data_6CQX
# 
_entry.id   6CQX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CQX         
WWPDB D_1000233253 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 6CQY unspecified 
PDB . 6CQZ unspecified 
PDB . 6CQT unspecified 
PDB . 6CQU unspecified 
PDB . 6CQV unspecified 
PDB . 6CQW unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6CQX 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bester, S.M.' 1 ? 
'Guelta, M.A.' 2 ? 
'Pegan, S.D.'  3 ? 
'Height, J.J.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Chem. Res. Toxicol.' 
_citation.journal_id_ASTM           CRTOEC 
_citation.journal_id_CSD            2140 
_citation.journal_id_ISSN           1520-5010 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            31 
_citation.language                  ? 
_citation.page_first                1405 
_citation.page_last                 1417 
_citation.title                     
'Structural Insights of Stereospecific Inhibition of Human Acetylcholinesterase by VX and Subsequent Reactivation by HI-6.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.chemrestox.8b00294 
_citation.pdbx_database_id_PubMed   30462502 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bester, S.M.'     1 ?                   
primary 'Guelta, M.A.'     2 ?                   
primary 'Cheung, J.'       3 0000-0002-1014-0707 
primary 'Winemiller, M.D.' 4 0000-0001-7433-428X 
primary 'Bae, S.Y.'        5 ?                   
primary 'Myslinski, J.'    6 ?                   
primary 'Pegan, S.D.'      7 0000-0002-2958-5319 
primary 'Height, J.J.'     8 ?                   
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6CQX 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     104.934 
_cell.length_a_esd                 ? 
_cell.length_b                     104.934 
_cell.length_b_esd                 ? 
_cell.length_c                     323.903 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6CQX 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 59447.105 2   3.1.1.7 ? ? ? 
2 branched    syn 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   3 
?       ? ? ? 
3 non-polymer syn 'O-ETHYLMETHYLPHOSPHONIC ACID ESTER GROUP' 124.076   2   ?       ? ? ? 
4 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?       ? ? ? 
5 non-polymer nat '2-(2-(2-(2-(2-(2-ETHOXYETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHANOL' 310.384   1   ?       ? ? ? 
6 water       nat water 18.015    917 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   GLU n 
1 4   ASP n 
1 5   ALA n 
1 6   GLU n 
1 7   LEU n 
1 8   LEU n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  LEU n 
1 17  ARG n 
1 18  GLY n 
1 19  ILE n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  PRO n 
1 28  VAL n 
1 29  SER n 
1 30  ALA n 
1 31  PHE n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  PRO n 
1 36  PHE n 
1 37  ALA n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  MET n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  PRO n 
1 49  PRO n 
1 50  GLU n 
1 51  PRO n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  TRP n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  VAL n 
1 60  ASP n 
1 61  ALA n 
1 62  THR n 
1 63  THR n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  CYS n 
1 69  TYR n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  ASP n 
1 74  THR n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  PHE n 
1 80  GLU n 
1 81  GLY n 
1 82  THR n 
1 83  GLU n 
1 84  MET n 
1 85  TRP n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  SER n 
1 93  GLU n 
1 94  ASP n 
1 95  CYS n 
1 96  LEU n 
1 97  TYR n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 TYR n 
1 105 PRO n 
1 106 ARG n 
1 107 PRO n 
1 108 THR n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 VAL n 
1 114 LEU n 
1 115 VAL n 
1 116 TRP n 
1 117 ILE n 
1 118 TYR n 
1 119 GLY n 
1 120 GLY n 
1 121 GLY n 
1 122 PHE n 
1 123 TYR n 
1 124 SER n 
1 125 GLY n 
1 126 ALA n 
1 127 SER n 
1 128 SER n 
1 129 LEU n 
1 130 ASP n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 ARG n 
1 136 PHE n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 MET n 
1 149 ASN n 
1 150 TYR n 
1 151 ARG n 
1 152 VAL n 
1 153 GLY n 
1 154 ALA n 
1 155 PHE n 
1 156 GLY n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 PRO n 
1 162 GLY n 
1 163 SER n 
1 164 ARG n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 ASN n 
1 170 VAL n 
1 171 GLY n 
1 172 LEU n 
1 173 LEU n 
1 174 ASP n 
1 175 GLN n 
1 176 ARG n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 GLN n 
1 181 TRP n 
1 182 VAL n 
1 183 GLN n 
1 184 GLU n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 PHE n 
1 190 GLY n 
1 191 GLY n 
1 192 ASP n 
1 193 PRO n 
1 194 THR n 
1 195 SER n 
1 196 VAL n 
1 197 THR n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 GLU n 
1 202 SER n 
1 203 ALA n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 SER n 
1 208 VAL n 
1 209 GLY n 
1 210 MET n 
1 211 HIS n 
1 212 LEU n 
1 213 LEU n 
1 214 SER n 
1 215 PRO n 
1 216 PRO n 
1 217 SER n 
1 218 ARG n 
1 219 GLY n 
1 220 LEU n 
1 221 PHE n 
1 222 HIS n 
1 223 ARG n 
1 224 ALA n 
1 225 VAL n 
1 226 LEU n 
1 227 GLN n 
1 228 SER n 
1 229 GLY n 
1 230 ALA n 
1 231 PRO n 
1 232 ASN n 
1 233 GLY n 
1 234 PRO n 
1 235 TRP n 
1 236 ALA n 
1 237 THR n 
1 238 VAL n 
1 239 GLY n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 ALA n 
1 244 ARG n 
1 245 ARG n 
1 246 ARG n 
1 247 ALA n 
1 248 THR n 
1 249 GLN n 
1 250 LEU n 
1 251 ALA n 
1 252 HIS n 
1 253 LEU n 
1 254 VAL n 
1 255 GLY n 
1 256 CYS n 
1 257 PRO n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 GLY n 
1 263 GLY n 
1 264 ASN n 
1 265 ASP n 
1 266 THR n 
1 267 GLU n 
1 268 LEU n 
1 269 VAL n 
1 270 ALA n 
1 271 CYS n 
1 272 LEU n 
1 273 ARG n 
1 274 THR n 
1 275 ARG n 
1 276 PRO n 
1 277 ALA n 
1 278 GLN n 
1 279 VAL n 
1 280 LEU n 
1 281 VAL n 
1 282 ASN n 
1 283 HIS n 
1 284 GLU n 
1 285 TRP n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 PRO n 
1 290 GLN n 
1 291 GLU n 
1 292 SER n 
1 293 VAL n 
1 294 PHE n 
1 295 ARG n 
1 296 PHE n 
1 297 SER n 
1 298 PHE n 
1 299 VAL n 
1 300 PRO n 
1 301 VAL n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 ASP n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 ASP n 
1 310 THR n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 LEU n 
1 315 ILE n 
1 316 ASN n 
1 317 ALA n 
1 318 GLY n 
1 319 ASP n 
1 320 PHE n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 GLN n 
1 325 VAL n 
1 326 LEU n 
1 327 VAL n 
1 328 GLY n 
1 329 VAL n 
1 330 VAL n 
1 331 LYS n 
1 332 ASP n 
1 333 GLU n 
1 334 GLY n 
1 335 SER n 
1 336 TYR n 
1 337 PHE n 
1 338 LEU n 
1 339 VAL n 
1 340 TYR n 
1 341 GLY n 
1 342 ALA n 
1 343 PRO n 
1 344 GLY n 
1 345 PHE n 
1 346 SER n 
1 347 LYS n 
1 348 ASP n 
1 349 ASN n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ILE n 
1 354 SER n 
1 355 ARG n 
1 356 ALA n 
1 357 GLU n 
1 358 PHE n 
1 359 LEU n 
1 360 ALA n 
1 361 GLY n 
1 362 VAL n 
1 363 ARG n 
1 364 VAL n 
1 365 GLY n 
1 366 VAL n 
1 367 PRO n 
1 368 GLN n 
1 369 VAL n 
1 370 SER n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 VAL n 
1 378 VAL n 
1 379 LEU n 
1 380 HIS n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 TRP n 
1 385 LEU n 
1 386 HIS n 
1 387 PRO n 
1 388 GLU n 
1 389 ASP n 
1 390 PRO n 
1 391 ALA n 
1 392 ARG n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 SER n 
1 399 ASP n 
1 400 VAL n 
1 401 VAL n 
1 402 GLY n 
1 403 ASP n 
1 404 HIS n 
1 405 ASN n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 PRO n 
1 410 VAL n 
1 411 ALA n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 GLY n 
1 416 ARG n 
1 417 LEU n 
1 418 ALA n 
1 419 ALA n 
1 420 GLN n 
1 421 GLY n 
1 422 ALA n 
1 423 ARG n 
1 424 VAL n 
1 425 TYR n 
1 426 ALA n 
1 427 TYR n 
1 428 VAL n 
1 429 PHE n 
1 430 GLU n 
1 431 HIS n 
1 432 ARG n 
1 433 ALA n 
1 434 SER n 
1 435 THR n 
1 436 LEU n 
1 437 SER n 
1 438 TRP n 
1 439 PRO n 
1 440 LEU n 
1 441 TRP n 
1 442 MET n 
1 443 GLY n 
1 444 VAL n 
1 445 PRO n 
1 446 HIS n 
1 447 GLY n 
1 448 TYR n 
1 449 GLU n 
1 450 ILE n 
1 451 GLU n 
1 452 PHE n 
1 453 ILE n 
1 454 PHE n 
1 455 GLY n 
1 456 ILE n 
1 457 PRO n 
1 458 LEU n 
1 459 ASP n 
1 460 PRO n 
1 461 SER n 
1 462 ARG n 
1 463 ASN n 
1 464 TYR n 
1 465 THR n 
1 466 ALA n 
1 467 GLU n 
1 468 GLU n 
1 469 LYS n 
1 470 ILE n 
1 471 PHE n 
1 472 ALA n 
1 473 GLN n 
1 474 ARG n 
1 475 LEU n 
1 476 MET n 
1 477 ARG n 
1 478 TYR n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 ASP n 
1 488 PRO n 
1 489 ASN n 
1 490 GLU n 
1 491 PRO n 
1 492 ARG n 
1 493 ASP n 
1 494 PRO n 
1 495 LYS n 
1 496 ALA n 
1 497 PRO n 
1 498 GLN n 
1 499 TRP n 
1 500 PRO n 
1 501 PRO n 
1 502 TYR n 
1 503 THR n 
1 504 ALA n 
1 505 GLY n 
1 506 ALA n 
1 507 GLN n 
1 508 GLN n 
1 509 TYR n 
1 510 VAL n 
1 511 SER n 
1 512 LEU n 
1 513 ASP n 
1 514 LEU n 
1 515 ARG n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 VAL n 
1 520 ARG n 
1 521 ARG n 
1 522 GLY n 
1 523 LEU n 
1 524 ARG n 
1 525 ALA n 
1 526 GLN n 
