B 430 
AA6 10 GLN B 508 ? LEU B 512 ? GLN B 509 LEU B 513 
AA6 11 GLU B 518 ? ARG B 521 ? GLU B 519 ARG B 522 
AA7 1  VAL B 67  ? CYS B 68  ? VAL B 68  CYS B 69  
AA7 2  LEU B 91  ? SER B 92  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 9   ? N VAL A 10  O LEU A 16  ? O LEU A 17  
AA1 2  3  N ARG A 15  ? N ARG A 16  O VAL A 59  ? O VAL A 60  
AA2 1  2  N LEU A 21  ? N LEU A 22  O VAL A 28  ? O VAL A 29  
AA2 2  3  N ILE A 34  ? N ILE A 35  O LEU A 98  ? O LEU A 99  
AA2 3  4  N ASN A 99  ? N ASN A 100 O SER A 147 ? O SER A 148 
AA2 4  5  O VAL A 146 ? O VAL A 147 N LEU A 114 ? N LEU A 115 
AA2 5  6  N VAL A 113 ? N VAL A 114 O THR A 197 ? O THR A 198 
AA2 6  7  N GLY A 200 ? N GLY A 201 O GLN A 227 ? O GLN A 228 
AA2 7  8  N LEU A 226 ? N LEU A 227 O LEU A 326 ? O LEU A 327 
AA2 8  9  N VAL A 329 ? N VAL A 330 O PHE A 429 ? O PHE A 430 
AA2 9  10 N VAL A 428 ? N VAL A 429 O LEU A 512 ? O LEU A 513 
AA2 10 11 N TYR A 509 ? N TYR A 510 O ARG A 520 ? O ARG A 521 
AA3 1  2  N VAL A 67  ? N VAL A 68  O SER A 92  ? O SER A 93  
AA4 1  2  N VAL A 238 ? N VAL A 239 O VAL A 302 ? O VAL A 303 
AA5 1  2  N VAL B 9   ? N VAL B 10  O LEU B 16  ? O LEU B 17  
AA5 2  3  N ARG B 15  ? N ARG B 16  O VAL B 59  ? O VAL B 60  
AA6 1  2  N ILE B 19  ? N ILE B 20  O ALA B 30  ? O ALA B 31  
AA6 2  3  N SER B 29  ? N SER B 30  O THR B 102 ? O THR B 103 
AA6 3  4  N ASN B 99  ? N ASN B 100 O SER B 147 ? O SER B 148 
AA6 4  5  O VAL B 146 ? O VAL B 147 N LEU B 114 ? N LEU B 115 
AA6 5  6  N THR B 111 ? N THR B 112 O ASP B 192 ? O ASP B 193 
AA6 6  7  N LEU B 198 ? N LEU B 199 O ARG B 223 ? O ARG B 224 
AA6 7  8  N LEU B 226 ? N LEU B 227 O LEU B 326 ? O LEU B 327 
AA6 8  9  N VAL B 329 ? N VAL B 330 O PHE B 429 ? O PHE B 430 
AA6 9  10 N VAL B 428 ? N VAL B 429 O LEU B 512 ? O LEU B 513 
AA6 10 11 N TYR B 509 ? N TYR B 510 O ARG B 520 ? O ARG B 521 
AA7 1  2  N VAL B 67  ? N VAL B 68  O SER B 92  ? O SER B 93  
# 
_atom_sites.entry_id                    6CQW 
_atom_sites.fract_transf_matrix[1][1]   0.009521 
_atom_sites.fract_transf_matrix[1][2]   0.005497 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010994 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003081 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 2   ? 81.238  39.428 55.693  1.00 162.51 ? 3    ARG A N   1 
ATOM   2    C CA  . ARG A 1 2   ? 79.915  39.787 56.190  1.00 158.44 ? 3    ARG A CA  1 
ATOM   3    C C   . ARG A 1 2   ? 78.857  39.716 55.092  1.00 146.33 ? 3    ARG A C   1 
ATOM   4    O O   . ARG A 1 2   ? 78.410  38.630 54.723  1.00 148.15 ? 3    ARG A O   1 
ATOM   5    C CB  . ARG A 1 2   ? 79.939  41.187 56.807  1.00 164.74 ? 3    ARG A CB  1 
ATOM   6    C CG  . ARG A 1 2   ? 80.314  41.203 58.278  1.00 175.27 ? 3    ARG A CG  1 
ATOM   7    C CD  . ARG A 1 2   ? 79.283  40.450 59.101  1.00 178.21 ? 3    ARG A CD  1 
ATOM   8    N NE  . ARG A 1 2   ? 77.938  40.975 58.886  1.00 176.42 ? 3    ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 2   ? 77.404  41.970 59.588  1.00 178.77 ? 3    ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 2   ? 78.101  42.549 60.556  1.00 183.07 ? 3    ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 2   ? 76.173  42.385 59.322  1.00 175.57 ? 3    ARG A NH2 1 
ATOM   12   N N   . GLU A 1 3   ? 78.458  40.877 54.574  1.00 137.58 ? 4    GLU A N   1 
ATOM   13   C CA  . GLU A 1 3   ? 77.399  40.965 53.578  1.00 123.46 ? 4    GLU A CA  1 
ATOM   14   C C   . GLU A 1 3   ? 77.832  41.851 52.418  1.00 115.06 ? 4    GLU A C   1 
ATOM   15   O O   . GLU A 1 3   ? 78.645  42.765 52.579  1.00 122.34 ? 4    GLU A O   1 
ATOM   16   C CB  . GLU A 1 3   ? 76.101  41.520 54.186  1.00 120.39 ? 4    GLU A CB  1 
ATOM   17   C CG  . GLU A 1 3   ? 75.391  40.570 55.140  1.00 119.59 ? 4    GLU A CG  1 
ATOM   18   C CD  . GLU A 1 3   ? 74.199  39.879 54.500  1.00 110.46 ? 4    GLU A CD  1 
ATOM   19   O OE1 . GLU A 1 3   ? 74.306  39.456 53.329  1.00 103.42 ? 4    GLU A OE1 1 
ATOM   20   O OE2 . GLU A 1 3   ? 73.150  39.764 55.169  1.00 107.25 ? 4    GLU A OE2 1 
ATOM   21   N N   . ASP A 1 4   ? 77.274  41.566 51.244  1.00 102.33 ? 5    ASP A N   1 
ATOM   22   C CA  . ASP A 1 4   ? 77.477  42.374 50.048  1.00 95.15  ? 5    ASP A CA  1 
ATOM   23   C C   . ASP A 1 4   ? 76.245  43.249 49.848  1.00 88.03  ? 5    ASP A C   1 
ATOM   24   O O   . ASP A 1 4   ? 75.131  42.734 49.701  1.00 81.65  ? 5    ASP A O   1 
ATOM   25   C CB  . ASP A 1 4   ? 77.716  41.487 48.826  1.00 93.62  ? 5    ASP A CB  1 
ATOM   26   C CG  . ASP A 1 4   ? 78.155  42.272 47.600  1.00 94.41  ? 5    ASP A CG  1 
ATOM   27   O OD1 . ASP A 1 4   ? 77.971  43.508 47.565  1.00 94.07  ? 5    ASP A OD1 1 
ATOM   28   O OD2 . ASP A 1 4   ? 78.678  41.642 46.657  1.00 92.39  ? 5    ASP A OD2 1 
ATOM   29   N N   . ALA A 1 5   ? 76.450  44.569 49.832  1.00 87.54  ? 6    ALA A N   1 
ATOM   30   C CA  . ALA A 1 5   ? 75.323  45.492 49.737  1.00 80.62  ? 6    ALA A CA  1 
ATOM   31   C C   . ALA A 1 5   ? 74.590  45.365 48.408  1.00 79.91  ? 6    ALA A C   1 
ATOM   32   O O   . ALA A 1 5   ? 73.395  45.672 48.328  1.00 76.53  ? 6    ALA A O   1 
ATOM   33   C CB  . ALA A 1 5   ? 75.803  46.929 49.941  1.00 83.56  ? 6    ALA A CB  1 
ATOM   34   N N   . GLU A 1 6   ? 75.279  44.913 47.357  1.00 78.69  ? 7    GLU A N   1 
ATOM   35   C CA  . GLU A 1 6   ? 74.639  44.808 46.049  1.00 74.00  ? 7    GLU A CA  1 
ATOM   36   C C   . GLU A 1 6   ? 73.583  43.712 46.022  1.00 69.12  ? 7    GLU A C   1 
ATOM   37   O O   . GLU A 1 6   ? 72.629  43.792 45.238  1.00 64.43  ? 7    GLU A O   1 
ATOM   38   C CB  . GLU A 1 6   ? 75.689  44.556 44.967  1.00 82.08  ? 7    GLU A CB  1 
ATOM   39   C CG  . GLU A 1 6   ? 76.640  45.719 44.735  1.00 95.96  ? 7    GLU A CG  1 
ATOM   40   C CD  . GLU A 1 6   ? 75.995  46.869 43.978  1.00 100.74 ? 7    GLU A CD  1 
ATOM   41   O OE1 . GLU A 1 6   ? 74.825  46.737 43.560  1.00 96.19  ? 7    GLU A OE1 1 
ATOM   42   O OE2 . GLU A 1 6   ? 76.663  47.909 43.801  1.00 107.47 ? 7    GLU A OE2 1 
ATOM   43   N N   . LEU A 1 7   ? 73.729  42.691 46.863  1.00 62.14  ? 8    LEU A N   1 
ATOM   44   C CA  . LEU A 1 7   ? 72.822  41.552 46.886  1.00 59.10  ? 8    LEU A CA  1 
ATOM   45   C C   . LEU A 1 7   ? 71.718  41.693 47.922  1.00 58.59  ? 8    LEU A C   1 
ATOM   46   O O   . LEU A 1 7   ? 70.995  40.724 48.176  1.00 57.73  ? 8    LEU A O   1 
ATOM   47   C CB  . LEU A 1 7   ? 73.606  40.263 47.127  1.00 54.22  ? 8    LEU A CB  1 
ATOM   48   C CG  . LEU A 1 7   ? 74.796  40.087 46.187  1.00 57.75  ? 8    LEU A CG  1 
ATOM   49   C CD1 . LEU A 1 7   ? 75.678  38.906 46.627  1.00 52.11  ? 8    LEU A CD1 1 
ATOM   50   C CD2 . LEU A 1 7   ? 74.306  39.975 44.721  1.00 45.41  ? 8    LEU A CD2 1 
ATOM   51   N N   . LEU A 1 8   ? 71.567  42.874 48.517  1.00 52.28  ? 9    LEU A N   1 
ATOM   52   C CA  . LEU A 1 8   ? 70.515  43.146 49.485  1.00 54.29  ? 9    LEU A CA  1 
ATOM   53   C C   . LEU A 1 8   ? 69.592  44.200 48.895  1.00 55.08  ? 9    LEU A C   1 
ATOM   54   O O   . LEU A 1 8   ? 70.044  45.284 48.509  1.00 64.62  ? 9    LEU A O   1 
ATOM   55   C CB  . LEU A 1 8   ? 71.100  43.606 50.823  1.00 54.28  ? 9    LEU A CB  1 
ATOM   56   C CG  . LEU A 1 8   ? 72.033  42.600 51.500  1.00 61.74  ? 9    LEU A CG  1 
ATOM   57   C CD1 . LEU A 1 8   ? 72.751  43.218 52.702  1.00 59.19  ? 9    LEU A CD1 1 
ATOM   58   C CD2 . LEU A 1 8   ? 71.272  41.320 51.876  1.00 65.06  ? 9    LEU A CD2 1 
ATOM   59   N N   . VAL A 1 9   ? 68.308  43.875 48.812  1.00 53.67  ? 10   VAL A N   1 
ATOM   60   C CA  . VAL A 1 9   ? 67.307  44.741 48.204  1.00 58.24  ? 10   VAL A CA  1 
ATOM   61   C C   . VAL A 1 9   ? 66.074  44.715 49.090  1.00 53.92  ? 10   VAL A C   1 
ATOM   62   O O   . VAL A 1 9   ? 65.717  43.670 49.644  1.00 54.47  ? 10   VAL A O   1 
ATOM   63   C CB  . VAL A 1 9   ? 66.971  44.293 46.764  1.00 57.61  ? 10   VAL A CB  1 
ATOM   64   C CG1 . VAL A 1 9   ? 65.699  44.959 46.264  1.00 60.99  ? 10   VAL A CG1 1 
ATOM   65   C CG2 . VAL A 1 9   ? 68.125  44.603 45.829  1.00 64.65  ? 10   VAL A CG2 1 
ATOM   66   N N   . THR A 1 10  ? 65.433  45.867 49.243  1.00 53.97  ? 11   THR A N   1 
ATOM   67   C CA  . THR A 1 10  ? 64.183  45.966 49.978  1.00 57.22  ? 11   THR A CA  1 
ATOM   68   C C   . THR A 1 10  ? 63.041  46.133 48.984  1.00 57.35  ? 11   THR A C   1 
ATOM   69   O O   . THR A 1 10  ? 63.057  47.055 48.160  1.00 58.07  ? 11   THR A O   1 
ATOM   70   C CB  . THR A 1 10  ? 64.222  47.127 50.972  1.00 59.45  ? 11   THR A CB  1 
ATOM   71   O OG1 . THR A 1 10  ? 65.258  46.891 51.935  1.00 62.70  ? 11   THR A OG1 1 
ATOM   72   C CG2 . THR A 1 10  ? 62.891  47.255 51.691  1.00 57.53  ? 11   THR A CG2 1 
ATOM   73   N N   . VAL A 1 11  ? 62.067  45.225 49.052  1.00 52.67  ? 12   VAL A N   1 
ATOM   74   C CA  . VAL A 1 11  ? 60.845  45.317 48.268  1.00 52.43  ? 12   VAL A CA  1 
ATOM   75   C C   . VAL A 1 11  ? 59.672  45.438 49.229  1.00 60.51  ? 12   VAL A C   1 
ATOM   76   O O   . VAL A 1 11  ? 59.809  45.243 50.440  1.00 57.48  ? 12   VAL A O   1 
ATOM   77   C CB  . VAL A 1 11  ? 60.663  44.118 47.324  1.00 58.11  ? 12   VAL A CB  1 
ATOM   78   C CG1 . VAL A 1 11  ? 61.858  44.034 46.387  1.00 60.18  ? 12   VAL A CG1 1 
ATOM   79   C CG2 . VAL A 1 11  ? 60.480  42.815 48.128  1.00 63.23  ? 12   VAL A CG2 1 
ATOM   80   N N   . ARG A 1 12  ? 58.502  45.764 48.673  1.00 63.44  ? 13   ARG A N   1 
ATOM   81   C CA  . ARG A 1 12  ? 57.360  46.135 49.509  1.00 66.06  ? 13   ARG A CA  1 
ATOM   82   C C   . ARG A 1 12  ? 57.014  45.057 50.527  1.00 56.62  ? 13   ARG A C   1 
ATOM   83   O O   . ARG A 1 12  ? 56.598  45.363 51.650  1.00 61.21  ? 13   ARG A O   1 
ATOM   84   C CB  . ARG A 1 12  ? 56.146  46.437 48.640  1.00 71.74  ? 13   ARG A CB  1 
ATOM   85   C CG  . ARG A 1 12  ? 56.078  47.867 48.180  1.00 82.26  ? 13   ARG A CG  1 
ATOM   86   C CD  . ARG A 1 12  ? 54.694  48.187 47.678  1.00 91.97  ? 13   ARG A CD  1 
ATOM   87   N NE  . ARG A 1 12  ? 54.731  49.216 46.649  1.00 101.21 ? 13   ARG A NE  1 
ATOM   88   C CZ  . ARG A 1 12  ? 53.684  49.574 45.915  1.00 106.90 ? 13   ARG A CZ  1 
ATOM   89   N NH1 . ARG A 1 12  ? 52.511  48.983 46.098  1.00 111.41 ? 13   ARG A NH1 1 
ATOM   90   N NH2 . ARG A 1 12  ? 53.810  50.523 44.999  1.00 106.73 ? 13   ARG A NH2 1 
ATOM   91   N N   . GLY A 1 13  ? 57.179  43.788 50.156  1.00 55.57  ? 14   GLY A N   1 
ATOM   92   C CA  . GLY A 1 13  ? 56.880  42.715 51.084  1.00 60.85  ? 14   GLY A CA  1 
ATOM   93   C C   . GLY A 1 13  ? 57.876  42.582 52.216  1.00 58.76  ? 14   GLY A C   1 
ATOM   94   O O   . GLY A 1 13  ? 57.548  41.987 53.245  1.00 50.98  ? 14   GLY A O   1 
ATOM   95   N N   . GLY A 1 14  ? 59.071  43.123 52.055  1.00 60.47  ? 15   GLY A N   1 
ATOM   96   C CA  . GLY A 1 14  ? 60.133  42.936 53.018  1.00 55.35  ? 15   GLY A CA  1 
ATOM   97   C C   . GLY A 1 14  ? 61.472  42.896 52.311  1.00 59.27  ? 15   GLY A C   1 
ATOM   98   O O   . GLY A 1 14  ? 61.591  43.295 51.158  1.00 57.23  ? 15   GLY A O   1 
ATOM   99   N N   . ARG A 1 15  ? 62.476  42.395 53.016  1.00 60.82  ? 16   ARG A N   1 
ATOM   100  C CA  . ARG A 1 15  ? 63.839  42.428 52.510  1.00 59.27  ? 16   ARG A CA  1 
ATOM   101  C C   . ARG A 1 15  ? 64.227  41.096 51.882  1.00 57.99  ? 16   ARG A C   1 
ATOM   102  O O   . ARG A 1 15  ? 63.722  40.034 52.258  1.00 54.88  ? 16   ARG A O   1 
ATOM   103  C CB  . ARG A 1 15  ? 64.813  42.797 53.625  1.00 56.10  ? 16   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 15  ? 64.501  44.145 54.245  1.00 59.32  ? 16   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 15  ? 65.512  44.503 55.307  1.00 66.31  ? 16   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 15  ? 65.413  43.615 56.458  1.00 75.28  ? 16   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 15  ? 66.417  43.362 57.289  1.00 85.66  ? 16   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 15  ? 67.601  43.926 57.091  1.00 92.51  ? 16   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 15  ? 66.241  42.542 58.316  1.00 79.70  ? 16   ARG A NH2 1 
ATOM   110  N N   . LEU A 1 16  ? 65.132  41.170 50.908  1.00 52.10  ? 17   LEU A N   1 
ATOM   111  C CA  . LEU A 1 16  ? 65.576  40.002 50.167  1.00 50.08  ? 17   LEU A CA  1 
ATOM   112  C C   . LEU A 1 16  ? 67.094  39.964 50.102  1.00 48.14  ? 17   LEU A C   1 
ATOM   113  O O   . LEU A 1 16  ? 67.765  41.000 50.146  1.00 50.40  ? 17   LEU A O   1 
ATOM   114  C CB  . LEU A 1 16  ? 65.021  39.985 48.739  1.00 54.24  ? 17   LEU A CB  1 
ATOM   115  C CG  . LEU A 1 16  ? 63.534  40.208 48.520  1.00 52.65  ? 17   LEU A CG  1 
ATOM   116  C CD1 . LEU A 1 16  ? 63.332  40.840 47.141  1.00 53.79  ? 17   LEU A CD1 1 
ATOM   117  C CD2 . LEU A 1 16  ? 62.780  38.882 48.680  1.00 46.58  ? 17   LEU A CD2 1 
ATOM   118  N N   . ARG A 1 17  ? 67.624  38.751 49.987  1.00 47.38  ? 18   ARG A N   1 
ATOM   119  C CA  . ARG A 1 17  ? 69.044  38.516 49.781  1.00 54.82  ? 18   ARG A CA  1 
ATOM   120  C C   . ARG A 1 17  ? 69.210  37.686 48.517  1.00 52.81  ? 18   ARG A C   1 
ATOM   121  O O   . ARG A 1 17  ? 68.597  36.622 48.384  1.00 55.65  ? 18   ARG A O   1 
ATOM   122  C CB  . ARG A 1 17  ? 69.666  37.807 50.988  1.00 57.79  ? 18   ARG A CB  1 
ATOM   123  C CG  . ARG A 1 17  ? 71.149  37.534 50.858  1.00 56.21  ? 18   ARG A CG  1 
ATOM   124  C CD  . ARG A 1 17  ? 71.679  36.784 52.073  1.00 58.20  ? 18   ARG A CD  1 
ATOM   125  N NE  . ARG A 1 17  ? 71.594  37.571 53.300  1.00 59.91  ? 18   ARG A NE  1 
ATOM   126  C CZ  . ARG A 1 17  ? 70.709  37.363 54.272  1.00 64.75  ? 18   ARG A CZ  1 
ATOM   127  N NH1 . ARG A 1 17  ? 69.822  36.382 54.175  1.00 58.24  ? 18   ARG A NH1 1 
ATOM   128  N NH2 . ARG A 1 17  ? 70.717  38.134 55.351  1.00 65.57  ? 18   ARG A NH2 1 
ATOM   129  N N   . GLY A 1 18  ? 70.016  38.186 47.581  1.00 50.20  ? 19   GLY A N   1 
ATOM   130  C CA  . GLY A 1 18  ? 70.274  37.507 46.336  1.00 47.95  ? 19   GLY A CA  1 
ATOM   131  C C   . GLY A 1 18  ? 71.651  36.873 46.296  1.00 50.34  ? 19   GLY A C   1 
ATOM   132  O O   . GLY A 1 18  ? 72.378  36.816 47.289  1.00 52.18  ? 19   GLY A O   1 
ATOM   133  N N   . ILE A 1 19  ? 72.002  36.385 45.110  1.00 48.72  ? 20   ILE A N   1 
ATOM   134  C CA  . ILE A 1 19  ? 73.312  35.806 44.871  1.00 51.25  ? 20   ILE A CA  1 
ATOM   135  C C   . ILE A 1 19  ? 73.945  36.519 43.691  1.00 56.75  ? 20   ILE A C   1 
ATOM   136  O O   . ILE A 1 19  ? 73.287  37.219 42.920  1.00 58.96  ? 20   ILE A O   1 
ATOM   137  C CB  . ILE A 1 19  ? 73.257  34.287 44.612  1.00 53.17  ? 20   ILE A CB  1 
ATOM   138  C CG1 . ILE A 1 19  ? 72.284  33.984 43.478  1.00 58.97  ? 20   ILE A CG1 1 
ATOM   139  C CG2 . ILE A 1 19  ? 72.884  33.543 45.855  1.00 57.47  ? 20   ILE A CG2 1 
ATOM   140  C CD1 . ILE A 1 19  ? 72.979  33.662 42.212  1.00 67.24  ? 20   ILE A CD1 1 
ATOM   141  N N   . ARG A 1 20  ? 75.232  36.306 43.550  1.00 57.34  ? 21   ARG A N   1 
ATOM   142  C CA  . ARG A 1 20  ? 76.038  36.986 42.553  1.00 61.01  ? 21   ARG A CA  1 
ATOM   143  C C   . ARG A 1 20  ? 76.557  35.942 41.574  1.00 61.82  ? 21   ARG A C   1 
ATOM   144  O O   . ARG A 1 20  ? 77.345  35.068 41.952  1.00 63.21  ? 21   ARG A O   1 
ATOM   145  C CB  . ARG A 1 20  ? 77.155  37.735 43.258  1.00 63.83  ? 21   ARG A CB  1 
ATOM   146  C CG  . ARG A 1 20  ? 78.271  38.121 42.369  1.00 67.93  ? 21   ARG A CG  1 
ATOM   147  C CD  . ARG A 1 20  ? 79.525  38.172 43.190  1.00 86.08  ? 21   ARG A CD  1 
ATOM   148  N NE  . ARG A 1 20  ? 80.721  38.242 42.382  1.00 94.73  ? 21   ARG A NE  1 
ATOM   149  C CZ  . ARG A 1 20  ? 81.390  39.367 42.203  1.00 101.89 ? 21   ARG A CZ  1 
ATOM   150  N NH1 . ARG A 1 20  ? 80.983  40.509 42.757  1.00 109.85 ? 21   ARG A NH1 1 
ATOM   151  N NH2 . ARG A 1 20  ? 82.487  39.376 41.460  1.00 99.04  ? 21   ARG A NH2 1 
ATOM   152  N N   . LEU A 1 21  ? 76.112  36.027 40.323  1.00 56.27  ? 22   LEU A N   1 
ATOM   153  C CA  . LEU A 1 21  ? 76.371  34.993 39.328  1.00 58.57  ? 22   LEU A CA  1 
ATOM   154  C C   . LEU A 1 21  ? 77.619  35.321 38.525  1.00 54.03  ? 22   LEU A C   1 
ATOM   155  O O   . LEU A 1 21  ? 77.789  36.453 38.066  1.00 54.32  ? 22   LEU A O   1 
ATOM   156  C CB  . LEU A 1 21  ? 75.176  34.860 38.388  1.00 60.60  ? 22   LEU A CB  1 
ATOM   157  C CG  . LEU A 1 21  ? 74.008  34.054 38.935  1.00 64.88  ? 22   LEU A CG  1 
ATOM   158  C CD1 . LEU A 1 21  ? 72.874  33.998 37.928  1.00 64.36  ? 22   LEU A CD1 1 
ATOM   159  C CD2 . LEU A 1 21  ? 74.512  32.664 39.261  1.00 68.08  ? 22   LEU A CD2 1 
ATOM   160  N N   . LYS A 1 22  ? 78.478  34.323 38.346  1.00 59.05  ? 23   LYS A N   1 
ATOM   161  C CA  . LYS A 1 22  ? 79.570  34.437 37.394  1.00 57.34  ? 23   LYS A CA  1 
ATOM   162  C C   . LYS A 1 22  ? 79.034  34.230 35.982  1.00 58.03  ? 23   LYS A C   1 
ATOM   163  O O   . LYS A 1 22  ? 78.275  33.290 35.730  1.00 61.47  ? 23   LYS A O   1 
ATOM   164  C CB  . LYS A 1 22  ? 80.659  33.406 37.690  1.00 61.01  ? 23   LYS A CB  1 
ATOM   165  C CG  . LYS A 1 22  ? 81.401  33.595 39.000  1.00 66.10  ? 23   LYS A CG  1 
ATOM   166  C CD  . LYS A 1 22  ? 82.651  32.727 39.019  1.00 74.37  ? 23   LYS A CD  1 
ATOM   167  C CE  . LYS A 1 22  ? 83.429  32.864 40.317  1.00 82.05  ? 23   LYS A CE  1 
ATOM   168  N NZ  . LYS A 1 22  ? 82.774  32.143 41.441  1.00 88.77  ? 23   LYS A NZ  1 
ATOM   169  N N   . THR A 1 23  ? 79.405  35.118 35.072  1.00 58.27  ? 24   THR A N   1 
ATOM   170  C CA  . THR A 1 23  ? 79.207  34.930 33.645  1.00 59.23  ? 24   THR A CA  1 
ATOM   171  C C   . THR A 1 23  ? 80.548  35.139 32.963  1.00 64.03  ? 24   THR A C   1 
ATOM   172  O O   . THR A 1 23  ? 81.458  35.738 33.546  1.00 65.18  ? 24   THR A O   1 
ATOM   173  C CB  . THR A 1 23  ? 78.171  35.903 33.057  1.00 57.38  ? 24   THR A CB  1 
ATOM   174  O OG1 . THR A 1 23  ? 78.812  37.140 32.725  1.00 61.22  ? 24   THR A OG1 1 
ATOM   175  C CG2 . THR A 1 23  ? 77.044  36.162 34.044  1.00 57.80  ? 24   THR A CG2 1 
ATOM   176  N N   . PRO A 1 24  ? 80.715  34.633 31.737  1.00 60.84  ? 25   PRO A N   1 
ATOM   177  C CA  . PRO A 1 24  ? 81.977  34.880 31.018  1.00 63.33  ? 25   PRO A CA  1 
ATOM   178  C C   . PRO A 1 24  ? 82.348  36.351 30.918  1.00 64.62  ? 25   PRO A C   1 
ATOM   179  O O   . PRO A 1 24  ? 83.520  36.701 31.096  1.00 72.93  ? 25   PRO A O   1 
ATOM   180  C CB  . PRO A 1 24  ? 81.706  34.266 29.639  1.00 64.88  ? 25   PRO A CB  1 
ATOM   181  C CG  . PRO A 1 24  ? 80.744  33.168 29.917  1.00 63.02  ? 25   PRO A CG  1 
ATOM   182  C CD  . PRO A 1 24  ? 79.861  33.661 31.033  1.00 53.85  ? 25   PRO A CD  1 
ATOM   183  N N   . GLY A 1 25  ? 81.377  37.225 30.657  1.00 62.59  ? 26   GLY A N   1 
ATOM   184  C CA  . GLY A 1 25  ? 81.669  38.637 30.500  1.00 62.61  ? 26   GLY A CA  1 
ATOM   185  C C   . GLY A 1 25  ? 81.773  39.429 31.784  1.00 66.43  ? 26   GLY A C   1 
ATOM   186  O O   . GLY A 1 25  ? 82.264  40.561 31.756  1.00 76.24  ? 26   GLY A O   1 
ATOM   187  N N   . GLY A 1 26  ? 81.325  38.872 32.906  1.00 60.84  ? 27   GLY A N   1 
ATOM   188  C CA  . GLY A 1 26  ? 81.369  39.574 34.167  1.00 64.25  ? 27   GLY A CA  1 
ATOM   189  C C   . GLY A 1 26  ? 80.254  39.160 35.105  1.00 63.54  ? 27   GLY A C   1 
ATOM   190  O O   . GLY A 1 26  ? 79.427  38.301 34.784  1.00 67.57  ? 27   GLY A O   1 
ATOM   191  N N   . PRO A 1 27  ? 80.207  39.769 36.286  1.00 60.96  ? 28   PRO A N   1 
ATOM   192  C CA  . PRO A 1 27  ? 79.232  39.350 37.295  1.00 53.95  ? 28   PRO A CA  1 
ATOM   193  C C   . PRO A 1 27  ? 77.843  39.918 37.047  1.00 49.25  ? 28   PRO A C   1 
ATOM   194  O O   . PRO A 1 27  ? 77.669  40.981 36.448  1.00 49.59  ? 28   PRO A O   1 
ATOM   195  C CB  . PRO A 1 27  ? 79.821  39.904 38.598  1.00 51.83  ? 28   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 27  ? 80.561  41.121 38.163  1.00 60.09  ? 28   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 27  ? 81.114  40.814 36.792  1.00 62.63  ? 28   PRO A CD  1 
ATOM   198  N N   . VAL A 1 28  ? 76.849  39.183 37.539  1.00 48.21  ? 29   VAL A N   1 
ATOM   199  C CA  . VAL A 1 28  ? 75.446  39.575 37.480  1.00 48.16  ? 29   VAL A CA  1 
ATOM   200  C C   . VAL A 1 28  ? 74.816  39.303 38.843  1.00 49.63  ? 29   VAL A C   1 
ATOM   201  O O   . VAL A 1 28  ? 75.136  38.304 39.495  1.00 47.15  ? 29   VAL A O   1 
ATOM   202  C CB  . VAL A 1 28  ? 74.699  38.813 36.364  1.00 50.69  ? 29   VAL A CB  1 
ATOM   203  C CG1 . VAL A 1 28  ? 73.198  39.025 36.470  1.00 54.09  ? 29   VAL A CG1 1 
ATOM   204  C CG2 . VAL A 1 28  ? 75.207  39.242 34.994  1.00 51.42  ? 29   VAL A CG2 1 
ATOM   205  N N   . SER A 1 29  ? 73.936  40.201 39.283  1.00 46.02  ? 30   SER A N   1 
ATOM   206  C CA  . SER A 1 29  ? 73.165  39.990 40.502  1.00 49.59  ? 30   SER A CA  1 
ATOM   207  C C   . SER A 1 29  ? 71.866  39.272 40.160  1.00 50.00  ? 30   SER A C   1 
ATOM   208  O O   . SER A 1 29  ? 71.168  39.659 39.219  1.00 53.25  ? 30   SER A O   1 
ATOM   209  C CB  . SER A 1 29  ? 72.867  41.316 41.204  1.00 47.49  ? 30   SER A CB  1 
ATOM   210  O OG  . SER A 1 29  ? 74.053  41.928 41.675  1.00 50.40  ? 30   SER A OG  1 
ATOM   211  N N   . ALA A 1 30  ? 71.544  38.232 40.929  1.00 47.38  ? 31   ALA A N   1 
ATOM   212  C CA  . ALA A 1 30  ? 70.367  37.409 40.683  1.00 42.47  ? 31   ALA A CA  1 
ATOM   213  C C   . ALA A 1 30  ? 69.565  37.253 41.965  1.00 48.23  ? 31   ALA A C   1 
ATOM   214  O O   . ALA A 1 30  ? 70.127  36.965 43.025  1.00 49.82  ? 31   ALA A O   1 
ATOM   215  C CB  . ALA A 1 30  ? 70.761  36.031 40.141  1.00 39.36  ? 31   ALA A CB  1 
ATOM   216  N N   . PHE A 1 31  ? 68.253  37.440 41.860  1.00 48.28  ? 32   PHE A N   1 
ATOM   217  C CA  . PHE A 1 31  ? 67.316  37.249 42.963  1.00 45.17  ? 32   PHE A CA  1 
ATOM   218  C C   . PHE A 1 31  ? 66.317  36.196 42.496  1.00 48.54  ? 32   PHE A C   1 
ATOM   219  O O   . PHE A 1 31  ? 65.330  36.513 41.828  1.00 51.27  ? 32   PHE A O   1 
ATOM   220  C CB  . PHE A 1 31  ? 66.639  38.560 43.345  1.00 42.54  ? 32   PHE A CB  1 
ATOM   221  C CG  . PHE A 1 31  ? 67.595  39.619 43.811  1.00 45.18  ? 32   PHE A CG  1 
ATOM   222  C CD1 . PHE A 1 31  ? 67.886  39.764 45.158  1.00 48.08  ? 32   PHE A CD1 1 
ATOM   223  C CD2 . PHE A 1 31  ? 68.214  40.461 42.902  1.00 45.13  ? 32   PHE A CD2 1 
ATOM   224  C CE1 . PHE A 1 31  ? 68.771  40.735 45.592  1.00 50.70  ? 32   PHE A CE1 1 
ATOM   225  C CE2 . PHE A 1 31  ? 69.100  41.435 43.328  1.00 49.09  ? 32   PHE A CE2 1 
ATOM   226  C CZ  . PHE A 1 31  ? 69.378  41.571 44.675  1.00 51.06  ? 32   PHE A CZ  1 
ATOM   227  N N   . LEU A 1 32  ? 66.586  34.941 42.847  1.00 44.21  ? 33   LEU A N   1 
ATOM   228  C CA  . LEU A 1 32  ? 65.867  33.790 42.316  1.00 45.19  ? 33   LEU A CA  1 
ATOM   229  C C   . LEU A 1 32  ? 64.919  33.234 43.368  1.00 47.21  ? 33   LEU A C   1 
ATOM   230  O O   . LEU A 1 32  ? 65.333  32.957 44.496  1.00 49.67  ? 33   LEU A O   1 
ATOM   231  C CB  . LEU A 1 32  ? 66.849  32.705 41.871  1.00 45.29  ? 33   LEU A CB  1 
ATOM   232  C CG  . LEU A 1 32  ? 67.985  33.162 40.953  1.00 44.49  ? 33   LEU A CG  1 
ATOM   233  C CD1 . LEU A 1 32  ? 68.908  31.995 40.628  1.00 42.03  ? 33   LEU A CD1 1 
ATOM   234  C CD2 . LEU A 1 32  ? 67.424  33.782 39.675  1.00 41.28  ? 33   LEU A CD2 1 
ATOM   235  N N   . GLY A 1 33  ? 63.659  33.051 42.991  1.00 49.06  ? 34   GLY A N   1 
ATOM   236  C CA  . GLY A 1 33  ? 62.690  32.491 43.913  1.00 42.69  ? 34   GLY A CA  1 
ATOM   237  C C   . GLY A 1 33  ? 62.073  33.497 44.858  1.00 47.91  ? 34   GLY A C   1 
ATOM   238  O O   . GLY A 1 33  ? 61.940  33.216 46.056  1.00 46.70  ? 34   GLY A O   1 
ATOM   239  N N   . ILE A 1 34  ? 61.700  34.669 44.355  1.00 42.50  ? 35   ILE A N   1 
ATOM   240  C CA  . ILE A 1 34  ? 61.015  35.680 45.155  1.00 42.31  ? 35   ILE A CA  1 
ATOM   241  C C   . ILE A 1 34  ? 59.530  35.346 45.189  1.00 47.95  ? 35   ILE A C   1 
ATOM   242  O O   . ILE A 1 34  ? 58.895  35.249 44.128  1.00 47.57  ? 35   ILE A O   1 
ATOM   243  C CB  . ILE A 1 34  ? 61.240  37.091 44.591  1.00 44.55  ? 35   ILE A CB  1 
ATOM   244  C CG1 . ILE A 1 34  ? 62.733  37.366 44.413  1.00 46.60  ? 35   ILE A CG1 1 
ATOM   245  C CG2 . ILE A 1 34  ? 60.585  38.135 45.487  1.00 50.60  ? 35   ILE A CG2 1 
ATOM   246  C CD1 . ILE A 1 34  ? 63.022  38.615 43.610  1.00 44.41  ? 35   ILE A CD1 1 
ATOM   247  N N   . PRO A 1 35  ? 58.931  35.164 46.364  1.00 44.09  ? 36   PRO A N   1 
ATOM   248  C CA  . PRO A 1 35  ? 57.492  34.883 46.415  1.00 43.87  ? 36   PRO A CA  1 
ATOM   249  C C   . PRO A 1 35  ? 56.688  36.126 46.066  1.00 47.42  ? 36   PRO A C   1 
ATOM   250  O O   . PRO A 1 35  ? 56.884  37.192 46.651  1.00 47.81  ? 36   PRO A O   1 
ATOM   251  C CB  . PRO A 1 35  ? 57.266  34.449 47.867  1.00 46.61  ? 36   PRO A CB  1 
ATOM   252  C CG  . PRO A 1 35  ? 58.351  35.137 48.628  1.00 49.27  ? 36   PRO A CG  1 
ATOM   253  C CD  . PRO A 1 35  ? 59.544  35.173 47.704  1.00 47.27  ? 36   PRO A CD  1 
ATOM   254  N N   . PHE A 1 36  ? 55.790  35.990 45.089  1.00 48.75  ? 37   PHE A N   1 
ATOM   255  C CA  . PHE A 1 36  ? 54.894  37.082 44.744  1.00 49.36  ? 37   PHE A CA  1 
ATOM   256  C C   . PHE A 1 36  ? 53.433  36.770 45.024  1.00 52.45  ? 37   PHE A C   1 
ATOM   257  O O   . PHE A 1 36  ? 52.591  37.666 44.894  1.00 52.73  ? 37   PHE A O   1 
ATOM   258  C CB  . PHE A 1 36  ? 55.071  37.492 43.270  1.00 44.12  ? 37   PHE A CB  1 
ATOM   259  C CG  . PHE A 1 36  ? 54.632  36.451 42.270  1.00 44.00  ? 37   PHE A CG  1 
ATOM   260  C CD1 . PHE A 1 36  ? 53.343  36.462 41.756  1.00 43.14  ? 37   PHE A CD1 1 
ATOM   261  C CD2 . PHE A 1 36  ? 55.521  35.491 41.811  1.00 40.05  ? 37   PHE A CD2 1 
ATOM   262  C CE1 . PHE A 1 36  ? 52.938  35.520 40.821  1.00 43.75  ? 37   PHE A CE1 1 
ATOM   263  C CE2 . PHE A 1 36  ? 55.126  34.545 40.874  1.00 44.86  ? 37   PHE A CE2 1 
ATOM   264  C CZ  . PHE A 1 36  ? 53.832  34.559 40.378  1.00 45.37  ? 37   PHE A CZ  1 
ATOM   265  N N   . ALA A 1 37  ? 53.112  35.545 45.431  1.00 48.31  ? 38   ALA A N   1 
ATOM   266  C CA  . ALA A 1 37  ? 51.752  35.185 45.790  1.00 45.44  ? 38   ALA A CA  1 
ATOM   267  C C   . ALA A 1 37  ? 51.775  34.242 46.984  1.00 54.46  ? 38   ALA A C   1 
ATOM   268  O O   . ALA A 1 37  ? 52.776  33.573 47.253  1.00 49.93  ? 38   ALA A O   1 
ATOM   269  C CB  . ALA A 1 37  ? 51.014  34.529 44.618  1.00 42.40  ? 38   ALA A CB  1 
ATOM   270  N N   . GLU A 1 38  ? 50.659  34.204 47.706  1.00 51.93  ? 39   GLU A N   1 
ATOM   271  C CA  . GLU A 1 38  ? 50.473  33.159 48.699  1.00 51.67  ? 39   GLU A CA  1 
ATOM   272  C C   . GLU A 1 38  ? 50.392  31.806 47.995  1.00 52.49  ? 39   GLU A C   1 
ATOM   273  O O   . GLU A 1 38  ? 49.843  31.715 46.892  1.00 51.57  ? 39   GLU A O   1 
ATOM   274  C CB  . GLU A 1 38  ? 49.206  33.402 49.519  1.00 53.49  ? 39   GLU A CB  1 
ATOM   275  C CG  . GLU A 1 38  ? 49.288  34.608 50.441  1.00 56.72  ? 39   GLU A CG  1 
ATOM   276  C CD  . GLU A 1 38  ? 50.318  34.431 51.536  1.00 63.53  ? 39   GLU A CD  1 
ATOM   277  O OE1 . GLU A 1 38  ? 50.363  33.338 52.142  1.00 65.72  ? 39   GLU A OE1 1 
ATOM   278  O OE2 . GLU A 1 38  ? 51.091  35.380 51.784  1.00 71.22  ? 39   GLU A OE2 1 
ATOM   279  N N   . PRO A 1 39  ? 50.942  30.752 48.590  1.00 51.66  ? 40   PRO A N   1 
ATOM   280  C CA  . PRO A 1 39  ? 50.956  29.439 47.930  1.00 50.47  ? 40   PRO A CA  1 
ATOM   281  C C   . PRO A 1 39  ? 49.550  28.972 47.597  1.00 48.85  ? 40   PRO A C   1 
ATOM   282  O O   . PRO A 1 39  ? 48.690  28.868 48.483  1.00 48.57  ? 40   PRO A O   1 
ATOM   283  C CB  . PRO A 1 39  ? 51.617  28.530 48.975  1.00 50.30  ? 40   PRO A CB  1 
ATOM   284  C CG  . PRO A 1 39  ? 52.470  29.456 49.778  1.00 52.48  ? 40   PRO A CG  1 
ATOM   285  C CD  . PRO A 1 39  ? 51.692  30.741 49.857  1.00 54.97  ? 40   PRO A CD  1 
ATOM   286  N N   . PRO A 1 40  ? 49.267  28.683 46.308  1.00 52.52  ? 41   PRO A N   1 
ATOM   287  C CA  . PRO A 1 40  ? 47.911  28.276 45.895  1.00 56.56  ? 41   PRO A CA  1 
ATOM   288  C C   . PRO A 1 40  ? 47.626  26.805 46.187  1.00 64.10  ? 41   PRO A C   1 
ATOM   289  O O   . PRO A 1 40  ? 47.371  26.000 45.286  1.00 64.87  ? 41   PRO A O   1 
ATOM   290  C CB  . PRO A 1 40  ? 47.925  28.585 44.392  1.00 51.48  ? 41   PRO A CB  1 
ATOM   291  C CG  . PRO A 1 40  ? 49.341  28.336 43.992  1.00 50.35  ? 41   PRO A CG  1 
ATOM   292  C CD  . PRO A 1 40  ? 50.190  28.784 45.164  1.00 47.43  ? 41   PRO A CD  1 
ATOM   293  N N   . MET A 1 41  ? 47.660  26.444 47.468  1.00 61.13  ? 42   MET A N   1 
ATOM   294  C CA  . MET A 1 41  ? 47.495  25.063 47.891  1.00 65.50  ? 42   MET A CA  1 
ATOM   295  C C   . MET A 1 41  ? 46.242  24.904 48.741  1.00 64.36  ? 42   MET A C   1 
ATOM   296  O O   . MET A 1 41  ? 45.676  25.880 49.244  1.00 58.96  ? 42   MET A O   1 
ATOM   297  C CB  . MET A 1 41  ? 48.701  24.571 48.696  1.00 73.85  ? 42   MET A CB  1 
ATOM   298  C CG  . MET A 1 41  ? 49.973  25.336 48.451  1.00 78.38  ? 42   MET A CG  1 
ATOM   299  S SD  . MET A 1 41  ? 51.344  24.508 49.260  1.00 94.79  ? 42   MET A SD  1 
ATOM   300  C CE  . MET A 1 41  ? 51.266  22.901 48.471  1.00 92.50  ? 42   MET A CE  1 
ATOM   301  N N   . GLY A 1 42  ? 45.834  23.647 48.909  1.00 59.47  ? 43   GLY A N   1 
ATOM   302  C CA  . GLY A 1 42  ? 44.697  23.304 49.725  1.00 58.89  ? 43   GLY A CA  1 
ATOM   303  C C   . GLY A 1 42  ? 43.441  24.031 49.297  1.00 64.20  ? 43   GLY A C   1 
ATOM   304  O O   . GLY A 1 42  ? 42.933  23.848 48.185  1.00 57.13  ? 43   GLY A O   1 
ATOM   305  N N   . PRO A 1 43  ? 42.919  24.886 50.181  1.00 64.93  ? 44   PRO A N   1 
ATOM   306  C CA  . PRO A 1 43  ? 41.715  25.657 49.833  1.00 60.72  ? 44   PRO A CA  1 
ATOM   307  C C   . PRO A 1 43  ? 41.949  26.705 48.757  1.00 63.96  ? 44   PRO A C   1 
ATOM   308  O O   . PRO A 1 43  ? 40.974  27.183 48.164  1.00 62.67  ? 44   PRO A O   1 
ATOM   309  C CB  . PRO A 1 43  ? 41.313  26.305 51.166  1.00 64.68  ? 44   PRO A CB  1 
ATOM   310  C CG  . PRO A 1 43  ? 42.586  26.360 51.959  1.00 63.52  ? 44   PRO A CG  1 
ATOM   311  C CD  . PRO A 1 43  ? 43.374  25.144 51.560  1.00 63.75  ? 44   PRO A CD  1 
ATOM   312  N N   . ARG A 1 44  ? 43.198  27.070 48.477  1.00 63.28  ? 45   ARG A N   1 
ATOM   313  C CA  . ARG A 1 44  ? 43.501  28.101 47.492  1.00 55.10  ? 45   ARG A CA  1 
ATOM   314  C C   . ARG A 1 44  ? 43.709  27.550 46.089  1.00 61.05  ? 45   ARG A C   1 
ATOM   315  O O   . ARG A 1 44  ? 43.985  28.326 45.167  1.00 54.14  ? 45   ARG A O   1 
ATOM   316  C CB  . ARG A 1 44  ? 44.742  28.890 47.918  1.00 56.21  ? 45   ARG A CB  1 
ATOM   317  C CG  . ARG A 1 44  ? 44.514  29.805 49.107  1.00 62.05  ? 45   ARG A CG  1 
ATOM   318  C CD  . ARG A 1 44  ? 45.828  30.330 49.646  1.00 67.94  ? 45   ARG A CD  1 
ATOM   319  N NE  . ARG A 1 44  ? 45.658  31.601 50.340  1.00 81.49  ? 45   ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 44  ? 45.767  31.758 51.655  1.00 86.99  ? 45   ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 44  ? 46.040  30.718 52.431  1.00 89.83  ? 45   ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 44  ? 45.596  32.958 52.193  1.00 89.92  ? 45   ARG A NH2 1 
ATOM   323  N N   . ARG A 1 45  ? 43.585  26.244 45.898  1.00 56.06  ? 46   ARG A N   1 
ATOM   324  C CA  . ARG A 1 45  ? 43.746  25.680 44.569  1.00 57.76  ? 46   ARG A CA  1 
ATOM   325  C C   . ARG A 1 45  ? 42.568  26.061 43.682  1.00 53.92  ? 46   ARG A C   1 
ATOM   326  O O   . ARG A 1 45  ? 41.421  26.097 44.135  1.00 51.61  ? 46   ARG A O   1 
ATOM   327  C CB  . ARG A 1 45  ? 43.865  24.166 44.652  1.00 53.41  ? 46   ARG A CB  1 
ATOM   328  C CG  . ARG A 1 45  ? 43.685  23.484 43.312  1.00 59.89  ? 46   ARG A CG  1 
ATOM   329  C CD  . ARG A 1 45  ? 43.593  21.981 43.475  1.00 57.10  ? 46   ARG A CD  1 
ATOM   330  N NE  . ARG A 1 45  ? 44.840  21.387 43.933  1.00 50.33  ? 46   ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 45  ? 44.969  20.113 44.269  1.00 51.60  ? 46   ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 45  ? 43.929  19.275 44.224  1.00 45.59  ? 46   ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 45  ? 46.140  19.631 44.684  1.00 53.70  ? 46   ARG A NH2 1 
ATOM   334  N N   . PHE A 1 46  ? 42.867  26.332 42.406  1.00 46.15  ? 47   PHE A N   1 
ATOM   335  C CA  . PHE A 1 46  ? 41.910  26.756 41.383  1.00 52.10  ? 47   PHE A CA  1 
ATOM   336  C C   . PHE A 1 46  ? 41.483  28.205 41.578  1.00 52.49  ? 47   PHE A C   1 
ATOM   337  O O   . PHE A 1 46  ? 40.800  28.767 40.718  1.00 49.94  ? 47   PHE A O   1 
ATOM   338  C CB  . PHE A 1 46  ? 40.657  25.871 41.351  1.00 51.04  ? 47   PHE A CB  1 
ATOM   339  C CG  . PHE A 1 46  ? 40.934  24.408 41.174  1.00 50.79  ? 47   PHE A CG  1 
ATOM   340  C CD1 . PHE A 1 46  ? 41.664  23.950 40.088  1.00 47.50  ? 47   PHE A CD1 1 
ATOM   341  C CD2 . PHE A 1 46  ? 40.419  23.483 42.069  1.00 47.05  ? 47   PHE A CD2 1 
ATOM   342  C CE1 . PHE A 1 46  ? 41.905  22.600 39.918  1.00 43.84  ? 47   PHE A CE1 1 
ATOM   343  C CE2 . PHE A 1 46  ? 40.648  22.133 41.902  1.00 48.95  ? 47   PHE A CE2 1 
ATOM   344  C CZ  . PHE A 1 46  ? 41.394  21.690 40.824  1.00 50.38  ? 47   PHE A CZ  1 
ATOM   345  N N   . LEU A 1 47  ? 41.867  28.818 42.695  1.00 44.58  ? 48   LEU A N   1 
ATOM   346  C CA  . LEU A 1 47  ? 41.458  30.185 42.981  1.00 48.29  ? 48   LEU A CA  1 
ATOM   347  C C   . LEU A 1 47  ? 42.476  31.185 42.442  1.00 51.89  ? 48   LEU A C   1 
ATOM   348  O O   . LEU A 1 47  ? 43.639  30.841 42.203  1.00 47.24  ? 48   LEU A O   1 
ATOM   349  C CB  . LEU A 1 47  ? 41.274  30.376 44.487  1.00 47.82  ? 48   LEU A CB  1 
ATOM   350  C CG  . LEU A 1 47  ? 40.208  29.535 45.192  1.00 51.30  ? 48   LEU A CG  1 
ATOM   351  C CD1 . LEU A 1 47  ? 40.139  29.896 46.683  1.00 50.64  ? 48   LEU A CD1 1 
ATOM   352  C CD2 . LEU A 1 47  ? 38.862  29.711 44.496  1.00 55.39  ? 48   LEU A CD2 1 
ATOM   353  N N   . PRO A 1 48  ? 42.055  32.428 42.207  1.00 50.09  ? 49   PRO A N   1 
ATOM   354  C CA  . PRO A 1 48  ? 43.008  33.444 41.763  1.00 51.29  ? 49   PRO A CA  1 
ATOM   355  C C   . PRO A 1 48  ? 44.096  33.638 42.784  1.00 52.97  ? 49   PRO A C   1 
ATOM   356  O O   . PRO A 1 48  ? 43.904  33.380 43.991  1.00 57.90  ? 49   PRO A O   1 
ATOM   357  C CB  . PRO A 1 48  ? 42.135  34.702 41.622  1.00 55.56  ? 49   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 48  ? 40.763  34.189 41.394  1.00 55.70  ? 49   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 48  ? 40.670  32.929 42.205  1.00 48.88  ? 49   PRO A CD  1 
ATOM   360  N N   . PRO A 1 49  ? 45.276  34.098 42.366  1.00 49.81  ? 50   PRO A N   1 
ATOM   361  C CA  . PRO A 1 49  ? 46.375  34.282 43.318  1.00 44.82  ? 50   PRO A CA  1 
ATOM   362  C C   . PRO A 1 49  ? 46.114  35.459 44.244  1.00 50.73  ? 50   PRO A C   1 
ATOM   363  O O   . PRO A 1 49  ? 45.533  36.471 43.848  1.00 56.67  ? 50   PRO A O   1 
ATOM   364  C CB  . PRO A 1 49  ? 47.582  34.545 42.415  1.00 42.83  ? 50   PRO A CB  1 
ATOM   365  C CG  . PRO A 1 49  ? 46.979  35.201 41.201  1.00 44.14  ? 50   PRO A CG  1 
ATOM   366  C CD  . PRO A 1 49  ? 45.651  34.513 41.000  1.00 43.11  ? 50   PRO A CD  1 
ATOM   367  N N   . GLU A 1 50  ? 46.543  35.314 45.493  1.00 52.38  ? 51   GLU A N   1 
ATOM   368  C CA  . GLU A 1 50  ? 46.518  36.472 46.373  1.00 60.44  ? 51   GLU A CA  1 
ATOM   369  C C   . GLU A 1 50  ? 47.934  36.988 46.586  1.00 55.81  ? 51   GLU A C   1 
ATOM   370  O O   . GLU A 1 50  ? 48.877  36.191 46.638  1.00 54.58  ? 51   GLU A O   1 
ATOM   371  C CB  . GLU A 1 50  ? 45.891  36.149 47.733  1.00 71.88  ? 51   GLU A CB  1 
ATOM   372  C CG  . GLU A 1 50  ? 44.859  35.051 47.689  1.00 90.78  ? 51   GLU A CG  1 
ATOM   373  C CD  . GLU A 1 50  ? 44.429  34.631 49.073  1.00 109.04 ? 51   GLU A CD  1 
ATOM   374  O OE1 . GLU A 1 50  ? 43.897  35.478 49.811  1.00 116.06 ? 51   GLU A OE1 1 
ATOM   375  O OE2 . GLU A 1 50  ? 44.626  33.458 49.424  1.00 112.84 ? 51   GLU A OE2 1 
ATOM   376  N N   . PRO A 1 51  ? 48.117  38.303 46.701  1.00 60.58  ? 52   PRO A N   1 
ATOM   377  C CA  . PRO A 1 51  ? 49.472  38.845 46.851  1.00 63.74  ? 52   PRO A CA  1 
ATOM   378  C C   . PRO A 1 51  ? 50.155  38.297 48.093  1.00 61.12  ? 52   PRO A C   1 
ATOM   379  O O   . PRO A 1 51  ? 49.515  38.004 49.105  1.00 61.37  ? 52   PRO A O   1 
ATOM   380  C CB  . PRO A 1 51  ? 49.243  40.357 46.959  1.00 69.54  ? 52   PRO A CB  1 
ATOM   381  C CG  . PRO A 1 51  ? 47.902  40.586 46.343  1.00 68.75  ? 52   PRO A CG  1 
ATOM   382  C CD  . PRO A 1 51  ? 47.098  39.364 46.670  1.00 64.27  ? 52   PRO A CD  1 
ATOM   383  N N   . LYS A 1 52  ? 51.473  38.140 47.994  1.00 58.05  ? 53   LYS A N   1 
ATOM   384  C CA  . LYS A 1 52  ? 52.255  37.651 49.119  1.00 58.08  ? 53   LYS A CA  1 
ATOM   385  C C   . LYS A 1 52  ? 52.190  38.643 50.271  1.00 55.97  ? 53   LYS A C   1 
ATOM   386  O O   . LYS A 1 52  ? 52.454  39.836 50.096  1.00 55.64  ? 53   LYS A O   1 
ATOM   387  C CB  . LYS A 1 52  ? 53.704  37.425 48.687  1.00 60.34  ? 53   LYS A CB  1 
ATOM   388  C CG  . LYS A 1 52  ? 54.632  36.961 49.797  1.00 59.19  ? 53   LYS A CG  1 
ATOM   389  C CD  . LYS A 1 52  ? 54.254  35.582 50.317  1.00 59.94  ? 53   LYS A CD  1 
ATOM   390  C CE  . LYS A 1 52  ? 55.259  35.094 51.354  1.00 64.48  ? 53   LYS A CE  1 
ATOM   391  N NZ  . LYS A 1 52  ? 54.886  33.768 51.923  1.00 73.31  ? 53   LYS A NZ  1 
ATOM   392  N N   . GLN A 1 53  ? 51.818  38.151 51.447  1.00 58.30  ? 54   GLN A N   1 
ATOM   393  C CA  A GLN A 1 53  ? 51.754  39.000 52.624  0.51 60.23  ? 54   GLN A CA  1 
ATOM   394  C CA  B GLN A 1 53  ? 51.754  39.015 52.610  0.49 60.19  ? 54   GLN A CA  1 
ATOM   395  C C   . GLN A 1 53  ? 53.162  39.413 53.051  1.00 60.88  ? 54   GLN A C   1 
ATOM   396  O O   . GLN A 1 53  ? 54.119  38.655 52.872  1.00 57.30  ? 54   GLN A O   1 
ATOM   397  C CB  A GLN A 1 53  ? 51.052  38.269 53.765  0.51 63.34  ? 54   GLN A CB  1 
ATOM   398  C CB  B GLN A 1 53  ? 51.017  38.327 53.755  0.49 63.40  ? 54   GLN A CB  1 
ATOM   399  C CG  A GLN A 1 53  ? 49.646  37.805 53.417  0.51 65.92  ? 54   GLN A CG  1 
ATOM   400  C CG  B GLN A 1 53  ? 49.506  38.464 53.670  0.49 67.66  ? 54   GLN A CG  1 
ATOM   401  C CD  A GLN A 1 53  ? 49.156  36.688 54.318  0.51 71.59  ? 54   GLN A CD  1 
ATOM   402  C CD  B GLN A 1 53  ? 49.049  39.912 53.717  0.49 74.77  ? 54   GLN A CD  1 
ATOM   403  O OE1 A GLN A 1 53  ? 49.842  36.283 55.257  0.51 76.55  ? 54   GLN A OE1 1 
ATOM   404  O OE1 B GLN A 1 53  ? 49.313  40.628 54.684  0.49 83.32  ? 54   GLN A OE1 1 
ATOM   405  N NE2 A GLN A 1 53  ? 47.963  36.179 54.032  0.51 73.50  ? 54   GLN A NE2 1 
ATOM   406  N NE2 B GLN A 1 53  ? 48.362  40.350 52.669  0.49 74.77  ? 54   GLN A NE2 1 
ATOM   407  N N   . PRO A 1 54  ? 53.315  40.612 53.614  1.00 66.36  ? 55   PRO A N   1 
ATOM   408  C CA  . PRO A 1 54  ? 54.646  41.065 54.033  1.00 66.14  ? 55   PRO A CA  1 
ATOM   409  C C   . PRO A 1 54  ? 55.286  40.110 55.029  1.00 62.04  ? 55   PRO A C   1 
ATOM   410  O O   . PRO A 1 54  ? 54.606  39.384 55.757  1.00 57.87  ? 55   PRO A O   1 
ATOM   411  C CB  . PRO A 1 54  ? 54.370  42.432 54.670  1.00 71.56  ? 55   PRO A CB  1 
ATOM   412  C CG  . PRO A 1 54  ? 53.112  42.896 54.024  1.00 71.11  ? 55   PRO A CG  1 
ATOM   413  C CD  . PRO A 1 54  ? 52.294  41.661 53.789  1.00 69.23  ? 55   PRO A CD  1 
ATOM   414  N N   . TRP A 1 55  ? 56.616  40.118 55.049  1.00 59.47  ? 56   TRP A N   1 
ATOM   415  C CA  . TRP A 1 55  ? 57.391  39.253 55.924  1.00 59.81  ? 56   TRP A CA  1 
ATOM   416  C C   . TRP A 1 55  ? 58.426  40.071 56.681  1.00 59.65  ? 56   TRP A C   1 
ATOM   417  O O   . TRP A 1 55  ? 58.913  41.095 56.192  1.00 56.74  ? 56   TRP A O   1 
ATOM   418  C CB  . TRP A 1 55  ? 58.095  38.142 55.134  1.00 54.63  ? 56   TRP A CB  1 
ATOM   419  C CG  . TRP A 1 55  ? 59.105  38.654 54.151  1.00 55.38  ? 56   TRP A CG  1 
ATOM   420  C CD1 . TRP A 1 55  ? 60.424  38.914 54.390  1.00 53.83  ? 56   TRP A CD1 1 
ATOM   421  C CD2 . TRP A 1 55  ? 58.879  38.965 52.770  1.00 53.96  ? 56   TRP A CD2 1 
ATOM   422  N NE1 . TRP A 1 55  ? 61.032  39.371 53.246  1.00 54.94  ? 56   TRP A NE1 1 
ATOM   423  C CE2 . TRP A 1 55  ? 60.105  39.410 52.237  1.00 52.63  ? 56   TRP A CE2 1 
ATOM   424  C CE3 . TRP A 1 55  ? 57.759  38.910 51.934  1.00 54.63  ? 56   TRP A CE3 1 
ATOM   425  C CZ2 . TRP A 1 55  ? 60.243  39.799 50.906  1.00 51.39  ? 56   TRP A CZ2 1 
ATOM   426  C CZ3 . TRP A 1 55  ? 57.898  39.297 50.610  1.00 53.05  ? 56   TRP A CZ3 1 
ATOM   427  C CH2 . TRP A 1 55  ? 59.130  39.736 50.110  1.00 48.44  ? 56   TRP A CH2 1 
ATOM   428  N N   . SER A 1 56  ? 58.757  39.608 57.881  1.00 53.61  ? 57   SER A N   1 
ATOM   429  C CA  . SER A 1 56  ? 59.871  40.153 58.637  1.00 58.80  ? 57   SER A CA  1 
ATOM   430  C C   . SER A 1 56  ? 61.138  39.358 58.338  1.00 58.46  ? 57   SER A C   1 
ATOM   431  O O   . SER A 1 56  ? 61.090  38.223 57.857  1.00 60.23  ? 57   SER A O   1 
ATOM   432  C CB  . SER A 1 56  ? 59.577  40.128 60.137  1.00 62.90  ? 57   SER A CB  1 
ATOM   433  O OG  . SER A 1 56  ? 59.317  38.806 60.573  1.00 68.67  ? 57   SER A OG  1 
ATOM   434  N N   . GLY A 1 57  ? 62.280  39.966 58.637  1.00 56.45  ? 58   GLY A N   1 
ATOM   435  C CA  . GLY A 1 57  ? 63.539  39.325 58.326  1.00 55.59  ? 58   GLY A CA  1 
ATOM   436  C C   . GLY A 1 57  ? 63.831  39.366 56.833  1.00 54.00  ? 58   GLY A C   1 
ATOM   437  O O   . GLY A 1 57  ? 63.161  40.040 56.050  1.00 53.15  ? 58   GLY A O   1 
ATOM   438  N N   . VAL A 1 58  ? 64.855  38.611 56.444  1.00 55.90  ? 59   VAL A N   1 
ATOM   439  C CA  . VAL A 1 58  ? 65.355  38.606 55.074  1.00 56.84  ? 59   VAL A CA  1 
ATOM   440  C C   . VAL A 1 58  ? 64.986  37.283 54.418  1.00 55.02  ? 59   VAL A C   1 
ATOM   441  O O   . VAL A 1 58  ? 65.230  36.210 54.985  1.00 57.92  ? 59   VAL A O   1 
ATOM   442  C CB  . VAL A 1 58  ? 66.877  38.831 55.029  1.00 56.18  ? 59   VAL A CB  1 
ATOM   443  C CG1 . VAL A 1 58  ? 67.356  38.932 53.573  1.00 54.90  ? 59   VAL A CG1 1 
ATOM   444  C CG2 . VAL A 1 58  ? 67.264  40.068 55.854  1.00 49.04  ? 59   VAL A CG2 1 
ATOM   445  N N   . VAL A 1 59  ? 64.394  37.363 53.230  1.00 49.68  ? 60   VAL A N   1 
ATOM   446  C CA  . VAL A 1 59  ? 64.094  36.189 52.418  1.00 53.52  ? 60   VAL A CA  1 
ATOM   447  C C   . VAL A 1 59  ? 65.272  35.945 51.482  1.00 51.85  ? 60   VAL A C   1 
ATOM   448  O O   . VAL A 1 59  ? 65.663  36.833 50.717  1.00 52.39  ? 60   VAL A O   1 
ATOM   449  C CB  . VAL A 1 59  ? 62.791  36.378 51.627  1.00 53.19  ? 60   VAL A CB  1 
ATOM   450  C CG1 . VAL A 1 59  ? 62.792  35.514 50.363  1.00 42.39  ? 60   VAL A CG1 1 
ATOM   451  C CG2 . VAL A 1 59  ? 61.582  36.070 52.511  1.00 54.64  ? 60   VAL A CG2 1 
ATOM   452  N N   . ASP A 1 60  ? 65.846  34.747 51.546  1.00 46.00  ? 61   ASP A N   1 
ATOM   453  C CA  . ASP A 1 60  ? 66.947  34.382 50.657  1.00 45.85  ? 61   ASP A CA  1 
ATOM   454  C C   . ASP A 1 60  ? 66.377  34.008 49.296  1.00 48.34  ? 61   ASP A C   1 
ATOM   455  O O   . ASP A 1 60  ? 65.816  32.923 49.119  1.00 50.11  ? 61   ASP A O   1 
ATOM   456  C CB  . ASP A 1 60  ? 67.766  33.239 51.241  1.00 45.77  ? 61   ASP A CB  1 
ATOM   457  C CG  . ASP A 1 60  ? 68.578  33.660 52.456  1.00 56.90  ? 61   ASP A CG  1 
ATOM   458  O OD1 . ASP A 1 60  ? 69.714  34.141 52.275  1.00 56.88  ? 61   ASP A OD1 1 
ATOM   459  O OD2 . ASP A 1 60  ? 68.093  33.486 53.591  1.00 59.98  ? 61   ASP A OD2 1 
ATOM   460  N N   . ALA A 1 61  ? 66.510  34.913 48.329  1.00 47.07  ? 62   ALA A N   1 
ATOM   461  C CA  . ALA A 1 61  ? 66.165  34.612 46.940  1.00 46.88  ? 62   ALA A CA  1 
ATOM   462  C C   . ALA A 1 61  ? 67.427  34.182 46.194  1.00 46.94  ? 62   ALA A C   1 
ATOM   463  O O   . ALA A 1 61  ? 67.971  34.895 45.351  1.00 43.78  ? 62   ALA A O   1 
ATOM   464  C CB  . ALA A 1 61  ? 65.501  35.817 46.282  1.00 43.56  ? 62   ALA A CB  1 
ATOM   465  N N   . THR A 1 62  ? 67.885  32.974 46.524  1.00 43.11  ? 63   THR A N   1 
ATOM   466  C CA  . THR A 1 62  ? 69.201  32.514 46.111  1.00 42.05  ? 63   THR A CA  1 
ATOM   467  C C   . THR A 1 62  ? 69.184  31.291 45.203  1.00 42.16  ? 63   THR A C   1 
ATOM   468  O O   . THR A 1 62  ? 70.260  30.814 44.823  1.00 44.94  ? 63   THR A O   1 
ATOM   469  C CB  . THR A 1 62  ? 70.058  32.207 47.345  1.00 40.98  ? 63   THR A CB  1 
ATOM   470  O OG1 . THR A 1 62  ? 69.431  31.178 48.116  1.00 47.31  ? 63   THR A OG1 1 
ATOM   471  C CG2 . THR A 1 62  ? 70.222  33.456 48.204  1.00 40.15  ? 63   THR A CG2 1 
ATOM   472  N N   . THR A 1 63  ? 68.013  30.767 44.848  1.00 46.49  ? 64   THR A N   1 
ATOM   473  C CA  . THR A 1 63  ? 67.924  29.628 43.942  1.00 39.51  ? 64   THR A CA  1 
ATOM   474  C C   . THR A 1 63  ? 66.493  29.531 43.438  1.00 41.79  ? 64   THR A C   1 
ATOM   475  O O   . THR A 1 63  ? 65.558  30.020 44.078  1.00 46.59  ? 64   THR A O   1 
ATOM   476  C CB  . THR A 1 63  ? 68.344  28.317 44.621  1.00 53.04  ? 64   THR A CB  1 
ATOM   477  O OG1 . THR A 1 63  ? 68.683  27.346 43.626  1.00 54.33  ? 64   THR A OG1 1 
ATOM   478  C CG2 . THR A 1 63  ? 67.208  27.762 45.466  1.00 53.92  ? 64   THR A CG2 1 
ATOM   479  N N   . PHE A 1 64  ? 66.338  28.903 42.273  1.00 38.17  ? 65   PHE A N   1 
ATOM   480  C CA  . PHE A 1 64  ? 65.014  28.727 41.693  1.00 42.47  ? 65   PHE A CA  1 
ATOM   481  C C   . PHE A 1 64  ? 64.128  27.911 42.624  1.00 40.41  ? 65   PHE A C   1 
ATOM   482  O O   . PHE A 1 64  ? 64.564  26.918 43.211  1.00 41.30  ? 65   PHE A O   1 
ATOM   483  C CB  . PHE A 1 64  ? 65.106  28.020 40.340  1.00 40.37  ? 65   PHE A CB  1 
ATOM   484  C CG  . PHE A 1 64  ? 65.711  28.850 39.250  1.00 40.35  ? 65   PHE A CG  1 
ATOM   485  C CD1 . PHE A 1 64  ? 65.064  29.982 38.780  1.00 43.10  ? 65   PHE A CD1 1 
ATOM   486  C CD2 . PHE A 1 64  ? 66.909  28.475 38.663  1.00 40.20  ? 65   PHE A CD2 1 
ATOM   487  C CE1 . PHE A 1 64  ? 65.611  30.741 37.761  1.00 43.34  ? 65   PHE A CE1 1 
ATOM   488  C CE2 . PHE A 1 64  ? 67.464  29.230 37.641  1.00 42.34  ? 65   PHE A CE2 1 
ATOM   489  C CZ  . PHE A 1 64  ? 66.814  30.364 37.191  1.00 40.96  ? 65   PHE A CZ  1 
ATOM   490  N N   . GLN A 1 65  ? 62.871  28.323 42.738  1.00 46.85  ? 66   GLN A N   1 
ATOM   491  C CA  . GLN A 1 65  ? 61.898  27.598 43.543  1.00 48.77  ? 66   GLN A CA  1 
ATOM   492  C C   . GLN A 1 65  ? 61.281  26.469 42.718  1.00 45.80  ? 66   GLN A C   1 
ATOM   493  O O   . GLN A 1 65  ? 61.661  26.219 41.570  1.00 45.21  ? 66   GLN A O   1 
ATOM   494  C CB  . GLN A 1 65  ? 60.840  28.555 44.083  1.00 48.49  ? 66   GLN A CB  1 
ATOM   495  C CG  . GLN A 1 65  ? 61.016  28.915 45.547  1.00 50.55  ? 66   GLN A CG  1 
ATOM   496  C CD  . GLN A 1 65  ? 60.551  27.812 46.481  1.00 52.57  ? 66   GLN A CD  1 
ATOM   497  O OE1 . GLN A 1 65  ? 60.221  26.707 46.047  1.00 52.30  ? 66   GLN A OE1 1 
ATOM   498  N NE2 . GLN A 1 65  ? 60.520  28.110 47.774  1.00 44.33  ? 66   GLN A NE2 1 
ATOM   499  N N   . SER A 1 66  ? 60.290  25.795 43.300  1.00 39.59  ? 67   SER A N   1 
ATOM   500  C CA  . SER A 1 66  ? 59.740  24.581 42.714  1.00 40.74  ? 67   SER A CA  1 
ATOM   501  C C   . SER A 1 66  ? 59.033  24.865 41.393  1.00 41.54  ? 67   SER A C   1 
ATOM   502  O O   . SER A 1 66  ? 58.529  25.964 41.149  1.00 42.20  ? 67   SER A O   1 
ATOM   503  C CB  . SER A 1 66  ? 58.759  23.923 43.687  1.00 44.18  ? 67   SER A CB  1 
ATOM   504  O OG  . SER A 1 66  ? 59.409  23.521 44.880  1.00 46.03  ? 67   SER A OG  1 
ATOM   505  N N   . VAL A 1 67  ? 59.004  23.847 40.539  1.00 39.47  ? 68   VAL A N   1 
ATOM   506  C CA  . VAL A 1 67  ? 58.226  23.884 39.307  1.00 41.47  ? 68   VAL A CA  1 
ATOM   507  C C   . VAL A 1 67  ? 56.763  23.626 39.644  1.00 41.44  ? 68   VAL A C   1 
ATOM   508  O O   . VAL A 1 67  ? 56.449  22.727 40.434  1.00 42.66  ? 68   VAL A O   1 
ATOM   509  C CB  . VAL A 1 67  ? 58.756  22.843 38.307  1.00 44.74  ? 68   VAL A CB  1 
ATOM   510  C CG1 . VAL A 1 67  ? 57.933  22.850 37.035  1.00 50.94  ? 68   VAL A CG1 1 
ATOM   511  C CG2 . VAL A 1 67  ? 60.228  23.090 38.010  1.00 39.12  ? 68   VAL A CG2 1 
ATOM   512  N N   . CYS A 1 68  ? 55.865  24.416 39.056  1.00 40.87  ? 69   CYS A N   1 
ATOM   513  C CA  . CYS A 1 68  ? 54.439  24.175 39.243  1.00 41.91  ? 69   CYS A CA  1 
ATOM   514  C C   . CYS A 1 68  ? 54.081  22.768 38.785  1.00 43.82  ? 69   CYS A C   1 
ATOM   515  O O   . CYS A 1 68  ? 54.585  22.282 37.767  1.00 43.02  ? 69   CYS A O   1 
ATOM   516  C CB  . CYS A 1 68  ? 53.611  25.203 38.472  1.00 39.64  ? 69   CYS A CB  1 
ATOM   517  S SG  . CYS A 1 68  ? 53.755  26.893 39.097  1.00 45.58  ? 69   CYS A SG  1 
ATOM   518  N N   . TYR A 1 69  ? 53.210  22.113 39.553  1.00 41.17  ? 70   TYR A N   1 
ATOM   519  C CA  . TYR A 1 69  ? 52.876  20.718 39.295  1.00 43.68  ? 70   TYR A CA  1 
ATOM   520  C C   . TYR A 1 69  ? 52.389  20.533 37.863  1.00 45.32  ? 70   TYR A C   1 
ATOM   521  O O   . TYR A 1 69  ? 51.527  21.275 37.384  1.00 38.65  ? 70   TYR A O   1 
ATOM   522  C CB  . TYR A 1 69  ? 51.816  20.238 40.282  1.00 48.97  ? 70   TYR A CB  1 
ATOM   523  C CG  . TYR A 1 69  ? 52.093  18.845 40.783  1.00 49.52  ? 70   TYR A CG  1 
ATOM   524  C CD1 . TYR A 1 69  ? 51.850  17.742 39.979  1.00 47.08  ? 70   TYR A CD1 1 
ATOM   525  C CD2 . TYR A 1 69  ? 52.618  18.632 42.051  1.00 51.54  ? 70   TYR A CD2 1 
ATOM   526  C CE1 . TYR A 1 69  ? 52.113  16.465 40.423  1.00 60.17  ? 70   TYR A CE1 1 
ATOM   527  C CE2 . TYR A 1 69  ? 52.884  17.355 42.507  1.00 58.23  ? 70   TYR A CE2 1 
ATOM   528  C CZ  . TYR A 1 69  ? 52.629  16.274 41.686  1.00 66.90  ? 70   TYR A CZ  1 
ATOM   529  O OH  . TYR A 1 69  ? 52.889  14.997 42.128  1.00 78.90  ? 70   TYR A OH  1 
ATOM   530  N N   . GLN A 1 70  ? 52.950  19.537 37.179  1.00 46.08  ? 71   GLN A N   1 
ATOM   531  C CA  . GLN A 1 70  ? 52.716  19.399 35.750  1.00 45.84  ? 71   GLN A CA  1 
ATOM   532  C C   . GLN A 1 70  ? 53.125  18.011 35.282  1.00 46.12  ? 71   GLN A C   1 
ATOM   533  O O   . GLN A 1 70  ? 53.899  17.308 35.940  1.00 46.07  ? 71   GLN A O   1 
ATOM   534  C CB  . GLN A 1 70  ? 53.483  20.463 34.964  1.00 40.23  ? 71   GLN A CB  1 
ATOM   535  C CG  . GLN A 1 70  ? 54.995  20.334 35.070  1.00 38.23  ? 71   GLN A CG  1 
ATOM   536  C CD  . GLN A 1 70  ? 55.716  21.507 34.436  1.00 43.99  ? 71   GLN A CD  1 
ATOM   537  O OE1 . GLN A 1 70  ? 56.489  21.341 33.491  1.00 42.05  ? 71   GLN A OE1 1 
ATOM   538  N NE2 . GLN A 1 70  ? 55.463  22.707 34.954  1.00 39.08  ? 71   GLN A NE2 1 
ATOM   539  N N   . TYR A 1 71  ? 52.592  17.636 34.124  1.00 46.17  ? 72   TYR A N   1 
ATOM   540  C CA  . TYR A 1 71  ? 52.985  16.406 33.452  1.00 48.03  ? 72   TYR A CA  1 
ATOM   541  C C   . TYR A 1 71  ? 54.470  16.432 33.105  1.00 48.18  ? 72   TYR A C   1 
ATOM   542  O O   . TYR A 1 71  ? 55.040  17.479 32.786  1.00 50.32  ? 72   TYR A O   1 
ATOM   543  C CB  . TYR A 1 71  ? 52.139  16.225 32.189  1.00 51.10  ? 72   TYR A CB  1 
ATOM   544  C CG  . TYR A 1 71  ? 52.554  15.087 31.285  1.00 50.46  ? 72   TYR A CG  1 
ATOM   545  C CD1 . TYR A 1 71  ? 52.228  13.773 31.595  1.00 48.41  ? 72   TYR A CD1 1 
ATOM   546  C CD2 . TYR A 1 71  ? 53.246  15.331 30.104  1.00 45.40  ? 72   TYR A CD2 1 
ATOM   547  C CE1 . TYR A 1 71  ? 52.594  12.732 30.765  1.00 54.06  ? 72   TYR A CE1 1 
ATOM   548  C CE2 . TYR A 1 71  ? 53.614  14.299 29.267  1.00 50.80  ? 72   TYR A CE2 1 
ATOM   549  C CZ  . TYR A 1 71  ? 53.288  13.002 29.602  1.00 56.98  ? 72   TYR A CZ  1 
ATOM   550  O OH  . TYR A 1 71  ? 53.658  11.970 28.771  1.00 60.13  ? 72   TYR A OH  1 
ATOM   551  N N   . VAL A 1 72  ? 55.101  15.262 33.179  1.00 45.72  ? 73   VAL A N   1 
ATOM   552  C CA  . VAL A 1 72  ? 56.506  15.088 32.822  1.00 45.04  ? 73   VAL A CA  1 
ATOM   553  C C   . VAL A 1 72  ? 56.571  14.231 31.564  1.00 46.24  ? 73   VAL A C   1 
ATOM   554  O O   . VAL A 1 72  ? 56.112  13.082 31.563  1.00 48.70  ? 73   VAL A O   1 
ATOM   555  C CB  . VAL A 1 72  ? 57.309  14.451 33.965  1.00 50.32  ? 73   VAL A CB  1 
ATOM   556  C CG1 . VAL A 1 72  ? 58.735  14.176 33.515  1.00 47.46  ? 73   VAL A CG1 1 
ATOM   557  C CG2 . VAL A 1 72  ? 57.299  15.356 35.192  1.00 48.51  ? 73   VAL A CG2 1 
ATOM   558  N N   . ASP A 1 73  ? 57.151  14.784 30.501  1.00 45.03  ? 74   ASP A N   1 
ATOM   559  C CA  . ASP A 1 73  ? 57.188  14.100 29.214  1.00 43.33  ? 74   ASP A CA  1 
ATOM   560  C C   . ASP A 1 73  ? 58.047  12.842 29.283  1.00 48.83  ? 74   ASP A C   1 
ATOM   561  O O   . ASP A 1 73  ? 59.141  12.847 29.855  1.00 53.64  ? 74   ASP A O   1 
ATOM   562  C CB  . ASP A 1 73  ? 57.724  15.039 28.137  1.00 50.56  ? 74   ASP A CB  1 
ATOM   563  C CG  . ASP A 1 73  ? 57.521  14.495 26.740  1.00 60.21  ? 74   ASP A CG  1 
ATOM   564  O OD1 . ASP A 1 73  ? 58.487  13.955 26.160  1.00 55.88  ? 74   ASP A OD1 1 
ATOM   565  O OD2 . ASP A 1 73  ? 56.390  14.608 26.225  1.00 67.29  ? 74   ASP A OD2 1 
ATOM   566  N N   . THR A 1 74  ? 57.548  11.756 28.684  1.00 49.62  ? 75   THR A N   1 
ATOM   567  C CA  . THR A 1 74  ? 58.225  10.465 28.737  1.00 58.46  ? 75   THR A CA  1 
ATOM   568  C C   . THR A 1 74  ? 58.374  9.802  27.370  1.00 56.44  ? 75   THR A C   1 
ATOM   569  O O   . THR A 1 74  ? 58.690  8.607  27.310  1.00 61.07  ? 75   THR A O   1 
ATOM   570  C CB  . THR A 1 74  ? 57.484  9.508  29.677  1.00 63.47  ? 75   THR A CB  1 
ATOM   571  O OG1 . THR A 1 74  ? 56.113  9.409  29.271  1.00 66.26  ? 75   THR A OG1 1 
ATOM   572  C CG2 . THR A 1 74  ? 57.555  10.000 31.116  1.00 64.46  ? 75   THR A CG2 1 
ATOM   573  N N   . LEU A 1 75  ? 58.165  10.536 26.275  1.00 52.66  ? 76   LEU A N   1 
ATOM   574  C CA  . LEU A 1 75  ? 58.200  9.917  24.953  1.00 55.62  ? 76   LEU A CA  1 
ATOM   575  C C   . LEU A 1 75  ? 59.587  9.370  24.635  1.00 55.27  ? 76   LEU A C   1 
ATOM   576  O O   . LEU A 1 75  ? 59.728  8.227  24.183  1.00 56.16  ? 76   LEU A O   1 
ATOM   577  C CB  . LEU A 1 75  ? 57.752  10.919 23.887  1.00 58.77  ? 76   LEU A CB  1 
ATOM   578  C CG  . LEU A 1 75  ? 57.862  10.452 22.434  1.00 60.81  ? 76   LEU A CG  1 
ATOM   579  C CD1 . LEU A 1 75  ? 56.753  9.458  22.103  1.00 57.68  ? 76   LEU A CD1 1 
ATOM   580  C CD2 . LEU A 1 75  ? 57.785  11.653 21.500  1.00 60.05  ? 76   LEU A CD2 1 
ATOM   581  N N   . TYR A 1 76  ? 60.628  10.170 24.867  1.00 47.70  ? 77   TYR A N   1 
ATOM   582  C CA  . TYR A 1 76  ? 62.014  9.762  24.652  1.00 49.25  ? 77   TYR A CA  1 
ATOM   583  C C   . TYR A 1 76  ? 62.767  9.964  25.962  1.00 55.92  ? 77   TYR A C   1 
ATOM   584  O O   . TYR A 1 76  ? 63.403  11.008 26.173  1.00 52.18  ? 77   TYR A O   1 
ATOM   585  C CB  . TYR A 1 76  ? 62.660  10.539 23.507  1.00 48.18  ? 77   TYR A CB  1 
ATOM   586  C CG  . TYR A 1 76  ? 61.994  10.332 22.164  1.00 52.25  ? 77   TYR A CG  1 
ATOM   587  C CD1 . TYR A 1 76  ? 61.950  9.074  21.576  1.00 51.21  ? 77   TYR A CD1 1 
ATOM   588  C CD2 . TYR A 1 76  ? 61.434  11.398 21.473  1.00 49.87  ? 77   TYR A CD2 1 
ATOM   589  C CE1 . TYR A 1 76  ? 61.352  8.880  20.344  1.00 55.39  ? 77   TYR A CE1 1 
ATOM   590  C CE2 . TYR A 1 76  ? 60.839  11.215 20.236  1.00 59.11  ? 77   TYR A CE2 1 
ATOM   591  C CZ  . TYR A 1 76  ? 60.797  9.954  19.678  1.00 56.92  ? 77   TYR A CZ  1 
ATOM   592  O OH  . TYR A 1 76  ? 60.202  9.766  18.451  1.00 53.31  ? 77   TYR A OH  1 
ATOM   593  N N   . PRO A 1 77  ? 62.710  8.988  26.867  1.00 56.72  ? 78   PRO A N   1 
ATOM   594  C CA  . PRO A 1 77  ? 63.336  9.159  28.185  1.00 62.95  ? 78   PRO A CA  1 
ATOM   595  C C   . PRO A 1 77  ? 64.847  9.302  28.072  1.00 64.99  ? 78   PRO A C   1 
ATOM   596  O O   . PRO A 1 77  ? 65.513  8.535  27.372  1.00 66.12  ? 78   PRO A O   1 
ATOM   597  C CB  . PRO A 1 77  ? 62.943  7.877  28.931  1.00 64.60  ? 78   PRO A CB  1 
ATOM   598  C CG  . PRO A 1 77  ? 61.743  7.357  28.201  1.00 66.14  ? 78   PRO A CG  1 
ATOM   599  C CD  . PRO A 1 77  ? 61.961  7.726  26.766  1.00 60.83  ? 78   PRO A CD  1 
ATOM   600  N N   . GLY A 1 78  ? 65.386  10.295 28.779  1.00 58.73  ? 79   GLY A N   1 
ATOM   601  C CA  . GLY A 1 78  ? 66.803  10.581 28.741  1.00 60.66  ? 79   GLY A CA  1 
ATOM   602  C C   . GLY A 1 78  ? 67.279  11.306 27.502  1.00 62.26  ? 79   GLY A C   1 
ATOM   603  O O   . GLY A 1 78  ? 68.467  11.645 27.421  1.00 62.68  ? 79   GLY A O   1 
ATOM   604  N N   . PHE A 1 79  ? 66.398  11.555 26.536  1.00 57.81  ? 80   PHE A N   1 
ATOM   605  C CA  . PHE A 1 79  ? 66.788  12.242 25.315  1.00 53.84  ? 80   PHE A CA  1 
ATOM   606  C C   . PHE A 1 79  ? 66.945  13.732 25.580  1.00 51.25  ? 80   PHE A C   1 
ATOM   607  O O   . PHE A 1 79  ? 66.059  14.370 26.158  1.00 50.42  ? 80   PHE A O   1 
ATOM   608  C CB  . PHE A 1 79  ? 65.761  12.007 24.211  1.00 49.05  ? 80   PHE A CB  1 
ATOM   609  C CG  . PHE A 1 79  ? 66.068  12.730 22.930  1.00 50.33  ? 80   PHE A CG  1 
ATOM   610  C CD1 . PHE A 1 79  ? 67.258  12.502 22.255  1.00 46.48  ? 80   PHE A CD1 1 
ATOM   611  C CD2 . PHE A 1 79  ? 65.158  13.625 22.390  1.00 50.16  ? 80   PHE A CD2 1 
ATOM   612  C CE1 . PHE A 1 79  ? 67.539  13.164 21.068  1.00 51.11  ? 80   PHE A CE1 1 
ATOM   613  C CE2 . PHE A 1 79  ? 65.429  14.287 21.205  1.00 49.88  ? 80   PHE A CE2 1 
ATOM   614  C CZ  . PHE A 1 79  ? 66.623  14.058 20.543  1.00 48.53  ? 80   PHE A CZ  1 
ATOM   615  N N   . GLU A 1 80  ? 68.076  14.281 25.135  1.00 53.64  ? 81   GLU A N   1 
ATOM   616  C CA  . GLU A 1 80  ? 68.382  15.687 25.375  1.00 55.17  ? 81   GLU A CA  1 
ATOM   617  C C   . GLU A 1 80  ? 67.297  16.606 24.822  1.00 54.36  ? 81   GLU A C   1 
ATOM   618  O O   . GLU A 1 80  ? 66.933  17.597 25.465  1.00 46.88  ? 81   GLU A O   1 
ATOM   619  C CB  . GLU A 1 80  ? 69.744  16.031 24.768  1.00 64.17  ? 81   GLU A CB  1 
ATOM   620  C CG  . GLU A 1 80  ? 69.931  17.481 24.355  1.00 80.26  ? 81   GLU A CG  1 
ATOM   621  C CD  . GLU A 1 80  ? 70.022  18.439 25.534  1.00 99.68  ? 81   GLU A CD  1 
ATOM   622  O OE1 . GLU A 1 80  ? 69.938  18.017 26.701  1.00 107.64 ? 81   GLU A OE1 1 
ATOM   623  O OE2 . GLU A 1 80  ? 70.180  19.639 25.285  1.00 105.02 ? 81   GLU A OE2 1 
ATOM   624  N N   . GLY A 1 81  ? 66.756  16.289 23.642  1.00 45.19  ? 82   GLY A N   1 
ATOM   625  C CA  . GLY A 1 81  ? 65.802  17.185 23.007  1.00 44.74  ? 82   GLY A CA  1 
ATOM   626  C C   . GLY A 1 81  ? 64.486  17.323 23.749  1.00 49.99  ? 82   GLY A C   1 
ATOM   627  O O   . GLY A 1 81  ? 63.785  18.328 23.592  1.00 45.43  ? 82   GLY A O   1 
ATOM   628  N N   . THR A 1 82  ? 64.122  16.327 24.554  1.00 51.37  ? 83   THR A N   1 
ATOM   629  C CA  . THR A 1 82  ? 62.908  16.426 25.354  1.00 47.93  ? 83   THR A CA  1 
ATOM   630  C C   . THR A 1 82  ? 63.175  16.738 26.819  1.00 46.02  ? 83   THR A C   1 
ATOM   631  O O   . THR A 1 82  ? 62.375  17.444 27.440  1.00 51.78  ? 83   THR A O   1 
ATOM   632  C CB  . THR A 1 82  ? 62.088  15.134 25.256  1.00 46.08  ? 83   THR A CB  1 
ATOM   633  O OG1 . THR A 1 82  ? 62.909  14.015 25.605  1.00 51.59  ? 83   THR A OG1 1 
ATOM   634  C CG2 . THR A 1 82  ? 61.561  14.946 23.841  1.00 46.42  ? 83   THR A CG2 1 
ATOM   635  N N   . GLU A 1 83  ? 64.282  16.246 27.384  1.00 45.45  ? 84   GLU A N   1 
ATOM   636  C CA  . GLU A 1 83  ? 64.549  16.484 28.800  1.00 50.75  ? 84   GLU A CA  1 
ATOM   637  C C   . GLU A 1 83  ? 64.829  17.955 29.087  1.00 53.33  ? 84   GLU A C   1 
ATOM   638  O O   . GLU A 1 83  ? 64.593  18.418 30.209  1.00 52.08  ? 84   GLU A O   1 
ATOM   639  C CB  . GLU A 1 83  ? 65.724  15.627 29.279  1.00 50.83  ? 84   GLU A CB  1 
ATOM   640  C CG  . GLU A 1 83  ? 65.515  14.116 29.195  1.00 53.10  ? 84   GLU A CG  1 
ATOM   641  C CD  . GLU A 1 83  ? 64.392  13.601 30.083  1.00 60.26  ? 84   GLU A CD  1 
ATOM   642  O OE1 . GLU A 1 83  ? 63.990  12.432 29.898  1.00 62.02  ? 84   GLU A OE1 1 
ATOM   643  O OE2 . GLU A 1 83  ? 63.915  14.349 30.965  1.00 59.39  ? 84   GLU A OE2 1 
ATOM   644  N N   . MET A 1 84  ? 65.321  18.703 28.096  1.00 42.02  ? 85   MET A N   1 
ATOM   645  C CA  . MET A 1 84  ? 65.589  20.124 28.298  1.00 41.24  ? 85   MET A CA  1 
ATOM   646  C C   . MET A 1 84  ? 64.332  20.912 28.638  1.00 43.96  ? 85   MET A C   1 
ATOM   647  O O   . MET A 1 84  ? 64.438  22.034 29.144  1.00 45.99  ? 85   MET A O   1 
ATOM   648  C CB  . MET A 1 84  ? 66.241  20.725 27.051  1.00 41.58  ? 85   MET A CB  1 
ATOM   649  C CG  . MET A 1 84  ? 65.369  20.656 25.801  1.00 45.36  ? 85   MET A CG  1 
ATOM   650  S SD  . MET A 1 84  ? 66.165  21.379 24.349  1.00 48.08  ? 85   MET A SD  1 
ATOM   651  C CE  . MET A 1 84  ? 66.169  23.117 24.790  1.00 48.51  ? 85   MET A CE  1 
ATOM   652  N N   . TRP A 1 85  ? 63.149  20.362 28.358  1.00 42.04  ? 86   TRP A N   1 
ATOM   653  C CA  . TRP A 1 85  ? 61.889  21.034 28.644  1.00 39.83  ? 86   TRP A CA  1 
ATOM   654  C C   . TRP A 1 85  ? 61.221  20.529 29.915  1.00 42.04  ? 86   TRP A C   1 
ATOM   655  O O   . TRP A 1 85  ? 60.252  21.142 30.373  1.00 39.54  ? 86   TRP A O   1 
ATOM   656  C CB  . TRP A 1 85  ? 60.920  20.870 27.465  1.00 40.50  ? 86   TRP A CB  1 
ATOM   657  C CG  . TRP A 1 85  ? 61.496  21.271 26.136  1.00 43.16  ? 86   TRP A CG  1 
ATOM   658  C CD1 . TRP A 1 85  ? 61.784  20.449 25.084  1.00 46.52  ? 86   TRP A CD1 1 
ATOM   659  C CD2 . TRP A 1 85  ? 61.858  22.595 25.719  1.00 45.49  ? 86   TRP A CD2 1 
ATOM   660  N NE1 . TRP A 1 85  ? 62.296  21.179 24.036  1.00 45.04  ? 86   TRP A NE1 1 
ATOM   661  C CE2 . TRP A 1 85  ? 62.353  22.498 24.401  1.00 46.16  ? 86   TRP A CE2 1 
ATOM   662  C CE3 . TRP A 1 85  ? 61.807  23.852 26.330  1.00 44.02  ? 86   TRP A CE3 1 
ATOM   663  C CZ2 . TRP A 1 85  ? 62.796  23.610 23.686  1.00 40.67  ? 86   TRP A CZ2 1 
ATOM   664  C CZ3 . TRP A 1 85  ? 62.247  24.955 25.619  1.00 45.48  ? 86   TRP A CZ3 1 
ATOM   665  C CH2 . TRP A 1 85  ? 62.736  24.827 24.310  1.00 45.73  ? 86   TRP A CH2 1 
ATOM   666  N N   . ASN A 1 86  ? 61.712  19.436 30.486  1.00 37.60  ? 87   ASN A N   1 
ATOM   667  C CA  . ASN A 1 86  ? 61.107  18.826 31.655  1.00 45.17  ? 87   ASN A CA  1 
ATOM   668  C C   . ASN A 1 86  ? 61.502  19.565 32.931  1.00 48.43  ? 87   ASN A C   1 
ATOM   669  O O   . ASN A 1 86  ? 62.510  20.276 32.964  1.00 41.55  ? 87   ASN A O   1 
ATOM   670  C CB  . ASN A 1 86  ? 61.519  17.359 31.745  1.00 47.99  ? 87   ASN A CB  1 
ATOM   671  C CG  . ASN A 1 86  ? 60.590  16.447 30.973  1.00 48.67  ? 87   ASN A CG  1 
ATOM   672  O OD1 . ASN A 1 86  ? 59.434  16.793 30.718  1.00 46.80  ? 87   ASN A OD1 1 
ATOM   673  N ND2 . ASN A 1 86  ? 61.081  15.265 30.618  1.00 43.40  ? 87   ASN A ND2 1 
ATOM   674  N N   . PRO A 1 87  ? 60.715  19.414 33.998  1.00 50.80  ? 88   PRO A N   1 
ATOM   675  C CA  . PRO A 1 87  ? 61.033  20.103 35.256  1.00 49.45  ? 88   PRO A CA  1 
ATOM   676  C C   . PRO A 1 87  ? 62.437  19.777 35.744  1.00 48.44  ? 88   PRO A C   1 
ATOM   677  O O   . PRO A 1 87  ? 62.854  18.618 35.761  1.00 46.53  ? 88   PRO A O   1 
ATOM   678  C CB  . PRO A 1 87  ? 59.966  19.576 36.221  1.00 44.57  ? 88   PRO A CB  1 
ATOM   679  C CG  . PRO A 1 87  ? 58.816  19.230 35.335  1.00 50.70  ? 88   PRO A CG  1 
ATOM   680  C CD  . PRO A 1 87  ? 59.429  18.698 34.075  1.00 45.47  ? 88   PRO A CD  1 
ATOM   681  N N   . ASN A 1 88  ? 63.170  20.822 36.129  1.00 46.82  ? 89   ASN A N   1 
ATOM   682  C CA  . ASN A 1 88  ? 64.496  20.683 36.715  1.00 48.28  ? 89   ASN A CA  1 
ATOM   683  C C   . ASN A 1 88  ? 64.513  21.075 38.187  1.00 48.15  ? 89   ASN A C   1 
ATOM   684  O O   . ASN A 1 88  ? 65.590  21.268 38.759  1.00 53.49  ? 89   ASN A O   1 
ATOM   685  C CB  . ASN A 1 88  ? 65.516  21.509 35.927  1.00 47.69  ? 89   ASN A CB  1 
ATOM   686  C CG  . ASN A 1 88  ? 65.253  22.998 36.009  1.00 49.50  ? 89   ASN A CG  1 
ATOM   687  O OD1 . ASN A 1 88  ? 64.140  23.432 36.307  1.00 45.50  ? 89   ASN A OD1 1 
ATOM   688  N ND2 . ASN A 1 88  ? 66.283  23.791 35.744  1.00 53.86  ? 89   ASN A ND2 1 
ATOM   689  N N   . ARG A 1 89  ? 63.343  21.222 38.799  1.00 49.42  ? 90   ARG A N   1 
ATOM   690  C CA  . ARG A 1 89  ? 63.183  21.353 40.238  1.00 50.83  ? 90   ARG A CA  1 
ATOM   691  C C   . ARG A 1 89  ? 62.035  20.448 40.661  1.00 50.83  ? 90   ARG A C   1 
ATOM   692  O O   . ARG A 1 89  ? 61.305  19.912 39.822  1.00 46.70  ? 90   ARG A O   1 
ATOM   693  C CB  . ARG A 1 89  ? 62.908  22.805 40.653  1.00 51.60  ? 90   ARG A CB  1 
ATOM   694  C CG  . ARG A 1 89  ? 64.089  23.747 40.478  1.00 59.39  ? 90   ARG A CG  1 
ATOM   695  C CD  . ARG A 1 89  ? 65.231  23.367 41.405  1.00 66.44  ? 90   ARG A CD  1 
ATOM   696  N NE  . ARG A 1 89  ? 66.245  24.413 41.480  1.00 70.03  ? 90   ARG A NE  1 
ATOM   697  C CZ  . ARG A 1 89  ? 67.266  24.526 40.638  1.00 68.72  ? 90   ARG A CZ  1 
ATOM   698  N NH1 . ARG A 1 89  ? 67.410  23.656 39.648  1.00 61.79  ? 90   ARG A NH1 1 
ATOM   699  N NH2 . ARG A 1 89  ? 68.141  25.511 40.785  1.00 72.95  ? 90   ARG A NH2 1 
ATOM   700  N N   . GLU A 1 90  ? 61.874  20.274 41.970  1.00 47.95  ? 91   GLU A N   1 
ATOM   701  C CA  A GLU A 1 90  ? 60.801  19.420 42.459  0.57 47.46  ? 91   GLU A CA  1 
ATOM   702  C CA  B GLU A 1 90  ? 60.800  19.435 42.481  0.43 47.60  ? 91   GLU A CA  1 
ATOM   703  C C   . GLU A 1 90  ? 59.444  20.006 42.086  1.00 46.61  ? 91   GLU A C   1 
ATOM   704  O O   . GLU A 1 90  ? 59.258  21.225 42.026  1.00 45.25  ? 91   GLU A O   1 
ATOM   705  C CB  A GLU A 1 90  ? 60.897  19.233 43.977  0.57 48.57  ? 91   GLU A CB  1 
ATOM   706  C CB  B GLU A 1 90  ? 60.898  19.317 44.005  0.43 48.71  ? 91   GLU A CB  1 
ATOM   707  C CG  A GLU A 1 90  ? 60.548  20.463 44.800  0.57 49.30  ? 91   GLU A CG  1 
ATOM   708  C CG  B GLU A 1 90  ? 62.245  18.819 44.522  0.43 53.73  ? 91   GLU A CG  1 
ATOM   709  C CD  A GLU A 1 90  ? 60.379  20.150 46.280  0.57 58.44  ? 91   GLU A CD  1 
ATOM   710  C CD  B GLU A 1 90  ? 63.246  19.941 44.754  0.43 56.13  ? 91   GLU A CD  1 
ATOM   711  O OE1 A GLU A 1 90  ? 59.225  19.964 46.723  0.57 56.51  ? 91   GLU A OE1 1 
ATOM   712  O OE1 B GLU A 1 90  ? 63.502  20.725 43.814  0.43 49.55  ? 91   GLU A OE1 1 
ATOM   713  O OE2 A GLU A 1 90  ? 61.400  20.084 46.998  0.57 59.58  ? 91   GLU A OE2 1 
ATOM   714  O OE2 B GLU A 1 90  ? 63.773  20.040 45.882  0.43 56.76  ? 91   GLU A OE2 1 
ATOM   715  N N   . LEU A 1 91  ? 58.492  19.118 41.810  1.00 43.81  ? 92   LEU A N   1 
ATOM   716  C CA  . LEU A 1 91  ? 57.131  19.540 41.517  1.00 44.68  ? 92   LEU A CA  1 
ATOM   717  C C   . LEU A 1 91  ? 56.425  19.938 42.807  1.00 48.02  ? 92   LEU A C   1 
ATOM   718  O O   . LEU A 1 91  ? 56.563  19.271 43.835  1.00 46.22  ? 92   LEU A O   1 
ATOM   719  C CB  . LEU A 1 91  ? 56.350  18.420 40.827  1.00 41.55  ? 92   LEU A CB  1 
ATOM   720  C CG  . LEU A 1 91  ? 56.838  17.904 39.473  1.00 48.64  ? 92   LEU A CG  1 
ATOM   721  C CD1 . LEU A 1 91  ? 55.796  16.975 38.854  1.00 41.40  ? 92   LEU A CD1 1 
ATOM   722  C CD2 . LEU A 1 91  ? 57.146  19.065 38.547  1.00 45.50  ? 92   LEU A CD2 1 
ATOM   723  N N   . SER A 1 92  ? 55.660  21.025 42.748  1.00 52.37  ? 93   SER A N   1 
ATOM   724  C CA  . SER A 1 92  ? 54.900  21.477 43.904  1.00 46.98  ? 93   SER A CA  1 
ATOM   725  C C   . SER A 1 92  ? 53.816  22.438 43.444  1.00 48.94  ? 93   SER A C   1 
ATOM   726  O O   . SER A 1 92  ? 53.965  23.123 42.430  1.00 51.73  ? 93   SER A O   1 
ATOM   727  C CB  . SER A 1 92  ? 55.803  22.158 44.939  1.00 44.29  ? 93   SER A CB  1 
ATOM   728  O OG  . SER A 1 92  ? 55.039  22.721 45.991  1.00 48.79  ? 93   SER A OG  1 
ATOM   729  N N   . GLU A 1 93  ? 52.721  22.473 44.201  1.00 48.21  ? 94   GLU A N   1 
ATOM   730  C CA  . GLU A 1 93  ? 51.726  23.516 43.988  1.00 45.89  ? 94   GLU A CA  1 
ATOM   731  C C   . GLU A 1 93  ? 52.177  24.852 44.563  1.00 50.14  ? 94   GLU A C   1 
ATOM   732  O O   . GLU A 1 93  ? 51.733  25.902 44.089  1.00 56.39  ? 94   GLU A O   1 
ATOM   733  C CB  . GLU A 1 93  ? 50.388  23.113 44.600  1.00 46.66  ? 94   GLU A CB  1 
ATOM   734  C CG  . GLU A 1 93  ? 49.722  21.952 43.909  1.00 48.13  ? 94   GLU A CG  1 
ATOM   735  C CD  . GLU A 1 93  ? 48.346  21.681 44.466  1.00 52.69  ? 94   GLU A CD  1 
ATOM   736  O OE1 . GLU A 1 93  ? 47.394  22.378 44.059  1.00 51.31  ? 94   GLU A OE1 1 
ATOM   737  O OE2 . GLU A 1 93  ? 48.217  20.778 45.321  1.00 54.14  ? 94   GLU A OE2 1 
ATOM   738  N N   . ASP A 1 94  ? 53.038  24.835 45.578  1.00 44.29  ? 95   ASP A N   1 
ATOM   739  C CA  . ASP A 1 94  ? 53.666  26.049 46.091  1.00 45.73  ? 95   ASP A CA  1 
ATOM   740  C C   . ASP A 1 94  ? 54.765  26.417 45.106  1.00 47.73  ? 95   ASP A C   1 
ATOM   741  O O   . ASP A 1 94  ? 55.921  26.014 45.243  1.00 49.17  ? 95   ASP A O   1 
ATOM   742  C CB  . ASP A 1 94  ? 54.203  25.824 47.499  1.00 43.28  ? 95   ASP A CB  1 
ATOM   743  C CG  . ASP A 1 94  ? 54.983  27.021 48.040  1.00 52.58  ? 95   ASP A CG  1 
ATOM   744  O OD1 . ASP A 1 94  ? 54.985  28.111 47.431  1.00 58.09  ? 95   ASP A OD1 1 
ATOM   745  O OD2 . ASP A 1 94  ? 55.584  26.874 49.117  1.00 64.59  ? 95   ASP A OD2 1 
ATOM   746  N N   . CYS A 1 95  ? 54.395  27.188 44.082  1.00 46.98  ? 96   CYS A N   1 
ATOM   747  C CA  . CYS A 1 95  ? 55.319  27.466 42.993  1.00 44.44  ? 96   CYS A CA  1 
ATOM   748  C C   . CYS A 1 95  ? 55.253  28.903 42.500  1.00 43.63  ? 96   CYS A C   1 
ATOM   749  O O   . CYS A 1 95  ? 55.925  29.230 41.514  1.00 43.16  ? 96   CYS A O   1 
ATOM   750  C CB  . CYS A 1 95  ? 55.047  26.520 41.824  1.00 44.18  ? 96   CYS A CB  1 
ATOM   751  S SG  . CYS A 1 95  ? 53.394  26.709 41.090  1.00 44.34  ? 96   CYS A SG  1 
ATOM   752  N N   . LEU A 1 96  ? 54.476  29.775 43.140  1.00 38.33  ? 97   LEU A N   1 
ATOM   753  C CA  . LEU A 1 96  ? 54.288  31.132 42.627  1.00 42.68  ? 97   LEU A CA  1 
ATOM   754  C C   . LEU A 1 96  ? 55.447  32.009 43.097  1.00 44.66  ? 97   LEU A C   1 
ATOM   755  O O   . LEU A 1 96  ? 55.359  32.761 44.070  1.00 45.12  ? 97   LEU A O   1 
ATOM   756  C CB  . LEU A 1 96  ? 52.928  31.679 43.043  1.00 38.32  ? 97   LEU A CB  1 
ATOM   757  C CG  . LEU A 1 96  ? 51.774  30.927 42.362  1.00 41.15  ? 97   LEU A CG  1 
ATOM   758  C CD1 . LEU A 1 96  ? 50.428  31.601 42.598  1.00 41.86  ? 97   LEU A CD1 1 
ATOM   759  C CD2 . LEU A 1 96  ? 52.037  30.758 40.860  1.00 37.17  ? 97   LEU A CD2 1 
ATOM   760  N N   . TYR A 1 97  ? 56.558  31.904 42.366  1.00 43.71  ? 98   TYR A N   1 
ATOM   761  C CA  . TYR A 1 97  ? 57.774  32.659 42.627  1.00 37.53  ? 98   TYR A CA  1 
ATOM   762  C C   . TYR A 1 97  ? 58.299  33.230 41.317  1.00 42.88  ? 98   TYR A C   1 
ATOM   763  O O   . TYR A 1 97  ? 58.087  32.656 40.246  1.00 42.71  ? 98   TYR A O   1 
ATOM   764  C CB  . TYR A 1 97  ? 58.859  31.782 43.274  1.00 37.09  ? 98   TYR A CB  1 
ATOM   765  C CG  . TYR A 1 97  ? 58.435  31.126 44.569  1.00 44.16  ? 98   TYR A CG  1 
ATOM   766  C CD1 . TYR A 1 97  ? 58.776  31.680 45.797  1.00 44.30  ? 98   TYR A CD1 1 
ATOM   767  C CD2 . TYR A 1 97  ? 57.690  29.955 44.563  1.00 45.24  ? 98   TYR A CD2 1 
ATOM   768  C CE1 . TYR A 1 97  ? 58.386  31.081 46.984  1.00 43.47  ? 98   TYR A CE1 1 
ATOM   769  C CE2 . TYR A 1 97  ? 57.298  29.354 45.735  1.00 42.81  ? 98   TYR A CE2 1 
ATOM   770  C CZ  . TYR A 1 97  ? 57.647  29.917 46.942  1.00 46.51  ? 98   TYR A CZ  1 
ATOM   771  O OH  . TYR A 1 97  ? 57.250  29.307 48.106  1.00 45.48  ? 98   TYR A OH  1 
ATOM   772  N N   . LEU A 1 98  ? 58.992  34.363 41.407  1.00 38.62  ? 99   LEU A N   1 
ATOM   773  C CA  . LEU A 1 98  ? 59.585  34.991 40.235  1.00 45.03  ? 99   LEU A CA  1 
ATOM   774  C C   . LEU A 1 98  ? 61.068  35.239 40.481  1.00 45.98  ? 99   LEU A C   1 
ATOM   775  O O   . LEU A 1 98  ? 61.572  35.097 41.598  1.00 45.93  ? 99   LEU A O   1 
ATOM   776  C CB  . LEU A 1 98  ? 58.862  36.297 39.859  1.00 44.72  ? 99   LEU A CB  1 
ATOM   777  C CG  . LEU A 1 98  ? 58.623  37.409 40.884  1.00 50.27  ? 99   LEU A CG  1 
ATOM   778  C CD1 . LEU A 1 98  ? 59.878  38.228 41.141  1.00 46.12  ? 99   LEU A CD1 1 
ATOM   779  C CD2 . LEU A 1 98  ? 57.489  38.311 40.411  1.00 48.54  ? 99   LEU A CD2 1 
ATOM   780  N N   . ASN A 1 99  ? 61.763  35.621 39.411  1.00 40.28  ? 100  ASN A N   1 
ATOM   781  C CA  . ASN A 1 99  ? 63.207  35.801 39.427  1.00 42.91  ? 100  ASN A CA  1 
ATOM   782  C C   . ASN A 1 99  ? 63.565  37.134 38.787  1.00 46.57  ? 100  ASN A C   1 
ATOM   783  O O   . ASN A 1 99  ? 62.908  37.584 37.847  1.00 50.97  ? 100  ASN A O   1 
ATOM   784  C CB  . ASN A 1 99  ? 63.908  34.658 38.684  1.00 42.29  ? 100  ASN A CB  1 
ATOM   785  C CG  . ASN A 1 99  ? 63.239  33.318 38.924  1.00 46.88  ? 100  ASN A CG  1 
ATOM   786  O OD1 . ASN A 1 99  ? 63.332  32.752 40.014  1.00 47.15  ? 100  ASN A OD1 1 
ATOM   787  N ND2 . ASN A 1 99  ? 62.550  32.809 37.909  1.00 41.90  ? 100  ASN A ND2 1 
ATOM   788  N N   . VAL A 1 100 ? 64.616  37.766 39.307  1.00 43.95  ? 101  VAL A N   1 
ATOM   789  C CA  . VAL A 1 100 ? 65.087  39.055 38.811  1.00 41.34  ? 101  VAL A CA  1 
ATOM   790  C C   . VAL A 1 100 ? 66.596  38.981 38.630  1.00 44.38  ? 101  VAL A C   1 
ATOM   791  O O   . VAL A 1 100 ? 67.324  38.673 39.581  1.00 50.63  ? 101  VAL A O   1 
ATOM   792  C CB  . VAL A 1 100 ? 64.721  40.214 39.756  1.00 47.62  ? 101  VAL A CB  1 
ATOM   793  C CG1 . VAL A 1 100 ? 65.271  41.530 39.219  1.00 41.81  ? 101  VAL A CG1 1 
ATOM   794  C CG2 . VAL A 1 100 ? 63.211  40.303 39.957  1.00 42.61  ? 101  VAL A CG2 1 
ATOM   795  N N   . TRP A 1 101 ? 67.062  39.261 37.415  1.00 48.85  ? 102  TRP A N   1 
ATOM   796  C CA  . TRP A 1 101 ? 68.478  39.427 37.117  1.00 43.85  ? 102  TRP A CA  1 
ATOM   797  C C   . TRP A 1 101 ? 68.756  40.901 36.849  1.00 48.65  ? 102  TRP A C   1 
ATOM   798  O O   . TRP A 1 101 ? 67.987  41.564 36.144  1.00 48.47  ? 102  TRP A O   1 
ATOM   799  C CB  . TRP A 1 101 ? 68.892  38.612 35.890  1.00 42.93  ? 102  TRP A CB  1 
ATOM   800  C CG  . TRP A 1 101 ? 68.948  37.119 36.054  1.00 41.60  ? 102  TRP A CG  1 
ATOM   801  C CD1 . TRP A 1 101 ? 70.047  36.373 36.356  1.00 41.65  ? 102  TRP A CD1 1 
ATOM   802  C CD2 . TRP A 1 101 ? 67.875  36.187 35.856  1.00 40.38  ? 102  TRP A CD2 1 
ATOM   803  N NE1 . TRP A 1 101 ? 69.722  35.038 36.382  1.00 40.68  ? 102  TRP A NE1 1 
ATOM   804  C CE2 . TRP A 1 101 ? 68.394  34.898 36.078  1.00 34.98  ? 102  TRP A CE2 1 
ATOM   805  C CE3 . TRP A 1 101 ? 66.523  36.320 35.532  1.00 40.99  ? 102  TRP A CE3 1 
ATOM   806  C CZ2 . TRP A 1 101 ? 67.610  33.748 35.981  1.00 40.94  ? 102  TRP A CZ2 1 
ATOM   807  C CZ3 . TRP A 1 101 ? 65.746  35.174 35.426  1.00 40.88  ? 102  TRP A CZ3 1 
ATOM   808  C CH2 . TRP A 1 101 ? 66.292  33.908 35.655  1.00 42.45  ? 102  TRP A CH2 1 
ATOM   809  N N   . THR A 1 102 ? 69.856  41.415 37.397  1.00 45.75  ? 103  THR A N   1 
ATOM   810  C CA  . THR A 1 102 ? 70.215  42.808 37.178  1.00 39.35  ? 103  THR A CA  1 
ATOM   811  C C   . THR A 1 102 ? 71.734  42.920 37.156  1.00 52.49  ? 103  THR A C   1 
ATOM   812  O O   . THR A 1 102 ? 72.419  42.073 37.742  1.00 58.43  ? 103  THR A O   1 
ATOM   813  C CB  . THR A 1 102 ? 69.595  43.711 38.262  1.00 53.22  ? 103  THR A CB  1 
ATOM   814  O OG1 . THR A 1 102 ? 69.729  45.094 37.893  1.00 57.81  ? 103  THR A OG1 1 
ATOM   815  C CG2 . THR A 1 102 ? 70.258  43.486 39.621  1.00 48.36  ? 103  THR A CG2 1 
ATOM   816  N N   . PRO A 1 103 ? 72.290  43.917 36.460  1.00 55.14  ? 104  PRO A N   1 
ATOM   817  C CA  . PRO A 1 103 ? 73.752  44.026 36.362  1.00 57.00  ? 104  PRO A CA  1 
ATOM   818  C C   . PRO A 1 103 ? 74.431  44.213 37.711  1.00 62.72  ? 104  PRO A C   1 
ATOM   819  O O   . PRO A 1 103 ? 73.831  44.661 38.691  1.00 60.63  ? 104  PRO A O   1 
ATOM   820  C CB  . PRO A 1 103 ? 73.957  45.258 35.473  1.00 58.93  ? 104  PRO A CB  1 
ATOM   821  C CG  . PRO A 1 103 ? 72.735  45.312 34.637  1.00 56.08  ? 104  PRO A CG  1 
ATOM   822  C CD  . PRO A 1 103 ? 71.614  44.827 35.517  1.00 52.16  ? 104  PRO A CD  1 
ATOM   823  N N   . TYR A 1 104 ? 75.714  43.859 37.738  1.00 69.08  ? 105  TYR A N   1 
ATOM   824  C CA  . TYR A 1 104 ? 76.582  44.033 38.900  1.00 70.39  ? 105  TYR A CA  1 
ATOM   825  C C   . TYR A 1 104 ? 77.762  44.911 38.486  1.00 81.34  ? 105  TYR A C   1 
ATOM   826  O O   . TYR A 1 104 ? 78.574  44.502 37.657  1.00 94.30  ? 105  TYR A O   1 
ATOM   827  C CB  . TYR A 1 104 ? 77.071  42.677 39.420  1.00 72.40  ? 105  TYR A CB  1 
ATOM   828  C CG  . TYR A 1 104 ? 77.712  42.695 40.799  1.00 75.50  ? 105  TYR A CG  1 
ATOM   829  C CD1 . TYR A 1 104 ? 78.921  43.345 41.024  1.00 77.73  ? 105  TYR A CD1 1 
ATOM   830  C CD2 . TYR A 1 104 ? 77.121  42.029 41.867  1.00 72.96  ? 105  TYR A CD2 1 
ATOM   831  C CE1 . TYR A 1 104 ? 79.508  43.353 42.277  1.00 79.57  ? 105  TYR A CE1 1 
ATOM   832  C CE2 . TYR A 1 104 ? 77.701  42.029 43.122  1.00 76.27  ? 105  TYR A CE2 1 
ATOM   833  C CZ  . TYR A 1 104 ? 78.893  42.692 43.321  1.00 79.09  ? 105  TYR A CZ  1 
ATOM   834  O OH  . TYR A 1 104 ? 79.473  42.693 44.567  1.00 77.41  ? 105  TYR A OH  1 
ATOM   835  N N   . PRO A 1 105 ? 77.871  46.119 39.062  1.00 78.51  ? 106  PRO A N   1 
ATOM   836  C CA  . PRO A 1 105 ? 77.015  46.676 40.115  1.00 78.32  ? 106  PRO A CA  1 
ATOM   837  C C   . PRO A 1 105 ? 75.636  47.112 39.620  1.00 77.31  ? 106  PRO A C   1 
ATOM   838  O O   . PRO A 1 105 ? 75.424  47.235 38.413  1.00 76.27  ? 106  PRO A O   1 
ATOM   839  C CB  . PRO A 1 105 ? 77.816  47.885 40.601  1.00 74.34  ? 106  PRO A CB  1 
ATOM   840  C CG  . PRO A 1 105 ? 78.551  48.333 39.388  1.00 73.99  ? 106  PRO A CG  1 
ATOM   841  C CD  . PRO A 1 105 ? 78.914  47.074 38.646  1.00 76.67  ? 106  PRO A CD  1 
ATOM   842  N N   . ARG A 1 106 ? 74.725  47.333 40.563  1.00 77.63  ? 107  ARG A N   1 
ATOM   843  C CA  . ARG A 1 106 ? 73.363  47.721 40.229  1.00 70.51  ? 107  ARG A CA  1 
ATOM   844  C C   . ARG A 1 106 ? 73.375  48.983 39.369  1.00 73.22  ? 107  ARG A C   1 
ATOM   845  O O   . ARG A 1 106 ? 74.247  49.842 39.544  1.00 78.22  ? 107  ARG A O   1 
ATOM   846  C CB  . ARG A 1 106 ? 72.561  47.958 41.511  1.00 69.94  ? 107  ARG A CB  1 
ATOM   847  C CG  . ARG A 1 106 ? 71.066  47.725 41.392  1.00 67.38  ? 107  ARG A CG  1 
ATOM   848  C CD  . ARG A 1 106 ? 70.396  47.833 42.754  1.00 78.47  ? 107  ARG A CD  1 
ATOM   849  N NE  . ARG A 1 106 ? 70.914  46.838 43.688  1.00 83.04  ? 107  ARG A NE  1 
ATOM   850  C CZ  . ARG A 1 106 ? 70.660  46.828 44.993  1.00 87.07  ? 107  ARG A CZ  1 
ATOM   851  N NH1 . ARG A 1 106 ? 69.893  47.766 45.531  1.00 89.69  ? 107  ARG A NH1 1 
ATOM   852  N NH2 . ARG A 1 106 ? 71.178  45.880 45.762  1.00 82.20  ? 107  ARG A NH2 1 
ATOM   853  N N   . PRO A 1 107 ? 72.448  49.117 38.420  1.00 80.44  ? 108  PRO A N   1 
ATOM   854  C CA  . PRO A 1 107 ? 72.467  50.287 37.533  1.00 86.14  ? 108  PRO A CA  1 
ATOM   855  C C   . PRO A 1 107 ? 72.348  51.595 38.301  1.00 93.53  ? 108  PRO A C   1 
ATOM   856  O O   . PRO A 1 107 ? 71.590  51.708 39.266  1.00 84.41  ? 108  PRO A O   1 
ATOM   857  C CB  . PRO A 1 107 ? 71.255  50.061 36.619  1.00 83.00  ? 108  PRO A CB  1 
ATOM   858  C CG  . PRO A 1 107 ? 70.475  48.924 37.239  1.00 82.14  ? 108  PRO A CG  1 
ATOM   859  C CD  . PRO A 1 107 ? 71.482  48.104 37.967  1.00 80.61  ? 108  PRO A CD  1 
ATOM   860  N N   . THR A 1 108 ? 73.120  52.591 37.858  1.00 109.32 ? 109  THR A N   1 
ATOM   861  C CA  . THR A 1 108 ? 73.014  53.926 38.439  1.00 115.35 ? 109  THR A CA  1 
ATOM   862  C C   . THR A 1 108 ? 71.746  54.623 37.962  1.00 110.98 ? 109  THR A C   1 
ATOM   863  O O   . THR A 1 108 ? 70.969  55.145 38.770  1.00 115.01 ? 109  THR A O   1 
ATOM   864  C CB  . THR A 1 108 ? 74.252  54.754 38.084  1.00 122.03 ? 109  THR A CB  1 
ATOM   865  O OG1 . THR A 1 108 ? 74.406  54.799 36.660  1.00 126.41 ? 109  THR A OG1 1 
ATOM   866  C CG2 . THR A 1 108 ? 75.501  54.145 38.707  1.00 119.81 ? 109  THR A CG2 1 
ATOM   867  N N   . SER A 1 109 ? 71.518  54.634 36.655  1.00 101.81 ? 110  SER A N   1 
ATOM   868  C CA  . SER A 1 109 ? 70.326  55.192 36.042  1.00 98.17  ? 110  SER A CA  1 
ATOM   869  C C   . SER A 1 109 ? 69.336  54.084 35.703  1.00 93.92  ? 110  SER A C   1 
ATOM   870  O O   . SER A 1 109 ? 69.723  52.927 35.516  1.00 92.77  ? 110  SER A O   1 
ATOM   871  C CB  . SER A 1 109 ? 70.699  55.976 34.777  1.00 101.06 ? 110  SER A CB  1 
ATOM   872  O OG  . SER A 1 109 ? 71.668  55.284 34.008  1.00 104.48 ? 110  SER A OG  1 
ATOM   873  N N   . PRO A 1 110 ? 68.041  54.402 35.625  1.00 86.23  ? 111  PRO A N   1 
ATOM   874  C CA  . PRO A 1 110 ? 67.034  53.351 35.415  1.00 78.43  ? 111  PRO A CA  1 
ATOM   875  C C   . PRO A 1 110 ? 67.225  52.617 34.094  1.00 81.40  ? 111  PRO A C   1 
ATOM   876  O O   . PRO A 1 110 ? 67.602  53.206 33.078  1.00 78.15  ? 111  PRO A O   1 
ATOM   877  C CB  . PRO A 1 110 ? 65.709  54.121 35.443  1.00 77.83  ? 111  PRO A CB  1 
ATOM   878  C CG  . PRO A 1 110 ? 66.009  55.362 36.214  1.00 77.71  ? 111  PRO A CG  1 
ATOM   879  C CD  . PRO A 1 110 ? 67.420  55.716 35.863  1.00 84.71  ? 111  PRO A CD  1 
ATOM   880  N N   . THR A 1 111 ? 66.936  51.316 34.118  1.00 73.29  ? 112  THR A N   1 
ATOM   881  C CA  . THR A 1 111 ? 67.250  50.401 33.035  1.00 72.43  ? 112  THR A CA  1 
ATOM   882  C C   . THR A 1 111 ? 65.988  49.699 32.544  1.00 64.69  ? 112  THR A C   1 
ATOM   883  O O   . THR A 1 111 ? 65.192  49.222 33.366  1.00 62.43  ? 112  THR A O   1 
ATOM   884  C CB  . THR A 1 111 ? 68.285  49.357 33.504  1.00 74.33  ? 112  THR A CB  1 
ATOM   885  O OG1 . THR A 1 111 ? 69.548  49.996 33.728  1.00 82.24  ? 112  THR A OG1 1 
ATOM   886  C CG2 . THR A 1 111 ? 68.454  48.260 32.475  1.00 71.34  ? 112  THR A CG2 1 
ATOM   887  N N   . PRO A 1 112 ? 65.767  49.614 31.231  1.00 60.44  ? 113  PRO A N   1 
ATOM   888  C CA  . PRO A 1 112 ? 64.571  48.931 30.719  1.00 62.46  ? 113  PRO A CA  1 
ATOM   889  C C   . PRO A 1 112 ? 64.538  47.458 31.104  1.00 55.50  ? 113  PRO A C   1 
ATOM   890  O O   . PRO A 1 112 ? 65.563  46.826 31.368  1.00 52.90  ? 113  PRO A O   1 
ATOM   891  C CB  . PRO A 1 112 ? 64.680  49.108 29.198  1.00 64.25  ? 113  PRO A CB  1 
ATOM   892  C CG  . PRO A 1 112 ? 66.105  49.500 28.948  1.00 70.31  ? 113  PRO A CG  1 
ATOM   893  C CD  . PRO A 1 112 ? 66.544  50.252 30.157  1.00 66.14  ? 113  PRO A CD  1 
ATOM   894  N N   . VAL A 1 113 ? 63.325  46.905 31.115  1.00 52.73  ? 114  VAL A N   1 
ATOM   895  C CA  . VAL A 1 113 ? 63.047  45.614 31.734  1.00 46.56  ? 114  VAL A CA  1 
ATOM   896  C C   . VAL A 1 113 ? 62.420  44.673 30.713  1.00 48.87  ? 114  VAL A C   1 
ATOM   897  O O   . VAL A 1 113 ? 61.494  45.056 29.991  1.00 52.64  ? 114  VAL A O   1 
ATOM   898  C CB  . VAL A 1 113 ? 62.124  45.772 32.955  1.00 47.49  ? 114  VAL A CB  1 
ATOM   899  C CG1 . VAL A 1 113 ? 61.825  44.414 33.573  1.00 48.62  ? 114  VAL A CG1 1 
ATOM   900  C CG2 . VAL A 1 113 ? 62.752  46.718 33.972  1.00 50.58  ? 114  VAL A CG2 1 
ATOM   901  N N   . LEU A 1 114 ? 62.914  43.437 30.680  1.00 44.05  ? 115  LEU A N   1 
ATOM   902  C CA  . LEU A 1 114 ? 62.345  42.346 29.898  1.00 45.21  ? 115  LEU A CA  1 
ATOM   903  C C   . LEU A 1 114 ? 61.705  41.337 30.843  1.00 46.70  ? 115  LEU A C   1 
ATOM   904  O O   . LEU A 1 114 ? 62.316  40.956 31.847  1.00 45.50  ? 115  LEU A O   1 
ATOM   905  C CB  . LEU A 1 114 ? 63.427  41.656 29.066  1.00 44.89  ? 115  LEU A CB  1 
ATOM   906  C CG  . LEU A 1 114 ? 63.937  42.348 27.805  1.00 52.36  ? 115  LEU A CG  1 
ATOM   907  C CD1 . LEU A 1 114 ? 65.257  41.727 27.371  1.00 51.42  ? 115  LEU A CD1 1 
ATOM   908  C CD2 . LEU A 1 114 ? 62.903  42.224 26.702  1.00 52.30  ? 115  LEU A CD2 1 
ATOM   909  N N   . VAL A 1 115 ? 60.495  40.887 30.514  1.00 46.47  ? 116  VAL A N   1 
ATOM   910  C CA  . VAL A 1 115 ? 59.742  39.959 31.358  1.00 45.36  ? 116  VAL A CA  1 
ATOM   911  C C   . VAL A 1 115 ? 59.399  38.719 30.536  1.00 40.46  ? 116  VAL A C   1 
ATOM   912  O O   . VAL A 1 115 ? 58.599  38.794 29.595  1.00 40.32  ? 116  VAL A O   1 
ATOM   913  C CB  . VAL A 1 115 ? 58.477  40.609 31.935  1.00 44.94  ? 116  VAL A CB  1 
ATOM   914  C CG1 . VAL A 1 115 ? 57.711  39.609 32.785  1.00 41.73  ? 116  VAL A CG1 1 
ATOM   915  C CG2 . VAL A 1 115 ? 58.839  41.849 32.752  1.00 38.67  ? 116  VAL A CG2 1 
ATOM   916  N N   . TRP A 1 116 ? 59.974  37.574 30.911  1.00 40.21  ? 117  TRP A N   1 
ATOM   917  C CA  . TRP A 1 116 ? 59.798  36.317 30.186  1.00 36.91  ? 117  TRP A CA  1 
ATOM   918  C C   . TRP A 1 116 ? 58.600  35.527 30.691  1.00 45.85  ? 117  TRP A C   1 
ATOM   919  O O   . TRP A 1 116 ? 58.375  35.412 31.900  1.00 45.48  ? 117  TRP A O   1 
ATOM   920  C CB  . TRP A 1 116 ? 61.059  35.454 30.304  1.00 35.04  ? 117  TRP A CB  1 
ATOM   921  C CG  . TRP A 1 116 ? 60.990  34.080 29.652  1.00 37.63  ? 117  TRP A CG  1 
ATOM   922  C CD1 . TRP A 1 116 ? 61.025  32.864 30.281  1.00 39.24  ? 117  TRP A CD1 1 
ATOM   923  C CD2 . TRP A 1 116 ? 60.891  33.799 28.249  1.00 37.25  ? 117  TRP A CD2 1 
ATOM   924  N NE1 . TRP A 1 116 ? 60.957  31.848 29.354  1.00 41.66  ? 117  TRP A NE1 1 
ATOM   925  C CE2 . TRP A 1 116 ? 60.873  32.396 28.100  1.00 38.27  ? 117  TRP A CE2 1 
ATOM   926  C CE3 . TRP A 1 116 ? 60.817  34.597 27.104  1.00 37.33  ? 117  TRP A CE3 1 
ATOM   927  C CZ2 . TRP A 1 116 ? 60.782  31.776 26.851  1.00 38.79  ? 117  TRP A CZ2 1 
ATOM   928  C CZ3 . TRP A 1 116 ? 60.728  33.980 25.860  1.00 36.24  ? 117  TRP A CZ3 1 
ATOM   929  C CH2 . TRP A 1 116 ? 60.710  32.584 25.746  1.00 36.33  ? 117  TRP A CH2 1 
ATOM   930  N N   . ILE A 1 117 ? 57.845  34.967 29.748  1.00 37.75  ? 118  ILE A N   1 
ATOM   931  C CA  . ILE A 1 117 ? 56.748  34.053 30.040  1.00 39.82  ? 118  ILE A CA  1 
ATOM   932  C C   . ILE A 1 117 ? 57.011  32.779 29.253  1.00 44.96  ? 118  ILE A C   1 
ATOM   933  O O   . ILE A 1 117 ? 56.941  32.783 28.016  1.00 43.61  ? 118  ILE A O   1 
ATOM   934  C CB  . ILE A 1 117 ? 55.381  34.644 29.680  1.00 38.44  ? 118  ILE A CB  1 
ATOM   935  C CG1 . ILE A 1 117 ? 55.215  36.018 30.326  1.00 39.93  ? 118  ILE A CG1 1 
ATOM   936  C CG2 . ILE A 1 117 ? 54.276  33.714 30.137  1.00 36.10  ? 118  ILE A CG2 1 
ATOM   937  C CD1 . ILE A 1 117 ? 53.888  36.667 30.022  1.00 40.47  ? 118  ILE A CD1 1 
ATOM   938  N N   . TYR A 1 118 ? 57.315  31.694 29.957  1.00 34.35  ? 119  TYR A N   1 
ATOM   939  C CA  . TYR A 1 118 ? 57.650  30.458 29.271  1.00 34.20  ? 119  TYR A CA  1 
ATOM   940  C C   . TYR A 1 118 ? 56.423  29.862 28.589  1.00 40.23  ? 119  TYR A C   1 
ATOM   941  O O   . TYR A 1 118 ? 55.275  30.175 28.918  1.00 43.61  ? 119  TYR A O   1 
ATOM   942  C CB  . TYR A 1 118 ? 58.256  29.440 30.240  1.00 39.92  ? 119  TYR A CB  1 
ATOM   943  C CG  . TYR A 1 118 ? 57.418  29.113 31.464  1.00 39.19  ? 119  TYR A CG  1 
ATOM   944  C CD1 . TYR A 1 118 ? 56.310  28.273 31.377  1.00 37.37  ? 119  TYR A CD1 1 
ATOM   945  C CD2 . TYR A 1 118 ? 57.759  29.616 32.715  1.00 40.21  ? 119  TYR A CD2 1 
ATOM   946  C CE1 . TYR A 1 118 ? 55.553  27.963 32.498  1.00 37.84  ? 119  TYR A CE1 1 
ATOM   947  C CE2 . TYR A 1 118 ? 57.008  29.309 33.845  1.00 38.21  ? 119  TYR A CE2 1 
ATOM   948  C CZ  . TYR A 1 118 ? 55.909  28.482 33.730  1.00 38.66  ? 119  TYR A CZ  1 
ATOM   949  O OH  . TYR A 1 118 ? 55.161  28.178 34.847  1.00 39.06  ? 119  TYR A OH  1 
ATOM   950  N N   . GLY A 1 119 ? 56.687  28.991 27.616  1.00 36.62  ? 120  GLY A N   1 
ATOM   951  C CA  . GLY A 1 119 ? 55.658  28.200 26.983  1.00 36.75  ? 120  GLY A CA  1 
ATOM   952  C C   . GLY A 1 119 ? 55.608  26.786 27.535  1.00 37.65  ? 120  GLY A C   1 
ATOM   953  O O   . GLY A 1 119 ? 56.224  26.454 28.549  1.00 39.73  ? 120  GLY A O   1 
ATOM   954  N N   . GLY A 1 120 ? 54.862  25.938 26.834  1.00 37.44  ? 121  GLY A N   1 
ATOM   955  C CA  . GLY A 1 120 ? 54.649  24.576 27.278  1.00 37.79  ? 121  GLY A CA  1 
ATOM   956  C C   . GLY A 1 120 ? 53.194  24.168 27.182  1.00 43.30  ? 121  GLY A C   1 
ATOM   957  O O   . GLY A 1 120 ? 52.716  23.344 27.971  1.00 46.29  ? 121  GLY A O   1 
ATOM   958  N N   . GLY A 1 121 ? 52.479  24.760 26.226  1.00 37.93  ? 122  GLY A N   1 
ATOM   959  C CA  . GLY A 1 121 ? 51.104  24.388 25.944  1.00 42.44  ? 122  GLY A CA  1 
ATOM   960  C C   . GLY A 1 121 ? 50.125  24.618 27.072  1.00 43.14  ? 122  GLY A C   1 
ATOM   961  O O   . GLY A 1 121 ? 49.065  23.986 27.094  1.00 39.61  ? 122  GLY A O   1 
ATOM   962  N N   . PHE A 1 122 ? 50.448  25.508 28.011  1.00 39.33  ? 123  PHE A N   1 
ATOM   963  C CA  . PHE A 1 122 ? 49.659  25.782 29.210  1.00 37.92  ? 123  PHE A CA  1 
ATOM   964  C C   . PHE A 1 122 ? 49.548  24.576 30.137  1.00 38.54  ? 123  PHE A C   1 
ATOM   965  O O   . PHE A 1 122 ? 48.809  24.631 31.127  1.00 41.81  ? 123  PHE A O   1 
ATOM   966  C CB  . PHE A 1 122 ? 48.254  26.302 28.869  1.00 37.14  ? 123  PHE A CB  1 
ATOM   967  C CG  . PHE A 1 122 ? 48.247  27.646 28.195  1.00 41.22  ? 123  PHE A CG  1 
ATOM   968  C CD1 . PHE A 1 122 ? 48.544  28.795 28.910  1.00 40.02  ? 123  PHE A CD1 1 
ATOM   969  C CD2 . PHE A 1 122 ? 47.929  27.762 26.849  1.00 39.64  ? 123  PHE A CD2 1 
ATOM   970  C CE1 . PHE A 1 122 ? 48.539  30.034 28.295  1.00 39.50  ? 123  PHE A CE1 1 
ATOM   971  C CE2 . PHE A 1 122 ? 47.916  28.999 26.226  1.00 35.98  ? 123  PHE A CE2 1 
ATOM   972  C CZ  . PHE A 1 122 ? 48.221  30.137 26.949  1.00 40.99  ? 123  PHE A CZ  1 
ATOM   973  N N   . TYR A 1 123 ? 50.262  23.484 29.852  1.00 34.61  ? 124  TYR A N   1 
ATOM   974  C CA  . TYR A 1 123 ? 50.281  22.326 30.736  1.00 41.48  ? 124  TYR A CA  1 
ATOM   975  C C   . TYR A 1 123 ? 51.643  22.066 31.365  1.00 40.66  ? 124  TYR A C   1 
ATOM   976  O O   . TYR A 1 123 ? 51.744  21.198 32.239  1.00 41.79  ? 124  TYR A O   1 
ATOM   977  C CB  . TYR A 1 123 ? 49.828  21.062 29.985  1.00 40.03  ? 124  TYR A CB  1 
ATOM   978  C CG  . TYR A 1 123 ? 50.830  20.548 28.970  1.00 43.90  ? 124  TYR A CG  1 
ATOM   979  C CD1 . TYR A 1 123 ? 51.849  19.677 29.344  1.00 39.06  ? 124  TYR A CD1 1 
ATOM   980  C CD2 . TYR A 1 123 ? 50.751  20.924 27.636  1.00 41.94  ? 124  TYR A CD2 1 
ATOM   981  C CE1 . TYR A 1 123 ? 52.768  19.212 28.426  1.00 40.19  ? 124  TYR A CE1 1 
ATOM   982  C CE2 . TYR A 1 123 ? 51.665  20.458 26.706  1.00 40.38  ? 124  TYR A CE2 1 
ATOM   983  C CZ  . TYR A 1 123 ? 52.669  19.602 27.107  1.00 45.05  ? 124  TYR A CZ  1 
ATOM   984  O OH  . TYR A 1 123 ? 53.581  19.137 26.190  1.00 45.44  ? 124  TYR A OH  1 
ATOM   985  N N   . SER A 1 124 ? 52.689  22.773 30.941  1.00 38.74  ? 125  SER A N   1 
ATOM   986  C CA  . SER A 1 124 ? 54.039  22.497 31.408  1.00 35.89  ? 125  SER A CA  1 
ATOM   987  C C   . SER A 1 124 ? 54.870  23.768 31.304  1.00 38.22  ? 125  SER A C   1 
ATOM   988  O O   . SER A 1 124 ? 54.401  24.807 30.829  1.00 39.31  ? 125  SER A O   1 
ATOM   989  C CB  . SER A 1 124 ? 54.682  21.367 30.602  1.00 37.00  ? 125  SER A CB  1 
ATOM   990  O OG  . SER A 1 124 ? 54.740  21.708 29.226  1.00 37.45  ? 125  SER A OG  1 
ATOM   991  N N   . GLY A 1 125 ? 56.123  23.669 31.741  1.00 35.03  ? 126  GLY A N   1 
ATOM   992  C CA  . GLY A 1 125 ? 57.041  24.788 31.681  1.00 35.47  ? 126  GLY A CA  1 
ATOM   993  C C   . GLY A 1 125 ? 57.484  25.258 33.051  1.00 43.37  ? 126  GLY A C   1 
ATOM   994  O O   . GLY A 1 125 ? 56.834  24.958 34.058  1.00 41.55  ? 126  GLY A O   1 
ATOM   995  N N   . ALA A 1 126 ? 58.589  25.999 33.098  1.00 42.79  ? 127  ALA A N   1 
ATOM   996  C CA  . ALA A 1 126 ? 59.127  26.526 34.346  1.00 47.28  ? 127  ALA A CA  1 
ATOM   997  C C   . ALA A 1 126 ? 60.159  27.591 34.014  1.00 49.70  ? 127  ALA A C   1 
ATOM   998  O O   . ALA A 1 126 ? 60.871  27.488 33.011  1.00 44.92  ? 127  ALA A O   1 
ATOM   999  C CB  . ALA A 1 126 ? 59.760  25.424 35.203  1.00 35.39  ? 127  ALA A CB  1 
ATOM   1000 N N   . SER A 1 127 ? 60.237  28.612 34.870  1.00 40.46  ? 128  SER A N   1 
ATOM   1001 C CA  . SER A 1 127 ? 61.228  29.660 34.664  1.00 39.41  ? 128  SER A CA  1 
ATOM   1002 C C   . SER A 1 127 ? 62.636  29.213 35.032  1.00 40.74  ? 128  SER A C   1 
ATOM   1003 O O   . SER A 1 127 ? 63.586  29.970 34.805  1.00 40.32  ? 128  SER A O   1 
ATOM   1004 C CB  . SER A 1 127 ? 60.852  30.909 35.462  1.00 40.40  ? 128  SER A CB  1 
ATOM   1005 O OG  . SER A 1 127 ? 60.874  30.651 36.854  1.00 44.35  ? 128  SER A OG  1 
ATOM   1006 N N   . SER A 1 128 ? 62.796  28.007 35.575  1.00 38.58  ? 129  SER A N   1 
ATOM   1007 C CA  . SER A 1 128 ? 64.099  27.528 36.013  1.00 41.06  ? 129  SER A CA  1 
ATOM   1008 C C   . SER A 1 128 ? 64.844  26.730 34.952  1.00 41.22  ? 129  SER A C   1 
ATOM   1009 O O   . SER A 1 128 ? 65.996  26.349 35.191  1.00 44.81  ? 129  SER A O   1 
ATOM   1010 C CB  . SER A 1 128 ? 63.948  26.670 37.275  1.00 37.15  ? 129  SER A CB  1 
ATOM   1011 O OG  . SER A 1 128 ? 63.018  25.621 37.074  1.00 40.88  ? 129  SER A OG  1 
ATOM   1012 N N   . LEU A 1 129 ? 64.228  26.465 33.800  1.00 41.43  ? 130  LEU A N   1 
ATOM   1013 C CA  . LEU A 1 129 ? 64.902  25.705 32.754  1.00 46.77  ? 130  LEU A CA  1 
ATOM   1014 C C   . LEU A 1 129 ? 66.212  26.379 32.359  1.00 46.32  ? 130  LEU A C   1 
ATOM   1015 O O   . LEU A 1 129 ? 66.302  27.608 32.294  1.00 43.86  ? 130  LEU A O   1 
ATOM   1016 C CB  . LEU A 1 129 ? 63.993  25.558 31.530  1.00 42.35  ? 130  LEU A CB  1 
ATOM   1017 C CG  . LEU A 1 129 ? 62.661  24.842 31.773  1.00 49.16  ? 130  LEU A CG  1 
ATOM   1018 C CD1 . LEU A 1 129 ? 61.988  24.491 30.460  1.00 43.65  ? 130  LEU A CD1 1 
ATOM   1019 C CD2 . LEU A 1 129 ? 62.852  23.596 32.633  1.00 50.58  ? 130  LEU A CD2 1 
ATOM   1020 N N   . ASP A 1 130 ? 67.235  25.555 32.102  1.00 44.14  ? 131  ASP A N   1 
ATOM   1021 C CA  . ASP A 1 130 ? 68.566  26.072 31.790  1.00 47.53  ? 131  ASP A CA  1 
ATOM   1022 C C   . ASP A 1 130 ? 68.547  27.015 30.595  1.00 44.35  ? 131  ASP A C   1 
ATOM   1023 O O   . ASP A 1 130 ? 69.358  27.944 30.521  1.00 50.14  ? 131  ASP A O   1 
ATOM   1024 C CB  . ASP A 1 130 ? 69.530  24.916 31.518  1.00 46.47  ? 131  ASP A CB  1 
ATOM   1025 C CG  . ASP A 1 130 ? 69.764  24.053 32.739  1.00 56.21  ? 131  ASP A CG  1 
ATOM   1026 O OD1 . ASP A 1 130 ? 69.543  24.549 33.864  1.00 52.39  ? 131  ASP A OD1 1 
ATOM   1027 O OD2 . ASP A 1 130 ? 70.170  22.883 32.575  1.00 65.69  ? 131  ASP A OD2 1 
ATOM   1028 N N   . VAL A 1 131 ? 67.630  26.797 29.653  1.00 41.25  ? 132  VAL A N   1 
ATOM   1029 C CA  . VAL A 1 131 ? 67.602  27.599 28.434  1.00 42.83  ? 132  VAL A CA  1 
ATOM   1030 C C   . VAL A 1 131 ? 66.925  28.946 28.642  1.00 41.83  ? 132  VAL A C   1 
ATOM   1031 O O   . VAL A 1 131 ? 66.957  29.794 27.742  1.00 41.98  ? 132  VAL A O   1 
ATOM   1032 C CB  . VAL A 1 131 ? 66.945  26.742 27.333  1.00 47.01  ? 132  VAL A CB  1 
ATOM   1033 C CG1 . VAL A 1 131 ? 65.463  26.532 27.619  1.00 49.21  ? 132  VAL A CG1 1 
ATOM   1034 C CG2 . VAL A 1 131 ? 67.172  27.332 25.963  1.00 49.51  ? 132  VAL A CG2 1 
ATOM   1035 N N   . TYR A 1 132 ? 66.332  29.181 29.814  1.00 46.93  ? 133  TYR A N   1 
ATOM   1036 C CA  . TYR A 1 132 ? 65.789  30.486 30.172  1.00 43.20  ? 133  TYR A CA  1 
ATOM   1037 C C   . TYR A 1 132 ? 66.706  31.252 31.120  1.00 45.02  ? 133  TYR A C   1 
ATOM   1038 O O   . TYR A 1 132 ? 66.274  32.240 31.723  1.00 44.72  ? 133  TYR A O   1 
ATOM   1039 C CB  . TYR A 1 132 ? 64.401  30.339 30.804  1.00 45.54  ? 133  TYR A CB  1 
ATOM   1040 C CG  . TYR A 1 132 ? 63.392  29.551 29.989  1.00 41.88  ? 133  TYR A CG  1 
ATOM   1041 C CD1 . TYR A 1 132 ? 63.428  29.548 28.598  1.00 37.17  ? 133  TYR A CD1 1 
ATOM   1042 C CD2 . TYR A 1 132 ? 62.400  28.809 30.619  1.00 35.86  ? 133  TYR A CD2 1 
ATOM   1043 C CE1 . TYR A 1 132 ? 62.501  28.826 27.860  1.00 35.99  ? 133  TYR A CE1 1 
ATOM   1044 C CE2 . TYR A 1 132 ? 61.475  28.084 29.896  1.00 37.36  ? 133  TYR A CE2 1 
ATOM   1045 C CZ  . TYR A 1 132 ? 61.527  28.096 28.517  1.00 41.15  ? 133  TYR A CZ  1 
ATOM   1046 O OH  . TYR A 1 132 ? 60.602  27.374 27.799  1.00 41.84  ? 133  TYR A OH  1 
ATOM   1047 N N   . ASP A 1 133 ? 67.951  30.805 31.276  1.00 45.95  ? 134  ASP A N   1 
ATOM   1048 C CA  . ASP A 1 133 ? 68.912  31.477 32.143  1.00 47.21  ? 134  ASP A CA  1 
ATOM   1049 C C   . ASP A 1 133 ? 69.142  32.906 31.668  1.00 47.90  ? 134  ASP A C   1 
ATOM   1050 O O   . ASP A 1 133 ? 69.637  33.129 30.559  1.00 50.61  ? 134  ASP A O   1 
ATOM   1051 C CB  . ASP A 1 133 ? 70.225  30.693 32.149  1.00 55.59  ? 134  ASP A CB  1 
ATOM   1052 C CG  . ASP A 1 133 ? 71.188  31.159 33.227  1.00 56.15  ? 134  ASP A CG  1 
ATOM   1053 O OD1 . ASP A 1 133 ? 70.957  32.230 33.824  1.00 49.76  ? 134  ASP A OD1 1 
ATOM   1054 O OD2 . ASP A 1 133 ? 72.187  30.449 33.470  1.00 60.40  ? 134  ASP A OD2 1 
ATOM   1055 N N   . GLY A 1 134 ? 68.794  33.874 32.511  1.00 45.33  ? 135  GLY A N   1 
ATOM   1056 C CA  . GLY A 1 134 ? 68.853  35.270 32.136  1.00 44.42  ? 135  GLY A CA  1 
ATOM   1057 C C   . GLY A 1 134 ? 70.180  35.970 32.329  1.00 48.28  ? 135  GLY A C   1 
ATOM   1058 O O   . GLY A 1 134 ? 70.298  37.146 31.972  1.00 50.65  ? 135  GLY A O   1 
ATOM   1059 N N   . ARG A 1 135 ? 71.195  35.284 32.864  1.00 47.12  ? 136  ARG A N   1 
ATOM   1060 C CA  . ARG A 1 135 ? 72.442  35.959 33.218  1.00 49.23  ? 136  ARG A CA  1 
ATOM   1061 C C   . ARG A 1 135 ? 73.183  36.493 31.993  1.00 47.09  ? 136  ARG A C   1 
ATOM   1062 O O   . ARG A 1 135 ? 73.897  37.498 32.096  1.00 52.63  ? 136  ARG A O   1 
ATOM   1063 C CB  . ARG A 1 135 ? 73.344  35.010 34.011  1.00 43.29  ? 136  ARG A CB  1 
ATOM   1064 C CG  . ARG A 1 135 ? 74.055  33.969 33.159  1.00 49.93  ? 136  ARG A CG  1 
ATOM   1065 C CD  . ARG A 1 135 ? 74.920  33.058 34.000  1.00 50.76  ? 136  ARG A CD  1 
ATOM   1066 N NE  . ARG A 1 135 ? 74.119  32.094 34.742  1.00 49.10  ? 136  ARG A NE  1 
ATOM   1067 C CZ  . ARG A 1 135 ? 74.580  31.359 35.747  1.00 56.24  ? 136  ARG A CZ  1 
ATOM   1068 N NH1 . ARG A 1 135 ? 75.841  31.482 36.140  1.00 53.99  ? 136  ARG A NH1 1 
ATOM   1069 N NH2 . ARG A 1 135 ? 73.777  30.503 36.364  1.00 53.28  ? 136  ARG A NH2 1 
ATOM   1070 N N   . PHE A 1 136 ? 73.027  35.853 30.833  1.00 42.95  ? 137  PHE A N   1 
ATOM   1071 C CA  . PHE A 1 136 ? 73.790  36.261 29.656  1.00 48.79  ? 137  PHE A CA  1 
ATOM   1072 C C   . PHE A 1 136 ? 73.207  37.509 29.005  1.00 43.12  ? 137  PHE A C   1 
ATOM   1073 O O   . PHE A 1 136 ? 73.956  38.416 28.625  1.00 50.31  ? 137  PHE A O   1 
ATOM   1074 C CB  . PHE A 1 136 ? 73.860  35.110 28.650  1.00 41.72  ? 137  PHE A CB  1 
ATOM   1075 C CG  . PHE A 1 136 ? 74.405  33.840 29.234  1.00 43.25  ? 137  PHE A CG  1 
ATOM   1076 C CD1 . PHE A 1 136 ? 73.569  32.769 29.502  1.00 45.31  ? 137  PHE A CD1 1 
ATOM   1077 C CD2 . PHE A 1 136 ? 75.750  33.728 29.545  1.00 53.16  ? 137  PHE A CD2 1 
ATOM   1078 C CE1 . PHE A 1 136 ? 74.068  31.602 30.055  1.00 52.28  ? 137  PHE A CE1 1 
ATOM   1079 C CE2 . PHE A 1 136 ? 76.257  32.564 30.100  1.00 54.62  ? 137  PHE A CE2 1 
ATOM   1080 C CZ  . PHE A 1 136 ? 75.414  31.499 30.354  1.00 53.88  ? 137  PHE A CZ  1 
ATOM   1081 N N   . LEU A 1 137 ? 71.880  37.574 28.867  1.00 39.23  ? 138  LEU A N   1 
ATOM   1082 C CA  . LEU A 1 137 ? 71.246  38.778 28.334  1.00 43.41  ? 138  LEU A CA  1 
ATOM   1083 C C   . LEU A 1 137 ? 71.580  40.002 29.176  1.00 50.82  ? 138  LEU A C   1 
ATOM   1084 O O   . LEU A 1 137 ? 71.883  41.072 28.637  1.00 54.16  ? 138  LEU A O   1 
ATOM   1085 C CB  . LEU A 1 137 ? 69.731  38.587 28.268  1.00 47.03  ? 138  LEU A CB  1 
ATOM   1086 C CG  . LEU A 1 137 ? 69.118  38.279 26.907  1.00 52.24  ? 138  LEU A CG  1 
ATOM   1087 C CD1 . LEU A 1 137 ? 67.637  37.983 27.061  1.00 51.13  ? 138  LEU A CD1 1 
ATOM   1088 C CD2 . LEU A 1 137 ? 69.343  39.447 25.960  1.00 54.50  ? 138  LEU A CD2 1 
ATOM   1089 N N   . VAL A 1 138 ? 71.527  39.858 30.501  1.00 48.90  ? 139  VAL A N   1 
ATOM   1090 C CA  . VAL A 1 138 ? 71.729  40.994 31.397  1.00 46.28  ? 139  VAL A CA  1 
ATOM   1091 C C   . VAL A 1 138 ? 73.179  41.453 31.355  1.00 46.94  ? 139  VAL A C   1 
ATOM   1092 O O   . VAL A 1 138 ? 73.465  42.655 31.304  1.00 52.83  ? 139  VAL A O   1 
ATOM   1093 C CB  . VAL A 1 138 ? 71.288  40.626 32.827  1.00 43.07  ? 139  VAL A CB  1 
ATOM   1094 C CG1 . VAL A 1 138 ? 71.809  41.655 33.852  1.00 40.93  ? 139  VAL A CG1 1 
ATOM   1095 C CG2 . VAL A 1 138 ? 69.761  40.440 32.909  1.00 43.59  ? 139  VAL A CG2 1 
ATOM   1096 N N   . GLN A 1 139 ? 74.118  40.506 31.379  1.00 43.15  ? 140  GLN A N   1 
ATOM   1097 C CA  . GLN A 1 139 ? 75.525  40.872 31.265  1.00 48.92  ? 140  GLN A CA  1 
ATOM   1098 C C   . GLN A 1 139 ? 75.827  41.481 29.900  1.00 54.24  ? 140  GLN A C   1 
ATOM   1099 O O   . GLN A 1 139 ? 76.561  42.473 29.804  1.00 57.18  ? 140  GLN A O   1 
ATOM   1100 C CB  . GLN A 1 139 ? 76.423  39.654 31.512  1.00 52.28  ? 140  GLN A CB  1 
ATOM   1101 C CG  . GLN A 1 139 ? 77.863  40.003 31.913  1.00 63.38  ? 140  GLN A CG  1 
ATOM   1102 C CD  . GLN A 1 139 ? 78.696  40.566 30.769  1.00 74.72  ? 140  GLN A CD  1 
ATOM   1103 O OE1 . GLN A 1 139 ? 78.705  40.020 29.666  1.00 81.14  ? 140  GLN A OE1 1 
ATOM   1104 N NE2 . GLN A 1 139 ? 79.392  41.670 31.029  1.00 77.48  ? 140  GLN A NE2 1 
ATOM   1105 N N   . ALA A 1 140 ? 75.267  40.910 28.832  1.00 50.94  ? 141  ALA A N   1 
ATOM   1106 C CA  . ALA A 1 140 ? 75.616  41.370 27.492  1.00 53.43  ? 141  ALA A CA  1 
ATOM   1107 C C   . ALA A 1 140 ? 74.970  42.711 27.169  1.00 53.06  ? 141  ALA A C   1 
ATOM   1108 O O   . ALA A 1 140 ? 75.622  43.596 26.604  1.00 55.72  ? 141  ALA A O   1 
ATOM   1109 C CB  . ALA A 1 140 ? 75.214  40.327 26.451  1.00 52.64  ? 141  ALA A CB  1 
ATOM   1110 N N   . GLU A 1 141 ? 73.696  42.885 27.514  1.00 52.10  ? 142  GLU A N   1 
ATOM   1111 C CA  . GLU A 1 141 ? 72.936  44.046 27.071  1.00 51.97  ? 142  GLU A CA  1 
ATOM   1112 C C   . GLU A 1 141 ? 72.552  44.997 28.196  1.00 58.03  ? 142  GLU A C   1 
ATOM   1113 O O   . GLU A 1 141 ? 71.833  45.969 27.940  1.00 59.83  ? 142  GLU A O   1 
ATOM   1114 C CB  . GLU A 1 141 ? 71.680  43.588 26.324  1.00 50.36  ? 142  GLU A CB  1 
ATOM   1115 C CG  . GLU A 1 141 ? 71.986  42.928 24.986  1.00 51.30  ? 142  GLU A CG  1 
ATOM   1116 C CD  . GLU A 1 141 ? 72.696  43.863 24.025  1.00 59.42  ? 142  GLU A CD  1 
ATOM   1117 O OE1 . GLU A 1 141 ? 72.380  45.073 24.020  1.00 58.46  ? 142  GLU A OE1 1 
ATOM   1118 O OE2 . GLU A 1 141 ? 73.575  43.391 23.276  1.00 70.50  ? 142  GLU A OE2 1 
ATOM   1119 N N   . ARG A 1 142 ? 73.016  44.752 29.422  1.00 60.75  ? 143  ARG A N   1 
ATOM   1120 C CA  . ARG A 1 142 ? 72.759  45.634 30.565  1.00 66.09  ? 143  ARG A CA  1 
ATOM   1121 C C   . ARG A 1 142 ? 71.270  45.931 30.704  1.00 60.18  ? 143  ARG A C   1 
ATOM   1122 O O   . ARG A 1 142 ? 70.839  47.080 30.804  1.00 67.66  ? 143  ARG A O   1 
ATOM   1123 C CB  . ARG A 1 142 ? 73.570  46.924 30.457  1.00 68.37  ? 143  ARG A CB  1 
ATOM   1124 C CG  . ARG A 1 142 ? 75.065  46.708 30.550  1.00 81.14  ? 143  ARG A CG  1 
ATOM   1125 C CD  . ARG A 1 142 ? 75.711  47.756 31.431  1.00 98.41  ? 143  ARG A CD  1 
ATOM   1126 N NE  . ARG A 1 142 ? 77.168  47.692 31.382  1.00 109.52 ? 143  ARG A NE  1 
ATOM   1127 C CZ  . ARG A 1 142 ? 77.905  46.874 32.126  1.00 112.12 ? 143  ARG A CZ  1 
ATOM   1128 N NH1 . ARG A 1 142 ? 77.322  46.040 32.978  1.00 110.34 ? 143  ARG A NH1 1 
ATOM   1129 N NH2 . ARG A 1 142 ? 79.227  46.888 32.016  1.00 113.96 ? 143  ARG A NH2 1 
ATOM   1130 N N   . THR A 1 143 ? 70.481  44.869 30.682  1.00 59.73  ? 144  THR A N   1 
ATOM   1131 C CA  . THR A 1 143 ? 69.040  44.921 30.846  1.00 57.67  ? 144  THR A CA  1 
ATOM   1132 C C   . THR A 1 143 ? 68.675  44.335 32.204  1.00 54.59  ? 144  THR A C   1 
ATOM   1133 O O   . THR A 1 143 ? 69.473  43.637 32.831  1.00 54.69  ? 144  THR A O   1 
ATOM   1134 C CB  . THR A 1 143 ? 68.352  44.146 29.710  1.00 61.22  ? 144  THR A CB  1 
ATOM   1135 O OG1 . THR A 1 143 ? 66.965  44.492 29.641  1.00 71.00  ? 144  THR A OG1 1 
ATOM   1136 C CG2 . THR A 1 143 ? 68.499  42.645 29.915  1.00 56.78  ? 144  THR A CG2 1 
ATOM   1137 N N   . VAL A 1 144 ? 67.477  44.647 32.678  1.00 50.73  ? 145  VAL A N   1 
ATOM   1138 C CA  . VAL A 1 144 ? 66.904  43.929 33.812  1.00 50.64  ? 145  VAL A CA  1 
ATOM   1139 C C   . VAL A 1 144 ? 65.923  42.904 33.268  1.00 50.18  ? 145  VAL A C   1 
ATOM   1140 O O   . VAL A 1 144 ? 65.053  43.233 32.454  1.00 49.72  ? 145  VAL A O   1 
ATOM   1141 C CB  . VAL A 1 144 ? 66.219  44.886 34.802  1.00 51.07  ? 145  VAL A CB  1 
ATOM   1142 C CG1 . VAL A 1 144 ? 65.569  44.090 35.930  1.00 48.05  ? 145  VAL A CG1 1 
ATOM   1143 C CG2 . VAL A 1 144 ? 67.230  45.861 35.377  1.00 47.16  ? 145  VAL A CG2 1 
ATOM   1144 N N   . LEU A 1 145 ? 66.070  41.653 33.693  1.00 48.62  ? 146  LEU A N   1 
ATOM   1145 C CA  . LEU A 1 145 ? 65.234  40.574 33.190  1.00 46.38  ? 146  LEU A CA  1 
ATOM   1146 C C   . LEU A 1 145 ? 64.471  39.928 34.337  1.00 49.98  ? 146  LEU A C   1 
ATOM   1147 O O   . LEU A 1 145 ? 65.058  39.589 35.371  1.00 53.02  ? 146  LEU A O   1 
ATOM   1148 C CB  . LEU A 1 145 ? 66.069  39.532 32.441  1.00 49.40  ? 146  LEU A CB  1 
ATOM   1149 C CG  . LEU A 1 145 ? 65.276  38.410 31.776  1.00 56.05  ? 146  LEU A CG  1 
ATOM   1150 C CD1 . LEU A 1 145 ? 65.646  38.294 30.298  1.00 54.36  ? 146  LEU A CD1 1 
ATOM   1151 C CD2 . LEU A 1 145 ? 65.499  37.093 32.499  1.00 62.11  ? 146  LEU A CD2 1 
ATOM   1152 N N   . VAL A 1 146 ? 63.166  39.758 34.144  1.00 45.57  ? 147  VAL A N   1 
ATOM   1153 C CA  . VAL A 1 146 ? 62.285  39.118 35.110  1.00 41.18  ? 147  VAL A CA  1 
ATOM   1154 C C   . VAL A 1 146 ? 61.621  37.923 34.440  1.00 45.30  ? 147  VAL A C   1 
ATOM   1155 O O   . VAL A 1 146 ? 61.274  37.976 33.254  1.00 43.52  ? 147  VAL A O   1 
ATOM   1156 C CB  . VAL A 1 146 ? 61.221  40.100 35.649  1.00 44.27  ? 147  VAL A CB  1 
ATOM   1157 C CG1 . VAL A 1 146 ? 60.392  39.452 36.749  1.00 39.72  ? 147  VAL A CG1 1 
ATOM   1158 C CG2 . VAL A 1 146 ? 61.876  41.375 36.155  1.00 43.38  ? 147  VAL A CG2 1 
ATOM   1159 N N   . SER A 1 147 ? 61.464  36.838 35.195  1.00 41.12  ? 148  SER A N   1 
ATOM   1160 C CA  . SER A 1 147 ? 60.660  35.704 34.764  1.00 39.08  ? 148  SER A CA  1 
ATOM   1161 C C   . SER A 1 147 ? 59.879  35.195 35.963  1.00 47.61  ? 148  SER A C   1 
ATOM   1162 O O   . SER A 1 147 ? 60.327  35.314 37.107  1.00 51.12  ? 148  SER A O   1 
ATOM   1163 C CB  . SER A 1 147 ? 61.509  34.572 34.160  1.00 41.68  ? 148  SER A CB  1 
ATOM   1164 O OG  . SER A 1 147 ? 62.374  33.984 35.118  1.00 39.99  ? 148  SER A OG  1 
ATOM   1165 N N   . MET A 1 148 ? 58.700  34.639 35.697  1.00 43.72  ? 149  MET A N   1 
ATOM   1166 C CA  . MET A 1 148 ? 57.834  34.159 36.761  1.00 41.55  ? 149  MET A CA  1 
ATOM   1167 C C   . MET A 1 148 ? 57.318  32.766 36.434  1.00 49.10  ? 149  MET A C   1 
ATOM   1168 O O   . MET A 1 148 ? 57.204  32.381 35.265  1.00 41.07  ? 149  MET A O   1 
ATOM   1169 C CB  . MET A 1 148 ? 56.645  35.108 37.000  1.00 39.24  ? 149  MET A CB  1 
ATOM   1170 C CG  . MET A 1 148 ? 55.409  34.794 36.170  1.00 39.64  ? 149  MET A CG  1 
ATOM   1171 S SD  . MET A 1 148 ? 55.684  35.030 34.405  1.00 42.09  ? 149  MET A SD  1 
ATOM   1172 C CE  . MET A 1 148 ? 55.815  36.812 34.315  1.00 41.89  ? 149  MET A CE  1 
ATOM   1173 N N   . ASN A 1 149 ? 57.023  32.010 37.488  1.00 44.97  ? 150  ASN A N   1 
ATOM   1174 C CA  . ASN A 1 149 ? 56.286  30.765 37.362  1.00 43.02  ? 150  ASN A CA  1 
ATOM   1175 C C   . ASN A 1 149 ? 54.794  31.052 37.429  1.00 39.85  ? 150  ASN A C   1 
ATOM   1176 O O   . ASN A 1 149 ? 54.354  31.951 38.151  1.00 42.20  ? 150  ASN A O   1 
ATOM   1177 C CB  . ASN A 1 149 ? 56.673  29.780 38.465  1.00 42.45  ? 150  ASN A CB  1 
ATOM   1178 C CG  . ASN A 1 149 ? 57.845  28.912 38.080  1.00 45.65  ? 150  ASN A CG  1 
ATOM   1179 O OD1 . ASN A 1 149 ? 58.522  29.173 37.088  1.00 43.40  ? 150  ASN A OD1 1 
ATOM   1180 N ND2 . ASN A 1 149 ? 58.093  27.868 38.864  1.00 45.81  ? 150  ASN A ND2 1 
ATOM   1181 N N   . TYR A 1 150 ? 54.019  30.292 36.662  1.00 37.12  ? 151  TYR A N   1 
ATOM   1182 C CA  . TYR A 1 150 ? 52.570  30.400 36.686  1.00 33.80  ? 151  TYR A CA  1 
ATOM   1183 C C   . TYR A 1 150 ? 51.986  29.002 36.600  1.00 36.77  ? 151  TYR A C   1 
ATOM   1184 O O   . TYR A 1 150 ? 52.576  28.103 35.995  1.00 43.71  ? 151  TYR A O   1 
ATOM   1185 C CB  . TYR A 1 150 ? 52.035  31.286 35.547  1.00 36.28  ? 151  TYR A CB  1 
ATOM   1186 C CG  . TYR A 1 150 ? 52.330  30.788 34.144  1.00 35.00  ? 151  TYR A CG  1 
ATOM   1187 C CD1 . TYR A 1 150 ? 53.486  31.172 33.474  1.00 34.36  ? 151  TYR A CD1 1 
ATOM   1188 C CD2 . TYR A 1 150 ? 51.439  29.951 33.484  1.00 37.49  ? 151  TYR A CD2 1 
ATOM   1189 C CE1 . TYR A 1 150 ? 53.748  30.728 32.180  1.00 32.53  ? 151  TYR A CE1 1 
ATOM   1190 C CE2 . TYR A 1 150 ? 51.692  29.501 32.200  1.00 42.08  ? 151  TYR A CE2 1 
ATOM   1191 C CZ  . TYR A 1 150 ? 52.846  29.891 31.552  1.00 37.58  ? 151  TYR A CZ  1 
ATOM   1192 O OH  . TYR A 1 150 ? 53.090  29.435 30.274  1.00 39.44  ? 151  TYR A OH  1 
ATOM   1193 N N   . ARG A 1 151 ? 50.828  28.819 37.223  1.00 34.36  ? 152  ARG A N   1 
ATOM   1194 C CA  . ARG A 1 151 ? 50.240  27.491 37.291  1.00 37.09  ? 152  ARG A CA  1 
ATOM   1195 C C   . ARG A 1 151 ? 49.772  27.026 35.921  1.00 43.69  ? 152  ARG A C   1 
ATOM   1196 O O   . ARG A 1 151 ? 49.296  27.815 35.098  1.00 43.16  ? 152  ARG A O   1 
ATOM   1197 C CB  . ARG A 1 151 ? 49.087  27.473 38.280  1.00 39.99  ? 152  ARG A CB  1 
ATOM   1198 C CG  . ARG A 1 151 ? 49.505  27.806 39.708  1.00 39.03  ? 152  ARG A CG  1 
ATOM   1199 C CD  . ARG A 1 151 ? 48.255  28.003 40.557  1.00 35.36  ? 152  ARG A CD  1 
ATOM   1200 N NE  . ARG A 1 151 ? 47.839  29.404 40.581  1.00 39.14  ? 152  ARG A NE  1 
ATOM   1201 C CZ  . ARG A 1 151 ? 46.706  29.841 41.115  1.00 45.42  ? 152  ARG A CZ  1 
ATOM   1202 N NH1 . ARG A 1 151 ? 45.831  28.993 41.663  1.00 42.61  ? 152  ARG A NH1 1 
ATOM   1203 N NH2 . ARG A 1 151 ? 46.404  31.140 41.094  1.00 44.62  ? 152  ARG A NH2 1 
ATOM   1204 N N   . VAL A 1 152 ? 49.930  25.728 35.675  1.00 39.59  ? 153  VAL A N   1 
ATOM   1205 C CA  . VAL A 1 152 ? 49.634  25.129 34.387  1.00 40.69  ? 153  VAL A CA  1 
ATOM   1206 C C   . VAL A 1 152 ? 48.693  23.952 34.602  1.00 42.81  ? 153  VAL A C   1 
ATOM   1207 O O   . VAL A 1 152 ? 48.414  23.545 35.730  1.00 42.17  ? 153  VAL A O   1 
ATOM   1208 C CB  . VAL A 1 152 ? 50.911  24.681 33.651  1.00 39.66  ? 153  VAL A CB  1 
ATOM   1209 C CG1 . VAL A 1 152 ? 51.783  25.886 33.333  1.00 35.63  ? 153  VAL A CG1 1 
ATOM   1210 C CG2 . VAL A 1 152 ? 51.671  23.678 34.497  1.00 37.54  ? 153  VAL A CG2 1 
ATOM   1211 N N   . GLY A 1 153 ? 48.202  23.410 33.492  1.00 43.75  ? 154  GLY A N   1 
ATOM   1212 C CA  . GLY A 1 153 ? 47.282  22.295 33.571  1.00 39.57  ? 154  GLY A CA  1 
ATOM   1213 C C   . GLY A 1 153 ? 45.987  22.685 34.259  1.00 45.59  ? 154  GLY A C   1 
ATOM   1214 O O   . GLY A 1 153 ? 45.526  23.830 34.188  1.00 44.62  ? 154  GLY A O   1 
ATOM   1215 N N   . ALA A 1 154 ? 45.385  21.707 34.942  1.00 37.82  ? 155  ALA A N   1 
ATOM   1216 C CA  . ALA A 1 154 ? 44.152  21.977 35.670  1.00 43.43  ? 155  ALA A CA  1 
ATOM   1217 C C   . ALA A 1 154 ? 44.368  23.007 36.769  1.00 45.32  ? 155  ALA A C   1 
ATOM   1218 O O   . ALA A 1 154 ? 43.466  23.799 37.064  1.00 47.25  ? 155  ALA A O   1 
ATOM   1219 C CB  . ALA A 1 154 ? 43.593  20.683 36.262  1.00 45.28  ? 155  ALA A CB  1 
ATOM   1220 N N   . PHE A 1 155 ? 45.555  23.023 37.375  1.00 43.75  ? 156  PHE A N   1 
ATOM   1221 C CA  . PHE A 1 155 ? 45.802  23.942 38.480  1.00 47.08  ? 156  PHE A CA  1 
ATOM   1222 C C   . PHE A 1 155 ? 45.747  25.394 38.026  1.00 43.30  ? 156  PHE A C   1 
ATOM   1223 O O   . PHE A 1 155 ? 45.437  26.284 38.825  1.00 40.63  ? 156  PHE A O   1 
ATOM   1224 C CB  . PHE A 1 155 ? 47.151  23.625 39.125  1.00 44.99  ? 156  PHE A CB  1 
ATOM   1225 C CG  . PHE A 1 155 ? 47.322  22.175 39.460  1.00 43.69  ? 156  PHE A CG  1 
ATOM   1226 C CD1 . PHE A 1 155 ? 47.982  21.322 38.590  1.00 46.14  ? 156  PHE A CD1 1 
ATOM   1227 C CD2 . PHE A 1 155 ? 46.802  21.658 40.634  1.00 41.91  ? 156  PHE A CD2 1 
ATOM   1228 C CE1 . PHE A 1 155 ? 48.130  19.983 38.893  1.00 50.01  ? 156  PHE A CE1 1 
ATOM   1229 C CE2 . PHE A 1 155 ? 46.948  20.322 40.942  1.00 47.79  ? 156  PHE A CE2 1 
ATOM   1230 C CZ  . PHE A 1 155 ? 47.612  19.483 40.070  1.00 48.66  ? 156  PHE A CZ  1 
ATOM   1231 N N   . GLY A 1 156 ? 46.017  25.652 36.752  1.00 43.03  ? 157  GLY A N   1 
ATOM   1232 C CA  . GLY A 1 156 ? 46.043  27.017 36.276  1.00 40.44  ? 157  GLY A CA  1 
ATOM   1233 C C   . GLY A 1 156 ? 44.879  27.384 35.384  1.00 44.77  ? 157  GLY A C   1 
ATOM   1234 O O   . GLY A 1 156 ? 44.575  28.569 35.215  1.00 47.39  ? 157  GLY A O   1 
ATOM   1235 N N   . PHE A 1 157 ? 44.213  26.383 34.806  1.00 39.65  ? 158  PHE A N   1 
ATOM   1236 C CA  . PHE A 1 157 ? 43.244  26.667 33.760  1.00 39.57  ? 158  PHE A CA  1 
ATOM   1237 C C   . PHE A 1 157 ? 42.016  25.772 33.767  1.00 43.95  ? 158  PHE A C   1 
ATOM   1238 O O   . PHE A 1 157 ? 41.190  25.891 32.854  1.00 43.71  ? 158  PHE A O   1 
ATOM   1239 C CB  . PHE A 1 157 ? 43.929  26.594 32.383  1.00 37.49  ? 158  PHE A CB  1 
ATOM   1240 C CG  . PHE A 1 157 ? 45.036  27.587 32.231  1.00 34.90  ? 158  PHE A CG  1 
ATOM   1241 C CD1 . PHE A 1 157 ? 46.355  27.207 32.406  1.00 40.53  ? 158  PHE A CD1 1 
ATOM   1242 C CD2 . PHE A 1 157 ? 44.754  28.916 31.970  1.00 35.60  ? 158  PHE A CD2 1 
ATOM   1243 C CE1 . PHE A 1 157 ? 47.378  28.129 32.293  1.00 41.90  ? 158  PHE A CE1 1 
ATOM   1244 C CE2 . PHE A 1 157 ? 45.769  29.844 31.856  1.00 41.92  ? 158  PHE A CE2 1 
ATOM   1245 C CZ  . PHE A 1 157 ? 47.085  29.450 32.017  1.00 41.73  ? 158  PHE A CZ  1 
ATOM   1246 N N   . LEU A 1 158 ? 41.858  24.887 34.748  1.00 42.38  ? 159  LEU A N   1 
ATOM   1247 C CA  . LEU A 1 158 ? 40.566  24.246 34.926  1.00 46.34  ? 159  LEU A CA  1 
ATOM   1248 C C   . LEU A 1 158 ? 39.526  25.315 35.214  1.00 51.72  ? 159  LEU A C   1 
ATOM   1249 O O   . LEU A 1 158 ? 39.727  26.181 36.070  1.00 55.73  ? 159  LEU A O   1 
ATOM   1250 C CB  . LEU A 1 158 ? 40.610  23.223 36.057  1.00 44.82  ? 159  LEU A CB  1 
ATOM   1251 C CG  . LEU A 1 158 ? 39.396  22.302 36.175  1.00 49.12  ? 159  LEU A CG  1 
ATOM   1252 C CD1 . LEU A 1 158 ? 39.851  20.895 36.492  1.00 53.32  ? 159  LEU A CD1 1 
ATOM   1253 C CD2 . LEU A 1 158 ? 38.427  22.817 37.243  1.00 43.16  ? 159  LEU A CD2 1 
ATOM   1254 N N   . ALA A 1 159 ? 38.421  25.266 34.482  1.00 52.46  ? 160  ALA A N   1 
ATOM   1255 C CA  . ALA A 1 159 ? 37.419  26.314 34.564  1.00 53.10  ? 160  ALA A CA  1 
ATOM   1256 C C   . ALA A 1 159 ? 36.035  25.697 34.581  1.00 53.53  ? 160  ALA A C   1 
ATOM   1257 O O   . ALA A 1 159 ? 35.685  24.911 33.695  1.00 54.47  ? 160  ALA A O   1 
ATOM   1258 C CB  . ALA A 1 159 ? 37.544  27.291 33.388  1.00 56.97  ? 160  ALA A CB  1 
ATOM   1259 N N   . LEU A 1 160 ? 35.258  26.044 35.603  1.00 51.04  ? 161  LEU A N   1 
ATOM   1260 C CA  . LEU A 1 160 ? 33.814  25.854 35.585  1.00 55.84  ? 161  LEU A CA  1 
ATOM   1261 C C   . LEU A 1 160 ? 33.207  27.247 35.501  1.00 58.07  ? 161  LEU A C   1 
ATOM   1262 O O   . LEU A 1 160 ? 32.960  27.888 36.534  1.00 56.35  ? 161  LEU A O   1 
ATOM   1263 C CB  . LEU A 1 160 ? 33.332  25.097 36.822  1.00 55.82  ? 161  LEU A CB  1 
ATOM   1264 C CG  . LEU A 1 160 ? 33.871  23.663 36.816  1.00 58.78  ? 161  LEU A CG  1 
ATOM   1265 C CD1 . LEU A 1 160 ? 34.056  23.143 38.219  1.00 59.50  ? 161  LEU A CD1 1 
ATOM   1266 C CD2 . LEU A 1 160 ? 32.962  22.735 36.025  1.00 50.60  ? 161  LEU A CD2 1 
ATOM   1267 N N   . PRO A 1 161 ? 32.971  27.766 34.293  1.00 55.93  ? 162  PRO A N   1 
ATOM   1268 C CA  . PRO A 1 161 ? 32.698  29.200 34.134  1.00 56.58  ? 162  PRO A CA  1 
ATOM   1269 C C   . PRO A 1 161 ? 31.479  29.650 34.922  1.00 60.12  ? 162  PRO A C   1 
ATOM   1270 O O   . PRO A 1 161 ? 30.500  28.917 35.078  1.00 60.57  ? 162  PRO A O   1 
ATOM   1271 C CB  . PRO A 1 161 ? 32.473  29.352 32.625  1.00 61.87  ? 162  PRO A CB  1 
ATOM   1272 C CG  . PRO A 1 161 ? 33.208  28.196 32.018  1.00 59.89  ? 162  PRO A CG  1 
ATOM   1273 C CD  . PRO A 1 161 ? 33.054  27.069 32.998  1.00 57.62  ? 162  PRO A CD  1 
ATOM   1274 N N   . GLY A 1 162 ? 31.555  30.882 35.423  1.00 58.61  ? 163  GLY A N   1 
ATOM   1275 C CA  . GLY A 1 162 ? 30.560  31.402 36.329  1.00 58.99  ? 163  GLY A CA  1 
ATOM   1276 C C   . GLY A 1 162 ? 30.737  30.987 37.772  1.00 65.68  ? 163  GLY A C   1 
ATOM   1277 O O   . GLY A 1 162 ? 30.194  31.651 38.664  1.00 68.19  ? 163  GLY A O   1 
ATOM   1278 N N   . SER A 1 163 ? 31.476  29.913 38.037  1.00 64.40  ? 164  SER A N   1 
ATOM   1279 C CA  . SER A 1 163 ? 31.689  29.494 39.411  1.00 68.41  ? 164  SER A CA  1 
ATOM   1280 C C   . SER A 1 163 ? 32.716  30.388 40.091  1.00 64.34  ? 164  SER A C   1 
ATOM   1281 O O   . SER A 1 163 ? 33.501  31.098 39.455  1.00 70.33  ? 164  SER A O   1 
ATOM   1282 C CB  . SER A 1 163 ? 32.153  28.040 39.491  1.00 69.58  ? 164  SER A CB  1 
ATOM   1283 O OG  . SER A 1 163 ? 33.543  27.938 39.226  1.00 68.37  ? 164  SER A OG  1 
ATOM   1284 N N   . ARG A 1 164 ? 32.705  30.318 41.412  1.00 69.62  ? 165  ARG A N   1 
ATOM   1285 C CA  . ARG A 1 164 ? 33.545  31.124 42.275  1.00 67.93  ? 165  ARG A CA  1 
ATOM   1286 C C   . ARG A 1 164 ? 34.866  30.453 42.628  1.00 59.52  ? 165  ARG A C   1 
ATOM   1287 O O   . ARG A 1 164 ? 35.823  31.148 42.985  1.00 63.29  ? 165  ARG A O   1 
ATOM   1288 C CB  . ARG A 1 164 ? 32.771  31.418 43.560  1.00 88.69  ? 165  ARG A CB  1 
ATOM   1289 C CG  . ARG A 1 164 ? 33.250  32.603 44.331  1.00 105.02 ? 165  ARG A CG  1 
ATOM   1290 C CD  . ARG A 1 164 ? 33.540  33.788 43.430  1.00 115.99 ? 165  ARG A CD  1 
ATOM   1291 N NE  . ARG A 1 164 ? 34.011  34.913 44.222  1.00 126.19 ? 165  ARG A NE  1 
ATOM   1292 C CZ  . ARG A 1 164 ? 33.717  36.180 43.965  1.00 129.87 ? 165  ARG A CZ  1 
ATOM   1293 N NH1 . ARG A 1 164 ? 32.958  36.522 42.925  1.00 128.82 ? 165  ARG A NH1 1 
ATOM   1294 N NH2 . ARG A 1 164 ? 34.185  37.134 44.759  1.00 131.03 ? 165  ARG A NH2 1 
ATOM   1295 N N   . GLU A 1 165 ? 34.930  29.124 42.539  1.00 69.39  ? 166  GLU A N   1 
ATOM   1296 C CA  . GLU A 1 165 ? 36.073  28.329 42.971  1.00 75.68  ? 166  GLU A CA  1 
ATOM   1297 C C   . GLU A 1 165 ? 37.013  27.992 41.833  1.00 72.03  ? 166  GLU A C   1 
ATOM   1298 O O   . GLU A 1 165 ? 38.213  27.803 42.059  1.00 82.29  ? 166  GLU A O   1 
ATOM   1299 C CB  . GLU A 1 165 ? 35.604  27.011 43.579  1.00 85.84  ? 166  GLU A CB  1 
ATOM   1300 C CG  . GLU A 1 165 ? 34.571  27.114 44.684  1.00 102.03 ? 166  GLU A CG  1 
ATOM   1301 C CD  . GLU A 1 165 ? 33.183  27.482 44.173  1.00 119.87 ? 166  GLU A CD  1 
ATOM   1302 O OE1 . GLU A 1 165 ? 32.222  26.869 44.618  1.00 125.19 ? 166  GLU A OE1 1 
ATOM   1303 O OE2 . GLU A 1 165 ? 33.030  28.393 43.352  1.00 125.60 ? 166  GLU A OE2 1 
ATOM   1304 N N   . ALA A 1 166 ? 36.477  27.869 40.627  1.00 58.86  ? 167  ALA A N   1 
ATOM   1305 C CA  . ALA A 1 166 ? 37.267  27.591 39.433  1.00 57.12  ? 167  ALA A CA  1 
ATOM   1306 C C   . ALA A 1 166 ? 36.841  28.554 38.335  1.00 53.25  ? 167  ALA A C   1 
ATOM   1307 O O   . ALA A 1 166 ? 36.295  28.146 37.308  1.00 55.99  ? 167  ALA A O   1 
ATOM   1308 C CB  . ALA A 1 166 ? 37.097  26.135 39.003  1.00 65.30  ? 167  ALA A CB  1 
ATOM   1309 N N   . PRO A 1 167 ? 37.062  29.860 38.532  1.00 55.44  ? 168  PRO A N   1 
ATOM   1310 C CA  . PRO A 1 167 ? 36.687  30.829 37.493  1.00 60.11  ? 168  PRO A CA  1 
ATOM   1311 C C   . PRO A 1 167 ? 37.517  30.699 36.233  1.00 60.03  ? 168  PRO A C   1 
ATOM   1312 O O   . PRO A 1 167 ? 37.158  31.298 35.211  1.00 66.74  ? 168  PRO A O   1 
ATOM   1313 C CB  . PRO A 1 167 ? 36.920  32.181 38.177  1.00 58.37  ? 168  PRO A CB  1 
ATOM   1314 C CG  . PRO A 1 167 ? 38.011  31.909 39.151  1.00 57.22  ? 168  PRO A CG  1 
ATOM   1315 C CD  . PRO A 1 167 ? 37.792  30.500 39.642  1.00 49.56  ? 168  PRO A CD  1 
ATOM   1316 N N   . GLY A 1 168 ? 38.601  29.933 36.272  1.00 53.65  ? 169  GLY A N   1 
ATOM   1317 C CA  . GLY A 1 168 ? 39.457  29.761 35.122  1.00 49.73  ? 169  GLY A CA  1 
ATOM   1318 C C   . GLY A 1 168 ? 40.457  30.891 34.979  1.00 55.77  ? 169  GLY A C   1 
ATOM   1319 O O   . GLY A 1 168 ? 40.388  31.926 35.646  1.00 52.38  ? 169  GLY A O   1 
ATOM   1320 N N   . ASN A 1 169 ? 41.422  30.667 34.088  1.00 50.58  ? 170  ASN A N   1 
ATOM   1321 C CA  . ASN A 1 169 ? 42.439  31.652 33.735  1.00 43.72  ? 170  ASN A CA  1 
ATOM   1322 C C   . ASN A 1 169 ? 43.272  32.106 34.934  1.00 43.98  ? 170  ASN A C   1 
ATOM   1323 O O   . ASN A 1 169 ? 43.909  33.162 34.874  1.00 48.42  ? 170  ASN A O   1 
ATOM   1324 C CB  . ASN A 1 169 ? 41.805  32.868 33.046  1.00 44.66  ? 170  ASN A CB  1 
ATOM   1325 C CG  . ASN A 1 169 ? 41.113  32.506 31.740  1.00 52.43  ? 170  ASN A CG  1 
ATOM   1326 O OD1 . ASN A 1 169 ? 41.315  31.422 31.198  1.00 54.56  ? 170  ASN A OD1 1 
ATOM   1327 N ND2 . ASN A 1 169 ? 40.286  33.415 31.236  1.00 47.01  ? 170  ASN A ND2 1 
ATOM   1328 N N   . VAL A 1 170 ? 43.300  31.337 36.029  1.00 39.83  ? 171  VAL A N   1 
ATOM   1329 C CA  . VAL A 1 170 ? 44.069  31.786 37.190  1.00 41.32  ? 171  VAL A CA  1 
ATOM   1330 C C   . VAL A 1 170 ? 45.561  31.774 36.882  1.00 44.51  ? 171  VAL A C   1 
ATOM   1331 O O   . VAL A 1 170 ? 46.324  32.572 37.442  1.00 41.66  ? 171  VAL A O   1 
ATOM   1332 C CB  . VAL A 1 170 ? 43.737  30.950 38.446  1.00 43.42  ? 171  VAL A CB  1 
ATOM   1333 C CG1 . VAL A 1 170 ? 42.249  31.042 38.769  1.00 43.50  ? 171  VAL A CG1 1 
ATOM   1334 C CG2 . VAL A 1 170 ? 44.175  29.501 38.288  1.00 43.34  ? 171  VAL A CG2 1 
ATOM   1335 N N   . GLY A 1 171 ? 46.003  30.896 35.976  1.00 43.25  ? 172  GLY A N   1 
ATOM   1336 C CA  . GLY A 1 171 ? 47.385  30.943 35.527  1.00 38.45  ? 172  GLY A CA  1 
ATOM   1337 C C   . GLY A 1 171 ? 47.738  32.250 34.843  1.00 41.67  ? 172  GLY A C   1 
ATOM   1338 O O   . GLY A 1 171 ? 48.867  32.736 34.965  1.00 44.34  ? 172  GLY A O   1 
ATOM   1339 N N   . LEU A 1 172 ? 46.786  32.837 34.115  1.00 40.20  ? 173  LEU A N   1 
ATOM   1340 C CA  . LEU A 1 172 ? 47.011  34.161 33.545  1.00 42.98  ? 173  LEU A CA  1 
ATOM   1341 C C   . LEU A 1 172 ? 47.010  35.228 34.632  1.00 42.61  ? 173  LEU A C   1 
ATOM   1342 O O   . LEU A 1 172 ? 47.766  36.205 34.555  1.00 44.77  ? 173  LEU A O   1 
ATOM   1343 C CB  . LEU A 1 172 ? 45.952  34.468 32.483  1.00 38.05  ? 173  LEU A CB  1 
ATOM   1344 C CG  . LEU A 1 172 ? 46.023  33.678 31.174  1.00 44.97  ? 173  LEU A CG  1 
ATOM   1345 C CD1 . LEU A 1 172 ? 44.777  33.910 30.309  1.00 35.42  ? 173  LEU A CD1 1 
ATOM   1346 C CD2 . LEU A 1 172 ? 47.311  34.013 30.413  1.00 41.33  ? 173  LEU A CD2 1 
ATOM   1347 N N   . LEU A 1 173 ? 46.171  35.059 35.655  1.00 42.87  ? 174  LEU A N   1 
ATOM   1348 C CA  . LEU A 1 173 ? 46.195  35.986 36.780  1.00 43.84  ? 174  LEU A CA  1 
ATOM   1349 C C   . LEU A 1 173 ? 47.504  35.889 37.549  1.00 43.05  ? 174  LEU A C   1 
ATOM   1350 O O   . LEU A 1 173 ? 47.974  36.892 38.098  1.00 46.56  ? 174  LEU A O   1 
ATOM   1351 C CB  . LEU A 1 173 ? 44.999  35.729 37.695  1.00 43.17  ? 174  LEU A CB  1 
ATOM   1352 C CG  . LEU A 1 173 ? 43.647  35.983 37.021  1.00 53.32  ? 174  LEU A CG  1 
ATOM   1353 C CD1 . LEU A 1 173 ? 42.482  35.646 37.944  1.00 49.75  ? 174  LEU A CD1 1 
ATOM   1354 C CD2 . LEU A 1 173 ? 43.558  37.427 36.546  1.00 54.46  ? 174  LEU A CD2 1 
ATOM   1355 N N   . ASP A 1 174 ? 48.113  34.700 37.590  1.00 44.87  ? 175  ASP A N   1 
ATOM   1356 C CA  . ASP A 1 174 ? 49.454  34.579 38.157  1.00 43.06  ? 175  ASP A CA  1 
ATOM   1357 C C   . ASP A 1 174 ? 50.436  35.465 37.402  1.00 43.62  ? 175  ASP A C   1 
ATOM   1358 O O   . ASP A 1 174 ? 51.229  36.195 38.008  1.00 44.19  ? 175  ASP A O   1 
ATOM   1359 C CB  . ASP A 1 174 ? 49.924  33.123 38.127  1.00 39.17  ? 175  ASP A CB  1 
ATOM   1360 C CG  . ASP A 1 174 ? 49.051  32.202 38.958  1.00 46.05  ? 175  ASP A CG  1 