1 527 ALA n 
1 528 CYS n 
1 529 ALA n 
1 530 PHE n 
1 531 TRP n 
1 532 ASN n 
1 533 ARG n 
1 534 PHE n 
1 535 LEU n 
1 536 PRO n 
1 537 LYS n 
1 538 LEU n 
1 539 LEU n 
1 540 SER n 
1 541 ALA n 
1 542 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   542 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           33 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6CQX A 1 ? 542 ? P22303 33 ? 574 ? 2 543 
2 1 6CQX B 1 ? 542 ? P22303 33 ? 574 ? 2 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
7PE non-polymer                   . '2-(2-(2-(2-(2-(2-ETHOXYETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHANOL' 
'POLYETHYLENE GLYCOL FRAGMENT' 'C14 H30 O7'     310.384 
ALA 'L-peptide linking'           y ALANINE                                                             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                                            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                                          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                                     ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE                                                            ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                                                ? 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                                           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                                     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                                             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                                           ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                                               ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                                          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                                             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                                              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                                                          ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose                            ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                                                       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                                             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                                              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                                           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                                          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                                            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                                              ? 'C5 H11 N O2'    117.146 
VX  non-polymer                   . 'O-ETHYLMETHYLPHOSPHONIC ACID ESTER GROUP'                          ? 'C3 H9 O3 P'     124.076 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CQX 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.33 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.59 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'15 to 21% PEG 3350, 0.17 - 0.21M potassium nitrate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-07-13 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6CQX 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.40 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       81653 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.4 
_reflns.pdbx_Rmerge_I_obs                0.070 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.044 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.4 
_reflns_shell.d_res_low                   2.44 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           7941 
_reflns_shell.percent_possible_all        95.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.362 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.241 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6CQX 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.400 
_refine.ls_d_res_low                             41.234 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     81623 
_refine.ls_number_reflns_R_free                  4059 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.64 
_refine.ls_percent_reflns_R_free                 4.97 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1567 
_refine.ls_R_factor_R_free                       0.1870 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1551 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4EY4 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 19.47 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.19 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8246 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         161 
_refine_hist.number_atoms_solvent             917 
_refine_hist.number_atoms_total               9324 
_refine_hist.d_res_high                       2.400 
_refine_hist.d_res_low                        41.234 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006 ? 8781  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.990 ? 12020 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 5.555 ? 6976  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.057 ? 1301  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007 ? 1576  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.4003 2.4286  . . 128 2542 95.00  . . . 0.2649 . 0.2307 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4286 2.4582  . . 129 2654 100.00 . . . 0.2259 . 0.2154 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4582 2.4893  . . 142 2635 100.00 . . . 0.2478 . 0.2063 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4893 2.5220  . . 145 2646 100.00 . . . 0.2349 . 0.2004 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5220 2.5566  . . 149 2641 100.00 . . . 0.2453 . 0.1932 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5566 2.5931  . . 155 2614 100.00 . . . 0.2253 . 0.1856 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5931 2.6318  . . 136 2663 100.00 . . . 0.2221 . 0.1875 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6318 2.6729  . . 160 2609 100.00 . . . 0.2437 . 0.1888 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6729 2.7167  . . 105 2679 100.00 . . . 0.2587 . 0.1776 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7167 2.7636  . . 147 2666 100.00 . . . 0.2169 . 0.1832 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7636 2.8138  . . 136 2625 100.00 . . . 0.2208 . 0.1776 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8138 2.8679  . . 149 2646 100.00 . . . 0.2375 . 0.1776 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8679 2.9265  . . 129 2708 100.00 . . . 0.2089 . 0.1752 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9265 2.9901  . . 110 2689 100.00 . . . 0.2380 . 0.1711 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9901 3.0596  . . 162 2604 100.00 . . . 0.1996 . 0.1597 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0596 3.1361  . . 131 2698 100.00 . . . 0.1962 . 0.1679 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1361 3.2209  . . 132 2644 100.00 . . . 0.1832 . 0.1721 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2209 3.3156  . . 160 2670 100.00 . . . 0.2085 . 0.1589 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3156 3.4226  . . 119 2673 100.00 . . . 0.2113 . 0.1519 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4226 3.5448  . . 134 2691 100.00 . . . 0.1971 . 0.1559 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5448 3.6867  . . 156 2682 100.00 . . . 0.1593 . 0.1447 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6867 3.8543  . . 120 2710 100.00 . . . 0.1705 . 0.1353 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8543 4.0574  . . 154 2700 100.00 . . . 0.1514 . 0.1246 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0574 4.3113  . . 145 2703 100.00 . . . 0.1461 . 0.1229 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3113 4.6438  . . 152 2686 100.00 . . . 0.1303 . 0.1142 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6438 5.1103  . . 147 2726 100.00 . . . 0.1633 . 0.1208 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1103 5.8480  . . 128 2783 100.00 . . . 0.1558 . 0.1471 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.8480 7.3611  . . 146 2770 100.00 . . . 0.1853 . 0.1623 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.3611 41.2404 . . 153 2807 96.00  . . . 0.1937 . 0.1651 . . . . . . . . . . 
# 
_struct.entry_id                     6CQX 
_struct.title                        'Crystal Structure of Recombinant Human Acetylcholinesterase Inhibited by VX(+)' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CQX 
_struct_keywords.text            Hydrolase 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 3 ? 
J N N 6 ? 
K N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 4   ? GLU A 6   ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  AA2 MET A 41  ? ARG A 45  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  AA3 PHE A 79  ? MET A 84  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  AA4 LEU A 129 ? ASP A 133 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 134 ? ARG A 142 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  AA6 VAL A 152 ? LEU A 158 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  AA7 ASN A 169 ? VAL A 186 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  AA8 ALA A 187 ? PHE A 189 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  AA9 SER A 202 ? LEU A 213 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 AB1 SER A 214 ? GLY A 219 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 AB2 GLY A 239 ? VAL A 254 ? GLY A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 AB3 ASN A 264 ? THR A 274 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 AB4 PRO A 276 ? GLU A 284 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 AB5 TRP A 285 ? LEU A 288 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 AB6 THR A 310 ? ALA A 317 ? THR A 311 ALA A 318 1 ? 8  
HELX_P HELX_P16 AB7 GLY A 334 ? VAL A 339 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 AB8 SER A 354 ? VAL A 366 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 AB9 SER A 370 ? THR A 382 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 AC1 ASP A 389 ? VAL A 406 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 AC2 VAL A 406 ? GLN A 420 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 AC3 PRO A 439 ? GLY A 443 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 AC4 GLU A 449 ? PHE A 454 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 AC5 GLY A 455 ? ASP A 459 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 AC6 THR A 465 ? GLY A 486 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 AC7 ARG A 524 ? ARG A 533 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 AC8 PHE A 534 ? SER A 540 ? PHE A 535 SER A 541 1 ? 7  
HELX_P HELX_P27 AC9 ASP B 4   ? GLU B 6   ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 AD1 MET B 41  ? ARG B 45  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 AD2 PHE B 79  ? MET B 84  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 AD3 LEU B 129 ? ASP B 133 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 AD4 GLY B 134 ? ARG B 142 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 AD5 VAL B 152 ? LEU B 158 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 AD6 ASN B 169 ? VAL B 186 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 AD7 ALA B 187 ? PHE B 189 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 AD8 SER B 202 ? LEU B 213 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 AD9 SER B 214 ? GLY B 219 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 AE1 MET B 240 ? VAL B 254 ? MET B 241 VAL B 255 1 ? 15 
HELX_P HELX_P38 AE2 ASP B 265 ? THR B 274 ? ASP B 266 THR B 275 1 ? 10 
HELX_P HELX_P39 AE3 PRO B 276 ? GLU B 284 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P40 AE4 TRP B 285 ? LEU B 288 ? TRP B 286 LEU B 289 5 ? 4  
HELX_P HELX_P41 AE5 THR B 310 ? GLY B 318 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 AE6 GLY B 334 ? VAL B 339 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 AE7 SER B 354 ? VAL B 366 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 AE8 SER B 370 ? TYR B 381 ? SER B 371 TYR B 382 1 ? 12 
HELX_P HELX_P45 AE9 ASP B 389 ? VAL B 406 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 AF1 VAL B 406 ? GLN B 420 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 AF2 PRO B 439 ? GLY B 443 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 AF3 GLU B 449 ? PHE B 454 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 AF4 GLY B 455 ? ASP B 459 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 AF5 THR B 465 ? GLY B 486 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 AF6 ARG B 524 ? ARG B 533 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 AF7 ARG B 533 ? SER B 540 ? ARG B 534 SER B 541 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 68  SG  ? ? ? 1_555 A CYS 95  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf2  disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 271 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 1.932 ? ?               
disulf3  disulf ?    ? A CYS 408 SG  ? ? ? 1_555 A CYS 528 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf4  disulf ?    ? B CYS 68  SG  ? ? ? 1_555 B CYS 95  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf5  disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 271 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 1.962 ? ?               
disulf6  disulf ?    ? B CYS 408 SG  ? ? ? 1_555 B CYS 528 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.049 ? ?               
covale1  covale one  ? A ASN 264 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 265 D NAG 1   1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale2  covale one  ? A ASN 349 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.468 ? N-Glycosylation 
covale3  covale one  ? A ASN 463 ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 464 A NAG 605 1_555 ? ? ? ? ? ? ? 1.549 ? N-Glycosylation 
covale4  covale one  ? B SER 202 OG  ? ? ? 1_555 I VX  .   P1 ? ? B SER 203 B VX  601 1_555 ? ? ? ? ? ? ? 1.412 ? ?               
covale5  covale one  ? B ASN 349 ND2 ? ? ? 1_555 E NAG .   C1 ? ? B ASN 350 E NAG 1   1_555 ? ? ? ? ? ? ? 1.281 ? N-Glycosylation 