ATOM   1361 O OD1 . ASP A 1 174 ? 48.310  32.701 39.830  1.00 46.73  ? 175  ASP A OD1 1 
ATOM   1362 O OD2 . ASP A 1 174 ? 49.118  30.972 38.745  1.00 48.03  ? 175  ASP A OD2 1 
ATOM   1363 N N   . GLN A 1 175 ? 50.390  35.417 36.068  1.00 40.81  ? 176  GLN A N   1 
ATOM   1364 C CA  . GLN A 1 175 ? 51.257  36.270 35.262  1.00 39.53  ? 176  GLN A CA  1 
ATOM   1365 C C   . GLN A 1 175 ? 50.965  37.742 35.525  1.00 39.12  ? 176  GLN A C   1 
ATOM   1366 O O   . GLN A 1 175 ? 51.885  38.549 35.704  1.00 41.69  ? 176  GLN A O   1 
ATOM   1367 C CB  . GLN A 1 175 ? 51.084  35.940 33.777  1.00 45.04  ? 176  GLN A CB  1 
ATOM   1368 C CG  . GLN A 1 175 ? 51.297  34.472 33.420  1.00 38.34  ? 176  GLN A CG  1 
ATOM   1369 C CD  . GLN A 1 175 ? 50.994  34.192 31.956  1.00 41.79  ? 176  GLN A CD  1 
ATOM   1370 O OE1 . GLN A 1 175 ? 50.635  35.098 31.207  1.00 42.04  ? 176  GLN A OE1 1 
ATOM   1371 N NE2 . GLN A 1 175 ? 51.136  32.937 31.545  1.00 37.15  ? 176  GLN A NE2 1 
ATOM   1372 N N   . ARG A 1 176 ? 49.681  38.108 35.563  1.00 42.38  ? 177  ARG A N   1 
ATOM   1373 C CA  . ARG A 1 176 ? 49.320  39.499 35.813  1.00 43.39  ? 177  ARG A CA  1 
ATOM   1374 C C   . ARG A 1 176 ? 49.809  39.962 37.180  1.00 49.83  ? 177  ARG A C   1 
ATOM   1375 O O   . ARG A 1 176 ? 50.325  41.079 37.317  1.00 48.13  ? 177  ARG A O   1 
ATOM   1376 C CB  . ARG A 1 176 ? 47.808  39.682 35.699  1.00 41.47  ? 177  ARG A CB  1 
ATOM   1377 C CG  . ARG A 1 176 ? 47.334  41.066 36.104  1.00 53.75  ? 177  ARG A CG  1 
ATOM   1378 C CD  . ARG A 1 176 ? 45.835  41.201 35.943  1.00 56.90  ? 177  ARG A CD  1 
ATOM   1379 N NE  . ARG A 1 176 ? 45.442  41.225 34.539  1.00 60.36  ? 177  ARG A NE  1 
ATOM   1380 C CZ  . ARG A 1 176 ? 44.191  41.088 34.116  1.00 61.83  ? 177  ARG A CZ  1 
ATOM   1381 N NH1 . ARG A 1 176 ? 43.212  40.913 34.994  1.00 62.54  ? 177  ARG A NH1 1 
ATOM   1382 N NH2 . ARG A 1 176 ? 43.918  41.126 32.818  1.00 55.53  ? 177  ARG A NH2 1 
ATOM   1383 N N   . LEU A 1 177 ? 49.655  39.119 38.208  1.00 48.86  ? 178  LEU A N   1 
ATOM   1384 C CA  . LEU A 1 177 ? 50.156  39.484 39.532  1.00 46.65  ? 178  LEU A CA  1 
ATOM   1385 C C   . LEU A 1 177 ? 51.661  39.730 39.494  1.00 48.20  ? 178  LEU A C   1 
ATOM   1386 O O   . LEU A 1 177 ? 52.157  40.684 40.105  1.00 47.94  ? 178  LEU A O   1 
ATOM   1387 C CB  . LEU A 1 177 ? 49.806  38.400 40.555  1.00 40.10  ? 178  LEU A CB  1 
ATOM   1388 C CG  . LEU A 1 177 ? 50.210  38.671 42.011  1.00 47.52  ? 178  LEU A CG  1 
ATOM   1389 C CD1 . LEU A 1 177 ? 49.719  40.046 42.485  1.00 45.31  ? 178  LEU A CD1 1 
ATOM   1390 C CD2 . LEU A 1 177 ? 49.724  37.554 42.953  1.00 41.93  ? 178  LEU A CD2 1 
ATOM   1391 N N   . ALA A 1 178 ? 52.400  38.899 38.751  1.00 46.73  ? 179  ALA A N   1 
ATOM   1392 C CA  . ALA A 1 178 ? 53.835  39.122 38.608  1.00 46.83  ? 179  ALA A CA  1 
ATOM   1393 C C   . ALA A 1 178 ? 54.123  40.449 37.918  1.00 49.15  ? 179  ALA A C   1 
ATOM   1394 O O   . ALA A 1 178 ? 55.053  41.168 38.304  1.00 46.76  ? 179  ALA A O   1 
ATOM   1395 C CB  . ALA A 1 178 ? 54.475  37.967 37.839  1.00 40.31  ? 179  ALA A CB  1 
ATOM   1396 N N   . LEU A 1 179 ? 53.334  40.794 36.895  1.00 45.47  ? 180  LEU A N   1 
ATOM   1397 C CA  . LEU A 1 179 ? 53.528  42.070 36.212  1.00 46.67  ? 180  LEU A CA  1 
ATOM   1398 C C   . LEU A 1 179 ? 53.272  43.243 37.150  1.00 50.64  ? 180  LEU A C   1 
ATOM   1399 O O   . LEU A 1 179 ? 53.995  44.247 37.114  1.00 51.03  ? 180  LEU A O   1 
ATOM   1400 C CB  . LEU A 1 179 ? 52.619  42.159 34.985  1.00 44.09  ? 180  LEU A CB  1 
ATOM   1401 C CG  . LEU A 1 179 ? 52.902  41.154 33.870  1.00 45.64  ? 180  LEU A CG  1 
ATOM   1402 C CD1 . LEU A 1 179 ? 52.078  41.475 32.630  1.00 51.95  ? 180  LEU A CD1 1 
ATOM   1403 C CD2 . LEU A 1 179 ? 54.383  41.135 33.548  1.00 47.26  ? 180  LEU A CD2 1 
ATOM   1404 N N   . GLN A 1 180 ? 52.242  43.140 37.993  1.00 49.92  ? 181  GLN A N   1 
ATOM   1405 C CA  . GLN A 1 180 ? 51.995  44.181 38.986  1.00 52.25  ? 181  GLN A CA  1 
ATOM   1406 C C   . GLN A 1 180 ? 53.144  44.267 39.983  1.00 48.52  ? 181  GLN A C   1 
ATOM   1407 O O   . GLN A 1 180 ? 53.506  45.362 40.431  1.00 54.65  ? 181  GLN A O   1 
ATOM   1408 C CB  . GLN A 1 180 ? 50.671  43.917 39.702  1.00 52.34  ? 181  GLN A CB  1 
ATOM   1409 C CG  . GLN A 1 180 ? 49.462  43.996 38.780  1.00 58.24  ? 181  GLN A CG  1 
ATOM   1410 C CD  . GLN A 1 180 ? 48.200  43.436 39.408  1.00 62.90  ? 181  GLN A CD  1 
ATOM   1411 O OE1 . GLN A 1 180 ? 48.256  42.684 40.379  1.00 65.16  ? 181  GLN A OE1 1 
ATOM   1412 N NE2 . GLN A 1 180 ? 47.050  43.807 38.856  1.00 65.46  ? 181  GLN A NE2 1 
ATOM   1413 N N   . TRP A 1 181 ? 53.735  43.122 40.333  1.00 45.29  ? 182  TRP A N   1 
ATOM   1414 C CA  . TRP A 1 181 ? 54.898  43.124 41.216  1.00 54.80  ? 182  TRP A CA  1 
ATOM   1415 C C   . TRP A 1 181 ? 56.062  43.868 40.578  1.00 55.58  ? 182  TRP A C   1 
ATOM   1416 O O   . TRP A 1 181 ? 56.809  44.579 41.262  1.00 56.76  ? 182  TRP A O   1 
ATOM   1417 C CB  . TRP A 1 181 ? 55.298  41.685 41.553  1.00 51.47  ? 182  TRP A CB  1 
ATOM   1418 C CG  . TRP A 1 181 ? 56.385  41.562 42.587  1.00 46.15  ? 182  TRP A CG  1 
ATOM   1419 C CD1 . TRP A 1 181 ? 56.222  41.343 43.925  1.00 48.03  ? 182  TRP A CD1 1 
ATOM   1420 C CD2 . TRP A 1 181 ? 57.798  41.637 42.363  1.00 45.39  ? 182  TRP A CD2 1 
ATOM   1421 N NE1 . TRP A 1 181 ? 57.444  41.284 44.547  1.00 49.46  ? 182  TRP A NE1 1 
ATOM   1422 C CE2 . TRP A 1 181 ? 58.429  41.462 43.611  1.00 49.14  ? 182  TRP A CE2 1 
ATOM   1423 C CE3 . TRP A 1 181 ? 58.592  41.840 41.230  1.00 47.54  ? 182  TRP A CE3 1 
ATOM   1424 C CZ2 . TRP A 1 181 ? 59.815  41.483 43.758  1.00 51.55  ? 182  TRP A CZ2 1 
ATOM   1425 C CZ3 . TRP A 1 181 ? 59.967  41.861 41.377  1.00 50.24  ? 182  TRP A CZ3 1 
ATOM   1426 C CH2 . TRP A 1 181 ? 60.564  41.683 42.631  1.00 53.80  ? 182  TRP A CH2 1 
ATOM   1427 N N   . VAL A 1 182 ? 56.228  43.715 39.261  1.00 51.27  ? 183  VAL A N   1 
ATOM   1428 C CA  . VAL A 1 182 ? 57.293  44.413 38.547  1.00 48.22  ? 183  VAL A CA  1 
ATOM   1429 C C   . VAL A 1 182 ? 57.073  45.920 38.599  1.00 51.83  ? 183  VAL A C   1 
ATOM   1430 O O   . VAL A 1 182 ? 58.005  46.691 38.860  1.00 50.14  ? 183  VAL A O   1 
ATOM   1431 C CB  . VAL A 1 182 ? 57.382  43.896 37.097  1.00 52.35  ? 183  VAL A CB  1 
ATOM   1432 C CG1 . VAL A 1 182 ? 58.251  44.812 36.246  1.00 46.54  ? 183  VAL A CG1 1 
ATOM   1433 C CG2 . VAL A 1 182 ? 57.919  42.467 37.075  1.00 48.11  ? 183  VAL A CG2 1 
ATOM   1434 N N   . GLN A 1 183 ? 55.835  46.364 38.370  1.00 47.12  ? 184  GLN A N   1 
ATOM   1435 C CA  . GLN A 1 183 ? 55.546  47.795 38.405  1.00 54.92  ? 184  GLN A CA  1 
ATOM   1436 C C   . GLN A 1 183 ? 55.846  48.393 39.776  1.00 58.19  ? 184  GLN A C   1 
ATOM   1437 O O   . GLN A 1 183 ? 56.327  49.528 39.875  1.00 63.19  ? 184  GLN A O   1 
ATOM   1438 C CB  . GLN A 1 183 ? 54.089  48.043 38.015  1.00 57.60  ? 184  GLN A CB  1 
ATOM   1439 C CG  . GLN A 1 183 ? 53.846  48.025 36.512  1.00 60.90  ? 184  GLN A CG  1 
ATOM   1440 C CD  . GLN A 1 183 ? 54.611  49.119 35.793  1.00 62.94  ? 184  GLN A CD  1 
ATOM   1441 O OE1 . GLN A 1 183 ? 54.431  50.304 36.073  1.00 69.07  ? 184  GLN A OE1 1 
ATOM   1442 N NE2 . GLN A 1 183 ? 55.478  48.725 34.868  1.00 57.62  ? 184  GLN A NE2 1 
ATOM   1443 N N   . GLU A 1 184 ? 55.586  47.643 40.844  1.00 55.56  ? 185  GLU A N   1 
ATOM   1444 C CA  . GLU A 1 184 ? 55.752  48.181 42.188  1.00 60.72  ? 185  GLU A CA  1 
ATOM   1445 C C   . GLU A 1 184 ? 57.167  48.044 42.732  1.00 57.35  ? 185  GLU A C   1 
ATOM   1446 O O   . GLU A 1 184 ? 57.544  48.812 43.624  1.00 58.44  ? 185  GLU A O   1 
ATOM   1447 C CB  . GLU A 1 184 ? 54.775  47.498 43.151  1.00 64.30  ? 185  GLU A CB  1 
ATOM   1448 C CG  . GLU A 1 184 ? 53.316  47.649 42.750  1.00 77.87  ? 185  GLU A CG  1 
ATOM   1449 C CD  . GLU A 1 184 ? 52.367  46.948 43.704  1.00 83.58  ? 185  GLU A CD  1 
ATOM   1450 O OE1 . GLU A 1 184 ? 51.140  47.017 43.479  1.00 80.33  ? 185  GLU A OE1 1 
ATOM   1451 O OE2 . GLU A 1 184 ? 52.848  46.328 44.676  1.00 89.14  ? 185  GLU A OE2 1 
ATOM   1452 N N   . ASN A 1 185 ? 57.967  47.107 42.221  1.00 51.74  ? 186  ASN A N   1 
ATOM   1453 C CA  . ASN A 1 185 ? 59.225  46.775 42.874  1.00 47.51  ? 186  ASN A CA  1 
ATOM   1454 C C   . ASN A 1 185 ? 60.459  46.780 41.979  1.00 49.89  ? 186  ASN A C   1 
ATOM   1455 O O   . ASN A 1 185 ? 61.570  46.746 42.518  1.00 52.17  ? 186  ASN A O   1 
ATOM   1456 C CB  . ASN A 1 185 ? 59.122  45.397 43.549  1.00 49.41  ? 186  ASN A CB  1 
ATOM   1457 C CG  . ASN A 1 185 ? 58.001  45.331 44.574  1.00 55.69  ? 186  ASN A CG  1 
ATOM   1458 O OD1 . ASN A 1 185 ? 58.054  45.993 45.608  1.00 57.64  ? 186  ASN A OD1 1 
ATOM   1459 N ND2 . ASN A 1 185 ? 56.985  44.522 44.295  1.00 57.66  ? 186  ASN A ND2 1 
ATOM   1460 N N   . VAL A 1 186 ? 60.317  46.830 40.649  1.00 45.78  ? 187  VAL A N   1 
ATOM   1461 C CA  . VAL A 1 186 ? 61.492  46.643 39.800  1.00 44.16  ? 187  VAL A CA  1 
ATOM   1462 C C   . VAL A 1 186 ? 62.462  47.810 39.937  1.00 51.27  ? 187  VAL A C   1 
ATOM   1463 O O   . VAL A 1 186 ? 63.667  47.653 39.701  1.00 58.17  ? 187  VAL A O   1 
ATOM   1464 C CB  . VAL A 1 186 ? 61.078  46.418 38.329  1.00 47.64  ? 187  VAL A CB  1 
ATOM   1465 C CG1 . VAL A 1 186 ? 60.806  47.743 37.629  1.00 49.14  ? 187  VAL A CG1 1 
ATOM   1466 C CG2 . VAL A 1 186 ? 62.145  45.617 37.592  1.00 41.40  ? 187  VAL A CG2 1 
ATOM   1467 N N   . ALA A 1 187 ? 61.971  48.988 40.335  1.00 51.61  ? 188  ALA A N   1 
ATOM   1468 C CA  . ALA A 1 187 ? 62.861  50.131 40.511  1.00 51.24  ? 188  ALA A CA  1 
ATOM   1469 C C   . ALA A 1 187 ? 63.861  49.896 41.634  1.00 56.97  ? 188  ALA A C   1 
ATOM   1470 O O   . ALA A 1 187 ? 64.966  50.450 41.606  1.00 66.40  ? 188  ALA A O   1 
ATOM   1471 C CB  . ALA A 1 187 ? 62.049  51.399 40.778  1.00 53.61  ? 188  ALA A CB  1 
ATOM   1472 N N   . ALA A 1 188 ? 63.500  49.078 42.625  1.00 50.57  ? 189  ALA A N   1 
ATOM   1473 C CA  . ALA A 1 188 ? 64.440  48.761 43.695  1.00 55.59  ? 189  ALA A CA  1 
ATOM   1474 C C   . ALA A 1 188 ? 65.632  47.961 43.189  1.00 54.28  ? 189  ALA A C   1 
ATOM   1475 O O   . ALA A 1 188 ? 66.668  47.925 43.859  1.00 57.85  ? 189  ALA A O   1 
ATOM   1476 C CB  . ALA A 1 188 ? 63.733  47.996 44.814  1.00 50.88  ? 189  ALA A CB  1 
ATOM   1477 N N   . PHE A 1 189 ? 65.506  47.321 42.029  1.00 54.48  ? 190  PHE A N   1 
ATOM   1478 C CA  . PHE A 1 189 ? 66.603  46.607 41.394  1.00 54.74  ? 190  PHE A CA  1 
ATOM   1479 C C   . PHE A 1 189 ? 67.280  47.440 40.313  1.00 61.85  ? 190  PHE A C   1 
ATOM   1480 O O   . PHE A 1 189 ? 68.167  46.935 39.617  1.00 65.79  ? 190  PHE A O   1 
ATOM   1481 C CB  . PHE A 1 189 ? 66.099  45.292 40.795  1.00 57.92  ? 190  PHE A CB  1 
ATOM   1482 C CG  . PHE A 1 189 ? 65.399  44.399 41.782  1.00 54.96  ? 190  PHE A CG  1 
ATOM   1483 C CD1 . PHE A 1 189 ? 64.039  44.532 42.018  1.00 52.07  ? 190  PHE A CD1 1 
ATOM   1484 C CD2 . PHE A 1 189 ? 66.100  43.418 42.466  1.00 51.41  ? 190  PHE A CD2 1 
ATOM   1485 C CE1 . PHE A 1 189 ? 63.393  43.711 42.924  1.00 46.23  ? 190  PHE A CE1 1 
ATOM   1486 C CE2 . PHE A 1 189 ? 65.460  42.593 43.369  1.00 49.45  ? 190  PHE A CE2 1 
ATOM   1487 C CZ  . PHE A 1 189 ? 64.102  42.739 43.597  1.00 46.03  ? 190  PHE A CZ  1 
ATOM   1488 N N   . GLY A 1 190 ? 66.882  48.699 40.157  1.00 59.67  ? 191  GLY A N   1 
ATOM   1489 C CA  . GLY A 1 190 ? 67.370  49.526 39.076  1.00 63.58  ? 191  GLY A CA  1 
ATOM   1490 C C   . GLY A 1 190 ? 66.568  49.437 37.799  1.00 62.98  ? 191  GLY A C   1 
ATOM   1491 O O   . GLY A 1 190 ? 66.991  49.999 36.782  1.00 60.71  ? 191  GLY A O   1 
ATOM   1492 N N   . GLY A 1 191 ? 65.428  48.752 37.817  1.00 62.83  ? 192  GLY A N   1 
ATOM   1493 C CA  . GLY A 1 191 ? 64.605  48.618 36.634  1.00 56.38  ? 192  GLY A CA  1 
ATOM   1494 C C   . GLY A 1 191 ? 63.661  49.791 36.441  1.00 60.12  ? 192  GLY A C   1 
ATOM   1495 O O   . GLY A 1 191 ? 63.244  50.446 37.391  1.00 64.91  ? 192  GLY A O   1 
ATOM   1496 N N   . ASP A 1 192 ? 63.323  50.044 35.179  1.00 61.10  ? 193  ASP A N   1 
ATOM   1497 C CA  . ASP A 1 192 ? 62.453  51.150 34.819  1.00 61.52  ? 193  ASP A CA  1 
ATOM   1498 C C   . ASP A 1 192 ? 61.038  50.629 34.626  1.00 56.03  ? 193  ASP A C   1 
ATOM   1499 O O   . ASP A 1 192 ? 60.782  49.917 33.643  1.00 60.82  ? 193  ASP A O   1 
ATOM   1500 C CB  . ASP A 1 192 ? 62.953  51.824 33.543  1.00 68.31  ? 193  ASP A CB  1 
ATOM   1501 C CG  . ASP A 1 192 ? 62.267  53.149 33.267  1.00 72.36  ? 193  ASP A CG  1 
ATOM   1502 O OD1 . ASP A 1 192 ? 61.241  53.450 33.913  1.00 75.79  ? 193  ASP A OD1 1 
ATOM   1503 O OD2 . ASP A 1 192 ? 62.758  53.892 32.394  1.00 74.19  ? 193  ASP A OD2 1 
ATOM   1504 N N   . PRO A 1 193 ? 60.090  50.951 35.512  1.00 57.12  ? 194  PRO A N   1 
ATOM   1505 C CA  . PRO A 1 193 ? 58.710  50.483 35.313  1.00 57.03  ? 194  PRO A CA  1 
ATOM   1506 C C   . PRO A 1 193 ? 57.988  51.172 34.166  1.00 64.25  ? 194  PRO A C   1 
ATOM   1507 O O   . PRO A 1 193 ? 56.890  50.730 33.803  1.00 66.40  ? 194  PRO A O   1 
ATOM   1508 C CB  . PRO A 1 193 ? 58.039  50.791 36.657  1.00 59.52  ? 194  PRO A CB  1 
ATOM   1509 C CG  . PRO A 1 193 ? 58.826  51.928 37.209  1.00 59.33  ? 194  PRO A CG  1 
ATOM   1510 C CD  . PRO A 1 193 ? 60.246  51.702 36.769  1.00 58.72  ? 194  PRO A CD  1 
ATOM   1511 N N   . THR A 1 194 ? 58.554  52.230 33.590  1.00 61.46  ? 195  THR A N   1 
ATOM   1512 C CA  . THR A 1 194 ? 57.965  52.884 32.429  1.00 59.14  ? 195  THR A CA  1 
ATOM   1513 C C   . THR A 1 194 ? 58.484  52.320 31.113  1.00 62.16  ? 195  THR A C   1 
ATOM   1514 O O   . THR A 1 194 ? 58.122  52.834 30.050  1.00 65.47  ? 195  THR A O   1 
ATOM   1515 C CB  . THR A 1 194 ? 58.219  54.396 32.477  1.00 62.69  ? 195  THR A CB  1 
ATOM   1516 O OG1 . THR A 1 194 ? 59.625  54.653 32.387  1.00 64.99  ? 195  THR A OG1 1 
ATOM   1517 C CG2 . THR A 1 194 ? 57.686  54.986 33.781  1.00 68.00  ? 195  THR A CG2 1 
ATOM   1518 N N   . SER A 1 195 ? 59.316  51.266 31.157  1.00 60.27  ? 196  SER A N   1 
ATOM   1519 C CA  . SER A 1 195 ? 59.847  50.616 29.955  1.00 62.85  ? 196  SER A CA  1 
ATOM   1520 C C   . SER A 1 195 ? 59.928  49.113 30.238  1.00 56.17  ? 196  SER A C   1 
ATOM   1521 O O   . SER A 1 195 ? 60.987  48.573 30.569  1.00 53.84  ? 196  SER A O   1 
ATOM   1522 C CB  . SER A 1 195 ? 61.205  51.192 29.558  1.00 64.57  ? 196  SER A CB  1 
ATOM   1523 O OG  . SER A 1 195 ? 61.693  50.566 28.385  1.00 68.41  ? 196  SER A OG  1 
ATOM   1524 N N   . VAL A 1 196 ? 58.793  48.434 30.098  1.00 51.47  ? 197  VAL A N   1 
ATOM   1525 C CA  . VAL A 1 196 ? 58.684  47.003 30.360  1.00 50.11  ? 197  VAL A CA  1 
ATOM   1526 C C   . VAL A 1 196 ? 58.261  46.316 29.071  1.00 50.80  ? 197  VAL A C   1 
ATOM   1527 O O   . VAL A 1 196 ? 57.221  46.656 28.492  1.00 49.67  ? 197  VAL A O   1 
ATOM   1528 C CB  . VAL A 1 196 ? 57.689  46.702 31.491  1.00 46.50  ? 197  VAL A CB  1 
ATOM   1529 C CG1 . VAL A 1 196 ? 57.461  45.202 31.606  1.00 42.09  ? 197  VAL A CG1 1 
ATOM   1530 C CG2 . VAL A 1 196 ? 58.197  47.276 32.811  1.00 42.37  ? 197  VAL A CG2 1 
ATOM   1531 N N   . THR A 1 197 ? 59.058  45.346 28.629  1.00 50.44  ? 198  THR A N   1 
ATOM   1532 C CA  . THR A 1 197 ? 58.806  44.605 27.400  1.00 48.50  ? 198  THR A CA  1 
ATOM   1533 C C   . THR A 1 197 ? 58.559  43.144 27.747  1.00 46.73  ? 198  THR A C   1 
ATOM   1534 O O   . THR A 1 197 ? 59.457  42.464 28.253  1.00 50.59  ? 198  THR A O   1 
ATOM   1535 C CB  . THR A 1 197 ? 59.984  44.731 26.429  1.00 47.81  ? 198  THR A CB  1 
ATOM   1536 O OG1 . THR A 1 197 ? 60.116  46.092 25.997  1.00 50.86  ? 198  THR A OG1 1 
ATOM   1537 C CG2 . THR A 1 197 ? 59.775  43.833 25.219  1.00 41.09  ? 198  THR A CG2 1 
ATOM   1538 N N   . LEU A 1 198 ? 57.347  42.666 27.478  1.00 42.77  ? 199  LEU A N   1 
ATOM   1539 C CA  . LEU A 1 198 ? 57.038  41.254 27.647  1.00 42.40  ? 199  LEU A CA  1 
ATOM   1540 C C   . LEU A 1 198 ? 57.585  40.456 26.473  1.00 46.05  ? 199  LEU A C   1 
ATOM   1541 O O   . LEU A 1 198 ? 57.528  40.900 25.324  1.00 48.12  ? 199  LEU A O   1 
ATOM   1542 C CB  . LEU A 1 198 ? 55.529  41.035 27.743  1.00 44.81  ? 199  LEU A CB  1 
ATOM   1543 C CG  . LEU A 1 198 ? 54.734  41.755 28.825  1.00 49.68  ? 199  LEU A CG  1 
ATOM   1544 C CD1 . LEU A 1 198 ? 53.315  41.205 28.856  1.00 47.03  ? 199  LEU A CD1 1 
ATOM   1545 C CD2 . LEU A 1 198 ? 55.413  41.593 30.169  1.00 44.17  ? 199  LEU A CD2 1 
ATOM   1546 N N   . PHE A 1 199 ? 58.114  39.270 26.760  1.00 43.64  ? 200  PHE A N   1 
ATOM   1547 C CA  . PHE A 1 199 ? 58.519  38.359 25.700  1.00 41.72  ? 200  PHE A CA  1 
ATOM   1548 C C   . PHE A 1 199 ? 58.236  36.929 26.132  1.00 40.86  ? 200  PHE A C   1 
ATOM   1549 O O   . PHE A 1 199 ? 58.360  36.589 27.311  1.00 42.24  ? 200  PHE A O   1 
ATOM   1550 C CB  . PHE A 1 199 ? 59.998  38.580 25.282  1.00 43.39  ? 200  PHE A CB  1 
ATOM   1551 C CG  . PHE A 1 199 ? 61.045  38.110 26.278  1.00 61.06  ? 200  PHE A CG  1 
ATOM   1552 C CD1 . PHE A 1 199 ? 62.091  37.312 25.846  1.00 65.18  ? 200  PHE A CD1 1 
ATOM   1553 C CD2 . PHE A 1 199 ? 61.038  38.526 27.603  1.00 63.23  ? 200  PHE A CD2 1 
ATOM   1554 C CE1 . PHE A 1 199 ? 63.082  36.891 26.718  1.00 73.83  ? 200  PHE A CE1 1 
ATOM   1555 C CE2 . PHE A 1 199 ? 62.030  38.113 28.479  1.00 73.25  ? 200  PHE A CE2 1 
ATOM   1556 C CZ  . PHE A 1 199 ? 63.048  37.289 28.039  1.00 71.05  ? 200  PHE A CZ  1 
ATOM   1557 N N   . GLY A 1 200 ? 57.801  36.114 25.177  1.00 39.56  ? 201  GLY A N   1 
ATOM   1558 C CA  . GLY A 1 200 ? 57.391  34.753 25.464  1.00 37.06  ? 201  GLY A CA  1 
ATOM   1559 C C   . GLY A 1 200 ? 57.338  33.930 24.199  1.00 44.22  ? 201  GLY A C   1 
ATOM   1560 O O   . GLY A 1 200 ? 57.345  34.463 23.083  1.00 42.27  ? 201  GLY A O   1 
ATOM   1561 N N   . GLU A 1 201 ? 57.279  32.614 24.383  1.00 39.40  ? 202  GLU A N   1 
ATOM   1562 C CA  . GLU A 1 201 ? 57.333  31.679 23.270  1.00 40.40  ? 202  GLU A CA  1 
ATOM   1563 C C   . GLU A 1 201 ? 56.217  30.651 23.408  1.00 46.67  ? 202  GLU A C   1 
ATOM   1564 O O   . GLU A 1 201 ? 55.923  30.186 24.513  1.00 39.81  ? 202  GLU A O   1 
ATOM   1565 C CB  . GLU A 1 201 ? 58.711  30.999 23.206  1.00 40.65  ? 202  GLU A CB  1 
ATOM   1566 C CG  . GLU A 1 201 ? 58.973  30.177 21.959  1.00 42.35  ? 202  GLU A CG  1 
ATOM   1567 C CD  . GLU A 1 201 ? 58.624  28.715 22.147  1.00 52.12  ? 202  GLU A CD  1 
ATOM   1568 O OE1 . GLU A 1 201 ? 58.690  27.952 21.159  1.00 50.77  ? 202  GLU A OE1 1 
ATOM   1569 O OE2 . GLU A 1 201 ? 58.286  28.332 23.289  1.00 47.09  ? 202  GLU A OE2 1 
ATOM   1570 N N   . SER A 1 202 ? 55.590  30.319 22.275  1.00 44.26  ? 203  SER A N   1 
ATOM   1571 C CA  . SER A 1 202 ? 54.500  29.338 22.185  1.00 39.34  ? 203  SER A CA  1 
ATOM   1572 C C   . SER A 1 202 ? 53.381  29.767 23.130  1.00 39.98  ? 203  SER A C   1 
ATOM   1573 O O   . SER A 1 202 ? 52.854  30.881 22.962  1.00 37.86  ? 203  SER A O   1 
ATOM   1574 C CB  . SER A 1 202 ? 55.077  27.940 22.417  1.00 37.82  ? 203  SER A CB  1 
ATOM   1575 O OG  . SER A 1 202 ? 54.136  26.934 22.079  1.00 47.49  ? 203  SER A OG  1 
ATOM   1576 N N   . ALA A 1 203 ? 52.981  28.949 24.109  1.00 35.92  ? 204  ALA A N   1 
ATOM   1577 C CA  . ALA A 1 203 ? 51.936  29.367 25.041  1.00 41.44  ? 204  ALA A CA  1 
ATOM   1578 C C   . ALA A 1 203 ? 52.315  30.650 25.772  1.00 36.75  ? 204  ALA A C   1 
ATOM   1579 O O   . ALA A 1 203 ? 51.435  31.438 26.139  1.00 34.80  ? 204  ALA A O   1 
ATOM   1580 C CB  . ALA A 1 203 ? 51.641  28.252 26.045  1.00 43.36  ? 204  ALA A CB  1 
ATOM   1581 N N   . GLY A 1 204 ? 53.612  30.883 25.980  1.00 36.15  ? 205  GLY A N   1 
ATOM   1582 C CA  . GLY A 1 204 ? 54.040  32.159 26.530  1.00 33.32  ? 205  GLY A CA  1 
ATOM   1583 C C   . GLY A 1 204 ? 53.757  33.318 25.593  1.00 42.73  ? 205  GLY A C   1 
ATOM   1584 O O   . GLY A 1 204 ? 53.342  34.396 26.028  1.00 42.01  ? 205  GLY A O   1 
ATOM   1585 N N   . ALA A 1 205 ? 53.976  33.114 24.289  1.00 33.73  ? 206  ALA A N   1 
ATOM   1586 C CA  . ALA A 1 205 ? 53.640  34.151 23.320  1.00 38.39  ? 206  ALA A CA  1 
ATOM   1587 C C   . ALA A 1 205 ? 52.135  34.379 23.266  1.00 40.41  ? 206  ALA A C   1 
ATOM   1588 O O   . ALA A 1 205 ? 51.675  35.525 23.189  1.00 40.65  ? 206  ALA A O   1 
ATOM   1589 C CB  . ALA A 1 205 ? 54.180  33.779 21.937  1.00 40.70  ? 206  ALA A CB  1 
ATOM   1590 N N   . ALA A 1 206 ? 51.352  33.298 23.311  1.00 35.47  ? 207  ALA A N   1 
ATOM   1591 C CA  . ALA A 1 206 ? 49.904  33.444 23.404  1.00 37.02  ? 207  ALA A CA  1 
ATOM   1592 C C   . ALA A 1 206 ? 49.510  34.180 24.679  1.00 42.30  ? 207  ALA A C   1 
ATOM   1593 O O   . ALA A 1 206 ? 48.582  34.998 24.671  1.00 43.61  ? 207  ALA A O   1 
ATOM   1594 C CB  . ALA A 1 206 ? 49.232  32.073 23.342  1.00 36.13  ? 207  ALA A CB  1 
ATOM   1595 N N   . SER A 1 207 ? 50.211  33.910 25.786  1.00 33.74  ? 208  SER A N   1 
ATOM   1596 C CA  . SER A 1 207 ? 49.948  34.644 27.021  1.00 35.49  ? 208  SER A CA  1 
ATOM   1597 C C   . SER A 1 207 ? 50.237  36.129 26.841  1.00 39.68  ? 208  SER A C   1 
ATOM   1598 O O   . SER A 1 207 ? 49.434  36.983 27.237  1.00 41.49  ? 208  SER A O   1 
ATOM   1599 C CB  . SER A 1 207 ? 50.780  34.068 28.168  1.00 30.95  ? 208  SER A CB  1 
ATOM   1600 O OG  . SER A 1 207 ? 50.400  32.732 28.449  1.00 37.61  ? 208  SER A OG  1 
ATOM   1601 N N   . VAL A 1 208 ? 51.386  36.454 26.240  1.00 37.00  ? 209  VAL A N   1 
ATOM   1602 C CA  . VAL A 1 208 ? 51.729  37.852 25.982  1.00 39.50  ? 209  VAL A CA  1 
ATOM   1603 C C   . VAL A 1 208 ? 50.610  38.539 25.209  1.00 44.78  ? 209  VAL A C   1 
ATOM   1604 O O   . VAL A 1 208 ? 50.175  39.644 25.557  1.00 47.62  ? 209  VAL A O   1 
ATOM   1605 C CB  . VAL A 1 208 ? 53.068  37.948 25.229  1.00 38.45  ? 209  VAL A CB  1 
ATOM   1606 C CG1 . VAL A 1 208 ? 53.302  39.372 24.754  1.00 42.09  ? 209  VAL A CG1 1 
ATOM   1607 C CG2 . VAL A 1 208 ? 54.213  37.483 26.112  1.00 40.00  ? 209  VAL A CG2 1 
ATOM   1608 N N   . GLY A 1 209 ? 50.119  37.885 24.153  1.00 45.15  ? 210  GLY A N   1 
ATOM   1609 C CA  . GLY A 1 209 ? 49.064  38.480 23.348  1.00 44.32  ? 210  GLY A CA  1 
ATOM   1610 C C   . GLY A 1 209 ? 47.774  38.700 24.112  1.00 43.52  ? 210  GLY A C   1 
ATOM   1611 O O   . GLY A 1 209 ? 47.057  39.673 23.862  1.00 49.66  ? 210  GLY A O   1 
ATOM   1612 N N   . MET A 1 210 ? 47.457  37.809 25.053  1.00 44.62  ? 211  MET A N   1 
ATOM   1613 C CA  . MET A 1 210 ? 46.244  37.993 25.842  1.00 50.50  ? 211  MET A CA  1 
ATOM   1614 C C   . MET A 1 210 ? 46.373  39.165 26.805  1.00 47.71  ? 211  MET A C   1 
ATOM   1615 O O   . MET A 1 210 ? 45.382  39.858 27.064  1.00 51.12  ? 211  MET A O   1 
ATOM   1616 C CB  . MET A 1 210 ? 45.904  36.708 26.591  1.00 47.54  ? 211  MET A CB  1 
ATOM   1617 C CG  . MET A 1 210 ? 45.507  35.579 25.662  1.00 45.52  ? 211  MET A CG  1 
ATOM   1618 S SD  . MET A 1 210 ? 45.265  34.014 26.511  1.00 53.98  ? 211  MET A SD  1 
ATOM   1619 C CE  . MET A 1 210 ? 45.280  32.888 25.118  1.00 48.51  ? 211  MET A CE  1 
ATOM   1620 N N   . HIS A 1 211 ? 47.575  39.410 27.337  1.00 43.97  ? 212  HIS A N   1 
ATOM   1621 C CA  . HIS A 1 211 ? 47.778  40.603 28.152  1.00 46.06  ? 212  HIS A CA  1 
ATOM   1622 C C   . HIS A 1 211 ? 47.634  41.874 27.324  1.00 53.98  ? 212  HIS A C   1 
ATOM   1623 O O   . HIS A 1 211 ? 47.166  42.896 27.838  1.00 55.78  ? 212  HIS A O   1 
ATOM   1624 C CB  . HIS A 1 211 ? 49.147  40.560 28.831  1.00 45.09  ? 212  HIS A CB  1 
ATOM   1625 C CG  . HIS A 1 211 ? 49.262  39.506 29.887  1.00 44.36  ? 212  HIS A CG  1 
ATOM   1626 N ND1 . HIS A 1 211 ? 48.541  39.547 31.061  1.00 44.69  ? 212  HIS A ND1 1 
ATOM   1627 C CD2 . HIS A 1 211 ? 50.007  38.377 29.943  1.00 38.28  ? 212  HIS A CD2 1 
ATOM   1628 C CE1 . HIS A 1 211 ? 48.839  38.490 31.795  1.00 45.34  ? 212  HIS A CE1 1 
ATOM   1629 N NE2 . HIS A 1 211 ? 49.726  37.764 31.139  1.00 41.75  ? 212  HIS A NE2 1 
ATOM   1630 N N   . LEU A 1 212 ? 48.027  41.831 26.047  1.00 52.24  ? 213  LEU A N   1 
ATOM   1631 C CA  . LEU A 1 212 ? 47.794  42.966 25.160  1.00 54.99  ? 213  LEU A CA  1 
ATOM   1632 C C   . LEU A 1 212 ? 46.307  43.245 25.003  1.00 50.78  ? 213  LEU A C   1 
ATOM   1633 O O   . LEU A 1 212 ? 45.893  44.402 24.863  1.00 54.16  ? 213  LEU A O   1 
ATOM   1634 C CB  . LEU A 1 212 ? 48.420  42.705 23.790  1.00 60.96  ? 213  LEU A CB  1 
ATOM   1635 C CG  . LEU A 1 212 ? 49.911  42.978 23.598  1.00 66.56  ? 213  LEU A CG  1 
ATOM   1636 C CD1 . LEU A 1 212 ? 50.368  42.447 22.247  1.00 58.85  ? 213  LEU A CD1 1 
ATOM   1637 C CD2 . LEU A 1 212 ? 50.186  44.467 23.704  1.00 70.01  ? 213  LEU A CD2 1 
ATOM   1638 N N   . LEU A 1 213 ? 45.489  42.196 25.018  1.00 47.05  ? 214  LEU A N   1 
ATOM   1639 C CA  . LEU A 1 213 ? 44.064  42.306 24.747  1.00 47.73  ? 214  LEU A CA  1 
ATOM   1640 C C   . LEU A 1 213 ? 43.222  42.403 26.012  1.00 52.21  ? 214  LEU A C   1 
ATOM   1641 O O   . LEU A 1 213 ? 41.998  42.536 25.916  1.00 55.44  ? 214  LEU A O   1 
ATOM   1642 C CB  . LEU A 1 213 ? 43.607  41.113 23.900  1.00 44.70  ? 214  LEU A CB  1 
ATOM   1643 C CG  . LEU A 1 213 ? 44.354  40.964 22.571  1.00 49.38  ? 214  LEU A CG  1 
ATOM   1644 C CD1 . LEU A 1 213 ? 44.042  39.632 21.900  1.00 42.76  ? 214  LEU A CD1 1 
ATOM   1645 C CD2 . LEU A 1 213 ? 44.024  42.124 21.640  1.00 49.09  ? 214  LEU A CD2 1 
ATOM   1646 N N   . SER A 1 214 ? 43.841  42.343 27.187  1.00 48.72  ? 215  SER A N   1 
ATOM   1647 C CA  . SER A 1 214 ? 43.122  42.484 28.447  1.00 49.00  ? 215  SER A CA  1 
ATOM   1648 C C   . SER A 1 214 ? 43.489  43.817 29.082  1.00 52.43  ? 215  SER A C   1 
ATOM   1649 O O   . SER A 1 214 ? 44.642  43.996 29.506  1.00 54.59  ? 215  SER A O   1 
ATOM   1650 C CB  . SER A 1 214 ? 43.453  41.330 29.393  1.00 53.92  ? 215  SER A CB  1 
ATOM   1651 O OG  . SER A 1 214 ? 42.608  41.354 30.528  1.00 55.83  ? 215  SER A OG  1 
ATOM   1652 N N   . PRO A 1 215 ? 42.559  44.765 29.170  1.00 53.98  ? 216  PRO A N   1 
ATOM   1653 C CA  . PRO A 1 215 ? 42.898  46.125 29.622  1.00 60.15  ? 216  PRO A CA  1 
ATOM   1654 C C   . PRO A 1 215 ? 43.585  46.156 30.981  1.00 64.85  ? 216  PRO A C   1 
ATOM   1655 O O   . PRO A 1 215 ? 44.513  46.958 31.168  1.00 67.64  ? 216  PRO A O   1 
ATOM   1656 C CB  . PRO A 1 215 ? 41.533  46.828 29.659  1.00 63.64  ? 216  PRO A CB  1 
ATOM   1657 C CG  . PRO A 1 215 ? 40.747  46.130 28.593  1.00 56.69  ? 216  PRO A CG  1 
ATOM   1658 C CD  . PRO A 1 215 ? 41.183  44.684 28.647  1.00 59.39  ? 216  PRO A CD  1 
ATOM   1659 N N   . PRO A 1 216 ? 43.180  45.332 31.963  1.00 60.22  ? 217  PRO A N   1 
ATOM   1660 C CA  . PRO A 1 216 ? 43.907  45.369 33.248  1.00 62.50  ? 217  PRO A CA  1 
ATOM   1661 C C   . PRO A 1 216 ? 45.379  45.013 33.131  1.00 59.92  ? 217  PRO A C   1 
ATOM   1662 O O   . PRO A 1 216 ? 46.180  45.460 33.962  1.00 60.05  ? 217  PRO A O   1 
ATOM   1663 C CB  . PRO A 1 216 ? 43.146  44.353 34.112  1.00 55.52  ? 217  PRO A CB  1 
ATOM   1664 C CG  . PRO A 1 216 ? 41.779  44.371 33.568  1.00 58.77  ? 217  PRO A CG  1 
ATOM   1665 C CD  . PRO A 1 216 ? 41.961  44.507 32.082  1.00 57.11  ? 217  PRO A CD  1 
ATOM   1666 N N   . SER A 1 217 ? 45.767  44.229 32.127  1.00 55.97  ? 218  SER A N   1 
ATOM   1667 C CA  . SER A 1 217 ? 47.174  43.900 31.929  1.00 55.34  ? 218  SER A CA  1 
ATOM   1668 C C   . SER A 1 217 ? 47.895  44.913 31.052  1.00 60.61  ? 218  SER A C   1 
ATOM   1669 O O   . SER A 1 217 ? 49.093  45.146 31.247  1.00 58.89  ? 218  SER A O   1 
ATOM   1670 C CB  . SER A 1 217 ? 47.314  42.513 31.297  1.00 50.67  ? 218  SER A CB  1 
ATOM   1671 O OG  . SER A 1 217 ? 46.760  41.504 32.121  1.00 55.25  ? 218  SER A OG  1 
ATOM   1672 N N   . ARG A 1 218 ? 47.182  45.517 30.097  1.00 67.53  ? 219  ARG A N   1 
ATOM   1673 C CA  . ARG A 1 218 ? 47.808  46.386 29.104  1.00 65.59  ? 219  ARG A CA  1 
ATOM   1674 C C   . ARG A 1 218 ? 48.568  47.542 29.746  1.00 60.85  ? 219  ARG A C   1 
ATOM   1675 O O   . ARG A 1 218 ? 49.606  47.966 29.225  1.00 65.15  ? 219  ARG A O   1 
ATOM   1676 C CB  . ARG A 1 218 ? 46.738  46.910 28.143  1.00 70.07  ? 219  ARG A CB  1 
ATOM   1677 C CG  . ARG A 1 218 ? 47.229  47.918 27.127  1.00 71.83  ? 219  ARG A CG  1 
ATOM   1678 C CD  . ARG A 1 218 ? 48.000  47.254 26.002  1.00 70.76  ? 219  ARG A CD  1 
ATOM   1679 N NE  . ARG A 1 218 ? 48.590  48.257 25.126  1.00 76.42  ? 219  ARG A NE  1 
ATOM   1680 C CZ  . ARG A 1 218 ? 49.825  48.721 25.264  1.00 77.45  ? 219  ARG A CZ  1 
ATOM   1681 N NH1 . ARG A 1 218 ? 50.597  48.261 26.237  1.00 74.46  ? 219  ARG A NH1 1 
ATOM   1682 N NH2 . ARG A 1 218 ? 50.288  49.641 24.432  1.00 76.61  ? 219  ARG A NH2 1 
ATOM   1683 N N   . GLY A 1 219 ? 48.086  48.053 30.876  1.00 60.43  ? 220  GLY A N   1 
ATOM   1684 C CA  . GLY A 1 219 ? 48.777  49.133 31.556  1.00 58.14  ? 220  GLY A CA  1 
ATOM   1685 C C   . GLY A 1 219 ? 50.042  48.735 32.285  1.00 58.82  ? 220  GLY A C   1 
ATOM   1686 O O   . GLY A 1 219 ? 50.693  49.600 32.878  1.00 61.54  ? 220  GLY A O   1 
ATOM   1687 N N   . LEU A 1 220 ? 50.418  47.459 32.252  1.00 54.52  ? 221  LEU A N   1 
ATOM   1688 C CA  . LEU A 1 220 ? 51.563  46.963 33.003  1.00 54.40  ? 221  LEU A CA  1 
ATOM   1689 C C   . LEU A 1 220 ? 52.811  46.781 32.148  1.00 60.69  ? 221  LEU A C   1 
ATOM   1690 O O   . LEU A 1 220 ? 53.849  46.373 32.678  1.00 54.57  ? 221  LEU A O   1 
ATOM   1691 C CB  . LEU A 1 220 ? 51.203  45.637 33.679  1.00 52.43  ? 221  LEU A CB  1 
ATOM   1692 C CG  . LEU A 1 220 ? 49.958  45.699 34.565  1.00 53.71  ? 221  LEU A CG  1 
ATOM   1693 C CD1 . LEU A 1 220 ? 49.581  44.319 35.083  1.00 52.95  ? 221  LEU A CD1 1 
ATOM   1694 C CD2 . LEU A 1 220 ? 50.179  46.670 35.718  1.00 53.34  ? 221  LEU A CD2 1 
ATOM   1695 N N   . PHE A 1 221 ? 52.740  47.068 30.849  1.00 51.50  ? 222  PHE A N   1 
ATOM   1696 C CA  . PHE A 1 221 ? 53.894  46.919 29.972  1.00 47.13  ? 222  PHE A CA  1 
ATOM   1697 C C   . PHE A 1 221 ? 53.705  47.828 28.765  1.00 54.35  ? 222  PHE A C   1 
ATOM   1698 O O   . PHE A 1 221 ? 52.646  48.431 28.576  1.00 57.64  ? 222  PHE A O   1 
ATOM   1699 C CB  . PHE A 1 221 ? 54.095  45.458 29.554  1.00 46.15  ? 222  PHE A CB  1 
ATOM   1700 C CG  . PHE A 1 221 ? 52.953  44.883 28.766  1.00 49.24  ? 222  PHE A CG  1 
ATOM   1701 C CD1 . PHE A 1 221 ? 51.775  44.511 29.393  1.00 47.96  ? 222  PHE A CD1 1 
ATOM   1702 C CD2 . PHE A 1 221 ? 53.064  44.698 27.397  1.00 52.37  ? 222  PHE A CD2 1 
ATOM   1703 C CE1 . PHE A 1 221 ? 50.726  43.978 28.670  1.00 51.22  ? 222  PHE A CE1 1 
ATOM   1704 C CE2 . PHE A 1 221 ? 52.020  44.164 26.668  1.00 49.40  ? 222  PHE A CE2 1 
ATOM   1705 C CZ  . PHE A 1 221 ? 50.849  43.803 27.304  1.00 49.74  ? 222  PHE A CZ  1 
ATOM   1706 N N   . HIS A 1 222 ? 54.750  47.919 27.943  1.00 51.76  ? 223  HIS A N   1 
ATOM   1707 C CA  . HIS A 1 222 ? 54.759  48.914 26.879  1.00 56.30  ? 223  HIS A CA  1 
ATOM   1708 C C   . HIS A 1 222 ? 55.035  48.308 25.508  1.00 55.76  ? 223  HIS A C   1 
ATOM   1709 O O   . HIS A 1 222 ? 54.620  48.870 24.490  1.00 57.94  ? 223  HIS A O   1 
ATOM   1710 C CB  . HIS A 1 222 ? 55.786  50.001 27.198  1.00 54.23  ? 223  HIS A CB  1 
ATOM   1711 C CG  . HIS A 1 222 ? 55.663  50.548 28.586  1.00 66.79  ? 223  HIS A CG  1 
ATOM   1712 N ND1 . HIS A 1 222 ? 56.109  49.864 29.696  1.00 63.51  ? 223  HIS A ND1 1 
ATOM   1713 C CD2 . HIS A 1 222 ? 55.126  51.702 29.046  1.00 68.19  ? 223  HIS A CD2 1 
ATOM   1714 C CE1 . HIS A 1 222 ? 55.859  50.576 30.779  1.00 62.25  ? 223  HIS A CE1 1 
ATOM   1715 N NE2 . HIS A 1 222 ? 55.266  51.698 30.412  1.00 68.34  ? 223  HIS A NE2 1 
ATOM   1716 N N   . ARG A 1 223 ? 55.744  47.179 25.462  1.00 52.84  ? 224  ARG A N   1 
ATOM   1717 C CA  . ARG A 1 223 ? 56.015  46.486 24.208  1.00 52.15  ? 224  ARG A CA  1 
ATOM   1718 C C   . ARG A 1 223 ? 55.854  44.989 24.416  1.00 49.20  ? 224  ARG A C   1 
ATOM   1719 O O   . ARG A 1 223 ? 55.815  44.495 25.547  1.00 48.71  ? 224  ARG A O   1 
ATOM   1720 C CB  . ARG A 1 223 ? 57.421  46.777 23.672  1.00 55.26  ? 224  ARG A CB  1 
ATOM   1721 C CG  . ARG A 1 223 ? 57.980  48.119 24.064  1.00 57.03  ? 224  ARG A CG  1 
ATOM   1722 C CD  . ARG A 1 223 ? 59.168  48.481 23.212  1.00 56.39  ? 224  ARG A CD  1 
ATOM   1723 N NE  . ARG A 1 223 ? 60.094  49.345 23.933  1.00 71.53  ? 224  ARG A NE  1 
ATOM   1724 C CZ  . ARG A 1 223 ? 59.883  50.635 24.167  1.00 85.72  ? 224  ARG A CZ  1 
ATOM   1725 N NH1 . ARG A 1 223 ? 58.772  51.218 23.739  1.00 89.15  ? 224  ARG A NH1 1 
ATOM   1726 N NH2 . ARG A 1 223 ? 60.785  51.341 24.834  1.00 93.17  ? 224  ARG A NH2 1 
ATOM   1727 N N   . ALA A 1 224 ? 55.789  44.260 23.303  1.00 43.59  ? 225  ALA A N   1 
ATOM   1728 C CA  . ALA A 1 224 ? 55.549  42.826 23.340  1.00 46.15  ? 225  ALA A CA  1 
ATOM   1729 C C   . ALA A 1 224 ? 56.390  42.121 22.286  1.00 48.98  ? 225  ALA A C   1 
ATOM   1730 O O   . ALA A 1 224 ? 56.614  42.653 21.195  1.00 47.09  ? 225  ALA A O   1 
ATOM   1731 C CB  . ALA A 1 224 ? 54.064  42.513 23.120  1.00 49.33  ? 225  ALA A CB  1 
ATOM   1732 N N   . VAL A 1 225 ? 56.851  40.918 22.625  1.00 44.22  ? 226  VAL A N   1 
ATOM   1733 C CA  . VAL A 1 225 ? 57.537  40.027 21.698  1.00 42.23  ? 226  VAL A CA  1 
ATOM   1734 C C   . VAL A 1 225 ? 56.820  38.686 21.732  1.00 43.52  ? 226  VAL A C   1 
ATOM   1735 O O   . VAL A 1 225 ? 56.649  38.101 22.807  1.00 42.07  ? 226  VAL A O   1 
ATOM   1736 C CB  . VAL A 1 225 ? 59.026  39.855 22.056  1.00 43.97  ? 226  VAL A CB  1 
ATOM   1737 C CG1 . VAL A 1 225 ? 59.717  38.950 21.045  1.00 41.48  ? 226  VAL A CG1 1 
ATOM   1738 C CG2 . VAL A 1 225 ? 59.722  41.209 22.141  1.00 40.44  ? 226  VAL A CG2 1 
ATOM   1739 N N   . LEU A 1 226 ? 56.393  38.202 20.566  1.00 41.79  ? 227  LEU A N   1 
ATOM   1740 C CA  . LEU A 1 226 ? 55.646  36.951 20.460  1.00 41.38  ? 227  LEU A CA  1 
ATOM   1741 C C   . LEU A 1 226 ? 56.417  35.989 19.565  1.00 42.37  ? 227  LEU A C   1 
ATOM   1742 O O   . LEU A 1 226 ? 56.432  36.149 18.340  1.00 46.25  ? 227  LEU A O   1 
ATOM   1743 C CB  . LEU A 1 226 ? 54.236  37.192 19.921  1.00 40.82  ? 227  LEU A CB  1 
ATOM   1744 C CG  . LEU A 1 226 ? 53.270  37.926 20.854  1.00 45.16  ? 227  LEU A CG  1 
ATOM   1745 C CD1 . LEU A 1 226 ? 53.423  39.433 20.734  1.00 45.58  ? 227  LEU A CD1 1 
ATOM   1746 C CD2 . LEU A 1 226 ? 51.835  37.507 20.580  1.00 47.94  ? 227  LEU A CD2 1 
ATOM   1747 N N   . GLN A 1 227 ? 57.043  34.986 20.176  1.00 37.53  ? 228  GLN A N   1 
ATOM   1748 C CA  . GLN A 1 227 ? 57.880  34.025 19.466  1.00 38.58  ? 228  GLN A CA  1 
ATOM   1749 C C   . GLN A 1 227 ? 57.093  32.734 19.263  1.00 37.89  ? 228  GLN A C   1 
ATOM   1750 O O   . GLN A 1 227 ? 56.772  32.038 20.230  1.00 40.67  ? 228  GLN A O   1 
ATOM   1751 C CB  . GLN A 1 227 ? 59.173  33.769 20.239  1.00 37.20  ? 228  GLN A CB  1 
ATOM   1752 C CG  . GLN A 1 227 ? 59.897  35.041 20.634  1.00 37.30  ? 228  GLN A CG  1 
ATOM   1753 C CD  . GLN A 1 227 ? 61.106  34.792 21.514  1.00 47.98  ? 228  GLN A CD  1 
ATOM   1754 O OE1 . GLN A 1 227 ? 61.636  35.723 22.117  1.00 46.25  ? 228  GLN A OE1 1 
ATOM   1755 N NE2 . GLN A 1 227 ? 61.553  33.540 21.592  1.00 41.62  ? 228  GLN A NE2 1 
ATOM   1756 N N   . SER A 1 228 ? 56.777  32.420 18.006  1.00 42.81  ? 229  SER A N   1 
ATOM   1757 C CA  . SER A 1 228 ? 56.153  31.144 17.646  1.00 35.54  ? 229  SER A CA  1 
ATOM   1758 C C   . SER A 1 228 ? 54.852  30.913 18.410  1.00 38.93  ? 229  SER A C   1 
ATOM   1759 O O   . SER A 1 228 ? 54.598  29.818 18.921  1.00 38.44  ? 229  SER A O   1 
ATOM   1760 C CB  . SER A 1 228 ? 57.114  29.976 17.876  1.00 37.62  ? 229  SER A CB  1 
ATOM   1761 O OG  . SER A 1 228 ? 58.332  30.165 17.179  1.00 45.61  ? 229  SER A OG  1 
ATOM   1762 N N   . GLY A 1 229 ? 54.020  31.940 18.500  1.00 36.92  ? 230  GLY A N   1 
ATOM   1763 C CA  . GLY A 1 229 ? 52.759  31.793 19.197  1.00 32.99  ? 230  GLY A CA  1 
ATOM   1764 C C   . GLY A 1 229 ? 51.953  33.067 19.092  1.00 35.33  ? 230  GLY A C   1 
ATOM   1765 O O   . GLY A 1 229 ? 52.493  34.154 18.855  1.00 38.41  ? 230  GLY A O   1 
ATOM   1766 N N   . ALA A 1 230 ? 50.645  32.910 19.272  1.00 34.08  ? 231  ALA A N   1 
ATOM   1767 C CA  . ALA A 1 230 ? 49.693  34.002 19.164  1.00 36.53  ? 231  ALA A CA  1 
ATOM   1768 C C   . ALA A 1 230 ? 48.472  33.657 19.999  1.00 41.89  ? 231  ALA A C   1 
ATOM   1769 O O   . ALA A 1 230 ? 48.156  32.473 20.169  1.00 41.38  ? 231  ALA A O   1 
ATOM   1770 C CB  . ALA A 1 230 ? 49.283  34.256 17.704  1.00 39.97  ? 231  ALA A CB  1 
ATOM   1771 N N   . PRO A 1 231 ? 47.768  34.659 20.537  1.00 44.51  ? 232  PRO A N   1 
ATOM   1772 C CA  . PRO A 1 231 ? 46.567  34.362 21.334  1.00 41.65  ? 232  PRO A CA  1 
ATOM   1773 C C   . PRO A 1 231 ? 45.408  33.829 20.511  1.00 50.32  ? 232  PRO A C   1 
ATOM   1774 O O   . PRO A 1 231 ? 44.500  33.215 21.088  1.00 45.79  ? 232  PRO A O   1 
ATOM   1775 C CB  . PRO A 1 231 ? 46.220  35.717 21.962  1.00 39.86  ? 232  PRO A CB  1 
ATOM   1776 C CG  . PRO A 1 231 ? 46.776  36.717 20.999  1.00 41.56  ? 232  PRO A CG  1 
ATOM   1777 C CD  . PRO A 1 231 ? 48.042  36.106 20.470  1.00 44.27  ? 232  PRO A CD  1 
ATOM   1778 N N   . ASN A 1 232 ? 45.406  34.041 19.192  1.00 43.97  ? 233  ASN A N   1 
ATOM   1779 C CA  . ASN A 1 232 ? 44.320  33.612 18.320  1.00 45.75  ? 233  ASN A CA  1 
ATOM   1780 C C   . ASN A 1 232 ? 44.534  32.227 17.716  1.00 48.53  ? 233  ASN A C   1 
ATOM   1781 O O   . ASN A 1 232 ? 43.722  31.797 16.890  1.00 44.66  ? 233  ASN A O   1 
ATOM   1782 C CB  . ASN A 1 232 ? 44.108  34.637 17.195  1.00 47.71  ? 233  ASN A CB  1 
ATOM   1783 C CG  . ASN A 1 232 ? 45.414  35.102 16.570  1.00 45.03  ? 233  ASN A CG  1 
ATOM   1784 O OD1 . ASN A 1 232 ? 46.348  35.489 17.273  1.00 47.19  ? 233  ASN A OD1 1 
ATOM   1785 N ND2 . ASN A 1 232 ? 45.485  35.066 15.242  1.00 39.13  ? 233  ASN A ND2 1 
ATOM   1786 N N   . GLY A 1 233 ? 45.591  31.517 18.099  1.00 49.74  ? 234  GLY A N   1 
ATOM   1787 C CA  . GLY A 1 233 ? 45.782  30.157 17.650  1.00 57.20  ? 234  GLY A CA  1 
ATOM   1788 C C   . GLY A 1 233 ? 44.659  29.237 18.095  1.00 62.38  ? 234  GLY A C   1 
ATOM   1789 O O   . GLY A 1 233 ? 44.101  29.387 19.187  1.00 59.83  ? 234  GLY A O   1 
ATOM   1790 N N   . PRO A 1 234 ? 44.319  28.248 17.260  1.00 49.99  ? 235  PRO A N   1 
ATOM   1791 C CA  . PRO A 1 234 ? 43.187  27.358 17.581  1.00 42.62  ? 235  PRO A CA  1 
ATOM   1792 C C   . PRO A 1 234 ? 43.398  26.504 18.826  1.00 44.92  ? 235  PRO A C   1 
ATOM   1793 O O   . PRO A 1 234 ? 42.460  25.818 19.251  1.00 44.81  ? 235  PRO A O   1 
ATOM   1794 C CB  . PRO A 1 234 ? 43.070  26.481 16.329  1.00 47.56  ? 235  PRO A CB  1 
ATOM   1795 C CG  . PRO A 1 234 ? 44.456  26.451 15.780  1.00 46.69  ? 235  PRO A CG  1 
ATOM   1796 C CD  . PRO A 1 234 ? 45.039  27.812 16.052  1.00 41.84  ? 235  PRO A CD  1 
ATOM   1797 N N   . TRP A 1 235 ? 44.592  26.517 19.411  1.00 40.03  ? 236  TRP A N   1 
ATOM   1798 C CA  . TRP A 1 235 ? 44.910  25.742 20.601  1.00 41.76  ? 236  TRP A CA  1 
ATOM   1799 C C   . TRP A 1 235 ? 44.955  26.588 21.864  1.00 42.04  ? 236  TRP A C   1 
ATOM   1800 O O   . TRP A 1 235 ? 44.975  26.030 22.967  1.00 44.31  ? 236  TRP A O   1 
ATOM   1801 C CB  . TRP A 1 235 ? 46.266  25.055 20.416  1.00 32.19  ? 236  TRP A CB  1 
ATOM   1802 C CG  . TRP A 1 235 ? 47.312  26.029 19.955  1.00 44.00  ? 236  TRP A CG  1 
ATOM   1803 C CD1 . TRP A 1 235 ? 47.634  26.338 18.662  1.00 45.36  ? 236  TRP A CD1 1 
ATOM   1804 C CD2 . TRP A 1 235 ? 48.147  26.849 20.783  1.00 39.05  ? 236  TRP A CD2 1 
ATOM   1805 N NE1 . TRP A 1 235 ? 48.627  27.288 18.636  1.00 41.35  ? 236  TRP A NE1 1 
ATOM   1806 C CE2 . TRP A 1 235 ? 48.959  27.619 19.924  1.00 39.80  ? 236  TRP A CE2 1 
ATOM   1807 C CE3 . TRP A 1 235 ? 48.295  26.999 22.168  1.00 42.43  ? 236  TRP A CE3 1 
ATOM   1808 C CZ2 . TRP A 1 235 ? 49.906  28.525 20.403  1.00 37.38  ? 236  TRP A CZ2 1 
ATOM   1809 C CZ3 . TRP A 1 235 ? 49.234  27.902 22.643  1.00 38.54  ? 236  TRP A CZ3 1 
ATOM   1810 C CH2 . TRP A 1 235 ? 50.028  28.654 21.761  1.00 41.80  ? 236  TRP A CH2 1 
ATOM   1811 N N   . ALA A 1 236 ? 44.965  27.914 21.726  1.00 45.55  ? 237  ALA A N   1 
ATOM   1812 C CA  . ALA A 1 236 ? 45.301  28.810 22.822  1.00 45.81  ? 237  ALA A CA  1 
ATOM   1813 C C   . ALA A 1 236 ? 44.120  29.150 23.719  1.00 46.90  ? 237  ALA A C   1 
ATOM   1814 O O   . ALA A 1 236 ? 44.332  29.528 24.877  1.00 47.10  ? 237  ALA A O   1 
ATOM   1815 C CB  . ALA A 1 236 ? 45.908  30.104 22.269  1.00 34.76  ? 237  ALA A CB  1 
ATOM   1816 N N   . THR A 1 237 ? 42.892  29.043 23.224  1.00 43.47  ? 238  THR A N   1 
ATOM   1817 C CA  . THR A 1 237 ? 41.712  29.330 24.024  1.00 43.36  ? 238  THR A CA  1 
ATOM   1818 C C   . THR A 1 237 ? 40.682  28.231 23.823  1.00 47.78  ? 238  THR A C   1 
ATOM   1819 O O   . THR A 1 237 ? 40.802  27.383 22.936  1.00 48.95  ? 238  THR A O   1 
ATOM   1820 C CB  . THR A 1 237 ? 41.084  30.688 23.672  1.00 42.89  ? 238  THR A CB  1 
ATOM   1821 O OG1 . THR A 1 237 ? 40.790  30.730 22.270  1.00 44.54  ? 238  THR A OG1 1 
ATOM   1822 C CG2 . THR A 1 237 ? 42.019  31.829 24.031  1.00 39.00  ? 238  THR A CG2 1 
ATOM   1823 N N   . VAL A 1 238 ? 39.648  28.268 24.659  1.00 46.21  ? 239  VAL A N   1 
ATOM   1824 C CA  . VAL A 1 238 ? 38.560  27.307 24.580  1.00 39.25  ? 239  VAL A CA  1 
ATOM   1825 C C   . VAL A 1 238 ? 37.289  28.003 25.045  1.00 44.98  ? 239  VAL A C   1 
ATOM   1826 O O   . VAL A 1 238 ? 37.334  28.949 25.837  1.00 51.71  ? 239  VAL A O   1 
ATOM   1827 C CB  . VAL A 1 238 ? 38.884  26.039 25.409  1.00 44.52  ? 239  VAL A CB  1 
ATOM   1828 C CG1 . VAL A 1 238 ? 38.592  26.258 26.885  1.00 42.16  ? 239  VAL A CG1 1 
ATOM   1829 C CG2 . VAL A 1 238 ? 38.147  24.840 24.866  1.00 53.71  ? 239  VAL A CG2 1 
ATOM   1830 N N   . GLY A 1 239 ? 36.152  27.558 24.512  1.00 50.72  ? 240  GLY A N   1 
ATOM   1831 C CA  . GLY A 1 239 ? 34.885  28.150 24.884  1.00 46.61  ? 240  GLY A CA  1 
ATOM   1832 C C   . GLY A 1 239 ? 34.455  27.763 26.287  1.00 49.13  ? 240  GLY A C   1 
ATOM   1833 O O   . GLY A 1 239 ? 34.953  26.807 26.881  1.00 47.60  ? 240  GLY A O   1 
ATOM   1834 N N   . MET A 1 240 ? 33.498  28.529 26.820  1.00 51.74  ? 241  MET A N   1 
ATOM   1835 C CA  . MET A 1 240 ? 33.040  28.307 28.190  1.00 58.04  ? 241  MET A CA  1 
ATOM   1836 C C   . MET A 1 240 ? 32.420  26.926 28.354  1.00 55.59  ? 241  MET A C   1 
ATOM   1837 O O   . MET A 1 240 ? 32.660  26.245 29.359  1.00 52.74  ? 241  MET A O   1 
ATOM   1838 C CB  . MET A 1 240 ? 32.036  29.389 28.595  1.00 60.68  ? 241  MET A CB  1 
ATOM   1839 C CG  . MET A 1 240 ? 32.663  30.687 29.074  1.00 65.75  ? 241  MET A CG  1 
ATOM   1840 S SD  . MET A 1 240 ? 31.442  31.996 29.319  1.00 72.83  ? 241  MET A SD  1 
ATOM   1841 C CE  . MET A 1 240 ? 30.255  31.174 30.378  1.00 74.95  ? 241  MET A CE  1 
ATOM   1842 N N   . GLY A 1 241 ? 31.613  26.498 27.383  1.00 52.18  ? 242  GLY A N   1 
ATOM   1843 C CA  . GLY A 1 241 ? 30.968  25.200 27.492  1.00 51.85  ? 242  GLY A CA  1 
ATOM   1844 C C   . GLY A 1 241 ? 31.950  24.050 27.387  1.00 56.52  ? 242  GLY A C   1 
ATOM   1845 O O   . GLY A 1 241 ? 31.865  23.079 28.144  1.00 57.49  ? 242  GLY A O   1 
ATOM   1846 N N   . GLU A 1 242 ? 32.897  24.142 26.451  1.00 49.32  ? 243  GLU A N   1 
ATOM   1847 C CA  . GLU A 1 242 ? 33.894  23.087 26.314  1.00 50.36  ? 243  GLU A CA  1 
ATOM   1848 C C   . GLU A 1 242 ? 34.824  23.052 27.520  1.00 52.00  ? 243  GLU A C   1 
ATOM   1849 O O   . GLU A 1 242 ? 35.251  21.975 27.949  1.00 56.42  ? 243  GLU A O   1 
ATOM   1850 C CB  . GLU A 1 242 ? 34.682  23.276 25.016  1.00 48.31  ? 243  GLU A CB  1 
ATOM   1851 C CG  . GLU A 1 242 ? 35.820  22.277 24.804  1.00 46.69  ? 243  GLU A CG  1 
ATOM   1852 C CD  . GLU A 1 242 ? 35.351  20.844 24.633  1.00 52.40  ? 243  GLU A CD  1 
ATOM   1853 O OE1 . GLU A 1 242 ? 34.147  20.626 24.381  1.00 61.09  ? 243  GLU A OE1 1 
ATOM   1854 O OE2 . GLU A 1 242 ? 36.196  19.932 24.752  1.00 49.63  ? 243  GLU A OE2 1 
ATOM   1855 N N   . ALA A 1 243 ? 35.142  24.219 28.088  1.00 50.94  ? 244  ALA A N   1 
ATOM   1856 C CA  . ALA A 1 243 ? 35.936  24.244 29.313  1.00 53.39  ? 244  ALA A CA  1 
ATOM   1857 C C   . ALA A 1 243 ? 35.192  23.568 30.457  1.00 49.02  ? 244  ALA A C   1 
ATOM   1858 O O   . ALA A 1 243 ? 35.782  22.809 31.234  1.00 51.89  ? 244  ALA A O   1 
ATOM   1859 C CB  . ALA A 1 243 ? 36.293  25.683 29.685  1.00 49.91  ? 244  ALA A CB  1 
ATOM   1860 N N   . ARG A 1 244 ? 33.892  23.827 30.569  1.00 49.43  ? 245  ARG A N   1 
ATOM   1861 C CA  . ARG A 1 244 ? 33.083  23.169 31.586  1.00 50.02  ? 245  ARG A CA  1 
ATOM   1862 C C   . ARG A 1 244 ? 33.024  21.663 31.368  1.00 53.06  ? 245  ARG A C   1 
ATOM   1863 O O   . ARG A 1 244 ? 33.104  20.886 32.327  1.00 63.88  ? 245  ARG A O   1 
ATOM   1864 C CB  . ARG A 1 244 ? 31.682  23.769 31.576  1.00 51.03  ? 245  ARG A CB  1 
ATOM   1865 C CG  . ARG A 1 244 ? 30.679  23.032 32.424  1.00 54.45  ? 245  ARG A CG  1 
ATOM   1866 C CD  . ARG A 1 244 ? 29.505  23.940 32.730  1.00 53.92  ? 245  ARG A CD  1 
ATOM   1867 N NE  . ARG A 1 244 ? 29.860  25.099 33.538  1.00 53.51  ? 245  ARG A NE  1 
ATOM   1868 C CZ  . ARG A 1 244 ? 29.767  25.125 34.862  1.00 67.32  ? 245  ARG A CZ  1 
ATOM   1869 N NH1 . ARG A 1 244 ? 29.342  24.063 35.544  1.00 52.31  ? 245  ARG A NH1 1 
ATOM   1870 N NH2 . ARG A 1 244 ? 30.095  26.223 35.533  1.00 56.64  ? 245  ARG A NH2 1 
ATOM   1871 N N   . ARG A 1 245 ? 32.864  21.234 30.115  1.00 55.63  ? 246  ARG A N   1 
ATOM   1872 C CA  . ARG A 1 245 ? 32.797  19.806 29.824  1.00 58.77  ? 246  ARG A CA  1 
ATOM   1873 C C   . ARG A 1 245 ? 34.077  19.098 30.243  1.00 54.69  ? 246  ARG A C   1 
ATOM   1874 O O   . ARG A 1 245 ? 34.032  18.015 30.836  1.00 53.06  ? 246  ARG A O   1 
ATOM   1875 C CB  . ARG A 1 245 ? 32.527  19.587 28.335  1.00 53.83  ? 246  ARG A CB  1 
ATOM   1876 C CG  . ARG A 1 245 ? 32.298  18.133 27.953  1.00 56.82  ? 246  ARG A CG  1 
ATOM   1877 C CD  . ARG A 1 245 ? 32.441  17.914 26.449  1.00 56.62  ? 246  ARG A CD  1 
ATOM   1878 N NE  . ARG A 1 245 ? 33.795  18.194 25.974  1.00 59.99  ? 246  ARG A NE  1 
ATOM   1879 C CZ  . ARG A 1 245 ? 34.829  17.370 26.126  1.00 61.82  ? 246  ARG A CZ  1 
ATOM   1880 N NH1 . ARG A 1 245 ? 34.674  16.210 26.750  1.00 63.11  ? 246  ARG A NH1 1 
ATOM   1881 N NH2 . ARG A 1 245 ? 36.023  17.708 25.658  1.00 58.43  ? 246  ARG A NH2 1 
ATOM   1882 N N   . ARG A 1 246 ? 35.229  19.698 29.950  1.00 48.83  ? 247  ARG A N   1 
ATOM   1883 C CA  . ARG A 1 246 ? 36.500  19.081 30.314  1.00 45.40  ? 247  ARG A CA  1 
ATOM   1884 C C   . ARG A 1 246 ? 36.685  19.035 31.822  1.00 52.46  ? 247  ARG A C   1 
ATOM   1885 O O   . ARG A 1 246 ? 37.103  18.010 32.374  1.00 53.50  ? 247  ARG A O   1 
ATOM   1886 C CB  . ARG A 1 246 ? 37.641  19.847 29.671  1.00 43.97  ? 247  ARG A CB  1 
ATOM   1887 C CG  . ARG A 1 246 ? 37.530  19.870 28.176  1.00 49.10  ? 247  ARG A CG  1 
ATOM   1888 C CD  . ARG A 1 246 ? 38.785  20.465 27.552  1.00 47.50  ? 247  ARG A CD  1 
ATOM   1889 N NE  . ARG A 1 246 ? 38.734  20.434 26.097  1.00 49.25  ? 247  ARG A NE  1 
ATOM   1890 C CZ  . ARG A 1 246 ? 39.552  21.104 25.296  1.00 49.13  ? 247  ARG A CZ  1 
ATOM   1891 N NH1 . ARG A 1 246 ? 40.542  21.877 25.764  1.00 41.05  ? 247  ARG A NH1 1 
ATOM   1892 N NH2 . ARG A 1 246 ? 39.401  21.006 23.976  1.00 46.34  ? 247  ARG A NH2 1 
ATOM   1893 N N   . ALA A 1 247 ? 36.416  20.151 32.502  1.00 50.87  ? 248  ALA A N   1 
ATOM   1894 C CA  . ALA A 1 247 ? 36.535  20.166 33.953  1.00 50.48  ? 248  ALA A CA  1 
ATOM   1895 C C   . ALA A 1 247 ? 35.628  19.117 34.578  1.00 52.34  ? 248  ALA A C   1 
ATOM   1896 O O   . ALA A 1 247 ? 36.033  18.405 35.502  1.00 50.49  ? 248  ALA A O   1 
ATOM   1897 C CB  . ALA A 1 247 ? 36.206  21.558 34.491  1.00 41.74  ? 248  ALA A CB  1 
ATOM   1898 N N   . THR A 1 248 ? 34.405  18.986 34.062  1.00 56.01  ? 249  THR A N   1 
ATOM   1899 C CA  . THR A 1 248 ? 33.467  18.022 34.624  1.00 58.94  ? 249  THR A CA  1 
ATOM   1900 C C   . THR A 1 248 ? 33.925  16.590 34.374  1.00 59.27  ? 249  THR A C   1 
ATOM   1901 O O   . THR A 1 248 ? 33.817  15.735 35.262  1.00 55.57  ? 249  THR A O   1 
ATOM   1902 C CB  . THR A 1 248 ? 32.071  18.254 34.048  1.00 62.63  ? 249  THR A CB  1 
ATOM   1903 O OG1 . THR A 1 248 ? 31.618  19.561 34.419  1.00 72.25  ? 249  THR A OG1 1 
ATOM   1904 C CG2 . THR A 1 248 ? 31.090  17.218 34.581  1.00 59.89  ? 249  THR A CG2 1 
ATOM   1905 N N   . GLN A 1 249 ? 34.452  16.306 33.178  1.00 56.32  ? 250  GLN A N   1 
ATOM   1906 C CA  . GLN A 1 249 ? 34.909  14.947 32.900  1.00 54.50  ? 250  GLN A CA  1 
ATOM   1907 C C   . GLN A 1 249 ? 36.144  14.598 33.721  1.00 51.66  ? 250  GLN A C   1 
ATOM   1908 O O   . GLN A 1 249 ? 36.270  13.467 34.203  1.00 55.68  ? 250  GLN A O   1 
ATOM   1909 C CB  . GLN A 1 249 ? 35.197  14.757 31.411  1.00 51.36  ? 250  GLN A CB  1 
ATOM   1910 C CG  . GLN A 1 249 ? 35.436  13.291 31.058  1.00 62.33  ? 250  GLN A CG  1 
ATOM   1911 C CD  . GLN A 1 249 ? 35.981  13.085 29.659  1.00 79.55  ? 250  GLN A CD  1 
ATOM   1912 O OE1 . GLN A 1 249 ? 36.064  14.021 28.863  1.00 83.26  ? 250  GLN A OE1 1 
ATOM   1913 N NE2 . GLN A 1 249 ? 36.359  11.848 29.352  1.00 83.56  ? 250  GLN A NE2 1 
ATOM   1914 N N   . LEU A 1 250 ? 37.071  15.549 33.882  1.00 48.26  ? 251  LEU A N   1 
ATOM   1915 C CA  . LEU A 1 250 ? 38.226  15.308 34.742  1.00 53.42  ? 251  LEU A CA  1 
ATOM   1916 C C   . LEU A 1 250 ? 37.780  14.955 36.153  1.00 60.38  ? 251  LEU A C   1 
ATOM   1917 O O   . LEU A 1 250 ? 38.257  13.981 36.745  1.00 65.17  ? 251  LEU A O   1 
ATOM   1918 C CB  . LEU A 1 250 ? 39.143  16.530 34.769  1.00 53.63  ? 251  LEU A CB  1 
ATOM   1919 C CG  . LEU A 1 250 ? 40.286  16.402 35.785  1.00 51.60  ? 251  LEU A CG  1 
ATOM   1920 C CD1 . LEU A 1 250 ? 41.242  15.300 35.374  1.00 54.88  ? 251  LEU A CD1 1 
ATOM   1921 C CD2 . LEU A 1 250 ? 41.044  17.695 35.948  1.00 45.25  ? 251  LEU A CD2 1 
ATOM   1922 N N   . ALA A 1 251 ? 36.852  15.740 36.704  1.00 59.03  ? 252  ALA A N   1 
ATOM   1923 C CA  . ALA A 1 251 ? 36.328  15.447 38.032  1.00 63.48  ? 252  ALA A CA  1 
ATOM   1924 C C   . ALA A 1 251 ? 35.659  14.082 38.068  1.00 64.46  ? 252  ALA A C   1 
ATOM   1925 O O   . ALA A 1 251 ? 35.806  13.333 39.041  1.00 60.25  ? 252  ALA A O   1 
ATOM   1926 C CB  . ALA A 1 251 ? 35.344  16.533 38.456  1.00 63.43  ? 252  ALA A CB  1 
ATOM   1927 N N   . HIS A 1 252 ? 34.920  13.742 37.012  1.00 63.64  ? 253  HIS A N   1 
ATOM   1928 C CA  . HIS A 1 252 ? 34.244  12.452 36.969  1.00 67.08  ? 253  HIS A CA  1 
ATOM   1929 C C   . HIS A 1 252 ? 35.243  11.302 36.975  1.00 70.02  ? 253  HIS A C   1 
ATOM   1930 O O   . HIS A 1 252 ? 35.006  10.266 37.608  1.00 77.23  ? 253  HIS A O   1 
ATOM   1931 C CB  . HIS A 1 252 ? 33.346  12.380 35.736  1.00 70.15  ? 253  HIS A CB  1 
ATOM   1932 C CG  . HIS A 1 252 ? 32.720  11.038 35.527  1.00 77.25  ? 253  HIS A CG  1 
ATOM   1933 N ND1 . HIS A 1 252 ? 31.507  10.690 36.080  1.00 85.89  ? 253  HIS A ND1 1 
ATOM   1934 C CD2 . HIS A 1 252 ? 33.142  9.957  34.830  1.00 79.99  ? 253  HIS A CD2 1 
ATOM   1935 C CE1 . HIS A 1 252 ? 31.207  9.452  35.731  1.00 90.04  ? 253  HIS A CE1 1 
ATOM   1936 N NE2 . HIS A 1 252 ? 32.182  8.984  34.972  1.00 88.53  ? 253  HIS A NE2 1 
ATOM   1937 N N   . LEU A 1 253 ? 36.373  11.469 36.284  1.00 70.19  ? 254  LEU A N   1 
ATOM   1938 C CA  . LEU A 1 253 ? 37.366  10.405 36.192  1.00 66.87  ? 254  LEU A CA  1 
ATOM   1939 C C   . LEU A 1 253 ? 38.156  10.207 37.480  1.00 66.88  ? 254  LEU A C   1 
ATOM   1940 O O   . LEU A 1 253 ? 38.782  9.154  37.643  1.00 65.96  ? 254  LEU A O   1 
ATOM   1941 C CB  . LEU A 1 253 ? 38.334  10.684 35.040  1.00 52.26  ? 254  LEU A CB  1 
ATOM   1942 C CG  . LEU A 1 253 ? 37.752  10.603 33.628  1.00 54.78  ? 254  LEU A CG  1 
ATOM   1943 C CD1 . LEU A 1 253 ? 38.718  11.207 32.630  1.00 46.80  ? 254  LEU A CD1 1 
ATOM   1944 C CD2 . LEU A 1 253 ? 37.426  9.167  33.256  1.00 57.52  ? 254  LEU A CD2 1 
ATOM   1945 N N   . VAL A 1 254 ? 38.149  11.182 38.389  1.00 64.94  ? 255  VAL A N   1 
ATOM   1946 C CA  . VAL A 1 254 ? 38.863  11.075 39.656  1.00 65.66  ? 255  VAL A CA  1 
ATOM   1947 C C   . VAL A 1 254 ? 37.910  10.962 40.839  1.00 67.54  ? 255  VAL A C   1 
ATOM   1948 O O   . VAL A 1 254 ? 38.330  11.140 41.987  1.00 76.17  ? 255  VAL A O   1 
ATOM   1949 C CB  . VAL A 1 254 ? 39.839  12.246 39.853  1.00 57.96  ? 255  VAL A CB  1 
ATOM   1950 C CG1 . VAL A 1 254 ? 40.871  12.265 38.738  1.00 52.69  ? 255  VAL A CG1 1 
ATOM   1951 C CG2 . VAL A 1 254 ? 39.082  13.563 39.913  1.00 58.82  ? 255  VAL A CG2 1 
ATOM   1952 N N   . GLY A 1 255 ? 36.636  10.680 40.591  1.00 65.66  ? 256  GLY A N   1 
ATOM   1953 C CA  . GLY A 1 255 ? 35.689  10.402 41.651  1.00 68.84  ? 256  GLY A CA  1 
ATOM   1954 C C   . GLY A 1 255 ? 34.839  11.562 42.123  1.00 74.86  ? 256  GLY A C   1 
ATOM   1955 O O   . GLY A 1 255 ? 34.236  11.459 43.197  1.00 87.33  ? 256  GLY A O   1 
ATOM   1956 N N   . CYS A 1 256 ? 34.764  12.650 41.366  1.00 74.09  ? 257  CYS A N   1 
ATOM   1957 C CA  . CYS A 1 256 ? 33.979  13.810 41.775  1.00 76.65  ? 257  CYS A CA  1 
ATOM   1958 C C   . CYS A 1 256 ? 32.854  14.097 40.783  1.00 90.52  ? 257  CYS A C   1 
ATOM   1959 O O   . CYS A 1 256 ? 33.095  14.192 39.583  1.00 96.19  ? 257  CYS A O   1 
ATOM   1960 C CB  . CYS A 1 256 ? 34.879  15.040 41.911  1.00 70.17  ? 257  CYS A CB  1 
ATOM   1961 S SG  . CYS A 1 256 ? 36.272  14.839 43.044  1.00 68.96  ? 257  CYS A SG  1 
ATOM   1962 N N   . PRO A 1 257 ? 31.634  14.275 41.244  1.00 100.03 ? 258  PRO A N   1 
ATOM   1963 C CA  . PRO A 1 257 ? 31.310  14.086 42.638  1.00 106.46 ? 258  PRO A CA  1 
ATOM   1964 C C   . PRO A 1 257 ? 31.045  12.590 42.774  1.00 115.47 ? 258  PRO A C   1 
ATOM   1965 O O   . PRO A 1 257 ? 30.953  11.877 41.769  1.00 116.58 ? 258  PRO A O   1 
ATOM   1966 C CB  . PRO A 1 257 ? 30.013  14.847 42.762  1.00 105.55 ? 258  PRO A CB  1 
ATOM   1967 C CG  . PRO A 1 257 ? 29.328  14.545 41.474  1.00 105.05 ? 258  PRO A CG  1 
ATOM   1968 C CD  . PRO A 1 257 ? 30.411  14.424 40.439  1.00 102.78 ? 258  PRO A CD  1 
ATOM   1969 N N   . PRO A 1 258 ? 30.933  12.107 44.068  1.00 120.95 ? 259  PRO A N   1 
ATOM   1970 C CA  . PRO A 1 258 ? 30.676  10.660 44.149  1.00 122.61 ? 259  PRO A CA  1 
ATOM   1971 C C   . PRO A 1 258 ? 29.252  10.330 43.739  1.00 121.68 ? 259  PRO A C   1 
ATOM   1972 O O   . PRO A 1 258 ? 29.051  9.430  42.929  1.00 119.89 ? 259  PRO A O   1 
ATOM   1973 C CB  . PRO A 1 258 ? 30.856  10.353 45.620  1.00 126.40 ? 259  PRO A CB  1 
ATOM   1974 C CG  . PRO A 1 258 ? 30.367  11.572 46.293  1.00 125.36 ? 259  PRO A CG  1 
ATOM   1975 C CD  . PRO A 1 258 ? 31.013  12.646 45.497  1.00 121.07 ? 259  PRO A CD  1 
ATOM   1976 N N   . GLY A 1 262 ? 27.842  16.458 37.770  1.00 128.86 ? 263  GLY A N   1 
ATOM   1977 C CA  . GLY A 1 262 ? 28.029  17.868 38.042  1.00 124.13 ? 263  GLY A CA  1 
ATOM   1978 C C   . GLY A 1 262 ? 27.326  18.337 39.299  1.00 129.03 ? 263  GLY A C   1 
ATOM   1979 O O   . GLY A 1 262 ? 27.749  18.017 40.414  1.00 130.03 ? 263  GLY A O   1 
ATOM   1980 N N   . GLY A 1 263 ? 26.248  19.097 39.124  1.00 130.04 ? 264  GLY A N   1 
ATOM   1981 C CA  . GLY A 1 263 ? 25.501  19.637 40.242  1.00 127.25 ? 264  GLY A CA  1 
ATOM   1982 C C   . GLY A 1 263 ? 26.054  20.950 40.758  1.00 117.89 ? 264  GLY A C   1 
ATOM   1983 O O   . GLY A 1 263 ? 26.389  21.847 39.981  1.00 120.80 ? 264  GLY A O   1 
ATOM   1984 N N   . ASN A 1 264 ? 26.140  21.064 42.079  1.00 101.88 ? 265  ASN A N   1 
ATOM   1985 C CA  . ASN A 1 264 ? 26.678  22.253 42.725  1.00 88.18  ? 265  ASN A CA  1 
ATOM   1986 C C   . ASN A 1 264 ? 28.163  22.387 42.408  1.00 75.72  ? 265  ASN A C   1 
ATOM   1987 O O   . ASN A 1 264 ? 28.942  21.456 42.636  1.00 73.13  ? 265  ASN A O   1 
ATOM   1988 C CB  . ASN A 1 264 ? 26.438  22.141 44.232  1.00 98.79  ? 265  ASN A CB  1 
ATOM   1989 C CG  . ASN A 1 264 ? 26.887  23.360 45.019  1.00 107.46 ? 265  ASN A CG  1 
ATOM   1990 O OD1 . ASN A 1 264 ? 27.808  24.078 44.642  1.00 97.41  ? 265  ASN A OD1 1 
ATOM   1991 N ND2 . ASN A 1 264 ? 26.218  23.582 46.146  1.00 131.63 ? 265  ASN A ND2 1 
ATOM   1992 N N   . ASP A 1 265 ? 28.558  23.555 41.889  1.00 64.26  ? 266  ASP A N   1 
ATOM   1993 C CA  . ASP A 1 265 ? 29.951  23.755 41.502  1.00 60.28  ? 266  ASP A CA  1 
ATOM   1994 C C   . ASP A 1 265 ? 30.894  23.692 42.704  1.00 64.42  ? 266  ASP A C   1 
ATOM   1995 O O   . ASP A 1 265 ? 32.035  23.244 42.558  1.00 62.47  ? 266  ASP A O   1 
ATOM   1996 C CB  . ASP A 1 265 ? 30.112  25.086 40.761  1.00 59.81  ? 266  ASP A CB  1 
ATOM   1997 C CG  . ASP A 1 265 ? 29.986  24.938 39.241  1.00 71.89  ? 266  ASP A CG  1 
ATOM   1998 O OD1 . ASP A 1 265 ? 30.107  23.803 38.735  1.00 72.21  ? 266  ASP A OD1 1 
ATOM   1999 O OD2 . ASP A 1 265 ? 29.766  25.959 38.552  1.00 67.04  ? 266  ASP A OD2 1 
ATOM   2000 N N   . THR A 1 266 ? 30.440  24.115 43.894  1.00 65.82  ? 267  THR A N   1 
ATOM   2001 C CA  . THR A 1 266 ? 31.314  24.104 45.068  1.00 66.67  ? 267  THR A CA  1 
ATOM   2002 C C   . THR A 1 266 ? 31.671  22.680 45.471  1.00 64.10  ? 267  THR A C   1 
ATOM   2003 O O   . THR A 1 266 ? 32.850  22.343 45.626  1.00 72.47  ? 267  THR A O   1 
ATOM   2004 C CB  . THR A 1 266 ? 30.656  24.813 46.259  1.00 78.58  ? 267  THR A CB  1 
ATOM   2005 O OG1 . THR A 1 266 ? 29.799  23.887 46.936  1.00 93.58  ? 267  THR A OG1 1 
ATOM   2006 C CG2 . THR A 1 266 ? 29.801  26.009 45.823  1.00 61.25  ? 267  THR A CG2 1 
ATOM   2007 N N   . GLU A 1 267 ? 30.654  21.833 45.654  1.00 60.46  ? 268  GLU A N   1 
ATOM   2008 C CA  . GLU A 1 267 ? 30.887  20.450 46.056  1.00 77.54  ? 268  GLU A CA  1 
ATOM   2009 C C   . GLU A 1 267 ? 31.787  19.725 45.062  1.00 75.87  ? 268  GLU A C   1 
ATOM   2010 O O   . GLU A 1 267 ? 32.612  18.890 45.454  1.00 74.27  ? 268  GLU A O   1 
ATOM   2011 C CB  . GLU A 1 267 ? 29.551  19.719 46.207  1.00 80.01  ? 268  GLU A CB  1 
ATOM   2012 C CG  . GLU A 1 267 ? 28.630  20.363 47.229  1.00 101.45 ? 268  GLU A CG  1 
ATOM   2013 C CD  . GLU A 1 267 ? 27.242  19.769 47.204  1.00 117.04 ? 268  GLU A CD  1 
ATOM   2014 O OE1 . GLU A 1 267 ? 27.127  18.540 47.055  1.00 121.21 ? 268  GLU A OE1 1 
ATOM   2015 O OE2 . GLU A 1 267 ? 26.268  20.528 47.333  1.00 121.22 ? 268  GLU A OE2 1 
ATOM   2016 N N   . LEU A 1 268 ? 31.674  20.072 43.788  1.00 68.17  ? 269  LEU A N   1 
ATOM   2017 C CA  . LEU A 1 268 ? 32.511  19.465 42.765  1.00 67.83  ? 269  LEU A CA  1 
ATOM   2018 C C   . LEU A 1 268 ? 33.985  19.810 42.870  1.00 65.21  ? 269  LEU A C   1 
ATOM   2019 O O   . LEU A 1 268 ? 34.832  18.957 42.883  1.00 71.05  ? 269  LEU A O   1 
ATOM   2020 C CB  . LEU A 1 268 ? 32.006  19.897 41.404  1.00 70.28  ? 269  LEU A CB  1 
ATOM   2021 C CG  . LEU A 1 268 ? 32.377  19.118 40.158  1.00 71.76  ? 269  LEU A CG  1 
ATOM   2022 C CD1 . LEU A 1 268 ? 33.749  19.519 39.724  1.00 72.52  ? 269  LEU A CD1 1 
ATOM   2023 C CD2 . LEU A 1 268 ? 32.315  17.638 40.401  1.00 74.99  ? 269  LEU A CD2 1 
ATOM   2024 N N   . VAL A 1 269 ? 34.283  21.071 43.002  1.00 52.56  ? 270  VAL A N   1 
ATOM   2025 C CA  . VAL A 1 269 ? 35.674  21.480 43.152  1.00 61.91  ? 270  VAL A CA  1 
ATOM   2026 C C   . VAL A 1 269 ? 36.185  21.179 44.553  1.00 60.59  ? 270  VAL A C   1 
ATOM   2027 O O   . VAL A 1 269 ? 37.375  20.896 44.737  1.00 62.13  ? 270  VAL A O   1 
ATOM   2028 C CB  . VAL A 1 269 ? 35.816  22.971 42.821  1.00 63.27  ? 270  VAL A CB  1 
ATOM   2029 C CG1 . VAL A 1 269 ? 35.538  23.214 41.360  1.00 60.08  ? 270  VAL A CG1 1 
ATOM   2030 C CG2 . VAL A 1 269 ? 34.839  23.728 43.646  1.00 74.20  ? 270  VAL A CG2 1 
ATOM   2031 N N   . ALA A 1 270 ? 35.314  21.261 45.563  1.00 58.51  ? 271  ALA A N   1 
ATOM   2032 C CA  . ALA A 1 270 ? 35.719  20.865 46.905  1.00 61.03  ? 271  ALA A CA  1 
ATOM   2033 C C   . ALA A 1 270 ? 36.186  19.418 46.914  1.00 63.20  ? 271  ALA A C   1 
ATOM   2034 O O   . ALA A 1 270 ? 37.179  19.082 47.566  1.00 69.31  ? 271  ALA A O   1 
ATOM   2035 C CB  . ALA A 1 270 ? 34.569  21.070 47.892  1.00 59.75  ? 271  ALA A CB  1 
ATOM   2036 N N   . CYS A 1 271 ? 35.491  18.552 46.177  1.00 62.53  ? 272  CYS A N   1 
ATOM   2037 C CA  . CYS A 1 271 ? 35.973  17.188 46.000  1.00 65.54  ? 272  CYS A CA  1 
ATOM   2038 C C   . CYS A 1 271 ? 37.281  17.169 45.217  1.00 65.56  ? 272  CYS A C   1 
ATOM   2039 O O   . CYS A 1 271 ? 38.193  16.399 45.541  1.00 65.40  ? 272  CYS A O   1 
ATOM   2040 C CB  . CYS A 1 271 ? 34.904  16.351 45.299  1.00 69.30  ? 272  CYS A CB  1 
ATOM   2041 S SG  . CYS A 1 271 ? 35.396  14.667 44.875  1.00 81.02  ? 272  CYS A SG  1 
ATOM   2042 N N   . LEU A 1 272 ? 37.394  18.016 44.188  1.00 58.06  ? 273  LEU A N   1 
ATOM   2043 C CA  . LEU A 1 272 ? 38.632  18.076 43.418  1.00 58.81  ? 273  LEU A CA  1 
ATOM   2044 C C   . LEU A 1 272 ? 39.804  18.548 44.264  1.00 59.34  ? 273  LEU A C   1 
ATOM   2045 O O   . LEU A 1 272 ? 40.940  18.115 44.041  1.00 59.76  ? 273  LEU A O   1 
ATOM   2046 C CB  . LEU A 1 272 ? 38.480  18.993 42.204  1.00 54.41  ? 273  LEU A CB  1 
ATOM   2047 C CG  . LEU A 1 272 ? 37.629  18.528 41.033  1.00 60.76  ? 273  LEU A CG  1 
ATOM   2048 C CD1 . LEU A 1 272 ? 37.514  19.660 40.027  1.00 52.40  ? 273  LEU A CD1 1 
ATOM   2049 C CD2 . LEU A 1 272 ? 38.253  17.282 40.419  1.00 63.07  ? 273  LEU A CD2 1 
ATOM   2050 N N   . ARG A 1 273 ? 39.556  19.444 45.222  1.00 56.71  ? 274  ARG A N   1 
ATOM   2051 C CA  . ARG A 1 273 ? 40.631  19.925 46.080  1.00 60.16  ? 274  ARG A CA  1 
ATOM   2052 C C   . ARG A 1 273 ? 41.199  18.826 46.966  1.00 58.97  ? 274  ARG A C   1 
ATOM   2053 O O   . ARG A 1 273 ? 42.348  18.936 47.406  1.00 61.38  ? 274  ARG A O   1 
ATOM   2054 C CB  . ARG A 1 273 ? 40.141  21.085 46.948  1.00 64.75  ? 274  ARG A CB  1 
ATOM   2055 C CG  . ARG A 1 273 ? 39.957  22.388 46.192  1.00 65.95  ? 274  ARG A CG  1 
ATOM   2056 C CD  . ARG A 1 273 ? 39.698  23.542 47.146  1.00 71.37  ? 274  ARG A CD  1 
ATOM   2057 N NE  . ARG A 1 273 ? 39.553  24.804 46.430  1.00 79.41  ? 274  ARG A NE  1 
ATOM   2058 C CZ  . ARG A 1 273 ? 38.391  25.406 46.200  1.00 80.27  ? 274  ARG A CZ  1 
ATOM   2059 N NH1 . ARG A 1 273 ? 37.261  24.867 46.640  1.00 77.48  ? 274  ARG A NH1 1 
ATOM   2060 N NH2 . ARG A 1 273 ? 38.362  26.553 45.534  1.00 69.93  ? 274  ARG A NH2 1 
ATOM   2061 N N   . THR A 1 274 ? 40.427  17.776 47.238  1.00 56.98  ? 275  THR A N   1 
ATOM   2062 C CA  . THR A 1 274 ? 40.909  16.662 48.045  1.00 61.62  ? 275  THR A CA  1 
ATOM   2063 C C   . THR A 1 274 ? 41.735  15.666 47.243  1.00 62.41  ? 275  THR A C   1 
ATOM   2064 O O   . THR A 1 274 ? 42.270  14.718 47.828  1.00 61.91  ? 275  THR A O   1 
ATOM   2065 C CB  . THR A 1 274 ? 39.736  15.926 48.696  1.00 59.61  ? 275  THR A CB  1 
ATOM   2066 O OG1 . THR A 1 274 ? 39.008  15.210 47.690  1.00 57.54  ? 275  THR A OG1 1 
ATOM   2067 C CG2 . THR A 1 274 ? 38.803  16.907 49.404  1.00 54.90  ? 275  THR A CG2 1 
ATOM   2068 N N   . ARG A 1 275 ? 41.846  15.846 45.950  1.00 53.57  ? 276  ARG A N   1 
ATOM   2069 C CA  . ARG A 1 275 ? 42.601  14.848 45.207  1.00 61.25  ? 276  ARG A CA  1 
ATOM   2070 C C   . ARG A 1 275 ? 44.080  15.217 45.176  1.00 61.68  ? 276  ARG A C   1 
ATOM   2071 O O   . ARG A 1 275 ? 44.422  16.397 45.046  1.00 60.22  ? 276  ARG A O   1 
ATOM   2072 C CB  . ARG A 1 275 ? 42.078  14.728 43.779  1.00 61.56  ? 276  ARG A CB  1 
ATOM   2073 C CG  . ARG A 1 275 ? 40.680  14.144 43.679  1.00 66.10  ? 276  ARG A CG  1 
ATOM   2074 C CD  . ARG A 1 275 ? 40.646  12.728 44.221  1.00 65.91  ? 276  ARG A CD  1 
ATOM   2075 N NE  . ARG A 1 275 ? 39.305  12.155 44.176  1.00 72.53  ? 276  ARG A NE  1 
ATOM   2076 C CZ  . ARG A 1 275 ? 38.419  12.252 45.162  1.00 80.33  ? 276  ARG A CZ  1 
ATOM   2077 N NH1 . ARG A 1 275 ? 38.730  12.904 46.274  1.00 84.42  ? 276  ARG A NH1 1 
ATOM   2078 N NH2 . ARG A 1 275 ? 37.222  11.696 45.036  1.00 82.37  ? 276  ARG A NH2 1 
ATOM   2079 N N   . PRO A 1 276 ? 44.964  14.228 45.302  1.00 60.15  ? 277  PRO A N   1 
ATOM   2080 C CA  . PRO A 1 276 ? 46.396  14.502 45.147  1.00 55.80  ? 277  PRO A CA  1 
ATOM   2081 C C   . PRO A 1 276 ? 46.681  15.117 43.785  1.00 55.06  ? 277  PRO A C   1 
ATOM   2082 O O   . PRO A 1 276 ? 46.024  14.804 42.789  1.00 48.85  ? 277  PRO A O   1 
ATOM   2083 C CB  . PRO A 1 276 ? 47.043  13.120 45.289  1.00 55.46  ? 277  PRO A CB  1 
ATOM   2084 C CG  . PRO A 1 276 ? 46.041  12.313 46.074  1.00 56.72  ? 277  PRO A CG  1 
ATOM   2085 C CD  . PRO A 1 276 ? 44.697  12.817 45.632  1.00 58.41  ? 277  PRO A CD  1 
ATOM   2086 N N   . ALA A 1 277 ? 47.664  16.020 43.758  1.00 49.11  ? 278  ALA A N   1 
ATOM   2087 C CA  . ALA A 1 277 ? 47.969  16.751 42.532  1.00 49.41  ? 278  ALA A CA  1 
ATOM   2088 C C   . ALA A 1 277 ? 48.325  15.805 41.393  1.00 53.90  ? 278  ALA A C   1 
ATOM   2089 O O   . ALA A 1 277 ? 47.909  16.017 40.247  1.00 56.66  ? 278  ALA A O   1 
ATOM   2090 C CB  . ALA A 1 277 ? 49.107  17.742 42.779  1.00 43.94  ? 278  ALA A CB  1 
ATOM   2091 N N   . GLN A 1 278 ? 49.087  14.750 41.689  1.00 55.31  ? 279  GLN A N   1 
ATOM   2092 C CA  . GLN A 1 278 ? 49.498  13.822 40.642  1.00 58.15  ? 279  GLN A CA  1 
ATOM   2093 C C   . GLN A 1 278 ? 48.305  13.084 40.047  1.00 58.16  ? 279  GLN A C   1 
ATOM   2094 O O   . GLN A 1 278 ? 48.304  12.773 38.850  1.00 55.95  ? 279  GLN A O   1 
ATOM   2095 C CB  . GLN A 1 278 ? 50.526  12.829 41.192  1.00 54.86  ? 279  GLN A CB  1 
ATOM   2096 C CG  . GLN A 1 278 ? 51.173  11.948 40.129  1.00 62.31  ? 279  GLN A CG  1 
ATOM   2097 C CD  . GLN A 1 278 ? 51.954  12.746 39.094  1.00 63.10  ? 279  GLN A CD  1 
ATOM   2098 O OE1 . GLN A 1 278 ? 52.763  13.608 39.437  1.00 63.81  ? 279  GLN A OE1 1 
ATOM   2099 N NE2 . GLN A 1 278 ? 51.712  12.459 37.819  1.00 56.70  ? 279  GLN A NE2 1 
ATOM   2100 N N   . VAL A 1 279 ? 47.281  12.804 40.858  1.00 57.00  ? 280  VAL A N   1 
ATOM   2101 C CA  . VAL A 1 279 ? 46.086  12.137 40.345  1.00 57.66  ? 280  VAL A CA  1 
ATOM   2102 C C   . VAL A 1 279 ? 45.419  12.987 39.272  1.00 57.43  ? 280  VAL A C   1 
ATOM   2103 O O   . VAL A 1 279 ? 44.947  12.469 38.252  1.00 58.19  ? 280  VAL A O   1 
ATOM   2104 C CB  . VAL A 1 279 ? 45.117  11.815 41.497  1.00 60.30  ? 280  VAL A CB  1 
ATOM   2105 C CG1 . VAL A 1 279 ? 43.836  11.196 40.958  1.00 56.89  ? 280  VAL A CG1 1 
ATOM   2106 C CG2 . VAL A 1 279 ? 45.782  10.889 42.507  1.00 56.74  ? 280  VAL A CG2 1 
ATOM   2107 N N   . LEU A 1 280 ? 45.372  14.305 39.477  1.00 52.70  ? 281  LEU A N   1 
ATOM   2108 C CA  . LEU A 1 280 ? 44.808  15.184 38.458  1.00 50.07  ? 281  LEU A CA  1 
ATOM   2109 C C   . LEU A 1 280 ? 45.665  15.185 37.198  1.00 52.08  ? 281  LEU A C   1 
ATOM   2110 O O   . LEU A 1 280 ? 45.136  15.140 36.080  1.00 56.12  ? 281  LEU A O   1 
ATOM   2111 C CB  . LEU A 1 280 ? 44.655  16.602 39.009  1.00 52.10  ? 281  LEU A CB  1 
ATOM   2112 C CG  . LEU A 1 280 ? 43.724  16.791 40.210  1.00 53.90  ? 281  LEU A CG  1 
ATOM   2113 C CD1 . LEU A 1 280 ? 43.514  18.269 40.501  1.00 54.47  ? 281  LEU A CD1 1 
ATOM   2114 C CD2 . LEU A 1 280 ? 42.390  16.096 39.986  1.00 51.93  ? 281  LEU A CD2 1 
ATOM   2115 N N   . VAL A 1 281 ? 46.991  15.226 37.360  1.00 47.08  ? 282  VAL A N   1 
ATOM   2116 C CA  . VAL A 1 281 ? 47.886  15.207 36.206  1.00 49.47  ? 282  VAL A CA  1 
ATOM   2117 C C   . VAL A 1 281 ? 47.710  13.920 35.408  1.00 52.56  ? 282  VAL A C   1 
ATOM   2118 O O   . VAL A 1 281 ? 47.690  13.938 34.171  1.00 54.67  ? 282  VAL A O   1 
ATOM   2119 C CB  . VAL A 1 281 ? 49.347  15.393 36.661  1.00 47.95  ? 282  VAL A CB  1 
ATOM   2120 C CG1 . VAL A 1 281 ? 50.294  15.194 35.493  1.00 48.20  ? 282  VAL A CG1 1 
ATOM   2121 C CG2 . VAL A 1 281 ? 49.545  16.772 37.272  1.00 41.04  ? 282  VAL A CG2 1 
ATOM   2122 N N   . ASN A 1 282 ? 47.559  12.787 36.100  1.00 51.71  ? 283  ASN A N   1 
ATOM   2123 C CA  . ASN A 1 282 ? 47.518  11.500 35.411  1.00 51.97  ? 283  ASN A CA  1 
ATOM   2124 C C   . ASN A 1 282 ? 46.295  11.362 34.512  1.00 55.64  ? 283  ASN A C   1 
ATOM   2125 O O   . ASN A 1 282 ? 46.336  10.612 33.531  1.00 61.67  ? 283  ASN A O   1 
ATOM   2126 C CB  . ASN A 1 282 ? 47.552  10.356 36.424  1.00 50.97  ? 283  ASN A CB  1 
ATOM   2127 C CG  . ASN A 1 282 ? 48.875  10.264 37.156  1.00 58.98  ? 283  ASN A CG  1 
ATOM   2128 O OD1 . ASN A 1 282 ? 49.894  10.771 36.688  1.00 56.51  ? 283  ASN A OD1 1 
ATOM   2129 N ND2 . ASN A 1 282 ? 48.866  9.611  38.312  1.00 63.31  ? 283  ASN A ND2 1 
ATOM   2130 N N   . HIS A 1 283 ? 45.205  12.062 34.821  1.00 50.85  ? 284  HIS A N   1 
ATOM   2131 C CA  . HIS A 1 283 ? 43.977  11.958 34.045  1.00 52.68  ? 284  HIS A CA  1 
ATOM   2132 C C   . HIS A 1 283 ? 43.720  13.172 33.164  1.00 51.83  ? 284  HIS A C   1 
ATOM   2133 O O   . HIS A 1 283 ? 42.678  13.233 32.504  1.00 54.94  ? 284  HIS A O   1 
ATOM   2134 C CB  . HIS A 1 283 ? 42.779  11.741 34.977  1.00 50.66  ? 284  HIS A CB  1 
ATOM   2135 C CG  . HIS A 1 283 ? 42.826  10.448 35.730  1.00 56.27  ? 284  HIS A CG  1 
ATOM   2136 N ND1 . HIS A 1 283 ? 43.397  10.334 36.980  1.00 56.84  ? 284  HIS A ND1 1 
ATOM   2137 C CD2 . HIS A 1 283 ? 42.372  9.213  35.409  1.00 59.67  ? 284  HIS A CD2 1 
ATOM   2138 C CE1 . HIS A 1 283 ? 43.292  9.084  37.396  1.00 59.84  ? 284  HIS A CE1 1 
ATOM   2139 N NE2 . HIS A 1 283 ? 42.675  8.384  36.462  1.00 61.46  ? 284  HIS A NE2 1 
ATOM   2140 N N   . GLU A 1 284 ? 44.650  14.124 33.115  1.00 49.20  ? 285  GLU A N   1 
ATOM   2141 C CA  . GLU A 1 284 ? 44.367  15.413 32.496  1.00 50.99  ? 285  GLU A CA  1 
ATOM   2142 C C   . GLU A 1 284 ? 44.152  15.303 30.990  1.00 61.05  ? 285  GLU A C   1 
ATOM   2143 O O   . GLU A 1 284 ? 43.369  16.071 30.420  1.00 57.97  ? 285  GLU A O   1 
ATOM   2144 C CB  . GLU A 1 284 ? 45.505  16.383 32.808  1.00 55.50  ? 285  GLU A CB  1 
ATOM   2145 C CG  . GLU A 1 284 ? 45.306  17.782 32.279  1.00 68.61  ? 285  GLU A CG  1 
ATOM   2146 C CD  . GLU A 1 284 ? 46.221  18.780 32.951  1.00 75.97  ? 285  GLU A CD  1 
ATOM   2147 O OE1 . GLU A 1 284 ? 46.174  18.885 34.195  1.00 76.53  ? 285  GLU A OE1 1 
ATOM   2148 O OE2 . GLU A 1 284 ? 47.003  19.441 32.236  1.00 71.32  ? 285  GLU A OE2 1 
ATOM   2149 N N   . TRP A 1 285 ? 44.816  14.361 30.328  1.00 55.78  ? 286  TRP A N   1 
ATOM   2150 C CA  A TRP A 1 285 ? 44.735  14.228 28.877  0.62 59.45  ? 286  TRP A CA  1 
ATOM   2151 C CA  B TRP A 1 285 ? 44.690  14.295 28.880  0.38 58.75  ? 286  TRP A CA  1 
ATOM   2152 C C   . TRP A 1 285 ? 43.522  13.437 28.416  1.00 59.58  ? 286  TRP A C   1 
ATOM   2153 O O   . TRP A 1 285 ? 43.149  13.523 27.242  1.00 65.29  ? 286  TRP A O   1 
ATOM   2154 C CB  A TRP A 1 285 ? 46.000  13.554 28.347  0.62 57.56  ? 286  TRP A CB  1 
ATOM   2155 C CB  B TRP A 1 285 ? 45.998  13.799 28.255  0.38 57.43  ? 286  TRP A CB  1 
ATOM   2156 C CG  A TRP A 1 285 ? 46.588  14.243 27.174  0.62 56.82  ? 286  TRP A CG  1 
ATOM   2157 C CG  B TRP A 1 285 ? 46.690  14.864 27.445  0.38 56.22  ? 286  TRP A CG  1 
ATOM   2158 C CD1 A TRP A 1 285 ? 46.834  13.707 25.944  0.62 57.19  ? 286  TRP A CD1 1 
ATOM   2159 C CD1 B TRP A 1 285 ? 47.110  14.767 26.149  0.38 57.00  ? 286  TRP A CD1 1 
ATOM   2160 C CD2 A TRP A 1 285 ? 47.001  15.610 27.108  0.62 56.93  ? 286  TRP A CD2 1 
ATOM   2161 C CD2 B TRP A 1 285 ? 47.016  16.195 27.872  0.38 55.45  ? 286  TRP A CD2 1 
ATOM   2162 N NE1 A TRP A 1 285 ? 47.383  14.657 25.117  0.62 56.07  ? 286  TRP A NE1 1 
ATOM   2163 N NE1 B TRP A 1 285 ? 47.688  15.948 25.748  0.38 54.81  ? 286  TRP A NE1 1 
ATOM   2164 C CE2 A TRP A 1 285 ? 47.495  15.835 25.808  0.62 55.31  ? 286  TRP A CE2 1 
ATOM   2165 C CE2 B TRP A 1 285 ? 47.641  16.841 26.786  0.38 55.24  ? 286  TRP A CE2 1 
ATOM   2166 C CE3 A TRP A 1 285 ? 47.003  16.668 28.024  0.62 54.95  ? 286  TRP A CE3 1 
ATOM   2167 C CE3 B TRP A 1 285 ? 46.844  16.900 29.068  0.38 54.16  ? 286  TRP A CE3 1 
ATOM   2168 C CZ2 A TRP A 1 285 ? 47.985  17.072 25.401  0.62 53.17  ? 286  TRP A CZ2 1 
ATOM   2169 C CZ2 B TRP A 1 285 ? 48.093  18.157 26.862  0.38 54.27  ? 286  TRP A CZ2 1 
ATOM   2170 C CZ3 A TRP A 1 285 ? 47.490  17.894 27.619  0.62 54.61  ? 286  TRP A CZ3 1 
ATOM   2171 C CZ3 B TRP A 1 285 ? 47.295  18.202 29.140  0.38 53.14  ? 286  TRP A CZ3 1 
ATOM   2172 C CH2 A TRP A 1 285 ? 47.975  18.087 26.319  0.62 53.38  ? 286  TRP A CH2 1 
ATOM   2173 C CH2 B TRP A 1 285 ? 47.912  18.817 28.046  0.38 52.54  ? 286  TRP A CH2 1 
ATOM   2174 N N   . HIS A 1 286 ? 42.913  12.654 29.302  1.00 57.96  ? 287  HIS A N   1 
ATOM   2175 C CA  . HIS A 1 286 ? 41.759  11.856 28.916  1.00 62.72  ? 287  HIS A CA  1 
ATOM   2176 C C   . HIS A 1 286 ? 40.530  12.702 28.606  1.00 60.27  ? 287  HIS A C   1 
ATOM   2177 O O   . HIS A 1 286 ? 39.538  12.158 28.107  1.00 65.51  ? 287  HIS A O   1 
ATOM   2178 C CB  . HIS A 1 286 ? 41.443  10.845 30.019  1.00 71.02  ? 287  HIS A CB  1 
ATOM   2179 C CG  . HIS A 1 286 ? 42.508  9.810  30.203  1.00 83.94  ? 287  HIS A CG  1 
ATOM   2180 N ND1 . HIS A 1 286 ? 43.079  9.536  31.427  1.00 87.41  ? 287  HIS A ND1 1 
ATOM   2181 C CD2 . HIS A 1 286 ? 43.110  8.985  29.314  1.00 90.57  ? 287  HIS A CD2 1 
ATOM   2182 C CE1 . HIS A 1 286 ? 43.986  8.586  31.284  1.00 90.15  ? 287  HIS A CE1 1 
ATOM   2183 N NE2 . HIS A 1 286 ? 44.024  8.234  30.012  1.00 92.53  ? 287  HIS A NE2 1 
ATOM   2184 N N   . VAL A 1 287 ? 40.569  14.013 28.870  1.00 51.67  ? 288  VAL A N   1 
ATOM   2185 C CA  . VAL A 1 287 ? 39.416  14.868 28.595  1.00 54.73  ? 288  VAL A CA  1 
ATOM   2186 C C   . VAL A 1 287 ? 39.460  15.496 27.210  1.00 58.67  ? 288  VAL A C   1 
ATOM   2187 O O   . VAL A 1 287 ? 38.468  16.115 26.793  1.00 57.19  ? 288  VAL A O   1 
ATOM   2188 C CB  . VAL A 1 287 ? 39.275  15.986 29.649  1.00 53.42  ? 288  VAL A CB  1 
ATOM   2189 C CG1 . VAL A 1 287 ? 39.232  15.395 31.054  1.00 45.80  ? 288  VAL A CG1 1 
ATOM   2190 C CG2 . VAL A 1 287 ? 40.401  16.992 29.521  1.00 49.50  ? 288  VAL A CG2 1 
ATOM   2191 N N   . LEU A 1 288 ? 40.566  15.366 26.484  1.00 58.10  ? 289  LEU A N   1 
ATOM   2192 C CA  . LEU A 1 288 ? 40.613  15.883 25.123  1.00 55.11  ? 289  LEU A CA  1 
ATOM   2193 C C   . LEU A 1 288 ? 39.577  15.163 24.269  1.00 58.48  ? 289  LEU A C   1 
ATOM   2194 O O   . LEU A 1 288 ? 39.514  13.925 24.287  1.00 58.98  ? 289  LEU A O   1 
ATOM   2195 C CB  . LEU A 1 288 ? 42.005  15.716 24.517  1.00 50.05  ? 289  LEU A CB  1 
ATOM   2196 C CG  . LEU A 1 288 ? 42.969  16.846 24.876  1.00 51.65  ? 289  LEU A CG  1 
ATOM   2197 C CD1 . LEU A 1 288 ? 44.337  16.609 24.266  1.00 49.27  ? 289  LEU A CD1 1 
ATOM   2198 C CD2 . LEU A 1 288 ? 42.397  18.184 24.430  1.00 47.55  ? 289  LEU A CD2 1 
ATOM   2199 N N   . PRO A 1 289 ? 38.746  15.890 23.518  1.00 64.20  ? 290  PRO A N   1 
ATOM   2200 C CA  . PRO A 1 289 ? 37.644  15.235 22.800  1.00 65.23  ? 290  PRO A CA  1 
ATOM   2201 C C   . PRO A 1 289 ? 38.094  14.345 21.650  1.00 64.69  ? 290  PRO A C   1 
ATOM   2202 O O   . PRO A 1 289 ? 37.275  13.550 21.176  1.00 61.19  ? 290  PRO A O   1 
ATOM   2203 C CB  . PRO A 1 289 ? 36.802  16.413 22.288  1.00 61.09  ? 290  PRO A CB  1 
ATOM   2204 C CG  . PRO A 1 289 ? 37.716  17.576 22.282  1.00 58.02  ? 290  PRO A CG  1 
ATOM   2205 C CD  . PRO A 1 289 ? 38.732  17.353 23.361  1.00 64.36  ? 290  PRO A CD  1 
ATOM   2206 N N   . GLN A 1 290 ? 39.341  14.454 21.180  1.00 61.29  ? 291  GLN A N   1 
ATOM   2207 C CA  . GLN A 1 290 ? 39.833  13.587 20.111  1.00 73.12  ? 291  GLN A CA  1 
ATOM   2208 C C   . GLN A 1 290 ? 41.333  13.370 20.237  1.00 68.66  ? 291  GLN A C   1 
ATOM   2209 O O   . GLN A 1 290 ? 42.061  14.211 20.772  1.00 66.14  ? 291  GLN A O   1 
ATOM   2210 C CB  . GLN A 1 290 ? 39.568  14.153 18.711  1.00 81.27  ? 291  GLN A CB  1 
ATOM   2211 C CG  . GLN A 1 290 ? 38.114  14.430 18.358  1.00 98.19  ? 291  GLN A CG  1 
ATOM   2212 C CD  . GLN A 1 290 ? 37.756  15.836 18.701  1.00 113.25 ? 291  GLN A CD  1 
ATOM   2213 O OE1 . GLN A 1 290 ? 38.609  16.727 18.656  1.00 115.28 ? 291  GLN A OE1 1 
ATOM   2214 N NE2 . GLN A 1 290 ? 36.528  16.058 19.113  1.00 121.74 ? 291  GLN A NE2 1 
ATOM   2215 N N   . GLU A 1 291 ? 41.773  12.243 19.677  1.00 72.89  ? 292  GLU A N   1 
ATOM   2216 C CA  . GLU A 1 291 ? 43.172  11.998 19.359  1.00 79.95  ? 292  GLU A CA  1 
ATOM   2217 C C   . GLU A 1 291 ? 43.713  13.142 18.513  1.00 73.35  ? 292  GLU A C   1 
ATOM   2218 O O   . GLU A 1 291 ? 43.166  13.446 17.450  1.00 74.86  ? 292  GLU A O   1 
ATOM   2219 C CB  . GLU A 1 291 ? 43.283  10.665 18.612  1.00 90.31  ? 292  GLU A CB  1 
ATOM   2220 C CG  . GLU A 1 291 ? 44.549  10.442 17.797  1.00 95.57  ? 292  GLU A CG  1 
ATOM   2221 C CD  . GLU A 1 291 ? 44.423  9.219  16.901  1.00 100.52 ? 292  GLU A CD  1 
ATOM   2222 O OE1 . GLU A 1 291 ? 45.390  8.447  16.789  1.00 100.09 ? 292  GLU A OE1 1 
ATOM   2223 O OE2 . GLU A 1 291 ? 43.349  9.035  16.300  1.00 103.63 ? 292  GLU A OE2 1 
ATOM   2224 N N   . SER A 1 292 ? 44.773  13.789 18.991  1.00 66.20  ? 293  SER A N   1 
ATOM   2225 C CA  . SER A 1 292 ? 45.274  14.968 18.301  1.00 57.17  ? 293  SER A CA  1 
ATOM   2226 C C   . SER A 1 292 ? 46.689  15.293 18.751  1.00 54.74  ? 293  SER A C   1 
ATOM   2227 O O   . SER A 1 292 ? 47.163  14.830 19.793  1.00 62.07  ? 293  SER A O   1 
ATOM   2228 C CB  . SER A 1 292 ? 44.370  16.182 18.541  1.00 61.26  ? 293  SER A CB  1 
ATOM   2229 O OG  . SER A 1 292 ? 44.306  16.506 19.918  1.00 62.47  ? 293  SER A OG  1 
ATOM   2230 N N   . VAL A 1 293 ? 47.354  16.107 17.933  1.00 48.30  ? 294  VAL A N   1 
ATOM   2231 C CA  . VAL A 1 293 ? 48.577  16.803 18.312  1.00 49.91  ? 294  VAL A CA  1 
ATOM   2232 C C   . VAL A 1 293 ? 48.266  18.293 18.340  1.00 53.43  ? 294  VAL A C   1 
ATOM   2233 O O   . VAL A 1 293 ? 47.326  18.764 17.688  1.00 57.18  ? 294  VAL A O   1 
ATOM   2234 C CB  . VAL A 1 293 ? 49.760  16.512 17.360  1.00 53.70  ? 294  VAL A CB  1 
ATOM   2235 C CG1 . VAL A 1 293 ? 50.078  15.028 17.331  1.00 55.12  ? 294  VAL A CG1 1 
ATOM   2236 C CG2 . VAL A 1 293 ? 49.476  17.035 15.954  1.00 51.13  ? 294  VAL A CG2 1 
ATOM   2237 N N   . PHE A 1 294 ? 49.048  19.029 19.127  1.00 46.79  ? 295  PHE A N   1 
ATOM   2238 C CA  . PHE A 1 294 ? 48.923  20.483 19.240  1.00 50.90  ? 295  PHE A CA  1 
ATOM   2239 C C   . PHE A 1 294 ? 47.568  20.929 19.810  1.00 51.69  ? 295  PHE A C   1 
ATOM   2240 O O   . PHE A 1 294 ? 47.053  21.983 19.428  1.00 54.73  ? 295  PHE A O   1 
ATOM   2241 C CB  . PHE A 1 294 ? 49.179  21.166 17.888  1.00 45.47  ? 295  PHE A CB  1 
ATOM   2242 C CG  . PHE A 1 294 ? 50.001  22.415 17.990  1.00 43.73  ? 295  PHE A CG  1 
ATOM   2243 C CD1 . PHE A 1 294 ? 51.099  22.603 17.171  1.00 40.89  ? 295  PHE A CD1 1 
ATOM   2244 C CD2 . PHE A 1 294 ? 49.681  23.400 18.914  1.00 41.94  ? 295  PHE A CD2 1 
ATOM   2245 C CE1 . PHE A 1 294 ? 51.859  23.752 17.265  1.00 44.59  ? 295  PHE A CE1 1 
ATOM   2246 C CE2 . PHE A 1 294 ? 50.439  24.550 19.015  1.00 48.94  ? 295  PHE A CE2 1 
ATOM   2247 C CZ  . PHE A 1 294 ? 51.530  24.726 18.191  1.00 51.61  ? 295  PHE A CZ  1 
ATOM   2248 N N   . ARG A 1 295 ? 46.964  20.138 20.713  1.00 42.51  ? 296  ARG A N   1 
ATOM   2249 C CA  . ARG A 1 295 ? 45.826  20.584 21.526  1.00 50.19  ? 296  ARG A CA  1 
ATOM   2250 C C   . ARG A 1 295 ? 45.988  20.144 22.969  1.00 47.89  ? 296  ARG A C   1 
ATOM   2251 O O   . ARG A 1 295 ? 46.444  19.029 23.251  1.00 47.29  ? 296  ARG A O   1 
ATOM   2252 C CB  . ARG A 1 295 ? 44.459  20.105 21.010  1.00 48.74  ? 296  ARG A CB  1 
ATOM   2253 C CG  . ARG A 1 295 ? 44.196  20.650 19.612  1.00 48.51  ? 296  ARG A CG  1 
ATOM   2254 C CD  . ARG A 1 295 ? 43.473  22.011 19.574  1.00 49.87  ? 296  ARG A CD  1 
ATOM   2255 N NE  . ARG A 1 295 ? 43.003  22.304 18.225  1.00 49.65  ? 296  ARG A NE  1 
ATOM   2256 C CZ  . ARG A 1 295 ? 43.796  22.572 17.191  1.00 50.18  ? 296  ARG A CZ  1 
ATOM   2257 N NH1 . ARG A 1 295 ? 45.130  22.642 17.299  1.00 39.65  ? 296  ARG A NH1 1 
ATOM   2258 N NH2 . ARG A 1 295 ? 43.245  22.808 16.004  1.00 49.66  ? 296  ARG A NH2 1 
ATOM   2259 N N   . PHE A 1 296 ? 45.586  21.016 23.880  1.00 43.60  ? 297  PHE A N   1 
ATOM   2260 C CA  . PHE A 1 296 ? 45.901  20.865 25.290  1.00 39.83  ? 297  PHE A CA  1 
ATOM   2261 C C   . PHE A 1 296 ? 44.632  21.013 26.115  1.00 42.68  ? 297  PHE A C   1 
ATOM   2262 O O   . PHE A 1 296 ? 43.755  21.814 25.781  1.00 44.90  ? 297  PHE A O   1 
ATOM   2263 C CB  . PHE A 1 296 ? 46.963  21.885 25.674  1.00 38.36  ? 297  PHE A CB  1 
ATOM   2264 C CG  . PHE A 1 296 ? 48.004  22.083 24.603  1.00 38.93  ? 297  PHE A CG  1 
ATOM   2265 C CD1 . PHE A 1 296 ? 48.993  21.136 24.402  1.00 40.43  ? 297  PHE A CD1 1 
ATOM   2266 C CD2 . PHE A 1 296 ? 47.965  23.190 23.770  1.00 41.28  ? 297  PHE A CD2 1 
ATOM   2267 C CE1 . PHE A 1 296 ? 49.941  21.299 23.411  1.00 44.67  ? 297  PHE A CE1 1 
ATOM   2268 C CE2 . PHE A 1 296 ? 48.913  23.358 22.770  1.00 42.15  ? 297  PHE A CE2 1 
ATOM   2269 C CZ  . PHE A 1 296 ? 49.901  22.412 22.593  1.00 42.70  ? 297  PHE A CZ  1 
ATOM   2270 N N   . SER A 1 297 ? 44.538  20.230 27.191  1.00 41.92  ? 298  SER A N   1 
ATOM   2271 C CA  . SER A 1 297 ? 43.258  20.038 27.864  1.00 47.99  ? 298  SER A CA  1 
ATOM   2272 C C   . SER A 1 297 ? 42.761  21.321 28.518  1.00 45.97  ? 298  SER A C   1 
ATOM   2273 O O   . SER A 1 297 ? 41.603  21.715 28.333  1.00 43.59  ? 298  SER A O   1 
ATOM   2274 C CB  . SER A 1 297 ? 43.376  18.922 28.899  1.00 48.99  ? 298  SER A CB  1 
ATOM   2275 O OG  . SER A 1 297 ? 43.527  17.668 28.261  1.00 56.05  ? 298  SER A OG  1 
ATOM   2276 N N   . PHE A 1 298 ? 43.610  21.982 29.297  1.00 41.57  ? 299  PHE A N   1 
ATOM   2277 C CA  . PHE A 1 298 ? 43.198  23.143 30.077  1.00 41.50  ? 299  PHE A CA  1 
ATOM   2278 C C   . PHE A 1 298 ? 44.017  24.346 29.635  1.00 41.25  ? 299  PHE A C   1 
ATOM   2279 O O   . PHE A 1 298 ? 45.227  24.410 29.879  1.00 45.01  ? 299  PHE A O   1 
ATOM   2280 C CB  . PHE A 1 298 ? 43.339  22.859 31.571  1.00 42.87  ? 299  PHE A CB  1 
ATOM   2281 C CG  . PHE A 1 298 ? 42.475  21.724 32.031  1.00 43.52  ? 299  PHE A CG  1 
ATOM   2282 C CD1 . PHE A 1 298 ? 41.117  21.915 32.245  1.00 45.61  ? 299  PHE A CD1 1 
ATOM   2283 C CD2 . PHE A 1 298 ? 43.005  20.457 32.209  1.00 38.87  ? 299  PHE A CD2 1 
ATOM   2284 C CE1 . PHE A 1 298 ? 40.311  20.870 32.649  1.00 46.28  ? 299  PHE A CE1 1 
ATOM   2285 C CE2 . PHE A 1 298 ? 42.203  19.406 32.612  1.00 42.11  ? 299  PHE A CE2 1 
ATOM   2286 C CZ  . PHE A 1 298 ? 40.854  19.613 32.834  1.00 47.34  ? 299  PHE A CZ  1 
ATOM   2287 N N   . VAL A 1 299 ? 43.349  25.288 28.978  1.00 39.94  ? 300  VAL A N   1 
ATOM   2288 C CA  . VAL A 1 299 ? 43.973  26.467 28.387  1.00 38.89  ? 300  VAL A CA  1 
ATOM   2289 C C   . VAL A 1 299 ? 43.109  27.664 28.770  1.00 40.36  ? 300  VAL A C   1 
ATOM   2290 O O   . VAL A 1 299 ? 42.039  27.471 29.367  1.00 38.40  ? 300  VAL A O   1 
ATOM   2291 C CB  . VAL A 1 299 ? 44.105  26.314 26.861  1.00 39.22  ? 300  VAL A CB  1 
ATOM   2292 C CG1 . VAL A 1 299 ? 44.971  25.107 26.511  1.00 32.84  ? 300  VAL A CG1 1 
ATOM   2293 C CG2 . VAL A 1 299 ? 42.732  26.199 26.223  1.00 37.76  ? 300  VAL A CG2 1 
ATOM   2294 N N   . PRO A 1 300 ? 43.522  28.902 28.478  1.00 41.08  ? 301  PRO A N   1 
ATOM   2295 C CA  . PRO A 1 300 ? 42.656  30.053 28.764  1.00 39.15  ? 301  PRO A CA  1 
ATOM   2296 C C   . PRO A 1 300 ? 41.260  29.890 28.176  1.00 45.23  ? 301  PRO A C   1 
ATOM   2297 O O   . PRO A 1 300 ? 41.076  29.309 27.104  1.00 47.35  ? 301  PRO A O   1 
ATOM   2298 C CB  . PRO A 1 300 ? 43.405  31.222 28.118  1.00 40.16  ? 301  PRO A CB  1 
ATOM   2299 C CG  . PRO A 1 300 ? 44.833  30.837 28.256  1.00 39.20  ? 301  PRO A CG  1 
ATOM   2300 C CD  . PRO A 1 300 ? 44.882  29.335 28.100  1.00 39.07  ? 301  PRO A CD  1 
ATOM   2301 N N   . VAL A 1 301 ? 40.271  30.411 28.896  1.00 44.10  ? 302  VAL A N   1 
ATOM   2302 C CA  . VAL A 1 301 ? 38.866  30.288 28.526  1.00 38.79  ? 302  VAL A CA  1 
ATOM   2303 C C   . VAL A 1 301 ? 38.327  31.669 28.179  1.00 45.26  ? 302  VAL A C   1 
ATOM   2304 O O   . VAL A 1 301 ? 38.607  32.651 28.877  1.00 43.80  ? 302  VAL A O   1 
ATOM   2305 C CB  . VAL A 1 301 ? 38.047  29.632 29.658  1.00 45.23  ? 302  VAL A CB  1 
ATOM   2306 C CG1 . VAL A 1 301 ? 38.294  30.340 30.984  1.00 43.04  ? 302  VAL A CG1 1 
ATOM   2307 C CG2 . VAL A 1 301 ? 36.562  29.625 29.322  1.00 47.44  ? 302  VAL A CG2 1 
ATOM   2308 N N   . VAL A 1 302 ? 37.565  31.744 27.088  1.00 46.24  ? 303  VAL A N   1 
ATOM   2309 C CA  . VAL A 1 302 ? 36.926  32.987 26.655  1.00 49.13  ? 303  VAL A CA  1 
ATOM   2310 C C   . VAL A 1 302 ? 35.622  33.119 27.438  1.00 55.86  ? 303  VAL A C   1 
ATOM   2311 O O   . VAL A 1 302 ? 34.609  32.520 27.073  1.00 58.90  ? 303  VAL A O   1 
ATOM   2312 C CB  . VAL A 1 302 ? 36.680  33.006 25.145  1.00 49.30  ? 303  VAL A CB  1 
ATOM   2313 C CG1 . VAL A 1 302 ? 35.996  34.303 24.734  1.00 46.81  ? 303  VAL A CG1 1 
ATOM   2314 C CG2 . VAL A 1 302 ? 37.988  32.817 24.389  1.00 39.43  ? 303  VAL A CG2 1 
ATOM   2315 N N   . ASP A 1 303 ? 35.633  33.912 28.514  1.00 61.58  ? 304  ASP A N   1 
ATOM   2316 C CA  . ASP A 1 303 ? 34.493  33.964 29.422  1.00 66.36  ? 304  ASP A CA  1 
ATOM   2317 C C   . ASP A 1 303 ? 34.003  35.377 29.724  1.00 67.38  ? 304  ASP A C   1 
ATOM   2318 O O   . ASP A 1 303 ? 33.137  35.542 30.589  1.00 68.42  ? 304  ASP A O   1 
ATOM   2319 C CB  . ASP A 1 303 ? 34.829  33.245 30.735  1.00 67.14  ? 304  ASP A CB  1 
ATOM   2320 C CG  . ASP A 1 303 ? 35.871  33.979 31.561  1.00 67.18  ? 304  ASP A CG  1 
ATOM   2321 O OD1 . ASP A 1 303 ? 36.623  34.801 30.998  1.00 63.47  ? 304  ASP A OD1 1 
ATOM   2322 O OD2 . ASP A 1 303 ? 35.946  33.721 32.779  1.00 80.53  ? 304  ASP A OD2 1 
ATOM   2323 N N   . GLY A 1 304 ? 34.522  36.399 29.044  1.00 66.07  ? 305  GLY A N   1 
ATOM   2324 C CA  . GLY A 1 304 ? 34.080  37.759 29.250  1.00 68.49  ? 305  GLY A CA  1 
ATOM   2325 C C   . GLY A 1 304 ? 34.833  38.534 30.313  1.00 69.82  ? 305  GLY A C   1 
ATOM   2326 O O   . GLY A 1 304 ? 34.738  39.766 30.342  1.00 75.66  ? 305  GLY A O   1 
ATOM   2327 N N   . ASP A 1 305 ? 35.610  37.881 31.182  1.00 61.36  ? 306  ASP A N   1 
ATOM   2328 C CA  . ASP A 1 305 ? 36.333  38.644 32.218  1.00 64.77  ? 306  ASP A CA  1 
ATOM   2329 C C   . ASP A 1 305 ? 37.760  39.001 31.786  1.00 60.37  ? 306  ASP A C   1 
ATOM   2330 O O   . ASP A 1 305 ? 38.003  40.130 31.361  1.00 64.68  ? 306  ASP A O   1 
ATOM   2331 C CB  . ASP A 1 305 ? 36.361  37.866 33.535  1.00 67.61  ? 306  ASP A CB  1 
ATOM   2332 C CG  . ASP A 1 305 ? 37.088  38.612 34.637  1.00 77.22  ? 306  ASP A CG  1 
ATOM   2333 O OD1 . ASP A 1 305 ? 37.561  39.739 34.382  1.00 80.01  ? 306  ASP A OD1 1 
ATOM   2334 O OD2 . ASP A 1 305 ? 37.186  38.071 35.759  1.00 83.83  ? 306  ASP A OD2 1 
ATOM   2335 N N   . PHE A 1 306 ? 38.696  38.056 31.854  1.00 52.93  ? 307  PHE A N   1 
ATOM   2336 C CA  . PHE A 1 306 ? 40.040  38.334 31.355  1.00 49.77  ? 307  PHE A CA  1 
ATOM   2337 C C   . PHE A 1 306 ? 40.006  38.693 29.874  1.00 56.85  ? 307  PHE A C   1 
ATOM   2338 O O   . PHE A 1 306 ? 40.599  39.691 29.448  1.00 59.75  ? 307  PHE A O   1 
ATOM   2339 C CB  . PHE A 1 306 ? 40.950  37.127 31.597  1.00 43.34  ? 307  PHE A CB  1 
ATOM   2340 C CG  . PHE A 1 306 ? 42.418  37.460 31.580  1.00 45.41  ? 307  PHE A CG  1 
ATOM   2341 C CD1 . PHE A 1 306 ? 43.080  37.687 30.384  1.00 45.49  ? 307  PHE A CD1 1 
ATOM   2342 C CD2 . PHE A 1 306 ? 43.134  37.543 32.761  1.00 43.77  ? 307  PHE A CD2 1 
ATOM   2343 C CE1 . PHE A 1 306 ? 44.429  37.995 30.368  1.00 48.03  ? 307  PHE A CE1 1 
ATOM   2344 C CE2 . PHE A 1 306 ? 44.482  37.847 32.752  1.00 49.61  ? 307  PHE A CE2 1 
ATOM   2345 C CZ  . PHE A 1 306 ? 45.131  38.073 31.554  1.00 48.49  ? 307  PHE A CZ  1 
ATOM   2346 N N   . LEU A 1 307 ? 39.306  37.890 29.077  1.00 56.18  ? 308  LEU A N   1 
ATOM   2347 C CA  . LEU A 1 307 ? 39.076  38.159 27.661  1.00 54.48  ? 308  LEU A CA  1 
ATOM   2348 C C   . LEU A 1 307 ? 37.604  38.513 27.488  1.00 57.01  ? 308  LEU A C   1 
ATOM   2349 O O   . LEU A 1 307 ? 36.738  37.636 27.573  1.00 57.65  ? 308  LEU A O   1 
ATOM   2350 C CB  . LEU A 1 307 ? 39.452  36.951 26.806  1.00 50.14  ? 308  LEU A CB  1 
ATOM   2351 C CG  . LEU A 1 307 ? 40.877  36.421 26.970  1.00 54.51  ? 308  LEU A CG  1 
ATOM   2352 C CD1 . LEU A 1 307 ? 41.052  35.089 26.247  1.00 45.26  ? 308  LEU A CD1 1 
ATOM   2353 C CD2 . LEU A 1 307 ? 41.880  37.452 26.468  1.00 53.97  ? 308  LEU A CD2 1 
ATOM   2354 N N   . SER A 1 308 ? 37.320  39.797 27.252  1.00 57.66  ? 309  SER A N   1 
ATOM   2355 C CA  . SER A 1 308 ? 35.937  40.223 27.066  1.00 65.22  ? 309  SER A CA  1 
ATOM   2356 C C   . SER A 1 308 ? 35.304  39.585 25.835  1.00 68.42  ? 309  SER A C   1 
ATOM   2357 O O   . SER A 1 308 ? 34.076  39.456 25.777  1.00 76.68  ? 309  SER A O   1 
ATOM   2358 C CB  . SER A 1 308 ? 35.861  41.748 26.966  1.00 70.73  ? 309  SER A CB  1 
ATOM   2359 O OG  . SER A 1 308 ? 36.536  42.223 25.814  1.00 75.82  ? 309  SER A OG  1 
ATOM   2360 N N   . ASP A 1 309 ? 36.112  39.180 24.860  1.00 58.30  ? 310  ASP A N   1 
ATOM   2361 C CA  . ASP A 1 309 ? 35.633  38.477 23.680  1.00 63.65  ? 310  ASP A CA  1 
ATOM   2362 C C   . ASP A 1 309 ? 36.748  37.550 23.212  1.00 60.20  ? 310  ASP A C   1 
ATOM   2363 O O   . ASP A 1 309 ? 37.794  37.433 23.857  1.00 63.49  ? 310  ASP A O   1 
ATOM   2364 C CB  . ASP A 1 309 ? 35.201  39.467 22.590  1.00 69.95  ? 310  ASP A CB  1 
ATOM   2365 C CG  . ASP A 1 309 ? 34.201  38.869 21.614  1.00 76.55  ? 310  ASP A CG  1 
ATOM   2366 O OD1 . ASP A 1 309 ? 33.163  39.516 21.354  1.00 81.95  ? 310  ASP A OD1 1 
ATOM   2367 O OD2 . ASP A 1 309 ? 34.452  37.758 21.103  1.00 78.29  ? 310  ASP A OD2 1 
ATOM   2368 N N   . THR A 1 310 ? 36.518  36.880 22.085  1.00 56.06  ? 311  THR A N   1 
ATOM   2369 C CA  . THR A 1 310 ? 37.549  36.028 21.517  1.00 54.72  ? 311  THR A CA  1 
ATOM   2370 C C   . THR A 1 310 ? 38.758  36.875 21.122  1.00 58.83  ? 311  THR A C   1 
ATOM   2371 O O   . THR A 1 310 ? 38.613  38.049 20.766  1.00 61.71  ? 311  THR A O   1 
ATOM   2372 C CB  . THR A 1 310 ? 37.027  35.282 20.290  1.00 57.14  ? 311  THR A CB  1 
ATOM   2373 O OG1 . THR A 1 310 ? 36.914  36.196 19.194  1.00 61.81  ? 311  THR A OG1 1 
ATOM   2374 C CG2 . THR A 1 310 ? 35.667  34.666 20.574  1.00 54.67  ? 311  THR A CG2 1 
ATOM   2375 N N   . PRO A 1 311 ? 39.965  36.307 21.190  1.00 50.10  ? 312  PRO A N   1 
ATOM   2376 C CA  . PRO A 1 311 ? 41.154  37.069 20.772  1.00 53.03  ? 312  PRO A CA  1 
ATOM   2377 C C   . PRO A 1 311 ? 41.055  37.628 19.360  1.00 54.91  ? 312  PRO A C   1 
ATOM   2378 O O   . PRO A 1 311 ? 41.539  38.738 19.112  1.00 55.27  ? 312  PRO A O   1 
ATOM   2379 C CB  . PRO A 1 311 ? 42.283  36.038 20.905  1.00 50.13  ? 312  PRO A CB  1 
ATOM   2380 C CG  . PRO A 1 311 ? 41.806  35.110 21.977  1.00 48.01  ? 312  PRO A CG  1 
ATOM   2381 C CD  . PRO A 1 311 ? 40.317  35.008 21.787  1.00 45.08  ? 312  PRO A CD  1 
ATOM   2382 N N   . GLU A 1 312 ? 40.427  36.901 18.430  1.00 60.49  ? 313  GLU A N   1 
ATOM   2383 C CA  . GLU A 1 312 ? 40.284  37.415 17.070  1.00 61.82  ? 313  GLU A CA  1 
ATOM   2384 C C   . GLU A 1 312 ? 39.422  38.671 17.044  1.00 57.26  ? 313  GLU A C   1 
ATOM   2385 O O   . GLU A 1 312 ? 39.784  39.673 16.417  1.00 62.77  ? 313  GLU A O   1 
ATOM   2386 C CB  . GLU A 1 312 ? 39.697  36.347 16.147  1.00 75.28  ? 313  GLU A CB  1 
ATOM   2387 C CG  . GLU A 1 312 ? 38.931  36.926 14.962  1.00 94.00  ? 313  GLU A CG  1 
ATOM   2388 C CD  . GLU A 1 312 ? 38.769  35.933 13.835  1.00 109.23 ? 313  GLU A CD  1 
ATOM   2389 O OE1 . GLU A 1 312 ? 39.551  35.999 12.870  1.00 113.97 ? 313  GLU A OE1 1 
ATOM   2390 O OE2 . GLU A 1 312 ? 37.862  35.088 13.913  1.00 114.67 ? 313  GLU A OE2 1 
ATOM   2391 N N   . ALA A 1 313 ? 38.268  38.632 17.716  1.00 55.56  ? 314  ALA A N   1 
ATOM   2392 C CA  . ALA A 1 313 ? 37.409  39.810 17.777  1.00 61.10  ? 314  ALA A CA  1 
ATOM   2393 C C   . ALA A 1 313 ? 38.126  40.982 18.436  1.00 67.09  ? 314  ALA A C   1 
ATOM   2394 O O   . ALA A 1 313 ? 37.986  42.131 18.000  1.00 69.68  ? 314  ALA A O   1 
ATOM   2395 C CB  . ALA A 1 313 ? 36.118  39.483 18.529  1.00 61.35  ? 314  ALA A CB  1 
ATOM   2396 N N   . LEU A 1 314 ? 38.899  40.711 19.489  1.00 62.29  ? 315  LEU A N   1 
ATOM   2397 C CA  . LEU A 1 314 ? 39.635  41.781 20.153  1.00 61.36  ? 315  LEU A CA  1 
ATOM   2398 C C   . LEU A 1 314 ? 40.762  42.301 19.272  1.00 56.88  ? 315  LEU A C   1 
ATOM   2399 O O   . LEU A 1 314 ? 41.037  43.507 19.250  1.00 61.00  ? 315  LEU A O   1 
ATOM   2400 C CB  . LEU A 1 314 ? 40.178  41.290 21.496  1.00 52.88  ? 315  LEU A CB  1 
ATOM   2401 C CG  . LEU A 1 314 ? 39.113  41.033 22.563  1.00 57.02  ? 315  LEU A CG  1 
ATOM   2402 C CD1 . LEU A 1 314 ? 39.704  40.304 23.759  1.00 56.12  ? 315  LEU A CD1 1 
ATOM   2403 C CD2 . LEU A 1 314 ? 38.478  42.347 22.994  1.00 60.41  ? 315  LEU A CD2 1 
ATOM   2404 N N   . ILE A 1 315 ? 41.425  41.406 18.539  1.00 53.18  ? 316  ILE A N   1 
ATOM   2405 C CA  . ILE A 1 315 ? 42.472  41.828 17.615  1.00 60.79  ? 316  ILE A CA  1 
ATOM   2406 C C   . ILE A 1 315 ? 41.891  42.713 16.517  1.00 60.87  ? 316  ILE A C   1 
ATOM   2407 O O   . ILE A 1 315 ? 42.455  43.762 16.181  1.00 58.85  ? 316  ILE A O   1 
ATOM   2408 C CB  . ILE A 1 315 ? 43.192  40.594 17.040  1.00 58.72  ? 316  ILE A CB  1 
ATOM   2409 C CG1 . ILE A 1 315 ? 44.159  40.010 18.074  1.00 53.94  ? 316  ILE A CG1 1 
ATOM   2410 C CG2 . ILE A 1 315 ? 43.919  40.940 15.759  1.00 56.18  ? 316  ILE A CG2 1 
ATOM   2411 C CD1 . ILE A 1 315 ? 44.565  38.579 17.787  1.00 54.97  ? 316  ILE A CD1 1 
ATOM   2412 N N   . ASN A 1 316 ? 40.743  42.319 15.957  1.00 64.15  ? 317  ASN A N   1 
ATOM   2413 C CA  . ASN A 1 316 ? 40.162  43.070 14.846  1.00 65.48  ? 317  ASN A CA  1 
ATOM   2414 C C   . ASN A 1 316 ? 39.634  44.429 15.286  1.00 72.80  ? 317  ASN A C   1 
ATOM   2415 O O   . ASN A 1 316 ? 39.707  45.397 14.520  1.00 81.14  ? 317  ASN A O   1 
ATOM   2416 C CB  . ASN A 1 316 ? 39.039  42.265 14.193  1.00 57.57  ? 317  ASN A CB  1 
ATOM   2417 C CG  . ASN A 1 316 ? 39.536  40.991 13.543  1.00 62.09  ? 317  ASN A CG  1 
ATOM   2418 O OD1 . ASN A 1 316 ? 40.719  40.860 13.229  1.00 71.84  ? 317  ASN A OD1 1 
ATOM   2419 N ND2 . ASN A 1 316 ? 38.629  40.045 13.328  1.00 63.51  ? 317  ASN A ND2 1 
ATOM   2420 N N   . ALA A 1 317 ? 39.101  44.525 16.500  1.00 73.95  ? 318  ALA A N   1 
ATOM   2421 C CA  . ALA A 1 317 ? 38.493  45.755 16.985  1.00 75.29  ? 318  ALA A CA  1 
ATOM   2422 C C   . ALA A 1 317 ? 39.449  46.615 17.801  1.00 77.50  ? 318  ALA A C   1 
ATOM   2423 O O   . ALA A 1 317 ? 39.033  47.657 18.316  1.00 78.22  ? 318  ALA A O   1 
ATOM   2424 C CB  . ALA A 1 317 ? 37.251  45.432 17.822  1.00 78.80  ? 318  ALA A CB  1 
ATOM   2425 N N   . GLY A 1 318 ? 40.711  46.215 17.928  1.00 75.63  ? 319  GLY A N   1 
ATOM   2426 C CA  . GLY A 1 318 ? 41.650  46.938 18.760  1.00 73.90  ? 319  GLY A CA  1 
ATOM   2427 C C   . GLY A 1 318 ? 42.346  48.080 18.038  1.00 75.27  ? 319  GLY A C   1 
ATOM   2428 O O   . GLY A 1 318 ? 42.567  48.039 16.829  1.00 66.95  ? 319  GLY A O   1 
ATOM   2429 N N   . ASP A 1 319 ? 42.687  49.109 18.810  1.00 75.87  ? 320  ASP A N   1 
ATOM   2430 C CA  . ASP A 1 319 ? 43.487  50.235 18.346  1.00 77.04  ? 320  ASP A CA  1 
ATOM   2431 C C   . ASP A 1 319 ? 44.840  50.168 19.041  1.00 77.69  ? 320  ASP A C   1 
ATOM   2432 O O   . ASP A 1 319 ? 44.914  50.257 20.272  1.00 81.25  ? 320  ASP A O   1 
ATOM   2433 C CB  . ASP A 1 319 ? 42.787  51.562 18.637  1.00 82.86  ? 320  ASP A CB  1 
ATOM   2434 C CG  . ASP A 1 319 ? 43.723  52.747 18.546  1.00 91.81  ? 320  ASP A CG  1 
ATOM   2435 O OD1 . ASP A 1 319 ? 43.718  53.577 19.477  1.00 101.83 ? 320  ASP A OD1 1 
ATOM   2436 O OD2 . ASP A 1 319 ? 44.462  52.854 17.545  1.00 93.54  ? 320  ASP A OD2 1 
ATOM   2437 N N   . PHE A 1 320 ? 45.906  50.013 18.256  1.00 72.96  ? 321  PHE A N   1 
ATOM   2438 C CA  . PHE A 1 320 ? 47.218  49.676 18.794  1.00 69.87  ? 321  PHE A CA  1 
ATOM   2439 C C   . PHE A 1 320 ? 48.258  50.757 18.517  1.00 71.75  ? 321  PHE A C   1 
ATOM   2440 O O   . PHE A 1 320 ? 49.452  50.465 18.437  1.00 76.02  ? 321  PHE A O   1 
ATOM   2441 C CB  . PHE A 1 320 ? 47.684  48.331 18.241  1.00 66.01  ? 321  PHE A CB  1 
ATOM   2442 C CG  . PHE A 1 320 ? 46.717  47.208 18.488  1.00 61.09  ? 321  PHE A CG  1 
ATOM   2443 C CD1 . PHE A 1 320 ? 46.735  46.510 19.686  1.00 53.41  ? 321  PHE A CD1 1 
ATOM   2444 C CD2 . PHE A 1 320 ? 45.788  46.852 17.523  1.00 58.65  ? 321  PHE A CD2 1 
ATOM   2445 C CE1 . PHE A 1 320 ? 45.846  45.476 19.916  1.00 50.07  ? 321  PHE A CE1 1 
ATOM   2446 C CE2 . PHE A 1 320 ? 44.893  45.820 17.748  1.00 56.16  ? 321  PHE A CE2 1 
ATOM   2447 C CZ  . PHE A 1 320 ? 44.924  45.129 18.946  1.00 51.92  ? 321  PHE A CZ  1 
ATOM   2448 N N   . HIS A 1 321 ? 47.828  52.008 18.372  1.00 71.53  ? 322  HIS A N   1 
ATOM   2449 C CA  . HIS A 1 321 ? 48.782  53.101 18.249  1.00 73.21  ? 322  HIS A CA  1 
ATOM   2450 C C   . HIS A 1 321 ? 49.579  53.252 19.540  1.00 75.09  ? 322  HIS A C   1 
ATOM   2451 O O   . HIS A 1 321 ? 49.050  53.078 20.642  1.00 69.48  ? 322  HIS A O   1 
ATOM   2452 C CB  . HIS A 1 321 ? 48.065  54.408 17.910  1.00 79.52  ? 322  HIS A CB  1 
ATOM   2453 C CG  . HIS A 1 321 ? 47.688  54.534 16.466  1.00 84.85  ? 322  HIS A CG  1 
ATOM   2454 N ND1 . HIS A 1 321 ? 46.445  54.181 15.985  1.00 85.10  ? 322  HIS A ND1 1 
ATOM   2455 C CD2 . HIS A 1 321 ? 48.394  54.972 15.396  1.00 87.83  ? 322  HIS A CD2 1 
ATOM   2456 C CE1 . HIS A 1 321 ? 46.400  54.400 14.683  1.00 86.59  ? 322  HIS A CE1 1 
ATOM   2457 N NE2 . HIS A 1 321 ? 47.571  54.878 14.301  1.00 89.45  ? 322  HIS A NE2 1 
ATOM   2458 N N   . GLY A 1 322 ? 50.864  53.569 19.398  1.00 77.77  ? 323  GLY A N   1 
ATOM   2459 C CA  . GLY A 1 322 ? 51.751  53.661 20.539  1.00 70.23  ? 323  GLY A CA  1 
ATOM   2460 C C   . GLY A 1 322 ? 52.338  52.346 20.996  1.00 67.69  ? 323  GLY A C   1 
ATOM   2461 O O   . GLY A 1 322 ? 53.012  52.312 22.032  1.00 67.65  ? 323  GLY A O   1 
ATOM   2462 N N   . LEU A 1 323 ? 52.111  51.265 20.256  1.00 63.76  ? 324  LEU A N   1 
ATOM   2463 C CA  . LEU A 1 323 ? 52.572  49.935 20.623  1.00 62.20  ? 324  LEU A CA  1 
ATOM   2464 C C   . LEU A 1 323 ? 53.566  49.427 19.589  1.00 58.99  ? 324  LEU A C   1 
ATOM   2465 O O   . LEU A 1 323 ? 53.356  49.590 18.383  1.00 62.78  ? 324  LEU A O   1 
ATOM   2466 C CB  . LEU A 1 323 ? 51.394  48.964 20.734  1.00 57.75  ? 324  LEU A CB  1 
ATOM   2467 C CG  . LEU A 1 323 ? 51.733  47.480 20.858  1.00 56.01  ? 324  LEU A CG  1 
ATOM   2468 C CD1 . LEU A 1 323 ? 52.364  47.183 22.212  1.00 58.02  ? 324  LEU A CD1 1 
ATOM   2469 C CD2 . LEU A 1 323 ? 50.493  46.629 20.628  1.00 52.86  ? 324  LEU A CD2 1 
ATOM   2470 N N   . GLN A 1 324 ? 54.651  48.821 20.064  1.00 58.61  ? 325  GLN A N   1 
ATOM   2471 C CA  . GLN A 1 324 ? 55.627  48.158 19.209  1.00 53.72  ? 325  GLN A CA  1 
ATOM   2472 C C   . GLN A 1 324 ? 55.622  46.673 19.534  1.00 48.40  ? 325  GLN A C   1 
ATOM   2473 O O   . GLN A 1 324 ? 55.649  46.293 20.709  1.00 50.68  ? 325  GLN A O   1 
ATOM   2474 C CB  . GLN A 1 324 ? 57.034  48.737 19.391  1.00 57.36  ? 325  GLN A CB  1 
ATOM   2475 C CG  . GLN A 1 324 ? 57.163  50.218 19.058  1.00 60.55  ? 325  GLN A CG  1 
ATOM   2476 C CD  . GLN A 1 324 ? 56.741  51.110 20.211  1.00 67.51  ? 325  GLN A CD  1 
ATOM   2477 O OE1 . GLN A 1 324 ? 56.997  50.800 21.374  1.00 66.30  ? 325  GLN A OE1 1 
ATOM   2478 N NE2 . GLN A 1 324 ? 56.091  52.223 19.893  1.00 74.94  ? 325  GLN A NE2 1 
ATOM   2479 N N   . VAL A 1 325 ? 55.579  45.841 18.497  1.00 46.72  ? 326  VAL A N   1 
ATOM   2480 C CA  . VAL A 1 325 ? 55.493  44.394 18.641  1.00 46.29  ? 326  VAL A CA  1 
ATOM   2481 C C   . VAL A 1 325 ? 56.546  43.752 17.751  1.00 50.00  ? 326  VAL A C   1 
ATOM   2482 O O   . VAL A 1 325 ? 56.803  44.220 16.636  1.00 49.49  ? 326  VAL A O   1 
ATOM   2483 C CB  . VAL A 1 325 ? 54.089  43.862 18.278  1.00 53.52  ? 326  VAL A CB  1 
ATOM   2484 C CG1 . VAL A 1 325 ? 53.972  42.391 18.617  1.00 53.18  ? 326  VAL A CG1 1 
ATOM   2485 C CG2 . VAL A 1 325 ? 53.015  44.646 18.995  1.00 61.35  ? 326  VAL A CG2 1 
ATOM   2486 N N   . LEU A 1 326 ? 57.150  42.676 18.247  1.00 46.95  ? 327  LEU A N   1 
ATOM   2487 C CA  . LEU A 1 326 ? 58.125  41.886 17.507  1.00 42.71  ? 327  LEU A CA  1 
ATOM   2488 C C   . LEU A 1 326 ? 57.642  40.444 17.502  1.00 45.46  ? 327  LEU A C   1 
ATOM   2489 O O   . LEU A 1 326 ? 57.511  39.831 18.565  1.00 45.09  ? 327  LEU A O   1 
ATOM   2490 C CB  . LEU A 1 326 ? 59.512  42.003 18.147  1.00 47.49  ? 327  LEU A CB  1 
ATOM   2491 C CG  . LEU A 1 326 ? 60.630  41.066 17.694  1.00 50.80  ? 327  LEU A CG  1 
ATOM   2492 C CD1 . LEU A 1 326 ? 60.984  41.321 16.250  1.00 51.60  ? 327  LEU A CD1 1 
ATOM   2493 C CD2 . LEU A 1 326 ? 61.853  41.233 18.583  1.00 49.38  ? 327  LEU A CD2 1 
ATOM   2494 N N   . VAL A 1 327 ? 57.353  39.907 16.314  1.00 45.93  ? 328  VAL A N   1 
ATOM   2495 C CA  . VAL A 1 327 ? 56.792  38.568 16.180  1.00 45.67  ? 328  VAL A CA  1 
ATOM   2496 C C   . VAL A 1 327 ? 57.662  37.756 15.233  1.00 48.60  ? 328  VAL A C   1 
ATOM   2497 O O   . VAL A 1 327 ? 58.428  38.299 14.435  1.00 56.98  ? 328  VAL A O   1 
ATOM   2498 C CB  . VAL A 1 327 ? 55.334  38.588 15.674  1.00 48.21  ? 328  VAL A CB  1 
ATOM   2499 C CG1 . VAL A 1 327 ? 54.480  39.483 16.551  1.00 45.88  ? 328  VAL A CG1 1 
ATOM   2500 C CG2 . VAL A 1 327 ? 55.277  39.044 14.216  1.00 44.76  ? 328  VAL A CG2 1 
ATOM   2501 N N   . GLY A 1 328 ? 57.529  36.439 15.319  1.00 41.30  ? 329  GLY A N   1 
ATOM   2502 C CA  . GLY A 1 328 ? 58.304  35.583 14.442  1.00 43.77  ? 329  GLY A CA  1 
ATOM   2503 C C   . GLY A 1 328 ? 58.023  34.122 14.698  1.00 42.27  ? 329  GLY A C   1 
ATOM   2504 O O   . GLY A 1 328 ? 57.299  33.752 15.628  1.00 41.86  ? 329  GLY A O   1 
ATOM   2505 N N   . VAL A 1 329 ? 58.609  33.291 13.835  1.00 39.78  ? 330  VAL A N   1 
ATOM   2506 C CA  . VAL A 1 329 ? 58.463  31.843 13.877  1.00 37.79  ? 330  VAL A CA  1 
ATOM   2507 C C   . VAL A 1 329 ? 59.815  31.222 13.555  1.00 41.33  ? 330  VAL A C   1 
ATOM   2508 O O   . VAL A 1 329 ? 60.727  31.887 13.059  1.00 45.42  ? 330  VAL A O   1 
ATOM   2509 C CB  . VAL A 1 329 ? 57.396  31.327 12.879  1.00 40.23  ? 330  VAL A CB  1 
ATOM   2510 C CG1 . VAL A 1 329 ? 56.055  32.016 13.102  1.00 33.54  ? 330  VAL A CG1 1 
ATOM   2511 C CG2 . VAL A 1 329 ? 57.871  31.538 11.445  1.00 40.34  ? 330  VAL A CG2 1 
ATOM   2512 N N   . VAL A 1 330 ? 59.940  29.928 13.848  1.00 37.31  ? 331  VAL A N   1 
ATOM   2513 C CA  . VAL A 1 330 ? 61.095  29.167 13.383  1.00 38.34  ? 331  VAL A CA  1 
ATOM   2514 C C   . VAL A 1 330 ? 60.776  28.644 11.989  1.00 41.63  ? 331  VAL A C   1 
ATOM   2515 O O   . VAL A 1 330 ? 59.641  28.767 11.514  1.00 40.16  ? 331  VAL A O   1 
ATOM   2516 C CB  . VAL A 1 330 ? 61.459  28.016 14.338  1.00 38.39  ? 331  VAL A CB  1 
ATOM   2517 C CG1 . VAL A 1 330 ? 61.768  28.551 15.739  1.00 37.90  ? 331  VAL A CG1 1 
ATOM   2518 C CG2 . VAL A 1 330 ? 60.344  26.982 14.373  1.00 36.05  ? 331  VAL A CG2 1 
ATOM   2519 N N   . LYS A 1 331 ? 61.768  28.040 11.332  1.00 40.56  ? 332  LYS A N   1 
ATOM   2520 C CA  . LYS A 1 331 ? 61.598  27.640 9.939   1.00 39.59  ? 332  LYS A CA  1 
ATOM   2521 C C   . LYS A 1 331 ? 60.699  26.416 9.794   1.00 47.95  ? 332  LYS A C   1 
ATOM   2522 O O   . LYS A 1 331 ? 59.996  26.284 8.785   1.00 44.33  ? 332  LYS A O   1 
ATOM   2523 C CB  . LYS A 1 331 ? 62.964  27.376 9.308   1.00 42.12  ? 332  LYS A CB  1 
ATOM   2524 C CG  . LYS A 1 331 ? 62.918  27.059 7.822   1.00 41.69  ? 332  LYS A CG  1 
ATOM   2525 C CD  . LYS A 1 331 ? 64.318  26.874 7.261   1.00 58.51  ? 332  LYS A CD  1 
ATOM   2526 C CE  . LYS A 1 331 ? 64.309  25.924 6.073   1.00 73.87  ? 332  LYS A CE  1 
ATOM   2527 N NZ  . LYS A 1 331 ? 63.879  24.557 6.483   1.00 83.49  ? 332  LYS A NZ  1 
ATOM   2528 N N   . ASP A 1 332 ? 60.699  25.512 10.777  1.00 47.78  ? 333  ASP A N   1 
ATOM   2529 C CA  . ASP A 1 332 ? 59.910  24.276 10.709  1.00 45.25  ? 333  ASP A CA  1 
ATOM   2530 C C   . ASP A 1 332 ? 59.095  24.148 11.994  1.00 47.56  ? 333  ASP A C   1 
ATOM   2531 O O   . ASP A 1 332 ? 59.424  23.359 12.883  1.00 46.59  ? 333  ASP A O   1 
ATOM   2532 C CB  . ASP A 1 332 ? 60.815  23.075 10.480  1.00 45.95  ? 333  ASP A CB  1 
ATOM   2533 C CG  . ASP A 1 332 ? 61.620  23.197 9.200   1.00 54.18  ? 333  ASP A CG  1 
ATOM   2534 O OD1 . ASP A 1 332 ? 61.059  22.919 8.120   1.00 58.53  ? 333  ASP A OD1 1 
ATOM   2535 O OD2 . ASP A 1 332 ? 62.807  23.580 9.272   1.00 55.11  ? 333  ASP A OD2 1 
ATOM   2536 N N   . GLU A 1 333 ? 58.011  24.923 12.075  1.00 42.07  ? 334  GLU A N   1 
ATOM   2537 C CA  . GLU A 1 333 ? 57.203  24.952 13.289  1.00 44.89  ? 334  GLU A CA  1 
ATOM   2538 C C   . GLU A 1 333 ? 56.532  23.612 13.567  1.00 47.51  ? 334  GLU A C   1 
ATOM   2539 O O   . GLU A 1 333 ? 56.329  23.254 14.733  1.00 42.57  ? 334  GLU A O   1 
ATOM   2540 C CB  . GLU A 1 333 ? 56.146  26.054 13.189  1.00 43.14  ? 334  GLU A CB  1 
ATOM   2541 C CG  . GLU A 1 333 ? 56.694  27.468 13.291  1.00 46.01  ? 334  GLU A CG  1 
ATOM   2542 C CD  . GLU A 1 333 ? 57.067  27.851 14.718  1.00 51.35  ? 334  GLU A CD  1 
ATOM   2543 O OE1 . GLU A 1 333 ? 56.780  27.066 15.649  1.00 45.75  ? 334  GLU A OE1 1 
ATOM   2544 O OE2 . GLU A 1 333 ? 57.651  28.938 14.909  1.00 47.42  ? 334  GLU A OE2 1 
ATOM   2545 N N   . GLY A 1 334 ? 56.191  22.857 12.525  1.00 40.41  ? 335  GLY A N   1 
ATOM   2546 C CA  . GLY A 1 334 ? 55.344  21.692 12.696  1.00 38.46  ? 335  GLY A CA  1 
ATOM   2547 C C   . GLY A 1 334 ? 56.025  20.387 13.062  1.00 41.58  ? 335  GLY A C   1 
ATOM   2548 O O   . GLY A 1 334 ? 55.387  19.505 13.646  1.00 43.32  ? 335  GLY A O   1 
ATOM   2549 N N   . SER A 1 335 ? 57.315  20.252 12.738  1.00 41.35  ? 336  SER A N   1 
ATOM   2550 C CA  . SER A 1 335 ? 57.972  18.948 12.818  1.00 45.81  ? 336  SER A CA  1 
ATOM   2551 C C   . SER A 1 335 ? 58.002  18.409 14.246  1.00 47.55  ? 336  SER A C   1 
ATOM   2552 O O   . SER A 1 335 ? 57.730  17.223 14.474  1.00 47.03  ? 336  SER A O   1 
ATOM   2553 C CB  . SER A 1 335 ? 59.390  19.043 12.255  1.00 48.30  ? 336  SER A CB  1 
ATOM   2554 O OG  . SER A 1 335 ? 60.194  19.910 13.040  1.00 53.15  ? 336  SER A OG  1 
ATOM   2555 N N   . TYR A 1 336 ? 58.336  19.260 15.219  1.00 45.94  ? 337  TYR A N   1 
ATOM   2556 C CA  . TYR A 1 336 ? 58.447  18.811 16.606  1.00 45.13  ? 337  TYR A CA  1 
ATOM   2557 C C   . TYR A 1 336 ? 57.165  18.153 17.100  1.00 48.57  ? 337  TYR A C   1 
ATOM   2558 O O   . TYR A 1 336 ? 57.218  17.205 17.892  1.00 48.31  ? 337  TYR A O   1 
ATOM   2559 C CB  . TYR A 1 336 ? 58.820  20.000 17.494  1.00 45.96  ? 337  TYR A CB  1 
ATOM   2560 C CG  . TYR A 1 336 ? 58.747  19.761 18.982  1.00 46.91  ? 337  TYR A CG  1 
ATOM   2561 C CD1 . TYR A 1 336 ? 59.711  19.005 19.635  1.00 53.91  ? 337  TYR A CD1 1 
ATOM   2562 C CD2 . TYR A 1 336 ? 57.735  20.329 19.743  1.00 56.66  ? 337  TYR A CD2 1 
ATOM   2563 C CE1 . TYR A 1 336 ? 59.656  18.802 21.004  1.00 55.99  ? 337  TYR A CE1 1 
ATOM   2564 C CE2 . TYR A 1 336 ? 57.671  20.132 21.109  1.00 59.90  ? 337  TYR A CE2 1 
ATOM   2565 C CZ  . TYR A 1 336 ? 58.633  19.368 21.735  1.00 62.03  ? 337  TYR A CZ  1 
ATOM   2566 O OH  . TYR A 1 336 ? 58.568  19.173 23.096  1.00 67.94  ? 337  TYR A OH  1 
ATOM   2567 N N   . PHE A 1 337 ? 56.009  18.619 16.631  1.00 46.14  ? 338  PHE A N   1 
ATOM   2568 C CA  . PHE A 1 337 ? 54.738  18.118 17.134  1.00 45.83  ? 338  PHE A CA  1 
ATOM   2569 C C   . PHE A 1 337 ? 54.318  16.800 16.497  1.00 47.62  ? 338  PHE A C   1 
ATOM   2570 O O   . PHE A 1 337 ? 53.528  16.065 17.099  1.00 49.05  ? 338  PHE A O   1 
ATOM   2571 C CB  . PHE A 1 337 ? 53.655  19.180 16.924  1.00 41.71  ? 338  PHE A CB  1 
ATOM   2572 C CG  . PHE A 1 337 ? 53.937  20.459 17.650  1.00 41.85  ? 338  PHE A CG  1 
ATOM   2573 C CD1 . PHE A 1 337 ? 54.660  21.472 17.044  1.00 38.35  ? 338  PHE A CD1 1 
ATOM   2574 C CD2 . PHE A 1 337 ? 53.515  20.631 18.959  1.00 42.87  ? 338  PHE A CD2 1 
ATOM   2575 C CE1 . PHE A 1 337 ? 54.943  22.645 17.724  1.00 41.59  ? 338  PHE A CE1 1 
ATOM   2576 C CE2 . PHE A 1 337 ? 53.792  21.802 19.645  1.00 39.82  ? 338  PHE A CE2 1 
ATOM   2577 C CZ  . PHE A 1 337 ? 54.508  22.809 19.029  1.00 42.11  ? 338  PHE A CZ  1 
ATOM   2578 N N   . LEU A 1 338 ? 54.843  16.475 15.313  1.00 40.82  ? 339  LEU A N   1 
ATOM   2579 C CA  . LEU A 1 338 ? 54.378  15.291 14.597  1.00 47.72  ? 339  LEU A CA  1 
ATOM   2580 C C   . LEU A 1 338 ? 54.795  13.994 15.284  1.00 48.97  ? 339  LEU A C   1 
ATOM   2581 O O   . LEU A 1 338 ? 54.094  12.983 15.164  1.00 45.36  ? 339  LEU A O   1 
ATOM   2582 C CB  . LEU A 1 338 ? 54.887  15.321 13.156  1.00 42.34  ? 339  LEU A CB  1 
ATOM   2583 C CG  . LEU A 1 338 ? 54.349  16.498 12.340  1.00 45.16  ? 339  LEU A CG  1 
ATOM   2584 C CD1 . LEU A 1 338 ? 54.970  16.539 10.955  1.00 46.34  ? 339  LEU A CD1 1 
ATOM   2585 C CD2 . LEU A 1 338 ? 52.833  16.427 12.250  1.00 43.23  ? 339  LEU A CD2 1 
ATOM   2586 N N   . VAL A 1 339 ? 55.918  13.990 16.010  1.00 45.16  ? 340  VAL A N   1 
ATOM   2587 C CA  . VAL A 1 339 ? 56.355  12.760 16.670  1.00 53.86  ? 340  VAL A CA  1 
ATOM   2588 C C   . VAL A 1 339 ? 55.541  12.436 17.909  1.00 49.98  ? 340  VAL A C   1 
ATOM   2589 O O   . VAL A 1 339 ? 55.785  11.402 18.543  1.00 49.26  ? 340  VAL A O   1 
ATOM   2590 C CB  . VAL A 1 339 ? 57.846  12.820 17.053  1.00 53.33  ? 340  VAL A CB  1 
ATOM   2591 C CG1 . VAL A 1 339 ? 58.685  12.985 15.812  1.00 48.22  ? 340  VAL A CG1 1 
ATOM   2592 C CG2 . VAL A 1 339 ? 58.101  13.948 18.038  1.00 51.21  ? 340  VAL A CG2 1 
ATOM   2593 N N   . TYR A 1 340 ? 54.571  13.275 18.268  1.00 49.24  ? 341  TYR A N   1 
ATOM   2594 C CA  . TYR A 1 340 ? 53.718  13.036 19.424  1.00 52.68  ? 341  TYR A CA  1 
ATOM   2595 C C   . TYR A 1 340 ? 52.320  12.565 19.035  1.00 58.44  ? 341  TYR A C   1 
ATOM   2596 O O   . TYR A 1 340 ? 51.342  12.915 19.704  1.00 64.69  ? 341  TYR A O   1 
ATOM   2597 C CB  . TYR A 1 340 ? 53.634  14.295 20.286  1.00 49.59  ? 341  TYR A CB  1 
ATOM   2598 C CG  . TYR A 1 340 ? 54.861  14.535 21.137  1.00 48.61  ? 341  TYR A CG  1 
ATOM   2599 C CD1 . TYR A 1 340 ? 55.024  13.877 22.350  1.00 52.19  ? 341  TYR A CD1 1 
ATOM   2600 C CD2 . TYR A 1 340 ? 55.857  15.414 20.730  1.00 43.96  ? 341  TYR A CD2 1 
ATOM   2601 C CE1 . TYR A 1 340 ? 56.136  14.096 23.142  1.00 49.62  ? 341  TYR A CE1 1 
ATOM   2602 C CE2 . TYR A 1 340 ? 56.980  15.633 21.511  1.00 53.27  ? 341  TYR A CE2 1 
ATOM   2603 C CZ  . TYR A 1 340 ? 57.113  14.969 22.716  1.00 53.45  ? 341  TYR A CZ  1 
ATOM   2604 O OH  . TYR A 1 340 ? 58.223  15.179 23.497  1.00 54.84  ? 341  TYR A OH  1 
ATOM   2605 N N   . GLY A 1 341 ? 52.198  11.775 17.969  1.00 58.53  ? 342  GLY A N   1 
ATOM   2606 C CA  . GLY A 1 341 ? 50.901  11.218 17.634  1.00 60.63  ? 342  GLY A CA  1 
ATOM   2607 C C   . GLY A 1 341 ? 50.644  10.946 16.167  1.00 63.43  ? 342  GLY A C   1 
ATOM   2608 O O   . GLY A 1 341 ? 49.878  10.036 15.834  1.00 71.00  ? 342  GLY A O   1 
ATOM   2609 N N   . ALA A 1 342 ? 51.258  11.722 15.281  1.00 58.10  ? 343  ALA A N   1 
ATOM   2610 C CA  . ALA A 1 342 ? 51.007  11.556 13.856  1.00 53.78  ? 343  ALA A CA  1 
ATOM   2611 C C   . ALA A 1 342 ? 51.485  10.180 13.400  1.00 52.99  ? 343  ALA A C   1 
ATOM   2612 O O   . ALA A 1 342 ? 52.641  9.814  13.657  1.00 49.05  ? 343  ALA A O   1 
ATOM   2613 C CB  . ALA A 1 342 ? 51.701  12.653 13.052  1.00 50.90  ? 343  ALA A CB  1 
ATOM   2614 N N   . PRO A 1 343 ? 50.637  9.391  12.741  1.00 50.80  ? 344  PRO A N   1 
ATOM   2615 C CA  . PRO A 1 343 ? 51.042  8.035  12.348  1.00 54.09  ? 344  PRO A CA  1 
ATOM   2616 C C   . PRO A 1 343 ? 52.215  8.057  11.379  1.00 56.65  ? 344  PRO A C   1 
ATOM   2617 O O   . PRO A 1 343 ? 52.236  8.826  10.414  1.00 51.76  ? 344  PRO A O   1 
ATOM   2618 C CB  . PRO A 1 343 ? 49.775  7.460  11.699  1.00 49.39  ? 344  PRO A CB  1 
ATOM   2619 C CG  . PRO A 1 343 ? 48.949  8.651  11.331  1.00 49.57  ? 344  PRO A CG  1 
ATOM   2620 C CD  . PRO A 1 343 ? 49.241  9.683  12.377  1.00 50.10  ? 344  PRO A CD  1 
ATOM   2621 N N   . GLY A 1 344 ? 53.205  7.210  11.656  1.00 59.79  ? 345  GLY A N   1 
ATOM   2622 C CA  . GLY A 1 344 ? 54.376  7.076  10.818  1.00 56.31  ? 345  GLY A CA  1 
ATOM   2623 C C   . GLY A 1 344 ? 55.551  7.955  11.189  1.00 58.48  ? 345  GLY A C   1 
ATOM   2624 O O   . GLY A 1 344 ? 56.604  7.851  10.547  1.00 62.47  ? 345  GLY A O   1 
ATOM   2625 N N   . PHE A 1 345 ? 55.419  8.807  12.201  1.00 53.46  ? 346  PHE A N   1 
ATOM   2626 C CA  . PHE A 1 345 ? 56.460  9.764  12.545  1.00 54.90  ? 346  PHE A CA  1 
ATOM   2627 C C   . PHE A 1 345 ? 57.256  9.302  13.757  1.00 59.62  ? 346  PHE A C   1 
ATOM   2628 O O   . PHE A 1 345 ? 56.700  8.763  14.718  1.00 64.39  ? 346  PHE A O   1 
ATOM   2629 C CB  . PHE A 1 345 ? 55.865  11.147 12.812  1.00 50.07  ? 346  PHE A CB  1 
ATOM   2630 C CG  . PHE A 1 345 ? 55.554  11.913 11.564  1.00 51.81  ? 346  PHE A CG  1 
ATOM   2631 C CD1 . PHE A 1 345 ? 56.479  12.796 11.031  1.00 48.78  ? 346  PHE A CD1 1 
ATOM   2632 C CD2 . PHE A 1 345 ? 54.347  11.738 10.911  1.00 49.13  ? 346  PHE A CD2 1 
ATOM   2633 C CE1 . PHE A 1 345 ? 56.201  13.497 9.875   1.00 49.15  ? 346  PHE A CE1 1 
ATOM   2634 C CE2 . PHE A 1 345 ? 54.062  12.437 9.754   1.00 54.48  ? 346  PHE A CE2 1 
ATOM   2635 C CZ  . PHE A 1 345 ? 54.990  13.318 9.235   1.00 53.31  ? 346  PHE A CZ  1 
ATOM   2636 N N   . SER A 1 346 ? 58.565  9.525  13.700  1.00 60.31  ? 347  SER A N   1 
ATOM   2637 C CA  . SER A 1 346 ? 59.464  9.216  14.799  1.00 59.56  ? 347  SER A CA  1 
ATOM   2638 C C   . SER A 1 346 ? 60.734  10.028 14.615  1.00 56.29  ? 347  SER A C   1 
ATOM   2639 O O   . SER A 1 346 ? 61.133  10.328 13.487  1.00 53.91  ? 347  SER A O   1 
ATOM   2640 C CB  . SER A 1 346 ? 59.791  7.720  14.860  1.00 63.18  ? 347  SER A CB  1 
ATOM   2641 O OG  . SER A 1 346 ? 60.791  7.455  15.829  1.00 70.04  ? 347  SER A OG  1 
ATOM   2642 N N   . LYS A 1 347 ? 61.363  10.389 15.734  1.00 52.93  ? 348  LYS A N   1 
ATOM   2643 C CA  . LYS A 1 347 ? 62.662  11.039 15.639  1.00 47.83  ? 348  LYS A CA  1 
ATOM   2644 C C   . LYS A 1 347 ? 63.761  10.066 15.243  1.00 48.03  ? 348  LYS A C   1 
ATOM   2645 O O   . LYS A 1 347 ? 64.849  10.508 14.857  1.00 52.21  ? 348  LYS A O   1 
ATOM   2646 C CB  . LYS A 1 347 ? 63.026  11.710 16.965  1.00 52.07  ? 348  LYS A CB  1 
ATOM   2647 C CG  . LYS A 1 347 ? 63.706  10.788 17.970  1.00 48.88  ? 348  LYS A CG  1 
ATOM   2648 C CD  . LYS A 1 347 ? 64.141  11.557 19.211  1.00 54.44  ? 348  LYS A CD  1 
ATOM   2649 C CE  . LYS A 1 347 ? 64.860  10.661 20.208  1.00 48.33  ? 348  LYS A CE  1 
ATOM   2650 N NZ  . LYS A 1 347 ? 66.189  10.215 19.701  1.00 51.36  ? 348  LYS A NZ  1 
ATOM   2651 N N   . ASP A 1 348 ? 63.500  8.760  15.311  1.00 48.35  ? 349  ASP A N   1 
ATOM   2652 C CA  . ASP A 1 348 ? 64.537  7.757  15.126  1.00 49.77  ? 349  ASP A CA  1 
ATOM   2653 C C   . ASP A 1 348 ? 64.604  7.194  13.712  1.00 60.23  ? 349  ASP A C   1 
ATOM   2654 O O   . ASP A 1 348 ? 65.608  6.562  13.367  1.00 69.85  ? 349  ASP A O   1 
ATOM   2655 C CB  . ASP A 1 348 ? 64.343  6.612  16.127  1.00 57.18  ? 349  ASP A CB  1 
ATOM   2656 C CG  . ASP A 1 348 ? 64.551  7.057  17.568  1.00 66.44  ? 349  ASP A CG  1 
ATOM   2657 O OD1 . ASP A 1 348 ? 65.434  7.910  17.809  1.00 64.32  ? 349  ASP A OD1 1 
ATOM   2658 O OD2 . ASP A 1 348 ? 63.830  6.558  18.458  1.00 72.57  ? 349  ASP A OD2 1 
ATOM   2659 N N   . ASN A 1 349 ? 63.578  7.395  12.891  1.00 60.66  ? 350  ASN A N   1 
ATOM   2660 C CA  . ASN A 1 349 ? 63.677  7.112  11.463  1.00 62.18  ? 350  ASN A CA  1 
ATOM   2661 C C   . ASN A 1 349 ? 63.351  8.382  10.679  1.00 62.97  ? 350  ASN A C   1 
ATOM   2662 O O   . ASN A 1 349 ? 63.105  9.447  11.252  1.00 62.30  ? 350  ASN A O   1 
ATOM   2663 C CB  . ASN A 1 349 ? 62.798  5.917  11.053  1.00 58.82  ? 350  ASN A CB  1 
ATOM   2664 C CG  . ASN A 1 349 ? 61.305  6.118  11.322  1.00 68.44  ? 350  ASN A CG  1 
ATOM   2665 O OD1 . ASN A 1 349 ? 60.784  7.232  11.288  1.00 70.81  ? 350  ASN A OD1 1 
ATOM   2666 N ND2 . ASN A 1 349 ? 60.610  5.005  11.581  1.00 85.53  ? 350  ASN A ND2 1 
ATOM   2667 N N   . GLU A 1 350 ? 63.367  8.267  9.352   1.00 59.28  ? 351  GLU A N   1 
ATOM   2668 C CA  A GLU A 1 350 ? 63.184  9.420  8.480   0.66 57.13  ? 351  GLU A CA  1 
ATOM   2669 C CA  B GLU A 1 350 ? 63.190  9.436  8.501   0.34 57.58  ? 351  GLU A CA  1 
ATOM   2670 C C   . GLU A 1 350 ? 61.733  9.870  8.372   1.00 56.03  ? 351  GLU A C   1 
ATOM   2671 O O   . GLU A 1 350 ? 61.475  10.932 7.794   1.00 55.67  ? 351  GLU A O   1 
ATOM   2672 C CB  A GLU A 1 350 ? 63.732  9.113  7.084   0.66 60.38  ? 351  GLU A CB  1 
ATOM   2673 C CB  B GLU A 1 350 ? 63.784  9.167  7.115   0.34 60.58  ? 351  GLU A CB  1 
ATOM   2674 C CG  A GLU A 1 350 ? 65.249  9.010  7.019   0.66 63.59  ? 351  GLU A CG  1 
ATOM   2675 C CG  B GLU A 1 350 ? 64.264  10.422 6.399   0.34 62.72  ? 351  GLU A CG  1 
ATOM   2676 C CD  A GLU A 1 350 ? 65.939  10.248 7.565   0.66 70.40  ? 351  GLU A CD  1 
ATOM   2677 C CD  B GLU A 1 350 ? 65.066  10.121 5.148   0.34 68.36  ? 351  GLU A CD  1 
ATOM   2678 O OE1 A GLU A 1 350 ? 66.265  10.270 8.772   0.66 70.67  ? 351  GLU A OE1 1 
ATOM   2679 O OE1 B GLU A 1 350 ? 65.658  9.024  5.068   0.34 68.82  ? 351  GLU A OE1 1 
ATOM   2680 O OE2 A GLU A 1 350 ? 66.146  11.205 6.790   0.66 75.15  ? 351  GLU A OE2 1 
ATOM   2681 O OE2 B GLU A 1 350 ? 65.102  10.984 4.246   0.34 69.55  ? 351  GLU A OE2 1 
ATOM   2682 N N   . SER A 1 351 ? 60.786  9.091  8.902   1.00 48.80  ? 352  SER A N   1 
ATOM   2683 C CA  . SER A 1 351 ? 59.367  9.462  8.908   1.00 46.27  ? 352  SER A CA  1 
ATOM   2684 C C   . SER A 1 351 ? 58.849  9.751  7.499   1.00 50.26  ? 352  SER A C   1 
ATOM   2685 O O   . SER A 1 351 ? 58.106  10.709 7.274   1.00 47.22  ? 352  SER A O   1 
ATOM   2686 C CB  . SER A 1 351 ? 59.114  10.657 9.831   1.00 45.04  ? 352  SER A CB  1 
ATOM   2687 O OG  . SER A 1 351 ? 59.449  10.351 11.174  1.00 49.86  ? 352  SER A OG  1 
ATOM   2688 N N   . LEU A 1 352 ? 59.248  8.922  6.539   1.00 49.16  ? 353  LEU A N   1 
ATOM   2689 C CA  . LEU A 1 352 ? 58.748  9.039  5.171   1.00 51.54  ? 353  LEU A CA  1 
ATOM   2690 C C   . LEU A 1 352 ? 57.401  8.333  5.114   1.00 53.61  ? 353  LEU A C   1 
ATOM   2691 O O   . LEU A 1 352 ? 57.311  7.126  4.896   1.00 60.90  ? 353  LEU A O   1 
ATOM   2692 C CB  . LEU A 1 352 ? 59.743  8.458  4.175   1.00 50.68  ? 353  LEU A CB  1 
ATOM   2693 C CG  . LEU A 1 352 ? 61.181  8.958  4.303   1.00 51.74  ? 353  LEU A CG  1 
ATOM   2694 C CD1 . LEU A 1 352 ? 62.153  8.010  3.597   1.00 47.39  ? 353  LEU A CD1 1 
ATOM   2695 C CD2 . LEU A 1 352 ? 61.288  10.395 3.783   1.00 50.29  ? 353  LEU A CD2 1 
ATOM   2696 N N   . ILE A 1 353 ? 56.337  9.101  5.320   1.00 55.45  ? 354  ILE A N   1 
ATOM   2697 C CA  . ILE A 1 353 ? 55.017  8.516  5.504   1.00 50.32  ? 354  ILE A CA  1 
ATOM   2698 C C   . ILE A 1 353 ? 54.393  8.177  4.155   1.00 56.78  ? 354  ILE A C   1 
ATOM   2699 O O   . ILE A 1 353 ? 54.751  8.726  3.109   1.00 53.54  ? 354  ILE A O   1 
ATOM   2700 C CB  . ILE A 1 353 ? 54.115  9.464  6.309   1.00 48.56  ? 354  ILE A CB  1 
ATOM   2701 C CG1 . ILE A 1 353 ? 54.026  10.819 5.602   1.00 48.43  ? 354  ILE A CG1 1 
ATOM   2702 C CG2 . ILE A 1 353 ? 54.658  9.624  7.715   1.00 40.85  ? 354  ILE A CG2 1 
ATOM   2703 C CD1 . ILE A 1 353 ? 52.981  11.743 6.164   1.00 36.16  ? 354  ILE A CD1 1 
ATOM   2704 N N   . SER A 1 354 ? 53.448  7.245  4.190   1.00 57.28  ? 355  SER A N   1 
ATOM   2705 C CA  . SER A 1 354 ? 52.617  6.981  3.036   1.00 58.90  ? 355  SER A CA  1 
ATOM   2706 C C   . SER A 1 354 ? 51.520  8.035  2.940   1.00 61.18  ? 355  SER A C   1 
ATOM   2707 O O   . SER A 1 354 ? 51.321  8.859  3.838   1.00 58.18  ? 355  SER A O   1 
ATOM   2708 C CB  . SER A 1 354 ? 51.997  5.586  3.112   1.00 59.42  ? 355  SER A CB  1 
ATOM   2709 O OG  . SER A 1 354 ? 50.994  5.533  4.111   1.00 58.66  ? 355  SER A OG  1 
ATOM   2710 N N   . ARG A 1 355 ? 50.794  7.993  1.828   1.00 58.10  ? 356  ARG A N   1 
ATOM   2711 C CA  . ARG A 1 355 ? 49.694  8.925  1.639   1.00 54.52  ? 356  ARG A CA  1 
ATOM   2712 C C   . ARG A 1 355 ? 48.548  8.633  2.596   1.00 50.30  ? 356  ARG A C   1 
ATOM   2713 O O   . ARG A 1 355 ? 47.899  9.557  3.101   1.00 49.66  ? 356  ARG A O   1 
ATOM   2714 C CB  . ARG A 1 355 ? 49.210  8.863  0.200   1.00 58.36  ? 356  ARG A CB  1 
ATOM   2715 C CG  . ARG A 1 355 ? 47.986  9.708  0.000   1.00 62.56  ? 356  ARG A CG  1 
ATOM   2716 C CD  . ARG A 1 355 ? 48.178  10.683 -1.143  1.00 70.45  ? 356  ARG A CD  1 
ATOM   2717 N NE  . ARG A 1 355 ? 46.997  11.496 -1.373  1.00 69.32  ? 356  ARG A NE  1 
ATOM   2718 C CZ  . ARG A 1 355 ? 47.027  12.815 -1.475  1.00 55.98  ? 356  ARG A CZ  1 
ATOM   2719 N NH1 . ARG A 1 355 ? 48.160  13.515 -1.363  1.00 47.11  ? 356  ARG A NH1 1 
ATOM   2720 N NH2 . ARG A 1 355 ? 45.898  13.487 -1.669  1.00 52.59  ? 356  ARG A NH2 1 
ATOM   2721 N N   . ALA A 1 356 ? 48.263  7.353  2.821   1.00 50.11  ? 357  ALA A N   1 
ATOM   2722 C CA  . ALA A 1 356 ? 47.275  6.974  3.821   1.00 55.57  ? 357  ALA A CA  1 
ATOM   2723 C C   . ALA A 1 356 ? 47.626  7.557  5.183   1.00 52.85  ? 357  ALA A C   1 
ATOM   2724 O O   . ALA A 1 356 ? 46.753  8.062  5.896   1.00 59.06  ? 357  ALA A O   1 
ATOM   2725 C CB  . ALA A 1 356 ? 47.172  5.450  3.893   1.00 56.64  ? 357  ALA A CB  1 
ATOM   2726 N N   . GLU A 1 357 ? 48.907  7.507  5.554   1.00 51.95  ? 358  GLU A N   1 
ATOM   2727 C CA  . GLU A 1 357 ? 49.329  8.106  6.814   1.00 52.13  ? 358  GLU A CA  1 
ATOM   2728 C C   . GLU A 1 357 ? 49.223  9.625  6.771   1.00 53.48  ? 358  GLU A C   1 
ATOM   2729 O O   . GLU A 1 357 ? 48.928  10.254 7.795   1.00 46.65  ? 358  GLU A O   1 
ATOM   2730 C CB  . GLU A 1 357 ? 50.756  7.670  7.145   1.00 51.95  ? 358  GLU A CB  1 
ATOM   2731 C CG  . GLU A 1 357 ? 50.887  6.173  7.397   1.00 60.59  ? 358  GLU A CG  1 
ATOM   2732 C CD  . GLU A 1 357 ? 52.324  5.725  7.590   1.00 65.36  ? 358  GLU A CD  1 
ATOM   2733 O OE1 . GLU A 1 357 ? 53.224  6.316  6.960   1.00 63.60  ? 358  GLU A OE1 1 
ATOM   2734 O OE2 . GLU A 1 357 ? 52.552  4.782  8.377   1.00 72.00  ? 358  GLU A OE2 1 
ATOM   2735 N N   . PHE A 1 358 ? 49.442  10.226 5.599   1.00 51.63  ? 359  PHE A N   1 
ATOM   2736 C CA  . PHE A 1 358 ? 49.297  11.672 5.466   1.00 45.24  ? 359  PHE A CA  1 
ATOM   2737 C C   . PHE A 1 358 ? 47.854  12.099 5.696   1.00 44.53  ? 359  PHE A C   1 
ATOM   2738 O O   . PHE A 1 358 ? 47.584  13.029 6.466   1.00 41.17  ? 359  PHE A O   1 
ATOM   2739 C CB  . PHE A 1 358 ? 49.784  12.115 4.086   1.00 49.36  ? 359  PHE A CB  1 
ATOM   2740 C CG  . PHE A 1 358 ? 49.469  13.546 3.758   1.00 44.95  ? 359  PHE A CG  1 
ATOM   2741 C CD1 . PHE A 1 358 ? 50.241  14.575 4.270   1.00 43.22  ? 359  PHE A CD1 1 
ATOM   2742 C CD2 . PHE A 1 358 ? 48.412  13.861 2.919   1.00 47.51  ? 359  PHE A CD2 1 
ATOM   2743 C CE1 . PHE A 1 358 ? 49.955  15.895 3.962   1.00 47.38  ? 359  PHE A CE1 1 
ATOM   2744 C CE2 . PHE A 1 358 ? 48.121  15.177 2.606   1.00 47.73  ? 359  PHE A CE2 1 
ATOM   2745 C CZ  . PHE A 1 358 ? 48.894  16.195 3.128   1.00 45.68  ? 359  PHE A CZ  1 
ATOM   2746 N N   . LEU A 1 359 ? 46.908  11.422 5.037   1.00 43.23  ? 360  LEU A N   1 
ATOM   2747 C CA  . LEU A 1 359 ? 45.497  11.736 5.233   1.00 49.06  ? 360  LEU A CA  1 
ATOM   2748 C C   . LEU A 1 359 ? 45.084  11.521 6.685   1.00 53.87  ? 360  LEU A C   1 