covale6  covale none ? B ASN 349 ND2 ? ? ? 1_555 E NAG .   O5 ? ? B ASN 350 E NAG 1   1_555 ? ? ? ? ? ? ? 1.318 ? ?               
covale7  covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.440 ? ?               
covale8  covale one  ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale9  covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale10 covale one  ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? D NAG 1   D FUC 3   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale11 covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.440 ? ?               
covale12 covale one  ? E NAG .   O6  ? ? ? 1_555 E FUC .   C1 ? ? E NAG 1   E FUC 3   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 104 A . ? TYR 105 A PRO 105 A ? PRO 106 A 1 2.33   
2 CYS 256 A . ? CYS 257 A PRO 257 A ? PRO 258 A 1 -19.08 
3 TYR 104 B . ? TYR 105 B PRO 105 B ? PRO 106 B 1 -3.85  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
AA6 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
AA6 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 8   ? VAL A 11  ? LEU A 9   VAL A 12  
AA1 2  GLY A 14  ? ARG A 17  ? GLY A 15  ARG A 18  
AA1 3  VAL A 58  ? ASP A 60  ? VAL A 59  ASP A 61  
AA2 1  ILE A 19  ? LEU A 21  ? ILE A 20  LEU A 22  
AA2 2  VAL A 28  ? PRO A 35  ? VAL A 29  PRO A 36  
AA2 3  TYR A 97  ? PRO A 103 ? TYR A 98  PRO A 104 
AA2 4  VAL A 144 ? MET A 148 ? VAL A 145 MET A 149 
AA2 5  THR A 111 ? ILE A 117 ? THR A 112 ILE A 118 
AA2 6  GLY A 191 ? GLU A 201 ? GLY A 192 GLU A 202 
AA2 7  ARG A 223 ? GLN A 227 ? ARG A 224 GLN A 228 
AA2 8  GLN A 324 ? VAL A 330 ? GLN A 325 VAL A 331 
AA2 9  ARG A 423 ? PHE A 429 ? ARG A 424 PHE A 430 
AA2 10 GLN A 508 ? LEU A 512 ? GLN A 509 LEU A 513 
AA2 11 GLU A 518 ? ARG A 521 ? GLU A 519 ARG A 522 
AA3 1  VAL A 67  ? CYS A 68  ? VAL A 68  CYS A 69  
AA3 2  LEU A 91  ? SER A 92  ? LEU A 92  SER A 93  
AA4 1  LEU B 8   ? VAL B 11  ? LEU B 9   VAL B 12  
AA4 2  GLY B 14  ? ARG B 17  ? GLY B 15  ARG B 18  
AA4 3  VAL B 58  ? ASP B 60  ? VAL B 59  ASP B 61  
AA5 1  ILE B 19  ? LEU B 21  ? ILE B 20  LEU B 22  
AA5 2  VAL B 28  ? PRO B 35  ? VAL B 29  PRO B 36  
AA5 3  TYR B 97  ? PRO B 103 ? TYR B 98  PRO B 104 
AA5 4  VAL B 144 ? MET B 148 ? VAL B 145 MET B 149 
AA5 5  THR B 111 ? ILE B 117 ? THR B 112 ILE B 118 
AA5 6  GLY B 191 ? GLU B 201 ? GLY B 192 GLU B 202 
AA5 7  ARG B 223 ? GLN B 227 ? ARG B 224 GLN B 228 
AA5 8  GLN B 324 ? VAL B 330 ? GLN B 325 VAL B 331 
AA5 9  ARG B 423 ? PHE B 429 ? ARG B 424 PHE B 430 
AA5 10 GLN B 508 ? LEU B 512 ? GLN B 509 LEU B 513 
AA5 11 GLU B 518 ? ARG B 521 ? GLU B 519 ARG B 522 
AA6 1  VAL B 238 ? GLY B 239 ? VAL B 239 GLY B 240 
AA6 2  VAL B 301 ? VAL B 302 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 9   ? N VAL A 10  O LEU A 16  ? O LEU A 17  
AA1 2  3  N ARG A 15  ? N ARG A 16  O VAL A 59  ? O VAL A 60  
AA2 1  2  N ILE A 19  ? N ILE A 20  O ALA A 30  ? O ALA A 31  
AA2 2  3  N ILE A 34  ? N ILE A 35  O LEU A 98  ? O LEU A 99  
AA2 3  4  N ASN A 99  ? N ASN A 100 O SER A 147 ? O SER A 148 
AA2 4  5  O VAL A 144 ? O VAL A 145 N LEU A 114 ? N LEU A 115 
AA2 5  6  N VAL A 113 ? N VAL A 114 O SER A 195 ? O SER A 196 
AA2 6  7  N GLY A 200 ? N GLY A 201 O GLN A 227 ? O GLN A 228 
AA2 7  8  N LEU A 226 ? N LEU A 227 O LEU A 326 ? O LEU A 327 
AA2 8  9  N VAL A 327 ? N VAL A 328 O TYR A 425 ? O TYR A 426 
AA2 9  10 N VAL A 428 ? N VAL A 429 O LEU A 512 ? O LEU A 513 
AA2 10 11 N TYR A 509 ? N TYR A 510 O ARG A 520 ? O ARG A 521 
AA3 1  2  N VAL A 67  ? N VAL A 68  O SER A 92  ? O SER A 93  
AA4 1  2  N VAL B 9   ? N VAL B 10  O LEU B 16  ? O LEU B 17  
AA4 2  3  N ARG B 15  ? N ARG B 16  O VAL B 59  ? O VAL B 60  
AA5 1  2  N ILE B 19  ? N ILE B 20  O ALA B 30  ? O ALA B 31  
AA5 2  3  N SER B 29  ? N SER B 30  O THR B 102 ? O THR B 103 
AA5 3  4  N ASN B 99  ? N ASN B 100 O SER B 147 ? O SER B 148 
AA5 4  5  O VAL B 146 ? O VAL B 147 N LEU B 114 ? N LEU B 115 
AA5 5  6  N THR B 111 ? N THR B 112 O ASP B 192 ? O ASP B 193 
AA5 6  7  N LEU B 198 ? N LEU B 199 O VAL B 225 ? O VAL B 226 
AA5 7  8  N LEU B 226 ? N LEU B 227 O LEU B 326 ? O LEU B 327 
AA5 8  9  N VAL B 329 ? N VAL B 330 O PHE B 429 ? O PHE B 430 
AA5 9  10 N VAL B 428 ? N VAL B 429 O LEU B 512 ? O LEU B 513 
AA5 10 11 N TYR B 509 ? N TYR B 510 O ARG B 520 ? O ARG B 521 
AA6 1  2  N VAL B 238 ? N VAL B 239 O VAL B 302 ? O VAL B 303 
# 
_atom_sites.entry_id                    6CQX 
_atom_sites.fract_transf_matrix[1][1]   0.009530 
_atom_sites.fract_transf_matrix[1][2]   0.005502 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011004 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003087 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 2   ? -74.964 48.058  3.927   1.00 111.10 ? 3    ARG A N   1 
ATOM   2    C CA  . ARG A 1 2   ? -75.186 48.798  2.691   1.00 101.44 ? 3    ARG A CA  1 
ATOM   3    C C   . ARG A 1 2   ? -74.324 48.267  1.557   1.00 95.87  ? 3    ARG A C   1 
ATOM   4    O O   . ARG A 1 2   ? -73.205 48.695  1.374   1.00 95.85  ? 3    ARG A O   1 
ATOM   5    C CB  . ARG A 1 2   ? -74.928 50.287  2.906   1.00 98.57  ? 3    ARG A CB  1 
ATOM   6    C CG  . ARG A 1 2   ? -75.948 51.185  2.246   1.00 99.49  ? 3    ARG A CG  1 
ATOM   7    C CD  . ARG A 1 2   ? -75.813 52.626  2.693   1.00 101.59 ? 3    ARG A CD  1 
ATOM   8    N NE  . ARG A 1 2   ? -76.739 52.989  3.755   1.00 106.36 ? 3    ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 2   ? -78.044 53.205  3.591   1.00 110.57 ? 3    ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 2   ? -78.787 53.543  4.623   1.00 108.14 ? 3    ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 2   ? -78.609 53.087  2.405   1.00 114.02 ? 3    ARG A NH2 1 
ATOM   12   N N   . GLU A 1 3   ? -74.893 47.352  0.786   1.00 89.99  ? 4    GLU A N   1 
ATOM   13   C CA  . GLU A 1 3   ? -74.231 46.689  -0.328  1.00 82.64  ? 4    GLU A CA  1 
ATOM   14   C C   . GLU A 1 3   ? -75.129 46.748  -1.558  1.00 72.18  ? 4    GLU A C   1 
ATOM   15   O O   . GLU A 1 3   ? -76.309 47.102  -1.481  1.00 69.93  ? 4    GLU A O   1 
ATOM   16   C CB  . GLU A 1 3   ? -73.898 45.226  0.011   1.00 85.74  ? 4    GLU A CB  1 
ATOM   17   C CG  . GLU A 1 3   ? -72.826 45.045  1.084   1.00 89.60  ? 4    GLU A CG  1 
ATOM   18   C CD  . GLU A 1 3   ? -71.560 44.374  0.561   1.00 85.97  ? 4    GLU A CD  1 
ATOM   19   O OE1 . GLU A 1 3   ? -71.096 43.400  1.195   1.00 81.86  ? 4    GLU A OE1 1 
ATOM   20   O OE2 . GLU A 1 3   ? -71.025 44.820  -0.477  1.00 81.10  ? 4    GLU A OE2 1 
ATOM   21   N N   . ASP A 1 4   ? -74.553 46.398  -2.705  1.00 67.30  ? 5    ASP A N   1 
ATOM   22   C CA  . ASP A 1 4   ? -75.298 46.231  -3.947  1.00 59.71  ? 5    ASP A CA  1 
ATOM   23   C C   . ASP A 1 4   ? -75.465 44.739  -4.211  1.00 55.85  ? 5    ASP A C   1 
ATOM   24   O O   . ASP A 1 4   ? -74.477 44.031  -4.438  1.00 54.01  ? 5    ASP A O   1 
ATOM   25   C CB  . ASP A 1 4   ? -74.580 46.907  -5.114  1.00 63.35  ? 5    ASP A CB  1 
ATOM   26   C CG  . ASP A 1 4   ? -75.443 46.999  -6.365  1.00 65.80  ? 5    ASP A CG  1 
ATOM   27   O OD1 . ASP A 1 4   ? -75.186 47.901  -7.190  1.00 62.29  ? 5    ASP A OD1 1 
ATOM   28   O OD2 . ASP A 1 4   ? -76.377 46.182  -6.524  1.00 65.77  ? 5    ASP A OD2 1 
ATOM   29   N N   . ALA A 1 5   ? -76.714 44.266  -4.187  1.00 58.12  ? 6    ALA A N   1 
ATOM   30   C CA  . ALA A 1 5   ? -76.974 42.843  -4.376  1.00 55.03  ? 6    ALA A CA  1 
ATOM   31   C C   . ALA A 1 5   ? -76.464 42.349  -5.721  1.00 57.13  ? 6    ALA A C   1 
ATOM   32   O O   . ALA A 1 5   ? -76.087 41.177  -5.847  1.00 61.11  ? 6    ALA A O   1 
ATOM   33   C CB  . ALA A 1 5   ? -78.469 42.556  -4.251  1.00 52.19  ? 6    ALA A CB  1 
ATOM   34   N N   . GLU A 1 6   ? -76.444 43.219  -6.734  1.00 53.84  ? 7    GLU A N   1 
ATOM   35   C CA  . GLU A 1 6   ? -76.004 42.794  -8.058  1.00 53.36  ? 7    GLU A CA  1 
ATOM   36   C C   . GLU A 1 6   ? -74.525 42.436  -8.067  1.00 48.54  ? 7    GLU A C   1 
ATOM   37   O O   . GLU A 1 6   ? -74.091 41.612  -8.884  1.00 38.20  ? 7    GLU A O   1 
ATOM   38   C CB  . GLU A 1 6   ? -76.292 43.887  -9.088  1.00 59.72  ? 7    GLU A CB  1 
ATOM   39   C CG  . GLU A 1 6   ? -77.750 43.962  -9.528  1.00 71.58  ? 7    GLU A CG  1 
ATOM   40   C CD  . GLU A 1 6   ? -78.237 42.671  -10.161 1.00 79.44  ? 7    GLU A CD  1 
ATOM   41   O OE1 . GLU A 1 6   ? -79.384 42.264  -9.887  1.00 82.40  ? 7    GLU A OE1 1 
ATOM   42   O OE2 . GLU A 1 6   ? -77.472 42.063  -10.936 1.00 82.07  ? 7    GLU A OE2 1 
ATOM   43   N N   . LEU A 1 7   ? -73.738 43.028  -7.169  1.00 42.40  ? 8    LEU A N   1 
ATOM   44   C CA  . LEU A 1 7   ? -72.298 42.810  -7.157  1.00 46.65  ? 8    LEU A CA  1 
ATOM   45   C C   . LEU A 1 7   ? -71.875 41.724  -6.182  1.00 46.26  ? 8    LEU A C   1 
ATOM   46   O O   . LEU A 1 7   ? -70.675 41.554  -5.949  1.00 48.69  ? 8    LEU A O   1 
ATOM   47   C CB  . LEU A 1 7   ? -71.569 44.117  -6.843  1.00 44.47  ? 8    LEU A CB  1 
ATOM   48   C CG  . LEU A 1 7   ? -72.024 45.291  -7.716  1.00 45.74  ? 8    LEU A CG  1 
ATOM   49   C CD1 . LEU A 1 7   ? -71.348 46.579  -7.287  1.00 44.49  ? 8    LEU A CD1 1 
ATOM   50   C CD2 . LEU A 1 7   ? -71.758 45.003  -9.192  1.00 36.93  ? 8    LEU A CD2 1 
ATOM   51   N N   . LEU A 1 8   ? -72.828 40.984  -5.616  1.00 40.31  ? 9    LEU A N   1 
ATOM   52   C CA  . LEU A 1 8   ? -72.551 39.911  -4.667  1.00 45.66  ? 9    LEU A CA  1 
ATOM   53   C C   . LEU A 1 8   ? -72.996 38.591  -5.277  1.00 42.68  ? 9    LEU A C   1 
ATOM   54   O O   . LEU A 1 8   ? -74.175 38.421  -5.603  1.00 48.96  ? 9    LEU A O   1 
ATOM   55   C CB  . LEU A 1 8   ? -73.260 40.157  -3.330  1.00 36.84  ? 9    LEU A CB  1 
ATOM   56   C CG  . LEU A 1 8   ? -72.855 41.445  -2.609  1.00 43.07  ? 9    LEU A CG  1 
ATOM   57   C CD1 . LEU A 1 8   ? -73.659 41.649  -1.332  1.00 43.05  ? 9    LEU A CD1 1 
ATOM   58   C CD2 . LEU A 1 8   ? -71.374 41.425  -2.297  1.00 41.57  ? 9    LEU A CD2 1 
ATOM   59   N N   . VAL A 1 9   ? -72.056 37.662  -5.423  1.00 39.72  ? 10   VAL A N   1 
ATOM   60   C CA  . VAL A 1 9   ? -72.310 36.347  -5.991  1.00 43.55  ? 10   VAL A CA  1 
ATOM   61   C C   . VAL A 1 9   ? -71.642 35.312  -5.101  1.00 39.59  ? 10   VAL A C   1 
ATOM   62   O O   . VAL A 1 9   ? -70.568 35.552  -4.540  1.00 40.18  ? 10   VAL A O   1 
ATOM   63   C CB  . VAL A 1 9   ? -71.784 36.234  -7.445  1.00 44.07  ? 10   VAL A CB  1 
ATOM   64   C CG1 . VAL A 1 9   ? -71.945 34.819  -7.981  1.00 41.65  ? 10   VAL A CG1 1 
ATOM   65   C CG2 . VAL A 1 9   ? -72.500 37.215  -8.345  1.00 51.70  ? 10   VAL A CG2 1 
ATOM   66   N N   . THR A 1 10  ? -72.275 34.150  -4.979  1.00 41.58  ? 11   THR A N   1 
ATOM   67   C CA  . THR A 1 10  ? -71.709 33.023  -4.252  1.00 44.47  ? 11   THR A CA  1 
ATOM   68   C C   . THR A 1 10  ? -71.307 31.937  -5.239  1.00 42.09  ? 11   THR A C   1 
ATOM   69   O O   . THR A 1 10  ? -72.163 31.382  -5.936  1.00 40.78  ? 11   THR A O   1 
ATOM   70   C CB  . THR A 1 10  ? -72.705 32.478  -3.235  1.00 43.31  ? 11   THR A CB  1 
ATOM   71   O OG1 . THR A 1 10  ? -73.006 33.505  -2.285  1.00 47.44  ? 11   THR A OG1 1 
ATOM   72   C CG2 . THR A 1 10  ? -72.120 31.267  -2.512  1.00 40.44  ? 11   THR A CG2 1 