ATOM   2749 O O   . LEU A 1 359 ? 44.340  12.329 7.254   1.00 57.57  ? 360  LEU A O   1 
ATOM   2750 C CB  . LEU A 1 359 ? 44.637  10.889 4.294   1.00 46.82  ? 360  LEU A CB  1 
ATOM   2751 C CG  . LEU A 1 359 ? 45.054  10.874 2.822   1.00 54.02  ? 360  LEU A CG  1 
ATOM   2752 C CD1 . LEU A 1 359 ? 44.287  9.813  2.018   1.00 49.43  ? 360  LEU A CD1 1 
ATOM   2753 C CD2 . LEU A 1 359 ? 44.932  12.274 2.205   1.00 56.98  ? 360  LEU A CD2 1 
ATOM   2754 N N   . ALA A 1 360 ? 45.557  10.435 7.301   1.00 52.89  ? 361  ALA A N   1 
ATOM   2755 C CA  . ALA A 1 360 ? 45.283  10.212 8.716   1.00 52.16  ? 361  ALA A CA  1 
ATOM   2756 C C   . ALA A 1 360 ? 45.924  11.294 9.572   1.00 56.81  ? 361  ALA A C   1 
ATOM   2757 O O   . ALA A 1 360 ? 45.336  11.744 10.562  1.00 57.80  ? 361  ALA A O   1 
ATOM   2758 C CB  . ALA A 1 360 ? 45.779  8.829  9.135   1.00 57.26  ? 361  ALA A CB  1 
ATOM   2759 N N   . GLY A 1 361 ? 47.129  11.731 9.201   1.00 53.97  ? 362  GLY A N   1 
ATOM   2760 C CA  . GLY A 1 361 ? 47.791  12.780 9.955   1.00 47.64  ? 362  GLY A CA  1 
ATOM   2761 C C   . GLY A 1 361 ? 47.073  14.112 9.889   1.00 53.15  ? 362  GLY A C   1 
ATOM   2762 O O   . GLY A 1 361 ? 47.165  14.914 10.821  1.00 50.69  ? 362  GLY A O   1 
ATOM   2763 N N   . VAL A 1 362 ? 46.345  14.365 8.798   1.00 53.71  ? 363  VAL A N   1 
ATOM   2764 C CA  . VAL A 1 362 ? 45.628  15.628 8.662   1.00 49.25  ? 363  VAL A CA  1 
ATOM   2765 C C   . VAL A 1 362 ? 44.537  15.747 9.722   1.00 45.97  ? 363  VAL A C   1 
ATOM   2766 O O   . VAL A 1 362 ? 44.347  16.816 10.315  1.00 49.45  ? 363  VAL A O   1 
ATOM   2767 C CB  . VAL A 1 362 ? 45.060  15.768 7.236   1.00 52.11  ? 363  VAL A CB  1 
ATOM   2768 C CG1 . VAL A 1 362 ? 44.072  16.921 7.161   1.00 45.54  ? 363  VAL A CG1 1 
ATOM   2769 C CG2 . VAL A 1 362 ? 46.191  15.976 6.236   1.00 48.48  ? 363  VAL A CG2 1 
ATOM   2770 N N   . ARG A 1 363 ? 43.805  14.658 9.984   1.00 49.67  ? 364  ARG A N   1 
ATOM   2771 C CA  . ARG A 1 363 ? 42.749  14.713 10.993  1.00 54.15  ? 364  ARG A CA  1 
ATOM   2772 C C   . ARG A 1 363 ? 43.320  14.877 12.395  1.00 53.20  ? 364  ARG A C   1 
ATOM   2773 O O   . ARG A 1 363 ? 42.677  15.485 13.257  1.00 57.42  ? 364  ARG A O   1 
ATOM   2774 C CB  . ARG A 1 363 ? 41.872  13.461 10.931  1.00 60.10  ? 364  ARG A CB  1 
ATOM   2775 C CG  . ARG A 1 363 ? 41.246  13.183 9.573   1.00 64.24  ? 364  ARG A CG  1 
ATOM   2776 C CD  . ARG A 1 363 ? 40.674  14.442 8.936   1.00 70.43  ? 364  ARG A CD  1 
ATOM   2777 N NE  . ARG A 1 363 ? 39.507  14.982 9.633   1.00 70.67  ? 364  ARG A NE  1 
ATOM   2778 C CZ  . ARG A 1 363 ? 38.246  14.730 9.290   1.00 66.58  ? 364  ARG A CZ  1 
ATOM   2779 N NH1 . ARG A 1 363 ? 37.981  13.933 8.265   1.00 58.66  ? 364  ARG A NH1 1 
ATOM   2780 N NH2 . ARG A 1 363 ? 37.248  15.274 9.974   1.00 65.10  ? 364  ARG A NH2 1 
ATOM   2781 N N   . VAL A 1 364 ? 44.516  14.345 12.642  1.00 52.36  ? 365  VAL A N   1 
ATOM   2782 C CA  . VAL A 1 364 ? 45.156  14.528 13.940  1.00 55.15  ? 365  VAL A CA  1 
ATOM   2783 C C   . VAL A 1 364 ? 45.694  15.948 14.079  1.00 57.44  ? 365  VAL A C   1 
ATOM   2784 O O   . VAL A 1 364 ? 45.649  16.538 15.165  1.00 58.27  ? 365  VAL A O   1 
ATOM   2785 C CB  . VAL A 1 364 ? 46.260  13.472 14.127  1.00 56.20  ? 365  VAL A CB  1 
ATOM   2786 C CG1 . VAL A 1 364 ? 47.063  13.746 15.384  1.00 56.64  ? 365  VAL A CG1 1 
ATOM   2787 C CG2 . VAL A 1 364 ? 45.651  12.080 14.175  1.00 57.99  ? 365  VAL A CG2 1 
ATOM   2788 N N   . GLY A 1 365 ? 46.193  16.524 12.982  1.00 49.68  ? 366  GLY A N   1 
ATOM   2789 C CA  . GLY A 1 365 ? 46.762  17.858 13.046  1.00 44.07  ? 366  GLY A CA  1 
ATOM   2790 C C   . GLY A 1 365 ? 45.741  18.972 12.961  1.00 45.48  ? 366  GLY A C   1 
ATOM   2791 O O   . GLY A 1 365 ? 45.994  20.081 13.441  1.00 53.93  ? 366  GLY A O   1 
ATOM   2792 N N   . VAL A 1 366 ? 44.591  18.710 12.350  1.00 48.85  ? 367  VAL A N   1 
ATOM   2793 C CA  . VAL A 1 366 ? 43.527  19.709 12.266  1.00 49.77  ? 367  VAL A CA  1 
ATOM   2794 C C   . VAL A 1 366 ? 42.259  19.092 12.841  1.00 50.42  ? 367  VAL A C   1 
ATOM   2795 O O   . VAL A 1 366 ? 41.363  18.686 12.085  1.00 45.26  ? 367  VAL A O   1 
ATOM   2796 C CB  . VAL A 1 366 ? 43.319  20.191 10.822  1.00 47.59  ? 367  VAL A CB  1 
ATOM   2797 C CG1 . VAL A 1 366 ? 42.458  21.456 10.800  1.00 41.88  ? 367  VAL A CG1 1 
ATOM   2798 C CG2 . VAL A 1 366 ? 44.669  20.423 10.136  1.00 40.08  ? 367  VAL A CG2 1 
ATOM   2799 N N   . PRO A 1 367 ? 42.140  18.998 14.162  1.00 49.19  ? 368  PRO A N   1 
ATOM   2800 C CA  . PRO A 1 367 ? 41.036  18.240 14.753  1.00 41.32  ? 368  PRO A CA  1 
ATOM   2801 C C   . PRO A 1 367 ? 39.735  19.022 14.799  1.00 49.16  ? 368  PRO A C   1 
ATOM   2802 O O   . PRO A 1 367 ? 39.711  20.252 14.904  1.00 53.06  ? 368  PRO A O   1 
ATOM   2803 C CB  . PRO A 1 367 ? 41.543  17.932 16.167  1.00 47.24  ? 368  PRO A CB  1 
ATOM   2804 C CG  . PRO A 1 367 ? 42.497  19.031 16.470  1.00 45.51  ? 368  PRO A CG  1 
ATOM   2805 C CD  . PRO A 1 367 ? 43.132  19.419 15.167  1.00 43.76  ? 368  PRO A CD  1 
ATOM   2806 N N   . GLN A 1 368 ? 38.640  18.265 14.703  1.00 60.83  ? 369  GLN A N   1 
ATOM   2807 C CA  . GLN A 1 368 ? 37.280  18.790 14.844  1.00 74.49  ? 369  GLN A CA  1 
ATOM   2808 C C   . GLN A 1 368 ? 36.887  19.754 13.743  1.00 69.60  ? 369  GLN A C   1 
ATOM   2809 O O   . GLN A 1 368 ? 36.223  20.768 13.983  1.00 69.36  ? 369  GLN A O   1 
ATOM   2810 C CB  . GLN A 1 368 ? 37.065  19.449 16.190  1.00 84.73  ? 369  GLN A CB  1 
ATOM   2811 C CG  . GLN A 1 368 ? 36.665  18.473 17.161  1.00 96.74  ? 369  GLN A CG  1 
ATOM   2812 C CD  . GLN A 1 368 ? 36.240  19.070 18.446  1.00 107.78 ? 369  GLN A CD  1 
ATOM   2813 O OE1 . GLN A 1 368 ? 35.883  18.356 19.375  1.00 110.07 ? 369  GLN A OE1 1 
ATOM   2814 N NE2 . GLN A 1 368 ? 36.264  20.390 18.516  1.00 110.18 ? 369  GLN A NE2 1 
ATOM   2815 N N   . VAL A 1 369 ? 37.236  19.405 12.526  1.00 64.51  ? 370  VAL A N   1 
ATOM   2816 C CA  . VAL A 1 369 ? 36.714  20.089 11.362  1.00 50.08  ? 370  VAL A CA  1 
ATOM   2817 C C   . VAL A 1 369 ? 35.861  19.093 10.599  1.00 58.33  ? 370  VAL A C   1 
ATOM   2818 O O   . VAL A 1 369 ? 36.037  17.875 10.719  1.00 63.09  ? 370  VAL A O   1 
ATOM   2819 C CB  . VAL A 1 369 ? 37.848  20.672 10.498  1.00 51.70  ? 370  VAL A CB  1 
ATOM   2820 C CG1 . VAL A 1 369 ? 38.592  21.745 11.280  1.00 48.11  ? 370  VAL A CG1 1 
ATOM   2821 C CG2 . VAL A 1 369 ? 38.801  19.576 10.034  1.00 49.09  ? 370  VAL A CG2 1 
ATOM   2822 N N   . SER A 1 370 ? 34.901  19.620 9.847   1.00 59.95  ? 371  SER A N   1 
ATOM   2823 C CA  . SER A 1 370 ? 34.060  18.773 9.020   1.00 63.07  ? 371  SER A CA  1 
ATOM   2824 C C   . SER A 1 370 ? 34.916  17.989 8.032   1.00 61.81  ? 371  SER A C   1 
ATOM   2825 O O   . SER A 1 370 ? 36.066  18.340 7.748   1.00 56.55  ? 371  SER A O   1 
ATOM   2826 C CB  . SER A 1 370 ? 33.023  19.613 8.273   1.00 69.04  ? 371  SER A CB  1 
ATOM   2827 O OG  . SER A 1 370 ? 33.647  20.593 7.458   1.00 66.01  ? 371  SER A OG  1 
ATOM   2828 N N   . ASP A 1 371 ? 34.346  16.897 7.520   1.00 64.94  ? 372  ASP A N   1 
ATOM   2829 C CA  . ASP A 1 371 ? 35.028  16.141 6.476   1.00 63.75  ? 372  ASP A CA  1 
ATOM   2830 C C   . ASP A 1 371 ? 35.331  17.029 5.278   1.00 61.20  ? 372  ASP A C   1 
ATOM   2831 O O   . ASP A 1 371 ? 36.384  16.894 4.644   1.00 60.85  ? 372  ASP A O   1 
ATOM   2832 C CB  . ASP A 1 371 ? 34.182  14.939 6.060   1.00 71.52  ? 372  ASP A CB  1 
ATOM   2833 C CG  . ASP A 1 371 ? 33.869  14.017 7.222   1.00 83.21  ? 372  ASP A CG  1 
ATOM   2834 O OD1 . ASP A 1 371 ? 34.747  13.837 8.094   1.00 79.85  ? 372  ASP A OD1 1 
ATOM   2835 O OD2 . ASP A 1 371 ? 32.745  13.475 7.263   1.00 95.10  ? 372  ASP A OD2 1 
ATOM   2836 N N   . LEU A 1 372 ? 34.425  17.958 4.966   1.00 57.11  ? 373  LEU A N   1 
ATOM   2837 C CA  . LEU A 1 372 ? 34.675  18.906 3.887   1.00 57.80  ? 373  LEU A CA  1 
ATOM   2838 C C   . LEU A 1 372 ? 35.900  19.760 4.180   1.00 61.57  ? 373  LEU A C   1 
ATOM   2839 O O   . LEU A 1 372 ? 36.720  20.014 3.288   1.00 61.20  ? 373  LEU A O   1 
ATOM   2840 C CB  . LEU A 1 372 ? 33.449  19.791 3.672   1.00 54.23  ? 373  LEU A CB  1 
ATOM   2841 C CG  . LEU A 1 372 ? 33.550  20.795 2.522   1.00 63.80  ? 373  LEU A CG  1 
ATOM   2842 C CD1 . LEU A 1 372 ? 33.596  20.076 1.176   1.00 53.64  ? 373  LEU A CD1 1 
ATOM   2843 C CD2 . LEU A 1 372 ? 32.395  21.783 2.573   1.00 68.08  ? 373  LEU A CD2 1 
ATOM   2844 N N   . ALA A 1 373 ? 36.044  20.212 5.427   1.00 55.75  ? 374  ALA A N   1 
ATOM   2845 C CA  . ALA A 1 373 ? 37.182  21.052 5.777   1.00 52.45  ? 374  ALA A CA  1 
ATOM   2846 C C   . ALA A 1 373 ? 38.489  20.280 5.671   1.00 49.64  ? 374  ALA A C   1 
ATOM   2847 O O   . ALA A 1 373 ? 39.489  20.810 5.172   1.00 50.17  ? 374  ALA A O   1 
ATOM   2848 C CB  . ALA A 1 373 ? 37.003  21.620 7.183   1.00 52.99  ? 374  ALA A CB  1 
ATOM   2849 N N   . ALA A 1 374 ? 38.497  19.026 6.128   1.00 46.20  ? 375  ALA A N   1 
ATOM   2850 C CA  . ALA A 1 374 ? 39.694  18.199 6.011   1.00 52.63  ? 375  ALA A CA  1 
ATOM   2851 C C   . ALA A 1 374 ? 40.117  18.036 4.554   1.00 53.89  ? 375  ALA A C   1 
ATOM   2852 O O   . ALA A 1 374 ? 41.313  18.084 4.240   1.00 55.90  ? 375  ALA A O   1 
ATOM   2853 C CB  . ALA A 1 374 ? 39.452  16.834 6.652   1.00 55.71  ? 375  ALA A CB  1 
ATOM   2854 N N   . GLU A 1 375 ? 39.147  17.846 3.650   1.00 49.95  ? 376  GLU A N   1 
ATOM   2855 C CA  . GLU A 1 375 ? 39.467  17.687 2.234   1.00 57.65  ? 376  GLU A CA  1 
ATOM   2856 C C   . GLU A 1 375 ? 39.952  18.991 1.617   1.00 54.31  ? 376  GLU A C   1 
ATOM   2857 O O   . GLU A 1 375 ? 40.752  18.970 0.674   1.00 58.33  ? 376  GLU A O   1 
ATOM   2858 C CB  . GLU A 1 375 ? 38.257  17.135 1.469   1.00 69.58  ? 376  GLU A CB  1 
ATOM   2859 C CG  . GLU A 1 375 ? 37.799  15.778 2.008   1.00 87.59  ? 376  GLU A CG  1 
ATOM   2860 C CD  . GLU A 1 375 ? 38.757  14.651 1.622   1.00 102.08 ? 376  GLU A CD  1 
ATOM   2861 O OE1 . GLU A 1 375 ? 39.076  13.793 2.466   1.00 108.23 ? 376  GLU A OE1 1 
ATOM   2862 O OE2 . GLU A 1 375 ? 39.194  14.615 0.465   1.00 102.84 ? 376  GLU A OE2 1 
ATOM   2863 N N   . ALA A 1 376 ? 39.489  20.130 2.131   1.00 45.67  ? 377  ALA A N   1 
ATOM   2864 C CA  . ALA A 1 376 ? 40.065  21.399 1.709   1.00 46.67  ? 377  ALA A CA  1 
ATOM   2865 C C   . ALA A 1 376 ? 41.535  21.478 2.099   1.00 49.91  ? 377  ALA A C   1 
ATOM   2866 O O   . ALA A 1 376 ? 42.366  21.965 1.323   1.00 50.44  ? 377  ALA A O   1 
ATOM   2867 C CB  . ALA A 1 376 ? 39.275  22.561 2.310   1.00 40.65  ? 377  ALA A CB  1 
ATOM   2868 N N   . VAL A 1 377 ? 41.879  20.984 3.292   1.00 49.20  ? 378  VAL A N   1 
ATOM   2869 C CA  . VAL A 1 377 ? 43.279  20.943 3.704   1.00 43.76  ? 378  VAL A CA  1 
ATOM   2870 C C   . VAL A 1 377 ? 44.079  20.041 2.773   1.00 46.31  ? 378  VAL A C   1 
ATOM   2871 O O   . VAL A 1 377 ? 45.178  20.398 2.330   1.00 46.71  ? 378  VAL A O   1 
ATOM   2872 C CB  . VAL A 1 377 ? 43.399  20.482 5.169   1.00 42.97  ? 378  VAL A CB  1 
ATOM   2873 C CG1 . VAL A 1 377 ? 44.867  20.334 5.553   1.00 36.31  ? 378  VAL A CG1 1 
ATOM   2874 C CG2 . VAL A 1 377 ? 42.692  21.459 6.104   1.00 37.28  ? 378  VAL A CG2 1 
ATOM   2875 N N   . VAL A 1 378 ? 43.542  18.858 2.462   1.00 49.01  ? 379  VAL A N   1 
ATOM   2876 C CA  . VAL A 1 378 ? 44.249  17.910 1.603   1.00 55.26  ? 379  VAL A CA  1 
ATOM   2877 C C   . VAL A 1 378 ? 44.460  18.500 0.214   1.00 58.66  ? 379  VAL A C   1 
ATOM   2878 O O   . VAL A 1 378 ? 45.517  18.316 -0.402  1.00 60.48  ? 379  VAL A O   1 
ATOM   2879 C CB  . VAL A 1 378 ? 43.482  16.576 1.541   1.00 54.13  ? 379  VAL A CB  1 
ATOM   2880 C CG1 . VAL A 1 378 ? 44.084  15.658 0.488   1.00 51.85  ? 379  VAL A CG1 1 
ATOM   2881 C CG2 . VAL A 1 378 ? 43.496  15.902 2.903   1.00 49.53  ? 379  VAL A CG2 1 
ATOM   2882 N N   . LEU A 1 379 ? 43.462  19.229 -0.295  1.00 56.10  ? 380  LEU A N   1 
ATOM   2883 C CA  . LEU A 1 379 ? 43.582  19.847 -1.613  1.00 53.64  ? 380  LEU A CA  1 
ATOM   2884 C C   . LEU A 1 379 ? 44.726  20.849 -1.657  1.00 57.15  ? 380  LEU A C   1 
ATOM   2885 O O   . LEU A 1 379 ? 45.500  20.881 -2.622  1.00 57.45  ? 380  LEU A O   1 
ATOM   2886 C CB  . LEU A 1 379 ? 42.274  20.543 -1.995  1.00 56.64  ? 380  LEU A CB  1 
ATOM   2887 C CG  . LEU A 1 379 ? 42.384  21.554 -3.147  1.00 60.66  ? 380  LEU A CG  1 
ATOM   2888 C CD1 . LEU A 1 379 ? 42.629  20.870 -4.500  1.00 46.11  ? 380  LEU A CD1 1 
ATOM   2889 C CD2 . LEU A 1 379 ? 41.159  22.464 -3.201  1.00 64.27  ? 380  LEU A CD2 1 
ATOM   2890 N N   . HIS A 1 380 ? 44.850  21.674 -0.619  1.00 53.22  ? 381  HIS A N   1 
ATOM   2891 C CA  A HIS A 1 380 ? 45.826  22.751 -0.679  0.53 52.03  ? 381  HIS A CA  1 
ATOM   2892 C CA  B HIS A 1 380 ? 45.819  22.767 -0.619  0.47 52.20  ? 381  HIS A CA  1 
ATOM   2893 C C   . HIS A 1 380 ? 47.247  22.265 -0.441  1.00 50.41  ? 381  HIS A C   1 
ATOM   2894 O O   . HIS A 1 380 ? 48.189  22.861 -0.976  1.00 56.42  ? 381  HIS A O   1 
ATOM   2895 C CB  A HIS A 1 380 ? 45.459  23.850 0.316   0.53 55.51  ? 381  HIS A CB  1 
ATOM   2896 C CB  B HIS A 1 380 ? 45.466  23.757 0.494   0.47 55.03  ? 381  HIS A CB  1 
ATOM   2897 C CG  A HIS A 1 380 ? 44.436  24.808 -0.207  0.53 58.64  ? 381  HIS A CG  1 
ATOM   2898 C CG  B HIS A 1 380 ? 46.087  25.110 0.332   0.47 56.94  ? 381  HIS A CG  1 
ATOM   2899 N ND1 A HIS A 1 380 ? 44.773  26.023 -0.764  0.53 58.49  ? 381  HIS A ND1 1 
ATOM   2900 N ND1 B HIS A 1 380 ? 45.369  26.212 -0.079  0.47 59.33  ? 381  HIS A ND1 1 
ATOM   2901 C CD2 A HIS A 1 380 ? 43.087  24.722 -0.279  0.53 57.69  ? 381  HIS A CD2 1 
ATOM   2902 C CD2 B HIS A 1 380 ? 47.354  25.541 0.535   0.47 56.76  ? 381  HIS A CD2 1 
ATOM   2903 C CE1 A HIS A 1 380 ? 43.675  26.648 -1.146  0.53 58.51  ? 381  HIS A CE1 1 
ATOM   2904 C CE1 B HIS A 1 380 ? 46.167  27.263 -0.127  0.47 57.24  ? 381  HIS A CE1 1 
ATOM   2905 N NE2 A HIS A 1 380 ? 42.638  25.880 -0.863  0.53 58.16  ? 381  HIS A NE2 1 
ATOM   2906 N NE2 B HIS A 1 380 ? 47.378  26.882 0.239   0.47 58.57  ? 381  HIS A NE2 1 
ATOM   2907 N N   . TYR A 1 381 ? 47.430  21.183 0.313   1.00 41.56  ? 382  TYR A N   1 
ATOM   2908 C CA  . TYR A 1 381 ? 48.763  20.719 0.672   1.00 42.13  ? 382  TYR A CA  1 
ATOM   2909 C C   . TYR A 1 381 ? 49.200  19.476 -0.091  1.00 41.42  ? 382  TYR A C   1 
ATOM   2910 O O   . TYR A 1 381 ? 50.234  18.890 0.244   1.00 58.06  ? 382  TYR A O   1 
ATOM   2911 C CB  . TYR A 1 381 ? 48.839  20.472 2.181   1.00 37.96  ? 382  TYR A CB  1 
ATOM   2912 C CG  . TYR A 1 381 ? 48.888  21.750 2.979   1.00 44.00  ? 382  TYR A CG  1 
ATOM   2913 C CD1 . TYR A 1 381 ? 50.102  22.284 3.392   1.00 40.61  ? 382  TYR A CD1 1 
ATOM   2914 C CD2 . TYR A 1 381 ? 47.723  22.431 3.310   1.00 45.50  ? 382  TYR A CD2 1 
ATOM   2915 C CE1 . TYR A 1 381 ? 50.158  23.455 4.118   1.00 37.43  ? 382  TYR A CE1 1 
ATOM   2916 C CE2 . TYR A 1 381 ? 47.769  23.607 4.039   1.00 39.34  ? 382  TYR A CE2 1 
ATOM   2917 C CZ  . TYR A 1 381 ? 48.991  24.113 4.440   1.00 39.53  ? 382  TYR A CZ  1 
ATOM   2918 O OH  . TYR A 1 381 ? 49.052  25.283 5.162   1.00 38.91  ? 382  TYR A OH  1 
ATOM   2919 N N   . THR A 1 382 ? 48.459  19.067 -1.113  1.00 45.83  ? 383  THR A N   1 
ATOM   2920 C CA  . THR A 1 382 ? 48.859  17.956 -1.964  1.00 44.93  ? 383  THR A CA  1 
ATOM   2921 C C   . THR A 1 382 ? 49.471  18.503 -3.246  1.00 50.38  ? 383  THR A C   1 
ATOM   2922 O O   . THR A 1 382 ? 48.904  19.404 -3.874  1.00 52.72  ? 383  THR A O   1 
ATOM   2923 C CB  . THR A 1 382 ? 47.665  17.060 -2.299  1.00 45.49  ? 383  THR A CB  1 
ATOM   2924 O OG1 . THR A 1 382 ? 47.272  16.325 -1.130  1.00 48.65  ? 383  THR A OG1 1 
ATOM   2925 C CG2 . THR A 1 382 ? 48.009  16.084 -3.430  1.00 39.81  ? 383  THR A CG2 1 
ATOM   2926 N N   . ASP A 1 383 ? 50.633  17.974 -3.623  1.00 53.07  ? 384  ASP A N   1 
ATOM   2927 C CA  . ASP A 1 383 ? 51.191  18.201 -4.953  1.00 49.14  ? 384  ASP A CA  1 
ATOM   2928 C C   . ASP A 1 383 ? 50.587  17.150 -5.875  1.00 49.23  ? 384  ASP A C   1 
ATOM   2929 O O   . ASP A 1 383 ? 50.910  15.965 -5.771  1.00 52.25  ? 384  ASP A O   1 
ATOM   2930 C CB  . ASP A 1 383 ? 52.717  18.120 -4.937  1.00 51.71  ? 384  ASP A CB  1 
ATOM   2931 C CG  . ASP A 1 383 ? 53.348  18.548 -6.265  1.00 58.70  ? 384  ASP A CG  1 
ATOM   2932 O OD1 . ASP A 1 383 ? 52.730  18.343 -7.333  1.00 53.97  ? 384  ASP A OD1 1 
ATOM   2933 O OD2 . ASP A 1 383 ? 54.472  19.090 -6.243  1.00 66.80  ? 384  ASP A OD2 1 
ATOM   2934 N N   . TRP A 1 384 ? 49.711  17.582 -6.775  1.00 51.32  ? 385  TRP A N   1 
ATOM   2935 C CA  . TRP A 1 384 ? 48.957  16.657 -7.607  1.00 52.43  ? 385  TRP A CA  1 
ATOM   2936 C C   . TRP A 1 384 ? 49.756  16.120 -8.786  1.00 50.39  ? 385  TRP A C   1 
ATOM   2937 O O   . TRP A 1 384 ? 49.233  15.294 -9.540  1.00 53.49  ? 385  TRP A O   1 
ATOM   2938 C CB  . TRP A 1 384 ? 47.668  17.333 -8.076  1.00 50.44  ? 385  TRP A CB  1 
ATOM   2939 C CG  . TRP A 1 384 ? 46.801  17.653 -6.906  1.00 47.51  ? 385  TRP A CG  1 
ATOM   2940 C CD1 . TRP A 1 384 ? 46.673  18.860 -6.281  1.00 52.11  ? 385  TRP A CD1 1 
ATOM   2941 C CD2 . TRP A 1 384 ? 45.980  16.735 -6.179  1.00 45.92  ? 385  TRP A CD2 1 
ATOM   2942 N NE1 . TRP A 1 384 ? 45.805  18.754 -5.222  1.00 52.94  ? 385  TRP A NE1 1 
ATOM   2943 C CE2 . TRP A 1 384 ? 45.364  17.459 -5.140  1.00 55.19  ? 385  TRP A CE2 1 
ATOM   2944 C CE3 . TRP A 1 384 ? 45.699  15.372 -6.314  1.00 48.62  ? 385  TRP A CE3 1 
ATOM   2945 C CZ2 . TRP A 1 384 ? 44.484  16.864 -4.239  1.00 59.07  ? 385  TRP A CZ2 1 
ATOM   2946 C CZ3 . TRP A 1 384 ? 44.825  14.785 -5.422  1.00 53.54  ? 385  TRP A CZ3 1 
ATOM   2947 C CH2 . TRP A 1 384 ? 44.227  15.530 -4.396  1.00 57.68  ? 385  TRP A CH2 1 
ATOM   2948 N N   . LEU A 1 385 ? 51.001  16.556 -8.957  1.00 55.22  ? 386  LEU A N   1 
ATOM   2949 C CA  . LEU A 1 385 ? 51.930  15.883 -9.855  1.00 58.26  ? 386  LEU A CA  1 
ATOM   2950 C C   . LEU A 1 385 ? 52.823  14.888 -9.121  1.00 58.35  ? 386  LEU A C   1 
ATOM   2951 O O   . LEU A 1 385 ? 53.429  14.027 -9.765  1.00 57.14  ? 386  LEU A O   1 
ATOM   2952 C CB  . LEU A 1 385 ? 52.795  16.905 -10.595 1.00 58.33  ? 386  LEU A CB  1 
ATOM   2953 C CG  . LEU A 1 385 ? 52.072  17.640 -11.725 1.00 65.25  ? 386  LEU A CG  1 
ATOM   2954 C CD1 . LEU A 1 385 ? 52.970  18.700 -12.342 1.00 70.48  ? 386  LEU A CD1 1 
ATOM   2955 C CD2 . LEU A 1 385 ? 51.596  16.655 -12.782 1.00 63.29  ? 386  LEU A CD2 1 
ATOM   2956 N N   . HIS A 1 386 ? 52.900  14.980 -7.795  1.00 53.33  ? 387  HIS A N   1 
ATOM   2957 C CA  . HIS A 1 386 ? 53.562  13.970 -6.971  1.00 57.28  ? 387  HIS A CA  1 
ATOM   2958 C C   . HIS A 1 386 ? 52.673  13.649 -5.779  1.00 53.99  ? 387  HIS A C   1 
ATOM   2959 O O   . HIS A 1 386 ? 53.021  13.926 -4.631  1.00 44.47  ? 387  HIS A O   1 
ATOM   2960 C CB  . HIS A 1 386 ? 54.947  14.460 -6.537  1.00 55.83  ? 387  HIS A CB  1 
ATOM   2961 C CG  . HIS A 1 386 ? 55.752  15.022 -7.667  1.00 62.29  ? 387  HIS A CG  1 
ATOM   2962 N ND1 . HIS A 1 386 ? 56.583  14.244 -8.442  1.00 59.95  ? 387  HIS A ND1 1 
ATOM   2963 C CD2 . HIS A 1 386 ? 55.824  16.273 -8.179  1.00 67.31  ? 387  HIS A CD2 1 
ATOM   2964 C CE1 . HIS A 1 386 ? 57.138  14.990 -9.377  1.00 67.38  ? 387  HIS A CE1 1 
ATOM   2965 N NE2 . HIS A 1 386 ? 56.695  16.226 -9.240  1.00 67.89  ? 387  HIS A NE2 1 
ATOM   2966 N N   . PRO A 1 387 ? 51.492  13.063 -6.019  1.00 53.59  ? 388  PRO A N   1 
ATOM   2967 C CA  . PRO A 1 387 ? 50.521  12.918 -4.904  1.00 45.43  ? 388  PRO A CA  1 
ATOM   2968 C C   . PRO A 1 387 ? 50.979  11.968 -3.805  1.00 55.13  ? 388  PRO A C   1 
ATOM   2969 O O   . PRO A 1 387 ? 50.483  12.090 -2.686  1.00 54.39  ? 388  PRO A O   1 
ATOM   2970 C CB  . PRO A 1 387 ? 49.247  12.382 -5.586  1.00 44.29  ? 388  PRO A CB  1 
ATOM   2971 C CG  . PRO A 1 387 ? 49.606  12.051 -6.984  1.00 48.08  ? 388  PRO A CG  1 
ATOM   2972 C CD  . PRO A 1 387 ? 50.884  12.732 -7.336  1.00 48.32  ? 388  PRO A CD  1 
ATOM   2973 N N   . GLU A 1 388 ? 51.909  11.044 -4.075  1.00 56.62  ? 389  GLU A N   1 
ATOM   2974 C CA  . GLU A 1 388 ? 52.255  10.009 -3.103  1.00 57.57  ? 389  GLU A CA  1 
ATOM   2975 C C   . GLU A 1 388 ? 53.736  9.985  -2.739  1.00 56.68  ? 389  GLU A C   1 
ATOM   2976 O O   . GLU A 1 388 ? 54.209  8.997  -2.164  1.00 61.78  ? 389  GLU A O   1 
ATOM   2977 C CB  . GLU A 1 388 ? 51.828  8.635  -3.629  1.00 60.68  ? 389  GLU A CB  1 
ATOM   2978 C CG  . GLU A 1 388 ? 50.396  8.601  -4.137  1.00 70.94  ? 389  GLU A CG  1 
ATOM   2979 C CD  . GLU A 1 388 ? 49.692  7.299  -3.827  1.00 84.83  ? 389  GLU A CD  1 
ATOM   2980 O OE1 . GLU A 1 388 ? 50.356  6.373  -3.319  1.00 94.26  ? 389  GLU A OE1 1 
ATOM   2981 O OE2 . GLU A 1 388 ? 48.475  7.202  -4.088  1.00 89.00  ? 389  GLU A OE2 1 
ATOM   2982 N N   . ASP A 1 389 ? 54.477  11.040 -3.050  1.00 52.96  ? 390  ASP A N   1 
ATOM   2983 C CA  . ASP A 1 389 ? 55.897  11.091 -2.722  1.00 55.97  ? 390  ASP A CA  1 
ATOM   2984 C C   . ASP A 1 389 ? 56.077  11.199 -1.212  1.00 54.59  ? 390  ASP A C   1 
ATOM   2985 O O   . ASP A 1 389 ? 55.651  12.198 -0.617  1.00 52.11  ? 390  ASP A O   1 
ATOM   2986 C CB  . ASP A 1 389 ? 56.557  12.271 -3.429  1.00 61.19  ? 390  ASP A CB  1 
ATOM   2987 C CG  . ASP A 1 389 ? 58.045  12.362 -3.147  1.00 71.57  ? 390  ASP A CG  1 
ATOM   2988 O OD1 . ASP A 1 389 ? 58.640  11.342 -2.741  1.00 74.61  ? 390  ASP A OD1 1 
ATOM   2989 O OD2 . ASP A 1 389 ? 58.624  13.453 -3.331  1.00 78.05  ? 390  ASP A OD2 1 
ATOM   2990 N N   . PRO A 1 390 ? 56.702  10.214 -0.559  1.00 54.61  ? 391  PRO A N   1 
ATOM   2991 C CA  . PRO A 1 390 ? 56.763  10.239 0.916   1.00 53.80  ? 391  PRO A CA  1 
ATOM   2992 C C   . PRO A 1 390 ? 57.453  11.467 1.487   1.00 55.17  ? 391  PRO A C   1 
ATOM   2993 O O   . PRO A 1 390 ? 56.951  12.061 2.450   1.00 55.23  ? 391  PRO A O   1 
ATOM   2994 C CB  . PRO A 1 390 ? 57.521  8.947  1.249   1.00 55.56  ? 391  PRO A CB  1 
ATOM   2995 C CG  . PRO A 1 390 ? 57.302  8.059  0.063   1.00 58.24  ? 391  PRO A CG  1 
ATOM   2996 C CD  . PRO A 1 390 ? 57.266  8.975  -1.121  1.00 56.27  ? 391  PRO A CD  1 
ATOM   2997 N N   . ALA A 1 391 ? 58.597  11.864 0.923   1.00 54.79  ? 392  ALA A N   1 
ATOM   2998 C CA  . ALA A 1 391 ? 59.304  13.032 1.440   1.00 51.29  ? 392  ALA A CA  1 
ATOM   2999 C C   . ALA A 1 391 ? 58.452  14.291 1.324   1.00 50.71  ? 392  ALA A C   1 
ATOM   3000 O O   . ALA A 1 391 ? 58.413  15.108 2.251   1.00 51.03  ? 392  ALA A O   1 
ATOM   3001 C CB  . ALA A 1 391 ? 60.633  13.211 0.706   1.00 53.52  ? 392  ALA A CB  1 
ATOM   3002 N N   . ARG A 1 392 ? 57.755  14.460 0.196   1.00 49.65  ? 393  ARG A N   1 
ATOM   3003 C CA  . ARG A 1 392 ? 56.868  15.609 0.036   1.00 49.18  ? 393  ARG A CA  1 
ATOM   3004 C C   . ARG A 1 392 ? 55.701  15.549 1.013   1.00 46.75  ? 393  ARG A C   1 
ATOM   3005 O O   . ARG A 1 392 ? 55.264  16.583 1.533   1.00 44.26  ? 393  ARG A O   1 
ATOM   3006 C CB  . ARG A 1 392 ? 56.348  15.684 -1.401  1.00 51.59  ? 393  ARG A CB  1 
ATOM   3007 C CG  . ARG A 1 392 ? 57.336  16.241 -2.413  1.00 52.06  ? 393  ARG A CG  1 
ATOM   3008 C CD  . ARG A 1 392 ? 56.698  16.300 -3.796  1.00 55.12  ? 393  ARG A CD  1 
ATOM   3009 N NE  . ARG A 1 392 ? 57.531  16.993 -4.775  1.00 60.70  ? 393  ARG A NE  1 
ATOM   3010 C CZ  . ARG A 1 392 ? 58.349  16.382 -5.625  1.00 66.81  ? 393  ARG A CZ  1 
ATOM   3011 N NH1 . ARG A 1 392 ? 58.453  15.060 -5.615  1.00 68.73  ? 393  ARG A NH1 1 
ATOM   3012 N NH2 . ARG A 1 392 ? 59.065  17.093 -6.487  1.00 71.87  ? 393  ARG A NH2 1 
ATOM   3013 N N   . LEU A 1 393 ? 55.172  14.348 1.263   1.00 44.73  ? 394  LEU A N   1 
ATOM   3014 C CA  . LEU A 1 393 ? 54.071  14.203 2.212   1.00 46.72  ? 394  LEU A CA  1 
ATOM   3015 C C   . LEU A 1 393 ? 54.515  14.531 3.633   1.00 49.87  ? 394  LEU A C   1 
ATOM   3016 O O   . LEU A 1 393 ? 53.771  15.163 4.393   1.00 47.50  ? 394  LEU A O   1 
ATOM   3017 C CB  . LEU A 1 393 ? 53.506  12.786 2.139   1.00 49.25  ? 394  LEU A CB  1 
ATOM   3018 C CG  . LEU A 1 393 ? 52.769  12.422 0.851   1.00 48.02  ? 394  LEU A CG  1 
ATOM   3019 C CD1 . LEU A 1 393 ? 52.577  10.918 0.757   1.00 48.39  ? 394  LEU A CD1 1 
ATOM   3020 C CD2 . LEU A 1 393 ? 51.429  13.140 0.792   1.00 40.12  ? 394  LEU A CD2 1 
ATOM   3021 N N   . ARG A 1 394 ? 55.723  14.108 4.009   1.00 50.71  ? 395  ARG A N   1 
ATOM   3022 C CA  . ARG A 1 394 ? 56.254  14.445 5.326   1.00 46.06  ? 395  ARG A CA  1 
ATOM   3023 C C   . ARG A 1 394 ? 56.364  15.956 5.500   1.00 47.48  ? 395  ARG A C   1 
ATOM   3024 O O   . ARG A 1 394 ? 55.894  16.514 6.499   1.00 46.24  ? 395  ARG A O   1 
ATOM   3025 C CB  . ARG A 1 394 ? 57.613  13.774 5.521   1.00 47.35  ? 395  ARG A CB  1 
ATOM   3026 C CG  . ARG A 1 394 ? 58.289  14.061 6.853   1.00 48.63  ? 395  ARG A CG  1 
ATOM   3027 C CD  . ARG A 1 394 ? 59.736  13.593 6.819   1.00 48.82  ? 395  ARG A CD  1 
ATOM   3028 N NE  . ARG A 1 394 ? 60.528  14.382 5.880   1.00 53.44  ? 395  ARG A NE  1 
ATOM   3029 C CZ  . ARG A 1 394 ? 61.704  14.005 5.389   1.00 52.75  ? 395  ARG A CZ  1 
ATOM   3030 N NH1 . ARG A 1 394 ? 62.229  12.841 5.740   1.00 53.10  ? 395  ARG A NH1 1 
ATOM   3031 N NH2 . ARG A 1 394 ? 62.353  14.790 4.542   1.00 56.66  ? 395  ARG A NH2 1 
ATOM   3032 N N   . GLU A 1 395 ? 56.981  16.635 4.528   1.00 49.28  ? 396  GLU A N   1 
ATOM   3033 C CA  . GLU A 1 395 ? 57.080  18.091 4.583   1.00 48.99  ? 396  GLU A CA  1 
ATOM   3034 C C   . GLU A 1 395 ? 55.704  18.741 4.590   1.00 44.35  ? 396  GLU A C   1 
ATOM   3035 O O   . GLU A 1 395 ? 55.471  19.711 5.321   1.00 48.97  ? 396  GLU A O   1 
ATOM   3036 C CB  . GLU A 1 395 ? 57.898  18.615 3.401   1.00 54.63  ? 396  GLU A CB  1 
ATOM   3037 C CG  . GLU A 1 395 ? 59.356  18.910 3.709   1.00 76.22  ? 396  GLU A CG  1 
ATOM   3038 C CD  . GLU A 1 395 ? 60.177  17.659 3.939   1.00 94.64  ? 396  GLU A CD  1 
ATOM   3039 O OE1 . GLU A 1 395 ? 60.559  17.011 2.942   1.00 102.18 ? 396  GLU A OE1 1 
ATOM   3040 O OE2 . GLU A 1 395 ? 60.446  17.327 5.112   1.00 98.17  ? 396  GLU A OE2 1 
ATOM   3041 N N   . ALA A 1 396 ? 54.779  18.224 3.777   1.00 45.35  ? 397  ALA A N   1 
ATOM   3042 C CA  . ALA A 1 396 ? 53.454  18.827 3.683   1.00 42.68  ? 397  ALA A CA  1 
ATOM   3043 C C   . ALA A 1 396 ? 52.717  18.762 5.015   1.00 43.34  ? 397  ALA A C   1 
ATOM   3044 O O   . ALA A 1 396 ? 52.109  19.750 5.442   1.00 44.02  ? 397  ALA A O   1 
ATOM   3045 C CB  . ALA A 1 396 ? 52.641  18.144 2.582   1.00 36.32  ? 397  ALA A CB  1 
ATOM   3046 N N   . LEU A 1 397 ? 52.757  17.610 5.689   1.00 40.31  ? 398  LEU A N   1 
ATOM   3047 C CA  . LEU A 1 397 ? 52.080  17.507 6.979   1.00 43.15  ? 398  LEU A CA  1 
ATOM   3048 C C   . LEU A 1 397 ? 52.729  18.422 8.010   1.00 41.26  ? 398  LEU A C   1 
ATOM   3049 O O   . LEU A 1 397 ? 52.037  19.022 8.840   1.00 41.32  ? 398  LEU A O   1 
ATOM   3050 C CB  . LEU A 1 397 ? 52.073  16.061 7.472   1.00 44.01  ? 398  LEU A CB  1 
ATOM   3051 C CG  . LEU A 1 397 ? 51.161  15.862 8.685   1.00 47.13  ? 398  LEU A CG  1 
ATOM   3052 C CD1 . LEU A 1 397 ? 49.727  16.225 8.323   1.00 41.57  ? 398  LEU A CD1 1 
ATOM   3053 C CD2 . LEU A 1 397 ? 51.243  14.444 9.219   1.00 44.79  ? 398  LEU A CD2 1 
ATOM   3054 N N   . SER A 1 398 ? 54.057  18.547 7.967   1.00 40.68  ? 399  SER A N   1 
ATOM   3055 C CA  . SER A 1 398 ? 54.733  19.504 8.834   1.00 39.73  ? 399  SER A CA  1 
ATOM   3056 C C   . SER A 1 398 ? 54.233  20.920 8.578   1.00 44.07  ? 399  SER A C   1 
ATOM   3057 O O   . SER A 1 398 ? 53.994  21.682 9.523   1.00 41.82  ? 399  SER A O   1 
ATOM   3058 C CB  . SER A 1 398 ? 56.246  19.422 8.634   1.00 40.56  ? 399  SER A CB  1 
ATOM   3059 O OG  . SER A 1 398 ? 56.923  20.278 9.542   1.00 47.94  ? 399  SER A OG  1 
ATOM   3060 N N   . ASP A 1 399 ? 54.060  21.288 7.305   1.00 41.16  ? 400  ASP A N   1 
ATOM   3061 C CA  . ASP A 1 399 ? 53.479  22.588 6.988   1.00 44.65  ? 400  ASP A CA  1 
ATOM   3062 C C   . ASP A 1 399 ? 52.027  22.668 7.443   1.00 40.61  ? 400  ASP A C   1 
ATOM   3063 O O   . ASP A 1 399 ? 51.585  23.715 7.929   1.00 41.45  ? 400  ASP A O   1 
ATOM   3064 C CB  . ASP A 1 399 ? 53.581  22.868 5.487   1.00 47.42  ? 400  ASP A CB  1 
ATOM   3065 C CG  . ASP A 1 399 ? 55.005  23.112 5.032   1.00 52.63  ? 400  ASP A CG  1 
ATOM   3066 O OD1 . ASP A 1 399 ? 55.833  23.547 5.859   1.00 58.05  ? 400  ASP A OD1 1 
ATOM   3067 O OD2 . ASP A 1 399 ? 55.294  22.875 3.842   1.00 63.68  ? 400  ASP A OD2 1 
ATOM   3068 N N   . VAL A 1 400 ? 51.271  21.573 7.290   1.00 38.42  ? 401  VAL A N   1 
ATOM   3069 C CA  . VAL A 1 400 ? 49.868  21.559 7.703   1.00 38.63  ? 401  VAL A CA  1 
ATOM   3070 C C   . VAL A 1 400 ? 49.737  21.876 9.188   1.00 46.10  ? 401  VAL A C   1 
ATOM   3071 O O   . VAL A 1 400 ? 48.840  22.620 9.599   1.00 56.81  ? 401  VAL A O   1 
ATOM   3072 C CB  . VAL A 1 400 ? 49.212  20.206 7.376   1.00 40.17  ? 401  VAL A CB  1 
ATOM   3073 C CG1 . VAL A 1 400 ? 47.901  20.067 8.137   1.00 37.43  ? 401  VAL A CG1 1 
ATOM   3074 C CG2 . VAL A 1 400 ? 48.955  20.079 5.888   1.00 42.33  ? 401  VAL A CG2 1 
ATOM   3075 N N   . VAL A 1 401 ? 50.635  21.342 10.014  1.00 37.76  ? 402  VAL A N   1 
ATOM   3076 C CA  . VAL A 1 401 ? 50.505  21.564 11.449  1.00 38.65  ? 402  VAL A CA  1 
ATOM   3077 C C   . VAL A 1 401 ? 51.102  22.911 11.862  1.00 35.12  ? 402  VAL A C   1 
ATOM   3078 O O   . VAL A 1 401 ? 50.566  23.579 12.749  1.00 37.93  ? 402  VAL A O   1 
ATOM   3079 C CB  . VAL A 1 401 ? 51.130  20.391 12.222  1.00 40.30  ? 402  VAL A CB  1 
ATOM   3080 C CG1 . VAL A 1 401 ? 51.143  20.669 13.717  1.00 39.10  ? 402  VAL A CG1 1 
ATOM   3081 C CG2 . VAL A 1 401 ? 50.351  19.116 11.939  1.00 40.79  ? 402  VAL A CG2 1 
ATOM   3082 N N   . GLY A 1 402 ? 52.160  23.369 11.188  1.00 40.69  ? 403  GLY A N   1 
ATOM   3083 C CA  . GLY A 1 402 ? 52.786  24.623 11.582  1.00 35.35  ? 403  GLY A CA  1 
ATOM   3084 C C   . GLY A 1 402 ? 51.990  25.847 11.161  1.00 43.22  ? 403  GLY A C   1 
ATOM   3085 O O   . GLY A 1 402 ? 51.826  26.790 11.941  1.00 45.11  ? 403  GLY A O   1 
ATOM   3086 N N   . ASP A 1 403 ? 51.507  25.863 9.912   1.00 38.43  ? 404  ASP A N   1 
ATOM   3087 C CA  . ASP A 1 403 ? 50.741  27.010 9.425   1.00 43.06  ? 404  ASP A CA  1 
ATOM   3088 C C   . ASP A 1 403 ? 49.482  27.217 10.261  1.00 36.96  ? 404  ASP A C   1 
ATOM   3089 O O   . ASP A 1 403 ? 49.201  28.326 10.724  1.00 46.15  ? 404  ASP A O   1 
ATOM   3090 C CB  . ASP A 1 403 ? 50.355  26.810 7.954   1.00 42.85  ? 404  ASP A CB  1 
ATOM   3091 C CG  . ASP A 1 403 ? 51.550  26.577 7.048   1.00 45.64  ? 404  ASP A CG  1 
ATOM   3092 O OD1 . ASP A 1 403 ? 52.688  26.913 7.437   1.00 51.00  ? 404  ASP A OD1 1 
ATOM   3093 O OD2 . ASP A 1 403 ? 51.342  26.054 5.932   1.00 47.52  ? 404  ASP A OD2 1 
ATOM   3094 N N   . HIS A 1 404 ? 48.710  26.143 10.451  1.00 31.41  ? 405  HIS A N   1 
ATOM   3095 C CA  . HIS A 1 404 ? 47.436  26.202 11.164  1.00 39.70  ? 405  HIS A CA  1 
ATOM   3096 C C   . HIS A 1 404 ? 47.622  26.641 12.611  1.00 37.23  ? 405  HIS A C   1 
ATOM   3097 O O   . HIS A 1 404 ? 46.867  27.480 13.114  1.00 38.25  ? 405  HIS A O   1 
ATOM   3098 C CB  . HIS A 1 404 ? 46.768  24.824 11.096  1.00 37.61  ? 405  HIS A CB  1 
ATOM   3099 C CG  . HIS A 1 404 ? 45.520  24.694 11.915  1.00 43.20  ? 405  HIS A CG  1 
ATOM   3100 N ND1 . HIS A 1 404 ? 44.451  25.556 11.795  1.00 48.52  ? 405  HIS A ND1 1 
ATOM   3101 C CD2 . HIS A 1 404 ? 45.163  23.781 12.850  1.00 42.05  ? 405  HIS A CD2 1 
ATOM   3102 C CE1 . HIS A 1 404 ? 43.493  25.185 12.625  1.00 45.71  ? 405  HIS A CE1 1 
ATOM   3103 N NE2 . HIS A 1 404 ? 43.900  24.112 13.278  1.00 44.77  ? 405  HIS A NE2 1 
ATOM   3104 N N   . ASN A 1 405 ? 48.623  26.094 13.295  1.00 34.57  ? 406  ASN A N   1 
ATOM   3105 C CA  . ASN A 1 405 ? 48.754  26.330 14.728  1.00 37.75  ? 406  ASN A CA  1 
ATOM   3106 C C   . ASN A 1 405 ? 49.655  27.507 15.077  1.00 39.25  ? 406  ASN A C   1 
ATOM   3107 O O   . ASN A 1 405 ? 49.423  28.161 16.098  1.00 45.14  ? 406  ASN A O   1 
ATOM   3108 C CB  . ASN A 1 405 ? 49.271  25.069 15.423  1.00 32.45  ? 406  ASN A CB  1 
ATOM   3109 C CG  . ASN A 1 405 ? 48.260  23.939 15.401  1.00 36.49  ? 406  ASN A CG  1 
ATOM   3110 O OD1 . ASN A 1 405 ? 47.249  23.984 16.103  1.00 43.09  ? 406  ASN A OD1 1 
ATOM   3111 N ND2 . ASN A 1 405 ? 48.532  22.912 14.602  1.00 37.28  ? 406  ASN A ND2 1 
ATOM   3112 N N   . VAL A 1 406 ? 50.668  27.808 14.264  1.00 41.15  ? 407  VAL A N   1 
ATOM   3113 C CA  . VAL A 1 406 ? 51.631  28.844 14.626  1.00 34.98  ? 407  VAL A CA  1 
ATOM   3114 C C   . VAL A 1 406 ? 51.706  29.940 13.568  1.00 43.67  ? 407  VAL A C   1 
ATOM   3115 O O   . VAL A 1 406 ? 51.372  31.100 13.840  1.00 44.52  ? 407  VAL A O   1 
ATOM   3116 C CB  . VAL A 1 406 ? 53.025  28.238 14.867  1.00 39.80  ? 407  VAL A CB  1 
ATOM   3117 C CG1 . VAL A 1 406 ? 54.004  29.321 15.300  1.00 43.30  ? 407  VAL A CG1 1 
ATOM   3118 C CG2 . VAL A 1 406 ? 52.954  27.132 15.902  1.00 43.27  ? 407  VAL A CG2 1 
ATOM   3119 N N   . VAL A 1 407 ? 52.146  29.581 12.357  1.00 40.12  ? 408  VAL A N   1 
ATOM   3120 C CA  . VAL A 1 407 ? 52.567  30.588 11.382  1.00 37.84  ? 408  VAL A CA  1 
ATOM   3121 C C   . VAL A 1 407 ? 51.410  31.506 11.009  1.00 40.91  ? 408  VAL A C   1 
ATOM   3122 O O   . VAL A 1 407 ? 51.541  32.736 11.021  1.00 46.55  ? 408  VAL A O   1 
ATOM   3123 C CB  . VAL A 1 407 ? 53.169  29.916 10.134  1.00 39.44  ? 408  VAL A CB  1 
ATOM   3124 C CG1 . VAL A 1 407 ? 53.459  30.964 9.058   1.00 32.17  ? 408  VAL A CG1 1 
ATOM   3125 C CG2 . VAL A 1 407 ? 54.432  29.132 10.495  1.00 38.56  ? 408  VAL A CG2 1 
ATOM   3126 N N   . CYS A 1 408 ? 50.263  30.929 10.667  1.00 37.90  ? 409  CYS A N   1 
ATOM   3127 C CA  . CYS A 1 408 ? 49.167  31.750 10.165  1.00 35.45  ? 409  CYS A CA  1 
ATOM   3128 C C   . CYS A 1 408 ? 48.467  32.538 11.273  1.00 40.63  ? 409  CYS A C   1 
ATOM   3129 O O   . CYS A 1 408 ? 48.066  33.685 11.033  1.00 45.00  ? 409  CYS A O   1 
ATOM   3130 C CB  . CYS A 1 408 ? 48.170  30.885 9.391   1.00 43.17  ? 409  CYS A CB  1 
ATOM   3131 S SG  . CYS A 1 408 ? 48.918  30.120 7.921   1.00 46.61  ? 409  CYS A SG  1 
ATOM   3132 N N   . PRO A 1 409 ? 48.286  31.989 12.484  1.00 38.52  ? 410  PRO A N   1 
ATOM   3133 C CA  . PRO A 1 409 ? 47.825  32.854 13.586  1.00 39.45  ? 410  PRO A CA  1 
ATOM   3134 C C   . PRO A 1 409 ? 48.743  34.039 13.842  1.00 40.07  ? 410  PRO A C   1 
ATOM   3135 O O   . PRO A 1 409 ? 48.256  35.158 14.050  1.00 38.99  ? 410  PRO A O   1 
ATOM   3136 C CB  . PRO A 1 409 ? 47.776  31.894 14.782  1.00 34.74  ? 410  PRO A CB  1 
ATOM   3137 C CG  . PRO A 1 409 ? 47.458  30.585 14.174  1.00 37.21  ? 410  PRO A CG  1 
ATOM   3138 C CD  . PRO A 1 409 ? 48.222  30.564 12.866  1.00 34.72  ? 410  PRO A CD  1 
ATOM   3139 N N   . VAL A 1 410 ? 50.062  33.824 13.826  1.00 37.55  ? 411  VAL A N   1 
ATOM   3140 C CA  . VAL A 1 410 ? 51.005  34.929 13.989  1.00 38.01  ? 411  VAL A CA  1 
ATOM   3141 C C   . VAL A 1 410 ? 50.860  35.934 12.851  1.00 47.04  ? 411  VAL A C   1 
ATOM   3142 O O   . VAL A 1 410 ? 50.867  37.152 13.073  1.00 50.33  ? 411  VAL A O   1 
ATOM   3143 C CB  . VAL A 1 410 ? 52.444  34.387 14.089  1.00 41.37  ? 411  VAL A CB  1 
ATOM   3144 C CG1 . VAL A 1 410 ? 53.454  35.511 13.930  1.00 42.95  ? 411  VAL A CG1 1 
ATOM   3145 C CG2 . VAL A 1 410 ? 52.648  33.676 15.421  1.00 41.48  ? 411  VAL A CG2 1 
ATOM   3146 N N   . ALA A 1 411 ? 50.718  35.444 11.615  1.00 42.63  ? 412  ALA A N   1 
ATOM   3147 C CA  . ALA A 1 411 ? 50.573  36.345 10.474  1.00 41.85  ? 412  ALA A CA  1 
ATOM   3148 C C   . ALA A 1 411 ? 49.288  37.157 10.567  1.00 41.75  ? 412  ALA A C   1 
ATOM   3149 O O   . ALA A 1 411 ? 49.283  38.359 10.276  1.00 40.51  ? 412  ALA A O   1 
ATOM   3150 C CB  . ALA A 1 411 ? 50.614  35.553 9.165   1.00 38.93  ? 412  ALA A CB  1 
ATOM   3151 N N   . GLN A 1 412 ? 48.186  36.517 10.967  1.00 46.54  ? 413  GLN A N   1 
ATOM   3152 C CA  . GLN A 1 412 ? 46.933  37.244 11.156  1.00 45.48  ? 413  GLN A CA  1 
ATOM   3153 C C   . GLN A 1 412 ? 47.093  38.345 12.199  1.00 49.35  ? 413  GLN A C   1 
ATOM   3154 O O   . GLN A 1 412 ? 46.665  39.485 11.985  1.00 48.69  ? 413  GLN A O   1 
ATOM   3155 C CB  . GLN A 1 412 ? 45.821  36.270 11.557  1.00 42.46  ? 413  GLN A CB  1 
ATOM   3156 C CG  . GLN A 1 412 ? 44.469  36.918 11.830  1.00 46.49  ? 413  GLN A CG  1 
ATOM   3157 C CD  . GLN A 1 412 ? 43.805  37.456 10.578  1.00 70.56  ? 413  GLN A CD  1 
ATOM   3158 O OE1 . GLN A 1 412 ? 44.216  37.146 9.459   1.00 72.78  ? 413  GLN A OE1 1 
ATOM   3159 N NE2 . GLN A 1 412 ? 42.769  38.267 10.761  1.00 83.63  ? 413  GLN A NE2 1 
ATOM   3160 N N   . LEU A 1 413 ? 47.721  38.024 13.335  1.00 42.53  ? 414  LEU A N   1 
ATOM   3161 C CA  . LEU A 1 413 ? 47.956  39.032 14.365  1.00 44.78  ? 414  LEU A CA  1 
ATOM   3162 C C   . LEU A 1 413 ? 48.837  40.158 13.838  1.00 44.03  ? 414  LEU A C   1 
ATOM   3163 O O   . LEU A 1 413 ? 48.505  41.341 13.977  1.00 48.54  ? 414  LEU A O   1 
ATOM   3164 C CB  . LEU A 1 413 ? 48.595  38.385 15.596  1.00 43.30  ? 414  LEU A CB  1 
ATOM   3165 C CG  . LEU A 1 413 ? 49.033  39.320 16.726  1.00 48.30  ? 414  LEU A CG  1 
ATOM   3166 C CD1 . LEU A 1 413 ? 47.835  39.993 17.368  1.00 52.39  ? 414  LEU A CD1 1 
ATOM   3167 C CD2 . LEU A 1 413 ? 49.825  38.561 17.766  1.00 47.80  ? 414  LEU A CD2 1 
ATOM   3168 N N   . ALA A 1 414 ? 49.969  39.804 13.225  1.00 42.83  ? 415  ALA A N   1 
ATOM   3169 C CA  . ALA A 1 414 ? 50.900  40.815 12.732  1.00 45.00  ? 415  ALA A CA  1 
ATOM   3170 C C   . ALA A 1 414 ? 50.232  41.744 11.729  1.00 50.15  ? 415  ALA A C   1 
ATOM   3171 O O   . ALA A 1 414 ? 50.425  42.965 11.778  1.00 50.99  ? 415  ALA A O   1 
ATOM   3172 C CB  . ALA A 1 414 ? 52.119  40.140 12.102  1.00 42.41  ? 415  ALA A CB  1 
ATOM   3173 N N   . GLY A 1 415 ? 49.437  41.184 10.816  1.00 50.15  ? 416  GLY A N   1 
ATOM   3174 C CA  . GLY A 1 415 ? 48.783  42.012 9.815   1.00 52.33  ? 416  GLY A CA  1 
ATOM   3175 C C   . GLY A 1 415 ? 47.756  42.955 10.410  1.00 51.68  ? 416  GLY A C   1 
ATOM   3176 O O   . GLY A 1 415 ? 47.677  44.123 10.023  1.00 53.05  ? 416  GLY A O   1 
ATOM   3177 N N   . ARG A 1 416 ? 46.960  42.468 11.365  1.00 52.70  ? 417  ARG A N   1 
ATOM   3178 C CA  . ARG A 1 416 ? 45.923  43.313 11.951  1.00 58.72  ? 417  ARG A CA  1 
ATOM   3179 C C   . ARG A 1 416 ? 46.525  44.427 12.800  1.00 61.56  ? 417  ARG A C   1 
ATOM   3180 O O   . ARG A 1 416 ? 46.069  45.575 12.738  1.00 63.93  ? 417  ARG A O   1 
ATOM   3181 C CB  . ARG A 1 416 ? 44.961  42.467 12.783  1.00 61.07  ? 417  ARG A CB  1 
ATOM   3182 C CG  . ARG A 1 416 ? 44.182  41.442 11.980  1.00 66.71  ? 417  ARG A CG  1 
ATOM   3183 C CD  . ARG A 1 416 ? 43.551  42.081 10.756  1.00 72.94  ? 417  ARG A CD  1 
ATOM   3184 N NE  . ARG A 1 416 ? 42.545  43.076 11.112  1.00 82.91  ? 417  ARG A NE  1 
ATOM   3185 C CZ  . ARG A 1 416 ? 41.238  42.911 10.938  1.00 83.51  ? 417  ARG A CZ  1 
ATOM   3186 N NH1 . ARG A 1 416 ? 40.776  41.788 10.405  1.00 84.58  ? 417  ARG A NH1 1 
ATOM   3187 N NH2 . ARG A 1 416 ? 40.392  43.868 11.292  1.00 80.30  ? 417  ARG A NH2 1 
ATOM   3188 N N   . LEU A 1 417 ? 47.546  44.111 13.601  1.00 62.39  ? 418  LEU A N   1 
ATOM   3189 C CA  . LEU A 1 417 ? 48.159  45.138 14.439  1.00 61.79  ? 418  LEU A CA  1 
ATOM   3190 C C   . LEU A 1 417 ? 48.848  46.200 13.592  1.00 65.00  ? 418  LEU A C   1 
ATOM   3191 O O   . LEU A 1 417 ? 48.742  47.397 13.884  1.00 66.02  ? 418  LEU A O   1 
ATOM   3192 C CB  . LEU A 1 417 ? 49.153  44.511 15.418  1.00 58.06  ? 418  LEU A CB  1 
ATOM   3193 C CG  . LEU A 1 417 ? 48.689  43.461 16.433  1.00 58.46  ? 418  LEU A CG  1 
ATOM   3194 C CD1 . LEU A 1 417 ? 49.533  43.537 17.698  1.00 44.51  ? 418  LEU A CD1 1 
ATOM   3195 C CD2 . LEU A 1 417 ? 47.199  43.561 16.748  1.00 63.71  ? 418  LEU A CD2 1 
ATOM   3196 N N   . ALA A 1 418 ? 49.556  45.780 12.540  1.00 62.28  ? 419  ALA A N   1 
ATOM   3197 C CA  . ALA A 1 418 ? 50.238  46.734 11.671  1.00 63.06  ? 419  ALA A CA  1 
ATOM   3198 C C   . ALA A 1 418 ? 49.252  47.697 11.027  1.00 63.44  ? 419  ALA A C   1 
ATOM   3199 O O   . ALA A 1 418 ? 49.528  48.896 10.908  1.00 67.96  ? 419  ALA A O   1 
ATOM   3200 C CB  . ALA A 1 418 ? 51.034  45.991 10.598  1.00 61.73  ? 419  ALA A CB  1 
ATOM   3201 N N   . ALA A 1 419 ? 48.092  47.191 10.613  1.00 58.72  ? 420  ALA A N   1 
ATOM   3202 C CA  . ALA A 1 419 ? 47.097  48.020 9.950   1.00 57.22  ? 420  ALA A CA  1 
ATOM   3203 C C   . ALA A 1 419 ? 46.320  48.903 10.914  1.00 61.95  ? 420  ALA A C   1 
ATOM   3204 O O   . ALA A 1 419 ? 45.615  49.811 10.461  1.00 69.51  ? 420  ALA A O   1 
ATOM   3205 C CB  . ALA A 1 419 ? 46.122  47.140 9.163   1.00 51.70  ? 420  ALA A CB  1 
ATOM   3206 N N   . GLN A 1 420 ? 46.435  48.678 12.222  1.00 66.67  ? 421  GLN A N   1 
ATOM   3207 C CA  . GLN A 1 420 ? 45.612  49.379 13.198  1.00 63.94  ? 421  GLN A CA  1 
ATOM   3208 C C   . GLN A 1 420 ? 46.450  50.185 14.188  1.00 66.65  ? 421  GLN A C   1 
ATOM   3209 O O   . GLN A 1 420 ? 46.024  50.420 15.320  1.00 63.68  ? 421  GLN A O   1 
ATOM   3210 C CB  . GLN A 1 420 ? 44.700  48.393 13.926  1.00 59.84  ? 421  GLN A CB  1 
ATOM   3211 C CG  . GLN A 1 420 ? 43.669  47.749 13.005  1.00 63.42  ? 421  GLN A CG  1 
ATOM   3212 C CD  . GLN A 1 420 ? 43.061  46.489 13.585  1.00 63.32  ? 421  GLN A CD  1 
ATOM   3213 O OE1 . GLN A 1 420 ? 42.537  45.648 12.856  1.00 62.97  ? 421  GLN A OE1 1 
ATOM   3214 N NE2 . GLN A 1 420 ? 43.124  46.354 14.903  1.00 63.05  ? 421  GLN A NE2 1 
ATOM   3215 N N   . GLY A 1 421 ? 47.642  50.617 13.777  1.00 67.26  ? 422  GLY A N   1 
ATOM   3216 C CA  . GLY A 1 421 ? 48.397  51.613 14.513  1.00 69.82  ? 422  GLY A CA  1 
ATOM   3217 C C   . GLY A 1 421 ? 49.657  51.125 15.194  1.00 65.85  ? 422  GLY A C   1 
ATOM   3218 O O   . GLY A 1 421 ? 50.415  51.956 15.711  1.00 69.55  ? 422  GLY A O   1 
ATOM   3219 N N   . ALA A 1 422 ? 49.912  49.824 15.225  1.00 57.62  ? 423  ALA A N   1 
ATOM   3220 C CA  . ALA A 1 422 ? 51.114  49.318 15.867  1.00 58.91  ? 423  ALA A CA  1 
ATOM   3221 C C   . ALA A 1 422 ? 52.233  49.172 14.849  1.00 63.11  ? 423  ALA A C   1 
ATOM   3222 O O   . ALA A 1 422 ? 51.989  48.951 13.659  1.00 63.20  ? 423  ALA A O   1 
ATOM   3223 C CB  . ALA A 1 422 ? 50.846  47.972 16.544  1.00 52.62  ? 423  ALA A CB  1 
ATOM   3224 N N   . ARG A 1 423 ? 53.468  49.321 15.316  1.00 64.71  ? 424  ARG A N   1 
ATOM   3225 C CA  A ARG A 1 423 ? 54.637  49.079 14.484  0.40 69.89  ? 424  ARG A CA  1 
ATOM   3226 C CA  B ARG A 1 423 ? 54.648  49.085 14.493  0.60 69.95  ? 424  ARG A CA  1 
ATOM   3227 C C   . ARG A 1 423 ? 55.130  47.662 14.743  1.00 63.36  ? 424  ARG A C   1 
ATOM   3228 O O   . ARG A 1 423 ? 55.454  47.308 15.880  1.00 56.66  ? 424  ARG A O   1 
ATOM   3229 C CB  A ARG A 1 423 ? 55.742  50.094 14.757  0.40 75.42  ? 424  ARG A CB  1 
ATOM   3230 C CB  B ARG A 1 423 ? 55.762  50.087 14.798  0.60 74.91  ? 424  ARG A CB  1 
ATOM   3231 C CG  A ARG A 1 423 ? 56.770  50.137 13.646  0.40 81.81  ? 424  ARG A CG  1 
ATOM   3232 C CG  B ARG A 1 423 ? 57.034  49.824 13.995  0.60 81.58  ? 424  ARG A CG  1 
ATOM   3233 C CD  A ARG A 1 423 ? 58.148  50.266 14.217  0.40 85.13  ? 424  ARG A CD  1 
ATOM   3234 C CD  B ARG A 1 423 ? 58.074  50.916 14.187  0.60 87.00  ? 424  ARG A CD  1 
ATOM   3235 N NE  A ARG A 1 423 ? 58.199  51.305 15.234  0.40 87.44  ? 424  ARG A NE  1 
ATOM   3236 N NE  B ARG A 1 423 ? 57.618  52.208 13.679  0.60 89.64  ? 424  ARG A NE  1 
ATOM   3237 C CZ  A ARG A 1 423 ? 59.321  51.742 15.793  0.40 86.96  ? 424  ARG A CZ  1 
ATOM   3238 C CZ  B ARG A 1 423 ? 57.737  52.598 12.415  0.60 91.50  ? 424  ARG A CZ  1 
ATOM   3239 N NH1 A ARG A 1 423 ? 60.484  51.220 15.432  0.40 87.56  ? 424  ARG A NH1 1 
ATOM   3240 N NH1 B ARG A 1 423 ? 58.298  51.799 11.525  0.60 94.12  ? 424  ARG A NH1 1 
ATOM   3241 N NH2 A ARG A 1 423 ? 59.278  52.695 16.712  0.40 85.86  ? 424  ARG A NH2 1 
ATOM   3242 N NH2 B ARG A 1 423 ? 57.297  53.790 12.039  0.60 93.45  ? 424  ARG A NH2 1 
ATOM   3243 N N   . VAL A 1 424 ? 55.182  46.863 13.688  1.00 56.04  ? 425  VAL A N   1 
ATOM   3244 C CA  . VAL A 1 424 ? 55.461  45.440 13.784  1.00 49.17  ? 425  VAL A CA  1 
ATOM   3245 C C   . VAL A 1 424 ? 56.799  45.140 13.131  1.00 53.06  ? 425  VAL A C   1 
ATOM   3246 O O   . VAL A 1 424 ? 57.135  45.713 12.088  1.00 57.75  ? 425  VAL A O   1 
ATOM   3247 C CB  . VAL A 1 424 ? 54.341  44.620 13.128  1.00 55.13  ? 425  VAL A CB  1 
ATOM   3248 C CG1 . VAL A 1 424 ? 54.569  43.118 13.323  1.00 49.76  ? 425  VAL A CG1 1 
ATOM   3249 C CG2 . VAL A 1 424 ? 52.986  45.079 13.664  1.00 51.46  ? 425  VAL A CG2 1 
ATOM   3250 N N   . TYR A 1 425 ? 57.565  44.248 13.750  1.00 48.82  ? 426  TYR A N   1 
ATOM   3251 C CA  . TYR A 1 425 ? 58.735  43.646 13.136  1.00 48.58  ? 426  TYR A CA  1 
ATOM   3252 C C   . TYR A 1 425 ? 58.583  42.133 13.170  1.00 49.48  ? 426  TYR A C   1 
ATOM   3253 O O   . TYR A 1 425 ? 58.198  41.557 14.193  1.00 48.36  ? 426  TYR A O   1 
ATOM   3254 C CB  . TYR A 1 425 ? 60.026  44.053 13.851  1.00 49.57  ? 426  TYR A CB  1 
ATOM   3255 C CG  . TYR A 1 425 ? 60.331  45.531 13.780  1.00 52.60  ? 426  TYR A CG  1 
ATOM   3256 C CD1 . TYR A 1 425 ? 61.008  46.072 12.692  1.00 53.91  ? 426  TYR A CD1 1 
ATOM   3257 C CD2 . TYR A 1 425 ? 59.963  46.382 14.810  1.00 50.89  ? 426  TYR A CD2 1 
ATOM   3258 C CE1 . TYR A 1 425 ? 61.298  47.425 12.631  1.00 54.71  ? 426  TYR A CE1 1 
ATOM   3259 C CE2 . TYR A 1 425 ? 60.250  47.730 14.760  1.00 51.17  ? 426  TYR A CE2 1 
ATOM   3260 C CZ  . TYR A 1 425 ? 60.916  48.248 13.670  1.00 56.34  ? 426  TYR A CZ  1 
ATOM   3261 O OH  . TYR A 1 425 ? 61.196  49.596 13.625  1.00 59.87  ? 426  TYR A OH  1 
ATOM   3262 N N   . ALA A 1 426 ? 58.887  41.490 12.047  1.00 46.22  ? 427  ALA A N   1 
ATOM   3263 C CA  . ALA A 1 426 ? 58.675  40.058 11.900  1.00 44.85  ? 427  ALA A CA  1 
ATOM   3264 C C   . ALA A 1 426 ? 59.966  39.380 11.472  1.00 47.59  ? 427  ALA A C   1 
ATOM   3265 O O   . ALA A 1 426 ? 60.782  39.956 10.747  1.00 52.37  ? 427  ALA A O   1 
ATOM   3266 C CB  . ALA A 1 426 ? 57.563  39.763 10.888  1.00 39.29  ? 427  ALA A CB  1 
ATOM   3267 N N   . TYR A 1 427 ? 60.141  38.143 11.931  1.00 41.88  ? 428  TYR A N   1 
ATOM   3268 C CA  . TYR A 1 427 ? 61.331  37.369 11.620  1.00 41.00  ? 428  TYR A CA  1 
ATOM   3269 C C   . TYR A 1 427 ? 60.945  35.925 11.339  1.00 47.29  ? 428  TYR A C   1 
ATOM   3270 O O   . TYR A 1 427 ? 59.875  35.456 11.734  1.00 42.11  ? 428  TYR A O   1 
ATOM   3271 C CB  . TYR A 1 427 ? 62.360  37.417 12.763  1.00 40.46  ? 428  TYR A CB  1 
ATOM   3272 C CG  . TYR A 1 427 ? 61.915  36.717 14.034  1.00 38.73  ? 428  TYR A CG  1 
ATOM   3273 C CD1 . TYR A 1 427 ? 62.084  35.345 14.194  1.00 40.44  ? 428  TYR A CD1 1 
ATOM   3274 C CD2 . TYR A 1 427 ? 61.341  37.429 15.078  1.00 41.12  ? 428  TYR A CD2 1 
ATOM   3275 C CE1 . TYR A 1 427 ? 61.677  34.702 15.351  1.00 45.87  ? 428  TYR A CE1 1 
ATOM   3276 C CE2 . TYR A 1 427 ? 60.934  36.792 16.247  1.00 42.76  ? 428  TYR A CE2 1 
ATOM   3277 C CZ  . TYR A 1 427 ? 61.105  35.429 16.372  1.00 41.30  ? 428  TYR A CZ  1 
ATOM   3278 O OH  . TYR A 1 427 ? 60.704  34.785 17.516  1.00 46.55  ? 428  TYR A OH  1 
ATOM   3279 N N   . VAL A 1 428 ? 61.842  35.222 10.654  1.00 46.77  ? 429  VAL A N   1 
ATOM   3280 C CA  . VAL A 1 428 ? 61.824  33.767 10.590  1.00 42.68  ? 429  VAL A CA  1 
ATOM   3281 C C   . VAL A 1 428 ? 63.206  33.285 11.004  1.00 43.38  ? 429  VAL A C   1 
ATOM   3282 O O   . VAL A 1 428 ? 64.215  33.707 10.424  1.00 44.95  ? 429  VAL A O   1 
ATOM   3283 C CB  . VAL A 1 428 ? 61.455  33.235 9.195   1.00 50.25  ? 429  VAL A CB  1 
ATOM   3284 C CG1 . VAL A 1 428 ? 61.517  31.712 9.186   1.00 41.18  ? 429  VAL A CG1 1 
ATOM   3285 C CG2 . VAL A 1 428 ? 60.063  33.700 8.801   1.00 49.36  ? 429  VAL A CG2 1 
ATOM   3286 N N   . PHE A 1 429 ? 63.256  32.425 12.015  1.00 41.11  ? 430  PHE A N   1 
ATOM   3287 C CA  . PHE A 1 429 ? 64.514  31.919 12.547  1.00 42.38  ? 430  PHE A CA  1 
ATOM   3288 C C   . PHE A 1 429 ? 64.892  30.660 11.778  1.00 41.83  ? 430  PHE A C   1 
ATOM   3289 O O   . PHE A 1 429 ? 64.168  29.660 11.824  1.00 41.83  ? 430  PHE A O   1 
ATOM   3290 C CB  . PHE A 1 429 ? 64.382  31.637 14.042  1.00 37.86  ? 430  PHE A CB  1 
ATOM   3291 C CG  . PHE A 1 429 ? 65.645  31.139 14.681  1.00 42.85  ? 430  PHE A CG  1 
ATOM   3292 C CD1 . PHE A 1 429 ? 66.604  32.030 15.138  1.00 41.72  ? 430  PHE A CD1 1 
ATOM   3293 C CD2 . PHE A 1 429 ? 65.870  29.781 14.835  1.00 44.54  ? 430  PHE A CD2 1 
ATOM   3294 C CE1 . PHE A 1 429 ? 67.769  31.574 15.732  1.00 42.86  ? 430  PHE A CE1 1 
ATOM   3295 C CE2 . PHE A 1 429 ? 67.031  29.319 15.430  1.00 47.94  ? 430  PHE A CE2 1 
ATOM   3296 C CZ  . PHE A 1 429 ? 67.983  30.217 15.877  1.00 41.07  ? 430  PHE A CZ  1 
ATOM   3297 N N   . GLU A 1 430 ? 66.025  30.708 11.075  1.00 40.99  ? 431  GLU A N   1 
ATOM   3298 C CA  . GLU A 1 430 ? 66.362  29.683 10.093  1.00 43.50  ? 431  GLU A CA  1 
ATOM   3299 C C   . GLU A 1 430 ? 67.699  29.004 10.353  1.00 51.16  ? 431  GLU A C   1 
ATOM   3300 O O   . GLU A 1 430 ? 68.208  28.312 9.463   1.00 55.01  ? 431  GLU A O   1 
ATOM   3301 C CB  . GLU A 1 430 ? 66.362  30.281 8.683   1.00 43.63  ? 431  GLU A CB  1 
ATOM   3302 C CG  . GLU A 1 430 ? 65.066  30.980 8.304   1.00 54.50  ? 431  GLU A CG  1 
ATOM   3303 C CD  . GLU A 1 430 ? 64.917  31.159 6.803   1.00 60.02  ? 431  GLU A CD  1 
ATOM   3304 O OE1 . GLU A 1 430 ? 63.817  30.888 6.278   1.00 67.59  ? 431  GLU A OE1 1 
ATOM   3305 O OE2 . GLU A 1 430 ? 65.899  31.563 6.146   1.00 61.65  ? 431  GLU A OE2 1 
ATOM   3306 N N   . HIS A 1 431 ? 68.284  29.172 11.533  1.00 48.69  ? 432  HIS A N   1 
ATOM   3307 C CA  . HIS A 1 431 ? 69.545  28.523 11.862  1.00 52.40  ? 432  HIS A CA  1 
ATOM   3308 C C   . HIS A 1 431 ? 69.283  27.253 12.658  1.00 54.16  ? 432  HIS A C   1 
ATOM   3309 O O   . HIS A 1 431 ? 68.584  27.283 13.675  1.00 50.24  ? 432  HIS A O   1 
ATOM   3310 C CB  . HIS A 1 431 ? 70.463  29.451 12.657  1.00 49.71  ? 432  HIS A CB  1 
ATOM   3311 C CG  . HIS A 1 431 ? 71.703  28.776 13.150  1.00 50.74  ? 432  HIS A CG  1 
ATOM   3312 N ND1 . HIS A 1 431 ? 72.684  28.310 12.301  1.00 55.35  ? 432  HIS A ND1 1 
ATOM   3313 C CD2 . HIS A 1 431 ? 72.113  28.468 14.403  1.00 54.84  ? 432  HIS A CD2 1 
ATOM   3314 C CE1 . HIS A 1 431 ? 73.650  27.754 13.010  1.00 57.02  ? 432  HIS A CE1 1 
ATOM   3315 N NE2 . HIS A 1 431 ? 73.328  27.836 14.288  1.00 58.74  ? 432  HIS A NE2 1 
ATOM   3316 N N   . ARG A 1 432 ? 69.849  26.144 12.196  1.00 53.90  ? 433  ARG A N   1 
ATOM   3317 C CA  . ARG A 1 432 ? 69.784  24.883 12.919  1.00 51.08  ? 433  ARG A CA  1 
ATOM   3318 C C   . ARG A 1 432 ? 71.035  24.753 13.779  1.00 55.52  ? 433  ARG A C   1 
ATOM   3319 O O   . ARG A 1 432 ? 72.149  24.670 13.251  1.00 54.98  ? 433  ARG A O   1 
ATOM   3320 C CB  . ARG A 1 432 ? 69.662  23.710 11.948  1.00 53.57  ? 433  ARG A CB  1 
ATOM   3321 C CG  . ARG A 1 432 ? 69.588  22.357 12.625  1.00 58.46  ? 433  ARG A CG  1 
ATOM   3322 C CD  . ARG A 1 432 ? 69.465  21.245 11.608  1.00 55.52  ? 433  ARG A CD  1 
ATOM   3323 N NE  . ARG A 1 432 ? 69.734  19.941 12.203  1.00 57.61  ? 433  ARG A NE  1 
ATOM   3324 C CZ  . ARG A 1 432 ? 68.796  19.108 12.638  1.00 58.70  ? 433  ARG A CZ  1 
ATOM   3325 N NH1 . ARG A 1 432 ? 67.514  19.437 12.544  1.00 54.23  ? 433  ARG A NH1 1 
ATOM   3326 N NH2 . ARG A 1 432 ? 69.142  17.942 13.165  1.00 61.70  ? 433  ARG A NH2 1 
ATOM   3327 N N   . ALA A 1 433 ? 70.850  24.747 15.098  1.00 50.11  ? 434  ALA A N   1 
ATOM   3328 C CA  . ALA A 1 433 ? 71.982  24.729 16.014  1.00 55.42  ? 434  ALA A CA  1 
ATOM   3329 C C   . ALA A 1 433 ? 72.862  23.510 15.767  1.00 51.77  ? 434  ALA A C   1 
ATOM   3330 O O   . ALA A 1 433 ? 72.372  22.405 15.522  1.00 54.98  ? 434  ALA A O   1 
ATOM   3331 C CB  . ALA A 1 433 ? 71.491  24.740 17.463  1.00 54.38  ? 434  ALA A CB  1 
ATOM   3332 N N   . SER A 1 434 ? 74.178  23.725 15.825  1.00 45.93  ? 435  SER A N   1 
ATOM   3333 C CA  . SER A 1 434 ? 75.122  22.628 15.641  1.00 44.92  ? 435  SER A CA  1 
ATOM   3334 C C   . SER A 1 434 ? 74.947  21.547 16.700  1.00 55.86  ? 435  SER A C   1 
ATOM   3335 O O   . SER A 1 434 ? 75.283  20.382 16.458  1.00 57.00  ? 435  SER A O   1 
ATOM   3336 C CB  . SER A 1 434 ? 76.553  23.163 15.672  1.00 51.25  ? 435  SER A CB  1 
ATOM   3337 O OG  . SER A 1 434 ? 76.847  23.738 16.937  1.00 61.73  ? 435  SER A OG  1 
ATOM   3338 N N   . THR A 1 435 ? 74.433  21.908 17.875  1.00 53.63  ? 436  THR A N   1 
ATOM   3339 C CA  . THR A 1 435 ? 74.254  20.971 18.975  1.00 51.67  ? 436  THR A CA  1 
ATOM   3340 C C   . THR A 1 435 ? 72.872  20.332 19.001  1.00 54.51  ? 436  THR A C   1 
ATOM   3341 O O   . THR A 1 435 ? 72.570  19.590 19.941  1.00 59.61  ? 436  THR A O   1 
ATOM   3342 C CB  . THR A 1 435 ? 74.501  21.675 20.312  1.00 49.25  ? 436  THR A CB  1 
ATOM   3343 O OG1 . THR A 1 435 ? 73.673  22.841 20.390  1.00 49.45  ? 436  THR A OG1 1 
ATOM   3344 C CG2 . THR A 1 435 ? 75.959  22.083 20.443  1.00 50.77  ? 436  THR A CG2 1 
ATOM   3345 N N   . LEU A 1 436 ? 72.031  20.602 18.005  1.00 50.51  ? 437  LEU A N   1 
ATOM   3346 C CA  . LEU A 1 436 ? 70.662  20.102 18.022  1.00 53.53  ? 437  LEU A CA  1 
ATOM   3347 C C   . LEU A 1 436 ? 70.645  18.577 18.014  1.00 54.10  ? 437  LEU A C   1 
ATOM   3348 O O   . LEU A 1 436 ? 71.355  17.938 17.233  1.00 54.29  ? 437  LEU A O   1 
ATOM   3349 C CB  . LEU A 1 436 ? 69.893  20.654 16.821  1.00 52.21  ? 437  LEU A CB  1 
ATOM   3350 C CG  . LEU A 1 436 ? 68.381  20.440 16.820  1.00 55.01  ? 437  LEU A CG  1 
ATOM   3351 C CD1 . LEU A 1 436 ? 67.755  21.051 18.060  1.00 53.41  ? 437  LEU A CD1 1 
ATOM   3352 C CD2 . LEU A 1 436 ? 67.771  21.037 15.570  1.00 59.94  ? 437  LEU A CD2 1 
ATOM   3353 N N   . SER A 1 437 ? 69.832  17.994 18.894  1.00 55.14  ? 438  SER A N   1 
ATOM   3354 C CA  . SER A 1 437 ? 69.779  16.545 19.039  1.00 54.58  ? 438  SER A CA  1 
ATOM   3355 C C   . SER A 1 437 ? 68.676  15.899 18.213  1.00 52.07  ? 438  SER A C   1 
ATOM   3356 O O   . SER A 1 437 ? 68.726  14.685 17.984  1.00 56.34  ? 438  SER A O   1 
ATOM   3357 C CB  . SER A 1 437 ? 69.600  16.168 20.515  1.00 56.46  ? 438  SER A CB  1 
ATOM   3358 O OG  . SER A 1 437 ? 68.536  16.896 21.102  1.00 56.59  ? 438  SER A OG  1 
ATOM   3359 N N   . TRP A 1 438 ? 67.687  16.672 17.766  1.00 52.82  ? 439  TRP A N   1 
ATOM   3360 C CA  . TRP A 1 438 ? 66.640  16.140 16.910  1.00 51.12  ? 439  TRP A CA  1 
ATOM   3361 C C   . TRP A 1 438 ? 67.207  15.807 15.530  1.00 54.41  ? 439  TRP A C   1 
ATOM   3362 O O   . TRP A 1 438 ? 68.221  16.373 15.113  1.00 54.94  ? 439  TRP A O   1 
ATOM   3363 C CB  . TRP A 1 438 ? 65.495  17.144 16.795  1.00 46.23  ? 439  TRP A CB  1 
ATOM   3364 C CG  . TRP A 1 438 ? 64.788  17.384 18.097  1.00 49.19  ? 439  TRP A CG  1 
ATOM   3365 C CD1 . TRP A 1 438 ? 65.000  18.414 18.967  1.00 46.79  ? 439  TRP A CD1 1 
ATOM   3366 C CD2 . TRP A 1 438 ? 63.762  16.570 18.681  1.00 47.28  ? 439  TRP A CD2 1 
ATOM   3367 N NE1 . TRP A 1 438 ? 64.166  18.295 20.053  1.00 48.80  ? 439  TRP A NE1 1 
ATOM   3368 C CE2 . TRP A 1 438 ? 63.398  17.170 19.903  1.00 51.37  ? 439  TRP A CE2 1 
ATOM   3369 C CE3 . TRP A 1 438 ? 63.118  15.393 18.290  1.00 43.48  ? 439  TRP A CE3 1 
ATOM   3370 C CZ2 . TRP A 1 438 ? 62.416  16.633 20.737  1.00 48.53  ? 439  TRP A CZ2 1 
ATOM   3371 C CZ3 . TRP A 1 438 ? 62.143  14.862 19.115  1.00 48.57  ? 439  TRP A CZ3 1 
ATOM   3372 C CH2 . TRP A 1 438 ? 61.802  15.482 20.325  1.00 51.21  ? 439  TRP A CH2 1 
ATOM   3373 N N   . PRO A 1 439 ? 66.578  14.880 14.807  1.00 53.07  ? 440  PRO A N   1 
ATOM   3374 C CA  . PRO A 1 439 ? 67.118  14.460 13.508  1.00 52.10  ? 440  PRO A CA  1 
ATOM   3375 C C   . PRO A 1 439 ? 67.032  15.567 12.466  1.00 51.74  ? 440  PRO A C   1 
ATOM   3376 O O   . PRO A 1 439 ? 66.366  16.591 12.637  1.00 48.65  ? 440  PRO A O   1 
ATOM   3377 C CB  . PRO A 1 439 ? 66.240  13.264 13.127  1.00 56.84  ? 440  PRO A CB  1 
ATOM   3378 C CG  . PRO A 1 439 ? 64.965  13.493 13.863  1.00 58.00  ? 440  PRO A CG  1 
ATOM   3379 C CD  . PRO A 1 439 ? 65.377  14.107 15.171  1.00 55.51  ? 440  PRO A CD  1 
ATOM   3380 N N   . LEU A 1 440 ? 67.722  15.324 11.349  1.00 54.57  ? 441  LEU A N   1 
ATOM   3381 C CA  . LEU A 1 440 ? 67.877  16.343 10.314  1.00 60.82  ? 441  LEU A CA  1 
ATOM   3382 C C   . LEU A 1 440 ? 66.550  16.694 9.651   1.00 58.43  ? 441  LEU A C   1 
ATOM   3383 O O   . LEU A 1 440 ? 66.319  17.858 9.302   1.00 57.53  ? 441  LEU A O   1 
ATOM   3384 C CB  . LEU A 1 440 ? 68.881  15.870 9.264   1.00 71.26  ? 441  LEU A CB  1 
ATOM   3385 C CG  . LEU A 1 440 ? 70.337  16.285 9.469   1.00 79.71  ? 441  LEU A CG  1 
ATOM   3386 C CD1 . LEU A 1 440 ? 71.266  15.384 8.672   1.00 81.51  ? 441  LEU A CD1 1 
ATOM   3387 C CD2 . LEU A 1 440 ? 70.526  17.740 9.068   1.00 81.91  ? 441  LEU A CD2 1 
ATOM   3388 N N   . TRP A 1 441 ? 65.668  15.709 9.457   1.00 56.32  ? 442  TRP A N   1 
ATOM   3389 C CA  . TRP A 1 441 ? 64.442  15.976 8.713   1.00 54.64  ? 442  TRP A CA  1 
ATOM   3390 C C   . TRP A 1 441 ? 63.531  16.965 9.428   1.00 55.28  ? 442  TRP A C   1 
ATOM   3391 O O   . TRP A 1 441 ? 62.663  17.562 8.783   1.00 57.25  ? 442  TRP A O   1 
ATOM   3392 C CB  . TRP A 1 441 ? 63.683  14.674 8.422   1.00 58.47  ? 442  TRP A CB  1 
ATOM   3393 C CG  . TRP A 1 441 ? 63.111  13.972 9.623   1.00 57.38  ? 442  TRP A CG  1 
ATOM   3394 C CD1 . TRP A 1 441 ? 63.657  12.911 10.285  1.00 57.83  ? 442  TRP A CD1 1 
ATOM   3395 C CD2 . TRP A 1 441 ? 61.871  14.262 10.285  1.00 50.49  ? 442  TRP A CD2 1 
ATOM   3396 N NE1 . TRP A 1 441 ? 62.842  12.531 11.323  1.00 58.68  ? 442  TRP A NE1 1 
ATOM   3397 C CE2 . TRP A 1 441 ? 61.740  13.344 11.346  1.00 52.46  ? 442  TRP A CE2 1 
ATOM   3398 C CE3 . TRP A 1 441 ? 60.862  15.212 10.088  1.00 47.03  ? 442  TRP A CE3 1 
ATOM   3399 C CZ2 . TRP A 1 441 ? 60.644  13.348 12.207  1.00 47.24  ? 442  TRP A CZ2 1 
ATOM   3400 C CZ3 . TRP A 1 441 ? 59.773  15.214 10.946  1.00 47.16  ? 442  TRP A CZ3 1 
ATOM   3401 C CH2 . TRP A 1 441 ? 59.674  14.288 11.992  1.00 46.89  ? 442  TRP A CH2 1 
ATOM   3402 N N   . MET A 1 442 ? 63.708  17.163 10.737  1.00 49.20  ? 443  MET A N   1 
ATOM   3403 C CA  . MET A 1 442 ? 62.895  18.140 11.451  1.00 48.60  ? 443  MET A CA  1 
ATOM   3404 C C   . MET A 1 442 ? 63.317  19.577 11.175  1.00 45.29  ? 443  MET A C   1 
ATOM   3405 O O   . MET A 1 442 ? 62.571  20.499 11.522  1.00 42.87  ? 443  MET A O   1 
ATOM   3406 C CB  . MET A 1 442 ? 62.940  17.876 12.958  1.00 47.21  ? 443  MET A CB  1 
ATOM   3407 C CG  . MET A 1 442 ? 62.337  16.546 13.371  1.00 48.78  ? 443  MET A CG  1 
ATOM   3408 S SD  . MET A 1 442 ? 62.066  16.420 15.153  1.00 56.10  ? 443  MET A SD  1 
ATOM   3409 C CE  . MET A 1 442 ? 61.659  14.691 15.283  1.00 59.34  ? 443  MET A CE  1 
ATOM   3410 N N   . GLY A 1 443 ? 64.480  19.789 10.567  1.00 46.11  ? 444  GLY A N   1 
ATOM   3411 C CA  . GLY A 1 443 ? 64.889  21.142 10.219  1.00 46.84  ? 444  GLY A CA  1 
ATOM   3412 C C   . GLY A 1 443 ? 65.159  21.971 11.460  1.00 50.16  ? 444  GLY A C   1 
ATOM   3413 O O   . GLY A 1 443 ? 65.897  21.557 12.362  1.00 48.60  ? 444  GLY A O   1 
ATOM   3414 N N   . VAL A 1 444 ? 64.566  23.160 11.504  1.00 45.16  ? 445  VAL A N   1 
ATOM   3415 C CA  . VAL A 1 444 ? 64.697  24.064 12.643  1.00 47.08  ? 445  VAL A CA  1 
ATOM   3416 C C   . VAL A 1 444 ? 63.418  23.967 13.465  1.00 47.96  ? 445  VAL A C   1 
ATOM   3417 O O   . VAL A 1 444 ? 62.435  24.664 13.172  1.00 43.87  ? 445  VAL A O   1 
ATOM   3418 C CB  . VAL A 1 444 ? 64.969  25.506 12.186  1.00 49.29  ? 445  VAL A CB  1 
ATOM   3419 C CG1 . VAL A 1 444 ? 65.278  26.395 13.384  1.00 43.60  ? 445  VAL A CG1 1 
ATOM   3420 C CG2 . VAL A 1 444 ? 66.114  25.534 11.181  1.00 45.87  ? 445  VAL A CG2 1 
ATOM   3421 N N   . PRO A 1 445 ? 63.385  23.133 14.497  1.00 44.34  ? 446  PRO A N   1 
ATOM   3422 C CA  . PRO A 1 445 ? 62.117  22.798 15.147  1.00 43.93  ? 446  PRO A CA  1 
ATOM   3423 C C   . PRO A 1 445 ? 61.622  23.917 16.053  1.00 40.88  ? 446  PRO A C   1 
ATOM   3424 O O   . PRO A 1 445 ? 62.324  24.882 16.360  1.00 41.93  ? 446  PRO A O   1 
ATOM   3425 C CB  . PRO A 1 445 ? 62.453  21.541 15.964  1.00 41.22  ? 446  PRO A CB  1 
ATOM   3426 C CG  . PRO A 1 445 ? 63.831  21.116 15.508  1.00 43.51  ? 446  PRO A CG  1 
ATOM   3427 C CD  . PRO A 1 445 ? 64.501  22.374 15.073  1.00 42.97  ? 446  PRO A CD  1 
ATOM   3428 N N   . HIS A 1 446 ? 60.370  23.758 16.470  1.00 39.75  ? 447  HIS A N   1 
ATOM   3429 C CA  . HIS A 1 446 ? 59.743  24.664 17.420  1.00 42.97  ? 447  HIS A CA  1 
ATOM   3430 C C   . HIS A 1 446 ? 60.578  24.783 18.689  1.00 44.06  ? 447  HIS A C   1 
ATOM   3431 O O   . HIS A 1 446 ? 61.010  23.778 19.260  1.00 44.18  ? 447  HIS A O   1 
ATOM   3432 C CB  . HIS A 1 446 ? 58.341  24.146 17.749  1.00 42.82  ? 447  HIS A CB  1 
ATOM   3433 C CG  . HIS A 1 446 ? 57.575  25.011 18.697  1.00 47.11  ? 447  HIS A CG  1 
ATOM   3434 N ND1 . HIS A 1 446 ? 56.891  26.137 18.290  1.00 45.02  ? 447  HIS A ND1 1 
ATOM   3435 C CD2 . HIS A 1 446 ? 57.370  24.906 20.031  1.00 42.54  ? 447  HIS A CD2 1 
ATOM   3436 C CE1 . HIS A 1 446 ? 56.303  26.692 19.334  1.00 46.09  ? 447  HIS A CE1 1 
ATOM   3437 N NE2 . HIS A 1 446 ? 56.581  25.966 20.403  1.00 48.93  ? 447  HIS A NE2 1 
ATOM   3438 N N   . GLY A 1 447 ? 60.830  26.022 19.108  1.00 40.53  ? 448  GLY A N   1 
ATOM   3439 C CA  . GLY A 1 447 ? 61.461  26.293 20.381  1.00 42.66  ? 448  GLY A CA  1 
ATOM   3440 C C   . GLY A 1 447 ? 62.970  26.415 20.374  1.00 43.86  ? 448  GLY A C   1 
ATOM   3441 O O   . GLY A 1 447 ? 63.554  26.656 21.437  1.00 43.06  ? 448  GLY A O   1 
ATOM   3442 N N   . TYR A 1 448 ? 63.630  26.275 19.225  1.00 42.51  ? 449  TYR A N   1 
ATOM   3443 C CA  . TYR A 1 448 ? 65.085  26.216 19.213  1.00 44.40  ? 449  TYR A CA  1 
ATOM   3444 C C   . TYR A 1 448 ? 65.732  27.514 18.746  1.00 44.93  ? 449  TYR A C   1 
ATOM   3445 O O   . TYR A 1 448 ? 66.917  27.524 18.399  1.00 50.20  ? 449  TYR A O   1 
ATOM   3446 C CB  . TYR A 1 448 ? 65.546  25.009 18.397  1.00 40.40  ? 449  TYR A CB  1 
ATOM   3447 C CG  . TYR A 1 448 ? 65.299  23.761 19.207  1.00 50.15  ? 449  TYR A CG  1 
ATOM   3448 C CD1 . TYR A 1 448 ? 66.192  23.372 20.200  1.00 51.09  ? 449  TYR A CD1 1 
ATOM   3449 C CD2 . TYR A 1 448 ? 64.132  23.023 19.051  1.00 46.05  ? 449  TYR A CD2 1 
ATOM   3450 C CE1 . TYR A 1 448 ? 65.956  22.252 20.979  1.00 50.85  ? 449  TYR A CE1 1 
ATOM   3451 C CE2 . TYR A 1 448 ? 63.886  21.901 19.827  1.00 51.55  ? 449  TYR A CE2 1 
ATOM   3452 C CZ  . TYR A 1 448 ? 64.802  21.521 20.791  1.00 56.56  ? 449  TYR A CZ  1 
ATOM   3453 O OH  . TYR A 1 448 ? 64.562  20.407 21.567  1.00 56.89  ? 449  TYR A OH  1 
ATOM   3454 N N   . GLU A 1 449 ? 64.984  28.615 18.767  1.00 42.14  ? 450  GLU A N   1 
ATOM   3455 C CA  . GLU A 1 449 ? 65.578  29.942 18.747  1.00 42.00  ? 450  GLU A CA  1 
ATOM   3456 C C   . GLU A 1 449 ? 65.797  30.498 20.150  1.00 40.82  ? 450  GLU A C   1 
ATOM   3457 O O   . GLU A 1 449 ? 66.582  31.440 20.314  1.00 45.14  ? 450  GLU A O   1 
ATOM   3458 C CB  . GLU A 1 449 ? 64.691  30.907 17.952  1.00 40.47  ? 450  GLU A CB  1 
ATOM   3459 C CG  . GLU A 1 449 ? 63.608  31.615 18.772  1.00 39.42  ? 450  GLU A CG  1 
ATOM   3460 C CD  . GLU A 1 449 ? 62.454  30.709 19.179  1.00 44.88  ? 450  GLU A CD  1 
ATOM   3461 O OE1 . GLU A 1 449 ? 62.565  29.472 19.042  1.00 44.64  ? 450  GLU A OE1 1 
ATOM   3462 O OE2 . GLU A 1 449 ? 61.421  31.244 19.635  1.00 48.18  ? 450  GLU A OE2 1 
ATOM   3463 N N   . ILE A 1 450 ? 65.131  29.929 21.159  1.00 38.82  ? 451  ILE A N   1 
ATOM   3464 C CA  . ILE A 1 450 ? 65.181  30.489 22.510  1.00 38.83  ? 451  ILE A CA  1 
ATOM   3465 C C   . ILE A 1 450 ? 66.612  30.516 23.027  1.00 40.09  ? 451  ILE A C   1 
ATOM   3466 O O   . ILE A 1 450 ? 67.075  31.524 23.573  1.00 40.10  ? 451  ILE A O   1 
ATOM   3467 C CB  . ILE A 1 450 ? 64.262  29.697 23.457  1.00 39.31  ? 451  ILE A CB  1 
ATOM   3468 C CG1 . ILE A 1 450 ? 62.807  29.777 22.993  1.00 39.68  ? 451  ILE A CG1 1 
ATOM   3469 C CG2 . ILE A 1 450 ? 64.399  30.212 24.883  1.00 37.00  ? 451  ILE A CG2 1 
ATOM   3470 C CD1 . ILE A 1 450 ? 61.867  28.933 23.824  1.00 31.95  ? 451  ILE A CD1 1 
ATOM   3471 N N   . GLU A 1 451 ? 67.338  29.407 22.852  1.00 39.66  ? 452  GLU A N   1 
ATOM   3472 C CA  . GLU A 1 451 ? 68.690  29.309 23.394  1.00 41.69  ? 452  GLU A CA  1 
ATOM   3473 C C   . GLU A 1 451 ? 69.617  30.371 22.814  1.00 43.99  ? 452  GLU A C   1 
ATOM   3474 O O   . GLU A 1 451 ? 70.578  30.777 23.475  1.00 45.06  ? 452  GLU A O   1 
ATOM   3475 C CB  . GLU A 1 451 ? 69.254  27.906 23.148  1.00 41.64  ? 452  GLU A CB  1 
ATOM   3476 C CG  . GLU A 1 451 ? 69.288  27.475 21.680  1.00 47.66  ? 452  GLU A CG  1 
ATOM   3477 C CD  . GLU A 1 451 ? 69.419  25.965 21.518  1.00 49.74  ? 452  GLU A CD  1 
ATOM   3478 O OE1 . GLU A 1 451 ? 68.529  25.231 21.997  1.00 51.18  ? 452  GLU A OE1 1 
ATOM   3479 O OE2 . GLU A 1 451 ? 70.420  25.510 20.928  1.00 52.65  ? 452  GLU A OE2 1 
ATOM   3480 N N   . PHE A 1 452 ? 69.348  30.839 21.591  1.00 39.74  ? 453  PHE A N   1 
ATOM   3481 C CA  . PHE A 1 452 ? 70.169  31.902 21.022  1.00 40.28  ? 453  PHE A CA  1 
ATOM   3482 C C   . PHE A 1 452 ? 69.755  33.279 21.528  1.00 40.69  ? 453  PHE A C   1 
ATOM   3483 O O   . PHE A 1 452 ? 70.612  34.152 21.705  1.00 50.44  ? 453  PHE A O   1 
ATOM   3484 C CB  . PHE A 1 452 ? 70.114  31.850 19.491  1.00 46.44  ? 453  PHE A CB  1 
ATOM   3485 C CG  . PHE A 1 452 ? 70.882  30.701 18.907  1.00 42.91  ? 453  PHE A CG  1 
ATOM   3486 C CD1 . PHE A 1 452 ? 70.273  29.475 18.700  1.00 42.44  ? 453  PHE A CD1 1 
ATOM   3487 C CD2 . PHE A 1 452 ? 72.225  30.836 18.601  1.00 42.58  ? 453  PHE A CD2 1 
ATOM   3488 C CE1 . PHE A 1 452 ? 70.986  28.412 18.183  1.00 48.26  ? 453  PHE A CE1 1 
ATOM   3489 C CE2 . PHE A 1 452 ? 72.942  29.777 18.084  1.00 46.08  ? 453  PHE A CE2 1 
ATOM   3490 C CZ  . PHE A 1 452 ? 72.322  28.563 17.874  1.00 46.62  ? 453  PHE A CZ  1 
ATOM   3491 N N   . ILE A 1 453 ? 68.462  33.489 21.775  1.00 42.44  ? 454  ILE A N   1 
ATOM   3492 C CA  . ILE A 1 453 ? 68.006  34.771 22.305  1.00 46.27  ? 454  ILE A CA  1 
ATOM   3493 C C   . ILE A 1 453 ? 68.500  34.970 23.734  1.00 47.47  ? 454  ILE A C   1 
ATOM   3494 O O   . ILE A 1 453 ? 68.822  36.092 24.145  1.00 50.63  ? 454  ILE A O   1 
ATOM   3495 C CB  . ILE A 1 453 ? 66.473  34.860 22.207  1.00 45.17  ? 454  ILE A CB  1 
ATOM   3496 C CG1 . ILE A 1 453 ? 66.050  34.838 20.734  1.00 44.73  ? 454  ILE A CG1 1 
ATOM   3497 C CG2 . ILE A 1 453 ? 65.953  36.107 22.911  1.00 41.77  ? 454  ILE A CG2 1 
ATOM   3498 C CD1 . ILE A 1 453 ? 64.568  34.680 20.535  1.00 46.02  ? 454  ILE A CD1 1 
ATOM   3499 N N   . PHE A 1 454 ? 68.574  33.895 24.512  1.00 36.92  ? 455  PHE A N   1 
ATOM   3500 C CA  . PHE A 1 454 ? 69.083  34.003 25.873  1.00 38.86  ? 455  PHE A CA  1 
ATOM   3501 C C   . PHE A 1 454 ? 70.602  33.917 25.947  1.00 44.60  ? 455  PHE A C   1 
ATOM   3502 O O   . PHE A 1 454 ? 71.154  33.987 27.050  1.00 43.79  ? 455  PHE A O   1 
ATOM   3503 C CB  . PHE A 1 454 ? 68.453  32.926 26.761  1.00 36.06  ? 455  PHE A CB  1 
ATOM   3504 C CG  . PHE A 1 454 ? 67.079  33.284 27.267  1.00 41.18  ? 455  PHE A CG  1 
ATOM   3505 C CD1 . PHE A 1 454 ? 65.953  33.022 26.504  1.00 45.73  ? 455  PHE A CD1 1 
ATOM   3506 C CD2 . PHE A 1 454 ? 66.916  33.877 28.512  1.00 44.62  ? 455  PHE A CD2 1 
ATOM   3507 C CE1 . PHE A 1 454 ? 64.688  33.348 26.970  1.00 48.23  ? 455  PHE A CE1 1 
ATOM   3508 C CE2 . PHE A 1 454 ? 65.655  34.205 28.983  1.00 41.89  ? 455  PHE A CE2 1 
ATOM   3509 C CZ  . PHE A 1 454 ? 64.539  33.941 28.210  1.00 46.42  ? 455  PHE A CZ  1 
ATOM   3510 N N   . GLY A 1 455 ? 71.287  33.769 24.814  1.00 44.02  ? 456  GLY A N   1 
ATOM   3511 C CA  . GLY A 1 455 ? 72.738  33.785 24.811  1.00 44.48  ? 456  GLY A CA  1 
ATOM   3512 C C   . GLY A 1 455 ? 73.397  32.551 25.384  1.00 51.45  ? 456  GLY A C   1 
ATOM   3513 O O   . GLY A 1 455 ? 74.573  32.606 25.754  1.00 48.87  ? 456  GLY A O   1 
ATOM   3514 N N   . ILE A 1 456 ? 72.674  31.438 25.458  1.00 48.66  ? 457  ILE A N   1 
ATOM   3515 C CA  . ILE A 1 456 ? 73.183  30.168 25.979  1.00 41.52  ? 457  ILE A CA  1 
ATOM   3516 C C   . ILE A 1 456 ? 74.471  29.714 25.289  1.00 50.16  ? 457  ILE A C   1 
ATOM   3517 O O   . ILE A 1 456 ? 75.332  29.127 25.961  1.00 51.64  ? 457  ILE A O   1 
ATOM   3518 C CB  . ILE A 1 456 ? 72.097  29.084 25.886  1.00 42.22  ? 457  ILE A CB  1 
ATOM   3519 C CG1 . ILE A 1 456 ? 70.825  29.565 26.583  1.00 41.35  ? 457  ILE A CG1 1 
ATOM   3520 C CG2 . ILE A 1 456 ? 72.566  27.791 26.523  1.00 42.52  ? 457  ILE A CG2 1 
ATOM   3521 C CD1 . ILE A 1 456 ? 71.039  29.927 28.049  1.00 38.40  ? 457  ILE A CD1 1 
ATOM   3522 N N   . PRO A 1 457 ? 74.667  29.931 23.979  1.00 46.66  ? 458  PRO A N   1 
ATOM   3523 C CA  . PRO A 1 457 ? 75.953  29.539 23.370  1.00 46.59  ? 458  PRO A CA  1 
ATOM   3524 C C   . PRO A 1 457 ? 77.179  30.162 24.023  1.00 51.03  ? 458  PRO A C   1 
ATOM   3525 O O   . PRO A 1 457 ? 78.290  29.651 23.829  1.00 48.93  ? 458  PRO A O   1 
ATOM   3526 C CB  . PRO A 1 457 ? 75.800  29.996 21.914  1.00 46.66  ? 458  PRO A CB  1 
ATOM   3527 C CG  . PRO A 1 457 ? 74.353  29.830 21.650  1.00 43.77  ? 458  PRO A CG  1 
ATOM   3528 C CD  . PRO A 1 457 ? 73.668  30.241 22.936  1.00 42.81  ? 458  PRO A CD  1 
ATOM   3529 N N   . LEU A 1 458 ? 77.026  31.243 24.788  1.00 49.23  ? 459  LEU A N   1 
ATOM   3530 C CA  . LEU A 1 458 ? 78.165  31.798 25.505  1.00 53.64  ? 459  LEU A CA  1 
ATOM   3531 C C   . LEU A 1 458 ? 78.517  31.013 26.763  1.00 56.17  ? 459  LEU A C   1 
ATOM   3532 O O   . LEU A 1 458 ? 79.538  31.310 27.389  1.00 53.18  ? 459  LEU A O   1 
ATOM   3533 C CB  . LEU A 1 458 ? 77.903  33.262 25.868  1.00 53.64  ? 459  LEU A CB  1 
ATOM   3534 C CG  . LEU A 1 458 ? 77.506  34.161 24.696  1.00 61.12  ? 459  LEU A CG  1 
ATOM   3535 C CD1 . LEU A 1 458 ? 76.990  35.493 25.206  1.00 63.93  ? 459  LEU A CD1 1 
ATOM   3536 C CD2 . LEU A 1 458 ? 78.673  34.362 23.738  1.00 57.84  ? 459  LEU A CD2 1 
ATOM   3537 N N   . ASP A 1 459 ? 77.711  30.030 27.144  1.00 56.80  ? 460  ASP A N   1 
ATOM   3538 C CA  . ASP A 1 459 ? 78.015  29.195 28.299  1.00 62.22  ? 460  ASP A CA  1 
ATOM   3539 C C   . ASP A 1 459 ? 79.310  28.433 28.047  1.00 69.84  ? 460  ASP A C   1 
ATOM   3540 O O   . ASP A 1 459 ? 79.409  27.707 27.043  1.00 71.13  ? 460  ASP A O   1 
ATOM   3541 C CB  . ASP A 1 459 ? 76.867  28.227 28.572  1.00 68.56  ? 460  ASP A CB  1 
ATOM   3542 C CG  . ASP A 1 459 ? 76.977  27.532 29.924  1.00 71.24  ? 460  ASP A CG  1 
ATOM   3543 O OD1 . ASP A 1 459 ? 78.101  27.214 30.361  1.00 66.56  ? 460  ASP A OD1 1 
ATOM   3544 O OD2 . ASP A 1 459 ? 75.921  27.292 30.549  1.00 78.50  ? 460  ASP A OD2 1 
ATOM   3545 N N   . PRO A 1 460 ? 80.317  28.562 28.916  1.00 78.79  ? 461  PRO A N   1 
ATOM   3546 C CA  . PRO A 1 460 ? 81.608  27.886 28.652  1.00 79.61  ? 461  PRO A CA  1 
ATOM   3547 C C   . PRO A 1 460 ? 81.496  26.375 28.529  1.00 78.44  ? 461  PRO A C   1 
ATOM   3548 O O   . PRO A 1 460 ? 82.282  25.769 27.799  1.00 84.95  ? 461  PRO A O   1 
ATOM   3549 C CB  . PRO A 1 460 ? 82.471  28.280 29.865  1.00 86.59  ? 461  PRO A CB  1 
ATOM   3550 C CG  . PRO A 1 460 ? 81.583  29.063 30.793  1.00 87.72  ? 461  PRO A CG  1 
ATOM   3551 C CD  . PRO A 1 460 ? 80.399  29.527 30.024  1.00 82.84  ? 461  PRO A CD  1 
ATOM   3552 N N   . SER A 1 461 ? 80.537  25.752 29.222  1.00 74.75  ? 462  SER A N   1 
ATOM   3553 C CA  . SER A 1 461 ? 80.422  24.298 29.266  1.00 71.61  ? 462  SER A CA  1 
ATOM   3554 C C   . SER A 1 461 ? 79.759  23.696 28.032  1.00 73.41  ? 462  SER A C   1 
ATOM   3555 O O   . SER A 1 461 ? 79.694  22.467 27.929  1.00 76.92  ? 462  SER A O   1 
ATOM   3556 C CB  . SER A 1 461 ? 79.633  23.873 30.506  1.00 71.58  ? 462  SER A CB  1 
ATOM   3557 O OG  . SER A 1 461 ? 78.307  24.368 30.451  1.00 74.68  ? 462  SER A OG  1 
ATOM   3558 N N   . ARG A 1 462 ? 79.260  24.507 27.107  1.00 75.15  ? 463  ARG A N   1 
ATOM   3559 C CA  . ARG A 1 462 ? 78.565  24.011 25.927  1.00 79.88  ? 463  ARG A CA  1 
ATOM   3560 C C   . ARG A 1 462 ? 79.442  24.176 24.692  1.00 82.98  ? 463  ARG A C   1 
ATOM   3561 O O   . ARG A 1 462 ? 80.159  25.172 24.559  1.00 89.06  ? 463  ARG A O   1 
ATOM   3562 C CB  . ARG A 1 462 ? 77.233  24.738 25.744  1.00 76.91  ? 463  ARG A CB  1 
ATOM   3563 C CG  . ARG A 1 462 ? 76.149  24.250 26.692  1.00 78.89  ? 463  ARG A CG  1 
ATOM   3564 C CD  . ARG A 1 462 ? 75.071  25.293 26.896  1.00 79.20  ? 463  ARG A CD  1 
ATOM   3565 N NE  . ARG A 1 462 ? 73.784  24.688 27.226  1.00 83.24  ? 463  ARG A NE  1 
ATOM   3566 C CZ  . ARG A 1 462 ? 73.353  24.456 28.462  1.00 86.89  ? 463  ARG A CZ  1 
ATOM   3567 N NH1 . ARG A 1 462 ? 74.108  24.777 29.505  1.00 89.89  ? 463  ARG A NH1 1 
ATOM   3568 N NH2 . ARG A 1 462 ? 72.164  23.902 28.655  1.00 85.90  ? 463  ARG A NH2 1 
ATOM   3569 N N   . ASN A 1 463 ? 79.384  23.196 23.791  1.00 78.22  ? 464  ASN A N   1 
ATOM   3570 C CA  . ASN A 1 463 ? 80.275  23.174 22.630  1.00 78.24  ? 464  ASN A CA  1 
ATOM   3571 C C   . ASN A 1 463 ? 79.621  23.796 21.397  1.00 65.73  ? 464  ASN A C   1 
ATOM   3572 O O   . ASN A 1 463 ? 79.583  23.191 20.327  1.00 66.08  ? 464  ASN A O   1 
ATOM   3573 C CB  . ASN A 1 463 ? 80.732  21.746 22.336  1.00 93.73  ? 464  ASN A CB  1 
ATOM   3574 C CG  . ASN A 1 463 ? 81.017  20.939 23.597  1.00 112.09 ? 464  ASN A CG  1 
ATOM   3575 O OD1 . ASN A 1 463 ? 81.427  21.486 24.621  1.00 111.68 ? 464  ASN A OD1 1 
ATOM   3576 N ND2 . ASN A 1 463 ? 80.803  19.621 23.514  1.00 132.92 ? 464  ASN A ND2 1 
ATOM   3577 N N   . TYR A 1 464 ? 79.093  25.011 21.532  1.00 56.93  ? 465  TYR A N   1 
ATOM   3578 C CA  . TYR A 1 464 ? 78.660  25.752 20.356  1.00 52.23  ? 465  TYR A CA  1 
ATOM   3579 C C   . TYR A 1 464 ? 79.874  26.260 19.581  1.00 57.01  ? 465  TYR A C   1 
ATOM   3580 O O   . TYR A 1 464 ? 80.984  26.369 20.110  1.00 58.23  ? 465  TYR A O   1 
ATOM   3581 C CB  . TYR A 1 464 ? 77.771  26.935 20.744  1.00 50.61  ? 465  TYR A CB  1 
ATOM   3582 C CG  . TYR A 1 464 ? 76.373  26.569 21.192  1.00 53.55  ? 465  TYR A CG  1 
ATOM   3583 C CD1 . TYR A 1 464 ? 76.120  26.186 22.503  1.00 49.43  ? 465  TYR A CD1 1 
ATOM   3584 C CD2 . TYR A 1 464 ? 75.302  26.625 20.308  1.00 55.57  ? 465  TYR A CD2 1 
ATOM   3585 C CE1 . TYR A 1 464 ? 74.844  25.861 22.919  1.00 50.07  ? 465  TYR A CE1 1 
ATOM   3586 C CE2 . TYR A 1 464 ? 74.020  26.300 20.716  1.00 57.84  ? 465  TYR A CE2 1 
ATOM   3587 C CZ  . TYR A 1 464 ? 73.798  25.918 22.024  1.00 54.55  ? 465  TYR A CZ  1 
ATOM   3588 O OH  . TYR A 1 464 ? 72.526  25.593 22.437  1.00 52.12  ? 465  TYR A OH  1 
ATOM   3589 N N   . THR A 1 465 ? 79.654  26.577 18.310  1.00 51.68  ? 466  THR A N   1 
ATOM   3590 C CA  . THR A 1 465 ? 80.726  27.135 17.502  1.00 54.52  ? 466  THR A CA  1 
ATOM   3591 C C   . THR A 1 465 ? 80.903  28.622 17.796  1.00 55.00  ? 466  THR A C   1 
ATOM   3592 O O   . THR A 1 465 ? 80.000  29.298 18.297  1.00 54.51  ? 466  THR A O   1 
ATOM   3593 C CB  . THR A 1 465 ? 80.439  26.948 16.017  1.00 57.11  ? 466  THR A CB  1 
ATOM   3594 O OG1 . THR A 1 465 ? 79.403  27.856 15.632  1.00 58.38  ? 466  THR A OG1 1 
ATOM   3595 C CG2 . THR A 1 465 ? 79.987  25.526 15.736  1.00 63.83  ? 466  THR A CG2 1 
ATOM   3596 N N   . ALA A 1 466 ? 82.089  29.135 17.459  1.00 55.12  ? 467  ALA A N   1 
ATOM   3597 C CA  . ALA A 1 466 ? 82.342  30.562 17.621  1.00 62.08  ? 467  ALA A CA  1 
ATOM   3598 C C   . ALA A 1 466 ? 81.389  31.400 16.778  1.00 66.65  ? 467  ALA A C   1 
ATOM   3599 O O   . ALA A 1 466 ? 80.979  32.487 17.202  1.00 64.58  ? 467  ALA A O   1 
ATOM   3600 C CB  . ALA A 1 466 ? 83.793  30.882 17.263  1.00 56.04  ? 467  ALA A CB  1 
ATOM   3601 N N   . GLU A 1 467 ? 81.050  30.842 15.628  1.00 57.89  ? 468  GLU A N   1 
ATOM   3602 C CA  A GLU A 1 467 ? 80.073  31.586 14.763  0.50 59.95  ? 468  GLU A CA  1 
ATOM   3603 C CA  B GLU A 1 467 ? 80.012  31.517 14.844  0.50 59.95  ? 468  GLU A CA  1 
ATOM   3604 C C   . GLU A 1 467 ? 78.540  31.782 15.368  1.00 55.20  ? 468  GLU A C   1 
ATOM   3605 O O   . GLU A 1 467 ? 77.723  32.760 15.389  1.00 56.54  ? 468  GLU A O   1 
ATOM   3606 C CB  A GLU A 1 467 ? 79.835  30.769 13.525  0.50 67.16  ? 468  GLU A CB  1 
ATOM   3607 C CB  B GLU A 1 467 ? 79.933  30.885 13.442  0.50 67.16  ? 468  GLU A CB  1 
ATOM   3608 C CG  A GLU A 1 467 ? 80.712  31.074 12.359  0.50 85.60  ? 468  GLU A CG  1 
ATOM   3609 C CG  B GLU A 1 467 ? 81.269  30.810 12.710  0.50 85.60  ? 468  GLU A CG  1 
ATOM   3610 C CD  A GLU A 1 467 ? 80.256  30.317 11.136  0.50 97.42  ? 468  GLU A CD  1 
ATOM   3611 C CD  B GLU A 1 467 ? 82.263  29.879 13.375  0.50 97.42  ? 468  GLU A CD  1 
ATOM   3612 O OE1 A GLU A 1 467 ? 79.940  30.964 10.126  0.50 101.26 ? 468  GLU A OE1 1 
ATOM   3613 O OE1 B GLU A 1 467 ? 81.890  29.211 14.362  0.50 101.26 ? 468  GLU A OE1 1 
ATOM   3614 O OE2 A GLU A 1 467 ? 80.182  29.078 11.200  0.50 96.07  ? 468  GLU A OE2 1 
ATOM   3615 O OE2 B GLU A 1 467 ? 83.415  29.811 12.901  0.50 96.07  ? 468  GLU A OE2 1 
ATOM   3616 N N   . GLU A 1 468 ? 78.300  30.682 16.094  1.00 54.00  ? 469  GLU A N   1 
ATOM   3617 C CA  . GLU A 1 468 ? 77.006  30.704 16.767  1.00 52.59  ? 469  GLU A CA  1 
ATOM   3618 C C   . GLU A 1 468 ? 77.018  31.633 17.976  1.00 52.48  ? 469  GLU A C   1 
ATOM   3619 O O   . GLU A 1 468 ? 75.971  32.169 18.357  1.00 45.52  ? 469  GLU A O   1 
ATOM   3620 C CB  . GLU A 1 468 ? 76.609  29.287 17.182  1.00 52.04  ? 469  GLU A CB  1 
ATOM   3621 C CG  . GLU A 1 468 ? 76.187  28.397 16.021  1.00 55.20  ? 469  GLU A CG  1 
ATOM   3622 C CD  . GLU A 1 468 ? 76.067  26.936 16.414  1.00 57.30  ? 469  GLU A CD  1 
ATOM   3623 O OE1 . GLU A 1 468 ? 76.931  26.450 17.174  1.00 62.07  ? 469  GLU A OE1 1 
ATOM   3624 O OE2 . GLU A 1 468 ? 75.105  26.275 15.968  1.00 60.49  ? 469  GLU A OE2 1 
ATOM   3625 N N   . LYS A 1 469 ? 78.185  31.834 18.591  1.00 50.69  ? 470  LYS A N   1 
ATOM   3626 C CA  . LYS A 1 469 ? 78.282  32.793 19.686  1.00 55.70  ? 470  LYS A CA  1 
ATOM   3627 C C   . LYS A 1 469 ? 78.126  34.220 19.178  1.00 54.85  ? 470  LYS A C   1 
ATOM   3628 O O   . LYS A 1 469 ? 77.471  35.046 19.825  1.00 52.20  ? 470  LYS A O   1 
ATOM   3629 C CB  . LYS A 1 469 ? 79.611  32.612 20.419  1.00 54.67  ? 470  LYS A CB  1 
ATOM   3630 C CG  . LYS A 1 469 ? 79.730  31.266 21.119  1.00 51.18  ? 470  LYS A CG  1 
ATOM   3631 C CD  . LYS A 1 469 ? 81.150  30.995 21.582  1.00 52.90  ? 470  LYS A CD  1 
ATOM   3632 C CE  . LYS A 1 469 ? 81.283  29.579 22.121  1.00 52.04  ? 470  LYS A CE  1 
ATOM   3633 N NZ  . LYS A 1 469 ? 82.683  29.256 22.506  1.00 51.13  ? 470  LYS A NZ  1 
ATOM   3634 N N   . ILE A 1 470 ? 78.717  34.526 18.020  1.00 54.67  ? 471  ILE A N   1 
ATOM   3635 C CA  . ILE A 1 470 ? 78.480  35.815 17.376  1.00 57.14  ? 471  ILE A CA  1 
ATOM   3636 C C   . ILE A 1 470 ? 77.002  35.973 17.046  1.00 57.74  ? 471  ILE A C   1 
ATOM   3637 O O   . ILE A 1 470 ? 76.408  37.035 17.267  1.00 60.19  ? 471  ILE A O   1 
ATOM   3638 C CB  . ILE A 1 470 ? 79.355  35.953 16.115  1.00 61.35  ? 471  ILE A CB  1 
ATOM   3639 C CG1 . ILE A 1 470 ? 80.833  35.744 16.454  1.00 60.99  ? 471  ILE A CG1 1 
ATOM   3640 C CG2 . ILE A 1 470 ? 79.138  37.308 15.454  1.00 58.53  ? 471  ILE A CG2 1 
ATOM   3641 C CD1 . ILE A 1 470 ? 81.395  36.772 17.407  1.00 67.23  ? 471  ILE A CD1 1 
ATOM   3642 N N   . PHE A 1 471 ? 76.386  34.913 16.515  1.00 55.18  ? 472  PHE A N   1 
ATOM   3643 C CA  . PHE A 1 471 ? 74.974  34.965 16.153  1.00 51.11  ? 472  PHE A CA  1 
ATOM   3644 C C   . PHE A 1 471 ? 74.099  35.228 17.375  1.00 45.52  ? 472  PHE A C   1 
ATOM   3645 O O   . PHE A 1 471 ? 73.182  36.056 17.326  1.00 50.31  ? 472  PHE A O   1 
ATOM   3646 C CB  . PHE A 1 471 ? 74.580  33.659 15.461  1.00 48.37  ? 472  PHE A CB  1 
ATOM   3647 C CG  . PHE A 1 471 ? 73.142  33.597 15.034  1.00 48.22  ? 472  PHE A CG  1 
ATOM   3648 C CD1 . PHE A 1 471 ? 72.565  34.641 14.331  1.00 49.27  ? 472  PHE A CD1 1 
ATOM   3649 C CD2 . PHE A 1 471 ? 72.374  32.478 15.315  1.00 49.34  ? 472  PHE A CD2 1 
ATOM   3650 C CE1 . PHE A 1 471 ? 71.240  34.577 13.929  1.00 48.44  ? 472  PHE A CE1 1 
ATOM   3651 C CE2 . PHE A 1 471 ? 71.050  32.407 14.914  1.00 49.11  ? 472  PHE A CE2 1 
ATOM   3652 C CZ  . PHE A 1 471 ? 70.484  33.458 14.220  1.00 47.47  ? 472  PHE A CZ  1 
ATOM   3653 N N   . ALA A 1 472 ? 74.373  34.537 18.482  1.00 43.99  ? 473  ALA A N   1 
ATOM   3654 C CA  . ALA A 1 472 ? 73.627  34.783 19.714  1.00 44.27  ? 473  ALA A CA  1 
ATOM   3655 C C   . ALA A 1 472 ? 73.766  36.231 20.167  1.00 45.54  ? 473  ALA A C   1 
ATOM   3656 O O   . ALA A 1 472 ? 72.779  36.867 20.554  1.00 52.25  ? 473  ALA A O   1 
ATOM   3657 C CB  . ALA A 1 472 ? 74.103  33.835 20.814  1.00 45.55  ? 473  ALA A CB  1 
ATOM   3658 N N   . GLN A 1 473 ? 74.986  36.770 20.124  1.00 44.12  ? 474  GLN A N   1 
ATOM   3659 C CA  . GLN A 1 473 ? 75.198  38.152 20.541  1.00 51.83  ? 474  GLN A CA  1 
ATOM   3660 C C   . GLN A 1 473 ? 74.417  39.119 19.661  1.00 53.97  ? 474  GLN A C   1 
ATOM   3661 O O   . GLN A 1 473 ? 73.871  40.114 20.153  1.00 50.20  ? 474  GLN A O   1 
ATOM   3662 C CB  . GLN A 1 473 ? 76.691  38.480 20.521  1.00 50.44  ? 474  GLN A CB  1 
ATOM   3663 C CG  . GLN A 1 473 ? 77.459  37.873 21.689  1.00 54.23  ? 474  GLN A CG  1 
ATOM   3664 C CD  . GLN A 1 473 ? 78.956  38.078 21.579  1.00 60.13  ? 474  GLN A CD  1 
ATOM   3665 O OE1 . GLN A 1 473 ? 79.514  38.100 20.482  1.00 65.63  ? 474  GLN A OE1 1 
ATOM   3666 N NE2 . GLN A 1 473 ? 79.616  38.232 22.719  1.00 62.07  ? 474  GLN A NE2 1 
ATOM   3667 N N   . ARG A 1 474 ? 74.345  38.840 18.356  1.00 46.27  ? 475  ARG A N   1 
ATOM   3668 C CA  . ARG A 1 474 ? 73.568  39.696 17.467  1.00 51.36  ? 475  ARG A CA  1 
ATOM   3669 C C   . ARG A 1 474 ? 72.081  39.634 17.801  1.00 50.25  ? 475  ARG A C   1 
ATOM   3670 O O   . ARG A 1 474 ? 71.404  40.668 17.828  1.00 49.61  ? 475  ARG A O   1 
ATOM   3671 C CB  . ARG A 1 474 ? 73.820  39.306 16.007  1.00 50.52  ? 475  ARG A CB  1 
ATOM   3672 C CG  . ARG A 1 474 ? 73.061  40.158 14.999  1.00 65.16  ? 475  ARG A CG  1 
ATOM   3673 C CD  . ARG A 1 474 ? 73.728  40.173 13.619  1.00 62.25  ? 475  ARG A CD  1 
ATOM   3674 N NE  . ARG A 1 474 ? 73.879  38.836 13.054  1.00 57.22  ? 475  ARG A NE  1 
ATOM   3675 C CZ  . ARG A 1 474 ? 72.982  38.241 12.274  1.00 60.65  ? 475  ARG A CZ  1 
ATOM   3676 N NH1 . ARG A 1 474 ? 71.853  38.861 11.954  1.00 55.02  ? 475  ARG A NH1 1 
ATOM   3677 N NH2 . ARG A 1 474 ? 73.218  37.021 11.810  1.00 56.30  ? 475  ARG A NH2 1 
ATOM   3678 N N   . LEU A 1 475 ? 71.558  38.436 18.079  1.00 44.38  ? 476  LEU A N   1 
ATOM   3679 C CA  . LEU A 1 475 ? 70.141  38.314 18.411  1.00 43.82  ? 476  LEU A CA  1 
ATOM   3680 C C   . LEU A 1 475 ? 69.823  38.964 19.752  1.00 53.81  ? 476  LEU A C   1 
ATOM   3681 O O   . LEU A 1 475 ? 68.782  39.617 19.898  1.00 53.90  ? 476  LEU A O   1 
ATOM   3682 C CB  . LEU A 1 475 ? 69.720  36.845 18.418  1.00 42.33  ? 476  LEU A CB  1 
ATOM   3683 C CG  . LEU A 1 475 ? 69.773  36.119 17.072  1.00 51.01  ? 476  LEU A CG  1 
ATOM   3684 C CD1 . LEU A 1 475 ? 69.082  34.772 17.178  1.00 50.35  ? 476  LEU A CD1 1 
ATOM   3685 C CD2 . LEU A 1 475 ? 69.151  36.965 15.973  1.00 47.66  ? 476  LEU A CD2 1 
ATOM   3686 N N   . MET A 1 476 ? 70.695  38.785 20.749  1.00 47.67  ? 477  MET A N   1 
ATOM   3687 C CA  . MET A 1 476 ? 70.496  39.470 22.022  1.00 50.38  ? 477  MET A CA  1 
ATOM   3688 C C   . MET A 1 476 ? 70.479  40.978 21.826  1.00 51.82  ? 477  MET A C   1 
ATOM   3689 O O   . MET A 1 476 ? 69.673  41.685 22.443  1.00 48.33  ? 477  MET A O   1 
ATOM   3690 C CB  . MET A 1 476 ? 71.588  39.080 23.018  1.00 48.67  ? 477  MET A CB  1 
ATOM   3691 C CG  . MET A 1 476 ? 71.470  37.673 23.562  1.00 53.86  ? 477  MET A CG  1 
ATOM   3692 S SD  . MET A 1 476 ? 72.556  37.420 24.977  1.00 56.01  ? 477  MET A SD  1 
ATOM   3693 C CE  . MET A 1 476 ? 74.162  37.617 24.204  1.00 57.69  ? 477  MET A CE  1 
ATOM   3694 N N   . ARG A 1 477 ? 71.368  41.487 20.969  1.00 49.63  ? 478  ARG A N   1 
ATOM   3695 C CA  . ARG A 1 477 ? 71.338  42.902 20.619  1.00 53.34  ? 478  ARG A CA  1 
ATOM   3696 C C   . ARG A 1 477 ? 70.047  43.252 19.896  1.00 58.83  ? 478  ARG A C   1 
ATOM   3697 O O   . ARG A 1 477 ? 69.422  44.280 20.187  1.00 63.87  ? 478  ARG A O   1 
ATOM   3698 C CB  . ARG A 1 477 ? 72.551  43.249 19.757  1.00 55.45  ? 478  ARG A CB  1 
ATOM   3699 C CG  . ARG A 1 477 ? 72.568  44.676 19.232  1.00 56.96  ? 478  ARG A CG  1 
ATOM   3700 C CD  . ARG A 1 477 ? 72.694  45.676 20.366  1.00 67.47  ? 478  ARG A CD  1 
ATOM   3701 N NE  . ARG A 1 477 ? 73.762  45.311 21.292  1.00 74.22  ? 478  ARG A NE  1 
ATOM   3702 C CZ  . ARG A 1 477 ? 75.058  45.472 21.045  1.00 82.28  ? 478  ARG A CZ  1 
ATOM   3703 N NH1 . ARG A 1 477 ? 75.459  45.995 19.894  1.00 84.31  ? 478  ARG A NH1 1 
ATOM   3704 N NH2 . ARG A 1 477 ? 75.956  45.109 21.950  1.00 88.48  ? 478  ARG A NH2 1 
ATOM   3705 N N   . TYR A 1 478 ? 69.489  42.455 18.993  1.00 59.00  ? 479  TYR A N   1 
ATOM   3706 C CA  . TYR A 1 478 ? 68.223  42.971 18.417  1.00 57.07  ? 479  TYR A CA  1 
ATOM   3707 C C   . TYR A 1 478 ? 67.046  43.186 19.401  1.00 55.68  ? 479  TYR A C   1 
ATOM   3708 O O   . TYR A 1 478 ? 66.412  44.216 19.348  1.00 67.12  ? 479  TYR A O   1 
ATOM   3709 C CB  . TYR A 1 478 ? 67.651  42.087 17.294  1.00 51.80  ? 479  TYR A CB  1 
ATOM   3710 C CG  . TYR A 1 478 ? 68.466  41.836 16.043  1.00 47.98  ? 479  TYR A CG  1 
ATOM   3711 C CD1 . TYR A 1 478 ? 68.146  42.451 14.842  1.00 50.26  ? 479  TYR A CD1 1 
ATOM   3712 C CD2 . TYR A 1 478 ? 69.490  40.902 16.042  1.00 48.88  ? 479  TYR A CD2 1 
ATOM   3713 C CE1 . TYR A 1 478 ? 68.864  42.188 13.692  1.00 51.87  ? 479  TYR A CE1 1 
ATOM   3714 C CE2 . TYR A 1 478 ? 70.217  40.633 14.902  1.00 50.16  ? 479  TYR A CE2 1 
ATOM   3715 C CZ  . TYR A 1 478 ? 69.900  41.273 13.728  1.00 52.94  ? 479  TYR A CZ  1 
ATOM   3716 O OH  . TYR A 1 478 ? 70.642  40.975 12.609  1.00 67.72  ? 479  TYR A OH  1 
ATOM   3717 N N   . TRP A 1 479 ? 66.742  42.234 20.287  1.00 45.42  ? 480  TRP A N   1 
ATOM   3718 C CA  . TRP A 1 479 ? 65.592  42.399 21.196  1.00 46.96  ? 480  TRP A CA  1 
ATOM   3719 C C   . TRP A 1 479 ? 65.772  43.575 22.128  1.00 50.81  ? 480  TRP A C   1 
ATOM   3720 O O   . TRP A 1 479 ? 64.860  44.333 22.349  1.00 73.51  ? 480  TRP A O   1 
ATOM   3721 C CB  . TRP A 1 479 ? 65.379  41.183 22.109  1.00 48.61  ? 480  TRP A CB  1 
ATOM   3722 C CG  . TRP A 1 479 ? 64.818  39.922 21.551  1.00 44.50  ? 480  TRP A CG  1 
ATOM   3723 C CD1 . TRP A 1 479 ? 64.035  39.014 22.223  1.00 41.19  ? 480  TRP A CD1 1 
ATOM   3724 C CD2 . TRP A 1 479 ? 65.031  39.377 20.247  1.00 41.51  ? 480  TRP A CD2 1 
ATOM   3725 N NE1 . TRP A 1 479 ? 63.738  37.942 21.411  1.00 45.86  ? 480  TRP A NE1 1 
ATOM   3726 C CE2 . TRP A 1 479 ? 64.337  38.136 20.193  1.00 44.05  ? 480  TRP A CE2 1 
ATOM   3727 C CE3 . TRP A 1 479 ? 65.740  39.806 19.121  1.00 46.50  ? 480  TRP A CE3 1 
ATOM   3728 C CZ2 . TRP A 1 479 ? 64.322  37.335 19.052  1.00 48.32  ? 480  TRP A CZ2 1 
ATOM   3729 C CZ3 . TRP A 1 479 ? 65.725  39.008 17.988  1.00 47.63  ? 480  TRP A CZ3 1 
ATOM   3730 C CH2 . TRP A 1 479 ? 65.018  37.784 17.961  1.00 46.71  ? 480  TRP A CH2 1 
ATOM   3731 N N   . ALA A 1 480 ? 66.965  43.712 22.679  1.00 48.03  ? 481  ALA A N   1 
ATOM   3732 C CA  . ALA A 1 480 ? 67.258  44.789 23.602  1.00 56.93  ? 481  ALA A CA  1 
ATOM   3733 C C   . ALA A 1 480 ? 67.087  46.086 22.826  1.00 56.92  ? 481  ALA A C   1 
ATOM   3734 O O   . ALA A 1 480 ? 66.607  47.087 23.364  1.00 50.03  ? 481  ALA A O   1 
ATOM   3735 C CB  . ALA A 1 480 ? 68.658  44.650 24.181  1.00 52.84  ? 481  ALA A CB  1 
ATOM   3736 N N   . ASN A 1 481 ? 67.462  46.038 21.549  1.00 55.37  ? 482  ASN A N   1 
ATOM   3737 C CA  . ASN A 1 481 ? 67.357  47.174 20.633  1.00 58.39  ? 482  ASN A CA  1 
ATOM   3738 C C   . ASN A 1 481 ? 65.882  47.573 20.456  1.00 54.39  ? 482  ASN A C   1 
ATOM   3739 O O   . ASN A 1 481 ? 65.560  48.656 19.962  1.00 56.15  ? 482  ASN A O   1 
ATOM   3740 C CB  . ASN A 1 481 ? 67.991  46.834 19.277  1.00 55.78  ? 482  ASN A CB  1 
ATOM   3741 C CG  . ASN A 1 481 ? 69.385  47.445 19.099  1.00 60.29  ? 482  ASN A CG  1 
ATOM   3742 O OD1 . ASN A 1 481 ? 69.898  48.130 19.981  1.00 58.50  ? 482  ASN A OD1 1 
ATOM   3743 N ND2 . ASN A 1 481 ? 69.988  47.211 17.943  1.00 64.00  ? 482  ASN A ND2 1 
ATOM   3744 N N   . PHE A 1 482 ? 65.002  46.657 20.846  1.00 48.83  ? 483  PHE A N   1 
ATOM   3745 C CA  . PHE A 1 482 ? 63.551  46.791 20.753  1.00 52.55  ? 483  PHE A CA  1 
ATOM   3746 C C   . PHE A 1 482 ? 62.944  47.126 22.112  1.00 49.11  ? 483  PHE A C   1 
ATOM   3747 O O   . PHE A 1 482 ? 62.092  48.013 22.220  1.00 57.93  ? 483  PHE A O   1 
ATOM   3748 C CB  . PHE A 1 482 ? 62.963  45.498 20.178  1.00 52.19  ? 483  PHE A CB  1 
ATOM   3749 C CG  . PHE A 1 482 ? 61.466  45.449 20.175  1.00 55.14  ? 483  PHE A CG  1 
ATOM   3750 C CD1 . PHE A 1 482 ? 60.742  46.079 19.177  1.00 47.65  ? 483  PHE A CD1 1 
ATOM   3751 C CD2 . PHE A 1 482 ? 60.783  44.752 21.157  1.00 48.78  ? 483  PHE A CD2 1 
ATOM   3752 C CE1 . PHE A 1 482 ? 59.362  46.029 19.170  1.00 47.58  ? 483  PHE A CE1 1 
ATOM   3753 C CE2 . PHE A 1 482 ? 59.404  44.697 21.156  1.00 44.68  ? 483  PHE A CE2 1 
ATOM   3754 C CZ  . PHE A 1 482 ? 58.693  45.337 20.163  1.00 48.20  ? 483  PHE A CZ  1 
ATOM   3755 N N   . ALA A 1 483 ? 63.375  46.432 23.167  1.00 50.87  ? 484  ALA A N   1 
ATOM   3756 C CA  . ALA A 1 483 ? 62.906  46.765 24.509  1.00 51.76  ? 484  ALA A CA  1 
ATOM   3757 C C   . ALA A 1 483 ? 63.324  48.174 24.894  1.00 50.42  ? 484  ALA A C   1 
ATOM   3758 O O   . ALA A 1 483 ? 62.547  48.915 25.507  1.00 58.98  ? 484  ALA A O   1 
ATOM   3759 C CB  . ALA A 1 483 ? 63.437  45.751 25.522  1.00 49.00  ? 484  ALA A CB  1 
ATOM   3760 N N   . ARG A 1 484 ? 64.544  48.570 24.522  1.00 53.35  ? 485  ARG A N   1 
ATOM   3761 C CA  . ARG A 1 484 ? 65.009  49.922 24.808  1.00 58.57  ? 485  ARG A CA  1 
ATOM   3762 C C   . ARG A 1 484 ? 64.268  50.955 23.967  1.00 61.05  ? 485  ARG A C   1 
ATOM   3763 O O   . ARG A 1 484 ? 63.770  51.956 24.495  1.00 67.37  ? 485  ARG A O   1 
ATOM   3764 C CB  . ARG A 1 484 ? 66.517  50.024 24.568  1.00 57.79  ? 485  ARG A CB  1 
ATOM   3765 C CG  . ARG A 1 484 ? 67.373  49.364 25.636  1.00 59.73  ? 485  ARG A CG  1 
ATOM   3766 C CD  . ARG A 1 484 ? 68.849  49.649 25.411  1.00 60.82  ? 485  ARG A CD  1 
ATOM   3767 N NE  . ARG A 1 484 ? 69.380  48.921 24.263  1.00 62.89  ? 485  ARG A NE  1 
ATOM   3768 C CZ  . ARG A 1 484 ? 70.139  47.833 24.355  1.00 59.02  ? 485  ARG A CZ  1 
ATOM   3769 N NH1 . ARG A 1 484 ? 70.464  47.349 25.547  1.00 52.29  ? 485  ARG A NH1 1 
ATOM   3770 N NH2 . ARG A 1 484 ? 70.576  47.231 23.257  1.00 52.16  ? 485  ARG A NH2 1 
ATOM   3771 N N   . THR A 1 485 ? 64.185  50.731 22.654  1.00 53.95  ? 486  THR A N   1 
ATOM   3772 C CA  . THR A 1 485 ? 63.737  51.761 21.729  1.00 57.53  ? 486  THR A CA  1 
ATOM   3773 C C   . THR A 1 485 ? 62.465  51.426 20.962  1.00 61.74  ? 486  THR A C   1 
ATOM   3774 O O   . THR A 1 485 ? 61.936  52.308 20.277  1.00 66.36  ? 486  THR A O   1 
ATOM   3775 C CB  . THR A 1 485 ? 64.842  52.077 20.706  1.00 59.32  ? 486  THR A CB  1 
ATOM   3776 O OG1 . THR A 1 485 ? 64.916  51.019 19.740  1.00 56.60  ? 486  THR A OG1 1 
ATOM   3777 C CG2 . THR A 1 485 ? 66.188  52.209 21.400  1.00 59.36  ? 486  THR A CG2 1 
ATOM   3778 N N   . GLY A 1 486 ? 61.956  50.199 21.049  1.00 58.92  ? 487  GLY A N   1 
ATOM   3779 C CA  . GLY A 1 486 ? 60.866  49.795 20.182  1.00 57.35  ? 487  GLY A CA  1 
ATOM   3780 C C   . GLY A 1 486 ? 61.283  49.473 18.767  1.00 58.54  ? 487  GLY A C   1 
ATOM   3781 O O   . GLY A 1 486 ? 60.415  49.317 17.900  1.00 53.55  ? 487  GLY A O   1 
ATOM   3782 N N   . ASP A 1 487 ? 62.584  49.363 18.510  1.00 62.97  ? 488  ASP A N   1 
ATOM   3783 C CA  . ASP A 1 487 ? 63.149  49.169 17.183  1.00 59.24  ? 488  ASP A CA  1 
ATOM   3784 C C   . ASP A 1 487 ? 64.380  48.279 17.308  1.00 63.09  ? 488  ASP A C   1 
ATOM   3785 O O   . ASP A 1 487 ? 65.367  48.674 17.943  1.00 70.50  ? 488  ASP A O   1 
ATOM   3786 C CB  . ASP A 1 487 ? 63.503  50.523 16.564  1.00 65.20  ? 488  ASP A CB  1 
ATOM   3787 C CG  . ASP A 1 487 ? 63.937  50.423 15.111  1.00 60.38  ? 488  ASP A CG  1 
ATOM   3788 O OD1 . ASP A 1 487 ? 64.345  49.333 14.662  1.00 57.84  ? 488  ASP A OD1 1 
ATOM   3789 O OD2 . ASP A 1 487 ? 63.877  51.458 14.416  1.00 71.81  ? 488  ASP A OD2 1 
ATOM   3790 N N   . PRO A 1 488 ? 64.366  47.077 16.722  1.00 61.47  ? 489  PRO A N   1 
ATOM   3791 C CA  . PRO A 1 488 ? 65.537  46.199 16.840  1.00 57.59  ? 489  PRO A CA  1 
ATOM   3792 C C   . PRO A 1 488 ? 66.764  46.756 16.147  1.00 60.41  ? 489  PRO A C   1 
ATOM   3793 O O   . PRO A 1 488 ? 67.872  46.279 16.413  1.00 58.82  ? 489  PRO A O   1 
ATOM   3794 C CB  . PRO A 1 488 ? 65.071  44.896 16.180  1.00 57.61  ? 489  PRO A CB  1 
ATOM   3795 C CG  . PRO A 1 488 ? 64.045  45.345 15.185  1.00 56.20  ? 489  PRO A CG  1 
ATOM   3796 C CD  . PRO A 1 488 ? 63.336  46.508 15.836  1.00 59.03  ? 489  PRO A CD  1 
ATOM   3797 N N   . ASN A 1 489 ? 66.606  47.747 15.277  1.00 62.29  ? 490  ASN A N   1 
ATOM   3798 C CA  . ASN A 1 489 ? 67.754  48.318 14.600  1.00 68.79  ? 490  ASN A CA  1 
ATOM   3799 C C   . ASN A 1 489 ? 68.563  49.205 15.539  1.00 88.46  ? 490  ASN A C   1 
ATOM   3800 O O   . ASN A 1 489 ? 68.033  49.878 16.420  1.00 82.02  ? 490  ASN A O   1 
ATOM   3801 C CB  . ASN A 1 489 ? 67.318  49.116 13.371  1.00 64.73  ? 490  ASN A CB  1 
ATOM   3802 C CG  . ASN A 1 489 ? 66.775  48.233 12.274  1.00 65.56  ? 490  ASN A CG  1 
ATOM   3803 O OD1 . ASN A 1 489 ? 67.538  47.585 11.558  1.00 67.30  ? 490  ASN A OD1 1 
ATOM   3804 N ND2 . ASN A 1 489 ? 65.457  48.204 12.128  1.00 54.54  ? 490  ASN A ND2 1 
ATOM   3805 N N   . GLU A 1 490 ? 69.836  49.205 15.313  1.00 134.69 ? 491  GLU A N   1 
ATOM   3806 C CA  . GLU A 1 490 ? 70.924  49.862 16.006  1.00 146.57 ? 491  GLU A CA  1 
ATOM   3807 C C   . GLU A 1 490 ? 70.841  51.400 15.936  1.00 146.35 ? 491  GLU A C   1 
ATOM   3808 O O   . GLU A 1 490 ? 70.288  51.953 14.991  1.00 152.71 ? 491  GLU A O   1 
ATOM   3809 C CB  . GLU A 1 490 ? 72.220  49.354 15.370  1.00 158.03 ? 491  GLU A CB  1 
ATOM   3810 C CG  . GLU A 1 490 ? 72.208  49.500 13.802  1.00 164.49 ? 491  GLU A CG  1 
ATOM   3811 C CD  . GLU A 1 490 ? 72.673  50.859 13.350  1.00 173.57 ? 491  GLU A CD  1 
ATOM   3812 O OE1 . GLU A 1 490 ? 72.725  51.147 12.118  1.00 175.27 ? 491  GLU A OE1 1 
ATOM   3813 O OE2 . GLU A 1 490 ? 73.073  51.585 14.254  1.00 177.73 ? 491  GLU A OE2 1 
ATOM   3814 N N   . PRO A 1 491 ? 71.424  52.097 16.939  1.00 132.50 ? 492  PRO A N   1 
ATOM   3815 C CA  . PRO A 1 491 ? 71.772  53.525 16.848  1.00 131.36 ? 492  PRO A CA  1 
ATOM   3816 C C   . PRO A 1 491 ? 72.643  53.902 15.629  1.00 135.22 ? 492  PRO A C   1 
ATOM   3817 O O   . PRO A 1 491 ? 73.085  55.043 15.436  1.00 141.58 ? 492  PRO A O   1 
ATOM   3818 C CB  . PRO A 1 491 ? 72.555  53.778 18.148  1.00 130.13 ? 492  PRO A CB  1 
ATOM   3819 C CG  . PRO A 1 491 ? 72.114  52.689 19.089  1.00 124.58 ? 492  PRO A CG  1 
ATOM   3820 C CD  . PRO A 1 491 ? 71.361  51.633 18.339  1.00 121.69 ? 492  PRO A CD  1 
ATOM   3821 N N   . ALA A 1 496 ? 75.495  47.675 7.893   1.00 122.10 ? 497  ALA A N   1 
ATOM   3822 C CA  . ALA A 1 496 ? 74.437  47.243 8.799   1.00 121.67 ? 497  ALA A CA  1 
ATOM   3823 C C   . ALA A 1 496 ? 73.107  47.086 8.065   1.00 125.34 ? 497  ALA A C   1 
ATOM   3824 O O   . ALA A 1 496 ? 72.358  48.052 7.903   1.00 124.54 ? 497  ALA A O   1 
ATOM   3825 C CB  . ALA A 1 496 ? 74.300  48.222 9.947   1.00 118.89 ? 497  ALA A CB  1 
ATOM   3826 N N   . PRO A 1 497 ? 72.815  45.799 7.632   1.00 128.06 ? 498  PRO A N   1 
ATOM   3827 C CA  . PRO A 1 497 ? 71.534  45.688 6.917   1.00 129.98 ? 498  PRO A CA  1 
ATOM   3828 C C   . PRO A 1 497 ? 70.436  46.109 7.848   1.00 123.83 ? 498  PRO A C   1 
ATOM   3829 O O   . PRO A 1 497 ? 70.480  45.804 9.017   1.00 132.48 ? 498  PRO A O   1 
ATOM   3830 C CB  . PRO A 1 497 ? 71.403  44.203 6.630   1.00 130.37 ? 498  PRO A CB  1 
ATOM   3831 C CG  . PRO A 1 497 ? 72.772  43.687 6.601   1.00 129.38 ? 498  PRO A CG  1 
ATOM   3832 C CD  . PRO A 1 497 ? 73.434  44.407 7.711   1.00 129.02 ? 498  PRO A CD  1 
ATOM   3833 N N   . GLN A 1 498 ? 69.467  46.827 7.335   1.00 96.44  ? 499  GLN A N   1 
ATOM   3834 C CA  . GLN A 1 498 ? 68.407  47.313 8.160   1.00 80.63  ? 499  GLN A CA  1 
ATOM   3835 C C   . GLN A 1 498 ? 67.252  46.348 8.192   1.00 76.60  ? 499  GLN A C   1 
ATOM   3836 O O   . GLN A 1 498 ? 67.023  45.618 7.256   1.00 69.54  ? 499  GLN A O   1 
ATOM   3837 C CB  . GLN A 1 498 ? 67.949  48.644 7.609   1.00 82.68  ? 499  GLN A CB  1 
ATOM   3838 C CG  . GLN A 1 498 ? 67.522  49.638 8.658   1.00 86.54  ? 499  GLN A CG  1 
ATOM   3839 C CD  . GLN A 1 498 ? 68.619  49.967 9.642   1.00 89.51  ? 499  GLN A CD  1 
ATOM   3840 O OE1 . GLN A 1 498 ? 69.745  49.499 9.538   1.00 84.66  ? 499  GLN A OE1 1 
ATOM   3841 N NE2 . GLN A 1 498 ? 68.285  50.784 10.606  1.00 93.89  ? 499  GLN A NE2 1 
ATOM   3842 N N   . TRP A 1 499 ? 66.523  46.354 9.292   1.00 72.27  ? 500  TRP A N   1 
ATOM   3843 C CA  . TRP A 1 499 ? 65.353  45.490 9.437   1.00 60.58  ? 500  TRP A CA  1 
ATOM   3844 C C   . TRP A 1 499 ? 64.084  46.317 9.272   1.00 60.82  ? 500  TRP A C   1 
ATOM   3845 O O   . TRP A 1 499 ? 63.778  47.145 10.144  1.00 63.09  ? 500  TRP A O   1 
ATOM   3846 C CB  . TRP A 1 499 ? 65.389  44.815 10.812  1.00 61.95  ? 500  TRP A CB  1 
ATOM   3847 C CG  . TRP A 1 499 ? 64.276  43.843 11.150  1.00 59.05  ? 500  TRP A CG  1 
ATOM   3848 C CD1 . TRP A 1 499 ? 63.080  43.681 10.505  1.00 61.98  ? 500  TRP A CD1 1 
ATOM   3849 C CD2 . TRP A 1 499 ? 64.276  42.900 12.230  1.00 53.41  ? 500  TRP A CD2 1 
ATOM   3850 N NE1 . TRP A 1 499 ? 62.340  42.697 11.119  1.00 50.63  ? 500  TRP A NE1 1 
ATOM   3851 C CE2 . TRP A 1 499 ? 63.051  42.204 12.180  1.00 51.42  ? 500  TRP A CE2 1 
ATOM   3852 C CE3 . TRP A 1 499 ? 65.194  42.580 13.237  1.00 54.39  ? 500  TRP A CE3 1 
ATOM   3853 C CZ2 . TRP A 1 499 ? 62.724  41.204 13.095  1.00 51.25  ? 500  TRP A CZ2 1 
ATOM   3854 C CZ3 . TRP A 1 499 ? 64.868  41.590 14.145  1.00 51.46  ? 500  TRP A CZ3 1 
ATOM   3855 C CH2 . TRP A 1 499 ? 63.644  40.912 14.066  1.00 55.83  ? 500  TRP A CH2 1 
ATOM   3856 N N   . PRO A 1 500 ? 63.315  46.135 8.200   1.00 62.30  ? 501  PRO A N   1 
ATOM   3857 C CA  . PRO A 1 500 ? 62.159  46.999 7.963   1.00 59.00  ? 501  PRO A CA  1 
ATOM   3858 C C   . PRO A 1 500 ? 60.943  46.519 8.733   1.00 55.19  ? 501  PRO A C   1 
ATOM   3859 O O   . PRO A 1 500 ? 60.809  45.322 9.027   1.00 51.63  ? 501  PRO A O   1 
ATOM   3860 C CB  . PRO A 1 500 ? 61.934  46.879 6.450   1.00 58.99  ? 501  PRO A CB  1 
ATOM   3861 C CG  . PRO A 1 500 ? 62.387  45.493 6.139   1.00 58.91  ? 501  PRO A CG  1 
ATOM   3862 C CD  . PRO A 1 500 ? 63.520  45.178 7.099   1.00 57.91  ? 501  PRO A CD  1 
ATOM   3863 N N   . PRO A 1 501 ? 60.031  47.427 9.077   1.00 51.18  ? 502  PRO A N   1 
ATOM   3864 C CA  . PRO A 1 501 ? 58.788  47.017 9.749   1.00 50.94  ? 502  PRO A CA  1 
ATOM   3865 C C   . PRO A 1 501 ? 57.895  46.160 8.862   1.00 55.05  ? 502  PRO A C   1 
ATOM   3866 O O   . PRO A 1 501 ? 57.933  46.228 7.631   1.00 58.42  ? 502  PRO A O   1 
ATOM   3867 C CB  . PRO A 1 501 ? 58.094  48.346 10.089  1.00 53.72  ? 502  PRO A CB  1 
ATOM   3868 C CG  . PRO A 1 501 ? 59.055  49.414 9.745   1.00 54.81  ? 502  PRO A CG  1 
ATOM   3869 C CD  . PRO A 1 501 ? 60.105  48.881 8.856   1.00 54.36  ? 502  PRO A CD  1 
ATOM   3870 N N   . TYR A 1 502 ? 57.074  45.353 9.520   1.00 54.92  ? 503  TYR A N   1 
ATOM   3871 C CA  . TYR A 1 502 ? 56.090  44.525 8.848   1.00 52.93  ? 503  TYR A CA  1 
ATOM   3872 C C   . TYR A 1 502 ? 54.801  45.313 8.649   1.00 56.81  ? 503  TYR A C   1 
ATOM   3873 O O   . TYR A 1 502 ? 54.295  45.936 9.587   1.00 60.64  ? 503  TYR A O   1 
ATOM   3874 C CB  . TYR A 1 502 ? 55.815  43.252 9.654   1.00 47.94  ? 503  TYR A CB  1 
ATOM   3875 C CG  . TYR A 1 502 ? 54.842  42.292 9.008   1.00 49.84  ? 503  TYR A CG  1 
ATOM   3876 C CD1 . TYR A 1 502 ? 53.470  42.417 9.210   1.00 53.99  ? 503  TYR A CD1 1 
ATOM   3877 C CD2 . TYR A 1 502 ? 55.294  41.247 8.211   1.00 44.54  ? 503  TYR A CD2 1 
ATOM   3878 C CE1 . TYR A 1 502 ? 52.576  41.535 8.628   1.00 48.69  ? 503  TYR A CE1 1 
ATOM   3879 C CE2 . TYR A 1 502 ? 54.407  40.359 7.627   1.00 50.00  ? 503  TYR A CE2 1 
ATOM   3880 C CZ  . TYR A 1 502 ? 53.051  40.509 7.837   1.00 52.46  ? 503  TYR A CZ  1 
ATOM   3881 O OH  . TYR A 1 502 ? 52.168  39.629 7.257   1.00 53.48  ? 503  TYR A OH  1 
ATOM   3882 N N   . THR A 1 503 ? 54.275  45.285 7.425   1.00 61.36  ? 504  THR A N   1 
ATOM   3883 C CA  . THR A 1 503 ? 53.024  45.945 7.093   1.00 60.81  ? 504  THR A CA  1 
ATOM   3884 C C   . THR A 1 503 ? 52.118  44.961 6.366   1.00 62.69  ? 504  THR A C   1 
ATOM   3885 O O   . THR A 1 503 ? 52.580  43.986 5.771   1.00 62.82  ? 504  THR A O   1 
ATOM   3886 C CB  . THR A 1 503 ? 53.256  47.188 6.229   1.00 62.01  ? 504  THR A CB  1 
ATOM   3887 O OG1 . THR A 1 503 ? 53.924  46.809 5.019   1.00 61.95  ? 504  THR A OG1 1 
ATOM   3888 C CG2 . THR A 1 503 ? 54.107  48.198 6.977   1.00 57.37  ? 504  THR A CG2 1 
ATOM   3889 N N   . ALA A 1 504 ? 50.810  45.227 6.421   1.00 67.91  ? 505  ALA A N   1 
ATOM   3890 C CA  . ALA A 1 504 ? 49.847  44.290 5.847   1.00 66.16  ? 505  ALA A CA  1 
ATOM   3891 C C   . ALA A 1 504 ? 50.013  44.157 4.339   1.00 66.75  ? 505  ALA A C   1 
ATOM   3892 O O   . ALA A 1 504 ? 49.714  43.100 3.774   1.00 66.44  ? 505  ALA A O   1 
ATOM   3893 C CB  . ALA A 1 504 ? 48.421  44.722 6.189   1.00 66.54  ? 505  ALA A CB  1 
ATOM   3894 N N   . GLY A 1 505 ? 50.491  45.205 3.674   1.00 66.08  ? 506  GLY A N   1 
ATOM   3895 C CA  . GLY A 1 505 ? 50.684  45.159 2.239   1.00 60.73  ? 506  GLY A CA  1 
ATOM   3896 C C   . GLY A 1 505 ? 51.979  44.490 1.826   1.00 62.39  ? 506  GLY A C   1 
ATOM   3897 O O   . GLY A 1 505 ? 51.963  43.425 1.203   1.00 64.15  ? 506  GLY A O   1 
ATOM   3898 N N   . ALA A 1 506 ? 53.113  45.103 2.176   1.00 64.30  ? 507  ALA A N   1 
ATOM   3899 C CA  . ALA A 1 506 ? 54.405  44.570 1.754   1.00 54.74  ? 507  ALA A CA  1 
ATOM   3900 C C   . ALA A 1 506 ? 54.765  43.284 2.492   1.00 54.48  ? 507  ALA A C   1 
ATOM   3901 O O   . ALA A 1 506 ? 55.415  42.406 1.911   1.00 53.52  ? 507  ALA A O   1 
ATOM   3902 C CB  . ALA A 1 506 ? 55.494  45.624 1.950   1.00 52.78  ? 507  ALA A CB  1 
ATOM   3903 N N   . GLN A 1 507 ? 54.372  43.160 3.764   1.00 46.59  ? 508  GLN A N   1 
ATOM   3904 C CA  . GLN A 1 507 ? 54.537  41.920 4.527   1.00 47.43  ? 508  GLN A CA  1 
ATOM   3905 C C   . GLN A 1 507 ? 56.003  41.498 4.624   1.00 50.09  ? 508  GLN A C   1 
ATOM   3906 O O   . GLN A 1 507 ? 56.334  40.315 4.516   1.00 54.88  ? 508  GLN A O   1 
ATOM   3907 C CB  . GLN A 1 507 ? 53.693  40.788 3.929   1.00 49.94  ? 508  GLN A CB  1 
ATOM   3908 C CG  . GLN A 1 507 ? 52.222  41.117 3.754   1.00 54.00  ? 508  GLN A CG  1 
ATOM   3909 C CD  . GLN A 1 507 ? 51.494  40.086 2.911   1.00 61.33  ? 508  GLN A CD  1 
ATOM   3910 O OE1 . GLN A 1 507 ? 51.654  38.880 3.107   1.00 57.71  ? 508  GLN A OE1 1 
ATOM   3911 N NE2 . GLN A 1 507 ? 50.703  40.557 1.954   1.00 62.03  ? 508  GLN A NE2 1 
ATOM   3912 N N   . GLN A 1 508 ? 56.892  42.465 4.833   1.00 45.00  ? 509  GLN A N   1 
ATOM   3913 C CA  . GLN A 1 508 ? 58.317  42.168 4.881   1.00 48.84  ? 509  GLN A CA  1 
ATOM   3914 C C   . GLN A 1 508 ? 58.732  41.640 6.249   1.00 51.27  ? 509  GLN A C   1 
ATOM   3915 O O   . GLN A 1 508 ? 58.246  42.097 7.288   1.00 45.96  ? 509  GLN A O   1 
ATOM   3916 C CB  . GLN A 1 508 ? 59.141  43.406 4.538   1.00 57.16  ? 509  GLN A CB  1 
ATOM   3917 C CG  . GLN A 1 508 ? 58.484  44.331 3.542   1.00 64.81  ? 509  GLN A CG  1 
ATOM   3918 C CD  . GLN A 1 508 ? 59.346  45.527 3.210   1.00 65.13  ? 509  GLN A CD  1 
ATOM   3919 O OE1 . GLN A 1 508 ? 60.496  45.385 2.796   1.00 63.60  ? 509  GLN A OE1 1 
ATOM   3920 N NE2 . GLN A 1 508 ? 58.803  46.721 3.414   1.00 62.83  ? 509  GLN A NE2 1 
ATOM   3921 N N   . TYR A 1 509 ? 59.644  40.669 6.234   1.00 52.19  ? 510  TYR A N   1 
ATOM   3922 C CA  . TYR A 1 509 ? 60.258  40.118 7.431   1.00 51.28  ? 510  TYR A CA  1 
ATOM   3923 C C   . TYR A 1 509 ? 61.716  39.813 7.114   1.00 55.03  ? 510  TYR A C   1 
ATOM   3924 O O   . TYR A 1 509 ? 62.134  39.832 5.953   1.00 57.64  ? 510  TYR A O   1 
ATOM   3925 C CB  . TYR A 1 509 ? 59.534  38.854 7.905   1.00 44.65  ? 510  TYR A CB  1 
ATOM   3926 C CG  . TYR A 1 509 ? 59.627  37.713 6.921   1.00 45.75  ? 510  TYR A CG  1 
ATOM   3927 C CD1 . TYR A 1 509 ? 58.727  37.601 5.869   1.00 47.30  ? 510  TYR A CD1 1 
ATOM   3928 C CD2 . TYR A 1 509 ? 60.623  36.752 7.036   1.00 46.55  ? 510  TYR A CD2 1 
ATOM   3929 C CE1 . TYR A 1 509 ? 58.815  36.559 4.962   1.00 47.12  ? 510  TYR A CE1 1 
ATOM   3930 C CE2 . TYR A 1 509 ? 60.720  35.714 6.135   1.00 50.21  ? 510  TYR A CE2 1 
ATOM   3931 C CZ  . TYR A 1 509 ? 59.813  35.618 5.104   1.00 49.31  ? 510  TYR A CZ  1 
ATOM   3932 O OH  . TYR A 1 509 ? 59.916  34.575 4.215   1.00 55.34  ? 510  TYR A OH  1 
ATOM   3933 N N   . VAL A 1 510 ? 62.498  39.520 8.150   1.00 49.40  ? 511  VAL A N   1 
ATOM   3934 C CA  . VAL A 1 510 ? 63.905  39.195 7.964   1.00 47.36  ? 511  VAL A CA  1 
ATOM   3935 C C   . VAL A 1 510 ? 64.153  37.755 8.385   1.00 51.47  ? 511  VAL A C   1 
ATOM   3936 O O   . VAL A 1 510 ? 63.451  37.198 9.235   1.00 54.05  ? 511  VAL A O   1 
ATOM   3937 C CB  . VAL A 1 510 ? 64.841  40.147 8.739   1.00 49.40  ? 511  VAL A CB  1 
ATOM   3938 C CG1 . VAL A 1 510 ? 64.604  41.589 8.316   1.00 54.31  ? 511  VAL A CG1 1 
ATOM   3939 C CG2 . VAL A 1 510 ? 64.666  39.969 10.242  1.00 43.23  ? 511  VAL A CG2 1 
ATOM   3940 N N   . SER A 1 511 ? 65.166  37.151 7.773   1.00 50.08  ? 512  SER A N   1 
ATOM   3941 C CA  . SER A 1 511 ? 65.623  35.824 8.156   1.00 48.11  ? 512  SER A CA  1 
ATOM   3942 C C   . SER A 1 511 ? 66.748  35.963 9.171   1.00 52.22  ? 512  SER A C   1 
ATOM   3943 O O   . SER A 1 511 ? 67.652  36.787 8.997   1.00 50.87  ? 512  SER A O   1 
ATOM   3944 C CB  . SER A 1 511 ? 66.102  35.040 6.934   1.00 50.84  ? 512  SER A CB  1 
ATOM   3945 O OG  . SER A 1 511 ? 67.182  35.705 6.303   1.00 58.11  ? 512  SER A OG  1 
ATOM   3946 N N   . LEU A 1 512 ? 66.683  35.170 10.235  1.00 48.34  ? 513  LEU A N   1 
ATOM   3947 C CA  . LEU A 1 512 ? 67.698  35.171 11.280  1.00 49.15  ? 513  LEU A CA  1 
ATOM   3948 C C   . LEU A 1 512 ? 68.502  33.882 11.164  1.00 52.45  ? 513  LEU A C   1 
ATOM   3949 O O   . LEU A 1 512 ? 67.993  32.797 11.466  1.00 52.13  ? 513  LEU A O   1 
ATOM   3950 C CB  . LEU A 1 512 ? 67.062  35.305 12.663  1.00 52.19  ? 513  LEU A CB  1 
ATOM   3951 C CG  . LEU A 1 512 ? 66.214  36.553 12.922  1.00 55.78  ? 513  LEU A CG  1 
ATOM   3952 C CD1 . LEU A 1 512 ? 65.620  36.509 14.326  1.00 51.21  ? 513  LEU A CD1 1 
ATOM   3953 C CD2 . LEU A 1 512 ? 67.036  37.819 12.725  1.00 52.48  ? 513  LEU A CD2 1 
ATOM   3954 N N   . ASP A 1 513 ? 69.747  34.003 10.714  1.00 50.17  ? 514  ASP A N   1 
ATOM   3955 C CA  . ASP A 1 513 ? 70.680  32.882 10.664  1.00 48.17  ? 514  ASP A CA  1 
ATOM   3956 C C   . ASP A 1 513 ? 72.095  33.451 10.666  1.00 50.87  ? 514  ASP A C   1 
ATOM   3957 O O   . ASP A 1 513 ? 72.302  34.635 10.951  1.00 53.98  ? 514  ASP A O   1 
ATOM   3958 C CB  . ASP A 1 513 ? 70.407  31.980 9.453   1.00 54.57  ? 514  ASP A CB  1 
ATOM   3959 C CG  . ASP A 1 513 ? 70.466  32.725 8.130   1.00 69.36  ? 514  ASP A CG  1 
ATOM   3960 O OD1 . ASP A 1 513 ? 70.093  32.122 7.102   1.00 80.41  ? 514  ASP A OD1 1 
ATOM   3961 O OD2 . ASP A 1 513 ? 70.878  33.905 8.106   1.00 72.27  ? 514  ASP A OD2 1 
ATOM   3962 N N   . LEU A 1 514 ? 73.075  32.605 10.335  1.00 52.37  ? 515  LEU A N   1 
ATOM   3963 C CA  . LEU A 1 514 ? 74.469  33.031 10.414  1.00 55.86  ? 515  LEU A CA  1 
ATOM   3964 C C   . LEU A 1 514 ? 74.792  34.103 9.382   1.00 60.41  ? 515  LEU A C   1 
ATOM   3965 O O   . LEU A 1 514 ? 75.712  34.903 9.590   1.00 66.03  ? 515  LEU A O   1 
ATOM   3966 C CB  . LEU A 1 514 ? 75.394  31.826 10.247  1.00 56.06  ? 515  LEU A CB  1 
ATOM   3967 C CG  . LEU A 1 514 ? 75.265  30.748 11.326  1.00 60.25  ? 515  LEU A CG  1 
ATOM   3968 C CD1 . LEU A 1 514 ? 76.278  29.632 11.112  1.00 57.14  ? 515  LEU A CD1 1 
ATOM   3969 C CD2 . LEU A 1 514 ? 75.420  31.358 12.714  1.00 58.54  ? 515  LEU A CD2 1 
ATOM   3970 N N   . ARG A 1 515 ? 74.053  34.137 8.276   1.00 60.33  ? 516  ARG A N   1 
ATOM   3971 C CA  . ARG A 1 515 ? 74.235  35.163 7.267   1.00 61.38  ? 516  ARG A CA  1 
ATOM   3972 C C   . ARG A 1 515 ? 73.705  36.502 7.773   1.00 62.72  ? 516  ARG A C   1 
ATOM   3973 O O   . ARG A 1 515 ? 72.940  36.551 8.739   1.00 59.86  ? 516  ARG A O   1 
ATOM   3974 C CB  . ARG A 1 515 ? 73.503  34.778 5.983   1.00 61.80  ? 516  ARG A CB  1 
ATOM   3975 C CG  . ARG A 1 515 ? 73.976  33.496 5.326   1.00 69.96  ? 516  ARG A CG  1 
ATOM   3976 C CD  . ARG A 1 515 ? 72.795  32.783 4.687   1.00 78.52  ? 516  ARG A CD  1 
ATOM   3977 N NE  . ARG A 1 515 ? 71.785  33.732 4.225   1.00 85.29  ? 516  ARG A NE  1 
ATOM   3978 C CZ  . ARG A 1 515 ? 70.482  33.474 4.174   1.00 89.12  ? 516  ARG A CZ  1 
ATOM   3979 N NH1 . ARG A 1 515 ? 70.022  32.292 4.563   1.00 89.52  ? 516  ARG A NH1 1 
ATOM   3980 N NH2 . ARG A 1 515 ? 69.636  34.400 3.742   1.00 88.57  ? 516  ARG A NH2 1 
ATOM   3981 N N   . PRO A 1 516 ? 74.097  37.606 7.136   1.00 64.75  ? 517  PRO A N   1 
ATOM   3982 C CA  . PRO A 1 516 ? 73.463  38.894 7.438   1.00 63.52  ? 517  PRO A CA  1 
ATOM   3983 C C   . PRO A 1 516 ? 71.977  38.856 7.120   1.00 64.78  ? 517  PRO A C   1 
ATOM   3984 O O   . PRO A 1 516 ? 71.477  37.961 6.433   1.00 57.65  ? 517  PRO A O   1 
ATOM   3985 C CB  . PRO A 1 516 ? 74.205  39.884 6.533   1.00 65.32  ? 517  PRO A CB  1 
ATOM   3986 C CG  . PRO A 1 516 ? 75.515  39.228 6.252   1.00 65.56  ? 517  PRO A CG  1 
ATOM   3987 C CD  . PRO A 1 516 ? 75.225  37.757 6.199   1.00 65.65  ? 517  PRO A CD  1 
ATOM   3988 N N   . LEU A 1 517 ? 71.265  39.857 7.638   1.00 64.38  ? 518  LEU A N   1 
ATOM   3989 C CA  . LEU A 1 517 ? 69.820  39.933 7.451   1.00 61.89  ? 518  LEU A CA  1 
ATOM   3990 C C   . LEU A 1 517 ? 69.457  39.912 5.971   1.00 60.90  ? 518  LEU A C   1 
ATOM   3991 O O   . LEU A 1 517 ? 70.086  40.581 5.146   1.00 60.96  ? 518  LEU A O   1 
ATOM   3992 C CB  . LEU A 1 517 ? 69.260  41.203 8.091   1.00 57.03  ? 518  LEU A CB  1 
ATOM   3993 C CG  . LEU A 1 517 ? 69.254  41.331 9.611   1.00 62.18  ? 518  LEU A CG  1 
ATOM   3994 C CD1 . LEU A 1 517 ? 68.440  42.553 10.042  1.00 64.50  ? 518  LEU A CD1 1 
ATOM   3995 C CD2 . LEU A 1 517 ? 68.745  40.047 10.260  1.00 61.61  ? 518  LEU A CD2 1 
ATOM   3996 N N   . GLU A 1 518 ? 68.433  39.134 5.638   1.00 60.41  ? 519  GLU A N   1 
ATOM   3997 C CA  . GLU A 1 518 ? 67.861  39.101 4.299   1.00 59.25  ? 519  GLU A CA  1 
ATOM   3998 C C   . GLU A 1 518 ? 66.374  39.401 4.412   1.00 57.35  ? 519  GLU A C   1 
ATOM   3999 O O   . GLU A 1 518 ? 65.676  38.787 5.225   1.00 53.82  ? 519  GLU A O   1 
ATOM   4000 C CB  . GLU A 1 518 ? 68.092  37.742 3.630   1.00 57.16  ? 519  GLU A CB  1 
ATOM   4001 C CG  . GLU A 1 518 ? 67.521  37.628 2.229   1.00 73.60  ? 519  GLU A CG  1 
ATOM   4002 C CD  . GLU A 1 518 ? 67.583  36.211 1.693   1.00 87.94  ? 519  GLU A CD  1 
ATOM   4003 O OE1 . GLU A 1 518 ? 66.552  35.718 1.189   1.00 92.28  ? 519  GLU A OE1 1 
ATOM   4004 O OE2 . GLU A 1 518 ? 68.661  35.587 1.783   1.00 94.36  ? 519  GLU A OE2 1 
ATOM   4005 N N   . VAL A 1 519 ? 65.897  40.350 3.617   1.00 56.39  ? 520  VAL A N   1 
ATOM   4006 C CA  . VAL A 1 519 ? 64.498  40.760 3.654   1.00 53.40  ? 520  VAL A CA  1 
ATOM   4007 C C   . VAL A 1 519 ? 63.711  39.929 2.649   1.00 54.93  ? 520  VAL A C   1 
ATOM   4008 O O   . VAL A 1 519 ? 64.124  39.776 1.493   1.00 61.94  ? 520  VAL A O   1 
ATOM   4009 C CB  . VAL A 1 519 ? 64.359  42.263 3.358   1.00 54.73  ? 520  VAL A CB  1 
ATOM   4010 C CG1 . VAL A 1 519 ? 62.884  42.657 3.245   1.00 50.22  ? 520  VAL A CG1 1 
ATOM   4011 C CG2 . VAL A 1 519 ? 65.075  43.087 4.430   1.00 48.93  ? 520  VAL A CG2 1 
ATOM   4012 N N   . ARG A 1 520 ? 62.581  39.381 3.092   1.00 54.20  ? 521  ARG A N   1 
ATOM   4013 C CA  . ARG A 1 520 ? 61.686  38.612 2.241   1.00 53.89  ? 521  ARG A CA  1 
ATOM   4014 C C   . ARG A 1 520 ? 60.260  39.104 2.448   1.00 56.15  ? 521  ARG A C   1 
ATOM   4015 O O   . ARG A 1 520 ? 59.970  39.858 3.381   1.00 57.31  ? 521  ARG A O   1 
ATOM   4016 C CB  . ARG A 1 520 ? 61.789  37.112 2.539   1.00 53.33  ? 521  ARG A CB  1 
ATOM   4017 C CG  . ARG A 1 520 ? 63.206  36.576 2.477   1.00 54.61  ? 521  ARG A CG  1 
ATOM   4018 C CD  . ARG A 1 520 ? 63.279  35.151 2.978   1.00 57.12  ? 521  ARG A CD  1 
ATOM   4019 N NE  . ARG A 1 520 ? 64.654  34.672 3.044   1.00 56.63  ? 521  ARG A NE  1 
ATOM   4020 C CZ  . ARG A 1 520 ? 65.020  33.552 3.657   1.00 60.14  ? 521  ARG A CZ  1 
ATOM   4021 N NH1 . ARG A 1 520 ? 64.110  32.798 4.259   1.00 55.23  ? 521  ARG A NH1 1 
ATOM   4022 N NH2 . ARG A 1 520 ? 66.295  33.188 3.672   1.00 69.14  ? 521  ARG A NH2 1 
ATOM   4023 N N   . ARG A 1 521 ? 59.362  38.668 1.569   1.00 57.91  ? 522  ARG A N   1 
ATOM   4024 C CA  . ARG A 1 521 ? 57.970  39.100 1.591   1.00 59.10  ? 522  ARG A CA  1 
ATOM   4025 C C   . ARG A 1 521 ? 57.056  37.917 1.879   1.00 58.56  ? 522  ARG A C   1 
ATOM   4026 O O   . ARG A 1 521 ? 57.228  36.836 1.304   1.00 51.58  ? 522  ARG A O   1 
ATOM   4027 C CB  . ARG A 1 521 ? 57.568  39.751 0.263   1.00 60.80  ? 522  ARG A CB  1 
ATOM   4028 C CG  . ARG A 1 521 ? 58.198  41.107 0.013   1.00 63.36  ? 522  ARG A CG  1 
ATOM   4029 C CD  . ARG A 1 521 ? 57.428  41.903 -1.038  1.00 63.04  ? 522  ARG A CD  1 
ATOM   4030 N NE  . ARG A 1 521 ? 56.046  42.149 -0.633  1.00 66.70  ? 522  ARG A NE  1 
ATOM   4031 C CZ  . ARG A 1 521 ? 54.978  41.831 -1.360  1.00 72.71  ? 522  ARG A CZ  1 
ATOM   4032 N NH1 . ARG A 1 521 ? 55.121  41.266 -2.553  1.00 64.84  ? 522  ARG A NH1 1 
ATOM   4033 N NH2 . ARG A 1 521 ? 53.762  42.094 -0.897  1.00 70.90  ? 522  ARG A NH2 1 
ATOM   4034 N N   . GLY A 1 522 ? 56.088  38.129 2.768   1.00 56.37  ? 523  GLY A N   1 
ATOM   4035 C CA  . GLY A 1 522 ? 55.021  37.171 2.980   1.00 53.73  ? 523  GLY A CA  1 
ATOM   4036 C C   . GLY A 1 522 ? 55.362  36.016 3.898   1.00 55.60  ? 523  GLY A C   1 
ATOM   4037 O O   . GLY A 1 522 ? 56.238  35.202 3.594   1.00 59.18  ? 523  GLY A O   1 
ATOM   4038 N N   . LEU A 1 523 ? 54.665  35.936 5.032   1.00 53.14  ? 524  LEU A N   1 
ATOM   4039 C CA  . LEU A 1 523 ? 54.791  34.803 5.947   1.00 53.99  ? 524  LEU A CA  1 
ATOM   4040 C C   . LEU A 1 523 ? 53.835  33.715 5.471   1.00 53.21  ? 524  LEU A C   1 
ATOM   4041 O O   . LEU A 1 523 ? 52.706  33.577 5.948   1.00 52.11  ? 524  LEU A O   1 
ATOM   4042 C CB  . LEU A 1 523 ? 54.503  35.234 7.380   1.00 51.04  ? 524  LEU A CB  1 
ATOM   4043 C CG  . LEU A 1 523 ? 55.547  36.164 8.003   1.00 55.46  ? 524  LEU A CG  1 
ATOM   4044 C CD1 . LEU A 1 523 ? 54.982  36.892 9.211   1.00 51.02  ? 524  LEU A CD1 1 
ATOM   4045 C CD2 . LEU A 1 523 ? 56.787  35.374 8.386   1.00 57.12  ? 524  LEU A CD2 1 
ATOM   4046 N N   . ARG A 1 524 ? 54.313  32.932 4.503   1.00 55.90  ? 525  ARG A N   1 
ATOM   4047 C CA  A ARG A 1 524 ? 53.520  31.899 3.839   0.56 54.36  ? 525  ARG A CA  1 
ATOM   4048 C CA  B ARG A 1 524 ? 53.515  31.894 3.857   0.44 54.15  ? 525  ARG A CA  1 
ATOM   4049 C C   . ARG A 1 524 ? 52.142  32.443 3.462   1.00 52.01  ? 525  ARG A C   1 
ATOM   4050 O O   . ARG A 1 524 ? 51.097  31.992 3.935   1.00 47.95  ? 525  ARG A O   1 
ATOM   4051 C CB  A ARG A 1 524 ? 53.429  30.640 4.707   0.56 52.21  ? 525  ARG A CB  1 
ATOM   4052 C CB  B ARG A 1 524 ? 53.396  30.665 4.765   0.44 52.06  ? 525  ARG A CB  1 
ATOM   4053 C CG  A ARG A 1 524 ? 54.746  29.872 4.746   0.56 50.95  ? 525  ARG A CG  1 
ATOM   4054 C CG  B ARG A 1 524 ? 54.720  30.268 5.407   0.44 50.95  ? 525  ARG A CG  1 
ATOM   4055 C CD  A ARG A 1 524 ? 54.641  28.544 5.470   0.56 51.63  ? 525  ARG A CD  1 
ATOM   4056 C CD  B ARG A 1 524 ? 54.753  28.805 5.823   0.44 52.19  ? 525  ARG A CD  1 
ATOM   4057 N NE  A ARG A 1 524 ? 53.664  27.643 4.866   0.56 49.86  ? 525  ARG A NE  1 
ATOM   4058 N NE  B ARG A 1 524 ? 56.076  28.418 6.309   0.44 54.41  ? 525  ARG A NE  1 
ATOM   4059 C CZ  A ARG A 1 524 ? 53.897  26.879 3.805   0.56 44.41  ? 525  ARG A CZ  1 
ATOM   4060 C CZ  B ARG A 1 524 ? 56.456  27.166 6.541   0.44 52.58  ? 525  ARG A CZ  1 
ATOM   4061 N NH1 A ARG A 1 524 ? 55.078  26.908 3.200   0.56 55.71  ? 525  ARG A NH1 1 
ATOM   4062 N NH1 B ARG A 1 524 ? 55.614  26.163 6.329   0.44 53.76  ? 525  ARG A NH1 1 
ATOM   4063 N NH2 A ARG A 1 524 ? 52.941  26.088 3.344   0.56 33.64  ? 525  ARG A NH2 1 
ATOM   4064 N NH2 B ARG A 1 524 ? 57.683  26.915 6.979   0.44 46.02  ? 525  ARG A NH2 1 
ATOM   4065 N N   . ALA A 1 525 ? 52.175  33.441 2.573   1.00 53.71  ? 526  ALA A N   1 
ATOM   4066 C CA  . ALA A 1 525 ? 50.978  34.201 2.221   1.00 51.15  ? 526  ALA A CA  1 
ATOM   4067 C C   . ALA A 1 525 ? 49.903  33.321 1.592   1.00 51.99  ? 526  ALA A C   1 
ATOM   4068 O O   . ALA A 1 525 ? 48.730  33.394 1.974   1.00 52.96  ? 526  ALA A O   1 
ATOM   4069 C CB  . ALA A 1 525 ? 51.352  35.345 1.278   1.00 58.59  ? 526  ALA A CB  1 
ATOM   4070 N N   . GLN A 1 526 ? 50.276  32.502 0.603   1.00 53.94  ? 527  GLN A N   1 
ATOM   4071 C CA  . GLN A 1 526 ? 49.275  31.674 -0.067  1.00 56.52  ? 527  GLN A CA  1 
ATOM   4072 C C   . GLN A 1 526 ? 48.636  30.695 0.906   1.00 48.36  ? 527  GLN A C   1 
ATOM   4073 O O   . GLN A 1 526 ? 47.411  30.527 0.917   1.00 54.97  ? 527  GLN A O   1 
ATOM   4074 C CB  . GLN A 1 526 ? 49.899  30.921 -1.243  1.00 53.33  ? 527  GLN A CB  1 
ATOM   4075 C CG  . GLN A 1 526 ? 50.515  31.807 -2.306  1.00 59.56  ? 527  GLN A CG  1 
ATOM   4076 C CD  . GLN A 1 526 ? 49.534  32.805 -2.887  1.00 63.18  ? 527  GLN A CD  1 
ATOM   4077 O OE1 . GLN A 1 526 ? 48.404  32.461 -3.237  1.00 61.33  ? 527  GLN A OE1 1 
ATOM   4078 N NE2 . GLN A 1 526 ? 49.966  34.056 -2.991  1.00 67.42  ? 527  GLN A NE2 1 
ATOM   4079 N N   . ALA A 1 527 ? 49.449  30.044 1.738   1.00 51.20  ? 528  ALA A N   1 
ATOM   4080 C CA  . ALA A 1 527 ? 48.915  29.080 2.694   1.00 49.00  ? 528  ALA A CA  1 
ATOM   4081 C C   . ALA A 1 527 ? 48.032  29.763 3.731   1.00 45.59  ? 528  ALA A C   1 
ATOM   4082 O O   . ALA A 1 527 ? 46.922  29.302 4.017   1.00 53.08  ? 528  ALA A O   1 
ATOM   4083 C CB  . ALA A 1 527 ? 50.061  28.327 3.371   1.00 47.80  ? 528  ALA A CB  1 
ATOM   4084 N N   . CYS A 1 528 ? 48.505  30.872 4.298   1.00 44.61  ? 529  CYS A N   1 
ATOM   4085 C CA  . CYS A 1 528 ? 47.761  31.523 5.369   1.00 45.08  ? 529  CYS A CA  1 
ATOM   4086 C C   . CYS A 1 528 ? 46.506  32.220 4.869   1.00 47.43  ? 529  CYS A C   1 
ATOM   4087 O O   . CYS A 1 528 ? 45.606  32.493 5.670   1.00 48.85  ? 529  CYS A O   1 
ATOM   4088 C CB  . CYS A 1 528 ? 48.666  32.505 6.104   1.00 48.68  ? 529  CYS A CB  1 
ATOM   4089 S SG  . CYS A 1 528 ? 49.933  31.652 7.053   1.00 47.50  ? 529  CYS A SG  1 
ATOM   4090 N N   . ALA A 1 529 ? 46.421  32.512 3.568   1.00 42.53  ? 530  ALA A N   1 
ATOM   4091 C CA  . ALA A 1 529 ? 45.159  32.982 3.011   1.00 41.08  ? 530  ALA A CA  1 
ATOM   4092 C C   . ALA A 1 529 ? 44.086  31.907 3.130   1.00 41.75  ? 530  ALA A C   1 
ATOM   4093 O O   . ALA A 1 529 ? 42.910  32.212 3.357   1.00 45.86  ? 530  ALA A O   1 
ATOM   4094 C CB  . ALA A 1 529 ? 45.347  33.404 1.553   1.00 46.60  ? 530  ALA A CB  1 
ATOM   4095 N N   . PHE A 1 530 ? 44.476  30.639 2.988   1.00 41.81  ? 531  PHE A N   1 
ATOM   4096 C CA  . PHE A 1 530 ? 43.529  29.548 3.193   1.00 43.36  ? 531  PHE A CA  1 
ATOM   4097 C C   . PHE A 1 530 ? 43.076  29.482 4.648   1.00 42.29  ? 531  PHE A C   1 
ATOM   4098 O O   . PHE A 1 530 ? 41.876  29.393 4.933   1.00 44.03  ? 531  PHE A O   1 
ATOM   4099 C CB  . PHE A 1 530 ? 44.158  28.222 2.758   1.00 44.37  ? 531  PHE A CB  1 
ATOM   4100 C CG  . PHE A 1 530 ? 43.414  27.009 3.241   1.00 52.49  ? 531  PHE A CG  1 
ATOM   4101 C CD1 . PHE A 1 530 ? 42.297  26.549 2.563   1.00 53.78  ? 531  PHE A CD1 1 
ATOM   4102 C CD2 . PHE A 1 530 ? 43.833  26.328 4.375   1.00 54.18  ? 531  PHE A CD2 1 
ATOM   4103 C CE1 . PHE A 1 530 ? 41.609  25.433 3.009   1.00 56.55  ? 531  PHE A CE1 1 
ATOM   4104 C CE2 . PHE A 1 530 ? 43.148  25.215 4.826   1.00 55.98  ? 531  PHE A CE2 1 
ATOM   4105 C CZ  . PHE A 1 530 ? 42.036  24.766 4.141   1.00 57.47  ? 531  PHE A CZ  1 
ATOM   4106 N N   . TRP A 1 531 ? 44.025  29.538 5.587   1.00 40.22  ? 532  TRP A N   1 
ATOM   4107 C CA  . TRP A 1 531 ? 43.672  29.382 6.996   1.00 44.74  ? 532  TRP A CA  1 
ATOM   4108 C C   . TRP A 1 531 ? 42.960  30.616 7.540   1.00 45.55  ? 532  TRP A C   1 
ATOM   4109 O O   . TRP A 1 531 ? 42.014  30.494 8.325   1.00 49.70  ? 532  TRP A O   1 
ATOM   4110 C CB  . TRP A 1 531 ? 44.921  29.080 7.829   1.00 41.95  ? 532  TRP A CB  1 
ATOM   4111 C CG  . TRP A 1 531 ? 45.560  27.761 7.510   1.00 40.16  ? 532  TRP A CG  1 
ATOM   4112 C CD1 . TRP A 1 531 ? 46.709  27.558 6.803   1.00 38.19  ? 532  TRP A CD1 1 
ATOM   4113 C CD2 . TRP A 1 531 ? 45.084  26.462 7.884   1.00 38.72  ? 532  TRP A CD2 1 
ATOM   4114 N NE1 . TRP A 1 531 ? 46.978  26.214 6.713   1.00 40.72  ? 532  TRP A NE1 1 
ATOM   4115 C CE2 . TRP A 1 531 ? 45.996  25.519 7.369   1.00 38.78  ? 532  TRP A CE2 1 
ATOM   4116 C CE3 . TRP A 1 531 ? 43.976  26.005 8.605   1.00 38.91  ? 532  TRP A CE3 1 
ATOM   4117 C CZ2 . TRP A 1 531 ? 45.835  24.147 7.552   1.00 36.95  ? 532  TRP A CZ2 1 
ATOM   4118 C CZ3 . TRP A 1 531 ? 43.816  24.642 8.783   1.00 40.29  ? 532  TRP A CZ3 1 
ATOM   4119 C CH2 . TRP A 1 531 ? 44.742  23.730 8.260   1.00 39.60  ? 532  TRP A CH2 1 
ATOM   4120 N N   . ASN A 1 532 ? 43.391  31.811 7.134   1.00 45.83  ? 533  ASN A N   1 
ATOM   4121 C CA  . ASN A 1 532 ? 42.893  33.037 7.749   1.00 43.61  ? 533  ASN A CA  1 
ATOM   4122 C C   . ASN A 1 532 ? 41.714  33.664 7.017   1.00 50.25  ? 533  ASN A C   1 
ATOM   4123 O O   . ASN A 1 532 ? 40.964  34.430 7.633   1.00 54.73  ? 533  ASN A O   1 
ATOM   4124 C CB  . ASN A 1 532 ? 44.017  34.071 7.851   1.00 46.60  ? 533  ASN A CB  1 
ATOM   4125 C CG  . ASN A 1 532 ? 45.138  33.619 8.766   1.00 49.35  ? 533  ASN A CG  1 
ATOM   4126 O OD1 . ASN A 1 532 ? 44.911  32.870 9.713   1.00 50.39  ? 533  ASN A OD1 1 
ATOM   4127 N ND2 . ASN A 1 532 ? 46.355  34.074 8.486   1.00 51.21  ? 533  ASN A ND2 1 
ATOM   4128 N N   . ARG A 1 533 ? 41.532  33.380 5.730   1.00 50.22  ? 534  ARG A N   1 
ATOM   4129 C CA  . ARG A 1 533 ? 40.460  33.993 4.959   1.00 54.72  ? 534  ARG A CA  1 
ATOM   4130 C C   . ARG A 1 533 ? 39.384  33.002 4.548   1.00 55.73  ? 534  ARG A C   1 
ATOM   4131 O O   . ARG A 1 533 ? 38.193  33.265 4.744   1.00 60.96  ? 534  ARG A O   1 
ATOM   4132 C CB  . ARG A 1 533 ? 41.031  34.677 3.707   1.00 56.01  ? 534  ARG A CB  1 
ATOM   4133 C CG  . ARG A 1 533 ? 42.034  35.774 4.008   1.00 59.34  ? 534  ARG A CG  1 
ATOM   4134 C CD  . ARG A 1 533 ? 42.632  36.343 2.736   1.00 63.68  ? 534  ARG A CD  1 
ATOM   4135 N NE  . ARG A 1 533 ? 43.737  37.257 3.014   1.00 67.43  ? 534  ARG A NE  1 
ATOM   4136 C CZ  . ARG A 1 533 ? 43.627  38.582 3.023   1.00 68.89  ? 534  ARG A CZ  1 
ATOM   4137 N NH1 . ARG A 1 533 ? 42.459  39.157 2.765   1.00 62.80  ? 534  ARG A NH1 1 
ATOM   4138 N NH2 . ARG A 1 533 ? 44.689  39.334 3.286   1.00 65.27  ? 534  ARG A NH2 1 
ATOM   4139 N N   . PHE A 1 534 ? 39.769  31.861 3.979   1.00 54.82  ? 535  PHE A N   1 
ATOM   4140 C CA  . PHE A 1 534 ? 38.772  30.988 3.370   1.00 53.05  ? 535  PHE A CA  1 
ATOM   4141 C C   . PHE A 1 534 ? 38.117  30.061 4.387   1.00 56.56  ? 535  PHE A C   1 
ATOM   4142 O O   . PHE A 1 534 ? 36.896  30.101 4.578   1.00 58.14  ? 535  PHE A O   1 
ATOM   4143 C CB  . PHE A 1 534 ? 39.384  30.155 2.249   1.00 42.90  ? 535  PHE A CB  1 
ATOM   4144 C CG  . PHE A 1 534 ? 38.475  29.049 1.774   1.00 47.73  ? 535  PHE A CG  1 
ATOM   4145 C CD1 . PHE A 1 534 ? 37.314  29.338 1.074   1.00 50.71  ? 535  PHE A CD1 1 
ATOM   4146 C CD2 . PHE A 1 534 ? 38.758  27.724 2.069   1.00 54.67  ? 535  PHE A CD2 1 
ATOM   4147 C CE1 . PHE A 1 534 ? 36.457  28.317 0.654   1.00 55.93  ? 535  PHE A CE1 1 
ATOM   4148 C CE2 . PHE A 1 534 ? 37.905  26.700 1.652   1.00 54.14  ? 535  PHE A CE2 1 
ATOM   4149 C CZ  . PHE A 1 534 ? 36.756  26.999 0.945   1.00 58.32  ? 535  PHE A CZ  1 
ATOM   4150 N N   . LEU A 1 535 ? 38.912  29.203 5.026   1.00 50.68  ? 536  LEU A N   1 
ATOM   4151 C CA  . LEU A 1 535 ? 38.356  28.142 5.865   1.00 61.13  ? 536  LEU A CA  1 
ATOM   4152 C C   . LEU A 1 535 ? 37.408  28.636 6.955   1.00 61.86  ? 536  LEU A C   1 
ATOM   4153 O O   . LEU A 1 535 ? 36.416  27.936 7.229   1.00 61.05  ? 536  LEU A O   1 
ATOM   4154 C CB  . LEU A 1 535 ? 39.497  27.319 6.483   1.00 64.53  ? 536  LEU A CB  1 
ATOM   4155 C CG  . LEU A 1 535 ? 39.030  26.252 7.470   1.00 71.08  ? 536  LEU A CG  1 
ATOM   4156 C CD1 . LEU A 1 535 ? 38.670  24.960 6.731   1.00 76.73  ? 536  LEU A CD1 1 
ATOM   4157 C CD2 . LEU A 1 535 ? 40.088  26.006 8.535   1.00 69.33  ? 536  LEU A CD2 1 
ATOM   4158 N N   . PRO A 1 536 ? 37.636  29.780 7.612   1.00 58.89  ? 537  PRO A N   1 
ATOM   4159 C CA  . PRO A 1 536 ? 36.595  30.296 8.517   1.00 63.49  ? 537  PRO A CA  1 
ATOM   4160 C C   . PRO A 1 536 ? 35.248  30.471 7.836   1.00 68.76  ? 537  PRO A C   1 
ATOM   4161 O O   . PRO A 1 536 ? 34.210  30.169 8.441   1.00 66.92  ? 537  PRO A O   1 
ATOM   4162 C CB  . PRO A 1 536 ? 37.182  31.633 8.990   1.00 61.53  ? 537  PRO A CB  1 
ATOM   4163 C CG  . PRO A 1 536 ? 38.655  31.418 8.929   1.00 60.80  ? 537  PRO A CG  1 
ATOM   4164 C CD  . PRO A 1 536 ? 38.886  30.555 7.724   1.00 57.12  ? 537  PRO A CD  1 
ATOM   4165 N N   . LYS A 1 537 ? 35.234  30.931 6.579   1.00 65.08  ? 538  LYS A N   1 
ATOM   4166 C CA  . LYS A 1 537 ? 33.970  31.084 5.865   1.00 62.36  ? 538  LYS A CA  1 
ATOM   4167 C C   . LYS A 1 537 ? 33.305  29.737 5.610   1.00 61.95  ? 538  LYS A C   1 
ATOM   4168 O O   . LYS A 1 537 ? 32.072  29.652 5.569   1.00 66.80  ? 538  LYS A O   1 
ATOM   4169 C CB  . LYS A 1 537 ? 34.187  31.825 4.545   1.00 64.86  ? 538  LYS A CB  1 
ATOM   4170 C CG  . LYS A 1 537 ? 34.724  33.241 4.693   1.00 71.79  ? 538  LYS A CG  1 
ATOM   4171 C CD  . LYS A 1 537 ? 34.844  33.925 3.336   1.00 82.00  ? 538  LYS A CD  1 
ATOM   4172 C CE  . LYS A 1 537 ? 35.647  35.216 3.429   1.00 87.01  ? 538  LYS A CE  1 
ATOM   4173 N NZ  . LYS A 1 537 ? 35.063  36.177 4.406   1.00 91.35  ? 538  LYS A NZ  1 
ATOM   4174 N N   . LEU A 1 538 ? 34.098  28.676 5.439   1.00 62.91  ? 539  LEU A N   1 
ATOM   4175 C CA  . LEU A 1 538 ? 33.525  27.350 5.239   1.00 70.21  ? 539  LEU A CA  1 
ATOM   4176 C C   . LEU A 1 538 ? 32.955  26.791 6.536   1.00 72.02  ? 539  LEU A C   1 
ATOM   4177 O O   . LEU A 1 538 ? 31.855  26.229 6.540   1.00 75.89  ? 539  LEU A O   1 
ATOM   4178 C CB  . LEU A 1 538 ? 34.576  26.398 4.656   1.00 69.94  ? 539  LEU A CB  1 
ATOM   4179 C CG  . LEU A 1 538 ? 34.210  24.922 4.445   1.00 74.50  ? 539  LEU A CG  1 
ATOM   4180 C CD1 . LEU A 1 538 ? 35.046  24.348 3.327   1.00 76.96  ? 539  LEU A CD1 1 
ATOM   4181 C CD2 . LEU A 1 538 ? 34.409  24.074 5.691   1.00 74.83  ? 539  LEU A CD2 1 
ATOM   4182 N N   . LEU A 1 539 ? 33.694  26.924 7.641   1.00 78.17  ? 540  LEU A N   1 
ATOM   4183 C CA  . LEU A 1 539 ? 33.203  26.423 8.921   1.00 83.17  ? 540  LEU A CA  1 
ATOM   4184 C C   . LEU A 1 539 ? 31.928  27.136 9.351   1.00 83.40  ? 540  LEU A C   1 
ATOM   4185 O O   . LEU A 1 539 ? 31.126  26.573 10.104  1.00 86.40  ? 540  LEU A O   1 
ATOM   4186 C CB  . LEU A 1 539 ? 34.287  26.564 9.991   1.00 83.25  ? 540  LEU A CB  1 
ATOM   4187 C CG  . LEU A 1 539 ? 35.472  25.603 9.857   1.00 82.32  ? 540  LEU A CG  1 
ATOM   4188 C CD1 . LEU A 1 539 ? 36.464  25.795 10.995  1.00 76.48  ? 540  LEU A CD1 1 
ATOM   4189 C CD2 . LEU A 1 539 ? 34.989  24.159 9.796   1.00 82.83  ? 540  LEU A CD2 1 
ATOM   4190 N N   . SER A 1 540 ? 31.719  28.368 8.880   1.00 84.48  ? 541  SER A N   1 
ATOM   4191 C CA  . SER A 1 540 ? 30.472  29.073 9.153   1.00 89.81  ? 541  SER A CA  1 
ATOM   4192 C C   . SER A 1 540 ? 29.326  28.511 8.318   1.00 100.53 ? 541  SER A C   1 
ATOM   4193 O O   . SER A 1 540 ? 28.226  28.283 8.833   1.00 103.74 ? 541  SER A O   1 
ATOM   4194 C CB  . SER A 1 540 ? 30.646  30.570 8.886   1.00 88.04  ? 541  SER A CB  1 
ATOM   4195 O OG  . SER A 1 540 ? 31.646  31.130 9.718   1.00 87.99  ? 541  SER A OG  1 
ATOM   4196 N N   . ALA A 1 541 ? 29.565  28.284 7.029   1.00 104.37 ? 542  ALA A N   1 
ATOM   4197 C CA  . ALA A 1 541 ? 28.543  27.738 6.141   1.00 110.74 ? 542  ALA A CA  1 
ATOM   4198 C C   . ALA A 1 541 ? 28.490  26.216 6.232   1.00 111.44 ? 542  ALA A C   1 
ATOM   4199 O O   . ALA A 1 541 ? 28.499  25.649 7.324   1.00 112.70 ? 542  ALA A O   1 
ATOM   4200 C CB  . ALA A 1 541 ? 28.800  28.171 4.706   1.00 111.52 ? 542  ALA A CB  1 
ATOM   4201 N N   . GLU B 1 3   ? 102.304 35.169 69.950  1.00 114.06 ? 4    GLU B N   1 
ATOM   4202 C CA  . GLU B 1 3   ? 102.747 35.227 68.561  1.00 111.09 ? 4    GLU B CA  1 
ATOM   4203 C C   . GLU B 1 3   ? 101.566 35.490 67.627  1.00 101.42 ? 4    GLU B C   1 
ATOM   4204 O O   . GLU B 1 3   ? 100.448 35.040 67.879  1.00 109.02 ? 4    GLU B O   1 
ATOM   4205 C CB  . GLU B 1 3   ? 103.463 33.931 68.173  1.00 116.45 ? 4    GLU B CB  1 
ATOM   4206 C CG  . GLU B 1 3   ? 103.960 33.901 66.737  1.00 121.59 ? 4    GLU B CG  1 
ATOM   4207 C CD  . GLU B 1 3   ? 104.839 32.704 66.445  1.00 128.33 ? 4    GLU B CD  1 
ATOM   4208 O OE1 . GLU B 1 3   ? 104.857 31.764 67.268  1.00 133.82 ? 4    GLU B OE1 1 
ATOM   4209 O OE2 . GLU B 1 3   ? 105.508 32.702 65.391  1.00 127.29 ? 4    GLU B OE2 1 
ATOM   4210 N N   . ASP B 1 4   ? 101.830 36.219 66.544  1.00 87.16  ? 5    ASP B N   1 
ATOM   4211 C CA  . ASP B 1 4   ? 100.782 36.675 65.635  1.00 76.83  ? 5    ASP B CA  1 
ATOM   4212 C C   . ASP B 1 4   ? 100.246 35.504 64.819  1.00 76.05  ? 5    ASP B C   1 
ATOM   4213 O O   . ASP B 1 4   ? 100.943 34.972 63.947  1.00 73.63  ? 5    ASP B O   1 
ATOM   4214 C CB  . ASP B 1 4   ? 101.332 37.767 64.724  1.00 69.83  ? 5    ASP B CB  1 
ATOM   4215 C CG  . ASP B 1 4   ? 100.242 38.596 64.085  1.00 68.56  ? 5    ASP B CG  1 
ATOM   4216 O OD1 . ASP B 1 4   ? 99.081  38.136 64.054  1.00 72.68  ? 5    ASP B OD1 1 
ATOM   4217 O OD2 . ASP B 1 4   ? 100.548 39.711 63.612  1.00 70.30  ? 5    ASP B OD2 1 
ATOM   4218 N N   . ALA B 1 5   ? 98.995  35.116 65.083  1.00 73.18  ? 6    ALA B N   1 
ATOM   4219 C CA  . ALA B 1 5   ? 98.379  34.015 64.351  1.00 70.30  ? 6    ALA B CA  1 
ATOM   4220 C C   . ALA B 1 5   ? 98.080  34.375 62.901  1.00 69.52  ? 6    ALA B C   1 
ATOM   4221 O O   . ALA B 1 5   ? 97.853  33.474 62.087  1.00 68.54  ? 6    ALA B O   1 
ATOM   4222 C CB  . ALA B 1 5   ? 97.095  33.569 65.051  1.00 69.23  ? 6    ALA B CB  1 
ATOM   4223 N N   . GLU B 1 6   ? 98.067  35.666 62.562  1.00 64.61  ? 7    GLU B N   1 
ATOM   4224 C CA  . GLU B 1 6   ? 97.846  36.070 61.180  1.00 60.39  ? 7    GLU B CA  1 
ATOM   4225 C C   . GLU B 1 6   ? 99.017  35.703 60.280  1.00 58.26  ? 7    GLU B C   1 
ATOM   4226 O O   . GLU B 1 6   ? 98.836  35.588 59.063  1.00 59.61  ? 7    GLU B O   1 
ATOM   4227 C CB  . GLU B 1 6   ? 97.590  37.576 61.107  1.00 62.85  ? 7    GLU B CB  1 
ATOM   4228 C CG  . GLU B 1 6   ? 96.334  38.029 61.830  1.00 64.33  ? 7    GLU B CG  1 
ATOM   4229 C CD  . GLU B 1 6   ? 95.064  37.556 61.149  1.00 71.34  ? 7    GLU B CD  1 
ATOM   4230 O OE1 . GLU B 1 6   ? 95.093  37.322 59.920  1.00 70.11  ? 7    GLU B OE1 1 
ATOM   4231 O OE2 . GLU B 1 6   ? 94.035  37.421 61.844  1.00 73.79  ? 7    GLU B OE2 1 
ATOM   4232 N N   . LEU B 1 7   ? 100.205 35.512 60.849  1.00 54.17  ? 8    LEU B N   1 
ATOM   4233 C CA  . LEU B 1 7   ? 101.411 35.212 60.094  1.00 54.49  ? 8    LEU B CA  1 
ATOM   4234 C C   . LEU B 1 7   ? 101.737 33.725 60.077  1.00 54.05  ? 8    LEU B C   1 
ATOM   4235 O O   . LEU B 1 7   ? 102.817 33.340 59.617  1.00 57.61  ? 8    LEU B O   1 
ATOM   4236 C CB  . LEU B 1 7   ? 102.587 36.005 60.662  1.00 56.11  ? 8    LEU B CB  1 
ATOM   4237 C CG  . LEU B 1 7   ? 102.318 37.506 60.764  1.00 56.57  ? 8    LEU B CG  1 
ATOM   4238 C CD1 . LEU B 1 7   ? 103.485 38.215 61.426  1.00 56.68  ? 8    LEU B CD1 1 
ATOM   4239 C CD2 . LEU B 1 7   ? 102.034 38.090 59.379  1.00 54.83  ? 8    LEU B CD2 1 
ATOM   4240 N N   . LEU B 1 8   ? 100.827 32.886 60.562  1.00 49.38  ? 9    LEU B N   1 
ATOM   4241 C CA  . LEU B 1 8   ? 100.996 31.440 60.554  1.00 48.72  ? 9    LEU B CA  1 
ATOM   4242 C C   . LEU B 1 8   ? 99.953  30.839 59.623  1.00 49.87  ? 9    LEU B C   1 
ATOM   4243 O O   . LEU B 1 8   ? 98.750  31.047 59.816  1.00 59.79  ? 9    LEU B O   1 
ATOM   4244 C CB  . LEU B 1 8   ? 100.861 30.865 61.965  1.00 42.26  ? 9    LEU B CB  1 
ATOM   4245 C CG  . LEU B 1 8   ? 101.867 31.413 62.973  1.00 49.19  ? 9    LEU B CG  1 
ATOM   4246 C CD1 . LEU B 1 8   ? 101.390 31.167 64.412  1.00 52.98  ? 9    LEU B CD1 1 
ATOM   4247 C CD2 . LEU B 1 8   ? 103.266 30.831 62.712  1.00 48.11  ? 9    LEU B CD2 1 
ATOM   4248 N N   . VAL B 1 9   ? 100.413 30.109 58.611  1.00 47.82  ? 10   VAL B N   1 
ATOM   4249 C CA  . VAL B 1 9   ? 99.539  29.495 57.620  1.00 47.48  ? 10   VAL B CA  1 
ATOM   4250 C C   . VAL B 1 9   ? 99.969  28.048 57.431  1.00 49.28  ? 10   VAL B C   1 
ATOM   4251 O O   . VAL B 1 9   ? 101.166 27.740 57.439  1.00 55.07  ? 10   VAL B O   1 
ATOM   4252 C CB  . VAL B 1 9   ? 99.575  30.258 56.276  1.00 50.77  ? 10   VAL B CB  1 
ATOM   4253 C CG1 . VAL B 1 9   ? 98.696  29.573 55.241  1.00 50.02  ? 10   VAL B CG1 1 
ATOM   4254 C CG2 . VAL B 1 9   ? 99.127  31.693 56.472  1.00 54.65  ? 10   VAL B CG2 1 
ATOM   4255 N N   . THR B 1 10  ? 98.992  27.162 57.277  1.00 48.75  ? 11   THR B N   1 
ATOM   4256 C CA  . THR B 1 10  ? 99.235  25.768 56.934  1.00 49.88  ? 11   THR B CA  1 
ATOM   4257 C C   . THR B 1 10  ? 98.816  25.544 55.486  1.00 51.27  ? 11   THR B C   1 
ATOM   4258 O O   . THR B 1 10  ? 97.644  25.727 55.138  1.00 53.32  ? 11   THR B O   1 
ATOM   4259 C CB  . THR B 1 10  ? 98.476  24.832 57.874  1.00 47.26  ? 11   THR B CB  1 
ATOM   4260 O OG1 . THR B 1 10  ? 98.953  25.016 59.213  1.00 56.07  ? 11   THR B OG1 1 
ATOM   4261 C CG2 . THR B 1 10  ? 98.682  23.382 57.467  1.00 45.08  ? 11   THR B CG2 1 
ATOM   4262 N N   . VAL B 1 11  ? 99.776  25.174 54.642  1.00 46.64  ? 12   VAL B N   1 
ATOM   4263 C CA  . VAL B 1 11  ? 99.475  24.767 53.275  1.00 43.45  ? 12   VAL B CA  1 
ATOM   4264 C C   . VAL B 1 11  ? 99.609  23.253 53.203  1.00 49.41  ? 12   VAL B C   1 
ATOM   4265 O O   . VAL B 1 11  ? 99.887  22.600 54.216  1.00 51.26  ? 12   VAL B O   1 
ATOM   4266 C CB  . VAL B 1 11  ? 100.391 25.470 52.258  1.00 41.57  ? 12   VAL B CB  1 
ATOM   4267 C CG1 . VAL B 1 11  ? 100.133 26.968 52.278  1.00 38.66  ? 12   VAL B CG1 1 
ATOM   4268 C CG2 . VAL B 1 11  ? 101.856 25.171 52.557  1.00 40.54  ? 12   VAL B CG2 1 
ATOM   4269 N N   . ARG B 1 12  ? 99.413  22.683 52.013  1.00 47.96  ? 13   ARG B N   1 
ATOM   4270 C CA  . ARG B 1 12  ? 99.404  21.228 51.893  1.00 51.84  ? 13   ARG B CA  1 
ATOM   4271 C C   . ARG B 1 12  ? 100.745 20.620 52.277  1.00 51.02  ? 13   ARG B C   1 
ATOM   4272 O O   . ARG B 1 12  ? 100.791 19.501 52.800  1.00 52.53  ? 13   ARG B O   1 
ATOM   4273 C CB  . ARG B 1 12  ? 99.020  20.817 50.471  1.00 54.05  ? 13   ARG B CB  1 
ATOM   4274 C CG  . ARG B 1 12  ? 97.589  21.171 50.104  1.00 65.32  ? 13   ARG B CG  1 
ATOM   4275 C CD  . ARG B 1 12  ? 97.082  20.351 48.929  1.00 73.86  ? 13   ARG B CD  1 
ATOM   4276 N NE  . ARG B 1 12  ? 95.749  20.781 48.514  1.00 83.61  ? 13   ARG B NE  1 
ATOM   4277 C CZ  . ARG B 1 12  ? 95.052  20.222 47.529  1.00 87.58  ? 13   ARG B CZ  1 
ATOM   4278 N NH1 . ARG B 1 12  ? 95.557  19.200 46.852  1.00 87.26  ? 13   ARG B NH1 1 
ATOM   4279 N NH2 . ARG B 1 12  ? 93.847  20.684 47.224  1.00 90.35  ? 13   ARG B NH2 1 
ATOM   4280 N N   . GLY B 1 13  ? 101.844 21.338 52.037  1.00 50.45  ? 14   GLY B N   1 
ATOM   4281 C CA  . GLY B 1 13  ? 103.154 20.804 52.359  1.00 55.49  ? 14   GLY B CA  1 
ATOM   4282 C C   . GLY B 1 13  ? 103.537 20.901 53.819  1.00 54.59  ? 14   GLY B C   1 
ATOM   4283 O O   . GLY B 1 13  ? 104.398 20.140 54.271  1.00 55.82  ? 14   GLY B O   1 
ATOM   4284 N N   . GLY B 1 14  ? 102.927 21.814 54.560  1.00 51.85  ? 15   GLY B N   1 
ATOM   4285 C CA  . GLY B 1 14  ? 103.249 21.999 55.960  1.00 54.24  ? 15   GLY B CA  1 
ATOM   4286 C C   . GLY B 1 14  ? 102.957 23.422 56.393  1.00 52.09  ? 15   GLY B C   1 
ATOM   4287 O O   . GLY B 1 14  ? 102.192 24.137 55.753  1.00 54.33  ? 15   GLY B O   1 
ATOM   4288 N N   . ARG B 1 15  ? 103.595 23.817 57.489  1.00 54.53  ? 16   ARG B N   1 
ATOM   4289 C CA  . ARG B 1 15  ? 103.326 25.089 58.140  1.00 52.34  ? 16   ARG B CA  1 
ATOM   4290 C C   . ARG B 1 15  ? 104.310 26.159 57.682  1.00 52.29  ? 16   ARG B C   1 
ATOM   4291 O O   . ARG B 1 15  ? 105.469 25.873 57.369  1.00 48.85  ? 16   ARG B O   1 
ATOM   4292 C CB  . ARG B 1 15  ? 103.387 24.934 59.661  1.00 51.86  ? 16   ARG B CB  1 
ATOM   4293 C CG  . ARG B 1 15  ? 102.248 24.109 60.242  1.00 56.72  ? 16   ARG B CG  1 
ATOM   4294 C CD  . ARG B 1 15  ? 102.391 23.956 61.752  1.00 60.74  ? 16   ARG B CD  1 
ATOM   4295 N NE  . ARG B 1 15  ? 103.558 23.155 62.107  1.00 65.08  ? 16   ARG B NE  1 
ATOM   4296 C CZ  . ARG B 1 15  ? 104.192 23.231 63.273  1.00 75.43  ? 16   ARG B CZ  1 
ATOM   4297 N NH1 . ARG B 1 15  ? 103.778 24.082 64.202  1.00 76.53  ? 16   ARG B NH1 1 
ATOM   4298 N NH2 . ARG B 1 15  ? 105.246 22.462 63.507  1.00 80.09  ? 16   ARG B NH2 1 
ATOM   4299 N N   . LEU B 1 16  ? 103.831 27.404 57.651  1.00 47.83  ? 17   LEU B N   1 
ATOM   4300 C CA  . LEU B 1 16  ? 104.612 28.546 57.203  1.00 44.83  ? 17   LEU B CA  1 
ATOM   4301 C C   . LEU B 1 16  ? 104.554 29.653 58.246  1.00 44.85  ? 17   LEU B C   1 
ATOM   4302 O O   . LEU B 1 16  ? 103.556 29.809 58.953  1.00 49.99  ? 17   LEU B O   1 
ATOM   4303 C CB  . LEU B 1 16  ? 104.099 29.097 55.857  1.00 42.03  ? 17   LEU B CB  1 
ATOM   4304 C CG  . LEU B 1 16  ? 104.072 28.152 54.655  1.00 50.35  ? 17   LEU B CG  1 
ATOM   4305 C CD1 . LEU B 1 16  ? 103.390 28.815 53.463  1.00 43.40  ? 17   LEU B CD1 1 
ATOM   4306 C CD2 . LEU B 1 16  ? 105.481 27.723 54.290  1.00 56.66  ? 17   LEU B CD2 1 
ATOM   4307 N N   . ARG B 1 17  ? 105.633 30.429 58.320  1.00 46.39  ? 18   ARG B N   1 
ATOM   4308 C CA  A ARG B 1 17  ? 105.733 31.582 59.210  0.45 53.29  ? 18   ARG B CA  1 
ATOM   4309 C CA  B ARG B 1 17  ? 105.730 31.583 59.210  0.55 53.34  ? 18   ARG B CA  1 
ATOM   4310 C C   . ARG B 1 17  ? 106.016 32.813 58.358  1.00 51.40  ? 18   ARG B C   1 
ATOM   4311 O O   . ARG B 1 17  ? 107.078 32.908 57.732  1.00 50.45  ? 18   ARG B O   1 
ATOM   4312 C CB  A ARG B 1 17  ? 106.823 31.363 60.260  0.45 57.37  ? 18   ARG B CB  1 
ATOM   4313 C CB  B ARG B 1 17  ? 106.820 31.379 60.263  0.55 57.29  ? 18   ARG B CB  1 
ATOM   4314 C CG  A ARG B 1 17  ? 107.293 32.620 60.971  0.45 61.35  ? 18   ARG B CG  1 
ATOM   4315 C CG  B ARG B 1 17  ? 106.812 32.416 61.374  0.55 62.46  ? 18   ARG B CG  1 
ATOM   4316 C CD  A ARG B 1 17  ? 108.169 32.269 62.172  0.45 66.09  ? 18   ARG B CD  1 
ATOM   4317 C CD  B ARG B 1 17  ? 108.015 32.257 62.300  0.55 66.21  ? 18   ARG B CD  1 
ATOM   4318 N NE  A ARG B 1 17  ? 109.102 31.182 61.881  0.45 65.32  ? 18   ARG B NE  1 
ATOM   4319 N NE  B ARG B 1 17  ? 108.222 30.870 62.709  0.55 62.79  ? 18   ARG B NE  1 
ATOM   4320 C CZ  A ARG B 1 17  ? 110.361 31.356 61.490  0.45 59.55  ? 18   ARG B CZ  1 
ATOM   4321 C CZ  B ARG B 1 17  ? 107.606 30.292 63.734  0.55 62.55  ? 18   ARG B CZ  1 
ATOM   4322 N NH1 A ARG B 1 17  ? 110.849 32.580 61.341  0.45 53.21  ? 18   ARG B NH1 1 
ATOM   4323 N NH1 B ARG B 1 17  ? 106.737 30.979 64.461  0.55 66.62  ? 18   ARG B NH1 1 
ATOM   4324 N NH2 A ARG B 1 17  ? 111.132 30.304 61.250  0.45 60.33  ? 18   ARG B NH2 1 
ATOM   4325 N NH2 B ARG B 1 17  ? 107.859 29.025 64.033  0.55 63.69  ? 18   ARG B NH2 1 
ATOM   4326 N N   . GLY B 1 18  ? 105.071 33.752 58.331  1.00 48.06  ? 19   GLY B N   1 
ATOM   4327 C CA  . GLY B 1 18  ? 105.192 34.948 57.527  1.00 48.92  ? 19   GLY B CA  1 
ATOM   4328 C C   . GLY B 1 18  ? 105.708 36.143 58.310  1.00 53.62  ? 19   GLY B C   1 
ATOM   4329 O O   . GLY B 1 18  ? 106.153 36.041 59.454  1.00 50.10  ? 19   GLY B O   1 
ATOM   4330 N N   . ILE B 1 19  ? 105.642 37.306 57.664  1.00 46.45  ? 20   ILE B N   1 
ATOM   4331 C CA  . ILE B 1 19  ? 106.118 38.550 58.252  1.00 49.61  ? 20   ILE B CA  1 
ATOM   4332 C C   . ILE B 1 19  ? 105.129 39.659 57.923  1.00 52.88  ? 20   ILE B C   1 
ATOM   4333 O O   . ILE B 1 19  ? 104.511 39.669 56.854  1.00 55.49  ? 20   ILE B O   1 
ATOM   4334 C CB  . ILE B 1 19  ? 107.539 38.907 57.754  1.00 50.55  ? 20   ILE B CB  1 
ATOM   4335 C CG1 . ILE B 1 19  ? 108.079 40.139 58.483  1.00 52.01  ? 20   ILE B CG1 1 
ATOM   4336 C CG2 . ILE B 1 19  ? 107.546 39.129 56.245  1.00 47.49  ? 20   ILE B CG2 1 
ATOM   4337 C CD1 . ILE B 1 19  ? 109.469 40.546 58.039  1.00 52.74  ? 20   ILE B CD1 1 
ATOM   4338 N N   . ARG B 1 20  ? 104.966 40.596 58.855  1.00 53.83  ? 21   ARG B N   1 
ATOM   4339 C CA  . ARG B 1 20  ? 104.121 41.756 58.616  1.00 54.86  ? 21   ARG B CA  1 
ATOM   4340 C C   . ARG B 1 20  ? 104.972 42.897 58.082  1.00 54.41  ? 21   ARG B C   1 
ATOM   4341 O O   . ARG B 1 20  ? 106.058 43.167 58.606  1.00 52.72  ? 21   ARG B O   1 
ATOM   4342 C CB  . ARG B 1 20  ? 103.399 42.192 59.889  1.00 60.40  ? 21   ARG B CB  1 
ATOM   4343 C CG  . ARG B 1 20  ? 102.258 43.160 59.634  1.00 66.01  ? 21   ARG B CG  1 
ATOM   4344 C CD  . ARG B 1 20  ? 101.722 43.758 60.927  1.00 76.41  ? 21   ARG B CD  1 
ATOM   4345 N NE  . ARG B 1 20  ? 101.927 42.895 62.082  1.00 76.46  ? 21   ARG B NE  1 
ATOM   4346 C CZ  . ARG B 1 20  ? 102.853 43.103 63.009  1.00 77.11  ? 21   ARG B CZ  1 
ATOM   4347 N NH1 . ARG B 1 20  ? 103.675 44.150 62.947  1.00 80.95  ? 21   ARG B NH1 1 
ATOM   4348 N NH2 . ARG B 1 20  ? 102.973 42.256 64.024  1.00 68.48  ? 21   ARG B NH2 1 
ATOM   4349 N N   . LEU B 1 21  ? 104.477 43.559 57.042  1.00 47.59  ? 22   LEU B N   1 
ATOM   4350 C CA  . LEU B 1 21  ? 105.185 44.638 56.374  1.00 46.68  ? 22   LEU B CA  1 
ATOM   4351 C C   . LEU B 1 21  ? 104.453 45.957 56.587  1.00 57.35  ? 22   LEU B C   1 
ATOM   4352 O O   . LEU B 1 21  ? 103.226 45.989 56.715  1.00 56.42  ? 22   LEU B O   1 
ATOM   4353 C CB  . LEU B 1 21  ? 105.314 44.360 54.875  1.00 47.65  ? 22   LEU B CB  1 
ATOM   4354 C CG  . LEU B 1 21  ? 106.062 43.090 54.468  1.00 50.55  ? 22   LEU B CG  1 
ATOM   4355 C CD1 . LEU B 1 21  ? 106.128 42.980 52.959  1.00 48.25  ? 22   LEU B CD1 1 
ATOM   4356 C CD2 . LEU B 1 21  ? 107.457 43.066 55.072  1.00 50.93  ? 22   LEU B CD2 1 
ATOM   4357 N N   . LYS B 1 22  ? 105.216 47.047 56.609  1.00 56.24  ? 23   LYS B N   1 
ATOM   4358 C CA  . LYS B 1 22  ? 104.650 48.379 56.763  1.00 50.75  ? 23   LYS B CA  1 
ATOM   4359 C C   . LYS B 1 22  ? 104.421 49.034 55.401  1.00 49.37  ? 23   LYS B C   1 
ATOM   4360 O O   . LYS B 1 22  ? 105.154 48.793 54.438  1.00 50.55  ? 23   LYS B O   1 
ATOM   4361 C CB  . LYS B 1 22  ? 105.562 49.260 57.619  1.00 50.90  ? 23   LYS B CB  1 
ATOM   4362 C CG  . LYS B 1 22  ? 105.759 48.754 59.044  1.00 57.11  ? 23   LYS B CG  1 
ATOM   4363 C CD  . LYS B 1 22  ? 106.515 49.760 59.899  1.00 62.84  ? 23   LYS B CD  1 
ATOM   4364 C CE  . LYS B 1 22  ? 107.837 50.153 59.260  1.00 74.77  ? 23   LYS B CE  1 
ATOM   4365 N NZ  . LYS B 1 22  ? 108.582 51.142 60.093  1.00 81.66  ? 23   LYS B NZ  1 
ATOM   4366 N N   . THR B 1 23  ? 103.391 49.873 55.339  1.00 46.70  ? 24   THR B N   1 
ATOM   4367 C CA  . THR B 1 23  ? 102.972 50.635 54.170  1.00 53.00  ? 24   THR B CA  1 
ATOM   4368 C C   . THR B 1 23  ? 102.516 52.000 54.660  1.00 55.44  ? 24   THR B C   1 
ATOM   4369 O O   . THR B 1 23  ? 102.080 52.129 55.811  1.00 52.23  ? 24   THR B O   1 
ATOM   4370 C CB  . THR B 1 23  ? 101.826 49.917 53.423  1.00 49.13  ? 24   THR B CB  1 
ATOM   4371 O OG1 . THR B 1 23  ? 102.285 48.648 52.945  1.00 55.54  ? 24   THR B OG1 1 
ATOM   4372 C CG2 . THR B 1 23  ? 101.250 50.719 52.268  1.00 63.23  ? 24   THR B CG2 1 
ATOM   4373 N N   . PRO B 1 24  ? 102.638 53.042 53.833  1.00 54.31  ? 25   PRO B N   1 
ATOM   4374 C CA  . PRO B 1 24  ? 102.018 54.329 54.192  1.00 60.01  ? 25   PRO B CA  1 
ATOM   4375 C C   . PRO B 1 24  ? 100.529 54.230 54.477  1.00 57.86  ? 25   PRO B C   1 
ATOM   4376 O O   . PRO B 1 24  ? 99.985  55.118 55.143  1.00 53.74  ? 25   PRO B O   1 
ATOM   4377 C CB  . PRO B 1 24  ? 102.289 55.203 52.963  1.00 60.29  ? 25   PRO B CB  1 
ATOM   4378 C CG  . PRO B 1 24  ? 103.505 54.626 52.359  1.00 56.68  ? 25   PRO B CG  1 
ATOM   4379 C CD  . PRO B 1 24  ? 103.505 53.158 52.647  1.00 52.91  ? 25   PRO B CD  1 
ATOM   4380 N N   . GLY B 1 25  ? 99.851  53.192 53.988  1.00 53.98  ? 26   GLY B N   1 
ATOM   4381 C CA  . GLY B 1 25  ? 98.441  53.002 54.250  1.00 60.10  ? 26   GLY B CA  1 
ATOM   4382 C C   . GLY B 1 25  ? 98.099  51.903 55.232  1.00 59.25  ? 26   GLY B C   1 
ATOM   4383 O O   . GLY B 1 25  ? 96.925  51.518 55.312  1.00 55.45  ? 26   GLY B O   1 
ATOM   4384 N N   . GLY B 1 26  ? 99.069  51.370 55.985  1.00 51.55  ? 27   GLY B N   1 
ATOM   4385 C CA  . GLY B 1 26  ? 98.804  50.313 56.924  1.00 49.86  ? 27   GLY B CA  1 
ATOM   4386 C C   . GLY B 1 26  ? 99.465  49.011 56.543  1.00 52.31  ? 27   GLY B C   1 
ATOM   4387 O O   . GLY B 1 26  ? 100.009 48.848 55.455  1.00 54.42  ? 27   GLY B O   1 
ATOM   4388 N N   . PRO B 1 27  ? 99.413  48.028 57.436  1.00 47.52  ? 28   PRO B N   1 
ATOM   4389 C CA  . PRO B 1 27  ? 100.236 46.809 57.244  1.00 43.66  ? 28   PRO B CA  1 
ATOM   4390 C C   . PRO B 1 27  ? 99.625  45.844 56.231  1.00 49.05  ? 28   PRO B C   1 
ATOM   4391 O O   . PRO B 1 27  ? 98.434  45.898 55.911  1.00 52.20  ? 28   PRO B O   1 
ATOM   4392 C CB  . PRO B 1 27  ? 100.250 46.165 58.645  1.00 42.34  ? 28   PRO B CB  1 
ATOM   4393 C CG  . PRO B 1 27  ? 99.023  46.683 59.297  1.00 48.96  ? 28   PRO B CG  1 
ATOM   4394 C CD  . PRO B 1 27  ? 98.721  48.035 58.748  1.00 43.70  ? 28   PRO B CD  1 
ATOM   4395 N N   . VAL B 1 28  ? 100.481 44.973 55.714  1.00 45.30  ? 29   VAL B N   1 
ATOM   4396 C CA  . VAL B 1 28  ? 100.075 43.830 54.918  1.00 41.20  ? 29   VAL B CA  1 
ATOM   4397 C C   . VAL B 1 28  ? 100.834 42.609 55.417  1.00 47.59  ? 29   VAL B C   1 
ATOM   4398 O O   . VAL B 1 28  ? 101.863 42.720 56.081  1.00 53.01  ? 29   VAL B O   1 
ATOM   4399 C CB  . VAL B 1 28  ? 100.312 44.022 53.390  1.00 45.87  ? 29   VAL B CB  1 
ATOM   4400 C CG1 . VAL B 1 28  ? 99.720  45.335 52.902  1.00 43.88  ? 29   VAL B CG1 1 
ATOM   4401 C CG2 . VAL B 1 28  ? 101.791 43.937 53.060  1.00 40.97  ? 29   VAL B CG2 1 
ATOM   4402 N N   . SER B 1 29  ? 100.299 41.427 55.101  1.00 44.62  ? 30   SER B N   1 
ATOM   4403 C CA  . SER B 1 29  ? 100.938 40.162 55.442  1.00 41.89  ? 30   SER B CA  1 
ATOM   4404 C C   . SER B 1 29  ? 101.697 39.645 54.228  1.00 45.14  ? 30   SER B C   1 
ATOM   4405 O O   . SER B 1 29  ? 101.164 39.639 53.114  1.00 47.61  ? 30   SER B O   1 
ATOM   4406 C CB  . SER B 1 29  ? 99.909  39.128 55.896  1.00 42.93  ? 30   SER B CB  1 
ATOM   4407 O OG  . SER B 1 29  ? 99.052  39.649 56.895  1.00 56.37  ? 30   SER B OG  1 
ATOM   4408 N N   . ALA B 1 30  ? 102.934 39.208 54.445  1.00 43.40  ? 31   ALA B N   1 
ATOM   4409 C CA  . ALA B 1 30  ? 103.770 38.682 53.375  1.00 43.94  ? 31   ALA B CA  1 
ATOM   4410 C C   . ALA B 1 30  ? 104.330 37.326 53.771  1.00 45.54  ? 31   ALA B C   1 
ATOM   4411 O O   . ALA B 1 30  ? 104.769 37.130 54.908  1.00 45.98  ? 31   ALA B O   1 
ATOM   4412 C CB  . ALA B 1 30  ? 104.918 39.638 53.036  1.00 41.17  ? 31   ALA B CB  1 
ATOM   4413 N N   . PHE B 1 31  ? 104.318 36.395 52.820  1.00 44.11  ? 32   PHE B N   1 
ATOM   4414 C CA  . PHE B 1 31  ? 104.885 35.060 52.995  1.00 42.32  ? 32   PHE B CA  1 
ATOM   4415 C C   . PHE B 1 31  ? 105.857 34.854 51.838  1.00 45.39  ? 32   PHE B C   1 
ATOM   4416 O O   . PHE B 1 31  ? 105.446 34.520 50.722  1.00 46.82  ? 32   PHE B O   1 
ATOM   4417 C CB  . PHE B 1 31  ? 103.789 33.998 53.032  1.00 41.02  ? 32   PHE B CB  1 
ATOM   4418 C CG  . PHE B 1 31  ? 102.772 34.229 54.114  1.00 44.81  ? 32   PHE B CG  1 
ATOM   4419 C CD1 . PHE B 1 31  ? 101.711 35.097 53.913  1.00 44.16  ? 32   PHE B CD1 1 
ATOM   4420 C CD2 . PHE B 1 31  ? 102.888 33.596 55.338  1.00 43.05  ? 32   PHE B CD2 1 
ATOM   4421 C CE1 . PHE B 1 31  ? 100.783 35.321 54.908  1.00 44.25  ? 32   PHE B CE1 1 
ATOM   4422 C CE2 . PHE B 1 31  ? 101.962 33.818 56.338  1.00 50.92  ? 32   PHE B CE2 1 
ATOM   4423 C CZ  . PHE B 1 31  ? 100.910 34.683 56.122  1.00 46.16  ? 32   PHE B CZ  1 
ATOM   4424 N N   . LEU B 1 32  ? 107.142 35.070 52.108  1.00 43.41  ? 33   LEU B N   1 
ATOM   4425 C CA  . LEU B 1 32  ? 108.174 35.135 51.083  1.00 47.14  ? 33   LEU B CA  1 
ATOM   4426 C C   . LEU B 1 32  ? 109.060 33.900 51.142  1.00 45.97  ? 33   LEU B C   1 
ATOM   4427 O O   . LEU B 1 32  ? 109.407 33.425 52.226  1.00 43.74  ? 33   LEU B O   1 
ATOM   4428 C CB  . LEU B 1 32  ? 109.031 36.389 51.265  1.00 44.00  ? 33   LEU B CB  1 
ATOM   4429 C CG  . LEU B 1 32  ? 108.255 37.682 51.509  1.00 43.57  ? 33   LEU B CG  1 
ATOM   4430 C CD1 . LEU B 1 32  ? 109.207 38.819 51.844  1.00 42.21  ? 33   LEU B CD1 1 
ATOM   4431 C CD2 . LEU B 1 32  ? 107.396 38.026 50.296  1.00 41.09  ? 33   LEU B CD2 1 
ATOM   4432 N N   . GLY B 1 33  ? 109.442 33.395 49.975  1.00 40.51  ? 34   GLY B N   1 
ATOM   4433 C CA  . GLY B 1 33  ? 110.317 32.239 49.925  1.00 37.55  ? 34   GLY B CA  1 
ATOM   4434 C C   . GLY B 1 33  ? 109.642 30.927 50.253  1.00 40.35  ? 34   GLY B C   1 
ATOM   4435 O O   . GLY B 1 33  ? 110.249 30.067 50.902  1.00 45.89  ? 34   GLY B O   1 
ATOM   4436 N N   . ILE B 1 34  ? 108.394 30.750 49.831  1.00 41.44  ? 35   ILE B N   1 
ATOM   4437 C CA  . ILE B 1 34  ? 107.677 29.490 50.015  1.00 43.10  ? 35   ILE B CA  1 
ATOM   4438 C C   . ILE B 1 34  ? 108.165 28.502 48.963  1.00 43.10  ? 35   ILE B C   1 
ATOM   4439 O O   . ILE B 1 34  ? 108.067 28.788 47.762  1.00 47.81  ? 35   ILE B O   1 
ATOM   4440 C CB  . ILE B 1 34  ? 106.158 29.688 49.906  1.00 43.47  ? 35   ILE B CB  1 
ATOM   4441 C CG1 . ILE B 1 34  ? 105.684 30.781 50.864  1.00 39.02  ? 35   ILE B CG1 1 
ATOM   4442 C CG2 . ILE B 1 34  ? 105.427 28.375 50.152  1.00 42.04  ? 35   ILE B CG2 1 
ATOM   4443 C CD1 . ILE B 1 34  ? 104.246 31.195 50.632  1.00 38.45  ? 35   ILE B CD1 1 
ATOM   4444 N N   . PRO B 1 35  ? 108.692 27.342 49.349  1.00 45.44  ? 36   PRO B N   1 
ATOM   4445 C CA  . PRO B 1 35  ? 109.130 26.366 48.342  1.00 38.75  ? 36   PRO B CA  1 
ATOM   4446 C C   . PRO B 1 35  ? 107.934 25.687 47.690  1.00 41.96  ? 36   PRO B C   1 
ATOM   4447 O O   . PRO B 1 35  ? 107.067 25.140 48.373  1.00 41.76  ? 36   PRO B O   1 
ATOM   4448 C CB  . PRO B 1 35  ? 109.972 25.375 49.152  1.00 45.20  ? 36   PRO B CB  1 
ATOM   4449 C CG  . PRO B 1 35  ? 109.382 25.444 50.537  1.00 43.76  ? 36   PRO B CG  1 
ATOM   4450 C CD  . PRO B 1 35  ? 108.929 26.872 50.727  1.00 41.87  ? 36   PRO B CD  1 
ATOM   4451 N N   . PHE B 1 36  ? 107.887 25.730 46.357  1.00 41.13  ? 37   PHE B N   1 
ATOM   4452 C CA  . PHE B 1 36  ? 106.837 25.038 45.624  1.00 44.52  ? 37   PHE B CA  1 
ATOM   4453 C C   . PHE B 1 36  ? 107.353 23.890 44.768  1.00 43.44  ? 37   PHE B C   1 
ATOM   4454 O O   . PHE B 1 36  ? 106.543 23.155 44.196  1.00 42.54  ? 37   PHE B O   1 
ATOM   4455 C CB  . PHE B 1 36  ? 106.039 26.026 44.751  1.00 38.99  ? 37   PHE B CB  1 
ATOM   4456 C CG  . PHE B 1 36  ? 106.797 26.570 43.566  1.00 39.45  ? 37   PHE B CG  1 
ATOM   4457 C CD1 . PHE B 1 36  ? 106.697 25.962 42.322  1.00 41.74  ? 37   PHE B CD1 1 
ATOM   4458 C CD2 . PHE B 1 36  ? 107.578 27.710 43.686  1.00 38.92  ? 37   PHE B CD2 1 
ATOM   4459 C CE1 . PHE B 1 36  ? 107.379 26.466 41.223  1.00 36.41  ? 37   PHE B CE1 1 
ATOM   4460 C CE2 . PHE B 1 36  ? 108.265 28.220 42.592  1.00 39.61  ? 37   PHE B CE2 1 
ATOM   4461 C CZ  . PHE B 1 36  ? 108.164 27.596 41.359  1.00 39.13  ? 37   PHE B CZ  1 
ATOM   4462 N N   . ALA B 1 37  ? 108.666 23.699 44.684  1.00 38.37  ? 38   ALA B N   1 
ATOM   4463 C CA  . ALA B 1 37  ? 109.230 22.588 43.937  1.00 39.92  ? 38   ALA B CA  1 
ATOM   4464 C C   . ALA B 1 37  ? 110.434 22.037 44.683  1.00 44.49  ? 38   ALA B C   1 
ATOM   4465 O O   . ALA B 1 37  ? 111.022 22.703 45.539  1.00 40.71  ? 38   ALA B O   1 
ATOM   4466 C CB  . ALA B 1 37  ? 109.645 23.005 42.518  1.00 42.18  ? 38   ALA B CB  1 
ATOM   4467 N N   . GLU B 1 38  ? 110.792 20.803 44.351  1.00 45.23  ? 39   GLU B N   1 
ATOM   4468 C CA  . GLU B 1 38  ? 112.074 20.279 44.787  1.00 48.77  ? 39   GLU B CA  1 
ATOM   4469 C C   . GLU B 1 38  ? 113.195 21.037 44.081  1.00 48.63  ? 39   GLU B C   1 
ATOM   4470 O O   . GLU B 1 38  ? 113.067 21.368 42.898  1.00 46.14  ? 39   GLU B O   1 
ATOM   4471 C CB  . GLU B 1 38  ? 112.177 18.784 44.488  1.00 49.98  ? 39   GLU B CB  1 
ATOM   4472 C CG  . GLU B 1 38  ? 111.334 17.919 45.406  1.00 54.23  ? 39   GLU B CG  1 
ATOM   4473 C CD  . GLU B 1 38  ? 111.803 17.983 46.846  1.00 58.44  ? 39   GLU B CD  1 
ATOM   4474 O OE1 . GLU B 1 38  ? 112.980 17.655 47.102  1.00 66.55  ? 39   GLU B OE1 1 
ATOM   4475 O OE2 . GLU B 1 38  ? 111.000 18.369 47.721  1.00 56.00  ? 39   GLU B OE2 1 
ATOM   4476 N N   . PRO B 1 39  ? 114.283 21.348 44.779  1.00 48.90  ? 40   PRO B N   1 
ATOM   4477 C CA  . PRO B 1 39  ? 115.400 22.064 44.146  1.00 43.92  ? 40   PRO B CA  1 
ATOM   4478 C C   . PRO B 1 39  ? 115.892 21.331 42.913  1.00 49.64  ? 40   PRO B C   1 
ATOM   4479 O O   . PRO B 1 39  ? 116.270 20.152 42.986  1.00 57.10  ? 40   PRO B O   1 
ATOM   4480 C CB  . PRO B 1 39  ? 116.469 22.087 45.248  1.00 41.66  ? 40   PRO B CB  1 
ATOM   4481 C CG  . PRO B 1 39  ? 115.680 22.025 46.524  1.00 43.11  ? 40   PRO B CG  1 
ATOM   4482 C CD  . PRO B 1 39  ? 114.505 21.134 46.221  1.00 42.73  ? 40   PRO B CD  1 
ATOM   4483 N N   . PRO B 1 40  ? 115.892 21.989 41.753  1.00 45.60  ? 41   PRO B N   1 
ATOM   4484 C CA  . PRO B 1 40  ? 116.325 21.337 40.504  1.00 51.48  ? 41   PRO B CA  1 
ATOM   4485 C C   . PRO B 1 40  ? 117.845 21.284 40.372  1.00 56.14  ? 41   PRO B C   1 
ATOM   4486 O O   . PRO B 1 40  ? 118.440 21.863 39.458  1.00 55.81  ? 41   PRO B O   1 
ATOM   4487 C CB  . PRO B 1 40  ? 115.666 22.217 39.435  1.00 49.82  ? 41   PRO B CB  1 
ATOM   4488 C CG  . PRO B 1 40  ? 115.646 23.577 40.048  1.00 51.13  ? 41   PRO B CG  1 
ATOM   4489 C CD  . PRO B 1 40  ? 115.435 23.373 41.530  1.00 44.44  ? 41   PRO B CD  1 
ATOM   4490 N N   . MET B 1 41  ? 118.482 20.571 41.295  1.00 53.81  ? 42   MET B N   1 
ATOM   4491 C CA  . MET B 1 41  ? 119.931 20.478 41.386  1.00 59.67  ? 42   MET B CA  1 
ATOM   4492 C C   . MET B 1 41  ? 120.425 19.156 40.815  1.00 60.32  ? 42   MET B C   1 
ATOM   4493 O O   . MET B 1 41  ? 119.679 18.179 40.710  1.00 63.70  ? 42   MET B O   1 
ATOM   4494 C CB  . MET B 1 41  ? 120.392 20.595 42.842  1.00 66.23  ? 42   MET B CB  1 
ATOM   4495 C CG  . MET B 1 41  ? 119.652 21.627 43.663  1.00 70.70  ? 42   MET B CG  1 
ATOM   4496 S SD  . MET B 1 41  ? 120.418 23.251 43.600  1.00 82.87  ? 42   MET B SD  1 
ATOM   4497 C CE  . MET B 1 41  ? 121.960 22.934 44.452  1.00 82.34  ? 42   MET B CE  1 
ATOM   4498 N N   . GLY B 1 42  ? 121.711 19.138 40.465  1.00 55.40  ? 43   GLY B N   1 
ATOM   4499 C CA  . GLY B 1 42  ? 122.386 17.936 40.038  1.00 52.77  ? 43   GLY B CA  1 
ATOM   4500 C C   . GLY B 1 42  ? 121.662 17.211 38.923  1.00 55.79  ? 43   GLY B C   1 
ATOM   4501 O O   . GLY B 1 42  ? 121.514 17.723 37.809  1.00 52.23  ? 43   GLY B O   1 
ATOM   4502 N N   . PRO B 1 43  ? 121.182 15.998 39.213  1.00 57.59  ? 44   PRO B N   1 
ATOM   4503 C CA  . PRO B 1 43  ? 120.458 15.230 38.189  1.00 55.83  ? 44   PRO B CA  1 
ATOM   4504 C C   . PRO B 1 43  ? 119.134 15.849 37.787  1.00 55.59  ? 44   PRO B C   1 
ATOM   4505 O O   . PRO B 1 43  ? 118.573 15.447 36.759  1.00 56.03  ? 44   PRO B O   1 
ATOM   4506 C CB  . PRO B 1 43  ? 120.251 13.864 38.857  1.00 58.00  ? 44   PRO B CB  1 
ATOM   4507 C CG  . PRO B 1 43  ? 120.279 14.156 40.316  1.00 56.88  ? 44   PRO B CG  1 
ATOM   4508 C CD  . PRO B 1 43  ? 121.265 15.276 40.494  1.00 55.74  ? 44   PRO B CD  1 
ATOM   4509 N N   . ARG B 1 44  ? 118.619 16.809 38.554  1.00 55.14  ? 45   ARG B N   1 
ATOM   4510 C CA  . ARG B 1 44  ? 117.364 17.470 38.226  1.00 54.38  ? 45   ARG B CA  1 
ATOM   4511 C C   . ARG B 1 44  ? 117.542 18.674 37.308  1.00 51.54  ? 45   ARG B C   1 
ATOM   4512 O O   . ARG B 1 44  ? 116.540 19.223 36.835  1.00 45.03  ? 45   ARG B O   1 
ATOM   4513 C CB  . ARG B 1 44  ? 116.649 17.914 39.503  1.00 54.15  ? 45   ARG B CB  1 
ATOM   4514 C CG  . ARG B 1 44  ? 116.240 16.785 40.435  1.00 67.40  ? 45   ARG B CG  1 
ATOM   4515 C CD  . ARG B 1 44  ? 114.942 17.146 41.131  1.00 78.85  ? 45   ARG B CD  1 
ATOM   4516 N NE  . ARG B 1 44  ? 114.810 16.585 42.474  1.00 89.58  ? 45   ARG B NE  1 
ATOM   4517 C CZ  . ARG B 1 44  ? 114.396 15.349 42.741  1.00 96.00  ? 45   ARG B CZ  1 
ATOM   4518 N NH1 . ARG B 1 44  ? 114.079 14.522 41.752  1.00 99.17  ? 45   ARG B NH1 1 
ATOM   4519 N NH2 . ARG B 1 44  ? 114.298 14.941 43.998  1.00 97.69  ? 45   ARG B NH2 1 
ATOM   4520 N N   . ARG B 1 45  ? 118.778 19.106 37.064  1.00 49.61  ? 46   ARG B N   1 
ATOM   4521 C CA  . ARG B 1 45  ? 119.015 20.199 36.129  1.00 49.50  ? 46   ARG B CA  1 
ATOM   4522 C C   . ARG B 1 45  ? 118.474 19.834 34.750  1.00 45.75  ? 46   ARG B C   1 
ATOM   4523 O O   . ARG B 1 45  ? 118.633 18.701 34.287  1.00 50.31  ? 46   ARG B O   1 
ATOM   4524 C CB  . ARG B 1 45  ? 120.512 20.516 36.057  1.00 47.47  ? 46   ARG B CB  1 
ATOM   4525 C CG  . ARG B 1 45  ? 120.866 21.696 35.158  1.00 50.29  ? 46   ARG B CG  1 
ATOM   4526 C CD  . ARG B 1 45  ? 122.374 21.839 34.986  1.00 49.42  ? 46   ARG B CD  1 
ATOM   4527 N NE  . ARG B 1 45  ? 123.006 22.560 36.088  1.00 44.90  ? 46   ARG B NE  1 
ATOM   4528 C CZ  . ARG B 1 45  ? 124.316 22.759 36.194  1.00 51.25  ? 46   ARG B CZ  1 
ATOM   4529 N NH1 . ARG B 1 45  ? 125.137 22.284 35.266  1.00 55.61  ? 46   ARG B NH1 1 
ATOM   4530 N NH2 . ARG B 1 45  ? 124.808 23.430 37.227  1.00 49.37  ? 46   ARG B NH2 1 
ATOM   4531 N N   . PHE B 1 46  ? 117.797 20.800 34.118  1.00 43.41  ? 47   PHE B N   1 
ATOM   4532 C CA  . PHE B 1 46  ? 117.146 20.666 32.813  1.00 45.83  ? 47   PHE B CA  1 
ATOM   4533 C C   . PHE B 1 46  ? 115.863 19.838 32.875  1.00 48.16  ? 47   PHE B C   1 
ATOM   4534 O O   . PHE B 1 46  ? 115.136 19.750 31.880  1.00 49.46  ? 47   PHE B O   1 
ATOM   4535 C CB  . PHE B 1 46  ? 118.091 20.059 31.768  1.00 42.94  ? 47   PHE B CB  1 
ATOM   4536 C CG  . PHE B 1 46  ? 119.421 20.747 31.670  1.00 42.25  ? 47   PHE B CG  1 
ATOM   4537 C CD1 . PHE B 1 46  ? 119.499 22.098 31.378  1.00 39.68  ? 47   PHE B CD1 1 
ATOM   4538 C CD2 . PHE B 1 46  ? 120.596 20.037 31.855  1.00 43.29  ? 47   PHE B CD2 1 
ATOM   4539 C CE1 . PHE B 1 46  ? 120.724 22.732 31.282  1.00 37.15  ? 47   PHE B CE1 1 
ATOM   4540 C CE2 . PHE B 1 46  ? 121.826 20.665 31.756  1.00 42.60  ? 47   PHE B CE2 1 
ATOM   4541 C CZ  . PHE B 1 46  ? 121.889 22.014 31.469  1.00 39.71  ? 47   PHE B CZ  1 
ATOM   4542 N N   . LEU B 1 47  ? 115.566 19.235 34.024  1.00 48.13  ? 48   LEU B N   1 
ATOM   4543 C CA  . LEU B 1 47  ? 114.378 18.402 34.125  1.00 50.87  ? 48   LEU B CA  1 
ATOM   4544 C C   . LEU B 1 47  ? 113.162 19.218 34.547  1.00 50.56  ? 48   LEU B C   1 
ATOM   4545 O O   . LEU B 1 47  ? 113.292 20.271 35.180  1.00 42.24  ? 48   LEU B O   1 
ATOM   4546 C CB  . LEU B 1 47  ? 114.613 17.267 35.119  1.00 51.70  ? 48   LEU B CB  1 
ATOM   4547 C CG  . LEU B 1 47  ? 115.507 16.126 34.633  1.00 53.17  ? 48   LEU B CG  1 
ATOM   4548 C CD1 . LEU B 1 47  ? 115.442 14.953 35.602  1.00 48.70  ? 48   LEU B CD1 1 
ATOM   4549 C CD2 . LEU B 1 47  ? 115.116 15.700 33.224  1.00 52.71  ? 48   LEU B CD2 1 
ATOM   4550 N N   . PRO B 1 48  ? 111.962 18.758 34.192  1.00 47.01  ? 49   PRO B N   1 
ATOM   4551 C CA  . PRO B 1 48  ? 110.757 19.432 34.667  1.00 41.74  ? 49   PRO B CA  1 
ATOM   4552 C C   . PRO B 1 48  ? 110.732 19.475 36.176  1.00 44.76  ? 49   PRO B C   1 
ATOM   4553 O O   . PRO B 1 48  ? 111.319 18.608 36.855  1.00 45.21  ? 49   PRO B O   1 
ATOM   4554 C CB  . PRO B 1 48  ? 109.624 18.559 34.107  1.00 40.75  ? 49   PRO B CB  1 
ATOM   4555 C CG  . PRO B 1 48  ? 110.213 17.927 32.890  1.00 43.51  ? 49   PRO B CG  1 
ATOM   4556 C CD  . PRO B 1 48  ? 111.653 17.675 33.243  1.00 42.72  ? 49   PRO B CD  1 
ATOM   4557 N N   . PRO B 1 49  ? 110.066 20.469 36.761  1.00 42.49  ? 50   PRO B N   1 
ATOM   4558 C CA  . PRO B 1 49  ? 110.077 20.602 38.218  1.00 41.68  ? 50   PRO B CA  1 
ATOM   4559 C C   . PRO B 1 49  ? 109.223 19.535 38.873  1.00 46.66  ? 50   PRO B C   1 
ATOM   4560 O O   . PRO B 1 49  ? 108.228 19.065 38.315  1.00 49.67  ? 50   PRO B O   1 
ATOM   4561 C CB  . PRO B 1 49  ? 109.487 21.995 38.449  1.00 40.01  ? 50   PRO B CB  1 
ATOM   4562 C CG  . PRO B 1 49  ? 108.539 22.161 37.299  1.00 40.46  ? 50   PRO B CG  1 
ATOM   4563 C CD  . PRO B 1 49  ? 109.221 21.495 36.122  1.00 37.72  ? 50   PRO B CD  1 
ATOM   4564 N N   . GLU B 1 50  ? 109.620 19.155 40.064  1.00 51.86  ? 51   GLU B N   1 
ATOM   4565 C CA  . GLU B 1 50  ? 108.745 18.248 40.775  1.00 59.26  ? 51   GLU B CA  1 
ATOM   4566 C C   . GLU B 1 50  ? 108.191 18.917 42.023  1.00 50.80  ? 51   GLU B C   1 
ATOM   4567 O O   . GLU B 1 50  ? 108.865 19.745 42.644  1.00 49.38  ? 51   GLU B O   1 
ATOM   4568 C CB  . GLU B 1 50  ? 109.464 16.954 41.162  1.00 69.61  ? 51   GLU B CB  1 
ATOM   4569 C CG  . GLU B 1 50  ? 110.319 16.401 40.054  1.00 91.63  ? 51   GLU B CG  1 
ATOM   4570 C CD  . GLU B 1 50  ? 111.247 15.322 40.533  1.00 107.60 ? 51   GLU B CD  1 
ATOM   4571 O OE1 . GLU B 1 50  ? 112.428 15.634 40.731  1.00 112.85 ? 51   GLU B OE1 1 
ATOM   4572 O OE2 . GLU B 1 50  ? 110.805 14.167 40.707  1.00 112.63 ? 51   GLU B OE2 1 
ATOM   4573 N N   . PRO B 1 51  ? 106.956 18.591 42.397  1.00 46.82  ? 52   PRO B N   1 
ATOM   4574 C CA  . PRO B 1 51  ? 106.331 19.256 43.544  1.00 46.02  ? 52   PRO B CA  1 
ATOM   4575 C C   . PRO B 1 51  ? 107.159 19.085 44.809  1.00 45.31  ? 52   PRO B C   1 
ATOM   4576 O O   . PRO B 1 51  ? 107.757 18.034 45.048  1.00 47.03  ? 52   PRO B O   1 
ATOM   4577 C CB  . PRO B 1 51  ? 104.973 18.555 43.659  1.00 47.71  ? 52   PRO B CB  1 
ATOM   4578 C CG  . PRO B 1 51  ? 104.711 18.011 42.285  1.00 47.95  ? 52   PRO B CG  1 
ATOM   4579 C CD  . PRO B 1 51  ? 106.055 17.617 41.759  1.00 46.58  ? 52   PRO B CD  1 
ATOM   4580 N N   . LYS B 1 52  ? 107.202 20.146 45.608  1.00 46.08  ? 53   LYS B N   1 
ATOM   4581 C CA  . LYS B 1 52  ? 107.931 20.111 46.866  1.00 49.35  ? 53   LYS B CA  1 
ATOM   4582 C C   . LYS B 1 52  ? 107.352 19.042 47.783  1.00 53.12  ? 53   LYS B C   1 
ATOM   4583 O O   . LYS B 1 52  ? 106.145 19.011 48.038  1.00 54.52  ? 53   LYS B O   1 
ATOM   4584 C CB  . LYS B 1 52  ? 107.871 21.481 47.542  1.00 48.94  ? 53   LYS B CB  1 
ATOM   4585 C CG  . LYS B 1 52  ? 108.481 21.526 48.935  1.00 48.72  ? 53   LYS B CG  1 
ATOM   4586 C CD  . LYS B 1 52  ? 109.996 21.411 48.889  1.00 51.65  ? 53   LYS B CD  1 
ATOM   4587 C CE  . LYS B 1 52  ? 110.589 21.505 50.289  1.00 51.96  ? 53   LYS B CE  1 
ATOM   4588 N NZ  . LYS B 1 52  ? 112.077 21.466 50.280  1.00 52.81  ? 53   LYS B NZ  1 
ATOM   4589 N N   . GLN B 1 53  ? 108.216 18.151 48.261  1.00 54.70  ? 54   GLN B N   1 
ATOM   4590 C CA  . GLN B 1 53  ? 107.774 17.118 49.180  1.00 60.76  ? 54   GLN B CA  1 
ATOM   4591 C C   . GLN B 1 53  ? 107.424 17.732 50.534  1.00 58.50  ? 54   GLN B C   1 
ATOM   4592 O O   . GLN B 1 53  ? 108.044 18.710 50.962  1.00 57.58  ? 54   GLN B O   1 
ATOM   4593 C CB  . GLN B 1 53  ? 108.852 16.049 49.348  1.00 64.18  ? 54   GLN B CB  1 
ATOM   4594 C CG  . GLN B 1 53  ? 108.963 15.095 48.166  1.00 67.54  ? 54   GLN B CG  1 
ATOM   4595 C CD  . GLN B 1 53  ? 107.715 14.251 47.978  1.00 68.77  ? 54   GLN B CD  1 
ATOM   4596 O OE1 . GLN B 1 53  ? 107.068 14.303 46.932  1.00 64.14  ? 54   GLN B OE1 1 
ATOM   4597 N NE2 . GLN B 1 53  ? 107.376 13.461 48.991  1.00 73.30  ? 54   GLN B NE2 1 
ATOM   4598 N N   . PRO B 1 54  ? 106.419 17.184 51.221  1.00 55.38  ? 55   PRO B N   1 
ATOM   4599 C CA  . PRO B 1 54  ? 105.992 17.763 52.503  1.00 54.90  ? 55   PRO B CA  1 
ATOM   4600 C C   . PRO B 1 54  ? 107.125 17.834 53.515  1.00 54.78  ? 55   PRO B C   1 
ATOM   4601 O O   . PRO B 1 54  ? 108.028 16.995 53.539  1.00 60.81  ? 55   PRO B O   1 
ATOM   4602 C CB  . PRO B 1 54  ? 104.890 16.806 52.973  1.00 55.50  ? 55   PRO B CB  1 
ATOM   4603 C CG  . PRO B 1 54  ? 104.366 16.200 51.717  1.00 60.40  ? 55   PRO B CG  1 
ATOM   4604 C CD  . PRO B 1 54  ? 105.548 16.073 50.799  1.00 57.15  ? 55   PRO B CD  1 
ATOM   4605 N N   . TRP B 1 55  ? 107.061 18.856 54.364  1.00 48.53  ? 56   TRP B N   1 
ATOM   4606 C CA  . TRP B 1 55  ? 108.077 19.112 55.371  1.00 50.82  ? 56   TRP B CA  1 
ATOM   4607 C C   . TRP B 1 55  ? 107.450 19.124 56.758  1.00 56.69  ? 56   TRP B C   1 
ATOM   4608 O O   . TRP B 1 55  ? 106.260 19.413 56.920  1.00 55.30  ? 56   TRP B O   1 
ATOM   4609 C CB  . TRP B 1 55  ? 108.780 20.452 55.121  1.00 50.32  ? 56   TRP B CB  1 
ATOM   4610 C CG  . TRP B 1 55  ? 107.851 21.627 55.218  1.00 53.91  ? 56   TRP B CG  1 
ATOM   4611 C CD1 . TRP B 1 55  ? 107.515 22.317 56.349  1.00 53.73  ? 56   TRP B CD1 1 
ATOM   4612 C CD2 . TRP B 1 55  ? 107.131 22.245 54.144  1.00 51.80  ? 56   TRP B CD2 1 
ATOM   4613 N NE1 . TRP B 1 55  ? 106.632 23.324 56.045  1.00 53.57  ? 56   TRP B NE1 1 
ATOM   4614 C CE2 . TRP B 1 55  ? 106.381 23.303 54.698  1.00 49.13  ? 56   TRP B CE2 1 
ATOM   4615 C CE3 . TRP B 1 55  ? 107.047 22.006 52.768  1.00 51.34  ? 56   TRP B CE3 1 
ATOM   4616 C CZ2 . TRP B 1 55  ? 105.560 24.121 53.925  1.00 48.92  ? 56   TRP B CZ2 1 
ATOM   4617 C CZ3 . TRP B 1 55  ? 106.229 22.821 52.001  1.00 50.09  ? 56   TRP B CZ3 1 
ATOM   4618 C CH2 . TRP B 1 55  ? 105.497 23.865 52.582  1.00 51.15  ? 56   TRP B CH2 1 
ATOM   4619 N N   . SER B 1 56  ? 108.262 18.808 57.758  1.00 58.84  ? 57   SER B N   1 
ATOM   4620 C CA  . SER B 1 56  ? 107.874 18.976 59.148  1.00 62.56  ? 57   SER B CA  1 
ATOM   4621 C C   . SER B 1 56  ? 108.420 20.300 59.675  1.00 62.86  ? 57   SER B C   1 
ATOM   4622 O O   . SER B 1 56  ? 109.283 20.936 59.065  1.00 64.81  ? 57   SER B O   1 
ATOM   4623 C CB  . SER B 1 56  ? 108.371 17.803 59.999  1.00 65.44  ? 57   SER B CB  1 
ATOM   4624 O OG  . SER B 1 56  ? 109.777 17.668 59.906  1.00 71.77  ? 57   SER B OG  1 
ATOM   4625 N N   . GLY B 1 57  ? 107.894 20.717 60.822  1.00 59.49  ? 58   GLY B N   1 
ATOM   4626 C CA  . GLY B 1 57  ? 108.265 21.997 61.385  1.00 59.00  ? 58   GLY B CA  1 
ATOM   4627 C C   . GLY B 1 57  ? 107.636 23.153 60.625  1.00 63.16  ? 58   GLY B C   1 
ATOM   4628 O O   . GLY B 1 57  ? 106.683 22.994 59.853  1.00 59.96  ? 58   GLY B O   1 
ATOM   4629 N N   . VAL B 1 58  ? 108.195 24.339 60.843  1.00 61.24  ? 59   VAL B N   1 
ATOM   4630 C CA  . VAL B 1 58  ? 107.664 25.571 60.275  1.00 60.07  ? 59   VAL B CA  1 
ATOM   4631 C C   . VAL B 1 58  ? 108.710 26.166 59.345  1.00 57.48  ? 59   VAL B C   1 
ATOM   4632 O O   . VAL B 1 58  ? 109.817 26.504 59.781  1.00 61.18  ? 59   VAL B O   1 
ATOM   4633 C CB  . VAL B 1 58  ? 107.270 26.579 61.365  1.00 60.72  ? 59   VAL B CB  1 
ATOM   4634 C CG1 . VAL B 1 58  ? 106.578 27.780 60.740  1.00 51.90  ? 59   VAL B CG1 1 
ATOM   4635 C CG2 . VAL B 1 58  ? 106.380 25.915 62.408  1.00 54.58  ? 59   VAL B CG2 1 
ATOM   4636 N N   . VAL B 1 59  ? 108.357 26.297 58.066  1.00 53.41  ? 60   VAL B N   1 
ATOM   4637 C CA  . VAL B 1 59  ? 109.233 26.961 57.110  1.00 49.51  ? 60   VAL B CA  1 
ATOM   4638 C C   . VAL B 1 59  ? 109.262 28.453 57.410  1.00 52.83  ? 60   VAL B C   1 
ATOM   4639 O O   . VAL B 1 59  ? 108.217 29.081 57.630  1.00 56.42  ? 60   VAL B O   1 
ATOM   4640 C CB  . VAL B 1 59  ? 108.770 26.684 55.671  1.00 53.38  ? 60   VAL B CB  1 
ATOM   4641 C CG1 . VAL B 1 59  ? 109.303 27.748 54.716  1.00 55.40  ? 60   VAL B CG1 1 
ATOM   4642 C CG2 . VAL B 1 59  ? 109.223 25.303 55.223  1.00 54.63  ? 60   VAL B CG2 1 
ATOM   4643 N N   . ASP B 1 60  ? 110.463 29.025 57.436  1.00 51.32  ? 61   ASP B N   1 
ATOM   4644 C CA  . ASP B 1 60  ? 110.637 30.460 57.635  1.00 57.07  ? 61   ASP B CA  1 
ATOM   4645 C C   . ASP B 1 60  ? 110.340 31.181 56.326  1.00 55.49  ? 61   ASP B C   1 
ATOM   4646 O O   . ASP B 1 60  ? 111.139 31.131 55.386  1.00 54.57  ? 61   ASP B O   1 
ATOM   4647 C CB  . ASP B 1 60  ? 112.052 30.761 58.118  1.00 74.16  ? 61   ASP B CB  1 
ATOM   4648 C CG  . ASP B 1 60  ? 112.343 32.248 58.182  1.00 87.64  ? 61   ASP B CG  1 
ATOM   4649 O OD1 . ASP B 1 60  ? 111.405 33.030 58.442  1.00 93.33  ? 61   ASP B OD1 1 
ATOM   4650 O OD2 . ASP B 1 60  ? 113.512 32.635 57.977  1.00 92.74  ? 61   ASP B OD2 1 
ATOM   4651 N N   . ALA B 1 61  ? 109.194 31.858 56.264  1.00 54.77  ? 62   ALA B N   1 
ATOM   4652 C CA  . ALA B 1 61  ? 108.806 32.579 55.059  1.00 47.78  ? 62   ALA B CA  1 
ATOM   4653 C C   . ALA B 1 61  ? 108.797 34.085 55.295  1.00 47.38  ? 62   ALA B C   1 
ATOM   4654 O O   . ALA B 1 61  ? 107.818 34.765 54.973  1.00 44.17  ? 62   ALA B O   1 
ATOM   4655 C CB  . ALA B 1 61  ? 107.434 32.109 54.573  1.00 45.76  ? 62   ALA B CB  1 
ATOM   4656 N N   . THR B 1 62  ? 109.884 34.617 55.850  1.00 51.91  ? 63   THR B N   1 
ATOM   4657 C CA  . THR B 1 62  ? 109.978 36.032 56.182  1.00 53.18  ? 63   THR B CA  1 
ATOM   4658 C C   . THR B 1 62  ? 110.925 36.803 55.274  1.00 55.07  ? 63   THR B C   1 
ATOM   4659 O O   . THR B 1 62  ? 111.029 38.026 55.410  1.00 51.07  ? 63   THR B O   1 
ATOM   4660 C CB  . THR B 1 62  ? 110.431 36.206 57.635  1.00 55.38  ? 63   THR B CB  1 
ATOM   4661 O OG1 . THR B 1 62  ? 111.705 35.575 57.811  1.00 55.49  ? 63   THR B OG1 1 
ATOM   4662 C CG2 . THR B 1 62  ? 109.421 35.587 58.598  1.00 55.35  ? 63   THR B CG2 1 
ATOM   4663 N N   . THR B 1 63  ? 111.622 36.129 54.361  1.00 53.41  ? 64   THR B N   1 
ATOM   4664 C CA  . THR B 1 63  ? 112.623 36.774 53.525  1.00 49.96  ? 64   THR B CA  1 
ATOM   4665 C C   . THR B 1 63  ? 112.585 36.170 52.128  1.00 47.64  ? 64   THR B C   1 
ATOM   4666 O O   . THR B 1 63  ? 112.195 35.014 51.948  1.00 51.04  ? 64   THR B O   1 
ATOM   4667 C CB  . THR B 1 63  ? 114.030 36.637 54.140  1.00 54.68  ? 64   THR B CB  1 
ATOM   4668 O OG1 . THR B 1 63  ? 114.960 37.443 53.407  1.00 76.02  ? 64   THR B OG1 1 
ATOM   4669 C CG2 . THR B 1 63  ? 114.496 35.191 54.118  1.00 50.74  ? 64   THR B CG2 1 
ATOM   4670 N N   . PHE B 1 64  ? 112.975 36.971 51.136  1.00 48.49  ? 65   PHE B N   1 
ATOM   4671 C CA  . PHE B 1 64  ? 113.047 36.477 49.767  1.00 45.22  ? 65   PHE B CA  1 
ATOM   4672 C C   . PHE B 1 64  ? 114.113 35.395 49.651  1.00 45.55  ? 65   PHE B C   1 
ATOM   4673 O O   . PHE B 1 64  ? 115.156 35.451 50.309  1.00 46.02  ? 65   PHE B O   1 
ATOM   4674 C CB  . PHE B 1 64  ? 113.362 37.611 48.790  1.00 44.13  ? 65   PHE B CB  1 
ATOM   4675 C CG  . PHE B 1 64  ? 112.184 38.485 48.462  1.00 42.68  ? 65   PHE B CG  1 
ATOM   4676 C CD1 . PHE B 1 64  ? 111.100 37.976 47.769  1.00 39.03  ? 65   PHE B CD1 1 
ATOM   4677 C CD2 . PHE B 1 64  ? 112.176 39.825 48.820  1.00 46.04  ? 65   PHE B CD2 1 
ATOM   4678 C CE1 . PHE B 1 64  ? 110.018 38.779 47.458  1.00 42.73  ? 65   PHE B CE1 1 
ATOM   4679 C CE2 . PHE B 1 64  ? 111.096 40.635 48.510  1.00 38.79  ? 65   PHE B CE2 1 
ATOM   4680 C CZ  . PHE B 1 64  ? 110.016 40.111 47.829  1.00 37.04  ? 65   PHE B CZ  1 
ATOM   4681 N N   . GLN B 1 65  ? 113.850 34.406 48.804  1.00 47.07  ? 66   GLN B N   1 
ATOM   4682 C CA  . GLN B 1 65  ? 114.809 33.339 48.581  1.00 49.37  ? 66   GLN B CA  1 
ATOM   4683 C C   . GLN B 1 65  ? 115.750 33.700 47.431  1.00 46.21  ? 66   GLN B C   1 
ATOM   4684 O O   . GLN B 1 65  ? 115.689 34.791 46.859  1.00 44.18  ? 66   GLN B O   1 
ATOM   4685 C CB  . GLN B 1 65  ? 114.089 32.018 48.320  1.00 44.44  ? 66   GLN B CB  1 
ATOM   4686 C CG  . GLN B 1 65  ? 113.919 31.158 49.566  1.00 44.68  ? 66   GLN B CG  1 
ATOM   4687 C CD  . GLN B 1 65  ? 115.234 30.573 50.056  1.00 57.14  ? 66   GLN B CD  1 
ATOM   4688 O OE1 . GLN B 1 65  ? 116.264 30.678 49.389  1.00 63.55  ? 66   GLN B OE1 1 
ATOM   4689 N NE2 . GLN B 1 65  ? 115.202 29.951 51.228  1.00 61.98  ? 66   GLN B NE2 1 
ATOM   4690 N N   . SER B 1 66  ? 116.631 32.762 47.092  1.00 40.78  ? 67   SER B N   1 
ATOM   4691 C CA  . SER B 1 66  ? 117.680 33.010 46.116  1.00 43.46  ? 67   SER B CA  1 
ATOM   4692 C C   . SER B 1 66  ? 117.102 33.279 44.727  1.00 41.39  ? 67   SER B C   1 
ATOM   4693 O O   . SER B 1 66  ? 115.988 32.867 44.388  1.00 43.23  ? 67   SER B O   1 
ATOM   4694 C CB  . SER B 1 66  ? 118.636 31.821 46.053  1.00 44.84  ? 67   SER B CB  1 
ATOM   4695 O OG  . SER B 1 66  ? 119.156 31.521 47.333  1.00 48.23  ? 67   SER B OG  1 
ATOM   4696 N N   . VAL B 1 67  ? 117.885 33.984 43.923  1.00 42.77  ? 68   VAL B N   1 
ATOM   4697 C CA  . VAL B 1 67  ? 117.569 34.262 42.527  1.00 38.91  ? 68   VAL B CA  1 
ATOM   4698 C C   . VAL B 1 67  ? 118.101 33.122 41.670  1.00 35.76  ? 68   VAL B C   1 
ATOM   4699 O O   . VAL B 1 67  ? 119.223 32.649 41.878  1.00 41.61  ? 68   VAL B O   1 
ATOM   4700 C CB  . VAL B 1 67  ? 118.174 35.613 42.099  1.00 42.94  ? 68   VAL B CB  1 
ATOM   4701 C CG1 . VAL B 1 67  ? 117.975 35.854 40.609  1.00 45.02  ? 68   VAL B CG1 1 
ATOM   4702 C CG2 . VAL B 1 67  ? 117.576 36.746 42.917  1.00 42.05  ? 68   VAL B CG2 1 
ATOM   4703 N N   . CYS B 1 68  ? 117.297 32.670 40.708  1.00 40.07  ? 69   CYS B N   1 
ATOM   4704 C CA  . CYS B 1 68  ? 117.756 31.640 39.782  1.00 43.61  ? 69   CYS B CA  1 
ATOM   4705 C C   . CYS B 1 68  ? 118.995 32.116 39.036  1.00 44.19  ? 69   CYS B C   1 
ATOM   4706 O O   . CYS B 1 68  ? 119.094 33.284 38.648  1.00 45.57  ? 69   CYS B O   1 
ATOM   4707 C CB  . CYS B 1 68  ? 116.651 31.275 38.789  1.00 41.51  ? 69   CYS B CB  1 
ATOM   4708 S SG  . CYS B 1 68  ? 115.166 30.563 39.538  1.00 42.69  ? 69   CYS B SG  1 
ATOM   4709 N N   . TYR B 1 69  ? 119.944 31.198 38.847  1.00 37.00  ? 70   TYR B N   1 
ATOM   4710 C CA  . TYR B 1 69  ? 121.212 31.521 38.203  1.00 45.08  ? 70   TYR B CA  1 
ATOM   4711 C C   . TYR B 1 69  ? 120.993 32.232 36.875  1.00 45.27  ? 70   TYR B C   1 
ATOM   4712 O O   . TYR B 1 69  ? 120.227 31.767 36.025  1.00 44.12  ? 70   TYR B O   1 
ATOM   4713 C CB  . TYR B 1 69  ? 122.023 30.246 37.982  1.00 53.15  ? 70   TYR B CB  1 
ATOM   4714 C CG  . TYR B 1 69  ? 123.251 30.159 38.845  1.00 55.29  ? 70   TYR B CG  1 
ATOM   4715 C CD1 . TYR B 1 69  ? 124.430 30.792 38.473  1.00 55.32  ? 70   TYR B CD1 1 
ATOM   4716 C CD2 . TYR B 1 69  ? 123.235 29.443 40.034  1.00 57.38  ? 70   TYR B CD2 1 
ATOM   4717 C CE1 . TYR B 1 69  ? 125.562 30.713 39.267  1.00 63.42  ? 70   TYR B CE1 1 
ATOM   4718 C CE2 . TYR B 1 69  ? 124.357 29.357 40.829  1.00 58.92  ? 70   TYR B CE2 1 
ATOM   4719 C CZ  . TYR B 1 69  ? 125.517 29.993 40.443  1.00 68.43  ? 70   TYR B CZ  1 
ATOM   4720 O OH  . TYR B 1 69  ? 126.635 29.905 41.240  1.00 85.59  ? 70   TYR B OH  1 
ATOM   4721 N N   . GLN B 1 70  ? 121.675 33.362 36.700  1.00 44.17  ? 71   GLN B N   1 
ATOM   4722 C CA  . GLN B 1 70  ? 121.458 34.196 35.528  1.00 44.92  ? 71   GLN B CA  1 
ATOM   4723 C C   . GLN B 1 70  ? 122.627 35.152 35.356  1.00 49.61  ? 71   GLN B C   1 
ATOM   4724 O O   . GLN B 1 70  ? 123.385 35.419 36.292  1.00 47.88  ? 71   GLN B O   1 
ATOM   4725 C CB  . GLN B 1 70  ? 120.147 34.981 35.640  1.00 42.62  ? 71   GLN B CB  1 
ATOM   4726 C CG  . GLN B 1 70  ? 120.111 35.938 36.827  1.00 39.71  ? 71   GLN B CG  1 
ATOM   4727 C CD  . GLN B 1 70  ? 118.740 36.543 37.040  1.00 38.24  ? 71   GLN B CD  1 
ATOM   4728 O OE1 . GLN B 1 70  ? 118.545 37.747 36.871  1.00 41.95  ? 71   GLN B OE1 1 
ATOM   4729 N NE2 . GLN B 1 70  ? 117.778 35.708 37.412  1.00 37.60  ? 71   GLN B NE2 1 
ATOM   4730 N N   . TYR B 1 71  ? 122.748 35.669 34.137  1.00 46.25  ? 72   TYR B N   1 
ATOM   4731 C CA  . TYR B 1 71  ? 123.729 36.699 33.832  1.00 45.73  ? 72   TYR B CA  1 
ATOM   4732 C C   . TYR B 1 71  ? 123.416 37.978 34.600  1.00 48.51  ? 72   TYR B C   1 
ATOM   4733 O O   . TYR B 1 71  ? 122.257 38.294 34.880  1.00 51.58  ? 72   TYR B O   1 
ATOM   4734 C CB  . TYR B 1 71  ? 123.735 36.966 32.325  1.00 47.93  ? 72   TYR B CB  1 
ATOM   4735 C CG  . TYR B 1 71  ? 124.504 38.184 31.856  1.00 52.91  ? 72   TYR B CG  1 
ATOM   4736 C CD1 . TYR B 1 71  ? 123.865 39.408 31.682  1.00 53.66  ? 72   TYR B CD1 1 
ATOM   4737 C CD2 . TYR B 1 71  ? 125.856 38.104 31.547  1.00 51.49  ? 72   TYR B CD2 1 
ATOM   4738 C CE1 . TYR B 1 71  ? 124.553 40.517 31.224  1.00 52.96  ? 72   TYR B CE1 1 
ATOM   4739 C CE2 . TYR B 1 71  ? 126.555 39.213 31.095  1.00 54.06  ? 72   TYR B CE2 1 
ATOM   4740 C CZ  . TYR B 1 71  ? 125.898 40.417 30.938  1.00 56.81  ? 72   TYR B CZ  1 
ATOM   4741 O OH  . TYR B 1 71  ? 126.586 41.525 30.493  1.00 61.43  ? 72   TYR B OH  1 
ATOM   4742 N N   . VAL B 1 72  ? 124.469 38.716 34.937  1.00 47.41  ? 73   VAL B N   1 
ATOM   4743 C CA  . VAL B 1 72  ? 124.362 40.011 35.599  1.00 52.51  ? 73   VAL B CA  1 
ATOM   4744 C C   . VAL B 1 72  ? 124.810 41.083 34.614  1.00 54.45  ? 73   VAL B C   1 
ATOM   4745 O O   . VAL B 1 72  ? 125.906 40.994 34.048  1.00 53.91  ? 73   VAL B O   1 
ATOM   4746 C CB  . VAL B 1 72  ? 125.201 40.052 36.888  1.00 53.94  ? 73   VAL B CB  1 
ATOM   4747 C CG1 . VAL B 1 72  ? 125.083 41.410 37.562  1.00 50.39  ? 73   VAL B CG1 1 
ATOM   4748 C CG2 . VAL B 1 72  ? 124.766 38.942 37.834  1.00 49.41  ? 73   VAL B CG2 1 
ATOM   4749 N N   . ASP B 1 73  ? 123.962 42.090 34.406  1.00 51.55  ? 74   ASP B N   1 
ATOM   4750 C CA  . ASP B 1 73  ? 124.267 43.143 33.446  1.00 52.64  ? 74   ASP B CA  1 
ATOM   4751 C C   . ASP B 1 73  ? 125.448 43.980 33.925  1.00 54.82  ? 74   ASP B C   1 
ATOM   4752 O O   . ASP B 1 73  ? 125.484 44.422 35.077  1.00 58.90  ? 74   ASP B O   1 
ATOM   4753 C CB  . ASP B 1 73  ? 123.045 44.030 33.228  1.00 60.01  ? 74   ASP B CB  1 
ATOM   4754 C CG  . ASP B 1 73  ? 123.148 44.858 31.966  1.00 60.68  ? 74   ASP B CG  1 
ATOM   4755 O OD1 . ASP B 1 73  ? 123.583 46.026 32.047  1.00 59.05  ? 74   ASP B OD1 1 
ATOM   4756 O OD2 . ASP B 1 73  ? 122.799 44.334 30.890  1.00 72.14  ? 74   ASP B OD2 1 
ATOM   4757 N N   . THR B 1 74  ? 126.413 44.202 33.033  1.00 54.50  ? 75   THR B N   1 
ATOM   4758 C CA  . THR B 1 74  ? 127.626 44.940 33.361  1.00 60.76  ? 75   THR B CA  1 
ATOM   4759 C C   . THR B 1 74  ? 127.859 46.133 32.440  1.00 57.50  ? 75   THR B C   1 
ATOM   4760 O O   . THR B 1 74  ? 128.959 46.701 32.447  1.00 57.84  ? 75   THR B O   1 
ATOM   4761 C CB  . THR B 1 74  ? 128.839 44.005 33.318  1.00 66.75  ? 75   THR B CB  1 
ATOM   4762 O OG1 . THR B 1 74  ? 128.868 43.316 32.061  1.00 73.07  ? 75   THR B OG1 1 
ATOM   4763 C CG2 . THR B 1 74  ? 128.761 42.983 34.443  1.00 64.81  ? 75   THR B CG2 1 
ATOM   4764 N N   . LEU B 1 75  ? 126.854 46.533 31.657  1.00 56.04  ? 76   LEU B N   1 
ATOM   4765 C CA  . LEU B 1 75  ? 127.040 47.619 30.696  1.00 56.94  ? 76   LEU B CA  1 
ATOM   4766 C C   . LEU B 1 75  ? 127.324 48.942 31.399  1.00 56.79  ? 76   LEU B C   1 
ATOM   4767 O O   . LEU B 1 75  ? 128.257 49.665 31.030  1.00 55.67  ? 76   LEU B O   1 
ATOM   4768 C CB  . LEU B 1 75  ? 125.810 47.746 29.794  1.00 61.03  ? 76   LEU B CB  1 
ATOM   4769 C CG  . LEU B 1 75  ? 125.918 48.817 28.703  1.00 63.02  ? 76   LEU B CG  1 
ATOM   4770 C CD1 . LEU B 1 75  ? 126.940 48.421 27.644  1.00 57.45  ? 76   LEU B CD1 1 
ATOM   4771 C CD2 . LEU B 1 75  ? 124.559 49.106 28.065  1.00 61.87  ? 76   LEU B CD2 1 
ATOM   4772 N N   . TYR B 1 76  ? 126.525 49.278 32.410  1.00 54.38  ? 77   TYR B N   1 
ATOM   4773 C CA  . TYR B 1 76  ? 126.702 50.500 33.194  1.00 58.24  ? 77   TYR B CA  1 
ATOM   4774 C C   . TYR B 1 76  ? 126.757 50.107 34.664  1.00 61.03  ? 77   TYR B C   1 
ATOM   4775 O O   . TYR B 1 76  ? 125.747 50.177 35.376  1.00 62.74  ? 77   TYR B O   1 
ATOM   4776 C CB  . TYR B 1 76  ? 125.575 51.501 32.931  1.00 56.88  ? 77   TYR B CB  1 
ATOM   4777 C CG  . TYR B 1 76  ? 125.437 51.958 31.495  1.00 59.73  ? 77   TYR B CG  1 
ATOM   4778 C CD1 . TYR B 1 76  ? 126.469 52.626 30.852  1.00 62.28  ? 77   TYR B CD1 1 
ATOM   4779 C CD2 . TYR B 1 76  ? 124.260 51.737 30.789  1.00 60.02  ? 77   TYR B CD2 1 
ATOM   4780 C CE1 . TYR B 1 76  ? 126.338 53.053 29.539  1.00 66.02  ? 77   TYR B CE1 1 
ATOM   4781 C CE2 . TYR B 1 76  ? 124.119 52.162 29.479  1.00 61.18  ? 77   TYR B CE2 1 
ATOM   4782 C CZ  . TYR B 1 76  ? 125.160 52.816 28.858  1.00 64.31  ? 77   TYR B CZ  1 
ATOM   4783 O OH  . TYR B 1 76  ? 125.022 53.237 27.554  1.00 63.23  ? 77   TYR B OH  1 
ATOM   4784 N N   . PRO B 1 77  ? 127.922 49.684 35.152  1.00 61.36  ? 78   PRO B N   1 
ATOM   4785 C CA  . PRO B 1 77  ? 128.018 49.222 36.545  1.00 60.65  ? 78   PRO B CA  1 
ATOM   4786 C C   . PRO B 1 77  ? 127.654 50.326 37.527  1.00 55.02  ? 78   PRO B C   1 
ATOM   4787 O O   . PRO B 1 77  ? 128.154 51.449 37.440  1.00 56.19  ? 78   PRO B O   1 
ATOM   4788 C CB  . PRO B 1 77  ? 129.490 48.809 36.682  1.00 63.58  ? 78   PRO B CB  1 
ATOM   4789 C CG  . PRO B 1 77  ? 129.962 48.579 35.279  1.00 66.20  ? 78   PRO B CG  1 
ATOM   4790 C CD  . PRO B 1 77  ? 129.202 49.557 34.434  1.00 62.05  ? 78   PRO B CD  1 
ATOM   4791 N N   . GLY B 1 78  ? 126.774 49.994 38.469  1.00 57.51  ? 79   GLY B N   1 
ATOM   4792 C CA  . GLY B 1 78  ? 126.335 50.941 39.471  1.00 60.24  ? 79   GLY B CA  1 
ATOM   4793 C C   . GLY B 1 78  ? 125.262 51.907 39.020  1.00 66.20  ? 79   GLY B C   1 
ATOM   4794 O O   . GLY B 1 78  ? 124.812 52.728 39.829  1.00 63.53  ? 79   GLY B O   1 
ATOM   4795 N N   . PHE B 1 79  ? 124.838 51.840 37.761  1.00 64.81  ? 80   PHE B N   1 
ATOM   4796 C CA  . PHE B 1 79  ? 123.805 52.731 37.253  1.00 55.15  ? 80   PHE B CA  1 
ATOM   4797 C C   . PHE B 1 79  ? 122.436 52.225 37.687  1.00 49.65  ? 80   PHE B C   1 
ATOM   4798 O O   . PHE B 1 79  ? 122.117 51.043 37.519  1.00 54.93  ? 80   PHE B O   1 
ATOM   4799 C CB  . PHE B 1 79  ? 123.903 52.825 35.729  1.00 56.61  ? 80   PHE B CB  1 
ATOM   4800 C CG  . PHE B 1 79  ? 122.806 53.628 35.083  1.00 55.42  ? 80   PHE B CG  1 
ATOM   4801 C CD1 . PHE B 1 79  ? 122.606 54.958 35.416  1.00 56.64  ? 80   PHE B CD1 1 
ATOM   4802 C CD2 . PHE B 1 79  ? 121.997 53.056 34.113  1.00 54.57  ? 80   PHE B CD2 1 
ATOM   4803 C CE1 . PHE B 1 79  ? 121.600 55.697 34.810  1.00 57.74  ? 80   PHE B CE1 1 
ATOM   4804 C CE2 . PHE B 1 79  ? 120.995 53.789 33.501  1.00 52.93  ? 80   PHE B CE2 1 
ATOM   4805 C CZ  . PHE B 1 79  ? 120.794 55.110 33.850  1.00 55.03  ? 80   PHE B CZ  1 
ATOM   4806 N N   . GLU B 1 80  ? 121.628 53.124 38.252  1.00 46.92  ? 81   GLU B N   1 
ATOM   4807 C CA  . GLU B 1 80  ? 120.328 52.723 38.785  1.00 50.33  ? 81   GLU B CA  1 
ATOM   4808 C C   . GLU B 1 80  ? 119.438 52.122 37.702  1.00 46.77  ? 81   GLU B C   1 
ATOM   4809 O O   . GLU B 1 80  ? 118.682 51.179 37.965  1.00 46.01  ? 81   GLU B O   1 
ATOM   4810 C CB  . GLU B 1 80  ? 119.643 53.924 39.435  1.00 66.08  ? 81   GLU B CB  1 
ATOM   4811 C CG  . GLU B 1 80  ? 118.245 53.641 39.959  1.00 81.58  ? 81   GLU B CG  1 
ATOM   4812 C CD  . GLU B 1 80  ? 117.301 54.805 39.734  1.00 96.63  ? 81   GLU B CD  1 
ATOM   4813 O OE1 . GLU B 1 80  ? 116.560 54.779 38.730  1.00 104.18 ? 81   GLU B OE1 1 
ATOM   4814 O OE2 . GLU B 1 80  ? 117.305 55.748 40.554  1.00 96.05  ? 81   GLU B OE2 1 
ATOM   4815 N N   . GLY B 1 81  ? 119.520 52.648 36.477  1.00 47.86  ? 82   GLY B N   1 
ATOM   4816 C CA  . GLY B 1 81  ? 118.648 52.172 35.414  1.00 46.85  ? 82   GLY B CA  1 
ATOM   4817 C C   . GLY B 1 81  ? 118.864 50.714 35.062  1.00 43.77  ? 82   GLY B C   1 
ATOM   4818 O O   . GLY B 1 81  ? 117.934 50.033 34.622  1.00 44.66  ? 82   GLY B O   1 
ATOM   4819 N N   . THR B 1 82  ? 120.082 50.211 35.252  1.00 42.61  ? 83   THR B N   1 
ATOM   4820 C CA  . THR B 1 82  ? 120.356 48.801 35.013  1.00 45.18  ? 83   THR B CA  1 
ATOM   4821 C C   . THR B 1 82  ? 120.387 47.967 36.287  1.00 49.92  ? 83   THR B C   1 
ATOM   4822 O O   . THR B 1 82  ? 119.947 46.812 36.263  1.00 47.93  ? 83   THR B O   1 
ATOM   4823 C CB  . THR B 1 82  ? 121.684 48.636 34.267  1.00 47.66  ? 83   THR B CB  1 
ATOM   4824 O OG1 . THR B 1 82  ? 122.716 49.343 34.963  1.00 52.11  ? 83   THR B OG1 1 
ATOM   4825 C CG2 . THR B 1 82  ? 121.572 49.180 32.843  1.00 51.84  ? 83   THR B CG2 1 
ATOM   4826 N N   . GLU B 1 83  ? 120.879 48.515 37.403  1.00 45.07  ? 84   GLU B N   1 
ATOM   4827 C CA  . GLU B 1 83  ? 120.976 47.724 38.626  1.00 47.07  ? 84   GLU B CA  1 
ATOM   4828 C C   . GLU B 1 83  ? 119.611 47.351 39.196  1.00 45.26  ? 84   GLU B C   1 
ATOM   4829 O O   . GLU B 1 83  ? 119.506 46.340 39.898  1.00 51.27  ? 84   GLU B O   1 
ATOM   4830 C CB  . GLU B 1 83  ? 121.795 48.467 39.688  1.00 45.08  ? 84   GLU B CB  1 
ATOM   4831 C CG  . GLU B 1 83  ? 123.244 48.771 39.295  1.00 53.66  ? 84   GLU B CG  1 
ATOM   4832 C CD  . GLU B 1 83  ? 124.117 47.532 39.132  1.00 55.62  ? 84   GLU B CD  1 
ATOM   4833 O OE1 . GLU B 1 83  ? 125.285 47.687 38.712  1.00 59.54  ? 84   GLU B OE1 1 
ATOM   4834 O OE2 . GLU B 1 83  ? 123.649 46.409 39.422  1.00 54.22  ? 84   GLU B OE2 1 
ATOM   4835 N N   . MET B 1 84  ? 118.563 48.124 38.900  1.00 45.34  ? 85   MET B N   1 
ATOM   4836 C CA  . MET B 1 84  ? 117.227 47.785 39.383  1.00 42.00  ? 85   MET B CA  1 
ATOM   4837 C C   . MET B 1 84  ? 116.711 46.467 38.815  1.00 46.61  ? 85   MET B C   1 
ATOM   4838 O O   . MET B 1 84  ? 115.745 45.916 39.354  1.00 44.07  ? 85   MET B O   1 
ATOM   4839 C CB  . MET B 1 84  ? 116.241 48.903 39.042  1.00 44.25  ? 85   MET B CB  1 
ATOM   4840 C CG  . MET B 1 84  ? 116.064 49.128 37.540  1.00 45.73  ? 85   MET B CG  1 
ATOM   4841 S SD  . MET B 1 84  ? 114.966 50.512 37.166  1.00 47.40  ? 85   MET B SD  1 
ATOM   4842 C CE  . MET B 1 84  ? 113.390 49.855 37.711  1.00 40.82  ? 85   MET B CE  1 
ATOM   4843 N N   . TRP B 1 85  ? 117.315 45.957 37.739  1.00 51.04  ? 86   TRP B N   1 
ATOM   4844 C CA  . TRP B 1 85  ? 116.913 44.682 37.158  1.00 45.93  ? 86   TRP B CA  1 
ATOM   4845 C C   . TRP B 1 85  ? 117.855 43.540 37.513  1.00 41.73  ? 86   TRP B C   1 
ATOM   4846 O O   . TRP B 1 85  ? 117.516 42.378 37.261  1.00 39.80  ? 86   TRP B O   1 
ATOM   4847 C CB  . TRP B 1 85  ? 116.820 44.792 35.630  1.00 41.75  ? 86   TRP B CB  1 
ATOM   4848 C CG  . TRP B 1 85  ? 116.062 45.985 35.153  1.00 42.93  ? 86   TRP B CG  1 
ATOM   4849 C CD1 . TRP B 1 85  ? 116.573 47.088 34.527  1.00 42.74  ? 86   TRP B CD1 1 
ATOM   4850 C CD2 . TRP B 1 85  ? 114.652 46.207 35.269  1.00 38.89  ? 86   TRP B CD2 1 
ATOM   4851 N NE1 . TRP B 1 85  ? 115.566 47.979 34.241  1.00 41.51  ? 86   TRP B NE1 1 
ATOM   4852 C CE2 . TRP B 1 85  ? 114.377 47.461 34.687  1.00 40.30  ? 86   TRP B CE2 1 
ATOM   4853 C CE3 . TRP B 1 85  ? 113.594 45.465 35.806  1.00 36.42  ? 86   TRP B CE3 1 
ATOM   4854 C CZ2 . TRP B 1 85  ? 113.087 47.990 34.626  1.00 38.61  ? 86   TRP B CZ2 1 
ATOM   4855 C CZ3 . TRP B 1 85  ? 112.313 45.992 35.745  1.00 35.24  ? 86   TRP B CZ3 1 
ATOM   4856 C CH2 . TRP B 1 85  ? 112.071 47.243 35.161  1.00 37.82  ? 86   TRP B CH2 1 
ATOM   4857 N N   . ASN B 1 86  ? 119.020 43.839 38.076  1.00 41.41  ? 87   ASN B N   1 
ATOM   4858 C CA  . ASN B 1 86  ? 119.993 42.818 38.421  1.00 44.35  ? 87   ASN B CA  1 
ATOM   4859 C C   . ASN B 1 86  ? 119.575 42.078 39.689  1.00 48.18  ? 87   ASN B C   1 
ATOM   4860 O O   . ASN B 1 86  ? 118.788 42.592 40.489  1.00 42.29  ? 87   ASN B O   1 
ATOM   4861 C CB  . ASN B 1 86  ? 121.370 43.451 38.599  1.00 42.03  ? 87   ASN B CB  1 
ATOM   4862 C CG  . ASN B 1 86  ? 122.119 43.588 37.284  1.00 48.79  ? 87   ASN B CG  1 
ATOM   4863 O OD1 . ASN B 1 86  ? 121.873 42.838 36.338  1.00 44.14  ? 87   ASN B OD1 1 
ATOM   4864 N ND2 . ASN B 1 86  ? 123.043 44.540 37.222  1.00 49.45  ? 87   ASN B ND2 1 
ATOM   4865 N N   . PRO B 1 87  ? 120.075 40.857 39.885  1.00 46.86  ? 88   PRO B N   1 
ATOM   4866 C CA  . PRO B 1 87  ? 119.713 40.098 41.090  1.00 49.67  ? 88   PRO B CA  1 
ATOM   4867 C C   . PRO B 1 87  ? 120.046 40.873 42.355  1.00 49.19  ? 88   PRO B C   1 
ATOM   4868 O O   . PRO B 1 87  ? 121.143 41.416 42.501  1.00 47.99  ? 88   PRO B O   1 
ATOM   4869 C CB  . PRO B 1 87  ? 120.555 38.823 40.970  1.00 49.16  ? 88   PRO B CB  1 
ATOM   4870 C CG  . PRO B 1 87  ? 120.780 38.667 39.501  1.00 50.44  ? 88   PRO B CG  1 
ATOM   4871 C CD  . PRO B 1 87  ? 120.904 40.062 38.960  1.00 45.05  ? 88   PRO B CD  1 
ATOM   4872 N N   . ASN B 1 88  ? 119.074 40.940 43.265  1.00 49.13  ? 89   ASN B N   1 
ATOM   4873 C CA  . ASN B 1 88  ? 119.273 41.544 44.575  1.00 47.85  ? 89   ASN B CA  1 
ATOM   4874 C C   . ASN B 1 88  ? 119.316 40.499 45.682  1.00 47.56  ? 89   ASN B C   1 
ATOM   4875 O O   . ASN B 1 88  ? 119.202 40.848 46.861  1.00 54.54  ? 89   ASN B O   1 
ATOM   4876 C CB  . ASN B 1 88  ? 118.184 42.581 44.858  1.00 44.30  ? 89   ASN B CB  1 
ATOM   4877 C CG  . ASN B 1 88  ? 116.803 41.966 44.960  1.00 44.12  ? 89   ASN B CG  1 
ATOM   4878 O OD1 . ASN B 1 88  ? 116.569 40.850 44.495  1.00 44.04  ? 89   ASN B OD1 1 
ATOM   4879 N ND2 . ASN B 1 88  ? 115.875 42.700 45.564  1.00 45.01  ? 89   ASN B ND2 1 
ATOM   4880 N N   . ARG B 1 89  ? 119.454 39.225 45.323  1.00 48.34  ? 90   ARG B N   1 
ATOM   4881 C CA  . ARG B 1 89  ? 119.726 38.155 46.270  1.00 50.87  ? 90   ARG B CA  1 
ATOM   4882 C C   . ARG B 1 89  ? 120.778 37.242 45.661  1.00 53.37  ? 90   ARG B C   1 
ATOM   4883 O O   . ARG B 1 89  ? 121.096 37.331 44.471  1.00 55.65  ? 90   ARG B O   1 
ATOM   4884 C CB  . ARG B 1 89  ? 118.463 37.354 46.622  1.00 45.53  ? 90   ARG B CB  1 
ATOM   4885 C CG  . ARG B 1 89  ? 117.398 38.131 47.376  1.00 46.03  ? 90   ARG B CG  1 
ATOM   4886 C CD  . ARG B 1 89  ? 117.864 38.503 48.781  1.00 49.14  ? 90   ARG B CD  1 
ATOM   4887 N NE  . ARG B 1 89  ? 116.804 39.149 49.550  1.00 52.03  ? 90   ARG B NE  1 
ATOM   4888 C CZ  . ARG B 1 89  ? 116.490 40.438 49.454  1.00 57.90  ? 90   ARG B CZ  1 
ATOM   4889 N NH1 . ARG B 1 89  ? 117.154 41.224 48.617  1.00 59.07  ? 90   ARG B NH1 1 
ATOM   4890 N NH2 . ARG B 1 89  ? 115.508 40.942 50.192  1.00 53.88  ? 90   ARG B NH2 1 
ATOM   4891 N N   . GLU B 1 90  ? 121.314 36.354 46.493  1.00 49.49  ? 91   GLU B N   1 
ATOM   4892 C CA  . GLU B 1 90  ? 122.335 35.414 46.051  1.00 53.76  ? 91   GLU B CA  1 
ATOM   4893 C C   . GLU B 1 90  ? 121.800 34.514 44.941  1.00 48.26  ? 91   GLU B C   1 
ATOM   4894 O O   . GLU B 1 90  ? 120.627 34.130 44.937  1.00 46.51  ? 91   GLU B O   1 
ATOM   4895 C CB  . GLU B 1 90  ? 122.809 34.582 47.247  1.00 67.67  ? 91   GLU B CB  1 
ATOM   4896 C CG  . GLU B 1 90  ? 123.556 33.303 46.909  1.00 84.90  ? 91   GLU B CG  1 
ATOM   4897 C CD  . GLU B 1 90  ? 123.596 32.345 48.084  1.00 98.94  ? 91   GLU B CD  1 
ATOM   4898 O OE1 . GLU B 1 90  ? 123.960 32.782 49.193  1.00 99.28  ? 91   GLU B OE1 1 
ATOM   4899 O OE2 . GLU B 1 90  ? 123.254 31.161 47.904  1.00 103.50 ? 91   GLU B OE2 1 
ATOM   4900 N N   . LEU B 1 91  ? 122.667 34.190 43.984  1.00 44.10  ? 92   LEU B N   1 
ATOM   4901 C CA  . LEU B 1 91  ? 122.304 33.292 42.898  1.00 45.09  ? 92   LEU B CA  1 
ATOM   4902 C C   . LEU B 1 91  ? 122.389 31.840 43.349  1.00 40.26  ? 92   LEU B C   1 
ATOM   4903 O O   . LEU B 1 91  ? 123.294 31.457 44.091  1.00 44.44  ? 92   LEU B O   1 
ATOM   4904 C CB  . LEU B 1 91  ? 123.222 33.508 41.696  1.00 47.26  ? 92   LEU B CB  1 
ATOM   4905 C CG  . LEU B 1 91  ? 123.165 34.863 40.992  1.00 51.73  ? 92   LEU B CG  1 
ATOM   4906 C CD1 . LEU B 1 91  ? 124.058 34.848 39.759  1.00 50.59  ? 92   LEU B CD1 1 
ATOM   4907 C CD2 . LEU B 1 91  ? 121.730 35.206 40.614  1.00 49.12  ? 92   LEU B CD2 1 
ATOM   4908 N N   . SER B 1 92  ? 121.452 31.027 42.871  1.00 42.66  ? 93   SER B N   1 
ATOM   4909 C CA  . SER B 1 92  ? 121.447 29.607 43.185  1.00 41.53  ? 93   SER B CA  1 
ATOM   4910 C C   . SER B 1 92  ? 120.498 28.903 42.230  1.00 42.68  ? 93   SER B C   1 
ATOM   4911 O O   . SER B 1 92  ? 119.520 29.495 41.764  1.00 48.94  ? 93   SER B O   1 
ATOM   4912 C CB  . SER B 1 92  ? 121.022 29.354 44.641  1.00 41.14  ? 93   SER B CB  1 
ATOM   4913 O OG  . SER B 1 92  ? 120.827 27.973 44.887  1.00 45.64  ? 93   SER B OG  1 
ATOM   4914 N N   . GLU B 1 93  ? 120.803 27.637 41.934  1.00 45.68  ? 94   GLU B N   1 
ATOM   4915 C CA  . GLU B 1 93  ? 119.837 26.800 41.234  1.00 47.25  ? 94   GLU B CA  1 
ATOM   4916 C C   . GLU B 1 93  ? 118.706 26.366 42.155  1.00 46.25  ? 94   GLU B C   1 
ATOM   4917 O O   . GLU B 1 93  ? 117.628 26.004 41.674  1.00 50.57  ? 94   GLU B O   1 
ATOM   4918 C CB  . GLU B 1 93  ? 120.531 25.582 40.622  1.00 45.18  ? 94   GLU B CB  1 
ATOM   4919 C CG  . GLU B 1 93  ? 121.249 25.886 39.316  1.00 51.78  ? 94   GLU B CG  1 
ATOM   4920 C CD  . GLU B 1 93  ? 122.065 24.714 38.796  1.00 48.94  ? 94   GLU B CD  1 
ATOM   4921 O OE1 . GLU B 1 93  ? 123.131 24.399 39.363  1.00 47.02  ? 94   GLU B OE1 1 
ATOM   4922 O OE2 . GLU B 1 93  ? 121.611 24.083 37.824  1.00 48.55  ? 94   GLU B OE2 1 
ATOM   4923 N N   . ASP B 1 94  ? 118.936 26.400 43.468  1.00 44.02  ? 95   ASP B N   1 
ATOM   4924 C CA  . ASP B 1 94  ? 117.893 26.201 44.472  1.00 42.18  ? 95   ASP B CA  1 
ATOM   4925 C C   . ASP B 1 94  ? 117.120 27.513 44.566  1.00 39.90  ? 95   ASP B C   1 
ATOM   4926 O O   . ASP B 1 94  ? 117.359 28.361 45.429  1.00 46.67  ? 95   ASP B O   1 
ATOM   4927 C CB  . ASP B 1 94  ? 118.517 25.798 45.806  1.00 44.08  ? 95   ASP B CB  1 
ATOM   4928 C CG  . ASP B 1 94  ? 117.493 25.333 46.828  1.00 49.91  ? 95   ASP B CG  1 
ATOM   4929 O OD1 . ASP B 1 94  ? 116.278 25.510 46.602  1.00 46.46  ? 95   ASP B OD1 1 
ATOM   4930 O OD2 . ASP B 1 94  ? 117.915 24.792 47.874  1.00 54.28  ? 95   ASP B OD2 1 
ATOM   4931 N N   . CYS B 1 95  ? 116.184 27.692 43.636  1.00 40.15  ? 96   CYS B N   1 
ATOM   4932 C CA  . CYS B 1 95  ? 115.549 28.991 43.464  1.00 36.97  ? 96   CYS B CA  1 
ATOM   4933 C C   . CYS B 1 95  ? 114.047 28.930 43.244  1.00 34.69  ? 96   CYS B C   1 
ATOM   4934 O O   . CYS B 1 95  ? 113.436 29.982 43.040  1.00 42.05  ? 96   CYS B O   1 
ATOM   4935 C CB  . CYS B 1 95  ? 116.189 29.741 42.285  1.00 37.68  ? 96   CYS B CB  1 
ATOM   4936 S SG  . CYS B 1 95  ? 115.864 29.002 40.649  1.00 42.51  ? 96   CYS B SG  1 
ATOM   4937 N N   . LEU B 1 96  ? 113.430 27.752 43.275  1.00 35.65  ? 97   LEU B N   1 
ATOM   4938 C CA  . LEU B 1 96  ? 112.011 27.637 42.949  1.00 40.68  ? 97   LEU B CA  1 
ATOM   4939 C C   . LEU B 1 96  ? 111.195 27.887 44.215  1.00 45.01  ? 97   LEU B C   1 
ATOM   4940 O O   . LEU B 1 96  ? 110.741 26.974 44.908  1.00 38.00  ? 97   LEU B O   1 
ATOM   4941 C CB  . LEU B 1 96  ? 111.718 26.289 42.306  1.00 35.70  ? 97   LEU B CB  1 
ATOM   4942 C CG  . LEU B 1 96  ? 112.443 26.177 40.957  1.00 42.83  ? 97   LEU B CG  1 
ATOM   4943 C CD1 . LEU B 1 96  ? 112.160 24.848 40.263  1.00 41.14  ? 97   LEU B CD1 1 
ATOM   4944 C CD2 . LEU B 1 96  ? 112.084 27.352 40.051  1.00 35.43  ? 97   LEU B CD2 1 
ATOM   4945 N N   . TYR B 1 97  ? 111.018 29.171 44.513  1.00 42.08  ? 98   TYR B N   1 
ATOM   4946 C CA  . TYR B 1 97  ? 110.194 29.636 45.616  1.00 38.67  ? 98   TYR B CA  1 
ATOM   4947 C C   . TYR B 1 97  ? 109.228 30.686 45.088  1.00 39.29  ? 98   TYR B C   1 
ATOM   4948 O O   . TYR B 1 97  ? 109.469 31.316 44.053  1.00 38.32  ? 98   TYR B O   1 
ATOM   4949 C CB  . TYR B 1 97  ? 111.051 30.214 46.758  1.00 40.25  ? 98   TYR B CB  1 
ATOM   4950 C CG  . TYR B 1 97  ? 112.081 29.239 47.290  1.00 42.84  ? 98   TYR B CG  1 
ATOM   4951 C CD1 . TYR B 1 97  ? 111.844 28.508 48.448  1.00 40.41  ? 98   TYR B CD1 1 
ATOM   4952 C CD2 . TYR B 1 97  ? 113.287 29.040 46.625  1.00 41.70  ? 98   TYR B CD2 1 
ATOM   4953 C CE1 . TYR B 1 97  ? 112.781 27.609 48.933  1.00 39.35  ? 98   TYR B CE1 1 
ATOM   4954 C CE2 . TYR B 1 97  ? 114.225 28.146 47.098  1.00 42.17  ? 98   TYR B CE2 1 
ATOM   4955 C CZ  . TYR B 1 97  ? 113.968 27.431 48.253  1.00 45.50  ? 98   TYR B CZ  1 
ATOM   4956 O OH  . TYR B 1 97  ? 114.903 26.541 48.724  1.00 45.31  ? 98   TYR B OH  1 
ATOM   4957 N N   . LEU B 1 98  ? 108.116 30.860 45.798  1.00 38.06  ? 99   LEU B N   1 
ATOM   4958 C CA  . LEU B 1 98  ? 107.118 31.856 45.439  1.00 40.53  ? 99   LEU B CA  1 
ATOM   4959 C C   . LEU B 1 98  ? 106.759 32.685 46.667  1.00 42.45  ? 99   LEU B C   1 
ATOM   4960 O O   . LEU B 1 98  ? 107.089 32.337 47.804  1.00 41.92  ? 99   LEU B O   1 
ATOM   4961 C CB  . LEU B 1 98  ? 105.864 31.209 44.823  1.00 41.64  ? 99   LEU B CB  1 
ATOM   4962 C CG  . LEU B 1 98  ? 105.123 30.066 45.528  1.00 41.39  ? 99   LEU B CG  1 
ATOM   4963 C CD1 . LEU B 1 98  ? 104.257 30.567 46.677  1.00 33.98  ? 99   LEU B CD1 1 
ATOM   4964 C CD2 . LEU B 1 98  ? 104.275 29.297 44.516  1.00 36.57  ? 99   LEU B CD2 1 
ATOM   4965 N N   . ASN B 1 99  ? 106.059 33.790 46.423  1.00 42.14  ? 100  ASN B N   1 
ATOM   4966 C CA  . ASN B 1 99  ? 105.732 34.756 47.458  1.00 37.58  ? 100  ASN B CA  1 
ATOM   4967 C C   . ASN B 1 99  ? 104.247 35.067 47.423  1.00 44.45  ? 100  ASN B C   1 
ATOM   4968 O O   . ASN B 1 99  ? 103.640 35.113 46.350  1.00 45.31  ? 100  ASN B O   1 
ATOM   4969 C CB  . ASN B 1 99  ? 106.533 36.040 47.274  1.00 35.45  ? 100  ASN B CB  1 
ATOM   4970 C CG  . ASN B 1 99  ? 107.960 35.770 46.861  1.00 41.99  ? 100  ASN B CG  1 
ATOM   4971 O OD1 . ASN B 1 99  ? 108.770 35.302 47.661  1.00 41.19  ? 100  ASN B OD1 1 
ATOM   4972 N ND2 . ASN B 1 99  ? 108.278 36.061 45.603  1.00 38.14  ? 100  ASN B ND2 1 
ATOM   4973 N N   . VAL B 1 100 ? 103.667 35.284 48.601  1.00 37.80  ? 101  VAL B N   1 
ATOM   4974 C CA  . VAL B 1 100 ? 102.254 35.617 48.739  1.00 33.12  ? 101  VAL B CA  1 
ATOM   4975 C C   . VAL B 1 100 ? 102.142 36.864 49.606  1.00 42.09  ? 101  VAL B C   1 
ATOM   4976 O O   . VAL B 1 100 ? 102.600 36.865 50.754  1.00 43.63  ? 101  VAL B O   1 
ATOM   4977 C CB  . VAL B 1 100 ? 101.442 34.467 49.362  1.00 38.70  ? 101  VAL B CB  1 
ATOM   4978 C CG1 . VAL B 1 100 ? 99.960  34.816 49.370  1.00 37.12  ? 101  VAL B CG1 1 
ATOM   4979 C CG2 . VAL B 1 100 ? 101.691 33.161 48.625  1.00 33.98  ? 101  VAL B CG2 1 
ATOM   4980 N N   . TRP B 1 101 ? 101.542 37.916 49.060  1.00 38.97  ? 102  TRP B N   1 
ATOM   4981 C CA  . TRP B 1 101 ? 101.135 39.085 49.822  1.00 35.76  ? 102  TRP B CA  1 
ATOM   4982 C C   . TRP B 1 101 ? 99.623  39.065 49.972  1.00 41.28  ? 102  TRP B C   1 
ATOM   4983 O O   . TRP B 1 101 ? 98.899  38.755 49.019  1.00 40.96  ? 102  TRP B O   1 
ATOM   4984 C CB  . TRP B 1 101 ? 101.547 40.390 49.137  1.00 39.75  ? 102  TRP B CB  1 
ATOM   4985 C CG  . TRP B 1 101 ? 103.013 40.710 49.121  1.00 40.52  ? 102  TRP B CG  1 
ATOM   4986 C CD1 . TRP B 1 101 ? 103.690 41.485 50.016  1.00 46.69  ? 102  TRP B CD1 1 
ATOM   4987 C CD2 . TRP B 1 101 ? 103.971 40.301 48.140  1.00 40.32  ? 102  TRP B CD2 1 
ATOM   4988 N NE1 . TRP B 1 101 ? 105.014 41.571 49.661  1.00 43.60  ? 102  TRP B NE1 1 
ATOM   4989 C CE2 . TRP B 1 101 ? 105.212 40.852 48.513  1.00 40.59  ? 102  TRP B CE2 1 
ATOM   4990 C CE3 . TRP B 1 101 ? 103.902 39.514 46.988  1.00 40.41  ? 102  TRP B CE3 1 
ATOM   4991 C CZ2 . TRP B 1 101 ? 106.376 40.642 47.772  1.00 44.87  ? 102  TRP B CZ2 1 
ATOM   4992 C CZ3 . TRP B 1 101 ? 105.058 39.312 46.249  1.00 41.31  ? 102  TRP B CZ3 1 
ATOM   4993 C CH2 . TRP B 1 101 ? 106.277 39.872 46.645  1.00 41.96  ? 102  TRP B CH2 1 
ATOM   4994 N N   . THR B 1 102 ? 99.147  39.416 51.160  1.00 39.59  ? 103  THR B N   1 
ATOM   4995 C CA  . THR B 1 102 ? 97.717  39.487 51.417  1.00 43.84  ? 103  THR B CA  1 
ATOM   4996 C C   . THR B 1 102 ? 97.477  40.611 52.414  1.00 46.10  ? 103  THR B C   1 
ATOM   4997 O O   . THR B 1 102 ? 98.403  41.025 53.110  1.00 48.85  ? 103  THR B O   1 
ATOM   4998 C CB  . THR B 1 102 ? 97.181  38.150 51.943  1.00 50.04  ? 103  THR B CB  1 
ATOM   4999 O OG1 . THR B 1 102 ? 95.794  38.013 51.615  1.00 68.31  ? 103  THR B OG1 1 
ATOM   5000 C CG2 . THR B 1 102 ? 97.359  38.036 53.447  1.00 44.31  ? 103  THR B CG2 1 
ATOM   5001 N N   . PRO B 1 103 ? 96.267  41.169 52.464  1.00 43.92  ? 104  PRO B N   1 
ATOM   5002 C CA  . PRO B 1 103 ? 95.974  42.203 53.474  1.00 47.12  ? 104  PRO B CA  1 
ATOM   5003 C C   . PRO B 1 103 ? 96.148  41.707 54.901  1.00 50.68  ? 104  PRO B C   1 
ATOM   5004 O O   . PRO B 1 103 ? 96.120  40.504 55.183  1.00 52.23  ? 104  PRO B O   1 
ATOM   5005 C CB  . PRO B 1 103 ? 94.509  42.577 53.190  1.00 40.17  ? 104  PRO B CB  1 
ATOM   5006 C CG  . PRO B 1 103 ? 94.306  42.230 51.736  1.00 44.35  ? 104  PRO B CG  1 
ATOM   5007 C CD  . PRO B 1 103 ? 95.144  41.003 51.509  1.00 41.23  ? 104  PRO B CD  1 
ATOM   5008 N N   . TYR B 1 104 ? 96.350  42.657 55.800  1.00 48.83  ? 105  TYR B N   1 
ATOM   5009 C CA  . TYR B 1 104 ? 96.425  42.382 57.236  1.00 46.63  ? 105  TYR B CA  1 
ATOM   5010 C C   . TYR B 1 104 ? 95.229  43.036 57.927  1.00 56.09  ? 105  TYR B C   1 
ATOM   5011 O O   . TYR B 1 104 ? 95.011  44.238 57.771  1.00 58.20  ? 105  TYR B O   1 
ATOM   5012 C CB  . TYR B 1 104 ? 97.741  42.891 57.820  1.00 48.80  ? 105  TYR B CB  1 
ATOM   5013 C CG  . TYR B 1 104 ? 97.997  42.466 59.254  1.00 55.08  ? 105  TYR B CG  1 
ATOM   5014 C CD1 . TYR B 1 104 ? 97.352  43.093 60.315  1.00 54.01  ? 105  TYR B CD1 1 
ATOM   5015 C CD2 . TYR B 1 104 ? 98.890  41.444 59.545  1.00 56.48  ? 105  TYR B CD2 1 
ATOM   5016 C CE1 . TYR B 1 104 ? 97.583  42.707 61.620  1.00 50.32  ? 105  TYR B CE1 1 
ATOM   5017 C CE2 . TYR B 1 104 ? 99.129  41.053 60.847  1.00 52.24  ? 105  TYR B CE2 1 
ATOM   5018 C CZ  . TYR B 1 104 ? 98.474  41.690 61.880  1.00 56.51  ? 105  TYR B CZ  1 
ATOM   5019 O OH  . TYR B 1 104 ? 98.705  41.306 63.181  1.00 61.31  ? 105  TYR B OH  1 
ATOM   5020 N N   . PRO B 1 105 ? 94.445  42.251 58.687  1.00 57.15  ? 106  PRO B N   1 
ATOM   5021 C CA  . PRO B 1 105 ? 94.613  40.808 58.892  1.00 55.24  ? 106  PRO B CA  1 
ATOM   5022 C C   . PRO B 1 105 ? 94.226  40.015 57.649  1.00 51.94  ? 106  PRO B C   1 
ATOM   5023 O O   . PRO B 1 105 ? 93.619  40.594 56.748  1.00 50.17  ? 106  PRO B O   1 
ATOM   5024 C CB  . PRO B 1 105 ? 93.662  40.510 60.053  1.00 58.41  ? 106  PRO B CB  1 
ATOM   5025 C CG  . PRO B 1 105 ? 92.589  41.525 59.914  1.00 59.74  ? 106  PRO B CG  1 
ATOM   5026 C CD  . PRO B 1 105 ? 93.264  42.770 59.398  1.00 58.83  ? 106  PRO B CD  1 
ATOM   5027 N N   . ARG B 1 106 ? 94.588  38.736 57.599  1.00 58.33  ? 107  ARG B N   1 
ATOM   5028 C CA  . ARG B 1 106 ? 94.335  37.944 56.406  1.00 63.30  ? 107  ARG B CA  1 
ATOM   5029 C C   . ARG B 1 106 ? 92.848  37.977 56.065  1.00 59.22  ? 107  ARG B C   1 
ATOM   5030 O O   . ARG B 1 106 ? 92.003  37.982 56.968  1.00 60.92  ? 107  ARG B O   1 
ATOM   5031 C CB  . ARG B 1 106 ? 94.792  36.497 56.599  1.00 66.82  ? 107  ARG B CB  1 
ATOM   5032 C CG  . ARG B 1 106 ? 96.281  36.330 56.853  1.00 69.69  ? 107  ARG B CG  1 
ATOM   5033 C CD  . ARG B 1 106 ? 96.788  35.018 56.274  1.00 69.21  ? 107  ARG B CD  1 
ATOM   5034 N NE  . ARG B 1 106 ? 95.867  33.910 56.517  1.00 67.56  ? 107  ARG B NE  1 
ATOM   5035 C CZ  . ARG B 1 106 ? 95.966  33.064 57.537  1.00 69.08  ? 107  ARG B CZ  1 
ATOM   5036 N NH1 . ARG B 1 106 ? 96.947  33.200 58.418  1.00 66.81  ? 107  ARG B NH1 1 
ATOM   5037 N NH2 . ARG B 1 106 ? 95.084  32.084 57.676  1.00 78.39  ? 107  ARG B NH2 1 
ATOM   5038 N N   . PRO B 1 107 ? 92.494  38.032 54.783  1.00 54.28  ? 108  PRO B N   1 
ATOM   5039 C CA  . PRO B 1 107 ? 91.077  38.020 54.412  1.00 57.16  ? 108  PRO B CA  1 
ATOM   5040 C C   . PRO B 1 107 ? 90.393  36.750 54.890  1.00 59.75  ? 108  PRO B C   1 
ATOM   5041 O O   . PRO B 1 107 ? 90.986  35.669 54.924  1.00 66.41  ? 108  PRO B O   1 
ATOM   5042 C CB  . PRO B 1 107 ? 91.107  38.094 52.880  1.00 50.27  ? 108  PRO B CB  1 
ATOM   5043 C CG  . PRO B 1 107 ? 92.442  38.672 52.547  1.00 47.89  ? 108  PRO B CG  1 
ATOM   5044 C CD  . PRO B 1 107 ? 93.376  38.190 53.616  1.00 52.57  ? 108  PRO B CD  1 
ATOM   5045 N N   . THR B 1 108 ? 89.127  36.896 55.275  1.00 57.61  ? 109  THR B N   1 
ATOM   5046 C CA  . THR B 1 108 ? 88.314  35.768 55.700  1.00 66.39  ? 109  THR B CA  1 
ATOM   5047 C C   . THR B 1 108 ? 87.300  35.336 54.651  1.00 72.91  ? 109  THR B C   1 
ATOM   5048 O O   . THR B 1 108 ? 86.656  34.295 54.827  1.00 81.29  ? 109  THR B O   1 
ATOM   5049 C CB  . THR B 1 108 ? 87.590  36.100 57.015  1.00 67.54  ? 109  THR B CB  1 
ATOM   5050 O OG1 . THR B 1 108 ? 86.862  37.327 56.873  1.00 67.93  ? 109  THR B OG1 1 
ATOM   5051 C CG2 . THR B 1 108 ? 88.592  36.239 58.152  1.00 63.71  ? 109  THR B CG2 1 
ATOM   5052 N N   . SER B 1 109 ? 87.149  36.100 53.570  1.00 68.63  ? 110  SER B N   1 
ATOM   5053 C CA  . SER B 1 109 ? 86.322  35.782 52.420  1.00 66.23  ? 110  SER B CA  1 
ATOM   5054 C C   . SER B 1 109 ? 87.177  35.760 51.157  1.00 58.28  ? 110  SER B C   1 
ATOM   5055 O O   . SER B 1 109 ? 88.149  36.513 51.053  1.00 51.53  ? 110  SER B O   1 
ATOM   5056 C CB  . SER B 1 109 ? 85.187  36.801 52.254  1.00 67.86  ? 110  SER B CB  1 
ATOM   5057 O OG  . SER B 1 109 ? 85.653  38.121 52.470  1.00 74.94  ? 110  SER B OG  1 
ATOM   5058 N N   . PRO B 1 110 ? 86.842  34.900 50.182  1.00 57.05  ? 111  PRO B N   1 
ATOM   5059 C CA  . PRO B 1 110 ? 87.693  34.743 48.991  1.00 54.23  ? 111  PRO B CA  1 
ATOM   5060 C C   . PRO B 1 110 ? 88.017  36.047 48.276  1.00 54.95  ? 111  PRO B C   1 
ATOM   5061 O O   . PRO B 1 110 ? 87.126  36.793 47.857  1.00 56.50  ? 111  PRO B O   1 
ATOM   5062 C CB  . PRO B 1 110 ? 86.868  33.804 48.103  1.00 52.67  ? 111  PRO B CB  1 
ATOM   5063 C CG  . PRO B 1 110 ? 86.080  32.987 49.078  1.00 57.73  ? 111  PRO B CG  1 
ATOM   5064 C CD  . PRO B 1 110 ? 85.738  33.924 50.206  1.00 55.08  ? 111  PRO B CD  1 
ATOM   5065 N N   . THR B 1 111 ? 89.313  36.317 48.137  1.00 47.58  ? 112  THR B N   1 
ATOM   5066 C CA  . THR B 1 111 ? 89.846  37.544 47.571  1.00 51.88  ? 112  THR B CA  1 
ATOM   5067 C C   . THR B 1 111 ? 90.450  37.265 46.202  1.00 50.08  ? 112  THR B C   1 
ATOM   5068 O O   . THR B 1 111 ? 91.150  36.255 46.042  1.00 47.60  ? 112  THR B O   1 
ATOM   5069 C CB  . THR B 1 111 ? 90.912  38.125 48.512  1.00 52.38  ? 112  THR B CB  1 
ATOM   5070 O OG1 . THR B 1 111 ? 90.326  38.400 49.791  1.00 60.53  ? 112  THR B OG1 1 
ATOM   5071 C CG2 . THR B 1 111 ? 91.504  39.394 47.954  1.00 47.96  ? 112  THR B CG2 1 
ATOM   5072 N N   . PRO B 1 112 ? 90.201  38.106 45.195  1.00 52.71  ? 113  PRO B N   1 
ATOM   5073 C CA  . PRO B 1 112 ? 90.793  37.865 43.869  1.00 52.06  ? 113  PRO B CA  1 
ATOM   5074 C C   . PRO B 1 112 ? 92.314  37.874 43.915  1.00 46.91  ? 113  PRO B C   1 
ATOM   5075 O O   . PRO B 1 112 ? 92.933  38.612 44.686  1.00 47.15  ? 113  PRO B O   1 
ATOM   5076 C CB  . PRO B 1 112 ? 90.254  39.023 43.019  1.00 49.64  ? 113  PRO B CB  1 
ATOM   5077 C CG  . PRO B 1 112 ? 89.795  40.053 44.007  1.00 59.18  ? 113  PRO B CG  1 
ATOM   5078 C CD  . PRO B 1 112 ? 89.308  39.275 45.192  1.00 55.88  ? 113  PRO B CD  1 
ATOM   5079 N N   . VAL B 1 113 ? 92.914  37.045 43.062  1.00 42.64  ? 114  VAL B N   1 
ATOM   5080 C CA  . VAL B 1 113 ? 94.346  36.764 43.088  1.00 37.81  ? 114  VAL B CA  1 
ATOM   5081 C C   . VAL B 1 113 ? 94.991  37.317 41.826  1.00 39.41  ? 114  VAL B C   1 
ATOM   5082 O O   . VAL B 1 113 ? 94.517  37.060 40.713  1.00 40.48  ? 114  VAL B O   1 
ATOM   5083 C CB  . VAL B 1 113 ? 94.620  35.256 43.214  1.00 37.68  ? 114  VAL B CB  1 
ATOM   5084 C CG1 . VAL B 1 113 ? 96.118  34.987 43.233  1.00 34.35  ? 114  VAL B CG1 1 
ATOM   5085 C CG2 . VAL B 1 113 ? 93.956  34.697 44.460  1.00 39.63  ? 114  VAL B CG2 1 
ATOM   5086 N N   . LEU B 1 114 ? 96.077  38.065 42.004  1.00 37.63  ? 115  LEU B N   1 
ATOM   5087 C CA  . LEU B 1 114 ? 96.957  38.480 40.922  1.00 37.56  ? 115  LEU B CA  1 
ATOM   5088 C C   . LEU B 1 114 ? 98.233  37.656 40.992  1.00 38.50  ? 115  LEU B C   1 
ATOM   5089 O O   . LEU B 1 114 ? 98.824  37.515 42.068  1.00 39.24  ? 115  LEU B O   1 
ATOM   5090 C CB  . LEU B 1 114 ? 97.289  39.970 41.020  1.00 41.48  ? 115  LEU B CB  1 
ATOM   5091 C CG  . LEU B 1 114 ? 96.245  40.966 40.519  1.00 47.24  ? 115  LEU B CG  1 
ATOM   5092 C CD1 . LEU B 1 114 ? 96.558  42.357 41.029  1.00 40.96  ? 115  LEU B CD1 1 
ATOM   5093 C CD2 . LEU B 1 114 ? 96.199  40.956 38.995  1.00 43.39  ? 115  LEU B CD2 1 
ATOM   5094 N N   . VAL B 1 115 ? 98.653  37.107 39.855  1.00 34.50  ? 116  VAL B N   1 
ATOM   5095 C CA  . VAL B 1 115 ? 99.866  36.302 39.779  1.00 31.13  ? 116  VAL B CA  1 
ATOM   5096 C C   . VAL B 1 115 ? 100.823 36.971 38.810  1.00 37.99  ? 116  VAL B C   1 
ATOM   5097 O O   . VAL B 1 115 ? 100.509 37.130 37.623  1.00 39.13  ? 116  VAL B O   1 
ATOM   5098 C CB  . VAL B 1 115 ? 99.586  34.857 39.350  1.00 34.58  ? 116  VAL B CB  1 
ATOM   5099 C CG1 . VAL B 1 115 ? 100.888 34.058 39.373  1.00 33.21  ? 116  VAL B CG1 1 
ATOM   5100 C CG2 . VAL B 1 115 ? 98.546  34.233 40.251  1.00 34.75  ? 116  VAL B CG2 1 
ATOM   5101 N N   . TRP B 1 116 ? 101.998 37.327 39.311  1.00 36.76  ? 117  TRP B N   1 
ATOM   5102 C CA  . TRP B 1 116 ? 102.977 38.115 38.583  1.00 31.84  ? 117  TRP B CA  1 
ATOM   5103 C C   . TRP B 1 116 ? 104.068 37.207 38.033  1.00 39.12  ? 117  TRP B C   1 
ATOM   5104 O O   . TRP B 1 116 ? 104.624 36.384 38.769  1.00 33.90  ? 117  TRP B O   1 
ATOM   5105 C CB  . TRP B 1 116 ? 103.582 39.182 39.498  1.00 29.13  ? 117  TRP B CB  1 
ATOM   5106 C CG  . TRP B 1 116 ? 104.759 39.862 38.891  1.00 35.05  ? 117  TRP B CG  1 
ATOM   5107 C CD1 . TRP B 1 116 ? 106.058 39.682 39.245  1.00 39.05  ? 117  TRP B CD1 1 
ATOM   5108 C CD2 . TRP B 1 116 ? 104.759 40.802 37.803  1.00 35.05  ? 117  TRP B CD2 1 
ATOM   5109 N NE1 . TRP B 1 116 ? 106.872 40.466 38.450  1.00 37.00  ? 117  TRP B NE1 1 
ATOM   5110 C CE2 . TRP B 1 116 ? 106.100 41.160 37.562  1.00 34.33  ? 117  TRP B CE2 1 
ATOM   5111 C CE3 . TRP B 1 116 ? 103.757 41.381 37.014  1.00 35.09  ? 117  TRP B CE3 1 
ATOM   5112 C CZ2 . TRP B 1 116 ? 106.468 42.072 36.565  1.00 40.78  ? 117  TRP B CZ2 1 
ATOM   5113 C CZ3 . TRP B 1 116 ? 104.132 42.291 36.019  1.00 40.21  ? 117  TRP B CZ3 1 
ATOM   5114 C CH2 . TRP B 1 116 ? 105.472 42.625 35.806  1.00 38.64  ? 117  TRP B CH2 1 
ATOM   5115 N N   . ILE B 1 117 ? 104.372 37.363 36.743  1.00 40.64  ? 118  ILE B N   1 
ATOM   5116 C CA  . ILE B 1 117 ? 105.453 36.639 36.076  1.00 39.99  ? 118  ILE B CA  1 
ATOM   5117 C C   . ILE B 1 117 ? 106.417 37.680 35.527  1.00 36.49  ? 118  ILE B C   1 
ATOM   5118 O O   . ILE B 1 117 ? 106.060 38.447 34.624  1.00 37.46  ? 118  ILE B O   1 
ATOM   5119 C CB  . ILE B 1 117 ? 104.940 35.729 34.948  1.00 38.46  ? 118  ILE B CB  1 
ATOM   5120 C CG1 . ILE B 1 117 ? 103.866 34.769 35.466  1.00 39.94  ? 118  ILE B CG1 1 
ATOM   5121 C CG2 . ILE B 1 117 ? 106.091 34.949 34.331  1.00 33.23  ? 118  ILE B CG2 1 
ATOM   5122 C CD1 . ILE B 1 117 ? 103.327 33.838 34.394  1.00 36.08  ? 118  ILE B CD1 1 
ATOM   5123 N N   . TYR B 1 118 ? 107.637 37.705 36.055  1.00 33.57  ? 119  TYR B N   1 
ATOM   5124 C CA  . TYR B 1 118 ? 108.578 38.740 35.654  1.00 36.00  ? 119  TYR B CA  1 
ATOM   5125 C C   . TYR B 1 118 ? 109.126 38.482 34.252  1.00 36.70  ? 119  TYR B C   1 
ATOM   5126 O O   . TYR B 1 118 ? 109.114 37.358 33.743  1.00 32.44  ? 119  TYR B O   1 
ATOM   5127 C CB  . TYR B 1 118 ? 109.736 38.843 36.649  1.00 33.86  ? 119  TYR B CB  1 
ATOM   5128 C CG  . TYR B 1 118 ? 110.478 37.548 36.929  1.00 38.35  ? 119  TYR B CG  1 
ATOM   5129 C CD1 . TYR B 1 118 ? 111.368 37.010 36.004  1.00 39.09  ? 119  TYR B CD1 1 
ATOM   5130 C CD2 . TYR B 1 118 ? 110.314 36.884 38.139  1.00 38.33  ? 119  TYR B CD2 1 
ATOM   5131 C CE1 . TYR B 1 118 ? 112.056 35.835 36.268  1.00 38.67  ? 119  TYR B CE1 1 
ATOM   5132 C CE2 . TYR B 1 118 ? 110.995 35.709 38.412  1.00 39.93  ? 119  TYR B CE2 1 
ATOM   5133 C CZ  . TYR B 1 118 ? 111.863 35.189 37.475  1.00 43.71  ? 119  TYR B CZ  1 
ATOM   5134 O OH  . TYR B 1 118 ? 112.539 34.020 37.752  1.00 38.18  ? 119  TYR B OH  1 
ATOM   5135 N N   . GLY B 1 119 ? 109.627 39.552 33.636  1.00 33.14  ? 120  GLY B N   1 
ATOM   5136 C CA  . GLY B 1 119 ? 110.345 39.463 32.386  1.00 38.38  ? 120  GLY B CA  1 
ATOM   5137 C C   . GLY B 1 119 ? 111.849 39.428 32.593  1.00 40.53  ? 120  GLY B C   1 
ATOM   5138 O O   . GLY B 1 119 ? 112.359 39.212 33.695  1.00 44.52  ? 120  GLY B O   1 
ATOM   5139 N N   . GLY B 1 120 ? 112.567 39.655 31.498  1.00 38.30  ? 121  GLY B N   1 
ATOM   5140 C CA  . GLY B 1 120 ? 114.011 39.553 31.501  1.00 32.51  ? 121  GLY B CA  1 
ATOM   5141 C C   . GLY B 1 120 ? 114.517 38.665 30.382  1.00 36.69  ? 121  GLY B C   1 
ATOM   5142 O O   . GLY B 1 120 ? 115.544 37.994 30.528  1.00 36.61  ? 121  GLY B O   1 
ATOM   5143 N N   . GLY B 1 121 ? 113.785 38.640 29.267  1.00 38.57  ? 122  GLY B N   1 
ATOM   5144 C CA  . GLY B 1 121 ? 114.218 37.937 28.071  1.00 38.38  ? 122  GLY B CA  1 
ATOM   5145 C C   . GLY B 1 121 ? 114.415 36.448 28.233  1.00 40.52  ? 122  GLY B C   1 
ATOM   5146 O O   . GLY B 1 121 ? 115.147 35.843 27.447  1.00 42.59  ? 122  GLY B O   1 
ATOM   5147 N N   . PHE B 1 122 ? 113.784 35.839 29.235  1.00 34.92  ? 123  PHE B N   1 
ATOM   5148 C CA  . PHE B 1 122 ? 113.935 34.428 29.588  1.00 36.16  ? 123  PHE B CA  1 
ATOM   5149 C C   . PHE B 1 122 ? 115.354 34.072 30.020  1.00 34.42  ? 123  PHE B C   1 
ATOM   5150 O O   . PHE B 1 122 ? 115.660 32.889 30.205  1.00 38.80  ? 123  PHE B O   1 
ATOM   5151 C CB  . PHE B 1 122 ? 113.497 33.500 28.443  1.00 34.74  ? 123  PHE B CB  1 
ATOM   5152 C CG  . PHE B 1 122 ? 112.039 33.613 28.091  1.00 33.06  ? 123  PHE B CG  1 
ATOM   5153 C CD1 . PHE B 1 122 ? 111.065 33.138 28.956  1.00 36.18  ? 123  PHE B CD1 1 
ATOM   5154 C CD2 . PHE B 1 122 ? 111.642 34.189 26.893  1.00 32.89  ? 123  PHE B CD2 1 
ATOM   5155 C CE1 . PHE B 1 122 ? 109.723 33.238 28.638  1.00 34.28  ? 123  PHE B CE1 1 
ATOM   5156 C CE2 . PHE B 1 122 ? 110.301 34.292 26.566  1.00 36.55  ? 123  PHE B CE2 1 
ATOM   5157 C CZ  . PHE B 1 122 ? 109.339 33.815 27.440  1.00 37.58  ? 123  PHE B CZ  1 
ATOM   5158 N N   . TYR B 1 123 ? 116.238 35.059 30.182  1.00 30.60  ? 124  TYR B N   1 
ATOM   5159 C CA  . TYR B 1 123 ? 117.588 34.804 30.658  1.00 37.32  ? 124  TYR B CA  1 
ATOM   5160 C C   . TYR B 1 123 ? 117.870 35.427 32.017  1.00 39.53  ? 124  TYR B C   1 
ATOM   5161 O O   . TYR B 1 123 ? 118.956 35.203 32.565  1.00 36.76  ? 124  TYR B O   1 
ATOM   5162 C CB  . TYR B 1 123 ? 118.631 35.317 29.647  1.00 35.48  ? 124  TYR B CB  1 
ATOM   5163 C CG  . TYR B 1 123 ? 118.741 36.828 29.594  1.00 44.33  ? 124  TYR B CG  1 
ATOM   5164 C CD1 . TYR B 1 123 ? 119.579 37.518 30.470  1.00 43.81  ? 124  TYR B CD1 1 
ATOM   5165 C CD2 . TYR B 1 123 ? 118.013 37.565 28.668  1.00 44.57  ? 124  TYR B CD2 1 
ATOM   5166 C CE1 . TYR B 1 123 ? 119.673 38.893 30.436  1.00 41.74  ? 124  TYR B CE1 1 
ATOM   5167 C CE2 . TYR B 1 123 ? 118.106 38.945 28.622  1.00 41.43  ? 124  TYR B CE2 1 
ATOM   5168 C CZ  . TYR B 1 123 ? 118.937 39.601 29.508  1.00 47.79  ? 124  TYR B CZ  1 
ATOM   5169 O OH  . TYR B 1 123 ? 119.032 40.969 29.471  1.00 49.60  ? 124  TYR B OH  1 
ATOM   5170 N N   . SER B 1 124 ? 116.942 36.209 32.564  1.00 34.73  ? 125  SER B N   1 
ATOM   5171 C CA  . SER B 1 124 ? 117.182 36.937 33.804  1.00 40.05  ? 125  SER B CA  1 
ATOM   5172 C C   . SER B 1 124 ? 115.841 37.240 34.460  1.00 38.22  ? 125  SER B C   1 
ATOM   5173 O O   . SER B 1 124 ? 114.776 36.946 33.911  1.00 36.94  ? 125  SER B O   1 
ATOM   5174 C CB  . SER B 1 124 ? 117.967 38.227 33.545  1.00 41.70  ? 125  SER B CB  1 
ATOM   5175 O OG  . SER B 1 124 ? 117.207 39.130 32.755  1.00 40.49  ? 125  SER B OG  1 
ATOM   5176 N N   . GLY B 1 125 ? 115.905 37.849 35.642  1.00 37.74  ? 126  GLY B N   1 
ATOM   5177 C CA  . GLY B 1 125 ? 114.710 38.236 36.362  1.00 37.26  ? 126  GLY B CA  1 
ATOM   5178 C C   . GLY B 1 125 ? 114.608 37.582 37.722  1.00 38.88  ? 126  GLY B C   1 
ATOM   5179 O O   . GLY B 1 125 ? 115.248 36.555 37.970  1.00 38.69  ? 126  GLY B O   1 
ATOM   5180 N N   . ALA B 1 126 ? 113.808 38.167 38.612  1.00 35.73  ? 127  ALA B N   1 
ATOM   5181 C CA  . ALA B 1 126 ? 113.623 37.633 39.954  1.00 39.16  ? 127  ALA B CA  1 
ATOM   5182 C C   . ALA B 1 126 ? 112.371 38.245 40.564  1.00 41.11  ? 127  ALA B C   1 
ATOM   5183 O O   . ALA B 1 126 ? 112.064 39.414 40.320  1.00 40.62  ? 127  ALA B O   1 
ATOM   5184 C CB  . ALA B 1 126 ? 114.836 37.921 40.847  1.00 33.58  ? 127  ALA B CB  1 
ATOM   5185 N N   . SER B 1 127 ? 111.655 37.451 41.360  1.00 40.50  ? 128  SER B N   1 
ATOM   5186 C CA  . SER B 1 127 ? 110.469 37.965 42.031  1.00 42.33  ? 128  SER B CA  1 
ATOM   5187 C C   . SER B 1 127 ? 110.805 38.895 43.190  1.00 42.04  ? 128  SER B C   1 
ATOM   5188 O O   . SER B 1 127 ? 109.893 39.524 43.738  1.00 39.94  ? 128  SER B O   1 
ATOM   5189 C CB  . SER B 1 127 ? 109.605 36.805 42.530  1.00 45.14  ? 128  SER B CB  1 
ATOM   5190 O OG  . SER B 1 127 ? 110.319 35.993 43.447  1.00 46.13  ? 128  SER B OG  1 
ATOM   5191 N N   . SER B 1 128 ? 112.082 39.013 43.554  1.00 38.69  ? 129  SER B N   1 
ATOM   5192 C CA  . SER B 1 128 ? 112.514 39.746 44.737  1.00 40.11  ? 129  SER B CA  1 
ATOM   5193 C C   . SER B 1 128 ? 112.943 41.179 44.445  1.00 48.81  ? 129  SER B C   1 
ATOM   5194 O O   . SER B 1 128 ? 113.339 41.890 45.376  1.00 41.64  ? 129  SER B O   1 
ATOM   5195 C CB  . SER B 1 128 ? 113.671 39.003 45.411  1.00 39.77  ? 129  SER B CB  1 
ATOM   5196 O OG  . SER B 1 128 ? 114.687 38.689 44.468  1.00 40.18  ? 129  SER B OG  1 
ATOM   5197 N N   . LEU B 1 129 ? 112.892 41.618 43.189  1.00 42.73  ? 130  LEU B N   1 
ATOM   5198 C CA  . LEU B 1 129 ? 113.323 42.971 42.865  1.00 46.00  ? 130  LEU B CA  1 
ATOM   5199 C C   . LEU B 1 129 ? 112.406 43.997 43.523  1.00 43.08  ? 130  LEU B C   1 
ATOM   5200 O O   . LEU B 1 129 ? 111.200 43.781 43.669  1.00 43.46  ? 130  LEU B O   1 
ATOM   5201 C CB  . LEU B 1 129 ? 113.348 43.183 41.349  1.00 47.21  ? 130  LEU B CB  1 
ATOM   5202 C CG  . LEU B 1 129 ? 114.151 42.171 40.525  1.00 45.41  ? 130  LEU B CG  1 
ATOM   5203 C CD1 . LEU B 1 129 ? 114.046 42.480 39.036  1.00 37.07  ? 130  LEU B CD1 1 
ATOM   5204 C CD2 . LEU B 1 129 ? 115.605 42.148 40.967  1.00 46.55  ? 130  LEU B CD2 1 
ATOM   5205 N N   . ASP B 1 130 ? 112.999 45.127 43.925  1.00 44.32  ? 131  ASP B N   1 
ATOM   5206 C CA  . ASP B 1 130 ? 112.242 46.163 44.624  1.00 44.14  ? 131  ASP B CA  1 
ATOM   5207 C C   . ASP B 1 130 ? 111.046 46.641 43.811  1.00 49.10  ? 131  ASP B C   1 
ATOM   5208 O O   . ASP B 1 130 ? 109.997 46.962 44.381  1.00 47.52  ? 131  ASP B O   1 
ATOM   5209 C CB  . ASP B 1 130 ? 113.148 47.351 44.955  1.00 48.35  ? 131  ASP B CB  1 
ATOM   5210 C CG  . ASP B 1 130 ? 114.275 46.984 45.903  1.00 50.16  ? 131  ASP B CG  1 
ATOM   5211 O OD1 . ASP B 1 130 ? 114.184 45.922 46.553  1.00 47.89  ? 131  ASP B OD1 1 
ATOM   5212 O OD2 . ASP B 1 130 ? 115.247 47.761 46.004  1.00 56.04  ? 131  ASP B OD2 1 
ATOM   5213 N N   . VAL B 1 131 ? 111.175 46.683 42.483  1.00 42.36  ? 132  VAL B N   1 
ATOM   5214 C CA  . VAL B 1 131 ? 110.114 47.239 41.657  1.00 39.62  ? 132  VAL B CA  1 
ATOM   5215 C C   . VAL B 1 131 ? 108.915 46.299 41.574  1.00 41.67  ? 132  VAL B C   1 
ATOM   5216 O O   . VAL B 1 131 ? 107.827 46.721 41.163  1.00 42.96  ? 132  VAL B O   1 
ATOM   5217 C CB  . VAL B 1 131 ? 110.683 47.591 40.266  1.00 47.66  ? 132  VAL B CB  1 
ATOM   5218 C CG1 . VAL B 1 131 ? 110.977 46.335 39.469  1.00 44.91  ? 132  VAL B CG1 1 
ATOM   5219 C CG2 . VAL B 1 131 ? 109.747 48.518 39.514  1.00 48.97  ? 132  VAL B CG2 1 
ATOM   5220 N N   . TYR B 1 132 ? 109.075 45.037 41.971  1.00 37.96  ? 133  TYR B N   1 
ATOM   5221 C CA  . TYR B 1 132 ? 107.964 44.096 42.045  1.00 36.64  ? 133  TYR B CA  1 
ATOM   5222 C C   . TYR B 1 132 ? 107.395 43.966 43.454  1.00 44.04  ? 133  TYR B C   1 
ATOM   5223 O O   . TYR B 1 132 ? 106.618 43.039 43.708  1.00 44.37  ? 133  TYR B O   1 
ATOM   5224 C CB  . TYR B 1 132 ? 108.393 42.711 41.545  1.00 36.87  ? 133  TYR B CB  1 
ATOM   5225 C CG  . TYR B 1 132 ? 109.033 42.685 40.171  1.00 38.05  ? 133  TYR B CG  1 
ATOM   5226 C CD1 . TYR B 1 132 ? 108.683 43.609 39.192  1.00 36.06  ? 133  TYR B CD1 1 
ATOM   5227 C CD2 . TYR B 1 132 ? 109.987 41.725 39.855  1.00 33.42  ? 133  TYR B CD2 1 
ATOM   5228 C CE1 . TYR B 1 132 ? 109.275 43.577 37.934  1.00 41.05  ? 133  TYR B CE1 1 
ATOM   5229 C CE2 . TYR B 1 132 ? 110.581 41.685 38.607  1.00 36.59  ? 133  TYR B CE2 1 
ATOM   5230 C CZ  . TYR B 1 132 ? 110.223 42.610 37.650  1.00 39.56  ? 133  TYR B CZ  1 
ATOM   5231 O OH  . TYR B 1 132 ? 110.820 42.561 36.411  1.00 39.01  ? 133  TYR B OH  1 
ATOM   5232 N N   . ASP B 1 133 ? 107.775 44.856 44.376  1.00 47.68  ? 134  ASP B N   1 
ATOM   5233 C CA  . ASP B 1 133 ? 107.289 44.798 45.754  1.00 40.86  ? 134  ASP B CA  1 
ATOM   5234 C C   . ASP B 1 133 ? 105.768 44.828 45.776  1.00 40.19  ? 134  ASP B C   1 
ATOM   5235 O O   . ASP B 1 133 ? 105.148 45.835 45.422  1.00 40.47  ? 134  ASP B O   1 
ATOM   5236 C CB  . ASP B 1 133 ? 107.853 45.953 46.583  1.00 38.98  ? 134  ASP B CB  1 
ATOM   5237 C CG  . ASP B 1 133 ? 107.540 45.823 48.076  1.00 54.06  ? 134  ASP B CG  1 
ATOM   5238 O OD1 . ASP B 1 133 ? 106.718 44.963 48.461  1.00 49.23  ? 134  ASP B OD1 1 
ATOM   5239 O OD2 . ASP B 1 133 ? 108.123 46.592 48.871  1.00 55.44  ? 134  ASP B OD2 1 
ATOM   5240 N N   . GLY B 1 134 ? 105.158 43.732 46.201  1.00 42.17  ? 135  GLY B N   1 
ATOM   5241 C CA  . GLY B 1 134 ? 103.721 43.636 46.115  1.00 35.01  ? 135  GLY B CA  1 
ATOM   5242 C C   . GLY B 1 134 ? 102.962 44.137 47.323  1.00 40.24  ? 135  GLY B C   1 
ATOM   5243 O O   . GLY B 1 134 ? 101.826 43.705 47.525  1.00 49.14  ? 135  GLY B O   1 
ATOM   5244 N N   . ARG B 1 135 ? 103.520 45.064 48.109  1.00 42.53  ? 136  ARG B N   1 
ATOM   5245 C CA  . ARG B 1 135 ? 102.845 45.502 49.332  1.00 45.52  ? 136  ARG B CA  1 
ATOM   5246 C C   . ARG B 1 135 ? 101.836 46.625 49.105  1.00 49.25  ? 136  ARG B C   1 
ATOM   5247 O O   . ARG B 1 135 ? 100.822 46.682 49.813  1.00 44.76  ? 136  ARG B O   1 
ATOM   5248 C CB  . ARG B 1 135 ? 103.868 45.953 50.384  1.00 42.60  ? 136  ARG B CB  1 
ATOM   5249 C CG  . ARG B 1 135 ? 104.469 47.338 50.155  1.00 38.74  ? 136  ARG B CG  1 
ATOM   5250 C CD  . ARG B 1 135 ? 105.507 47.663 51.216  1.00 46.22  ? 136  ARG B CD  1 
ATOM   5251 N NE  . ARG B 1 135 ? 106.652 46.762 51.136  1.00 45.42  ? 136  ARG B NE  1 
ATOM   5252 C CZ  . ARG B 1 135 ? 107.520 46.563 52.121  1.00 49.91  ? 136  ARG B CZ  1 
ATOM   5253 N NH1 . ARG B 1 135 ? 107.372 47.190 53.285  1.00 44.96  ? 136  ARG B NH1 1 
ATOM   5254 N NH2 . ARG B 1 135 ? 108.530 45.722 51.946  1.00 47.77  ? 136  ARG B NH2 1 
ATOM   5255 N N   . PHE B 1 136 ? 102.073 47.509 48.130  1.00 43.88  ? 137  PHE B N   1 
ATOM   5256 C CA  . PHE B 1 136 ? 101.210 48.676 47.962  1.00 43.68  ? 137  PHE B CA  1 
ATOM   5257 C C   . PHE B 1 136 ? 99.926  48.326 47.218  1.00 45.24  ? 137  PHE B C   1 
ATOM   5258 O O   . PHE B 1 136 ? 98.846  48.815 47.570  1.00 49.91  ? 137  PHE B O   1 
ATOM   5259 C CB  . PHE B 1 136 ? 101.961 49.786 47.226  1.00 46.66  ? 137  PHE B CB  1 
ATOM   5260 C CG  . PHE B 1 136 ? 103.300 50.119 47.825  1.00 46.54  ? 137  PHE B CG  1 
ATOM   5261 C CD1 . PHE B 1 136 ? 104.468 49.611 47.275  1.00 43.07  ? 137  PHE B CD1 1 
ATOM   5262 C CD2 . PHE B 1 136 ? 103.391 50.936 48.942  1.00 48.84  ? 137  PHE B CD2 1 
ATOM   5263 C CE1 . PHE B 1 136 ? 105.704 49.916 47.827  1.00 45.49  ? 137  PHE B CE1 1 
ATOM   5264 C CE2 . PHE B 1 136 ? 104.623 51.244 49.499  1.00 47.47  ? 137  PHE B CE2 1 
ATOM   5265 C CZ  . PHE B 1 136 ? 105.780 50.734 48.942  1.00 41.88  ? 137  PHE B CZ  1 
ATOM   5266 N N   . LEU B 1 137 ? 100.035 47.493 46.183  1.00 43.55  ? 138  LEU B N   1 
ATOM   5267 C CA  . LEU B 1 137 ? 98.861  47.048 45.439  1.00 45.91  ? 138  LEU B CA  1 
ATOM   5268 C C   . LEU B 1 137 ? 97.902  46.283 46.343  1.00 42.52  ? 138  LEU B C   1 
ATOM   5269 O O   . LEU B 1 137 ? 96.684  46.483 46.288  1.00 45.67  ? 138  LEU B O   1 
ATOM   5270 C CB  . LEU B 1 137 ? 99.327  46.176 44.272  1.00 46.53  ? 138  LEU B CB  1 
ATOM   5271 C CG  . LEU B 1 137 ? 98.465  45.828 43.068  1.00 46.99  ? 138  LEU B CG  1 
ATOM   5272 C CD1 . LEU B 1 137 ? 97.720  47.040 42.570  1.00 47.84  ? 138  LEU B CD1 1 
ATOM   5273 C CD2 . LEU B 1 137 ? 99.383  45.281 41.983  1.00 40.95  ? 138  LEU B CD2 1 
ATOM   5274 N N   . VAL B 1 138 ? 98.445  45.409 47.191  1.00 38.76  ? 139  VAL B N   1 
ATOM   5275 C CA  . VAL B 1 138 ? 97.629  44.600 48.088  1.00 43.03  ? 139  VAL B CA  1 
ATOM   5276 C C   . VAL B 1 138 ? 96.931  45.475 49.122  1.00 43.36  ? 139  VAL B C   1 
ATOM   5277 O O   . VAL B 1 138 ? 95.749  45.277 49.422  1.00 45.62  ? 139  VAL B O   1 
ATOM   5278 C CB  . VAL B 1 138 ? 98.505  43.520 48.746  1.00 45.74  ? 139  VAL B CB  1 
ATOM   5279 C CG1 . VAL B 1 138 ? 97.793  42.890 49.919  1.00 38.35  ? 139  VAL B CG1 1 
ATOM   5280 C CG2 . VAL B 1 138 ? 98.881  42.467 47.722  1.00 39.00  ? 139  VAL B CG2 1 
ATOM   5281 N N   . GLN B 1 139 ? 97.640  46.459 49.677  1.00 43.95  ? 140  GLN B N   1 
ATOM   5282 C CA  . GLN B 1 139 ? 97.008  47.346 50.648  1.00 48.59  ? 140  GLN B CA  1 
ATOM   5283 C C   . GLN B 1 139 ? 95.963  48.232 49.983  1.00 50.95  ? 140  GLN B C   1 
ATOM   5284 O O   . GLN B 1 139 ? 94.863  48.413 50.517  1.00 51.97  ? 140  GLN B O   1 
ATOM   5285 C CB  . GLN B 1 139 ? 98.065  48.197 51.356  1.00 44.72  ? 140  GLN B CB  1 
ATOM   5286 C CG  . GLN B 1 139 ? 97.555  48.956 52.578  1.00 42.85  ? 140  GLN B CG  1 
ATOM   5287 C CD  . GLN B 1 139 ? 96.759  50.203 52.228  1.00 46.84  ? 140  GLN B CD  1 
ATOM   5288 O OE1 . GLN B 1 139 ? 97.132  50.960 51.336  1.00 50.93  ? 140  GLN B OE1 1 
ATOM   5289 N NE2 . GLN B 1 139 ? 95.650  50.415 52.928  1.00 47.68  ? 140  GLN B NE2 1 
ATOM   5290 N N   . ALA B 1 140 ? 96.284  48.792 48.816  1.00 50.82  ? 141  ALA B N   1 
ATOM   5291 C CA  . ALA B 1 140 ? 95.389  49.767 48.202  1.00 50.65  ? 141  ALA B CA  1 
ATOM   5292 C C   . ALA B 1 140 ? 94.166  49.101 47.585  1.00 49.84  ? 141  ALA B C   1 
ATOM   5293 O O   . ALA B 1 140 ? 93.063  49.656 47.637  1.00 47.48  ? 141  ALA B O   1 
ATOM   5294 C CB  . ALA B 1 140 ? 96.141  50.580 47.151  1.00 54.30  ? 141  ALA B CB  1 
ATOM   5295 N N   . GLU B 1 141 ? 94.335  47.916 46.998  1.00 44.52  ? 142  GLU B N   1 
ATOM   5296 C CA  . GLU B 1 141 ? 93.284  47.299 46.202  1.00 41.56  ? 142  GLU B CA  1 
ATOM   5297 C C   . GLU B 1 141 ? 92.742  46.007 46.795  1.00 44.21  ? 142  GLU B C   1 
ATOM   5298 O O   . GLU B 1 141 ? 91.818  45.423 46.219  1.00 48.49  ? 142  GLU B O   1 
ATOM   5299 C CB  . GLU B 1 141 ? 93.783  47.048 44.773  1.00 37.21  ? 142  GLU B CB  1 
ATOM   5300 C CG  . GLU B 1 141 ? 93.987  48.331 43.980  1.00 40.38  ? 142  GLU B CG  1 
ATOM   5301 C CD  . GLU B 1 141 ? 92.709  49.145 43.867  1.00 47.97  ? 142  GLU B CD  1 
ATOM   5302 O OE1 . GLU B 1 141 ? 91.617  48.538 43.821  1.00 53.46  ? 142  GLU B OE1 1 
ATOM   5303 O OE2 . GLU B 1 141 ? 92.792  50.392 43.837  1.00 52.96  ? 142  GLU B OE2 1 
ATOM   5304 N N   . ARG B 1 142 ? 93.285  45.549 47.923  1.00 47.82  ? 143  ARG B N   1 
ATOM   5305 C CA  . ARG B 1 142 ? 92.703  44.444 48.688  1.00 48.83  ? 143  ARG B CA  1 
ATOM   5306 C C   . ARG B 1 142 ? 92.627  43.168 47.851  1.00 47.65  ? 143  ARG B C   1 
ATOM   5307 O O   . ARG B 1 142 ? 91.588  42.513 47.765  1.00 52.42  ? 143  ARG B O   1 
ATOM   5308 C CB  . ARG B 1 142 ? 91.322  44.821 49.229  1.00 46.42  ? 143  ARG B CB  1 
ATOM   5309 C CG  . ARG B 1 142 ? 91.243  46.211 49.834  1.00 56.07  ? 143  ARG B CG  1 
ATOM   5310 C CD  . ARG B 1 142 ? 91.563  46.182 51.306  1.00 52.00  ? 143  ARG B CD  1 
ATOM   5311 N NE  . ARG B 1 142 ? 90.663  45.300 52.043  1.00 57.01  ? 143  ARG B NE  1 
ATOM   5312 C CZ  . ARG B 1 142 ? 90.860  44.921 53.301  1.00 63.75  ? 143  ARG B CZ  1 
ATOM   5313 N NH1 . ARG B 1 142 ? 91.931  45.345 53.959  1.00 52.46  ? 143  ARG B NH1 1 
ATOM   5314 N NH2 . ARG B 1 142 ? 89.993  44.116 53.899  1.00 67.85  ? 143  ARG B NH2 1 
ATOM   5315 N N   . THR B 1 143 ? 93.740  42.827 47.218  1.00 48.09  ? 144  THR B N   1 
ATOM   5316 C CA  . THR B 1 143 ? 93.876  41.585 46.478  1.00 46.90  ? 144  THR B CA  1 
ATOM   5317 C C   . THR B 1 143 ? 94.940  40.721 47.137  1.00 40.90  ? 144  THR B C   1 
ATOM   5318 O O   . THR B 1 143 ? 95.711  41.178 47.982  1.00 51.13  ? 144  THR B O   1 
ATOM   5319 C CB  . THR B 1 143 ? 94.257  41.838 45.013  1.00 53.55  ? 144  THR B CB  1 
ATOM   5320 O OG1 . THR B 1 143 ? 95.476  42.588 44.965  1.00 55.91  ? 144  THR B OG1 1 
ATOM   5321 C CG2 . THR B 1 143 ? 93.162  42.606 44.295  1.00 56.81  ? 144  THR B CG2 1 
ATOM   5322 N N   . VAL B 1 144 ? 94.976  39.460 46.741  1.00 42.40  ? 145  VAL B N   1 
ATOM   5323 C CA  . VAL B 1 144 ? 96.110  38.597 47.033  1.00 42.07  ? 145  VAL B CA  1 
ATOM   5324 C C   . VAL B 1 144 ? 97.052  38.639 45.840  1.00 44.38  ? 145  VAL B C   1 
ATOM   5325 O O   . VAL B 1 144 ? 96.618  38.499 44.690  1.00 48.33  ? 145  VAL B O   1 
ATOM   5326 C CB  . VAL B 1 144 ? 95.654  37.161 47.332  1.00 42.78  ? 145  VAL B CB  1 
ATOM   5327 C CG1 . VAL B 1 144 ? 96.863  36.263 47.529  1.00 38.32  ? 145  VAL B CG1 1 
ATOM   5328 C CG2 . VAL B 1 144 ? 94.757  37.143 48.565  1.00 43.65  ? 145  VAL B CG2 1 
ATOM   5329 N N   . LEU B 1 145 ? 98.337  38.854 46.105  1.00 35.50  ? 146  LEU B N   1 
ATOM   5330 C CA  . LEU B 1 145 ? 99.350  38.930 45.063  1.00 38.88  ? 146  LEU B CA  1 
ATOM   5331 C C   . LEU B 1 145 ? 100.316 37.771 45.248  1.00 43.09  ? 146  LEU B C   1 
ATOM   5332 O O   . LEU B 1 145 ? 100.849 37.573 46.345  1.00 39.98  ? 146  LEU B O   1 
ATOM   5333 C CB  . LEU B 1 145 ? 100.088 40.276 45.107  1.00 39.08  ? 146  LEU B CB  1 
ATOM   5334 C CG  . LEU B 1 145 ? 101.024 40.722 43.971  1.00 49.58  ? 146  LEU B CG  1 
ATOM   5335 C CD1 . LEU B 1 145 ? 102.336 39.978 43.971  1.00 54.96  ? 146  LEU B CD1 1 
ATOM   5336 C CD2 . LEU B 1 145 ? 100.361 40.567 42.624  1.00 49.97  ? 146  LEU B CD2 1 
ATOM   5337 N N   . VAL B 1 146 ? 100.515 36.998 44.185  1.00 38.43  ? 147  VAL B N   1 
ATOM   5338 C CA  . VAL B 1 146 ? 101.474 35.902 44.163  1.00 39.78  ? 147  VAL B CA  1 
ATOM   5339 C C   . VAL B 1 146 ? 102.490 36.175 43.065  1.00 43.18  ? 147  VAL B C   1 
ATOM   5340 O O   . VAL B 1 146 ? 102.133 36.650 41.981  1.00 42.37  ? 147  VAL B O   1 
ATOM   5341 C CB  . VAL B 1 146 ? 100.790 34.538 43.937  1.00 39.01  ? 147  VAL B CB  1 
ATOM   5342 C CG1 . VAL B 1 146 ? 101.811 33.406 44.023  1.00 33.38  ? 147  VAL B CG1 1 
ATOM   5343 C CG2 . VAL B 1 146 ? 99.663  34.332 44.935  1.00 38.37  ? 147  VAL B CG2 1 
ATOM   5344 N N   . SER B 1 147 ? 103.756 35.885 43.350  1.00 40.34  ? 148  SER B N   1 
ATOM   5345 C CA  . SER B 1 147 ? 104.807 35.919 42.345  1.00 39.36  ? 148  SER B CA  1 
ATOM   5346 C C   . SER B 1 147 ? 105.741 34.746 42.587  1.00 41.07  ? 148  SER B C   1 
ATOM   5347 O O   . SER B 1 147 ? 105.976 34.359 43.736  1.00 41.84  ? 148  SER B O   1 
ATOM   5348 C CB  . SER B 1 147 ? 105.588 37.237 42.380  1.00 35.15  ? 148  SER B CB  1 
ATOM   5349 O OG  . SER B 1 147 ? 106.399 37.314 43.536  1.00 40.25  ? 148  SER B OG  1 
ATOM   5350 N N   . MET B 1 148 ? 106.263 34.173 41.507  1.00 30.44  ? 149  MET B N   1 
ATOM   5351 C CA  . MET B 1 148 ? 107.134 33.016 41.613  1.00 33.58  ? 149  MET B CA  1 
ATOM   5352 C C   . MET B 1 148 ? 108.449 33.287 40.896  1.00 38.66  ? 149  MET B C   1 
ATOM   5353 O O   . MET B 1 148 ? 108.540 34.137 40.007  1.00 41.91  ? 149  MET B O   1 
ATOM   5354 C CB  . MET B 1 148 ? 106.473 31.751 41.042  1.00 32.30  ? 149  MET B CB  1 
ATOM   5355 C CG  . MET B 1 148 ? 106.663 31.556 39.539  1.00 44.87  ? 149  MET B CG  1 
ATOM   5356 S SD  . MET B 1 148 ? 105.825 32.813 38.556  1.00 38.93  ? 149  MET B SD  1 
ATOM   5357 C CE  . MET B 1 148 ? 104.114 32.309 38.729  1.00 38.48  ? 149  MET B CE  1 
ATOM   5358 N N   . ASN B 1 149 ? 109.479 32.568 41.328  1.00 42.21  ? 150  ASN B N   1 
ATOM   5359 C CA  . ASN B 1 149 ? 110.719 32.463 40.581  1.00 39.58  ? 150  ASN B CA  1 
ATOM   5360 C C   . ASN B 1 149 ? 110.626 31.262 39.652  1.00 44.27  ? 150  ASN B C   1 
ATOM   5361 O O   . ASN B 1 149 ? 110.041 30.235 40.006  1.00 45.48  ? 150  ASN B O   1 
ATOM   5362 C CB  . ASN B 1 149 ? 111.917 32.310 41.521  1.00 37.55  ? 150  ASN B CB  1 
ATOM   5363 C CG  . ASN B 1 149 ? 112.475 33.645 41.997  1.00 42.79  ? 150  ASN B CG  1 
ATOM   5364 O OD1 . ASN B 1 149 ? 111.916 34.708 41.726  1.00 43.46  ? 150  ASN B OD1 1 
ATOM   5365 N ND2 . ASN B 1 149 ? 113.596 33.590 42.706  1.00 41.66  ? 150  ASN B ND2 1 
ATOM   5366 N N   . TYR B 1 150 ? 111.186 31.401 38.453  1.00 38.20  ? 151  TYR B N   1 
ATOM   5367 C CA  . TYR B 1 150 ? 111.261 30.295 37.510  1.00 36.19  ? 151  TYR B CA  1 
ATOM   5368 C C   . TYR B 1 150 ? 112.634 30.299 36.859  1.00 33.52  ? 151  TYR B C   1 
ATOM   5369 O O   . TYR B 1 150 ? 113.275 31.346 36.740  1.00 39.11  ? 151  TYR B O   1 
ATOM   5370 C CB  . TYR B 1 150 ? 110.161 30.373 36.440  1.00 37.43  ? 151  TYR B CB  1 
ATOM   5371 C CG  . TYR B 1 150 ? 110.227 31.610 35.572  1.00 36.66  ? 151  TYR B CG  1 
ATOM   5372 C CD1 . TYR B 1 150 ? 109.594 32.785 35.960  1.00 32.73  ? 151  TYR B CD1 1 
ATOM   5373 C CD2 . TYR B 1 150 ? 110.912 31.600 34.362  1.00 38.40  ? 151  TYR B CD2 1 
ATOM   5374 C CE1 . TYR B 1 150 ? 109.644 33.914 35.177  1.00 34.14  ? 151  TYR B CE1 1 
ATOM   5375 C CE2 . TYR B 1 150 ? 110.973 32.731 33.568  1.00 36.29  ? 151  TYR B CE2 1 
ATOM   5376 C CZ  . TYR B 1 150 ? 110.336 33.886 33.981  1.00 41.64  ? 151  TYR B CZ  1 
ATOM   5377 O OH  . TYR B 1 150 ? 110.386 35.021 33.201  1.00 34.94  ? 151  TYR B OH  1 
ATOM   5378 N N   . ARG B 1 151 ? 113.080 29.119 36.442  1.00 38.30  ? 152  ARG B N   1 
ATOM   5379 C CA  . ARG B 1 151 ? 114.413 28.986 35.868  1.00 39.40  ? 152  ARG B CA  1 
ATOM   5380 C C   . ARG B 1 151 ? 114.519 29.745 34.550  1.00 40.85  ? 152  ARG B C   1 
ATOM   5381 O O   . ARG B 1 151 ? 113.600 29.729 33.727  1.00 39.58  ? 152  ARG B O   1 
ATOM   5382 C CB  . ARG B 1 151 ? 114.754 27.512 35.664  1.00 39.47  ? 152  ARG B CB  1 
ATOM   5383 C CG  . ARG B 1 151 ? 115.090 26.781 36.963  1.00 38.49  ? 152  ARG B CG  1 
ATOM   5384 C CD  . ARG B 1 151 ? 115.165 25.282 36.748  1.00 38.08  ? 152  ARG B CD  1 
ATOM   5385 N NE  . ARG B 1 151 ? 113.839 24.684 36.604  1.00 39.79  ? 152  ARG B NE  1 
ATOM   5386 C CZ  . ARG B 1 151 ? 113.632 23.401 36.330  1.00 41.98  ? 152  ARG B CZ  1 
ATOM   5387 N NH1 . ARG B 1 151 ? 114.665 22.586 36.160  1.00 39.15  ? 152  ARG B NH1 1 
ATOM   5388 N NH2 . ARG B 1 151 ? 112.396 22.933 36.222  1.00 37.04  ? 152  ARG B NH2 1 
ATOM   5389 N N   . VAL B 1 152 ? 115.652 30.420 34.362  1.00 36.39  ? 153  VAL B N   1 
ATOM   5390 C CA  . VAL B 1 152 ? 115.921 31.212 33.171  1.00 38.71  ? 153  VAL B CA  1 
ATOM   5391 C C   . VAL B 1 152 ? 117.214 30.710 32.533  1.00 40.31  ? 153  VAL B C   1 
ATOM   5392 O O   . VAL B 1 152 ? 117.928 29.877 33.091  1.00 41.59  ? 153  VAL B O   1 
ATOM   5393 C CB  . VAL B 1 152 ? 116.012 32.719 33.479  1.00 37.48  ? 153  VAL B CB  1 
ATOM   5394 C CG1 . VAL B 1 152 ? 114.655 33.261 33.907  1.00 35.79  ? 153  VAL B CG1 1 
ATOM   5395 C CG2 . VAL B 1 152 ? 117.054 32.972 34.560  1.00 34.48  ? 153  VAL B CG2 1 
ATOM   5396 N N   . GLY B 1 153 ? 117.509 31.239 31.348  1.00 43.00  ? 154  GLY B N   1 
ATOM   5397 C CA  . GLY B 1 153 ? 118.704 30.832 30.633  1.00 39.50  ? 154  GLY B CA  1 
ATOM   5398 C C   . GLY B 1 153 ? 118.665 29.357 30.280  1.00 39.65  ? 154  GLY B C   1 
ATOM   5399 O O   . GLY B 1 153 ? 117.600 28.752 30.113  1.00 37.59  ? 154  GLY B O   1 
ATOM   5400 N N   . ALA B 1 154 ? 119.855 28.761 30.181  1.00 37.89  ? 155  ALA B N   1 
ATOM   5401 C CA  . ALA B 1 154 ? 119.946 27.339 29.858  1.00 39.94  ? 155  ALA B CA  1 
ATOM   5402 C C   . ALA B 1 154 ? 119.203 26.478 30.875  1.00 38.71  ? 155  ALA B C   1 
ATOM   5403 O O   . ALA B 1 154 ? 118.602 25.461 30.513  1.00 38.91  ? 155  ALA B O   1 
ATOM   5404 C CB  . ALA B 1 154 ? 121.412 26.915 29.763  1.00 35.87  ? 155  ALA B CB  1 
ATOM   5405 N N   . PHE B 1 155 ? 119.224 26.872 32.153  1.00 35.35  ? 156  PHE B N   1 
ATOM   5406 C CA  . PHE B 1 155 ? 118.590 26.060 33.193  1.00 33.29  ? 156  PHE B CA  1 
ATOM   5407 C C   . PHE B 1 155 ? 117.087 25.954 32.993  1.00 35.69  ? 156  PHE B C   1 
ATOM   5408 O O   . PHE B 1 155 ? 116.467 24.979 33.433  1.00 43.73  ? 156  PHE B O   1 
ATOM   5409 C CB  . PHE B 1 155 ? 118.900 26.636 34.579  1.00 32.91  ? 156  PHE B CB  1 
ATOM   5410 C CG  . PHE B 1 155 ? 120.330 27.061 34.737  1.00 39.68  ? 156  PHE B CG  1 
ATOM   5411 C CD1 . PHE B 1 155 ? 121.278 26.177 35.220  1.00 37.80  ? 156  PHE B CD1 1 
ATOM   5412 C CD2 . PHE B 1 155 ? 120.734 28.338 34.376  1.00 47.58  ? 156  PHE B CD2 1 
ATOM   5413 C CE1 . PHE B 1 155 ? 122.612 26.563 35.348  1.00 45.35  ? 156  PHE B CE1 1 
ATOM   5414 C CE2 . PHE B 1 155 ? 122.067 28.726 34.500  1.00 42.49  ? 156  PHE B CE2 1 
ATOM   5415 C CZ  . PHE B 1 155 ? 123.002 27.839 34.985  1.00 45.29  ? 156  PHE B CZ  1 
ATOM   5416 N N   . GLY B 1 156 ? 116.486 26.934 32.328  1.00 40.90  ? 157  GLY B N   1 
ATOM   5417 C CA  . GLY B 1 156 ? 115.051 26.929 32.156  1.00 34.03  ? 157  GLY B CA  1 
ATOM   5418 C C   . GLY B 1 156 ? 114.606 26.545 30.765  1.00 40.25  ? 157  GLY B C   1 
ATOM   5419 O O   . GLY B 1 156 ? 113.489 26.047 30.593  1.00 44.14  ? 157  GLY B O   1 
ATOM   5420 N N   . PHE B 1 157 ? 115.457 26.765 29.754  1.00 41.34  ? 158  PHE B N   1 
ATOM   5421 C CA  . PHE B 1 157 ? 114.984 26.627 28.381  1.00 39.22  ? 158  PHE B CA  1 
ATOM   5422 C C   . PHE B 1 157 ? 115.981 25.992 27.419  1.00 41.49  ? 158  PHE B C   1 
ATOM   5423 O O   . PHE B 1 157 ? 115.729 26.004 26.207  1.00 44.14  ? 158  PHE B O   1 
ATOM   5424 C CB  . PHE B 1 157 ? 114.549 27.993 27.844  1.00 39.34  ? 158  PHE B CB  1 
ATOM   5425 C CG  . PHE B 1 157 ? 113.453 28.618 28.644  1.00 40.01  ? 158  PHE B CG  1 
ATOM   5426 C CD1 . PHE B 1 157 ? 113.741 29.542 29.636  1.00 41.51  ? 158  PHE B CD1 1 
ATOM   5427 C CD2 . PHE B 1 157 ? 112.134 28.246 28.438  1.00 38.08  ? 158  PHE B CD2 1 
ATOM   5428 C CE1 . PHE B 1 157 ? 112.729 30.103 30.394  1.00 39.40  ? 158  PHE B CE1 1 
ATOM   5429 C CE2 . PHE B 1 157 ? 111.118 28.804 29.188  1.00 37.30  ? 158  PHE B CE2 1 
ATOM   5430 C CZ  . PHE B 1 157 ? 111.416 29.734 30.170  1.00 37.20  ? 158  PHE B CZ  1 
ATOM   5431 N N   . LEU B 1 158 ? 117.096 25.440 27.895  1.00 44.42  ? 159  LEU B N   1 
ATOM   5432 C CA  . LEU B 1 158 ? 117.932 24.641 27.010  1.00 51.65  ? 159  LEU B CA  1 
ATOM   5433 C C   . LEU B 1 158 ? 117.164 23.389 26.616  1.00 50.76  ? 159  LEU B C   1 
ATOM   5434 O O   . LEU B 1 158 ? 116.610 22.693 27.473  1.00 43.65  ? 159  LEU B O   1 
ATOM   5435 C CB  . LEU B 1 158 ? 119.268 24.281 27.667  1.00 47.19  ? 159  LEU B CB  1 
ATOM   5436 C CG  . LEU B 1 158 ? 120.178 23.325 26.879  1.00 49.11  ? 159  LEU B CG  1 
ATOM   5437 C CD1 . LEU B 1 158 ? 121.659 23.692 27.058  1.00 45.48  ? 159  LEU B CD1 1 
ATOM   5438 C CD2 . LEU B 1 158 ? 119.938 21.840 27.237  1.00 51.53  ? 159  LEU B CD2 1 
ATOM   5439 N N   . ALA B 1 159 ? 117.122 23.103 25.319  1.00 48.21  ? 160  ALA B N   1 
ATOM   5440 C CA  . ALA B 1 159 ? 116.292 22.022 24.810  1.00 47.74  ? 160  ALA B CA  1 
ATOM   5441 C C   . ALA B 1 159 ? 117.079 21.209 23.797  1.00 54.56  ? 160  ALA B C   1 
ATOM   5442 O O   . ALA B 1 159 ? 117.621 21.764 22.837  1.00 48.55  ? 160  ALA B O   1 
ATOM   5443 C CB  . ALA B 1 159 ? 115.008 22.569 24.180  1.00 44.11  ? 160  ALA B CB  1 
ATOM   5444 N N   . LEU B 1 160 ? 117.156 19.906 24.029  1.00 55.97  ? 161  LEU B N   1 
ATOM   5445 C CA  . LEU B 1 160 ? 117.504 18.958 22.983  1.00 59.00  ? 161  LEU B CA  1 
ATOM   5446 C C   . LEU B 1 160 ? 116.207 18.273 22.578  1.00 60.77  ? 161  LEU B C   1 
ATOM   5447 O O   . LEU B 1 160 ? 115.855 17.231 23.145  1.00 58.44  ? 161  LEU B O   1 
ATOM   5448 C CB  . LEU B 1 160 ? 118.546 17.944 23.460  1.00 57.04  ? 161  LEU B CB  1 
ATOM   5449 C CG  . LEU B 1 160 ? 119.969 18.471 23.646  1.00 55.77  ? 161  LEU B CG  1 
ATOM   5450 C CD1 . LEU B 1 160 ? 120.858 17.391 24.234  1.00 57.62  ? 161  LEU B CD1 1 
ATOM   5451 C CD2 . LEU B 1 160 ? 120.534 18.967 22.319  1.00 53.55  ? 161  LEU B CD2 1 
ATOM   5452 N N   . PRO B 1 161 ? 115.466 18.838 21.626  1.00 61.21  ? 162  PRO B N   1 
ATOM   5453 C CA  . PRO B 1 161 ? 114.095 18.375 21.373  1.00 60.15  ? 162  PRO B CA  1 
ATOM   5454 C C   . PRO B 1 161 ? 114.033 16.880 21.098  1.00 59.69  ? 162  PRO B C   1 
ATOM   5455 O O   . PRO B 1 161 ? 114.832 16.331 20.335  1.00 59.16  ? 162  PRO B O   1 
ATOM   5456 C CB  . PRO B 1 161 ? 113.669 19.197 20.153  1.00 60.64  ? 162  PRO B CB  1 
ATOM   5457 C CG  . PRO B 1 161 ? 114.518 20.423 20.213  1.00 62.46  ? 162  PRO B CG  1 
ATOM   5458 C CD  . PRO B 1 161 ? 115.842 19.956 20.744  1.00 62.20  ? 162  PRO B CD  1 
ATOM   5459 N N   . GLY B 1 162 ? 113.075 16.219 21.744  1.00 59.96  ? 163  GLY B N   1 
ATOM   5460 C CA  . GLY B 1 162 ? 112.951 14.784 21.703  1.00 62.05  ? 163  GLY B CA  1 
ATOM   5461 C C   . GLY B 1 162 ? 113.629 14.070 22.855  1.00 65.55  ? 163  GLY B C   1 
ATOM   5462 O O   . GLY B 1 162 ? 113.198 12.977 23.234  1.00 63.45  ? 163  GLY B O   1 
ATOM   5463 N N   . SER B 1 163 ? 114.678 14.661 23.422  1.00 66.69  ? 164  SER B N   1 
ATOM   5464 C CA  . SER B 1 163 ? 115.380 14.030 24.528  1.00 72.34  ? 164  SER B CA  1 
ATOM   5465 C C   . SER B 1 163 ? 114.565 14.137 25.810  1.00 73.04  ? 164  SER B C   1 
ATOM   5466 O O   . SER B 1 163 ? 113.744 15.042 25.982  1.00 75.96  ? 164  SER B O   1 
ATOM   5467 C CB  . SER B 1 163 ? 116.752 14.671 24.737  1.00 76.65  ? 164  SER B CB  1 
ATOM   5468 O OG  . SER B 1 163 ? 116.625 15.964 25.303  1.00 77.67  ? 164  SER B OG  1 
ATOM   5469 N N   . ARG B 1 164 ? 114.799 13.194 26.716  1.00 72.14  ? 165  ARG B N   1 
ATOM   5470 C CA  . ARG B 1 164 ? 114.138 13.209 28.011  1.00 71.98  ? 165  ARG B CA  1 
ATOM   5471 C C   . ARG B 1 164 ? 114.970 13.891 29.084  1.00 63.97  ? 165  ARG B C   1 
ATOM   5472 O O   . ARG B 1 164 ? 114.414 14.327 30.098  1.00 64.97  ? 165  ARG B O   1 
ATOM   5473 C CB  . ARG B 1 164 ? 113.812 11.781 28.449  1.00 81.97  ? 165  ARG B CB  1 
ATOM   5474 C CG  . ARG B 1 164 ? 112.409 11.602 28.994  1.00 93.69  ? 165  ARG B CG  1 
ATOM   5475 C CD  . ARG B 1 164 ? 112.127 10.134 29.261  1.00 103.06 ? 165  ARG B CD  1 
ATOM   5476 N NE  . ARG B 1 164 ? 112.528 9.299  28.133  1.00 109.32 ? 165  ARG B NE  1 
ATOM   5477 C CZ  . ARG B 1 164 ? 112.349 7.983  28.073  1.00 114.20 ? 165  ARG B CZ  1 
ATOM   5478 N NH1 . ARG B 1 164 ? 111.771 7.345  29.081  1.00 116.98 ? 165  ARG B NH1 1 
ATOM   5479 N NH2 . ARG B 1 164 ? 112.746 7.306  27.004  1.00 115.64 ? 165  ARG B NH2 1 
ATOM   5480 N N   . GLU B 1 165 ? 116.284 13.994 28.883  1.00 64.31  ? 166  GLU B N   1 
ATOM   5481 C CA  . GLU B 1 165 ? 117.151 14.654 29.848  1.00 66.73  ? 166  GLU B CA  1 
ATOM   5482 C C   . GLU B 1 165 ? 117.116 16.169 29.720  1.00 64.03  ? 166  GLU B C   1 
ATOM   5483 O O   . GLU B 1 165 ? 117.465 16.866 30.679  1.00 65.75  ? 166  GLU B O   1 
ATOM   5484 C CB  . GLU B 1 165 ? 118.592 14.158 29.694  1.00 75.41  ? 166  GLU B CB  1 
ATOM   5485 C CG  . GLU B 1 165 ? 118.762 12.645 29.800  1.00 86.44  ? 166  GLU B CG  1 
ATOM   5486 C CD  . GLU B 1 165 ? 118.504 11.923 28.489  1.00 98.75  ? 166  GLU B CD  1 
ATOM   5487 O OE1 . GLU B 1 165 ? 118.928 10.754 28.361  1.00 100.67 ? 166  GLU B OE1 1 
ATOM   5488 O OE2 . GLU B 1 165 ? 117.883 12.522 27.585  1.00 101.81 ? 166  GLU B OE2 1 
ATOM   5489 N N   . ALA B 1 166 ? 116.706 16.692 28.562  1.00 58.90  ? 167  ALA B N   1 
ATOM   5490 C CA  . ALA B 1 166 ? 116.580 18.136 28.356  1.00 55.83  ? 167  ALA B CA  1 
ATOM   5491 C C   . ALA B 1 166 ? 115.421 18.400 27.406  1.00 54.64  ? 167  ALA B C   1 
ATOM   5492 O O   . ALA B 1 166 ? 115.614 18.789 26.248  1.00 57.38  ? 167  ALA B O   1 
ATOM   5493 C CB  . ALA B 1 166 ? 117.883 18.723 27.815  1.00 56.87  ? 167  ALA B CB  1 
ATOM   5494 N N   . PRO B 1 167 ? 114.184 18.204 27.873  1.00 55.89  ? 168  PRO B N   1 
ATOM   5495 C CA  . PRO B 1 167 ? 113.030 18.366 26.974  1.00 53.11  ? 168  PRO B CA  1 
ATOM   5496 C C   . PRO B 1 167 ? 112.722 19.810 26.628  1.00 53.21  ? 168  PRO B C   1 
ATOM   5497 O O   . PRO B 1 167 ? 112.002 20.052 25.651  1.00 50.67  ? 168  PRO B O   1 
ATOM   5498 C CB  . PRO B 1 167 ? 111.881 17.730 27.764  1.00 53.80  ? 168  PRO B CB  1 
ATOM   5499 C CG  . PRO B 1 167 ? 112.270 17.941 29.195  1.00 53.71  ? 168  PRO B CG  1 
ATOM   5500 C CD  . PRO B 1 167 ? 113.774 17.840 29.242  1.00 53.74  ? 168  PRO B CD  1 
ATOM   5501 N N   . GLY B 1 168 ? 113.231 20.772 27.390  1.00 52.34  ? 169  GLY B N   1 
ATOM   5502 C CA  . GLY B 1 168 ? 112.952 22.169 27.144  1.00 47.01  ? 169  GLY B CA  1 
ATOM   5503 C C   . GLY B 1 168 ? 111.667 22.634 27.806  1.00 47.61  ? 169  GLY B C   1 
ATOM   5504 O O   . GLY B 1 168 ? 110.831 21.846 28.256  1.00 46.14  ? 169  GLY B O   1 
ATOM   5505 N N   . ASN B 1 169 ? 111.524 23.958 27.870  1.00 41.91  ? 170  ASN B N   1 
ATOM   5506 C CA  . ASN B 1 169 ? 110.356 24.650 28.407  1.00 36.96  ? 170  ASN B CA  1 
ATOM   5507 C C   . ASN B 1 169 ? 110.154 24.418 29.901  1.00 36.65  ? 170  ASN B C   1 
ATOM   5508 O O   . ASN B 1 169 ? 109.066 24.706 30.415  1.00 39.31  ? 170  ASN B O   1 
ATOM   5509 C CB  . ASN B 1 169 ? 109.072 24.259 27.665  1.00 31.98  ? 170  ASN B CB  1 
ATOM   5510 C CG  . ASN B 1 169 ? 109.058 24.746 26.232  1.00 44.14  ? 170  ASN B CG  1 
ATOM   5511 O OD1 . ASN B 1 169 ? 108.604 24.045 25.328  1.00 49.17  ? 170  ASN B OD1 1 
ATOM   5512 N ND2 . ASN B 1 169 ? 109.561 25.946 26.016  1.00 39.84  ? 170  ASN B ND2 1 
ATOM   5513 N N   . VAL B 1 170 ? 111.161 23.913 30.621  1.00 38.52  ? 171  VAL B N   1 
ATOM   5514 C CA  . VAL B 1 170 ? 110.936 23.589 32.028  1.00 43.25  ? 171  VAL B CA  1 
ATOM   5515 C C   . VAL B 1 170 ? 110.736 24.858 32.849  1.00 41.68  ? 171  VAL B C   1 
ATOM   5516 O O   . VAL B 1 170 ? 110.077 24.831 33.896  1.00 46.81  ? 171  VAL B O   1 
ATOM   5517 C CB  . VAL B 1 170 ? 112.081 22.716 32.583  1.00 43.23  ? 171  VAL B CB  1 
ATOM   5518 C CG1 . VAL B 1 170 ? 112.241 21.456 31.737  1.00 41.82  ? 171  VAL B CG1 1 
ATOM   5519 C CG2 . VAL B 1 170 ? 113.388 23.495 32.652  1.00 40.93  ? 171  VAL B CG2 1 
ATOM   5520 N N   . GLY B 1 171 ? 111.276 25.988 32.387  1.00 41.19  ? 172  GLY B N   1 
ATOM   5521 C CA  . GLY B 1 171 ? 110.995 27.252 33.048  1.00 36.91  ? 172  GLY B CA  1 
ATOM   5522 C C   . GLY B 1 171 ? 109.523 27.613 32.994  1.00 43.58  ? 172  GLY B C   1 
ATOM   5523 O O   . GLY B 1 171 ? 108.969 28.155 33.955  1.00 41.89  ? 172  GLY B O   1 