ATOM   73   N N   . VAL A 1 11  ? -70.058 31.583  -5.257  1.00 45.57  ? 12   VAL A N   1 
ATOM   74   C CA  . VAL A 1 11  ? -69.590 30.493  -6.067  1.00 43.55  ? 12   VAL A CA  1 
ATOM   75   C C   . VAL A 1 11  ? -69.333 29.294  -5.187  1.00 41.73  ? 12   VAL A C   1 
ATOM   76   O O   . VAL A 1 11  ? -69.474 29.355  -4.022  1.00 46.21  ? 12   VAL A O   1 
ATOM   77   C CB  . VAL A 1 11  ? -68.403 30.866  -6.943  1.00 37.74  ? 12   VAL A CB  1 
ATOM   78   C CG1 . VAL A 1 11  ? -68.876 31.723  -8.076  1.00 34.47  ? 12   VAL A CG1 1 
ATOM   79   C CG2 . VAL A 1 11  ? -67.337 31.533  -6.136  1.00 36.48  ? 12   VAL A CG2 1 
ATOM   80   N N   . ARG A 1 12  ? -68.930 28.187  -5.737  1.00 44.55  ? 13   ARG A N   1 
ATOM   81   C CA  . ARG A 1 12  ? -68.786 27.000  -4.901  1.00 47.51  ? 13   ARG A CA  1 
ATOM   82   C C   . ARG A 1 12  ? -67.733 27.195  -3.814  1.00 45.43  ? 13   ARG A C   1 
ATOM   83   O O   . ARG A 1 12  ? -67.844 26.599  -2.737  1.00 47.80  ? 13   ARG A O   1 
ATOM   84   C CB  . ARG A 1 12  ? -68.456 25.779  -5.764  1.00 51.73  ? 13   ARG A CB  1 
ATOM   85   C CG  . ARG A 1 12  ? -69.667 24.885  -6.011  1.00 70.67  ? 13   ARG A CG  1 
ATOM   86   C CD  . ARG A 1 12  ? -69.368 23.728  -6.953  1.00 85.91  ? 13   ARG A CD  1 
ATOM   87   N NE  . ARG A 1 12  ? -70.543 23.360  -7.742  1.00 96.73  ? 13   ARG A NE  1 
ATOM   88   C CZ  . ARG A 1 12  ? -70.610 22.305  -8.549  1.00 102.60 ? 13   ARG A CZ  1 
ATOM   89   N NH1 . ARG A 1 12  ? -69.568 21.495  -8.674  1.00 106.06 ? 13   ARG A NH1 1 
ATOM   90   N NH2 . ARG A 1 12  ? -71.723 22.056  -9.230  1.00 103.57 ? 13   ARG A NH2 1 
ATOM   91   N N   . GLY A 1 13  ? -66.725 28.035  -4.067  1.00 39.28  ? 14   GLY A N   1 
ATOM   92   C CA  . GLY A 1 13  ? -65.652 28.235  -3.110  1.00 45.94  ? 14   GLY A CA  1 
ATOM   93   C C   . GLY A 1 13  ? -65.949 29.239  -2.018  1.00 49.33  ? 14   GLY A C   1 
ATOM   94   O O   . GLY A 1 13  ? -65.275 29.227  -0.982  1.00 44.92  ? 14   GLY A O   1 
ATOM   95   N N   . GLY A 1 14  ? -66.933 30.103  -2.219  1.00 49.40  ? 15   GLY A N   1 
ATOM   96   C CA  . GLY A 1 14  ? -67.287 31.104  -1.236  1.00 41.90  ? 15   GLY A CA  1 
ATOM   97   C C   . GLY A 1 14  ? -67.919 32.305  -1.911  1.00 45.33  ? 15   GLY A C   1 
ATOM   98   O O   . GLY A 1 14  ? -68.362 32.228  -3.050  1.00 44.40  ? 15   GLY A O   1 
ATOM   99   N N   . ARG A 1 15  ? -67.938 33.421  -1.190  1.00 44.92  ? 16   ARG A N   1 
ATOM   100  C CA  . ARG A 1 15  ? -68.622 34.622  -1.648  1.00 45.42  ? 16   ARG A CA  1 
ATOM   101  C C   . ARG A 1 15  ? -67.665 35.558  -2.378  1.00 41.62  ? 16   ARG A C   1 
ATOM   102  O O   . ARG A 1 15  ? -66.487 35.666  -2.024  1.00 41.91  ? 16   ARG A O   1 
ATOM   103  C CB  . ARG A 1 15  ? -69.278 35.344  -0.472  1.00 45.61  ? 16   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 15  ? -70.573 34.682  -0.029  1.00 49.89  ? 16   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 15  ? -71.164 35.366  1.192   1.00 47.99  ? 16   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 15  ? -70.366 35.093  2.380   1.00 58.71  ? 16   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 15  ? -70.236 35.931  3.402   1.00 65.54  ? 16   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 15  ? -70.857 37.105  3.384   1.00 62.91  ? 16   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 15  ? -69.482 35.595  4.442   1.00 66.31  ? 16   ARG A NH2 1 
ATOM   110  N N   . LEU A 1 16  ? -68.184 36.227  -3.406  1.00 41.35  ? 17   LEU A N   1 
ATOM   111  C CA  . LEU A 1 16  ? -67.440 37.206  -4.183  1.00 41.25  ? 17   LEU A CA  1 
ATOM   112  C C   . LEU A 1 16  ? -68.166 38.540  -4.162  1.00 40.58  ? 17   LEU A C   1 
ATOM   113  O O   . LEU A 1 16  ? -69.397 38.596  -4.065  1.00 33.36  ? 17   LEU A O   1 
ATOM   114  C CB  . LEU A 1 16  ? -67.265 36.776  -5.647  1.00 34.17  ? 17   LEU A CB  1 
ATOM   115  C CG  . LEU A 1 16  ? -66.678 35.402  -5.927  1.00 38.31  ? 17   LEU A CG  1 
ATOM   116  C CD1 . LEU A 1 16  ? -66.758 35.066  -7.426  1.00 30.22  ? 17   LEU A CD1 1 
ATOM   117  C CD2 . LEU A 1 16  ? -65.249 35.396  -5.440  1.00 41.67  ? 17   LEU A CD2 1 
ATOM   118  N N   . ARG A 1 17  ? -67.393 39.615  -4.268  1.00 29.93  ? 18   ARG A N   1 
ATOM   119  C CA  . ARG A 1 17  ? -67.949 40.943  -4.473  1.00 30.45  ? 18   ARG A CA  1 
ATOM   120  C C   . ARG A 1 17  ? -67.291 41.545  -5.703  1.00 36.99  ? 18   ARG A C   1 
ATOM   121  O O   . ARG A 1 17  ? -66.063 41.515  -5.835  1.00 30.24  ? 18   ARG A O   1 
ATOM   122  C CB  . ARG A 1 17  ? -67.747 41.841  -3.253  1.00 34.75  ? 18   ARG A CB  1 
ATOM   123  C CG  . ARG A 1 17  ? -67.856 43.322  -3.555  1.00 38.31  ? 18   ARG A CG  1 
ATOM   124  C CD  . ARG A 1 17  ? -67.480 44.161  -2.348  1.00 41.81  ? 18   ARG A CD  1 
ATOM   125  N NE  . ARG A 1 17  ? -68.213 43.771  -1.138  1.00 45.49  ? 18   ARG A NE  1 
ATOM   126  C CZ  . ARG A 1 17  ? -67.663 43.187  -0.072  1.00 46.81  ? 18   ARG A CZ  1 
ATOM   127  N NH1 . ARG A 1 17  ? -66.365 42.910  -0.043  1.00 40.21  ? 18   ARG A NH1 1 
ATOM   128  N NH2 . ARG A 1 17  ? -68.413 42.877  0.976   1.00 47.36  ? 18   ARG A NH2 1 
ATOM   129  N N   . GLY A 1 18  ? -68.112 42.062  -6.615  1.00 40.30  ? 19   GLY A N   1 
ATOM   130  C CA  . GLY A 1 18  ? -67.640 42.605  -7.863  1.00 33.08  ? 19   GLY A CA  1 
ATOM   131  C C   . GLY A 1 18  ? -67.730 44.117  -7.905  1.00 39.11  ? 19   GLY A C   1 
ATOM   132  O O   . GLY A 1 18  ? -68.000 44.786  -6.906  1.00 41.95  ? 19   GLY A O   1 
ATOM   133  N N   . ILE A 1 19  ? -67.497 44.649  -9.097  1.00 42.30  ? 20   ILE A N   1 