ATOM   5524 N N   . LEU B 1 172 ? 108.869 27.314 31.867  1.00 40.77  ? 173  LEU B N   1 
ATOM   5525 C CA  . LEU B 1 172 ? 107.422 27.474 31.783  1.00 40.93  ? 173  LEU B CA  1 
ATOM   5526 C C   . LEU B 1 172 ? 106.699 26.473 32.669  1.00 37.69  ? 173  LEU B C   1 
ATOM   5527 O O   . LEU B 1 172 ? 105.622 26.777 33.196  1.00 39.59  ? 173  LEU B O   1 
ATOM   5528 C CB  . LEU B 1 172 ? 106.953 27.320 30.337  1.00 35.49  ? 173  LEU B CB  1 
ATOM   5529 C CG  . LEU B 1 172 ? 107.342 28.433 29.368  1.00 39.89  ? 173  LEU B CG  1 
ATOM   5530 C CD1 . LEU B 1 172 ? 107.145 27.980 27.924  1.00 33.78  ? 173  LEU B CD1 1 
ATOM   5531 C CD2 . LEU B 1 172 ? 106.518 29.675 29.658  1.00 32.38  ? 173  LEU B CD2 1 
ATOM   5532 N N   . LEU B 1 173 ? 107.261 25.274 32.832  1.00 35.91  ? 174  LEU B N   1 
ATOM   5533 C CA  . LEU B 1 173 ? 106.656 24.302 33.734  1.00 40.24  ? 174  LEU B CA  1 
ATOM   5534 C C   . LEU B 1 173 ? 106.824 24.716 35.191  1.00 37.56  ? 174  LEU B C   1 
ATOM   5535 O O   . LEU B 1 173 ? 105.961 24.408 36.019  1.00 42.42  ? 174  LEU B O   1 
ATOM   5536 C CB  . LEU B 1 173 ? 107.250 22.914 33.483  1.00 42.27  ? 174  LEU B CB  1 
ATOM   5537 C CG  . LEU B 1 173 ? 106.938 22.331 32.099  1.00 48.81  ? 174  LEU B CG  1 
ATOM   5538 C CD1 . LEU B 1 173 ? 107.604 20.976 31.893  1.00 42.02  ? 174  LEU B CD1 1 
ATOM   5539 C CD2 . LEU B 1 173 ? 105.435 22.222 31.893  1.00 43.33  ? 174  LEU B CD2 1 
ATOM   5540 N N   . ASP B 1 174 ? 107.918 25.413 35.520  1.00 39.35  ? 175  ASP B N   1 
ATOM   5541 C CA  . ASP B 1 174 ? 108.038 26.033 36.838  1.00 39.32  ? 175  ASP B CA  1 
ATOM   5542 C C   . ASP B 1 174 ? 106.873 26.979 37.091  1.00 45.01  ? 175  ASP B C   1 
ATOM   5543 O O   . ASP B 1 174 ? 106.258 26.957 38.165  1.00 42.82  ? 175  ASP B O   1 
ATOM   5544 C CB  . ASP B 1 174 ? 109.358 26.798 36.960  1.00 34.39  ? 175  ASP B CB  1 
ATOM   5545 C CG  . ASP B 1 174 ? 110.575 25.902 36.861  1.00 41.12  ? 175  ASP B CG  1 
ATOM   5546 O OD1 . ASP B 1 174 ? 110.434 24.676 37.037  1.00 39.73  ? 175  ASP B OD1 1 
ATOM   5547 O OD2 . ASP B 1 174 ? 111.681 26.433 36.608  1.00 42.91  ? 175  ASP B OD2 1 
ATOM   5548 N N   . GLN B 1 175 ? 106.560 27.824 36.104  1.00 39.78  ? 176  GLN B N   1 
ATOM   5549 C CA  . GLN B 1 175 ? 105.441 28.749 36.245  1.00 39.16  ? 176  GLN B CA  1 
ATOM   5550 C C   . GLN B 1 175 ? 104.129 27.997 36.407  1.00 40.73  ? 176  GLN B C   1 
ATOM   5551 O O   . GLN B 1 175 ? 103.310 28.340 37.268  1.00 44.01  ? 176  GLN B O   1 
ATOM   5552 C CB  . GLN B 1 175 ? 105.374 29.681 35.036  1.00 35.65  ? 176  GLN B CB  1 
ATOM   5553 C CG  . GLN B 1 175 ? 106.596 30.567 34.848  1.00 35.58  ? 176  GLN B CG  1 
ATOM   5554 C CD  . GLN B 1 175 ? 106.547 31.342 33.540  1.00 37.75  ? 176  GLN B CD  1 
ATOM   5555 O OE1 . GLN B 1 175 ? 105.538 31.321 32.829  1.00 36.29  ? 176  GLN B OE1 1 
ATOM   5556 N NE2 . GLN B 1 175 ? 107.641 32.020 33.212  1.00 31.99  ? 176  GLN B NE2 1 
ATOM   5557 N N   . ARG B 1 176 ? 103.915 26.961 35.593  1.00 35.80  ? 177  ARG B N   1 
ATOM   5558 C CA  . ARG B 1 176 ? 102.674 26.201 35.680  1.00 41.00  ? 177  ARG B CA  1 
ATOM   5559 C C   . ARG B 1 176 ? 102.538 25.525 37.036  1.00 37.19  ? 177  ARG B C   1 
ATOM   5560 O O   . ARG B 1 176 ? 101.442 25.478 37.608  1.00 35.40  ? 177  ARG B O   1 
ATOM   5561 C CB  . ARG B 1 176 ? 102.609 25.163 34.560  1.00 31.52  ? 177  ARG B CB  1 
ATOM   5562 C CG  . ARG B 1 176 ? 101.591 24.063 34.820  1.00 38.03  ? 177  ARG B CG  1 
ATOM   5563 C CD  . ARG B 1 176 ? 101.495 23.119 33.646  1.00 37.07  ? 177  ARG B CD  1 
ATOM   5564 N NE  . ARG B 1 176 ? 101.133 23.822 32.424  1.00 40.55  ? 177  ARG B NE  1 
ATOM   5565 C CZ  . ARG B 1 176 ? 101.243 23.299 31.207  1.00 48.96  ? 177  ARG B CZ  1 
ATOM   5566 N NH1 . ARG B 1 176 ? 101.712 22.068 31.055  1.00 44.00  ? 177  ARG B NH1 1 
ATOM   5567 N NH2 . ARG B 1 176 ? 100.887 24.006 30.143  1.00 44.68  ? 177  ARG B NH2 1 
ATOM   5568 N N   . LEU B 1 177 ? 103.644 24.994 37.564  1.00 37.87  ? 178  LEU B N   1 
ATOM   5569 C CA  . LEU B 1 177 ? 103.603 24.349 38.871  1.00 43.76  ? 178  LEU B CA  1 
ATOM   5570 C C   . LEU B 1 177 ? 103.217 25.344 39.958  1.00 42.56  ? 178  LEU B C   1 
ATOM   5571 O O   . LEU B 1 177 ? 102.454 25.012 40.872  1.00 43.64  ? 178  LEU B O   1 
ATOM   5572 C CB  . LEU B 1 177 ? 104.956 23.704 39.177  1.00 37.38  ? 178  LEU B CB  1 
ATOM   5573 C CG  . LEU B 1 177 ? 105.054 22.969 40.515  1.00 42.20  ? 178  LEU B CG  1 
ATOM   5574 C CD1 . LEU B 1 177 ? 104.030 21.849 40.575  1.00 36.86  ? 178  LEU B CD1 1 
ATOM   5575 C CD2 . LEU B 1 177 ? 106.460 22.433 40.738  1.00 37.95  ? 178  LEU B CD2 1 
ATOM   5576 N N   . ALA B 1 178 ? 103.725 26.576 39.866  1.00 42.11  ? 179  ALA B N   1 
ATOM   5577 C CA  . ALA B 1 178 ? 103.317 27.617 40.804  1.00 35.75  ? 179  ALA B CA  1 
ATOM   5578 C C   . ALA B 1 178 ? 101.831 27.925 40.670  1.00 41.52  ? 179  ALA B C   1 
ATOM   5579 O O   . ALA B 1 178 ? 101.141 28.139 41.675  1.00 42.21  ? 179  ALA B O   1 
ATOM   5580 C CB  . ALA B 1 178 ? 104.153 28.879 40.583  1.00 33.57  ? 179  ALA B CB  1 
ATOM   5581 N N   . LEU B 1 179 ? 101.317 27.942 39.435  1.00 36.25  ? 180  LEU B N   1 
ATOM   5582 C CA  . LEU B 1 179 ? 99.891  28.182 39.229  1.00 37.91  ? 180  LEU B CA  1 
ATOM   5583 C C   . LEU B 1 179 ? 99.050  27.052 39.807  1.00 37.82  ? 180  LEU B C   1 
ATOM   5584 O O   . LEU B 1 179 ? 97.976  27.296 40.373  1.00 40.11  ? 180  LEU B O   1 
ATOM   5585 C CB  . LEU B 1 179 ? 99.597  28.363 37.741  1.00 40.51  ? 180  LEU B CB  1 
ATOM   5586 C CG  . LEU B 1 179 ? 100.219 29.617 37.128  1.00 42.07  ? 180  LEU B CG  1 
ATOM   5587 C CD1 . LEU B 1 179 ? 99.820  29.768 35.668  1.00 43.22  ? 180  LEU B CD1 1 
ATOM   5588 C CD2 . LEU B 1 179 ? 99.804  30.829 37.933  1.00 42.76  ? 180  LEU B CD2 1 
ATOM   5589 N N   . GLN B 1 180 ? 99.512  25.807 39.666  1.00 35.37  ? 181  GLN B N   1 
ATOM   5590 C CA  . GLN B 1 180 ? 98.838  24.697 40.329  1.00 35.99  ? 181  GLN B CA  1 
ATOM   5591 C C   . GLN B 1 180 ? 98.927  24.840 41.842  1.00 39.26  ? 181  GLN B C   1 
ATOM   5592 O O   . GLN B 1 180 ? 97.970  24.532 42.564  1.00 42.15  ? 181  GLN B O   1 
ATOM   5593 C CB  . GLN B 1 180 ? 99.444  23.368 39.875  1.00 41.69  ? 181  GLN B CB  1 
ATOM   5594 C CG  . GLN B 1 180 ? 99.350  23.119 38.375  1.00 54.26  ? 181  GLN B CG  1 
ATOM   5595 C CD  . GLN B 1 180 ? 100.166 21.917 37.921  1.00 61.15  ? 181  GLN B CD  1 
ATOM   5596 O OE1 . GLN B 1 180 ? 101.002 21.399 38.663  1.00 65.68  ? 181  GLN B OE1 1 
ATOM   5597 N NE2 . GLN B 1 180 ? 99.920  21.465 36.698  1.00 58.93  ? 181  GLN B NE2 1 
ATOM   5598 N N   . TRP B 1 181 ? 100.073 25.311 42.340  1.00 38.36  ? 182  TRP B N   1 
ATOM   5599 C CA  . TRP B 1 181 ? 100.217 25.557 43.770  1.00 42.64  ? 182  TRP B CA  1 
ATOM   5600 C C   . TRP B 1 181 ? 99.206  26.590 44.248  1.00 42.23  ? 182  TRP B C   1 
ATOM   5601 O O   . TRP B 1 181 ? 98.634  26.456 45.336  1.00 43.60  ? 182  TRP B O   1 
ATOM   5602 C CB  . TRP B 1 181 ? 101.644 26.015 44.075  1.00 35.90  ? 182  TRP B CB  1 
ATOM   5603 C CG  . TRP B 1 181 ? 101.968 26.109 45.537  1.00 43.21  ? 182  TRP B CG  1 
ATOM   5604 C CD1 . TRP B 1 181 ? 102.605 25.171 46.297  1.00 43.59  ? 182  TRP B CD1 1 
ATOM   5605 C CD2 . TRP B 1 181 ? 101.682 27.207 46.414  1.00 40.74  ? 182  TRP B CD2 1 
ATOM   5606 N NE1 . TRP B 1 181 ? 102.732 25.616 47.590  1.00 43.24  ? 182  TRP B NE1 1 
ATOM   5607 C CE2 . TRP B 1 181 ? 102.172 26.862 47.689  1.00 39.39  ? 182  TRP B CE2 1 
ATOM   5608 C CE3 . TRP B 1 181 ? 101.058 28.447 46.245  1.00 37.54  ? 182  TRP B CE3 1 
ATOM   5609 C CZ2 . TRP B 1 181 ? 102.056 27.710 48.786  1.00 37.37  ? 182  TRP B CZ2 1 
ATOM   5610 C CZ3 . TRP B 1 181 ? 100.945 29.287 47.336  1.00 36.48  ? 182  TRP B CZ3 1 
ATOM   5611 C CH2 . TRP B 1 181 ? 101.441 28.915 48.590  1.00 39.19  ? 182  TRP B CH2 1 
ATOM   5612 N N   . VAL B 1 182 ? 98.965  27.622 43.436  1.00 39.74  ? 183  VAL B N   1 
ATOM   5613 C CA  . VAL B 1 182 ? 97.987  28.647 43.792  1.00 40.85  ? 183  VAL B CA  1 
ATOM   5614 C C   . VAL B 1 182 ? 96.590  28.043 43.871  1.00 46.97  ? 183  VAL B C   1 
ATOM   5615 O O   . VAL B 1 182 ? 95.837  28.296 44.820  1.00 46.34  ? 183  VAL B O   1 
ATOM   5616 C CB  . VAL B 1 182 ? 98.052  29.814 42.791  1.00 36.36  ? 183  VAL B CB  1 
ATOM   5617 C CG1 . VAL B 1 182 ? 96.821  30.697 42.912  1.00 32.71  ? 183  VAL B CG1 1 
ATOM   5618 C CG2 . VAL B 1 182 ? 99.316  30.628 43.026  1.00 34.74  ? 183  VAL B CG2 1 
ATOM   5619 N N   . GLN B 1 183 ? 96.228  27.219 42.883  1.00 39.16  ? 184  GLN B N   1 
ATOM   5620 C CA  . GLN B 1 183 ? 94.920  26.569 42.904  1.00 45.49  ? 184  GLN B CA  1 
ATOM   5621 C C   . GLN B 1 183 ? 94.723  25.749 44.172  1.00 45.76  ? 184  GLN B C   1 
ATOM   5622 O O   . GLN B 1 183 ? 93.624  25.720 44.740  1.00 45.28  ? 184  GLN B O   1 
ATOM   5623 C CB  . GLN B 1 183 ? 94.749  25.683 41.668  1.00 43.42  ? 184  GLN B CB  1 
ATOM   5624 C CG  . GLN B 1 183 ? 94.434  26.452 40.395  1.00 44.11  ? 184  GLN B CG  1 
ATOM   5625 C CD  . GLN B 1 183 ? 93.156  27.261 40.509  1.00 43.56  ? 184  GLN B CD  1 
ATOM   5626 O OE1 . GLN B 1 183 ? 92.084  26.716 40.770  1.00 50.89  ? 184  GLN B OE1 1 
ATOM   5627 N NE2 . GLN B 1 183 ? 93.267  28.570 40.329  1.00 38.82  ? 184  GLN B NE2 1 
ATOM   5628 N N   . GLU B 1 184 ? 95.775  25.083 44.641  1.00 42.48  ? 185  GLU B N   1 
ATOM   5629 C CA  . GLU B 1 184 ? 95.637  24.173 45.768  1.00 45.82  ? 185  GLU B CA  1 
ATOM   5630 C C   . GLU B 1 184 ? 95.775  24.849 47.127  1.00 45.43  ? 185  GLU B C   1 
ATOM   5631 O O   . GLU B 1 184 ? 95.240  24.329 48.110  1.00 46.30  ? 185  GLU B O   1 
ATOM   5632 C CB  . GLU B 1 184 ? 96.667  23.045 45.658  1.00 54.44  ? 185  GLU B CB  1 
ATOM   5633 C CG  . GLU B 1 184 ? 96.507  22.191 44.411  1.00 68.89  ? 185  GLU B CG  1 
ATOM   5634 C CD  . GLU B 1 184 ? 97.526  21.070 44.331  1.00 80.49  ? 185  GLU B CD  1 
ATOM   5635 O OE1 . GLU B 1 184 ? 98.240  20.840 45.330  1.00 80.07  ? 185  GLU B OE1 1 
ATOM   5636 O OE2 . GLU B 1 184 ? 97.613  20.420 43.268  1.00 85.21  ? 185  GLU B OE2 1 
ATOM   5637 N N   . ASN B 1 185 ? 96.455  25.996 47.216  1.00 45.91  ? 186  ASN B N   1 
ATOM   5638 C CA  . ASN B 1 185 ? 96.827  26.545 48.513  1.00 46.53  ? 186  ASN B CA  1 
ATOM   5639 C C   . ASN B 1 185 ? 96.432  27.997 48.756  1.00 47.19  ? 186  ASN B C   1 
ATOM   5640 O O   . ASN B 1 185 ? 96.500  28.437 49.909  1.00 43.38  ? 186  ASN B O   1 
ATOM   5641 C CB  . ASN B 1 185 ? 98.345  26.422 48.725  1.00 43.60  ? 186  ASN B CB  1 
ATOM   5642 C CG  . ASN B 1 185 ? 98.811  24.984 48.756  1.00 42.76  ? 186  ASN B CG  1 
ATOM   5643 O OD1 . ASN B 1 185 ? 98.554  24.260 49.716  1.00 51.72  ? 186  ASN B OD1 1 
ATOM   5644 N ND2 . ASN B 1 185 ? 99.511  24.564 47.711  1.00 42.82  ? 186  ASN B ND2 1 
ATOM   5645 N N   . VAL B 1 186 ? 96.030  28.755 47.732  1.00 36.70  ? 187  VAL B N   1 
ATOM   5646 C CA  . VAL B 1 186 ? 95.846  30.189 47.932  1.00 37.79  ? 187  VAL B CA  1 
ATOM   5647 C C   . VAL B 1 186 ? 94.664  30.486 48.845  1.00 40.94  ? 187  VAL B C   1 
ATOM   5648 O O   . VAL B 1 186 ? 94.623  31.557 49.463  1.00 44.83  ? 187  VAL B O   1 
ATOM   5649 C CB  . VAL B 1 186 ? 95.697  30.929 46.585  1.00 39.00  ? 187  VAL B CB  1 
ATOM   5650 C CG1 . VAL B 1 186 ? 94.280  30.792 46.033  1.00 35.07  ? 187  VAL B CG1 1 
ATOM   5651 C CG2 . VAL B 1 186 ? 96.080  32.395 46.740  1.00 35.78  ? 187  VAL B CG2 1 
ATOM   5652 N N   . ALA B 1 187 ? 93.706  29.561 48.963  1.00 40.80  ? 188  ALA B N   1 
ATOM   5653 C CA  . ALA B 1 187 ? 92.584  29.774 49.873  1.00 42.39  ? 188  ALA B CA  1 
ATOM   5654 C C   . ALA B 1 187 ? 93.041  29.829 51.324  1.00 49.06  ? 188  ALA B C   1 
ATOM   5655 O O   . ALA B 1 187 ? 92.393  30.479 52.154  1.00 52.01  ? 188  ALA B O   1 
ATOM   5656 C CB  . ALA B 1 187 ? 91.535  28.676 49.695  1.00 36.65  ? 188  ALA B CB  1 
ATOM   5657 N N   . ALA B 1 188 ? 94.146  29.153 51.651  1.00 44.60  ? 189  ALA B N   1 
ATOM   5658 C CA  . ALA B 1 188 ? 94.674  29.203 53.009  1.00 49.23  ? 189  ALA B CA  1 
ATOM   5659 C C   . ALA B 1 188 ? 95.124  30.606 53.391  1.00 48.95  ? 189  ALA B C   1 
ATOM   5660 O O   . ALA B 1 188 ? 95.209  30.918 54.584  1.00 46.12  ? 189  ALA B O   1 
ATOM   5661 C CB  . ALA B 1 188 ? 95.837  28.219 53.158  1.00 44.11  ? 189  ALA B CB  1 
ATOM   5662 N N   . PHE B 1 189 ? 95.404  31.454 52.405  1.00 43.13  ? 190  PHE B N   1 
ATOM   5663 C CA  . PHE B 1 189 ? 95.789  32.840 52.629  1.00 45.68  ? 190  PHE B CA  1 
ATOM   5664 C C   . PHE B 1 189 ? 94.623  33.805 52.475  1.00 46.49  ? 190  PHE B C   1 
ATOM   5665 O O   . PHE B 1 189 ? 94.816  35.016 52.621  1.00 47.41  ? 190  PHE B O   1 
ATOM   5666 C CB  . PHE B 1 189 ? 96.908  33.236 51.658  1.00 40.81  ? 190  PHE B CB  1 
ATOM   5667 C CG  . PHE B 1 189 ? 98.137  32.381 51.765  1.00 41.47  ? 190  PHE B CG  1 
ATOM   5668 C CD1 . PHE B 1 189 ? 98.239  31.199 51.048  1.00 36.72  ? 190  PHE B CD1 1 
ATOM   5669 C CD2 . PHE B 1 189 ? 99.194  32.762 52.577  1.00 43.85  ? 190  PHE B CD2 1 
ATOM   5670 C CE1 . PHE B 1 189 ? 99.369  30.410 51.144  1.00 41.62  ? 190  PHE B CE1 1 
ATOM   5671 C CE2 . PHE B 1 189 ? 100.327 31.978 52.675  1.00 43.62  ? 190  PHE B CE2 1 
ATOM   5672 C CZ  . PHE B 1 189 ? 100.415 30.801 51.957  1.00 42.86  ? 190  PHE B CZ  1 
ATOM   5673 N N   . GLY B 1 190 ? 93.423  33.303 52.185  1.00 43.68  ? 191  GLY B N   1 
ATOM   5674 C CA  . GLY B 1 190 ? 92.288  34.149 51.888  1.00 49.04  ? 191  GLY B CA  1 
ATOM   5675 C C   . GLY B 1 190 ? 92.064  34.425 50.414  1.00 51.82  ? 191  GLY B C   1 
ATOM   5676 O O   . GLY B 1 190 ? 91.152  35.191 50.074  1.00 49.16  ? 191  GLY B O   1 
ATOM   5677 N N   . GLY B 1 191 ? 92.862  33.829 49.529  1.00 46.55  ? 192  GLY B N   1 
ATOM   5678 C CA  . GLY B 1 191 ? 92.687  34.054 48.111  1.00 46.11  ? 192  GLY B CA  1 
ATOM   5679 C C   . GLY B 1 191 ? 91.592  33.193 47.509  1.00 46.44  ? 192  GLY B C   1 
ATOM   5680 O O   . GLY B 1 191 ? 91.220  32.145 48.035  1.00 52.69  ? 192  GLY B O   1 
ATOM   5681 N N   . ASP B 1 192 ? 91.070  33.658 46.375  1.00 45.47  ? 193  ASP B N   1 
ATOM   5682 C CA  . ASP B 1 192 ? 90.015  32.957 45.660  1.00 48.25  ? 193  ASP B CA  1 
ATOM   5683 C C   . ASP B 1 192 ? 90.621  32.235 44.467  1.00 48.23  ? 193  ASP B C   1 
ATOM   5684 O O   . ASP B 1 192 ? 90.946  32.888 43.466  1.00 44.30  ? 193  ASP B O   1 
ATOM   5685 C CB  . ASP B 1 192 ? 88.942  33.942 45.198  1.00 47.71  ? 193  ASP B CB  1 
ATOM   5686 C CG  . ASP B 1 192 ? 87.750  33.258 44.545  1.00 53.77  ? 193  ASP B CG  1 
ATOM   5687 O OD1 . ASP B 1 192 ? 87.768  32.019 44.379  1.00 58.87  ? 193  ASP B OD1 1 
ATOM   5688 O OD2 . ASP B 1 192 ? 86.789  33.972 44.187  1.00 58.18  ? 193  ASP B OD2 1 
ATOM   5689 N N   . PRO B 1 193 ? 90.777  30.908 44.507  1.00 45.79  ? 194  PRO B N   1 
ATOM   5690 C CA  . PRO B 1 193 ? 91.338  30.198 43.345  1.00 45.08  ? 194  PRO B CA  1 
ATOM   5691 C C   . PRO B 1 193 ? 90.458  30.255 42.105  1.00 51.37  ? 194  PRO B C   1 
ATOM   5692 O O   . PRO B 1 193 ? 90.941  29.912 41.017  1.00 46.41  ? 194  PRO B O   1 
ATOM   5693 C CB  . PRO B 1 193 ? 91.487  28.757 43.850  1.00 47.50  ? 194  PRO B CB  1 
ATOM   5694 C CG  . PRO B 1 193 ? 90.466  28.636 44.941  1.00 46.86  ? 194  PRO B CG  1 
ATOM   5695 C CD  . PRO B 1 193 ? 90.424  29.989 45.604  1.00 41.84  ? 194  PRO B CD  1 
ATOM   5696 N N   . THR B 1 194 ? 89.197  30.669 42.224  1.00 50.29  ? 195  THR B N   1 
ATOM   5697 C CA  . THR B 1 194 ? 88.316  30.815 41.072  1.00 50.26  ? 195  THR B CA  1 
ATOM   5698 C C   . THR B 1 194 ? 88.394  32.202 40.443  1.00 49.79  ? 195  THR B C   1 
ATOM   5699 O O   . THR B 1 194 ? 87.597  32.508 39.551  1.00 55.97  ? 195  THR B O   1 
ATOM   5700 C CB  . THR B 1 194 ? 86.864  30.515 41.459  1.00 48.31  ? 195  THR B CB  1 
ATOM   5701 O OG1 . THR B 1 194 ? 86.291  31.661 42.099  1.00 49.39  ? 195  THR B OG1 1 
ATOM   5702 C CG2 . THR B 1 194 ? 86.790  29.318 42.403  1.00 47.93  ? 195  THR B CG2 1 
ATOM   5703 N N   . SER B 1 195 ? 89.339  33.049 40.883  1.00 46.68  ? 196  SER B N   1 
ATOM   5704 C CA  . SER B 1 195 ? 89.516  34.394 40.326  1.00 47.53  ? 196  SER B CA  1 
ATOM   5705 C C   . SER B 1 195 ? 91.015  34.702 40.316  1.00 47.24  ? 196  SER B C   1 
ATOM   5706 O O   . SER B 1 195 ? 91.523  35.463 41.144  1.00 47.67  ? 196  SER B O   1 
ATOM   5707 C CB  . SER B 1 195 ? 88.729  35.437 41.117  1.00 50.29  ? 196  SER B CB  1 
ATOM   5708 O OG  . SER B 1 195 ? 88.874  36.724 40.540  1.00 57.86  ? 196  SER B OG  1 
ATOM   5709 N N   . VAL B 1 196 ? 91.724  34.111 39.359  1.00 39.80  ? 197  VAL B N   1 
ATOM   5710 C CA  . VAL B 1 196 ? 93.168  34.260 39.232  1.00 36.54  ? 197  VAL B CA  1 
ATOM   5711 C C   . VAL B 1 196 ? 93.463  35.013 37.943  1.00 42.23  ? 197  VAL B C   1 
ATOM   5712 O O   . VAL B 1 196 ? 93.098  34.562 36.849  1.00 42.07  ? 197  VAL B O   1 
ATOM   5713 C CB  . VAL B 1 196 ? 93.882  32.901 39.255  1.00 36.62  ? 197  VAL B CB  1 
ATOM   5714 C CG1 . VAL B 1 196 ? 95.365  33.078 38.961  1.00 36.96  ? 197  VAL B CG1 1 
ATOM   5715 C CG2 . VAL B 1 196 ? 93.682  32.225 40.605  1.00 35.86  ? 197  VAL B CG2 1 
ATOM   5716 N N   . THR B 1 197 ? 94.128  36.156 38.071  1.00 38.90  ? 198  THR B N   1 
ATOM   5717 C CA  . THR B 1 197 ? 94.519  36.980 36.936  1.00 35.91  ? 198  THR B CA  1 
ATOM   5718 C C   . THR B 1 197 ? 96.036  36.945 36.807  1.00 38.82  ? 198  THR B C   1 
ATOM   5719 O O   . THR B 1 197 ? 96.750  37.352 37.730  1.00 39.96  ? 198  THR B O   1 
ATOM   5720 C CB  . THR B 1 197 ? 94.030  38.419 37.107  1.00 40.86  ? 198  THR B CB  1 
ATOM   5721 O OG1 . THR B 1 197 ? 92.598  38.437 37.192  1.00 42.45  ? 198  THR B OG1 1 
ATOM   5722 C CG2 . THR B 1 197 ? 94.483  39.286 35.936  1.00 35.39  ? 198  THR B CG2 1 
ATOM   5723 N N   . LEU B 1 198 ? 96.524  36.446 35.676  1.00 36.83  ? 199  LEU B N   1 
ATOM   5724 C CA  . LEU B 1 198 ? 97.946  36.513 35.380  1.00 36.12  ? 199  LEU B CA  1 
ATOM   5725 C C   . LEU B 1 198 ? 98.288  37.870 34.787  1.00 38.80  ? 199  LEU B C   1 
ATOM   5726 O O   . LEU B 1 198 ? 97.547  38.406 33.959  1.00 44.26  ? 199  LEU B O   1 
ATOM   5727 C CB  . LEU B 1 198 ? 98.354  35.421 34.390  1.00 38.65  ? 199  LEU B CB  1 
ATOM   5728 C CG  . LEU B 1 198 ? 98.125  33.951 34.722  1.00 42.65  ? 199  LEU B CG  1 
ATOM   5729 C CD1 . LEU B 1 198 ? 98.665  33.065 33.600  1.00 36.39  ? 199  LEU B CD1 1 
ATOM   5730 C CD2 . LEU B 1 198 ? 98.787  33.615 36.031  1.00 45.57  ? 199  LEU B CD2 1 
ATOM   5731 N N   . PHE B 1 199 ? 99.408  38.434 35.225  1.00 33.94  ? 200  PHE B N   1 
ATOM   5732 C CA  . PHE B 1 199 ? 99.962  39.613 34.581  1.00 35.94  ? 200  PHE B CA  1 
ATOM   5733 C C   . PHE B 1 199 ? 101.478 39.525 34.609  1.00 37.90  ? 200  PHE B C   1 
ATOM   5734 O O   . PHE B 1 199 ? 102.068 39.044 35.579  1.00 45.79  ? 200  PHE B O   1 
ATOM   5735 C CB  . PHE B 1 199 ? 99.462  40.935 35.209  1.00 35.50  ? 200  PHE B CB  1 
ATOM   5736 C CG  . PHE B 1 199 ? 99.952  41.218 36.611  1.00 38.21  ? 200  PHE B CG  1 
ATOM   5737 C CD1 . PHE B 1 199 ? 100.384 42.495 36.945  1.00 39.86  ? 200  PHE B CD1 1 
ATOM   5738 C CD2 . PHE B 1 199 ? 99.916  40.254 37.604  1.00 37.19  ? 200  PHE B CD2 1 
ATOM   5739 C CE1 . PHE B 1 199 ? 100.812 42.794 38.230  1.00 42.52  ? 200  PHE B CE1 1 
ATOM   5740 C CE2 . PHE B 1 199 ? 100.343 40.546 38.894  1.00 39.53  ? 200  PHE B CE2 1 
ATOM   5741 C CZ  . PHE B 1 199 ? 100.791 41.816 39.206  1.00 39.49  ? 200  PHE B CZ  1 
ATOM   5742 N N   . GLY B 1 200 ? 102.095 39.957 33.515  1.00 40.81  ? 201  GLY B N   1 
ATOM   5743 C CA  . GLY B 1 200 ? 103.534 39.890 33.355  1.00 39.82  ? 201  GLY B CA  1 
ATOM   5744 C C   . GLY B 1 200 ? 103.964 40.883 32.302  1.00 38.69  ? 201  GLY B C   1 
ATOM   5745 O O   . GLY B 1 200 ? 103.148 41.429 31.556  1.00 40.89  ? 201  GLY B O   1 
ATOM   5746 N N   . GLU B 1 201 ? 105.269 41.122 32.252  1.00 37.90  ? 202  GLU B N   1 
ATOM   5747 C CA  . GLU B 1 201 ? 105.815 42.160 31.394  1.00 42.41  ? 202  GLU B CA  1 
ATOM   5748 C C   . GLU B 1 201 ? 106.978 41.587 30.597  1.00 42.18  ? 202  GLU B C   1 
ATOM   5749 O O   . GLU B 1 201 ? 107.771 40.801 31.124  1.00 36.97  ? 202  GLU B O   1 
ATOM   5750 C CB  . GLU B 1 201 ? 106.249 43.391 32.226  1.00 35.95  ? 202  GLU B CB  1 
ATOM   5751 C CG  . GLU B 1 201 ? 106.724 44.598 31.411  1.00 32.34  ? 202  GLU B CG  1 
ATOM   5752 C CD  . GLU B 1 201 ? 108.218 44.554 31.153  1.00 48.37  ? 202  GLU B CD  1 
ATOM   5753 O OE1 . GLU B 1 201 ? 108.739 45.430 30.442  1.00 53.22  ? 202  GLU B OE1 1 
ATOM   5754 O OE2 . GLU B 1 201 ? 108.876 43.646 31.677  1.00 44.97  ? 202  GLU B OE2 1 
ATOM   5755 N N   . SER B 1 202 ? 107.061 41.969 29.320  1.00 40.37  ? 203  SER B N   1 
ATOM   5756 C CA  . SER B 1 202 ? 108.106 41.512 28.393  1.00 37.32  ? 203  SER B CA  1 
ATOM   5757 C C   . SER B 1 202 ? 108.066 39.988 28.325  1.00 36.66  ? 203  SER B C   1 
ATOM   5758 O O   . SER B 1 202 ? 107.010 39.434 27.971  1.00 39.52  ? 203  SER B O   1 
ATOM   5759 C CB  . SER B 1 202 ? 109.441 42.128 28.816  1.00 42.76  ? 203  SER B CB  1 
ATOM   5760 O OG  . SER B 1 202 ? 110.435 41.934 27.823  1.00 51.23  ? 203  SER B OG  1 
ATOM   5761 N N   . ALA B 1 203 ? 109.156 39.274 28.630  1.00 30.63  ? 204  ALA B N   1 
ATOM   5762 C CA  . ALA B 1 203 ? 109.119 37.812 28.594  1.00 31.57  ? 204  ALA B CA  1 
ATOM   5763 C C   . ALA B 1 203 ? 108.072 37.249 29.545  1.00 36.42  ? 204  ALA B C   1 
ATOM   5764 O O   . ALA B 1 203 ? 107.552 36.151 29.314  1.00 36.63  ? 204  ALA B O   1 
ATOM   5765 C CB  . ALA B 1 203 ? 110.496 37.237 28.927  1.00 32.47  ? 204  ALA B CB  1 
ATOM   5766 N N   . GLY B 1 204 ? 107.754 37.973 30.620  1.00 37.77  ? 205  GLY B N   1 
ATOM   5767 C CA  . GLY B 1 204 ? 106.647 37.562 31.467  1.00 32.61  ? 205  GLY B CA  1 
ATOM   5768 C C   . GLY B 1 204 ? 105.309 37.661 30.759  1.00 34.98  ? 205  GLY B C   1 
ATOM   5769 O O   . GLY B 1 204 ? 104.431 36.812 30.950  1.00 34.27  ? 205  GLY B O   1 
ATOM   5770 N N   . ALA B 1 205 ? 105.131 38.699 29.937  1.00 36.05  ? 206  ALA B N   1 
ATOM   5771 C CA  . ALA B 1 205 ? 103.905 38.822 29.155  1.00 33.73  ? 206  ALA B CA  1 
ATOM   5772 C C   . ALA B 1 205 ? 103.835 37.736 28.089  1.00 36.74  ? 206  ALA B C   1 
ATOM   5773 O O   . ALA B 1 205 ? 102.783 37.116 27.883  1.00 35.64  ? 206  ALA B O   1 
ATOM   5774 C CB  . ALA B 1 205 ? 103.825 40.212 28.521  1.00 36.65  ? 206  ALA B CB  1 
ATOM   5775 N N   . ALA B 1 206 ? 104.950 37.495 27.396  1.00 33.12  ? 207  ALA B N   1 
ATOM   5776 C CA  . ALA B 1 206 ? 105.016 36.365 26.477  1.00 34.00  ? 207  ALA B CA  1 
ATOM   5777 C C   . ALA B 1 206 ? 104.715 35.058 27.198  1.00 43.02  ? 207  ALA B C   1 
ATOM   5778 O O   . ALA B 1 206 ? 103.981 34.207 26.679  1.00 39.76  ? 207  ALA B O   1 
ATOM   5779 C CB  . ALA B 1 206 ? 106.391 36.312 25.816  1.00 32.56  ? 207  ALA B CB  1 
ATOM   5780 N N   . SER B 1 207 ? 105.266 34.888 28.404  1.00 34.66  ? 208  SER B N   1 
ATOM   5781 C CA  . SER B 1 207 ? 104.984 33.701 29.206  1.00 37.67  ? 208  SER B CA  1 
ATOM   5782 C C   . SER B 1 207 ? 103.491 33.576 29.474  1.00 39.23  ? 208  SER B C   1 
ATOM   5783 O O   . SER B 1 207 ? 102.910 32.487 29.375  1.00 38.45  ? 208  SER B O   1 
ATOM   5784 C CB  . SER B 1 207 ? 105.755 33.773 30.529  1.00 31.54  ? 208  SER B CB  1 
ATOM   5785 O OG  . SER B 1 207 ? 107.130 33.504 30.350  1.00 47.34  ? 208  SER B OG  1 
ATOM   5786 N N   . VAL B 1 208 ? 102.851 34.679 29.793  1.00 33.66  ? 209  VAL B N   1 
ATOM   5787 C CA  . VAL B 1 208 ? 101.436 34.681 30.024  1.00 37.65  ? 209  VAL B CA  1 
ATOM   5788 C C   . VAL B 1 208 ? 100.745 34.276 28.733  1.00 45.70  ? 209  VAL B C   1 
ATOM   5789 O O   . VAL B 1 208 ? 99.801  33.520 28.752  1.00 47.43  ? 209  VAL B O   1 
ATOM   5790 C CB  . VAL B 1 208 ? 100.939 36.061 30.464  1.00 35.00  ? 209  VAL B CB  1 
ATOM   5791 C CG1 . VAL B 1 208 ? 99.442  36.141 30.445  1.00 32.76  ? 209  VAL B CG1 1 
ATOM   5792 C CG2 . VAL B 1 208 ? 101.451 36.417 31.830  1.00 39.60  ? 209  VAL B CG2 1 
ATOM   5793 N N   . GLY B 1 209 ? 101.236 34.778 27.607  1.00 39.71  ? 210  GLY B N   1 
ATOM   5794 C CA  . GLY B 1 209 ? 100.590 34.413 26.360  1.00 36.69  ? 210  GLY B CA  1 
ATOM   5795 C C   . GLY B 1 209 ? 100.582 32.917 26.119  1.00 34.11  ? 210  GLY B C   1 
ATOM   5796 O O   . GLY B 1 209 ? 99.628  32.381 25.552  1.00 35.65  ? 210  GLY B O   1 
ATOM   5797 N N   . MET B 1 210 ? 101.661 32.280 26.525  1.00 35.08  ? 211  MET B N   1 
ATOM   5798 C CA  . MET B 1 210 ? 101.853 30.865 26.385  1.00 39.39  ? 211  MET B CA  1 
ATOM   5799 C C   . MET B 1 210 ? 100.934 29.947 27.185  1.00 42.09  ? 211  MET B C   1 
ATOM   5800 O O   . MET B 1 210 ? 100.501 28.978 26.673  1.00 41.31  ? 211  MET B O   1 
ATOM   5801 C CB  . MET B 1 210 ? 103.318 30.517 26.522  1.00 42.42  ? 211  MET B CB  1 
ATOM   5802 C CG  . MET B 1 210 ? 104.117 31.096 25.386  1.00 51.95  ? 211  MET B CG  1 
ATOM   5803 S SD  . MET B 1 210 ? 105.861 30.839 25.451  1.00 51.80  ? 211  MET B SD  1 
ATOM   5804 C CE  . MET B 1 210 ? 106.405 32.253 24.556  1.00 43.63  ? 211  MET B CE  1 
ATOM   5805 N N   . HIS B 1 211 ? 100.655 30.261 28.431  1.00 33.54  ? 212  HIS B N   1 
ATOM   5806 C CA  . HIS B 1 211 ? 99.697  29.515 29.249  1.00 35.17  ? 212  HIS B CA  1 
ATOM   5807 C C   . HIS B 1 211 ? 98.285  29.614 28.676  1.00 32.68  ? 212  HIS B C   1 
ATOM   5808 O O   . HIS B 1 211 ? 97.490  28.678 28.809  1.00 43.28  ? 212  HIS B O   1 
ATOM   5809 C CB  . HIS B 1 211 ? 99.729  30.038 30.689  1.00 34.48  ? 212  HIS B CB  1 
ATOM   5810 C CG  . HIS B 1 211 ? 101.046 29.843 31.372  1.00 35.73  ? 212  HIS B CG  1 
ATOM   5811 N ND1 . HIS B 1 211 ? 101.527 28.598 31.721  1.00 35.91  ? 212  HIS B ND1 1 
ATOM   5812 C CD2 . HIS B 1 211 ? 101.985 30.734 31.769  1.00 33.20  ? 212  HIS B CD2 1 
ATOM   5813 C CE1 . HIS B 1 211 ? 102.709 28.731 32.296  1.00 34.48  ? 212  HIS B CE1 1 
ATOM   5814 N NE2 . HIS B 1 211 ? 103.009 30.017 32.339  1.00 34.18  ? 212  HIS B NE2 1 
ATOM   5815 N N   . LEU B 1 212 ? 97.958  30.754 28.056  1.00 44.62  ? 213  LEU B N   1 
ATOM   5816 C CA  . LEU B 1 212 ? 96.697  30.928 27.342  1.00 48.12  ? 213  LEU B CA  1 
ATOM   5817 C C   . LEU B 1 212 ? 96.589  29.974 26.169  1.00 43.22  ? 213  LEU B C   1 
ATOM   5818 O O   . LEU B 1 212 ? 95.489  29.533 25.824  1.00 47.41  ? 213  LEU B O   1 
ATOM   5819 C CB  . LEU B 1 212 ? 96.575  32.366 26.831  1.00 48.94  ? 213  LEU B CB  1 
ATOM   5820 C CG  . LEU B 1 212 ? 96.002  33.466 27.723  1.00 58.81  ? 213  LEU B CG  1 
ATOM   5821 C CD1 . LEU B 1 212 ? 96.045  34.804 26.994  1.00 60.88  ? 213  LEU B CD1 1 
ATOM   5822 C CD2 . LEU B 1 212 ? 94.580  33.135 28.132  1.00 55.69  ? 213  LEU B CD2 1 
ATOM   5823 N N   . LEU B 1 213 ? 97.715  29.669 25.530  1.00 38.44  ? 214  LEU B N   1 
ATOM   5824 C CA  . LEU B 1 213 ? 97.738  28.828 24.347  1.00 43.18  ? 214  LEU B CA  1 
ATOM   5825 C C   . LEU B 1 213 ? 98.085  27.383 24.668  1.00 46.91  ? 214  LEU B C   1 
ATOM   5826 O O   . LEU B 1 213 ? 98.159  26.559 23.751  1.00 46.97  ? 214  LEU B O   1 
ATOM   5827 C CB  . LEU B 1 213 ? 98.729  29.399 23.326  1.00 40.10  ? 214  LEU B CB  1 
ATOM   5828 C CG  . LEU B 1 213 ? 98.475  30.865 22.958  1.00 41.65  ? 214  LEU B CG  1 
ATOM   5829 C CD1 . LEU B 1 213 ? 99.555  31.394 22.028  1.00 41.11  ? 214  LEU B CD1 1 
ATOM   5830 C CD2 . LEU B 1 213 ? 97.093  31.040 22.335  1.00 38.98  ? 214  LEU B CD2 1 
ATOM   5831 N N   . SER B 1 214 ? 98.292  27.059 25.940  1.00 46.43  ? 215  SER B N   1 
ATOM   5832 C CA  . SER B 1 214 ? 98.585  25.693 26.371  1.00 41.65  ? 215  SER B CA  1 
ATOM   5833 C C   . SER B 1 214 ? 97.447  25.200 27.254  1.00 49.54  ? 215  SER B C   1 
ATOM   5834 O O   . SER B 1 214 ? 97.254  25.733 28.365  1.00 45.57  ? 215  SER B O   1 
ATOM   5835 C CB  . SER B 1 214 ? 99.918  25.631 27.115  1.00 42.02  ? 215  SER B CB  1 
ATOM   5836 O OG  . SER B 1 214 ? 100.319 24.290 27.331  1.00 46.67  ? 215  SER B OG  1 
ATOM   5837 N N   . PRO B 1 215 ? 96.680  24.206 26.813  1.00 49.65  ? 216  PRO B N   1 
ATOM   5838 C CA  . PRO B 1 215 ? 95.463  23.794 27.540  1.00 48.38  ? 216  PRO B CA  1 
ATOM   5839 C C   . PRO B 1 215 ? 95.724  23.391 28.984  1.00 49.11  ? 216  PRO B C   1 
ATOM   5840 O O   . PRO B 1 215 ? 94.910  23.727 29.858  1.00 46.29  ? 216  PRO B O   1 
ATOM   5841 C CB  . PRO B 1 215 ? 94.945  22.611 26.708  1.00 50.76  ? 216  PRO B CB  1 
ATOM   5842 C CG  . PRO B 1 215 ? 95.412  22.918 25.322  1.00 51.06  ? 216  PRO B CG  1 
ATOM   5843 C CD  . PRO B 1 215 ? 96.761  23.585 25.478  1.00 52.75  ? 216  PRO B CD  1 
ATOM   5844 N N   . PRO B 1 216 ? 96.806  22.659 29.299  1.00 50.98  ? 217  PRO B N   1 
ATOM   5845 C CA  . PRO B 1 216 ? 97.028  22.319 30.719  1.00 50.51  ? 217  PRO B CA  1 
ATOM   5846 C C   . PRO B 1 216 ? 97.168  23.530 31.627  1.00 54.60  ? 217  PRO B C   1 
ATOM   5847 O O   . PRO B 1 216 ? 96.880  23.429 32.826  1.00 56.12  ? 217  PRO B O   1 
ATOM   5848 C CB  . PRO B 1 216 ? 98.318  21.488 30.687  1.00 46.32  ? 217  PRO B CB  1 
ATOM   5849 C CG  . PRO B 1 216 ? 98.341  20.899 29.331  1.00 46.54  ? 217  PRO B CG  1 
ATOM   5850 C CD  . PRO B 1 216 ? 97.781  21.960 28.436  1.00 45.86  ? 217  PRO B CD  1 
ATOM   5851 N N   . SER B 1 217 ? 97.600  24.675 31.101  1.00 53.97  ? 218  SER B N   1 
ATOM   5852 C CA  . SER B 1 217 ? 97.693  25.884 31.910  1.00 51.25  ? 218  SER B CA  1 
ATOM   5853 C C   . SER B 1 217 ? 96.407  26.695 31.908  1.00 51.16  ? 218  SER B C   1 
ATOM   5854 O O   . SER B 1 217 ? 96.157  27.446 32.858  1.00 44.27  ? 218  SER B O   1 
ATOM   5855 C CB  . SER B 1 217 ? 98.834  26.773 31.410  1.00 42.98  ? 218  SER B CB  1 
ATOM   5856 O OG  . SER B 1 217 ? 100.101 26.168 31.595  1.00 46.01  ? 218  SER B OG  1 
ATOM   5857 N N   . ARG B 1 218 ? 95.584  26.545 30.866  1.00 49.02  ? 219  ARG B N   1 
ATOM   5858 C CA  A ARG B 1 218 ? 94.408  27.394 30.720  0.59 51.05  ? 219  ARG B CA  1 
ATOM   5859 C CA  B ARG B 1 218 ? 94.397  27.382 30.715  0.41 50.67  ? 219  ARG B CA  1 
ATOM   5860 C C   . ARG B 1 218 ? 93.439  27.239 31.887  1.00 48.67  ? 219  ARG B C   1 
ATOM   5861 O O   . ARG B 1 218 ? 92.773  28.208 32.267  1.00 52.55  ? 219  ARG B O   1 
ATOM   5862 C CB  A ARG B 1 218 ? 93.706  27.088 29.396  0.59 51.15  ? 219  ARG B CB  1 
ATOM   5863 C CB  B ARG B 1 218 ? 93.677  27.041 29.411  0.41 50.91  ? 219  ARG B CB  1 
ATOM   5864 C CG  A ARG B 1 218 ? 92.564  28.031 29.068  0.59 49.13  ? 219  ARG B CG  1 
ATOM   5865 C CG  B ARG B 1 218 ? 94.143  27.863 28.239  0.41 46.39  ? 219  ARG B CG  1 
ATOM   5866 C CD  A ARG B 1 218 ? 93.041  29.471 28.992  0.59 48.91  ? 219  ARG B CD  1 
ATOM   5867 C CD  B ARG B 1 218 ? 93.834  29.330 28.470  0.41 47.86  ? 219  ARG B CD  1 
ATOM   5868 N NE  A ARG B 1 218 ? 91.930  30.398 28.801  0.59 48.09  ? 219  ARG B NE  1 
ATOM   5869 N NE  B ARG B 1 218 ? 92.481  29.688 28.059  0.41 50.34  ? 219  ARG B NE  1 
ATOM   5870 C CZ  A ARG B 1 218 ? 91.343  31.074 29.782  0.59 44.16  ? 219  ARG B CZ  1 
ATOM   5871 C CZ  B ARG B 1 218 ? 92.145  30.030 26.819  0.41 49.17  ? 219  ARG B CZ  1 
ATOM   5872 N NH1 A ARG B 1 218 ? 91.766  30.936 31.033  0.59 36.10  ? 219  ARG B NH1 1 
ATOM   5873 N NH1 B ARG B 1 218 ? 93.064  30.053 25.863  0.41 47.82  ? 219  ARG B NH1 1 
ATOM   5874 N NH2 A ARG B 1 218 ? 90.335  31.892 29.511  0.59 40.75  ? 219  ARG B NH2 1 
ATOM   5875 N NH2 B ARG B 1 218 ? 90.890  30.347 26.532  0.41 47.51  ? 219  ARG B NH2 1 
ATOM   5876 N N   . GLY B 1 219 ? 93.344  26.048 32.464  1.00 47.89  ? 220  GLY B N   1 
ATOM   5877 C CA  . GLY B 1 219 ? 92.441  25.866 33.581  1.00 43.97  ? 220  GLY B CA  1 
ATOM   5878 C C   . GLY B 1 219 ? 92.925  26.400 34.909  1.00 50.49  ? 220  GLY B C   1 
ATOM   5879 O O   . GLY B 1 219 ? 92.228  26.246 35.916  1.00 57.67  ? 220  GLY B O   1 
ATOM   5880 N N   . LEU B 1 220 ? 94.096  27.034 34.947  1.00 43.95  ? 221  LEU B N   1 
ATOM   5881 C CA  . LEU B 1 220 ? 94.696  27.498 36.190  1.00 43.11  ? 221  LEU B CA  1 
ATOM   5882 C C   . LEU B 1 220 ? 94.520  28.993 36.422  1.00 49.80  ? 221  LEU B C   1 
ATOM   5883 O O   . LEU B 1 220 ? 94.981  29.503 37.448  1.00 52.23  ? 221  LEU B O   1 
ATOM   5884 C CB  . LEU B 1 220 ? 96.188  27.148 36.211  1.00 38.91  ? 221  LEU B CB  1 
ATOM   5885 C CG  . LEU B 1 220 ? 96.528  25.682 35.943  1.00 44.43  ? 221  LEU B CG  1 
ATOM   5886 C CD1 . LEU B 1 220 ? 98.034  25.486 35.876  1.00 40.96  ? 221  LEU B CD1 1 
ATOM   5887 C CD2 . LEU B 1 220 ? 95.911  24.789 37.008  1.00 41.54  ? 221  LEU B CD2 1 
ATOM   5888 N N   . PHE B 1 221 ? 93.872  29.704 35.503  1.00 40.86  ? 222  PHE B N   1 
ATOM   5889 C CA  . PHE B 1 221 ? 93.667  31.139 35.648  1.00 38.59  ? 222  PHE B CA  1 
ATOM   5890 C C   . PHE B 1 221 ? 92.477  31.541 34.789  1.00 45.12  ? 222  PHE B C   1 
ATOM   5891 O O   . PHE B 1 221 ? 91.951  30.743 34.010  1.00 45.05  ? 222  PHE B O   1 
ATOM   5892 C CB  . PHE B 1 221 ? 94.925  31.932 35.272  1.00 34.06  ? 222  PHE B CB  1 
ATOM   5893 C CG  . PHE B 1 221 ? 95.313  31.818 33.822  1.00 38.95  ? 222  PHE B CG  1 
ATOM   5894 C CD1 . PHE B 1 221 ? 95.983  30.698 33.353  1.00 43.62  ? 222  PHE B CD1 1 
ATOM   5895 C CD2 . PHE B 1 221 ? 95.029  32.843 32.934  1.00 43.05  ? 222  PHE B CD2 1 
ATOM   5896 C CE1 . PHE B 1 221 ? 96.350  30.597 32.016  1.00 44.59  ? 222  PHE B CE1 1 
ATOM   5897 C CE2 . PHE B 1 221 ? 95.396  32.751 31.601  1.00 43.50  ? 222  PHE B CE2 1 
ATOM   5898 C CZ  . PHE B 1 221 ? 96.057  31.626 31.141  1.00 39.70  ? 222  PHE B CZ  1 
ATOM   5899 N N   . HIS B 1 222 ? 92.065  32.799 34.932  1.00 41.88  ? 223  HIS B N   1 
ATOM   5900 C CA  . HIS B 1 222 ? 90.814  33.238 34.331  1.00 40.30  ? 223  HIS B CA  1 
ATOM   5901 C C   . HIS B 1 222 ? 90.983  34.471 33.453  1.00 39.22  ? 223  HIS B C   1 
ATOM   5902 O O   . HIS B 1 222 ? 90.276  34.623 32.454  1.00 49.97  ? 223  HIS B O   1 
ATOM   5903 C CB  . HIS B 1 222 ? 89.786  33.489 35.434  1.00 44.96  ? 223  HIS B CB  1 
ATOM   5904 C CG  . HIS B 1 222 ? 89.646  32.337 36.379  1.00 53.82  ? 223  HIS B CG  1 
ATOM   5905 N ND1 . HIS B 1 222 ? 90.511  32.131 37.434  1.00 46.94  ? 223  HIS B ND1 1 
ATOM   5906 C CD2 . HIS B 1 222 ? 88.772  31.304 36.402  1.00 48.43  ? 223  HIS B CD2 1 
ATOM   5907 C CE1 . HIS B 1 222 ? 90.165  31.029 38.074  1.00 49.28  ? 223  HIS B CE1 1 
ATOM   5908 N NE2 . HIS B 1 222 ? 89.110  30.510 37.471  1.00 54.91  ? 223  HIS B NE2 1 
ATOM   5909 N N   . ARG B 1 223 ? 91.911  35.356 33.805  1.00 38.44  ? 224  ARG B N   1 
ATOM   5910 C CA  . ARG B 1 223 ? 92.144  36.564 33.029  1.00 38.73  ? 224  ARG B CA  1 
ATOM   5911 C C   . ARG B 1 223 ? 93.643  36.772 32.875  1.00 40.07  ? 224  ARG B C   1 
ATOM   5912 O O   . ARG B 1 223 ? 94.448  36.170 33.587  1.00 42.21  ? 224  ARG B O   1 
ATOM   5913 C CB  . ARG B 1 223 ? 91.479  37.784 33.679  1.00 42.04  ? 224  ARG B CB  1 
ATOM   5914 C CG  . ARG B 1 223 ? 89.984  37.851 33.423  1.00 52.11  ? 224  ARG B CG  1 
ATOM   5915 C CD  . ARG B 1 223 ? 89.314  38.911 34.274  1.00 56.70  ? 224  ARG B CD  1 
ATOM   5916 N NE  . ARG B 1 223 ? 89.346  38.563 35.687  1.00 62.71  ? 224  ARG B NE  1 
ATOM   5917 C CZ  . ARG B 1 223 ? 88.468  37.757 36.273  1.00 67.52  ? 224  ARG B CZ  1 
ATOM   5918 N NH1 . ARG B 1 223 ? 87.487  37.216 35.563  1.00 64.64  ? 224  ARG B NH1 1 
ATOM   5919 N NH2 . ARG B 1 223 ? 88.572  37.488 37.568  1.00 71.24  ? 224  ARG B NH2 1 
ATOM   5920 N N   . ALA B 1 224 ? 94.017  37.628 31.925  1.00 36.45  ? 225  ALA B N   1 
ATOM   5921 C CA  . ALA B 1 224 ? 95.418  37.783 31.563  1.00 36.39  ? 225  ALA B CA  1 
ATOM   5922 C C   . ALA B 1 224 ? 95.737  39.239 31.258  1.00 39.04  ? 225  ALA B C   1 
ATOM   5923 O O   . ALA B 1 224 ? 94.919  39.956 30.673  1.00 40.85  ? 225  ALA B O   1 
ATOM   5924 C CB  . ALA B 1 224 ? 95.770  36.905 30.354  1.00 32.17  ? 225  ALA B CB  1 
ATOM   5925 N N   . VAL B 1 225 ? 96.931  39.669 31.658  1.00 39.81  ? 226  VAL B N   1 
ATOM   5926 C CA  . VAL B 1 225 ? 97.444  40.998 31.345  1.00 38.17  ? 226  VAL B CA  1 
ATOM   5927 C C   . VAL B 1 225 ? 98.832  40.836 30.746  1.00 39.56  ? 226  VAL B C   1 
ATOM   5928 O O   . VAL B 1 225 ? 99.706  40.207 31.353  1.00 44.36  ? 226  VAL B O   1 
ATOM   5929 C CB  . VAL B 1 225 ? 97.501  41.914 32.583  1.00 37.42  ? 226  VAL B CB  1 
ATOM   5930 C CG1 . VAL B 1 225 ? 98.014  43.300 32.206  1.00 38.10  ? 226  VAL B CG1 1 
ATOM   5931 C CG2 . VAL B 1 225 ? 96.146  41.994 33.272  1.00 36.63  ? 226  VAL B CG2 1 
ATOM   5932 N N   . LEU B 1 226 ? 99.035  41.407 29.561  1.00 31.03  ? 227  LEU B N   1 
ATOM   5933 C CA  . LEU B 1 226 ? 100.298 41.304 28.836  1.00 35.68  ? 227  LEU B CA  1 
ATOM   5934 C C   . LEU B 1 226 ? 100.832 42.712 28.612  1.00 40.48  ? 227  LEU B C   1 
ATOM   5935 O O   . LEU B 1 226 ? 100.286 43.465 27.798  1.00 44.07  ? 227  LEU B O   1 
ATOM   5936 C CB  . LEU B 1 226 ? 100.118 40.559 27.509  1.00 34.37  ? 227  LEU B CB  1 
ATOM   5937 C CG  . LEU B 1 226 ? 99.711  39.079 27.534  1.00 34.01  ? 227  LEU B CG  1 
ATOM   5938 C CD1 . LEU B 1 226 ? 98.220  38.900 27.781  1.00 30.38  ? 227  LEU B CD1 1 
ATOM   5939 C CD2 . LEU B 1 226 ? 100.116 38.387 26.240  1.00 34.51  ? 227  LEU B CD2 1 
ATOM   5940 N N   . GLN B 1 227 ? 101.895 43.066 29.333  1.00 35.56  ? 228  GLN B N   1 
ATOM   5941 C CA  . GLN B 1 227 ? 102.515 44.381 29.229  1.00 35.13  ? 228  GLN B CA  1 
ATOM   5942 C C   . GLN B 1 227 ? 103.812 44.271 28.433  1.00 38.63  ? 228  GLN B C   1 
ATOM   5943 O O   . GLN B 1 227 ? 104.747 43.580 28.853  1.00 34.39  ? 228  GLN B O   1 
ATOM   5944 C CB  . GLN B 1 227 ? 102.775 44.966 30.620  1.00 28.12  ? 228  GLN B CB  1 
ATOM   5945 C CG  . GLN B 1 227 ? 101.752 44.529 31.685  1.00 34.75  ? 228  GLN B CG  1 
ATOM   5946 C CD  . GLN B 1 227 ? 102.029 45.109 33.063  1.00 40.47  ? 228  GLN B CD  1 
ATOM   5947 O OE1 . GLN B 1 227 ? 102.988 45.859 33.270  1.00 46.56  ? 228  GLN B OE1 1 
ATOM   5948 N NE2 . GLN B 1 227 ? 101.193 44.757 34.032  1.00 29.29  ? 228  GLN B NE2 1 
ATOM   5949 N N   . SER B 1 228 ? 103.859 44.942 27.280  1.00 35.71  ? 229  SER B N   1 
ATOM   5950 C CA  . SER B 1 228 ? 105.085 45.063 26.487  1.00 32.57  ? 229  SER B CA  1 
ATOM   5951 C C   . SER B 1 228 ? 105.673 43.699 26.140  1.00 33.08  ? 229  SER B C   1 
ATOM   5952 O O   . SER B 1 228 ? 106.886 43.493 26.201  1.00 37.45  ? 229  SER B O   1 
ATOM   5953 C CB  . SER B 1 228 ? 106.124 45.924 27.209  1.00 37.29  ? 229  SER B CB  1 
ATOM   5954 O OG  . SER B 1 228 ? 105.608 47.207 27.511  1.00 42.02  ? 229  SER B OG  1 
ATOM   5955 N N   . GLY B 1 229 ? 104.811 42.759 25.777  1.00 34.21  ? 230  GLY B N   1 
ATOM   5956 C CA  . GLY B 1 229 ? 105.270 41.446 25.368  1.00 32.50  ? 230  GLY B CA  1 
ATOM   5957 C C   . GLY B 1 229 ? 104.118 40.625 24.841  1.00 33.42  ? 230  GLY B C   1 
ATOM   5958 O O   . GLY B 1 229 ? 102.948 40.902 25.125  1.00 38.11  ? 230  GLY B O   1 
ATOM   5959 N N   . ALA B 1 230 ? 104.467 39.603 24.065  1.00 33.51  ? 231  ALA B N   1 
ATOM   5960 C CA  . ALA B 1 230 ? 103.471 38.749 23.434  1.00 35.24  ? 231  ALA B CA  1 
ATOM   5961 C C   . ALA B 1 230 ? 104.126 37.421 23.103  1.00 37.04  ? 231  ALA B C   1 
ATOM   5962 O O   . ALA B 1 230 ? 105.332 37.382 22.839  1.00 38.86  ? 231  ALA B O   1 
ATOM   5963 C CB  . ALA B 1 230 ? 102.901 39.403 22.166  1.00 39.93  ? 231  ALA B CB  1 
ATOM   5964 N N   . PRO B 1 231 ? 103.374 36.319 23.113  1.00 39.46  ? 232  PRO B N   1 
ATOM   5965 C CA  . PRO B 1 231 ? 103.995 35.020 22.824  1.00 39.49  ? 232  PRO B CA  1 
ATOM   5966 C C   . PRO B 1 231 ? 104.397 34.859 21.367  1.00 41.49  ? 232  PRO B C   1 
ATOM   5967 O O   . PRO B 1 231 ? 105.187 33.957 21.062  1.00 42.50  ? 232  PRO B O   1 
ATOM   5968 C CB  . PRO B 1 231 ? 102.906 34.016 23.225  1.00 33.52  ? 232  PRO B CB  1 
ATOM   5969 C CG  . PRO B 1 231 ? 101.631 34.760 22.981  1.00 37.63  ? 232  PRO B CG  1 
ATOM   5970 C CD  . PRO B 1 231 ? 101.921 36.197 23.342  1.00 39.60  ? 232  PRO B CD  1 
ATOM   5971 N N   . ASN B 1 232 ? 103.897 35.709 20.468  1.00 37.70  ? 233  ASN B N   1 
ATOM   5972 C CA  . ASN B 1 232 ? 104.217 35.639 19.047  1.00 42.00  ? 233  ASN B CA  1 
ATOM   5973 C C   . ASN B 1 232 ? 105.360 36.566 18.642  1.00 45.51  ? 233  ASN B C   1 
ATOM   5974 O O   . ASN B 1 232 ? 105.618 36.724 17.445  1.00 46.09  ? 233  ASN B O   1 
ATOM   5975 C CB  . ASN B 1 232 ? 102.972 35.947 18.207  1.00 37.70  ? 233  ASN B CB  1 
ATOM   5976 C CG  . ASN B 1 232 ? 102.171 37.118 18.753  1.00 44.09  ? 233  ASN B CG  1 
ATOM   5977 O OD1 . ASN B 1 232 ? 101.871 37.176 19.943  1.00 45.18  ? 233  ASN B OD1 1 
ATOM   5978 N ND2 . ASN B 1 232 ? 101.827 38.060 17.882  1.00 37.32  ? 233  ASN B ND2 1 
ATOM   5979 N N   . GLY B 1 233 ? 106.055 37.174 19.600  1.00 58.66  ? 234  GLY B N   1 
ATOM   5980 C CA  . GLY B 1 233 ? 107.212 37.982 19.288  1.00 68.04  ? 234  GLY B CA  1 
ATOM   5981 C C   . GLY B 1 233 ? 108.308 37.166 18.626  1.00 67.19  ? 234  GLY B C   1 
ATOM   5982 O O   . GLY B 1 233 ? 108.509 35.991 18.945  1.00 73.37  ? 234  GLY B O   1 
ATOM   5983 N N   . PRO B 1 234 ? 109.046 37.778 17.692  1.00 50.65  ? 235  PRO B N   1 
ATOM   5984 C CA  . PRO B 1 234 ? 110.118 37.040 16.997  1.00 44.33  ? 235  PRO B CA  1 
ATOM   5985 C C   . PRO B 1 234 ? 111.231 36.559 17.916  1.00 44.16  ? 235  PRO B C   1 
ATOM   5986 O O   . PRO B 1 234 ? 112.090 35.788 17.468  1.00 46.55  ? 235  PRO B O   1 
ATOM   5987 C CB  . PRO B 1 234 ? 110.645 38.060 15.977  1.00 41.00  ? 235  PRO B CB  1 
ATOM   5988 C CG  . PRO B 1 234 ? 110.300 39.394 16.567  1.00 44.85  ? 235  PRO B CG  1 
ATOM   5989 C CD  . PRO B 1 234 ? 108.992 39.194 17.289  1.00 42.61  ? 235  PRO B CD  1 
ATOM   5990 N N   . TRP B 1 235 ? 111.240 36.986 19.178  1.00 42.24  ? 236  TRP B N   1 
ATOM   5991 C CA  . TRP B 1 235 ? 112.249 36.607 20.155  1.00 39.57  ? 236  TRP B CA  1 
ATOM   5992 C C   . TRP B 1 235 ? 111.751 35.594 21.174  1.00 43.98  ? 236  TRP B C   1 
ATOM   5993 O O   . TRP B 1 235 ? 112.570 35.012 21.896  1.00 43.61  ? 236  TRP B O   1 
ATOM   5994 C CB  . TRP B 1 235 ? 112.730 37.856 20.906  1.00 44.29  ? 236  TRP B CB  1 
ATOM   5995 C CG  . TRP B 1 235 ? 111.568 38.649 21.428  1.00 40.16  ? 236  TRP B CG  1 
ATOM   5996 C CD1 . TRP B 1 235 ? 110.905 39.652 20.778  1.00 41.06  ? 236  TRP B CD1 1 
ATOM   5997 C CD2 . TRP B 1 235 ? 110.899 38.476 22.684  1.00 33.71  ? 236  TRP B CD2 1 
ATOM   5998 N NE1 . TRP B 1 235 ? 109.880 40.126 21.557  1.00 37.72  ? 236  TRP B NE1 1 
ATOM   5999 C CE2 . TRP B 1 235 ? 109.854 39.421 22.734  1.00 35.21  ? 236  TRP B CE2 1 
ATOM   6000 C CE3 . TRP B 1 235 ? 111.089 37.621 23.778  1.00 34.85  ? 236  TRP B CE3 1 
ATOM   6001 C CZ2 . TRP B 1 235 ? 109.000 39.534 23.830  1.00 38.63  ? 236  TRP B CZ2 1 
ATOM   6002 C CZ3 . TRP B 1 235 ? 110.239 37.735 24.868  1.00 34.43  ? 236  TRP B CZ3 1 
ATOM   6003 C CH2 . TRP B 1 235 ? 109.209 38.686 24.887  1.00 37.07  ? 236  TRP B CH2 1 
ATOM   6004 N N   . ALA B 1 236 ? 110.438 35.379 21.263  1.00 39.54  ? 237  ALA B N   1 
ATOM   6005 C CA  . ALA B 1 236 ? 109.862 34.641 22.380  1.00 39.31  ? 237  ALA B CA  1 
ATOM   6006 C C   . ALA B 1 236 ? 109.933 33.131 22.211  1.00 42.71  ? 237  ALA B C   1 
ATOM   6007 O O   . ALA B 1 236 ? 109.900 32.412 23.215  1.00 39.30  ? 237  ALA B O   1 
ATOM   6008 C CB  . ALA B 1 236 ? 108.407 35.060 22.589  1.00 36.56  ? 237  ALA B CB  1 
ATOM   6009 N N   . THR B 1 237 ? 110.014 32.630 20.980  1.00 38.86  ? 238  THR B N   1 
ATOM   6010 C CA  . THR B 1 237 ? 110.086 31.197 20.740  1.00 43.74  ? 238  THR B CA  1 
ATOM   6011 C C   . THR B 1 237 ? 111.212 30.885 19.767  1.00 43.41  ? 238  THR B C   1 
ATOM   6012 O O   . THR B 1 237 ? 111.717 31.759 19.058  1.00 45.52  ? 238  THR B O   1 
ATOM   6013 C CB  . THR B 1 237 ? 108.769 30.629 20.187  1.00 40.82  ? 238  THR B CB  1 
ATOM   6014 O OG1 . THR B 1 237 ? 108.463 31.256 18.933  1.00 41.94  ? 238  THR B OG1 1 
ATOM   6015 C CG2 . THR B 1 237 ? 107.629 30.854 21.170  1.00 40.54  ? 238  THR B CG2 1 
ATOM   6016 N N   . VAL B 1 238 ? 111.593 29.612 19.739  1.00 42.26  ? 239  VAL B N   1 
ATOM   6017 C CA  . VAL B 1 238 ? 112.638 29.122 18.853  1.00 43.55  ? 239  VAL B CA  1 
ATOM   6018 C C   . VAL B 1 238 ? 112.202 27.768 18.309  1.00 44.75  ? 239  VAL B C   1 
ATOM   6019 O O   . VAL B 1 238 ? 111.501 27.003 18.979  1.00 45.83  ? 239  VAL B O   1 
ATOM   6020 C CB  . VAL B 1 238 ? 114.001 29.039 19.584  1.00 51.65  ? 239  VAL B CB  1 
ATOM   6021 C CG1 . VAL B 1 238 ? 114.028 27.877 20.578  1.00 51.72  ? 239  VAL B CG1 1 
ATOM   6022 C CG2 . VAL B 1 238 ? 115.130 28.933 18.597  1.00 57.24  ? 239  VAL B CG2 1 
ATOM   6023 N N   . GLY B 1 239 ? 112.590 27.489 17.065  1.00 52.00  ? 240  GLY B N   1 
ATOM   6024 C CA  . GLY B 1 239 ? 112.294 26.199 16.481  1.00 47.00  ? 240  GLY B CA  1 
ATOM   6025 C C   . GLY B 1 239 ? 113.117 25.087 17.102  1.00 54.61  ? 240  GLY B C   1 
ATOM   6026 O O   . GLY B 1 239 ? 114.107 25.317 17.798  1.00 52.65  ? 240  GLY B O   1 
ATOM   6027 N N   . MET B 1 240 ? 112.690 23.848 16.841  1.00 54.38  ? 241  MET B N   1 
ATOM   6028 C CA  . MET B 1 240 ? 113.386 22.695 17.404  1.00 53.29  ? 241  MET B CA  1 
ATOM   6029 C C   . MET B 1 240 ? 114.809 22.585 16.867  1.00 55.59  ? 241  MET B C   1 
ATOM   6030 O O   . MET B 1 240 ? 115.744 22.293 17.623  1.00 53.75  ? 241  MET B O   1 
ATOM   6031 C CB  . MET B 1 240 ? 112.603 21.413 17.115  1.00 55.51  ? 241  MET B CB  1 
ATOM   6032 C CG  . MET B 1 240 ? 111.422 21.178 18.046  1.00 63.13  ? 241  MET B CG  1 
ATOM   6033 S SD  . MET B 1 240 ? 110.311 19.869 17.481  1.00 72.84  ? 241  MET B SD  1 
ATOM   6034 C CE  . MET B 1 240 ? 111.363 18.426 17.585  1.00 78.15  ? 241  MET B CE  1 
ATOM   6035 N N   . GLY B 1 241 ? 114.992 22.815 15.565  1.00 50.52  ? 242  GLY B N   1 
ATOM   6036 C CA  . GLY B 1 241 ? 116.320 22.693 14.984  1.00 53.98  ? 242  GLY B CA  1 
ATOM   6037 C C   . GLY B 1 241 ? 117.293 23.718 15.535  1.00 55.42  ? 242  GLY B C   1 
ATOM   6038 O O   . GLY B 1 241 ? 118.429 23.391 15.887  1.00 51.40  ? 242  GLY B O   1 
ATOM   6039 N N   . GLU B 1 242 ? 116.859 24.977 15.617  1.00 50.13  ? 243  GLU B N   1 
ATOM   6040 C CA  . GLU B 1 242 ? 117.726 26.017 16.157  1.00 51.42  ? 243  GLU B CA  1 
ATOM   6041 C C   . GLU B 1 242 ? 117.983 25.805 17.644  1.00 49.88  ? 243  GLU B C   1 
ATOM   6042 O O   . GLU B 1 242 ? 119.093 26.059 18.129  1.00 48.25  ? 243  GLU B O   1 
ATOM   6043 C CB  . GLU B 1 242 ? 117.114 27.396 15.896  1.00 53.19  ? 243  GLU B CB  1 
ATOM   6044 C CG  . GLU B 1 242 ? 117.893 28.563 16.490  1.00 57.95  ? 243  GLU B CG  1 
ATOM   6045 C CD  . GLU B 1 242 ? 119.221 28.812 15.805  1.00 62.53  ? 243  GLU B CD  1 
ATOM   6046 O OE1 . GLU B 1 242 ? 119.495 28.174 14.767  1.00 70.83  ? 243  GLU B OE1 1 
ATOM   6047 O OE2 . GLU B 1 242 ? 119.994 29.654 16.309  1.00 63.13  ? 243  GLU B OE2 1 
ATOM   6048 N N   . ALA B 1 243 ? 116.980 25.324 18.384  1.00 48.45  ? 244  ALA B N   1 
ATOM   6049 C CA  . ALA B 1 243 ? 117.190 25.043 19.802  1.00 51.07  ? 244  ALA B CA  1 
ATOM   6050 C C   . ALA B 1 243 ? 118.241 23.960 19.993  1.00 49.60  ? 244  ALA B C   1 
ATOM   6051 O O   . ALA B 1 243 ? 119.107 24.072 20.869  1.00 45.93  ? 244  ALA B O   1 
ATOM   6052 C CB  . ALA B 1 243 ? 115.875 24.637 20.466  1.00 43.99  ? 244  ALA B CB  1 
ATOM   6053 N N   . ARG B 1 244 ? 118.192 22.909 19.170  1.00 49.98  ? 245  ARG B N   1 
ATOM   6054 C CA  . ARG B 1 244 ? 119.192 21.852 19.266  1.00 55.61  ? 245  ARG B CA  1 
ATOM   6055 C C   . ARG B 1 244 ? 120.584 22.379 18.942  1.00 54.38  ? 245  ARG B C   1 
ATOM   6056 O O   . ARG B 1 244 ? 121.554 22.055 19.637  1.00 57.72  ? 245  ARG B O   1 
ATOM   6057 C CB  . ARG B 1 244 ? 118.830 20.691 18.341  1.00 55.80  ? 245  ARG B CB  1 
ATOM   6058 C CG  . ARG B 1 244 ? 119.952 19.678 18.159  1.00 55.66  ? 245  ARG B CG  1 
ATOM   6059 C CD  . ARG B 1 244 ? 119.461 18.414 17.473  1.00 53.87  ? 245  ARG B CD  1 
ATOM   6060 N NE  . ARG B 1 244 ? 118.524 17.680 18.316  1.00 59.40  ? 245  ARG B NE  1 
ATOM   6061 C CZ  . ARG B 1 244 ? 118.885 16.779 19.225  1.00 64.48  ? 245  ARG B CZ  1 
ATOM   6062 N NH1 . ARG B 1 244 ? 120.168 16.492 19.407  1.00 63.93  ? 245  ARG B NH1 1 
ATOM   6063 N NH2 . ARG B 1 244 ? 117.962 16.162 19.950  1.00 60.89  ? 245  ARG B NH2 1 
ATOM   6064 N N   . ARG B 1 245 ? 120.704 23.203 17.898  1.00 47.09  ? 246  ARG B N   1 
ATOM   6065 C CA  . ARG B 1 245 ? 122.016 23.733 17.540  1.00 51.43  ? 246  ARG B CA  1 
ATOM   6066 C C   . ARG B 1 245 ? 122.581 24.601 18.657  1.00 47.44  ? 246  ARG B C   1 
ATOM   6067 O O   . ARG B 1 245 ? 123.771 24.513 18.981  1.00 60.60  ? 246  ARG B O   1 
ATOM   6068 C CB  . ARG B 1 245 ? 121.938 24.534 16.241  1.00 43.81  ? 246  ARG B CB  1 
ATOM   6069 C CG  . ARG B 1 245 ? 123.300 25.039 15.783  1.00 51.25  ? 246  ARG B CG  1 
ATOM   6070 C CD  . ARG B 1 245 ? 123.196 26.131 14.735  1.00 52.18  ? 246  ARG B CD  1 
ATOM   6071 N NE  . ARG B 1 245 ? 122.712 27.389 15.303  1.00 61.95  ? 246  ARG B NE  1 
ATOM   6072 C CZ  . ARG B 1 245 ? 123.431 28.201 16.075  1.00 62.43  ? 246  ARG B CZ  1 
ATOM   6073 N NH1 . ARG B 1 245 ? 124.685 27.900 16.393  1.00 66.21  ? 246  ARG B NH1 1 
ATOM   6074 N NH2 . ARG B 1 245 ? 122.892 29.322 16.534  1.00 54.17  ? 246  ARG B NH2 1 
ATOM   6075 N N   . ARG B 1 246 ? 121.744 25.452 19.253  1.00 46.09  ? 247  ARG B N   1 
ATOM   6076 C CA  . ARG B 1 246 ? 122.203 26.292 20.355  1.00 53.03  ? 247  ARG B CA  1 
ATOM   6077 C C   . ARG B 1 246 ? 122.649 25.448 21.541  1.00 51.21  ? 247  ARG B C   1 
ATOM   6078 O O   . ARG B 1 246 ? 123.684 25.728 22.156  1.00 48.49  ? 247  ARG B O   1 
ATOM   6079 C CB  . ARG B 1 246 ? 121.098 27.263 20.770  1.00 49.54  ? 247  ARG B CB  1 
ATOM   6080 C CG  . ARG B 1 246 ? 120.782 28.307 19.712  1.00 49.92  ? 247  ARG B CG  1 
ATOM   6081 C CD  . ARG B 1 246 ? 119.715 29.282 20.180  1.00 48.35  ? 247  ARG B CD  1 
ATOM   6082 N NE  . ARG B 1 246 ? 119.324 30.198 19.114  1.00 44.88  ? 247  ARG B NE  1 
ATOM   6083 C CZ  . ARG B 1 246 ? 118.544 31.259 19.284  1.00 46.43  ? 247  ARG B CZ  1 
ATOM   6084 N NH1 . ARG B 1 246 ? 118.068 31.549 20.491  1.00 36.28  ? 247  ARG B NH1 1 
ATOM   6085 N NH2 . ARG B 1 246 ? 118.242 32.031 18.247  1.00 39.14  ? 247  ARG B NH2 1 
ATOM   6086 N N   . ALA B 1 247 ? 121.890 24.398 21.864  1.00 47.46  ? 248  ALA B N   1 
ATOM   6087 C CA  . ALA B 1 247 ? 122.250 23.544 22.991  1.00 45.03  ? 248  ALA B CA  1 
ATOM   6088 C C   . ALA B 1 247 ? 123.548 22.792 22.728  1.00 52.32  ? 248  ALA B C   1 
ATOM   6089 O O   . ALA B 1 247 ? 124.362 22.613 23.643  1.00 52.50  ? 248  ALA B O   1 
ATOM   6090 C CB  . ALA B 1 247 ? 121.113 22.569 23.295  1.00 42.73  ? 248  ALA B CB  1 
ATOM   6091 N N   . THR B 1 248 ? 123.771 22.350 21.486  1.00 50.20  ? 249  THR B N   1 
ATOM   6092 C CA  . THR B 1 248 ? 124.987 21.595 21.198  1.00 58.14  ? 249  THR B CA  1 
ATOM   6093 C C   . THR B 1 248 ? 126.214 22.496 21.159  1.00 56.22  ? 249  THR B C   1 
ATOM   6094 O O   . THR B 1 248 ? 127.306 22.065 21.547  1.00 57.24  ? 249  THR B O   1 
ATOM   6095 C CB  . THR B 1 248 ? 124.853 20.831 19.880  1.00 63.73  ? 249  THR B CB  1 
ATOM   6096 O OG1 . THR B 1 248 ? 124.614 21.752 18.810  1.00 81.26  ? 249  THR B OG1 1 
ATOM   6097 C CG2 . THR B 1 248 ? 123.710 19.825 19.956  1.00 50.85  ? 249  THR B CG2 1 
ATOM   6098 N N   . GLN B 1 249 ? 126.060 23.743 20.702  1.00 48.02  ? 250  GLN B N   1 
ATOM   6099 C CA  . GLN B 1 249 ? 127.197 24.657 20.697  1.00 49.68  ? 250  GLN B CA  1 
ATOM   6100 C C   . GLN B 1 249 ? 127.600 25.042 22.113  1.00 47.25  ? 250  GLN B C   1 
ATOM   6101 O O   . GLN B 1 249 ? 128.795 25.177 22.407  1.00 52.88  ? 250  GLN B O   1 
ATOM   6102 C CB  . GLN B 1 249 ? 126.882 25.910 19.881  1.00 55.12  ? 250  GLN B CB  1 
ATOM   6103 C CG  . GLN B 1 249 ? 128.079 26.854 19.764  1.00 73.62  ? 250  GLN B CG  1 
ATOM   6104 C CD  . GLN B 1 249 ? 127.784 28.071 18.925  1.00 89.40  ? 250  GLN B CD  1 
ATOM   6105 O OE1 . GLN B 1 249 ? 126.976 28.023 17.997  1.00 96.72  ? 250  GLN B OE1 1 
ATOM   6106 N NE2 . GLN B 1 249 ? 128.439 29.180 19.238  1.00 95.43  ? 250  GLN B NE2 1 
ATOM   6107 N N   . LEU B 1 250 ? 126.620 25.240 22.999  1.00 45.59  ? 251  LEU B N   1 
ATOM   6108 C CA  . LEU B 1 250 ? 126.941 25.514 24.396  1.00 57.26  ? 251  LEU B CA  1 
ATOM   6109 C C   . LEU B 1 250 ? 127.780 24.390 24.987  1.00 55.27  ? 251  LEU B C   1 
ATOM   6110 O O   . LEU B 1 250 ? 128.783 24.644 25.664  1.00 61.74  ? 251  LEU B O   1 
ATOM   6111 C CB  . LEU B 1 250 ? 125.662 25.716 25.212  1.00 51.12  ? 251  LEU B CB  1 
ATOM   6112 C CG  . LEU B 1 250 ? 125.877 26.036 26.697  1.00 52.87  ? 251  LEU B CG  1 
ATOM   6113 C CD1 . LEU B 1 250 ? 126.549 27.394 26.882  1.00 52.21  ? 251  LEU B CD1 1 
ATOM   6114 C CD2 . LEU B 1 250 ? 124.573 25.978 27.472  1.00 46.38  ? 251  LEU B CD2 1 
ATOM   6115 N N   . ALA B 1 251 ? 127.394 23.140 24.721  1.00 58.72  ? 252  ALA B N   1 
ATOM   6116 C CA  . ALA B 1 251 ? 128.177 22.003 25.191  1.00 61.24  ? 252  ALA B CA  1 
ATOM   6117 C C   . ALA B 1 251 ? 129.601 22.052 24.652  1.00 61.31  ? 252  ALA B C   1 
ATOM   6118 O O   . ALA B 1 251 ? 130.558 21.785 25.387  1.00 63.30  ? 252  ALA B O   1 
ATOM   6119 C CB  . ALA B 1 251 ? 127.495 20.695 24.792  1.00 55.04  ? 252  ALA B CB  1 
ATOM   6120 N N   . HIS B 1 252 ? 129.761 22.399 23.372  1.00 53.98  ? 253  HIS B N   1 
ATOM   6121 C CA  . HIS B 1 252 ? 131.101 22.512 22.805  1.00 62.14  ? 253  HIS B CA  1 
ATOM   6122 C C   . HIS B 1 252 ? 131.893 23.624 23.479  1.00 57.57  ? 253  HIS B C   1 
ATOM   6123 O O   . HIS B 1 252 ? 133.085 23.462 23.765  1.00 66.48  ? 253  HIS B O   1 
ATOM   6124 C CB  . HIS B 1 252 ? 131.021 22.756 21.298  1.00 69.27  ? 253  HIS B CB  1 
ATOM   6125 C CG  . HIS B 1 252 ? 132.313 23.210 20.690  1.00 81.14  ? 253  HIS B CG  1 
ATOM   6126 N ND1 . HIS B 1 252 ? 132.625 24.541 20.513  1.00 86.30  ? 253  HIS B ND1 1 
ATOM   6127 C CD2 . HIS B 1 252 ? 133.374 22.510 20.223  1.00 84.64  ? 253  HIS B CD2 1 
ATOM   6128 C CE1 . HIS B 1 252 ? 133.821 24.642 19.961  1.00 89.22  ? 253  HIS B CE1 1 
ATOM   6129 N NE2 . HIS B 1 252 ? 134.297 23.424 19.774  1.00 90.10  ? 253  HIS B NE2 1 
ATOM   6130 N N   . LEU B 1 253 ? 131.246 24.760 23.746  1.00 54.58  ? 254  LEU B N   1 
ATOM   6131 C CA  . LEU B 1 253 ? 131.942 25.896 24.335  1.00 58.13  ? 254  LEU B CA  1 
ATOM   6132 C C   . LEU B 1 253 ? 132.385 25.638 25.770  1.00 56.20  ? 254  LEU B C   1 
ATOM   6133 O O   . LEU B 1 253 ? 133.319 26.298 26.237  1.00 59.39  ? 254  LEU B O   1 
ATOM   6134 C CB  . LEU B 1 253 ? 131.057 27.143 24.283  1.00 55.48  ? 254  LEU B CB  1 
ATOM   6135 C CG  . LEU B 1 253 ? 130.931 27.855 22.934  1.00 52.99  ? 254  LEU B CG  1 
ATOM   6136 C CD1 . LEU B 1 253 ? 129.881 28.947 23.021  1.00 54.93  ? 254  LEU B CD1 1 
ATOM   6137 C CD2 . LEU B 1 253 ? 132.268 28.431 22.496  1.00 54.44  ? 254  LEU B CD2 1 
ATOM   6138 N N   . VAL B 1 254 ? 131.750 24.706 26.477  1.00 52.43  ? 255  VAL B N   1 
ATOM   6139 C CA  . VAL B 1 254 ? 132.108 24.410 27.859  1.00 53.20  ? 255  VAL B CA  1 
ATOM   6140 C C   . VAL B 1 254 ? 132.871 23.089 27.972  1.00 56.17  ? 255  VAL B C   1 
ATOM   6141 O O   . VAL B 1 254 ? 133.007 22.546 29.065  1.00 59.85  ? 255  VAL B O   1 
ATOM   6142 C CB  . VAL B 1 254 ? 130.873 24.422 28.776  1.00 50.89  ? 255  VAL B CB  1 
ATOM   6143 C CG1 . VAL B 1 254 ? 130.174 25.772 28.705  1.00 46.09  ? 255  VAL B CG1 1 
ATOM   6144 C CG2 . VAL B 1 254 ? 129.918 23.297 28.407  1.00 54.37  ? 255  VAL B CG2 1 
ATOM   6145 N N   . GLY B 1 255 ? 133.378 22.566 26.858  1.00 55.48  ? 256  GLY B N   1 
ATOM   6146 C CA  . GLY B 1 255 ? 134.220 21.386 26.911  1.00 55.70  ? 256  GLY B CA  1 
ATOM   6147 C C   . GLY B 1 255 ? 133.493 20.063 26.931  1.00 54.38  ? 256  GLY B C   1 
ATOM   6148 O O   . GLY B 1 255 ? 134.084 19.053 27.325  1.00 60.28  ? 256  GLY B O   1 
ATOM   6149 N N   . CYS B 1 256 ? 132.230 20.029 26.515  1.00 54.50  ? 257  CYS B N   1 
ATOM   6150 C CA  . CYS B 1 256 ? 131.465 18.794 26.476  1.00 63.32  ? 257  CYS B CA  1 
ATOM   6151 C C   . CYS B 1 256 ? 131.316 18.288 25.042  1.00 79.39  ? 257  CYS B C   1 
ATOM   6152 O O   . CYS B 1 256 ? 131.343 19.079 24.094  1.00 76.55  ? 257  CYS B O   1 
ATOM   6153 C CB  . CYS B 1 256 ? 130.073 18.991 27.090  1.00 58.61  ? 257  CYS B CB  1 
ATOM   6154 S SG  . CYS B 1 256 ? 130.076 19.175 28.888  1.00 65.82  ? 257  CYS B SG  1 
ATOM   6155 N N   . PRO B 1 257 ? 131.043 16.993 24.886  1.00 97.51  ? 258  PRO B N   1 
ATOM   6156 C CA  . PRO B 1 257 ? 130.911 16.332 23.574  1.00 102.62 ? 258  PRO B CA  1 
ATOM   6157 C C   . PRO B 1 257 ? 129.726 16.894 22.801  1.00 111.34 ? 258  PRO B C   1 
ATOM   6158 O O   . PRO B 1 257 ? 129.059 17.756 23.371  1.00 114.40 ? 258  PRO B O   1 
ATOM   6159 C CB  . PRO B 1 257 ? 130.654 14.872 23.948  1.00 101.42 ? 258  PRO B CB  1 
ATOM   6160 C CG  . PRO B 1 257 ? 130.012 14.940 25.292  1.00 100.42 ? 258  PRO B CG  1 
ATOM   6161 C CD  . PRO B 1 257 ? 130.647 16.108 25.995  1.00 101.51 ? 258  PRO B CD  1 
ATOM   6162 N N   . PRO B 1 258 ? 129.525 16.568 21.521  1.00 109.54 ? 259  PRO B N   1 
ATOM   6163 C CA  . PRO B 1 258 ? 130.179 15.508 20.743  1.00 112.13 ? 259  PRO B CA  1 
ATOM   6164 C C   . PRO B 1 258 ? 131.491 15.940 20.097  1.00 114.75 ? 259  PRO B C   1 
ATOM   6165 O O   . PRO B 1 258 ? 132.132 15.099 19.464  1.00 118.34 ? 259  PRO B O   1 
ATOM   6166 C CB  . PRO B 1 258 ? 129.135 15.170 19.665  1.00 108.07 ? 259  PRO B CB  1 
ATOM   6167 C CG  . PRO B 1 258 ? 127.985 16.161 19.856  1.00 100.00 ? 259  PRO B CG  1 
ATOM   6168 C CD  . PRO B 1 258 ? 128.513 17.261 20.711  1.00 101.11 ? 259  PRO B CD  1 
ATOM   6169 N N   . GLY B 1 263 ? 127.746 11.547 17.937  1.00 134.14 ? 264  GLY B N   1 
ATOM   6170 C CA  . GLY B 1 263 ? 127.212 12.245 19.092  1.00 132.14 ? 264  GLY B CA  1 
ATOM   6171 C C   . GLY B 1 263 ? 125.998 11.567 19.695  1.00 130.50 ? 264  GLY B C   1 
ATOM   6172 O O   . GLY B 1 263 ? 125.420 10.666 19.086  1.00 140.24 ? 264  GLY B O   1 
ATOM   6173 N N   . ASN B 1 264 ? 125.605 12.001 20.892  1.00 113.29 ? 265  ASN B N   1 
ATOM   6174 C CA  . ASN B 1 264 ? 124.479 11.392 21.587  1.00 96.50  ? 265  ASN B CA  1 
ATOM   6175 C C   . ASN B 1 264 ? 123.950 12.354 22.644  1.00 87.55  ? 265  ASN B C   1 
ATOM   6176 O O   . ASN B 1 264 ? 124.730 12.986 23.361  1.00 86.75  ? 265  ASN B O   1 
ATOM   6177 C CB  . ASN B 1 264 ? 124.883 10.063 22.231  1.00 99.36  ? 265  ASN B CB  1 
ATOM   6178 C CG  . ASN B 1 264 ? 123.792 9.489  23.103  1.00 101.66 ? 265  ASN B CG  1 
ATOM   6179 O OD1 . ASN B 1 264 ? 123.798 9.669  24.319  1.00 96.44  ? 265  ASN B OD1 1 
ATOM   6180 N ND2 . ASN B 1 264 ? 122.842 8.797  22.486  1.00 108.41 ? 265  ASN B ND2 1 
ATOM   6181 N N   . ASP B 1 265 ? 122.620 12.440 22.744  1.00 78.49  ? 266  ASP B N   1 
ATOM   6182 C CA  . ASP B 1 265 ? 121.998 13.415 23.638  1.00 75.91  ? 266  ASP B CA  1 
ATOM   6183 C C   . ASP B 1 265 ? 122.243 13.080 25.105  1.00 78.38  ? 266  ASP B C   1 
ATOM   6184 O O   . ASP B 1 265 ? 122.447 13.983 25.925  1.00 67.74  ? 266  ASP B O   1 
ATOM   6185 C CB  . ASP B 1 265 ? 120.495 13.500 23.368  1.00 74.59  ? 266  ASP B CB  1 
ATOM   6186 C CG  . ASP B 1 265 ? 120.163 14.341 22.153  1.00 77.59  ? 266  ASP B CG  1 
ATOM   6187 O OD1 . ASP B 1 265 ? 121.090 14.930 21.559  1.00 81.78  ? 266  ASP B OD1 1 
ATOM   6188 O OD2 . ASP B 1 265 ? 118.967 14.421 21.800  1.00 73.60  ? 266  ASP B OD2 1 
ATOM   6189 N N   . THR B 1 266 ? 122.211 11.795 25.460  1.00 81.18  ? 267  THR B N   1 
ATOM   6190 C CA  . THR B 1 266 ? 122.321 11.419 26.867  1.00 80.44  ? 267  THR B CA  1 
ATOM   6191 C C   . THR B 1 266 ? 123.669 11.832 27.445  1.00 80.44  ? 267  THR B C   1 
ATOM   6192 O O   . THR B 1 266 ? 123.733 12.473 28.501  1.00 79.46  ? 267  THR B O   1 
ATOM   6193 C CB  . THR B 1 266 ? 122.103 9.915  27.032  1.00 84.24  ? 267  THR B CB  1 
ATOM   6194 O OG1 . THR B 1 266 ? 120.786 9.570  26.585  1.00 87.87  ? 267  THR B OG1 1 
ATOM   6195 C CG2 . THR B 1 266 ? 122.257 9.515  28.490  1.00 76.92  ? 267  THR B CG2 1 
ATOM   6196 N N   . GLU B 1 267 ? 124.761 11.481 26.761  1.00 81.41  ? 268  GLU B N   1 
ATOM   6197 C CA  . GLU B 1 267 ? 126.084 11.820 27.276  1.00 82.88  ? 268  GLU B CA  1 
ATOM   6198 C C   . GLU B 1 267 ? 126.318 13.326 27.275  1.00 73.51  ? 268  GLU B C   1 
ATOM   6199 O O   . GLU B 1 267 ? 127.095 13.830 28.095  1.00 74.34  ? 268  GLU B O   1 
ATOM   6200 C CB  . GLU B 1 267 ? 127.171 11.108 26.466  1.00 93.39  ? 268  GLU B CB  1 
ATOM   6201 C CG  . GLU B 1 267 ? 127.634 11.851 25.220  1.00 106.35 ? 268  GLU B CG  1 
ATOM   6202 C CD  . GLU B 1 267 ? 128.604 11.040 24.378  1.00 118.00 ? 268  GLU B CD  1 
ATOM   6203 O OE1 . GLU B 1 267 ? 129.527 11.640 23.785  1.00 120.40 ? 268  GLU B OE1 1 
ATOM   6204 O OE2 . GLU B 1 267 ? 128.444 9.803  24.309  1.00 121.70 ? 268  GLU B OE2 1 
ATOM   6205 N N   . LEU B 1 268 ? 125.650 14.062 26.383  1.00 66.37  ? 269  LEU B N   1 
ATOM   6206 C CA  . LEU B 1 268 ? 125.852 15.505 26.318  1.00 64.21  ? 269  LEU B CA  1 
ATOM   6207 C C   . LEU B 1 268 ? 125.235 16.195 27.528  1.00 61.65  ? 269  LEU B C   1 
ATOM   6208 O O   . LEU B 1 268 ? 125.872 17.043 28.165  1.00 61.59  ? 269  LEU B O   1 
ATOM   6209 C CB  . LEU B 1 268 ? 125.277 16.055 25.007  1.00 61.49  ? 269  LEU B CB  1 
ATOM   6210 C CG  . LEU B 1 268 ? 125.444 17.535 24.640  1.00 64.01  ? 269  LEU B CG  1 
ATOM   6211 C CD1 . LEU B 1 268 ? 125.322 17.717 23.130  1.00 60.60  ? 269  LEU B CD1 1 
ATOM   6212 C CD2 . LEU B 1 268 ? 124.440 18.436 25.359  1.00 71.67  ? 269  LEU B CD2 1 
ATOM   6213 N N   . VAL B 1 269 ? 123.988 15.851 27.855  1.00 56.64  ? 270  VAL B N   1 
ATOM   6214 C CA  . VAL B 1 269 ? 123.339 16.457 29.012  1.00 58.76  ? 270  VAL B CA  1 
ATOM   6215 C C   . VAL B 1 269 ? 124.050 16.049 30.295  1.00 58.30  ? 270  VAL B C   1 
ATOM   6216 O O   . VAL B 1 269 ? 124.163 16.842 31.237  1.00 58.30  ? 270  VAL B O   1 
ATOM   6217 C CB  . VAL B 1 269 ? 121.846 16.083 29.046  1.00 57.89  ? 270  VAL B CB  1 
ATOM   6218 C CG1 . VAL B 1 269 ? 121.143 16.809 30.182  1.00 51.07  ? 270  VAL B CG1 1 
ATOM   6219 C CG2 . VAL B 1 269 ? 121.189 16.407 27.715  1.00 55.43  ? 270  VAL B CG2 1 
ATOM   6220 N N   . ALA B 1 270 ? 124.545 14.810 30.351  1.00 58.54  ? 271  ALA B N   1 
ATOM   6221 C CA  . ALA B 1 270 ? 125.275 14.356 31.530  1.00 65.18  ? 271  ALA B CA  1 
ATOM   6222 C C   . ALA B 1 270 ? 126.514 15.210 31.765  1.00 66.62  ? 271  ALA B C   1 
ATOM   6223 O O   . ALA B 1 270 ? 126.790 15.629 32.895  1.00 67.22  ? 271  ALA B O   1 
ATOM   6224 C CB  . ALA B 1 270 ? 125.654 12.882 31.380  1.00 56.91  ? 271  ALA B CB  1 
ATOM   6225 N N   . CYS B 1 271 ? 127.271 15.486 30.700  1.00 61.91  ? 272  CYS B N   1 
ATOM   6226 C CA  . CYS B 1 271 ? 128.452 16.330 30.836  1.00 65.33  ? 272  CYS B CA  1 
ATOM   6227 C C   . CYS B 1 271 ? 128.070 17.755 31.217  1.00 57.31  ? 272  CYS B C   1 
ATOM   6228 O O   . CYS B 1 271 ? 128.748 18.386 32.035  1.00 60.46  ? 272  CYS B O   1 
ATOM   6229 C CB  . CYS B 1 271 ? 129.260 16.316 29.538  1.00 71.42  ? 272  CYS B CB  1 
ATOM   6230 S SG  . CYS B 1 271 ? 130.738 17.366 29.550  1.00 73.59  ? 272  CYS B SG  1 
ATOM   6231 N N   . LEU B 1 272 ? 126.988 18.278 30.634  1.00 52.28  ? 273  LEU B N   1 
ATOM   6232 C CA  . LEU B 1 272 ? 126.517 19.606 31.013  1.00 55.92  ? 273  LEU B CA  1 
ATOM   6233 C C   . LEU B 1 272 ? 126.115 19.661 32.481  1.00 60.41  ? 273  LEU B C   1 
ATOM   6234 O O   . LEU B 1 272 ? 126.275 20.703 33.128  1.00 65.59  ? 273  LEU B O   1 
ATOM   6235 C CB  . LEU B 1 272 ? 125.340 20.026 30.136  1.00 50.20  ? 273  LEU B CB  1 
ATOM   6236 C CG  . LEU B 1 272 ? 125.620 20.468 28.699  1.00 58.14  ? 273  LEU B CG  1 
ATOM   6237 C CD1 . LEU B 1 272 ? 124.312 20.773 27.997  1.00 47.14  ? 273  LEU B CD1 1 
ATOM   6238 C CD2 . LEU B 1 272 ? 126.530 21.684 28.669  1.00 60.96  ? 273  LEU B CD2 1 
ATOM   6239 N N   . ARG B 1 273 ? 125.597 18.556 33.024  1.00 53.68  ? 274  ARG B N   1 
ATOM   6240 C CA  . ARG B 1 273 ? 125.190 18.538 34.423  1.00 56.75  ? 274  ARG B CA  1 
ATOM   6241 C C   . ARG B 1 273 ? 126.378 18.564 35.375  1.00 56.15  ? 274  ARG B C   1 
ATOM   6242 O O   . ARG B 1 273 ? 126.194 18.845 36.563  1.00 55.33  ? 274  ARG B O   1 
ATOM   6243 C CB  . ARG B 1 273 ? 124.321 17.311 34.708  1.00 55.68  ? 274  ARG B CB  1 
ATOM   6244 C CG  . ARG B 1 273 ? 122.894 17.420 34.188  1.00 56.07  ? 274  ARG B CG  1 
ATOM   6245 C CD  . ARG B 1 273 ? 121.967 16.453 34.910  1.00 64.29  ? 274  ARG B CD  1 
ATOM   6246 N NE  . ARG B 1 273 ? 121.573 15.321 34.078  1.00 76.27  ? 274  ARG B NE  1 
ATOM   6247 C CZ  . ARG B 1 273 ? 120.395 15.214 33.470  1.00 76.11  ? 274  ARG B CZ  1 
ATOM   6248 N NH1 . ARG B 1 273 ? 119.486 16.173 33.602  1.00 57.45  ? 274  ARG B NH1 1 
ATOM   6249 N NH2 . ARG B 1 273 ? 120.122 14.145 32.733  1.00 82.61  ? 274  ARG B NH2 1 
ATOM   6250 N N   . THR B 1 274 ? 127.585 18.273 34.890  1.00 54.20  ? 275  THR B N   1 
ATOM   6251 C CA  . THR B 1 274 ? 128.769 18.333 35.735  1.00 54.42  ? 275  THR B CA  1 
ATOM   6252 C C   . THR B 1 274 ? 129.347 19.738 35.847  1.00 53.82  ? 275  THR B C   1 
ATOM   6253 O O   . THR B 1 274 ? 130.186 19.974 36.720  1.00 60.21  ? 275  THR B O   1 
ATOM   6254 C CB  . THR B 1 274 ? 129.856 17.392 35.206  1.00 61.30  ? 275  THR B CB  1 
ATOM   6255 O OG1 . THR B 1 274 ? 130.317 17.860 33.932  1.00 62.99  ? 275  THR B OG1 1 
ATOM   6256 C CG2 . THR B 1 274 ? 129.319 15.982 35.062  1.00 57.63  ? 275  THR B CG2 1 
ATOM   6257 N N   . ARG B 1 275 ? 128.931 20.665 34.995  1.00 52.36  ? 276  ARG B N   1 
ATOM   6258 C CA  . ARG B 1 275 ? 129.562 21.968 34.973  1.00 59.27  ? 276  ARG B CA  1 
ATOM   6259 C C   . ARG B 1 275 ? 128.917 22.909 35.982  1.00 57.62  ? 276  ARG B C   1 
ATOM   6260 O O   . ARG B 1 275 ? 127.688 22.949 36.106  1.00 48.91  ? 276  ARG B O   1 
ATOM   6261 C CB  . ARG B 1 275 ? 129.508 22.590 33.590  1.00 54.28  ? 276  ARG B CB  1 
ATOM   6262 C CG  . ARG B 1 275 ? 130.262 21.729 32.593  1.00 56.74  ? 276  ARG B CG  1 
ATOM   6263 C CD  . ARG B 1 275 ? 131.758 22.019 32.672  1.00 65.00  ? 276  ARG B CD  1 
ATOM   6264 N NE  . ARG B 1 275 ? 132.430 21.650 31.444  1.00 67.08  ? 276  ARG B NE  1 
ATOM   6265 C CZ  . ARG B 1 275 ? 132.831 20.416 31.182  1.00 68.28  ? 276  ARG B CZ  1 
ATOM   6266 N NH1 . ARG B 1 275 ? 132.654 19.426 32.054  1.00 61.08  ? 276  ARG B NH1 1 
ATOM   6267 N NH2 . ARG B 1 275 ? 133.429 20.151 30.027  1.00 73.85  ? 276  ARG B NH2 1 
ATOM   6268 N N   . PRO B 1 276 ? 129.726 23.693 36.708  1.00 53.24  ? 277  PRO B N   1 
ATOM   6269 C CA  . PRO B 1 276 ? 129.144 24.741 37.580  1.00 49.63  ? 277  PRO B CA  1 
ATOM   6270 C C   . PRO B 1 276 ? 128.176 25.629 36.803  1.00 56.13  ? 277  PRO B C   1 
ATOM   6271 O O   . PRO B 1 276 ? 128.369 25.891 35.616  1.00 49.60  ? 277  PRO B O   1 
ATOM   6272 C CB  . PRO B 1 276 ? 130.374 25.521 38.062  1.00 52.90  ? 277  PRO B CB  1 
ATOM   6273 C CG  . PRO B 1 276 ? 131.562 24.646 37.799  1.00 54.37  ? 277  PRO B CG  1 
ATOM   6274 C CD  . PRO B 1 276 ? 131.211 23.748 36.652  1.00 55.08  ? 277  PRO B CD  1 
ATOM   6275 N N   . ALA B 1 277 ? 127.131 26.071 37.494  1.00 46.17  ? 278  ALA B N   1 
ATOM   6276 C CA  . ALA B 1 277 ? 126.116 26.893 36.872  1.00 50.89  ? 278  ALA B CA  1 
ATOM   6277 C C   . ALA B 1 277 ? 126.711 28.142 36.228  1.00 51.83  ? 278  ALA B C   1 
ATOM   6278 O O   . ALA B 1 277 ? 126.301 28.543 35.123  1.00 53.85  ? 278  ALA B O   1 
ATOM   6279 C CB  . ALA B 1 277 ? 125.044 27.295 37.898  1.00 49.55  ? 278  ALA B CB  1 
ATOM   6280 N N   . GLN B 1 278 ? 127.690 28.759 36.883  1.00 51.34  ? 279  GLN B N   1 
ATOM   6281 C CA  . GLN B 1 278 ? 128.291 29.974 36.347  1.00 52.15  ? 279  GLN B CA  1 
ATOM   6282 C C   . GLN B 1 278 ? 129.005 29.732 35.023  1.00 50.89  ? 279  GLN B C   1 
ATOM   6283 O O   . GLN B 1 278 ? 129.158 30.670 34.231  1.00 48.66  ? 279  GLN B O   1 
ATOM   6284 C CB  . GLN B 1 278 ? 129.258 30.580 37.365  1.00 51.87  ? 279  GLN B CB  1 
ATOM   6285 C CG  . GLN B 1 278 ? 129.619 32.026 37.074  1.00 69.54  ? 279  GLN B CG  1 
ATOM   6286 C CD  . GLN B 1 278 ? 128.394 32.925 36.988  1.00 75.05  ? 279  GLN B CD  1 
ATOM   6287 O OE1 . GLN B 1 278 ? 127.553 32.937 37.889  1.00 78.71  ? 279  GLN B OE1 1 
ATOM   6288 N NE2 . GLN B 1 278 ? 128.286 33.678 35.897  1.00 69.23  ? 279  GLN B NE2 1 
ATOM   6289 N N   . VAL B 1 279 ? 129.442 28.500 34.756  1.00 50.68  ? 280  VAL B N   1 
ATOM   6290 C CA  . VAL B 1 279 ? 130.141 28.226 33.504  1.00 49.30  ? 280  VAL B CA  1 
ATOM   6291 C C   . VAL B 1 279 ? 129.186 28.325 32.321  1.00 51.93  ? 280  VAL B C   1 
ATOM   6292 O O   . VAL B 1 279 ? 129.528 28.895 31.276  1.00 53.20  ? 280  VAL B O   1 
ATOM   6293 C CB  . VAL B 1 279 ? 130.826 26.850 33.564  1.00 54.95  ? 280  VAL B CB  1 
ATOM   6294 C CG1 . VAL B 1 279 ? 131.356 26.467 32.190  1.00 57.89  ? 280  VAL B CG1 1 
ATOM   6295 C CG2 . VAL B 1 279 ? 131.951 26.890 34.562  1.00 51.83  ? 280  VAL B CG2 1 
ATOM   6296 N N   . LEU B 1 280 ? 127.976 27.771 32.466  1.00 47.94  ? 281  LEU B N   1 
ATOM   6297 C CA  . LEU B 1 280 ? 126.989 27.868 31.396  1.00 51.18  ? 281  LEU B CA  1 
ATOM   6298 C C   . LEU B 1 280 ? 126.525 29.300 31.199  1.00 53.54  ? 281  LEU B C   1 
ATOM   6299 O O   . LEU B 1 280 ? 126.277 29.726 30.063  1.00 50.13  ? 281  LEU B O   1 
ATOM   6300 C CB  . LEU B 1 280 ? 125.800 26.939 31.670  1.00 43.66  ? 281  LEU B CB  1 
ATOM   6301 C CG  . LEU B 1 280 ? 126.128 25.529 32.152  1.00 50.02  ? 281  LEU B CG  1 
ATOM   6302 C CD1 . LEU B 1 280 ? 124.839 24.695 32.290  1.00 47.50  ? 281  LEU B CD1 1 
ATOM   6303 C CD2 . LEU B 1 280 ? 127.208 24.857 31.256  1.00 50.68  ? 281  LEU B CD2 1 
ATOM   6304 N N   . VAL B 1 281 ? 126.405 30.057 32.288  1.00 47.09  ? 282  VAL B N   1 
ATOM   6305 C CA  . VAL B 1 281 ? 126.001 31.457 32.183  1.00 54.06  ? 282  VAL B CA  1 
ATOM   6306 C C   . VAL B 1 281 ? 127.003 32.250 31.348  1.00 53.42  ? 282  VAL B C   1 
ATOM   6307 O O   . VAL B 1 281 ? 126.618 33.092 30.528  1.00 55.72  ? 282  VAL B O   1 
ATOM   6308 C CB  . VAL B 1 281 ? 125.825 32.074 33.585  1.00 51.38  ? 282  VAL B CB  1 
ATOM   6309 C CG1 . VAL B 1 281 ? 125.602 33.563 33.471  1.00 47.22  ? 282  VAL B CG1 1 
ATOM   6310 C CG2 . VAL B 1 281 ? 124.654 31.433 34.302  1.00 49.64  ? 282  VAL B CG2 1 
ATOM   6311 N N   . ASN B 1 282 ? 128.301 31.980 31.537  1.00 45.14  ? 283  ASN B N   1 
ATOM   6312 C CA  . ASN B 1 282 ? 129.327 32.801 30.903  1.00 50.37  ? 283  ASN B CA  1 
ATOM   6313 C C   . ASN B 1 282 ? 129.415 32.550 29.398  1.00 54.38  ? 283  ASN B C   1 
ATOM   6314 O O   . ASN B 1 282 ? 129.830 33.439 28.652  1.00 54.84  ? 283  ASN B O   1 
ATOM   6315 C CB  . ASN B 1 282 ? 130.691 32.570 31.573  1.00 59.12  ? 283  ASN B CB  1 
ATOM   6316 C CG  . ASN B 1 282 ? 130.749 33.174 32.969  1.00 72.80  ? 283  ASN B CG  1 
ATOM   6317 O OD1 . ASN B 1 282 ? 130.046 34.137 33.264  1.00 80.71  ? 283  ASN B OD1 1 
ATOM   6318 N ND2 . ASN B 1 282 ? 131.636 32.648 33.812  1.00 75.96  ? 283  ASN B ND2 1 
ATOM   6319 N N   . HIS B 1 283 ? 129.032 31.358 28.938  1.00 53.17  ? 284  HIS B N   1 
ATOM   6320 C CA  . HIS B 1 283 ? 129.059 31.034 27.512  1.00 58.51  ? 284  HIS B CA  1 
ATOM   6321 C C   . HIS B 1 283 ? 127.695 31.111 26.839  1.00 58.14  ? 284  HIS B C   1 
ATOM   6322 O O   . HIS B 1 283 ? 127.625 30.993 25.610  1.00 60.11  ? 284  HIS B O   1 
ATOM   6323 C CB  . HIS B 1 283 ? 129.652 29.634 27.282  1.00 53.90  ? 284  HIS B CB  1 
ATOM   6324 C CG  . HIS B 1 283 ? 131.091 29.518 27.674  1.00 60.32  ? 284  HIS B CG  1 
ATOM   6325 N ND1 . HIS B 1 283 ? 131.492 29.115 28.929  1.00 64.85  ? 284  HIS B ND1 1 
ATOM   6326 C CD2 . HIS B 1 283 ? 132.225 29.763 26.977  1.00 62.54  ? 284  HIS B CD2 1 
ATOM   6327 C CE1 . HIS B 1 283 ? 132.812 29.111 28.987  1.00 66.78  ? 284  HIS B CE1 1 
ATOM   6328 N NE2 . HIS B 1 283 ? 133.281 29.502 27.816  1.00 70.95  ? 284  HIS B NE2 1 
ATOM   6329 N N   . GLU B 1 284 ? 126.613 31.304 27.597  1.00 57.02  ? 285  GLU B N   1 
ATOM   6330 C CA  . GLU B 1 284 ? 125.278 31.189 27.017  1.00 56.52  ? 285  GLU B CA  1 
ATOM   6331 C C   . GLU B 1 284 ? 125.048 32.169 25.872  1.00 62.02  ? 285  GLU B C   1 
ATOM   6332 O O   . GLU B 1 284 ? 124.210 31.900 25.004  1.00 52.25  ? 285  GLU B O   1 
ATOM   6333 C CB  . GLU B 1 284 ? 124.204 31.387 28.091  1.00 59.14  ? 285  GLU B CB  1 
ATOM   6334 C CG  . GLU B 1 284 ? 123.689 32.810 28.216  1.00 69.07  ? 285  GLU B CG  1 
ATOM   6335 C CD  . GLU B 1 284 ? 122.518 32.938 29.179  1.00 74.52  ? 285  GLU B CD  1 
ATOM   6336 O OE1 . GLU B 1 284 ? 121.767 31.954 29.339  1.00 73.31  ? 285  GLU B OE1 1 
ATOM   6337 O OE2 . GLU B 1 284 ? 122.351 34.023 29.776  1.00 72.16  ? 285  GLU B OE2 1 
ATOM   6338 N N   . TRP B 1 285 ? 125.695 33.315 25.852  1.00 57.71  ? 286  TRP B N   1 
ATOM   6339 C CA  . TRP B 1 285 ? 125.450 34.265 24.792  1.00 56.35  ? 286  TRP B CA  1 
ATOM   6340 C C   . TRP B 1 285 ? 126.230 34.067 23.499  1.00 60.91  ? 286  TRP B C   1 
ATOM   6341 O O   . TRP B 1 285 ? 125.882 34.626 22.492  1.00 61.07  ? 286  TRP B O   1 
ATOM   6342 C CB  . TRP B 1 285 ? 125.676 35.666 25.307  1.00 60.58  ? 286  TRP B CB  1 
ATOM   6343 C CG  . TRP B 1 285 ? 124.571 36.593 25.038  1.00 69.27  ? 286  TRP B CG  1 
ATOM   6344 C CD1 . TRP B 1 285 ? 124.637 37.749 24.358  1.00 76.30  ? 286  TRP B CD1 1 
ATOM   6345 C CD2 . TRP B 1 285 ? 123.218 36.462 25.473  1.00 76.23  ? 286  TRP B CD2 1 
ATOM   6346 N NE1 . TRP B 1 285 ? 123.420 38.349 24.322  1.00 80.16  ? 286  TRP B NE1 1 
ATOM   6347 C CE2 . TRP B 1 285 ? 122.526 37.574 25.004  1.00 80.38  ? 286  TRP B CE2 1 
ATOM   6348 C CE3 . TRP B 1 285 ? 122.522 35.499 26.206  1.00 76.01  ? 286  TRP B CE3 1 
ATOM   6349 C CZ2 . TRP B 1 285 ? 121.184 37.763 25.250  1.00 84.25  ? 286  TRP B CZ2 1 
ATOM   6350 C CZ3 . TRP B 1 285 ? 121.189 35.680 26.433  1.00 69.49  ? 286  TRP B CZ3 1 
ATOM   6351 C CH2 . TRP B 1 285 ? 120.534 36.799 25.963  1.00 79.67  ? 286  TRP B CH2 1 
ATOM   6352 N N   . HIS B 1 286 ? 127.280 33.277 23.521  1.00 57.21  ? 287  HIS B N   1 
ATOM   6353 C CA  . HIS B 1 286 ? 128.041 33.057 22.306  1.00 61.47  ? 287  HIS B CA  1 
ATOM   6354 C C   . HIS B 1 286 ? 127.402 32.019 21.391  1.00 63.78  ? 287  HIS B C   1 
ATOM   6355 O O   . HIS B 1 286 ? 128.034 31.598 20.418  1.00 70.72  ? 287  HIS B O   1 
ATOM   6356 C CB  . HIS B 1 286 ? 129.473 32.671 22.675  1.00 64.97  ? 287  HIS B CB  1 
ATOM   6357 C CG  . HIS B 1 286 ? 130.151 33.684 23.545  1.00 80.56  ? 287  HIS B CG  1 
ATOM   6358 N ND1 . HIS B 1 286 ? 130.553 34.916 23.076  1.00 89.65  ? 287  HIS B ND1 1 
ATOM   6359 C CD2 . HIS B 1 286 ? 130.476 33.659 24.860  1.00 86.49  ? 287  HIS B CD2 1 
ATOM   6360 C CE1 . HIS B 1 286 ? 131.107 35.601 24.060  1.00 94.23  ? 287  HIS B CE1 1 
ATOM   6361 N NE2 . HIS B 1 286 ? 131.073 34.861 25.153  1.00 92.14  ? 287  HIS B NE2 1 
ATOM   6362 N N   . VAL B 1 287 ? 126.158 31.613 21.666  1.00 59.86  ? 288  VAL B N   1 
ATOM   6363 C CA  . VAL B 1 287 ? 125.442 30.679 20.805  1.00 51.36  ? 288  VAL B CA  1 
ATOM   6364 C C   . VAL B 1 287 ? 124.417 31.372 19.922  1.00 54.42  ? 288  VAL B C   1 
ATOM   6365 O O   . VAL B 1 287 ? 123.768 30.707 19.103  1.00 56.17  ? 288  VAL B O   1 
ATOM   6366 C CB  . VAL B 1 287 ? 124.758 29.564 21.622  1.00 51.42  ? 288  VAL B CB  1 
ATOM   6367 C CG1 . VAL B 1 287 ? 125.733 28.955 22.619  1.00 54.86  ? 288  VAL B CG1 1 
ATOM   6368 C CG2 . VAL B 1 287 ? 123.508 30.090 22.317  1.00 42.51  ? 288  VAL B CG2 1 
ATOM   6369 N N   . LEU B 1 288 ? 124.242 32.682 20.063  1.00 51.57  ? 289  LEU B N   1 
ATOM   6370 C CA  . LEU B 1 288 ? 123.359 33.397 19.156  1.00 50.02  ? 289  LEU B CA  1 
ATOM   6371 C C   . LEU B 1 288 ? 123.969 33.426 17.754  1.00 52.50  ? 289  LEU B C   1 
ATOM   6372 O O   . LEU B 1 288 ? 125.183 33.602 17.605  1.00 55.69  ? 289  LEU B O   1 
ATOM   6373 C CB  . LEU B 1 288 ? 123.096 34.819 19.646  1.00 40.07  ? 289  LEU B CB  1 
ATOM   6374 C CG  . LEU B 1 288 ? 122.207 34.970 20.877  1.00 43.36  ? 289  LEU B CG  1 
ATOM   6375 C CD1 . LEU B 1 288 ? 122.221 36.423 21.332  1.00 44.48  ? 289  LEU B CD1 1 
ATOM   6376 C CD2 . LEU B 1 288 ? 120.790 34.463 20.578  1.00 36.87  ? 289  LEU B CD2 1 
ATOM   6377 N N   . PRO B 1 289 ? 123.155 33.254 16.708  1.00 49.03  ? 290  PRO B N   1 
ATOM   6378 C CA  . PRO B 1 289 ? 123.727 33.103 15.359  1.00 50.21  ? 290  PRO B CA  1 
ATOM   6379 C C   . PRO B 1 289 ? 124.392 34.359 14.822  1.00 57.26  ? 290  PRO B C   1 
ATOM   6380 O O   . PRO B 1 289 ? 125.327 34.241 14.023  1.00 69.36  ? 290  PRO B O   1 
ATOM   6381 C CB  . PRO B 1 289 ? 122.515 32.695 14.510  1.00 50.53  ? 290  PRO B CB  1 
ATOM   6382 C CG  . PRO B 1 289 ? 121.330 33.206 15.262  1.00 48.27  ? 290  PRO B CG  1 
ATOM   6383 C CD  . PRO B 1 289 ? 121.689 33.107 16.715  1.00 47.03  ? 290  PRO B CD  1 
ATOM   6384 N N   . GLN B 1 290 ? 123.956 35.552 15.222  1.00 60.96  ? 291  GLN B N   1 
ATOM   6385 C CA  . GLN B 1 290 ? 124.579 36.774 14.731  1.00 70.88  ? 291  GLN B CA  1 
ATOM   6386 C C   . GLN B 1 290 ? 124.491 37.855 15.798  1.00 71.34  ? 291  GLN B C   1 
ATOM   6387 O O   . GLN B 1 290 ? 123.806 37.705 16.812  1.00 67.82  ? 291  GLN B O   1 
ATOM   6388 C CB  . GLN B 1 290 ? 123.928 37.263 13.431  1.00 78.04  ? 291  GLN B CB  1 
ATOM   6389 C CG  . GLN B 1 290 ? 122.591 37.965 13.630  1.00 84.37  ? 291  GLN B CG  1 
ATOM   6390 C CD  . GLN B 1 290 ? 122.302 38.994 12.547  1.00 92.58  ? 291  GLN B CD  1 
ATOM   6391 O OE1 . GLN B 1 290 ? 121.776 38.664 11.483  1.00 92.60  ? 291  GLN B OE1 1 
ATOM   6392 N NE2 . GLN B 1 290 ? 122.643 40.251 12.817  1.00 90.78  ? 291  GLN B NE2 1 
ATOM   6393 N N   . GLU B 1 291 ? 125.209 38.953 15.554  1.00 74.83  ? 292  GLU B N   1 
ATOM   6394 C CA  . GLU B 1 291 ? 125.082 40.133 16.398  1.00 77.77  ? 292  GLU B CA  1 
ATOM   6395 C C   . GLU B 1 291 ? 123.640 40.614 16.397  1.00 66.93  ? 292  GLU B C   1 
ATOM   6396 O O   . GLU B 1 291 ? 122.979 40.641 15.355  1.00 68.72  ? 292  GLU B O   1 
ATOM   6397 C CB  . GLU B 1 291 ? 126.004 41.249 15.902  1.00 90.46  ? 292  GLU B CB  1 
ATOM   6398 C CG  . GLU B 1 291 ? 127.479 41.010 16.163  1.00 103.23 ? 292  GLU B CG  1 
ATOM   6399 C CD  . GLU B 1 291 ? 127.744 40.482 17.559  1.00 109.04 ? 292  GLU B CD  1 
ATOM   6400 O OE1 . GLU B 1 291 ? 128.023 39.272 17.696  1.00 111.03 ? 292  GLU B OE1 1 
ATOM   6401 O OE2 . GLU B 1 291 ? 127.665 41.275 18.521  1.00 111.15 ? 292  GLU B OE2 1 
ATOM   6402 N N   . SER B 1 292 ? 123.144 40.996 17.569  1.00 60.11  ? 293  SER B N   1 
ATOM   6403 C CA  . SER B 1 292 ? 121.740 41.360 17.658  1.00 60.22  ? 293  SER B CA  1 
ATOM   6404 C C   . SER B 1 292 ? 121.469 42.111 18.949  1.00 60.51  ? 293  SER B C   1 
ATOM   6405 O O   . SER B 1 292 ? 122.216 42.009 19.926  1.00 64.47  ? 293  SER B O   1 
ATOM   6406 C CB  . SER B 1 292 ? 120.841 40.121 17.576  1.00 62.53  ? 293  SER B CB  1 
ATOM   6407 O OG  . SER B 1 292 ? 121.193 39.179 18.572  1.00 66.26  ? 293  SER B OG  1 
ATOM   6408 N N   . VAL B 1 293 ? 120.391 42.881 18.923  1.00 59.23  ? 294  VAL B N   1 
ATOM   6409 C CA  . VAL B 1 293 ? 119.695 43.309 20.126  1.00 53.62  ? 294  VAL B CA  1 
ATOM   6410 C C   . VAL B 1 293 ? 118.316 42.669 20.089  1.00 56.10  ? 294  VAL B C   1 
ATOM   6411 O O   . VAL B 1 293 ? 117.789 42.351 19.015  1.00 61.61  ? 294  VAL B O   1 
ATOM   6412 C CB  . VAL B 1 293 ? 119.598 44.844 20.248  1.00 49.91  ? 294  VAL B CB  1 
ATOM   6413 C CG1 . VAL B 1 293 ? 120.991 45.462 20.303  1.00 51.84  ? 294  VAL B CG1 1 
ATOM   6414 C CG2 . VAL B 1 293 ? 118.793 45.422 19.095  1.00 50.04  ? 294  VAL B CG2 1 
ATOM   6415 N N   . PHE B 1 294 ? 117.749 42.441 21.273  1.00 47.97  ? 295  PHE B N   1 
ATOM   6416 C CA  . PHE B 1 294 ? 116.407 41.868 21.419  1.00 48.12  ? 295  PHE B CA  1 
ATOM   6417 C C   . PHE B 1 294 ? 116.338 40.429 20.903  1.00 48.67  ? 295  PHE B C   1 
ATOM   6418 O O   . PHE B 1 294 ? 115.321 39.998 20.350  1.00 42.37  ? 295  PHE B O   1 
ATOM   6419 C CB  . PHE B 1 294 ? 115.350 42.744 20.740  1.00 39.94  ? 295  PHE B CB  1 
ATOM   6420 C CG  . PHE B 1 294 ? 114.097 42.896 21.545  1.00 46.80  ? 295  PHE B CG  1 
ATOM   6421 C CD1 . PHE B 1 294 ? 113.564 44.149 21.793  1.00 44.23  ? 295  PHE B CD1 1 
ATOM   6422 C CD2 . PHE B 1 294 ? 113.457 41.783 22.070  1.00 42.55  ? 295  PHE B CD2 1 
ATOM   6423 C CE1 . PHE B 1 294 ? 112.412 44.288 22.542  1.00 41.06  ? 295  PHE B CE1 1 
ATOM   6424 C CE2 . PHE B 1 294 ? 112.307 41.914 22.815  1.00 40.46  ? 295  PHE B CE2 1 
ATOM   6425 C CZ  . PHE B 1 294 ? 111.782 43.169 23.055  1.00 42.52  ? 295  PHE B CZ  1 
ATOM   6426 N N   . ARG B 1 295 ? 117.432 39.681 21.087  1.00 42.81  ? 296  ARG B N   1 
ATOM   6427 C CA  . ARG B 1 295 ? 117.483 38.242 20.841  1.00 43.66  ? 296  ARG B CA  1 
ATOM   6428 C C   . ARG B 1 295 ? 118.094 37.545 22.039  1.00 41.96  ? 296  ARG B C   1 
ATOM   6429 O O   . ARG B 1 295 ? 119.054 38.042 22.634  1.00 42.38  ? 296  ARG B O   1 
ATOM   6430 C CB  . ARG B 1 295 ? 118.279 37.866 19.585  1.00 43.94  ? 296  ARG B CB  1 
ATOM   6431 C CG  . ARG B 1 295 ? 117.537 38.258 18.309  1.00 47.41  ? 296  ARG B CG  1 
ATOM   6432 C CD  . ARG B 1 295 ? 116.321 37.346 18.009  1.00 47.83  ? 296  ARG B CD  1 
ATOM   6433 N NE  . ARG B 1 295 ? 115.541 37.813 16.865  1.00 49.31  ? 296  ARG B NE  1 
ATOM   6434 C CZ  . ARG B 1 295 ? 114.702 38.843 16.900  1.00 51.32  ? 296  ARG B CZ  1 
ATOM   6435 N NH1 . ARG B 1 295 ? 114.482 39.551 18.011  1.00 40.19  ? 296  ARG B NH1 1 
ATOM   6436 N NH2 . ARG B 1 295 ? 114.046 39.188 15.795  1.00 50.27  ? 296  ARG B NH2 1 
ATOM   6437 N N   . PHE B 1 296 ? 117.548 36.384 22.385  1.00 45.42  ? 297  PHE B N   1 
ATOM   6438 C CA  . PHE B 1 296 ? 117.971 35.685 23.587  1.00 43.80  ? 297  PHE B CA  1 
ATOM   6439 C C   . PHE B 1 296 ? 118.203 34.211 23.293  1.00 43.87  ? 297  PHE B C   1 
ATOM   6440 O O   . PHE B 1 296 ? 117.463 33.596 22.520  1.00 43.61  ? 297  PHE B O   1 
ATOM   6441 C CB  . PHE B 1 296 ? 116.944 35.888 24.704  1.00 39.65  ? 297  PHE B CB  1 
ATOM   6442 C CG  . PHE B 1 296 ? 116.399 37.284 24.749  1.00 35.62  ? 297  PHE B CG  1 
ATOM   6443 C CD1 . PHE B 1 296 ? 117.193 38.336 25.173  1.00 38.82  ? 297  PHE B CD1 1 
ATOM   6444 C CD2 . PHE B 1 296 ? 115.111 37.553 24.325  1.00 37.55  ? 297  PHE B CD2 1 
ATOM   6445 C CE1 . PHE B 1 296 ? 116.703 39.627 25.195  1.00 42.89  ? 297  PHE B CE1 1 
ATOM   6446 C CE2 . PHE B 1 296 ? 114.615 38.842 24.344  1.00 36.59  ? 297  PHE B CE2 1 
ATOM   6447 C CZ  . PHE B 1 296 ? 115.411 39.879 24.781  1.00 42.03  ? 297  PHE B CZ  1 
ATOM   6448 N N   . SER B 1 297 ? 119.239 33.653 23.928  1.00 39.67  ? 298  SER B N   1 
ATOM   6449 C CA  . SER B 1 297 ? 119.762 32.348 23.531  1.00 45.18  ? 298  SER B CA  1 
ATOM   6450 C C   . SER B 1 297 ? 118.760 31.230 23.793  1.00 45.31  ? 298  SER B C   1 
ATOM   6451 O O   . SER B 1 297 ? 118.416 30.463 22.885  1.00 40.86  ? 298  SER B O   1 
ATOM   6452 C CB  . SER B 1 297 ? 121.076 32.070 24.263  1.00 47.28  ? 298  SER B CB  1 
ATOM   6453 O OG  . SER B 1 297 ? 122.103 32.929 23.801  1.00 52.00  ? 298  SER B OG  1 
ATOM   6454 N N   . PHE B 1 298 ? 118.291 31.108 25.033  1.00 34.84  ? 299  PHE B N   1 
ATOM   6455 C CA  . PHE B 1 298 ? 117.462 29.981 25.446  1.00 39.28  ? 299  PHE B CA  1 
ATOM   6456 C C   . PHE B 1 298 ? 116.083 30.496 25.827  1.00 42.32  ? 299  PHE B C   1 
ATOM   6457 O O   . PHE B 1 298 ? 115.915 31.130 26.875  1.00 40.72  ? 299  PHE B O   1 
ATOM   6458 C CB  . PHE B 1 298 ? 118.128 29.218 26.588  1.00 42.94  ? 299  PHE B CB  1 
ATOM   6459 C CG  . PHE B 1 298 ? 119.466 28.659 26.213  1.00 42.86  ? 299  PHE B CG  1 
ATOM   6460 C CD1 . PHE B 1 298 ? 119.555 27.526 25.417  1.00 38.59  ? 299  PHE B CD1 1 
ATOM   6461 C CD2 . PHE B 1 298 ? 120.634 29.282 26.619  1.00 40.63  ? 299  PHE B CD2 1 
ATOM   6462 C CE1 . PHE B 1 298 ? 120.785 27.012 25.048  1.00 40.89  ? 299  PHE B CE1 1 
ATOM   6463 C CE2 . PHE B 1 298 ? 121.870 28.772 26.253  1.00 46.91  ? 299  PHE B CE2 1 
ATOM   6464 C CZ  . PHE B 1 298 ? 121.944 27.636 25.465  1.00 46.79  ? 299  PHE B CZ  1 
ATOM   6465 N N   . VAL B 1 299 ? 115.107 30.230 24.963  1.00 40.69  ? 300  VAL B N   1 
ATOM   6466 C CA  . VAL B 1 299 ? 113.737 30.717 25.106  1.00 36.58  ? 300  VAL B CA  1 
ATOM   6467 C C   . VAL B 1 299 ? 112.793 29.536 24.892  1.00 38.75  ? 300  VAL B C   1 
ATOM   6468 O O   . VAL B 1 299 ? 113.261 28.438 24.554  1.00 37.43  ? 300  VAL B O   1 
ATOM   6469 C CB  . VAL B 1 299 ? 113.454 31.861 24.117  1.00 39.95  ? 300  VAL B CB  1 
ATOM   6470 C CG1 . VAL B 1 299 ? 114.548 32.929 24.199  1.00 36.76  ? 300  VAL B CG1 1 
ATOM   6471 C CG2 . VAL B 1 299 ? 113.306 31.308 22.694  1.00 39.25  ? 300  VAL B CG2 1 
ATOM   6472 N N   . PRO B 1 300 ? 111.484 29.690 25.104  1.00 36.49  ? 301  PRO B N   1 
ATOM   6473 C CA  . PRO B 1 300 ? 110.559 28.585 24.825  1.00 35.26  ? 301  PRO B CA  1 
ATOM   6474 C C   . PRO B 1 300 ? 110.726 28.002 23.426  1.00 43.47  ? 301  PRO B C   1 
ATOM   6475 O O   . PRO B 1 300 ? 110.933 28.722 22.447  1.00 37.65  ? 301  PRO B O   1 
ATOM   6476 C CB  . PRO B 1 300 ? 109.185 29.232 25.003  1.00 37.82  ? 301  PRO B CB  1 
ATOM   6477 C CG  . PRO B 1 300 ? 109.419 30.235 26.087  1.00 40.76  ? 301  PRO B CG  1 
ATOM   6478 C CD  . PRO B 1 300 ? 110.814 30.772 25.856  1.00 41.42  ? 301  PRO B CD  1 
ATOM   6479 N N   . VAL B 1 301 ? 110.635 26.677 23.343  1.00 43.83  ? 302  VAL B N   1 
ATOM   6480 C CA  . VAL B 1 301 ? 110.783 25.946 22.091  1.00 44.60  ? 302  VAL B CA  1 
ATOM   6481 C C   . VAL B 1 301 ? 109.416 25.426 21.666  1.00 48.79  ? 302  VAL B C   1 
ATOM   6482 O O   . VAL B 1 301 ? 108.615 24.990 22.504  1.00 42.73  ? 302  VAL B O   1 
ATOM   6483 C CB  . VAL B 1 301 ? 111.805 24.795 22.222  1.00 41.35  ? 302  VAL B CB  1 
ATOM   6484 C CG1 . VAL B 1 301 ? 111.358 23.773 23.258  1.00 42.28  ? 302  VAL B CG1 1 
ATOM   6485 C CG2 . VAL B 1 301 ? 112.043 24.130 20.873  1.00 41.11  ? 302  VAL B CG2 1 
ATOM   6486 N N   . VAL B 1 302 ? 109.143 25.500 20.365  1.00 46.22  ? 303  VAL B N   1 
ATOM   6487 C CA  . VAL B 1 302 ? 107.917 24.962 19.781  1.00 45.77  ? 303  VAL B CA  1 
ATOM   6488 C C   . VAL B 1 302 ? 108.209 23.518 19.388  1.00 50.78  ? 303  VAL B C   1 
ATOM   6489 O O   . VAL B 1 302 ? 108.813 23.253 18.347  1.00 58.71  ? 303  VAL B O   1 
ATOM   6490 C CB  . VAL B 1 302 ? 107.447 25.793 18.585  1.00 48.16  ? 303  VAL B CB  1 
ATOM   6491 C CG1 . VAL B 1 302 ? 106.131 25.244 18.030  1.00 40.06  ? 303  VAL B CG1 1 
ATOM   6492 C CG2 . VAL B 1 302 ? 107.313 27.272 18.973  1.00 46.69  ? 303  VAL B CG2 1 
ATOM   6493 N N   . ASP B 1 303 ? 107.775 22.574 20.225  1.00 58.26  ? 304  ASP B N   1 
ATOM   6494 C CA  . ASP B 1 303 ? 108.087 21.165 20.013  1.00 65.04  ? 304  ASP B CA  1 
ATOM   6495 C C   . ASP B 1 303 ? 106.846 20.281 20.072  1.00 60.51  ? 304  ASP B C   1 
ATOM   6496 O O   . ASP B 1 303 ? 106.969 19.063 20.239  1.00 56.65  ? 304  ASP B O   1 
ATOM   6497 C CB  . ASP B 1 303 ? 109.121 20.686 21.034  1.00 70.51  ? 304  ASP B CB  1 
ATOM   6498 C CG  . ASP B 1 303 ? 108.577 20.667 22.449  1.00 69.23  ? 304  ASP B CG  1 
ATOM   6499 O OD1 . ASP B 1 303 ? 107.601 21.398 22.721  1.00 62.49  ? 304  ASP B OD1 1 
ATOM   6500 O OD2 . ASP B 1 303 ? 109.131 19.928 23.289  1.00 77.58  ? 304  ASP B OD2 1 
ATOM   6501 N N   . GLY B 1 304 ? 105.654 20.864 19.945  1.00 52.71  ? 305  GLY B N   1 
ATOM   6502 C CA  . GLY B 1 304 ? 104.427 20.098 19.962  1.00 55.43  ? 305  GLY B CA  1 
ATOM   6503 C C   . GLY B 1 304 ? 103.940 19.670 21.330  1.00 60.60  ? 305  GLY B C   1 
ATOM   6504 O O   . GLY B 1 304 ? 102.846 19.100 21.424  1.00 60.23  ? 305  GLY B O   1 
ATOM   6505 N N   . ASP B 1 305 ? 104.687 19.935 22.403  1.00 55.83  ? 306  ASP B N   1 
ATOM   6506 C CA  . ASP B 1 305 ? 104.222 19.512 23.734  1.00 54.09  ? 306  ASP B CA  1 
ATOM   6507 C C   . ASP B 1 305 ? 103.570 20.665 24.495  1.00 57.54  ? 306  ASP B C   1 
ATOM   6508 O O   . ASP B 1 305 ? 102.344 20.779 24.498  1.00 59.12  ? 306  ASP B O   1 
ATOM   6509 C CB  . ASP B 1 305 ? 105.381 18.932 24.548  1.00 57.01  ? 306  ASP B CB  1 
ATOM   6510 C CG  . ASP B 1 305 ? 104.953 18.480 25.930  1.00 63.88  ? 306  ASP B CG  1 
ATOM   6511 O OD1 . ASP B 1 305 ? 103.755 18.614 26.256  1.00 60.70  ? 306  ASP B OD1 1 
ATOM   6512 O OD2 . ASP B 1 305 ? 105.814 17.990 26.690  1.00 72.88  ? 306  ASP B OD2 1 
ATOM   6513 N N   . PHE B 1 306 ? 104.362 21.537 25.114  1.00 52.40  ? 307  PHE B N   1 
ATOM   6514 C CA  . PHE B 1 306 ? 103.769 22.695 25.780  1.00 46.25  ? 307  PHE B CA  1 
ATOM   6515 C C   . PHE B 1 306 ? 102.997 23.559 24.792  1.00 50.04  ? 307  PHE B C   1 
ATOM   6516 O O   . PHE B 1 306 ? 101.903 24.047 25.101  1.00 51.76  ? 307  PHE B O   1 
ATOM   6517 C CB  . PHE B 1 306 ? 104.855 23.519 26.473  1.00 41.04  ? 307  PHE B CB  1 
ATOM   6518 C CG  . PHE B 1 306 ? 104.324 24.509 27.477  1.00 43.20  ? 307  PHE B CG  1 
ATOM   6519 C CD1 . PHE B 1 306 ? 103.773 25.715 27.067  1.00 40.26  ? 307  PHE B CD1 1 
ATOM   6520 C CD2 . PHE B 1 306 ? 104.387 24.235 28.834  1.00 41.51  ? 307  PHE B CD2 1 
ATOM   6521 C CE1 . PHE B 1 306 ? 103.288 26.624 27.994  1.00 40.07  ? 307  PHE B CE1 1 
ATOM   6522 C CE2 . PHE B 1 306 ? 103.906 25.139 29.765  1.00 44.77  ? 307  PHE B CE2 1 
ATOM   6523 C CZ  . PHE B 1 306 ? 103.354 26.334 29.345  1.00 39.60  ? 307  PHE B CZ  1 
ATOM   6524 N N   . LEU B 1 307 ? 103.552 23.765 23.601  1.00 48.25  ? 308  LEU B N   1 
ATOM   6525 C CA  . LEU B 1 307 ? 102.872 24.456 22.513  1.00 52.25  ? 308  LEU B CA  1 
ATOM   6526 C C   . LEU B 1 307 ? 102.750 23.477 21.355  1.00 51.60  ? 308  LEU B C   1 
ATOM   6527 O O   . LEU B 1 307 ? 103.757 23.122 20.733  1.00 55.51  ? 308  LEU B O   1 
ATOM   6528 C CB  . LEU B 1 307 ? 103.632 25.713 22.094  1.00 50.87  ? 308  LEU B CB  1 
ATOM   6529 C CG  . LEU B 1 307 ? 103.942 26.729 23.193  1.00 52.84  ? 308  LEU B CG  1 
ATOM   6530 C CD1 . LEU B 1 307 ? 105.110 27.608 22.779  1.00 50.59  ? 308  LEU B CD1 1 
ATOM   6531 C CD2 . LEU B 1 307 ? 102.717 27.574 23.510  1.00 46.65  ? 308  LEU B CD2 1 
ATOM   6532 N N   . SER B 1 308 ? 101.523 23.036 21.069  1.00 51.65  ? 309  SER B N   1 
ATOM   6533 C CA  . SER B 1 308 ? 101.299 22.094 19.979  1.00 55.89  ? 309  SER B CA  1 
ATOM   6534 C C   . SER B 1 308 ? 101.601 22.690 18.611  1.00 58.21  ? 309  SER B C   1 
ATOM   6535 O O   . SER B 1 308 ? 101.701 21.939 17.636  1.00 66.10  ? 309  SER B O   1 
ATOM   6536 C CB  . SER B 1 308 ? 99.858  21.586 20.013  1.00 59.61  ? 309  SER B CB  1 
ATOM   6537 O OG  . SER B 1 308 ? 98.940  22.659 19.906  1.00 64.32  ? 309  SER B OG  1 
ATOM   6538 N N   . ASP B 1 309 ? 101.745 24.006 18.515  1.00 57.75  ? 310  ASP B N   1 
ATOM   6539 C CA  . ASP B 1 309 ? 102.080 24.673 17.264  1.00 55.12  ? 310  ASP B CA  1 
ATOM   6540 C C   . ASP B 1 309 ? 102.694 26.020 17.620  1.00 52.31  ? 310  ASP B C   1 
ATOM   6541 O O   . ASP B 1 309 ? 102.847 26.359 18.796  1.00 47.38  ? 310  ASP B O   1 
ATOM   6542 C CB  . ASP B 1 309 ? 100.845 24.822 16.370  1.00 54.68  ? 310  ASP B CB  1 
ATOM   6543 C CG  . ASP B 1 309 ? 101.190 24.854 14.890  1.00 64.55  ? 310  ASP B CG  1 
ATOM   6544 O OD1 . ASP B 1 309 ? 102.303 25.302 14.538  1.00 66.64  ? 310  ASP B OD1 1 
ATOM   6545 O OD2 . ASP B 1 309 ? 100.342 24.430 14.077  1.00 62.49  ? 310  ASP B OD2 1 
ATOM   6546 N N   . THR B 1 310 ? 103.052 26.789 16.595  1.00 50.20  ? 311  THR B N   1 
ATOM   6547 C CA  . THR B 1 310 ? 103.586 28.118 16.839  1.00 52.11  ? 311  THR B CA  1 
ATOM   6548 C C   . THR B 1 310 ? 102.519 28.988 17.501  1.00 52.67  ? 311  THR B C   1 
ATOM   6549 O O   . THR B 1 310 ? 101.322 28.807 17.258  1.00 48.21  ? 311  THR B O   1 
ATOM   6550 C CB  . THR B 1 310 ? 104.045 28.768 15.537  1.00 52.46  ? 311  THR B CB  1 
ATOM   6551 O OG1 . THR B 1 310 ? 102.898 29.125 14.755  1.00 54.60  ? 311  THR B OG1 1 
ATOM   6552 C CG2 . THR B 1 310 ? 104.925 27.811 14.743  1.00 49.86  ? 311  THR B CG2 1 
ATOM   6553 N N   . PRO B 1 311 ? 102.923 29.927 18.360  1.00 49.07  ? 312  PRO B N   1 
ATOM   6554 C CA  . PRO B 1 311 ? 101.934 30.838 18.959  1.00 44.50  ? 312  PRO B CA  1 
ATOM   6555 C C   . PRO B 1 311 ? 101.062 31.541 17.931  1.00 51.76  ? 312  PRO B C   1 
ATOM   6556 O O   . PRO B 1 311 ? 99.862  31.716 18.167  1.00 49.34  ? 312  PRO B O   1 
ATOM   6557 C CB  . PRO B 1 311 ? 102.811 31.820 19.746  1.00 46.96  ? 312  PRO B CB  1 
ATOM   6558 C CG  . PRO B 1 311 ? 104.014 31.007 20.119  1.00 48.28  ? 312  PRO B CG  1 
ATOM   6559 C CD  . PRO B 1 311 ? 104.266 30.102 18.942  1.00 50.07  ? 312  PRO B CD  1 
ATOM   6560 N N   . GLU B 1 312 ? 101.626 31.926 16.784  1.00 51.02  ? 313  GLU B N   1 
ATOM   6561 C CA  . GLU B 1 312 ? 100.816 32.542 15.738  1.00 53.25  ? 313  GLU B CA  1 
ATOM   6562 C C   . GLU B 1 312 ? 99.738  31.583 15.244  1.00 47.52  ? 313  GLU B C   1 
ATOM   6563 O O   . GLU B 1 312 ? 98.564  31.956 15.133  1.00 48.20  ? 313  GLU B O   1 
ATOM   6564 C CB  . GLU B 1 312 ? 101.706 33.002 14.583  1.00 59.91  ? 313  GLU B CB  1 
ATOM   6565 C CG  . GLU B 1 312 ? 100.965 33.166 13.266  1.00 76.43  ? 313  GLU B CG  1 
ATOM   6566 C CD  . GLU B 1 312 ? 101.896 33.346 12.082  1.00 94.01  ? 313  GLU B CD  1 
ATOM   6567 O OE1 . GLU B 1 312 ? 101.688 34.298 11.302  1.00 99.14  ? 313  GLU B OE1 1 
ATOM   6568 O OE2 . GLU B 1 312 ? 102.838 32.539 11.932  1.00 98.29  ? 313  GLU B OE2 1 
ATOM   6569 N N   . ALA B 1 313 ? 100.115 30.335 14.954  1.00 44.99  ? 314  ALA B N   1 
ATOM   6570 C CA  . ALA B 1 313 ? 99.130  29.355 14.505  1.00 48.10  ? 314  ALA B CA  1 
ATOM   6571 C C   . ALA B 1 313 ? 98.052  29.133 15.558  1.00 56.05  ? 314  ALA B C   1 
ATOM   6572 O O   . ALA B 1 313 ? 96.862  29.044 15.231  1.00 54.28  ? 314  ALA B O   1 
ATOM   6573 C CB  . ALA B 1 313 ? 99.817  28.034 14.160  1.00 49.49  ? 314  ALA B CB  1 
ATOM   6574 N N   . LEU B 1 314 ? 98.450  29.048 16.829  1.00 52.59  ? 315  LEU B N   1 
ATOM   6575 C CA  . LEU B 1 314 ? 97.479  28.826 17.895  1.00 49.87  ? 315  LEU B CA  1 
ATOM   6576 C C   . LEU B 1 314 ? 96.596  30.049 18.099  1.00 47.38  ? 315  LEU B C   1 
ATOM   6577 O O   . LEU B 1 314 ? 95.402  29.917 18.397  1.00 49.59  ? 315  LEU B O   1 
ATOM   6578 C CB  . LEU B 1 314 ? 98.199  28.453 19.190  1.00 49.52  ? 315  LEU B CB  1 
ATOM   6579 C CG  . LEU B 1 314 ? 98.963  27.129 19.139  1.00 50.34  ? 315  LEU B CG  1 
ATOM   6580 C CD1 . LEU B 1 314 ? 99.804  26.943 20.388  1.00 51.04  ? 315  LEU B CD1 1 
ATOM   6581 C CD2 . LEU B 1 314 ? 97.997  25.968 18.962  1.00 48.47  ? 315  LEU B CD2 1 
ATOM   6582 N N   . ILE B 1 315 ? 97.160  31.245 17.935  1.00 46.61  ? 316  ILE B N   1 
ATOM   6583 C CA  . ILE B 1 315 ? 96.367  32.464 18.052  1.00 50.65  ? 316  ILE B CA  1 
ATOM   6584 C C   . ILE B 1 315 ? 95.324  32.530 16.941  1.00 51.90  ? 316  ILE B C   1 
ATOM   6585 O O   . ILE B 1 315 ? 94.147  32.820 17.189  1.00 55.16  ? 316  ILE B O   1 
ATOM   6586 C CB  . ILE B 1 315 ? 97.286  33.699 18.044  1.00 49.17  ? 316  ILE B CB  1 
ATOM   6587 C CG1 . ILE B 1 315 ? 98.027  33.823 19.375  1.00 48.70  ? 316  ILE B CG1 1 
ATOM   6588 C CG2 . ILE B 1 315 ? 96.492  34.955 17.776  1.00 46.35  ? 316  ILE B CG2 1 
ATOM   6589 C CD1 . ILE B 1 315 ? 99.239  34.718 19.299  1.00 48.10  ? 316  ILE B CD1 1 
ATOM   6590 N N   . ASN B 1 316 ? 95.734  32.247 15.702  1.00 51.94  ? 317  ASN B N   1 
ATOM   6591 C CA  . ASN B 1 316 ? 94.814  32.368 14.574  1.00 52.55  ? 317  ASN B CA  1 
ATOM   6592 C C   . ASN B 1 316 ? 93.696  31.336 14.635  1.00 52.99  ? 317  ASN B C   1 
ATOM   6593 O O   . ASN B 1 316 ? 92.591  31.595 14.147  1.00 58.28  ? 317  ASN B O   1 
ATOM   6594 C CB  . ASN B 1 316 ? 95.573  32.236 13.254  1.00 50.43  ? 317  ASN B CB  1 
ATOM   6595 C CG  . ASN B 1 316 ? 96.579  33.347 13.050  1.00 58.16  ? 317  ASN B CG  1 
ATOM   6596 O OD1 . ASN B 1 316 ? 96.433  34.439 13.601  1.00 59.41  ? 317  ASN B OD1 1 
ATOM   6597 N ND2 . ASN B 1 316 ? 97.607  33.076 12.253  1.00 59.43  ? 317  ASN B ND2 1 
ATOM   6598 N N   . ALA B 1 317 ? 93.954  30.173 15.227  1.00 53.07  ? 318  ALA B N   1 
ATOM   6599 C CA  . ALA B 1 317 ? 92.976  29.096 15.254  1.00 54.38  ? 318  ALA B CA  1 
ATOM   6600 C C   . ALA B 1 317 ? 92.153  29.054 16.533  1.00 57.68  ? 318  ALA B C   1 
ATOM   6601 O O   . ALA B 1 317 ? 91.184  28.290 16.598  1.00 63.40  ? 318  ALA B O   1 
ATOM   6602 C CB  . ALA B 1 317 ? 93.674  27.744 15.062  1.00 58.62  ? 318  ALA B CB  1 
ATOM   6603 N N   . GLY B 1 318 ? 92.501  29.850 17.540  1.00 57.60  ? 319  GLY B N   1 
ATOM   6604 C CA  . GLY B 1 318 ? 91.873  29.711 18.839  1.00 54.84  ? 319  GLY B CA  1 
ATOM   6605 C C   . GLY B 1 318 ? 90.494  30.344 18.908  1.00 58.10  ? 319  GLY B C   1 
ATOM   6606 O O   . GLY B 1 318 ? 90.163  31.277 18.175  1.00 54.58  ? 319  GLY B O   1 
ATOM   6607 N N   . ASP B 1 319 ? 89.676  29.807 19.811  1.00 58.22  ? 320  ASP B N   1 
ATOM   6608 C CA  . ASP B 1 319 ? 88.382  30.377 20.168  1.00 56.66  ? 320  ASP B CA  1 
ATOM   6609 C C   . ASP B 1 319 ? 88.539  31.007 21.545  1.00 53.45  ? 320  ASP B C   1 
ATOM   6610 O O   . ASP B 1 319 ? 88.736  30.297 22.537  1.00 52.17  ? 320  ASP B O   1 
ATOM   6611 C CB  . ASP B 1 319 ? 87.286  29.311 20.160  1.00 63.53  ? 320  ASP B CB  1 
ATOM   6612 C CG  . ASP B 1 319 ? 85.926  29.853 20.587  1.00 70.91  ? 320  ASP B CG  1 
ATOM   6613 O OD1 . ASP B 1 319 ? 85.008  29.036 20.818  1.00 72.98  ? 320  ASP B OD1 1 
ATOM   6614 O OD2 . ASP B 1 319 ? 85.767  31.088 20.697  1.00 69.57  ? 320  ASP B OD2 1 
ATOM   6615 N N   . PHE B 1 320 ? 88.456  32.335 21.605  1.00 51.08  ? 321  PHE B N   1 
ATOM   6616 C CA  . PHE B 1 320 ? 88.732  33.073 22.830  1.00 54.17  ? 321  PHE B CA  1 
ATOM   6617 C C   . PHE B 1 320 ? 87.495  33.776 23.382  1.00 56.89  ? 321  PHE B C   1 
ATOM   6618 O O   . PHE B 1 320 ? 87.613  34.782 24.087  1.00 55.23  ? 321  PHE B O   1 
ATOM   6619 C CB  . PHE B 1 320 ? 89.865  34.072 22.603  1.00 51.16  ? 321  PHE B CB  1 
ATOM   6620 C CG  . PHE B 1 320 ? 91.131  33.442 22.098  1.00 47.43  ? 321  PHE B CG  1 
ATOM   6621 C CD1 . PHE B 1 320 ? 92.036  32.868 22.979  1.00 42.46  ? 321  PHE B CD1 1 
ATOM   6622 C CD2 . PHE B 1 320 ? 91.414  33.418 20.743  1.00 43.01  ? 321  PHE B CD2 1 
ATOM   6623 C CE1 . PHE B 1 320 ? 93.200  32.284 22.516  1.00 43.08  ? 321  PHE B CE1 1 
ATOM   6624 C CE2 . PHE B 1 320 ? 92.577  32.836 20.273  1.00 44.00  ? 321  PHE B CE2 1 
ATOM   6625 C CZ  . PHE B 1 320 ? 93.471  32.269 21.160  1.00 44.60  ? 321  PHE B CZ  1 
ATOM   6626 N N   . HIS B 1 321 ? 86.306  33.262 23.072  1.00 55.00  ? 322  HIS B N   1 
ATOM   6627 C CA  . HIS B 1 321 ? 85.103  33.727 23.748  1.00 57.23  ? 322  HIS B CA  1 
ATOM   6628 C C   . HIS B 1 321 ? 85.187  33.401 25.234  1.00 56.28  ? 322  HIS B C   1 
ATOM   6629 O O   . HIS B 1 321 ? 85.601  32.306 25.625  1.00 53.11  ? 322  HIS B O   1 
ATOM   6630 C CB  . HIS B 1 321 ? 83.855  33.086 23.135  1.00 53.32  ? 322  HIS B CB  1 
ATOM   6631 C CG  . HIS B 1 321 ? 83.390  33.747 21.875  1.00 54.91  ? 322  HIS B CG  1 
ATOM   6632 N ND1 . HIS B 1 321 ? 83.745  33.296 20.621  1.00 54.10  ? 322  HIS B ND1 1 
ATOM   6633 C CD2 . HIS B 1 321 ? 82.599  34.828 21.676  1.00 53.41  ? 322  HIS B CD2 1 
ATOM   6634 C CE1 . HIS B 1 321 ? 83.193  34.070 19.704  1.00 54.53  ? 322  HIS B CE1 1 
ATOM   6635 N NE2 . HIS B 1 321 ? 82.492  35.007 20.318  1.00 56.10  ? 322  HIS B NE2 1 
ATOM   6636 N N   . GLY B 1 322 ? 84.802  34.365 26.066  1.00 57.33  ? 323  GLY B N   1 
ATOM   6637 C CA  . GLY B 1 322 ? 84.903  34.218 27.501  1.00 59.68  ? 323  GLY B CA  1 
ATOM   6638 C C   . GLY B 1 322 ? 86.212  34.682 28.101  1.00 57.18  ? 323  GLY B C   1 
ATOM   6639 O O   . GLY B 1 322 ? 86.370  34.620 29.328  1.00 58.39  ? 323  GLY B O   1 
ATOM   6640 N N   . LEU B 1 323 ? 87.152  35.142 27.283  1.00 53.34  ? 324  LEU B N   1 
ATOM   6641 C CA  . LEU B 1 323 ? 88.437  35.632 27.760  1.00 49.23  ? 324  LEU B CA  1 
ATOM   6642 C C   . LEU B 1 323 ? 88.433  37.154 27.764  1.00 44.94  ? 324  LEU B C   1 
ATOM   6643 O O   . LEU B 1 323 ? 87.984  37.781 26.798  1.00 50.85  ? 324  LEU B O   1 
ATOM   6644 C CB  . LEU B 1 323 ? 89.579  35.108 26.885  1.00 53.77  ? 324  LEU B CB  1 
ATOM   6645 C CG  . LEU B 1 323 ? 90.992  35.594 27.222  1.00 51.90  ? 324  LEU B CG  1 
ATOM   6646 C CD1 . LEU B 1 323 ? 91.404  35.140 28.611  1.00 53.64  ? 324  LEU B CD1 1 
ATOM   6647 C CD2 . LEU B 1 323 ? 91.991  35.115 26.182  1.00 48.66  ? 324  LEU B CD2 1 
ATOM   6648 N N   . GLN B 1 324 ? 88.911  37.741 28.857  1.00 37.71  ? 325  GLN B N   1 
ATOM   6649 C CA  . GLN B 1 324 ? 89.212  39.165 28.927  1.00 39.58  ? 325  GLN B CA  1 
ATOM   6650 C C   . GLN B 1 324 ? 90.716  39.327 29.087  1.00 40.15  ? 325  GLN B C   1 
ATOM   6651 O O   . GLN B 1 324 ? 91.329  38.639 29.909  1.00 45.71  ? 325  GLN B O   1 
ATOM   6652 C CB  . GLN B 1 324 ? 88.483  39.843 30.091  1.00 43.99  ? 325  GLN B CB  1 
ATOM   6653 C CG  . GLN B 1 324 ? 86.969  39.802 30.008  1.00 45.82  ? 325  GLN B CG  1 
ATOM   6654 C CD  . GLN B 1 324 ? 86.385  38.583 30.693  1.00 54.51  ? 325  GLN B CD  1 
ATOM   6655 O OE1 . GLN B 1 324 ? 86.765  38.243 31.815  1.00 58.19  ? 325  GLN B OE1 1 
ATOM   6656 N NE2 . GLN B 1 324 ? 85.457  37.917 30.019  1.00 59.53  ? 325  GLN B NE2 1 
ATOM   6657 N N   . VAL B 1 325 ? 91.310  40.217 28.296  1.00 43.97  ? 326  VAL B N   1 
ATOM   6658 C CA  . VAL B 1 325 ? 92.746  40.455 28.331  1.00 44.31  ? 326  VAL B CA  1 
ATOM   6659 C C   . VAL B 1 325 ? 93.005  41.953 28.360  1.00 45.32  ? 326  VAL B C   1 
ATOM   6660 O O   . VAL B 1 325 ? 92.286  42.735 27.727  1.00 47.46  ? 326  VAL B O   1 
ATOM   6661 C CB  . VAL B 1 325 ? 93.479  39.810 27.135  1.00 41.28  ? 326  VAL B CB  1 
ATOM   6662 C CG1 . VAL B 1 325 ? 93.498  38.305 27.278  1.00 49.44  ? 326  VAL B CG1 1 
ATOM   6663 C CG2 . VAL B 1 325 ? 92.822  40.210 25.831  1.00 54.20  ? 326  VAL B CG2 1 
ATOM   6664 N N   . LEU B 1 326 ? 94.035  42.343 29.100  1.00 40.66  ? 327  LEU B N   1 
ATOM   6665 C CA  . LEU B 1 326 ? 94.539  43.708 29.129  1.00 42.31  ? 327  LEU B CA  1 
ATOM   6666 C C   . LEU B 1 326 ? 95.945  43.686 28.547  1.00 38.85  ? 327  LEU B C   1 
ATOM   6667 O O   . LEU B 1 326 ? 96.807  42.951 29.037  1.00 44.68  ? 327  LEU B O   1 
ATOM   6668 C CB  . LEU B 1 326 ? 94.542  44.248 30.559  1.00 45.52  ? 327  LEU B CB  1 
ATOM   6669 C CG  . LEU B 1 326 ? 95.075  45.656 30.810  1.00 48.44  ? 327  LEU B CG  1 
ATOM   6670 C CD1 . LEU B 1 326 ? 94.172  46.672 30.156  1.00 51.85  ? 327  LEU B CD1 1 
ATOM   6671 C CD2 . LEU B 1 326 ? 95.181  45.913 32.306  1.00 52.01  ? 327  LEU B CD2 1 
ATOM   6672 N N   . VAL B 1 327 ? 96.173  44.467 27.489  1.00 34.81  ? 328  VAL B N   1 
ATOM   6673 C CA  . VAL B 1 327 ? 97.471  44.503 26.828  1.00 37.03  ? 328  VAL B CA  1 
ATOM   6674 C C   . VAL B 1 327 ? 97.873  45.953 26.606  1.00 37.19  ? 328  VAL B C   1 
ATOM   6675 O O   . VAL B 1 327 ? 97.036  46.855 26.554  1.00 41.37  ? 328  VAL B O   1 
ATOM   6676 C CB  . VAL B 1 327 ? 97.478  43.733 25.485  1.00 38.07  ? 328  VAL B CB  1 
ATOM   6677 C CG1 . VAL B 1 327 ? 96.973  42.310 25.676  1.00 32.39  ? 328  VAL B CG1 1 
ATOM   6678 C CG2 . VAL B 1 327 ? 96.649  44.462 24.441  1.00 36.72  ? 328  VAL B CG2 1 
ATOM   6679 N N   . GLY B 1 328 ? 99.175  46.173 26.473  1.00 35.23  ? 329  GLY B N   1 
ATOM   6680 C CA  . GLY B 1 328 ? 99.649  47.518 26.209  1.00 37.23  ? 329  GLY B CA  1 
ATOM   6681 C C   . GLY B 1 328 ? 101.151 47.560 26.051  1.00 38.73  ? 329  GLY B C   1 
ATOM   6682 O O   . GLY B 1 328 ? 101.847 46.544 26.159  1.00 32.52  ? 329  GLY B O   1 
ATOM   6683 N N   . VAL B 1 329 ? 101.640 48.772 25.782  1.00 37.15  ? 330  VAL B N   1 
ATOM   6684 C CA  . VAL B 1 329 ? 103.047 49.041 25.517  1.00 38.09  ? 330  VAL B CA  1 
ATOM   6685 C C   . VAL B 1 329 ? 103.397 50.388 26.133  1.00 39.33  ? 330  VAL B C   1 
ATOM   6686 O O   . VAL B 1 329 ? 102.522 51.181 26.487  1.00 40.56  ? 330  VAL B O   1 
ATOM   6687 C CB  . VAL B 1 329 ? 103.364 49.062 24.006  1.00 36.01  ? 330  VAL B CB  1 
ATOM   6688 C CG1 . VAL B 1 329 ? 102.994 47.736 23.345  1.00 34.47  ? 330  VAL B CG1 1 
ATOM   6689 C CG2 . VAL B 1 329 ? 102.642 50.230 23.344  1.00 30.40  ? 330  VAL B CG2 1 
ATOM   6690 N N   . VAL B 1 330 ? 104.700 50.649 26.252  1.00 39.54  ? 331  VAL B N   1 
ATOM   6691 C CA  . VAL B 1 330 ? 105.173 51.981 26.618  1.00 41.71  ? 331  VAL B CA  1 
ATOM   6692 C C   . VAL B 1 330 ? 105.374 52.793 25.344  1.00 45.43  ? 331  VAL B C   1 
ATOM   6693 O O   . VAL B 1 330 ? 105.302 52.256 24.232  1.00 42.07  ? 331  VAL B O   1 
ATOM   6694 C CB  . VAL B 1 330 ? 106.468 51.928 27.449  1.00 42.29  ? 331  VAL B CB  1 
ATOM   6695 C CG1 . VAL B 1 330 ? 106.245 51.153 28.745  1.00 40.23  ? 331  VAL B CG1 1 
ATOM   6696 C CG2 . VAL B 1 330 ? 107.602 51.325 26.635  1.00 35.09  ? 331  VAL B CG2 1 
ATOM   6697 N N   . LYS B 1 331 ? 105.638 54.092 25.497  1.00 47.05  ? 332  LYS B N   1 
ATOM   6698 C CA  . LYS B 1 331 ? 105.703 54.980 24.340  1.00 47.11  ? 332  LYS B CA  1 
ATOM   6699 C C   . LYS B 1 331 ? 106.922 54.701 23.466  1.00 44.80  ? 332  LYS B C   1 
ATOM   6700 O O   . LYS B 1 331 ? 106.844 54.838 22.241  1.00 50.27  ? 332  LYS B O   1 
ATOM   6701 C CB  . LYS B 1 331 ? 105.703 56.434 24.812  1.00 54.80  ? 332  LYS B CB  1 
ATOM   6702 C CG  . LYS B 1 331 ? 105.370 57.464 23.743  1.00 53.59  ? 332  LYS B CG  1 
ATOM   6703 C CD  . LYS B 1 331 ? 105.329 58.860 24.355  1.00 62.70  ? 332  LYS B CD  1 
ATOM   6704 C CE  . LYS B 1 331 ? 105.002 59.932 23.327  1.00 63.24  ? 332  LYS B CE  1 
ATOM   6705 N NZ  . LYS B 1 331 ? 106.073 60.083 22.305  1.00 68.84  ? 332  LYS B NZ  1 
ATOM   6706 N N   . ASP B 1 332 ? 108.053 54.306 24.064  1.00 44.73  ? 333  ASP B N   1 
ATOM   6707 C CA  . ASP B 1 332 ? 109.308 54.107 23.328  1.00 47.68  ? 333  ASP B CA  1 
ATOM   6708 C C   . ASP B 1 332 ? 109.874 52.729 23.670  1.00 46.07  ? 333  ASP B C   1 
ATOM   6709 O O   . ASP B 1 332 ? 110.845 52.613 24.420  1.00 50.62  ? 333  ASP B O   1 
ATOM   6710 C CB  . ASP B 1 332 ? 110.294 55.223 23.647  1.00 48.77  ? 333  ASP B CB  1 
ATOM   6711 C CG  . ASP B 1 332 ? 109.706 56.597 23.408  1.00 54.21  ? 333  ASP B CG  1 
ATOM   6712 O OD1 . ASP B 1 332 ? 109.730 57.060 22.247  1.00 61.72  ? 333  ASP B OD1 1 
ATOM   6713 O OD2 . ASP B 1 332 ? 109.214 57.211 24.379  1.00 51.39  ? 333  ASP B OD2 1 
ATOM   6714 N N   . GLU B 1 333 ? 109.275 51.687 23.088  1.00 45.77  ? 334  GLU B N   1 
ATOM   6715 C CA  . GLU B 1 333 ? 109.666 50.317 23.409  1.00 43.94  ? 334  GLU B CA  1 
ATOM   6716 C C   . GLU B 1 333 ? 111.106 50.014 23.013  1.00 49.33  ? 334  GLU B C   1 
ATOM   6717 O O   . GLU B 1 333 ? 111.770 49.207 23.675  1.00 48.77  ? 334  GLU B O   1 
ATOM   6718 C CB  . GLU B 1 333 ? 108.722 49.328 22.721  1.00 41.67  ? 334  GLU B CB  1 
ATOM   6719 C CG  . GLU B 1 333 ? 107.341 49.217 23.355  1.00 45.21  ? 334  GLU B CG  1 
ATOM   6720 C CD  . GLU B 1 333 ? 107.365 48.502 24.702  1.00 53.68  ? 334  GLU B CD  1 
ATOM   6721 O OE1 . GLU B 1 333 ? 106.347 48.561 25.427  1.00 50.13  ? 334  GLU B OE1 1 
ATOM   6722 O OE2 . GLU B 1 333 ? 108.400 47.882 25.036  1.00 48.91  ? 334  GLU B OE2 1 
ATOM   6723 N N   . GLY B 1 334 ? 111.609 50.639 21.950  1.00 48.93  ? 335  GLY B N   1 
ATOM   6724 C CA  . GLY B 1 334 ? 112.890 50.242 21.393  1.00 45.18  ? 335  GLY B CA  1 
ATOM   6725 C C   . GLY B 1 334 ? 114.130 50.873 22.000  1.00 45.06  ? 335  GLY B C   1 
ATOM   6726 O O   . GLY B 1 334 ? 115.216 50.289 21.925  1.00 44.55  ? 335  GLY B O   1 
ATOM   6727 N N   . SER B 1 335 ? 113.984 52.051 22.615  1.00 41.33  ? 336  SER B N   1 
ATOM   6728 C CA  . SER B 1 335 ? 115.152 52.863 22.957  1.00 48.41  ? 336  SER B CA  1 
ATOM   6729 C C   . SER B 1 335 ? 116.075 52.150 23.940  1.00 49.16  ? 336  SER B C   1 
ATOM   6730 O O   . SER B 1 335 ? 117.303 52.206 23.803  1.00 52.21  ? 336  SER B O   1 
ATOM   6731 C CB  . SER B 1 335 ? 114.702 54.210 23.525  1.00 55.41  ? 336  SER B CB  1 
ATOM   6732 O OG  . SER B 1 335 ? 113.915 54.044 24.695  1.00 56.28  ? 336  SER B OG  1 
ATOM   6733 N N   . TYR B 1 336 ? 115.500 51.480 24.940  1.00 48.78  ? 337  TYR B N   1 
ATOM   6734 C CA  . TYR B 1 336 ? 116.300 50.802 25.957  1.00 50.23  ? 337  TYR B CA  1 
ATOM   6735 C C   . TYR B 1 336 ? 117.237 49.769 25.338  1.00 44.07  ? 337  TYR B C   1 
ATOM   6736 O O   . TYR B 1 336 ? 118.400 49.655 25.737  1.00 48.45  ? 337  TYR B O   1 
ATOM   6737 C CB  . TYR B 1 336 ? 115.357 50.163 26.980  1.00 51.72  ? 337  TYR B CB  1 
ATOM   6738 C CG  . TYR B 1 336 ? 115.980 49.240 28.000  1.00 52.61  ? 337  TYR B CG  1 
ATOM   6739 C CD1 . TYR B 1 336 ? 115.808 47.867 27.909  1.00 54.87  ? 337  TYR B CD1 1 
ATOM   6740 C CD2 . TYR B 1 336 ? 116.700 49.739 29.079  1.00 61.89  ? 337  TYR B CD2 1 
ATOM   6741 C CE1 . TYR B 1 336 ? 116.351 47.014 28.847  1.00 62.85  ? 337  TYR B CE1 1 
ATOM   6742 C CE2 . TYR B 1 336 ? 117.252 48.889 30.024  1.00 61.50  ? 337  TYR B CE2 1 
ATOM   6743 C CZ  . TYR B 1 336 ? 117.075 47.527 29.900  1.00 69.04  ? 337  TYR B CZ  1 
ATOM   6744 O OH  . TYR B 1 336 ? 117.618 46.671 30.833  1.00 76.67  ? 337  TYR B OH  1 
ATOM   6745 N N   . PHE B 1 337 ? 116.759 49.028 24.339  1.00 42.18  ? 338  PHE B N   1 
ATOM   6746 C CA  . PHE B 1 337 ? 117.553 47.948 23.767  1.00 48.92  ? 338  PHE B CA  1 
ATOM   6747 C C   . PHE B 1 337 ? 118.675 48.444 22.862  1.00 46.02  ? 338  PHE B C   1 
ATOM   6748 O O   . PHE B 1 337 ? 119.623 47.693 22.606  1.00 45.31  ? 338  PHE B O   1 
ATOM   6749 C CB  . PHE B 1 337 ? 116.636 46.994 22.998  1.00 48.09  ? 338  PHE B CB  1 
ATOM   6750 C CG  . PHE B 1 337 ? 115.578 46.364 23.857  1.00 46.46  ? 338  PHE B CG  1 
ATOM   6751 C CD1 . PHE B 1 337 ? 114.373 47.011 24.088  1.00 46.15  ? 338  PHE B CD1 1 
ATOM   6752 C CD2 . PHE B 1 337 ? 115.796 45.133 24.450  1.00 46.21  ? 338  PHE B CD2 1 
ATOM   6753 C CE1 . PHE B 1 337 ? 113.401 46.437 24.893  1.00 44.06  ? 338  PHE B CE1 1 
ATOM   6754 C CE2 . PHE B 1 337 ? 114.830 44.552 25.252  1.00 46.48  ? 338  PHE B CE2 1 
ATOM   6755 C CZ  . PHE B 1 337 ? 113.632 45.207 25.475  1.00 43.59  ? 338  PHE B CZ  1 
ATOM   6756 N N   . LEU B 1 338 ? 118.605 49.689 22.386  1.00 47.41  ? 339  LEU B N   1 
ATOM   6757 C CA  . LEU B 1 338 ? 119.571 50.149 21.392  1.00 51.92  ? 339  LEU B CA  1 
ATOM   6758 C C   . LEU B 1 338 ? 120.968 50.322 21.978  1.00 54.20  ? 339  LEU B C   1 
ATOM   6759 O O   . LEU B 1 338 ? 121.959 50.206 21.250  1.00 51.07  ? 339  LEU B O   1 
ATOM   6760 C CB  . LEU B 1 338 ? 119.089 51.454 20.760  1.00 51.52  ? 339  LEU B CB  1 
ATOM   6761 C CG  . LEU B 1 338 ? 117.826 51.304 19.907  1.00 53.41  ? 339  LEU B CG  1 
ATOM   6762 C CD1 . LEU B 1 338 ? 117.326 52.649 19.412  1.00 51.98  ? 339  LEU B CD1 1 
ATOM   6763 C CD2 . LEU B 1 338 ? 118.086 50.368 18.738  1.00 46.30  ? 339  LEU B CD2 1 
ATOM   6764 N N   . VAL B 1 339 ? 121.079 50.586 23.284  1.00 51.81  ? 340  VAL B N   1 
ATOM   6765 C CA  . VAL B 1 339 ? 122.398 50.780 23.886  1.00 55.30  ? 340  VAL B CA  1 
ATOM   6766 C C   . VAL B 1 339 ? 123.153 49.480 24.101  1.00 55.33  ? 340  VAL B C   1 
ATOM   6767 O O   . VAL B 1 339 ? 124.292 49.513 24.585  1.00 57.42  ? 340  VAL B O   1 
ATOM   6768 C CB  . VAL B 1 339 ? 122.294 51.528 25.228  1.00 52.83  ? 340  VAL B CB  1 
ATOM   6769 C CG1 . VAL B 1 339 ? 121.739 52.918 24.999  1.00 58.60  ? 340  VAL B CG1 1 
ATOM   6770 C CG2 . VAL B 1 339 ? 121.423 50.752 26.202  1.00 46.81  ? 340  VAL B CG2 1 
ATOM   6771 N N   . TYR B 1 340 ? 122.569 48.338 23.744  1.00 57.01  ? 341  TYR B N   1 
ATOM   6772 C CA  . TYR B 1 340 ? 123.201 47.038 23.932  1.00 55.24  ? 341  TYR B CA  1 
ATOM   6773 C C   . TYR B 1 340 ? 123.686 46.425 22.620  1.00 62.18  ? 341  TYR B C   1 
ATOM   6774 O O   . TYR B 1 340 ? 123.783 45.200 22.504  1.00 63.04  ? 341  TYR B O   1 
ATOM   6775 C CB  . TYR B 1 340 ? 122.243 46.081 24.637  1.00 52.99  ? 341  TYR B CB  1 
ATOM   6776 C CG  . TYR B 1 340 ? 122.048 46.384 26.105  1.00 55.63  ? 341  TYR B CG  1 
ATOM   6777 C CD1 . TYR B 1 340 ? 122.981 45.971 27.047  1.00 56.94  ? 341  TYR B CD1 1 
ATOM   6778 C CD2 . TYR B 1 340 ? 120.935 47.085 26.549  1.00 53.00  ? 341  TYR B CD2 1 
ATOM   6779 C CE1 . TYR B 1 340 ? 122.806 46.236 28.395  1.00 59.62  ? 341  TYR B CE1 1 
ATOM   6780 C CE2 . TYR B 1 340 ? 120.755 47.363 27.892  1.00 57.87  ? 341  TYR B CE2 1 
ATOM   6781 C CZ  . TYR B 1 340 ? 121.694 46.936 28.810  1.00 58.68  ? 341  TYR B CZ  1 
ATOM   6782 O OH  . TYR B 1 340 ? 121.520 47.211 30.147  1.00 50.98  ? 341  TYR B OH  1 
ATOM   6783 N N   . GLY B 1 341 ? 123.995 47.251 21.623  1.00 63.15  ? 342  GLY B N   1 
ATOM   6784 C CA  . GLY B 1 341 ? 124.547 46.711 20.395  1.00 66.87  ? 342  GLY B CA  1 
ATOM   6785 C C   . GLY B 1 341 ? 124.354 47.543 19.144  1.00 63.58  ? 342  GLY B C   1 
ATOM   6786 O O   . GLY B 1 341 ? 125.022 47.301 18.135  1.00 68.03  ? 342  GLY B O   1 
ATOM   6787 N N   . ALA B 1 342 ? 123.447 48.509 19.180  1.00 59.91  ? 343  ALA B N   1 
ATOM   6788 C CA  . ALA B 1 342 ? 123.236 49.351 18.007  1.00 55.35  ? 343  ALA B CA  1 
ATOM   6789 C C   . ALA B 1 342 ? 124.382 50.348 17.877  1.00 58.17  ? 343  ALA B C   1 
ATOM   6790 O O   . ALA B 1 342 ? 124.674 51.075 18.833  1.00 57.63  ? 343  ALA B O   1 
ATOM   6791 C CB  . ALA B 1 342 ? 121.902 50.084 18.094  1.00 55.78  ? 343  ALA B CB  1 
ATOM   6792 N N   . PRO B 1 343 ? 125.056 50.402 16.729  1.00 60.29  ? 344  PRO B N   1 
ATOM   6793 C CA  . PRO B 1 343 ? 126.213 51.296 16.591  1.00 59.10  ? 344  PRO B CA  1 
ATOM   6794 C C   . PRO B 1 343 ? 125.827 52.754 16.790  1.00 60.37  ? 344  PRO B C   1 
ATOM   6795 O O   . PRO B 1 343 ? 124.814 53.228 16.269  1.00 58.69  ? 344  PRO B O   1 
ATOM   6796 C CB  . PRO B 1 343 ? 126.694 51.033 15.160  1.00 61.35  ? 344  PRO B CB  1 
ATOM   6797 C CG  . PRO B 1 343 ? 126.177 49.670 14.832  1.00 63.54  ? 344  PRO B CG  1 
ATOM   6798 C CD  . PRO B 1 343 ? 124.863 49.555 15.540  1.00 55.95  ? 344  PRO B CD  1 
ATOM   6799 N N   . GLY B 1 344 ? 126.649 53.464 17.562  1.00 63.45  ? 345  GLY B N   1 
ATOM   6800 C CA  . GLY B 1 344 ? 126.453 54.873 17.812  1.00 61.28  ? 345  GLY B CA  1 
ATOM   6801 C C   . GLY B 1 344 ? 125.563 55.208 18.989  1.00 59.04  ? 345  GLY B C   1 
ATOM   6802 O O   . GLY B 1 344 ? 125.437 56.391 19.331  1.00 65.32  ? 345  GLY B O   1 
ATOM   6803 N N   . PHE B 1 345 ? 124.946 54.219 19.625  1.00 54.40  ? 346  PHE B N   1 
ATOM   6804 C CA  . PHE B 1 345 ? 124.043 54.474 20.736  1.00 59.24  ? 346  PHE B CA  1 
ATOM   6805 C C   . PHE B 1 345 ? 124.760 54.340 22.074  1.00 60.60  ? 346  PHE B C   1 
ATOM   6806 O O   . PHE B 1 345 ? 125.666 53.521 22.242  1.00 65.21  ? 346  PHE B O   1 
ATOM   6807 C CB  . PHE B 1 345 ? 122.840 53.531 20.689  1.00 54.24  ? 346  PHE B CB  1 
ATOM   6808 C CG  . PHE B 1 345 ? 121.823 53.913 19.658  1.00 57.21  ? 346  PHE B CG  1 
ATOM   6809 C CD1 . PHE B 1 345 ? 120.721 54.676 20.006  1.00 51.46  ? 346  PHE B CD1 1 
ATOM   6810 C CD2 . PHE B 1 345 ? 121.982 53.532 18.334  1.00 51.22  ? 346  PHE B CD2 1 
ATOM   6811 C CE1 . PHE B 1 345 ? 119.787 55.040 19.055  1.00 51.09  ? 346  PHE B CE1 1 
ATOM   6812 C CE2 . PHE B 1 345 ? 121.050 53.888 17.382  1.00 51.89  ? 346  PHE B CE2 1 
ATOM   6813 C CZ  . PHE B 1 345 ? 119.951 54.644 17.741  1.00 51.97  ? 346  PHE B CZ  1 
ATOM   6814 N N   . SER B 1 346 ? 124.338 55.169 23.024  1.00 61.85  ? 347  SER B N   1 
ATOM   6815 C CA  . SER B 1 346 ? 124.848 55.180 24.387  1.00 61.88  ? 347  SER B CA  1 
ATOM   6816 C C   . SER B 1 346 ? 123.916 56.037 25.227  1.00 55.64  ? 347  SER B C   1 
ATOM   6817 O O   . SER B 1 346 ? 123.320 56.994 24.725  1.00 57.52  ? 347  SER B O   1 
ATOM   6818 C CB  . SER B 1 346 ? 126.281 55.726 24.454  1.00 64.09  ? 347  SER B CB  1 
ATOM   6819 O OG  . SER B 1 346 ? 126.702 55.886 25.798  1.00 73.77  ? 347  SER B OG  1 
ATOM   6820 N N   . LYS B 1 347 ? 123.793 55.690 26.507  1.00 55.42  ? 348  LYS B N   1 
ATOM   6821 C CA  . LYS B 1 347 ? 122.946 56.493 27.379  1.00 51.51  ? 348  LYS B CA  1 
ATOM   6822 C C   . LYS B 1 347 ? 123.577 57.832 27.737  1.00 53.93  ? 348  LYS B C   1 
ATOM   6823 O O   . LYS B 1 347 ? 122.875 58.709 28.252  1.00 58.60  ? 348  LYS B O   1 
ATOM   6824 C CB  . LYS B 1 347 ? 122.616 55.724 28.660  1.00 50.63  ? 348  LYS B CB  1 
ATOM   6825 C CG  . LYS B 1 347 ? 123.663 55.868 29.759  1.00 46.00  ? 348  LYS B CG  1 
ATOM   6826 C CD  . LYS B 1 347 ? 123.213 55.179 31.039  1.00 52.25  ? 348  LYS B CD  1 
ATOM   6827 C CE  . LYS B 1 347 ? 124.241 55.343 32.146  1.00 50.41  ? 348  LYS B CE  1 
ATOM   6828 N NZ  . LYS B 1 347 ? 124.366 56.762 32.585  1.00 54.83  ? 348  LYS B NZ  1 
ATOM   6829 N N   . ASP B 1 348 ? 124.869 58.018 27.470  1.00 49.92  ? 349  ASP B N   1 
ATOM   6830 C CA  . ASP B 1 348 ? 125.601 59.184 27.943  1.00 53.82  ? 349  ASP B CA  1 
ATOM   6831 C C   . ASP B 1 348 ? 125.894 60.202 26.847  1.00 58.97  ? 349  ASP B C   1 
ATOM   6832 O O   . ASP B 1 348 ? 126.665 61.139 27.079  1.00 66.25  ? 349  ASP B O   1 
ATOM   6833 C CB  . ASP B 1 348 ? 126.896 58.743 28.624  1.00 60.24  ? 349  ASP B CB  1 
ATOM   6834 C CG  . ASP B 1 348 ? 126.639 58.025 29.936  1.00 66.62  ? 349  ASP B CG  1 
ATOM   6835 O OD1 . ASP B 1 348 ? 127.332 57.029 30.227  1.00 67.84  ? 349  ASP B OD1 1 
ATOM   6836 O OD2 . ASP B 1 348 ? 125.735 58.462 30.676  1.00 73.02  ? 349  ASP B OD2 1 
ATOM   6837 N N   . ASN B 1 349 ? 125.306 60.049 25.663  1.00 55.27  ? 350  ASN B N   1 
ATOM   6838 C CA  . ASN B 1 349 ? 125.295 61.127 24.684  1.00 62.13  ? 350  ASN B CA  1 
ATOM   6839 C C   . ASN B 1 349 ? 123.971 61.077 23.932  1.00 61.48  ? 350  ASN B C   1 
ATOM   6840 O O   . ASN B 1 349 ? 123.110 60.234 24.202  1.00 64.80  ? 350  ASN B O   1 
ATOM   6841 C CB  . ASN B 1 349 ? 126.525 61.084 23.753  1.00 57.52  ? 350  ASN B CB  1 
ATOM   6842 C CG  . ASN B 1 349 ? 126.604 59.829 22.886  1.00 65.13  ? 350  ASN B CG  1 
ATOM   6843 O OD1 . ASN B 1 349 ? 125.598 59.196 22.565  1.00 63.99  ? 350  ASN B OD1 1 
ATOM   6844 N ND2 . ASN B 1 349 ? 127.830 59.478 22.491  1.00 84.97  ? 350  ASN B ND2 1 
ATOM   6845 N N   . GLU B 1 350 ? 123.803 62.004 22.992  1.00 60.31  ? 351  GLU B N   1 
ATOM   6846 C CA  . GLU B 1 350 ? 122.528 62.163 22.306  1.00 63.13  ? 351  GLU B CA  1 
ATOM   6847 C C   . GLU B 1 350 ? 122.202 61.010 21.366  1.00 60.18  ? 351  GLU B C   1 
ATOM   6848 O O   . GLU B 1 350 ? 121.062 60.929 20.896  1.00 62.21  ? 351  GLU B O   1 
ATOM   6849 C CB  . GLU B 1 350 ? 122.522 63.481 21.532  1.00 73.82  ? 351  GLU B CB  1 
ATOM   6850 C CG  . GLU B 1 350 ? 122.293 64.708 22.398  1.00 80.76  ? 351  GLU B CG  1 
ATOM   6851 C CD  . GLU B 1 350 ? 120.910 64.727 23.020  1.00 89.62  ? 351  GLU B CD  1 
ATOM   6852 O OE1 . GLU B 1 350 ? 120.745 64.187 24.135  1.00 85.35  ? 351  GLU B OE1 1 
ATOM   6853 O OE2 . GLU B 1 350 ? 119.984 65.274 22.386  1.00 98.76  ? 351  GLU B OE2 1 
ATOM   6854 N N   . SER B 1 351 ? 123.162 60.127 21.084  1.00 55.45  ? 352  SER B N   1 
ATOM   6855 C CA  . SER B 1 351 ? 122.958 59.006 20.165  1.00 54.28  ? 352  SER B CA  1 
ATOM   6856 C C   . SER B 1 351 ? 122.436 59.486 18.810  1.00 55.92  ? 352  SER B C   1 
ATOM   6857 O O   . SER B 1 351 ? 121.558 58.871 18.203  1.00 58.89  ? 352  SER B O   1 
ATOM   6858 C CB  . SER B 1 351 ? 122.021 57.963 20.774  1.00 55.08  ? 352  SER B CB  1 
ATOM   6859 O OG  . SER B 1 351 ? 122.618 57.341 21.898  1.00 57.36  ? 352  SER B OG  1 
ATOM   6860 N N   . LEU B 1 352 ? 122.981 60.605 18.336  1.00 52.62  ? 353  LEU B N   1 
ATOM   6861 C CA  . LEU B 1 352 ? 122.619 61.166 17.035  1.00 58.87  ? 353  LEU B CA  1 
ATOM   6862 C C   . LEU B 1 352 ? 123.406 60.421 15.964  1.00 57.91  ? 353  LEU B C   1 
ATOM   6863 O O   . LEU B 1 352 ? 124.476 60.850 15.534  1.00 62.47  ? 353  LEU B O   1 
ATOM   6864 C CB  . LEU B 1 352 ? 122.896 62.663 17.002  1.00 58.72  ? 353  LEU B CB  1 
ATOM   6865 C CG  . LEU B 1 352 ? 122.036 63.490 17.958  1.00 61.72  ? 353  LEU B CG  1 
ATOM   6866 C CD1 . LEU B 1 352 ? 122.555 64.912 18.065  1.00 63.94  ? 353  LEU B CD1 1 
ATOM   6867 C CD2 . LEU B 1 352 ? 120.585 63.479 17.501  1.00 61.06  ? 353  LEU B CD2 1 
ATOM   6868 N N   . ILE B 1 353 ? 122.857 59.290 15.521  1.00 54.86  ? 354  ILE B N   1 
ATOM   6869 C CA  . ILE B 1 353 ? 123.593 58.378 14.654  1.00 54.02  ? 354  ILE B CA  1 
ATOM   6870 C C   . ILE B 1 353 ? 123.597 58.893 13.218  1.00 65.01  ? 354  ILE B C   1 
ATOM   6871 O O   . ILE B 1 353 ? 122.803 59.751 12.824  1.00 62.95  ? 354  ILE B O   1 
ATOM   6872 C CB  . ILE B 1 353 ? 123.004 56.961 14.731  1.00 54.03  ? 354  ILE B CB  1 
ATOM   6873 C CG1 . ILE B 1 353 ? 121.541 56.977 14.282  1.00 52.27  ? 354  ILE B CG1 1 
ATOM   6874 C CG2 . ILE B 1 353 ? 123.144 56.408 16.143  1.00 53.12  ? 354  ILE B CG2 1 
ATOM   6875 C CD1 . ILE B 1 353 ? 120.916 55.605 14.160  1.00 50.19  ? 354  ILE B CD1 1 
ATOM   6876 N N   . SER B 1 354 ? 124.507 58.342 12.421  1.00 61.59  ? 355  SER B N   1 
ATOM   6877 C CA  . SER B 1 354 ? 124.587 58.659 11.006  1.00 59.89  ? 355  SER B CA  1 
ATOM   6878 C C   . SER B 1 354 ? 123.768 57.662 10.191  1.00 57.78  ? 355  SER B C   1 
ATOM   6879 O O   . SER B 1 354 ? 123.288 56.645 10.698  1.00 51.77  ? 355  SER B O   1 
ATOM   6880 C CB  . SER B 1 354 ? 126.042 58.658 10.536  1.00 64.00  ? 355  SER B CB  1 
ATOM   6881 O OG  . SER B 1 354 ? 126.583 57.348 10.573  1.00 66.71  ? 355  SER B OG  1 
ATOM   6882 N N   . ARG B 1 355 ? 123.614 57.970 8.901   1.00 61.26  ? 356  ARG B N   1 
ATOM   6883 C CA  . ARG B 1 355 ? 122.885 57.079 8.005   1.00 60.33  ? 356  ARG B CA  1 
ATOM   6884 C C   . ARG B 1 355 ? 123.529 55.698 7.957   1.00 54.36  ? 356  ARG B C   1 
ATOM   6885 O O   . ARG B 1 355 ? 122.832 54.678 8.000   1.00 54.93  ? 356  ARG B O   1 
ATOM   6886 C CB  . ARG B 1 355 ? 122.820 57.693 6.606   1.00 64.32  ? 356  ARG B CB  1 
ATOM   6887 C CG  . ARG B 1 355 ? 122.122 56.830 5.570   1.00 66.08  ? 356  ARG B CG  1 
ATOM   6888 C CD  . ARG B 1 355 ? 120.616 56.946 5.683   1.00 67.02  ? 356  ARG B CD  1 
ATOM   6889 N NE  . ARG B 1 355 ? 119.926 56.102 4.712   1.00 66.72  ? 356  ARG B NE  1 
ATOM   6890 C CZ  . ARG B 1 355 ? 118.617 55.879 4.721   1.00 61.23  ? 356  ARG B CZ  1 
ATOM   6891 N NH1 . ARG B 1 355 ? 117.854 56.441 5.649   1.00 62.15  ? 356  ARG B NH1 1 
ATOM   6892 N NH2 . ARG B 1 355 ? 118.069 55.094 3.806   1.00 61.18  ? 356  ARG B NH2 1 
ATOM   6893 N N   . ALA B 1 356 ? 124.860 55.647 7.870   1.00 55.85  ? 357  ALA B N   1 
ATOM   6894 C CA  . ALA B 1 356 ? 125.552 54.362 7.846   1.00 58.01  ? 357  ALA B CA  1 
ATOM   6895 C C   . ALA B 1 356 ? 125.314 53.580 9.133   1.00 60.72  ? 357  ALA B C   1 
ATOM   6896 O O   . ALA B 1 356 ? 125.120 52.359 9.099   1.00 66.17  ? 357  ALA B O   1 
ATOM   6897 C CB  . ALA B 1 356 ? 127.048 54.579 7.608   1.00 52.66  ? 357  ALA B CB  1 
ATOM   6898 N N   . GLU B 1 357 ? 125.316 54.266 10.280  1.00 57.76  ? 358  GLU B N   1 
ATOM   6899 C CA  . GLU B 1 357 ? 125.025 53.586 11.540  1.00 57.74  ? 358  GLU B CA  1 
ATOM   6900 C C   . GLU B 1 357 ? 123.576 53.113 11.593  1.00 55.32  ? 358  GLU B C   1 
ATOM   6901 O O   . GLU B 1 357 ? 123.288 52.030 12.120  1.00 49.94  ? 358  GLU B O   1 
ATOM   6902 C CB  . GLU B 1 357 ? 125.342 54.507 12.722  1.00 56.92  ? 358  GLU B CB  1 
ATOM   6903 C CG  . GLU B 1 357 ? 126.834 54.738 12.944  1.00 62.72  ? 358  GLU B CG  1 
ATOM   6904 C CD  . GLU B 1 357 ? 127.121 55.813 13.978  1.00 73.25  ? 358  GLU B CD  1 
ATOM   6905 O OE1 . GLU B 1 357 ? 126.373 56.812 14.024  1.00 74.95  ? 358  GLU B OE1 1 
ATOM   6906 O OE2 . GLU B 1 357 ? 128.096 55.658 14.746  1.00 79.95  ? 358  GLU B OE2 1 
ATOM   6907 N N   . PHE B 1 358 ? 122.652 53.905 11.045  1.00 52.81  ? 359  PHE B N   1 
ATOM   6908 C CA  . PHE B 1 358 ? 121.248 53.506 11.033  1.00 54.03  ? 359  PHE B CA  1 
ATOM   6909 C C   . PHE B 1 358 ? 121.049 52.233 10.219  1.00 51.55  ? 359  PHE B C   1 
ATOM   6910 O O   . PHE B 1 358 ? 120.354 51.306 10.652  1.00 49.61  ? 359  PHE B O   1 
ATOM   6911 C CB  . PHE B 1 358 ? 120.386 54.642 10.479  1.00 57.20  ? 359  PHE B CB  1 
ATOM   6912 C CG  . PHE B 1 358 ? 118.974 54.237 10.161  1.00 54.15  ? 359  PHE B CG  1 
ATOM   6913 C CD1 . PHE B 1 358 ? 118.023 54.142 11.162  1.00 48.38  ? 359  PHE B CD1 1 
ATOM   6914 C CD2 . PHE B 1 358 ? 118.596 53.959 8.855   1.00 52.04  ? 359  PHE B CD2 1 
ATOM   6915 C CE1 . PHE B 1 358 ? 116.720 53.771 10.870  1.00 44.10  ? 359  PHE B CE1 1 
ATOM   6916 C CE2 . PHE B 1 358 ? 117.298 53.588 8.557   1.00 50.84  ? 359  PHE B CE2 1 
ATOM   6917 C CZ  . PHE B 1 358 ? 116.359 53.494 9.563   1.00 45.44  ? 359  PHE B CZ  1 
ATOM   6918 N N   . LEU B 1 359 ? 121.651 52.172 9.029   1.00 54.72  ? 360  LEU B N   1 
ATOM   6919 C CA  . LEU B 1 359 ? 121.543 50.966 8.216   1.00 54.10  ? 360  LEU B CA  1 
ATOM   6920 C C   . LEU B 1 359 ? 122.233 49.788 8.890   1.00 56.87  ? 360  LEU B C   1 
ATOM   6921 O O   . LEU B 1 359 ? 121.729 48.660 8.850   1.00 59.20  ? 360  LEU B O   1 
ATOM   6922 C CB  . LEU B 1 359 ? 122.127 51.214 6.827   1.00 51.08  ? 360  LEU B CB  1 
ATOM   6923 C CG  . LEU B 1 359 ? 121.426 52.293 5.999   1.00 59.41  ? 360  LEU B CG  1 
ATOM   6924 C CD1 . LEU B 1 359 ? 122.265 52.697 4.808   1.00 57.21  ? 360  LEU B CD1 1 
ATOM   6925 C CD2 . LEU B 1 359 ? 120.094 51.786 5.538   1.00 58.14  ? 360  LEU B CD2 1 
ATOM   6926 N N   . ALA B 1 360 ? 123.388 50.029 9.514   1.00 54.99  ? 361  ALA B N   1 
ATOM   6927 C CA  . ALA B 1 360 ? 124.024 48.985 10.311  1.00 56.86  ? 361  ALA B CA  1 
ATOM   6928 C C   . ALA B 1 360 ? 123.119 48.544 11.453  1.00 54.81  ? 361  ALA B C   1 
ATOM   6929 O O   . ALA B 1 360 ? 123.001 47.347 11.736  1.00 59.43  ? 361  ALA B O   1 
ATOM   6930 C CB  . ALA B 1 360 ? 125.366 49.479 10.851  1.00 54.82  ? 361  ALA B CB  1 
ATOM   6931 N N   . GLY B 1 361 ? 122.463 49.498 12.114  1.00 55.37  ? 362  GLY B N   1 
ATOM   6932 C CA  . GLY B 1 361 ? 121.598 49.152 13.228  1.00 48.74  ? 362  GLY B CA  1 
ATOM   6933 C C   . GLY B 1 361 ? 120.383 48.341 12.820  1.00 52.29  ? 362  GLY B C   1 
ATOM   6934 O O   . GLY B 1 361 ? 119.830 47.595 13.631  1.00 52.23  ? 362  GLY B O   1 
ATOM   6935 N N   . VAL B 1 362 ? 119.954 48.469 11.562  1.00 57.56  ? 363  VAL B N   1 
ATOM   6936 C CA  . VAL B 1 362 ? 118.783 47.729 11.102  1.00 52.19  ? 363  VAL B CA  1 
ATOM   6937 C C   . VAL B 1 362 ? 119.082 46.236 11.028  1.00 49.02  ? 363  VAL B C   1 
ATOM   6938 O O   . VAL B 1 362 ? 118.242 45.405 11.393  1.00 52.99  ? 363  VAL B O   1 
ATOM   6939 C CB  . VAL B 1 362 ? 118.298 48.285 9.750   1.00 52.63  ? 363  VAL B CB  1 
ATOM   6940 C CG1 . VAL B 1 362 ? 117.555 47.205 8.945   1.00 45.18  ? 363  VAL B CG1 1 
ATOM   6941 C CG2 . VAL B 1 362 ? 117.416 49.514 9.967   1.00 52.40  ? 363  VAL B CG2 1 
ATOM   6942 N N   . ARG B 1 363 ? 120.279 45.869 10.561  1.00 47.31  ? 364  ARG B N   1 
ATOM   6943 C CA  . ARG B 1 363 ? 120.651 44.456 10.534  1.00 50.43  ? 364  ARG B CA  1 
ATOM   6944 C C   . ARG B 1 363 ? 120.795 43.884 11.939  1.00 55.76  ? 364  ARG B C   1 
ATOM   6945 O O   . ARG B 1 363 ? 120.526 42.696 12.155  1.00 57.45  ? 364  ARG B O   1 
ATOM   6946 C CB  . ARG B 1 363 ? 121.951 44.254 9.755   1.00 51.32  ? 364  ARG B CB  1 
ATOM   6947 C CG  . ARG B 1 363 ? 121.946 44.837 8.351   1.00 62.48  ? 364  ARG B CG  1 
ATOM   6948 C CD  . ARG B 1 363 ? 120.675 44.480 7.588   1.00 68.46  ? 364  ARG B CD  1 
ATOM   6949 N NE  . ARG B 1 363 ? 120.513 43.044 7.368   1.00 66.74  ? 364  ARG B NE  1 
ATOM   6950 C CZ  . ARG B 1 363 ? 120.820 42.421 6.234   1.00 66.77  ? 364  ARG B CZ  1 
ATOM   6951 N NH1 . ARG B 1 363 ? 121.317 43.105 5.209   1.00 58.97  ? 364  ARG B NH1 1 
ATOM   6952 N NH2 . ARG B 1 363 ? 120.631 41.112 6.123   1.00 64.44  ? 364  ARG B NH2 1 
ATOM   6953 N N   . VAL B 1 364 ? 121.215 44.705 12.902  1.00 54.93  ? 365  VAL B N   1 
ATOM   6954 C CA  . VAL B 1 364 ? 121.325 44.243 14.283  1.00 56.28  ? 365  VAL B CA  1 
ATOM   6955 C C   . VAL B 1 364 ? 119.950 44.160 14.933  1.00 58.18  ? 365  VAL B C   1 
ATOM   6956 O O   . VAL B 1 364 ? 119.663 43.224 15.689  1.00 60.41  ? 365  VAL B O   1 
ATOM   6957 C CB  . VAL B 1 364 ? 122.279 45.160 15.072  1.00 54.89  ? 365  VAL B CB  1 
ATOM   6958 C CG1 . VAL B 1 364 ? 122.148 44.920 16.563  1.00 60.04  ? 365  VAL B CG1 1 
ATOM   6959 C CG2 . VAL B 1 364 ? 123.714 44.932 14.629  1.00 58.33  ? 365  VAL B CG2 1 
ATOM   6960 N N   . GLY B 1 365 ? 119.071 45.123 14.639  1.00 56.83  ? 366  GLY B N   1 
ATOM   6961 C CA  . GLY B 1 365 ? 117.739 45.121 15.218  1.00 48.06  ? 366  GLY B CA  1 
ATOM   6962 C C   . GLY B 1 365 ? 116.758 44.183 14.549  1.00 49.38  ? 366  GLY B C   1 
ATOM   6963 O O   . GLY B 1 365 ? 115.774 43.784 15.177  1.00 56.89  ? 366  GLY B O   1 
ATOM   6964 N N   . VAL B 1 366 ? 116.991 43.835 13.288  1.00 53.66  ? 367  VAL B N   1 
ATOM   6965 C CA  . VAL B 1 366 ? 116.159 42.861 12.586  1.00 53.38  ? 367  VAL B CA  1 
ATOM   6966 C C   . VAL B 1 366 ? 117.068 41.729 12.126  1.00 53.59  ? 367  VAL B C   1 
ATOM   6967 O O   . VAL B 1 366 ? 117.318 41.584 10.919  1.00 51.18  ? 367  VAL B O   1 
ATOM   6968 C CB  . VAL B 1 366 ? 115.412 43.500 11.403  1.00 53.38  ? 367  VAL B CB  1 
ATOM   6969 C CG1 . VAL B 1 366 ? 114.320 42.566 10.892  1.00 53.98  ? 367  VAL B CG1 1 
ATOM   6970 C CG2 . VAL B 1 366 ? 114.822 44.841 11.804  1.00 52.60  ? 367  VAL B CG2 1 
ATOM   6971 N N   . PRO B 1 367 ? 117.582 40.910 13.037  1.00 51.29  ? 368  PRO B N   1 
ATOM   6972 C CA  . PRO B 1 367 ? 118.596 39.924 12.658  1.00 46.26  ? 368  PRO B CA  1 
ATOM   6973 C C   . PRO B 1 367 ? 117.993 38.731 11.932  1.00 46.82  ? 368  PRO B C   1 
ATOM   6974 O O   . PRO B 1 367 ? 116.812 38.409 12.072  1.00 53.59  ? 368  PRO B O   1 
ATOM   6975 C CB  . PRO B 1 367 ? 119.189 39.501 14.006  1.00 48.26  ? 368  PRO B CB  1 
ATOM   6976 C CG  . PRO B 1 367 ? 118.049 39.651 14.961  1.00 45.63  ? 368  PRO B CG  1 
ATOM   6977 C CD  . PRO B 1 367 ? 117.241 40.830 14.471  1.00 48.13  ? 368  PRO B CD  1 
ATOM   6978 N N   . GLN B 1 368 ? 118.847 38.079 11.140  1.00 52.30  ? 369  GLN B N   1 
ATOM   6979 C CA  . GLN B 1 368 ? 118.522 36.813 10.480  1.00 68.48  ? 369  GLN B CA  1 
ATOM   6980 C C   . GLN B 1 368 ? 117.403 36.973 9.448   1.00 69.20  ? 369  GLN B C   1 
ATOM   6981 O O   . GLN B 1 368 ? 116.489 36.151 9.376   1.00 71.45  ? 369  GLN B O   1 
ATOM   6982 C CB  . GLN B 1 368 ? 118.159 35.731 11.504  1.00 76.79  ? 369  GLN B CB  1 
ATOM   6983 C CG  . GLN B 1 368 ? 119.170 35.564 12.633  1.00 86.88  ? 369  GLN B CG  1 
ATOM   6984 C CD  . GLN B 1 368 ? 120.395 34.777 12.212  1.00 92.51  ? 369  GLN B CD  1 
ATOM   6985 O OE1 . GLN B 1 368 ? 121.491 35.327 12.094  1.00 96.29  ? 369  GLN B OE1 1 
ATOM   6986 N NE2 . GLN B 1 368 ? 120.217 33.480 11.991  1.00 90.37  ? 369  GLN B NE2 1 
ATOM   6987 N N   . VAL B 1 369 ? 117.469 38.034 8.641   1.00 66.08  ? 370  VAL B N   1 
ATOM   6988 C CA  . VAL B 1 369 ? 116.552 38.208 7.521   1.00 60.65  ? 370  VAL B CA  1 
ATOM   6989 C C   . VAL B 1 369 ? 117.364 38.513 6.272   1.00 59.87  ? 370  VAL B C   1 
ATOM   6990 O O   . VAL B 1 369 ? 118.499 38.990 6.337   1.00 64.12  ? 370  VAL B O   1 
ATOM   6991 C CB  . VAL B 1 369 ? 115.502 39.318 7.758   1.00 51.42  ? 370  VAL B CB  1 
ATOM   6992 C CG1 . VAL B 1 369 ? 114.744 39.077 9.057   1.00 47.18  ? 370  VAL B CG1 1 
ATOM   6993 C CG2 . VAL B 1 369 ? 116.155 40.694 7.737   1.00 45.60  ? 370  VAL B CG2 1 
ATOM   6994 N N   . SER B 1 370 ? 116.759 38.231 5.120   1.00 62.90  ? 371  SER B N   1 
ATOM   6995 C CA  . SER B 1 370 ? 117.425 38.447 3.846   1.00 60.32  ? 371  SER B CA  1 
ATOM   6996 C C   . SER B 1 370 ? 117.697 39.932 3.621   1.00 59.61  ? 371  SER B C   1 
ATOM   6997 O O   . SER B 1 370 ? 117.098 40.807 4.256   1.00 52.86  ? 371  SER B O   1 
ATOM   6998 C CB  . SER B 1 370 ? 116.577 37.894 2.701   1.00 60.78  ? 371  SER B CB  1 
ATOM   6999 O OG  . SER B 1 370 ? 115.300 38.506 2.678   1.00 59.40  ? 371  SER B OG  1 
ATOM   7000 N N   . ASP B 1 371 ? 118.624 40.210 2.700   1.00 63.87  ? 372  ASP B N   1 
ATOM   7001 C CA  . ASP B 1 371 ? 118.921 41.593 2.343   1.00 68.49  ? 372  ASP B CA  1 
ATOM   7002 C C   . ASP B 1 371 ? 117.672 42.318 1.862   1.00 65.02  ? 372  ASP B C   1 
ATOM   7003 O O   . ASP B 1 371 ? 117.461 43.492 2.189   1.00 64.51  ? 372  ASP B O   1 
ATOM   7004 C CB  . ASP B 1 371 ? 120.009 41.641 1.269   1.00 72.46  ? 372  ASP B CB  1 
ATOM   7005 C CG  . ASP B 1 371 ? 121.380 41.298 1.813   1.00 81.74  ? 372  ASP B CG  1 
ATOM   7006 O OD1 . ASP B 1 371 ? 121.591 41.468 3.032   1.00 79.55  ? 372  ASP B OD1 1 
ATOM   7007 O OD2 . ASP B 1 371 ? 122.247 40.867 1.022   1.00 87.71  ? 372  ASP B OD2 1 
ATOM   7008 N N   . LEU B 1 372 ? 116.826 41.631 1.089   1.00 62.15  ? 373  LEU B N   1 
ATOM   7009 C CA  . LEU B 1 372 ? 115.608 42.261 0.589   1.00 65.02  ? 373  LEU B CA  1 
ATOM   7010 C C   . LEU B 1 372 ? 114.688 42.660 1.734   1.00 61.29  ? 373  LEU B C   1 
ATOM   7011 O O   . LEU B 1 372 ? 114.116 43.757 1.728   1.00 54.75  ? 373  LEU B O   1 
ATOM   7012 C CB  . LEU B 1 372 ? 114.886 41.322 -0.376  1.00 63.88  ? 373  LEU B CB  1 
ATOM   7013 C CG  . LEU B 1 372 ? 113.587 41.870 -0.970  1.00 65.63  ? 373  LEU B CG  1 
ATOM   7014 C CD1 . LEU B 1 372 ? 113.874 43.012 -1.937  1.00 62.26  ? 373  LEU B CD1 1 
ATOM   7015 C CD2 . LEU B 1 372 ? 112.795 40.766 -1.654  1.00 68.58  ? 373  LEU B CD2 1 
ATOM   7016 N N   . ALA B 1 373 ? 114.533 41.783 2.727   1.00 59.60  ? 374  ALA B N   1 
ATOM   7017 C CA  . ALA B 1 373 ? 113.735 42.131 3.896   1.00 51.52  ? 374  ALA B CA  1 
ATOM   7018 C C   . ALA B 1 373 ? 114.308 43.351 4.602   1.00 50.58  ? 374  ALA B C   1 
ATOM   7019 O O   . ALA B 1 373 ? 113.563 44.252 5.007   1.00 51.02  ? 374  ALA B O   1 
ATOM   7020 C CB  . ALA B 1 373 ? 113.654 40.941 4.852   1.00 54.76  ? 374  ALA B CB  1 
ATOM   7021 N N   . ALA B 1 374 ? 115.633 43.403 4.750   1.00 51.09  ? 375  ALA B N   1 
ATOM   7022 C CA  . ALA B 1 374 ? 116.263 44.571 5.357   1.00 52.65  ? 375  ALA B CA  1 
ATOM   7023 C C   . ALA B 1 374 ? 116.014 45.822 4.526   1.00 57.38  ? 375  ALA B C   1 
ATOM   7024 O O   . ALA B 1 374 ? 115.715 46.890 5.075   1.00 60.42  ? 375  ALA B O   1 
ATOM   7025 C CB  . ALA B 1 374 ? 117.761 44.330 5.528   1.00 55.14  ? 375  ALA B CB  1 
ATOM   7026 N N   . GLU B 1 375 ? 116.136 45.710 3.200   1.00 50.62  ? 376  GLU B N   1 
ATOM   7027 C CA  . GLU B 1 375 ? 115.837 46.844 2.331   1.00 52.09  ? 376  GLU B CA  1 
ATOM   7028 C C   . GLU B 1 375 ? 114.408 47.326 2.531   1.00 50.24  ? 376  GLU B C   1 
ATOM   7029 O O   . GLU B 1 375 ? 114.154 48.535 2.582   1.00 51.95  ? 376  GLU B O   1 
ATOM   7030 C CB  . GLU B 1 375 ? 116.071 46.464 0.868   1.00 66.90  ? 376  GLU B CB  1 
ATOM   7031 C CG  . GLU B 1 375 ? 117.533 46.321 0.484   1.00 86.06  ? 376  GLU B CG  1 
ATOM   7032 C CD  . GLU B 1 375 ? 118.258 47.653 0.439   1.00 103.13 ? 376  GLU B CD  1 
ATOM   7033 O OE1 . GLU B 1 375 ? 117.584 48.698 0.307   1.00 105.80 ? 376  GLU B OE1 1 
ATOM   7034 O OE2 . GLU B 1 375 ? 119.503 47.655 0.534   1.00 112.48 ? 376  GLU B OE2 1 
ATOM   7035 N N   . ALA B 1 376 ? 113.463 46.391 2.655   1.00 40.82  ? 377  ALA B N   1 
ATOM   7036 C CA  . ALA B 1 376 ? 112.075 46.769 2.897   1.00 51.45  ? 377  ALA B CA  1 
ATOM   7037 C C   . ALA B 1 376 ? 111.931 47.546 4.201   1.00 48.50  ? 377  ALA B C   1 
ATOM   7038 O O   . ALA B 1 376 ? 111.155 48.506 4.275   1.00 48.53  ? 377  ALA B O   1 
ATOM   7039 C CB  . ALA B 1 376 ? 111.187 45.524 2.910   1.00 41.88  ? 377  ALA B CB  1 
ATOM   7040 N N   . VAL B 1 377 ? 112.669 47.147 5.242   1.00 47.45  ? 378  VAL B N   1 
ATOM   7041 C CA  . VAL B 1 377 ? 112.615 47.873 6.510   1.00 42.07  ? 378  VAL B CA  1 
ATOM   7042 C C   . VAL B 1 377 ? 113.135 49.293 6.326   1.00 39.62  ? 378  VAL B C   1 
ATOM   7043 O O   . VAL B 1 377 ? 112.516 50.267 6.773   1.00 44.77  ? 378  VAL B O   1 
ATOM   7044 C CB  . VAL B 1 377 ? 113.405 47.123 7.598   1.00 43.37  ? 378  VAL B CB  1 
ATOM   7045 C CG1 . VAL B 1 377 ? 113.411 47.927 8.893   1.00 38.32  ? 378  VAL B CG1 1 
ATOM   7046 C CG2 . VAL B 1 377 ? 112.815 45.743 7.828   1.00 43.38  ? 378  VAL B CG2 1 
ATOM   7047 N N   . VAL B 1 378 ? 114.276 49.430 5.651   1.00 43.91  ? 379  VAL B N   1 
ATOM   7048 C CA  . VAL B 1 378 ? 114.867 50.747 5.424   1.00 51.33  ? 379  VAL B CA  1 
ATOM   7049 C C   . VAL B 1 378 ? 113.913 51.637 4.638   1.00 54.87  ? 379  VAL B C   1 
ATOM   7050 O O   . VAL B 1 378 ? 113.828 52.847 4.882   1.00 57.08  ? 379  VAL B O   1 
ATOM   7051 C CB  . VAL B 1 378 ? 116.223 50.598 4.713   1.00 54.09  ? 379  VAL B CB  1 
ATOM   7052 C CG1 . VAL B 1 378 ? 116.806 51.961 4.380   1.00 54.31  ? 379  VAL B CG1 1 
ATOM   7053 C CG2 . VAL B 1 378 ? 117.176 49.802 5.591   1.00 52.86  ? 379  VAL B CG2 1 
ATOM   7054 N N   . LEU B 1 379 ? 113.168 51.055 3.698   1.00 52.37  ? 380  LEU B N   1 
ATOM   7055 C CA  . LEU B 1 379 ? 112.242 51.847 2.894   1.00 55.37  ? 380  LEU B CA  1 
ATOM   7056 C C   . LEU B 1 379 ? 111.132 52.436 3.754   1.00 47.84  ? 380  LEU B C   1 
ATOM   7057 O O   . LEU B 1 379 ? 110.822 53.629 3.663   1.00 50.73  ? 380  LEU B O   1 
ATOM   7058 C CB  . LEU B 1 379 ? 111.648 50.990 1.774   1.00 50.32  ? 380  LEU B CB  1 
ATOM   7059 C CG  . LEU B 1 379 ? 110.306 51.488 1.219   1.00 55.94  ? 380  LEU B CG  1 
ATOM   7060 C CD1 . LEU B 1 379 ? 110.485 52.720 0.333   1.00 53.77  ? 380  LEU B CD1 1 
ATOM   7061 C CD2 . LEU B 1 379 ? 109.569 50.384 0.474   1.00 58.99  ? 380  LEU B CD2 1 
ATOM   7062 N N   . HIS B 1 380 ? 110.524 51.612 4.605   1.00 44.62  ? 381  HIS B N   1 
ATOM   7063 C CA  A HIS B 1 380 ? 109.369 52.059 5.375   0.48 47.96  ? 381  HIS B CA  1 
ATOM   7064 C CA  B HIS B 1 380 ? 109.369 52.081 5.357   0.52 47.94  ? 381  HIS B CA  1 
ATOM   7065 C C   . HIS B 1 380 ? 109.758 53.070 6.447   1.00 48.13  ? 381  HIS B C   1 
ATOM   7066 O O   . HIS B 1 380 ? 108.978 53.977 6.755   1.00 52.36  ? 381  HIS B O   1 
ATOM   7067 C CB  A HIS B 1 380 ? 108.672 50.853 6.005   0.48 49.08  ? 381  HIS B CB  1 
ATOM   7068 C CB  B HIS B 1 380 ? 108.611 50.894 5.946   0.52 49.16  ? 381  HIS B CB  1 
ATOM   7069 C CG  A HIS B 1 380 ? 107.430 51.200 6.766   0.48 49.53  ? 381  HIS B CG  1 
ATOM   7070 C CG  B HIS B 1 380 ? 107.843 50.116 4.925   0.52 51.61  ? 381  HIS B CG  1 
ATOM   7071 N ND1 A HIS B 1 380 ? 106.172 51.132 6.207   0.48 50.45  ? 381  HIS B ND1 1 
ATOM   7072 N ND1 B HIS B 1 380 ? 108.456 49.306 3.993   0.52 57.48  ? 381  HIS B ND1 1 
ATOM   7073 C CD2 A HIS B 1 380 ? 107.254 51.620 8.041   0.48 54.01  ? 381  HIS B CD2 1 
ATOM   7074 C CD2 B HIS B 1 380 ? 106.515 50.041 4.674   0.52 52.29  ? 381  HIS B CD2 1 
ATOM   7075 C CE1 A HIS B 1 380 ? 105.274 51.496 7.106   0.48 51.45  ? 381  HIS B CE1 1 
ATOM   7076 C CE1 B HIS B 1 380 ? 107.538 48.758 3.218   0.52 56.15  ? 381  HIS B CE1 1 
ATOM   7077 N NE2 A HIS B 1 380 ? 105.905 51.798 8.227   0.48 53.36  ? 381  HIS B NE2 1 
ATOM   7078 N NE2 B HIS B 1 380 ? 106.352 49.187 3.609   0.52 59.38  ? 381  HIS B NE2 1 
ATOM   7079 N N   . TYR B 1 381 ? 110.953 52.936 7.020   1.00 46.22  ? 382  TYR B N   1 
ATOM   7080 C CA  . TYR B 1 381 ? 111.361 53.767 8.144   1.00 46.80  ? 382  TYR B CA  1 
ATOM   7081 C C   . TYR B 1 381 ? 112.297 54.900 7.749   1.00 47.60  ? 382  TYR B C   1 
ATOM   7082 O O   . TYR B 1 381 ? 112.869 55.553 8.627   1.00 51.47  ? 382  TYR B O   1 
ATOM   7083 C CB  . TYR B 1 381 ? 111.999 52.897 9.225   1.00 42.84  ? 382  TYR B CB  1 
ATOM   7084 C CG  . TYR B 1 381 ? 110.981 52.086 9.991   1.00 44.08  ? 382  TYR B CG  1 
ATOM   7085 C CD1 . TYR B 1 381 ? 110.475 52.539 11.204  1.00 41.33  ? 382  TYR B CD1 1 
ATOM   7086 C CD2 . TYR B 1 381 ? 110.513 50.879 9.494   1.00 41.97  ? 382  TYR B CD2 1 
ATOM   7087 C CE1 . TYR B 1 381 ? 109.538 51.806 11.905  1.00 43.08  ? 382  TYR B CE1 1 
ATOM   7088 C CE2 . TYR B 1 381 ? 109.577 50.136 10.189  1.00 39.79  ? 382  TYR B CE2 1 
ATOM   7089 C CZ  . TYR B 1 381 ? 109.093 50.605 11.396  1.00 43.66  ? 382  TYR B CZ  1 
ATOM   7090 O OH  . TYR B 1 381 ? 108.159 49.871 12.096  1.00 40.12  ? 382  TYR B OH  1 
ATOM   7091 N N   . THR B 1 382 ? 112.452 55.164 6.459   1.00 47.13  ? 383  THR B N   1 
ATOM   7092 C CA  . THR B 1 382 ? 113.205 56.316 5.991   1.00 42.72  ? 383  THR B CA  1 
ATOM   7093 C C   . THR B 1 382 ? 112.242 57.445 5.654   1.00 53.83  ? 383  THR B C   1 
ATOM   7094 O O   . THR B 1 382 ? 111.198 57.223 5.031   1.00 57.78  ? 383  THR B O   1 
ATOM   7095 C CB  . THR B 1 382 ? 114.039 55.970 4.757   1.00 51.13  ? 383  THR B CB  1 
ATOM   7096 O OG1 . THR B 1 382 ? 114.986 54.944 5.094   1.00 50.92  ? 383  THR B OG1 1 
ATOM   7097 C CG2 . THR B 1 382 ? 114.789 57.197 4.242   1.00 47.74  ? 383  THR B CG2 1 
ATOM   7098 N N   . ASP B 1 383 ? 112.586 58.654 6.088   1.00 49.57  ? 384  ASP B N   1 
ATOM   7099 C CA  . ASP B 1 383 ? 111.986 59.865 5.541   1.00 52.52  ? 384  ASP B CA  1 
ATOM   7100 C C   . ASP B 1 383 ? 112.874 60.312 4.387   1.00 50.79  ? 384  ASP B C   1 
ATOM   7101 O O   . ASP B 1 383 ? 113.961 60.857 4.606   1.00 50.40  ? 384  ASP B O   1 
ATOM   7102 C CB  . ASP B 1 383 ? 111.858 60.953 6.604   1.00 55.42  ? 384  ASP B CB  1 
ATOM   7103 C CG  . ASP B 1 383 ? 111.066 62.161 6.118   1.00 61.62  ? 384  ASP B CG  1 
ATOM   7104 O OD1 . ASP B 1 383 ? 111.067 62.441 4.899   1.00 66.61  ? 384  ASP B OD1 1 
ATOM   7105 O OD2 . ASP B 1 383 ? 110.440 62.838 6.957   1.00 63.59  ? 384  ASP B OD2 1 
ATOM   7106 N N   . TRP B 1 384 ? 112.418 60.076 3.160   1.00 50.90  ? 385  TRP B N   1 
ATOM   7107 C CA  . TRP B 1 384 ? 113.214 60.402 1.985   1.00 48.73  ? 385  TRP B CA  1 
ATOM   7108 C C   . TRP B 1 384 ? 113.227 61.888 1.665   1.00 54.13  ? 385  TRP B C   1 
ATOM   7109 O O   . TRP B 1 384 ? 113.835 62.286 0.665   1.00 53.89  ? 385  TRP B O   1 
ATOM   7110 C CB  . TRP B 1 384 ? 112.721 59.597 0.781   1.00 51.00  ? 385  TRP B CB  1 
ATOM   7111 C CG  . TRP B 1 384 ? 112.695 58.130 1.086   1.00 48.08  ? 385  TRP B CG  1 
ATOM   7112 C CD1 . TRP B 1 384 ? 111.656 57.434 1.624   1.00 49.40  ? 385  TRP B CD1 1 
ATOM   7113 C CD2 . TRP B 1 384 ? 113.783 57.202 0.962   1.00 47.29  ? 385  TRP B CD2 1 
ATOM   7114 N NE1 . TRP B 1 384 ? 112.015 56.113 1.794   1.00 48.72  ? 385  TRP B NE1 1 
ATOM   7115 C CE2 . TRP B 1 384 ? 113.315 55.949 1.400   1.00 45.82  ? 385  TRP B CE2 1 
ATOM   7116 C CE3 . TRP B 1 384 ? 115.100 57.304 0.502   1.00 48.51  ? 385  TRP B CE3 1 
ATOM   7117 C CZ2 . TRP B 1 384 ? 114.118 54.805 1.394   1.00 52.65  ? 385  TRP B CZ2 1 
ATOM   7118 C CZ3 . TRP B 1 384 ? 115.894 56.160 0.497   1.00 56.02  ? 385  TRP B CZ3 1 
ATOM   7119 C CH2 . TRP B 1 384 ? 115.402 54.931 0.938   1.00 53.95  ? 385  TRP B CH2 1 
ATOM   7120 N N   . LEU B 1 385 ? 112.570 62.713 2.474   1.00 55.80  ? 386  LEU B N   1 
ATOM   7121 C CA  . LEU B 1 385 ? 112.821 64.145 2.438   1.00 63.16  ? 386  LEU B CA  1 
ATOM   7122 C C   . LEU B 1 385 ? 113.925 64.571 3.398   1.00 62.41  ? 386  LEU B C   1 
ATOM   7123 O O   . LEU B 1 385 ? 114.534 65.628 3.188   1.00 61.54  ? 386  LEU B O   1 
ATOM   7124 C CB  . LEU B 1 385 ? 111.531 64.919 2.737   1.00 68.75  ? 386  LEU B CB  1 
ATOM   7125 C CG  . LEU B 1 385 ? 110.475 64.922 1.626   1.00 68.76  ? 386  LEU B CG  1 
ATOM   7126 C CD1 . LEU B 1 385 ? 109.253 65.734 2.027   1.00 72.07  ? 386  LEU B CD1 1 
ATOM   7127 C CD2 . LEU B 1 385 ? 111.068 65.456 0.334   1.00 71.54  ? 386  LEU B CD2 1 
ATOM   7128 N N   . HIS B 1 386 ? 114.196 63.772 4.434   1.00 57.04  ? 387  HIS B N   1 
ATOM   7129 C CA  . HIS B 1 386 ? 115.292 63.997 5.383   1.00 60.89  ? 387  HIS B CA  1 
ATOM   7130 C C   . HIS B 1 386 ? 116.018 62.680 5.602   1.00 57.94  ? 387  HIS B C   1 
ATOM   7131 O O   . HIS B 1 386 ? 115.979 62.097 6.693   1.00 54.10  ? 387  HIS B O   1 
ATOM   7132 C CB  . HIS B 1 386 ? 114.779 64.556 6.711   1.00 52.13  ? 387  HIS B CB  1 
ATOM   7133 C CG  . HIS B 1 386 ? 113.905 65.778 6.540   1.00 62.91  ? 387  HIS B CG  1 
ATOM   7134 N ND1 . HIS B 1 386 ? 112.530 65.697 6.383   1.00 68.71  ? 387  HIS B ND1 1 
ATOM   7135 C CD2 . HIS B 1 386 ? 114.229 67.090 6.433   1.00 61.87  ? 387  HIS B CD2 1 
ATOM   7136 C CE1 . HIS B 1 386 ? 112.051 66.912 6.226   1.00 66.43  ? 387  HIS B CE1 1 
ATOM   7137 N NE2 . HIS B 1 386 ? 113.059 67.766 6.248   1.00 65.72  ? 387  HIS B NE2 1 
ATOM   7138 N N   . PRO B 1 387 ? 116.676 62.158 4.565   1.00 59.55  ? 388  PRO B N   1 
ATOM   7139 C CA  . PRO B 1 387 ? 117.208 60.776 4.661   1.00 54.22  ? 388  PRO B CA  1 
ATOM   7140 C C   . PRO B 1 387 ? 118.384 60.650 5.614   1.00 60.52  ? 388  PRO B C   1 
ATOM   7141 O O   . PRO B 1 387 ? 118.691 59.535 6.031   1.00 57.04  ? 388  PRO B O   1 
ATOM   7142 C CB  . PRO B 1 387 ? 117.630 60.453 3.217   1.00 52.63  ? 388  PRO B CB  1 
ATOM   7143 C CG  . PRO B 1 387 ? 117.693 61.756 2.493   1.00 54.40  ? 388  PRO B CG  1 
ATOM   7144 C CD  . PRO B 1 387 ? 116.857 62.750 3.221   1.00 54.22  ? 388  PRO B CD  1 
ATOM   7145 N N   . GLU B 1 388 ? 119.027 61.759 5.988   1.00 63.69  ? 389  GLU B N   1 
ATOM   7146 C CA  . GLU B 1 388 ? 120.276 61.706 6.736   1.00 65.59  ? 389  GLU B CA  1 
ATOM   7147 C C   . GLU B 1 388 ? 120.207 62.404 8.091   1.00 62.19  ? 389  GLU B C   1 
ATOM   7148 O O   . GLU B 1 388 ? 121.241 62.562 8.742   1.00 67.70  ? 389  GLU B O   1 
ATOM   7149 C CB  . GLU B 1 388 ? 121.402 62.320 5.897   1.00 68.96  ? 389  GLU B CB  1 
ATOM   7150 C CG  . GLU B 1 388 ? 121.472 61.786 4.481   1.00 83.00  ? 389  GLU B CG  1 
ATOM   7151 C CD  . GLU B 1 388 ? 122.670 60.891 4.250   1.00 95.48  ? 389  GLU B CD  1 
ATOM   7152 O OE1 . GLU B 1 388 ? 123.588 60.893 5.096   1.00 103.63 ? 389  GLU B OE1 1 
ATOM   7153 O OE2 . GLU B 1 388 ? 122.698 60.191 3.217   1.00 97.40  ? 389  GLU B OE2 1 
ATOM   7154 N N   . ASP B 1 389 ? 119.030 62.825 8.532   1.00 56.35  ? 390  ASP B N   1 
ATOM   7155 C CA  . ASP B 1 389 ? 118.912 63.589 9.771   1.00 60.56  ? 390  ASP B CA  1 
ATOM   7156 C C   . ASP B 1 389 ? 119.162 62.686 10.974  1.00 52.86  ? 390  ASP B C   1 
ATOM   7157 O O   . ASP B 1 389 ? 118.400 61.732 11.194  1.00 54.79  ? 390  ASP B O   1 
ATOM   7158 C CB  . ASP B 1 389 ? 117.535 64.232 9.853   1.00 68.22  ? 390  ASP B CB  1 
ATOM   7159 C CG  . ASP B 1 389 ? 117.348 65.088 11.092  1.00 77.76  ? 390  ASP B CG  1 
ATOM   7160 O OD1 . ASP B 1 389 ? 116.185 65.303 11.497  1.00 81.20  ? 390  ASP B OD1 1 
ATOM   7161 O OD2 . ASP B 1 389 ? 118.356 65.550 11.659  1.00 88.10  ? 390  ASP B OD2 1 
ATOM   7162 N N   . PRO B 1 390 ? 120.194 62.948 11.784  1.00 58.54  ? 391  PRO B N   1 
ATOM   7163 C CA  . PRO B 1 390 ? 120.494 62.022 12.914  1.00 54.77  ? 391  PRO B CA  1 
ATOM   7164 C C   . PRO B 1 390 ? 119.360 61.859 13.910  1.00 49.64  ? 391  PRO B C   1 
ATOM   7165 O O   . PRO B 1 390 ? 119.116 60.747 14.376  1.00 53.08  ? 391  PRO B O   1 
ATOM   7166 C CB  . PRO B 1 390 ? 121.737 62.671 13.576  1.00 53.86  ? 391  PRO B CB  1 
ATOM   7167 C CG  . PRO B 1 390 ? 122.279 63.638 12.553  1.00 64.39  ? 391  PRO B CG  1 
ATOM   7168 C CD  . PRO B 1 390 ? 121.129 64.096 11.728  1.00 59.98  ? 391  PRO B CD  1 
ATOM   7169 N N   . ALA B 1 391 ? 118.664 62.947 14.242  1.00 55.64  ? 392  ALA B N   1 
ATOM   7170 C CA  . ALA B 1 391 ? 117.590 62.868 15.224  1.00 55.50  ? 392  ALA B CA  1 
ATOM   7171 C C   . ALA B 1 391 ? 116.485 61.922 14.758  1.00 55.18  ? 392  ALA B C   1 
ATOM   7172 O O   . ALA B 1 391 ? 116.027 61.060 15.519  1.00 54.89  ? 392  ALA B O   1 
ATOM   7173 C CB  . ALA B 1 391 ? 117.037 64.266 15.499  1.00 54.53  ? 392  ALA B CB  1 
ATOM   7174 N N   . ARG B 1 392 ? 116.066 62.056 13.493  1.00 59.22  ? 393  ARG B N   1 
ATOM   7175 C CA  . ARG B 1 392 ? 115.016 61.192 12.960  1.00 56.51  ? 393  ARG B CA  1 
ATOM   7176 C C   . ARG B 1 392 ? 115.500 59.770 12.767  1.00 49.86  ? 393  ARG B C   1 
ATOM   7177 O O   . ARG B 1 392 ? 114.719 58.823 12.911  1.00 49.54  ? 393  ARG B O   1 
ATOM   7178 C CB  . ARG B 1 392 ? 114.486 61.717 11.627  1.00 55.55  ? 393  ARG B CB  1 
ATOM   7179 C CG  . ARG B 1 392 ? 113.832 63.062 11.698  1.00 48.32  ? 393  ARG B CG  1 
ATOM   7180 C CD  . ARG B 1 392 ? 113.671 63.678 10.306  1.00 59.62  ? 393  ARG B CD  1 
ATOM   7181 N NE  . ARG B 1 392 ? 112.470 64.496 10.169  1.00 57.83  ? 393  ARG B NE  1 
ATOM   7182 C CZ  . ARG B 1 392 ? 112.506 65.787 9.872   1.00 61.56  ? 393  ARG B CZ  1 
ATOM   7183 N NH1 . ARG B 1 392 ? 113.667 66.415 9.681   1.00 68.26  ? 393  ARG B NH1 1 
ATOM   7184 N NH2 . ARG B 1 392 ? 111.379 66.484 9.758   1.00 70.07  ? 393  ARG B NH2 1 
ATOM   7185 N N   . LEU B 1 393 ? 116.757 59.603 12.367  1.00 48.47  ? 394  LEU B N   1 
ATOM   7186 C CA  . LEU B 1 393 ? 117.322 58.263 12.264  1.00 46.31  ? 394  LEU B CA  1 
ATOM   7187 C C   . LEU B 1 393 ? 117.359 57.574 13.625  1.00 48.91  ? 394  LEU B C   1 
ATOM   7188 O O   . LEU B 1 393 ? 117.000 56.395 13.740  1.00 48.74  ? 394  LEU B O   1 
ATOM   7189 C CB  . LEU B 1 393 ? 118.720 58.323 11.643  1.00 44.74  ? 394  LEU B CB  1 
ATOM   7190 C CG  . LEU B 1 393 ? 118.799 58.687 10.158  1.00 54.03  ? 394  LEU B CG  1 
ATOM   7191 C CD1 . LEU B 1 393 ? 120.217 59.127 9.785   1.00 51.66  ? 394  LEU B CD1 1 
ATOM   7192 C CD2 . LEU B 1 393 ? 118.295 57.533 9.279   1.00 44.99  ? 394  LEU B CD2 1 
ATOM   7193 N N   . ARG B 1 394 ? 117.777 58.296 14.669  1.00 48.35  ? 395  ARG B N   1 
ATOM   7194 C CA  . ARG B 1 394 ? 117.747 57.730 16.016  1.00 46.12  ? 395  ARG B CA  1 
ATOM   7195 C C   . ARG B 1 394 ? 116.337 57.289 16.388  1.00 46.42  ? 395  ARG B C   1 
ATOM   7196 O O   . ARG B 1 394 ? 116.127 56.165 16.858  1.00 45.54  ? 395  ARG B O   1 
ATOM   7197 C CB  . ARG B 1 394 ? 118.279 58.746 17.029  1.00 46.74  ? 395  ARG B CB  1 
ATOM   7198 C CG  . ARG B 1 394 ? 118.179 58.300 18.490  1.00 53.89  ? 395  ARG B CG  1 
ATOM   7199 C CD  . ARG B 1 394 ? 118.304 59.490 19.426  1.00 54.46  ? 395  ARG B CD  1 
ATOM   7200 N NE  . ARG B 1 394 ? 117.188 60.417 19.263  1.00 59.22  ? 395  ARG B NE  1 
ATOM   7201 C CZ  . ARG B 1 394 ? 117.210 61.686 19.648  1.00 60.27  ? 395  ARG B CZ  1 
ATOM   7202 N NH1 . ARG B 1 394 ? 118.298 62.188 20.210  1.00 59.49  ? 395  ARG B NH1 1 
ATOM   7203 N NH2 . ARG B 1 394 ? 116.150 62.460 19.459  1.00 66.48  ? 395  ARG B NH2 1 
ATOM   7204 N N   . GLU B 1 395 ? 115.351 58.162 16.167  1.00 50.89  ? 396  GLU B N   1 
ATOM   7205 C CA  . GLU B 1 395 ? 113.970 57.801 16.468  1.00 47.19  ? 396  GLU B CA  1 
ATOM   7206 C C   . GLU B 1 395 ? 113.479 56.681 15.560  1.00 45.50  ? 396  GLU B C   1 
ATOM   7207 O O   . GLU B 1 395 ? 112.701 55.823 15.992  1.00 44.36  ? 396  GLU B O   1 
ATOM   7208 C CB  . GLU B 1 395 ? 113.065 59.029 16.346  1.00 49.80  ? 396  GLU B CB  1 
ATOM   7209 C CG  . GLU B 1 395 ? 112.702 59.671 17.681  1.00 69.92  ? 396  GLU B CG  1 
ATOM   7210 C CD  . GLU B 1 395 ? 113.912 60.180 18.451  1.00 76.20  ? 396  GLU B CD  1 
ATOM   7211 O OE1 . GLU B 1 395 ? 114.428 61.262 18.100  1.00 76.04  ? 396  GLU B OE1 1 
ATOM   7212 O OE2 . GLU B 1 395 ? 114.344 59.500 19.410  1.00 76.39  ? 396  GLU B OE2 1 
ATOM   7213 N N   . ALA B 1 396 ? 113.927 56.666 14.302  1.00 40.38  ? 397  ALA B N   1 
ATOM   7214 C CA  . ALA B 1 396 ? 113.459 55.647 13.368  1.00 45.55  ? 397  ALA B CA  1 
ATOM   7215 C C   . ALA B 1 396 ? 113.928 54.259 13.789  1.00 37.55  ? 397  ALA B C   1 
ATOM   7216 O O   . ALA B 1 396 ? 113.142 53.306 13.798  1.00 43.42  ? 397  ALA B O   1 
ATOM   7217 C CB  . ALA B 1 396 ? 113.928 55.971 11.946  1.00 39.52  ? 397  ALA B CB  1 
ATOM   7218 N N   . LEU B 1 397 ? 115.208 54.126 14.145  1.00 38.09  ? 398  LEU B N   1 
ATOM   7219 C CA  . LEU B 1 397 ? 115.708 52.825 14.578  1.00 42.95  ? 398  LEU B CA  1 
ATOM   7220 C C   . LEU B 1 397 ? 115.061 52.382 15.885  1.00 46.72  ? 398  LEU B C   1 
ATOM   7221 O O   . LEU B 1 397 ? 114.863 51.181 16.101  1.00 44.81  ? 398  LEU B O   1 
ATOM   7222 C CB  . LEU B 1 397 ? 117.227 52.862 14.726  1.00 46.08  ? 398  LEU B CB  1 
ATOM   7223 C CG  . LEU B 1 397 ? 117.862 51.481 14.892  1.00 49.02  ? 398  LEU B CG  1 
ATOM   7224 C CD1 . LEU B 1 397 ? 117.622 50.639 13.642  1.00 46.88  ? 398  LEU B CD1 1 
ATOM   7225 C CD2 . LEU B 1 397 ? 119.347 51.595 15.197  1.00 46.31  ? 398  LEU B CD2 1 
ATOM   7226 N N   . SER B 1 398 ? 114.727 53.328 16.765  1.00 47.60  ? 399  SER B N   1 
ATOM   7227 C CA  . SER B 1 398 ? 113.967 52.975 17.958  1.00 45.56  ? 399  SER B CA  1 
ATOM   7228 C C   . SER B 1 398 ? 112.603 52.409 17.583  1.00 47.03  ? 399  SER B C   1 
ATOM   7229 O O   . SER B 1 398 ? 112.150 51.418 18.167  1.00 46.06  ? 399  SER B O   1 
ATOM   7230 C CB  . SER B 1 398 ? 113.814 54.194 18.867  1.00 47.70  ? 399  SER B CB  1 
ATOM   7231 O OG  . SER B 1 398 ? 113.009 53.888 19.995  1.00 54.93  ? 399  SER B OG  1 
ATOM   7232 N N   . ASP B 1 399 ? 111.942 53.019 16.596  1.00 50.21  ? 400  ASP B N   1 
ATOM   7233 C CA  . ASP B 1 399 ? 110.668 52.492 16.121  1.00 50.90  ? 400  ASP B CA  1 
ATOM   7234 C C   . ASP B 1 399 ? 110.836 51.114 15.492  1.00 45.42  ? 400  ASP B C   1 
ATOM   7235 O O   . ASP B 1 399 ? 110.010 50.223 15.714  1.00 40.38  ? 400  ASP B O   1 
ATOM   7236 C CB  . ASP B 1 399 ? 110.034 53.460 15.120  1.00 55.31  ? 400  ASP B CB  1 
ATOM   7237 C CG  . ASP B 1 399 ? 109.474 54.703 15.785  1.00 62.23  ? 400  ASP B CG  1 
ATOM   7238 O OD1 . ASP B 1 399 ? 109.125 54.633 16.982  1.00 65.21  ? 400  ASP B OD1 1 
ATOM   7239 O OD2 . ASP B 1 399 ? 109.382 55.750 15.109  1.00 61.51  ? 400  ASP B OD2 1 
ATOM   7240 N N   . VAL B 1 400 ? 111.894 50.921 14.698  1.00 42.93  ? 401  VAL B N   1 
ATOM   7241 C CA  . VAL B 1 400 ? 112.129 49.615 14.082  1.00 42.44  ? 401  VAL B CA  1 
ATOM   7242 C C   . VAL B 1 400 ? 112.197 48.530 15.149  1.00 41.91  ? 401  VAL B C   1 
ATOM   7243 O O   . VAL B 1 400 ? 111.475 47.528 15.091  1.00 45.68  ? 401  VAL B O   1 
ATOM   7244 C CB  . VAL B 1 400 ? 113.412 49.636 13.231  1.00 43.88  ? 401  VAL B CB  1 
ATOM   7245 C CG1 . VAL B 1 400 ? 113.791 48.218 12.826  1.00 40.94  ? 401  VAL B CG1 1 
ATOM   7246 C CG2 . VAL B 1 400 ? 113.229 50.507 12.000  1.00 42.36  ? 401  VAL B CG2 1 
ATOM   7247 N N   . VAL B 1 401 ? 113.060 48.722 16.145  1.00 43.17  ? 402  VAL B N   1 
ATOM   7248 C CA  . VAL B 1 401 ? 113.225 47.716 17.189  1.00 40.23  ? 402  VAL B CA  1 
ATOM   7249 C C   . VAL B 1 401 ? 111.944 47.567 18.002  1.00 42.59  ? 402  VAL B C   1 
ATOM   7250 O O   . VAL B 1 401 ? 111.518 46.448 18.314  1.00 37.80  ? 402  VAL B O   1 
ATOM   7251 C CB  . VAL B 1 401 ? 114.434 48.078 18.070  1.00 39.18  ? 402  VAL B CB  1 
ATOM   7252 C CG1 . VAL B 1 401 ? 114.559 47.115 19.244  1.00 41.14  ? 402  VAL B CG1 1 
ATOM   7253 C CG2 . VAL B 1 401 ? 115.703 48.073 17.230  1.00 39.00  ? 402  VAL B CG2 1 
ATOM   7254 N N   . GLY B 1 402 ? 111.291 48.684 18.329  1.00 44.42  ? 403  GLY B N   1 
ATOM   7255 C CA  . GLY B 1 402 ? 110.092 48.614 19.151  1.00 43.42  ? 403  GLY B CA  1 
ATOM   7256 C C   . GLY B 1 402 ? 108.903 48.009 18.427  1.00 44.80  ? 403  GLY B C   1 
ATOM   7257 O O   . GLY B 1 402 ? 108.122 47.259 19.021  1.00 46.25  ? 403  GLY B O   1 
ATOM   7258 N N   . ASP B 1 403 ? 108.742 48.330 17.140  1.00 41.04  ? 404  ASP B N   1 
ATOM   7259 C CA  . ASP B 1 403 ? 107.622 47.786 16.377  1.00 35.86  ? 404  ASP B CA  1 
ATOM   7260 C C   . ASP B 1 403 ? 107.821 46.303 16.096  1.00 36.27  ? 404  ASP B C   1 
ATOM   7261 O O   . ASP B 1 403 ? 106.906 45.495 16.289  1.00 41.79  ? 404  ASP B O   1 
ATOM   7262 C CB  . ASP B 1 403 ? 107.445 48.556 15.063  1.00 39.29  ? 404  ASP B CB  1 
ATOM   7263 C CG  . ASP B 1 403 ? 107.143 50.034 15.278  1.00 46.30  ? 404  ASP B CG  1 
ATOM   7264 O OD1 . ASP B 1 403 ? 106.805 50.421 16.417  1.00 51.16  ? 404  ASP B OD1 1 
ATOM   7265 O OD2 . ASP B 1 403 ? 107.250 50.811 14.304  1.00 46.01  ? 404  ASP B OD2 1 
ATOM   7266 N N   . HIS B 1 404 ? 109.017 45.931 15.634  1.00 36.74  ? 405  HIS B N   1 
ATOM   7267 C CA  . HIS B 1 404 ? 109.280 44.545 15.257  1.00 39.21  ? 405  HIS B CA  1 
ATOM   7268 C C   . HIS B 1 404 ? 109.134 43.603 16.448  1.00 43.16  ? 405  HIS B C   1 
ATOM   7269 O O   . HIS B 1 404 ? 108.583 42.504 16.317  1.00 41.60  ? 405  HIS B O   1 
ATOM   7270 C CB  . HIS B 1 404 ? 110.681 44.443 14.651  1.00 36.77  ? 405  HIS B CB  1 
ATOM   7271 C CG  . HIS B 1 404 ? 111.111 43.046 14.330  1.00 43.51  ? 405  HIS B CG  1 
ATOM   7272 N ND1 . HIS B 1 404 ? 110.297 42.146 13.676  1.00 45.93  ? 405  HIS B ND1 1 
ATOM   7273 C CD2 . HIS B 1 404 ? 112.280 42.400 14.557  1.00 48.45  ? 405  HIS B CD2 1 
ATOM   7274 C CE1 . HIS B 1 404 ? 110.943 41.003 13.521  1.00 39.99  ? 405  HIS B CE1 1 
ATOM   7275 N NE2 . HIS B 1 404 ? 112.148 41.131 14.047  1.00 50.78  ? 405  HIS B NE2 1 
ATOM   7276 N N   . ASN B 1 405 ? 109.601 44.021 17.621  1.00 40.27  ? 406  ASN B N   1 
ATOM   7277 C CA  . ASN B 1 405 ? 109.700 43.112 18.754  1.00 39.07  ? 406  ASN B CA  1 
ATOM   7278 C C   . ASN B 1 405 ? 108.545 43.207 19.741  1.00 36.60  ? 406  ASN B C   1 
ATOM   7279 O O   . ASN B 1 405 ? 108.246 42.211 20.405  1.00 42.16  ? 406  ASN B O   1 
ATOM   7280 C CB  . ASN B 1 405 ? 111.017 43.346 19.501  1.00 38.11  ? 406  ASN B CB  1 
ATOM   7281 C CG  . ASN B 1 405 ? 112.226 42.958 18.674  1.00 44.66  ? 406  ASN B CG  1 
ATOM   7282 O OD1 . ASN B 1 405 ? 112.533 41.774 18.525  1.00 48.27  ? 406  ASN B OD1 1 
ATOM   7283 N ND2 . ASN B 1 405 ? 112.916 43.953 18.124  1.00 39.04  ? 406  ASN B ND2 1 
ATOM   7284 N N   . VAL B 1 406 ? 107.882 44.359 19.864  1.00 35.08  ? 407  VAL B N   1 
ATOM   7285 C CA  . VAL B 1 406 ? 106.871 44.521 20.908  1.00 36.30  ? 407  VAL B CA  1 
ATOM   7286 C C   . VAL B 1 406 ? 105.533 45.000 20.355  1.00 40.38  ? 407  VAL B C   1 
ATOM   7287 O O   . VAL B 1 406 ? 104.515 44.314 20.497  1.00 40.89  ? 407  VAL B O   1 
ATOM   7288 C CB  . VAL B 1 406 ? 107.360 45.486 22.005  1.00 39.69  ? 407  VAL B CB  1 
ATOM   7289 C CG1 . VAL B 1 406 ? 106.288 45.644 23.069  1.00 41.34  ? 407  VAL B CG1 1 
ATOM   7290 C CG2 . VAL B 1 406 ? 108.657 44.985 22.620  1.00 39.18  ? 407  VAL B CG2 1 
ATOM   7291 N N   . VAL B 1 407 ? 105.520 46.184 19.737  1.00 37.05  ? 408  VAL B N   1 
ATOM   7292 C CA  . VAL B 1 407 ? 104.254 46.846 19.421  1.00 37.26  ? 408  VAL B CA  1 
ATOM   7293 C C   . VAL B 1 407 ? 103.428 46.009 18.451  1.00 42.75  ? 408  VAL B C   1 
ATOM   7294 O O   . VAL B 1 407 ? 102.241 45.745 18.682  1.00 38.12  ? 408  VAL B O   1 
ATOM   7295 C CB  . VAL B 1 407 ? 104.509 48.257 18.864  1.00 40.62  ? 408  VAL B CB  1 
ATOM   7296 C CG1 . VAL B 1 407 ? 103.185 48.952 18.571  1.00 38.36  ? 408  VAL B CG1 1 
ATOM   7297 C CG2 . VAL B 1 407 ? 105.346 49.072 19.840  1.00 34.68  ? 408  VAL B CG2 1 
ATOM   7298 N N   . CYS B 1 408 ? 104.034 45.586 17.352  1.00 35.80  ? 409  CYS B N   1 
ATOM   7299 C CA  . CYS B 1 408 ? 103.252 44.910 16.325  1.00 41.41  ? 409  CYS B CA  1 
ATOM   7300 C C   . CYS B 1 408 ? 102.904 43.472 16.710  1.00 41.78  ? 409  CYS B C   1 
ATOM   7301 O O   . CYS B 1 408 ? 101.807 43.007 16.372  1.00 41.64  ? 409  CYS B O   1 
ATOM   7302 C CB  . CYS B 1 408 ? 103.988 44.973 14.985  1.00 39.09  ? 409  CYS B CB  1 
ATOM   7303 S SG  . CYS B 1 408 ? 104.220 46.687 14.437  1.00 40.28  ? 409  CYS B SG  1 
ATOM   7304 N N   . PRO B 1 409 ? 103.781 42.724 17.395  1.00 38.31  ? 410  PRO B N   1 
ATOM   7305 C CA  . PRO B 1 409 ? 103.312 41.452 17.974  1.00 41.04  ? 410  PRO B CA  1 
ATOM   7306 C C   . PRO B 1 409 ? 102.137 41.631 18.921  1.00 40.90  ? 410  PRO B C   1 
ATOM   7307 O O   . PRO B 1 409 ? 101.184 40.843 18.871  1.00 39.50  ? 410  PRO B O   1 
ATOM   7308 C CB  . PRO B 1 409 ? 104.557 40.920 18.695  1.00 36.64  ? 410  PRO B CB  1 
ATOM   7309 C CG  . PRO B 1 409 ? 105.685 41.463 17.904  1.00 37.08  ? 410  PRO B CG  1 
ATOM   7310 C CD  . PRO B 1 409 ? 105.250 42.843 17.485  1.00 33.25  ? 410  PRO B CD  1 
ATOM   7311 N N   . VAL B 1 410 ? 102.173 42.655 19.779  1.00 37.89  ? 411  VAL B N   1 
ATOM   7312 C CA  . VAL B 1 410 ? 101.049 42.910 20.676  1.00 36.09  ? 411  VAL B CA  1 
ATOM   7313 C C   . VAL B 1 410 ? 99.810  43.307 19.882  1.00 43.23  ? 411  VAL B C   1 
ATOM   7314 O O   . VAL B 1 410 ? 98.696  42.852 20.173  1.00 44.26  ? 411  VAL B O   1 
ATOM   7315 C CB  . VAL B 1 410 ? 101.426 43.976 21.721  1.00 36.72  ? 411  VAL B CB  1 
ATOM   7316 C CG1 . VAL B 1 410 ? 100.181 44.496 22.434  1.00 33.52  ? 411  VAL B CG1 1 
ATOM   7317 C CG2 . VAL B 1 410 ? 102.412 43.403 22.736  1.00 34.45  ? 411  VAL B CG2 1 
ATOM   7318 N N   . ALA B 1 411 ? 99.979  44.153 18.862  1.00 39.96  ? 412  ALA B N   1 
ATOM   7319 C CA  . ALA B 1 411 ? 98.838  44.554 18.043  1.00 40.17  ? 412  ALA B CA  1 
ATOM   7320 C C   . ALA B 1 411 ? 98.231  43.360 17.317  1.00 35.93  ? 412  ALA B C   1 
ATOM   7321 O O   . ALA B 1 411 ? 97.003  43.241 17.220  1.00 39.21  ? 412  ALA B O   1 
ATOM   7322 C CB  . ALA B 1 411 ? 99.258  45.635 17.046  1.00 41.12  ? 412  ALA B CB  1 
ATOM   7323 N N   . GLN B 1 412 ? 99.073  42.463 16.801  1.00 39.23  ? 413  GLN B N   1 
ATOM   7324 C CA  A GLN B 1 412 ? 98.556  41.272 16.134  0.46 40.08  ? 413  GLN B CA  1 
ATOM   7325 C CA  B GLN B 1 412 ? 98.565  41.266 16.135  0.54 40.11  ? 413  GLN B CA  1 
ATOM   7326 C C   . GLN B 1 412 ? 97.780  40.397 17.108  1.00 42.45  ? 413  GLN B C   1 
ATOM   7327 O O   . GLN B 1 412 ? 96.680  39.926 16.797  1.00 43.13  ? 413  GLN B O   1 
ATOM   7328 C CB  A GLN B 1 412 ? 99.699  40.485 15.494  0.46 39.56  ? 413  GLN B CB  1 
ATOM   7329 C CB  B GLN B 1 412 ? 99.724  40.477 15.525  0.54 39.28  ? 413  GLN B CB  1 
ATOM   7330 C CG  A GLN B 1 412 ? 99.250  39.192 14.831  0.46 42.53  ? 413  GLN B CG  1 
ATOM   7331 C CG  B GLN B 1 412 ? 99.317  39.153 14.894  0.54 42.31  ? 413  GLN B CG  1 
ATOM   7332 C CD  A GLN B 1 412 ? 100.299 38.613 13.902  0.46 48.77  ? 413  GLN B CD  1 
ATOM   7333 C CD  B GLN B 1 412 ? 98.665  39.324 13.533  0.54 50.62  ? 413  GLN B CD  1 
ATOM   7334 O OE1 A GLN B 1 412 ? 101.174 37.859 14.328  0.46 54.70  ? 413  GLN B OE1 1 
ATOM   7335 O OE1 B GLN B 1 412 ? 98.618  40.426 12.987  0.54 53.02  ? 413  GLN B OE1 1 
ATOM   7336 N NE2 A GLN B 1 412 ? 100.216 38.964 12.624  0.46 51.96  ? 413  GLN B NE2 1 
ATOM   7337 N NE2 B GLN B 1 412 ? 98.161  38.227 12.977  0.54 56.58  ? 413  GLN B NE2 1 
ATOM   7338 N N   . LEU B 1 413 ? 98.342  40.171 18.296  1.00 42.61  ? 414  LEU B N   1 
ATOM   7339 C CA  . LEU B 1 413 ? 97.658  39.385 19.316  1.00 43.88  ? 414  LEU B CA  1 
ATOM   7340 C C   . LEU B 1 413 ? 96.310  40.007 19.669  1.00 38.51  ? 414  LEU B C   1 
ATOM   7341 O O   . LEU B 1 413 ? 95.279  39.325 19.674  1.00 41.12  ? 414  LEU B O   1 
ATOM   7342 C CB  . LEU B 1 413 ? 98.564  39.268 20.548  1.00 36.69  ? 414  LEU B CB  1 
ATOM   7343 C CG  . LEU B 1 413 ? 98.208  38.420 21.774  1.00 44.50  ? 414  LEU B CG  1 
ATOM   7344 C CD1 . LEU B 1 413 ? 97.404  39.232 22.762  1.00 46.01  ? 414  LEU B CD1 1 
ATOM   7345 C CD2 . LEU B 1 413 ? 97.465  37.155 21.375  1.00 42.69  ? 414  LEU B CD2 1 
ATOM   7346 N N   . ALA B 1 414 ? 96.299  41.315 19.940  1.00 41.01  ? 415  ALA B N   1 
ATOM   7347 C CA  . ALA B 1 414 ? 95.067  41.994 20.332  1.00 37.81  ? 415  ALA B CA  1 
ATOM   7348 C C   . ALA B 1 414 ? 93.995  41.873 19.253  1.00 45.81  ? 415  ALA B C   1 
ATOM   7349 O O   . ALA B 1 414 ? 92.827  41.595 19.550  1.00 46.27  ? 415  ALA B O   1 
ATOM   7350 C CB  . ALA B 1 414 ? 95.360  43.464 20.635  1.00 36.37  ? 415  ALA B CB  1 
ATOM   7351 N N   . GLY B 1 415 ? 94.375  42.076 17.990  1.00 40.73  ? 416  GLY B N   1 
ATOM   7352 C CA  . GLY B 1 415 ? 93.391  42.032 16.920  1.00 37.94  ? 416  GLY B CA  1 
ATOM   7353 C C   . GLY B 1 415 ? 92.800  40.651 16.711  1.00 41.43  ? 416  GLY B C   1 
ATOM   7354 O O   . GLY B 1 415 ? 91.593  40.509 16.491  1.00 46.18  ? 416  GLY B O   1 
ATOM   7355 N N   . ARG B 1 416 ? 93.637  39.612 16.768  1.00 41.99  ? 417  ARG B N   1 
ATOM   7356 C CA  . ARG B 1 416 ? 93.122  38.260 16.577  1.00 42.87  ? 417  ARG B CA  1 
ATOM   7357 C C   . ARG B 1 416 ? 92.242  37.837 17.746  1.00 44.84  ? 417  ARG B C   1 
ATOM   7358 O O   . ARG B 1 416 ? 91.186  37.229 17.542  1.00 48.84  ? 417  ARG B O   1 
ATOM   7359 C CB  . ARG B 1 416 ? 94.273  37.274 16.387  1.00 43.37  ? 417  ARG B CB  1 
ATOM   7360 C CG  . ARG B 1 416 ? 95.159  37.546 15.178  1.00 48.81  ? 417  ARG B CG  1 
ATOM   7361 C CD  . ARG B 1 416 ? 94.392  37.460 13.862  1.00 48.98  ? 417  ARG B CD  1 
ATOM   7362 N NE  . ARG B 1 416 ? 93.756  36.159 13.677  1.00 59.30  ? 417  ARG B NE  1 
ATOM   7363 C CZ  . ARG B 1 416 ? 93.653  35.535 12.507  1.00 65.37  ? 417  ARG B CZ  1 
ATOM   7364 N NH1 . ARG B 1 416 ? 94.159  36.086 11.413  1.00 65.93  ? 417  ARG B NH1 1 
ATOM   7365 N NH2 . ARG B 1 416 ? 93.054  34.353 12.432  1.00 62.88  ? 417  ARG B NH2 1 
ATOM   7366 N N   . LEU B 1 417 ? 92.654  38.153 18.978  1.00 42.97  ? 418  LEU B N   1 
ATOM   7367 C CA  . LEU B 1 417 ? 91.836  37.804 20.138  1.00 43.99  ? 418  LEU B CA  1 
ATOM   7368 C C   . LEU B 1 417 ? 90.484  38.504 20.085  1.00 43.71  ? 418  LEU B C   1 
ATOM   7369 O O   . LEU B 1 417 ? 89.441  37.882 20.311  1.00 48.99  ? 418  LEU B O   1 
ATOM   7370 C CB  . LEU B 1 417 ? 92.569  38.154 21.436  1.00 39.91  ? 418  LEU B CB  1 
ATOM   7371 C CG  . LEU B 1 417 ? 93.849  37.391 21.788  1.00 50.00  ? 418  LEU B CG  1 
ATOM   7372 C CD1 . LEU B 1 417 ? 94.231  37.626 23.240  1.00 47.53  ? 418  LEU B CD1 1 
ATOM   7373 C CD2 . LEU B 1 417 ? 93.708  35.911 21.513  1.00 57.70  ? 418  LEU B CD2 1 
ATOM   7374 N N   . ALA B 1 418 ? 90.484  39.806 19.785  1.00 42.07  ? 419  ALA B N   1 
ATOM   7375 C CA  . ALA B 1 418 ? 89.233  40.560 19.743  1.00 44.31  ? 419  ALA B CA  1 
ATOM   7376 C C   . ALA B 1 418 ? 88.319  40.043 18.642  1.00 50.49  ? 419  ALA B C   1 
ATOM   7377 O O   . ALA B 1 418 ? 87.142  39.749 18.882  1.00 55.54  ? 419  ALA B O   1 
ATOM   7378 C CB  . ALA B 1 418 ? 89.519  42.050 19.544  1.00 38.69  ? 419  ALA B CB  1 
ATOM   7379 N N   . ALA B 1 419 ? 88.849  39.915 17.423  1.00 51.52  ? 420  ALA B N   1 
ATOM   7380 C CA  . ALA B 1 419 ? 88.044  39.457 16.296  1.00 55.20  ? 420  ALA B CA  1 
ATOM   7381 C C   . ALA B 1 419 ? 87.558  38.025 16.461  1.00 62.01  ? 420  ALA B C   1 
ATOM   7382 O O   . ALA B 1 419 ? 86.722  37.581 15.666  1.00 67.10  ? 420  ALA B O   1 
ATOM   7383 C CB  . ALA B 1 419 ? 88.838  39.578 14.992  1.00 40.69  ? 420  ALA B CB  1 
ATOM   7384 N N   . GLN B 1 420 ? 88.048  37.296 17.467  1.00 57.43  ? 421  GLN B N   1 
ATOM   7385 C CA  . GLN B 1 420 ? 87.702  35.892 17.649  1.00 55.32  ? 421  GLN B CA  1 
ATOM   7386 C C   . GLN B 1 420 ? 87.082  35.615 19.015  1.00 57.76  ? 421  GLN B C   1 
ATOM   7387 O O   . GLN B 1 420 ? 87.094  34.469 19.478  1.00 57.56  ? 421  GLN B O   1 
ATOM   7388 C CB  . GLN B 1 420 ? 88.933  35.013 17.429  1.00 51.34  ? 421  GLN B CB  1 
ATOM   7389 C CG  . GLN B 1 420 ? 89.392  34.989 15.977  1.00 54.33  ? 421  GLN B CG  1 
ATOM   7390 C CD  . GLN B 1 420 ? 90.806  34.475 15.819  1.00 57.49  ? 421  GLN B CD  1 
ATOM   7391 O OE1 . GLN B 1 420 ? 91.529  34.887 14.912  1.00 64.11  ? 421  GLN B OE1 1 
ATOM   7392 N NE2 . GLN B 1 420 ? 91.212  33.572 16.704  1.00 53.10  ? 421  GLN B NE2 1 
ATOM   7393 N N   . GLY B 1 421 ? 86.541  36.635 19.675  1.00 51.41  ? 422  GLY B N   1 
ATOM   7394 C CA  . GLY B 1 421 ? 85.696  36.383 20.825  1.00 48.90  ? 422  GLY B CA  1 
ATOM   7395 C C   . GLY B 1 421 ? 86.117  37.019 22.133  1.00 49.85  ? 422  GLY B C   1 
ATOM   7396 O O   . GLY B 1 421 ? 85.290  37.159 23.039  1.00 55.27  ? 422  GLY B O   1 
ATOM   7397 N N   . ALA B 1 422 ? 87.383  37.402 22.260  1.00 42.46  ? 423  ALA B N   1 
ATOM   7398 C CA  . ALA B 1 422 ? 87.860  37.962 23.515  1.00 48.49  ? 423  ALA B CA  1 
ATOM   7399 C C   . ALA B 1 422 ? 87.464  39.428 23.641  1.00 44.79  ? 423  ALA B C   1 
ATOM   7400 O O   . ALA B 1 422 ? 87.280  40.133 22.645  1.00 48.78  ? 423  ALA B O   1 
ATOM   7401 C CB  . ALA B 1 422 ? 89.379  37.826 23.627  1.00 47.35  ? 423  ALA B CB  1 
ATOM   7402 N N   . ARG B 1 423 ? 87.321  39.881 24.883  1.00 45.49  ? 424  ARG B N   1 
ATOM   7403 C CA  . ARG B 1 423 ? 87.164  41.298 25.181  1.00 50.16  ? 424  ARG B CA  1 
ATOM   7404 C C   . ARG B 1 423 ? 88.533  41.845 25.565  1.00 49.78  ? 424  ARG B C   1 
ATOM   7405 O O   . ARG B 1 423 ? 89.121  41.416 26.564  1.00 48.08  ? 424  ARG B O   1 
ATOM   7406 C CB  . ARG B 1 423 ? 86.143  41.536 26.295  1.00 48.14  ? 424  ARG B CB  1 
ATOM   7407 C CG  . ARG B 1 423 ? 85.686  42.989 26.373  1.00 54.79  ? 424  ARG B CG  1 
ATOM   7408 C CD  . ARG B 1 423 ? 84.365  43.164 27.111  1.00 68.49  ? 424  ARG B CD  1 
ATOM   7409 N NE  . ARG B 1 423 ? 84.541  43.259 28.558  1.00 75.27  ? 424  ARG B NE  1 
ATOM   7410 C CZ  . ARG B 1 423 ? 84.039  42.395 29.434  1.00 75.24  ? 424  ARG B CZ  1 
ATOM   7411 N NH1 . ARG B 1 423 ? 83.314  41.366 29.016  1.00 75.32  ? 424  ARG B NH1 1 
ATOM   7412 N NH2 . ARG B 1 423 ? 84.256  42.566 30.730  1.00 79.41  ? 424  ARG B NH2 1 
ATOM   7413 N N   . VAL B 1 424 ? 89.040  42.776 24.764  1.00 44.37  ? 425  VAL B N   1 
ATOM   7414 C CA  . VAL B 1 424 ? 90.416  43.243 24.860  1.00 42.39  ? 425  VAL B CA  1 
ATOM   7415 C C   . VAL B 1 424 ? 90.415  44.711 25.252  1.00 40.90  ? 425  VAL B C   1 
ATOM   7416 O O   . VAL B 1 424 ? 89.632  45.505 24.720  1.00 45.18  ? 425  VAL B O   1 
ATOM   7417 C CB  . VAL B 1 424 ? 91.172  43.040 23.529  1.00 37.54  ? 425  VAL B CB  1 
ATOM   7418 C CG1 . VAL B 1 424 ? 92.644  43.414 23.679  1.00 33.12  ? 425  VAL B CG1 1 
ATOM   7419 C CG2 . VAL B 1 424 ? 91.023  41.609 23.047  1.00 36.14  ? 425  VAL B CG2 1 
ATOM   7420 N N   . TYR B 1 425 ? 91.299  45.070 26.177  1.00 39.63  ? 426  TYR B N   1 
ATOM   7421 C CA  . TYR B 1 425 ? 91.562  46.459 26.524  1.00 42.63  ? 426  TYR B CA  1 
ATOM   7422 C C   . TYR B 1 425 ? 93.027  46.760 26.242  1.00 44.16  ? 426  TYR B C   1 
ATOM   7423 O O   . TYR B 1 425 ? 93.910  46.009 26.666  1.00 50.52  ? 426  TYR B O   1 
ATOM   7424 C CB  . TYR B 1 425 ? 91.216  46.734 27.989  1.00 39.87  ? 426  TYR B CB  1 
ATOM   7425 C CG  . TYR B 1 425 ? 89.750  46.528 28.302  1.00 41.30  ? 426  TYR B CG  1 
ATOM   7426 C CD1 . TYR B 1 425 ? 88.842  47.574 28.190  1.00 40.80  ? 426  TYR B CD1 1 
ATOM   7427 C CD2 . TYR B 1 425 ? 89.272  45.284 28.696  1.00 41.07  ? 426  TYR B CD2 1 
ATOM   7428 C CE1 . TYR B 1 425 ? 87.497  47.390 28.471  1.00 43.07  ? 426  TYR B CE1 1 
ATOM   7429 C CE2 . TYR B 1 425 ? 87.930  45.090 28.980  1.00 42.75  ? 426  TYR B CE2 1 
ATOM   7430 C CZ  . TYR B 1 425 ? 87.048  46.145 28.865  1.00 44.44  ? 426  TYR B CZ  1 
ATOM   7431 O OH  . TYR B 1 425 ? 85.713  45.957 29.142  1.00 48.48  ? 426  TYR B OH  1 
ATOM   7432 N N   . ALA B 1 426 ? 93.279  47.849 25.519  1.00 40.65  ? 427  ALA B N   1 
ATOM   7433 C CA  . ALA B 1 426 ? 94.620  48.212 25.085  1.00 38.96  ? 427  ALA B CA  1 
ATOM   7434 C C   . ALA B 1 426 ? 94.993  49.593 25.606  1.00 43.79  ? 427  ALA B C   1 
ATOM   7435 O O   . ALA B 1 426 ? 94.143  50.482 25.724  1.00 42.40  ? 427  ALA B O   1 
ATOM   7436 C CB  . ALA B 1 426 ? 94.733  48.188 23.555  1.00 37.09  ? 427  ALA B CB  1 
ATOM   7437 N N   . TYR B 1 427 ? 96.279  49.768 25.912  1.00 37.11  ? 428  TYR B N   1 
ATOM   7438 C CA  . TYR B 1 427 ? 96.786  51.023 26.447  1.00 38.16  ? 428  TYR B CA  1 
ATOM   7439 C C   . TYR B 1 427 ? 98.153  51.319 25.850  1.00 40.24  ? 428  TYR B C   1 
ATOM   7440 O O   . TYR B 1 427 ? 98.855  50.427 25.370  1.00 36.17  ? 428  TYR B O   1 
ATOM   7441 C CB  . TYR B 1 427 ? 96.901  50.995 27.985  1.00 39.81  ? 428  TYR B CB  1 
ATOM   7442 C CG  . TYR B 1 427 ? 97.971  50.048 28.500  1.00 38.11  ? 428  TYR B CG  1 
ATOM   7443 C CD1 . TYR B 1 427 ? 99.304  50.441 28.567  1.00 38.01  ? 428  TYR B CD1 1 
ATOM   7444 C CD2 . TYR B 1 427 ? 97.646  48.762 28.920  1.00 35.16  ? 428  TYR B CD2 1 
ATOM   7445 C CE1 . TYR B 1 427 ? 100.285 49.579 29.022  1.00 40.66  ? 428  TYR B CE1 1 
ATOM   7446 C CE2 . TYR B 1 427 ? 98.621  47.892 29.386  1.00 34.57  ? 428  TYR B CE2 1 
ATOM   7447 C CZ  . TYR B 1 427 ? 99.939  48.309 29.432  1.00 39.90  ? 428  TYR B CZ  1 
ATOM   7448 O OH  . TYR B 1 427 ? 100.919 47.458 29.881  1.00 40.96  ? 428  TYR B OH  1 
ATOM   7449 N N   . VAL B 1 428 ? 98.537  52.591 25.915  1.00 41.12  ? 429  VAL B N   1 
ATOM   7450 C CA  . VAL B 1 428 ? 99.914  53.014 25.696  1.00 37.72  ? 429  VAL B CA  1 
ATOM   7451 C C   . VAL B 1 428 ? 100.322 53.863 26.889  1.00 40.70  ? 429  VAL B C   1 
ATOM   7452 O O   . VAL B 1 428 ? 99.682  54.882 27.175  1.00 43.82  ? 429  VAL B O   1 
ATOM   7453 C CB  . VAL B 1 428 ? 100.094 53.801 24.389  1.00 40.86  ? 429  VAL B CB  1 
ATOM   7454 C CG1 . VAL B 1 428 ? 101.505 54.351 24.317  1.00 39.09  ? 429  VAL B CG1 1 
ATOM   7455 C CG2 . VAL B 1 428 ? 99.822  52.910 23.192  1.00 45.93  ? 429  VAL B CG2 1 
ATOM   7456 N N   . PHE B 1 429 ? 101.375 53.442 27.584  1.00 39.97  ? 430  PHE B N   1 
ATOM   7457 C CA  . PHE B 1 429 ? 101.867 54.138 28.767  1.00 41.40  ? 430  PHE B CA  1 
ATOM   7458 C C   . PHE B 1 429 ? 102.831 55.232 28.324  1.00 43.26  ? 430  PHE B C   1 
ATOM   7459 O O   . PHE B 1 429 ? 103.881 54.940 27.742  1.00 45.19  ? 430  PHE B O   1 
ATOM   7460 C CB  . PHE B 1 429 ? 102.547 53.149 29.712  1.00 39.53  ? 430  PHE B CB  1 
ATOM   7461 C CG  . PHE B 1 429 ? 103.054 53.764 30.984  1.00 46.18  ? 430  PHE B CG  1 
ATOM   7462 C CD1 . PHE B 1 429 ? 102.233 53.868 32.094  1.00 43.48  ? 430  PHE B CD1 1 
ATOM   7463 C CD2 . PHE B 1 429 ? 104.361 54.217 31.076  1.00 46.96  ? 430  PHE B CD2 1 
ATOM   7464 C CE1 . PHE B 1 429 ? 102.702 54.425 33.272  1.00 43.78  ? 430  PHE B CE1 1 
ATOM   7465 C CE2 . PHE B 1 429 ? 104.835 54.773 32.249  1.00 49.97  ? 430  PHE B CE2 1 
ATOM   7466 C CZ  . PHE B 1 429 ? 104.004 54.879 33.349  1.00 42.12  ? 430  PHE B CZ  1 
ATOM   7467 N N   . GLU B 1 430 ? 102.480 56.489 28.604  1.00 44.24  ? 431  GLU B N   1 
ATOM   7468 C CA  . GLU B 1 430 ? 103.195 57.624 28.032  1.00 48.40  ? 431  GLU B CA  1 
ATOM   7469 C C   . GLU B 1 430 ? 103.781 58.571 29.070  1.00 52.65  ? 431  GLU B C   1 
ATOM   7470 O O   . GLU B 1 430 ? 104.247 59.654 28.700  1.00 53.97  ? 431  GLU B O   1 
ATOM   7471 C CB  . GLU B 1 430 ? 102.276 58.415 27.096  1.00 45.06  ? 431  GLU B CB  1 
ATOM   7472 C CG  . GLU B 1 430 ? 101.698 57.607 25.951  1.00 52.31  ? 431  GLU B CG  1 
ATOM   7473 C CD  . GLU B 1 430 ? 101.112 58.489 24.866  1.00 59.14  ? 431  GLU B CD  1 
ATOM   7474 O OE1 . GLU B 1 430 ? 101.552 58.375 23.704  1.00 64.62  ? 431  GLU B OE1 1 
ATOM   7475 O OE2 . GLU B 1 430 ? 100.224 59.310 25.181  1.00 60.46  ? 431  GLU B OE2 1 
ATOM   7476 N N   . HIS B 1 431 ? 103.775 58.213 30.349  1.00 50.71  ? 432  HIS B N   1 
ATOM   7477 C CA  . HIS B 1 431 ? 104.329 59.087 31.374  1.00 50.68  ? 432  HIS B CA  1 
ATOM   7478 C C   . HIS B 1 431 ? 105.788 58.725 31.624  1.00 51.03  ? 432  HIS B C   1 
ATOM   7479 O O   . HIS B 1 431 ? 106.103 57.572 31.936  1.00 53.08  ? 432  HIS B O   1 
ATOM   7480 C CB  . HIS B 1 431 ? 103.534 59.001 32.675  1.00 51.20  ? 432  HIS B CB  1 
ATOM   7481 C CG  . HIS B 1 431 ? 104.118 59.820 33.784  1.00 53.71  ? 432  HIS B CG  1 
ATOM   7482 N ND1 . HIS B 1 431 ? 104.186 61.196 33.735  1.00 57.33  ? 432  HIS B ND1 1 
ATOM   7483 C CD2 . HIS B 1 431 ? 104.678 59.458 34.963  1.00 48.39  ? 432  HIS B CD2 1 
ATOM   7484 C CE1 . HIS B 1 431 ? 104.753 61.647 34.840  1.00 53.27  ? 432  HIS B CE1 1 
ATOM   7485 N NE2 . HIS B 1 431 ? 105.062 60.612 35.601  1.00 50.91  ? 432  HIS B NE2 1 
ATOM   7486 N N   . ARG B 1 432 ? 106.671 59.709 31.481  1.00 49.39  ? 433  ARG B N   1 
ATOM   7487 C CA  . ARG B 1 432 ? 108.071 59.551 31.849  1.00 47.51  ? 433  ARG B CA  1 
ATOM   7488 C C   . ARG B 1 432 ? 108.222 59.930 33.316  1.00 54.68  ? 433  ARG B C   1 
ATOM   7489 O O   . ARG B 1 432 ? 107.881 61.050 33.712  1.00 57.63  ? 433  ARG B O   1 
ATOM   7490 C CB  . ARG B 1 432 ? 108.975 60.413 30.967  1.00 54.65  ? 433  ARG B CB  1 
ATOM   7491 C CG  . ARG B 1 432 ? 110.447 60.326 31.336  1.00 56.02  ? 433  ARG B CG  1 
ATOM   7492 C CD  . ARG B 1 432 ? 111.301 61.250 30.484  1.00 53.52  ? 433  ARG B CD  1 
ATOM   7493 N NE  . ARG B 1 432 ? 112.665 61.345 30.998  1.00 60.18  ? 433  ARG B NE  1 
ATOM   7494 C CZ  . ARG B 1 432 ? 113.688 60.627 30.547  1.00 58.40  ? 433  ARG B CZ  1 
ATOM   7495 N NH1 . ARG B 1 432 ? 113.508 59.759 29.559  1.00 52.81  ? 433  ARG B NH1 1 
ATOM   7496 N NH2 . ARG B 1 432 ? 114.893 60.780 31.080  1.00 61.79  ? 433  ARG B NH2 1 
ATOM   7497 N N   . ALA B 1 433 ? 108.715 58.995 34.120  1.00 50.75  ? 434  ALA B N   1 
ATOM   7498 C CA  . ALA B 1 433 ? 108.819 59.229 35.552  1.00 55.51  ? 434  ALA B CA  1 
ATOM   7499 C C   . ALA B 1 433 ? 109.819 60.340 35.844  1.00 58.89  ? 434  ALA B C   1 
ATOM   7500 O O   . ALA B 1 433 ? 110.884 60.419 35.226  1.00 57.83  ? 434  ALA B O   1 
ATOM   7501 C CB  . ALA B 1 433 ? 109.230 57.944 36.270  1.00 40.84  ? 434  ALA B CB  1 
ATOM   7502 N N   . SER B 1 434 ? 109.462 61.209 36.795  1.00 57.83  ? 435  SER B N   1 
ATOM   7503 C CA  . SER B 1 434 ? 110.354 62.290 37.198  1.00 55.14  ? 435  SER B CA  1 
ATOM   7504 C C   . SER B 1 434 ? 111.665 61.766 37.767  1.00 57.98  ? 435  SER B C   1 
ATOM   7505 O O   . SER B 1 434 ? 112.662 62.496 37.779  1.00 62.96  ? 435  SER B O   1 
ATOM   7506 C CB  . SER B 1 434 ? 109.666 63.183 38.232  1.00 54.56  ? 435  SER B CB  1 
ATOM   7507 O OG  . SER B 1 434 ? 109.371 62.457 39.415  1.00 57.73  ? 435  SER B OG  1 
ATOM   7508 N N   . THR B 1 435 ? 111.683 60.524 38.237  1.00 53.18  ? 436  THR B N   1 
ATOM   7509 C CA  . THR B 1 435 ? 112.874 59.910 38.803  1.00 52.89  ? 436  THR B CA  1 
ATOM   7510 C C   . THR B 1 435 ? 113.679 59.118 37.783  1.00 52.18  ? 436  THR B C   1 
ATOM   7511 O O   . THR B 1 435 ? 114.715 58.552 38.145  1.00 53.47  ? 436  THR B O   1 
ATOM   7512 C CB  . THR B 1 435 ? 112.481 58.987 39.956  1.00 52.79  ? 436  THR B CB  1 
ATOM   7513 O OG1 . THR B 1 435 ? 111.627 57.948 39.457  1.00 54.26  ? 436  THR B OG1 1 
ATOM   7514 C CG2 . THR B 1 435 ? 111.741 59.770 41.028  1.00 56.98  ? 436  THR B CG2 1 
ATOM   7515 N N   . LEU B 1 436 ? 113.228 59.058 36.531  1.00 48.08  ? 437  LEU B N   1 
ATOM   7516 C CA  . LEU B 1 436 ? 113.886 58.221 35.536  1.00 49.90  ? 437  LEU B CA  1 
ATOM   7517 C C   . LEU B 1 436 ? 115.337 58.648 35.348  1.00 53.01  ? 437  LEU B C   1 
ATOM   7518 O O   . LEU B 1 436 ? 115.628 59.825 35.117  1.00 56.15  ? 437  LEU B O   1 
ATOM   7519 C CB  . LEU B 1 436 ? 113.135 58.293 34.208  1.00 48.39  ? 437  LEU B CB  1 
ATOM   7520 C CG  . LEU B 1 436 ? 113.532 57.254 33.161  1.00 54.67  ? 437  LEU B CG  1 
ATOM   7521 C CD1 . LEU B 1 436 ? 113.311 55.853 33.698  1.00 50.81  ? 437  LEU B CD1 1 
ATOM   7522 C CD2 . LEU B 1 436 ? 112.743 57.464 31.882  1.00 56.52  ? 437  LEU B CD2 1 
ATOM   7523 N N   . SER B 1 437 ? 116.247 57.679 35.455  1.00 50.29  ? 438  SER B N   1 
ATOM   7524 C CA  . SER B 1 437 ? 117.675 57.942 35.351  1.00 51.88  ? 438  SER B CA  1 
ATOM   7525 C C   . SER B 1 437 ? 118.208 57.843 33.927  1.00 49.74  ? 438  SER B C   1 
ATOM   7526 O O   . SER B 1 437 ? 119.304 58.347 33.657  1.00 55.22  ? 438  SER B O   1 
ATOM   7527 C CB  . SER B 1 437 ? 118.449 56.970 36.247  1.00 55.30  ? 438  SER B CB  1 
ATOM   7528 O OG  . SER B 1 437 ? 118.009 55.640 36.033  1.00 61.73  ? 438  SER B OG  1 
ATOM   7529 N N   . TRP B 1 438 ? 117.473 57.204 33.018  1.00 48.20  ? 439  TRP B N   1 
ATOM   7530 C CA  . TRP B 1 438 ? 117.902 57.117 31.632  1.00 51.39  ? 439  TRP B CA  1 
ATOM   7531 C C   . TRP B 1 438 ? 117.816 58.490 30.962  1.00 54.46  ? 439  TRP B C   1 
ATOM   7532 O O   . TRP B 1 438 ? 117.029 59.344 31.380  1.00 55.97  ? 439  TRP B O   1 
ATOM   7533 C CB  . TRP B 1 438 ? 117.045 56.109 30.868  1.00 48.77  ? 439  TRP B CB  1 
ATOM   7534 C CG  . TRP B 1 438 ? 117.235 54.692 31.318  1.00 51.25  ? 439  TRP B CG  1 
ATOM   7535 C CD1 . TRP B 1 438 ? 116.431 53.986 32.167  1.00 48.63  ? 439  TRP B CD1 1 
ATOM   7536 C CD2 . TRP B 1 438 ? 118.299 53.807 30.945  1.00 49.71  ? 439  TRP B CD2 1 
ATOM   7537 N NE1 . TRP B 1 438 ? 116.928 52.716 32.343  1.00 45.59  ? 439  TRP B NE1 1 
ATOM   7538 C CE2 . TRP B 1 438 ? 118.075 52.582 31.605  1.00 51.50  ? 439  TRP B CE2 1 
ATOM   7539 C CE3 . TRP B 1 438 ? 119.420 53.934 30.121  1.00 44.12  ? 439  TRP B CE3 1 
ATOM   7540 C CZ2 . TRP B 1 438 ? 118.930 51.489 31.464  1.00 47.03  ? 439  TRP B CZ2 1 
ATOM   7541 C CZ3 . TRP B 1 438 ? 120.269 52.846 29.981  1.00 47.56  ? 439  TRP B CZ3 1 
ATOM   7542 C CH2 . TRP B 1 438 ? 120.017 51.641 30.647  1.00 45.27  ? 439  TRP B CH2 1 
ATOM   7543 N N   . PRO B 1 439 ? 118.613 58.725 29.918  1.00 55.47  ? 440  PRO B N   1 
ATOM   7544 C CA  . PRO B 1 439 ? 118.605 60.040 29.267  1.00 52.88  ? 440  PRO B CA  1 
ATOM   7545 C C   . PRO B 1 439 ? 117.248 60.364 28.659  1.00 57.87  ? 440  PRO B C   1 
ATOM   7546 O O   . PRO B 1 439 ? 116.395 59.496 28.458  1.00 50.43  ? 440  PRO B O   1 
ATOM   7547 C CB  . PRO B 1 439 ? 119.683 59.909 28.184  1.00 55.16  ? 440  PRO B CB  1 
ATOM   7548 C CG  . PRO B 1 439 ? 119.781 58.441 27.932  1.00 59.97  ? 440  PRO B CG  1 
ATOM   7549 C CD  . PRO B 1 439 ? 119.569 57.808 29.274  1.00 56.54  ? 440  PRO B CD  1 
ATOM   7550 N N   . LEU B 1 440 ? 117.065 61.651 28.352  1.00 64.61  ? 441  LEU B N   1 
ATOM   7551 C CA  . LEU B 1 440 ? 115.771 62.124 27.874  1.00 69.14  ? 441  LEU B CA  1 
ATOM   7552 C C   . LEU B 1 440 ? 115.436 61.586 26.488  1.00 60.87  ? 441  LEU B C   1 
ATOM   7553 O O   . LEU B 1 440 ? 114.256 61.383 26.178  1.00 56.90  ? 441  LEU B O   1 
ATOM   7554 C CB  . LEU B 1 440 ? 115.743 63.653 27.863  1.00 75.23  ? 441  LEU B CB  1 
ATOM   7555 C CG  . LEU B 1 440 ? 114.352 64.276 27.732  1.00 81.13  ? 441  LEU B CG  1 
ATOM   7556 C CD1 . LEU B 1 440 ? 113.714 64.452 29.104  1.00 83.22  ? 441  LEU B CD1 1 
ATOM   7557 C CD2 . LEU B 1 440 ? 114.408 65.597 26.982  1.00 85.27  ? 441  LEU B CD2 1 
ATOM   7558 N N   . TRP B 1 441 ? 116.445 61.342 25.643  1.00 54.97  ? 442  TRP B N   1 
ATOM   7559 C CA  . TRP B 1 441 ? 116.158 60.902 24.282  1.00 58.69  ? 442  TRP B CA  1 
ATOM   7560 C C   . TRP B 1 441 ? 115.510 59.525 24.243  1.00 55.60  ? 442  TRP B C   1 
ATOM   7561 O O   . TRP B 1 441 ? 114.884 59.180 23.236  1.00 54.14  ? 442  TRP B O   1 
ATOM   7562 C CB  . TRP B 1 441 ? 117.429 60.916 23.417  1.00 60.07  ? 442  TRP B CB  1 
ATOM   7563 C CG  . TRP B 1 441 ? 118.471 59.879 23.757  1.00 57.49  ? 442  TRP B CG  1 
ATOM   7564 C CD1 . TRP B 1 441 ? 119.606 60.072 24.489  1.00 60.81  ? 442  TRP B CD1 1 
ATOM   7565 C CD2 . TRP B 1 441 ? 118.487 58.502 23.349  1.00 55.36  ? 442  TRP B CD2 1 
ATOM   7566 N NE1 . TRP B 1 441 ? 120.321 58.900 24.574  1.00 59.92  ? 442  TRP B NE1 1 
ATOM   7567 C CE2 . TRP B 1 441 ? 119.655 57.922 23.884  1.00 53.88  ? 442  TRP B CE2 1 
ATOM   7568 C CE3 . TRP B 1 441 ? 117.625 57.703 22.587  1.00 56.67  ? 442  TRP B CE3 1 
ATOM   7569 C CZ2 . TRP B 1 441 ? 119.981 56.579 23.688  1.00 52.43  ? 442  TRP B CZ2 1 
ATOM   7570 C CZ3 . TRP B 1 441 ? 117.951 56.368 22.393  1.00 52.75  ? 442  TRP B CZ3 1 
ATOM   7571 C CH2 . TRP B 1 441 ? 119.118 55.820 22.943  1.00 51.57  ? 442  TRP B CH2 1 
ATOM   7572 N N   . MET B 1 442 ? 115.630 58.737 25.313  1.00 47.24  ? 443  MET B N   1 
ATOM   7573 C CA  . MET B 1 442 ? 114.967 57.440 25.353  1.00 47.88  ? 443  MET B CA  1 
ATOM   7574 C C   . MET B 1 442 ? 113.472 57.541 25.633  1.00 43.29  ? 443  MET B C   1 
ATOM   7575 O O   . MET B 1 442 ? 112.765 56.540 25.474  1.00 44.25  ? 443  MET B O   1 
ATOM   7576 C CB  . MET B 1 442 ? 115.625 56.541 26.400  1.00 52.17  ? 443  MET B CB  1 
ATOM   7577 C CG  . MET B 1 442 ? 117.057 56.161 26.074  1.00 59.88  ? 443  MET B CG  1 
ATOM   7578 S SD  . MET B 1 442 ? 117.661 54.841 27.142  1.00 61.00  ? 443  MET B SD  1 
ATOM   7579 C CE  . MET B 1 442 ? 119.402 54.885 26.761  1.00 61.07  ? 443  MET B CE  1 
ATOM   7580 N N   . GLY B 1 443 ? 112.977 58.707 26.039  1.00 48.26  ? 444  GLY B N   1 
ATOM   7581 C CA  . GLY B 1 443 ? 111.541 58.875 26.222  1.00 50.04  ? 444  GLY B CA  1 
ATOM   7582 C C   . GLY B 1 443 ? 111.020 58.047 27.381  1.00 50.22  ? 444  GLY B C   1 
ATOM   7583 O O   . GLY B 1 443 ? 111.544 58.102 28.499  1.00 49.00  ? 444  GLY B O   1 
ATOM   7584 N N   . VAL B 1 444 ? 109.963 57.282 27.118  1.00 46.88  ? 445  VAL B N   1 
ATOM   7585 C CA  . VAL B 1 444 ? 109.381 56.365 28.097  1.00 44.04  ? 445  VAL B CA  1 
ATOM   7586 C C   . VAL B 1 444 ? 109.852 54.958 27.755  1.00 41.65  ? 445  VAL B C   1 
ATOM   7587 O O   . VAL B 1 444 ? 109.231 54.284 26.922  1.00 44.97  ? 445  VAL B O   1 
ATOM   7588 C CB  . VAL B 1 444 ? 107.846 56.451 28.107  1.00 45.20  ? 445  VAL B CB  1 
ATOM   7589 C CG1 . VAL B 1 444 ? 107.270 55.570 29.204  1.00 43.59  ? 445  VAL B CG1 1 
ATOM   7590 C CG2 . VAL B 1 444 ? 107.390 57.896 28.274  1.00 48.32  ? 445  VAL B CG2 1 
ATOM   7591 N N   . PRO B 1 445 ? 110.926 54.470 28.366  1.00 48.65  ? 446  PRO B N   1 
ATOM   7592 C CA  . PRO B 1 445 ? 111.556 53.237 27.891  1.00 44.63  ? 446  PRO B CA  1 
ATOM   7593 C C   . PRO B 1 445 ? 110.832 51.990 28.383  1.00 49.48  ? 446  PRO B C   1 
ATOM   7594 O O   . PRO B 1 445 ? 109.957 52.027 29.251  1.00 42.15  ? 446  PRO B O   1 
ATOM   7595 C CB  . PRO B 1 445 ? 112.977 53.311 28.473  1.00 40.31  ? 446  PRO B CB  1 
ATOM   7596 C CG  . PRO B 1 445 ? 113.103 54.698 29.078  1.00 43.27  ? 446  PRO B CG  1 
ATOM   7597 C CD  . PRO B 1 445 ? 111.706 55.087 29.446  1.00 47.18  ? 446  PRO B CD  1 
ATOM   7598 N N   . HIS B 1 446 ? 111.235 50.869 27.793  1.00 46.04  ? 447  HIS B N   1 
ATOM   7599 C CA  . HIS B 1 446 ? 110.678 49.566 28.119  1.00 40.40  ? 447  HIS B CA  1 
ATOM   7600 C C   . HIS B 1 446 ? 110.852 49.255 29.601  1.00 42.85  ? 447  HIS B C   1 
ATOM   7601 O O   . HIS B 1 446 ? 111.944 49.404 30.154  1.00 39.67  ? 447  HIS B O   1 
ATOM   7602 C CB  . HIS B 1 446 ? 111.373 48.509 27.264  1.00 39.95  ? 447  HIS B CB  1 
ATOM   7603 C CG  . HIS B 1 446 ? 110.994 47.101 27.595  1.00 47.69  ? 447  HIS B CG  1 
ATOM   7604 N ND1 . HIS B 1 446 ? 109.918 46.464 27.015  1.00 42.94  ? 447  HIS B ND1 1 
ATOM   7605 C CD2 . HIS B 1 446 ? 111.566 46.197 28.425  1.00 46.23  ? 447  HIS B CD2 1 
ATOM   7606 C CE1 . HIS B 1 446 ? 109.837 45.232 27.481  1.00 49.31  ? 447  HIS B CE1 1 
ATOM   7607 N NE2 . HIS B 1 446 ? 110.824 45.045 28.339  1.00 53.80  ? 447  HIS B NE2 1 
ATOM   7608 N N   . GLY B 1 447 ? 109.763 48.832 30.244  1.00 38.87  ? 448  GLY B N   1 
ATOM   7609 C CA  . GLY B 1 447 ? 109.802 48.390 31.621  1.00 38.76  ? 448  GLY B CA  1 
ATOM   7610 C C   . GLY B 1 447 ? 109.460 49.436 32.662  1.00 44.27  ? 448  GLY B C   1 
ATOM   7611 O O   . GLY B 1 447 ? 109.295 49.083 33.837  1.00 48.49  ? 448  GLY B O   1 
ATOM   7612 N N   . TYR B 1 448 ? 109.331 50.706 32.282  1.00 43.50  ? 449  TYR B N   1 
ATOM   7613 C CA  . TYR B 1 448 ? 109.187 51.773 33.259  1.00 48.04  ? 449  TYR B CA  1 
ATOM   7614 C C   . TYR B 1 448 ? 107.738 52.194 33.471  1.00 46.86  ? 449  TYR B C   1 
ATOM   7615 O O   . TYR B 1 448 ? 107.482 53.295 33.969  1.00 50.42  ? 449  TYR B O   1 
ATOM   7616 C CB  . TYR B 1 448 ? 110.085 52.948 32.874  1.00 42.26  ? 449  TYR B CB  1 
ATOM   7617 C CG  . TYR B 1 448 ? 111.514 52.560 33.151  1.00 44.39  ? 449  TYR B CG  1 
ATOM   7618 C CD1 . TYR B 1 448 ? 112.032 52.646 34.438  1.00 44.18  ? 449  TYR B CD1 1 
ATOM   7619 C CD2 . TYR B 1 448 ? 112.316 52.017 32.155  1.00 36.39  ? 449  TYR B CD2 1 
ATOM   7620 C CE1 . TYR B 1 448 ? 113.325 52.253 34.714  1.00 43.48  ? 449  TYR B CE1 1 
ATOM   7621 C CE2 . TYR B 1 448 ? 113.613 51.619 32.423  1.00 43.51  ? 449  TYR B CE2 1 
ATOM   7622 C CZ  . TYR B 1 448 ? 114.111 51.737 33.707  1.00 46.16  ? 449  TYR B CZ  1 
ATOM   7623 O OH  . TYR B 1 448 ? 115.399 51.343 33.988  1.00 52.03  ? 449  TYR B OH  1 
ATOM   7624 N N   . GLU B 1 449 ? 106.790 51.324 33.128  1.00 45.03  ? 450  GLU B N   1 
ATOM   7625 C CA  . GLU B 1 449 ? 105.436 51.410 33.654  1.00 44.09  ? 450  GLU B CA  1 
ATOM   7626 C C   . GLU B 1 449 ? 105.228 50.524 34.878  1.00 43.42  ? 450  GLU B C   1 
ATOM   7627 O O   . GLU B 1 449 ? 104.262 50.737 35.620  1.00 42.34  ? 450  GLU B O   1 
ATOM   7628 C CB  . GLU B 1 449 ? 104.417 51.018 32.576  1.00 42.57  ? 450  GLU B CB  1 
ATOM   7629 C CG  . GLU B 1 449 ? 104.065 49.529 32.538  1.00 44.37  ? 450  GLU B CG  1 
ATOM   7630 C CD  . GLU B 1 449 ? 105.154 48.656 31.927  1.00 49.79  ? 450  GLU B CD  1 
ATOM   7631 O OE1 . GLU B 1 449 ? 106.303 49.127 31.777  1.00 46.64  ? 450  GLU B OE1 1 
ATOM   7632 O OE2 . GLU B 1 449 ? 104.856 47.487 31.597  1.00 46.24  ? 450  GLU B OE2 1 
ATOM   7633 N N   . ILE B 1 450 ? 106.120 49.555 35.107  1.00 38.74  ? 451  ILE B N   1 
ATOM   7634 C CA  . ILE B 1 450 ? 105.925 48.568 36.170  1.00 44.40  ? 451  ILE B CA  1 
ATOM   7635 C C   . ILE B 1 450 ? 105.867 49.244 37.537  1.00 45.54  ? 451  ILE B C   1 
ATOM   7636 O O   . ILE B 1 450 ? 105.007 48.927 38.368  1.00 43.65  ? 451  ILE B O   1 
ATOM   7637 C CB  . ILE B 1 450 ? 107.038 47.505 36.121  1.00 43.31  ? 451  ILE B CB  1 
ATOM   7638 C CG1 . ILE B 1 450 ? 107.031 46.775 34.775  1.00 36.95  ? 451  ILE B CG1 1 
ATOM   7639 C CG2 . ILE B 1 450 ? 106.900 46.520 37.274  1.00 37.71  ? 451  ILE B CG2 1 
ATOM   7640 C CD1 . ILE B 1 450 ? 108.191 45.812 34.609  1.00 32.79  ? 451  ILE B CD1 1 
ATOM   7641 N N   . GLU B 1 451 ? 106.783 50.184 37.793  1.00 40.57  ? 452  GLU B N   1 
ATOM   7642 C CA  . GLU B 1 451 ? 106.845 50.810 39.112  1.00 44.83  ? 452  GLU B CA  1 
ATOM   7643 C C   . GLU B 1 451 ? 105.551 51.538 39.452  1.00 45.44  ? 452  GLU B C   1 
ATOM   7644 O O   . GLU B 1 451 ? 105.203 51.664 40.632  1.00 44.58  ? 452  GLU B O   1 
ATOM   7645 C CB  . GLU B 1 451 ? 108.033 51.770 39.186  1.00 42.34  ? 452  GLU B CB  1 
ATOM   7646 C CG  . GLU B 1 451 ? 108.040 52.834 38.100  1.00 46.08  ? 452  GLU B CG  1 
ATOM   7647 C CD  . GLU B 1 451 ? 109.372 53.550 37.997  1.00 52.07  ? 452  GLU B CD  1 
ATOM   7648 O OE1 . GLU B 1 451 ? 109.427 54.753 38.327  1.00 55.78  ? 452  GLU B OE1 1 
ATOM   7649 O OE2 . GLU B 1 451 ? 110.367 52.909 37.597  1.00 48.98  ? 452  GLU B OE2 1 
ATOM   7650 N N   . PHE B 1 452 ? 104.821 52.012 38.442  1.00 42.92  ? 453  PHE B N   1 
ATOM   7651 C CA  . PHE B 1 452 ? 103.537 52.651 38.695  1.00 42.19  ? 453  PHE B CA  1 
ATOM   7652 C C   . PHE B 1 452 ? 102.426 51.630 38.909  1.00 46.80  ? 453  PHE B C   1 
ATOM   7653 O O   . PHE B 1 452 ? 101.525 51.866 39.722  1.00 44.87  ? 453  PHE B O   1 
ATOM   7654 C CB  . PHE B 1 452 ? 103.188 53.598 37.545  1.00 40.81  ? 453  PHE B CB  1 
ATOM   7655 C CG  . PHE B 1 452 ? 104.019 54.847 37.528  1.00 41.28  ? 453  PHE B CG  1 
ATOM   7656 C CD1 . PHE B 1 452 ? 105.228 54.884 36.853  1.00 44.03  ? 453  PHE B CD1 1 
ATOM   7657 C CD2 . PHE B 1 452 ? 103.606 55.977 38.216  1.00 46.68  ? 453  PHE B CD2 1 
ATOM   7658 C CE1 . PHE B 1 452 ? 106.003 56.031 36.850  1.00 45.55  ? 453  PHE B CE1 1 
ATOM   7659 C CE2 . PHE B 1 452 ? 104.375 57.127 38.219  1.00 46.40  ? 453  PHE B CE2 1 
ATOM   7660 C CZ  . PHE B 1 452 ? 105.576 57.153 37.535  1.00 49.50  ? 453  PHE B CZ  1 
ATOM   7661 N N   . ILE B 1 453 ? 102.480 50.494 38.208  1.00 39.30  ? 454  ILE B N   1 
ATOM   7662 C CA  . ILE B 1 453 ? 101.477 49.450 38.401  1.00 35.69  ? 454  ILE B CA  1 
ATOM   7663 C C   . ILE B 1 453 ? 101.542 48.902 39.822  1.00 41.41  ? 454  ILE B C   1 
ATOM   7664 O O   . ILE B 1 453 ? 100.510 48.615 40.440  1.00 43.09  ? 454  ILE B O   1 
ATOM   7665 C CB  . ILE B 1 453 ? 101.660 48.332 37.358  1.00 40.60  ? 454  ILE B CB  1 
ATOM   7666 C CG1 . ILE B 1 453 ? 101.601 48.898 35.933  1.00 50.37  ? 454  ILE B CG1 1 
ATOM   7667 C CG2 . ILE B 1 453 ? 100.610 47.246 37.552  1.00 38.51  ? 454  ILE B CG2 1 
ATOM   7668 C CD1 . ILE B 1 453 ? 100.276 49.532 35.578  1.00 53.65  ? 454  ILE B CD1 1 
ATOM   7669 N N   . PHE B 1 454 ? 102.749 48.749 40.363  1.00 39.92  ? 455  PHE B N   1 
ATOM   7670 C CA  . PHE B 1 454 ? 102.940 48.230 41.711  1.00 42.86  ? 455  PHE B CA  1 
ATOM   7671 C C   . PHE B 1 454 ? 102.860 49.311 42.780  1.00 43.60  ? 455  PHE B C   1 
ATOM   7672 O O   . PHE B 1 454 ? 103.096 49.019 43.956  1.00 47.76  ? 455  PHE B O   1 
ATOM   7673 C CB  . PHE B 1 454 ? 104.280 47.495 41.808  1.00 38.20  ? 455  PHE B CB  1 
ATOM   7674 C CG  . PHE B 1 454 ? 104.249 46.107 41.236  1.00 42.32  ? 455  PHE B CG  1 
ATOM   7675 C CD1 . PHE B 1 454 ? 104.407 45.897 39.873  1.00 41.06  ? 455  PHE B CD1 1 
ATOM   7676 C CD2 . PHE B 1 454 ? 104.048 45.012 42.058  1.00 41.14  ? 455  PHE B CD2 1 
ATOM   7677 C CE1 . PHE B 1 454 ? 104.371 44.617 39.345  1.00 37.79  ? 455  PHE B CE1 1 
ATOM   7678 C CE2 . PHE B 1 454 ? 104.012 43.730 41.537  1.00 44.12  ? 455  PHE B CE2 1 
ATOM   7679 C CZ  . PHE B 1 454 ? 104.174 43.534 40.178  1.00 45.94  ? 455  PHE B CZ  1 
ATOM   7680 N N   . GLY B 1 455 ? 102.539 50.546 42.401  1.00 46.49  ? 456  GLY B N   1 
ATOM   7681 C CA  . GLY B 1 455 ? 102.380 51.609 43.371  1.00 42.48  ? 456  GLY B CA  1 
ATOM   7682 C C   . GLY B 1 455 ? 103.641 52.015 44.097  1.00 47.49  ? 456  GLY B C   1 
ATOM   7683 O O   . GLY B 1 455 ? 103.559 52.544 45.209  1.00 48.68  ? 456  GLY B O   1 
ATOM   7684 N N   . ILE B 1 456 ? 104.807 51.780 43.502  1.00 43.93  ? 457  ILE B N   1 
ATOM   7685 C CA  . ILE B 1 456 ? 106.092 52.177 44.081  1.00 43.66  ? 457  ILE B CA  1 
ATOM   7686 C C   . ILE B 1 456 ? 106.136 53.671 44.396  1.00 48.07  ? 457  ILE B C   1 
ATOM   7687 O O   . ILE B 1 456 ? 106.741 54.051 45.409  1.00 49.97  ? 457  ILE B O   1 
ATOM   7688 C CB  . ILE B 1 456 ? 107.259 51.778 43.165  1.00 50.14  ? 457  ILE B CB  1 
ATOM   7689 C CG1 . ILE B 1 456 ? 107.193 50.286 42.838  1.00 45.33  ? 457  ILE B CG1 1 
ATOM   7690 C CG2 . ILE B 1 456 ? 108.598 52.110 43.819  1.00 44.80  ? 457  ILE B CG2 1 
ATOM   7691 C CD1 . ILE B 1 456 ? 107.312 49.402 44.059  1.00 45.45  ? 457  ILE B CD1 1 
ATOM   7692 N N   . PRO B 1 457 ? 105.529 54.575 43.573  1.00 44.46  ? 458  PRO B N   1 
ATOM   7693 C CA  . PRO B 1 457 ? 105.502 55.993 43.961  1.00 44.59  ? 458  PRO B CA  1 
ATOM   7694 C C   . PRO B 1 457 ? 104.921 56.272 45.343  1.00 50.23  ? 458  PRO B C   1 
ATOM   7695 O O   . PRO B 1 457 ? 105.198 57.330 45.914  1.00 55.12  ? 458  PRO B O   1 
ATOM   7696 C CB  . PRO B 1 457 ? 104.643 56.634 42.867  1.00 45.14  ? 458  PRO B CB  1 
ATOM   7697 C CG  . PRO B 1 457 ? 104.937 55.825 41.672  1.00 46.02  ? 458  PRO B CG  1 
ATOM   7698 C CD  . PRO B 1 457 ? 105.078 54.408 42.176  1.00 40.72  ? 458  PRO B CD  1 
ATOM   7699 N N   . LEU B 1 458 ? 104.117 55.356 45.892  1.00 53.01  ? 459  LEU B N   1 
ATOM   7700 C CA  . LEU B 1 458 ? 103.563 55.577 47.224  1.00 53.03  ? 459  LEU B CA  1 
ATOM   7701 C C   . LEU B 1 458 ? 104.603 55.407 48.323  1.00 56.38  ? 459  LEU B C   1 
ATOM   7702 O O   . LEU B 1 458 ? 104.366 55.842 49.455  1.00 56.42  ? 459  LEU B O   1 
ATOM   7703 C CB  . LEU B 1 458 ? 102.384 54.638 47.478  1.00 52.07  ? 459  LEU B CB  1 
ATOM   7704 C CG  . LEU B 1 458 ? 101.174 54.862 46.572  1.00 65.82  ? 459  LEU B CG  1 
ATOM   7705 C CD1 . LEU B 1 458 ? 100.036 53.944 46.974  1.00 68.16  ? 459  LEU B CD1 1 
ATOM   7706 C CD2 . LEU B 1 458 ? 100.737 56.317 46.617  1.00 69.21  ? 459  LEU B CD2 1 
ATOM   7707 N N   . ASP B 1 459 ? 105.737 54.779 48.020  1.00 56.53  ? 460  ASP B N   1 
ATOM   7708 C CA  . ASP B 1 459 ? 106.831 54.664 48.974  1.00 53.74  ? 460  ASP B CA  1 
ATOM   7709 C C   . ASP B 1 459 ? 107.328 56.064 49.308  1.00 62.54  ? 460  ASP B C   1 
ATOM   7710 O O   . ASP B 1 459 ? 107.868 56.754 48.434  1.00 59.36  ? 460  ASP B O   1 
ATOM   7711 C CB  . ASP B 1 459 ? 107.960 53.802 48.400  1.00 52.96  ? 460  ASP B CB  1 
ATOM   7712 C CG  . ASP B 1 459 ? 108.980 53.384 49.449  1.00 61.20  ? 460  ASP B CG  1 
ATOM   7713 O OD1 . ASP B 1 459 ? 109.048 54.025 50.519  1.00 62.48  ? 460  ASP B OD1 1 
ATOM   7714 O OD2 . ASP B 1 459 ? 109.724 52.413 49.197  1.00 62.15  ? 460  ASP B OD2 1 
ATOM   7715 N N   . PRO B 1 460 ? 107.159 56.527 50.551  1.00 68.29  ? 461  PRO B N   1 
ATOM   7716 C CA  . PRO B 1 460 ? 107.615 57.882 50.890  1.00 73.31  ? 461  PRO B CA  1 
ATOM   7717 C C   . PRO B 1 460 ? 109.121 58.023 50.850  1.00 73.95  ? 461  PRO B C   1 
ATOM   7718 O O   . PRO B 1 460 ? 109.622 59.144 50.705  1.00 75.29  ? 461  PRO B O   1 
ATOM   7719 C CB  . PRO B 1 460 ? 107.069 58.090 52.307  1.00 74.44  ? 461  PRO B CB  1 
ATOM   7720 C CG  . PRO B 1 460 ? 107.026 56.712 52.879  1.00 74.29  ? 461  PRO B CG  1 
ATOM   7721 C CD  . PRO B 1 460 ? 106.690 55.788 51.736  1.00 66.02  ? 461  PRO B CD  1 
ATOM   7722 N N   . SER B 1 461 ? 109.855 56.915 50.960  1.00 73.41  ? 462  SER B N   1 
ATOM   7723 C CA  . SER B 1 461 ? 111.307 56.917 50.863  1.00 73.94  ? 462  SER B CA  1 
ATOM   7724 C C   . SER B 1 461 ? 111.813 57.282 49.473  1.00 75.98  ? 462  SER B C   1 
ATOM   7725 O O   . SER B 1 461 ? 113.027 57.417 49.293  1.00 80.29  ? 462  SER B O   1 
ATOM   7726 C CB  . SER B 1 461 ? 111.844 55.542 51.265  1.00 78.68  ? 462  SER B CB  1 
ATOM   7727 O OG  . SER B 1 461 ? 113.108 55.292 50.679  1.00 86.90  ? 462  SER B OG  1 
ATOM   7728 N N   . ARG B 1 462 ? 110.929 57.445 48.495  1.00 71.04  ? 463  ARG B N   1 
ATOM   7729 C CA  . ARG B 1 462 ? 111.321 57.749 47.127  1.00 73.91  ? 463  ARG B CA  1 
ATOM   7730 C C   . ARG B 1 462 ? 110.838 59.142 46.735  1.00 76.87  ? 463  ARG B C   1 
ATOM   7731 O O   . ARG B 1 462 ? 110.036 59.771 47.430  1.00 80.90  ? 463  ARG B O   1 
ATOM   7732 C CB  . ARG B 1 462 ? 110.792 56.677 46.169  1.00 69.58  ? 463  ARG B CB  1 
ATOM   7733 C CG  . ARG B 1 462 ? 111.352 55.293 46.484  1.00 71.12  ? 463  ARG B CG  1 
ATOM   7734 C CD  . ARG B 1 462 ? 110.955 54.258 45.451  1.00 75.12  ? 463  ARG B CD  1 
ATOM   7735 N NE  . ARG B 1 462 ? 112.094 53.443 45.032  1.00 79.86  ? 463  ARG B NE  1 
ATOM   7736 C CZ  . ARG B 1 462 ? 112.432 52.283 45.585  1.00 81.88  ? 463  ARG B CZ  1 
ATOM   7737 N NH1 . ARG B 1 462 ? 111.719 51.789 46.587  1.00 80.90  ? 463  ARG B NH1 1 
ATOM   7738 N NH2 . ARG B 1 462 ? 113.486 51.614 45.135  1.00 85.82  ? 463  ARG B NH2 1 
ATOM   7739 N N   . ASN B 1 463 ? 111.346 59.622 45.599  1.00 76.02  ? 464  ASN B N   1 
ATOM   7740 C CA  . ASN B 1 463 ? 111.284 61.033 45.241  1.00 77.75  ? 464  ASN B CA  1 
ATOM   7741 C C   . ASN B 1 463 ? 110.138 61.373 44.288  1.00 69.10  ? 464  ASN B C   1 
ATOM   7742 O O   . ASN B 1 463 ? 110.169 62.437 43.661  1.00 71.44  ? 464  ASN B O   1 
ATOM   7743 C CB  . ASN B 1 463 ? 112.606 61.477 44.607  1.00 90.86  ? 464  ASN B CB  1 
ATOM   7744 C CG  . ASN B 1 463 ? 113.769 61.504 45.588  1.00 108.61 ? 464  ASN B CG  1 
ATOM   7745 O OD1 . ASN B 1 463 ? 113.590 61.460 46.805  1.00 102.88 ? 464  ASN B OD1 1 
ATOM   7746 N ND2 . ASN B 1 463 ? 114.982 61.588 45.037  1.00 137.17 ? 464  ASN B ND2 1 
ATOM   7747 N N   . TYR B 1 464 ? 109.137 60.507 44.156  1.00 61.84  ? 465  TYR B N   1 
ATOM   7748 C CA  . TYR B 1 464 ? 108.074 60.771 43.191  1.00 60.61  ? 465  TYR B CA  1 
ATOM   7749 C C   . TYR B 1 464 ? 107.240 61.977 43.611  1.00 59.41  ? 465  TYR B C   1 
ATOM   7750 O O   . TYR B 1 464 ? 107.148 62.319 44.792  1.00 56.12  ? 465  TYR B O   1 
ATOM   7751 C CB  . TYR B 1 464 ? 107.170 59.548 43.028  1.00 55.80  ? 465  TYR B CB  1 
ATOM   7752 C CG  . TYR B 1 464 ? 107.836 58.359 42.373  1.00 52.25  ? 465  TYR B CG  1 
ATOM   7753 C CD1 . TYR B 1 464 ? 108.539 57.430 43.130  1.00 46.24  ? 465  TYR B CD1 1 
ATOM   7754 C CD2 . TYR B 1 464 ? 107.753 58.160 40.997  1.00 49.15  ? 465  TYR B CD2 1 
ATOM   7755 C CE1 . TYR B 1 464 ? 109.144 56.339 42.539  1.00 50.29  ? 465  TYR B CE1 1 
ATOM   7756 C CE2 . TYR B 1 464 ? 108.355 57.071 40.396  1.00 48.23  ? 465  TYR B CE2 1 
ATOM   7757 C CZ  . TYR B 1 464 ? 109.049 56.164 41.172  1.00 51.87  ? 465  TYR B CZ  1 
ATOM   7758 O OH  . TYR B 1 464 ? 109.653 55.077 40.586  1.00 50.99  ? 465  TYR B OH  1 
ATOM   7759 N N   . THR B 1 465 ? 106.626 62.626 42.625  1.00 62.20  ? 466  THR B N   1 
ATOM   7760 C CA  . THR B 1 465 ? 105.815 63.803 42.894  1.00 64.05  ? 466  THR B CA  1 
ATOM   7761 C C   . THR B 1 465 ? 104.431 63.401 43.398  1.00 66.80  ? 466  THR B C   1 
ATOM   7762 O O   . THR B 1 465 ? 104.040 62.231 43.366  1.00 67.01  ? 466  THR B O   1 
ATOM   7763 C CB  . THR B 1 465 ? 105.678 64.669 41.644  1.00 62.11  ? 466  THR B CB  1 
ATOM   7764 O OG1 . THR B 1 465 ? 104.763 64.046 40.733  1.00 58.22  ? 466  THR B OG1 1 
ATOM   7765 C CG2 . THR B 1 465 ? 107.028 64.848 40.966  1.00 59.27  ? 466  THR B CG2 1 
ATOM   7766 N N   . ALA B 1 466 ? 103.680 64.402 43.862  1.00 68.47  ? 467  ALA B N   1 
ATOM   7767 C CA  . ALA B 1 466 ? 102.346 64.146 44.397  1.00 62.76  ? 467  ALA B CA  1 
ATOM   7768 C C   . ALA B 1 466 ? 101.421 63.590 43.321  1.00 63.21  ? 467  ALA B C   1 
ATOM   7769 O O   . ALA B 1 466 ? 100.752 62.571 43.529  1.00 67.15  ? 467  ALA B O   1 
ATOM   7770 C CB  . ALA B 1 466 ? 101.767 65.426 45.000  1.00 54.92  ? 467  ALA B CB  1 
ATOM   7771 N N   . GLU B 1 467 ? 101.376 64.244 42.157  1.00 59.36  ? 468  GLU B N   1 
ATOM   7772 C CA  . GLU B 1 467 ? 100.494 63.784 41.088  1.00 64.96  ? 468  GLU B CA  1 
ATOM   7773 C C   . GLU B 1 467 ? 100.909 62.414 40.565  1.00 58.52  ? 468  GLU B C   1 
ATOM   7774 O O   . GLU B 1 467 ? 100.068 61.667 40.051  1.00 53.89  ? 468  GLU B O   1 
ATOM   7775 C CB  . GLU B 1 467 ? 100.462 64.807 39.950  1.00 73.96  ? 468  GLU B CB  1 
ATOM   7776 C CG  . GLU B 1 467 ? 101.775 65.539 39.733  1.00 92.84  ? 468  GLU B CG  1 
ATOM   7777 C CD  . GLU B 1 467 ? 101.698 66.541 38.598  1.00 107.54 ? 468  GLU B CD  1 
ATOM   7778 O OE1 . GLU B 1 467 ? 100.600 67.072 38.348  1.00 112.71 ? 468  GLU B OE1 1 
ATOM   7779 O OE2 . GLU B 1 467 ? 102.734 66.803 37.960  1.00 108.87 ? 468  GLU B OE2 1 
ATOM   7780 N N   . GLU B 1 468 ? 102.192 62.063 40.686  1.00 57.64  ? 469  GLU B N   1 
ATOM   7781 C CA  . GLU B 1 468 ? 102.618 60.723 40.296  1.00 54.92  ? 469  GLU B CA  1 
ATOM   7782 C C   . GLU B 1 468 ? 102.071 59.666 41.245  1.00 55.56  ? 469  GLU B C   1 
ATOM   7783 O O   . GLU B 1 468 ? 101.813 58.532 40.824  1.00 51.41  ? 469  GLU B O   1 
ATOM   7784 C CB  . GLU B 1 468 ? 104.143 60.651 40.227  1.00 49.20  ? 469  GLU B CB  1 
ATOM   7785 C CG  . GLU B 1 468 ? 104.711 61.234 38.942  1.00 51.73  ? 469  GLU B CG  1 
ATOM   7786 C CD  . GLU B 1 468 ? 106.225 61.231 38.911  1.00 58.10  ? 469  GLU B CD  1 
ATOM   7787 O OE1 . GLU B 1 468 ? 106.847 61.408 39.982  1.00 55.89  ? 469  GLU B OE1 1 
ATOM   7788 O OE2 . GLU B 1 468 ? 106.791 61.048 37.812  1.00 52.33  ? 469  GLU B OE2 1 
ATOM   7789 N N   . LYS B 1 469 ? 101.877 60.020 42.518  1.00 50.29  ? 470  LYS B N   1 
ATOM   7790 C CA  . LYS B 1 469 ? 101.249 59.096 43.457  1.00 49.49  ? 470  LYS B CA  1 
ATOM   7791 C C   . LYS B 1 469 ? 99.783  58.880 43.105  1.00 51.76  ? 470  LYS B C   1 
ATOM   7792 O O   . LYS B 1 469 ? 99.298  57.742 43.095  1.00 54.54  ? 470  LYS B O   1 
ATOM   7793 C CB  . LYS B 1 469 ? 101.395 59.619 44.888  1.00 48.48  ? 470  LYS B CB  1 
ATOM   7794 C CG  . LYS B 1 469 ? 102.832 59.669 45.380  1.00 52.83  ? 470  LYS B CG  1 
ATOM   7795 C CD  . LYS B 1 469 ? 102.940 60.356 46.735  1.00 60.69  ? 470  LYS B CD  1 
ATOM   7796 C CE  . LYS B 1 469 ? 104.385 60.418 47.208  1.00 66.59  ? 470  LYS B CE  1 
ATOM   7797 N NZ  . LYS B 1 469 ? 104.531 61.235 48.445  1.00 75.13  ? 470  LYS B NZ  1 
ATOM   7798 N N   . ILE B 1 470 ? 99.057  59.965 42.820  1.00 51.16  ? 471  ILE B N   1 
ATOM   7799 C CA  . ILE B 1 470 ? 97.679  59.833 42.354  1.00 59.07  ? 471  ILE B CA  1 
ATOM   7800 C C   . ILE B 1 470 ? 97.630  59.001 41.081  1.00 54.09  ? 471  ILE B C   1 
ATOM   7801 O O   . ILE B 1 470 ? 96.750  58.149 40.908  1.00 52.59  ? 471  ILE B O   1 
ATOM   7802 C CB  . ILE B 1 470 ? 97.047  61.222 42.139  1.00 60.81  ? 471  ILE B CB  1 
ATOM   7803 C CG1 . ILE B 1 470 ? 96.938  61.974 43.463  1.00 63.54  ? 471  ILE B CG1 1 
ATOM   7804 C CG2 . ILE B 1 470 ? 95.684  61.097 41.472  1.00 60.55  ? 471  ILE B CG2 1 
ATOM   7805 C CD1 . ILE B 1 470 ? 97.666  63.292 43.466  1.00 70.90  ? 471  ILE B CD1 1 
ATOM   7806 N N   . PHE B 1 471 ? 98.582  59.232 40.174  1.00 47.33  ? 472  PHE B N   1 
ATOM   7807 C CA  . PHE B 1 471 ? 98.617  58.489 38.918  1.00 46.12  ? 472  PHE B CA  1 
ATOM   7808 C C   . PHE B 1 471 ? 98.815  56.999 39.165  1.00 50.33  ? 472  PHE B C   1 
ATOM   7809 O O   . PHE B 1 471 ? 98.150  56.164 38.540  1.00 48.73  ? 472  PHE B O   1 
ATOM   7810 C CB  . PHE B 1 471 ? 99.721  59.043 38.019  1.00 39.80  ? 472  PHE B CB  1 
ATOM   7811 C CG  . PHE B 1 471 ? 99.846  58.338 36.695  1.00 48.87  ? 472  PHE B CG  1 
ATOM   7812 C CD1 . PHE B 1 471 ? 101.085 57.923 36.228  1.00 49.54  ? 472  PHE B CD1 1 
ATOM   7813 C CD2 . PHE B 1 471 ? 98.727  58.084 35.920  1.00 46.94  ? 472  PHE B CD2 1 
ATOM   7814 C CE1 . PHE B 1 471 ? 101.199 57.274 34.996  1.00 46.87  ? 472  PHE B CE1 1 
ATOM   7815 C CE2 . PHE B 1 471 ? 98.839  57.433 34.698  1.00 49.84  ? 472  PHE B CE2 1 
ATOM   7816 C CZ  . PHE B 1 471 ? 100.075 57.031 34.238  1.00 44.70  ? 472  PHE B CZ  1 
ATOM   7817 N N   . ALA B 1 472 ? 99.720  56.647 40.082  1.00 43.12  ? 473  ALA B N   1 
ATOM   7818 C CA  . ALA B 1 472 ? 99.911  55.243 40.432  1.00 48.89  ? 473  ALA B CA  1 
ATOM   7819 C C   . ALA B 1 472 ? 98.635  54.645 41.009  1.00 49.67  ? 473  ALA B C   1 
ATOM   7820 O O   . ALA B 1 472 ? 98.295  53.492 40.722  1.00 48.16  ? 473  ALA B O   1 
ATOM   7821 C CB  . ALA B 1 472 ? 101.067 55.101 41.424  1.00 45.83  ? 473  ALA B CB  1 
ATOM   7822 N N   . GLN B 1 473 ? 97.914  55.419 41.824  1.00 45.80  ? 474  GLN B N   1 
ATOM   7823 C CA  . GLN B 1 473 ? 96.672  54.924 42.406  1.00 43.84  ? 474  GLN B CA  1 
ATOM   7824 C C   . GLN B 1 473 ? 95.615  54.681 41.336  1.00 44.75  ? 474  GLN B C   1 
ATOM   7825 O O   . GLN B 1 473 ? 94.829  53.732 41.440  1.00 48.63  ? 474  GLN B O   1 
ATOM   7826 C CB  . GLN B 1 473 ? 96.168  55.906 43.467  1.00 48.35  ? 474  GLN B CB  1 
ATOM   7827 C CG  . GLN B 1 473 ? 97.036  55.937 44.723  1.00 47.96  ? 474  GLN B CG  1 
ATOM   7828 C CD  . GLN B 1 473 ? 96.610  57.003 45.716  1.00 58.38  ? 474  GLN B CD  1 
ATOM   7829 O OE1 . GLN B 1 473 ? 96.283  58.130 45.338  1.00 58.18  ? 474  GLN B OE1 1 
ATOM   7830 N NE2 . GLN B 1 473 ? 96.615  56.651 46.998  1.00 53.72  ? 474  GLN B NE2 1 
ATOM   7831 N N   . ARG B 1 474 ? 95.582  55.524 40.299  1.00 46.79  ? 475  ARG B N   1 
ATOM   7832 C CA  . ARG B 1 474 ? 94.699  55.272 39.163  1.00 49.48  ? 475  ARG B CA  1 
ATOM   7833 C C   . ARG B 1 474 ? 95.031  53.945 38.493  1.00 44.33  ? 475  ARG B C   1 
ATOM   7834 O O   . ARG B 1 474 ? 94.137  53.145 38.190  1.00 50.07  ? 475  ARG B O   1 
ATOM   7835 C CB  . ARG B 1 474 ? 94.804  56.406 38.141  1.00 56.89  ? 475  ARG B CB  1 
ATOM   7836 C CG  . ARG B 1 474 ? 94.114  57.702 38.517  1.00 63.64  ? 475  ARG B CG  1 
ATOM   7837 C CD  . ARG B 1 474 ? 94.275  58.700 37.381  1.00 58.51  ? 475  ARG B CD  1 
ATOM   7838 N NE  . ARG B 1 474 ? 93.803  58.132 36.121  1.00 55.21  ? 475  ARG B NE  1 
ATOM   7839 C CZ  . ARG B 1 474 ? 94.313  58.425 34.928  1.00 53.34  ? 475  ARG B CZ  1 
ATOM   7840 N NH1 . ARG B 1 474 ? 95.324  59.278 34.827  1.00 51.10  ? 475  ARG B NH1 1 
ATOM   7841 N NH2 . ARG B 1 474 ? 93.818  57.855 33.835  1.00 46.64  ? 475  ARG B NH2 1 
ATOM   7842 N N   . LEU B 1 475 ? 96.319  53.703 38.234  1.00 42.47  ? 476  LEU B N   1 
ATOM   7843 C CA  . LEU B 1 475 ? 96.710  52.504 37.499  1.00 46.80  ? 476  LEU B CA  1 
ATOM   7844 C C   . LEU B 1 475 ? 96.449  51.248 38.317  1.00 46.82  ? 476  LEU B C   1 
ATOM   7845 O O   . LEU B 1 475 ? 95.961  50.244 37.785  1.00 44.38  ? 476  LEU B O   1 
ATOM   7846 C CB  . LEU B 1 475 ? 98.181  52.589 37.095  1.00 49.20  ? 476  LEU B CB  1 
ATOM   7847 C CG  . LEU B 1 475 ? 98.526  53.659 36.056  1.00 59.51  ? 476  LEU B CG  1 
ATOM   7848 C CD1 . LEU B 1 475 ? 99.967  53.511 35.599  1.00 65.37  ? 476  LEU B CD1 1 
ATOM   7849 C CD2 . LEU B 1 475 ? 97.576  53.591 34.868  1.00 55.75  ? 476  LEU B CD2 1 
ATOM   7850 N N   . MET B 1 476 ? 96.768  51.286 39.612  1.00 47.50  ? 477  MET B N   1 
ATOM   7851 C CA  . MET B 1 476 ? 96.431  50.168 40.484  1.00 43.71  ? 477  MET B CA  1 
ATOM   7852 C C   . MET B 1 476 ? 94.935  49.885 40.450  1.00 40.11  ? 477  MET B C   1 
ATOM   7853 O O   . MET B 1 476 ? 94.515  48.723 40.446  1.00 42.83  ? 477  MET B O   1 
ATOM   7854 C CB  . MET B 1 476 ? 96.898  50.456 41.913  1.00 44.30  ? 477  MET B CB  1 
ATOM   7855 C CG  . MET B 1 476 ? 98.411  50.537 42.068  1.00 46.11  ? 477  MET B CG  1 
ATOM   7856 S SD  . MET B 1 476 ? 98.956  50.396 43.785  1.00 53.83  ? 477  MET B SD  1 
ATOM   7857 C CE  . MET B 1 476 ? 98.263  51.893 44.482  1.00 56.07  ? 477  MET B CE  1 
ATOM   7858 N N   . ARG B 1 477 ? 94.116  50.940 40.397  1.00 40.53  ? 478  ARG B N   1 
ATOM   7859 C CA  . ARG B 1 477 ? 92.670  50.756 40.329  1.00 41.89  ? 478  ARG B CA  1 
ATOM   7860 C C   . ARG B 1 477 ? 92.249  50.136 39.000  1.00 46.28  ? 478  ARG B C   1 
ATOM   7861 O O   . ARG B 1 477 ? 91.398  49.238 38.973  1.00 47.28  ? 478  ARG B O   1 
ATOM   7862 C CB  . ARG B 1 477 ? 91.965  52.094 40.552  1.00 47.54  ? 478  ARG B CB  1 
ATOM   7863 C CG  . ARG B 1 477 ? 90.445  52.023 40.507  1.00 51.38  ? 478  ARG B CG  1 
ATOM   7864 C CD  . ARG B 1 477 ? 89.894  51.068 41.558  1.00 52.72  ? 478  ARG B CD  1 
ATOM   7865 N NE  . ARG B 1 477 ? 90.290  51.445 42.911  1.00 56.88  ? 478  ARG B NE  1 
ATOM   7866 C CZ  . ARG B 1 477 ? 89.645  52.335 43.659  1.00 56.13  ? 478  ARG B CZ  1 
ATOM   7867 N NH1 . ARG B 1 477 ? 88.571  52.950 43.187  1.00 49.93  ? 478  ARG B NH1 1 
ATOM   7868 N NH2 . ARG B 1 477 ? 90.076  52.611 44.881  1.00 54.77  ? 478  ARG B NH2 1 
ATOM   7869 N N   . TYR B 1 478 ? 92.823  50.605 37.886  1.00 43.53  ? 479  TYR B N   1 
ATOM   7870 C CA  . TYR B 1 478 ? 92.538  49.990 36.590  1.00 40.25  ? 479  TYR B CA  1 
ATOM   7871 C C   . TYR B 1 478 ? 92.865  48.501 36.611  1.00 41.41  ? 479  TYR B C   1 
ATOM   7872 O O   . TYR B 1 478 ? 92.026  47.661 36.265  1.00 44.22  ? 479  TYR B O   1 
ATOM   7873 C CB  . TYR B 1 478 ? 93.337  50.683 35.481  1.00 38.91  ? 479  TYR B CB  1 
ATOM   7874 C CG  . TYR B 1 478 ? 92.886  52.085 35.116  1.00 42.60  ? 479  TYR B CG  1 
ATOM   7875 C CD1 . TYR B 1 478 ? 91.543  52.438 35.134  1.00 44.43  ? 479  TYR B CD1 1 
ATOM   7876 C CD2 . TYR B 1 478 ? 93.812  53.053 34.744  1.00 44.02  ? 479  TYR B CD2 1 
ATOM   7877 C CE1 . TYR B 1 478 ? 91.135  53.720 34.793  1.00 44.82  ? 479  TYR B CE1 1 
ATOM   7878 C CE2 . TYR B 1 478 ? 93.414  54.336 34.401  1.00 44.86  ? 479  TYR B CE2 1 
ATOM   7879 C CZ  . TYR B 1 478 ? 92.076  54.664 34.427  1.00 47.73  ? 479  TYR B CZ  1 
ATOM   7880 O OH  . TYR B 1 478 ? 91.678  55.940 34.090  1.00 51.00  ? 479  TYR B OH  1 
ATOM   7881 N N   . TRP B 1 479 ? 94.088  48.159 37.027  1.00 40.01  ? 480  TRP B N   1 
ATOM   7882 C CA  . TRP B 1 479 ? 94.533  46.769 37.010  1.00 37.77  ? 480  TRP B CA  1 
ATOM   7883 C C   . TRP B 1 479 ? 93.683  45.897 37.927  1.00 41.92  ? 480  TRP B C   1 
ATOM   7884 O O   . TRP B 1 479 ? 93.320  44.772 37.564  1.00 45.03  ? 480  TRP B O   1 
ATOM   7885 C CB  . TRP B 1 479 ? 96.008  46.695 37.414  1.00 37.98  ? 480  TRP B CB  1 
ATOM   7886 C CG  . TRP B 1 479 ? 96.970  46.546 36.264  1.00 40.94  ? 480  TRP B CG  1 
ATOM   7887 C CD1 . TRP B 1 479 ? 97.842  45.517 36.060  1.00 40.33  ? 480  TRP B CD1 1 
ATOM   7888 C CD2 . TRP B 1 479 ? 97.156  47.452 35.164  1.00 38.74  ? 480  TRP B CD2 1 
ATOM   7889 N NE1 . TRP B 1 479 ? 98.560  45.724 34.905  1.00 39.45  ? 480  TRP B NE1 1 
ATOM   7890 C CE2 . TRP B 1 479 ? 98.157  46.903 34.336  1.00 41.37  ? 480  TRP B CE2 1 
ATOM   7891 C CE3 . TRP B 1 479 ? 96.573  48.670 34.800  1.00 39.60  ? 480  TRP B CE3 1 
ATOM   7892 C CZ2 . TRP B 1 479 ? 98.588  47.530 33.162  1.00 41.82  ? 480  TRP B CZ2 1 
ATOM   7893 C CZ3 . TRP B 1 479 ? 97.004  49.294 33.636  1.00 44.78  ? 480  TRP B CZ3 1 
ATOM   7894 C CH2 . TRP B 1 479 ? 98.002  48.721 32.832  1.00 42.84  ? 480  TRP B CH2 1 
ATOM   7895 N N   . ALA B 1 480 ? 93.352  46.398 39.119  1.00 36.69  ? 481  ALA B N   1 
ATOM   7896 C CA  . ALA B 1 480 ? 92.579  45.594 40.060  1.00 38.04  ? 481  ALA B CA  1 
ATOM   7897 C C   . ALA B 1 480 ? 91.122  45.480 39.629  1.00 41.07  ? 481  ALA B C   1 
ATOM   7898 O O   . ALA B 1 480 ? 90.494  44.432 39.826  1.00 44.49  ? 481  ALA B O   1 
ATOM   7899 C CB  . ALA B 1 480 ? 92.683  46.183 41.467  1.00 35.96  ? 481  ALA B CB  1 
ATOM   7900 N N   . ASN B 1 481 ? 90.560  46.548 39.054  1.00 38.38  ? 482  ASN B N   1 
ATOM   7901 C CA  . ASN B 1 481 ? 89.232  46.449 38.455  1.00 45.42  ? 482  ASN B CA  1 
ATOM   7902 C C   . ASN B 1 481 ? 89.188  45.324 37.433  1.00 46.31  ? 482  ASN B C   1 
ATOM   7903 O O   . ASN B 1 481 ? 88.270  44.495 37.440  1.00 41.12  ? 482  ASN B O   1 
ATOM   7904 C CB  . ASN B 1 481 ? 88.844  47.773 37.795  1.00 49.48  ? 482  ASN B CB  1 
ATOM   7905 C CG  . ASN B 1 481 ? 88.288  48.775 38.780  1.00 48.37  ? 482  ASN B CG  1 
ATOM   7906 O OD1 . ASN B 1 481 ? 88.191  48.503 39.976  1.00 45.34  ? 482  ASN B OD1 1 
ATOM   7907 N ND2 . ASN B 1 481 ? 87.921  49.946 38.281  1.00 46.19  ? 482  ASN B ND2 1 
ATOM   7908 N N   . PHE B 1 482 ? 90.188  45.280 36.546  1.00 39.34  ? 483  PHE B N   1 
ATOM   7909 C CA  . PHE B 1 482 ? 90.243  44.230 35.535  1.00 41.93  ? 483  PHE B CA  1 
ATOM   7910 C C   . PHE B 1 482 ? 90.346  42.855 36.177  1.00 41.98  ? 483  PHE B C   1 
ATOM   7911 O O   . PHE B 1 482 ? 89.670  41.911 35.753  1.00 46.04  ? 483  PHE B O   1 
ATOM   7912 C CB  . PHE B 1 482 ? 91.422  44.467 34.588  1.00 39.46  ? 483  PHE B CB  1 
ATOM   7913 C CG  . PHE B 1 482 ? 91.596  43.386 33.558  1.00 39.20  ? 483  PHE B CG  1 
ATOM   7914 C CD1 . PHE B 1 482 ? 90.808  43.363 32.417  1.00 42.57  ? 483  PHE B CD1 1 
ATOM   7915 C CD2 . PHE B 1 482 ? 92.544  42.389 33.732  1.00 36.50  ? 483  PHE B CD2 1 
ATOM   7916 C CE1 . PHE B 1 482 ? 90.963  42.365 31.465  1.00 38.58  ? 483  PHE B CE1 1 
ATOM   7917 C CE2 . PHE B 1 482 ? 92.705  41.389 32.785  1.00 38.01  ? 483  PHE B CE2 1 
ATOM   7918 C CZ  . PHE B 1 482 ? 91.911  41.376 31.651  1.00 36.20  ? 483  PHE B CZ  1 
ATOM   7919 N N   . ALA B 1 483 ? 91.191  42.722 37.201  1.00 42.01  ? 484  ALA B N   1 
ATOM   7920 C CA  . ALA B 1 483 ? 91.320  41.441 37.885  1.00 44.94  ? 484  ALA B CA  1 
ATOM   7921 C C   . ALA B 1 483 ? 89.998  41.013 38.508  1.00 46.29  ? 484  ALA B C   1 
ATOM   7922 O O   . ALA B 1 483 ? 89.654  39.825 38.502  1.00 48.01  ? 484  ALA B O   1 
ATOM   7923 C CB  . ALA B 1 483 ? 92.414  41.523 38.950  1.00 38.13  ? 484  ALA B CB  1 
ATOM   7924 N N   . ARG B 1 484 ? 89.233  41.970 39.033  1.00 43.84  ? 485  ARG B N   1 
ATOM   7925 C CA  . ARG B 1 484 ? 87.992  41.632 39.721  1.00 41.30  ? 485  ARG B CA  1 
ATOM   7926 C C   . ARG B 1 484 ? 86.853  41.342 38.749  1.00 42.64  ? 485  ARG B C   1 
ATOM   7927 O O   . ARG B 1 484 ? 86.023  40.467 39.017  1.00 46.36  ? 485  ARG B O   1 
ATOM   7928 C CB  . ARG B 1 484 ? 87.597  42.761 40.674  1.00 40.63  ? 485  ARG B CB  1 
ATOM   7929 C CG  . ARG B 1 484 ? 88.394  42.790 41.978  1.00 41.18  ? 485  ARG B CG  1 
ATOM   7930 C CD  . ARG B 1 484 ? 87.887  43.880 42.914  1.00 39.27  ? 485  ARG B CD  1 
ATOM   7931 N NE  . ARG B 1 484 ? 88.159  45.219 42.396  1.00 47.29  ? 485  ARG B NE  1 
ATOM   7932 C CZ  . ARG B 1 484 ? 89.148  46.001 42.823  1.00 49.68  ? 485  ARG B CZ  1 
ATOM   7933 N NH1 . ARG B 1 484 ? 89.961  45.584 43.788  1.00 39.46  ? 485  ARG B NH1 1 
ATOM   7934 N NH2 . ARG B 1 484 ? 89.319  47.204 42.292  1.00 45.87  ? 485  ARG B NH2 1 
ATOM   7935 N N   . THR B 1 485 ? 86.786  42.060 37.622  1.00 37.90  ? 486  THR B N   1 
ATOM   7936 C CA  . THR B 1 485 ? 85.606  42.019 36.765  1.00 45.13  ? 486  THR B CA  1 
ATOM   7937 C C   . THR B 1 485 ? 85.884  41.755 35.292  1.00 44.34  ? 486  THR B C   1 
ATOM   7938 O O   . THR B 1 485 ? 84.924  41.562 34.538  1.00 52.86  ? 486  THR B O   1 
ATOM   7939 C CB  . THR B 1 485 ? 84.823  43.340 36.855  1.00 46.66  ? 486  THR B CB  1 
ATOM   7940 O OG1 . THR B 1 485 ? 85.589  44.391 36.253  1.00 46.90  ? 486  THR B OG1 1 
ATOM   7941 C CG2 . THR B 1 485 ? 84.517  43.700 38.304  1.00 48.09  ? 486  THR B CG2 1 
ATOM   7942 N N   . GLY B 1 486 ? 87.138  41.748 34.852  1.00 42.44  ? 487  GLY B N   1 
ATOM   7943 C CA  . GLY B 1 486 ? 87.414  41.720 33.431  1.00 43.96  ? 487  GLY B CA  1 
ATOM   7944 C C   . GLY B 1 486 ? 87.206  43.040 32.731  1.00 44.85  ? 487  GLY B C   1 
ATOM   7945 O O   . GLY B 1 486 ? 87.163  43.075 31.496  1.00 44.36  ? 487  GLY B O   1 
ATOM   7946 N N   . ASP B 1 487 ? 87.079  44.127 33.485  1.00 48.77  ? 488  ASP B N   1 
ATOM   7947 C CA  . ASP B 1 487 ? 86.817  45.462 32.971  1.00 48.33  ? 488  ASP B CA  1 
ATOM   7948 C C   . ASP B 1 487 ? 87.568  46.457 33.848  1.00 49.08  ? 488  ASP B C   1 
ATOM   7949 O O   . ASP B 1 487 ? 87.278  46.564 35.047  1.00 50.81  ? 488  ASP B O   1 
ATOM   7950 C CB  . ASP B 1 487 ? 85.312  45.744 32.971  1.00 48.73  ? 488  ASP B CB  1 
ATOM   7951 C CG  . ASP B 1 487 ? 84.951  47.058 32.296  1.00 51.04  ? 488  ASP B CG  1 
ATOM   7952 O OD1 . ASP B 1 487 ? 83.756  47.248 31.988  1.00 59.40  ? 488  ASP B OD1 1 
ATOM   7953 O OD2 . ASP B 1 487 ? 85.845  47.897 32.070  1.00 51.33  ? 488  ASP B OD2 1 
ATOM   7954 N N   . PRO B 1 488 ? 88.539  47.194 33.300  1.00 45.43  ? 489  PRO B N   1 
ATOM   7955 C CA  . PRO B 1 488 ? 89.282  48.158 34.128  1.00 40.69  ? 489  PRO B CA  1 
ATOM   7956 C C   . PRO B 1 488 ? 88.473  49.386 34.508  1.00 49.81  ? 489  PRO B C   1 
ATOM   7957 O O   . PRO B 1 488 ? 88.883  50.113 35.422  1.00 54.74  ? 489  PRO B O   1 
ATOM   7958 C CB  . PRO B 1 488 ? 90.468  48.540 33.237  1.00 39.32  ? 489  PRO B CB  1 
ATOM   7959 C CG  . PRO B 1 488 ? 89.930  48.377 31.836  1.00 42.09  ? 489  PRO B CG  1 
ATOM   7960 C CD  . PRO B 1 488 ? 88.993  47.195 31.897  1.00 42.88  ? 489  PRO B CD  1 
ATOM   7961 N N   . ASN B 1 489 ? 87.342  49.631 33.853  1.00 49.55  ? 490  ASN B N   1 
ATOM   7962 C CA  . ASN B 1 489 ? 86.627  50.886 34.036  1.00 51.83  ? 490  ASN B CA  1 
ATOM   7963 C C   . ASN B 1 489 ? 86.048  51.000 35.438  1.00 61.58  ? 490  ASN B C   1 
ATOM   7964 O O   . ASN B 1 489 ? 85.570  50.020 36.016  1.00 54.77  ? 490  ASN B O   1 
ATOM   7965 C CB  . ASN B 1 489 ? 85.508  51.016 33.008  1.00 46.52  ? 490  ASN B CB  1 
ATOM   7966 C CG  . ASN B 1 489 ? 86.027  51.349 31.631  1.00 48.32  ? 490  ASN B CG  1 
ATOM   7967 O OD1 . ASN B 1 489 ? 86.359  52.499 31.345  1.00 52.90  ? 490  ASN B OD1 1 
ATOM   7968 N ND2 . ASN B 1 489 ? 86.106  50.344 30.770  1.00 37.49  ? 490  ASN B ND2 1 
ATOM   7969 N N   . GLU B 1 490 ? 86.092  52.217 35.979  1.00 75.51  ? 491  GLU B N   1 
ATOM   7970 C CA  . GLU B 1 490 ? 85.430  52.550 37.233  1.00 91.46  ? 491  GLU B CA  1 
ATOM   7971 C C   . GLU B 1 490 ? 84.036  53.093 36.950  1.00 107.73 ? 491  GLU B C   1 
ATOM   7972 O O   . GLU B 1 490 ? 83.888  54.000 36.122  1.00 110.36 ? 491  GLU B O   1 
ATOM   7973 C CB  . GLU B 1 490 ? 86.229  53.579 38.019  1.00 93.16  ? 491  GLU B CB  1 
ATOM   7974 C CG  . GLU B 1 490 ? 87.282  52.978 38.926  1.00 94.64  ? 491  GLU B CG  1 
ATOM   7975 C CD  . GLU B 1 490 ? 86.803  52.822 40.353  1.00 94.99  ? 491  GLU B CD  1 
ATOM   7976 O OE1 . GLU B 1 490 ? 87.281  53.577 41.222  1.00 101.17 ? 491  GLU B OE1 1 
ATOM   7977 O OE2 . GLU B 1 490 ? 85.944  51.952 40.605  1.00 95.34  ? 491  GLU B OE2 1 
ATOM   7978 N N   . PRO B 1 491 ? 82.995  52.551 37.594  1.00 116.82 ? 492  PRO B N   1 
ATOM   7979 C CA  . PRO B 1 491 ? 81.617  53.028 37.472  1.00 122.80 ? 492  PRO B CA  1 
ATOM   7980 C C   . PRO B 1 491 ? 81.192  53.894 38.656  1.00 120.60 ? 492  PRO B C   1 
ATOM   7981 O O   . PRO B 1 491 ? 81.089  55.111 38.506  1.00 119.40 ? 492  PRO B O   1 
ATOM   7982 C CB  . PRO B 1 491 ? 80.818  51.728 37.433  1.00 123.95 ? 492  PRO B CB  1 
ATOM   7983 C CG  . PRO B 1 491 ? 81.603  50.810 38.334  1.00 121.76 ? 492  PRO B CG  1 
ATOM   7984 C CD  . PRO B 1 491 ? 83.056  51.250 38.280  1.00 117.92 ? 492  PRO B CD  1 
ATOM   7985 N N   . ALA B 1 496 ? 83.876  60.226 32.369  1.00 119.27 ? 497  ALA B N   1 
ATOM   7986 C CA  . ALA B 1 496 ? 84.956  59.818 33.264  1.00 112.51 ? 497  ALA B CA  1 
ATOM   7987 C C   . ALA B 1 496 ? 86.359  60.143 32.716  1.00 110.14 ? 497  ALA B C   1 
ATOM   7988 O O   . ALA B 1 496 ? 87.170  60.724 33.436  1.00 111.46 ? 497  ALA B O   1 
ATOM   7989 C CB  . ALA B 1 496 ? 84.838  58.326 33.587  1.00 104.98 ? 497  ALA B CB  1 
ATOM   7990 N N   . PRO B 1 497 ? 86.666  59.777 31.453  1.00 108.95 ? 498  PRO B N   1 
ATOM   7991 C CA  . PRO B 1 497 ? 85.924  59.055 30.414  1.00 103.22 ? 498  PRO B CA  1 
ATOM   7992 C C   . PRO B 1 497 ? 86.161  57.549 30.481  1.00 85.13  ? 498  PRO B C   1 
ATOM   7993 O O   . PRO B 1 497 ? 86.956  57.083 31.298  1.00 82.38  ? 498  PRO B O   1 
ATOM   7994 C CB  . PRO B 1 497 ? 86.475  59.648 29.113  1.00 106.20 ? 498  PRO B CB  1 
ATOM   7995 C CG  . PRO B 1 497 ? 87.823  60.238 29.478  1.00 109.40 ? 498  PRO B CG  1 
ATOM   7996 C CD  . PRO B 1 497 ? 88.007  60.144 30.972  1.00 109.40 ? 498  PRO B CD  1 
ATOM   7997 N N   . GLN B 1 498 ? 85.473  56.801 29.626  1.00 72.43  ? 499  GLN B N   1 
ATOM   7998 C CA  . GLN B 1 498 ? 85.496  55.350 29.685  1.00 63.52  ? 499  GLN B CA  1 
ATOM   7999 C C   . GLN B 1 498 ? 86.596  54.775 28.801  1.00 64.89  ? 499  GLN B C   1 
ATOM   8000 O O   . GLN B 1 498 ? 86.931  55.320 27.745  1.00 63.50  ? 499  GLN B O   1 
ATOM   8001 C CB  . GLN B 1 498 ? 84.141  54.777 29.269  1.00 62.61  ? 499  GLN B CB  1 
ATOM   8002 C CG  . GLN B 1 498 ? 83.033  55.040 30.273  1.00 66.13  ? 499  GLN B CG  1 
ATOM   8003 C CD  . GLN B 1 498 ? 83.300  54.382 31.613  1.00 72.87  ? 499  GLN B CD  1 
ATOM   8004 O OE1 . GLN B 1 498 ? 83.697  55.041 32.574  1.00 79.82  ? 499  GLN B OE1 1 
ATOM   8005 N NE2 . GLN B 1 498 ? 83.087  53.073 31.681  1.00 70.63  ? 499  GLN B NE2 1 
ATOM   8006 N N   . TRP B 1 499 ? 87.156  53.655 29.257  1.00 53.03  ? 500  TRP B N   1 
ATOM   8007 C CA  . TRP B 1 499 ? 88.154  52.911 28.506  1.00 47.00  ? 500  TRP B CA  1 
ATOM   8008 C C   . TRP B 1 499 ? 87.424  51.928 27.600  1.00 48.70  ? 500  TRP B C   1 
ATOM   8009 O O   . TRP B 1 499 ? 86.864  50.941 28.103  1.00 49.36  ? 500  TRP B O   1 
ATOM   8010 C CB  . TRP B 1 499 ? 89.088  52.180 29.464  1.00 42.02  ? 500  TRP B CB  1 
ATOM   8011 C CG  . TRP B 1 499 ? 90.275  51.490 28.855  1.00 43.95  ? 500  TRP B CG  1 
ATOM   8012 C CD1 . TRP B 1 499 ? 90.433  51.092 27.555  1.00 44.60  ? 500  TRP B CD1 1 
ATOM   8013 C CD2 . TRP B 1 499 ? 91.476  51.116 29.537  1.00 43.44  ? 500  TRP B CD2 1 
ATOM   8014 N NE1 . TRP B 1 499 ? 91.659  50.491 27.391  1.00 40.38  ? 500  TRP B NE1 1 
ATOM   8015 C CE2 . TRP B 1 499 ? 92.317  50.491 28.594  1.00 41.70  ? 500  TRP B CE2 1 
ATOM   8016 C CE3 . TRP B 1 499 ? 91.923  51.249 30.857  1.00 40.46  ? 500  TRP B CE3 1 
ATOM   8017 C CZ2 . TRP B 1 499 ? 93.578  50.004 28.928  1.00 41.71  ? 500  TRP B CZ2 1 
ATOM   8018 C CZ3 . TRP B 1 499 ? 93.173  50.762 31.187  1.00 41.86  ? 500  TRP B CZ3 1 
ATOM   8019 C CH2 . TRP B 1 499 ? 93.987  50.148 30.227  1.00 38.86  ? 500  TRP B CH2 1 
ATOM   8020 N N   . PRO B 1 500 ? 87.384  52.149 26.289  1.00 44.15  ? 501  PRO B N   1 
ATOM   8021 C CA  . PRO B 1 500 ? 86.617  51.265 25.409  1.00 45.37  ? 501  PRO B CA  1 
ATOM   8022 C C   . PRO B 1 500 ? 87.415  50.026 25.049  1.00 48.82  ? 501  PRO B C   1 
ATOM   8023 O O   . PRO B 1 500 ? 88.655  50.057 25.028  1.00 47.83  ? 501  PRO B O   1 
ATOM   8024 C CB  . PRO B 1 500 ? 86.364  52.140 24.173  1.00 45.71  ? 501  PRO B CB  1 
ATOM   8025 C CG  . PRO B 1 500 ? 87.583  53.002 24.106  1.00 47.83  ? 501  PRO B CG  1 
ATOM   8026 C CD  . PRO B 1 500 ? 87.995  53.267 25.547  1.00 46.82  ? 501  PRO B CD  1 
ATOM   8027 N N   . PRO B 1 501 ? 86.740  48.914 24.763  1.00 50.10  ? 502  PRO B N   1 
ATOM   8028 C CA  . PRO B 1 501 ? 87.454  47.718 24.308  1.00 48.50  ? 502  PRO B CA  1 
ATOM   8029 C C   . PRO B 1 501 ? 88.147  47.945 22.971  1.00 51.83  ? 502  PRO B C   1 
ATOM   8030 O O   . PRO B 1 501 ? 87.701  48.736 22.136  1.00 48.41  ? 502  PRO B O   1 
ATOM   8031 C CB  . PRO B 1 501 ? 86.345  46.666 24.186  1.00 48.50  ? 502  PRO B CB  1 
ATOM   8032 C CG  . PRO B 1 501 ? 85.266  47.148 25.105  1.00 51.39  ? 502  PRO B CG  1 
ATOM   8033 C CD  . PRO B 1 501 ? 85.315  48.646 25.023  1.00 48.54  ? 502  PRO B CD  1 
ATOM   8034 N N   . TYR B 1 502 ? 89.256  47.236 22.783  1.00 48.66  ? 503  TYR B N   1 
ATOM   8035 C CA  . TYR B 1 502 ? 89.966  47.227 21.512  1.00 46.68  ? 503  TYR B CA  1 
ATOM   8036 C C   . TYR B 1 502 ? 89.308  46.221 20.575  1.00 47.48  ? 503  TYR B C   1 
ATOM   8037 O O   . TYR B 1 502 ? 89.037  45.083 20.971  1.00 48.21  ? 503  TYR B O   1 
ATOM   8038 C CB  . TYR B 1 502 ? 91.438  46.874 21.738  1.00 41.93  ? 503  TYR B CB  1 
ATOM   8039 C CG  . TYR B 1 502 ? 92.308  46.840 20.497  1.00 42.96  ? 503  TYR B CG  1 
ATOM   8040 C CD1 . TYR B 1 502 ? 92.402  45.691 19.719  1.00 45.62  ? 503  TYR B CD1 1 
ATOM   8041 C CD2 . TYR B 1 502 ? 93.060  47.946 20.121  1.00 40.88  ? 503  TYR B CD2 1 
ATOM   8042 C CE1 . TYR B 1 502 ? 93.202  45.652 18.590  1.00 39.32  ? 503  TYR B CE1 1 
ATOM   8043 C CE2 . TYR B 1 502 ? 93.865  47.915 18.994  1.00 45.91  ? 503  TYR B CE2 1 
ATOM   8044 C CZ  . TYR B 1 502 ? 93.932  46.765 18.233  1.00 41.89  ? 503  TYR B CZ  1 
ATOM   8045 O OH  . TYR B 1 502 ? 94.729  46.729 17.111  1.00 52.45  ? 503  TYR B OH  1 
ATOM   8046 N N   . THR B 1 503 ? 89.038  46.645 19.342  1.00 44.31  ? 504  THR B N   1 
ATOM   8047 C CA  . THR B 1 503 ? 88.467  45.778 18.319  1.00 46.91  ? 504  THR B CA  1 
ATOM   8048 C C   . THR B 1 503 ? 89.332  45.839 17.068  1.00 52.37  ? 504  THR B C   1 
ATOM   8049 O O   . THR B 1 503 ? 90.070  46.801 16.846  1.00 54.16  ? 504  THR B O   1 
ATOM   8050 C CB  . THR B 1 503 ? 87.021  46.171 17.971  1.00 53.61  ? 504  THR B CB  1 
ATOM   8051 O OG1 . THR B 1 503 ? 86.982  47.536 17.533  1.00 55.85  ? 504  THR B OG1 1 
ATOM   8052 C CG2 . THR B 1 503 ? 86.111  46.004 19.181  1.00 53.24  ? 504  THR B CG2 1 
ATOM   8053 N N   . ALA B 1 504 ? 89.231  44.791 16.245  1.00 57.51  ? 505  ALA B N   1 
ATOM   8054 C CA  . ALA B 1 504 ? 90.029  44.733 15.023  1.00 61.46  ? 505  ALA B CA  1 
ATOM   8055 C C   . ALA B 1 504 ? 89.713  45.891 14.084  1.00 57.11  ? 505  ALA B C   1 
ATOM   8056 O O   . ALA B 1 504 ? 90.601  46.369 13.369  1.00 57.67  ? 505  ALA B O   1 
ATOM   8057 C CB  . ALA B 1 504 ? 89.807  43.399 14.311  1.00 62.30  ? 505  ALA B CB  1 
ATOM   8058 N N   . GLY B 1 505 ? 88.469  46.361 14.079  1.00 52.14  ? 506  GLY B N   1 
ATOM   8059 C CA  . GLY B 1 505 ? 88.090  47.472 13.227  1.00 52.91  ? 506  GLY B CA  1 
ATOM   8060 C C   . GLY B 1 505 ? 88.469  48.829 13.785  1.00 56.44  ? 506  GLY B C   1 
ATOM   8061 O O   . GLY B 1 505 ? 89.290  49.541 13.200  1.00 57.15  ? 506  GLY B O   1 
ATOM   8062 N N   . ALA B 1 506 ? 87.880  49.196 14.926  1.00 54.63  ? 507  ALA B N   1 
ATOM   8063 C CA  . ALA B 1 506 ? 88.102  50.530 15.476  1.00 50.80  ? 507  ALA B CA  1 
ATOM   8064 C C   . ALA B 1 506 ? 89.503  50.685 16.054  1.00 50.63  ? 507  ALA B C   1 
ATOM   8065 O O   . ALA B 1 506 ? 90.055  51.791 16.035  1.00 52.11  ? 507  ALA B O   1 
ATOM   8066 C CB  . ALA B 1 506 ? 87.047  50.842 16.537  1.00 43.85  ? 507  ALA B CB  1 
ATOM   8067 N N   . GLN B 1 507 ? 90.086  49.601 16.575  1.00 48.27  ? 508  GLN B N   1 
ATOM   8068 C CA  . GLN B 1 507 ? 91.465  49.599 17.073  1.00 47.92  ? 508  GLN B CA  1 
ATOM   8069 C C   . GLN B 1 507 ? 91.682  50.663 18.148  1.00 49.34  ? 508  GLN B C   1 
ATOM   8070 O O   . GLN B 1 507 ? 92.705  51.351 18.171  1.00 49.10  ? 508  GLN B O   1 
ATOM   8071 C CB  . GLN B 1 507 ? 92.463  49.776 15.926  1.00 44.23  ? 508  GLN B CB  1 
ATOM   8072 C CG  . GLN B 1 507 ? 92.317  48.748 14.814  1.00 50.97  ? 508  GLN B CG  1 
ATOM   8073 C CD  . GLN B 1 507 ? 93.164  49.078 13.599  1.00 54.56  ? 508  GLN B CD  1 
ATOM   8074 O OE1 . GLN B 1 507 ? 94.391  49.134 13.679  1.00 51.69  ? 508  GLN B OE1 1 
ATOM   8075 N NE2 . GLN B 1 507 ? 92.509  49.306 12.465  1.00 54.52  ? 508  GLN B NE2 1 
ATOM   8076 N N   . GLN B 1 508 ? 90.716  50.797 19.052  1.00 41.60  ? 509  GLN B N   1 
ATOM   8077 C CA  . GLN B 1 508 ? 90.767  51.849 20.057  1.00 46.80  ? 509  GLN B CA  1 
ATOM   8078 C C   . GLN B 1 508 ? 91.607  51.431 21.257  1.00 43.32  ? 509  GLN B C   1 
ATOM   8079 O O   . GLN B 1 508 ? 91.567  50.278 21.696  1.00 43.18  ? 509  GLN B O   1 
ATOM   8080 C CB  . GLN B 1 508 ? 89.359  52.219 20.518  1.00 50.88  ? 509  GLN B CB  1 
ATOM   8081 C CG  . GLN B 1 508 ? 88.550  52.976 19.489  1.00 52.72  ? 509  GLN B CG  1 
ATOM   8082 C CD  . GLN B 1 508 ? 87.145  53.270 19.967  1.00 55.72  ? 509  GLN B CD  1 
ATOM   8083 O OE1 . GLN B 1 508 ? 86.367  52.357 20.239  1.00 61.54  ? 509  GLN B OE1 1 
ATOM   8084 N NE2 . GLN B 1 508 ? 86.814  54.550 20.078  1.00 56.51  ? 509  GLN B NE2 1 
ATOM   8085 N N   . TYR B 1 509 ? 92.369  52.386 21.782  1.00 44.07  ? 510  TYR B N   1 
ATOM   8086 C CA  . TYR B 1 509 ? 93.160  52.203 22.990  1.00 43.06  ? 510  TYR B CA  1 
ATOM   8087 C C   . TYR B 1 509 ? 93.182  53.533 23.731  1.00 45.36  ? 510  TYR B C   1 
ATOM   8088 O O   . TYR B 1 509 ? 92.737  54.558 23.211  1.00 52.84  ? 510  TYR B O   1 
ATOM   8089 C CB  . TYR B 1 509 ? 94.579  51.725 22.661  1.00 41.77  ? 510  TYR B CB  1 
ATOM   8090 C CG  . TYR B 1 509 ? 95.409  52.760 21.935  1.00 47.74  ? 510  TYR B CG  1 
ATOM   8091 C CD1 . TYR B 1 509 ? 95.345  52.887 20.552  1.00 42.66  ? 510  TYR B CD1 1 
ATOM   8092 C CD2 . TYR B 1 509 ? 96.253  53.614 22.633  1.00 50.40  ? 510  TYR B CD2 1 
ATOM   8093 C CE1 . TYR B 1 509 ? 96.102  53.836 19.888  1.00 45.57  ? 510  TYR B CE1 1 
ATOM   8094 C CE2 . TYR B 1 509 ? 97.008  54.565 21.978  1.00 51.43  ? 510  TYR B CE2 1 
ATOM   8095 C CZ  . TYR B 1 509 ? 96.931  54.671 20.607  1.00 51.71  ? 510  TYR B CZ  1 
ATOM   8096 O OH  . TYR B 1 509 ? 97.688  55.619 19.962  1.00 56.66  ? 510  TYR B OH  1 
ATOM   8097 N N   . VAL B 1 510 ? 93.707  53.515 24.956  1.00 42.41  ? 511  VAL B N   1 
ATOM   8098 C CA  . VAL B 1 510 ? 93.816  54.734 25.747  1.00 40.67  ? 511  VAL B CA  1 
ATOM   8099 C C   . VAL B 1 510 ? 95.279  55.007 26.057  1.00 39.58  ? 511  VAL B C   1 
ATOM   8100 O O   . VAL B 1 510 ? 96.102  54.092 26.149  1.00 42.67  ? 511  VAL B O   1 
ATOM   8101 C CB  . VAL B 1 510 ? 92.998  54.669 27.056  1.00 41.76  ? 511  VAL B CB  1 
ATOM   8102 C CG1 . VAL B 1 510 ? 91.520  54.484 26.753  1.00 48.29  ? 511  VAL B CG1 1 
ATOM   8103 C CG2 . VAL B 1 510 ? 93.522  53.562 27.961  1.00 37.74  ? 511  VAL B CG2 1 
ATOM   8104 N N   . SER B 1 511 ? 95.600  56.286 26.209  1.00 42.93  ? 512  SER B N   1 
ATOM   8105 C CA  . SER B 1 511 ? 96.904  56.698 26.700  1.00 45.53  ? 512  SER B CA  1 
ATOM   8106 C C   . SER B 1 511 ? 96.860  56.821 28.217  1.00 47.43  ? 512  SER B C   1 
ATOM   8107 O O   . SER B 1 511 ? 95.907  57.368 28.780  1.00 44.75  ? 512  SER B O   1 
ATOM   8108 C CB  . SER B 1 511 ? 97.319  58.032 26.081  1.00 50.37  ? 512  SER B CB  1 
ATOM   8109 O OG  . SER B 1 511 ? 96.427  59.062 26.473  1.00 58.03  ? 512  SER B OG  1 
ATOM   8110 N N   . LEU B 1 512 ? 97.892  56.304 28.875  1.00 45.44  ? 513  LEU B N   1 
ATOM   8111 C CA  . LEU B 1 512 ? 98.020  56.378 30.326  1.00 43.98  ? 513  LEU B CA  1 
ATOM   8112 C C   . LEU B 1 512 ? 99.103  57.397 30.656  1.00 44.94  ? 513  LEU B C   1 
ATOM   8113 O O   . LEU B 1 512 ? 100.284 57.171 30.369  1.00 46.13  ? 513  LEU B O   1 
ATOM   8114 C CB  . LEU B 1 512 ? 98.349  55.009 30.918  1.00 39.49  ? 513  LEU B CB  1 
ATOM   8115 C CG  . LEU B 1 512 ? 97.330  53.899 30.645  1.00 40.25  ? 513  LEU B CG  1 
ATOM   8116 C CD1 . LEU B 1 512 ? 97.799  52.569 31.212  1.00 37.24  ? 513  LEU B CD1 1 
ATOM   8117 C CD2 . LEU B 1 512 ? 95.976  54.269 31.220  1.00 43.22  ? 513  LEU B CD2 1 
ATOM   8118 N N   . ASP B 1 513 ? 98.699  58.521 31.238  1.00 47.35  ? 514  ASP B N   1 
ATOM   8119 C CA  . ASP B 1 513 ? 99.639  59.516 31.742  1.00 50.97  ? 514  ASP B CA  1 
ATOM   8120 C C   . ASP B 1 513 ? 98.921  60.339 32.812  1.00 53.22  ? 514  ASP B C   1 
ATOM   8121 O O   . ASP B 1 513 ? 97.874  59.927 33.324  1.00 58.07  ? 514  ASP B O   1 
ATOM   8122 C CB  . ASP B 1 513 ? 100.205 60.367 30.591  1.00 50.32  ? 514  ASP B CB  1 
ATOM   8123 C CG  . ASP B 1 513 ? 99.125  61.026 29.752  1.00 63.69  ? 514  ASP B CG  1 
ATOM   8124 O OD1 . ASP B 1 513 ? 98.009  61.263 30.262  1.00 66.33  ? 514  ASP B OD1 1 
ATOM   8125 O OD2 . ASP B 1 513 ? 99.398  61.321 28.571  1.00 78.19  ? 514  ASP B OD2 1 
ATOM   8126 N N   . LEU B 1 514 ? 99.474  61.508 33.139  1.00 53.61  ? 515  LEU B N   1 
ATOM   8127 C CA  . LEU B 1 514 ? 98.897  62.331 34.196  1.00 54.89  ? 515  LEU B CA  1 
ATOM   8128 C C   . LEU B 1 514 ? 97.568  62.957 33.793  1.00 58.82  ? 515  LEU B C   1 
ATOM   8129 O O   . LEU B 1 514 ? 96.761  63.281 34.670  1.00 66.11  ? 515  LEU B O   1 
ATOM   8130 C CB  . LEU B 1 514 ? 99.884  63.424 34.602  1.00 54.21  ? 515  LEU B CB  1 
ATOM   8131 C CG  . LEU B 1 514 ? 101.247 62.916 35.076  1.00 53.66  ? 515  LEU B CG  1 
ATOM   8132 C CD1 . LEU B 1 514 ? 102.119 64.076 35.540  1.00 50.49  ? 515  LEU B CD1 1 
ATOM   8133 C CD2 . LEU B 1 514 ? 101.086 61.879 36.177  1.00 55.69  ? 515  LEU B CD2 1 
ATOM   8134 N N   . ARG B 1 515 ? 97.328  63.144 32.499  1.00 56.35  ? 516  ARG B N   1 
ATOM   8135 C CA  . ARG B 1 515 ? 96.056  63.658 32.021  1.00 56.36  ? 516  ARG B CA  1 
ATOM   8136 C C   . ARG B 1 515 ? 94.994  62.566 32.083  1.00 55.98  ? 516  ARG B C   1 
ATOM   8137 O O   . ARG B 1 515 ? 95.318  61.378 32.148  1.00 53.46  ? 516  ARG B O   1 
ATOM   8138 C CB  . ARG B 1 515 ? 96.204  64.164 30.590  1.00 63.55  ? 516  ARG B CB  1 
ATOM   8139 C CG  . ARG B 1 515 ? 97.371  65.111 30.387  1.00 71.34  ? 516  ARG B CG  1 
ATOM   8140 C CD  . ARG B 1 515 ? 97.635  65.359 28.908  1.00 77.80  ? 516  ARG B CD  1 
ATOM   8141 N NE  . ARG B 1 515 ? 98.003  64.133 28.203  1.00 83.37  ? 516  ARG B NE  1 
ATOM   8142 C CZ  . ARG B 1 515 ? 97.227  63.514 27.317  1.00 88.07  ? 516  ARG B CZ  1 
ATOM   8143 N NH1 . ARG B 1 515 ? 96.034  64.008 27.014  1.00 92.15  ? 516  ARG B NH1 1 
ATOM   8144 N NH2 . ARG B 1 515 ? 97.648  62.403 26.728  1.00 87.19  ? 516  ARG B NH2 1 
ATOM   8145 N N   . PRO B 1 516 ? 93.712  62.939 32.073  1.00 58.76  ? 517  PRO B N   1 
ATOM   8146 C CA  . PRO B 1 516 ? 92.656  61.922 31.999  1.00 56.75  ? 517  PRO B CA  1 
ATOM   8147 C C   . PRO B 1 516 ? 92.804  61.071 30.746  1.00 55.06  ? 517  PRO B C   1 
ATOM   8148 O O   . PRO B 1 516 ? 93.526  61.418 29.809  1.00 54.40  ? 517  PRO B O   1 
ATOM   8149 C CB  . PRO B 1 516 ? 91.365  62.749 31.963  1.00 60.84  ? 517  PRO B CB  1 
ATOM   8150 C CG  . PRO B 1 516 ? 91.733  64.044 32.612  1.00 62.73  ? 517  PRO B CG  1 
ATOM   8151 C CD  . PRO B 1 516 ? 93.161  64.297 32.227  1.00 56.50  ? 517  PRO B CD  1 
ATOM   8152 N N   . LEU B 1 517 ? 92.106  59.935 30.743  1.00 52.22  ? 518  LEU B N   1 
ATOM   8153 C CA  . LEU B 1 517 ? 92.207  58.998 29.631  1.00 51.55  ? 518  LEU B CA  1 
ATOM   8154 C C   . LEU B 1 517 ? 91.865  59.678 28.314  1.00 57.12  ? 518  LEU B C   1 
ATOM   8155 O O   . LEU B 1 517 ? 90.877  60.410 28.214  1.00 62.50  ? 518  LEU B O   1 
ATOM   8156 C CB  . LEU B 1 517 ? 91.280  57.802 29.849  1.00 52.47  ? 518  LEU B CB  1 
ATOM   8157 C CG  . LEU B 1 517 ? 91.661  56.800 30.935  1.00 56.37  ? 518  LEU B CG  1 
ATOM   8158 C CD1 . LEU B 1 517 ? 90.684  55.639 30.930  1.00 51.37  ? 518  LEU B CD1 1 
ATOM   8159 C CD2 . LEU B 1 517 ? 93.079  56.310 30.728  1.00 55.55  ? 518  LEU B CD2 1 
ATOM   8160 N N   . GLU B 1 518 ? 92.698  59.441 27.307  1.00 54.28  ? 519  GLU B N   1 
ATOM   8161 C CA  . GLU B 1 518 ? 92.448  59.888 25.946  1.00 57.92  ? 519  GLU B CA  1 
ATOM   8162 C C   . GLU B 1 518 ? 92.349  58.662 25.053  1.00 53.61  ? 519  GLU B C   1 
ATOM   8163 O O   . GLU B 1 518 ? 93.235  57.802 25.077  1.00 53.73  ? 519  GLU B O   1 
ATOM   8164 C CB  . GLU B 1 518 ? 93.558  60.820 25.454  1.00 65.28  ? 519  GLU B CB  1 
ATOM   8165 C CG  . GLU B 1 518 ? 93.309  61.404 24.075  1.00 74.99  ? 519  GLU B CG  1 
ATOM   8166 C CD  . GLU B 1 518 ? 94.494  62.193 23.558  1.00 87.37  ? 519  GLU B CD  1 
ATOM   8167 O OE1 . GLU B 1 518 ? 94.833  62.047 22.365  1.00 89.08  ? 519  GLU B OE1 1 
ATOM   8168 O OE2 . GLU B 1 518 ? 95.092  62.954 24.349  1.00 97.29  ? 519  GLU B OE2 1 
ATOM   8169 N N   . VAL B 1 519 ? 91.273  58.577 24.280  1.00 56.01  ? 520  VAL B N   1 
ATOM   8170 C CA  . VAL B 1 519 ? 91.040  57.447 23.389  1.00 51.11  ? 520  VAL B CA  1 
ATOM   8171 C C   . VAL B 1 519 ? 91.638  57.765 22.025  1.00 50.29  ? 520  VAL B C   1 
ATOM   8172 O O   . VAL B 1 519 ? 91.443  58.864 21.494  1.00 53.41  ? 520  VAL B O   1 
ATOM   8173 C CB  . VAL B 1 519 ? 89.538  57.138 23.275  1.00 53.92  ? 520  VAL B CB  1 
ATOM   8174 C CG1 . VAL B 1 519 ? 89.300  55.982 22.313  1.00 57.09  ? 520  VAL B CG1 1 
ATOM   8175 C CG2 . VAL B 1 519 ? 88.958  56.829 24.645  1.00 55.54  ? 520  VAL B CG2 1 
ATOM   8176 N N   . ARG B 1 520 ? 92.374  56.807 21.461  1.00 50.41  ? 521  ARG B N   1 
ATOM   8177 C CA  . ARG B 1 520 ? 92.988  56.939 20.147  1.00 55.21  ? 521  ARG B CA  1 
ATOM   8178 C C   . ARG B 1 520 ? 92.738  55.668 19.346  1.00 54.75  ? 521  ARG B C   1 
ATOM   8179 O O   . ARG B 1 520 ? 92.302  54.646 19.882  1.00 48.76  ? 521  ARG B O   1 
ATOM   8180 C CB  . ARG B 1 520 ? 94.493  57.215 20.256  1.00 57.01  ? 521  ARG B CB  1 
ATOM   8181 C CG  . ARG B 1 520 ? 94.830  58.490 21.004  1.00 58.51  ? 521  ARG B CG  1 
ATOM   8182 C CD  . ARG B 1 520 ? 96.321  58.620 21.244  1.00 62.33  ? 521  ARG B CD  1 
ATOM   8183 N NE  . ARG B 1 520 ? 96.607  59.667 22.220  1.00 67.80  ? 521  ARG B NE  1 
ATOM   8184 C CZ  . ARG B 1 520 ? 97.783  59.835 22.813  1.00 66.04  ? 521  ARG B CZ  1 
ATOM   8185 N NH1 . ARG B 1 520 ? 98.791  59.021 22.531  1.00 67.17  ? 521  ARG B NH1 1 
ATOM   8186 N NH2 . ARG B 1 520 ? 97.950  60.817 23.690  1.00 60.32  ? 521  ARG B NH2 1 
ATOM   8187 N N   . ARG B 1 521 ? 93.020  55.740 18.046  1.00 53.80  ? 522  ARG B N   1 
ATOM   8188 C CA  . ARG B 1 521 ? 92.827  54.620 17.133  1.00 53.39  ? 522  ARG B CA  1 
ATOM   8189 C C   . ARG B 1 521 ? 94.169  54.176 16.571  1.00 54.00  ? 522  ARG B C   1 
ATOM   8190 O O   . ARG B 1 521 ? 94.988  55.012 16.174  1.00 56.42  ? 522  ARG B O   1 
ATOM   8191 C CB  . ARG B 1 521 ? 91.886  54.990 15.983  1.00 59.40  ? 522  ARG B CB  1 
ATOM   8192 C CG  . ARG B 1 521 ? 90.463  55.301 16.401  1.00 63.99  ? 522  ARG B CG  1 
ATOM   8193 C CD  . ARG B 1 521 ? 89.515  55.257 15.205  1.00 61.47  ? 522  ARG B CD  1 
ATOM   8194 N NE  . ARG B 1 521 ? 89.579  53.981 14.494  1.00 60.92  ? 522  ARG B NE  1 
ATOM   8195 C CZ  . ARG B 1 521 ? 89.821  53.856 13.191  1.00 68.16  ? 522  ARG B CZ  1 
ATOM   8196 N NH1 . ARG B 1 521 ? 90.013  54.933 12.441  1.00 72.65  ? 522  ARG B NH1 1 
ATOM   8197 N NH2 . ARG B 1 521 ? 89.861  52.653 12.634  1.00 60.10  ? 522  ARG B NH2 1 
ATOM   8198 N N   . GLY B 1 522 ? 94.387  52.864 16.539  1.00 52.20  ? 523  GLY B N   1 
ATOM   8199 C CA  . GLY B 1 522 ? 95.536  52.300 15.857  1.00 50.11  ? 523  GLY B CA  1 
ATOM   8200 C C   . GLY B 1 522 ? 96.819  52.239 16.661  1.00 47.96  ? 523  GLY B C   1 
ATOM   8201 O O   . GLY B 1 522 ? 97.404  53.274 16.997  1.00 47.23  ? 523  GLY B O   1 
ATOM   8202 N N   . LEU B 1 523 ? 97.266  51.020 16.970  1.00 48.85  ? 524  LEU B N   1 
ATOM   8203 C CA  . LEU B 1 523 ? 98.579  50.791 17.573  1.00 46.72  ? 524  LEU B CA  1 
ATOM   8204 C C   . LEU B 1 523 ? 99.602  50.719 16.442  1.00 48.77  ? 524  LEU B C   1 
ATOM   8205 O O   . LEU B 1 523 ? 99.970  49.645 15.960  1.00 46.57  ? 524  LEU B O   1 
ATOM   8206 C CB  . LEU B 1 523 ? 98.581  49.516 18.408  1.00 42.17  ? 524  LEU B CB  1 
ATOM   8207 C CG  . LEU B 1 523 ? 97.717  49.442 19.671  1.00 47.89  ? 524  LEU B CG  1 
ATOM   8208 C CD1 . LEU B 1 523 ? 97.605  48.005 20.149  1.00 44.60  ? 524  LEU B CD1 1 
ATOM   8209 C CD2 . LEU B 1 523 ? 98.293  50.314 20.768  1.00 44.64  ? 524  LEU B CD2 1 
ATOM   8210 N N   . ARG B 1 524 ? 100.065 51.895 16.016  1.00 48.45  ? 525  ARG B N   1 
ATOM   8211 C CA  A ARG B 1 524 ? 101.012 52.000 14.908  0.52 45.56  ? 525  ARG B CA  1 
ATOM   8212 C CA  B ARG B 1 524 ? 100.994 52.031 14.895  0.48 45.58  ? 525  ARG B CA  1 
ATOM   8213 C C   . ARG B 1 524 ? 100.525 51.185 13.711  1.00 48.23  ? 525  ARG B C   1 
ATOM   8214 O O   . ARG B 1 524 ? 101.230 50.315 13.195  1.00 47.58  ? 525  ARG B O   1 
ATOM   8215 C CB  A ARG B 1 524 ? 102.410 51.551 15.344  0.52 44.58  ? 525  ARG B CB  1 
ATOM   8216 C CB  B ARG B 1 524 ? 102.421 51.676 15.326  0.48 44.99  ? 525  ARG B CB  1 
ATOM   8217 C CG  A ARG B 1 524 ? 103.002 52.348 16.499  0.52 46.80  ? 525  ARG B CG  1 
ATOM   8218 C CG  B ARG B 1 524 ? 102.891 52.469 16.543  0.48 46.85  ? 525  ARG B CG  1 
ATOM   8219 C CD  A ARG B 1 524 ? 103.843 53.505 15.992  0.52 47.95  ? 525  ARG B CD  1 
ATOM   8220 C CD  B ARG B 1 524 ? 104.407 52.526 16.655  0.48 45.51  ? 525  ARG B CD  1 
ATOM   8221 N NE  A ARG B 1 524 ? 104.943 53.038 15.153  0.52 48.94  ? 525  ARG B NE  1 
ATOM   8222 N NE  B ARG B 1 524 ? 104.829 53.305 17.818  0.48 45.91  ? 525  ARG B NE  1 
ATOM   8223 C CZ  A ARG B 1 524 ? 105.744 53.837 14.458  0.52 47.74  ? 525  ARG B CZ  1 
ATOM   8224 C CZ  B ARG B 1 524 ? 106.091 53.614 18.099  0.48 47.43  ? 525  ARG B CZ  1 
ATOM   8225 N NH1 A ARG B 1 524 ? 105.571 55.150 14.497  0.52 52.85  ? 525  ARG B NH1 1 
ATOM   8226 N NH1 B ARG B 1 524 ? 107.070 53.211 17.298  0.48 39.18  ? 525  ARG B NH1 1 
ATOM   8227 N NH2 A ARG B 1 524 ? 106.718 53.320 13.723  0.52 34.18  ? 525  ARG B NH2 1 
ATOM   8228 N NH2 B ARG B 1 524 ? 106.377 54.328 19.181  0.48 47.35  ? 525  ARG B NH2 1 
ATOM   8229 N N   . ALA B 1 525 ? 99.289  51.469 13.288  1.00 46.07  ? 526  ALA B N   1 
ATOM   8230 C CA  . ALA B 1 525 ? 98.621  50.650 12.280  1.00 46.49  ? 526  ALA B CA  1 
ATOM   8231 C C   . ALA B 1 525 ? 99.413  50.579 10.981  1.00 50.12  ? 526  ALA B C   1 
ATOM   8232 O O   . ALA B 1 525 ? 99.497  49.513 10.359  1.00 50.40  ? 526  ALA B O   1 
ATOM   8233 C CB  . ALA B 1 525 ? 97.215  51.190 12.020  1.00 47.29  ? 526  ALA B CB  1 
ATOM   8234 N N   . GLN B 1 526 ? 99.992  51.700 10.545  1.00 48.16  ? 527  GLN B N   1 
ATOM   8235 C CA  . GLN B 1 526 ? 100.741 51.691 9.292   1.00 50.58  ? 527  GLN B CA  1 
ATOM   8236 C C   . GLN B 1 526 ? 102.010 50.859 9.419   1.00 49.22  ? 527  GLN B C   1 
ATOM   8237 O O   . GLN B 1 526 ? 102.299 50.016 8.563   1.00 46.88  ? 527  GLN B O   1 
ATOM   8238 C CB  . GLN B 1 526 ? 101.073 53.118 8.860   1.00 54.00  ? 527  GLN B CB  1 
ATOM   8239 C CG  . GLN B 1 526 ? 99.866  53.927 8.445   1.00 59.99  ? 527  GLN B CG  1 
ATOM   8240 C CD  . GLN B 1 526 ? 99.059  53.245 7.359   1.00 65.40  ? 527  GLN B CD  1 
ATOM   8241 O OE1 . GLN B 1 526 ? 99.551  53.000 6.257   1.00 68.13  ? 527  GLN B OE1 1 
ATOM   8242 N NE2 . GLN B 1 526 ? 97.811  52.932 7.668   1.00 67.50  ? 527  GLN B NE2 1 
ATOM   8243 N N   . ALA B 1 527 ? 102.778 51.078 10.488  1.00 47.80  ? 528  ALA B N   1 
ATOM   8244 C CA  . ALA B 1 527 ? 104.009 50.318 10.672  1.00 45.97  ? 528  ALA B CA  1 
ATOM   8245 C C   . ALA B 1 527 ? 103.721 48.832 10.841  1.00 46.07  ? 528  ALA B C   1 
ATOM   8246 O O   . ALA B 1 527 ? 104.433 47.986 10.288  1.00 54.26  ? 528  ALA B O   1 
ATOM   8247 C CB  . ALA B 1 527 ? 104.783 50.856 11.877  1.00 51.14  ? 528  ALA B CB  1 
ATOM   8248 N N   . CYS B 1 528 ? 102.671 48.493 11.590  1.00 39.92  ? 529  CYS B N   1 
ATOM   8249 C CA  . CYS B 1 528 ? 102.402 47.095 11.899  1.00 41.45  ? 529  CYS B CA  1 
ATOM   8250 C C   . CYS B 1 528 ? 101.786 46.336 10.732  1.00 46.83  ? 529  CYS B C   1 
ATOM   8251 O O   . CYS B 1 528 ? 101.904 45.106 10.681  1.00 44.80  ? 529  CYS B O   1 
ATOM   8252 C CB  . CYS B 1 528 ? 101.504 47.003 13.131  1.00 46.72  ? 529  CYS B CB  1 
ATOM   8253 S SG  . CYS B 1 528 ? 102.370 47.505 14.637  1.00 47.53  ? 529  CYS B SG  1 
ATOM   8254 N N   . ALA B 1 529 ? 101.136 47.030 9.796   1.00 44.87  ? 530  ALA B N   1 
ATOM   8255 C CA  . ALA B 1 529 ? 100.717 46.365 8.569   1.00 43.42  ? 530  ALA B CA  1 
ATOM   8256 C C   . ALA B 1 529 ? 101.923 45.806 7.828   1.00 45.19  ? 530  ALA B C   1 
ATOM   8257 O O   . ALA B 1 529 ? 101.862 44.710 7.263   1.00 47.92  ? 530  ALA B O   1 
ATOM   8258 C CB  . ALA B 1 529 ? 99.933  47.330 7.681   1.00 39.85  ? 530  ALA B CB  1 
ATOM   8259 N N   . PHE B 1 530 ? 103.036 46.541 7.842   1.00 44.91  ? 531  PHE B N   1 
ATOM   8260 C CA  . PHE B 1 530 ? 104.264 46.044 7.230   1.00 44.23  ? 531  PHE B CA  1 
ATOM   8261 C C   . PHE B 1 530 ? 104.761 44.791 7.939   1.00 43.31  ? 531  PHE B C   1 
ATOM   8262 O O   . PHE B 1 530 ? 105.033 43.769 7.298   1.00 42.63  ? 531  PHE B O   1 
ATOM   8263 C CB  . PHE B 1 530 ? 105.333 47.139 7.248   1.00 43.16  ? 531  PHE B CB  1 
ATOM   8264 C CG  . PHE B 1 530 ? 106.717 46.646 6.925   1.00 45.93  ? 531  PHE B CG  1 
ATOM   8265 C CD1 . PHE B 1 530 ? 107.082 46.369 5.618   1.00 52.11  ? 531  PHE B CD1 1 
ATOM   8266 C CD2 . PHE B 1 530 ? 107.658 46.477 7.928   1.00 44.45  ? 531  PHE B CD2 1 
ATOM   8267 C CE1 . PHE B 1 530 ? 108.356 45.919 5.317   1.00 52.15  ? 531  PHE B CE1 1 
ATOM   8268 C CE2 . PHE B 1 530 ? 108.933 46.026 7.634   1.00 46.00  ? 531  PHE B CE2 1 
ATOM   8269 C CZ  . PHE B 1 530 ? 109.282 45.751 6.325   1.00 53.31  ? 531  PHE B CZ  1 
ATOM   8270 N N   . TRP B 1 531 ? 104.876 44.848 9.270   1.00 37.30  ? 532  TRP B N   1 
ATOM   8271 C CA  . TRP B 1 531 ? 105.462 43.733 10.007  1.00 38.44  ? 532  TRP B CA  1 
ATOM   8272 C C   . TRP B 1 531 ? 104.553 42.511 10.001  1.00 42.17  ? 532  TRP B C   1 
ATOM   8273 O O   . TRP B 1 531 ? 105.035 41.377 9.893   1.00 48.12  ? 532  TRP B O   1 
ATOM   8274 C CB  . TRP B 1 531 ? 105.778 44.158 11.444  1.00 37.53  ? 532  TRP B CB  1 
ATOM   8275 C CG  . TRP B 1 531 ? 106.878 45.162 11.519  1.00 39.02  ? 532  TRP B CG  1 
ATOM   8276 C CD1 . TRP B 1 531 ? 106.759 46.499 11.771  1.00 38.30  ? 532  TRP B CD1 1 
ATOM   8277 C CD2 . TRP B 1 531 ? 108.272 44.914 11.315  1.00 38.75  ? 532  TRP B CD2 1 
ATOM   8278 N NE1 . TRP B 1 531 ? 107.996 47.096 11.749  1.00 38.42  ? 532  TRP B NE1 1 
ATOM   8279 C CE2 . TRP B 1 531 ? 108.942 46.144 11.470  1.00 41.57  ? 532  TRP B CE2 1 
ATOM   8280 C CE3 . TRP B 1 531 ? 109.020 43.769 11.024  1.00 32.83  ? 532  TRP B CE3 1 
ATOM   8281 C CZ2 . TRP B 1 531 ? 110.326 46.262 11.342  1.00 38.61  ? 532  TRP B CZ2 1 
ATOM   8282 C CZ3 . TRP B 1 531 ? 110.393 43.888 10.895  1.00 37.75  ? 532  TRP B CZ3 1 
ATOM   8283 C CH2 . TRP B 1 531 ? 111.032 45.125 11.054  1.00 38.35  ? 532  TRP B CH2 1 
ATOM   8284 N N   . ASN B 1 532 ? 103.241 42.714 10.111  1.00 40.59  ? 533  ASN B N   1 
ATOM   8285 C CA  . ASN B 1 532 ? 102.324 41.601 10.316  1.00 44.45  ? 533  ASN B CA  1 
ATOM   8286 C C   . ASN B 1 532 ? 101.655 41.103 9.041   1.00 47.29  ? 533  ASN B C   1 
ATOM   8287 O O   . ASN B 1 532 ? 101.171 39.966 9.027   1.00 54.52  ? 533  ASN B O   1 
ATOM   8288 C CB  . ASN B 1 532 ? 101.246 41.974 11.348  1.00 35.29  ? 533  ASN B CB  1 
ATOM   8289 C CG  . ASN B 1 532 ? 101.834 42.294 12.722  1.00 43.64  ? 533  ASN B CG  1 
ATOM   8290 O OD1 . ASN B 1 532 ? 102.804 41.674 13.148  1.00 49.27  ? 533  ASN B OD1 1 
ATOM   8291 N ND2 . ASN B 1 532 ? 101.214 43.233 13.437  1.00 37.76  ? 533  ASN B ND2 1 
ATOM   8292 N N   . ARG B 1 533 ? 101.621 41.898 7.972   1.00 49.97  ? 534  ARG B N   1 
ATOM   8293 C CA  . ARG B 1 533 ? 100.961 41.484 6.737   1.00 53.72  ? 534  ARG B CA  1 
ATOM   8294 C C   . ARG B 1 533 ? 101.930 41.229 5.593   1.00 56.95  ? 534  ARG B C   1 
ATOM   8295 O O   . ARG B 1 533 ? 101.866 40.174 4.955   1.00 60.57  ? 534  ARG B O   1 
ATOM   8296 C CB  . ARG B 1 533 ? 99.925  42.531 6.306   1.00 53.84  ? 534  ARG B CB  1 
ATOM   8297 C CG  . ARG B 1 533 ? 98.834  42.776 7.329   1.00 56.03  ? 534  ARG B CG  1 
ATOM   8298 C CD  . ARG B 1 533 ? 97.902  43.886 6.882   1.00 62.80  ? 534  ARG B CD  1 
ATOM   8299 N NE  . ARG B 1 533 ? 96.963  44.260 7.935   1.00 67.35  ? 534  ARG B NE  1 