ATOM   134  C CA  . ILE A 1 19  ? -67.482 46.081  -9.346  1.00 45.85  ? 20   ILE A CA  1 
ATOM   135  C C   . ILE A 1 19  ? -68.424 46.362  -10.511 1.00 46.79  ? 20   ILE A C   1 
ATOM   136  O O   . ILE A 1 19  ? -68.635 45.517  -11.387 1.00 45.33  ? 20   ILE A O   1 
ATOM   137  C CB  . ILE A 1 19  ? -66.040 46.585  -9.629  1.00 50.26  ? 20   ILE A CB  1 
ATOM   138  C CG1 . ILE A 1 19  ? -65.928 48.099  -9.458  1.00 59.34  ? 20   ILE A CG1 1 
ATOM   139  C CG2 . ILE A 1 19  ? -65.557 46.164  -11.021 1.00 34.31  ? 20   ILE A CG2 1 
ATOM   140  C CD1 . ILE A 1 19  ? -64.557 48.650  -9.833  1.00 64.75  ? 20   ILE A CD1 1 
ATOM   141  N N   . ARG A 1 20  ? -69.020 47.540  -10.505 1.00 46.37  ? 21   ARG A N   1 
ATOM   142  C CA  . ARG A 1 20  ? -69.973 47.930  -11.535 1.00 46.84  ? 21   ARG A CA  1 
ATOM   143  C C   . ARG A 1 20  ? -69.289 48.903  -12.489 1.00 43.75  ? 21   ARG A C   1 
ATOM   144  O O   . ARG A 1 20  ? -68.950 50.025  -12.103 1.00 43.66  ? 21   ARG A O   1 
ATOM   145  C CB  . ARG A 1 20  ? -71.217 48.550  -10.913 1.00 39.97  ? 21   ARG A CB  1 
ATOM   146  C CG  . ARG A 1 20  ? -72.156 49.129  -11.933 1.00 46.35  ? 21   ARG A CG  1 
ATOM   147  C CD  . ARG A 1 20  ? -73.095 50.127  -11.305 1.00 58.41  ? 21   ARG A CD  1 
ATOM   148  N NE  . ARG A 1 20  ? -73.579 51.075  -12.302 1.00 70.02  ? 21   ARG A NE  1 
ATOM   149  C CZ  . ARG A 1 20  ? -74.751 51.693  -12.231 1.00 69.52  ? 21   ARG A CZ  1 
ATOM   150  N NH1 . ARG A 1 20  ? -75.558 51.460  -11.207 1.00 77.73  ? 21   ARG A NH1 1 
ATOM   151  N NH2 . ARG A 1 20  ? -75.119 52.539  -13.186 1.00 62.54  ? 21   ARG A NH2 1 
ATOM   152  N N   . LEU A 1 21  ? -69.094 48.476  -13.732 1.00 44.16  ? 22   LEU A N   1 
ATOM   153  C CA  . LEU A 1 21  ? -68.380 49.271  -14.721 1.00 45.47  ? 22   LEU A CA  1 
ATOM   154  C C   . LEU A 1 21  ? -69.340 50.076  -15.581 1.00 46.58  ? 22   LEU A C   1 
ATOM   155  O O   . LEU A 1 21  ? -70.397 49.583  -15.991 1.00 40.39  ? 22   LEU A O   1 
ATOM   156  C CB  . LEU A 1 21  ? -67.523 48.393  -15.626 1.00 42.39  ? 22   LEU A CB  1 
ATOM   157  C CG  . LEU A 1 21  ? -66.426 47.579  -14.963 1.00 45.00  ? 22   LEU A CG  1 
ATOM   158  C CD1 . LEU A 1 21  ? -65.891 46.615  -15.995 1.00 46.92  ? 22   LEU A CD1 1 
ATOM   159  C CD2 . LEU A 1 21  ? -65.335 48.497  -14.446 1.00 40.00  ? 22   LEU A CD2 1 
ATOM   160  N N   . LYS A 1 22  ? -68.870 51.220  -15.984 1.00 48.59  ? 23   LYS A N   1 
ATOM   161  C CA  . LYS A 1 22  ? -69.594 52.046  -16.870 1.00 47.75  ? 23   LYS A CA  1 
ATOM   162  C C   . LYS A 1 22  ? -69.179 51.751  -18.293 1.00 46.87  ? 23   LYS A C   1 
ATOM   163  O O   . LYS A 1 22  ? -68.050 51.521  -18.568 1.00 49.94  ? 23   LYS A O   1 
ATOM   164  C CB  . LYS A 1 22  ? -69.254 53.491  -16.582 1.00 53.54  ? 23   LYS A CB  1 
ATOM   165  C CG  . LYS A 1 22  ? -69.999 54.088  -15.427 1.00 63.41  ? 23   LYS A CG  1 
ATOM   166  C CD  . LYS A 1 22  ? -69.225 55.236  -14.820 1.00 72.75  ? 23   LYS A CD  1 
ATOM   167  C CE  . LYS A 1 22  ? -69.970 55.874  -13.668 1.00 80.04  ? 23   LYS A CE  1 
ATOM   168  N NZ  . LYS A 1 22  ? -69.058 56.507  -12.676 1.00 83.81  ? 23   LYS A NZ  1 
ATOM   169  N N   . THR A 1 23  ? -70.125 51.702  -19.186 1.00 42.80  ? 24   THR A N   1 
ATOM   170  C CA  . THR A 1 23  ? -69.845 51.554  -20.605 1.00 52.10  ? 24   THR A CA  1 
ATOM   171  C C   . THR A 1 23  ? -70.667 52.601  -21.337 1.00 55.82  ? 24   THR A C   1 
ATOM   172  O O   . THR A 1 23  ? -71.618 53.152  -20.775 1.00 55.72  ? 24   THR A O   1 
ATOM   173  C CB  . THR A 1 23  ? -70.194 50.153  -21.139 1.00 48.90  ? 24   THR A CB  1 
ATOM   174  O OG1 . THR A 1 23  ? -71.604 50.074  -21.384 1.00 49.57  ? 24   THR A OG1 1 
ATOM   175  C CG2 . THR A 1 23  ? -69.775 49.049  -20.162 1.00 48.94  ? 24   THR A CG2 1 
ATOM   176  N N   . PRO A 1 24  ? -70.316 52.917  -22.587 1.00 57.38  ? 25   PRO A N   1 
ATOM   177  C CA  . PRO A 1 24  ? -71.164 53.839  -23.358 1.00 60.88  ? 25   PRO A CA  1 
ATOM   178  C C   . PRO A 1 24  ? -72.610 53.387  -23.458 1.00 61.58  ? 25   PRO A C   1 
ATOM   179  O O   . PRO A 1 24  ? -73.509 54.234  -23.504 1.00 67.95  ? 25   PRO A O   1 
ATOM   180  C CB  . PRO A 1 24  ? -70.485 53.869  -24.732 1.00 67.09  ? 25   PRO A CB  1 
ATOM   181  C CG  . PRO A 1 24  ? -69.061 53.571  -24.442 1.00 67.08  ? 25   PRO A CG  1 
ATOM   182  C CD  . PRO A 1 24  ? -69.065 52.597  -23.298 1.00 61.57  ? 25   PRO A CD  1 
ATOM   183  N N   . GLY A 1 25  ? -72.870 52.081  -23.478 1.00 57.85  ? 26   GLY A N   1 
ATOM   184  C CA  . GLY A 1 25  ? -74.236 51.608  -23.560 1.00 59.05  ? 26   GLY A CA  1 
ATOM   185  C C   . GLY A 1 25  ? -74.943 51.398  -22.239 1.00 62.79  ? 26   GLY A C   1 
ATOM   186  O O   . GLY A 1 25  ? -76.152 51.151  -22.228 1.00 73.72  ? 26   GLY A O   1 
ATOM   187  N N   . GLY A 1 26  ? -74.229 51.482  -21.119 1.00 50.73  ? 27   GLY A N   1 
ATOM   188  C CA  . GLY A 1 26  ? -74.833 51.274  -19.825 1.00 51.44  ? 27   GLY A CA  1 
ATOM   189  C C   . GLY A 1 26  ? -73.973 50.416  -18.919 1.00 50.14  ? 27   GLY A C   1 
ATOM   190  O O   . GLY A 1 26  ? -72.884 49.971  -19.294 1.00 47.94  ? 27   GLY A O   1 
ATOM   191  N N   . PRO A 1 27  ? -74.458 50.156  -17.709 1.00 46.14  ? 28   PRO A N   1 
ATOM   192  C CA  . PRO A 1 27  ? -73.650 49.428  -16.727 1.00 41.15  ? 28   PRO A CA  1 
ATOM   193  C C   . PRO A 1 27  ? -73.557 47.940  -17.030 1.00 42.17  ? 28   PRO A C   1 
ATOM   194  O O   . PRO A 1 27  ? -74.488 47.321  -17.550 1.00 43.69  ? 28   PRO A O   1 