ATOM   8300 C CZ  . ARG B 1 533 ? 95.766  43.708 8.097   1.00 70.47  ? 534  ARG B CZ  1 
ATOM   8301 N NH1 . ARG B 1 533 ? 95.359  42.754 7.271   1.00 77.34  ? 534  ARG B NH1 1 
ATOM   8302 N NH2 . ARG B 1 533 ? 94.977  44.111 9.083   1.00 73.99  ? 534  ARG B NH2 1 
ATOM   8303 N N   . PHE B 1 534 ? 102.836 42.163 5.313   1.00 54.60  ? 535  PHE B N   1 
ATOM   8304 C CA  . PHE B 1 534 ? 103.675 42.026 4.130   1.00 55.51  ? 535  PHE B CA  1 
ATOM   8305 C C   . PHE B 1 534 ? 104.940 41.214 4.387   1.00 56.38  ? 535  PHE B C   1 
ATOM   8306 O O   . PHE B 1 534 ? 105.208 40.245 3.672   1.00 55.65  ? 535  PHE B O   1 
ATOM   8307 C CB  . PHE B 1 534 ? 104.058 43.400 3.584   1.00 53.04  ? 535  PHE B CB  1 
ATOM   8308 C CG  . PHE B 1 534 ? 104.991 43.335 2.412   1.00 52.69  ? 535  PHE B CG  1 
ATOM   8309 C CD1 . PHE B 1 534 ? 104.561 42.820 1.199   1.00 53.36  ? 535  PHE B CD1 1 
ATOM   8310 C CD2 . PHE B 1 534 ? 106.301 43.770 2.524   1.00 52.48  ? 535  PHE B CD2 1 
ATOM   8311 C CE1 . PHE B 1 534 ? 105.417 42.746 0.118   1.00 50.84  ? 535  PHE B CE1 1 
ATOM   8312 C CE2 . PHE B 1 534 ? 107.163 43.701 1.442   1.00 56.03  ? 535  PHE B CE2 1 
ATOM   8313 C CZ  . PHE B 1 534 ? 106.719 43.189 0.238   1.00 49.39  ? 535  PHE B CZ  1 
ATOM   8314 N N   . LEU B 1 535 ? 105.729 41.605 5.386   1.00 55.32  ? 536  LEU B N   1 
ATOM   8315 C CA  . LEU B 1 535 ? 107.042 40.991 5.572   1.00 62.09  ? 536  LEU B CA  1 
ATOM   8316 C C   . LEU B 1 535 ? 107.006 39.470 5.711   1.00 66.17  ? 536  LEU B C   1 
ATOM   8317 O O   . LEU B 1 535 ? 107.931 38.817 5.194   1.00 66.00  ? 536  LEU B O   1 
ATOM   8318 C CB  . LEU B 1 535 ? 107.743 41.640 6.771   1.00 57.43  ? 536  LEU B CB  1 
ATOM   8319 C CG  . LEU B 1 535 ? 109.236 41.339 6.921   1.00 67.57  ? 536  LEU B CG  1 
ATOM   8320 C CD1 . LEU B 1 535 ? 109.997 42.580 7.337   1.00 66.59  ? 536  LEU B CD1 1 
ATOM   8321 C CD2 . LEU B 1 535 ? 109.448 40.244 7.943   1.00 70.27  ? 536  LEU B CD2 1 
ATOM   8322 N N   . PRO B 1 536 ? 106.020 38.845 6.372   1.00 66.01  ? 537  PRO B N   1 
ATOM   8323 C CA  . PRO B 1 536 ? 105.970 37.372 6.346   1.00 64.16  ? 537  PRO B CA  1 
ATOM   8324 C C   . PRO B 1 536 ? 105.896 36.791 4.944   1.00 66.70  ? 537  PRO B C   1 
ATOM   8325 O O   . PRO B 1 536 ? 106.520 35.757 4.673   1.00 72.53  ? 537  PRO B O   1 
ATOM   8326 C CB  . PRO B 1 536 ? 104.706 37.054 7.154   1.00 59.30  ? 537  PRO B CB  1 
ATOM   8327 C CG  . PRO B 1 536 ? 104.564 38.193 8.077   1.00 58.44  ? 537  PRO B CG  1 
ATOM   8328 C CD  . PRO B 1 536 ? 105.031 39.398 7.317   1.00 62.17  ? 537  PRO B CD  1 
ATOM   8329 N N   . LYS B 1 537 ? 105.142 37.428 4.043   1.00 66.43  ? 538  LYS B N   1 
ATOM   8330 C CA  . LYS B 1 537 ? 104.995 36.899 2.691   1.00 63.43  ? 538  LYS B CA  1 
ATOM   8331 C C   . LYS B 1 537 ? 106.289 37.024 1.898   1.00 66.20  ? 538  LYS B C   1 
ATOM   8332 O O   . LYS B 1 537 ? 106.574 36.182 1.039   1.00 68.62  ? 538  LYS B O   1 
ATOM   8333 C CB  . LYS B 1 537 ? 103.861 37.621 1.961   1.00 64.65  ? 538  LYS B CB  1 
ATOM   8334 C CG  . LYS B 1 537 ? 102.490 37.406 2.583   1.00 62.38  ? 538  LYS B CG  1 
ATOM   8335 C CD  . LYS B 1 537 ? 101.388 38.112 1.809   1.00 65.11  ? 538  LYS B CD  1 
ATOM   8336 C CE  . LYS B 1 537 ? 100.050 37.883 2.490   1.00 70.31  ? 538  LYS B CE  1 
ATOM   8337 N NZ  . LYS B 1 537 ? 99.883  38.775 3.669   1.00 73.10  ? 538  LYS B NZ  1 
ATOM   8338 N N   . LEU B 1 538 ? 107.080 38.064 2.172   1.00 71.08  ? 539  LEU B N   1 
ATOM   8339 C CA  . LEU B 1 538 ? 108.337 38.249 1.458   1.00 79.27  ? 539  LEU B CA  1 
ATOM   8340 C C   . LEU B 1 538 ? 109.336 37.160 1.824   1.00 84.38  ? 539  LEU B C   1 
ATOM   8341 O O   . LEU B 1 538 ? 110.027 36.623 0.949   1.00 92.33  ? 539  LEU B O   1 
ATOM   8342 C CB  . LEU B 1 538 ? 108.901 39.645 1.750   1.00 76.36  ? 539  LEU B CB  1 
ATOM   8343 C CG  . LEU B 1 538 ? 110.275 40.085 1.233   1.00 82.50  ? 539  LEU B CG  1 
ATOM   8344 C CD1 . LEU B 1 538 ? 110.310 41.609 1.137   1.00 84.23  ? 539  LEU B CD1 1 
ATOM   8345 C CD2 . LEU B 1 538 ? 111.431 39.571 2.105   1.00 81.38  ? 539  LEU B CD2 1 
ATOM   8346 N N   . LEU B 1 539 ? 109.428 36.824 3.112   1.00 87.35  ? 540  LEU B N   1 
ATOM   8347 C CA  . LEU B 1 539 ? 110.411 35.840 3.549   1.00 91.89  ? 540  LEU B CA  1 
ATOM   8348 C C   . LEU B 1 539 ? 110.088 34.445 3.032   1.00 97.97  ? 540  LEU B C   1 
ATOM   8349 O O   . LEU B 1 539 ? 111.003 33.641 2.816   1.00 104.71 ? 540  LEU B O   1 
ATOM   8350 C CB  . LEU B 1 539 ? 110.508 35.824 5.074   1.00 84.99  ? 540  LEU B CB  1 
ATOM   8351 C CG  . LEU B 1 539 ? 110.937 37.116 5.769   1.00 82.39  ? 540  LEU B CG  1 
ATOM   8352 C CD1 . LEU B 1 539 ? 110.627 37.027 7.243   1.00 77.26  ? 540  LEU B CD1 1 
ATOM   8353 C CD2 . LEU B 1 539 ? 112.413 37.376 5.560   1.00 83.71  ? 540  LEU B CD2 1 
ATOM   8354 N N   . SER B 1 540 ? 108.810 34.136 2.827   1.00 92.97  ? 541  SER B N   1 
ATOM   8355 C CA  . SER B 1 540 ? 108.398 32.832 2.329   1.00 92.87  ? 541  SER B CA  1 
ATOM   8356 C C   . SER B 1 540 ? 108.403 32.752 0.806   1.00 95.89  ? 541  SER B C   1 
ATOM   8357 O O   . SER B 1 540 ? 107.926 31.757 0.250   1.00 98.47  ? 541  SER B O   1 
ATOM   8358 C CB  . SER B 1 540 ? 107.007 32.478 2.861   1.00 92.34  ? 541  SER B CB  1 
ATOM   8359 O OG  . SER B 1 540 ? 106.002 33.227 2.200   1.00 95.57  ? 541  SER B OG  1 
ATOM   8360 N N   . ALA B 1 541 ? 108.929 33.767 0.125   1.00 96.23  ? 542  ALA B N   1 
ATOM   8361 C CA  . ALA B 1 541 ? 108.963 33.778 -1.334  1.00 93.69  ? 542  ALA B CA  1 
ATOM   8362 C C   . ALA B 1 541 ? 110.202 34.501 -1.855  1.00 95.47  ? 542  ALA B C   1 
ATOM   8363 O O   . ALA B 1 541 ? 111.221 34.585 -1.169  1.00 99.40  ? 542  ALA B O   1 
ATOM   8364 C CB  . ALA B 1 541 ? 107.701 34.425 -1.887  1.00 87.16  ? 542  ALA B CB  1 
HETATM 8365 C C1  . NAG C 2 .   ? 59.342  4.560  11.842  1.00 66.53  ? 1    NAG C C1  1 
HETATM 8366 C C2  . NAG C 2 .   ? 58.591  3.547  10.983  1.00 81.09  ? 1    NAG C C2  1 
HETATM 8367 C C3  . NAG C 2 .   ? 57.095  3.586  11.257  1.00 89.23  ? 1    NAG C C3  1 
HETATM 8368 C C4  . NAG C 2 .   ? 56.841  3.459  12.751  1.00 95.17  ? 1    NAG C C4  1 
HETATM 8369 C C5  . NAG C 2 .   ? 57.625  4.526  13.504  1.00 88.95  ? 1    NAG C C5  1 
HETATM 8370 C C6  . NAG C 2 .   ? 57.397  4.408  15.007  1.00 99.75  ? 1    NAG C C6  1 
HETATM 8371 C C7  . NAG C 2 .   ? 59.950  3.366  8.981   1.00 96.99  ? 1    NAG C C7  1 
HETATM 8372 C C8  . NAG C 2 .   ? 61.229  3.607  9.726   1.00 95.90  ? 1    NAG C C8  1 
HETATM 8373 N N2  . NAG C 2 .   ? 58.844  3.802  9.578   1.00 89.67  ? 1    NAG C N2  1 
HETATM 8374 O O3  . NAG C 2 .   ? 56.451  2.508  10.568  1.00 94.65  ? 1    NAG C O3  1 
HETATM 8375 O O4  . NAG C 2 .   ? 55.443  3.614  13.016  1.00 106.79 ? 1    NAG C O4  1 
HETATM 8376 O O5  . NAG C 2 .   ? 59.020  4.401  13.226  1.00 75.10  ? 1    NAG C O5  1 
HETATM 8377 O O6  . NAG C 2 .   ? 57.959  3.178  15.479  1.00 106.97 ? 1    NAG C O6  1 
HETATM 8378 O O7  . NAG C 2 .   ? 59.925  2.806  7.897   1.00 103.33 ? 1    NAG C O7  1 
HETATM 8379 C C1  . NAG C 2 .   ? 55.043  2.622  13.979  1.00 115.13 ? 2    NAG C C1  1 
HETATM 8380 C C2  . NAG C 2 .   ? 53.576  2.829  14.343  1.00 117.51 ? 2    NAG C C2  1 
HETATM 8381 C C3  . NAG C 2 .   ? 53.089  1.763  15.315  1.00 120.39 ? 2    NAG C C3  1 
HETATM 8382 C C4  . NAG C 2 .   ? 53.418  0.382  14.773  1.00 123.48 ? 2    NAG C C4  1 
HETATM 8383 C C5  . NAG C 2 .   ? 54.905  0.286  14.459  1.00 123.47 ? 2    NAG C C5  1 
HETATM 8384 C C6  . NAG C 2 .   ? 55.255  -1.088 13.898  1.00 126.28 ? 2    NAG C C6  1 
HETATM 8385 C C7  . NAG C 2 .   ? 53.264  5.228  14.153  1.00 105.36 ? 2    NAG C C7  1 
HETATM 8386 C C8  . NAG C 2 .   ? 53.844  6.491  14.717  1.00 103.86 ? 2    NAG C C8  1 
HETATM 8387 N N2  . NAG C 2 .   ? 53.387  4.147  14.918  1.00 112.75 ? 2    NAG C N2  1 
HETATM 8388 O O3  . NAG C 2 .   ? 51.674  1.885  15.493  1.00 118.40 ? 2    NAG C O3  1 
HETATM 8389 O O4  . NAG C 2 .   ? 53.067  -0.611 15.742  1.00 124.84 ? 2    NAG C O4  1 
HETATM 8390 O O5  . NAG C 2 .   ? 55.277  1.291  13.515  1.00 120.38 ? 2    NAG C O5  1 
HETATM 8391 O O6  . NAG C 2 .   ? 54.642  -1.250 12.615  1.00 129.12 ? 2    NAG C O6  1 
HETATM 8392 O O7  . NAG C 2 .   ? 52.716  5.194  13.064  1.00 99.41  ? 2    NAG C O7  1 
HETATM 8393 C C1  . FUC C 2 .   ? 58.902  3.474  16.525  1.00 108.76 ? 3    FUC C C1  1 
HETATM 8394 C C2  . FUC C 2 .   ? 58.990  2.286  17.480  1.00 113.47 ? 3    FUC C C2  1 
HETATM 8395 C C3  . FUC C 2 .   ? 59.710  1.110  16.837  1.00 115.14 ? 3    FUC C C3  1 
HETATM 8396 C C4  . FUC C 2 .   ? 61.047  1.569  16.276  1.00 112.14 ? 3    FUC C C4  1 
HETATM 8397 C C5  . FUC C 2 .   ? 60.838  2.743  15.330  1.00 106.05 ? 3    FUC C C5  1 
HETATM 8398 C C6  . FUC C 2 .   ? 62.168  3.231  14.767  1.00 101.08 ? 3    FUC C C6  1 
HETATM 8399 O O2  . FUC C 2 .   ? 57.671  1.884  17.868  1.00 115.17 ? 3    FUC C O2  1 
HETATM 8400 O O3  . FUC C 2 .   ? 59.925  0.085  17.814  1.00 118.57 ? 3    FUC C O3  1 
HETATM 8401 O O4  . FUC C 2 .   ? 61.906  1.965  17.350  1.00 114.47 ? 3    FUC C O4  1 
HETATM 8402 O O5  . FUC C 2 .   ? 60.190  3.818  16.012  1.00 105.92 ? 3    FUC C O5  1 
HETATM 8403 C C1  . NAG D 2 .   ? 128.505 58.361 21.621  1.00 64.93  ? 1    NAG D C1  1 
HETATM 8404 C C2  . NAG D 2 .   ? 129.230 58.759 20.339  1.00 85.75  ? 1    NAG D C2  1 
HETATM 8405 C C3  . NAG D 2 .   ? 129.436 57.562 19.421  1.00 91.19  ? 1    NAG D C3  1 
HETATM 8406 C C4  . NAG D 2 .   ? 130.092 56.429 20.193  1.00 94.66  ? 1    NAG D C4  1 
HETATM 8407 C C5  . NAG D 2 .   ? 129.278 56.107 21.439  1.00 84.08  ? 1    NAG D C5  1 
HETATM 8408 C C6  . NAG D 2 .   ? 129.927 54.982 22.237  1.00 92.74  ? 1    NAG D C6  1 
HETATM 8409 C C7  . NAG D 2 .   ? 128.578 61.071 19.998  1.00 104.00 ? 1    NAG D C7  1 
HETATM 8410 C C8  . NAG D 2 .   ? 129.947 61.537 20.396  1.00 105.26 ? 1    NAG D C8  1 
HETATM 8411 N N2  . NAG D 2 .   ? 128.484 59.792 19.646  1.00 95.52  ? 1    NAG D N2  1 
HETATM 8412 O O3  . NAG D 2 .   ? 130.269 57.939 18.320  1.00 92.45  ? 1    NAG D O3  1 
HETATM 8413 O O4  . NAG D 2 .   ? 130.176 55.267 19.361  1.00 105.77 ? 1    NAG D O4  1 
HETATM 8414 O O5  . NAG D 2 .   ? 129.161 57.267 22.265  1.00 70.40  ? 1    NAG D O5  1 
HETATM 8415 O O6  . NAG D 2 .   ? 131.178 55.434 22.767  1.00 101.83 ? 1    NAG D O6  1 
HETATM 8416 O O7  . NAG D 2 .   ? 127.613 61.817 19.997  1.00 107.27 ? 1    NAG D O7  1 
HETATM 8417 C C1  . NAG D 2 .   ? 131.531 54.780 19.384  1.00 121.29 ? 2    NAG D C1  1 
HETATM 8418 C C2  . NAG D 2 .   ? 131.588 53.404 18.728  1.00 127.97 ? 2    NAG D C2  1 
HETATM 8419 C C3  . NAG D 2 .   ? 133.014 52.874 18.672  1.00 135.25 ? 2    NAG D C3  1 
HETATM 8420 C C4  . NAG D 2 .   ? 133.926 53.914 18.043  1.00 136.57 ? 2    NAG D C4  1 
HETATM 8421 C C5  . NAG D 2 .   ? 133.798 55.238 18.785  1.00 135.01 ? 2    NAG D C5  1 
HETATM 8422 C C6  . NAG D 2 .   ? 134.694 56.300 18.160  1.00 134.44 ? 2    NAG D C6  1 
HETATM 8423 C C7  . NAG D 2 .   ? 129.428 52.426 19.243  1.00 125.54 ? 2    NAG D C7  1 
HETATM 8424 C C8  . NAG D 2 .   ? 128.657 51.536 20.172  1.00 124.50 ? 2    NAG D C8  1 
HETATM 8425 N N2  . NAG D 2 .   ? 130.741 52.474 19.449  1.00 126.89 ? 2    NAG D N2  1 
HETATM 8426 O O3  . NAG D 2 .   ? 133.049 51.671 17.897  1.00 138.43 ? 2    NAG D O3  1 
HETATM 8427 O O4  . NAG D 2 .   ? 135.283 53.461 18.101  1.00 135.91 ? 2    NAG D O4  1 
HETATM 8428 O O5  . NAG D 2 .   ? 132.442 55.687 18.761  1.00 130.79 ? 2    NAG D O5  1 
HETATM 8429 O O6  . NAG D 2 .   ? 134.673 57.480 18.972  1.00 133.00 ? 2    NAG D O6  1 
HETATM 8430 O O7  . NAG D 2 .   ? 128.886 53.064 18.355  1.00 125.08 ? 2    NAG D O7  1 
HETATM 8431 C C1  . FUC D 2 .   ? 131.230 55.131 24.167  1.00 103.66 ? 3    FUC D C1  1 
HETATM 8432 C C2  . FUC D 2 .   ? 132.682 55.125 24.636  1.00 109.28 ? 3    FUC D C2  1 
HETATM 8433 C C3  . FUC D 2 .   ? 133.257 56.533 24.678  1.00 110.84 ? 3    FUC D C3  1 
HETATM 8434 C C4  . FUC D 2 .   ? 132.339 57.441 25.480  1.00 103.86 ? 3    FUC D C4  1 
HETATM 8435 C C5  . FUC D 2 .   ? 130.925 57.379 24.917  1.00 99.32  ? 3    FUC D C5  1 
HETATM 8436 C C6  . FUC D 2 .   ? 129.982 58.271 25.715  1.00 96.33  ? 3    FUC D C6  1 
HETATM 8437 O O2  . FUC D 2 .   ? 133.467 54.315 23.754  1.00 111.50 ? 3    FUC D O2  1 
HETATM 8438 O O3  . FUC D 2 .   ? 134.554 56.505 25.284  1.00 115.82 ? 3    FUC D O3  1 
HETATM 8439 O O4  . FUC D 2 .   ? 132.328 57.023 26.849  1.00 103.97 ? 3    FUC D O4  1 
HETATM 8440 O O5  . FUC D 2 .   ? 130.442 56.035 24.943  1.00 100.64 ? 3    FUC D O5  1 
HETATM 8441 C C1  . NAG E 3 .   ? 26.477  24.631 47.094  1.00 87.07  ? 604  NAG A C1  1 
HETATM 8442 C C2  . NAG E 3 .   ? 25.640  25.920 46.980  1.00 102.22 ? 604  NAG A C2  1 
HETATM 8443 C C3  . NAG E 3 .   ? 25.908  26.845 48.180  1.00 106.78 ? 604  NAG A C3  1 
HETATM 8444 C C4  . NAG E 3 .   ? 25.815  26.092 49.502  1.00 107.97 ? 604  NAG A C4  1 
HETATM 8445 C C5  . NAG E 3 .   ? 26.682  24.841 49.459  1.00 106.72 ? 604  NAG A C5  1 
HETATM 8446 C C6  . NAG E 3 .   ? 26.579  23.992 50.705  1.00 108.71 ? 604  NAG A C6  1 
HETATM 8447 C C7  . NAG E 3 .   ? 25.378  27.754 45.327  1.00 120.57 ? 604  NAG A C7  1 
HETATM 8448 C C8  . NAG E 3 .   ? 25.835  28.274 43.996  1.00 116.29 ? 604  NAG A C8  1 
HETATM 8449 N N2  . NAG E 3 .   ? 25.939  26.604 45.728  1.00 113.55 ? 604  NAG A N2  1 
HETATM 8450 O O3  . NAG E 3 .   ? 24.960  27.907 48.190  1.00 109.39 ? 604  NAG A O3  1 
HETATM 8451 O O4  . NAG E 3 .   ? 26.254  26.931 50.565  1.00 109.28 ? 604  NAG A O4  1 
HETATM 8452 O O5  . NAG E 3 .   ? 26.257  24.023 48.364  1.00 101.19 ? 604  NAG A O5  1 
HETATM 8453 O O6  . NAG E 3 .   ? 27.572  22.975 50.721  1.00 110.74 ? 604  NAG A O6  1 
HETATM 8454 O O7  . NAG E 3 .   ? 24.544  28.350 46.004  1.00 127.27 ? 604  NAG A O7  1 
HETATM 8455 C C1  . NAG F 3 .   ? 81.030  18.685 24.578  1.00 107.17 ? 605  NAG A C1  1 
HETATM 8456 C C2  . NAG F 3 .   ? 82.412  18.560 25.209  1.00 120.80 ? 605  NAG A C2  1 
HETATM 8457 C C3  . NAG F 3 .   ? 82.415  17.512 26.315  1.00 124.17 ? 605  NAG A C3  1 
HETATM 8458 C C4  . NAG F 3 .   ? 81.256  17.734 27.280  1.00 122.63 ? 605  NAG A C4  1 
HETATM 8459 C C5  . NAG F 3 .   ? 79.943  17.909 26.526  1.00 117.25 ? 605  NAG A C5  1 
HETATM 8460 C C6  . NAG F 3 .   ? 78.798  18.207 27.486  1.00 113.00 ? 605  NAG A C6  1 
HETATM 8461 C C7  . NAG F 3 .   ? 83.371  17.033 23.585  1.00 130.64 ? 605  NAG A C7  1 
HETATM 8462 C C8  . NAG F 3 .   ? 84.466  16.800 22.587  1.00 128.82 ? 605  NAG A C8  1 
HETATM 8463 N N2  . NAG F 3 .   ? 83.390  18.215 24.196  1.00 127.45 ? 605  NAG A N2  1 
HETATM 8464 O O3  . NAG F 3 .   ? 83.652  17.578 27.032  1.00 125.60 ? 605  NAG A O3  1 
HETATM 8465 O O4  . NAG F 3 .   ? 81.152  16.614 28.166  1.00 123.22 ? 605  NAG A O4  1 
HETATM 8466 O O5  . NAG F 3 .   ? 80.070  18.978 25.591  1.00 113.01 ? 605  NAG A O5  1 
HETATM 8467 O O6  . NAG F 3 .   ? 78.044  19.322 26.998  1.00 109.05 ? 605  NAG A O6  1 
HETATM 8468 O O7  . NAG F 3 .   ? 82.518  16.194 23.822  1.00 132.86 ? 605  NAG A O7  1 
HETATM 8469 P P1  . VX  G 4 .   ? 53.724  25.782 22.763  1.00 48.14  ? 606  VX  A P1  1 
HETATM 8470 O O1  . VX  G 4 .   ? 53.509  26.143 24.222  1.00 35.97  ? 606  VX  A O1  1 
HETATM 8471 O O2  . VX  G 4 .   ? 54.887  24.618 22.656  1.00 55.24  ? 606  VX  A O2  1 
HETATM 8472 C C1  . VX  G 4 .   ? 52.128  25.176 22.031  1.00 42.58  ? 606  VX  A C1  1 
HETATM 8473 C C2  . VX  G 4 .   ? 54.518  23.268 22.676  1.00 67.25  ? 606  VX  A C2  1 
HETATM 8474 C C3  . VX  G 4 .   ? 54.166  22.826 24.096  1.00 66.43  ? 606  VX  A C3  1 
HETATM 8475 O O3  . HI6 H 5 .   ? 49.102  12.831 30.676  1.00 69.53  ? 607  HI6 A O3  1 
HETATM 8476 C C14 . HI6 H 5 .   ? 49.058  14.019 30.519  1.00 65.10  ? 607  HI6 A C14 1 
HETATM 8477 N N4  . HI6 H 5 .   ? 48.479  14.791 31.408  1.00 63.23  ? 607  HI6 A N4  1 
HETATM 8478 C C11 . HI6 H 5 .   ? 49.651  14.640 29.305  1.00 56.79  ? 607  HI6 A C11 1 
HETATM 8479 C C10 . HI6 H 5 .   ? 50.008  13.871 28.234  1.00 61.83  ? 607  HI6 A C10 1 
HETATM 8480 C C9  . HI6 H 5 .   ? 50.548  14.455 27.119  1.00 59.96  ? 607  HI6 A C9  1 
HETATM 8481 N N3  . HI6 H 5 .   ? 50.718  15.749 27.069  1.00 60.62  ? 607  HI6 A N3  1 
HETATM 8482 C C13 . HI6 H 5 .   ? 50.378  16.522 28.082  1.00 54.38  ? 607  HI6 A C13 1 
HETATM 8483 C C12 . HI6 H 5 .   ? 49.837  15.988 29.224  1.00 55.26  ? 607  HI6 A C12 1 
HETATM 8484 C C8  . HI6 H 5 .   ? 51.289  16.291 25.863  1.00 64.17  ? 607  HI6 A C8  1 
HETATM 8485 O O2  . HI6 H 5 .   ? 52.623  15.856 25.791  1.00 69.65  ? 607  HI6 A O2  1 
HETATM 8486 C C7  . HI6 H 5 .   ? 53.003  15.526 24.477  1.00 75.79  ? 607  HI6 A C7  1 
HETATM 8487 N N2  . HI6 H 5 .   ? 53.626  16.656 23.813  1.00 75.58  ? 607  HI6 A N2  1 
HETATM 8488 C C2  . HI6 H 5 .   ? 52.975  17.312 22.782  1.00 77.99  ? 607  HI6 A C2  1 
HETATM 8489 C C1  . HI6 H 5 .   ? 51.647  16.886 22.380  1.00 86.63  ? 607  HI6 A C1  1 
HETATM 8490 N N1  . HI6 H 5 .   ? 50.858  17.757 22.006  1.00 95.77  ? 607  HI6 A N1  1 
HETATM 8491 O O1  . HI6 H 5 .   ? 49.596  17.331 21.664  1.00 103.79 ? 607  HI6 A O1  1 
HETATM 8492 C C3  . HI6 H 5 .   ? 53.540  18.388 22.156  1.00 74.62  ? 607  HI6 A C3  1 
HETATM 8493 C C4  . HI6 H 5 .   ? 54.783  18.798 22.543  1.00 73.44  ? 607  HI6 A C4  1 
HETATM 8494 C C5  . HI6 H 5 .   ? 55.416  18.124 23.558  1.00 73.39  ? 607  HI6 A C5  1 
HETATM 8495 C C6  . HI6 H 5 .   ? 54.822  17.055 24.180  1.00 73.37  ? 607  HI6 A C6  1 
HETATM 8496 C C1  . NAG I 3 .   ? 116.271 61.649 45.696  1.00 116.73 ? 604  NAG B C1  1 
HETATM 8497 C C2  . NAG I 3 .   ? 116.696 63.090 45.989  1.00 129.91 ? 604  NAG B C2  1 
HETATM 8498 C C3  . NAG I 3 .   ? 118.132 63.122 46.510  1.00 129.98 ? 604  NAG B C3  1 
HETATM 8499 C C4  . NAG I 3 .   ? 118.301 62.163 47.682  1.00 131.88 ? 604  NAG B C4  1 
HETATM 8500 C C5  . NAG I 3 .   ? 117.794 60.772 47.311  1.00 130.10 ? 604  NAG B C5  1 
HETATM 8501 C C6  . NAG I 3 .   ? 117.844 59.793 48.461  1.00 130.69 ? 604  NAG B C6  1 
HETATM 8502 C C7  . NAG I 3 .   ? 115.966 65.114 44.801  1.00 143.99 ? 604  NAG B C7  1 
HETATM 8503 C C8  . NAG I 3 .   ? 115.924 65.828 43.483  1.00 143.14 ? 604  NAG B C8  1 
HETATM 8504 N N2  . NAG I 3 .   ? 116.566 63.920 44.801  1.00 140.44 ? 604  NAG B N2  1 
HETATM 8505 O O3  . NAG I 3 .   ? 118.463 64.446 46.911  1.00 127.57 ? 604  NAG B O3  1 
HETATM 8506 O O4  . NAG I 3 .   ? 119.676 62.078 48.043  1.00 133.34 ? 604  NAG B O4  1 
HETATM 8507 O O5  . NAG I 3 .   ? 116.427 60.849 46.879  1.00 125.46 ? 604  NAG B O5  1 
HETATM 8508 O O6  . NAG I 3 .   ? 119.112 59.157 48.543  1.00 130.80 ? 604  NAG B O6  1 
HETATM 8509 O O7  . NAG I 3 .   ? 115.479 65.598 45.819  1.00 144.69 ? 604  NAG B O7  1 
HETATM 8510 P P1  . VX  J 4 .   ? 111.728 41.402 27.744  1.00 45.91  ? 605  VX  B P1  1 
HETATM 8511 O O1  . VX  J 4 .   ? 111.977 40.338 28.792  1.00 41.76  ? 605  VX  B O1  1 
HETATM 8512 O O2  . VX  J 4 .   ? 112.685 42.717 28.018  1.00 48.53  ? 605  VX  B O2  1 
HETATM 8513 C C1  . VX  J 4 .   ? 112.129 40.696 26.069  1.00 40.12  ? 605  VX  B C1  1 
HETATM 8514 C C2  . VX  J 4 .   ? 113.726 42.633 28.950  1.00 54.03  ? 605  VX  B C2  1 
HETATM 8515 C C3  . VX  J 4 .   ? 114.916 41.911 28.322  1.00 56.48  ? 605  VX  B C3  1 
HETATM 8516 O O3  . HI6 K 5 .   ? 126.432 36.599 28.580  1.00 99.86  ? 606  HI6 B O3  1 
HETATM 8517 C C14 . HI6 K 5 .   ? 125.249 36.491 28.773  1.00 94.93  ? 606  HI6 B C14 1 
HETATM 8518 N N4  . HI6 K 5 .   ? 124.733 35.426 29.359  1.00 95.57  ? 606  HI6 B N4  1 
HETATM 8519 C C11 . HI6 K 5 .   ? 124.367 37.584 28.320  1.00 89.85  ? 606  HI6 B C11 1 
HETATM 8520 C C10 . HI6 K 5 .   ? 124.920 38.648 27.671  1.00 89.55  ? 606  HI6 B C10 1 
HETATM 8521 C C9  . HI6 K 5 .   ? 124.089 39.659 27.254  1.00 92.31  ? 606  HI6 B C9  1 
HETATM 8522 N N3  . HI6 K 5 .   ? 122.783 39.605 27.461  1.00 91.36  ? 606  HI6 B N3  1 
HETATM 8523 C C13 . HI6 K 5 .   ? 122.227 38.583 28.083  1.00 89.63  ? 606  HI6 B C13 1 
HETATM 8524 C C12 . HI6 K 5 .   ? 123.015 37.546 28.530  1.00 89.97  ? 606  HI6 B C12 1 
HETATM 8525 C C8  . HI6 K 5 .   ? 121.969 40.701 26.982  1.00 91.86  ? 606  HI6 B C8  1 
HETATM 8526 O O2  . HI6 K 5 .   ? 121.889 41.624 28.032  1.00 87.38  ? 606  HI6 B O2  1 
HETATM 8527 C C7  . HI6 K 5 .   ? 121.905 42.953 27.590  1.00 82.51  ? 606  HI6 B C7  1 
HETATM 8528 N N2  . HI6 K 5 .   ? 120.546 43.433 27.640  1.00 80.63  ? 606  HI6 B N2  1 
HETATM 8529 C C2  . HI6 K 5 .   ? 119.740 43.332 26.525  1.00 79.03  ? 606  HI6 B C2  1 
HETATM 8530 C C1  . HI6 K 5 .   ? 120.238 42.736 25.291  1.00 83.57  ? 606  HI6 B C1  1 
HETATM 8531 N N1  . HI6 K 5 .   ? 119.393 42.278 24.506  1.00 91.02  ? 606  HI6 B N1  1 
HETATM 8532 O O1  . HI6 K 5 .   ? 119.814 41.702 23.328  1.00 95.82  ? 606  HI6 B O1  1 
HETATM 8533 C C3  . HI6 K 5 .   ? 118.457 43.779 26.583  1.00 81.60  ? 606  HI6 B C3  1 
HETATM 8534 C C4  . HI6 K 5 .   ? 117.982 44.332 27.746  1.00 84.23  ? 606  HI6 B C4  1 
HETATM 8535 C C5  . HI6 K 5 .   ? 118.799 44.427 28.841  1.00 83.56  ? 606  HI6 B C5  1 
HETATM 8536 C C6  . HI6 K 5 .   ? 120.084 43.963 28.750  1.00 82.30  ? 606  HI6 B C6  1 
HETATM 8537 O O   . HOH L 6 .   ? 47.311  19.418 35.827  1.00 74.15  ? 701  HOH A O   1 
HETATM 8538 O O   . HOH L 6 .   ? 25.002  28.493 51.237  1.00 30.00  ? 702  HOH A O   1 
HETATM 8539 O O   . HOH L 6 .   ? 69.925  53.108 18.170  1.00 30.00  ? 703  HOH A O   1 
HETATM 8540 O O   . HOH L 6 .   ? 38.123  35.577 29.502  1.00 64.50  ? 704  HOH A O   1 
HETATM 8541 O O   . HOH L 6 .   ? 68.864  54.980 37.661  1.00 30.00  ? 705  HOH A O   1 
HETATM 8542 O O   . HOH L 6 .   ? 40.655  13.695 4.114   1.00 79.30  ? 706  HOH A O   1 
HETATM 8543 O O   . HOH L 6 .   ? 65.194  22.974 7.479   1.00 69.12  ? 707  HOH A O   1 
HETATM 8544 O O   . HOH L 6 .   ? 48.298  51.477 22.115  1.00 75.41  ? 708  HOH A O   1 
HETATM 8545 O O   . HOH L 6 .   ? 59.311  17.463 24.493  1.00 58.01  ? 709  HOH A O   1 
HETATM 8546 O O   . HOH L 6 .   ? 29.095  21.653 38.364  1.00 74.52  ? 710  HOH A O   1 
HETATM 8547 O O   . HOH L 6 .   ? 79.169  27.197 23.673  1.00 47.85  ? 711  HOH A O   1 
HETATM 8548 O O   . HOH L 6 .   ? 68.366  30.890 5.692   1.00 65.20  ? 712  HOH A O   1 
HETATM 8549 O O   . HOH L 6 .   ? 40.590  22.526 14.573  1.00 65.25  ? 713  HOH A O   1 
HETATM 8550 O O   . HOH L 6 .   ? 55.898  19.533 -4.276  1.00 70.10  ? 714  HOH A O   1 
HETATM 8551 O O   . HOH L 6 .   ? 53.678  29.600 45.947  1.00 39.02  ? 715  HOH A O   1 
HETATM 8552 O O   . HOH L 6 .   ? 69.898  32.944 55.209  1.00 50.47  ? 716  HOH A O   1 
HETATM 8553 O O   . HOH L 6 .   ? 48.697  17.637 31.964  1.00 53.17  ? 717  HOH A O   1 
HETATM 8554 O O   . HOH L 6 .   ? 49.689  39.751 7.452   1.00 69.56  ? 718  HOH A O   1 
HETATM 8555 O O   . HOH L 6 .   ? 26.943  25.439 41.666  1.00 65.66  ? 719  HOH A O   1 
HETATM 8556 O O   . HOH L 6 .   ? 49.840  27.151 -0.121  1.00 79.56  ? 720  HOH A O   1 
HETATM 8557 O O   . HOH L 6 .   ? 45.851  36.281 3.943   1.00 58.45  ? 721  HOH A O   1 
HETATM 8558 O O   . HOH L 6 .   ? 70.044  35.911 6.609   1.00 53.66  ? 722  HOH A O   1 
HETATM 8559 O O   . HOH L 6 .   ? 61.525  41.951 55.936  1.00 50.96  ? 723  HOH A O   1 
HETATM 8560 O O   . HOH L 6 .   ? 71.628  44.672 42.613  1.00 60.46  ? 724  HOH A O   1 
HETATM 8561 O O   . HOH L 6 .   ? 67.116  13.533 6.504   1.00 67.79  ? 725  HOH A O   1 
HETATM 8562 O O   . HOH L 6 .   ? 70.508  32.329 36.321  1.00 55.59  ? 726  HOH A O   1 
HETATM 8563 O O   . HOH L 6 .   ? 47.187  13.811 -9.282  1.00 62.13  ? 727  HOH A O   1 
HETATM 8564 O O   . HOH L 6 .   ? 37.985  44.186 26.538  1.00 64.06  ? 728  HOH A O   1 
HETATM 8565 O O   . HOH L 6 .   ? 74.729  41.203 22.651  1.00 51.47  ? 729  HOH A O   1 
HETATM 8566 O O   . HOH L 6 .   ? 68.655  26.395 35.405  1.00 46.32  ? 730  HOH A O   1 
HETATM 8567 O O   . HOH L 6 .   ? 54.990  12.487 26.589  1.00 71.01  ? 731  HOH A O   1 
HETATM 8568 O O   . HOH L 6 .   ? 42.601  31.343 20.536  1.00 49.09  ? 732  HOH A O   1 
HETATM 8569 O O   . HOH L 6 .   ? 79.167  22.264 17.952  1.00 57.45  ? 733  HOH A O   1 
HETATM 8570 O O   . HOH L 6 .   ? 44.921  31.463 11.884  1.00 44.07  ? 734  HOH A O   1 
HETATM 8571 O O   . HOH L 6 .   ? 52.459  40.221 45.283  1.00 50.60  ? 735  HOH A O   1 
HETATM 8572 O O   . HOH L 6 .   ? 57.084  18.783 31.871  1.00 52.94  ? 736  HOH A O   1 
HETATM 8573 O O   . HOH L 6 .   ? 54.742  31.966 46.728  1.00 39.80  ? 737  HOH A O   1 
HETATM 8574 O O   . HOH L 6 .   ? 60.247  32.234 17.364  1.00 44.53  ? 738  HOH A O   1 
HETATM 8575 O O   . HOH L 6 .   ? 45.496  26.189 41.419  1.00 43.63  ? 739  HOH A O   1 
HETATM 8576 O O   . HOH L 6 .   ? 50.421  19.228 33.296  1.00 39.22  ? 740  HOH A O   1 
HETATM 8577 O O   . HOH L 6 .   ? 66.530  29.611 33.957  1.00 50.97  ? 741  HOH A O   1 
HETATM 8578 O O   . HOH L 6 .   ? 60.605  12.485 26.597  1.00 59.34  ? 742  HOH A O   1 
HETATM 8579 O O   . HOH L 6 .   ? 55.044  45.428 34.815  1.00 50.33  ? 743  HOH A O   1 
HETATM 8580 O O   . HOH L 6 .   ? 56.222  27.960 51.424  1.00 75.18  ? 744  HOH A O   1 
HETATM 8581 O O   . HOH L 6 .   ? 59.239  21.025 8.378   1.00 69.32  ? 745  HOH A O   1 
HETATM 8582 O O   . HOH L 6 .   ? 52.240  37.639 5.363   1.00 45.24  ? 746  HOH A O   1 
HETATM 8583 O O   . HOH L 6 .   ? 55.185  11.469 33.440  1.00 54.71  ? 747  HOH A O   1 
HETATM 8584 O O   . HOH L 6 .   ? 70.457  35.383 29.299  1.00 46.73  ? 748  HOH A O   1 
HETATM 8585 O O   . HOH L 6 .   ? 46.758  16.848 21.462  1.00 68.97  ? 749  HOH A O   1 
HETATM 8586 O O   . HOH L 6 .   ? 58.906  28.758 26.173  1.00 43.04  ? 750  HOH A O   1 
HETATM 8587 O O   . HOH L 6 .   ? 66.972  12.794 9.222   1.00 61.19  ? 751  HOH A O   1 
HETATM 8588 O O   . HOH L 6 .   ? 63.765  32.318 33.566  1.00 42.59  ? 752  HOH A O   1 
HETATM 8589 O O   . HOH L 6 .   ? 46.515  21.537 47.437  1.00 58.50  ? 753  HOH A O   1 
HETATM 8590 O O   . HOH L 6 .   ? 53.978  22.126 1.652   1.00 75.78  ? 754  HOH A O   1 
HETATM 8591 O O   . HOH L 6 .   ? 39.428  16.853 11.993  1.00 59.73  ? 755  HOH A O   1 
HETATM 8592 O O   . HOH L 6 .   ? 76.729  43.130 35.174  1.00 69.01  ? 756  HOH A O   1 
HETATM 8593 O O   . HOH L 6 .   ? 45.893  20.908 30.174  1.00 53.37  ? 757  HOH A O   1 
HETATM 8594 O O   . HOH L 6 .   ? 40.370  21.961 17.930  1.00 62.69  ? 758  HOH A O   1 
HETATM 8595 O O   . HOH L 6 .   ? 66.616  48.153 48.510  1.00 64.23  ? 759  HOH A O   1 
HETATM 8596 O O   . HOH L 6 .   ? 58.707  22.101 15.161  1.00 42.97  ? 760  HOH A O   1 
HETATM 8597 O O   . HOH L 6 .   ? 40.872  11.620 24.404  1.00 30.00  ? 761  HOH A O   1 
HETATM 8598 O O   . HOH L 6 .   ? 63.037  52.510 27.122  1.00 56.22  ? 762  HOH A O   1 
HETATM 8599 O O   . HOH L 6 .   ? 61.595  16.400 34.938  1.00 56.64  ? 763  HOH A O   1 
HETATM 8600 O O   . HOH L 6 .   ? 40.191  25.625 30.381  1.00 36.61  ? 764  HOH A O   1 
HETATM 8601 O O   . HOH L 6 .   ? 57.084  21.514 27.913  1.00 42.93  ? 765  HOH A O   1 
HETATM 8602 O O   . HOH L 6 .   ? 68.987  43.637 54.797  1.00 61.78  ? 766  HOH A O   1 
HETATM 8603 O O   . HOH L 6 .   ? 39.724  41.681 27.090  1.00 63.13  ? 767  HOH A O   1 
HETATM 8604 O O   . HOH L 6 .   ? 58.788  25.982 29.247  1.00 37.88  ? 768  HOH A O   1 
HETATM 8605 O O   . HOH L 6 .   ? 38.189  23.510 32.241  1.00 40.38  ? 769  HOH A O   1 
HETATM 8606 O O   . HOH L 6 .   ? 65.054  20.535 32.091  1.00 46.56  ? 770  HOH A O   1 
HETATM 8607 O O   . HOH L 6 .   ? 54.664  48.046 11.236  1.00 48.30  ? 771  HOH A O   1 
HETATM 8608 O O   . HOH L 6 .   ? 60.018  28.619 18.721  1.00 40.75  ? 772  HOH A O   1 
HETATM 8609 O O   . HOH L 6 .   ? 50.740  10.983 9.756   1.00 52.56  ? 773  HOH A O   1 
HETATM 8610 O O   . HOH L 6 .   ? 58.263  32.812 32.649  1.00 38.65  ? 774  HOH A O   1 
HETATM 8611 O O   . HOH L 6 .   ? 40.703  24.970 21.704  1.00 52.61  ? 775  HOH A O   1 
HETATM 8612 O O   . HOH L 6 .   ? 59.353  49.682 40.482  1.00 53.53  ? 776  HOH A O   1 
HETATM 8613 O O   . HOH L 6 .   ? 49.980  19.149 46.592  1.00 53.87  ? 777  HOH A O   1 
HETATM 8614 O O   . HOH L 6 .   ? 82.196  26.185 22.537  1.00 30.00  ? 778  HOH A O   1 
HETATM 8615 O O   . HOH L 6 .   ? 49.643  47.493 7.375   1.00 67.57  ? 779  HOH A O   1 
HETATM 8616 O O   . HOH L 6 .   ? 62.439  50.758 11.500  1.00 66.89  ? 780  HOH A O   1 
HETATM 8617 O O   . HOH L 6 .   ? 46.252  11.854 31.108  1.00 56.07  ? 781  HOH A O   1 
HETATM 8618 O O   . HOH L 6 .   ? 63.510  31.788 47.765  1.00 49.34  ? 782  HOH A O   1 
HETATM 8619 O O   . HOH L 6 .   ? 38.576  35.306 32.835  1.00 62.94  ? 783  HOH A O   1 
HETATM 8620 O O   . HOH L 6 .   ? 57.833  25.054 46.941  1.00 47.97  ? 784  HOH A O   1 
HETATM 8621 O O   . HOH L 6 .   ? 68.543  25.756 16.160  1.00 57.97  ? 785  HOH A O   1 
HETATM 8622 O O   . HOH L 6 .   ? 47.663  24.741 42.711  1.00 50.74  ? 786  HOH A O   1 
HETATM 8623 O O   . HOH L 6 .   ? 50.845  3.971  10.357  1.00 74.33  ? 787  HOH A O   1 
HETATM 8624 O O   . HOH L 6 .   ? 47.265  22.804 29.002  1.00 46.45  ? 788  HOH A O   1 
HETATM 8625 O O   . HOH L 6 .   ? 59.567  42.939 9.562   1.00 52.17  ? 789  HOH A O   1 
HETATM 8626 O O   . HOH L 6 .   ? 49.003  14.690 22.103  1.00 77.51  ? 790  HOH A O   1 
HETATM 8627 O O   . HOH L 6 .   ? 39.435  34.377 36.433  1.00 63.83  ? 791  HOH A O   1 
HETATM 8628 O O   . HOH L 6 .   ? 62.134  30.615 41.265  1.00 39.29  ? 792  HOH A O   1 
HETATM 8629 O O   . HOH L 6 .   ? 60.985  17.222 39.342  1.00 63.39  ? 793  HOH A O   1 
HETATM 8630 O O   . HOH L 6 .   ? 64.413  29.860 3.796   1.00 60.57  ? 794  HOH A O   1 
HETATM 8631 O O   . HOH L 6 .   ? 69.073  14.004 28.707  1.00 78.95  ? 795  HOH A O   1 
HETATM 8632 O O   . HOH L 6 .   ? 67.482  12.267 17.538  1.00 58.24  ? 796  HOH A O   1 
HETATM 8633 O O   . HOH L 6 .   ? 40.090  28.404 38.019  1.00 43.09  ? 797  HOH A O   1 
HETATM 8634 O O   . HOH L 6 .   ? 58.997  16.407 41.877  1.00 54.78  ? 798  HOH A O   1 
HETATM 8635 O O   . HOH L 6 .   ? 58.345  29.716 7.191   1.00 59.89  ? 799  HOH A O   1 
HETATM 8636 O O   . HOH L 6 .   ? 56.490  26.099 36.554  1.00 36.92  ? 800  HOH A O   1 
HETATM 8637 O O   . HOH L 6 .   ? 47.293  32.552 46.222  1.00 47.95  ? 801  HOH A O   1 
HETATM 8638 O O   . HOH L 6 .   ? 64.543  29.595 46.617  1.00 40.30  ? 802  HOH A O   1 
HETATM 8639 O O   . HOH L 6 .   ? 43.802  21.285 47.205  1.00 60.66  ? 803  HOH A O   1 
HETATM 8640 O O   . HOH L 6 .   ? 59.619  17.526 27.155  1.00 50.35  ? 804  HOH A O   1 
HETATM 8641 O O   . HOH L 6 .   ? 40.999  28.593 32.262  1.00 43.58  ? 805  HOH A O   1 
HETATM 8642 O O   . HOH L 6 .   ? 58.108  24.062 7.361   1.00 64.56  ? 806  HOH A O   1 
HETATM 8643 O O   . HOH L 6 .   ? 52.903  26.654 29.385  1.00 38.86  ? 807  HOH A O   1 
HETATM 8644 O O   . HOH L 6 .   ? 44.167  23.329 23.249  1.00 44.30  ? 808  HOH A O   1 
HETATM 8645 O O   . HOH L 6 .   ? 31.468  21.331 24.081  1.00 69.54  ? 809  HOH A O   1 
HETATM 8646 O O   . HOH L 6 .   ? 43.234  40.900 37.789  1.00 69.67  ? 810  HOH A O   1 
HETATM 8647 O O   . HOH L 6 .   ? 61.674  47.428 27.900  1.00 51.68  ? 811  HOH A O   1 
HETATM 8648 O O   . HOH L 6 .   ? 57.414  26.853 9.766   1.00 50.66  ? 812  HOH A O   1 
HETATM 8649 O O   . HOH L 6 .   ? 70.389  36.742 9.887   1.00 55.27  ? 813  HOH A O   1 
HETATM 8650 O O   . HOH L 6 .   ? 56.288  45.351 5.473   1.00 60.28  ? 814  HOH A O   1 
HETATM 8651 O O   . HOH L 6 .   ? 57.587  37.226 58.800  1.00 77.59  ? 815  HOH A O   1 
HETATM 8652 O O   . HOH L 6 .   ? 39.861  38.161 2.370   1.00 76.29  ? 816  HOH A O   1 
HETATM 8653 O O   . HOH L 6 .   ? 55.870  19.155 0.576   1.00 60.88  ? 817  HOH A O   1 
HETATM 8654 O O   . HOH L 6 .   ? 66.252  26.770 22.622  1.00 42.98  ? 818  HOH A O   1 
HETATM 8655 O O   . HOH L 6 .   ? 50.529  23.858 37.916  1.00 38.64  ? 819  HOH A O   1 
HETATM 8656 O O   . HOH L 6 .   ? 61.626  30.252 49.238  1.00 44.72  ? 820  HOH A O   1 
HETATM 8657 O O   . HOH L 6 .   ? 55.017  33.998 1.352   1.00 53.97  ? 821  HOH A O   1 
HETATM 8658 O O   . HOH L 6 .   ? 32.944  30.956 25.414  1.00 55.66  ? 822  HOH A O   1 
HETATM 8659 O O   . HOH L 6 .   ? 59.133  22.173 32.952  1.00 46.88  ? 823  HOH A O   1 
HETATM 8660 O O   . HOH L 6 .   ? 57.960  19.624 -7.101  1.00 69.96  ? 824  HOH A O   1 
HETATM 8661 O O   . HOH L 6 .   ? 57.087  25.846 23.947  1.00 63.49  ? 825  HOH A O   1 
HETATM 8662 O O   . HOH L 6 .   ? 54.040  14.615 36.816  1.00 47.98  ? 826  HOH A O   1 
HETATM 8663 O O   . HOH L 6 .   ? 45.243  30.859 44.927  1.00 54.71  ? 827  HOH A O   1 
HETATM 8664 O O   . HOH L 6 .   ? 54.692  54.578 22.401  1.00 65.51  ? 828  HOH A O   1 
HETATM 8665 O O   . HOH L 6 .   ? 58.830  23.265 29.110  1.00 37.30  ? 829  HOH A O   1 
HETATM 8666 O O   . HOH L 6 .   ? 27.968  27.741 39.869  1.00 71.20  ? 830  HOH A O   1 
HETATM 8667 O O   . HOH L 6 .   ? 53.589  9.737  16.348  1.00 60.15  ? 831  HOH A O   1 
HETATM 8668 O O   . HOH L 6 .   ? 58.479  34.304 1.738   1.00 62.64  ? 832  HOH A O   1 
HETATM 8669 O O   . HOH L 6 .   ? 81.583  32.870 26.139  1.00 60.84  ? 833  HOH A O   1 
HETATM 8670 O O   . HOH L 6 .   ? 64.988  13.988 3.767   1.00 71.85  ? 834  HOH A O   1 
HETATM 8671 O O   . HOH L 6 .   ? 74.789  46.585 24.338  1.00 71.93  ? 835  HOH A O   1 
HETATM 8672 O O   . HOH L 6 .   ? 57.265  5.898  8.435   1.00 72.47  ? 836  HOH A O   1 
HETATM 8673 O O   . HOH L 6 .   ? 70.386  48.444 28.195  1.00 63.67  ? 837  HOH A O   1 
HETATM 8674 O O   . HOH L 6 .   ? 78.754  36.665 29.644  1.00 59.62  ? 838  HOH A O   1 
HETATM 8675 O O   . HOH L 6 .   ? 62.306  23.159 44.751  1.00 66.05  ? 839  HOH A O   1 
HETATM 8676 O O   . HOH L 6 .   ? 43.983  7.343  6.106   1.00 58.21  ? 840  HOH A O   1 
HETATM 8677 O O   . HOH L 6 .   ? 77.664  34.766 13.336  1.00 58.64  ? 841  HOH A O   1 
HETATM 8678 O O   . HOH L 6 .   ? 34.026  32.338 35.253  1.00 74.96  ? 842  HOH A O   1 
HETATM 8679 O O   . HOH L 6 .   ? 48.903  5.279  0.937   1.00 63.49  ? 843  HOH A O   1 
HETATM 8680 O O   . HOH L 6 .   ? 66.865  22.702 32.180  1.00 44.89  ? 844  HOH A O   1 
HETATM 8681 O O   . HOH L 6 .   ? 55.676  17.530 27.338  1.00 51.59  ? 845  HOH A O   1 
HETATM 8682 O O   . HOH L 6 .   ? 50.194  3.195  5.590   1.00 71.91  ? 846  HOH A O   1 
HETATM 8683 O O   . HOH L 6 .   ? 58.641  52.899 27.218  1.00 65.69  ? 847  HOH A O   1 
HETATM 8684 O O   . HOH L 6 .   ? 55.059  25.617 9.104   1.00 59.92  ? 848  HOH A O   1 
HETATM 8685 O O   . HOH L 6 .   ? 82.021  36.833 36.153  1.00 68.98  ? 849  HOH A O   1 
HETATM 8686 O O   . HOH L 6 .   ? 44.665  28.734 11.736  1.00 45.38  ? 850  HOH A O   1 
HETATM 8687 O O   . HOH L 6 .   ? 66.765  23.714 29.464  1.00 46.72  ? 851  HOH A O   1 
HETATM 8688 O O   . HOH L 6 .   ? 53.468  10.507 -6.448  1.00 54.23  ? 852  HOH A O   1 
HETATM 8689 O O   . HOH L 6 .   ? 56.784  40.032 47.197  1.00 53.62  ? 853  HOH A O   1 
HETATM 8690 O O   . HOH L 6 .   ? 56.289  42.769 47.598  1.00 64.07  ? 854  HOH A O   1 
HETATM 8691 O O   . HOH L 6 .   ? 69.185  50.590 21.888  1.00 58.66  ? 855  HOH A O   1 
HETATM 8692 O O   . HOH L 6 .   ? 60.831  26.527 38.768  1.00 48.15  ? 856  HOH A O   1 
HETATM 8693 O O   . HOH L 6 .   ? 41.930  13.261 5.902   1.00 56.08  ? 857  HOH A O   1 
HETATM 8694 O O   . HOH L 6 .   ? 69.770  22.528 25.366  1.00 67.54  ? 858  HOH A O   1 
HETATM 8695 O O   . HOH L 6 .   ? 51.984  15.518 -2.413  1.00 50.17  ? 859  HOH A O   1 
HETATM 8696 O O   . HOH L 6 .   ? 70.952  30.271 37.097  1.00 57.24  ? 860  HOH A O   1 
HETATM 8697 O O   . HOH L 6 .   ? 58.353  36.191 -1.324  1.00 66.48  ? 861  HOH A O   1 
HETATM 8698 O O   . HOH L 6 .   ? 62.581  44.175 56.993  1.00 76.09  ? 862  HOH A O   1 
HETATM 8699 O O   . HOH L 6 .   ? 70.311  12.632 24.177  1.00 62.20  ? 863  HOH A O   1 
HETATM 8700 O O   . HOH L 6 .   ? 70.834  22.342 20.980  1.00 62.50  ? 864  HOH A O   1 
HETATM 8701 O O   . HOH L 6 .   ? 50.578  35.589 5.661   1.00 43.70  ? 865  HOH A O   1 
HETATM 8702 O O   . HOH L 6 .   ? 69.056  22.405 22.627  1.00 49.04  ? 866  HOH A O   1 
HETATM 8703 O O   . HOH L 6 .   ? 67.781  43.125 52.187  1.00 51.64  ? 867  HOH A O   1 
HETATM 8704 O O   . HOH L 6 .   ? 43.167  12.418 -1.362  1.00 58.75  ? 868  HOH A O   1 
HETATM 8705 O O   . HOH L 6 .   ? 44.323  10.532 -2.168  1.00 64.66  ? 869  HOH A O   1 
HETATM 8706 O O   . HOH L 6 .   ? 71.099  26.016 9.519   1.00 60.01  ? 870  HOH A O   1 
HETATM 8707 O O   . HOH L 6 .   ? 24.037  23.387 40.899  1.00 70.69  ? 871  HOH A O   1 
HETATM 8708 O O   . HOH L 6 .   ? 53.657  13.109 34.603  1.00 47.99  ? 872  HOH A O   1 
HETATM 8709 O O   . HOH L 6 .   ? 56.471  23.298 9.591   1.00 50.93  ? 873  HOH A O   1 
HETATM 8710 O O   . HOH L 6 .   ? 67.921  45.654 51.476  1.00 62.00  ? 874  HOH A O   1 
HETATM 8711 O O   . HOH L 6 .   ? 72.450  43.024 16.338  1.00 65.62  ? 875  HOH A O   1 
HETATM 8712 O O   . HOH L 6 .   ? 50.246  48.123 4.218   1.00 75.07  ? 876  HOH A O   1 
HETATM 8713 O O   . HOH L 6 .   ? 32.352  26.028 24.209  1.00 52.32  ? 877  HOH A O   1 
HETATM 8714 O O   . HOH L 6 .   ? 76.014  36.221 12.477  1.00 58.32  ? 878  HOH A O   1 
HETATM 8715 O O   . HOH L 6 .   ? 53.794  53.030 32.645  1.00 30.00  ? 879  HOH A O   1 
HETATM 8716 O O   . HOH L 6 .   ? 49.197  16.729 46.225  1.00 65.81  ? 880  HOH A O   1 
HETATM 8717 O O   . HOH L 6 .   ? 65.668  36.483 58.386  1.00 49.48  ? 881  HOH A O   1 
HETATM 8718 O O   . HOH L 6 .   ? 41.507  45.003 24.283  1.00 58.61  ? 882  HOH A O   1 
HETATM 8719 O O   . HOH L 6 .   ? 62.833  14.012 33.745  1.00 67.70  ? 883  HOH A O   1 
HETATM 8720 O O   . HOH L 6 .   ? 36.010  25.533 22.299  1.00 47.23  ? 884  HOH A O   1 
HETATM 8721 O O   . HOH L 6 .   ? 25.737  21.135 52.227  1.00 30.00  ? 885  HOH A O   1 
HETATM 8722 O O   . HOH L 6 .   ? 72.320  21.392 34.053  1.00 71.83  ? 886  HOH A O   1 
HETATM 8723 O O   . HOH L 6 .   ? 50.961  5.652  -0.459  1.00 71.35  ? 887  HOH A O   1 
HETATM 8724 O O   . HOH L 6 .   ? 79.388  42.157 34.004  1.00 72.93  ? 888  HOH A O   1 
HETATM 8725 O O   . HOH L 6 .   ? 44.473  48.448 22.648  1.00 70.51  ? 889  HOH A O   1 
HETATM 8726 O O   . HOH L 6 .   ? 56.871  32.129 3.108   1.00 74.23  ? 890  HOH A O   1 
HETATM 8727 O O   . HOH L 6 .   ? 52.372  29.592 1.112   1.00 57.04  ? 891  HOH A O   1 
HETATM 8728 O O   . HOH L 6 .   ? 56.670  16.273 44.239  1.00 74.29  ? 892  HOH A O   1 
HETATM 8729 O O   . HOH L 6 .   ? 69.244  12.707 11.328  1.00 60.60  ? 893  HOH A O   1 
HETATM 8730 O O   . HOH L 6 .   ? 58.694  30.378 50.555  1.00 61.33  ? 894  HOH A O   1 
HETATM 8731 O O   . HOH L 6 .   ? 52.642  20.494 46.505  1.00 60.43  ? 895  HOH A O   1 
HETATM 8732 O O   . HOH L 6 .   ? 60.880  55.526 36.104  1.00 69.65  ? 896  HOH A O   1 
HETATM 8733 O O   . HOH L 6 .   ? 47.167  11.826 20.274  1.00 77.86  ? 897  HOH A O   1 
HETATM 8734 O O   . HOH L 6 .   ? 41.626  17.599 20.888  1.00 55.34  ? 898  HOH A O   1 
HETATM 8735 O O   . HOH L 6 .   ? 48.658  38.347 2.862   1.00 61.31  ? 899  HOH A O   1 
HETATM 8736 O O   . HOH L 6 .   ? 60.839  49.151 48.442  1.00 70.68  ? 900  HOH A O   1 
HETATM 8737 O O   . HOH L 6 .   ? 46.629  27.790 51.445  1.00 63.71  ? 901  HOH A O   1 
HETATM 8738 O O   . HOH L 6 .   ? 76.953  37.992 28.104  1.00 59.76  ? 902  HOH A O   1 
HETATM 8739 O O   . HOH L 6 .   ? 31.754  15.956 31.023  1.00 64.59  ? 903  HOH A O   1 
HETATM 8740 O O   . HOH L 6 .   ? 75.596  48.054 34.551  1.00 76.82  ? 904  HOH A O   1 
HETATM 8741 O O   . HOH L 6 .   ? 55.290  31.863 49.527  1.00 49.53  ? 905  HOH A O   1 
HETATM 8742 O O   . HOH L 6 .   ? 55.889  20.315 47.756  1.00 78.54  ? 906  HOH A O   1 
HETATM 8743 O O   . HOH L 6 .   ? 53.230  32.788 -0.309  1.00 73.53  ? 907  HOH A O   1 
HETATM 8744 O O   . HOH L 6 .   ? 50.774  50.923 28.706  1.00 73.79  ? 908  HOH A O   1 
HETATM 8745 O O   . HOH L 6 .   ? 51.685  39.443 56.852  1.00 71.57  ? 909  HOH A O   1 
HETATM 8746 O O   . HOH L 6 .   ? 41.644  22.819 22.775  1.00 41.80  ? 910  HOH A O   1 
HETATM 8747 O O   . HOH L 6 .   ? 47.971  36.140 3.261   1.00 47.22  ? 911  HOH A O   1 
HETATM 8748 O O   . HOH L 6 .   ? 52.564  17.121 -0.872  1.00 46.41  ? 912  HOH A O   1 
HETATM 8749 O O   . HOH L 6 .   ? 49.351  20.165 35.423  1.00 42.68  ? 913  HOH A O   1 
HETATM 8750 O O   . HOH L 6 .   ? 45.346  13.300 22.037  1.00 63.53  ? 914  HOH A O   1 
HETATM 8751 O O   . HOH L 6 .   ? 71.593  28.893 42.721  1.00 61.58  ? 915  HOH A O   1 
HETATM 8752 O O   . HOH L 6 .   ? 36.799  13.052 25.963  1.00 65.29  ? 916  HOH A O   1 
HETATM 8753 O O   . HOH L 6 .   ? 39.224  23.309 29.639  1.00 45.35  ? 917  HOH A O   1 
HETATM 8754 O O   . HOH L 6 .   ? 32.042  14.898 27.889  1.00 72.29  ? 918  HOH A O   1 
HETATM 8755 O O   . HOH L 6 .   ? 63.828  24.837 45.475  1.00 59.05  ? 919  HOH A O   1 
HETATM 8756 O O   . HOH L 6 .   ? 60.373  50.062 44.282  1.00 78.54  ? 920  HOH A O   1 
HETATM 8757 O O   . HOH L 6 .   ? 29.603  27.425 31.404  1.00 57.03  ? 921  HOH A O   1 
HETATM 8758 O O   . HOH L 6 .   ? 42.182  49.061 21.937  1.00 76.83  ? 922  HOH A O   1 
HETATM 8759 O O   . HOH L 6 .   ? 50.161  25.005 41.477  1.00 64.74  ? 923  HOH A O   1 
HETATM 8760 O O   . HOH L 6 .   ? 72.353  27.519 31.517  1.00 73.64  ? 924  HOH A O   1 
HETATM 8761 O O   . HOH L 6 .   ? 69.168  22.962 28.090  1.00 50.80  ? 925  HOH A O   1 
HETATM 8762 O O   . HOH L 6 .   ? 67.960  41.991 1.783   1.00 63.33  ? 926  HOH A O   1 
HETATM 8763 O O   . HOH L 6 .   ? 69.325  19.952 21.735  1.00 55.93  ? 927  HOH A O   1 
HETATM 8764 O O   . HOH L 6 .   ? 35.676  16.223 13.461  1.00 77.94  ? 928  HOH A O   1 
HETATM 8765 O O   . HOH L 6 .   ? 72.570  29.537 9.324   1.00 60.99  ? 929  HOH A O   1 
HETATM 8766 O O   . HOH L 6 .   ? 65.326  8.304  24.156  1.00 76.67  ? 930  HOH A O   1 
HETATM 8767 O O   . HOH L 6 .   ? 58.986  26.622 50.200  1.00 64.33  ? 931  HOH A O   1 
HETATM 8768 O O   . HOH L 6 .   ? 71.901  43.659 10.978  1.00 58.29  ? 932  HOH A O   1 
HETATM 8769 O O   . HOH L 6 .   ? 57.775  18.835 28.835  1.00 54.29  ? 933  HOH A O   1 
HETATM 8770 O O   . HOH L 6 .   ? 58.401  23.747 3.452   1.00 30.00  ? 934  HOH A O   1 
HETATM 8771 O O   . HOH L 6 .   ? 47.913  36.128 6.487   1.00 63.46  ? 935  HOH A O   1 
HETATM 8772 O O   . HOH L 6 .   ? 54.140  40.855 47.494  1.00 56.39  ? 936  HOH A O   1 
HETATM 8773 O O   . HOH L 6 .   ? 75.624  28.941 38.556  1.00 72.95  ? 937  HOH A O   1 
HETATM 8774 O O   . HOH L 6 .   ? 41.471  33.944 11.210  1.00 70.87  ? 938  HOH A O   1 
HETATM 8775 O O   . HOH L 6 .   ? 60.899  37.232 -0.939  1.00 55.44  ? 939  HOH A O   1 
HETATM 8776 O O   . HOH L 6 .   ? 79.378  45.944 50.345  1.00 76.10  ? 940  HOH A O   1 
HETATM 8777 O O   . HOH L 6 .   ? 77.060  34.733 45.767  1.00 53.91  ? 941  HOH A O   1 
HETATM 8778 O O   . HOH L 6 .   ? 37.221  21.696 21.365  1.00 63.47  ? 942  HOH A O   1 
HETATM 8779 O O   . HOH L 6 .   ? 68.055  25.349 8.050   1.00 71.12  ? 943  HOH A O   1 
HETATM 8780 O O   . HOH L 6 .   ? 66.946  9.534  12.503  1.00 68.52  ? 944  HOH A O   1 
HETATM 8781 O O   . HOH L 6 .   ? 60.638  54.258 23.274  1.00 79.82  ? 945  HOH A O   1 
HETATM 8782 O O   . HOH L 6 .   ? 57.130  21.319 25.181  1.00 63.38  ? 946  HOH A O   1 
HETATM 8783 O O   . HOH L 6 .   ? 46.019  8.080  39.094  1.00 61.47  ? 947  HOH A O   1 
HETATM 8784 O O   . HOH L 6 .   ? 58.377  21.391 5.926   1.00 60.41  ? 948  HOH A O   1 
HETATM 8785 O O   . HOH L 6 .   ? 58.149  11.687 -6.981  1.00 70.57  ? 949  HOH A O   1 
HETATM 8786 O O   . HOH L 6 .   ? 82.829  23.233 19.418  1.00 73.26  ? 950  HOH A O   1 
HETATM 8787 O O   . HOH L 6 .   ? 73.238  48.043 17.605  1.00 30.00  ? 951  HOH A O   1 
HETATM 8788 O O   . HOH L 6 .   ? 57.914  41.385 -4.440  1.00 65.96  ? 952  HOH A O   1 
HETATM 8789 O O   . HOH L 6 .   ? 50.679  14.743 44.669  1.00 60.96  ? 953  HOH A O   1 
HETATM 8790 O O   . HOH L 6 .   ? 30.437  34.348 40.691  1.00 78.92  ? 954  HOH A O   1 
HETATM 8791 O O   . HOH L 6 .   ? 69.405  29.194 34.944  1.00 59.45  ? 955  HOH A O   1 
HETATM 8792 O O   . HOH L 6 .   ? 63.752  18.325 5.665   1.00 76.74  ? 956  HOH A O   1 
HETATM 8793 O O   . HOH L 6 .   ? 43.414  32.726 13.618  1.00 56.23  ? 957  HOH A O   1 
HETATM 8794 O O   . HOH L 6 .   ? 33.628  17.981 22.258  1.00 71.25  ? 958  HOH A O   1 
HETATM 8795 O O   . HOH L 6 .   ? 61.681  48.631 2.846   1.00 79.51  ? 959  HOH A O   1 
HETATM 8796 O O   . HOH L 6 .   ? 69.236  37.823 58.493  1.00 69.46  ? 960  HOH A O   1 
HETATM 8797 O O   . HOH L 6 .   ? 54.122  9.933  37.630  1.00 77.67  ? 961  HOH A O   1 
HETATM 8798 O O   . HOH L 6 .   ? 64.098  17.448 38.813  1.00 66.99  ? 962  HOH A O   1 
HETATM 8799 O O   . HOH L 6 .   ? 45.452  18.394 48.953  1.00 76.49  ? 963  HOH A O   1 
HETATM 8800 O O   . HOH L 6 .   ? 44.148  37.790 40.901  1.00 64.42  ? 964  HOH A O   1 
HETATM 8801 O O   . HOH L 6 .   ? 45.662  39.172 39.452  1.00 57.43  ? 965  HOH A O   1 
HETATM 8802 O O   . HOH L 6 .   ? 55.395  40.253 59.102  1.00 76.85  ? 966  HOH A O   1 
HETATM 8803 O O   . HOH L 6 .   ? 50.008  56.928 20.156  1.00 30.00  ? 967  HOH A O   1 
HETATM 8804 O O   . HOH L 6 .   ? 52.443  42.859 44.033  1.00 68.85  ? 968  HOH A O   1 
HETATM 8805 O O   . HOH L 6 .   ? 40.536  16.944 -2.235  1.00 58.83  ? 969  HOH A O   1 
HETATM 8806 O O   . HOH L 6 .   ? 71.218  14.492 14.782  1.00 75.53  ? 970  HOH A O   1 
HETATM 8807 O O   . HOH L 6 .   ? 65.719  17.334 33.416  1.00 66.01  ? 971  HOH A O   1 
HETATM 8808 O O   . HOH L 6 .   ? 50.495  25.142 0.580   1.00 74.88  ? 972  HOH A O   1 
HETATM 8809 O O   . HOH L 6 .   ? 32.972  22.107 21.327  1.00 67.23  ? 973  HOH A O   1 
HETATM 8810 O O   . HOH L 6 .   ? 62.940  38.901 62.006  1.00 71.96  ? 974  HOH A O   1 
HETATM 8811 O O   . HOH L 6 .   ? 41.844  21.411 50.594  1.00 68.53  ? 975  HOH A O   1 
HETATM 8812 O O   . HOH L 6 .   ? 24.191  16.144 39.140  1.00 74.73  ? 976  HOH A O   1 
HETATM 8813 O O   . HOH L 6 .   ? 32.703  19.595 12.710  1.00 75.98  ? 977  HOH A O   1 
HETATM 8814 O O   . HOH L 6 .   ? 78.051  30.513 33.388  1.00 69.87  ? 978  HOH A O   1 
HETATM 8815 O O   . HOH L 6 .   ? 52.216  8.108  35.789  1.00 74.49  ? 979  HOH A O   1 
HETATM 8816 O O   . HOH L 6 .   ? 49.955  47.365 40.048  1.00 30.00  ? 980  HOH A O   1 
HETATM 8817 O O   . HOH L 6 .   ? 41.331  29.692 15.102  1.00 79.66  ? 981  HOH A O   1 
HETATM 8818 O O   . HOH L 6 .   ? 41.663  11.047 47.451  1.00 73.89  ? 982  HOH A O   1 
HETATM 8819 O O   . HOH L 6 .   ? 40.590  38.083 7.788   1.00 79.12  ? 983  HOH A O   1 
HETATM 8820 O O   . HOH L 6 .   ? 47.111  38.092 7.307   1.00 63.18  ? 984  HOH A O   1 
HETATM 8821 O O   . HOH L 6 .   ? 57.845  38.954 -3.558  1.00 75.89  ? 985  HOH A O   1 
HETATM 8822 O O   . HOH L 6 .   ? 76.790  42.732 18.702  1.00 79.98  ? 986  HOH A O   1 
HETATM 8823 O O   . HOH L 6 .   ? 50.316  43.511 44.496  1.00 67.14  ? 987  HOH A O   1 
HETATM 8824 O O   . HOH L 6 .   ? 41.394  48.479 32.938  1.00 72.57  ? 988  HOH A O   1 
HETATM 8825 O O   . HOH L 6 .   ? 64.116  27.021 47.548  1.00 43.86  ? 989  HOH A O   1 
HETATM 8826 O O   . HOH L 6 .   ? 53.978  30.796 0.456   1.00 75.67  ? 990  HOH A O   1 
HETATM 8827 O O   . HOH L 6 .   ? 58.257  24.318 26.038  1.00 67.81  ? 991  HOH A O   1 
HETATM 8828 O O   . HOH L 6 .   ? 77.067  25.739 12.668  1.00 76.17  ? 992  HOH A O   1 
HETATM 8829 O O   . HOH L 6 .   ? 56.396  13.343 38.106  1.00 69.42  ? 993  HOH A O   1 
HETATM 8830 O O   . HOH L 6 .   ? 38.660  28.233 19.808  1.00 78.97  ? 994  HOH A O   1 
HETATM 8831 O O   . HOH L 6 .   ? 46.014  16.283 48.591  1.00 74.34  ? 995  HOH A O   1 
HETATM 8832 O O   . HOH L 6 .   ? 40.228  33.016 18.468  1.00 73.69  ? 996  HOH A O   1 
HETATM 8833 O O   . HOH L 6 .   ? 55.825  10.275 -6.630  1.00 71.21  ? 997  HOH A O   1 
HETATM 8834 O O   . HOH L 6 .   ? 75.408  52.821 9.829   1.00 30.00  ? 998  HOH A O   1 
HETATM 8835 O O   . HOH L 6 .   ? 47.920  58.790 14.485  1.00 30.00  ? 999  HOH A O   1 
HETATM 8836 O O   . HOH L 6 .   ? 52.445  22.100 -4.697  1.00 75.31  ? 1000 HOH A O   1 
HETATM 8837 O O   . HOH L 6 .   ? 58.606  22.954 24.240  1.00 69.30  ? 1001 HOH A O   1 
HETATM 8838 O O   . HOH L 6 .   ? 48.714  4.436  14.860  1.00 77.42  ? 1002 HOH A O   1 
HETATM 8839 O O   . HOH L 6 .   ? 51.153  -3.877 16.917  1.00 30.00  ? 1003 HOH A O   1 
HETATM 8840 O O   . HOH L 6 .   ? 66.118  15.908 5.184   1.00 77.23  ? 1004 HOH A O   1 
HETATM 8841 O O   . HOH L 6 .   ? 63.800  20.525 6.294   1.00 67.76  ? 1005 HOH A O   1 
HETATM 8842 O O   . HOH L 6 .   ? 51.829  21.845 -2.489  1.00 69.35  ? 1006 HOH A O   1 
HETATM 8843 O O   . HOH L 6 .   ? 85.561  40.651 43.778  1.00 72.90  ? 1007 HOH A O   1 
HETATM 8844 O O   . HOH L 6 .   ? 54.319  18.908 -1.792  1.00 58.87  ? 1008 HOH A O   1 
HETATM 8845 O O   . HOH L 6 .   ? 72.517  52.443 8.133   1.00 30.00  ? 1009 HOH A O   1 
HETATM 8846 O O   . HOH L 6 .   ? 58.914  20.364 0.913   1.00 75.99  ? 1010 HOH A O   1 
HETATM 8847 O O   . HOH L 6 .   ? 53.393  10.758 24.650  1.00 69.66  ? 1011 HOH A O   1 
HETATM 8848 O O   . HOH L 6 .   ? 60.049  15.743 37.461  1.00 66.09  ? 1012 HOH A O   1 
HETATM 8849 O O   . HOH L 6 .   ? 23.826  16.124 41.570  1.00 79.02  ? 1013 HOH A O   1 
HETATM 8850 O O   . HOH L 6 .   ? 39.974  26.358 13.599  1.00 74.54  ? 1014 HOH A O   1 
HETATM 8851 O O   . HOH L 6 .   ? 39.648  37.609 43.101  1.00 77.23  ? 1015 HOH A O   1 
HETATM 8852 O O   . HOH M 6 .   ? 100.546 45.161 46.950  1.00 64.48  ? 701  HOH B O   1 
HETATM 8853 O O   . HOH M 6 .   ? 115.320 54.873 36.987  1.00 59.54  ? 702  HOH B O   1 
HETATM 8854 O O   . HOH M 6 .   ? 128.505 35.656 32.853  1.00 65.14  ? 703  HOH B O   1 
HETATM 8855 O O   . HOH M 6 .   ? 116.445 37.724 51.721  1.00 59.76  ? 704  HOH B O   1 
HETATM 8856 O O   . HOH M 6 .   ? 121.825 39.948 9.615   1.00 72.13  ? 705  HOH B O   1 
HETATM 8857 O O   . HOH M 6 .   ? 106.293 23.252 22.935  1.00 57.09  ? 706  HOH B O   1 
HETATM 8858 O O   . HOH M 6 .   ? 119.528 45.970 32.024  1.00 60.03  ? 707  HOH B O   1 
HETATM 8859 O O   . HOH M 6 .   ? 109.743 50.716 47.358  1.00 64.78  ? 708  HOH B O   1 
HETATM 8860 O O   . HOH M 6 .   ? 105.916 53.720 9.690   1.00 79.40  ? 709  HOH B O   1 
HETATM 8861 O O   . HOH M 6 .   ? 103.552 62.655 31.917  1.00 76.37  ? 710  HOH B O   1 
HETATM 8862 O O   . HOH M 6 .   ? 122.065 30.112 30.880  1.00 51.39  ? 711  HOH B O   1 
HETATM 8863 O O   . HOH M 6 .   ? 104.587 41.167 14.705  1.00 41.85  ? 712  HOH B O   1 
HETATM 8864 O O   . HOH M 6 .   ? 104.705 65.297 38.149  1.00 73.57  ? 713  HOH B O   1 
HETATM 8865 O O   . HOH M 6 .   ? 127.863 39.577 34.708  1.00 58.26  ? 714  HOH B O   1 
HETATM 8866 O O   . HOH M 6 .   ? 116.760 41.536 33.318  1.00 37.73  ? 715  HOH B O   1 
HETATM 8867 O O   . HOH M 6 .   ? 125.332 43.668 30.080  1.00 60.12  ? 716  HOH B O   1 
HETATM 8868 O O   . HOH M 6 .   ? 84.930  47.640 36.533  1.00 65.20  ? 717  HOH B O   1 
HETATM 8869 O O   . HOH M 6 .   ? 110.116 56.874 12.966  1.00 73.51  ? 718  HOH B O   1 
HETATM 8870 O O   . HOH M 6 .   ? 113.892 57.666 21.098  1.00 62.82  ? 719  HOH B O   1 
HETATM 8871 O O   . HOH M 6 .   ? 92.705  22.811 48.005  1.00 78.50  ? 720  HOH B O   1 
HETATM 8872 O O   . HOH M 6 .   ? 92.912  45.177 56.693  1.00 44.52  ? 721  HOH B O   1 
HETATM 8873 O O   . HOH M 6 .   ? 111.560 56.232 37.585  1.00 76.54  ? 722  HOH B O   1 
HETATM 8874 O O   . HOH M 6 .   ? 99.455  35.505 11.120  1.00 76.50  ? 723  HOH B O   1 
HETATM 8875 O O   . HOH M 6 .   ? 114.346 38.460 12.723  1.00 66.14  ? 724  HOH B O   1 
HETATM 8876 O O   . HOH M 6 .   ? 95.895  48.729 15.705  1.00 45.40  ? 725  HOH B O   1 
HETATM 8877 O O   . HOH M 6 .   ? 105.062 21.379 58.707  1.00 57.33  ? 726  HOH B O   1 
HETATM 8878 O O   . HOH M 6 .   ? 94.394  52.394 43.896  1.00 47.09  ? 727  HOH B O   1 
HETATM 8879 O O   . HOH M 6 .   ? 112.888 43.815 47.232  1.00 54.17  ? 728  HOH B O   1 
HETATM 8880 O O   . HOH M 6 .   ? 82.752  51.550 29.636  1.00 77.31  ? 729  HOH B O   1 
HETATM 8881 O O   . HOH M 6 .   ? 107.841 43.182 49.942  1.00 61.54  ? 730  HOH B O   1 
HETATM 8882 O O   . HOH M 6 .   ? 118.992 65.763 44.762  1.00 30.00  ? 731  HOH B O   1 
HETATM 8883 O O   . HOH M 6 .   ? 128.200 34.565 27.004  1.00 69.73  ? 732  HOH B O   1 
HETATM 8884 O O   . HOH M 6 .   ? 115.287 66.987 13.235  1.00 77.30  ? 733  HOH B O   1 
HETATM 8885 O O   . HOH M 6 .   ? 112.704 40.851 35.965  1.00 31.49  ? 734  HOH B O   1 
HETATM 8886 O O   . HOH M 6 .   ? 102.646 46.802 45.224  1.00 42.12  ? 735  HOH B O   1 
HETATM 8887 O O   . HOH M 6 .   ? 112.756 51.226 25.493  1.00 44.76  ? 736  HOH B O   1 
HETATM 8888 O O   . HOH M 6 .   ? 94.932  44.822 15.354  1.00 51.65  ? 737  HOH B O   1 
HETATM 8889 O O   . HOH M 6 .   ? 107.813 15.261 44.628  1.00 66.44  ? 738  HOH B O   1 
HETATM 8890 O O   . HOH M 6 .   ? 111.119 34.266 47.181  1.00 50.92  ? 739  HOH B O   1 
HETATM 8891 O O   . HOH M 6 .   ? 83.996  47.910 28.872  1.00 51.93  ? 740  HOH B O   1 
HETATM 8892 O O   . HOH M 6 .   ? 124.801 47.752 33.658  1.00 55.93  ? 741  HOH B O   1 
HETATM 8893 O O   . HOH M 6 .   ? 84.668  37.063 25.587  1.00 71.67  ? 742  HOH B O   1 
HETATM 8894 O O   . HOH M 6 .   ? 88.691  36.007 30.873  1.00 54.60  ? 743  HOH B O   1 
HETATM 8895 O O   . HOH M 6 .   ? 95.678  60.625 28.509  1.00 59.31  ? 744  HOH B O   1 
HETATM 8896 O O   . HOH M 6 .   ? 121.326 34.018 32.206  1.00 36.23  ? 745  HOH B O   1 
HETATM 8897 O O   . HOH M 6 .   ? 104.196 22.098 44.798  1.00 50.30  ? 746  HOH B O   1 
HETATM 8898 O O   . HOH M 6 .   ? 115.458 27.110 23.821  1.00 45.02  ? 747  HOH B O   1 
HETATM 8899 O O   . HOH M 6 .   ? 96.212  29.408 39.799  1.00 38.04  ? 748  HOH B O   1 
HETATM 8900 O O   . HOH M 6 .   ? 107.370 47.587 29.706  1.00 46.88  ? 749  HOH B O   1 
HETATM 8901 O O   . HOH M 6 .   ? 108.200 56.537 33.204  1.00 54.88  ? 750  HOH B O   1 
HETATM 8902 O O   . HOH M 6 .   ? 125.002 45.624 11.407  1.00 65.45  ? 751  HOH B O   1 
HETATM 8903 O O   . HOH M 6 .   ? 123.791 19.692 37.333  1.00 51.77  ? 752  HOH B O   1 
HETATM 8904 O O   . HOH M 6 .   ? 112.025 56.403 21.059  1.00 63.96  ? 753  HOH B O   1 
HETATM 8905 O O   . HOH M 6 .   ? 116.812 33.758 27.376  1.00 38.98  ? 754  HOH B O   1 
HETATM 8906 O O   . HOH M 6 .   ? 126.082 44.886 17.702  1.00 75.11  ? 755  HOH B O   1 
HETATM 8907 O O   . HOH M 6 .   ? 120.207 39.772 35.755  1.00 44.58  ? 756  HOH B O   1 
HETATM 8908 O O   . HOH M 6 .   ? 120.439 41.996 31.502  1.00 58.07  ? 757  HOH B O   1 
HETATM 8909 O O   . HOH M 6 .   ? 109.719 42.139 45.186  1.00 50.51  ? 758  HOH B O   1 
HETATM 8910 O O   . HOH M 6 .   ? 112.070 25.062 46.273  1.00 41.50  ? 759  HOH B O   1 
HETATM 8911 O O   . HOH M 6 .   ? 107.307 36.394 38.827  1.00 34.47  ? 760  HOH B O   1 
HETATM 8912 O O   . HOH M 6 .   ? 95.996  23.847 54.155  1.00 72.16  ? 761  HOH B O   1 
HETATM 8913 O O   . HOH M 6 .   ? 111.433 43.013 31.147  1.00 62.95  ? 762  HOH B O   1 
HETATM 8914 O O   . HOH M 6 .   ? 103.480 47.955 29.226  1.00 39.15  ? 763  HOH B O   1 
HETATM 8915 O O   . HOH M 6 .   ? 115.024 20.907 29.394  1.00 52.15  ? 764  HOH B O   1 
HETATM 8916 O O   . HOH M 6 .   ? 112.173 32.551 53.345  1.00 54.69  ? 765  HOH B O   1 
HETATM 8917 O O   . HOH M 6 .   ? 111.284 15.917 36.975  1.00 64.36  ? 766  HOH B O   1 
HETATM 8918 O O   . HOH M 6 .   ? 107.176 22.589 65.386  1.00 74.11  ? 767  HOH B O   1 
HETATM 8919 O O   . HOH M 6 .   ? 108.732 55.413 19.925  1.00 56.88  ? 768  HOH B O   1 
HETATM 8920 O O   . HOH M 6 .   ? 107.284 39.925 43.177  1.00 40.87  ? 769  HOH B O   1 
HETATM 8921 O O   . HOH M 6 .   ? 107.569 58.573 46.270  1.00 51.83  ? 770  HOH B O   1 
HETATM 8922 O O   . HOH M 6 .   ? 96.129  45.352 54.612  1.00 42.50  ? 771  HOH B O   1 
HETATM 8923 O O   . HOH M 6 .   ? 103.866 18.215 56.535  1.00 53.11  ? 772  HOH B O   1 
HETATM 8924 O O   . HOH M 6 .   ? 91.853  38.080 39.769  1.00 45.26  ? 773  HOH B O   1 
HETATM 8925 O O   . HOH M 6 .   ? 87.393  43.550 22.484  1.00 45.43  ? 774  HOH B O   1 
HETATM 8926 O O   . HOH M 6 .   ? 115.001 59.640 7.303   1.00 47.50  ? 775  HOH B O   1 
HETATM 8927 O O   . HOH M 6 .   ? 115.708 61.045 -0.862  1.00 59.67  ? 776  HOH B O   1 
HETATM 8928 O O   . HOH M 6 .   ? 86.681  38.314 40.747  1.00 50.43  ? 777  HOH B O   1 
HETATM 8929 O O   . HOH M 6 .   ? 109.276 42.191 34.182  1.00 41.86  ? 778  HOH B O   1 
HETATM 8930 O O   . HOH M 6 .   ? 95.697  53.048 50.349  1.00 58.98  ? 779  HOH B O   1 
HETATM 8931 O O   . HOH M 6 .   ? 110.797 18.085 57.082  1.00 70.18  ? 780  HOH B O   1 
HETATM 8932 O O   . HOH M 6 .   ? 99.510  27.283 60.613  1.00 51.41  ? 781  HOH B O   1 
HETATM 8933 O O   . HOH M 6 .   ? 122.683 51.951 14.775  1.00 50.77  ? 782  HOH B O   1 
HETATM 8934 O O   . HOH M 6 .   ? 112.453 29.300 52.308  1.00 53.36  ? 783  HOH B O   1 
HETATM 8935 O O   . HOH M 6 .   ? 114.481 43.423 49.721  1.00 69.58  ? 784  HOH B O   1 
HETATM 8936 O O   . HOH M 6 .   ? 92.319  36.954 59.477  1.00 57.29  ? 785  HOH B O   1 
HETATM 8937 O O   . HOH M 6 .   ? 118.023 44.909 41.719  1.00 45.23  ? 786  HOH B O   1 
HETATM 8938 O O   . HOH M 6 .   ? 107.106 33.648 19.043  1.00 46.22  ? 787  HOH B O   1 
HETATM 8939 O O   . HOH M 6 .   ? 92.629  49.775 51.311  1.00 60.92  ? 788  HOH B O   1 
HETATM 8940 O O   . HOH M 6 .   ? 97.588  42.939 12.650  1.00 77.51  ? 789  HOH B O   1 
HETATM 8941 O O   . HOH M 6 .   ? 114.376 25.426 44.636  1.00 49.06  ? 790  HOH B O   1 
HETATM 8942 O O   . HOH M 6 .   ? 112.304 19.833 40.760  1.00 45.67  ? 791  HOH B O   1 
HETATM 8943 O O   . HOH M 6 .   ? 94.415  27.826 19.868  1.00 74.52  ? 792  HOH B O   1 
HETATM 8944 O O   . HOH M 6 .   ? 113.045 25.588 25.839  1.00 40.84  ? 793  HOH B O   1 
HETATM 8945 O O   . HOH M 6 .   ? 108.270 14.350 52.848  1.00 71.43  ? 794  HOH B O   1 
HETATM 8946 O O   . HOH M 6 .   ? 87.007  36.784 45.113  1.00 67.10  ? 795  HOH B O   1 
HETATM 8947 O O   . HOH M 6 .   ? 82.245  49.472 31.418  1.00 78.83  ? 796  HOH B O   1 
HETATM 8948 O O   . HOH M 6 .   ? 91.339  41.965 56.046  1.00 59.24  ? 797  HOH B O   1 
HETATM 8949 O O   . HOH M 6 .   ? 96.435  41.633 4.996   1.00 63.85  ? 798  HOH B O   1 
HETATM 8950 O O   . HOH M 6 .   ? 103.791 38.297 15.077  1.00 59.66  ? 799  HOH B O   1 
HETATM 8951 O O   . HOH M 6 .   ? 91.376  49.726 24.394  1.00 40.28  ? 800  HOH B O   1 
HETATM 8952 O O   . HOH M 6 .   ? 118.352 24.837 23.415  1.00 43.13  ? 801  HOH B O   1 
HETATM 8953 O O   . HOH M 6 .   ? 99.389  24.239 22.888  1.00 47.73  ? 802  HOH B O   1 
HETATM 8954 O O   . HOH M 6 .   ? 104.673 23.927 49.044  1.00 43.40  ? 803  HOH B O   1 
HETATM 8955 O O   . HOH M 6 .   ? 115.294 35.169 21.326  1.00 49.91  ? 804  HOH B O   1 
HETATM 8956 O O   . HOH M 6 .   ? 114.736 35.919 44.393  1.00 44.26  ? 805  HOH B O   1 
HETATM 8957 O O   . HOH M 6 .   ? 101.316 18.190 55.185  1.00 65.60  ? 806  HOH B O   1 
HETATM 8958 O O   . HOH M 6 .   ? 123.234 21.634 39.538  1.00 48.38  ? 807  HOH B O   1 
HETATM 8959 O O   . HOH M 6 .   ? 135.304 27.867 25.102  1.00 61.20  ? 808  HOH B O   1 
HETATM 8960 O O   . HOH M 6 .   ? 118.070 30.024 35.977  1.00 39.00  ? 809  HOH B O   1 
HETATM 8961 O O   . HOH M 6 .   ? 97.698  45.416 10.349  1.00 58.96  ? 810  HOH B O   1 
HETATM 8962 O O   . HOH M 6 .   ? 117.414 23.240 35.393  1.00 42.75  ? 811  HOH B O   1 
HETATM 8963 O O   . HOH M 6 .   ? 121.721 58.295 32.284  1.00 53.68  ? 812  HOH B O   1 
HETATM 8964 O O   . HOH M 6 .   ? 117.295 39.746 38.353  1.00 42.85  ? 813  HOH B O   1 
HETATM 8965 O O   . HOH M 6 .   ? 125.524 50.132 21.315  1.00 64.30  ? 814  HOH B O   1 
HETATM 8966 O O   . HOH M 6 .   ? 98.473  22.869 60.926  1.00 69.38  ? 815  HOH B O   1 
HETATM 8967 O O   . HOH M 6 .   ? 113.626 33.523 18.005  1.00 55.81  ? 816  HOH B O   1 
HETATM 8968 O O   . HOH M 6 .   ? 102.276 23.159 49.967  1.00 50.14  ? 817  HOH B O   1 
HETATM 8969 O O   . HOH M 6 .   ? 123.232 26.809 43.032  1.00 48.56  ? 818  HOH B O   1 
HETATM 8970 O O   . HOH M 6 .   ? 126.017 50.489 7.229   1.00 62.68  ? 819  HOH B O   1 
HETATM 8971 O O   . HOH M 6 .   ? 118.816 24.123 37.781  1.00 46.95  ? 820  HOH B O   1 
HETATM 8972 O O   . HOH M 6 .   ? 97.635  47.557 11.089  1.00 55.28  ? 821  HOH B O   1 
HETATM 8973 O O   . HOH M 6 .   ? 91.432  31.116 54.704  1.00 64.21  ? 822  HOH B O   1 
HETATM 8974 O O   . HOH M 6 .   ? 135.844 23.891 23.966  1.00 62.65  ? 823  HOH B O   1 
HETATM 8975 O O   . HOH M 6 .   ? 118.300 28.967 48.102  1.00 49.01  ? 824  HOH B O   1 
HETATM 8976 O O   . HOH M 6 .   ? 114.883 34.247 39.516  1.00 37.02  ? 825  HOH B O   1 
HETATM 8977 O O   . HOH M 6 .   ? 122.903 12.858 33.935  1.00 64.94  ? 826  HOH B O   1 
HETATM 8978 O O   . HOH M 6 .   ? 117.657 39.294 -0.219  1.00 65.49  ? 827  HOH B O   1 
HETATM 8979 O O   . HOH M 6 .   ? 119.384 40.857 9.166   1.00 55.12  ? 828  HOH B O   1 
HETATM 8980 O O   . HOH M 6 .   ? 115.348 41.630 35.637  1.00 37.72  ? 829  HOH B O   1 
HETATM 8981 O O   . HOH M 6 .   ? 95.826  58.701 31.450  1.00 49.27  ? 830  HOH B O   1 
HETATM 8982 O O   . HOH M 6 .   ? 106.946 52.184 21.314  1.00 47.22  ? 831  HOH B O   1 
HETATM 8983 O O   . HOH M 6 .   ? 107.096 41.661 14.081  1.00 47.06  ? 832  HOH B O   1 
HETATM 8984 O O   . HOH M 6 .   ? 123.497 38.728 44.005  1.00 57.81  ? 833  HOH B O   1 
HETATM 8985 O O   . HOH M 6 .   ? 112.770 36.361 32.007  1.00 34.26  ? 834  HOH B O   1 
HETATM 8986 O O   . HOH M 6 .   ? 97.232  56.400 17.196  1.00 59.04  ? 835  HOH B O   1 
HETATM 8987 O O   . HOH M 6 .   ? 110.454 62.139 9.699   1.00 55.90  ? 836  HOH B O   1 
HETATM 8988 O O   . HOH M 6 .   ? 97.995  53.934 14.308  1.00 58.77  ? 837  HOH B O   1 
HETATM 8989 O O   . HOH M 6 .   ? 120.098 44.999 34.088  1.00 43.86  ? 838  HOH B O   1 
HETATM 8990 O O   . HOH M 6 .   ? 115.766 36.324 14.452  1.00 71.10  ? 839  HOH B O   1 
HETATM 8991 O O   . HOH M 6 .   ? 125.029 42.444 19.980  1.00 78.68  ? 840  HOH B O   1 
HETATM 8992 O O   . HOH M 6 .   ? 97.731  62.715 38.798  1.00 72.17  ? 841  HOH B O   1 
HETATM 8993 O O   . HOH M 6 .   ? 88.190  49.465 19.423  1.00 53.48  ? 842  HOH B O   1 
HETATM 8994 O O   . HOH M 6 .   ? 128.413 28.273 39.710  1.00 49.03  ? 843  HOH B O   1 
HETATM 8995 O O   . HOH M 6 .   ? 114.085 46.979 41.424  1.00 44.48  ? 844  HOH B O   1 
HETATM 8996 O O   . HOH M 6 .   ? 108.270 51.271 19.024  1.00 57.94  ? 845  HOH B O   1 
HETATM 8997 O O   . HOH M 6 .   ? 93.336  27.205 47.383  1.00 47.61  ? 846  HOH B O   1 
HETATM 8998 O O   . HOH M 6 .   ? 92.086  52.271 47.008  1.00 58.15  ? 847  HOH B O   1 
HETATM 8999 O O   . HOH M 6 .   ? 113.677 19.286 38.331  1.00 62.61  ? 848  HOH B O   1 
HETATM 9000 O O   . HOH M 6 .   ? 116.329 58.273 45.632  1.00 79.03  ? 849  HOH B O   1 
HETATM 9001 O O   . HOH M 6 .   ? 120.970 39.890 21.397  1.00 66.22  ? 850  HOH B O   1 
HETATM 9002 O O   . HOH M 6 .   ? 113.181 58.343 9.205   1.00 45.28  ? 851  HOH B O   1 
HETATM 9003 O O   . HOH M 6 .   ? 116.222 23.591 49.852  1.00 57.38  ? 852  HOH B O   1 
HETATM 9004 O O   . HOH M 6 .   ? 110.376 52.755 20.092  1.00 48.95  ? 853  HOH B O   1 
HETATM 9005 O O   . HOH M 6 .   ? 109.456 50.386 36.580  1.00 43.65  ? 854  HOH B O   1 
HETATM 9006 O O   . HOH M 6 .   ? 113.871 29.330 15.275  1.00 52.07  ? 855  HOH B O   1 
HETATM 9007 O O   . HOH M 6 .   ? 96.879  23.106 21.856  1.00 51.65  ? 856  HOH B O   1 
HETATM 9008 O O   . HOH M 6 .   ? 111.940 59.546 12.844  1.00 53.48  ? 857  HOH B O   1 
HETATM 9009 O O   . HOH M 6 .   ? 98.348  47.757 14.525  1.00 45.93  ? 858  HOH B O   1 
HETATM 9010 O O   . HOH M 6 .   ? 100.479 21.811 46.848  1.00 60.77  ? 859  HOH B O   1 
HETATM 9011 O O   . HOH M 6 .   ? 111.672 18.041 23.476  1.00 78.82  ? 860  HOH B O   1 
HETATM 9012 O O   . HOH M 6 .   ? 96.363  28.097 58.000  1.00 60.95  ? 861  HOH B O   1 
HETATM 9013 O O   . HOH M 6 .   ? 123.637 41.603 41.066  1.00 49.31  ? 862  HOH B O   1 
HETATM 9014 O O   . HOH M 6 .   ? 118.739 64.584 5.480   1.00 53.93  ? 863  HOH B O   1 
HETATM 9015 O O   . HOH M 6 .   ? 113.518 39.888 51.996  1.00 57.99  ? 864  HOH B O   1 
HETATM 9016 O O   . HOH M 6 .   ? 117.128 45.584 45.781  1.00 73.03  ? 865  HOH B O   1 
HETATM 9017 O O   . HOH M 6 .   ? 88.291  27.887 38.353  1.00 60.83  ? 866  HOH B O   1 
HETATM 9018 O O   . HOH M 6 .   ? 101.866 56.722 21.358  1.00 67.34  ? 867  HOH B O   1 
HETATM 9019 O O   . HOH M 6 .   ? 119.024 62.877 26.056  1.00 58.97  ? 868  HOH B O   1 
HETATM 9020 O O   . HOH M 6 .   ? 126.239 35.652 36.739  1.00 45.95  ? 869  HOH B O   1 
HETATM 9021 O O   . HOH M 6 .   ? 89.861  28.785 33.551  1.00 60.14  ? 870  HOH B O   1 
HETATM 9022 O O   . HOH M 6 .   ? 114.322 34.906 7.878   1.00 71.16  ? 871  HOH B O   1 
HETATM 9023 O O   . HOH M 6 .   ? 122.467 55.840 38.914  1.00 58.22  ? 872  HOH B O   1 
HETATM 9024 O O   . HOH M 6 .   ? 118.418 17.127 43.123  1.00 63.39  ? 873  HOH B O   1 
HETATM 9025 O O   . HOH M 6 .   ? 120.891 36.799 16.905  1.00 57.06  ? 874  HOH B O   1 
HETATM 9026 O O   . HOH M 6 .   ? 117.709 12.497 32.743  1.00 74.92  ? 875  HOH B O   1 
HETATM 9027 O O   . HOH M 6 .   ? 108.448 60.028 24.213  1.00 57.59  ? 876  HOH B O   1 
HETATM 9028 O O   . HOH M 6 .   ? 119.392 32.577 27.312  1.00 50.32  ? 877  HOH B O   1 
HETATM 9029 O O   . HOH M 6 .   ? 89.682  43.381 45.721  1.00 67.24  ? 878  HOH B O   1 
HETATM 9030 O O   . HOH M 6 .   ? 86.401  49.221 42.178  1.00 74.69  ? 879  HOH B O   1 
HETATM 9031 O O   . HOH M 6 .   ? 102.102 50.392 58.178  1.00 51.30  ? 880  HOH B O   1 
HETATM 9032 O O   . HOH M 6 .   ? 102.329 27.776 60.684  1.00 53.37  ? 881  HOH B O   1 
HETATM 9033 O O   . HOH M 6 .   ? 107.563 55.532 11.980  1.00 78.03  ? 882  HOH B O   1 
HETATM 9034 O O   . HOH M 6 .   ? 89.432  49.283 45.642  1.00 65.35  ? 883  HOH B O   1 
HETATM 9035 O O   . HOH M 6 .   ? 109.956 23.788 15.687  1.00 64.74  ? 884  HOH B O   1 
HETATM 9036 O O   . HOH M 6 .   ? 84.817  49.073 21.648  1.00 56.84  ? 885  HOH B O   1 
HETATM 9037 O O   . HOH M 6 .   ? 113.619 37.137 0.680   1.00 76.20  ? 886  HOH B O   1 
HETATM 9038 O O   . HOH M 6 .   ? 112.626 62.531 33.699  1.00 64.35  ? 887  HOH B O   1 
HETATM 9039 O O   . HOH M 6 .   ? 127.232 25.589 40.404  1.00 48.16  ? 888  HOH B O   1 
HETATM 9040 O O   . HOH M 6 .   ? 124.564 44.004 40.870  1.00 66.95  ? 889  HOH B O   1 
HETATM 9041 O O   . HOH M 6 .   ? 107.568 21.281 25.676  1.00 56.45  ? 890  HOH B O   1 
HETATM 9042 O O   . HOH M 6 .   ? 120.309 21.574 14.499  1.00 64.43  ? 891  HOH B O   1 
HETATM 9043 O O   . HOH M 6 .   ? 102.333 20.872 28.419  1.00 54.64  ? 892  HOH B O   1 
HETATM 9044 O O   . HOH M 6 .   ? 125.411 35.311 44.050  1.00 57.48  ? 893  HOH B O   1 
HETATM 9045 O O   . HOH M 6 .   ? 110.215 24.638 63.000  1.00 69.39  ? 894  HOH B O   1 
HETATM 9046 O O   . HOH M 6 .   ? 104.412 21.293 47.248  1.00 54.44  ? 895  HOH B O   1 
HETATM 9047 O O   . HOH M 6 .   ? 85.899  46.134 40.695  1.00 59.36  ? 896  HOH B O   1 
HETATM 9048 O O   . HOH M 6 .   ? 106.831 33.298 6.319   1.00 79.61  ? 897  HOH B O   1 
HETATM 9049 O O   . HOH M 6 .   ? 108.181 46.746 56.674  1.00 65.99  ? 898  HOH B O   1 
HETATM 9050 O O   . HOH M 6 .   ? 104.547 21.788 35.822  1.00 50.89  ? 899  HOH B O   1 
HETATM 9051 O O   . HOH M 6 .   ? 113.357 23.755 48.849  1.00 54.24  ? 900  HOH B O   1 
HETATM 9052 O O   . HOH M 6 .   ? 116.039 33.828 19.174  1.00 46.99  ? 901  HOH B O   1 
HETATM 9053 O O   . HOH M 6 .   ? 121.174 55.340 2.103   1.00 76.81  ? 902  HOH B O   1 
HETATM 9054 O O   . HOH M 6 .   ? 101.720 60.836 22.012  1.00 77.23  ? 903  HOH B O   1 
HETATM 9055 O O   . HOH M 6 .   ? 119.533 53.847 1.506   1.00 64.40  ? 904  HOH B O   1 
HETATM 9056 O O   . HOH M 6 .   ? 121.070 31.345 33.170  1.00 45.63  ? 905  HOH B O   1 
HETATM 9057 O O   . HOH M 6 .   ? 102.324 20.051 33.200  1.00 65.01  ? 906  HOH B O   1 
HETATM 9058 O O   . HOH M 6 .   ? 110.632 45.828 54.096  1.00 68.65  ? 907  HOH B O   1 
HETATM 9059 O O   . HOH M 6 .   ? 125.831 56.639 35.211  1.00 68.07  ? 908  HOH B O   1 
HETATM 9060 O O   . HOH M 6 .   ? 119.006 28.431 38.093  1.00 49.54  ? 909  HOH B O   1 
HETATM 9061 O O   . HOH M 6 .   ? 92.851  58.551 16.961  1.00 62.12  ? 910  HOH B O   1 
HETATM 9062 O O   . HOH M 6 .   ? 88.984  60.504 24.707  1.00 67.28  ? 911  HOH B O   1 
HETATM 9063 O O   . HOH M 6 .   ? 134.296 17.167 30.887  1.00 65.50  ? 912  HOH B O   1 
HETATM 9064 O O   . HOH M 6 .   ? 105.763 62.486 30.680  1.00 57.54  ? 913  HOH B O   1 
HETATM 9065 O O   . HOH M 6 .   ? 86.187  30.462 46.451  1.00 69.56  ? 914  HOH B O   1 
HETATM 9066 O O   . HOH M 6 .   ? 117.841 26.387 38.666  1.00 47.51  ? 915  HOH B O   1 
HETATM 9067 O O   . HOH M 6 .   ? 95.913  24.538 51.198  1.00 49.42  ? 916  HOH B O   1 
HETATM 9068 O O   . HOH M 6 .   ? 90.733  59.245 33.373  1.00 63.52  ? 917  HOH B O   1 
HETATM 9069 O O   . HOH M 6 .   ? 87.786  31.112 16.264  1.00 63.84  ? 918  HOH B O   1 
HETATM 9070 O O   . HOH M 6 .   ? 96.949  53.764 47.944  1.00 62.22  ? 919  HOH B O   1 
HETATM 9071 O O   . HOH M 6 .   ? 115.947 45.476 43.181  1.00 50.47  ? 920  HOH B O   1 
HETATM 9072 O O   . HOH M 6 .   ? 99.497  62.802 46.320  1.00 69.95  ? 921  HOH B O   1 
HETATM 9073 O O   . HOH M 6 .   ? 126.412 58.139 6.961   1.00 67.81  ? 922  HOH B O   1 
HETATM 9074 O O   . HOH M 6 .   ? 119.862 37.664 1.496   1.00 78.27  ? 923  HOH B O   1 
HETATM 9075 O O   . HOH M 6 .   ? 117.791 27.487 22.393  1.00 43.03  ? 924  HOH B O   1 
HETATM 9076 O O   . HOH M 6 .   ? 117.766 32.239 15.208  1.00 61.78  ? 925  HOH B O   1 
HETATM 9077 O O   . HOH M 6 .   ? 102.500 26.763 63.319  1.00 58.68  ? 926  HOH B O   1 
HETATM 9078 O O   . HOH M 6 .   ? 107.958 37.246 61.668  1.00 60.92  ? 927  HOH B O   1 
HETATM 9079 O O   . HOH M 6 .   ? 97.584  22.645 17.115  1.00 69.87  ? 928  HOH B O   1 
HETATM 9080 O O   . HOH M 6 .   ? 112.780 23.106 13.407  1.00 72.03  ? 929  HOH B O   1 
HETATM 9081 O O   . HOH M 6 .   ? 115.329 50.804 -0.067  1.00 64.59  ? 930  HOH B O   1 
HETATM 9082 O O   . HOH M 6 .   ? 119.333 63.623 29.174  1.00 64.93  ? 931  HOH B O   1 
HETATM 9083 O O   . HOH M 6 .   ? 110.219 48.483 47.541  1.00 76.97  ? 932  HOH B O   1 
HETATM 9084 O O   . HOH M 6 .   ? 86.823  42.882 16.801  1.00 61.09  ? 933  HOH B O   1 
HETATM 9085 O O   . HOH M 6 .   ? 127.169 37.154 34.775  1.00 49.11  ? 934  HOH B O   1 
HETATM 9086 O O   . HOH M 6 .   ? 93.762  58.398 41.790  1.00 55.23  ? 935  HOH B O   1 
HETATM 9087 O O   . HOH M 6 .   ? 110.080 43.394 50.543  1.00 60.83  ? 936  HOH B O   1 
HETATM 9088 O O   . HOH M 6 .   ? 114.380 25.929 13.959  1.00 59.83  ? 937  HOH B O   1 
HETATM 9089 O O   . HOH M 6 .   ? 83.727  38.359 27.437  1.00 70.62  ? 938  HOH B O   1 
HETATM 9090 O O   . HOH M 6 .   ? 94.158  25.991 50.557  1.00 51.75  ? 939  HOH B O   1 
HETATM 9091 O O   . HOH M 6 .   ? 102.812 54.061 20.130  1.00 65.74  ? 940  HOH B O   1 
HETATM 9092 O O   . HOH M 6 .   ? 106.638 40.157 61.501  1.00 70.11  ? 941  HOH B O   1 
HETATM 9093 O O   . HOH M 6 .   ? 126.118 23.882 16.948  1.00 67.08  ? 942  HOH B O   1 
HETATM 9094 O O   . HOH M 6 .   ? 120.193 47.780 3.627   1.00 63.39  ? 943  HOH B O   1 
HETATM 9095 O O   . HOH M 6 .   ? 118.911 25.667 12.911  1.00 56.30  ? 944  HOH B O   1 
HETATM 9096 O O   . HOH M 6 .   ? 110.906 56.830 18.422  1.00 67.00  ? 945  HOH B O   1 
HETATM 9097 O O   . HOH M 6 .   ? 121.276 37.358 49.511  1.00 69.51  ? 946  HOH B O   1 
HETATM 9098 O O   . HOH M 6 .   ? 102.283 53.819 12.030  1.00 45.65  ? 947  HOH B O   1 
HETATM 9099 O O   . HOH M 6 .   ? 87.008  54.936 45.147  1.00 75.94  ? 948  HOH B O   1 
HETATM 9100 O O   . HOH M 6 .   ? 113.517 53.313 38.033  1.00 55.21  ? 949  HOH B O   1 
HETATM 9101 O O   . HOH M 6 .   ? 116.486 43.715 31.362  1.00 66.82  ? 950  HOH B O   1 
HETATM 9102 O O   . HOH M 6 .   ? 112.266 21.926 53.457  1.00 59.20  ? 951  HOH B O   1 
HETATM 9103 O O   . HOH M 6 .   ? 95.299  26.824 22.301  1.00 65.31  ? 952  HOH B O   1 
HETATM 9104 O O   . HOH M 6 .   ? 113.289 55.379 38.448  1.00 72.15  ? 953  HOH B O   1 
HETATM 9105 O O   . HOH M 6 .   ? 97.045  28.478 60.769  1.00 77.98  ? 954  HOH B O   1 
HETATM 9106 O O   . HOH M 6 .   ? 99.201  58.079 54.109  1.00 73.76  ? 955  HOH B O   1 
HETATM 9107 O O   . HOH M 6 .   ? 133.402 30.101 32.829  1.00 65.88  ? 956  HOH B O   1 
HETATM 9108 O O   . HOH M 6 .   ? 104.375 52.592 21.116  1.00 70.01  ? 957  HOH B O   1 
HETATM 9109 O O   . HOH M 6 .   ? 129.491 55.504 28.286  1.00 76.00  ? 958  HOH B O   1 
HETATM 9110 O O   . HOH M 6 .   ? 124.940 21.757 15.533  1.00 64.61  ? 959  HOH B O   1 
HETATM 9111 O O   . HOH M 6 .   ? 96.202  61.260 37.311  1.00 66.63  ? 960  HOH B O   1 
HETATM 9112 O O   . HOH M 6 .   ? 107.371 57.576 16.990  1.00 75.54  ? 961  HOH B O   1 
HETATM 9113 O O   . HOH M 6 .   ? 119.541 42.343 34.042  1.00 50.00  ? 962  HOH B O   1 
HETATM 9114 O O   . HOH M 6 .   ? 93.536  62.801 35.377  1.00 75.39  ? 963  HOH B O   1 
HETATM 9115 O O   . HOH M 6 .   ? 87.280  36.835 12.485  1.00 73.65  ? 964  HOH B O   1 
HETATM 9116 O O   . HOH M 6 .   ? 95.390  47.051 11.286  1.00 57.42  ? 965  HOH B O   1 
HETATM 9117 O O   . HOH M 6 .   ? 127.240 36.077 18.449  1.00 30.00  ? 966  HOH B O   1 
HETATM 9118 O O   . HOH M 6 .   ? 106.787 20.765 28.267  1.00 70.72  ? 967  HOH B O   1 
HETATM 9119 O O   . HOH M 6 .   ? 91.058  27.544 21.848  1.00 72.12  ? 968  HOH B O   1 
HETATM 9120 O O   . HOH M 6 .   ? 103.717 33.486 4.642   1.00 78.28  ? 969  HOH B O   1 
HETATM 9121 O O   . HOH M 6 .   ? 117.318 27.282 50.939  1.00 70.04  ? 970  HOH B O   1 
HETATM 9122 O O   . HOH M 6 .   ? 98.400  45.093 13.354  1.00 60.87  ? 971  HOH B O   1 
HETATM 9123 O O   . HOH M 6 .   ? 105.486 67.213 44.337  1.00 60.87  ? 972  HOH B O   1 
HETATM 9124 O O   . HOH M 6 .   ? 126.758 19.107 39.893  1.00 78.51  ? 973  HOH B O   1 
HETATM 9125 O O   . HOH M 6 .   ? 118.055 15.263 15.980  1.00 76.64  ? 974  HOH B O   1 
HETATM 9126 O O   . HOH M 6 .   ? 111.633 23.339 58.581  1.00 79.50  ? 975  HOH B O   1 
HETATM 9127 O O   . HOH M 6 .   ? 109.631 33.017 16.266  1.00 74.55  ? 976  HOH B O   1 
HETATM 9128 O O   . HOH M 6 .   ? 85.227  45.994 15.048  1.00 74.86  ? 977  HOH B O   1 
HETATM 9129 O O   . HOH M 6 .   ? 120.852 47.341 5.819   1.00 68.72  ? 978  HOH B O   1 
HETATM 9130 O O   . HOH M 6 .   ? 95.490  41.570 13.795  1.00 66.30  ? 979  HOH B O   1 
HETATM 9131 O O   . HOH M 6 .   ? 108.888 65.555 44.387  1.00 74.71  ? 980  HOH B O   1 
HETATM 9132 O O   . HOH M 6 .   ? 118.530 62.035 32.950  1.00 73.37  ? 981  HOH B O   1 
HETATM 9133 O O   . HOH M 6 .   ? 108.428 39.379 12.721  1.00 59.19  ? 982  HOH B O   1 
HETATM 9134 O O   . HOH M 6 .   ? 89.209  31.458 13.369  1.00 71.46  ? 983  HOH B O   1 
HETATM 9135 O O   . HOH M 6 .   ? 110.092 43.915 47.850  1.00 72.84  ? 984  HOH B O   1 
HETATM 9136 O O   . HOH M 6 .   ? 124.566 39.024 20.062  1.00 68.95  ? 985  HOH B O   1 
HETATM 9137 O O   . HOH M 6 .   ? 101.018 20.245 42.558  1.00 65.97  ? 986  HOH B O   1 
HETATM 9138 O O   . HOH M 6 .   ? 108.478 49.900 51.271  1.00 30.00  ? 987  HOH B O   1 
HETATM 9139 O O   . HOH M 6 .   ? 115.189 58.878 9.318   1.00 62.85  ? 988  HOH B O   1 
HETATM 9140 O O   . HOH M 6 .   ? 104.683 33.444 15.929  1.00 62.48  ? 989  HOH B O   1 
HETATM 9141 O O   . HOH M 6 .   ? 93.508  33.945 62.026  1.00 71.50  ? 990  HOH B O   1 
HETATM 9142 O O   . HOH M 6 .   ? 115.500 20.648 49.871  1.00 66.74  ? 991  HOH B O   1 
HETATM 9143 O O   . HOH M 6 .   ? 83.912  39.120 17.526  1.00 79.36  ? 992  HOH B O   1 
HETATM 9144 O O   . HOH M 6 .   ? 102.069 21.250 48.470  1.00 60.55  ? 993  HOH B O   1 
HETATM 9145 O O   . HOH M 6 .   ? 88.472  57.467 18.840  1.00 68.52  ? 994  HOH B O   1 
HETATM 9146 O O   . HOH M 6 .   ? 120.145 35.463 49.781  1.00 71.12  ? 995  HOH B O   1 
HETATM 9147 O O   . HOH M 6 .   ? 112.283 24.295 52.518  1.00 77.74  ? 996  HOH B O   1 
HETATM 9148 O O   . HOH M 6 .   ? 114.660 44.890 31.965  1.00 65.92  ? 997  HOH B O   1 
HETATM 9149 O O   . HOH M 6 .   ? 92.554  40.401 12.983  1.00 67.96  ? 998  HOH B O   1 
HETATM 9150 O O   . HOH M 6 .   ? 123.789 14.011 37.628  1.00 75.08  ? 999  HOH B O   1 
HETATM 9151 O O   . HOH M 6 .   ? 105.815 42.400 66.316  1.00 68.32  ? 1000 HOH B O   1 
HETATM 9152 O O   . HOH M 6 .   ? 104.063 37.954 12.081  1.00 64.14  ? 1001 HOH B O   1 
HETATM 9153 O O   . HOH M 6 .   ? 94.245  53.944 46.261  1.00 49.95  ? 1002 HOH B O   1 
HETATM 9154 O O   . HOH M 6 .   ? 81.259  49.791 35.892  1.00 30.00  ? 1003 HOH B O   1 
HETATM 9155 O O   . HOH M 6 .   ? 108.851 58.004 7.754   1.00 64.66  ? 1004 HOH B O   1 
HETATM 9156 O O   . HOH M 6 .   ? 101.430 22.041 43.902  1.00 60.74  ? 1005 HOH B O   1 
HETATM 9157 O O   . HOH M 6 .   ? 91.983  55.415 43.400  1.00 70.57  ? 1006 HOH B O   1 
HETATM 9158 O O   . HOH M 6 .   ? 125.190 15.842 38.514  1.00 71.76  ? 1007 HOH B O   1 
HETATM 9159 O O   . HOH M 6 .   ? 116.680 63.674 32.688  1.00 77.21  ? 1008 HOH B O   1 
HETATM 9160 O O   . HOH M 6 .   ? 126.167 55.581 37.767  1.00 75.95  ? 1009 HOH B O   1 
HETATM 9161 O O   . HOH M 6 .   ? 111.946 47.609 49.087  1.00 75.86  ? 1010 HOH B O   1 
HETATM 9162 O O   . HOH M 6 .   ? 107.148 51.584 52.700  1.00 69.29  ? 1011 HOH B O   1 
HETATM 9163 O O   . HOH M 6 .   ? 108.317 17.677 29.519  1.00 64.45  ? 1012 HOH B O   1 
HETATM 9164 O O   . HOH M 6 .   ? 109.306 67.626 5.728   1.00 71.19  ? 1013 HOH B O   1 
HETATM 9165 O O   . HOH M 6 .   ? 122.964 40.500 45.999  1.00 78.70  ? 1014 HOH B O   1 
HETATM 9166 O O   . HOH M 6 .   ? 121.267 45.234 43.091  1.00 72.03  ? 1015 HOH B O   1 
HETATM 9167 O O   . HOH M 6 .   ? 106.067 53.036 55.495  1.00 69.36  ? 1016 HOH B O   1 
HETATM 9168 O O   . HOH M 6 .   ? 114.094 49.621 41.937  1.00 55.46  ? 1017 HOH B O   1 
HETATM 9169 O O   . HOH M 6 .   ? 95.700  23.248 60.265  1.00 71.72  ? 1018 HOH B O   1 
HETATM 9170 O O   . HOH M 6 .   ? 108.079 15.936 22.195  1.00 75.88  ? 1019 HOH B O   1 
HETATM 9171 O O   . HOH M 6 .   ? 106.038 19.996 35.269  1.00 71.92  ? 1020 HOH B O   1 
HETATM 9172 O O   . HOH M 6 .   ? 103.720 16.218 46.600  1.00 76.41  ? 1021 HOH B O   1 
HETATM 9173 O O   . HOH M 6 .   ? 107.439 37.058 14.021  1.00 69.22  ? 1022 HOH B O   1 
HETATM 9174 O O   . HOH M 6 .   ? 113.260 26.455 52.259  1.00 73.17  ? 1023 HOH B O   1 
HETATM 9175 O O   . HOH M 6 .   ? 127.381 21.192 39.578  1.00 71.57  ? 1024 HOH B O   1 
HETATM 9176 O O   . HOH M 6 .   ? 83.938  48.393 39.170  1.00 72.02  ? 1025 HOH B O   1 
HETATM 9177 O O   . HOH M 6 .   ? 111.489 61.079 22.682  1.00 63.66  ? 1026 HOH B O   1 
HETATM 9178 O O   . HOH M 6 .   ? 112.713 44.047 32.554  1.00 67.52  ? 1027 HOH B O   1 
HETATM 9179 O O   . HOH M 6 .   ? 105.733 15.479 56.872  1.00 73.70  ? 1028 HOH B O   1 
HETATM 9180 O O   . HOH M 6 .   ? 112.031 37.679 12.090  1.00 76.63  ? 1029 HOH B O   1 
HETATM 9181 O O   . HOH M 6 .   ? 109.252 28.268 15.053  1.00 69.73  ? 1030 HOH B O   1 
HETATM 9182 O O   . HOH M 6 .   ? 127.299 36.730 39.235  1.00 59.88  ? 1031 HOH B O   1 
HETATM 9183 O O   . HOH M 6 .   ? 98.625  55.391 50.820  1.00 61.97  ? 1032 HOH B O   1 
HETATM 9184 O O   . HOH M 6 .   ? 113.280 52.247 40.388  1.00 59.77  ? 1033 HOH B O   1 
HETATM 9185 O O   . HOH M 6 .   ? 118.202 48.812 42.914  1.00 76.19  ? 1034 HOH B O   1 
HETATM 9186 O O   . HOH M 6 .   ? 111.776 59.959 10.306  1.00 51.49  ? 1035 HOH B O   1 
HETATM 9187 O O   . HOH M 6 .   ? 83.046  51.488 22.568  1.00 79.86  ? 1036 HOH B O   1 
HETATM 9188 O O   . HOH M 6 .   ? 126.892 46.623 13.214  1.00 66.75  ? 1037 HOH B O   1 
HETATM 9189 O O   . HOH M 6 .   ? 91.501  56.356 41.525  1.00 71.25  ? 1038 HOH B O   1 
HETATM 9190 O O   . HOH M 6 .   ? 91.130  25.541 48.185  1.00 71.87  ? 1039 HOH B O   1 
HETATM 9191 O O   . HOH M 6 .   ? 108.427 25.816 14.854  1.00 54.05  ? 1040 HOH B O   1 
HETATM 9192 O O   . HOH M 6 .   ? 128.232 38.643 22.943  1.00 78.52  ? 1041 HOH B O   1 
HETATM 9193 O O   . HOH M 6 .   ? 127.444 44.252 15.124  1.00 75.90  ? 1042 HOH B O   1 
HETATM 9194 O O   . HOH M 6 .   ? 94.802  24.113 21.423  1.00 60.38  ? 1043 HOH B O   1 
HETATM 9195 O O   . HOH M 6 .   ? 111.524 42.317 53.090  1.00 78.57  ? 1044 HOH B O   1 
HETATM 9196 O O   . HOH M 6 .   ? 110.991 61.449 14.832  1.00 72.85  ? 1045 HOH B O   1 
HETATM 9197 O O   . HOH M 6 .   ? 124.268 66.047 10.339  1.00 74.47  ? 1046 HOH B O   1 
HETATM 9198 O O   . HOH M 6 .   ? 124.247 65.638 14.388  1.00 75.94  ? 1047 HOH B O   1 
HETATM 9199 O O   . HOH M 6 .   ? 121.779 26.454 10.406  1.00 30.00  ? 1048 HOH B O   1 
HETATM 9200 O O   . HOH M 6 .   ? 83.216  46.281 21.632  1.00 72.10  ? 1049 HOH B O   1 
HETATM 9201 O O   . HOH M 6 .   ? 88.122  28.044 48.074  1.00 70.74  ? 1050 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ARG A 2   ? 1.9448 2.5017 1.7283 -0.0113 -0.4261 -0.1903 3   ARG A N   
2    C CA  . ARG A 2   ? 1.9481 2.4147 1.6570 -0.0191 -0.4113 -0.1849 3   ARG A CA  
3    C C   . ARG A 2   ? 1.8215 2.2087 1.5297 -0.0303 -0.3786 -0.1651 3   ARG A C   
4    O O   . ARG A 2   ? 1.8645 2.2091 1.5553 0.0061  -0.3631 -0.1225 3   ARG A O   
5    C CB  . ARG A 2   ? 2.0294 2.4928 1.7372 -0.0682 -0.4122 -0.2307 3   ARG A CB  
6    C CG  . ARG A 2   ? 2.1664 2.6637 1.8293 -0.0499 -0.4373 -0.2410 3   ARG A CG  
7    C CD  . ARG A 2   ? 2.2572 2.6891 1.8249 -0.0084 -0.4325 -0.2042 3   ARG A CD  
8    N NE  . ARG A 2   ? 2.2791 2.6167 1.8074 -0.0316 -0.4038 -0.2040 3   ARG A NE  
9    C CZ  . ARG A 2   ? 2.3341 2.6326 1.8256 -0.0608 -0.3972 -0.2318 3   ARG A CZ  
10   N NH1 . ARG A 2   ? 2.3748 2.7191 1.8619 -0.0726 -0.4183 -0.2628 3   ARG A NH1 
11   N NH2 . ARG A 2   ? 2.3320 2.5472 1.7917 -0.0762 -0.3688 -0.2307 3   ARG A NH2 
12   N N   . GLU A 3   ? 1.7174 2.0611 1.4490 -0.0818 -0.3552 -0.1888 4   GLU A N   
13   C CA  . GLU A 3   ? 1.5693 1.8190 1.3027 -0.0930 -0.3150 -0.1643 4   GLU A CA  
14   C C   . GLU A 3   ? 1.4402 1.6917 1.2398 -0.1373 -0.2958 -0.1835 4   GLU A C   
15   O O   . GLU A 3   ? 1.5058 1.8040 1.3386 -0.1742 -0.3040 -0.2243 4   GLU A O   
16   C CB  . GLU A 3   ? 1.5793 1.7452 1.2499 -0.1000 -0.2971 -0.1646 4   GLU A CB  
17   C CG  . GLU A 3   ? 1.6027 1.7395 1.2015 -0.0571 -0.3008 -0.1376 4   GLU A CG  
18   C CD  . GLU A 3   ? 1.5171 1.5776 1.1023 -0.0411 -0.2668 -0.1016 4   GLU A CD  
19   O OE1 . GLU A 3   ? 1.4122 1.4727 1.0446 -0.0411 -0.2535 -0.0857 4   GLU A OE1 
20   O OE2 . GLU A 3   ? 1.5140 1.5184 1.0427 -0.0305 -0.2519 -0.0928 4   GLU A OE2 
21   N N   . ASP A 4   ? 1.2909 1.4903 1.1067 -0.1341 -0.2672 -0.1554 5   ASP A N   
22   C CA  . ASP A 4   ? 1.1913 1.3709 1.0532 -0.1696 -0.2413 -0.1645 5   ASP A CA  
23   C C   . ASP A 4   ? 1.1448 1.2305 0.9695 -0.1833 -0.2123 -0.1612 5   ASP A C   
24   O O   . ASP A 4   ? 1.0916 1.1274 0.8834 -0.1579 -0.2011 -0.1336 5   ASP A O   
25   C CB  . ASP A 4   ? 1.1558 1.3457 1.0558 -0.1527 -0.2301 -0.1366 5   ASP A CB  
26   C CG  . ASP A 4   ? 1.1538 1.3335 1.0997 -0.1873 -0.2041 -0.1462 5   ASP A CG  
27   O OD1 . ASP A 4   ? 1.1662 1.3037 1.1045 -0.2211 -0.1860 -0.1664 5   ASP A OD1 
28   O OD2 . ASP A 4   ? 1.1061 1.3129 1.0912 -0.1793 -0.1976 -0.1325 5   ASP A OD2 
29   N N   . ALA A 5   ? 1.1438 1.2066 0.9757 -0.2231 -0.1975 -0.1912 6   ALA A N   
30   C CA  . ALA A 5   ? 1.0995 1.0714 0.8922 -0.2309 -0.1692 -0.1890 6   ALA A CA  
31   C C   . ALA A 5   ? 1.1067 1.0270 0.9024 -0.2155 -0.1422 -0.1560 6   ALA A C   
32   O O   . ALA A 5   ? 1.0970 0.9546 0.8561 -0.2010 -0.1255 -0.1427 6   ALA A O   
33   C CB  . ALA A 5   ? 1.1421 1.0917 0.9412 -0.2773 -0.1522 -0.2287 6   ALA A CB  
34   N N   . GLU A 6   ? 1.0665 1.0181 0.9053 -0.2163 -0.1381 -0.1444 7   GLU A N   
35   C CA  . GLU A 6   ? 1.0216 0.9309 0.8593 -0.2014 -0.1141 -0.1161 7   GLU A CA  
36   C C   . GLU A 6   ? 0.9683 0.8738 0.7843 -0.1633 -0.1214 -0.0897 7   GLU A C   
37   O O   . GLU A 6   ? 0.9273 0.7931 0.7277 -0.1479 -0.1040 -0.0725 7   GLU A O   
38   C CB  . GLU A 6   ? 1.0955 1.0412 0.9819 -0.2131 -0.1063 -0.1128 7   GLU A CB  
39   C CG  . GLU A 6   ? 1.2655 1.2038 1.1768 -0.2562 -0.0858 -0.1394 7   GLU A CG  
40   C CD  . GLU A 6   ? 1.3681 1.2132 1.2462 -0.2639 -0.0461 -0.1307 7   GLU A CD  
41   O OE1 . GLU A 6   ? 1.3383 1.1379 1.1787 -0.2314 -0.0396 -0.1037 7   GLU A OE1 
42   O OE2 . GLU A 6   ? 1.4588 1.2766 1.3480 -0.3013 -0.0193 -0.1520 7   GLU A OE2 
43   N N   . LEU A 7   ? 0.8671 0.8138 0.6802 -0.1470 -0.1449 -0.0876 8   LEU A N   
44   C CA  . LEU A 7   ? 0.8370 0.7769 0.6318 -0.1162 -0.1452 -0.0659 8   LEU A CA  
45   C C   . LEU A 7   ? 0.8582 0.7621 0.6059 -0.1064 -0.1444 -0.0685 8   LEU A C   
46   O O   . LEU A 7   ? 0.8548 0.7532 0.5855 -0.0851 -0.1418 -0.0551 8   LEU A O   
47   C CB  . LEU A 7   ? 0.7521 0.7436 0.5644 -0.0992 -0.1623 -0.0568 8   LEU A CB  
48   C CG  . LEU A 7   ? 0.7648 0.8007 0.6288 -0.1080 -0.1632 -0.0571 8   LEU A CG  
49   C CD1 . LEU A 7   ? 0.6696 0.7610 0.5494 -0.0855 -0.1825 -0.0502 8   LEU A CD1 
50   C CD2 . LEU A 7   ? 0.6124 0.6229 0.4899 -0.1067 -0.1392 -0.0426 8   LEU A CD2 
51   N N   . LEU A 8   ? 0.7948 0.6702 0.5212 -0.1235 -0.1418 -0.0874 9   LEU A N   
52   C CA  . LEU A 8   ? 0.8477 0.6860 0.5291 -0.1156 -0.1373 -0.0926 9   LEU A CA  
53   C C   . LEU A 8   ? 0.8787 0.6635 0.5508 -0.1174 -0.1131 -0.0934 9   LEU A C   
54   O O   . LEU A 8   ? 1.0048 0.7667 0.6838 -0.1370 -0.1028 -0.1042 9   LEU A O   
55   C CB  . LEU A 8   ? 0.8517 0.7023 0.5085 -0.1298 -0.1547 -0.1167 9   LEU A CB  
56   C CG  . LEU A 8   ? 0.9257 0.8360 0.5841 -0.1185 -0.1825 -0.1148 9   LEU A CG  
57   C CD1 . LEU A 8   ? 0.8910 0.8291 0.5289 -0.1346 -0.2041 -0.1455 9   LEU A CD1 
58   C CD2 . LEU A 8   ? 0.9814 0.8808 0.6097 -0.0856 -0.1794 -0.0897 9   LEU A CD2 
59   N N   . VAL A 9   ? 0.8723 0.6379 0.5291 -0.0956 -0.1014 -0.0827 10  VAL A N   
60   C CA  . VAL A 9   ? 0.9464 0.6718 0.5946 -0.0853 -0.0807 -0.0804 10  VAL A CA  
61   C C   . VAL A 9   ? 0.9077 0.6143 0.5267 -0.0709 -0.0730 -0.0862 10  VAL A C   
62   O O   . VAL A 9   ? 0.9092 0.6369 0.5234 -0.0634 -0.0771 -0.0832 10  VAL A O   
63   C CB  . VAL A 9   ? 0.9239 0.6667 0.5983 -0.0687 -0.0738 -0.0624 10  VAL A CB  
64   C CG1 . VAL A 9   ? 0.9800 0.6966 0.6410 -0.0452 -0.0570 -0.0589 10  VAL A CG1 
65   C CG2 . VAL A 9   ? 1.0038 0.7518 0.7007 -0.0835 -0.0735 -0.0574 10  VAL A CG2 
66   N N   . THR A 10  ? 0.9303 0.5923 0.5279 -0.0668 -0.0572 -0.0945 11  THR A N   
67   C CA  . THR A 10  ? 0.9850 0.6298 0.5592 -0.0510 -0.0455 -0.1015 11  THR A CA  
68   C C   . THR A 10  ? 0.9805 0.6289 0.5696 -0.0220 -0.0314 -0.0919 11  THR A C   
69   O O   . THR A 10  ? 0.9991 0.6205 0.5867 -0.0118 -0.0219 -0.0851 11  THR A O   
70   C CB  . THR A 10  ? 1.0421 0.6369 0.5797 -0.0633 -0.0367 -0.1211 11  THR A CB  
71   O OG1 . THR A 10  ? 1.0834 0.6917 0.6072 -0.0884 -0.0547 -0.1346 11  THR A OG1 
72   C CG2 . THR A 10  ? 1.0313 0.6083 0.5462 -0.0448 -0.0209 -0.1287 11  THR A CG2 
73   N N   . VAL A 11  ? 0.9052 0.5888 0.5073 -0.0079 -0.0284 -0.0924 12  VAL A N   
74   C CA  . VAL A 11  ? 0.8884 0.5948 0.5089 0.0210  -0.0178 -0.0914 12  VAL A CA  
75   C C   . VAL A 11  ? 0.9965 0.6977 0.6050 0.0310  -0.0026 -0.1070 12  VAL A C   
76   O O   . VAL A 11  ? 0.9734 0.6537 0.5570 0.0145  0.0004  -0.1159 12  VAL A O   
77   C CB  . VAL A 11  ? 0.9276 0.6940 0.5861 0.0250  -0.0240 -0.0865 12  VAL A CB  
78   C CG1 . VAL A 11  ? 0.9499 0.7187 0.6180 0.0155  -0.0364 -0.0715 12  VAL A CG1 
79   C CG2 . VAL A 11  ? 0.9836 0.7708 0.6481 0.0092  -0.0203 -0.0945 12  VAL A CG2 
80   N N   . ARG A 12  ? 1.0198 0.7452 0.6453 0.0612  0.0073  -0.1110 13  ARG A N   
81   C CA  . ARG A 12  ? 1.0577 0.7774 0.6750 0.0749  0.0253  -0.1274 13  ARG A CA  
82   C C   . ARG A 12  ? 0.9318 0.6688 0.5509 0.0540  0.0342  -0.1409 13  ARG A C   
83   O O   . ARG A 12  ? 1.0089 0.7158 0.6012 0.0508  0.0492  -0.1528 13  ARG A O   
84   C CB  . ARG A 12  ? 1.1039 0.8711 0.7506 0.1147  0.0309  -0.1315 13  ARG A CB  
85   C CG  . ARG A 12  ? 1.2606 0.9825 0.8825 0.1478  0.0361  -0.1199 13  ARG A CG  
86   C CD  . ARG A 12  ? 1.3585 1.1319 1.0040 0.1953  0.0430  -0.1274 13  ARG A CD  
87   N NE  . ARG A 12  ? 1.4904 1.2391 1.1161 0.2374  0.0421  -0.1063 13  ARG A NE  
88   C CZ  . ARG A 12  ? 1.5407 1.3398 1.1814 0.2909  0.0419  -0.1059 13  ARG A CZ  
89   N NH1 . ARG A 12  ? 1.5533 1.4402 1.2395 0.3031  0.0417  -0.1313 13  ARG A NH1 
90   N NH2 . ARG A 12  ? 1.5611 1.3241 1.1701 0.3335  0.0437  -0.0810 13  ARG A NH2 
91   N N   . GLY A 13  ? 0.8961 0.6741 0.5413 0.0401  0.0297  -0.1390 14  GLY A N   
92   C CA  . GLY A 13  ? 0.9638 0.7447 0.6036 0.0213  0.0456  -0.1483 14  GLY A CA  
93   C C   . GLY A 13  ? 0.9717 0.7003 0.5607 0.0022  0.0405  -0.1394 14  GLY A C   
94   O O   . GLY A 13  ? 0.8870 0.5991 0.4509 -0.0068 0.0583  -0.1452 14  GLY A O   
95   N N   . GLY A 14  ? 1.0066 0.7122 0.5787 -0.0034 0.0182  -0.1273 15  GLY A N   
96   C CA  . GLY A 14  ? 0.9654 0.6415 0.4960 -0.0195 0.0065  -0.1220 15  GLY A CA  
97   C C   . GLY A 14  ? 1.0069 0.6940 0.5510 -0.0279 -0.0185 -0.1088 15  GLY A C   
98   O O   . GLY A 14  ? 0.9658 0.6674 0.5413 -0.0226 -0.0239 -0.1037 15  GLY A O   
99   N N   . ARG A 15  ? 1.0364 0.7196 0.5548 -0.0382 -0.0328 -0.1034 16  ARG A N   
100  C CA  . ARG A 15  ? 1.0061 0.7064 0.5395 -0.0474 -0.0567 -0.0955 16  ARG A CA  
101  C C   . ARG A 15  ? 0.9709 0.7021 0.5302 -0.0431 -0.0602 -0.0789 16  ARG A C   
102  O O   . ARG A 15  ? 0.9358 0.6648 0.4845 -0.0365 -0.0456 -0.0733 16  ARG A O   
103  C CB  . ARG A 15  ? 0.9818 0.6734 0.4766 -0.0589 -0.0748 -0.1045 16  ARG A CB  
104  C CG  . ARG A 15  ? 1.0435 0.6990 0.5112 -0.0677 -0.0682 -0.1258 16  ARG A CG  
105  C CD  . ARG A 15  ? 1.1429 0.8011 0.5753 -0.0831 -0.0882 -0.1421 16  ARG A CD  
106  N NE  . ARG A 15  ? 1.2710 0.9328 0.6564 -0.0717 -0.0920 -0.1376 16  ARG A NE  
107  C CZ  . ARG A 15  ? 1.4042 1.0912 0.7591 -0.0735 -0.1171 -0.1428 16  ARG A CZ  
108  N NH1 . ARG A 15  ? 1.4726 1.1926 0.8499 -0.0916 -0.1412 -0.1581 16  ARG A NH1 
109  N NH2 . ARG A 15  ? 1.3485 1.0301 0.6495 -0.0559 -0.1167 -0.1336 16  ARG A NH2 
110  N N   . LEU A 16  ? 0.8778 0.6318 0.4698 -0.0480 -0.0745 -0.0720 17  LEU A N   
111  C CA  . LEU A 16  ? 0.8336 0.6155 0.4537 -0.0439 -0.0763 -0.0579 17  LEU A CA  
112  C C   . LEU A 16  ? 0.7984 0.6028 0.4281 -0.0502 -0.0994 -0.0526 17  LEU A C   
113  O O   . LEU A 16  ? 0.8259 0.6313 0.4578 -0.0635 -0.1118 -0.0627 17  LEU A O   
114  C CB  . LEU A 16  ? 0.8669 0.6668 0.5274 -0.0404 -0.0666 -0.0565 17  LEU A CB  
115  C CG  . LEU A 16  ? 0.8454 0.6442 0.5110 -0.0317 -0.0479 -0.0668 17  LEU A CG  
116  C CD1 . LEU A 16  ? 0.8444 0.6617 0.5379 -0.0238 -0.0497 -0.0658 17  LEU A CD1 
117  C CD2 . LEU A 16  ? 0.7624 0.5722 0.4351 -0.0307 -0.0282 -0.0699 17  LEU A CD2 
118  N N   . ARG A 17  ? 0.7798 0.6027 0.4178 -0.0411 -0.1017 -0.0389 18  ARG A N   
119  C CA  . ARG A 17  ? 0.8561 0.7131 0.5137 -0.0416 -0.1223 -0.0333 18  ARG A CA  
120  C C   . ARG A 17  ? 0.8115 0.6860 0.5091 -0.0375 -0.1130 -0.0219 18  ARG A C   
121  O O   . ARG A 17  ? 0.8526 0.7148 0.5469 -0.0272 -0.0943 -0.0137 18  ARG A O   
122  C CB  . ARG A 17  ? 0.9035 0.7676 0.5247 -0.0254 -0.1357 -0.0260 18  ARG A CB  
123  C CG  . ARG A 17  ? 0.8588 0.7726 0.5043 -0.0200 -0.1600 -0.0225 18  ARG A CG  
124  C CD  . ARG A 17  ? 0.8952 0.8194 0.4965 0.0071  -0.1747 -0.0122 18  ARG A CD  
125  N NE  . ARG A 17  ? 0.9331 0.8540 0.4891 0.0024  -0.1895 -0.0285 18  ARG A NE  
126  C CZ  . ARG A 17  ? 1.0292 0.9054 0.5255 0.0136  -0.1759 -0.0236 18  ARG A CZ  
127  N NH1 . ARG A 17  ? 0.9682 0.7986 0.4461 0.0277  -0.1448 -0.0040 18  ARG A NH1 
128  N NH2 . ARG A 17  ? 1.0533 0.9300 0.5079 0.0081  -0.1903 -0.0416 18  ARG A NH2 
129  N N   . GLY A 18  ? 0.7578 0.6575 0.4919 -0.0483 -0.1215 -0.0241 19  GLY A N   
130  C CA  . GLY A 18  ? 0.7113 0.6294 0.4813 -0.0457 -0.1129 -0.0156 19  GLY A CA  
131  C C   . GLY A 18  ? 0.7222 0.6762 0.5143 -0.0397 -0.1261 -0.0084 19  GLY A C   
132  O O   . GLY A 18  ? 0.7441 0.7155 0.5228 -0.0328 -0.1442 -0.0090 19  GLY A O   
133  N N   . ILE A 19  ? 0.6847 0.6554 0.5111 -0.0397 -0.1171 -0.0030 20  ILE A N   
134  C CA  . ILE A 19  ? 0.6938 0.7033 0.5501 -0.0326 -0.1260 0.0028  20  ILE A CA  
135  C C   . ILE A 19  ? 0.7434 0.7747 0.6382 -0.0514 -0.1236 -0.0035 20  ILE A C   
136  O O   . ILE A 19  ? 0.7797 0.7891 0.6715 -0.0633 -0.1116 -0.0068 20  ILE A O   
137  C CB  . ILE A 19  ? 0.7200 0.7223 0.5778 -0.0112 -0.1101 0.0169  20  ILE A CB  
138  C CG1 . ILE A 19  ? 0.7975 0.7796 0.6636 -0.0194 -0.0856 0.0136  20  ILE A CG1 
139  C CG2 . ILE A 19  ? 0.7981 0.7729 0.6125 0.0100  -0.1081 0.0268  20  ILE A CG2 
140  C CD1 . ILE A 19  ? 0.8815 0.8884 0.7850 -0.0222 -0.0782 0.0145  20  ILE A CD1 
141  N N   . ARG A 20  ? 0.7248 0.8003 0.6537 -0.0507 -0.1330 -0.0044 21  ARG A N   
142  C CA  . ARG A 20  ? 0.7507 0.8496 0.7180 -0.0714 -0.1275 -0.0121 21  ARG A CA  
143  C C   . ARG A 20  ? 0.7436 0.8638 0.7415 -0.0592 -0.1152 -0.0026 21  ARG A C   
144  O O   . ARG A 20  ? 0.7436 0.8985 0.7595 -0.0399 -0.1238 0.0022  21  ARG A O   
145  C CB  . ARG A 20  ? 0.7641 0.9070 0.7542 -0.0871 -0.1466 -0.0297 21  ARG A CB  
146  C CG  . ARG A 20  ? 0.7868 0.9673 0.8271 -0.1072 -0.1383 -0.0395 21  ARG A CG  
147  C CD  . ARG A 20  ? 0.9803 1.2339 1.0564 -0.1105 -0.1621 -0.0580 21  ARG A CD  
148  N NE  . ARG A 20  ? 1.0523 1.3587 1.1884 -0.1257 -0.1534 -0.0689 21  ARG A NE  
149  C CZ  . ARG A 20  ? 1.1266 1.4514 1.2935 -0.1649 -0.1450 -0.0943 21  ARG A CZ  
150  N NH1 . ARG A 20  ? 1.2477 1.5373 1.3886 -0.1915 -0.1440 -0.1107 21  ARG A NH1 
151  N NH2 . ARG A 20  ? 1.0542 1.4296 1.2793 -0.1802 -0.1327 -0.1058 21  ARG A NH2 
152  N N   . LEU A 21  ? 0.6795 0.7794 0.6793 -0.0667 -0.0946 0.0002  22  LEU A N   
153  C CA  . LEU A 21  ? 0.6980 0.8090 0.7182 -0.0562 -0.0786 0.0066  22  LEU A CA  
154  C C   . LEU A 21  ? 0.6142 0.7620 0.6769 -0.0691 -0.0724 0.0020  22  LEU A C   
155  O O   . LEU A 21  ? 0.6193 0.7603 0.6842 -0.0917 -0.0659 -0.0042 22  LEU A O   
156  C CB  . LEU A 21  ? 0.7426 0.8208 0.7391 -0.0567 -0.0608 0.0075  22  LEU A CB  
157  C CG  . LEU A 21  ? 0.8146 0.8668 0.7838 -0.0440 -0.0573 0.0080  22  LEU A CG  
158  C CD1 . LEU A 21  ? 0.8165 0.8567 0.7721 -0.0471 -0.0424 0.0008  22  LEU A CD1 
159  C CD2 . LEU A 21  ? 0.8498 0.9068 0.8301 -0.0262 -0.0504 0.0144  22  LEU A CD2 
160  N N   . LYS A 22  ? 0.6554 0.8377 0.7504 -0.0539 -0.0696 0.0051  23  LYS A N   
161  C CA  . LYS A 22  ? 0.6073 0.8254 0.7458 -0.0646 -0.0566 0.0000  23  LYS A CA  
162  C C   . LYS A 22  ? 0.6307 0.8191 0.7550 -0.0688 -0.0302 0.0038  23  LYS A C   
163  O O   . LYS A 22  ? 0.6887 0.8541 0.7926 -0.0535 -0.0218 0.0083  23  LYS A O   
164  C CB  . LYS A 22  ? 0.6232 0.8925 0.8022 -0.0408 -0.0622 0.0018  23  LYS A CB  
165  C CG  . LYS A 22  ? 0.6648 0.9845 0.8622 -0.0316 -0.0921 -0.0046 23  LYS A CG  
166  C CD  . LYS A 22  ? 0.7314 1.1163 0.9780 -0.0052 -0.0959 -0.0042 23  LYS A CD  
167  C CE  . LYS A 22  ? 0.8003 1.2519 1.0651 0.0107  -0.1305 -0.0128 23  LYS A CE  
168  N NZ  . LYS A 22  ? 0.9143 1.3334 1.1252 0.0474  -0.1459 0.0054  23  LYS A NZ  
169  N N   . THR A 23  ? 0.6317 0.8192 0.7631 -0.0902 -0.0149 0.0000  24  THR A N   
170  C CA  . THR A 23  ? 0.6532 0.8247 0.7727 -0.0917 0.0104  0.0031  24  THR A CA  
171  C C   . THR A 23  ? 0.6881 0.8936 0.8512 -0.1059 0.0284  -0.0021 24  THR A C   
172  O O   . THR A 23  ? 0.6797 0.9173 0.8794 -0.1212 0.0218  -0.0111 24  THR A O   
173  C CB  . THR A 23  ? 0.6621 0.7876 0.7304 -0.0988 0.0177  0.0077  24  THR A CB  
174  O OG1 . THR A 23  ? 0.7136 0.8282 0.7844 -0.1207 0.0316  0.0076  24  THR A OG1 
175  C CG2 . THR A 23  ? 0.6863 0.7871 0.7229 -0.0916 -0.0024 0.0087  24  THR A CG2 
176  N N   . PRO A 24  ? 0.6479 0.8525 0.8110 -0.1029 0.0527  -0.0007 25  PRO A N   
177  C CA  . PRO A 24  ? 0.6558 0.8907 0.8598 -0.1185 0.0758  -0.0065 25  PRO A CA  
178  C C   . PRO A 24  ? 0.6781 0.8976 0.8795 -0.1489 0.0882  -0.0097 25  PRO A C   
179  O O   . PRO A 24  ? 0.7515 1.0129 1.0066 -0.1686 0.0960  -0.0227 25  PRO A O   
180  C CB  . PRO A 24  ? 0.6895 0.9068 0.8689 -0.1105 0.1016  -0.0032 25  PRO A CB  
181  C CG  . PRO A 24  ? 0.6771 0.8824 0.8349 -0.0875 0.0885  -0.0024 25  PRO A CG  
182  C CD  . PRO A 24  ? 0.5761 0.7609 0.7091 -0.0859 0.0613  0.0014  25  PRO A CD  
183  N N   . GLY A 25  ? 0.6919 0.8527 0.8334 -0.1526 0.0926  0.0001  26  GLY A N   
184  C CA  . GLY A 25  ? 0.7081 0.8345 0.8364 -0.1798 0.1134  -0.0004 26  GLY A CA  
185  C C   . GLY A 25  ? 0.7503 0.8792 0.8945 -0.1974 0.0950  -0.0119 26  GLY A C   
186  O O   . GLY A 25  ? 0.8812 0.9870 1.0287 -0.2275 0.1174  -0.0196 26  GLY A O   
187  N N   . GLY A 26  ? 0.6699 0.8215 0.8203 -0.1810 0.0590  -0.0149 27  GLY A N   
188  C CA  . GLY A 26  ? 0.7086 0.8650 0.8675 -0.1956 0.0393  -0.0279 27  GLY A CA  
189  C C   . GLY A 26  ? 0.7159 0.8577 0.8409 -0.1711 0.0084  -0.0209 27  GLY A C   
190  O O   . GLY A 26  ? 0.7794 0.9091 0.8788 -0.1451 0.0035  -0.0079 27  GLY A O   
191  N N   . PRO A 27  ? 0.6828 0.8259 0.8073 -0.1820 -0.0101 -0.0328 28  PRO A N   
192  C CA  . PRO A 27  ? 0.6079 0.7400 0.7018 -0.1598 -0.0373 -0.0276 28  PRO A CA  
193  C C   . PRO A 27  ? 0.5910 0.6553 0.6251 -0.1515 -0.0298 -0.0153 28  PRO A C   
194  O O   . PRO A 27  ? 0.6187 0.6373 0.6282 -0.1644 -0.0078 -0.0123 28  PRO A O   
195  C CB  . PRO A 27  ? 0.5638 0.7272 0.6784 -0.1769 -0.0577 -0.0486 28  PRO A CB  
196  C CG  . PRO A 27  ? 0.6650 0.8191 0.7990 -0.2157 -0.0328 -0.0650 28  PRO A CG  
197  C CD  . PRO A 27  ? 0.6879 0.8484 0.8435 -0.2180 -0.0049 -0.0564 28  PRO A CD  
198  N N   . VAL A 28  ? 0.5878 0.6460 0.5981 -0.1276 -0.0460 -0.0083 29  VAL A N   
199  C CA  . VAL A 28  ? 0.6189 0.6302 0.5806 -0.1152 -0.0441 -0.0008 29  VAL A CA  
200  C C   . VAL A 28  ? 0.6424 0.6529 0.5905 -0.1064 -0.0653 -0.0054 29  VAL A C   
201  O O   . VAL A 28  ? 0.5950 0.6363 0.5600 -0.0971 -0.0787 -0.0064 29  VAL A O   
202  C CB  . VAL A 28  ? 0.6563 0.6664 0.6034 -0.0957 -0.0343 0.0085  29  VAL A CB  
203  C CG1 . VAL A 28  ? 0.7213 0.7052 0.6286 -0.0791 -0.0381 0.0107  29  VAL A CG1 
204  C CG2 . VAL A 28  ? 0.6689 0.6708 0.6140 -0.1018 -0.0112 0.0150  29  VAL A CG2 
205  N N   . SER A 29  ? 0.6213 0.5924 0.5347 -0.1064 -0.0653 -0.0068 30  SER A N   
206  C CA  . SER A 29  ? 0.6758 0.6396 0.5690 -0.0973 -0.0803 -0.0110 30  SER A CA  
207  C C   . SER A 29  ? 0.6891 0.6462 0.5644 -0.0763 -0.0762 -0.0053 30  SER A C   
208  O O   . SER A 29  ? 0.7398 0.6832 0.6003 -0.0680 -0.0651 -0.0012 30  SER A O   
209  C CB  . SER A 29  ? 0.6705 0.5962 0.5378 -0.1088 -0.0796 -0.0195 30  SER A CB  
210  O OG  . SER A 29  ? 0.6959 0.6349 0.5841 -0.1343 -0.0832 -0.0336 30  SER A OG  
211  N N   . ALA A 30  ? 0.6523 0.6206 0.5273 -0.0670 -0.0831 -0.0065 31  ALA A N   
212  C CA  . ALA A 30  ? 0.5934 0.5606 0.4598 -0.0542 -0.0744 -0.0080 31  ALA A CA  
213  C C   . ALA A 30  ? 0.6799 0.6294 0.5233 -0.0496 -0.0775 -0.0125 31  ALA A C   
214  O O   . ALA A 30  ? 0.7030 0.6502 0.5398 -0.0494 -0.0865 -0.0100 31  ALA A O   
215  C CB  . ALA A 30  ? 0.5393 0.5278 0.4282 -0.0498 -0.0660 -0.0059 31  ALA A CB  
216  N N   . PHE A 31  ? 0.6875 0.6291 0.5177 -0.0438 -0.0696 -0.0200 32  PHE A N   
217  C CA  . PHE A 31  ? 0.6602 0.5856 0.4704 -0.0406 -0.0657 -0.0268 32  PHE A CA  
218  C C   . PHE A 31  ? 0.6936 0.6348 0.5160 -0.0381 -0.0481 -0.0377 32  PHE A C   
219  O O   . PHE A 31  ? 0.7197 0.6801 0.5483 -0.0334 -0.0437 -0.0494 32  PHE A O   
220  C CB  . PHE A 31  ? 0.6405 0.5464 0.4295 -0.0380 -0.0690 -0.0317 32  PHE A CB  
221  C CG  . PHE A 31  ? 0.6844 0.5703 0.4620 -0.0472 -0.0805 -0.0280 32  PHE A CG  
222  C CD1 . PHE A 31  ? 0.7329 0.6037 0.4901 -0.0530 -0.0888 -0.0318 32  PHE A CD1 
223  C CD2 . PHE A 31  ? 0.6824 0.5645 0.4678 -0.0520 -0.0801 -0.0232 32  PHE A CD2 
224  C CE1 . PHE A 31  ? 0.7716 0.6323 0.5227 -0.0667 -0.0989 -0.0366 32  PHE A CE1 
225  C CE2 . PHE A 31  ? 0.7409 0.6038 0.5205 -0.0676 -0.0846 -0.0261 32  PHE A CE2 
226  C CZ  . PHE A 31  ? 0.7726 0.6291 0.5385 -0.0767 -0.0951 -0.0355 32  PHE A CZ  
227  N N   . LEU A 32  ? 0.5875 0.6180 0.4744 -0.0191 -0.1016 -0.0021 33  LEU A N   
228  C CA  . LEU A 32  ? 0.5916 0.6318 0.4937 -0.0106 -0.0936 0.0048  33  LEU A CA  
229  C C   . LEU A 32  ? 0.6193 0.6624 0.5121 -0.0001 -0.0912 0.0080  33  LEU A C   
230  O O   . LEU A 32  ? 0.6495 0.7011 0.5366 0.0007  -0.0963 0.0095  33  LEU A O   
231  C CB  . LEU A 32  ? 0.5776 0.6394 0.5038 -0.0131 -0.0945 0.0101  33  LEU A CB  
232  C CG  . LEU A 32  ? 0.5618 0.6297 0.4991 -0.0248 -0.0968 0.0071  33  LEU A CG  
233  C CD1 . LEU A 32  ? 0.5140 0.6074 0.4756 -0.0234 -0.0977 0.0110  33  LEU A CD1 
234  C CD2 . LEU A 32  ? 0.5269 0.5792 0.4622 -0.0283 -0.0909 0.0051  33  LEU A CD2 
235  N N   . GLY A 33  ? 0.6446 0.6831 0.5363 0.0072  -0.0836 0.0094  34  GLY A N   
236  C CA  . GLY A 33  ? 0.5643 0.6095 0.4482 0.0154  -0.0800 0.0132  34  GLY A CA  
237  C C   . GLY A 33  ? 0.6413 0.6779 0.5010 0.0204  -0.0809 0.0056  34  GLY A C   
238  O O   . GLY A 33  ? 0.6268 0.6719 0.4758 0.0234  -0.0820 0.0073  34  GLY A O   
239  N N   . ILE A 34  ? 0.5824 0.6009 0.4315 0.0219  -0.0809 -0.0029 35  ILE A N   
240  C CA  . ILE A 34  ? 0.5918 0.5992 0.4167 0.0296  -0.0820 -0.0121 35  ILE A CA  
241  C C   . ILE A 34  ? 0.6599 0.6774 0.4844 0.0409  -0.0730 -0.0111 35  ILE A C   
242  O O   . ILE A 34  ? 0.6521 0.6679 0.4873 0.0434  -0.0681 -0.0098 35  ILE A O   
243  C CB  . ILE A 34  ? 0.6340 0.6135 0.4454 0.0272  -0.0876 -0.0218 35  ILE A CB  
244  C CG1 . ILE A 34  ? 0.6607 0.6344 0.4756 0.0125  -0.0958 -0.0216 35  ILE A CG1 
245  C CG2 . ILE A 34  ? 0.7244 0.6897 0.5085 0.0372  -0.0903 -0.0329 35  ILE A CG2 
246  C CD1 . ILE A 34  ? 0.6460 0.5914 0.4500 0.0058  -0.1009 -0.0282 35  ILE A CD1 
247  N N   . PRO A 35  ? 0.6108 0.6412 0.4231 0.0476  -0.0705 -0.0118 36  PRO A N   
248  C CA  . PRO A 35  ? 0.6030 0.6483 0.4156 0.0574  -0.0614 -0.0112 36  PRO A CA  
249  C C   . PRO A 35  ? 0.6572 0.6877 0.4568 0.0686  -0.0612 -0.0236 36  PRO A C   
250  O O   . PRO A 35  ? 0.6747 0.6889 0.4531 0.0733  -0.0670 -0.0343 36  PRO A O   
251  C CB  . PRO A 35  ? 0.6357 0.6996 0.4359 0.0595  -0.0596 -0.0090 36  PRO A CB  
252  C CG  . PRO A 35  ? 0.6794 0.7293 0.4634 0.0561  -0.0693 -0.0150 36  PRO A CG  
253  C CD  . PRO A 35  ? 0.6544 0.6896 0.4522 0.0457  -0.0758 -0.0127 36  PRO A CD  
254  N N   . PHE A 36  ? 0.6686 0.7032 0.4802 0.0735  -0.0555 -0.0225 37  PHE A N   
255  C CA  . PHE A 36  ? 0.6843 0.7070 0.4843 0.0869  -0.0556 -0.0337 37  PHE A CA  
256  C C   . PHE A 36  ? 0.7133 0.7636 0.5159 0.0988  -0.0465 -0.0349 37  PHE A C   
257  O O   . PHE A 36  ? 0.7220 0.7672 0.5143 0.1134  -0.0467 -0.0456 37  PHE A O   
258  C CB  . PHE A 36  ? 0.6225 0.6234 0.4306 0.0840  -0.0586 -0.0337 37  PHE A CB  
259  C CG  . PHE A 36  ? 0.6072 0.6248 0.4397 0.0800  -0.0520 -0.0239 37  PHE A CG  
260  C CD1 . PHE A 36  ? 0.5907 0.6198 0.4286 0.0905  -0.0467 -0.0259 37  PHE A CD1 
261  C CD2 . PHE A 36  ? 0.5502 0.5717 0.3999 0.0663  -0.0519 -0.0137 37  PHE A CD2 
262  C CE1 . PHE A 36  ? 0.5867 0.6299 0.4459 0.0858  -0.0416 -0.0175 37  PHE A CE1 
263  C CE2 . PHE A 36  ? 0.6003 0.6338 0.4703 0.0629  -0.0467 -0.0059 37  PHE A CE2 
264  C CZ  . PHE A 36  ? 0.6019 0.6456 0.4762 0.0718  -0.0417 -0.0076 37  PHE A CZ  
265  N N   . ALA A 37  ? 0.6469 0.7265 0.4621 0.0931  -0.0393 -0.0245 38  ALA A N   
266  C CA  . ALA A 37  ? 0.5990 0.7103 0.4171 0.1013  -0.0301 -0.0246 38  ALA A CA  
267  C C   . ALA A 37  ? 0.7059 0.8419 0.5215 0.0941  -0.0255 -0.0160 38  ALA A C   
268  O O   . ALA A 37  ? 0.6499 0.7794 0.4679 0.0821  -0.0292 -0.0070 38  ALA A O   
269  C CB  . ALA A 37  ? 0.5492 0.6723 0.3897 0.0991  -0.0250 -0.0181 38  ALA A CB  
270  N N   . GLU A 38  ? 0.6659 0.8316 0.4757 0.1020  -0.0177 -0.0190 39  GLU A N   
271  C CA  . GLU A 38  ? 0.6540 0.8468 0.4626 0.0930  -0.0118 -0.0081 39  GLU A CA  
272  C C   . GLU A 38  ? 0.6542 0.8553 0.4850 0.0785  -0.0087 0.0079  39  GLU A C   
273  O O   . GLU A 38  ? 0.6366 0.8391 0.4838 0.0796  -0.0066 0.0080  39  GLU A O   
274  C CB  . GLU A 38  ? 0.6684 0.8964 0.4677 0.1036  -0.0028 -0.0147 39  GLU A CB  
275  C CG  . GLU A 38  ? 0.7201 0.9415 0.4937 0.1183  -0.0058 -0.0308 39  GLU A CG  
276  C CD  . GLU A 38  ? 0.8152 1.0272 0.5716 0.1103  -0.0108 -0.0270 39  GLU A CD  
277  O OE1 . GLU A 38  ? 0.8360 1.0669 0.5942 0.0977  -0.0067 -0.0131 39  GLU A OE1 
278  O OE2 . GLU A 38  ? 0.9272 1.1114 0.6673 0.1158  -0.0196 -0.0376 39  GLU A OE2 
279  N N   . PRO A 39  ? 0.6427 0.8470 0.4732 0.0654  -0.0095 0.0212  40  PRO A N   
280  C CA  . PRO A 39  ? 0.6210 0.8267 0.4700 0.0519  -0.0084 0.0360  40  PRO A CA  
281  C C   . PRO A 39  ? 0.5870 0.8218 0.4472 0.0503  0.0009  0.0393  40  PRO A C   
282  O O   . PRO A 39  ? 0.5764 0.8410 0.4281 0.0505  0.0083  0.0402  40  PRO A O   
283  C CB  . PRO A 39  ? 0.6219 0.8282 0.4611 0.0411  -0.0112 0.0483  40  PRO A CB  
284  C CG  . PRO A 39  ? 0.6600 0.8535 0.4805 0.0480  -0.0173 0.0392  40  PRO A CG  
285  C CD  . PRO A 39  ? 0.6919 0.8935 0.5033 0.0628  -0.0133 0.0229  40  PRO A CD  
286  N N   . PRO A 40  ? 0.6288 0.8583 0.5083 0.0481  0.0010  0.0408  41  PRO A N   
287  C CA  . PRO A 40  ? 0.6661 0.9248 0.5581 0.0460  0.0090  0.0431  41  PRO A CA  
288  C C   . PRO A 40  ? 0.7555 1.0275 0.6526 0.0279  0.0121  0.0601  41  PRO A C   
289  O O   . PRO A 40  ? 0.7608 1.0303 0.6737 0.0187  0.0119  0.0672  41  PRO A O   
290  C CB  . PRO A 40  ? 0.6022 0.8438 0.5099 0.0504  0.0056  0.0380  41  PRO A CB  
291  C CG  . PRO A 40  ? 0.5991 0.8060 0.5078 0.0448  -0.0028 0.0419  41  PRO A CG  
292  C CD  . PRO A 40  ? 0.5712 0.7696 0.4611 0.0474  -0.0064 0.0396  41  PRO A CD  
293  N N   . MET A 41  ? 0.7187 1.0035 0.6005 0.0220  0.0145  0.0668  42  MET A N   
294  C CA  . MET A 41  ? 0.7718 1.0638 0.6530 0.0034  0.0160  0.0844  42  MET A CA  
295  C C   . MET A 41  ? 0.7451 1.0803 0.6202 -0.0016 0.0267  0.0875  42  MET A C   
296  O O   . MET A 41  ? 0.6710 1.0305 0.5389 0.0113  0.0326  0.0753  42  MET A O   
297  C CB  . MET A 41  ? 0.8903 1.1586 0.7569 -0.0023 0.0084  0.0932  42  MET A CB  
298  C CG  . MET A 41  ? 0.9585 1.1966 0.8229 0.0086  -0.0004 0.0839  42  MET A CG  
299  S SD  . MET A 41  ? 1.1785 1.3926 1.0304 0.0006  -0.0105 0.0962  42  MET A SD  
300  C CE  . MET A 41  ? 1.1491 1.3502 1.0153 -0.0145 -0.0134 0.1125  42  MET A CE  
301  N N   . GLY A 42  ? 0.6795 1.0238 0.5563 -0.0210 0.0288  0.1040  43  GLY A N   
302  C CA  . GLY A 42  ? 0.6599 1.0468 0.5307 -0.0310 0.0391  0.1102  43  GLY A CA  
303  C C   . GLY A 42  ? 0.7095 1.1360 0.5937 -0.0213 0.0482  0.0977  43  GLY A C   
304  O O   . GLY A 42  ? 0.6126 1.0415 0.5168 -0.0231 0.0481  0.0964  43  GLY A O   
305  N N   . PRO A 43  ? 0.7118 1.1707 0.5846 -0.0093 0.0558  0.0873  44  PRO A N   
306  C CA  . PRO A 43  ? 0.6409 1.1403 0.5260 0.0039  0.0639  0.0734  44  PRO A CA  
307  C C   . PRO A 43  ? 0.6859 1.1626 0.5818 0.0249  0.0579  0.0569  44  PRO A C   
308  O O   . PRO A 43  ? 0.6558 1.1598 0.5658 0.0350  0.0621  0.0472  44  PRO A O   
309  C CB  . PRO A 43  ? 0.6859 1.2200 0.5518 0.0133  0.0721  0.0656  44  PRO A CB  
310  C CG  . PRO A 43  ? 0.6907 1.1885 0.5342 0.0133  0.0649  0.0688  44  PRO A CG  
311  C CD  . PRO A 43  ? 0.7043 1.1663 0.5518 -0.0070 0.0569  0.0875  44  PRO A CD  
312  N N   . ARG A 44  ? 0.6952 1.1243 0.5848 0.0313  0.0479  0.0539  45  ARG A N   
313  C CA  . ARG A 44  ? 0.5977 1.0020 0.4938 0.0494  0.0416  0.0395  45  ARG A CA  
314  C C   . ARG A 44  ? 0.6742 1.0554 0.5899 0.0417  0.0362  0.0452  45  ARG A C   
315  O O   . ARG A 44  ? 0.5924 0.9514 0.5133 0.0542  0.0307  0.0351  45  ARG A O   
316  C CB  . ARG A 44  ? 0.6300 0.9973 0.5082 0.0593  0.0337  0.0323  45  ARG A CB  
317  C CG  . ARG A 44  ? 0.7050 1.0901 0.5626 0.0734  0.0375  0.0205  45  ARG A CG  
318  C CD  . ARG A 44  ? 0.7981 1.1464 0.6369 0.0773  0.0288  0.0168  45  ARG A CD  
319  N NE  . ARG A 44  ? 0.9744 1.3273 0.7947 0.0969  0.0291  -0.0008 45  ARG A NE  
320  C CZ  . ARG A 44  ? 1.0471 1.4124 0.8459 0.0986  0.0316  -0.0030 45  ARG A CZ  
321  N NH1 . ARG A 44  ? 1.0817 1.4566 0.8747 0.0812  0.0339  0.0126  45  ARG A NH1 
322  N NH2 . ARG A 44  ? 1.0895 1.4561 0.8710 0.1181  0.0310  -0.0210 45  ARG A NH2 
323  N N   . ARG A 45  ? 0.6070 0.9913 0.5316 0.0212  0.0370  0.0609  46  ARG A N   
324  C CA  . ARG A 45  ? 0.6299 0.9929 0.5718 0.0142  0.0318  0.0653  46  ARG A CA  
325  C C   . ARG A 45  ? 0.5667 0.9567 0.5254 0.0212  0.0356  0.0572  46  ARG A C   
326  O O   . ARG A 45  ? 0.5216 0.9558 0.4835 0.0212  0.0438  0.0557  46  ARG A O   
327  C CB  . ARG A 45  ? 0.5759 0.9332 0.5204 -0.0092 0.0308  0.0835  46  ARG A CB  
328  C CG  . ARG A 45  ? 0.6560 1.0010 0.6188 -0.0176 0.0271  0.0874  46  ARG A CG  
329  C CD  . ARG A 45  ? 0.6217 0.9630 0.5849 -0.0412 0.0260  0.1050  46  ARG A CD  
330  N NE  . ARG A 45  ? 0.5524 0.8571 0.5028 -0.0464 0.0187  0.1138  46  ARG A NE  
331  C CZ  . ARG A 45  ? 0.5742 0.8672 0.5190 -0.0650 0.0156  0.1297  46  ARG A CZ  
332  N NH1 . ARG A 45  ? 0.4895 0.8036 0.4391 -0.0829 0.0195  0.1394  46  ARG A NH1 
333  N NH2 . ARG A 45  ? 0.6160 0.8753 0.5490 -0.0666 0.0077  0.1367  46  ARG A NH2 
334  N N   . PHE A 46  ? 0.4731 0.8380 0.4425 0.0271  0.0294  0.0522  47  PHE A N   
335  C CA  . PHE A 46  ? 0.5374 0.9201 0.5221 0.0356  0.0303  0.0441  47  PHE A CA  
336  C C   . PHE A 46  ? 0.5404 0.9356 0.5185 0.0599  0.0315  0.0274  47  PHE A C   
337  O O   . PHE A 46  ? 0.5017 0.9062 0.4898 0.0715  0.0302  0.0188  47  PHE A O   
338  C CB  . PHE A 46  ? 0.5050 0.9303 0.5039 0.0213  0.0368  0.0516  47  PHE A CB  
339  C CG  . PHE A 46  ? 0.5048 0.9167 0.5081 -0.0035 0.0348  0.0680  47  PHE A CG  
340  C CD1 . PHE A 46  ? 0.4740 0.8474 0.4834 -0.0083 0.0269  0.0710  47  PHE A CD1 
341  C CD2 . PHE A 46  ? 0.4499 0.8877 0.4502 -0.0220 0.0407  0.0803  47  PHE A CD2 
342  C CE1 . PHE A 46  ? 0.4318 0.7900 0.4438 -0.0291 0.0239  0.0848  47  PHE A CE1 
343  C CE2 . PHE A 46  ? 0.4792 0.8999 0.4810 -0.0448 0.0373  0.0956  47  PHE A CE2 
344  C CZ  . PHE A 46  ? 0.5090 0.8886 0.5166 -0.0474 0.0285  0.0973  47  PHE A CZ  
345  N N   . LEU A 47  ? 0.4466 0.8404 0.4067 0.0684  0.0329  0.0224  48  LEU A N   
346  C CA  . LEU A 47  ? 0.4937 0.8967 0.4444 0.0925  0.0333  0.0055  48  LEU A CA  
347  C C   . LEU A 47  ? 0.5592 0.9134 0.4991 0.1051  0.0235  -0.0031 48  LEU A C   
348  O O   . LEU A 47  ? 0.5133 0.8313 0.4502 0.0946  0.0180  0.0039  48  LEU A O   
349  C CB  . LEU A 47  ? 0.4846 0.9129 0.4193 0.0959  0.0400  0.0030  48  LEU A CB  
350  C CG  . LEU A 47  ? 0.5084 0.9907 0.4502 0.0837  0.0509  0.0108  48  LEU A CG  
351  C CD1 . LEU A 47  ? 0.4993 1.0036 0.4213 0.0895  0.0571  0.0063  48  LEU A CD1 
352  C CD2 . LEU A 47  ? 0.5403 1.0630 0.5012 0.0916  0.0550  0.0041  48  LEU A CD2 
353  N N   . PRO A 48  ? 0.5390 0.8912 0.4729 0.1273  0.0207  -0.0183 49  PRO A N   
354  C CA  . PRO A 48  ? 0.5749 0.8789 0.4951 0.1375  0.0109  -0.0261 49  PRO A CA  
355  C C   . PRO A 48  ? 0.6100 0.8915 0.5111 0.1340  0.0087  -0.0258 49  PRO A C   
356  O O   . PRO A 48  ? 0.6669 0.9728 0.5601 0.1321  0.0147  -0.0247 49  PRO A O   
357  C CB  . PRO A 48  ? 0.6285 0.9404 0.5422 0.1634  0.0088  -0.0428 49  PRO A CB  
358  C CG  . PRO A 48  ? 0.6070 0.9691 0.5401 0.1647  0.0161  -0.0419 49  PRO A CG  
359  C CD  . PRO A 48  ? 0.5078 0.9011 0.4482 0.1438  0.0253  -0.0288 49  PRO A CD  
360  N N   . PRO A 49  ? 0.5879 0.8246 0.4802 0.1322  0.0000  -0.0265 50  PRO A N   
361  C CA  . PRO A 49  ? 0.5374 0.7535 0.4123 0.1278  -0.0032 -0.0263 50  PRO A CA  
362  C C   . PRO A 49  ? 0.6194 0.8356 0.4723 0.1463  -0.0044 -0.0414 50  PRO A C   
363  O O   . PRO A 49  ? 0.6987 0.9087 0.5458 0.1645  -0.0076 -0.0539 50  PRO A O   
364  C CB  . PRO A 49  ? 0.5269 0.6993 0.4012 0.1214  -0.0122 -0.0244 50  PRO A CB  
365  C CG  . PRO A 49  ? 0.5448 0.7079 0.4244 0.1321  -0.0153 -0.0308 50  PRO A CG  
366  C CD  . PRO A 49  ? 0.5121 0.7167 0.4092 0.1336  -0.0073 -0.0278 50  PRO A CD  
367  N N   . GLU A 50  ? 0.6429 0.8651 0.4822 0.1425  -0.0026 -0.0405 51  GLU A N   
368  C CA  . GLU A 50  ? 0.7555 0.9702 0.5706 0.1593  -0.0055 -0.0558 51  GLU A CA  
369  C C   . GLU A 50  ? 0.7169 0.8882 0.5155 0.1537  -0.0155 -0.0573 51  GLU A C   
370  O O   . GLU A 50  ? 0.7020 0.8652 0.5066 0.1360  -0.0169 -0.0450 51  GLU A O   
371  C CB  . GLU A 50  ? 0.8897 1.1448 0.6965 0.1618  0.0035  -0.0570 51  GLU A CB  
372  C CG  . GLU A 50  ? 1.1067 1.4091 0.9334 0.1535  0.0147  -0.0467 51  GLU A CG  
373  C CD  . GLU A 50  ? 1.3286 1.6692 1.1452 0.1509  0.0237  -0.0449 51  GLU A CD  
374  O OE1 . GLU A 50  ? 1.4176 1.7738 1.2185 0.1690  0.0260  -0.0597 51  GLU A OE1 
375  O OE2 . GLU A 50  ? 1.3702 1.7243 1.1929 0.1311  0.0280  -0.0287 51  GLU A OE2 
376  N N   . PRO A 51  ? 0.7937 0.9365 0.5716 0.1684  -0.0234 -0.0722 52  PRO A N   
377  C CA  . PRO A 51  ? 0.8526 0.9541 0.6151 0.1609  -0.0338 -0.0738 52  PRO A CA  
378  C C   . PRO A 51  ? 0.8188 0.9309 0.5727 0.1503  -0.0324 -0.0685 52  PRO A C   
379  O O   . PRO A 51  ? 0.8133 0.9574 0.5612 0.1552  -0.0251 -0.0701 52  PRO A O   
380  C CB  . PRO A 51  ? 0.9435 1.0172 0.6815 0.1808  -0.0417 -0.0923 52  PRO A CB  
381  C CG  . PRO A 51  ? 0.9243 1.0168 0.6711 0.1982  -0.0374 -0.0983 52  PRO A CG  
382  C CD  . PRO A 51  ? 0.8431 0.9887 0.6102 0.1927  -0.0242 -0.0887 52  PRO A CD  
383  N N   . LYS A 52  ? 0.7884 0.8754 0.5419 0.1352  -0.0396 -0.0620 53  LYS A N   
384  C CA  . LYS A 52  ? 0.7895 0.8830 0.5344 0.1252  -0.0407 -0.0567 53  LYS A CA  
385  C C   . LYS A 52  ? 0.7744 0.8619 0.4902 0.1375  -0.0442 -0.0718 53  LYS A C   
386  O O   . LYS A 52  ? 0.7866 0.8415 0.4859 0.1457  -0.0529 -0.0846 53  LYS A O   
387  C CB  . LYS A 52  ? 0.8243 0.8925 0.5756 0.1088  -0.0490 -0.0489 53  LYS A CB  
388  C CG  . LYS A 52  ? 0.8112 0.8840 0.5538 0.0989  -0.0524 -0.0437 53  LYS A CG  
389  C CD  . LYS A 52  ? 0.8060 0.9121 0.5595 0.0923  -0.0441 -0.0298 53  LYS A CD  
390  C CE  . LYS A 52  ? 0.8661 0.9737 0.6104 0.0826  -0.0493 -0.0234 53  LYS A CE  
391  N NZ  . LYS A 52  ? 0.9664 1.1021 0.7169 0.0757  -0.0424 -0.0088 53  LYS A NZ  
392  N N   . GLN A 53  ? 0.7965 0.9143 0.5041 0.1386  -0.0378 -0.0701 54  GLN A N   
393  C CA  A GLN A 53  ? 0.8314 0.9469 0.5100 0.1504  -0.0405 -0.0846 54  GLN A CA  
394  C CA  B GLN A 53  ? 0.8311 0.9461 0.5097 0.1505  -0.0406 -0.0848 54  GLN A CA  
395  C C   . GLN A 53  ? 0.8555 0.9388 0.5189 0.1406  -0.0527 -0.0864 54  GLN A C   
396  O O   . GLN A 53  ? 0.8071 0.8868 0.4832 0.1235  -0.0559 -0.0729 54  GLN A O   
397  C CB  A GLN A 53  ? 0.8579 1.0171 0.5316 0.1513  -0.0298 -0.0806 54  GLN A CB  
398  C CB  B GLN A 53  ? 0.8591 1.0178 0.5322 0.1523  -0.0298 -0.0815 54  GLN A CB  
399  C CG  A GLN A 53  ? 0.8725 1.0700 0.5623 0.1585  -0.0171 -0.0783 54  GLN A CG  
400  C CG  B GLN A 53  ? 0.9005 1.0923 0.5780 0.1686  -0.0191 -0.0888 54  GLN A CG  
401  C CD  A GLN A 53  ? 0.9291 1.1703 0.6208 0.1494  -0.0062 -0.0663 54  GLN A CD  
402  C CD  B GLN A 53  ? 1.0031 1.1772 0.6606 0.1922  -0.0239 -0.1113 54  GLN A CD  
403  O OE1 A GLN A 53  ? 0.9960 1.2378 0.6747 0.1396  -0.0083 -0.0600 54  GLN A OE1 
404  O OE1 B GLN A 53  ? 1.1237 1.2877 0.7543 0.2006  -0.0285 -0.1240 54  GLN A OE1 
405  N NE2 A GLN A 53  ? 0.9357 1.2141 0.6430 0.1518  0.0050  -0.0625 54  GLN A NE2 
406  N NE2 B GLN A 53  ? 1.0010 1.1696 0.6704 0.2038  -0.0238 -0.1168 54  GLN A NE2 
407  N N   . PRO A 54  ? 0.9418 1.0018 0.5779 0.1516  -0.0605 -0.1034 55  PRO A N   
408  C CA  . PRO A 54  ? 0.9540 0.9840 0.5749 0.1411  -0.0731 -0.1059 55  PRO A CA  
409  C C   . PRO A 54  ? 0.8949 0.9470 0.5153 0.1282  -0.0721 -0.0946 55  PRO A C   
410  O O   . PRO A 54  ? 0.8306 0.9178 0.4505 0.1309  -0.0624 -0.0894 55  PRO A O   
411  C CB  . PRO A 54  ? 1.0411 1.0487 0.6293 0.1581  -0.0798 -0.1275 55  PRO A CB  
412  C CG  . PRO A 54  ? 1.0330 1.0443 0.6245 0.1774  -0.0740 -0.1362 55  PRO A CG  
413  C CD  . PRO A 54  ? 0.9850 1.0421 0.6031 0.1749  -0.0595 -0.1221 55  PRO A CD  
414  N N   . TRP A 55  ? 0.8693 0.9010 0.4893 0.1135  -0.0827 -0.0904 56  TRP A N   
415  C CA  . TRP A 55  ? 0.8683 0.9165 0.4878 0.1014  -0.0847 -0.0795 56  TRP A CA  
416  C C   . TRP A 55  ? 0.8819 0.9069 0.4777 0.0973  -0.0982 -0.0896 56  TRP A C   
417  O O   . TRP A 55  ? 0.8585 0.8502 0.4470 0.0963  -0.1076 -0.0998 56  TRP A O   
418  C CB  . TRP A 55  ? 0.7908 0.8448 0.4402 0.0858  -0.0847 -0.0612 56  TRP A CB  
419  C CG  . TRP A 55  ? 0.8065 0.8314 0.4661 0.0766  -0.0942 -0.0626 56  TRP A CG  
420  C CD1 . TRP A 55  ? 0.7932 0.8037 0.4484 0.0650  -0.1061 -0.0633 56  TRP A CD1 
421  C CD2 . TRP A 55  ? 0.7885 0.7978 0.4639 0.0769  -0.0926 -0.0631 56  TRP A CD2 
422  N NE1 . TRP A 55  ? 0.8104 0.7989 0.4781 0.0572  -0.1112 -0.0640 56  TRP A NE1 
423  C CE2 . TRP A 55  ? 0.7782 0.7641 0.4573 0.0644  -0.1031 -0.0637 56  TRP A CE2 
424  C CE3 . TRP A 55  ? 0.7915 0.8061 0.4781 0.0861  -0.0835 -0.0630 56  TRP A CE3 
425  C CZ2 . TRP A 55  ? 0.7647 0.7313 0.4565 0.0604  -0.1043 -0.0636 56  TRP A CZ2 
426  C CZ3 . TRP A 55  ? 0.7743 0.7681 0.4734 0.0833  -0.0856 -0.0632 56  TRP A CZ3 
427  C CH2 . TRP A 55  ? 0.7233 0.6929 0.4241 0.0703  -0.0957 -0.0632 56  TRP A CH2 
428  N N   . SER A 56  ? 0.8041 0.8463 0.3866 0.0939  -0.0997 -0.0862 57  SER A N   
429  C CA  . SER A 56  ? 0.8818 0.9071 0.4451 0.0869  -0.1133 -0.0928 57  SER A CA  
430  C C   . SER A 56  ? 0.8697 0.8975 0.4539 0.0692  -0.1204 -0.0780 57  SER A C   
431  O O   . SER A 56  ? 0.8778 0.9241 0.4867 0.0641  -0.1140 -0.0621 57  SER A O   
432  C CB  . SER A 56  ? 0.9373 0.9803 0.4723 0.0936  -0.1122 -0.0981 57  SER A CB  
433  O OG  . SER A 56  ? 0.9957 1.0727 0.5407 0.0893  -0.1038 -0.0811 57  SER A OG  
434  N N   . GLY A 57  ? 0.8539 0.8632 0.4277 0.0603  -0.1342 -0.0842 58  GLY A N   
435  C CA  . GLY A 57  ? 0.8346 0.8485 0.4292 0.0447  -0.1419 -0.0724 58  GLY A CA  
436  C C   . GLY A 57  ? 0.8094 0.8113 0.4311 0.0378  -0.1410 -0.0683 58  GLY A C   
437  O O   . GLY A 57  ? 0.8046 0.7889 0.4259 0.0438  -0.1368 -0.0753 58  GLY A O   
438  N N   . VAL A 58  ? 0.8221 0.8347 0.4670 0.0259  -0.1454 -0.0567 59  VAL A N   
439  C CA  . VAL A 58  ? 0.8280 0.8329 0.4987 0.0172  -0.1456 -0.0526 59  VAL A CA  
440  C C   . VAL A 58  ? 0.7890 0.8147 0.4870 0.0193  -0.1356 -0.0375 59  VAL A C   
441  O O   . VAL A 58  ? 0.8166 0.8631 0.5210 0.0189  -0.1357 -0.0267 59  VAL A O   
442  C CB  . VAL A 58  ? 0.8179 0.8212 0.4956 0.0018  -0.1587 -0.0530 59  VAL A CB  
443  C CG1 . VAL A 58  ? 0.7956 0.7924 0.4979 -0.0077 -0.1578 -0.0499 59  VAL A CG1 
444  C CG2 . VAL A 58  ? 0.7443 0.7271 0.3919 -0.0018 -0.1702 -0.0677 59  VAL A CG2 
445  N N   . VAL A 59  ? 0.7192 0.7370 0.4313 0.0215  -0.1279 -0.0368 60  VAL A N   
446  C CA  . VAL A 59  ? 0.7538 0.7872 0.4925 0.0221  -0.1194 -0.0238 60  VAL A CA  
447  C C   . VAL A 59  ? 0.7245 0.7586 0.4868 0.0107  -0.1246 -0.0192 60  VAL A C   
448  O O   . VAL A 59  ? 0.7366 0.7540 0.5001 0.0043  -0.1279 -0.0260 60  VAL A O   
449  C CB  . VAL A 59  ? 0.7508 0.7782 0.4922 0.0309  -0.1085 -0.0258 60  VAL A CB  
450  C CG1 . VAL A 59  ? 0.6020 0.6361 0.3725 0.0274  -0.1028 -0.0156 60  VAL A CG1 
451  C CG2 . VAL A 59  ? 0.7690 0.8105 0.4964 0.0420  -0.1004 -0.0254 60  VAL A CG2 
452  N N   . ASP A 60  ? 0.6381 0.6917 0.4181 0.0084  -0.1258 -0.0078 61  ASP A N   
453  C CA  . ASP A 60  ? 0.6258 0.6860 0.4305 -0.0001 -0.1299 -0.0038 61  ASP A CA  
454  C C   . ASP A 60  ? 0.6517 0.7094 0.4756 0.0017  -0.1204 0.0001  61  ASP A C   
455  O O   . ASP A 60  ? 0.6674 0.7346 0.5021 0.0072  -0.1140 0.0092  61  ASP A O   
456  C CB  . ASP A 60  ? 0.6143 0.6951 0.4296 -0.0003 -0.1359 0.0057  61  ASP A CB  
457  C CG  . ASP A 60  ? 0.7594 0.8443 0.5583 -0.0040 -0.1475 0.0014  61  ASP A CG  
458  O OD1 . ASP A 60  ? 0.7556 0.8439 0.5615 -0.0133 -0.1562 -0.0034 61  ASP A OD1 
459  O OD2 . ASP A 60  ? 0.8044 0.8911 0.5834 0.0015  -0.1480 0.0029  61  ASP A OD2 
460  N N   . ALA A 61  ? 0.6396 0.6829 0.4659 -0.0040 -0.1200 -0.0065 62  ALA A N   
461  C CA  . ALA A 61  ? 0.6316 0.6732 0.4765 -0.0040 -0.1124 -0.0032 62  ALA A CA  
462  C C   . ALA A 61  ? 0.6202 0.6752 0.4882 -0.0130 -0.1162 0.0001  62  ALA A C   
463  O O   . ALA A 61  ? 0.5809 0.6293 0.4533 -0.0224 -0.1177 -0.0041 62  ALA A O   
464  C CB  . ALA A 61  ? 0.6017 0.6193 0.4340 -0.0041 -0.1098 -0.0114 62  ALA A CB  
465  N N   . THR A 62  ? 0.5605 0.6352 0.4425 -0.0097 -0.1179 0.0079  63  THR A N   
466  C CA  . THR A 62  ? 0.5339 0.6269 0.4368 -0.0155 -0.1233 0.0098  63  THR A CA  
467  C C   . THR A 62  ? 0.5238 0.6279 0.4501 -0.0101 -0.1182 0.0168  63  THR A C   
468  O O   . THR A 62  ? 0.5468 0.6689 0.4919 -0.0122 -0.1223 0.0176  63  THR A O   
469  C CB  . THR A 62  ? 0.5169 0.6243 0.4159 -0.0154 -0.1337 0.0111  63  THR A CB  
470  O OG1 . THR A 62  ? 0.5979 0.7077 0.4918 -0.0049 -0.1325 0.0193  63  THR A OG1 
471  C CG2 . THR A 62  ? 0.5179 0.6143 0.3935 -0.0221 -0.1403 0.0027  63  THR A CG2 
472  N N   . THR A 63  ? 0.5819 0.6771 0.5075 -0.0029 -0.1098 0.0212  64  THR A N   
473  C CA  . THR A 63  ? 0.4847 0.5863 0.4301 0.0018  -0.1053 0.0270  64  THR A CA  
474  C C   . THR A 63  ? 0.5196 0.6079 0.4603 0.0058  -0.0957 0.0290  64  THR A C   
475  O O   . THR A 63  ? 0.5893 0.6685 0.5124 0.0079  -0.0930 0.0280  64  THR A O   
476  C CB  . THR A 63  ? 0.6501 0.7630 0.6022 0.0087  -0.1110 0.0349  64  THR A CB  
477  O OG1 . THR A 63  ? 0.6571 0.7768 0.6303 0.0126  -0.1096 0.0375  64  THR A OG1 
478  C CG2 . THR A 63  ? 0.6692 0.7732 0.6061 0.0142  -0.1082 0.0422  64  THR A CG2 
479  N N   . PHE A 64  ? 0.4680 0.5574 0.4249 0.0073  -0.0908 0.0310  65  PHE A N   
480  C CA  . PHE A 64  ? 0.5264 0.6059 0.4815 0.0105  -0.0824 0.0330  65  PHE A CA  
481  C C   . PHE A 64  ? 0.5031 0.5825 0.4498 0.0157  -0.0811 0.0407  65  PHE A C   
482  O O   . PHE A 64  ? 0.5115 0.5964 0.4612 0.0181  -0.0859 0.0473  65  PHE A O   
483  C CB  . PHE A 64  ? 0.4927 0.5745 0.4666 0.0111  -0.0787 0.0342  65  PHE A CB  
484  C CG  . PHE A 64  ? 0.4903 0.5724 0.4706 0.0048  -0.0774 0.0275  65  PHE A CG  
485  C CD1 . PHE A 64  ? 0.5332 0.6020 0.5026 0.0013  -0.0736 0.0229  65  PHE A CD1 
486  C CD2 . PHE A 64  ? 0.4780 0.5743 0.4749 0.0027  -0.0802 0.0259  65  PHE A CD2 
487  C CE1 . PHE A 64  ? 0.5358 0.6025 0.5084 -0.0063 -0.0728 0.0182  65  PHE A CE1 
488  C CE2 . PHE A 64  ? 0.5025 0.6016 0.5045 -0.0052 -0.0782 0.0206  65  PHE A CE2 
489  C CZ  . PHE A 64  ? 0.4949 0.5777 0.4837 -0.0107 -0.0746 0.0174  65  PHE A CZ  
490  N N   . GLN A 65  ? 0.5904 0.6639 0.5259 0.0174  -0.0747 0.0399  66  GLN A N   
491  C CA  . GLN A 65  ? 0.6164 0.6931 0.5437 0.0202  -0.0718 0.0474  66  GLN A CA  
492  C C   . GLN A 65  ? 0.5745 0.6507 0.5151 0.0204  -0.0675 0.0541  66  GLN A C   
493  O O   . GLN A 65  ? 0.5630 0.6364 0.5185 0.0199  -0.0672 0.0524  66  GLN A O   
494  C CB  . GLN A 65  ? 0.6188 0.6947 0.5291 0.0227  -0.0668 0.0424  66  GLN A CB  
495  C CG  . GLN A 65  ? 0.6499 0.7296 0.5413 0.0237  -0.0707 0.0416  66  GLN A CG  
496  C CD  . GLN A 65  ? 0.6743 0.7631 0.5599 0.0236  -0.0698 0.0526  66  GLN A CD  
497  O OE1 . GLN A 65  ? 0.6669 0.7569 0.5633 0.0218  -0.0676 0.0613  66  GLN A OE1 
498  N NE2 . GLN A 65  ? 0.5746 0.6685 0.4414 0.0246  -0.0719 0.0523  66  GLN A NE2 
499  N N   . SER A 66  ? 0.4969 0.5763 0.4308 0.0203  -0.0640 0.0616  67  SER A N   
500  C CA  . SER A 66  ? 0.5090 0.5862 0.4528 0.0185  -0.0618 0.0695  67  SER A CA  
501  C C   . SER A 66  ? 0.5162 0.5915 0.4704 0.0185  -0.0555 0.0645  67  SER A C   
502  O O   . SER A 66  ? 0.5255 0.6025 0.4753 0.0204  -0.0512 0.0570  67  SER A O   
503  C CB  . SER A 66  ? 0.5546 0.6373 0.4866 0.0154  -0.0590 0.0791  67  SER A CB  
504  O OG  . SER A 66  ? 0.5819 0.6645 0.5027 0.0150  -0.0657 0.0854  67  SER A OG  
505  N N   . VAL A 67  ? 0.4877 0.5578 0.4543 0.0170  -0.0558 0.0686  68  VAL A N   
506  C CA  . VAL A 67  ? 0.5104 0.5791 0.4862 0.0163  -0.0504 0.0655  68  VAL A CA  
507  C C   . VAL A 67  ? 0.5091 0.5857 0.4797 0.0132  -0.0446 0.0705  68  VAL A C   
508  O O   . VAL A 67  ? 0.5258 0.6040 0.4909 0.0089  -0.0456 0.0799  68  VAL A O   
509  C CB  . VAL A 67  ? 0.5500 0.6102 0.5396 0.0161  -0.0536 0.0671  68  VAL A CB  
510  C CG1 . VAL A 67  ? 0.6263 0.6852 0.6240 0.0148  -0.0485 0.0639  68  VAL A CG1 
511  C CG2 . VAL A 67  ? 0.4770 0.5360 0.4733 0.0195  -0.0587 0.0617  68  VAL A CG2 
512  N N   . CYS A 68  ? 0.4996 0.5821 0.4712 0.0150  -0.0388 0.0644  69  CYS A N   
513  C CA  . CYS A 68  ? 0.5089 0.6044 0.4789 0.0123  -0.0330 0.0681  69  CYS A CA  
514  C C   . CYS A 68  ? 0.5316 0.6234 0.5100 0.0047  -0.0338 0.0768  69  CYS A C   
515  O O   . CYS A 68  ? 0.5223 0.6017 0.5107 0.0044  -0.0369 0.0755  69  CYS A O   
516  C CB  . CYS A 68  ? 0.4775 0.5792 0.4497 0.0175  -0.0283 0.0592  69  CYS A CB  
517  S SG  . CYS A 68  ? 0.5573 0.6596 0.5150 0.0268  -0.0280 0.0487  69  CYS A SG  
518  N N   . TYR A 69  ? 0.4963 0.5987 0.4692 -0.0022 -0.0312 0.0854  70  TYR A N   
519  C CA  . TYR A 69  ? 0.5291 0.6242 0.5063 -0.0119 -0.0334 0.0952  70  TYR A CA  
520  C C   . TYR A 69  ? 0.5465 0.6386 0.5370 -0.0130 -0.0322 0.0909  70  TYR A C   
521  O O   . TYR A 69  ? 0.4556 0.5626 0.4505 -0.0106 -0.0268 0.0848  70  TYR A O   
522  C CB  . TYR A 69  ? 0.5935 0.7050 0.5620 -0.0215 -0.0293 0.1050  70  TYR A CB  
523  C CG  . TYR A 69  ? 0.6080 0.7036 0.5700 -0.0315 -0.0355 0.1184  70  TYR A CG  
524  C CD1 . TYR A 69  ? 0.5799 0.6606 0.5485 -0.0394 -0.0391 0.1235  70  TYR A CD1 
525  C CD2 . TYR A 69  ? 0.6395 0.7322 0.5867 -0.0327 -0.0388 0.1259  70  TYR A CD2 
526  C CE1 . TYR A 69  ? 0.7552 0.8157 0.7152 -0.0481 -0.0463 0.1358  70  TYR A CE1 
527  C CE2 . TYR A 69  ? 0.7331 0.8074 0.6719 -0.0412 -0.0459 0.1390  70  TYR A CE2 
528  C CZ  . TYR A 69  ? 0.8468 0.9035 0.7917 -0.0488 -0.0499 0.1440  70  TYR A CZ  
529  O OH  . TYR A 69  ? 1.0102 1.0433 0.9442 -0.0570 -0.0585 0.1571  70  TYR A OH  
530  N N   . GLN A 70  ? 0.5607 0.6333 0.5570 -0.0154 -0.0380 0.0935  71  GLN A N   
531  C CA  . GLN A 70  ? 0.5556 0.6228 0.5634 -0.0151 -0.0379 0.0877  71  GLN A CA  
532  C C   . GLN A 70  ? 0.5657 0.6109 0.5760 -0.0196 -0.0449 0.0926  71  GLN A C   
533  O O   . GLN A 70  ? 0.5717 0.6026 0.5760 -0.0193 -0.0510 0.0985  71  GLN A O   
534  C CB  . GLN A 70  ? 0.4836 0.5488 0.4962 -0.0049 -0.0373 0.0763  71  GLN A CB  
535  C CG  . GLN A 70  ? 0.4627 0.5145 0.4753 0.0006  -0.0430 0.0746  71  GLN A CG  
536  C CD  . GLN A 70  ? 0.5340 0.5876 0.5496 0.0076  -0.0416 0.0644  71  GLN A CD  
537  O OE1 . GLN A 70  ? 0.5095 0.5556 0.5324 0.0103  -0.0437 0.0596  71  GLN A OE1 
538  N NE2 . GLN A 70  ? 0.4710 0.5342 0.4797 0.0102  -0.0382 0.0610  71  GLN A NE2 
539  N N   . TYR A 71  ? 0.5649 0.6063 0.5832 -0.0227 -0.0447 0.0894  72  TYR A N   
540  C CA  . TYR A 71  ? 0.5956 0.6135 0.6160 -0.0250 -0.0518 0.0909  72  TYR A CA  
541  C C   . TYR A 71  ? 0.6009 0.6055 0.6241 -0.0132 -0.0564 0.0843  72  TYR A C   
542  O O   . TYR A 71  ? 0.6234 0.6379 0.6508 -0.0053 -0.0531 0.0761  72  TYR A O   
543  C CB  . TYR A 71  ? 0.6314 0.6508 0.6596 -0.0294 -0.0503 0.0862  72  TYR A CB  
544  C CG  . TYR A 71  ? 0.6310 0.6253 0.6611 -0.0298 -0.0575 0.0843  72  TYR A CG  
545  C CD1 . TYR A 71  ? 0.6137 0.5887 0.6370 -0.0400 -0.0641 0.0933  72  TYR A CD1 
546  C CD2 . TYR A 71  ? 0.5665 0.5555 0.6032 -0.0204 -0.0580 0.0732  72  TYR A CD2 
547  C CE1 . TYR A 71  ? 0.6942 0.6428 0.7172 -0.0390 -0.0718 0.0902  72  TYR A CE1 
548  C CE2 . TYR A 71  ? 0.6419 0.6089 0.6793 -0.0192 -0.0646 0.0698  72  TYR A CE2 
549  C CZ  . TYR A 71  ? 0.7296 0.6752 0.7600 -0.0277 -0.0718 0.0778  72  TYR A CZ  
550  O OH  . TYR A 71  ? 0.7784 0.6986 0.8076 -0.0251 -0.0794 0.0731  72  TYR A OH  
551  N N   . VAL A 72  ? 0.5782 0.5606 0.5985 -0.0123 -0.0647 0.0880  73  VAL A N   
552  C CA  . VAL A 72  ? 0.5716 0.5437 0.5960 -0.0002 -0.0700 0.0814  73  VAL A CA  
553  C C   . VAL A 72  ? 0.5907 0.5460 0.6200 0.0018  -0.0740 0.0755  73  VAL A C   
554  O O   . VAL A 72  ? 0.6306 0.5654 0.6541 -0.0044 -0.0801 0.0813  73  VAL A O   
555  C CB  . VAL A 72  ? 0.6452 0.6052 0.6615 0.0033  -0.0780 0.0890  73  VAL A CB  
556  C CG1 . VAL A 72  ? 0.6092 0.5619 0.6320 0.0173  -0.0841 0.0810  73  VAL A CG1 
557  C CG2 . VAL A 72  ? 0.6185 0.5960 0.6287 0.0018  -0.0741 0.0935  73  VAL A CG2 
558  N N   . ASP A 73  ? 0.5699 0.5329 0.6082 0.0098  -0.0710 0.0639  74  ASP A N   
559  C CA  . ASP A 73  ? 0.5512 0.5016 0.5935 0.0124  -0.0736 0.0563  74  ASP A CA  
560  C C   . ASP A 73  ? 0.6297 0.5563 0.6693 0.0205  -0.0839 0.0559  74  ASP A C   
561  O O   . ASP A 73  ? 0.6898 0.6179 0.7305 0.0303  -0.0875 0.0553  74  ASP A O   
562  C CB  . ASP A 73  ? 0.6346 0.6010 0.6854 0.0190  -0.0675 0.0445  74  ASP A CB  
563  C CG  . ASP A 73  ? 0.7590 0.7165 0.8124 0.0201  -0.0684 0.0364  74  ASP A CG  
564  O OD1 . ASP A 73  ? 0.7054 0.6560 0.7618 0.0301  -0.0722 0.0285  74  ASP A OD1 
565  O OD2 . ASP A 73  ? 0.8484 0.8075 0.9008 0.0115  -0.0656 0.0372  74  ASP A OD2 
566  N N   . THR A 74  ? 0.6488 0.5524 0.6842 0.0171  -0.0896 0.0557  75  THR A N   
567  C CA  . THR A 74  ? 0.7723 0.6468 0.8020 0.0253  -0.1012 0.0553  75  THR A CA  
568  C C   . THR A 74  ? 0.7509 0.6110 0.7826 0.0317  -0.1045 0.0433  75  THR A C   
569  O O   . THR A 74  ? 0.8220 0.6519 0.8463 0.0375  -0.1154 0.0425  75  THR A O   
570  C CB  . THR A 74  ? 0.8488 0.6983 0.8646 0.0134  -0.1088 0.0697  75  THR A CB  
571  O OG1 . THR A 74  ? 0.8851 0.7340 0.8986 -0.0031 -0.1054 0.0733  75  THR A OG1 
572  C CG2 . THR A 74  ? 0.8589 0.7204 0.8701 0.0099  -0.1071 0.0810  75  THR A CG2 
573  N N   . LEU A 75  ? 0.6940 0.5730 0.7337 0.0313  -0.0963 0.0339  76  LEU A N   
574  C CA  . LEU A 75  ? 0.7358 0.6022 0.7755 0.0362  -0.0990 0.0223  76  LEU A CA  
575  C C   . LEU A 75  ? 0.7326 0.5923 0.7749 0.0555  -0.1047 0.0116  76  LEU A C   
576  O O   . LEU A 75  ? 0.7555 0.5872 0.7912 0.0621  -0.1139 0.0062  76  LEU A O   
577  C CB  . LEU A 75  ? 0.7655 0.6558 0.8118 0.0322  -0.0888 0.0151  76  LEU A CB  
578  C CG  . LEU A 75  ? 0.7940 0.6767 0.8399 0.0378  -0.0902 0.0018  76  LEU A CG  
579  C CD1 . LEU A 75  ? 0.7662 0.6223 0.8031 0.0269  -0.0972 0.0043  76  LEU A CD1 
580  C CD2 . LEU A 75  ? 0.7730 0.6836 0.8250 0.0367  -0.0796 -0.0049 76  LEU A CD2 
581  N N   . TYR A 76  ? 0.6250 0.5106 0.6767 0.0651  -0.0997 0.0079  77  TYR A N   
582  C CA  . TYR A 76  ? 0.6419 0.5302 0.6991 0.0843  -0.1042 -0.0026 77  TYR A CA  
583  C C   . TYR A 76  ? 0.7230 0.6190 0.7825 0.0893  -0.1074 0.0049  77  TYR A C   
584  O O   . TYR A 76  ? 0.6623 0.5892 0.7312 0.0906  -0.1004 0.0034  77  TYR A O   
585  C CB  . TYR A 76  ? 0.6149 0.5332 0.6826 0.0905  -0.0949 -0.0161 77  TYR A CB  
586  C CG  . TYR A 76  ? 0.6699 0.5814 0.7340 0.0868  -0.0922 -0.0244 77  TYR A CG  
587  C CD1 . TYR A 76  ? 0.6686 0.5516 0.7255 0.0946  -0.1011 -0.0318 77  TYR A CD1 
588  C CD2 . TYR A 76  ? 0.6321 0.5642 0.6985 0.0762  -0.0817 -0.0252 77  TYR A CD2 
589  C CE1 . TYR A 76  ? 0.7251 0.6020 0.7776 0.0910  -0.0993 -0.0401 77  TYR A CE1 
590  C CE2 . TYR A 76  ? 0.7523 0.6791 0.8146 0.0731  -0.0799 -0.0328 77  TYR A CE2 
591  C CZ  . TYR A 76  ? 0.7356 0.6358 0.7912 0.0801  -0.0885 -0.0404 77  TYR A CZ  
592  O OH  . TYR A 76  ? 0.6935 0.5884 0.7438 0.0767  -0.0874 -0.0485 77  TYR A OH  
593  N N   . PRO A 77  ? 0.7461 0.6133 0.7955 0.0912  -0.1188 0.0136  78  PRO A N   
594  C CA  . PRO A 77  ? 0.8231 0.6963 0.8723 0.0950  -0.1228 0.0221  78  PRO A CA  
595  C C   . PRO A 77  ? 0.8376 0.7327 0.8991 0.1142  -0.1246 0.0112  78  PRO A C   
596  O O   . PRO A 77  ? 0.8536 0.7408 0.9178 0.1301  -0.1304 -0.0002 78  PRO A O   
597  C CB  . PRO A 77  ? 0.8634 0.6948 0.8963 0.0938  -0.1364 0.0327  78  PRO A CB  
598  C CG  . PRO A 77  ? 0.8932 0.7019 0.9178 0.0810  -0.1362 0.0337  78  PRO A CG  
599  C CD  . PRO A 77  ? 0.8166 0.6427 0.8520 0.0872  -0.1289 0.0176  78  PRO A CD  
600  N N   . GLY A 78  ? 0.7461 0.6702 0.8151 0.1126  -0.1197 0.0142  79  GLY A N   
601  C CA  . GLY A 78  ? 0.7567 0.7089 0.8393 0.1277  -0.1203 0.0047  79  GLY A CA  
602  C C   . GLY A 78  ? 0.7620 0.7455 0.8579 0.1296  -0.1097 -0.0090 79  GLY A C   
603  O O   . GLY A 78  ? 0.7531 0.7665 0.8619 0.1398  -0.1088 -0.0172 79  GLY A O   
604  N N   . PHE A 79  ? 0.7081 0.6873 0.8010 0.1195  -0.1020 -0.0116 80  PHE A N   
605  C CA  . PHE A 79  ? 0.6454 0.6524 0.7479 0.1198  -0.0918 -0.0235 80  PHE A CA  
606  C C   . PHE A 79  ? 0.6008 0.6378 0.7086 0.1077  -0.0821 -0.0200 80  PHE A C   
607  O O   . PHE A 79  ? 0.5949 0.6253 0.6955 0.0939  -0.0790 -0.0096 80  PHE A O   
608  C CB  . PHE A 79  ? 0.5926 0.5831 0.6878 0.1129  -0.0881 -0.0268 80  PHE A CB  
609  C CG  . PHE A 79  ? 0.5978 0.6150 0.6996 0.1116  -0.0776 -0.0378 80  PHE A CG  
610  C CD1 . PHE A 79  ? 0.5384 0.5775 0.6500 0.1262  -0.0768 -0.0513 80  PHE A CD1 
611  C CD2 . PHE A 79  ? 0.5958 0.6170 0.6931 0.0963  -0.0689 -0.0345 80  PHE A CD2 
612  C CE1 . PHE A 79  ? 0.5869 0.6521 0.7028 0.1233  -0.0667 -0.0607 80  PHE A CE1 
613  C CE2 . PHE A 79  ? 0.5838 0.6270 0.6843 0.0941  -0.0600 -0.0433 80  PHE A CE2 
614  C CZ  . PHE A 79  ? 0.5565 0.6219 0.6657 0.1066  -0.0584 -0.0560 80  PHE A CZ  
615  N N   . GLU A 80  ? 0.6159 0.6864 0.7359 0.1129  -0.0775 -0.0292 81  GLU A N   
616  C CA  . GLU A 80  ? 0.6249 0.7224 0.7490 0.1010  -0.0696 -0.0264 81  GLU A CA  
617  C C   . GLU A 80  ? 0.6192 0.7113 0.7347 0.0847  -0.0608 -0.0225 81  GLU A C   
618  O O   . GLU A 80  ? 0.5254 0.6197 0.6363 0.0732  -0.0579 -0.0147 81  GLU A O   
619  C CB  . GLU A 80  ? 0.7213 0.8570 0.8598 0.1072  -0.0656 -0.0378 81  GLU A CB  
620  C CG  . GLU A 80  ? 0.9161 1.0772 1.0561 0.0916  -0.0552 -0.0377 81  GLU A CG  
621  C CD  . GLU A 80  ? 1.1611 1.3273 1.2991 0.0811  -0.0562 -0.0286 81  GLU A CD  
622  O OE1 . GLU A 80  ? 1.2670 1.4200 1.4027 0.0857  -0.0642 -0.0219 81  GLU A OE1 
623  O OE2 . GLU A 80  ? 1.2237 1.4058 1.3607 0.0678  -0.0494 -0.0280 81  GLU A OE2 
624  N N   . GLY A 81  ? 0.5071 0.5909 0.6192 0.0846  -0.0574 -0.0281 82  GLY A N   
625  C CA  . GLY A 81  ? 0.5048 0.5861 0.6091 0.0708  -0.0498 -0.0253 82  GLY A CA  
626  C C   . GLY A 81  ? 0.5820 0.6409 0.6764 0.0618  -0.0515 -0.0140 82  GLY A C   
627  O O   . GLY A 81  ? 0.5257 0.5862 0.6143 0.0511  -0.0461 -0.0101 82  GLY A O   
628  N N   . THR A 82  ? 0.6074 0.6456 0.6990 0.0661  -0.0594 -0.0085 83  THR A N   
629  C CA  . THR A 82  ? 0.5720 0.5941 0.6548 0.0568  -0.0605 0.0026  83  THR A CA  
630  C C   . THR A 82  ? 0.5474 0.5723 0.6288 0.0557  -0.0635 0.0110  83  THR A C   
631  O O   . THR A 82  ? 0.6226 0.6469 0.6977 0.0467  -0.0606 0.0183  83  THR A O   
632  C CB  . THR A 82  ? 0.5595 0.5546 0.6366 0.0577  -0.0669 0.0051  83  THR A CB  
633  O OG1 . THR A 82  ? 0.6324 0.6164 0.7113 0.0698  -0.0758 0.0029  83  THR A OG1 
634  C CG2 . THR A 82  ? 0.5656 0.5567 0.6416 0.0561  -0.0638 -0.0025 83  THR A CG2 
635  N N   . GLU A 83  ? 0.5370 0.5664 0.6237 0.0656  -0.0695 0.0094  84  GLU A N   
636  C CA  . GLU A 83  ? 0.6042 0.6358 0.6882 0.0647  -0.0735 0.0175  84  GLU A CA  
637  C C   . GLU A 83  ? 0.6295 0.6823 0.7145 0.0572  -0.0672 0.0174  84  GLU A C   
638  O O   . GLU A 83  ? 0.6161 0.6681 0.6947 0.0525  -0.0683 0.0247  84  GLU A O   
639  C CB  . GLU A 83  ? 0.6029 0.6357 0.6926 0.0784  -0.0826 0.0152  84  GLU A CB  
640  C CG  . GLU A 83  ? 0.6424 0.6475 0.7277 0.0872  -0.0917 0.0161  84  GLU A CG  
641  C CD  . GLU A 83  ? 0.7467 0.7251 0.8179 0.0787  -0.0959 0.0293  84  GLU A CD  
642  O OE1 . GLU A 83  ? 0.7801 0.7314 0.8448 0.0814  -0.1029 0.0311  84  GLU A OE1 
643  O OE2 . GLU A 83  ? 0.7354 0.7199 0.8011 0.0688  -0.0926 0.0376  84  GLU A OE2 
644  N N   . MET A 84  ? 0.4785 0.5487 0.5695 0.0553  -0.0609 0.0094  85  MET A N   
645  C CA  . MET A 84  ? 0.4639 0.5497 0.5534 0.0465  -0.0559 0.0095  85  MET A CA  
646  C C   . MET A 84  ? 0.5063 0.5803 0.5838 0.0371  -0.0524 0.0159  85  MET A C   
647  O O   . MET A 84  ? 0.5315 0.6117 0.6040 0.0309  -0.0506 0.0173  85  MET A O   
648  C CB  . MET A 84  ? 0.4601 0.5640 0.5557 0.0439  -0.0498 0.0008  85  MET A CB  
649  C CG  . MET A 84  ? 0.5127 0.6069 0.6041 0.0412  -0.0447 -0.0019 85  MET A CG  
650  S SD  . MET A 84  ? 0.5383 0.6547 0.6338 0.0368  -0.0372 -0.0109 85  MET A SD  
651  C CE  . MET A 84  ? 0.5454 0.6660 0.6317 0.0224  -0.0339 -0.0060 85  MET A CE  
652  N N   . TRP A 85  ? 0.4890 0.5469 0.5616 0.0361  -0.0517 0.0191  86  TRP A N   
653  C CA  . TRP A 85  ? 0.4665 0.5173 0.5296 0.0289  -0.0484 0.0243  86  TRP A CA  
654  C C   . TRP A 85  ? 0.4995 0.5414 0.5565 0.0283  -0.0520 0.0331  86  TRP A C   
655  O O   . TRP A 85  ? 0.4707 0.5117 0.5201 0.0234  -0.0491 0.0370  86  TRP A O   
656  C CB  . TRP A 85  ? 0.4776 0.5215 0.5396 0.0266  -0.0449 0.0220  86  TRP A CB  
657  C CG  . TRP A 85  ? 0.5074 0.5594 0.5731 0.0266  -0.0411 0.0139  86  TRP A CG  
658  C CD1 . TRP A 85  ? 0.5484 0.5997 0.6196 0.0309  -0.0413 0.0078  86  TRP A CD1 
659  C CD2 . TRP A 85  ? 0.5352 0.5962 0.5972 0.0214  -0.0368 0.0112  86  TRP A CD2 
660  N NE1 . TRP A 85  ? 0.5256 0.5883 0.5972 0.0285  -0.0365 0.0017  86  TRP A NE1 
661  C CE2 . TRP A 85  ? 0.5401 0.6079 0.6058 0.0218  -0.0338 0.0043  86  TRP A CE2 
662  C CE3 . TRP A 85  ? 0.5187 0.5810 0.5729 0.0162  -0.0357 0.0137  86  TRP A CE3 
663  C CZ2 . TRP A 85  ? 0.4692 0.5454 0.5307 0.0154  -0.0296 0.0014  86  TRP A CZ2 
664  C CZ3 . TRP A 85  ? 0.5371 0.6041 0.5867 0.0104  -0.0325 0.0105  86  TRP A CZ3 
665  C CH2 . TRP A 85  ? 0.5367 0.6109 0.5898 0.0091  -0.0293 0.0051  86  TRP A CH2 
666  N N   . ASN A 86  ? 0.4446 0.4803 0.5038 0.0335  -0.0585 0.0361  87  ASN A N   
667  C CA  . ASN A 86  ? 0.5464 0.5720 0.5978 0.0315  -0.0624 0.0458  87  ASN A CA  
668  C C   . ASN A 86  ? 0.5867 0.6210 0.6323 0.0307  -0.0634 0.0494  87  ASN A C   
669  O O   . ASN A 86  ? 0.4942 0.5406 0.5438 0.0330  -0.0636 0.0443  87  ASN A O   
670  C CB  . ASN A 86  ? 0.5866 0.5973 0.6396 0.0377  -0.0706 0.0482  87  ASN A CB  
671  C CG  . ASN A 86  ? 0.6011 0.5954 0.6528 0.0346  -0.0711 0.0491  87  ASN A CG  
672  O OD1 . ASN A 86  ? 0.5781 0.5734 0.6268 0.0263  -0.0659 0.0512  87  ASN A OD1 
673  N ND2 . ASN A 86  ? 0.5388 0.5178 0.5924 0.0417  -0.0783 0.0471  87  ASN A ND2 
674  N N   . PRO A 87  ? 0.6215 0.6513 0.6571 0.0265  -0.0641 0.0580  88  PRO A N   
675  C CA  . PRO A 87  ? 0.6044 0.6422 0.6323 0.0259  -0.0653 0.0610  88  PRO A CA  
676  C C   . PRO A 87  ? 0.5894 0.6300 0.6210 0.0326  -0.0729 0.0601  88  PRO A C   
677  O O   . PRO A 87  ? 0.5676 0.5986 0.6019 0.0379  -0.0796 0.0630  88  PRO A O   
678  C CB  . PRO A 87  ? 0.5484 0.5801 0.5650 0.0206  -0.0654 0.0713  88  PRO A CB  
679  C CG  . PRO A 87  ? 0.6267 0.6538 0.6460 0.0158  -0.0609 0.0717  88  PRO A CG  
680  C CD  . PRO A 87  ? 0.5591 0.5791 0.5894 0.0205  -0.0631 0.0652  88  PRO A CD  
681  N N   . ASN A 88  ? 0.5646 0.6183 0.5959 0.0325  -0.0726 0.0558  89  ASN A N   
682  C CA  . ASN A 88  ? 0.5791 0.6410 0.6144 0.0379  -0.0801 0.0546  89  ASN A CA  
683  C C   . ASN A 88  ? 0.5810 0.6453 0.6034 0.0359  -0.0835 0.0601  89  ASN A C   
684  O O   . ASN A 88  ? 0.6446 0.7189 0.6690 0.0388  -0.0896 0.0584  89  ASN A O   
685  C CB  . ASN A 88  ? 0.5624 0.6406 0.6089 0.0380  -0.0782 0.0447  89  ASN A CB  
686  C CG  . ASN A 88  ? 0.5863 0.6694 0.6253 0.0298  -0.0729 0.0413  89  ASN A CG  
687  O OD1 . ASN A 88  ? 0.5421 0.6167 0.5699 0.0259  -0.0687 0.0442  89  ASN A OD1 
688  N ND2 . ASN A 88  ? 0.6349 0.7320 0.6797 0.0270  -0.0734 0.0348  89  ASN A ND2 
689  N N   . ARG A 89  ? 0.6035 0.6614 0.6129 0.0307  -0.0797 0.0660  90  ARG A N   
690  C CA  . ARG A 89  ? 0.6259 0.6848 0.6205 0.0290  -0.0827 0.0725  90  ARG A CA  
691  C C   . ARG A 89  ? 0.6326 0.6808 0.6177 0.0255  -0.0814 0.0829  90  ARG A C   
692  O O   . ARG A 89  ? 0.5811 0.6219 0.5714 0.0233  -0.0777 0.0840  90  ARG A O   
693  C CB  . ARG A 89  ? 0.6359 0.7031 0.6215 0.0252  -0.0778 0.0671  90  ARG A CB  
694  C CG  . ARG A 89  ? 0.7297 0.8062 0.7207 0.0255  -0.0806 0.0583  90  ARG A CG  
695  C CD  . ARG A 89  ? 0.8170 0.8999 0.8075 0.0289  -0.0903 0.0607  90  ARG A CD  
696  N NE  . ARG A 89  ? 0.8579 0.9523 0.8508 0.0263  -0.0931 0.0528  90  ARG A NE  
697  C CZ  . ARG A 89  ? 0.8324 0.9376 0.8410 0.0266  -0.0947 0.0466  90  ARG A CZ  
698  N NH1 . ARG A 89  ? 0.7398 0.8451 0.7628 0.0313  -0.0936 0.0463  90  ARG A NH1 
699  N NH2 . ARG A 89  ? 0.8820 0.9985 0.8913 0.0214  -0.0974 0.0402  90  ARG A NH2 
700  N N   . GLU A 90  ? 0.6011 0.6492 0.5714 0.0236  -0.0845 0.0909  91  GLU A N   
701  C CA  A GLU A 90  ? 0.6012 0.6412 0.5607 0.0175  -0.0831 0.1022  91  GLU A CA  
702  C CA  B GLU A 90  ? 0.6030 0.6432 0.5623 0.0175  -0.0831 0.1022  91  GLU A CA  
703  C C   . GLU A 90  ? 0.5881 0.6361 0.5467 0.0114  -0.0722 0.1000  91  GLU A C   
704  O O   . GLU A 90  ? 0.5674 0.6267 0.5254 0.0126  -0.0666 0.0916  91  GLU A O   
705  C CB  A GLU A 90  ? 0.6209 0.6620 0.5624 0.0157  -0.0879 0.1112  91  GLU A CB  
706  C CB  B GLU A 90  ? 0.6225 0.6646 0.5637 0.0157  -0.0876 0.1108  91  GLU A CB  
707  C CG  A GLU A 90  ? 0.6288 0.6857 0.5589 0.0139  -0.0823 0.1070  91  GLU A CG  
708  C CG  B GLU A 90  ? 0.6881 0.7247 0.6288 0.0229  -0.0998 0.1130  91  GLU A CG  
709  C CD  A GLU A 90  ? 0.7507 0.8093 0.6603 0.0105  -0.0855 0.1172  91  GLU A CD  
710  C CD  B GLU A 90  ? 0.7123 0.7635 0.6566 0.0275  -0.1018 0.1029  91  GLU A CD  
711  O OE1 A GLU A 90  ? 0.7283 0.7917 0.6272 0.0032  -0.0791 0.1240  91  GLU A OE1 
712  O OE1 B GLU A 90  ? 0.6223 0.6806 0.5798 0.0288  -0.0973 0.0920  91  GLU A OE1 
713  O OE2 A GLU A 90  ? 0.7675 0.8248 0.6715 0.0147  -0.0946 0.1186  91  GLU A OE2 
714  O OE2 B GLU A 90  ? 0.7231 0.7781 0.6556 0.0288  -0.1083 0.1063  91  GLU A OE2 
715  N N   . LEU A 91  ? 0.5551 0.5964 0.5132 0.0051  -0.0700 0.1074  92  LEU A N   
716  C CA  . LEU A 91  ? 0.5623 0.6149 0.5204 -0.0008 -0.0603 0.1063  92  LEU A CA  
717  C C   . LEU A 91  ? 0.6051 0.6723 0.5473 -0.0051 -0.0560 0.1113  92  LEU A C   
718  O O   . LEU A 91  ? 0.5878 0.6510 0.5173 -0.0090 -0.0604 0.1216  92  LEU A O   
719  C CB  . LEU A 91  ? 0.5244 0.5670 0.4873 -0.0082 -0.0601 0.1127  92  LEU A CB  
720  C CG  . LEU A 91  ? 0.6143 0.6423 0.5915 -0.0043 -0.0637 0.1074  92  LEU A CG  
721  C CD1 . LEU A 91  ? 0.5244 0.5447 0.5038 -0.0135 -0.0624 0.1128  92  LEU A CD1 
722  C CD2 . LEU A 91  ? 0.5678 0.6053 0.5558 0.0025  -0.0590 0.0941  92  LEU A CD2 
723  N N   . SER A 92  ? 0.6546 0.7387 0.5964 -0.0036 -0.0477 0.1037  93  SER A N   
724  C CA  . SER A 92  ? 0.5853 0.6871 0.5124 -0.0059 -0.0424 0.1060  93  SER A CA  
725  C C   . SER A 92  ? 0.6030 0.7223 0.5342 -0.0031 -0.0333 0.0971  93  SER A C   
726  O O   . SER A 92  ? 0.6363 0.7513 0.5777 0.0029  -0.0326 0.0872  93  SER A O   
727  C CB  . SER A 92  ? 0.5553 0.6577 0.4698 -0.0003 -0.0466 0.1029  93  SER A CB  
728  O OG  . SER A 92  ? 0.6112 0.7320 0.5106 -0.0009 -0.0407 0.1026  93  SER A OG  
729  N N   . GLU A 93  ? 0.5897 0.7298 0.5122 -0.0072 -0.0265 0.1006  94  GLU A N   
730  C CA  . GLU A 93  ? 0.5531 0.7133 0.4773 -0.0010 -0.0186 0.0906  94  GLU A CA  
731  C C   . GLU A 93  ? 0.6102 0.7715 0.5232 0.0104  -0.0190 0.0792  94  GLU A C   
732  O O   . GLU A 93  ? 0.6870 0.8534 0.6021 0.0193  -0.0159 0.0678  94  GLU A O   
733  C CB  . GLU A 93  ? 0.5551 0.7428 0.4750 -0.0087 -0.0106 0.0972  94  GLU A CB  
734  C CG  . GLU A 93  ? 0.5697 0.7582 0.5010 -0.0212 -0.0098 0.1067  94  GLU A CG  
735  C CD  . GLU A 93  ? 0.6174 0.8385 0.5459 -0.0302 -0.0011 0.1123  94  GLU A CD  
736  O OE1 . GLU A 93  ? 0.5894 0.8343 0.5260 -0.0244 0.0055  0.1035  94  GLU A OE1 
737  O OE2 . GLU A 93  ? 0.6384 0.8626 0.5563 -0.0431 -0.0012 0.1257  94  GLU A OE2 
738  N N   . ASP A 94  ? 0.5427 0.6977 0.4425 0.0102  -0.0239 0.0820  95  ASP A N   
739  C CA  . ASP A 94  ? 0.5662 0.7169 0.4545 0.0195  -0.0266 0.0710  95  ASP A CA  
740  C C   . ASP A 94  ? 0.5952 0.7241 0.4941 0.0225  -0.0332 0.0650  95  ASP A C   
741  O O   . ASP A 94  ? 0.6173 0.7337 0.5171 0.0201  -0.0406 0.0687  95  ASP A O   
742  C CB  . ASP A 94  ? 0.5403 0.6933 0.4109 0.0171  -0.0302 0.0766  95  ASP A CB  
743  C CG  . ASP A 94  ? 0.6646 0.8106 0.5226 0.0252  -0.0348 0.0652  95  ASP A CG  
744  O OD1 . ASP A 94  ? 0.7358 0.8751 0.5961 0.0326  -0.0346 0.0528  95  ASP A OD1 
745  O OD2 . ASP A 94  ? 0.8215 0.9673 0.6653 0.0235  -0.0394 0.0689  95  ASP A OD2 
746  N N   . CYS A 95  ? 0.5841 0.7099 0.4908 0.0278  -0.0307 0.0559  96  CYS A N   
747  C CA  . CYS A 95  ? 0.5546 0.6621 0.4719 0.0284  -0.0356 0.0514  96  CYS A CA  
748  C C   . CYS A 95  ? 0.5485 0.6481 0.4610 0.0358  -0.0356 0.0388  96  CYS A C   
749  O O   . CYS A 95  ? 0.5448 0.6303 0.4648 0.0350  -0.0388 0.0352  96  CYS A O   
750  C CB  . CYS A 95  ? 0.5462 0.6513 0.4810 0.0237  -0.0341 0.0569  96  CYS A CB  
751  S SG  . CYS A 95  ? 0.5414 0.6609 0.4825 0.0260  -0.0259 0.0541  96  CYS A SG  
752  N N   . LEU A 96  ? 0.4833 0.5907 0.3823 0.0433  -0.0325 0.0318  97  LEU A N   
753  C CA  . LEU A 96  ? 0.5446 0.6403 0.4369 0.0518  -0.0336 0.0197  97  LEU A CA  
754  C C   . LEU A 96  ? 0.5800 0.6576 0.4591 0.0516  -0.0411 0.0135  97  LEU A C   
755  O O   . LEU A 96  ? 0.5919 0.6691 0.4532 0.0573  -0.0426 0.0068  97  LEU A O   
756  C CB  . LEU A 96  ? 0.4867 0.5985 0.3706 0.0621  -0.0278 0.0135  97  LEU A CB  
757  C CG  . LEU A 96  ? 0.5110 0.6420 0.4106 0.0611  -0.0211 0.0187  97  LEU A CG  
758  C CD1 . LEU A 96  ? 0.5154 0.6658 0.4094 0.0733  -0.0158 0.0105  97  LEU A CD1 
759  C CD2 . LEU A 96  ? 0.4605 0.5767 0.3750 0.0576  -0.0233 0.0200  97  LEU A CD2 
760  N N   . TYR A 97  ? 0.5696 0.6334 0.4577 0.0445  -0.0461 0.0153  98  TYR A N   
761  C CA  . TYR A 97  ? 0.4994 0.5479 0.3785 0.0410  -0.0537 0.0104  98  TYR A CA  
762  C C   . TYR A 97  ? 0.5706 0.6023 0.4562 0.0371  -0.0563 0.0070  98  TYR A C   
763  O O   . TYR A 97  ? 0.5626 0.5968 0.4634 0.0352  -0.0529 0.0111  98  TYR A O   
764  C CB  . TYR A 97  ? 0.4898 0.5454 0.3741 0.0338  -0.0579 0.0176  98  TYR A CB  
765  C CG  . TYR A 97  ? 0.5771 0.6478 0.4532 0.0357  -0.0561 0.0231  98  TYR A CG  
766  C CD1 . TYR A 97  ? 0.5850 0.6556 0.4426 0.0372  -0.0603 0.0189  98  TYR A CD1 
767  C CD2 . TYR A 97  ? 0.5832 0.6676 0.4682 0.0346  -0.0506 0.0327  98  TYR A CD2 
768  C CE1 . TYR A 97  ? 0.5728 0.6581 0.4208 0.0382  -0.0584 0.0245  98  TYR A CE1 
769  C CE2 . TYR A 97  ? 0.5511 0.6489 0.4266 0.0342  -0.0489 0.0390  98  TYR A CE2 
770  C CZ  . TYR A 97  ? 0.6037 0.7028 0.4606 0.0363  -0.0525 0.0351  98  TYR A CZ  
771  O OH  . TYR A 97  ? 0.5897 0.7031 0.4353 0.0351  -0.0505 0.0421  98  TYR A OH  
772  N N   . LEU A 98  ? 0.5270 0.5409 0.3993 0.0348  -0.0626 -0.0003 99  LEU A N   
773  C CA  . LEU A 98  ? 0.6130 0.6100 0.4880 0.0285  -0.0656 -0.0027 99  LEU A CA  
774  C C   . LEU A 98  ? 0.6266 0.6197 0.5008 0.0173  -0.0726 -0.0032 99  LEU A C   
775  O O   . LEU A 98  ? 0.6253 0.6256 0.4942 0.0162  -0.0763 -0.0032 99  LEU A O   
776  C CB  . LEU A 98  ? 0.6223 0.5970 0.4799 0.0352  -0.0673 -0.0111 99  LEU A CB  
777  C CG  . LEU A 98  ? 0.7058 0.6658 0.5383 0.0422  -0.0723 -0.0206 99  LEU A CG  
778  C CD1 . LEU A 98  ? 0.6637 0.6048 0.4839 0.0313  -0.0813 -0.0244 99  LEU A CD1 
779  C CD2 . LEU A 98  ? 0.6936 0.6374 0.5134 0.0546  -0.0721 -0.0277 99  LEU A CD2 
780  N N   . ASN A 99  ? 0.5558 0.5395 0.4352 0.0083  -0.0745 -0.0035 100 ASN A N   
781  C CA  . ASN A 99  ? 0.5872 0.5728 0.4702 -0.0044 -0.0803 -0.0036 100 ASN A CA  
782  C C   . ASN A 99  ? 0.6466 0.6075 0.5152 -0.0132 -0.0851 -0.0088 100 ASN A C   
783  O O   . ASN A 99  ? 0.7089 0.6546 0.5730 -0.0110 -0.0828 -0.0096 100 ASN A O   
784  C CB  . ASN A 99  ? 0.5642 0.5705 0.4722 -0.0092 -0.0772 0.0029  100 ASN A CB  
785  C CG  . ASN A 99  ? 0.6127 0.6351 0.5334 0.0000  -0.0720 0.0090  100 ASN A CG  
786  O OD1 . ASN A 99  ? 0.6130 0.6456 0.5328 0.0033  -0.0739 0.0116  100 ASN A OD1 
787  N ND2 . ASN A 99  ? 0.5459 0.5692 0.4767 0.0032  -0.0660 0.0117  100 ASN A ND2 
788  N N   . VAL A 100 ? 0.6178 0.5740 0.4781 -0.0240 -0.0926 -0.0119 101 VAL A N   
789  C CA  . VAL A 100 ? 0.5988 0.5293 0.4428 -0.0360 -0.0988 -0.0161 101 VAL A CA  
790  C C   . VAL A 100 ? 0.6281 0.5743 0.4839 -0.0537 -0.1025 -0.0140 101 VAL A C   
791  O O   . VAL A 100 ? 0.7002 0.6630 0.5604 -0.0563 -0.1067 -0.0147 101 VAL A O   
792  C CB  . VAL A 100 ? 0.6973 0.5998 0.5120 -0.0322 -0.1063 -0.0244 101 VAL A CB  
793  C CG1 . VAL A 100 ? 0.6406 0.5117 0.4363 -0.0468 -0.1143 -0.0279 101 VAL A CG1 
794  C CG2 . VAL A 100 ? 0.6408 0.5330 0.4450 -0.0128 -0.1023 -0.0278 101 VAL A CG2 
795  N N   . TRP A 101 ? 0.6839 0.6274 0.5447 -0.0658 -0.1011 -0.0116 102 TRP A N   
796  C CA  . TRP A 101 ? 0.6126 0.5710 0.4823 -0.0850 -0.1045 -0.0105 102 TRP A CA  
797  C C   . TRP A 101 ? 0.6928 0.6182 0.5375 -0.1009 -0.1119 -0.0136 102 TRP A C   
798  O O   . TRP A 101 ? 0.7059 0.6014 0.5343 -0.0989 -0.1114 -0.0136 102 TRP A O   
799  C CB  . TRP A 101 ? 0.5846 0.5682 0.4785 -0.0890 -0.0968 -0.0054 102 TRP A CB  
800  C CG  . TRP A 101 ? 0.5481 0.5646 0.4679 -0.0768 -0.0914 -0.0024 102 TRP A CG  
801  C CD1 . TRP A 101 ? 0.5310 0.5805 0.4710 -0.0800 -0.0927 -0.0017 102 TRP A CD1 
802  C CD2 . TRP A 101 ? 0.5296 0.5478 0.4571 -0.0601 -0.0846 0.0003  102 TRP A CD2 
803  N NE1 . TRP A 101 ? 0.5069 0.5743 0.4647 -0.0653 -0.0880 0.0014  102 TRP A NE1 
804  C CE2 . TRP A 101 ? 0.4435 0.4918 0.3938 -0.0543 -0.0828 0.0029  102 TRP A CE2 
805  C CE3 . TRP A 101 ? 0.5476 0.5452 0.4647 -0.0495 -0.0807 0.0006  102 TRP A CE3 
806  C CZ2 . TRP A 101 ? 0.5132 0.5679 0.4743 -0.0403 -0.0774 0.0064  102 TRP A CZ2 
807  C CZ3 . TRP A 101 ? 0.5379 0.5470 0.4683 -0.0363 -0.0746 0.0039  102 TRP A CZ3 
808  C CH2 . TRP A 101 ? 0.5421 0.5775 0.4932 -0.0327 -0.0732 0.0070  102 TRP A CH2 
809  N N   . THR A 102 ? 0.6560 0.5856 0.4966 -0.1171 -0.1198 -0.0158 103 THR A N   
810  C CA  . THR A 102 ? 0.5946 0.4908 0.4098 -0.1355 -0.1282 -0.0182 103 THR A CA  
811  C C   . THR A 102 ? 0.7486 0.6704 0.5752 -0.1593 -0.1323 -0.0170 103 THR A C   
812  O O   . THR A 102 ? 0.8037 0.7639 0.6524 -0.1572 -0.1316 -0.0170 103 THR A O   
813  C CB  . THR A 102 ? 0.7929 0.6517 0.5776 -0.1278 -0.1373 -0.0258 103 THR A CB  
814  O OG1 . THR A 102 ? 0.8749 0.6910 0.6306 -0.1434 -0.1461 -0.0279 103 THR A OG1 
815  C CG2 . THR A 102 ? 0.7241 0.6017 0.5118 -0.1287 -0.1433 -0.0300 103 THR A CG2 
816  N N   . PRO A 103 ? 0.7931 0.6964 0.6056 -0.1823 -0.1367 -0.0154 104 PRO A N   
817  C CA  . PRO A 103 ? 0.8023 0.7357 0.6276 -0.2073 -0.1399 -0.0139 104 PRO A CA  
818  C C   . PRO A 103 ? 0.8729 0.8148 0.6954 -0.2123 -0.1499 -0.0195 104 PRO A C   
819  O O   . PRO A 103 ? 0.8637 0.7755 0.6643 -0.2020 -0.1568 -0.0252 104 PRO A O   
820  C CB  . PRO A 103 ? 0.8462 0.7454 0.6474 -0.2314 -0.1442 -0.0109 104 PRO A CB  
821  C CG  . PRO A 103 ? 0.8240 0.6930 0.6136 -0.2165 -0.1385 -0.0082 104 PRO A CG  
822  C CD  . PRO A 103 ? 0.7779 0.6378 0.5659 -0.1867 -0.1375 -0.0132 104 PRO A CD  
823  N N   . TYR A 104 ? 0.9311 0.9172 0.7764 -0.2279 -0.1508 -0.0184 105 TYR A N   
824  C CA  . TYR A 104 ? 0.9423 0.9439 0.7881 -0.2368 -0.1612 -0.0232 105 TYR A CA  
825  C C   . TYR A 104 ? 1.0799 1.0883 0.9222 -0.2711 -0.1675 -0.0221 105 TYR A C   
826  O O   . TYR A 104 ? 1.2221 1.2717 1.0891 -0.2834 -0.1612 -0.0180 105 TYR A O   
827  C CB  . TYR A 104 ? 0.9388 0.9938 0.8182 -0.2221 -0.1576 -0.0230 105 TYR A CB  
828  C CG  . TYR A 104 ? 0.9738 1.0428 0.8523 -0.2237 -0.1687 -0.0281 105 TYR A CG  
829  C CD1 . TYR A 104 ? 0.9964 1.0816 0.8755 -0.2498 -0.1781 -0.0304 105 TYR A CD1 
830  C CD2 . TYR A 104 ? 0.9421 1.0106 0.8193 -0.2000 -0.1699 -0.0303 105 TYR A CD2 
831  C CE1 . TYR A 104 ? 1.0154 1.1143 0.8934 -0.2512 -0.1891 -0.0353 105 TYR A CE1 
832  C CE2 . TYR A 104 ? 0.9806 1.0619 0.8554 -0.2011 -0.1804 -0.0346 105 TYR A CE2 
833  C CZ  . TYR A 104 ? 1.0111 1.1075 0.8865 -0.2261 -0.1902 -0.0374 105 TYR A CZ  
834  O OH  . TYR A 104 ? 0.9862 1.0962 0.8588 -0.2273 -0.2016 -0.0420 105 TYR A OH  
835  N N   . PRO A 105 ? 1.0675 1.0366 0.8788 -0.2872 -0.1801 -0.0263 106 PRO A N   
836  C CA  . PRO A 105 ? 1.0910 1.0132 0.8715 -0.2730 -0.1886 -0.0332 106 PRO A CA  
837  C C   . PRO A 105 ? 1.1039 0.9741 0.8595 -0.2573 -0.1852 -0.0330 106 PRO A C   
838  O O   . PRO A 105 ? 1.0933 0.9551 0.8494 -0.2632 -0.1787 -0.0268 106 PRO A O   
839  C CB  . PRO A 105 ? 1.0561 0.9557 0.8128 -0.3016 -0.2036 -0.0374 106 PRO A CB  
840  C CG  . PRO A 105 ? 1.0476 0.9549 0.8087 -0.3311 -0.2014 -0.0302 106 PRO A CG  
841  C CD  . PRO A 105 ? 1.0474 1.0156 0.8503 -0.3235 -0.1872 -0.0244 106 PRO A CD  
842  N N   . ARG A 106 ? 1.1255 0.9641 0.8598 -0.2370 -0.1898 -0.0400 107 ARG A N   
843  C CA  . ARG A 106 ? 1.0580 0.8513 0.7698 -0.2183 -0.1873 -0.0414 107 ARG A CA  
844  C C   . ARG A 106 ? 1.1181 0.8628 0.8010 -0.2382 -0.1940 -0.0396 107 ARG A C   
845  O O   . ARG A 106 ? 1.1916 0.9214 0.8590 -0.2644 -0.2051 -0.0409 107 ARG A O   
846  C CB  . ARG A 106 ? 1.0664 0.8348 0.7563 -0.1972 -0.1932 -0.0513 107 ARG A CB  
847  C CG  . ARG A 106 ? 1.0426 0.7921 0.7254 -0.1677 -0.1859 -0.0529 107 ARG A CG  
848  C CD  . ARG A 106 ? 1.1931 0.9300 0.8582 -0.1475 -0.1904 -0.0629 107 ARG A CD  
849  N NE  . ARG A 106 ? 1.2283 1.0113 0.9156 -0.1434 -0.1880 -0.0624 107 ARG A NE  
850  C CZ  . ARG A 106 ? 1.2840 1.0660 0.9584 -0.1311 -0.1925 -0.0701 107 ARG A CZ  
851  N NH1 . ARG A 106 ? 1.3429 1.0817 0.9831 -0.1206 -0.1992 -0.0804 107 ARG A NH1 
852  N NH2 . ARG A 106 ? 1.2016 1.0255 0.8961 -0.1284 -0.1908 -0.0679 107 ARG A NH2 
853  N N   . PRO A 107 ? 1.2209 0.9401 0.8955 -0.2278 -0.1884 -0.0359 108 PRO A N   
854  C CA  . PRO A 107 ? 1.3188 0.9899 0.9643 -0.2470 -0.1955 -0.0324 108 PRO A CA  
855  C C   . PRO A 107 ? 1.4460 1.0582 1.0495 -0.2524 -0.2122 -0.0411 108 PRO A C   
856  O O   . PRO A 107 ? 1.3416 0.9347 0.9309 -0.2293 -0.2162 -0.0508 108 PRO A O   
857  C CB  . PRO A 107 ? 1.2848 0.9400 0.9289 -0.2257 -0.1871 -0.0288 108 PRO A CB  
858  C CG  . PRO A 107 ? 1.2555 0.9431 0.9224 -0.1945 -0.1774 -0.0325 108 PRO A CG  
859  C CD  . PRO A 107 ? 1.2095 0.9489 0.9044 -0.2016 -0.1751 -0.0328 108 PRO A CD  
860  N N   . THR A 108 ? 1.6626 1.2461 1.2451 -0.2841 -0.2222 -0.0376 109 THR A N   
861  C CA  . THR A 108 ? 1.7756 1.2940 1.3134 -0.2917 -0.2398 -0.0454 109 THR A CA  
862  C C   . THR A 108 ? 1.7514 1.2085 1.2568 -0.2718 -0.2438 -0.0473 109 THR A C   
863  O O   . THR A 108 ? 1.8244 1.2419 1.3035 -0.2506 -0.2522 -0.0588 109 THR A O   
864  C CB  . THR A 108 ? 1.8648 1.3771 1.3947 -0.3297 -0.2462 -0.0381 109 THR A CB  
865  O OG1 . THR A 108 ? 1.9179 1.4326 1.4524 -0.3454 -0.2392 -0.0252 109 THR A OG1 
866  C CG2 . THR A 108 ? 1.8060 1.3794 1.3669 -0.3468 -0.2442 -0.0383 109 THR A CG2 
867  N N   . SER A 109 ? 1.6371 1.0872 1.1439 -0.2773 -0.2379 -0.0369 110 SER A N   
868  C CA  . SER A 109 ? 1.6174 1.0154 1.0974 -0.2578 -0.2410 -0.0371 110 SER A CA  
869  C C   . SER A 109 ? 1.5414 0.9766 1.0506 -0.2261 -0.2251 -0.0358 110 SER A C   
870  O O   . SER A 109 ? 1.4928 0.9901 1.0418 -0.2268 -0.2112 -0.0307 110 SER A O   
871  C CB  . SER A 109 ? 1.6708 1.0370 1.1319 -0.2839 -0.2446 -0.0244 110 SER A CB  
872  O OG  . SER A 109 ? 1.6869 1.1049 1.1778 -0.3104 -0.2344 -0.0138 110 SER A OG  
873  N N   . PRO A 110 ? 1.4625 0.8613 0.9527 -0.1972 -0.2275 -0.0410 111 PRO A N   
874  C CA  . PRO A 110 ? 1.3423 0.7776 0.8601 -0.1670 -0.2133 -0.0409 111 PRO A CA  
875  C C   . PRO A 110 ? 1.3601 0.8290 0.9037 -0.1768 -0.2008 -0.0278 111 PRO A C   
876  O O   . PRO A 110 ? 1.3323 0.7764 0.8607 -0.1981 -0.2047 -0.0190 111 PRO A O   
877  C CB  . PRO A 110 ? 1.3631 0.7451 0.8491 -0.1392 -0.2215 -0.0487 111 PRO A CB  
878  C CG  . PRO A 110 ? 1.3935 0.7196 0.8395 -0.1473 -0.2395 -0.0578 111 PRO A CG  
879  C CD  . PRO A 110 ? 1.4839 0.8078 0.9267 -0.1888 -0.2444 -0.0490 111 PRO A CD  
880  N N   . THR A 111 ? 1.2263 0.7509 0.8076 -0.1610 -0.1861 -0.0266 112 THR A N   
881  C CA  . THR A 111 ? 1.1913 0.7581 0.8026 -0.1694 -0.1731 -0.0161 112 THR A CA  
882  C C   . THR A 111 ? 1.0851 0.6634 0.7094 -0.1411 -0.1639 -0.0157 112 THR A C   
883  O O   . THR A 111 ? 1.0494 0.6404 0.6822 -0.1160 -0.1608 -0.0230 112 THR A O   
884  C CB  . THR A 111 ? 1.1830 0.8108 0.8304 -0.1798 -0.1646 -0.0147 112 THR A CB  
885  O OG1 . THR A 111 ? 1.2878 0.9109 0.9261 -0.2102 -0.1726 -0.0135 112 THR A OG1 
886  C CG2 . THR A 111 ? 1.1188 0.7928 0.7991 -0.1814 -0.1504 -0.0064 112 THR A CG2 
887  N N   . PRO A 112 ? 1.0315 0.6076 0.6574 -0.1453 -0.1593 -0.0073 113 PRO A N   
888  C CA  . PRO A 112 ? 1.0484 0.6372 0.6875 -0.1198 -0.1512 -0.0069 113 PRO A CA  
889  C C   . PRO A 112 ? 0.9272 0.5753 0.6063 -0.1083 -0.1378 -0.0076 113 PRO A C   
890  O O   . PRO A 112 ? 0.8747 0.5595 0.5756 -0.1223 -0.1328 -0.0056 113 PRO A O   
891  C CB  . PRO A 112 ? 1.0763 0.6553 0.7097 -0.1337 -0.1493 0.0034  113 PRO A CB  
892  C CG  . PRO A 112 ? 1.1537 0.7349 0.7829 -0.1680 -0.1517 0.0094  113 PRO A CG  
893  C CD  . PRO A 112 ? 1.1148 0.6723 0.7261 -0.1742 -0.1628 0.0022  113 PRO A CD  
894  N N   . VAL A 113 ? 0.8861 0.5432 0.5743 -0.0824 -0.1326 -0.0104 114 VAL A N   
895  C CA  . VAL A 113 ? 0.7820 0.4856 0.5015 -0.0680 -0.1223 -0.0124 114 VAL A CA  
896  C C   . VAL A 113 ? 0.7961 0.5242 0.5366 -0.0594 -0.1122 -0.0071 114 VAL A C   
897  O O   . VAL A 113 ? 0.8552 0.5615 0.5834 -0.0490 -0.1141 -0.0065 114 VAL A O   
898  C CB  . VAL A 113 ? 0.7994 0.4949 0.5100 -0.0452 -0.1254 -0.0218 114 VAL A CB  
899  C CG1 . VAL A 113 ? 0.7880 0.5306 0.5289 -0.0328 -0.1148 -0.0220 114 VAL A CG1 
900  C CG2 . VAL A 113 ? 0.8550 0.5242 0.5425 -0.0535 -0.1362 -0.0282 114 VAL A CG2 
901  N N   . LEU A 114 ? 0.7099 0.4825 0.4814 -0.0627 -0.1025 -0.0038 115 LEU A N   
902  C CA  . LEU A 114 ? 0.7080 0.5077 0.5021 -0.0536 -0.0929 -0.0001 115 LEU A CA  
903  C C   . LEU A 114 ? 0.7114 0.5385 0.5243 -0.0360 -0.0875 -0.0033 115 LEU A C   
904  O O   . LEU A 114 ? 0.6876 0.5320 0.5093 -0.0384 -0.0873 -0.0050 115 LEU A O   
905  C CB  . LEU A 114 ? 0.6880 0.5161 0.5017 -0.0707 -0.0864 0.0057  115 LEU A CB  
906  C CG  . LEU A 114 ? 0.7926 0.6040 0.5927 -0.0887 -0.0881 0.0110  115 LEU A CG  
907  C CD1 . LEU A 114 ? 0.7622 0.6087 0.5826 -0.1068 -0.0820 0.0145  115 LEU A CD1 
908  C CD2 . LEU A 114 ? 0.7961 0.5983 0.5928 -0.0783 -0.0854 0.0137  115 LEU A CD2 
909  N N   . VAL A 115 ? 0.7050 0.5370 0.5236 -0.0195 -0.0835 -0.0035 116 VAL A N   
910  C CA  . VAL A 115 ? 0.6774 0.5344 0.5117 -0.0041 -0.0783 -0.0055 116 VAL A CA  
911  C C   . VAL A 115 ? 0.5985 0.4823 0.4566 -0.0016 -0.0699 -0.0007 116 VAL A C   
912  O O   . VAL A 115 ? 0.5996 0.4767 0.4556 0.0041  -0.0689 0.0004  116 VAL A O   
913  C CB  . VAL A 115 ? 0.6830 0.5233 0.5010 0.0145  -0.0819 -0.0118 116 VAL A CB  
914  C CG1 . VAL A 115 ? 0.6268 0.4974 0.4613 0.0276  -0.0754 -0.0128 116 VAL A CG1 
915  C CG2 . VAL A 115 ? 0.6226 0.4324 0.4143 0.0129  -0.0913 -0.0179 116 VAL A CG2 
916  N N   . TRP A 116 ? 0.5784 0.4912 0.4581 -0.0050 -0.0647 0.0019  117 TRP A N   
917  C CA  . TRP A 116 ? 0.5215 0.4577 0.4231 -0.0037 -0.0578 0.0058  117 TRP A CA  
918  C C   . TRP A 116 ? 0.6272 0.5772 0.5378 0.0103  -0.0541 0.0059  117 TRP A C   
919  O O   . TRP A 116 ? 0.6209 0.5771 0.5301 0.0161  -0.0546 0.0044  117 TRP A O   
920  C CB  . TRP A 116 ? 0.4846 0.4430 0.4038 -0.0133 -0.0554 0.0082  117 TRP A CB  
921  C CG  . TRP A 116 ? 0.5029 0.4832 0.4437 -0.0110 -0.0494 0.0112  117 TRP A CG  
922  C CD1 . TRP A 116 ? 0.5115 0.5112 0.4684 -0.0060 -0.0471 0.0129  117 TRP A CD1 
923  C CD2 . TRP A 116 ? 0.4958 0.4778 0.4418 -0.0136 -0.0460 0.0124  117 TRP A CD2 
924  N NE1 . TRP A 116 ? 0.5334 0.5446 0.5050 -0.0052 -0.0429 0.0146  117 TRP A NE1 
925  C CE2 . TRP A 116 ? 0.4954 0.4975 0.4611 -0.0096 -0.0418 0.0139  117 TRP A CE2 
926  C CE3 . TRP A 116 ? 0.5059 0.4727 0.4399 -0.0193 -0.0466 0.0126  117 TRP A CE3 
927  C CZ2 . TRP A 116 ? 0.4972 0.5054 0.4712 -0.0104 -0.0381 0.0142  117 TRP A CZ2 
928  C CZ3 . TRP A 116 ? 0.4865 0.4615 0.4290 -0.0205 -0.0424 0.0138  117 TRP A CZ3 
929  C CH2 . TRP A 116 ? 0.4738 0.4699 0.4364 -0.0158 -0.0381 0.0139  117 TRP A CH2 
930  N N   . ILE A 117 ? 0.5196 0.4759 0.4389 0.0143  -0.0504 0.0078  118 ILE A N   
931  C CA  . ILE A 117 ? 0.5362 0.5096 0.4671 0.0240  -0.0464 0.0089  118 ILE A CA  
932  C C   . ILE A 117 ? 0.5896 0.5789 0.5396 0.0192  -0.0421 0.0128  118 ILE A C   
933  O O   . ILE A 117 ? 0.5736 0.5588 0.5247 0.0166  -0.0414 0.0131  118 ILE A O   
934  C CB  . ILE A 117 ? 0.5241 0.4902 0.4463 0.0351  -0.0475 0.0062  118 ILE A CB  
935  C CG1 . ILE A 117 ? 0.5573 0.5024 0.4576 0.0413  -0.0532 0.0008  118 ILE A CG1 
936  C CG2 . ILE A 117 ? 0.4827 0.4714 0.4176 0.0429  -0.0431 0.0074  118 ILE A CG2 
937  C CD1 . ILE A 117 ? 0.5696 0.5075 0.4605 0.0553  -0.0554 -0.0031 118 ILE A CD1 
938  N N   . TYR A 118 ? 0.4457 0.4509 0.4087 0.0184  -0.0400 0.0155  119 TYR A N   
939  C CA  . TYR A 118 ? 0.4345 0.4511 0.4138 0.0150  -0.0373 0.0182  119 TYR A CA  
940  C C   . TYR A 118 ? 0.5074 0.5286 0.4926 0.0193  -0.0349 0.0193  119 TYR A C   
941  O O   . TYR A 118 ? 0.5513 0.5737 0.5318 0.0256  -0.0346 0.0189  119 TYR A O   
942  C CB  . TYR A 118 ? 0.4997 0.5281 0.4890 0.0143  -0.0375 0.0213  119 TYR A CB  
943  C CG  . TYR A 118 ? 0.4891 0.5236 0.4764 0.0193  -0.0371 0.0240  119 TYR A CG  
944  C CD1 . TYR A 118 ? 0.4613 0.5034 0.4551 0.0219  -0.0345 0.0272  119 TYR A CD1 
945  C CD2 . TYR A 118 ? 0.5051 0.5392 0.4835 0.0202  -0.0394 0.0235  119 TYR A CD2 
946  C CE1 . TYR A 118 ? 0.4650 0.5160 0.4565 0.0245  -0.0334 0.0304  119 TYR A CE1 
947  C CE2 . TYR A 118 ? 0.4782 0.5202 0.4533 0.0242  -0.0384 0.0262  119 TYR A CE2 
948  C CZ  . TYR A 118 ? 0.4786 0.5300 0.4604 0.0260  -0.0350 0.0299  119 TYR A CZ  
949  O OH  . TYR A 118 ? 0.4812 0.5436 0.4594 0.0282  -0.0332 0.0332  119 TYR A OH  
950  N N   . GLY A 119 ? 0.4567 0.4820 0.4525 0.0161  -0.0333 0.0200  120 GLY A N   
951  C CA  . GLY A 119 ? 0.4542 0.4849 0.4573 0.0183  -0.0318 0.0210  120 GLY A CA  
952  C C   . GLY A 119 ? 0.4587 0.4982 0.4735 0.0174  -0.0313 0.0248  120 GLY A C   
953  O O   . GLY A 119 ? 0.4837 0.5258 0.5000 0.0169  -0.0323 0.0271  120 GLY A O   
954  N N   . GLY A 120 ? 0.4527 0.4952 0.4745 0.0168  -0.0306 0.0255  121 GLY A N   
955  C CA  . GLY A 120 ? 0.4530 0.4994 0.4833 0.0147  -0.0313 0.0297  121 GLY A CA  
956  C C   . GLY A 120 ? 0.5195 0.5731 0.5525 0.0135  -0.0305 0.0321  121 GLY A C   
957  O O   . GLY A 120 ? 0.5547 0.6134 0.5908 0.0103  -0.0308 0.0374  121 GLY A O   
958  N N   . GLY A 121 ? 0.4517 0.5067 0.4828 0.0153  -0.0300 0.0286  122 GLY A N   
959  C CA  . GLY A 121 ? 0.5038 0.5692 0.5394 0.0139  -0.0299 0.0298  122 GLY A CA  
960  C C   . GLY A 121 ? 0.5078 0.5886 0.5429 0.0153  -0.0281 0.0330  122 GLY A C   
961  O O   . GLY A 121 ? 0.4565 0.5505 0.4979 0.0113  -0.0276 0.0357  122 GLY A O   
962  N N   . PHE A 122 ? 0.4620 0.5429 0.4893 0.0204  -0.0270 0.0323  123 PHE A N   
963  C CA  . PHE A 122 ? 0.4396 0.5365 0.4645 0.0231  -0.0246 0.0343  123 PHE A CA  
964  C C   . PHE A 122 ? 0.4433 0.5481 0.4730 0.0148  -0.0234 0.0419  123 PHE A C   
965  O O   . PHE A 122 ? 0.4796 0.6014 0.5076 0.0148  -0.0206 0.0446  123 PHE A O   
966  C CB  . PHE A 122 ? 0.4235 0.5373 0.4502 0.0285  -0.0236 0.0312  123 PHE A CB  
967  C CG  . PHE A 122 ? 0.4814 0.5855 0.4993 0.0387  -0.0259 0.0243  123 PHE A CG  
968  C CD1 . PHE A 122 ? 0.4726 0.5699 0.4781 0.0470  -0.0264 0.0206  123 PHE A CD1 
969  C CD2 . PHE A 122 ? 0.4623 0.5618 0.4820 0.0396  -0.0285 0.0217  123 PHE A CD2 
970  C CE1 . PHE A 122 ? 0.4744 0.5574 0.4688 0.0557  -0.0300 0.0149  123 PHE A CE1 
971  C CE2 . PHE A 122 ? 0.4237 0.5109 0.4324 0.0485  -0.0317 0.0167  123 PHE A CE2 
972  C CZ  . PHE A 122 ? 0.4947 0.5723 0.4904 0.0564  -0.0327 0.0135  123 PHE A CZ  
973  N N   . TYR A 123 ? 0.3962 0.4885 0.4302 0.0080  -0.0259 0.0455  124 TYR A N   
974  C CA  . TYR A 123 ? 0.4826 0.5757 0.5178 0.0001  -0.0266 0.0537  124 TYR A CA  
975  C C   . TYR A 123 ? 0.4785 0.5570 0.5095 0.0011  -0.0294 0.0558  124 TYR A C   
976  O O   . TYR A 123 ? 0.4941 0.5708 0.5230 -0.0043 -0.0310 0.0633  124 TYR A O   
977  C CB  . TYR A 123 ? 0.4632 0.5518 0.5058 -0.0088 -0.0291 0.0570  124 TYR A CB  
978  C CG  . TYR A 123 ? 0.5183 0.5863 0.5635 -0.0077 -0.0331 0.0533  124 TYR A CG  
979  C CD1 . TYR A 123 ? 0.4628 0.5149 0.5066 -0.0087 -0.0370 0.0565  124 TYR A CD1 
980  C CD2 . TYR A 123 ? 0.4933 0.5589 0.5414 -0.0046 -0.0332 0.0462  124 TYR A CD2 
981  C CE1 . TYR A 123 ? 0.4812 0.5180 0.5279 -0.0056 -0.0404 0.0516  124 TYR A CE1 
982  C CE2 . TYR A 123 ? 0.4780 0.5282 0.5279 -0.0032 -0.0360 0.0420  124 TYR A CE2 
983  C CZ  . TYR A 123 ? 0.5417 0.5787 0.5915 -0.0032 -0.0393 0.0442  124 TYR A CZ  
984  O OH  . TYR A 123 ? 0.5499 0.5748 0.6020 0.0001  -0.0418 0.0386  124 TYR A OH  
985  N N   . SER A 124 ? 0.4578 0.5268 0.4871 0.0071  -0.0305 0.0499  125 SER A N   
986  C CA  . SER A 124 ? 0.4256 0.4846 0.4536 0.0083  -0.0338 0.0509  125 SER A CA  
987  C C   . SER A 124 ? 0.4572 0.5144 0.4807 0.0135  -0.0334 0.0444  125 SER A C   
988  O O   . SER A 124 ? 0.4716 0.5308 0.4913 0.0163  -0.0312 0.0397  125 SER A O   
989  C CB  . SER A 124 ? 0.4413 0.4881 0.4764 0.0067  -0.0375 0.0507  125 SER A CB  
990  O OG  . SER A 124 ? 0.4465 0.4909 0.4856 0.0085  -0.0364 0.0438  125 SER A OG  
991  N N   . GLY A 125 ? 0.4184 0.4709 0.4416 0.0145  -0.0364 0.0444  126 GLY A N   
992  C CA  . GLY A 125 ? 0.4259 0.4769 0.4449 0.0166  -0.0368 0.0390  126 GLY A CA  
993  C C   . GLY A 125 ? 0.5278 0.5814 0.5387 0.0175  -0.0387 0.0406  126 GLY A C   
994  O O   . GLY A 125 ? 0.5047 0.5631 0.5109 0.0174  -0.0382 0.0455  126 GLY A O   
995  N N   . ALA A 126 ? 0.5217 0.5736 0.5303 0.0173  -0.0408 0.0365  127 ALA A N   
996  C CA  . ALA A 126 ? 0.5808 0.6346 0.5809 0.0177  -0.0437 0.0368  127 ALA A CA  
997  C C   . ALA A 126 ? 0.6135 0.6642 0.6106 0.0150  -0.0456 0.0309  127 ALA A C   
998  O O   . ALA A 126 ? 0.5499 0.6015 0.5554 0.0125  -0.0454 0.0284  127 ALA A O   
999  C CB  . ALA A 126 ? 0.4277 0.4852 0.4318 0.0181  -0.0478 0.0425  127 ALA A CB  
1000 N N   . SER A 127 ? 0.5019 0.5494 0.4860 0.0148  -0.0475 0.0285  128 SER A N   
1001 C CA  . SER A 127 ? 0.4918 0.5346 0.4710 0.0097  -0.0504 0.0235  128 SER A CA  
1002 C C   . SER A 127 ? 0.5023 0.5556 0.4901 0.0063  -0.0547 0.0241  128 SER A C   
1003 O O   . SER A 127 ? 0.4972 0.5510 0.4837 -0.0002 -0.0571 0.0203  128 SER A O   
1004 C CB  . SER A 127 ? 0.5140 0.5465 0.4745 0.0108  -0.0523 0.0197  128 SER A CB  
1005 O OG  . SER A 127 ? 0.5638 0.6023 0.5189 0.0135  -0.0546 0.0217  128 SER A OG  
1006 N N   . SER A 128 ? 0.4693 0.5311 0.4656 0.0102  -0.0563 0.0289  129 SER A N   
1007 C CA  . SER A 128 ? 0.4941 0.5672 0.4987 0.0096  -0.0616 0.0293  129 SER A CA  
1008 C C   . SER A 128 ? 0.4873 0.5695 0.5092 0.0106  -0.0612 0.0280  129 SER A C   
1009 O O   . SER A 128 ? 0.5255 0.6205 0.5565 0.0116  -0.0658 0.0270  129 SER A O   
1010 C CB  . SER A 128 ? 0.4450 0.5202 0.4465 0.0145  -0.0654 0.0356  129 SER A CB  
1011 O OG  . SER A 128 ? 0.4928 0.5633 0.4973 0.0182  -0.0627 0.0411  129 SER A OG  
1012 N N   . LEU A 129 ? 0.4901 0.5674 0.5165 0.0113  -0.0561 0.0271  130 LEU A N   
1013 C CA  . LEU A 129 ? 0.5500 0.6360 0.5912 0.0133  -0.0554 0.0245  130 LEU A CA  
1014 C C   . LEU A 129 ? 0.5373 0.6383 0.5843 0.0075  -0.0562 0.0190  130 LEU A C   
1015 O O   . LEU A 129 ? 0.5102 0.6083 0.5481 -0.0010 -0.0551 0.0170  130 LEU A O   
1016 C CB  . LEU A 129 ? 0.4965 0.5743 0.5383 0.0132  -0.0498 0.0234  130 LEU A CB  
1017 C CG  . LEU A 129 ? 0.5877 0.6542 0.6257 0.0169  -0.0487 0.0286  130 LEU A CG  
1018 C CD1 . LEU A 129 ? 0.5183 0.5800 0.5601 0.0171  -0.0447 0.0266  130 LEU A CD1 
1019 C CD2 . LEU A 129 ? 0.6045 0.6707 0.6465 0.0222  -0.0538 0.0337  130 LEU A CD2 
1020 N N   . ASP A 130 ? 0.4992 0.6167 0.5612 0.0121  -0.0585 0.0166  131 ASP A N   
1021 C CA  . ASP A 130 ? 0.5320 0.6713 0.6026 0.0064  -0.0592 0.0114  131 ASP A CA  
1022 C C   . ASP A 130 ? 0.4928 0.6324 0.5598 -0.0040 -0.0529 0.0079  131 ASP A C   
1023 O O   . ASP A 130 ? 0.5627 0.7136 0.6287 -0.0148 -0.0531 0.0056  131 ASP A O   
1024 C CB  . ASP A 130 ? 0.5059 0.6650 0.5946 0.0162  -0.0619 0.0079  131 ASP A CB  
1025 C CG  . ASP A 130 ? 0.6287 0.7873 0.7195 0.0261  -0.0702 0.0118  131 ASP A CG  
1026 O OD1 . ASP A 130 ? 0.5864 0.7378 0.6663 0.0226  -0.0738 0.0161  131 ASP A OD1 
1027 O OD2 . ASP A 130 ? 0.7433 0.9075 0.8451 0.0378  -0.0737 0.0103  131 ASP A OD2 
1028 N N   . VAL A 131 ? 0.4587 0.5857 0.5227 -0.0022 -0.0478 0.0082  132 VAL A N   
1029 C CA  . VAL A 131 ? 0.4806 0.6069 0.5397 -0.0114 -0.0423 0.0056  132 VAL A CA  
1030 C C   . VAL A 131 ? 0.4812 0.5871 0.5212 -0.0202 -0.0424 0.0081  132 VAL A C   
1031 O O   . VAL A 131 ? 0.4872 0.5887 0.5193 -0.0296 -0.0394 0.0072  132 VAL A O   
1032 C CB  . VAL A 131 ? 0.5336 0.6556 0.5971 -0.0047 -0.0380 0.0042  132 VAL A CB  
1033 C CG1 . VAL A 131 ? 0.5723 0.6711 0.6265 0.0001  -0.0383 0.0087  132 VAL A CG1 
1034 C CG2 . VAL A 131 ? 0.5643 0.6917 0.6251 -0.0132 -0.0324 0.0010  132 VAL A CG2 
1035 N N   . TYR A 132 ? 0.5531 0.6458 0.5840 -0.0171 -0.0462 0.0111  133 TYR A N   
1036 C CA  . TYR A 132 ? 0.5188 0.5920 0.5306 -0.0231 -0.0477 0.0119  133 TYR A CA  
1037 C C   . TYR A 132 ? 0.5423 0.6194 0.5489 -0.0308 -0.0531 0.0107  133 TYR A C   
1038 O O   . TYR A 132 ? 0.5504 0.6092 0.5397 -0.0336 -0.0561 0.0106  133 TYR A O   
1039 C CB  . TYR A 132 ? 0.5567 0.6138 0.5598 -0.0140 -0.0478 0.0145  133 TYR A CB  
1040 C CG  . TYR A 132 ? 0.5097 0.5636 0.5179 -0.0073 -0.0435 0.0159  133 TYR A CG  
1041 C CD1 . TYR A 132 ? 0.4489 0.5035 0.4600 -0.0105 -0.0398 0.0142  133 TYR A CD1 
1042 C CD2 . TYR A 132 ? 0.4342 0.4852 0.4433 0.0009  -0.0433 0.0191  133 TYR A CD2 
1043 C CE1 . TYR A 132 ? 0.4336 0.4851 0.4486 -0.0049 -0.0368 0.0148  133 TYR A CE1 
1044 C CE2 . TYR A 132 ? 0.4523 0.5010 0.4661 0.0051  -0.0402 0.0204  133 TYR A CE2 
1045 C CZ  . TYR A 132 ? 0.4994 0.5478 0.5162 0.0026  -0.0373 0.0179  133 TYR A CZ  
1046 O OH  . TYR A 132 ? 0.5076 0.5536 0.5284 0.0063  -0.0350 0.0186  133 TYR A OH  
1047 N N   . ASP A 133 ? 0.5413 0.6424 0.5623 -0.0334 -0.0549 0.0092  134 ASP A N   
1048 C CA  . ASP A 133 ? 0.5556 0.6646 0.5737 -0.0420 -0.0608 0.0078  134 ASP A CA  
1049 C C   . ASP A 133 ? 0.5736 0.6700 0.5764 -0.0579 -0.0613 0.0065  134 ASP A C   
1050 O O   . ASP A 133 ? 0.6036 0.7090 0.6104 -0.0673 -0.0575 0.0057  134 ASP A O   
1051 C CB  . ASP A 133 ? 0.6435 0.7858 0.6829 -0.0414 -0.0623 0.0057  134 ASP A CB  
1052 C CG  . ASP A 133 ? 0.6466 0.8010 0.6857 -0.0480 -0.0697 0.0044  134 ASP A CG  
1053 O OD1 . ASP A 133 ? 0.5780 0.7138 0.5989 -0.0561 -0.0734 0.0045  134 ASP A OD1 
1054 O OD2 . ASP A 133 ? 0.6852 0.8678 0.7419 -0.0443 -0.0727 0.0027  134 ASP A OD2 
1055 N N   . GLY A 134 ? 0.5546 0.6293 0.5382 -0.0613 -0.0664 0.0062  135 GLY A N   
1056 C CA  . GLY A 134 ? 0.5568 0.6101 0.5208 -0.0756 -0.0687 0.0053  135 GLY A CA  
1057 C C   . GLY A 134 ? 0.6018 0.6672 0.5655 -0.0935 -0.0736 0.0037  135 GLY A C   
1058 O O   . GLY A 134 ? 0.6445 0.6897 0.5902 -0.1081 -0.0763 0.0037  135 GLY A O   
1059 N N   . ARG A 135 ? 0.5699 0.6677 0.5526 -0.0934 -0.0755 0.0025  136 ARG A N   
1060 C CA  . ARG A 135 ? 0.5916 0.7043 0.5748 -0.1109 -0.0813 0.0005  136 ARG A CA  
1061 C C   . ARG A 135 ? 0.5598 0.6841 0.5454 -0.1298 -0.0776 0.0011  136 ARG A C   
1062 O O   . ARG A 135 ? 0.6342 0.7560 0.6096 -0.1497 -0.0825 0.0007  136 ARG A O   
1063 C CB  . ARG A 135 ? 0.4969 0.6458 0.5022 -0.1042 -0.0846 -0.0011 136 ARG A CB  
1064 C CG  . ARG A 135 ? 0.5594 0.7461 0.5917 -0.1000 -0.0788 -0.0018 136 ARG A CG  
1065 C CD  . ARG A 135 ? 0.5523 0.7717 0.6046 -0.0909 -0.0839 -0.0037 136 ARG A CD  
1066 N NE  . ARG A 135 ? 0.5352 0.7426 0.5876 -0.0705 -0.0854 -0.0015 136 ARG A NE  
1067 C CZ  . ARG A 135 ? 0.6173 0.8407 0.6790 -0.0604 -0.0920 -0.0014 136 ARG A CZ  
1068 N NH1 . ARG A 135 ? 0.5745 0.8287 0.6482 -0.0674 -0.0981 -0.0044 136 ARG A NH1 
1069 N NH2 . ARG A 135 ? 0.5856 0.7946 0.6442 -0.0441 -0.0929 0.0021  136 ARG A NH2 
1070 N N   . PHE A 136 ? 0.4992 0.6360 0.4966 -0.1253 -0.0691 0.0022  137 PHE A N   
1071 C CA  . PHE A 136 ? 0.5665 0.7203 0.5670 -0.1433 -0.0645 0.0029  137 PHE A CA  
1072 C C   . PHE A 136 ? 0.5173 0.6318 0.4894 -0.1573 -0.0651 0.0066  137 PHE A C   
1073 O O   . PHE A 136 ? 0.6107 0.7268 0.5739 -0.1802 -0.0668 0.0082  137 PHE A O   
1074 C CB  . PHE A 136 ? 0.4606 0.6424 0.4823 -0.1325 -0.0554 0.0017  137 PHE A CB  
1075 C CG  . PHE A 136 ? 0.4599 0.6757 0.5076 -0.1166 -0.0561 -0.0020 137 PHE A CG  
1076 C CD1 . PHE A 136 ? 0.4871 0.6939 0.5407 -0.0944 -0.0552 -0.0020 137 PHE A CD1 
1077 C CD2 . PHE A 136 ? 0.5662 0.8222 0.6316 -0.1241 -0.0587 -0.0052 137 PHE A CD2 
1078 C CE1 . PHE A 136 ? 0.5597 0.7925 0.6342 -0.0795 -0.0574 -0.0046 137 PHE A CE1 
1079 C CE2 . PHE A 136 ? 0.5672 0.8526 0.6554 -0.1073 -0.0609 -0.0087 137 PHE A CE2 
1080 C CZ  . PHE A 136 ? 0.5615 0.8327 0.6529 -0.0848 -0.0606 -0.0082 137 PHE A CZ  
1081 N N   . LEU A 137 ? 0.4847 0.5642 0.4419 -0.1442 -0.0643 0.0081  138 LEU A N   
1082 C CA  . LEU A 137 ? 0.5611 0.5990 0.4892 -0.1541 -0.0669 0.0113  138 LEU A CA  
1083 C C   . LEU A 137 ? 0.6706 0.6833 0.5771 -0.1685 -0.0770 0.0107  138 LEU A C   
1084 O O   . LEU A 137 ? 0.7262 0.7187 0.6129 -0.1886 -0.0803 0.0137  138 LEU A O   
1085 C CB  . LEU A 137 ? 0.6202 0.6286 0.5382 -0.1341 -0.0658 0.0117  138 LEU A CB  
1086 C CG  . LEU A 137 ? 0.6870 0.6927 0.6052 -0.1303 -0.0588 0.0144  138 LEU A CG  
1087 C CD1 . LEU A 137 ? 0.6823 0.6657 0.5948 -0.1093 -0.0587 0.0139  138 LEU A CD1 
1088 C CD2 . LEU A 137 ? 0.7306 0.7143 0.6260 -0.1503 -0.0606 0.0186  138 LEU A CD2 
1089 N N   . VAL A 138 ? 0.6460 0.6579 0.5541 -0.1591 -0.0826 0.0070  139 VAL A N   
1090 C CA  . VAL A 138 ? 0.6295 0.6140 0.5149 -0.1701 -0.0932 0.0050  139 VAL A CA  
1091 C C   . VAL A 138 ? 0.6288 0.6359 0.5189 -0.1962 -0.0965 0.0054  139 VAL A C   
1092 O O   . VAL A 138 ? 0.7205 0.6999 0.5870 -0.2162 -0.1037 0.0065  139 VAL A O   
1093 C CB  . VAL A 138 ? 0.5894 0.5713 0.4756 -0.1523 -0.0975 0.0005  139 VAL A CB  
1094 C CG1 . VAL A 138 ? 0.5749 0.5384 0.4419 -0.1652 -0.1089 -0.0032 139 VAL A CG1 
1095 C CG2 . VAL A 138 ? 0.6081 0.5638 0.4843 -0.1298 -0.0951 0.0000  139 VAL A CG2 
1096 N N   . GLN A 139 ? 0.5538 0.6116 0.4743 -0.1964 -0.0921 0.0044  140 GLN A N   
1097 C CA  . GLN A 139 ? 0.6137 0.7021 0.5429 -0.2213 -0.0944 0.0045  140 GLN A CA  
1098 C C   . GLN A 139 ? 0.6847 0.7708 0.6054 -0.2428 -0.0896 0.0096  140 GLN A C   
1099 O O   . GLN A 139 ? 0.7283 0.8088 0.6355 -0.2698 -0.0949 0.0116  140 GLN A O   
1100 C CB  . GLN A 139 ? 0.6249 0.7715 0.5901 -0.2132 -0.0906 0.0016  140 GLN A CB  
1101 C CG  . GLN A 139 ? 0.7499 0.9321 0.7260 -0.2349 -0.0961 -0.0004 140 GLN A CG  
1102 C CD  . GLN A 139 ? 0.8866 1.0887 0.8639 -0.2622 -0.0915 0.0028  140 GLN A CD  
1103 O OE1 . GLN A 139 ? 0.9566 1.1798 0.9465 -0.2591 -0.0812 0.0043  140 GLN A OE1 
1104 N NE2 . GLN A 139 ? 0.9288 1.1237 0.8914 -0.2900 -0.0994 0.0039  140 GLN A NE2 
1105 N N   . ALA A 140 ? 0.6398 0.7294 0.5664 -0.2325 -0.0800 0.0120  141 ALA A N   
1106 C CA  . ALA A 140 ? 0.6723 0.7658 0.5921 -0.2527 -0.0745 0.0171  141 ALA A CA  
1107 C C   . ALA A 140 ? 0.7001 0.7348 0.5810 -0.2660 -0.0810 0.0222  141 ALA A C   
1108 O O   . ALA A 140 ? 0.7405 0.7698 0.6067 -0.2940 -0.0830 0.0270  141 ALA A O   
1109 C CB  . ALA A 140 ? 0.6494 0.7643 0.5861 -0.2369 -0.0629 0.0172  141 ALA A CB  
1110 N N   . GLU A 141 ? 0.7087 0.6989 0.5718 -0.2464 -0.0849 0.0213  142 GLU A N   
1111 C CA  . GLU A 141 ? 0.7385 0.6714 0.5649 -0.2532 -0.0911 0.0256  142 GLU A CA  
1112 C C   . GLU A 141 ? 0.8391 0.7262 0.6394 -0.2518 -0.1041 0.0223  142 GLU A C   
1113 O O   . GLU A 141 ? 0.8902 0.7248 0.6582 -0.2531 -0.1110 0.0245  142 GLU A O   
1114 C CB  . GLU A 141 ? 0.7242 0.6412 0.5480 -0.2312 -0.0854 0.0270  142 GLU A CB  
1115 C CG  . GLU A 141 ? 0.7199 0.6700 0.5593 -0.2362 -0.0741 0.0308  142 GLU A CG  
1116 C CD  . GLU A 141 ? 0.8316 0.7739 0.6520 -0.2670 -0.0748 0.0381  142 GLU A CD  
1117 O OE1 . GLU A 141 ? 0.8478 0.7394 0.6341 -0.2785 -0.0844 0.0422  142 GLU A OE1 
1118 O OE2 . GLU A 141 ? 0.9512 0.9379 0.7896 -0.2797 -0.0659 0.0396  142 GLU A OE2 
1119 N N   . ARG A 142 ? 0.8638 0.7685 0.6760 -0.2484 -0.1082 0.0165  143 ARG A N   
1120 C CA  . ARG A 142 ? 0.9529 0.8177 0.7404 -0.2476 -0.1207 0.0119  143 ARG A CA  
1121 C C   . ARG A 142 ? 0.9008 0.7191 0.6665 -0.2236 -0.1236 0.0095  143 ARG A C   
1122 O O   . ARG A 142 ? 1.0243 0.7903 0.7561 -0.2278 -0.1337 0.0088  143 ARG A O   
1123 C CB  . ARG A 142 ? 0.9989 0.8378 0.7609 -0.2800 -0.1306 0.0147  143 ARG A CB  
1124 C CG  . ARG A 142 ? 1.1368 1.0254 0.9207 -0.3044 -0.1293 0.0156  143 ARG A CG  
1125 C CD  . ARG A 142 ? 1.3704 1.2355 1.1332 -0.3258 -0.1431 0.0128  143 ARG A CD  
1126 N NE  . ARG A 142 ? 1.4886 1.4017 1.2707 -0.3535 -0.1425 0.0145  143 ARG A NE  
1127 C CZ  . ARG A 142 ? 1.4937 1.4594 1.3070 -0.3486 -0.1408 0.0096  143 ARG A CZ  
1128 N NH1 . ARG A 142 ? 1.4639 1.4379 1.2906 -0.3182 -0.1394 0.0038  143 ARG A NH1 
1129 N NH2 . ARG A 142 ? 1.4959 1.5072 1.3267 -0.3744 -0.1407 0.0109  143 ARG A NH2 
1130 N N   . THR A 143 ? 0.8819 0.7201 0.6675 -0.1982 -0.1151 0.0082  144 THR A N   
1131 C CA  . THR A 143 ? 0.8704 0.6778 0.6428 -0.1730 -0.1159 0.0054  144 THR A CA  
1132 C C   . THR A 143 ? 0.8237 0.6441 0.6063 -0.1532 -0.1164 -0.0013 144 THR A C   
1133 O O   . THR A 143 ? 0.8055 0.6629 0.6098 -0.1561 -0.1145 -0.0025 144 THR A O   
1134 C CB  . THR A 143 ? 0.9063 0.7273 0.6926 -0.1613 -0.1056 0.0097  144 THR A CB  
1135 O OG1 . THR A 143 ? 1.0479 0.8337 0.8161 -0.1414 -0.1082 0.0078  144 THR A OG1 
1136 C CG2 . THR A 143 ? 0.8212 0.6926 0.6436 -0.1487 -0.0957 0.0087  144 THR A CG2 
1137 N N   . VAL A 144 ? 0.7903 0.5809 0.5562 -0.1330 -0.1196 -0.0058 145 VAL A N   
1138 C CA  . VAL A 144 ? 0.7801 0.5871 0.5568 -0.1118 -0.1174 -0.0109 145 VAL A CA  
1139 C C   . VAL A 144 ? 0.7619 0.5875 0.5571 -0.0928 -0.1073 -0.0083 145 VAL A C   
1140 O O   . VAL A 144 ? 0.7670 0.5709 0.5514 -0.0857 -0.1064 -0.0070 145 VAL A O   
1141 C CB  . VAL A 144 ? 0.8083 0.5766 0.5557 -0.1011 -0.1269 -0.0189 145 VAL A CB  
1142 C CG1 . VAL A 144 ? 0.7592 0.5488 0.5177 -0.0796 -0.1231 -0.0234 145 VAL A CG1 
1143 C CG2 . VAL A 144 ? 0.7715 0.5204 0.5000 -0.1213 -0.1381 -0.0220 145 VAL A CG2 
1144 N N   . LEU A 145 ? 0.7202 0.5849 0.5422 -0.0850 -0.1004 -0.0074 146 LEU A N   
1145 C CA  . LEU A 145 ? 0.6793 0.5630 0.5199 -0.0697 -0.0913 -0.0045 146 LEU A CA  
1146 C C   . LEU A 145 ? 0.7196 0.6141 0.5654 -0.0512 -0.0896 -0.0074 146 LEU A C   
1147 O O   . LEU A 145 ? 0.7508 0.6612 0.6025 -0.0523 -0.0917 -0.0088 146 LEU A O   
1148 C CB  . LEU A 145 ? 0.6964 0.6162 0.5645 -0.0776 -0.0842 0.0003  146 LEU A CB  
1149 C CG  . LEU A 145 ? 0.7692 0.7054 0.6550 -0.0641 -0.0756 0.0030  146 LEU A CG  
1150 C CD1 . LEU A 145 ? 0.7433 0.6862 0.6359 -0.0741 -0.0709 0.0067  146 LEU A CD1 
1151 C CD2 . LEU A 145 ? 0.8276 0.7958 0.7365 -0.0556 -0.0720 0.0036  146 LEU A CD2 
1152 N N   . VAL A 146 ? 0.6669 0.5544 0.5102 -0.0350 -0.0860 -0.0080 147 VAL A N   
1153 C CA  . VAL A 146 ? 0.6055 0.5058 0.4535 -0.0183 -0.0830 -0.0098 147 VAL A CA  
1154 C C   . VAL A 146 ? 0.6432 0.5654 0.5126 -0.0104 -0.0743 -0.0049 147 VAL A C   
1155 O O   . VAL A 146 ? 0.6221 0.5381 0.4933 -0.0112 -0.0719 -0.0028 147 VAL A O   
1156 C CB  . VAL A 146 ? 0.6616 0.5352 0.4852 -0.0051 -0.0873 -0.0167 147 VAL A CB  
1157 C CG1 . VAL A 146 ? 0.5963 0.4885 0.4245 0.0102  -0.0834 -0.0187 147 VAL A CG1 
1158 C CG2 . VAL A 146 ? 0.6683 0.5126 0.4672 -0.0139 -0.0974 -0.0223 147 VAL A CG2 
1159 N N   . SER A 147 ? 0.5774 0.5238 0.4613 -0.0039 -0.0704 -0.0028 148 SER A N   
1160 C CA  . SER A 147 ? 0.5401 0.5040 0.4409 0.0041  -0.0633 0.0015  148 SER A CA  
1161 C C   . SER A 147 ? 0.6444 0.6199 0.5447 0.0149  -0.0614 0.0014  148 SER A C   
1162 O O   . SER A 147 ? 0.6901 0.6683 0.5839 0.0143  -0.0647 -0.0002 148 SER A O   
1163 C CB  . SER A 147 ? 0.5587 0.5432 0.4818 -0.0029 -0.0600 0.0066  148 SER A CB  
1164 O OG  . SER A 147 ? 0.5296 0.5296 0.4603 -0.0055 -0.0622 0.0080  148 SER A OG  
1165 N N   . MET A 148 ? 0.5902 0.5741 0.4969 0.0238  -0.0561 0.0032  149 MET A N   
1166 C CA  . MET A 148 ? 0.5583 0.5563 0.4642 0.0326  -0.0532 0.0039  149 MET A CA  
1167 C C   . MET A 148 ? 0.6411 0.6586 0.5658 0.0330  -0.0474 0.0109  149 MET A C   
1168 O O   . MET A 148 ? 0.5358 0.5532 0.4714 0.0307  -0.0453 0.0130  149 MET A O   
1169 C CB  . MET A 148 ? 0.5372 0.5264 0.4273 0.0445  -0.0533 -0.0029 149 MET A CB  
1170 C CG  . MET A 148 ? 0.5368 0.5340 0.4352 0.0517  -0.0485 -0.0018 149 MET A CG  
1171 S SD  . MET A 148 ? 0.5714 0.5530 0.4749 0.0459  -0.0499 -0.0005 149 MET A SD  
1172 C CE  . MET A 148 ? 0.5890 0.5367 0.4660 0.0494  -0.0578 -0.0086 149 MET A CE  
1173 N N   . ASN A 149 ? 0.5830 0.6159 0.5097 0.0350  -0.0454 0.0148  150 ASN A N   
1174 C CA  . ASN A 149 ? 0.5485 0.5974 0.4885 0.0352  -0.0404 0.0216  150 ASN A CA  
1175 C C   . ASN A 149 ? 0.5069 0.5645 0.4428 0.0433  -0.0360 0.0192  150 ASN A C   
1176 O O   . ASN A 149 ? 0.5417 0.5984 0.4632 0.0507  -0.0364 0.0131  150 ASN A O   
1177 C CB  . ASN A 149 ? 0.5370 0.5970 0.4789 0.0320  -0.0410 0.0284  150 ASN A CB  
1178 C CG  . ASN A 149 ? 0.5740 0.6323 0.5283 0.0256  -0.0443 0.0330  150 ASN A CG  
1179 O OD1 . ASN A 149 ? 0.5458 0.5967 0.5064 0.0229  -0.0458 0.0301  150 ASN A OD1 
1180 N ND2 . ASN A 149 ? 0.5727 0.6383 0.5297 0.0237  -0.0457 0.0402  150 ASN A ND2 
1181 N N   . TYR A 150 ? 0.4650 0.5320 0.4136 0.0424  -0.0322 0.0230  151 TYR A N   
1182 C CA  . TYR A 150 ? 0.4178 0.4998 0.3665 0.0492  -0.0278 0.0213  151 TYR A CA  
1183 C C   . TYR A 150 ? 0.4452 0.5443 0.4078 0.0425  -0.0238 0.0300  151 TYR A C   
1184 O O   . TYR A 150 ? 0.5317 0.6246 0.5046 0.0349  -0.0253 0.0352  151 TYR A O   
1185 C CB  . TYR A 150 ? 0.4529 0.5253 0.4001 0.0558  -0.0289 0.0148  151 TYR A CB  
1186 C CG  . TYR A 150 ? 0.4353 0.5001 0.3945 0.0497  -0.0297 0.0177  151 TYR A CG  
1187 C CD1 . TYR A 150 ? 0.4345 0.4797 0.3912 0.0449  -0.0335 0.0164  151 TYR A CD1 
1188 C CD2 . TYR A 150 ? 0.4579 0.5365 0.4299 0.0480  -0.0265 0.0212  151 TYR A CD2 
1189 C CE1 . TYR A 150 ? 0.4097 0.4502 0.3761 0.0398  -0.0335 0.0183  151 TYR A CE1 
1190 C CE2 . TYR A 150 ? 0.5155 0.5867 0.4967 0.0429  -0.0275 0.0227  151 TYR A CE2 
1191 C CZ  . TYR A 150 ? 0.4658 0.5183 0.4437 0.0395  -0.0306 0.0211  151 TYR A CZ  
1192 O OH  . TYR A 150 ? 0.4883 0.5359 0.4743 0.0349  -0.0309 0.0219  151 TYR A OH  
1193 N N   . ARG A 151 ? 0.4075 0.5285 0.3697 0.0450  -0.0191 0.0311  152 ARG A N   
1194 C CA  . ARG A 151 ? 0.4331 0.5701 0.4060 0.0359  -0.0158 0.0404  152 ARG A CA  
1195 C C   . ARG A 151 ? 0.5125 0.6486 0.4991 0.0327  -0.0158 0.0412  152 ARG A C   
1196 O O   . ARG A 151 ? 0.5058 0.6408 0.4933 0.0401  -0.0161 0.0342  152 ARG A O   
1197 C CB  . ARG A 151 ? 0.4618 0.6269 0.4308 0.0377  -0.0101 0.0414  152 ARG A CB  
1198 C CG  . ARG A 151 ? 0.4538 0.6216 0.4076 0.0399  -0.0098 0.0412  152 ARG A CG  
1199 C CD  . ARG A 151 ? 0.3983 0.5978 0.3476 0.0441  -0.0030 0.0395  152 ARG A CD  
1200 N NE  . ARG A 151 ? 0.4483 0.6499 0.3889 0.0604  -0.0028 0.0262  152 ARG A NE  
1201 C CZ  . ARG A 151 ? 0.5193 0.7496 0.4568 0.0693  0.0027  0.0205  152 ARG A CZ  
1202 N NH1 . ARG A 151 ? 0.4708 0.7341 0.4140 0.0613  0.0096  0.0278  152 ARG A NH1 
1203 N NH2 . ARG A 151 ? 0.5134 0.7405 0.4414 0.0864  0.0011  0.0073  152 ARG A NH2 
1204 N N   . VAL A 152 ? 0.4582 0.5924 0.4537 0.0221  -0.0165 0.0495  153 VAL A N   
1205 C CA  . VAL A 152 ? 0.4695 0.5998 0.4768 0.0177  -0.0175 0.0502  153 VAL A CA  
1206 C C   . VAL A 152 ? 0.4887 0.6351 0.5029 0.0072  -0.0152 0.0585  153 VAL A C   
1207 O O   . VAL A 152 ? 0.4780 0.6367 0.4874 0.0022  -0.0128 0.0648  153 VAL A O   
1208 C CB  . VAL A 152 ? 0.4631 0.5699 0.4738 0.0149  -0.0222 0.0507  153 VAL A CB  
1209 C CG1 . VAL A 152 ? 0.4187 0.5121 0.4229 0.0224  -0.0242 0.0430  153 VAL A CG1 
1210 C CG2 . VAL A 152 ? 0.4390 0.5391 0.4480 0.0086  -0.0247 0.0585  153 VAL A CG2 
1211 N N   . GLY A 153 ? 0.4973 0.6434 0.5216 0.0027  -0.0162 0.0587  154 GLY A N   
1212 C CA  . GLY A 153 ? 0.4377 0.5974 0.4685 -0.0096 -0.0150 0.0663  154 GLY A CA  
1213 C C   . GLY A 153 ? 0.5024 0.6961 0.5338 -0.0093 -0.0091 0.0664  154 GLY A C   
1214 O O   . GLY A 153 ? 0.4860 0.6932 0.5164 0.0030  -0.0067 0.0580  154 GLY A O   
1215 N N   . ALA A 154 ? 0.3990 0.6071 0.4311 -0.0229 -0.0069 0.0761  155 ALA A N   
1216 C CA  . ALA A 154 ? 0.4566 0.7032 0.4901 -0.0243 -0.0003 0.0768  155 ALA A CA  
1217 C C   . ALA A 154 ? 0.4812 0.7374 0.5032 -0.0121 0.0035  0.0720  155 ALA A C   
1218 O O   . ALA A 154 ? 0.4954 0.7814 0.5185 -0.0034 0.0086  0.0656  155 ALA A O   
1219 C CB  . ALA A 154 ? 0.4761 0.7343 0.5099 -0.0445 0.0012  0.0898  155 ALA A CB  
1220 N N   . PHE A 155 ? 0.4732 0.7051 0.4840 -0.0104 0.0006  0.0742  156 PHE A N   
1221 C CA  . PHE A 155 ? 0.5173 0.7563 0.5152 -0.0002 0.0033  0.0697  156 PHE A CA  
1222 C C   . PHE A 155 ? 0.4702 0.7084 0.4666 0.0180  0.0031  0.0558  156 PHE A C   
1223 O O   . PHE A 155 ? 0.4345 0.6876 0.4218 0.0285  0.0063  0.0493  156 PHE A O   
1224 C CB  . PHE A 155 ? 0.5034 0.7155 0.4905 -0.0027 -0.0014 0.0748  156 PHE A CB  
1225 C CG  . PHE A 155 ? 0.4897 0.6942 0.4762 -0.0190 -0.0036 0.0888  156 PHE A CG  
1226 C CD1 . PHE A 155 ? 0.5276 0.7051 0.5205 -0.0246 -0.0100 0.0925  156 PHE A CD1 
1227 C CD2 . PHE A 155 ? 0.4637 0.6871 0.4415 -0.0287 0.0003  0.0981  156 PHE A CD2 
1228 C CE1 . PHE A 155 ? 0.5814 0.7471 0.5715 -0.0385 -0.0137 0.1050  156 PHE A CE1 
1229 C CE2 . PHE A 155 ? 0.5433 0.7551 0.5175 -0.0446 -0.0030 0.1120  156 PHE A CE2 
1230 C CZ  . PHE A 155 ? 0.5626 0.7435 0.5427 -0.0490 -0.0107 0.1153  156 PHE A CZ  
1231 N N   . GLY A 156 ? 0.4705 0.6904 0.4739 0.0220  -0.0012 0.0509  157 GLY A N   
1232 C CA  . GLY A 156 ? 0.4416 0.6543 0.4405 0.0381  -0.0030 0.0391  157 GLY A CA  
1233 C C   . GLY A 156 ? 0.4872 0.7180 0.4958 0.0446  -0.0021 0.0334  157 GLY A C   
1234 O O   . GLY A 156 ? 0.5222 0.7533 0.5250 0.0600  -0.0032 0.0235  157 GLY A O   
1235 N N   . PHE A 157 ? 0.4132 0.6579 0.4354 0.0333  -0.0010 0.0394  158 PHE A N   
1236 C CA  . PHE A 157 ? 0.4040 0.6629 0.4364 0.0386  -0.0019 0.0342  158 PHE A CA  
1237 C C   . PHE A 157 ? 0.4430 0.7377 0.4892 0.0275  0.0019  0.0395  158 PHE A C   
1238 O O   . PHE A 157 ? 0.4318 0.7407 0.4883 0.0305  0.0004  0.0356  158 PHE A O   
1239 C CB  . PHE A 157 ? 0.3871 0.6154 0.4221 0.0373  -0.0080 0.0332  158 PHE A CB  
1240 C CG  . PHE A 157 ? 0.3690 0.5659 0.3911 0.0471  -0.0118 0.0276  158 PHE A CG  
1241 C CD1 . PHE A 157 ? 0.4505 0.6219 0.4676 0.0402  -0.0136 0.0317  158 PHE A CD1 
1242 C CD2 . PHE A 157 ? 0.3816 0.5751 0.3959 0.0631  -0.0141 0.0183  158 PHE A CD2 
1243 C CE1 . PHE A 157 ? 0.4800 0.6260 0.4859 0.0469  -0.0170 0.0269  158 PHE A CE1 
1244 C CE2 . PHE A 157 ? 0.4765 0.6393 0.4770 0.0695  -0.0181 0.0140  158 PHE A CE2 
1245 C CZ  . PHE A 157 ? 0.4826 0.6233 0.4796 0.0603  -0.0192 0.0184  158 PHE A CZ  
1246 N N   . LEU A 158 ? 0.4181 0.7279 0.4642 0.0137  0.0063  0.0486  159 LEU A N   
1247 C CA  . LEU A 158 ? 0.4508 0.8014 0.5085 0.0030  0.0110  0.0530  159 LEU A CA  
1248 C C   . LEU A 158 ? 0.5053 0.8939 0.5658 0.0198  0.0153  0.0427  159 LEU A C   
1249 O O   . LEU A 158 ? 0.5591 0.9504 0.6081 0.0333  0.0179  0.0368  159 LEU A O   
1250 C CB  . LEU A 158 ? 0.4304 0.7895 0.4832 -0.0149 0.0150  0.0654  159 LEU A CB  
1251 C CG  . LEU A 158 ? 0.4684 0.8653 0.5326 -0.0331 0.0191  0.0731  159 LEU A CG  
1252 C CD1 . LEU A 158 ? 0.5303 0.9063 0.5895 -0.0562 0.0168  0.0880  159 LEU A CD1 
1253 C CD2 . LEU A 158 ? 0.3765 0.8229 0.4405 -0.0285 0.0281  0.0704  159 LEU A CD2 
1254 N N   . ALA A 159 ? 0.5001 0.9178 0.5754 0.0199  0.0152  0.0397  160 ALA A N   
1255 C CA  . ALA A 159 ? 0.4948 0.9485 0.5745 0.0392  0.0176  0.0282  160 ALA A CA  
1256 C C   . ALA A 159 ? 0.4763 0.9838 0.5737 0.0284  0.0223  0.0310  160 ALA A C   
1257 O O   . ALA A 159 ? 0.4835 0.9931 0.5932 0.0143  0.0190  0.0359  160 ALA A O   
1258 C CB  . ALA A 159 ? 0.5515 0.9827 0.6304 0.0579  0.0099  0.0179  160 ALA A CB  
1259 N N   . LEU A 160 ? 0.4295 0.9819 0.5278 0.0345  0.0301  0.0275  161 LEU A N   
1260 C CA  . LEU A 160 ? 0.4638 1.0773 0.5806 0.0313  0.0348  0.0256  161 LEU A CA  
1261 C C   . LEU A 160 ? 0.4842 1.1201 0.6020 0.0628  0.0341  0.0089  161 LEU A C   
1262 O O   . LEU A 160 ? 0.4566 1.1172 0.5673 0.0764  0.0402  0.0021  161 LEU A O   
1263 C CB  . LEU A 160 ? 0.4500 1.1036 0.5674 0.0126  0.0450  0.0349  161 LEU A CB  
1264 C CG  . LEU A 160 ? 0.4971 1.1242 0.6120 -0.0189 0.0436  0.0522  161 LEU A CG  
1265 C CD1 . LEU A 160 ? 0.5068 1.1446 0.6093 -0.0332 0.0513  0.0624  161 LEU A CD1 
1266 C CD2 . LEU A 160 ? 0.3787 1.0313 0.5126 -0.0394 0.0419  0.0583  161 LEU A CD2 
1267 N N   . PRO A 161 ? 0.4582 1.0840 0.5828 0.0762  0.0258  0.0014  162 PRO A N   
1268 C CA  . PRO A 161 ? 0.4678 1.0951 0.5869 0.1090  0.0218  -0.0144 162 PRO A CA  
1269 C C   . PRO A 161 ? 0.4878 1.1804 0.6160 0.1232  0.0289  -0.0236 162 PRO A C   
1270 O O   . PRO A 161 ? 0.4691 1.2165 0.6160 0.1089  0.0350  -0.0194 162 PRO A O   
1271 C CB  . PRO A 161 ? 0.5368 1.1495 0.6644 0.1142  0.0117  -0.0172 162 PRO A CB  
1272 C CG  . PRO A 161 ? 0.5225 1.1016 0.6515 0.0870  0.0095  -0.0039 162 PRO A CG  
1273 C CD  . PRO A 161 ? 0.4832 1.0886 0.6174 0.0621  0.0186  0.0073  162 PRO A CD  
1274 N N   . GLY A 162 ? 0.4753 1.1621 0.5895 0.1516  0.0279  -0.0369 163 GLY A N   
1275 C CA  . GLY A 162 ? 0.4591 1.2043 0.5779 0.1687  0.0353  -0.0478 163 GLY A CA  
1276 C C   . GLY A 162 ? 0.5397 1.3055 0.6503 0.1567  0.0470  -0.0428 163 GLY A C   
1277 O O   . GLY A 162 ? 0.5606 1.3632 0.6671 0.1756  0.0529  -0.0541 163 GLY A O   
1278 N N   . SER A 163 ? 0.5324 1.2755 0.6391 0.1269  0.0501  -0.0265 164 SER A N   
1279 C CA  . SER A 163 ? 0.5813 1.3405 0.6775 0.1145  0.0602  -0.0203 164 SER A CA  
1280 C C   . SER A 163 ? 0.5533 1.2680 0.6232 0.1317  0.0578  -0.0274 164 SER A C   
1281 O O   . SER A 163 ? 0.6506 1.3118 0.7096 0.1453  0.0480  -0.0328 164 SER A O   
1282 C CB  . SER A 163 ? 0.5998 1.3456 0.6981 0.0778  0.0627  -0.0001 164 SER A CB  
1283 O OG  . SER A 163 ? 0.6128 1.2893 0.6956 0.0730  0.0554  0.0059  164 SER A OG  
1284 N N   . ARG A 164 ? 0.6159 1.3543 0.6749 0.1289  0.0670  -0.0267 165 ARG A N   
1285 C CA  . ARG A 164 ? 0.6136 1.3201 0.6471 0.1439  0.0660  -0.0341 165 ARG A CA  
1286 C C   . ARG A 164 ? 0.5286 1.1856 0.5474 0.1227  0.0640  -0.0199 165 ARG A C   
1287 O O   . ARG A 164 ? 0.5972 1.2118 0.5956 0.1339  0.0591  -0.0254 165 ARG A O   
1288 C CB  . ARG A 164 ? 0.8592 1.6228 0.8877 0.1535  0.0773  -0.0422 165 ARG A CB  
1289 C CG  . ARG A 164 ? 1.0815 1.8234 1.0854 0.1796  0.0752  -0.0574 165 ARG A CG  
1290 C CD  . ARG A 164 ? 1.2373 1.9346 1.2351 0.2067  0.0625  -0.0715 165 ARG A CD  
1291 N NE  . ARG A 164 ? 1.3833 2.0564 1.3550 0.2301  0.0596  -0.0862 165 ARG A NE  
1292 C CZ  . ARG A 164 ? 1.4364 2.0985 1.3997 0.2626  0.0523  -0.1050 165 ARG A CZ  
1293 N NH1 . ARG A 164 ? 1.4140 2.0875 1.3930 0.2771  0.0468  -0.1114 165 ARG A NH1 
1294 N NH2 . ARG A 164 ? 1.4682 2.1053 1.4052 0.2815  0.0493  -0.1180 165 ARG A NH2 
1295 N N   . GLU A 165 ? 0.6490 1.3104 0.6771 0.0926  0.0668  -0.0021 166 GLU A N   
1296 C CA  . GLU A 165 ? 0.7463 1.3679 0.7615 0.0718  0.0652  0.0124  166 GLU A CA  
1297 C C   . GLU A 165 ? 0.7175 1.2834 0.7358 0.0643  0.0548  0.0186  166 GLU A C   
1298 O O   . GLU A 165 ? 0.8667 1.3884 0.8715 0.0581  0.0503  0.0245  166 GLU A O   
1299 C CB  . GLU A 165 ? 0.8618 1.5173 0.8823 0.0427  0.0733  0.0290  166 GLU A CB  
1300 C CG  . GLU A 165 ? 1.0457 1.7659 1.0653 0.0440  0.0855  0.0258  166 GLU A CG  
1301 C CD  . GLU A 165 ? 1.2454 2.0224 1.2866 0.0552  0.0897  0.0154  166 GLU A CD  
1302 O OE1 . GLU A 165 ? 1.2905 2.1242 1.3418 0.0400  0.0992  0.0214  166 GLU A OE1 
1303 O OE2 . GLU A 165 ? 1.3190 2.0865 1.3668 0.0789  0.0835  0.0013  166 GLU A OE2 
1304 N N   . ALA A 166 ? 0.5432 1.1137 0.5794 0.0641  0.0510  0.0173  167 ALA A N   
1305 C CA  . ALA A 166 ? 0.5361 1.0583 0.5759 0.0585  0.0416  0.0215  167 ALA A CA  
1306 C C   . ALA A 166 ? 0.4855 1.0048 0.5328 0.0795  0.0357  0.0085  167 ALA A C   
1307 O O   . ALA A 166 ? 0.5118 1.0402 0.5753 0.0736  0.0330  0.0105  167 ALA A O   
1308 C CB  . ALA A 166 ? 0.6342 1.1602 0.6868 0.0304  0.0420  0.0368  167 ALA A CB  
1309 N N   . PRO A 167 ? 0.5224 1.0276 0.5564 0.1045  0.0327  -0.0051 168 PRO A N   
1310 C CA  . PRO A 167 ? 0.5832 1.0801 0.6207 0.1256  0.0255  -0.0168 168 PRO A CA  
1311 C C   . PRO A 167 ? 0.5984 1.0464 0.6360 0.1195  0.0165  -0.0125 168 PRO A C   
1312 O O   . PRO A 167 ? 0.6843 1.1257 0.7260 0.1325  0.0100  -0.0193 168 PRO A O   
1313 C CB  . PRO A 167 ? 0.5721 1.0560 0.5897 0.1511  0.0236  -0.0309 168 PRO A CB  
1314 C CG  . PRO A 167 ? 0.5712 1.0300 0.5727 0.1398  0.0258  -0.0245 168 PRO A CG  
1315 C CD  . PRO A 167 ? 0.4609 0.9486 0.4734 0.1137  0.0339  -0.0097 168 PRO A CD  
1316 N N   . GLY A 168 ? 0.5300 0.9454 0.5631 0.1009  0.0157  -0.0015 169 GLY A N   
1317 C CA  . GLY A 168 ? 0.4948 0.8670 0.5278 0.0947  0.0082  0.0022  169 GLY A CA  
1318 C C   . GLY A 168 ? 0.5923 0.9200 0.6069 0.1089  0.0016  -0.0051 169 GLY A C   
1319 O O   . GLY A 168 ? 0.5539 0.8812 0.5553 0.1261  0.0013  -0.0147 169 GLY A O   
1320 N N   . ASN A 169 ? 0.5397 0.8292 0.5528 0.1005  -0.0039 -0.0005 170 ASN A N   
1321 C CA  . ASN A 169 ? 0.4728 0.7187 0.4696 0.1093  -0.0106 -0.0056 170 ASN A CA  
1322 C C   . ASN A 169 ? 0.4866 0.7177 0.4668 0.1116  -0.0097 -0.0074 170 ASN A C   
1323 O O   . ASN A 169 ? 0.5585 0.7587 0.5226 0.1216  -0.0154 -0.0140 170 ASN A O   
1324 C CB  . ASN A 169 ? 0.4883 0.7294 0.4793 0.1298  -0.0165 -0.0164 170 ASN A CB  
1325 C CG  . ASN A 169 ? 0.5787 0.8295 0.5839 0.1279  -0.0193 -0.0148 170 ASN A CG  
1326 O OD1 . ASN A 169 ? 0.6013 0.8532 0.6184 0.1106  -0.0179 -0.0062 170 ASN A OD1 
1327 N ND2 . ASN A 169 ? 0.5088 0.7657 0.5117 0.1466  -0.0242 -0.0235 170 ASN A ND2 
1328 N N   . VAL A 170 ? 0.4267 0.6778 0.4088 0.1017  -0.0034 -0.0014 171 VAL A N   
1329 C CA  . VAL A 170 ? 0.4554 0.6938 0.4207 0.1044  -0.0032 -0.0036 171 VAL A CA  
1330 C C   . VAL A 170 ? 0.5120 0.7091 0.4702 0.0959  -0.0088 0.0002  171 VAL A C   
1331 O O   . VAL A 170 ? 0.4884 0.6641 0.4304 0.1014  -0.0123 -0.0048 171 VAL A O   
1332 C CB  . VAL A 170 ? 0.4710 0.7410 0.4380 0.0952  0.0046  0.0029  171 VAL A CB  
1333 C CG1 . VAL A 170 ? 0.4539 0.7705 0.4284 0.1035  0.0110  -0.0018 171 VAL A CG1 
1334 C CG2 . VAL A 170 ? 0.4671 0.7348 0.4449 0.0734  0.0059  0.0173  171 VAL A CG2 
1335 N N   . GLY A 171 ? 0.4955 0.6821 0.4656 0.0827  -0.0102 0.0083  172 GLY A N   
1336 C CA  . GLY A 171 ? 0.4479 0.6000 0.4132 0.0762  -0.0153 0.0105  172 GLY A CA  
1337 C C   . GLY A 171 ? 0.5017 0.6264 0.4552 0.0866  -0.0215 0.0020  172 GLY A C   
1338 O O   . GLY A 171 ? 0.5477 0.6466 0.4904 0.0843  -0.0256 0.0009  172 GLY A O   
1339 N N   . LEU A 172 ? 0.4810 0.6107 0.4355 0.0976  -0.0230 -0.0037 173 LEU A N   
1340 C CA  . LEU A 172 ? 0.5309 0.6318 0.4702 0.1086  -0.0300 -0.0115 173 LEU A CA  
1341 C C   . LEU A 172 ? 0.5350 0.6288 0.4554 0.1214  -0.0321 -0.0203 173 LEU A C   
1342 O O   . LEU A 172 ? 0.5792 0.6396 0.4822 0.1242  -0.0386 -0.0247 173 LEU A O   
1343 C CB  . LEU A 172 ? 0.4646 0.5724 0.4090 0.1184  -0.0323 -0.0149 173 LEU A CB  
1344 C CG  . LEU A 172 ? 0.5481 0.6543 0.5061 0.1073  -0.0327 -0.0084 173 LEU A CG  
1345 C CD1 . LEU A 172 ? 0.4201 0.5413 0.3843 0.1180  -0.0349 -0.0120 173 LEU A CD1 
1346 C CD2 . LEU A 172 ? 0.5173 0.5868 0.4660 0.0993  -0.0374 -0.0063 173 LEU A CD2 
1347 N N   . LEU A 173 ? 0.5272 0.6522 0.4497 0.1285  -0.0266 -0.0231 174 LEU A N   
1348 C CA  . LEU A 173 ? 0.5474 0.6674 0.4510 0.1408  -0.0281 -0.0323 174 LEU A CA  
1349 C C   . LEU A 173 ? 0.5470 0.6479 0.4408 0.1294  -0.0294 -0.0289 174 LEU A C   
1350 O O   . LEU A 173 ? 0.6058 0.6838 0.4796 0.1366  -0.0346 -0.0367 174 LEU A O   
1351 C CB  . LEU A 173 ? 0.5225 0.6863 0.4316 0.1499  -0.0206 -0.0359 174 LEU A CB  
1352 C CG  . LEU A 173 ? 0.6400 0.8272 0.5586 0.1642  -0.0202 -0.0415 174 LEU A CG  
1353 C CD1 . LEU A 173 ? 0.5753 0.8132 0.5017 0.1711  -0.0116 -0.0446 174 LEU A CD1 
1354 C CD2 . LEU A 173 ? 0.6708 0.8268 0.5714 0.1840  -0.0298 -0.0533 174 LEU A CD2 
1355 N N   . ASP A 174 ? 0.5630 0.6718 0.4699 0.1121  -0.0257 -0.0178 175 ASP A N   
1356 C CA  . ASP A 174 ? 0.5487 0.6390 0.4483 0.1014  -0.0283 -0.0142 175 ASP A CA  
1357 C C   . ASP A 174 ? 0.5719 0.6243 0.4612 0.0996  -0.0364 -0.0174 175 ASP A C   
1358 O O   . ASP A 174 ? 0.5912 0.6236 0.4643 0.0996  -0.0413 -0.0219 175 ASP A O   
1359 C CB  . ASP A 174 ? 0.4899 0.5924 0.4060 0.0851  -0.0246 -0.0018 175 ASP A CB  
1360 C CG  . ASP A 174 ? 0.5631 0.7001 0.4865 0.0830  -0.0172 0.0034  175 ASP A CG  
1361 O OD1 . ASP A 174 ? 0.5690 0.7232 0.4832 0.0932  -0.0142 -0.0027 175 ASP A OD1 
1362 O OD2 . ASP A 174 ? 0.5805 0.7269 0.5177 0.0708  -0.0146 0.0137  175 ASP A OD2 
1363 N N   . GLN A 175 ? 0.5368 0.5794 0.4343 0.0969  -0.0380 -0.0151 176 GLN A N   
1364 C CA  . GLN A 175 ? 0.5357 0.5438 0.4223 0.0935  -0.0452 -0.0171 176 GLN A CA  
1365 C C   . GLN A 175 ? 0.5462 0.5309 0.4093 0.1073  -0.0519 -0.0277 176 GLN A C   
1366 O O   . GLN A 175 ? 0.5938 0.5498 0.4404 0.1032  -0.0583 -0.0307 176 GLN A O   
1367 C CB  . GLN A 175 ? 0.6028 0.6077 0.5008 0.0893  -0.0452 -0.0128 176 GLN A CB  
1368 C CG  . GLN A 175 ? 0.5040 0.5288 0.4238 0.0771  -0.0395 -0.0037 176 GLN A CG  
1369 C CD  . GLN A 175 ? 0.5453 0.5679 0.4745 0.0747  -0.0397 -0.0011 176 GLN A CD  
1370 O OE1 . GLN A 175 ? 0.5572 0.5638 0.4764 0.0817  -0.0441 -0.0053 176 GLN A OE1 
1371 N NE2 . GLN A 175 ? 0.4762 0.5127 0.4226 0.0651  -0.0358 0.0055  176 GLN A NE2 
1372 N N   . ARG A 176 ? 0.5841 0.5810 0.4452 0.1241  -0.0511 -0.0341 177 ARG A N   
1373 C CA  . ARG A 176 ? 0.6127 0.5858 0.4503 0.1407  -0.0585 -0.0455 177 ARG A CA  
1374 C C   . ARG A 176 ? 0.7020 0.6685 0.5231 0.1428  -0.0601 -0.0517 177 ARG A C   
1375 O O   . ARG A 176 ? 0.7001 0.6306 0.4981 0.1459  -0.0689 -0.0584 177 ARG A O   
1376 C CB  . ARG A 176 ? 0.5796 0.5751 0.4211 0.1605  -0.0567 -0.0520 177 ARG A CB  
1377 C CG  . ARG A 176 ? 0.7506 0.7244 0.5674 0.1819  -0.0645 -0.0657 177 ARG A CG  
1378 C CD  . ARG A 176 ? 0.7791 0.7803 0.6025 0.2031  -0.0629 -0.0726 177 ARG A CD  
1379 N NE  . ARG A 176 ? 0.8231 0.8167 0.6537 0.2042  -0.0667 -0.0688 177 ARG A NE  
1380 C CZ  . ARG A 176 ? 0.8279 0.8505 0.6709 0.2183  -0.0651 -0.0719 177 ARG A CZ  
1381 N NH1 . ARG A 176 ? 0.8206 0.8843 0.6713 0.2319  -0.0589 -0.0787 177 ARG A NH1 
1382 N NH2 . ARG A 176 ? 0.7497 0.7627 0.5974 0.2184  -0.0698 -0.0681 177 ARG A NH2 
1383 N N   . LEU A 177 ? 0.6754 0.6748 0.5062 0.1404  -0.0523 -0.0492 178 LEU A N   
1384 C CA  . LEU A 177 ? 0.6543 0.6493 0.4688 0.1414  -0.0538 -0.0546 178 LEU A CA  
1385 C C   . LEU A 177 ? 0.6871 0.6513 0.4932 0.1254  -0.0604 -0.0513 178 LEU A C   
1386 O O   . LEU A 177 ? 0.6996 0.6385 0.4834 0.1282  -0.0676 -0.0593 178 LEU A O   
1387 C CB  . LEU A 177 ? 0.5537 0.5897 0.3802 0.1383  -0.0442 -0.0497 178 LEU A CB  
1388 C CG  . LEU A 177 ? 0.6530 0.6903 0.4624 0.1400  -0.0449 -0.0550 178 LEU A CG  
1389 C CD1 . LEU A 177 ? 0.6390 0.6592 0.4235 0.1601  -0.0506 -0.0712 178 LEU A CD1 
1390 C CD2 . LEU A 177 ? 0.5644 0.6442 0.3846 0.1364  -0.0349 -0.0486 178 LEU A CD2 
1391 N N   . ALA A 178 ? 0.6618 0.6284 0.4852 0.1087  -0.0585 -0.0403 179 ALA A N   
1392 C CA  . ALA A 178 ? 0.6727 0.6156 0.4909 0.0931  -0.0643 -0.0373 179 ALA A CA  
1393 C C   . ALA A 178 ? 0.7223 0.6245 0.5205 0.0943  -0.0738 -0.0432 179 ALA A C   
1394 O O   . ALA A 178 ? 0.7057 0.5834 0.4875 0.0869  -0.0810 -0.0465 179 ALA A O   
1395 C CB  . ALA A 178 ? 0.5779 0.5343 0.4195 0.0779  -0.0601 -0.0258 179 ALA A CB  
1396 N N   . LEU A 179 ? 0.6787 0.5722 0.4767 0.1027  -0.0748 -0.0443 180 LEU A N   
1397 C CA  . LEU A 179 ? 0.7155 0.5665 0.4913 0.1042  -0.0848 -0.0489 180 LEU A CA  
1398 C C   . LEU A 179 ? 0.7831 0.6100 0.5311 0.1180  -0.0926 -0.0613 180 LEU A C   
1399 O O   . LEU A 179 ? 0.8086 0.5962 0.5340 0.1119  -0.1025 -0.0647 180 LEU A O   
1400 C CB  . LEU A 179 ? 0.6822 0.5305 0.4624 0.1129  -0.0849 -0.0475 180 LEU A CB  
1401 C CG  . LEU A 179 ? 0.6886 0.5534 0.4920 0.0992  -0.0790 -0.0364 180 LEU A CG  
1402 C CD1 . LEU A 179 ? 0.7724 0.6273 0.5741 0.1075  -0.0816 -0.0360 180 LEU A CD1 
1403 C CD2 . LEU A 179 ? 0.7144 0.5643 0.5170 0.0775  -0.0812 -0.0304 180 LEU A CD2 
1404 N N   . GLN A 180 ? 0.7662 0.6162 0.5144 0.1364  -0.0884 -0.0686 181 GLN A N   
1405 C CA  . GLN A 180 ? 0.8110 0.6416 0.5326 0.1514  -0.0951 -0.0821 181 GLN A CA  
1406 C C   . GLN A 180 ? 0.7701 0.5919 0.4815 0.1380  -0.0981 -0.0829 181 GLN A C   
1407 O O   . GLN A 180 ? 0.8690 0.6547 0.5529 0.1409  -0.1083 -0.0922 181 GLN A O   
1408 C CB  . GLN A 180 ? 0.7984 0.6649 0.5254 0.1731  -0.0880 -0.0896 181 GLN A CB  
1409 C CG  . GLN A 180 ? 0.8673 0.7429 0.6025 0.1891  -0.0870 -0.0911 181 GLN A CG  
1410 C CD  . GLN A 180 ? 0.9054 0.8300 0.6544 0.2054  -0.0773 -0.0956 181 GLN A CD  
1411 O OE1 . GLN A 180 ? 0.9204 0.8773 0.6782 0.2001  -0.0689 -0.0933 181 GLN A OE1 
1412 N NE2 . GLN A 180 ? 0.9350 0.8667 0.6854 0.2251  -0.0786 -0.1017 181 GLN A NE2 
1413 N N   . TRP A 181 ? 0.7120 0.5648 0.4442 0.1233  -0.0903 -0.0734 182 TRP A N   
1414 C CA  . TRP A 181 ? 0.8366 0.6841 0.5615 0.1096  -0.0938 -0.0731 182 TRP A CA  
1415 C C   . TRP A 181 ? 0.8632 0.6723 0.5765 0.0928  -0.1037 -0.0714 182 TRP A C   
1416 O O   . TRP A 181 ? 0.8923 0.6787 0.5857 0.0867  -0.1120 -0.0772 182 TRP A O   
1417 C CB  . TRP A 181 ? 0.7726 0.6596 0.5233 0.0980  -0.0846 -0.0620 182 TRP A CB  
1418 C CG  . TRP A 181 ? 0.7067 0.5953 0.4516 0.0866  -0.0880 -0.0615 182 TRP A CG  
1419 C CD1 . TRP A 181 ? 0.7270 0.6334 0.4645 0.0925  -0.0859 -0.0654 182 TRP A CD1 
1420 C CD2 . TRP A 181 ? 0.7012 0.5759 0.4474 0.0671  -0.0941 -0.0570 182 TRP A CD2 
1421 N NE1 . TRP A 181 ? 0.7478 0.6502 0.4814 0.0785  -0.0913 -0.0635 182 TRP A NE1 
1422 C CE2 . TRP A 181 ? 0.7476 0.6321 0.4875 0.0629  -0.0964 -0.0586 182 TRP A CE2 
1423 C CE3 . TRP A 181 ? 0.7322 0.5898 0.4842 0.0525  -0.0977 -0.0518 182 TRP A CE3 
1424 C CZ2 . TRP A 181 ? 0.7796 0.6586 0.5205 0.0453  -0.1027 -0.0556 182 TRP A CZ2 
1425 C CZ3 . TRP A 181 ? 0.7672 0.6211 0.5204 0.0343  -0.1030 -0.0488 182 TRP A CZ3 
1426 C CH2 . TRP A 181 ? 0.8101 0.6752 0.5587 0.0311  -0.1057 -0.0509 182 TRP A CH2 
1427 N N   . VAL A 182 ? 0.8070 0.6094 0.5315 0.0839  -0.1030 -0.0634 183 VAL A N   
1428 C CA  . VAL A 182 ? 0.7832 0.5520 0.4968 0.0660  -0.1115 -0.0606 183 VAL A CA  
1429 C C   . VAL A 182 ? 0.8568 0.5767 0.5357 0.0738  -0.1239 -0.0709 183 VAL A C   
1430 O O   . VAL A 182 ? 0.8517 0.5419 0.5115 0.0605  -0.1333 -0.0734 183 VAL A O   
1431 C CB  . VAL A 182 ? 0.8273 0.6024 0.5594 0.0567  -0.1070 -0.0502 183 VAL A CB  
1432 C CG1 . VAL A 182 ? 0.7717 0.5090 0.4875 0.0399  -0.1159 -0.0478 183 VAL A CG1 
1433 C CG2 . VAL A 182 ? 0.7495 0.5658 0.5126 0.0458  -0.0973 -0.0407 183 VAL A CG2 
1434 N N   . GLN A 183 ? 0.8035 0.5139 0.4730 0.0958  -0.1249 -0.0774 184 GLN A N   
1435 C CA  . GLN A 183 ? 0.9306 0.5909 0.5651 0.1067  -0.1380 -0.0881 184 GLN A CA  
1436 C C   . GLN A 183 ? 0.9840 0.6306 0.5964 0.1108  -0.1444 -0.0997 184 GLN A C   
1437 O O   . GLN A 183 ? 1.0732 0.6719 0.6556 0.1061  -0.1575 -0.1058 184 GLN A O   
1438 C CB  . GLN A 183 ? 0.9655 0.6261 0.5971 0.1336  -0.1375 -0.0942 184 GLN A CB  
1439 C CG  . GLN A 183 ? 1.0085 0.6588 0.6467 0.1301  -0.1381 -0.0853 184 GLN A CG  
1440 C CD  . GLN A 183 ? 1.0623 0.6561 0.6731 0.1159  -0.1514 -0.0831 184 GLN A CD  
1441 O OE1 . GLN A 183 ? 1.1660 0.7144 0.7441 0.1262  -0.1641 -0.0928 184 GLN A OE1 
1442 N NE2 . GLN A 183 ? 0.9903 0.5862 0.6129 0.0916  -0.1488 -0.0703 184 GLN A NE2 
1443 N N   . GLU A 184 ? 0.9331 0.6197 0.5584 0.1182  -0.1358 -0.1025 185 GLU A N   
1444 C CA  . GLU A 184 ? 1.0090 0.6858 0.6122 0.1245  -0.1413 -0.1146 185 GLU A CA  
1445 C C   . GLU A 184 ? 0.9671 0.6422 0.5697 0.1000  -0.1448 -0.1104 185 GLU A C   
1446 O O   . GLU A 184 ? 0.9976 0.6483 0.5747 0.1003  -0.1541 -0.1206 185 GLU A O   
1447 C CB  . GLU A 184 ? 1.0359 0.7575 0.6498 0.1441  -0.1306 -0.1199 185 GLU A CB  
1448 C CG  . GLU A 184 ? 1.2042 0.9346 0.8197 0.1700  -0.1271 -0.1259 185 GLU A CG  
1449 C CD  . GLU A 184 ? 1.2562 1.0363 0.8833 0.1865  -0.1155 -0.1304 185 GLU A CD  
1450 O OE1 . GLU A 184 ? 1.2085 1.0043 0.8393 0.2080  -0.1117 -0.1361 185 GLU A OE1 
1451 O OE2 . GLU A 184 ? 1.3167 1.1214 0.9488 0.1775  -0.1104 -0.1280 185 GLU A OE2 
1452 N N   . ASN A 185 ? 0.8787 0.5791 0.5082 0.0796  -0.1385 -0.0965 186 ASN A N   
1453 C CA  . ASN A 185 ? 0.8198 0.5312 0.4541 0.0596  -0.1404 -0.0928 186 ASN A CA  
1454 C C   . ASN A 185 ? 0.8503 0.5522 0.4933 0.0331  -0.1440 -0.0829 186 ASN A C   
1455 O O   . ASN A 185 ? 0.8777 0.5838 0.5208 0.0161  -0.1483 -0.0817 186 ASN A O   
1456 C CB  . ASN A 185 ? 0.8176 0.5815 0.4782 0.0619  -0.1285 -0.0866 186 ASN A CB  
1457 C CG  . ASN A 185 ? 0.8946 0.6747 0.5466 0.0850  -0.1240 -0.0958 186 ASN A CG  
1458 O OD1 . ASN A 185 ? 0.9320 0.6981 0.5600 0.0911  -0.1304 -0.1069 186 ASN A OD1 
1459 N ND2 . ASN A 185 ? 0.9027 0.7141 0.5740 0.0970  -0.1128 -0.0914 186 ASN A ND2 
1460 N N   . VAL A 186 ? 0.7992 0.4910 0.4494 0.0285  -0.1424 -0.0759 187 VAL A N   
1461 C CA  . VAL A 186 ? 0.7737 0.4676 0.4365 0.0029  -0.1430 -0.0656 187 VAL A CA  
1462 C C   . VAL A 186 ? 0.8859 0.5399 0.5222 -0.0155 -0.1566 -0.0694 187 VAL A C   
1463 O O   . VAL A 186 ? 0.9667 0.6306 0.6130 -0.0393 -0.1580 -0.0630 187 VAL A O   
1464 C CB  . VAL A 186 ? 0.8141 0.5073 0.4888 0.0024  -0.1378 -0.0574 187 VAL A CB  
1465 C CG1 . VAL A 186 ? 0.8609 0.5011 0.5050 0.0025  -0.1485 -0.0608 187 VAL A CG1 
1466 C CG2 . VAL A 186 ? 0.7174 0.4377 0.4179 -0.0192 -0.1321 -0.0461 187 VAL A CG2 
1467 N N   . ALA A 187 ? 0.9165 0.5259 0.5186 -0.0053 -0.1674 -0.0804 188 ALA A N   
1468 C CA  . ALA A 187 ? 0.9356 0.5020 0.5091 -0.0239 -0.1818 -0.0844 188 ALA A CA  
1469 C C   . ALA A 187 ? 1.0003 0.5867 0.5776 -0.0369 -0.1845 -0.0870 188 ALA A C   
1470 O O   . ALA A 187 ? 1.1286 0.6982 0.6960 -0.0616 -0.1936 -0.0856 188 ALA A O   
1471 C CB  . ALA A 187 ? 0.9970 0.5087 0.5311 -0.0066 -0.1938 -0.0971 188 ALA A CB  
1472 N N   . ALA A 188 ? 0.9024 0.5256 0.4934 -0.0218 -0.1772 -0.0903 189 ALA A N   
1473 C CA  . ALA A 188 ? 0.9571 0.6024 0.5527 -0.0331 -0.1799 -0.0919 189 ALA A CA  
1474 C C   . ALA A 188 ? 0.9188 0.5991 0.5446 -0.0565 -0.1756 -0.0796 189 ALA A C   
1475 O O   . ALA A 188 ? 0.9594 0.6518 0.5869 -0.0717 -0.1812 -0.0803 189 ALA A O   
1476 C CB  . ALA A 188 ? 0.8842 0.5620 0.4869 -0.0117 -0.1723 -0.0964 189 ALA A CB  
1477 N N   . PHE A 189 ? 0.9075 0.6056 0.5568 -0.0586 -0.1662 -0.0694 190 PHE A N   
1478 C CA  . PHE A 189 ? 0.8906 0.6213 0.5680 -0.0790 -0.1619 -0.0588 190 PHE A CA  
1479 C C   . PHE A 189 ? 0.9927 0.6968 0.6605 -0.1020 -0.1678 -0.0547 190 PHE A C   
1480 O O   . PHE A 189 ? 1.0259 0.7575 0.7162 -0.1195 -0.1635 -0.0463 190 PHE A O   
1481 C CB  . PHE A 189 ? 0.9073 0.6766 0.6168 -0.0676 -0.1477 -0.0505 190 PHE A CB  
1482 C CG  . PHE A 189 ? 0.8577 0.6537 0.5767 -0.0475 -0.1414 -0.0524 190 PHE A CG  
1483 C CD1 . PHE A 189 ? 0.8288 0.6133 0.5362 -0.0251 -0.1381 -0.0576 190 PHE A CD1 
1484 C CD2 . PHE A 189 ? 0.7933 0.6273 0.5326 -0.0510 -0.1389 -0.0486 190 PHE A CD2 
1485 C CE1 . PHE A 189 ? 0.7432 0.5547 0.4585 -0.0090 -0.1316 -0.0585 190 PHE A CE1 
1486 C CE2 . PHE A 189 ? 0.7590 0.6154 0.5043 -0.0344 -0.1335 -0.0488 190 PHE A CE2 
1487 C CZ  . PHE A 189 ? 0.7233 0.5691 0.4565 -0.0145 -0.1293 -0.0535 190 PHE A CZ  
1488 N N   . GLY A 190 ? 0.9941 0.6454 0.6277 -0.1023 -0.1777 -0.0604 191 GLY A N   
1489 C CA  . GLY A 190 ? 1.0584 0.6787 0.6784 -0.1238 -0.1835 -0.0552 191 GLY A CA  
1490 C C   . GLY A 190 ? 1.0532 0.6638 0.6761 -0.1154 -0.1770 -0.0488 191 GLY A C   
1491 O O   . GLY A 190 ? 1.0346 0.6240 0.6482 -0.1345 -0.1803 -0.0423 191 GLY A O   
1492 N N   . GLY A 191 ? 1.0419 0.6685 0.6769 -0.0889 -0.1680 -0.0501 192 GLY A N   
1493 C CA  . GLY A 191 ? 0.9609 0.5813 0.5998 -0.0796 -0.1622 -0.0447 192 GLY A CA  
1494 C C   . GLY A 191 ? 1.0388 0.6034 0.6421 -0.0661 -0.1721 -0.0510 192 GLY A C   
1495 O O   . GLY A 191 ? 1.1158 0.6545 0.6960 -0.0531 -0.1802 -0.0619 192 GLY A O   
1496 N N   . ASP A 192 ? 1.0590 0.6052 0.6572 -0.0684 -0.1718 -0.0443 193 ASP A N   
1497 C CA  . ASP A 192 ? 1.0941 0.5853 0.6582 -0.0555 -0.1823 -0.0488 193 ASP A CA  
1498 C C   . ASP A 192 ? 1.0156 0.5223 0.5910 -0.0246 -0.1749 -0.0516 193 ASP A C   
1499 O O   . ASP A 192 ? 1.0611 0.5923 0.6576 -0.0245 -0.1657 -0.0431 193 ASP A O   
1500 C CB  . ASP A 192 ? 1.1965 0.6548 0.7442 -0.0780 -0.1881 -0.0388 193 ASP A CB  
1501 C CG  . ASP A 192 ? 1.2846 0.6751 0.7897 -0.0684 -0.2031 -0.0433 193 ASP A CG  
1502 O OD1 . ASP A 192 ? 1.3377 0.7119 0.8301 -0.0396 -0.2074 -0.0546 193 ASP A OD1 
1503 O OD2 . ASP A 192 ? 1.3273 0.6808 0.8107 -0.0895 -0.2110 -0.0353 193 ASP A OD2 
1504 N N   . PRO A 193 ? 1.0375 0.5331 0.5998 0.0016  -0.1785 -0.0636 194 PRO A N   
1505 C CA  . PRO A 193 ? 1.0262 0.5405 0.6002 0.0303  -0.1716 -0.0665 194 PRO A CA  
1506 C C   . PRO A 193 ? 1.1360 0.6134 0.6918 0.0390  -0.1783 -0.0643 194 PRO A C   
1507 O O   . PRO A 193 ? 1.1524 0.6495 0.7211 0.0602  -0.1724 -0.0651 194 PRO A O   
1508 C CB  . PRO A 193 ? 1.0628 0.5745 0.6241 0.0537  -0.1747 -0.0813 194 PRO A CB  
1509 C CG  . PRO A 193 ? 1.0877 0.5512 0.6153 0.0412  -0.1893 -0.0875 194 PRO A CG  
1510 C CD  . PRO A 193 ? 1.0744 0.5446 0.6120 0.0062  -0.1885 -0.0759 194 PRO A CD  
1511 N N   . THR A 194 ? 1.1281 0.5532 0.6539 0.0227  -0.1909 -0.0611 195 THR A N   
1512 C CA  . THR A 194 ? 1.1180 0.5049 0.6241 0.0285  -0.1984 -0.0569 195 THR A CA  
1513 C C   . THR A 194 ? 1.1445 0.5495 0.6678 0.0068  -0.1910 -0.0415 195 THR A C   
1514 O O   . THR A 194 ? 1.2025 0.5762 0.7087 0.0074  -0.1972 -0.0359 195 THR A O   
1515 C CB  . THR A 194 ? 1.2033 0.5165 0.6620 0.0231  -0.2179 -0.0611 195 THR A CB  
1516 O OG1 . THR A 194 ? 1.2389 0.5397 0.6906 -0.0131 -0.2211 -0.0533 195 THR A OG1 
1517 C CG2 . THR A 194 ? 1.2837 0.5771 0.7228 0.0468  -0.2259 -0.0783 195 THR A CG2 
1518 N N   . SER A 195 ? 1.0932 0.5480 0.6491 -0.0113 -0.1782 -0.0350 196 SER A N   
1519 C CA  . SER A 195 ? 1.1113 0.5903 0.6863 -0.0306 -0.1696 -0.0220 196 SER A CA  
1520 C C   . SER A 195 ? 0.9903 0.5352 0.6086 -0.0277 -0.1534 -0.0207 196 SER A C   
1521 O O   . SER A 195 ? 0.9456 0.5189 0.5813 -0.0461 -0.1479 -0.0177 196 SER A O   
1522 C CB  . SER A 195 ? 1.1450 0.6029 0.7054 -0.0651 -0.1749 -0.0142 196 SER A CB  
1523 O OG  . SER A 195 ? 1.1789 0.6633 0.7572 -0.0824 -0.1658 -0.0026 196 SER A OG  
1524 N N   . VAL A 196 ? 0.9171 0.4862 0.5522 -0.0045 -0.1465 -0.0228 197 VAL A N   
1525 C CA  . VAL A 196 ? 0.8682 0.4945 0.5413 0.0004  -0.1324 -0.0215 197 VAL A CA  
1526 C C   . VAL A 196 ? 0.8652 0.5102 0.5547 0.0011  -0.1252 -0.0139 197 VAL A C   
1527 O O   . VAL A 196 ? 0.8598 0.4885 0.5391 0.0170  -0.1288 -0.0150 197 VAL A O   
1528 C CB  . VAL A 196 ? 0.8146 0.4580 0.4943 0.0257  -0.1300 -0.0311 197 VAL A CB  
1529 C CG1 . VAL A 196 ? 0.7282 0.4264 0.4446 0.0297  -0.1162 -0.0278 197 VAL A CG1 
1530 C CG2 . VAL A 196 ? 0.7722 0.4013 0.4365 0.0240  -0.1363 -0.0390 197 VAL A CG2 
1531 N N   . THR A 197 ? 0.8407 0.5204 0.5552 -0.0148 -0.1157 -0.0070 198 THR A N   
1532 C CA  . THR A 197 ? 0.8042 0.5038 0.5348 -0.0163 -0.1084 -0.0004 198 THR A CA  
1533 C C   . THR A 197 ? 0.7539 0.5025 0.5190 -0.0083 -0.0969 -0.0008 198 THR A C   
1534 O O   . THR A 197 ? 0.7884 0.5629 0.5709 -0.0186 -0.0917 0.0002  198 THR A O   
1535 C CB  . THR A 197 ? 0.7973 0.4941 0.5252 -0.0424 -0.1075 0.0078  198 THR A CB  
1536 O OG1 . THR A 197 ? 0.8641 0.5115 0.5569 -0.0512 -0.1189 0.0099  198 THR A OG1 
1537 C CG2 . THR A 197 ? 0.6976 0.4200 0.4437 -0.0432 -0.0989 0.0134  198 THR A CG2 
1538 N N   . LEU A 198 ? 0.6968 0.4574 0.4710 0.0097  -0.0937 -0.0022 199 LEU A N   
1539 C CA  . LEU A 198 ? 0.6677 0.4710 0.4725 0.0153  -0.0835 -0.0013 199 LEU A CA  
1540 C C   . LEU A 198 ? 0.7026 0.5239 0.5232 0.0025  -0.0772 0.0052  199 LEU A C   
1541 O O   . LEU A 198 ? 0.7383 0.5429 0.5473 -0.0024 -0.0797 0.0087  199 LEU A O   
1542 C CB  . LEU A 198 ? 0.6938 0.5059 0.5030 0.0370  -0.0827 -0.0051 199 LEU A CB  
1543 C CG  . LEU A 198 ? 0.7641 0.5644 0.5593 0.0545  -0.0879 -0.0133 199 LEU A CG  
1544 C CD1 . LEU A 198 ? 0.7181 0.5426 0.5264 0.0734  -0.0840 -0.0161 199 LEU A CD1 
1545 C CD2 . LEU A 198 ? 0.6901 0.4999 0.4881 0.0503  -0.0863 -0.0162 199 LEU A CD2 
1546 N N   . PHE A 199 ? 0.6528 0.5072 0.4981 -0.0021 -0.0695 0.0067  200 PHE A N   
1547 C CA  . PHE A 199 ? 0.6162 0.4909 0.4782 -0.0103 -0.0630 0.0109  200 PHE A CA  
1548 C C   . PHE A 199 ? 0.5856 0.4932 0.4739 -0.0032 -0.0561 0.0106  200 PHE A C   
1549 O O   . PHE A 199 ? 0.5971 0.5155 0.4923 0.0003  -0.0554 0.0089  200 PHE A O   
1550 C CB  . PHE A 199 ? 0.6376 0.5130 0.4979 -0.0305 -0.0625 0.0139  200 PHE A CB  
1551 C CG  . PHE A 199 ? 0.8501 0.7457 0.7242 -0.0371 -0.0606 0.0127  200 PHE A CG  
1552 C CD1 . PHE A 199 ? 0.8875 0.8095 0.7795 -0.0474 -0.0551 0.0145  200 PHE A CD1 
1553 C CD2 . PHE A 199 ? 0.8823 0.7704 0.7497 -0.0328 -0.0650 0.0093  200 PHE A CD2 
1554 C CE1 . PHE A 199 ? 0.9862 0.9280 0.8911 -0.0525 -0.0545 0.0132  200 PHE A CE1 
1555 C CE2 . PHE A 199 ? 0.9992 0.9059 0.8780 -0.0392 -0.0643 0.0086  200 PHE A CE2 
1556 C CZ  . PHE A 199 ? 0.9559 0.8897 0.8541 -0.0487 -0.0593 0.0107  200 PHE A CZ  
1557 N N   . GLY A 200 ? 0.5607 0.4814 0.4610 -0.0011 -0.0518 0.0124  201 GLY A N   
1558 C CA  . GLY A 200 ? 0.5132 0.4597 0.4354 0.0051  -0.0465 0.0125  201 GLY A CA  
1559 C C   . GLY A 200 ? 0.5966 0.5541 0.5296 0.0024  -0.0426 0.0141  201 GLY A C   
1560 O O   . GLY A 200 ? 0.5793 0.5250 0.5015 -0.0019 -0.0438 0.0150  201 GLY A O   
1561 N N   . GLU A 201 ? 0.5222 0.5003 0.4745 0.0047  -0.0384 0.0144  202 GLU A N   
1562 C CA  . GLU A 201 ? 0.5278 0.5165 0.4908 0.0024  -0.0350 0.0145  202 GLU A CA  
1563 C C   . GLU A 201 ? 0.5995 0.5991 0.5745 0.0102  -0.0338 0.0147  202 GLU A C   
1564 O O   . GLU A 201 ? 0.5079 0.5151 0.4898 0.0142  -0.0335 0.0157  202 GLU A O   
1565 C CB  . GLU A 201 ? 0.5226 0.5248 0.4970 -0.0050 -0.0320 0.0139  202 GLU A CB  
1566 C CG  . GLU A 201 ? 0.5382 0.5501 0.5207 -0.0074 -0.0286 0.0123  202 GLU A CG  
1567 C CD  . GLU A 201 ? 0.6526 0.6762 0.6515 -0.0012 -0.0273 0.0114  202 GLU A CD  
1568 O OE1 . GLU A 201 ? 0.6317 0.6611 0.6364 -0.0013 -0.0253 0.0089  202 GLU A OE1 
1569 O OE2 . GLU A 201 ? 0.5864 0.6121 0.5908 0.0033  -0.0286 0.0132  202 GLU A OE2 
1570 N N   . SER A 202 ? 0.5683 0.5688 0.5445 0.0112  -0.0334 0.0142  203 SER A N   
1571 C CA  . SER A 202 ? 0.4988 0.5098 0.4860 0.0161  -0.0329 0.0143  203 SER A CA  
1572 C C   . SER A 202 ? 0.5071 0.5202 0.4919 0.0237  -0.0346 0.0151  203 SER A C   
1573 O O   . SER A 202 ? 0.4879 0.4909 0.4598 0.0287  -0.0377 0.0139  203 SER A O   
1574 C CB  . SER A 202 ? 0.4708 0.4927 0.4733 0.0133  -0.0305 0.0145  203 SER A CB  
1575 O OG  . SER A 202 ? 0.5883 0.6168 0.5995 0.0147  -0.0307 0.0147  203 SER A OG  
1576 N N   . ALA A 203 ? 0.4479 0.4736 0.4433 0.0252  -0.0331 0.0168  204 ALA A N   
1577 C CA  . ALA A 203 ? 0.5162 0.5488 0.5095 0.0324  -0.0336 0.0170  204 ALA A CA  
1578 C C   . ALA A 203 ? 0.4656 0.4862 0.4444 0.0364  -0.0356 0.0150  204 ALA A C   
1579 O O   . ALA A 203 ? 0.4436 0.4641 0.4147 0.0453  -0.0374 0.0127  204 ALA A O   
1580 C CB  . ALA A 203 ? 0.5315 0.5795 0.5365 0.0303  -0.0311 0.0204  204 ALA A CB  
1581 N N   . GLY A 204 ? 0.4626 0.4736 0.4374 0.0304  -0.0358 0.0153  205 GLY A N   
1582 C CA  . GLY A 204 ? 0.4372 0.4328 0.3960 0.0321  -0.0389 0.0131  205 GLY A CA  
1583 C C   . GLY A 204 ? 0.5681 0.5445 0.5108 0.0345  -0.0431 0.0111  205 GLY A C   
1584 O O   . GLY A 204 ? 0.5684 0.5314 0.4963 0.0418  -0.0471 0.0083  205 GLY A O   
1585 N N   . ALA A 205 ? 0.4549 0.4282 0.3987 0.0291  -0.0427 0.0123  206 ALA A N   
1586 C CA  . ALA A 205 ? 0.5259 0.4799 0.4528 0.0310  -0.0473 0.0117  206 ALA A CA  
1587 C C   . ALA A 205 ? 0.5510 0.5082 0.4763 0.0445  -0.0501 0.0097  206 ALA A C   
1588 O O   . ALA A 205 ? 0.5659 0.5047 0.4739 0.0523  -0.0560 0.0077  206 ALA A O   
1589 C CB  . ALA A 205 ? 0.5549 0.5084 0.4832 0.0219  -0.0456 0.0137  206 ALA A CB  
1590 N N   . ALA A 206 ? 0.4746 0.4555 0.4177 0.0474  -0.0466 0.0099  207 ALA A N   
1591 C CA  . ALA A 206 ? 0.4898 0.4818 0.4349 0.0597  -0.0487 0.0076  207 ALA A CA  
1592 C C   . ALA A 206 ? 0.5590 0.5509 0.4972 0.0700  -0.0501 0.0041  207 ALA A C   
1593 O O   . ALA A 206 ? 0.5797 0.5684 0.5090 0.0832  -0.0546 0.0003  207 ALA A O   
1594 C CB  . ALA A 206 ? 0.4625 0.4816 0.4285 0.0571  -0.0445 0.0091  207 ALA A CB  
1595 N N   . SER A 207 ? 0.4484 0.4438 0.3896 0.0654  -0.0467 0.0049  208 SER A N   
1596 C CA  . SER A 207 ? 0.4742 0.4681 0.4062 0.0748  -0.0480 0.0009  208 SER A CA  
1597 C C   . SER A 207 ? 0.5459 0.5077 0.4540 0.0802  -0.0554 -0.0029 208 SER A C   
1598 O O   . SER A 207 ? 0.5744 0.5309 0.4713 0.0948  -0.0595 -0.0084 208 SER A O   
1599 C CB  . SER A 207 ? 0.4122 0.4138 0.3500 0.0673  -0.0440 0.0030  208 SER A CB  
1600 O OG  . SER A 207 ? 0.4814 0.5093 0.4381 0.0631  -0.0384 0.0069  208 SER A OG  
1601 N N   . VAL A 208 ? 0.5224 0.4620 0.4215 0.0684  -0.0574 -0.0001 209 VAL A N   
1602 C CA  . VAL A 208 ? 0.5741 0.4787 0.4478 0.0699  -0.0653 -0.0021 209 VAL A CA  
1603 C C   . VAL A 208 ? 0.6483 0.5419 0.5112 0.0835  -0.0715 -0.0045 209 VAL A C   
1604 O O   . VAL A 208 ? 0.6976 0.5702 0.5415 0.0959  -0.0787 -0.0096 209 VAL A O   
1605 C CB  . VAL A 208 ? 0.5680 0.4567 0.4362 0.0520  -0.0655 0.0027  209 VAL A CB  
1606 C CG1 . VAL A 208 ? 0.6365 0.4865 0.4764 0.0511  -0.0744 0.0023  209 VAL A CG1 
1607 C CG2 . VAL A 208 ? 0.5817 0.4799 0.4583 0.0410  -0.0614 0.0037  209 VAL A CG2 
1608 N N   . GLY A 209 ? 0.6448 0.5520 0.5189 0.0823  -0.0697 -0.0016 210 GLY A N   
1609 C CA  . GLY A 209 ? 0.6401 0.5391 0.5048 0.0954  -0.0764 -0.0035 210 GLY A CA  
1610 C C   . GLY A 209 ? 0.6231 0.5389 0.4915 0.1154  -0.0780 -0.0101 210 GLY A C   
1611 O O   . GLY A 209 ? 0.7116 0.6109 0.5643 0.1308  -0.0864 -0.0143 210 GLY A O   
1612 N N   . MET A 210 ? 0.6192 0.5683 0.5077 0.1158  -0.0703 -0.0113 211 MET A N   
1613 C CA  . MET A 210 ? 0.6849 0.6562 0.5779 0.1338  -0.0705 -0.0180 211 MET A CA  
1614 C C   . MET A 210 ? 0.6638 0.6130 0.5360 0.1457  -0.0754 -0.0249 211 MET A C   
1615 O O   . MET A 210 ? 0.7082 0.6606 0.5736 0.1658  -0.0802 -0.0324 211 MET A O   
1616 C CB  . MET A 210 ? 0.6254 0.6379 0.5432 0.1281  -0.0607 -0.0161 211 MET A CB  
1617 C CG  . MET A 210 ? 0.5860 0.6204 0.5232 0.1192  -0.0573 -0.0110 211 MET A CG  
1618 S SD  . MET A 210 ? 0.6714 0.7457 0.6339 0.1082  -0.0472 -0.0068 211 MET A SD  
1619 C CE  . MET A 210 ? 0.5956 0.6752 0.5722 0.0947  -0.0465 -0.0010 211 MET A CE  
1620 N N   . HIS A 211 ? 0.6272 0.5546 0.4890 0.1344  -0.0751 -0.0233 212 HIS A N   
1621 C CA  . HIS A 211 ? 0.6707 0.5705 0.5089 0.1442  -0.0817 -0.0303 212 HIS A CA  
1622 C C   . HIS A 211 ? 0.7934 0.6518 0.6057 0.1532  -0.0937 -0.0326 212 HIS A C   
1623 O O   . HIS A 211 ? 0.8287 0.6685 0.6221 0.1709  -0.1012 -0.0411 212 HIS A O   
1624 C CB  . HIS A 211 ? 0.6647 0.5508 0.4978 0.1277  -0.0796 -0.0276 212 HIS A CB  
1625 C CG  . HIS A 211 ? 0.6373 0.5582 0.4899 0.1224  -0.0701 -0.0263 212 HIS A CG  
1626 N ND1 . HIS A 211 ? 0.6344 0.5755 0.4880 0.1358  -0.0675 -0.0329 212 HIS A ND1 
1627 C CD2 . HIS A 211 ? 0.5486 0.4871 0.4189 0.1058  -0.0630 -0.0191 212 HIS A CD2 
1628 C CE1 . HIS A 211 ? 0.6281 0.5964 0.4981 0.1259  -0.0593 -0.0285 212 HIS A CE1 
1629 N NE2 . HIS A 211 ? 0.5801 0.5458 0.4604 0.1085  -0.0570 -0.0203 212 HIS A NE2 
1630 N N   . LEU A 212 ? 0.7777 0.6202 0.5869 0.1418  -0.0962 -0.0254 213 LEU A N   
1631 C CA  . LEU A 212 ? 0.8343 0.6375 0.6177 0.1499  -0.1083 -0.0259 213 LEU A CA  
1632 C C   . LEU A 212 ? 0.7760 0.5924 0.5609 0.1753  -0.1133 -0.0326 213 LEU A C   
1633 O O   . LEU A 212 ? 0.8379 0.6216 0.5983 0.1916  -0.1251 -0.0376 213 LEU A O   
1634 C CB  . LEU A 212 ? 0.9143 0.7058 0.6963 0.1320  -0.1084 -0.0162 213 LEU A CB  
1635 C CG  . LEU A 212 ? 0.9988 0.7628 0.7675 0.1089  -0.1084 -0.0099 213 LEU A CG  
1636 C CD1 . LEU A 212 ? 0.8984 0.6655 0.6721 0.0927  -0.1055 -0.0013 213 LEU A CD1 
1637 C CD2 . LEU A 212 ? 1.0715 0.7839 0.8048 0.1123  -0.1211 -0.0120 213 LEU A CD2 
1638 N N   . LEU A 213 ? 0.7034 0.5676 0.5167 0.1789  -0.1052 -0.0328 214 LEU A N   
1639 C CA  . LEU A 213 ? 0.7026 0.5886 0.5225 0.2008  -0.1090 -0.0385 214 LEU A CA  
1640 C C   . LEU A 213 ? 0.7472 0.6620 0.5745 0.2198  -0.1062 -0.0488 214 LEU A C   
1641 O O   . LEU A 213 ? 0.7777 0.7166 0.6121 0.2399  -0.1091 -0.0551 214 LEU A O   
1642 C CB  . LEU A 213 ? 0.6433 0.5659 0.4892 0.1918  -0.1028 -0.0326 214 LEU A CB  
1643 C CG  . LEU A 213 ? 0.7129 0.6116 0.5516 0.1744  -0.1050 -0.0235 214 LEU A CG  
1644 C CD1 . LEU A 213 ? 0.6080 0.5435 0.4732 0.1634  -0.0976 -0.0187 214 LEU A CD1 
1645 C CD2 . LEU A 213 ? 0.7305 0.5919 0.5428 0.1868  -0.1189 -0.0240 214 LEU A CD2 
1646 N N   . SER A 214 ? 0.7032 0.6187 0.5291 0.2142  -0.1006 -0.0510 215 SER A N   
1647 C CA  . SER A 214 ? 0.6967 0.6388 0.5264 0.2316  -0.0974 -0.0611 215 SER A CA  
1648 C C   . SER A 214 ? 0.7650 0.6636 0.5634 0.2443  -0.1069 -0.0697 215 SER A C   
1649 O O   . SER A 214 ? 0.8058 0.6768 0.5918 0.2291  -0.1068 -0.0669 215 SER A O   
1650 C CB  . SER A 214 ? 0.7396 0.7186 0.5907 0.2161  -0.0839 -0.0573 215 SER A CB  
1651 O OG  . SER A 214 ? 0.7505 0.7633 0.6073 0.2322  -0.0794 -0.0663 215 SER A OG  
1652 N N   . PRO A 215 ? 0.7918 0.6827 0.5764 0.2719  -0.1159 -0.0808 216 PRO A N   
1653 C CA  . PRO A 215 ? 0.8986 0.7383 0.6485 0.2851  -0.1278 -0.0895 216 PRO A CA  
1654 C C   . PRO A 215 ? 0.9606 0.7990 0.7044 0.2791  -0.1226 -0.0940 216 PRO A C   
1655 O O   . PRO A 215 ? 1.0214 0.8102 0.7385 0.2723  -0.1305 -0.0947 216 PRO A O   
1656 C CB  . PRO A 215 ? 0.9411 0.7911 0.6857 0.3198  -0.1356 -0.1025 216 PRO A CB  
1657 C CG  . PRO A 215 ? 0.8341 0.7178 0.6022 0.3199  -0.1333 -0.0964 216 PRO A CG  
1658 C CD  . PRO A 215 ? 0.8449 0.7685 0.6430 0.2922  -0.1179 -0.0853 216 PRO A CD  
1659 N N   . PRO A 216 ? 0.8773 0.7676 0.6431 0.2801  -0.1101 -0.0969 217 PRO A N   
1660 C CA  . PRO A 216 ? 0.9102 0.7968 0.6675 0.2734  -0.1060 -0.1004 217 PRO A CA  
1661 C C   . PRO A 216 ? 0.8865 0.7487 0.6416 0.2433  -0.1042 -0.0890 217 PRO A C   
1662 O O   . PRO A 216 ? 0.9015 0.7405 0.6397 0.2381  -0.1067 -0.0925 217 PRO A O   
1663 C CB  . PRO A 216 ? 0.7911 0.7429 0.5753 0.2764  -0.0919 -0.1021 217 PRO A CB  
1664 C CG  . PRO A 216 ? 0.8181 0.8002 0.6146 0.2971  -0.0928 -0.1071 217 PRO A CG  
1665 C CD  . PRO A 216 ? 0.8075 0.7602 0.6021 0.2903  -0.1008 -0.0989 217 PRO A CD  
1666 N N   . SER A 217 ? 0.8288 0.6972 0.6006 0.2240  -0.1004 -0.0763 218 SER A N   
1667 C CA  . SER A 217 ? 0.8278 0.6763 0.5988 0.1969  -0.0989 -0.0663 218 SER A CA  
1668 C C   . SER A 217 ? 0.9217 0.7144 0.6667 0.1903  -0.1109 -0.0638 218 SER A C   
1669 O O   . SER A 217 ? 0.9123 0.6793 0.6460 0.1725  -0.1130 -0.0602 218 SER A O   
1670 C CB  . SER A 217 ? 0.7472 0.6299 0.5480 0.1792  -0.0886 -0.0546 218 SER A CB  
1671 O OG  . SER A 217 ? 0.7816 0.7127 0.6049 0.1807  -0.0778 -0.0548 218 SER A OG  
1672 N N   . ARG A 218 ? 1.0188 0.7932 0.7536 0.2036  -0.1192 -0.0651 219 ARG A N   
1673 C CA  . ARG A 218 ? 1.0202 0.7422 0.7300 0.1950  -0.1305 -0.0601 219 ARG A CA  
1674 C C   . ARG A 218 ? 0.9875 0.6599 0.6648 0.1931  -0.1407 -0.0655 219 ARG A C   
1675 O O   . ARG A 218 ? 1.0596 0.6951 0.7205 0.1730  -0.1461 -0.0583 219 ARG A O   
1676 C CB  . ARG A 218 ? 1.0833 0.7942 0.7848 0.2147  -0.1394 -0.0622 219 ARG A CB  
1677 C CG  . ARG A 218 ? 1.1353 0.7879 0.8059 0.2084  -0.1528 -0.0570 219 ARG A CG  
1678 C CD  . ARG A 218 ? 1.1173 0.7731 0.7981 0.1818  -0.1476 -0.0430 219 ARG A CD  
1679 N NE  . ARG A 218 ? 1.2187 0.8181 0.8669 0.1721  -0.1599 -0.0370 219 ARG A NE  
1680 C CZ  . ARG A 218 ? 1.2487 0.8151 0.8791 0.1503  -0.1627 -0.0325 219 ARG A CZ  
1681 N NH1 . ARG A 218 ? 1.2002 0.7855 0.8433 0.1377  -0.1543 -0.0340 219 ARG A NH1 
1682 N NH2 . ARG A 218 ? 1.2654 0.7807 0.8648 0.1402  -0.1741 -0.0261 219 ARG A NH2 
1683 N N   . GLY A 219 ? 0.9858 0.6575 0.6526 0.2127  -0.1435 -0.0782 220 GLY A N   
1684 C CA  . GLY A 219 ? 0.9835 0.6072 0.6182 0.2114  -0.1539 -0.0847 220 GLY A CA  
1685 C C   . GLY A 219 ? 0.9891 0.6173 0.6284 0.1865  -0.1480 -0.0806 220 GLY A C   
1686 O O   . GLY A 219 ? 1.0452 0.6347 0.6583 0.1825  -0.1569 -0.0858 220 GLY A O   
1687 N N   . LEU A 220 ? 0.9091 0.5822 0.5802 0.1700  -0.1345 -0.0716 221 LEU A N   
1688 C CA  . LEU A 220 ? 0.9013 0.5855 0.5801 0.1491  -0.1287 -0.0680 221 LEU A CA  
1689 C C   . LEU A 220 ? 0.9849 0.6551 0.6659 0.1204  -0.1288 -0.0559 221 LEU A C   
1690 O O   . LEU A 220 ? 0.9015 0.5819 0.5900 0.1023  -0.1248 -0.0526 221 LEU A O   
1691 C CB  . LEU A 220 ? 0.8461 0.5890 0.5570 0.1508  -0.1144 -0.0666 221 LEU A CB  
1692 C CG  . LEU A 220 ? 0.8540 0.6209 0.5659 0.1772  -0.1120 -0.0780 221 LEU A CG  
1693 C CD1 . LEU A 220 ? 0.8146 0.6393 0.5580 0.1749  -0.0977 -0.0738 221 LEU A CD1 
1694 C CD2 . LEU A 220 ? 0.8672 0.6077 0.5519 0.1863  -0.1195 -0.0901 221 LEU A CD2 
1695 N N   . PHE A 221 ? 0.8775 0.5270 0.5521 0.1160  -0.1331 -0.0495 222 PHE A N   
1696 C CA  . PHE A 221 ? 0.8251 0.4645 0.5010 0.0887  -0.1324 -0.0382 222 PHE A CA  
1697 C C   . PHE A 221 ? 0.9390 0.5356 0.5905 0.0884  -0.1428 -0.0344 222 PHE A C   
1698 O O   . PHE A 221 ? 0.9913 0.5699 0.6287 0.1107  -0.1502 -0.0400 222 PHE A O   
1699 C CB  . PHE A 221 ? 0.7843 0.4730 0.4962 0.0782  -0.1186 -0.0301 222 PHE A CB  
1700 C CG  . PHE A 221 ? 0.8110 0.5219 0.5381 0.0921  -0.1143 -0.0285 222 PHE A CG  
1701 C CD1 . PHE A 221 ? 0.7815 0.5202 0.5207 0.1137  -0.1106 -0.0354 222 PHE A CD1 
1702 C CD2 . PHE A 221 ? 0.8511 0.5581 0.5808 0.0825  -0.1140 -0.0203 222 PHE A CD2 
1703 C CE1 . PHE A 221 ? 0.8100 0.5718 0.5643 0.1250  -0.1072 -0.0341 222 PHE A CE1 
1704 C CE2 . PHE A 221 ? 0.8019 0.5298 0.5453 0.0946  -0.1110 -0.0193 222 PHE A CE2 
1705 C CZ  . PHE A 221 ? 0.7927 0.5481 0.5490 0.1155  -0.1079 -0.0261 222 PHE A CZ  
1706 N N   . HIS A 222 ? 0.9129 0.4947 0.5591 0.0630  -0.1436 -0.0245 223 HIS A N   
1707 C CA  . HIS A 222 ? 0.9962 0.5303 0.6127 0.0581  -0.1549 -0.0195 223 HIS A CA  
1708 C C   . HIS A 222 ? 0.9800 0.5297 0.6090 0.0428  -0.1487 -0.0079 223 HIS A C   
1709 O O   . HIS A 222 ? 1.0235 0.5447 0.6334 0.0456  -0.1562 -0.0036 223 HIS A O   
1710 C CB  . HIS A 222 ? 0.9960 0.4830 0.5816 0.0398  -0.1656 -0.0190 223 HIS A CB  
1711 C CG  . HIS A 222 ? 1.1641 0.6365 0.7371 0.0525  -0.1715 -0.0311 223 HIS A CG  
1712 N ND1 . HIS A 222 ? 1.1036 0.6120 0.6976 0.0491  -0.1630 -0.0354 223 HIS A ND1 
1713 C CD2 . HIS A 222 ? 1.2084 0.6337 0.7486 0.0697  -0.1856 -0.0405 223 HIS A CD2 
1714 C CE1 . HIS A 222 ? 1.1016 0.5873 0.6763 0.0628  -0.1710 -0.0468 223 HIS A CE1 
1715 N NE2 . HIS A 222 ? 1.2065 0.6415 0.7485 0.0759  -0.1847 -0.0507 223 HIS A NE2 
1716 N N   . ARG A 223 ? 0.9186 0.5118 0.5775 0.0273  -0.1357 -0.0032 224 ARG A N   
1717 C CA  . ARG A 223 ? 0.8985 0.5116 0.5712 0.0143  -0.1286 0.0060  224 ARG A CA  
1718 C C   . ARG A 223 ? 0.8294 0.4986 0.5411 0.0182  -0.1147 0.0052  224 ARG A C   
1719 O O   . ARG A 223 ? 0.8104 0.5025 0.5377 0.0249  -0.1102 -0.0003 224 ARG A O   
1720 C CB  . ARG A 223 ? 0.9453 0.5463 0.6082 -0.0161 -0.1286 0.0143  224 ARG A CB  
1721 C CG  . ARG A 223 ? 0.9958 0.5469 0.6242 -0.0267 -0.1411 0.0139  224 ARG A CG  
1722 C CD  . ARG A 223 ? 0.9962 0.5343 0.6119 -0.0577 -0.1418 0.0240  224 ARG A CD  
1723 N NE  . ARG A 223 ? 1.2040 0.7141 0.7998 -0.0750 -0.1495 0.0231  224 ARG A NE  
1724 C CZ  . ARG A 223 ? 1.4153 0.8680 0.9735 -0.0730 -0.1647 0.0212  224 ARG A CZ  
1725 N NH1 . ARG A 223 ? 1.4774 0.8955 1.0143 -0.0524 -0.1738 0.0198  224 ARG A NH1 
1726 N NH2 . ARG A 223 ? 1.5231 0.9524 1.0645 -0.0911 -0.1716 0.0202  224 ARG A NH2 
1727 N N   . ALA A 224 ? 0.7472 0.4365 0.4726 0.0130  -0.1085 0.0111  225 ALA A N   
1728 C CA  . ALA A 224 ? 0.7522 0.4893 0.5119 0.0169  -0.0969 0.0106  225 ALA A CA  
1729 C C   . ALA A 224 ? 0.7781 0.5334 0.5495 -0.0015 -0.0896 0.0174  225 ALA A C   
1730 O O   . ALA A 224 ? 0.7667 0.5017 0.5208 -0.0113 -0.0931 0.0229  225 ALA A O   
1731 C CB  . ALA A 224 ? 0.7862 0.5347 0.5534 0.0391  -0.0973 0.0073  225 ALA A CB  
1732 N N   . VAL A 225 ? 0.6958 0.4890 0.4954 -0.0057 -0.0798 0.0169  226 VAL A N   
1733 C CA  . VAL A 225 ? 0.6573 0.4746 0.4726 -0.0185 -0.0719 0.0210  226 VAL A CA  
1734 C C   . VAL A 225 ? 0.6537 0.5041 0.4958 -0.0069 -0.0649 0.0187  226 VAL A C   
1735 O O   . VAL A 225 ? 0.6245 0.4922 0.4819 0.0004  -0.0622 0.0154  226 VAL A O   
1736 C CB  . VAL A 225 ? 0.6726 0.5027 0.4953 -0.0366 -0.0679 0.0223  226 VAL A CB  
1737 C CG1 . VAL A 225 ? 0.6269 0.4839 0.4653 -0.0475 -0.0596 0.0250  226 VAL A CG1 
1738 C CG2 . VAL A 225 ? 0.6481 0.4448 0.4436 -0.0505 -0.0756 0.0247  226 VAL A CG2 
1739 N N   . LEU A 226 ? 0.6278 0.4860 0.4740 -0.0061 -0.0627 0.0206  227 LEU A N   
1740 C CA  . LEU A 226 ? 0.6058 0.4917 0.4749 0.0033  -0.0574 0.0186  227 LEU A CA  
1741 C C   . LEU A 226 ? 0.6073 0.5132 0.4896 -0.0076 -0.0505 0.0201  227 LEU A C   
1742 O O   . LEU A 226 ? 0.6614 0.5615 0.5343 -0.0128 -0.0508 0.0224  227 LEU A O   
1743 C CB  . LEU A 226 ? 0.6032 0.4820 0.4657 0.0171  -0.0622 0.0178  227 LEU A CB  
1744 C CG  . LEU A 226 ? 0.6648 0.5321 0.5191 0.0329  -0.0682 0.0141  227 LEU A CG  
1745 C CD1 . LEU A 226 ? 0.6933 0.5215 0.5171 0.0328  -0.0775 0.0150  227 LEU A CD1 
1746 C CD2 . LEU A 226 ? 0.6920 0.5742 0.5554 0.0479  -0.0693 0.0118  227 LEU A CD2 
1747 N N   . GLN A 227 ? 0.5312 0.4604 0.4342 -0.0100 -0.0447 0.0184  228 GLN A N   
1748 C CA  . GLN A 227 ? 0.5332 0.4827 0.4498 -0.0180 -0.0384 0.0180  228 GLN A CA  
1749 C C   . GLN A 227 ? 0.5128 0.4796 0.4472 -0.0091 -0.0356 0.0157  228 GLN A C   
1750 O O   . GLN A 227 ? 0.5399 0.5171 0.4881 -0.0026 -0.0348 0.0145  228 GLN A O   
1751 C CB  . GLN A 227 ? 0.5080 0.4707 0.4349 -0.0257 -0.0354 0.0172  228 GLN A CB  
1752 C CG  . GLN A 227 ? 0.5207 0.4662 0.4304 -0.0357 -0.0392 0.0192  228 GLN A CG  
1753 C CD  . GLN A 227 ? 0.6468 0.6083 0.5680 -0.0426 -0.0372 0.0180  228 GLN A CD  
1754 O OE1 . GLN A 227 ? 0.6329 0.5819 0.5424 -0.0500 -0.0411 0.0189  228 GLN A OE1 
1755 N NE2 . GLN A 227 ? 0.5501 0.5380 0.4933 -0.0398 -0.0323 0.0156  228 GLN A NE2 
1756 N N   . SER A 228 ? 0.5752 0.5439 0.5075 -0.0100 -0.0347 0.0154  229 SER A N   
1757 C CA  . SER A 228 ? 0.4729 0.4567 0.4208 -0.0043 -0.0326 0.0127  229 SER A CA  
1758 C C   . SER A 228 ? 0.5132 0.4985 0.4675 0.0062  -0.0355 0.0127  229 SER A C   
1759 O O   . SER A 228 ? 0.4971 0.4959 0.4677 0.0091  -0.0337 0.0116  229 SER A O   
1760 C CB  . SER A 228 ? 0.4873 0.4891 0.4528 -0.0070 -0.0276 0.0099  229 SER A CB  
1761 O OG  . SER A 228 ? 0.5881 0.5950 0.5497 -0.0162 -0.0241 0.0089  229 SER A OG  
1762 N N   . GLY A 229 ? 0.4967 0.4686 0.4377 0.0120  -0.0405 0.0140  230 GLY A N   
1763 C CA  . GLY A 229 ? 0.4425 0.4209 0.3900 0.0225  -0.0427 0.0132  230 GLY A CA  
1764 C C   . GLY A 229 ? 0.4833 0.4456 0.4135 0.0307  -0.0490 0.0134  230 GLY A C   
1765 O O   . GLY A 229 ? 0.5358 0.4766 0.4471 0.0276  -0.0523 0.0148  230 GLY A O   
1766 N N   . ALA A 230 ? 0.4619 0.4349 0.3981 0.0411  -0.0514 0.0118  231 ALA A N   
1767 C CA  . ALA A 230 ? 0.5014 0.4631 0.4236 0.0529  -0.0583 0.0106  231 ALA A CA  
1768 C C   . ALA A 230 ? 0.5573 0.5413 0.4931 0.0640  -0.0581 0.0079  231 ALA A C   
1769 O O   . ALA A 230 ? 0.5367 0.5439 0.4916 0.0602  -0.0536 0.0082  231 ALA A O   
1770 C CB  . ALA A 230 ? 0.5512 0.5044 0.4629 0.0534  -0.0631 0.0116  231 ALA A CB  
1771 N N   . PRO A 231 ? 0.5959 0.5737 0.5216 0.0775  -0.0631 0.0050  232 PRO A N   
1772 C CA  . PRO A 231 ? 0.5461 0.5510 0.4855 0.0885  -0.0621 0.0018  232 PRO A CA  
1773 C C   . PRO A 231 ? 0.6450 0.6713 0.5956 0.0924  -0.0641 0.0011  232 PRO A C   
1774 O O   . PRO A 231 ? 0.5720 0.6286 0.5394 0.0958  -0.0613 -0.0004 232 PRO A O   
1775 C CB  . PRO A 231 ? 0.5344 0.5236 0.4565 0.1038  -0.0679 -0.0026 232 PRO A CB  
1776 C CG  . PRO A 231 ? 0.5759 0.5287 0.4745 0.1026  -0.0751 -0.0009 232 PRO A CG  
1777 C CD  . PRO A 231 ? 0.6120 0.5575 0.5125 0.0834  -0.0701 0.0043  232 PRO A CD  
1778 N N   . ASN A 232 ? 0.5721 0.5852 0.5136 0.0909  -0.0690 0.0023  233 ASN A N   
1779 C CA  . ASN A 232 ? 0.5853 0.6173 0.5356 0.0947  -0.0725 0.0012  233 ASN A CA  
1780 C C   . ASN A 232 ? 0.6107 0.6568 0.5762 0.0799  -0.0678 0.0034  233 ASN A C   
1781 O O   . ASN A 232 ? 0.5549 0.6152 0.5268 0.0805  -0.0712 0.0025  233 ASN A O   
1782 C CB  . ASN A 232 ? 0.6249 0.6337 0.5542 0.1025  -0.0819 0.0013  233 ASN A CB  
1783 C CG  . ASN A 232 ? 0.6090 0.5837 0.5184 0.0918  -0.0822 0.0054  233 ASN A CG  
1784 O OD1 . ASN A 232 ? 0.6440 0.6027 0.5461 0.0872  -0.0792 0.0064  233 ASN A OD1 
1785 N ND2 . ASN A 232 ? 0.5403 0.5059 0.4405 0.0869  -0.0857 0.0077  233 ASN A ND2 
1786 N N   . GLY A 233 ? 0.6257 0.6678 0.5965 0.0677  -0.0612 0.0056  234 GLY A N   
1787 C CA  . GLY A 233 ? 0.7118 0.7651 0.6963 0.0557  -0.0575 0.0066  234 GLY A CA  
1788 C C   . GLY A 233 ? 0.7611 0.8442 0.7649 0.0551  -0.0565 0.0060  234 GLY A C   
1789 O O   . GLY A 233 ? 0.7214 0.8201 0.7320 0.0605  -0.0548 0.0059  234 GLY A O   
1790 N N   . PRO A 234 ? 0.5983 0.6904 0.6106 0.0474  -0.0577 0.0056  235 PRO A N   
1791 C CA  . PRO A 234 ? 0.4895 0.6102 0.5195 0.0439  -0.0577 0.0057  235 PRO A CA  
1792 C C   . PRO A 234 ? 0.5117 0.6418 0.5533 0.0361  -0.0518 0.0089  235 PRO A C   
1793 O O   . PRO A 234 ? 0.4975 0.6522 0.5527 0.0314  -0.0513 0.0101  235 PRO A O   
1794 C CB  . PRO A 234 ? 0.5516 0.6713 0.5840 0.0352  -0.0609 0.0042  235 PRO A CB  
1795 C CG  . PRO A 234 ? 0.5536 0.6464 0.5742 0.0309  -0.0588 0.0041  235 PRO A CG  
1796 C CD  . PRO A 234 ? 0.5024 0.5791 0.5082 0.0398  -0.0584 0.0049  235 PRO A CD  
1797 N N   . TRP A 235 ? 0.4575 0.5698 0.4938 0.0336  -0.0477 0.0108  236 TRP A N   
1798 C CA  . TRP A 235 ? 0.4749 0.5924 0.5192 0.0269  -0.0430 0.0145  236 TRP A CA  
1799 C C   . TRP A 235 ? 0.4783 0.6000 0.5188 0.0347  -0.0402 0.0153  236 TRP A C   
1800 O O   . TRP A 235 ? 0.5020 0.6330 0.5486 0.0300  -0.0365 0.0188  236 TRP A O   
1801 C CB  . TRP A 235 ? 0.3617 0.4581 0.4034 0.0194  -0.0413 0.0155  236 TRP A CB  
1802 C CG  . TRP A 235 ? 0.5223 0.5988 0.5506 0.0244  -0.0413 0.0133  236 TRP A CG  
1803 C CD1 . TRP A 235 ? 0.5463 0.6112 0.5661 0.0247  -0.0436 0.0104  236 TRP A CD1 
1804 C CD2 . TRP A 235 ? 0.4655 0.5321 0.4860 0.0283  -0.0391 0.0141  236 TRP A CD2 
1805 N NE1 . TRP A 235 ? 0.5050 0.5538 0.5123 0.0272  -0.0426 0.0102  236 TRP A NE1 
1806 C CE2 . TRP A 235 ? 0.4851 0.5342 0.4930 0.0293  -0.0402 0.0122  236 TRP A CE2 
1807 C CE3 . TRP A 235 ? 0.5064 0.5775 0.5283 0.0300  -0.0365 0.0164  236 TRP A CE3 
1808 C CZ2 . TRP A 235 ? 0.4623 0.4980 0.4598 0.0307  -0.0393 0.0126  236 TRP A CZ2 
1809 C CZ3 . TRP A 235 ? 0.4652 0.5226 0.4767 0.0329  -0.0358 0.0160  236 TRP A CZ3 
1810 C CH2 . TRP A 235 ? 0.5162 0.5559 0.5160 0.0327  -0.0374 0.0141  236 TRP A CH2 
1811 N N   . ALA A 236 ? 0.5297 0.6428 0.5583 0.0464  -0.0424 0.0121  237 ALA A N   
1812 C CA  . ALA A 236 ? 0.5373 0.6455 0.5577 0.0541  -0.0407 0.0114  237 ALA A CA  
1813 C C   . ALA A 236 ? 0.5406 0.6751 0.5661 0.0630  -0.0397 0.0096  237 ALA A C   
1814 O O   . ALA A 236 ? 0.5440 0.6801 0.5655 0.0670  -0.0368 0.0094  237 ALA A O   
1815 C CB  . ALA A 236 ? 0.4122 0.4941 0.4143 0.0616  -0.0446 0.0086  237 ALA A CB  
1816 N N   . THR A 237 ? 0.4868 0.6441 0.5209 0.0667  -0.0420 0.0077  238 THR A N   
1817 C CA  . THR A 237 ? 0.4723 0.6616 0.5136 0.0757  -0.0406 0.0051  238 THR A CA  
1818 C C   . THR A 237 ? 0.5112 0.7332 0.5710 0.0658  -0.0394 0.0075  238 THR A C   
1819 O O   . THR A 237 ? 0.5263 0.7423 0.5912 0.0542  -0.0413 0.0101  238 THR A O   
1820 C CB  . THR A 237 ? 0.4701 0.6580 0.5015 0.0955  -0.0465 -0.0017 238 THR A CB  
1821 O OG1 . THR A 237 ? 0.4934 0.6748 0.5239 0.0962  -0.0529 -0.0026 238 THR A OG1 
1822 C CG2 . THR A 237 ? 0.4387 0.5932 0.4498 0.1043  -0.0484 -0.0041 238 THR A CG2 
1823 N N   . VAL A 238 ? 0.4762 0.7342 0.5454 0.0702  -0.0363 0.0062  239 VAL A N   
1824 C CA  . VAL A 238 ? 0.3696 0.6645 0.4570 0.0595  -0.0350 0.0087  239 VAL A CA  
1825 C C   . VAL A 238 ? 0.4263 0.7619 0.5210 0.0740  -0.0344 0.0029  239 VAL A C   
1826 O O   . VAL A 238 ? 0.5140 0.8505 0.6003 0.0893  -0.0327 -0.0017 239 VAL A O   
1827 C CB  . VAL A 238 ? 0.4330 0.7320 0.5267 0.0396  -0.0291 0.0170  239 VAL A CB  
1828 C CG1 . VAL A 238 ? 0.3950 0.7179 0.4891 0.0427  -0.0223 0.0179  239 VAL A CG1 
1829 C CG2 . VAL A 238 ? 0.5381 0.8563 0.6462 0.0224  -0.0306 0.0211  239 VAL A CG2 
1830 N N   . GLY A 239 ? 0.4823 0.8523 0.5926 0.0701  -0.0366 0.0021  240 GLY A N   
1831 C CA  . GLY A 239 ? 0.4117 0.8273 0.5321 0.0844  -0.0362 -0.0042 240 GLY A CA  
1832 C C   . GLY A 239 ? 0.4288 0.8806 0.5575 0.0781  -0.0268 -0.0017 240 GLY A C   
1833 O O   . GLY A 239 ? 0.4113 0.8566 0.5406 0.0586  -0.0214 0.0068  240 GLY A O   
1834 N N   . MET A 240 ? 0.4468 0.9380 0.5811 0.0959  -0.0252 -0.0094 241 MET A N   
1835 C CA  . MET A 240 ? 0.5114 1.0417 0.6520 0.0923  -0.0155 -0.0082 241 MET A CA  
1836 C C   . MET A 240 ? 0.4627 1.0284 0.6211 0.0650  -0.0107 0.0009  241 MET A C   
1837 O O   . MET A 240 ? 0.4249 0.9970 0.5821 0.0491  -0.0030 0.0086  241 MET A O   
1838 C CB  . MET A 240 ? 0.5301 1.1007 0.6746 0.1186  -0.0153 -0.0201 241 MET A CB  
1839 C CG  . MET A 240 ? 0.6121 1.1510 0.7353 0.1434  -0.0171 -0.0284 241 MET A CG  
1840 S SD  . MET A 240 ? 0.6868 1.2675 0.8131 0.1788  -0.0199 -0.0447 241 MET A SD  
1841 C CE  . MET A 240 ? 0.6786 1.3403 0.8287 0.1669  -0.0074 -0.0432 241 MET A CE  
1842 N N   . GLY A 241 ? 0.4071 0.9950 0.5807 0.0583  -0.0158 0.0007  242 GLY A N   
1843 C CA  . GLY A 241 ? 0.3865 1.0073 0.5762 0.0304  -0.0124 0.0093  242 GLY A CA  
1844 C C   . GLY A 241 ? 0.4630 1.0399 0.6446 0.0054  -0.0128 0.0206  242 GLY A C   
1845 O O   . GLY A 241 ? 0.4701 1.0595 0.6548 -0.0168 -0.0071 0.0300  242 GLY A O   
1846 N N   . GLU A 242 ? 0.3930 0.9179 0.5631 0.0090  -0.0196 0.0198  243 GLU A N   
1847 C CA  . GLU A 242 ? 0.4232 0.9053 0.5851 -0.0111 -0.0206 0.0287  243 GLU A CA  
1848 C C   . GLU A 242 ? 0.4551 0.9164 0.6042 -0.0126 -0.0142 0.0339  243 GLU A C   
1849 O O   . GLU A 242 ? 0.5170 0.9636 0.6632 -0.0329 -0.0125 0.0436  243 GLU A O   
1850 C CB  . GLU A 242 ? 0.4153 0.8521 0.5680 -0.0048 -0.0287 0.0251  243 GLU A CB  
1851 C CG  . GLU A 242 ? 0.4131 0.8042 0.5566 -0.0210 -0.0302 0.0319  243 GLU A CG  
1852 C CD  . GLU A 242 ? 0.4798 0.8790 0.6321 -0.0470 -0.0321 0.0391  243 GLU A CD  
1853 O OE1 . GLU A 242 ? 0.5718 1.0109 0.7385 -0.0541 -0.0335 0.0383  243 GLU A OE1 
1854 O OE2 . GLU A 242 ? 0.4588 0.8238 0.6032 -0.0604 -0.0329 0.0454  243 GLU A OE2 
1855 N N   . ALA A 243 ? 0.4459 0.9039 0.5856 0.0088  -0.0115 0.0276  244 ALA A N   
1856 C CA  . ALA A 243 ? 0.4857 0.9293 0.6134 0.0079  -0.0056 0.0319  244 ALA A CA  
1857 C C   . ALA A 243 ? 0.4142 0.8992 0.5491 -0.0071 0.0022  0.0388  244 ALA A C   
1858 O O   . ALA A 243 ? 0.4580 0.9281 0.5855 -0.0222 0.0054  0.0483  244 ALA A O   
1859 C CB  . ALA A 243 ? 0.4487 0.8830 0.5645 0.0337  -0.0051 0.0225  244 ALA A CB  
1860 N N   . ARG A 244 ? 0.3968 0.9355 0.5458 -0.0033 0.0052  0.0345  245 ARG A N   
1861 C CA  . ARG A 244 ? 0.3862 0.9712 0.5432 -0.0199 0.0133  0.0414  245 ARG A CA  
1862 C C   . ARG A 244 ? 0.4253 1.0035 0.5871 -0.0518 0.0116  0.0543  245 ARG A C   
1863 O O   . ARG A 244 ? 0.5624 1.1455 0.7192 -0.0706 0.0168  0.0651  245 ARG A O   
1864 C CB  . ARG A 244 ? 0.3724 1.0204 0.5462 -0.0084 0.0161  0.0326  245 ARG A CB  
1865 C CG  . ARG A 244 ? 0.3926 1.0978 0.5784 -0.0285 0.0245  0.0396  245 ARG A CG  
1866 C CD  . ARG A 244 ? 0.3603 1.1293 0.5592 -0.0087 0.0293  0.0280  245 ARG A CD  
1867 N NE  . ARG A 244 ? 0.3606 1.1262 0.5462 0.0184  0.0333  0.0185  245 ARG A NE  
1868 C CZ  . ARG A 244 ? 0.5289 1.3208 0.7083 0.0165  0.0434  0.0204  245 ARG A CZ  
1869 N NH1 . ARG A 244 ? 0.3264 1.1499 0.5112 -0.0121 0.0508  0.0327  245 ARG A NH1 
1870 N NH2 . ARG A 244 ? 0.4001 1.1859 0.5660 0.0425  0.0458  0.0101  245 ARG A NH2 
1871 N N   . ARG A 245 ? 0.4595 1.0251 0.6290 -0.0584 0.0037  0.0535  246 ARG A N   
1872 C CA  . ARG A 245 ? 0.5021 1.0565 0.6745 -0.0882 0.0003  0.0645  246 ARG A CA  
1873 C C   . ARG A 245 ? 0.4743 0.9746 0.6290 -0.0983 -0.0009 0.0736  246 ARG A C   
1874 O O   . ARG A 245 ? 0.4555 0.9536 0.6068 -0.1223 0.0003  0.0856  246 ARG A O   
1875 C CB  . ARG A 245 ? 0.4400 0.9845 0.6208 -0.0900 -0.0090 0.0598  246 ARG A CB  
1876 C CG  . ARG A 245 ? 0.4799 1.0150 0.6639 -0.1207 -0.0139 0.0693  246 ARG A CG  
1877 C CD  . ARG A 245 ? 0.4859 0.9938 0.6716 -0.1200 -0.0241 0.0638  246 ARG A CD  
1878 N NE  . ARG A 245 ? 0.5528 1.0036 0.7229 -0.1058 -0.0278 0.0604  246 ARG A NE  
1879 C CZ  . ARG A 245 ? 0.5960 1.0000 0.7530 -0.1161 -0.0299 0.0669  246 ARG A CZ  
1880 N NH1 . ARG A 245 ? 0.6138 1.0155 0.7687 -0.1407 -0.0297 0.0781  246 ARG A NH1 
1881 N NH2 . ARG A 245 ? 0.5716 0.9315 0.7169 -0.1018 -0.0326 0.0625  246 ARG A NH2 
1882 N N   . ARG A 246 ? 0.4185 0.8753 0.5614 -0.0805 -0.0038 0.0684  247 ARG A N   
1883 C CA  . ARG A 246 ? 0.3966 0.8045 0.5241 -0.0872 -0.0057 0.0757  247 ARG A CA  
1884 C C   . ARG A 246 ? 0.4856 0.9035 0.6041 -0.0911 0.0015  0.0830  247 ARG A C   
1885 O O   . ARG A 246 ? 0.5084 0.9062 0.6183 -0.1092 0.0006  0.0945  247 ARG A O   
1886 C CB  . ARG A 246 ? 0.3948 0.7622 0.5136 -0.0670 -0.0097 0.0675  247 ARG A CB  
1887 C CG  . ARG A 246 ? 0.4618 0.8172 0.5866 -0.0637 -0.0167 0.0609  247 ARG A CG  
1888 C CD  . ARG A 246 ? 0.4593 0.7722 0.5733 -0.0481 -0.0203 0.0550  247 ARG A CD  
1889 N NE  . ARG A 246 ? 0.4846 0.7847 0.6019 -0.0460 -0.0269 0.0492  247 ARG A NE  
1890 C CZ  . ARG A 246 ? 0.4948 0.7672 0.6046 -0.0323 -0.0300 0.0427  247 ARG A CZ  
1891 N NH1 . ARG A 246 ? 0.4028 0.6553 0.5018 -0.0197 -0.0276 0.0409  247 ARG A NH1 
1892 N NH2 . ARG A 246 ? 0.4616 0.7257 0.5735 -0.0321 -0.0358 0.0380  247 ARG A NH2 
1893 N N   . ALA A 247 ? 0.4562 0.9024 0.5743 -0.0734 0.0080  0.0763  248 ALA A N   
1894 C CA  . ALA A 247 ? 0.4501 0.9095 0.5585 -0.0763 0.0152  0.0822  248 ALA A CA  
1895 C C   . ALA A 247 ? 0.4609 0.9537 0.5741 -0.1027 0.0194  0.0942  248 ALA A C   
1896 O O   . ALA A 247 ? 0.4457 0.9260 0.5466 -0.1175 0.0212  0.1058  248 ALA A O   
1897 C CB  . ALA A 247 ? 0.3297 0.8186 0.4375 -0.0520 0.0211  0.0708  248 ALA A CB  
1898 N N   . THR A 248 ? 0.4878 1.0224 0.6179 -0.1102 0.0203  0.0921  249 THR A N   
1899 C CA  . THR A 248 ? 0.5108 1.0821 0.6464 -0.1379 0.0246  0.1037  249 THR A CA  
1900 C C   . THR A 248 ? 0.5318 1.0608 0.6594 -0.1649 0.0172  0.1173  249 THR A C   
1901 O O   . THR A 248 ? 0.4868 1.0191 0.6057 -0.1875 0.0199  0.1311  249 THR A O   
1902 C CB  . THR A 248 ? 0.5312 1.1597 0.6888 -0.1391 0.0263  0.0972  249 THR A CB  
1903 O OG1 . THR A 248 ? 0.6378 1.3064 0.8010 -0.1125 0.0329  0.0845  249 THR A OG1 
1904 C CG2 . THR A 248 ? 0.4808 1.1497 0.6450 -0.1714 0.0306  0.1098  249 THR A CG2 
1905 N N   . GLN A 249 ? 0.5079 0.9953 0.6365 -0.1626 0.0076  0.1136  250 GLN A N   
1906 C CA  . GLN A 249 ? 0.5024 0.9461 0.6221 -0.1856 -0.0006 0.1246  250 GLN A CA  
1907 C C   . GLN A 249 ? 0.4884 0.8869 0.5877 -0.1849 -0.0019 0.1326  250 GLN A C   
1908 O O   . GLN A 249 ? 0.5500 0.9277 0.6380 -0.2076 -0.0053 0.1463  250 GLN A O   
1909 C CB  . GLN A 249 ? 0.4717 0.8832 0.5964 -0.1811 -0.0104 0.1170  250 GLN A CB  
1910 C CG  . GLN A 249 ? 0.6268 0.9981 0.7432 -0.2059 -0.0197 0.1269  250 GLN A CG  
1911 C CD  . GLN A 249 ? 0.8580 1.1895 0.9749 -0.1987 -0.0295 0.1184  250 GLN A CD  
1912 O OE1 . GLN A 249 ? 0.9004 1.2382 1.0249 -0.1776 -0.0292 0.1059  250 GLN A OE1 
1913 N NE2 . GLN A 249 ? 0.9264 1.2152 1.0331 -0.2161 -0.0385 0.1251  250 GLN A NE2 
1914 N N   . LEU A 250 ? 0.4530 0.8344 0.5463 -0.1596 -0.0004 0.1245  251 LEU A N   
1915 C CA  . LEU A 250 ? 0.5366 0.8815 0.6117 -0.1576 -0.0015 0.1314  251 LEU A CA  
1916 C C   . LEU A 250 ? 0.6191 0.9897 0.6853 -0.1732 0.0052  0.1438  251 LEU A C   
1917 O O   . LEU A 250 ? 0.6945 1.0360 0.7457 -0.1891 0.0011  0.1569  251 LEU A O   
1918 C CB  . LEU A 250 ? 0.5446 0.8771 0.6162 -0.1292 0.0001  0.1200  251 LEU A CB  
1919 C CG  . LEU A 250 ? 0.5345 0.8376 0.5885 -0.1262 -0.0007 0.1263  251 LEU A CG  
1920 C CD1 . LEU A 250 ? 0.5961 0.8473 0.6418 -0.1346 -0.0107 0.1329  251 LEU A CD1 
1921 C CD2 . LEU A 250 ? 0.4566 0.7552 0.5073 -0.1007 0.0017  0.1151  251 LEU A CD2 
1922 N N   . ALA A 251 ? 0.5811 1.0066 0.6552 -0.1684 0.0151  0.1396  252 ALA A N   
1923 C CA  . ALA A 251 ? 0.6295 1.0871 0.6954 -0.1838 0.0230  0.1507  252 ALA A CA  
1924 C C   . ALA A 251 ? 0.6414 1.1019 0.7060 -0.2181 0.0203  0.1662  252 ALA A C   
1925 O O   . ALA A 251 ? 0.5965 1.0480 0.6448 -0.2366 0.0209  0.1812  252 ALA A O   
1926 C CB  . ALA A 251 ? 0.6039 1.1252 0.6810 -0.1710 0.0342  0.1409  252 ALA A CB  
1927 N N   . HIS A 252 ? 0.6220 1.0936 0.7025 -0.2277 0.0165  0.1632  253 HIS A N   
1928 C CA  . HIS A 252 ? 0.6654 1.1384 0.7447 -0.2623 0.0128  0.1774  253 HIS A CA  
1929 C C   . HIS A 252 ? 0.7325 1.1365 0.7914 -0.2753 0.0014  0.1893  253 HIS A C   
1930 O O   . HIS A 252 ? 0.8310 1.2268 0.8767 -0.3034 -0.0006 0.2059  253 HIS A O   
1931 C CB  . HIS A 252 ? 0.6901 1.1851 0.7903 -0.2677 0.0093  0.1698  253 HIS A CB  
1932 C CG  . HIS A 252 ? 0.7824 1.2718 0.8809 -0.3040 0.0032  0.1832  253 HIS A CG  
1933 N ND1 . HIS A 252 ? 0.8711 1.4157 0.9766 -0.3300 0.0100  0.1921  253 HIS A ND1 
1934 C CD2 . HIS A 252 ? 0.8384 1.2730 0.9279 -0.3192 -0.0095 0.1888  253 HIS A CD2 
1935 C CE1 . HIS A 252 ? 0.9332 1.4548 1.0333 -0.3610 0.0012  0.2033  253 HIS A CE1 
1936 N NE2 . HIS A 252 ? 0.9400 1.3937 1.0300 -0.3548 -0.0110 0.2014  253 HIS A NE2 
1937 N N   . LEU A 253 ? 0.7526 1.1066 0.8078 -0.2550 -0.0064 0.1810  254 LEU A N   
1938 C CA  . LEU A 253 ? 0.7383 1.0269 0.7756 -0.2630 -0.0182 0.1896  254 LEU A CA  
1939 C C   . LEU A 253 ? 0.7526 1.0201 0.7684 -0.2631 -0.0175 0.2009  254 LEU A C   
1940 O O   . LEU A 253 ? 0.7632 0.9814 0.7616 -0.2748 -0.0276 0.2119  254 LEU A O   
1941 C CB  . LEU A 253 ? 0.5654 0.8135 0.6067 -0.2400 -0.0258 0.1761  254 LEU A CB  
1942 C CG  . LEU A 253 ? 0.5905 0.8432 0.6477 -0.2418 -0.0302 0.1664  254 LEU A CG  
1943 C CD1 . LEU A 253 ? 0.4978 0.7216 0.5588 -0.2150 -0.0342 0.1517  254 LEU A CD1 
1944 C CD2 . LEU A 253 ? 0.6374 0.8610 0.6872 -0.2700 -0.0404 0.1766  254 LEU A CD2 
1945 N N   . VAL A 254 ? 0.7166 1.0187 0.7321 -0.2496 -0.0070 0.1979  255 VAL A N   
1946 C CA  . VAL A 254 ? 0.7378 1.0245 0.7325 -0.2491 -0.0062 0.2080  255 VAL A CA  
1947 C C   . VAL A 254 ? 0.7483 1.0816 0.7364 -0.2692 0.0037  0.2200  255 VAL A C   
1948 O O   . VAL A 254 ? 0.8626 1.1972 0.8345 -0.2664 0.0074  0.2264  255 VAL A O   
1949 C CB  . VAL A 254 ? 0.6420 0.9236 0.6365 -0.2173 -0.0034 0.1952  255 VAL A CB  
1950 C CG1 . VAL A 254 ? 0.5892 0.8245 0.5882 -0.2001 -0.0131 0.1851  255 VAL A CG1 
1951 C CG2 . VAL A 254 ? 0.6291 0.9671 0.6388 -0.2021 0.0086  0.1821  255 VAL A CG2 
1952 N N   . GLY A 255 ? 0.7067 1.0810 0.7069 -0.2898 0.0083  0.2231  256 GLY A N   
1953 C CA  . GLY A 255 ? 0.7338 1.1540 0.7278 -0.3137 0.0176  0.2362  256 GLY A CA  
1954 C C   . GLY A 255 ? 0.7810 1.2742 0.7893 -0.3015 0.0328  0.2258  256 GLY A C   
1955 O O   . GLY A 255 ? 0.9284 1.4612 0.9284 -0.3171 0.0421  0.2357  256 GLY A O   
1956 N N   . CYS A 256 ? 0.7584 1.2703 0.7863 -0.2740 0.0355  0.2063  257 CYS A N   
1957 C CA  . CYS A 256 ? 0.7645 1.3426 0.8053 -0.2581 0.0486  0.1943  257 CYS A CA  
1958 C C   . CYS A 256 ? 0.9163 1.5389 0.9841 -0.2579 0.0507  0.1840  257 CYS A C   
1959 O O   . CYS A 256 ? 0.9933 1.5893 1.0721 -0.2475 0.0425  0.1751  257 CYS A O   
1960 C CB  . CYS A 256 ? 0.6887 1.2516 0.7259 -0.2220 0.0497  0.1792  257 CYS A CB  
1961 S SG  . CYS A 256 ? 0.6998 1.2133 0.7069 -0.2185 0.0462  0.1889  257 C