ATOM   195  C CB  . PRO A 1 27  ? -74.407 49.668  -15.416 1.00 42.04  ? 28   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 27  ? -75.837 49.798  -15.852 1.00 39.94  ? 28   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 27  ? -75.792 50.500  -17.186 1.00 45.92  ? 28   PRO A CD  1 
ATOM   198  N N   . VAL A 1 28  ? -72.398 47.370  -16.701 1.00 38.28  ? 29   VAL A N   1 
ATOM   199  C CA  . VAL A 1 28  ? -72.214 45.928  -16.662 1.00 35.98  ? 29   VAL A CA  1 
ATOM   200  C C   . VAL A 1 28  ? -71.559 45.588  -15.329 1.00 35.92  ? 29   VAL A C   1 
ATOM   201  O O   . VAL A 1 28  ? -70.918 46.428  -14.695 1.00 38.87  ? 29   VAL A O   1 
ATOM   202  C CB  . VAL A 1 28  ? -71.368 45.381  -17.843 1.00 41.51  ? 29   VAL A CB  1 
ATOM   203  C CG1 . VAL A 1 28  ? -71.797 46.007  -19.188 1.00 41.33  ? 29   VAL A CG1 1 
ATOM   204  C CG2 . VAL A 1 28  ? -69.899 45.599  -17.598 1.00 36.99  ? 29   VAL A CG2 1 
ATOM   205  N N   . SER A 1 29  ? -71.746 44.345  -14.895 1.00 34.88  ? 30   SER A N   1 
ATOM   206  C CA  . SER A 1 29  ? -71.125 43.845  -13.677 1.00 37.47  ? 30   SER A CA  1 
ATOM   207  C C   . SER A 1 29  ? -69.854 43.092  -14.033 1.00 38.63  ? 30   SER A C   1 
ATOM   208  O O   . SER A 1 29  ? -69.858 42.252  -14.938 1.00 37.89  ? 30   SER A O   1 
ATOM   209  C CB  . SER A 1 29  ? -72.072 42.935  -12.897 1.00 36.72  ? 30   SER A CB  1 
ATOM   210  O OG  . SER A 1 29  ? -73.250 43.629  -12.534 1.00 38.73  ? 30   SER A OG  1 
ATOM   211  N N   . ALA A 1 30  ? -68.774 43.393  -13.317 1.00 36.89  ? 31   ALA A N   1 
ATOM   212  C CA  . ALA A 1 30  ? -67.485 42.763  -13.548 1.00 33.17  ? 31   ALA A CA  1 
ATOM   213  C C   . ALA A 1 30  ? -66.977 42.162  -12.246 1.00 37.21  ? 31   ALA A C   1 
ATOM   214  O O   . ALA A 1 30  ? -67.033 42.801  -11.189 1.00 33.13  ? 31   ALA A O   1 
ATOM   215  C CB  . ALA A 1 30  ? -66.472 43.765  -14.106 1.00 26.90  ? 31   ALA A CB  1 
ATOM   216  N N   . PHE A 1 31  ? -66.498 40.930  -12.330 1.00 34.12  ? 32   PHE A N   1 
ATOM   217  C CA  . PHE A 1 31  ? -65.883 40.218  -11.221 1.00 26.79  ? 32   PHE A CA  1 
ATOM   218  C C   . PHE A 1 31  ? -64.472 39.881  -11.696 1.00 31.14  ? 32   PHE A C   1 
ATOM   219  O O   . PHE A 1 31  ? -64.253 38.864  -12.358 1.00 29.39  ? 32   PHE A O   1 
ATOM   220  C CB  . PHE A 1 31  ? -66.698 38.986  -10.851 1.00 30.37  ? 32   PHE A CB  1 
ATOM   221  C CG  . PHE A 1 31  ? -68.080 39.310  -10.368 1.00 36.49  ? 32   PHE A CG  1 
ATOM   222  C CD1 . PHE A 1 31  ? -68.347 39.398  -9.012  1.00 35.64  ? 32   PHE A CD1 1 
ATOM   223  C CD2 . PHE A 1 31  ? -69.108 39.551  -11.268 1.00 34.18  ? 32   PHE A CD2 1 
ATOM   224  C CE1 . PHE A 1 31  ? -69.615 39.713  -8.556  1.00 36.73  ? 32   PHE A CE1 1 
ATOM   225  C CE2 . PHE A 1 31  ? -70.380 39.864  -10.820 1.00 39.42  ? 32   PHE A CE2 1 
ATOM   226  C CZ  . PHE A 1 31  ? -70.632 39.945  -9.460  1.00 40.54  ? 32   PHE A CZ  1 
ATOM   227  N N   . LEU A 1 32  ? -63.529 40.765  -11.381 1.00 30.81  ? 33   LEU A N   1 
ATOM   228  C CA  . LEU A 1 32  ? -62.170 40.707  -11.898 1.00 31.12  ? 33   LEU A CA  1 
ATOM   229  C C   . LEU A 1 32  ? -61.251 40.051  -10.873 1.00 30.90  ? 33   LEU A C   1 
ATOM   230  O O   . LEU A 1 32  ? -61.260 40.424  -9.699  1.00 32.32  ? 33   LEU A O   1 
ATOM   231  C CB  . LEU A 1 32  ? -61.673 42.117  -12.219 1.00 33.50  ? 33   LEU A CB  1 
ATOM   232  C CG  . LEU A 1 32  ? -62.514 42.975  -13.169 1.00 31.95  ? 33   LEU A CG  1 
ATOM   233  C CD1 . LEU A 1 32  ? -61.779 44.258  -13.525 1.00 30.98  ? 33   LEU A CD1 1 
ATOM   234  C CD2 . LEU A 1 32  ? -62.872 42.190  -14.428 1.00 23.35  ? 33   LEU A CD2 1 
ATOM   235  N N   . GLY A 1 33  ? -60.450 39.090  -11.316 1.00 33.51  ? 34   GLY A N   1 
ATOM   236  C CA  . GLY A 1 33  ? -59.502 38.464  -10.416 1.00 30.36  ? 34   GLY A CA  1 
ATOM   237  C C   . GLY A 1 33  ? -60.118 37.462  -9.459  1.00 30.76  ? 34   GLY A C   1 
ATOM   238  O O   . GLY A 1 33  ? -59.875 37.525  -8.251  1.00 27.84  ? 34   GLY A O   1 
ATOM   239  N N   . ILE A 1 34  ? -60.916 36.537  -9.978  1.00 31.00  ? 35   ILE A N   1 
ATOM   240  C CA  . ILE A 1 34  ? -61.466 35.461  -9.151  1.00 29.07  ? 35   ILE A CA  1 
ATOM   241  C C   . ILE A 1 34  ? -60.447 34.327  -9.084  1.00 34.56  ? 35   ILE A C   1 
ATOM   242  O O   . ILE A 1 34  ? -60.000 33.848  -10.137 1.00 36.40  ? 35   ILE A O   1 
ATOM   243  C CB  . ILE A 1 34  ? -62.791 34.968  -9.720  1.00 29.68  ? 35   ILE A CB  1 
ATOM   244  C CG1 . ILE A 1 34  ? -63.806 36.114  -9.790  1.00 30.79  ? 35   ILE A CG1 1 
ATOM   245  C CG2 . ILE A 1 34  ? -63.318 33.791  -8.910  1.00 26.74  ? 35   ILE A CG2 1 
ATOM   246  C CD1 . ILE A 1 34  ? -65.019 35.803  -10.646 1.00 32.68  ? 35   ILE A CD1 1 
ATOM   247  N N   . PRO A 1 35  ? -60.047 33.880  -7.896  1.00 34.01  ? 36   PRO A N   1 
ATOM   248  C CA  . PRO A 1 35  ? -59.086 32.772  -7.826  1.00 34.65  ? 36   PRO A CA  1 
ATOM   249  C C   . PRO A 1 35  ? -59.762 31.465  -8.207  1.00 35.19  ? 36   PRO A C   1 
ATOM   250  O O   . PRO A 1 35  ? -60.803 31.105  -7.653  1.00 36.57  ? 36   PRO A O   1 
ATOM   251  C CB  . PRO A 1 35  ? -58.637 32.778  -6.359  1.00 34.18  ? 36   PRO A CB  1 
ATOM   252  C CG  . PRO A 1 35  ? -59.800 33.363  -5.612  1.00 31.95  ? 36   PRO A CG  1 
ATOM   253  C CD  . PRO A 1 35  ? -60.455 34.355  -6.561  1.00 30.65  ? 36   PRO A CD  1 
ATOM   254  N N   . PHE A 1 36  ? -59.178 30.761  -9.176  1.00 29.64  ? 37   PHE A N   1 
ATOM   255  C CA  . PHE A 1 36  ? -59.708 29.458  -9.546  1.00 31.81  ? 37   PHE A CA  1 
ATOM   256  C C   . PHE A 1 36  ? -58.748 28.311  -9.269  1.00 32.24  ? 37   PHE A C   1 
ATOM   257  O O   . PHE A 1 36  ? -59.150 27.149  -9.392  1.00 38.57  ? 37   PHE A O   1 
ATOM   258  C CB  . PHE A 1 36  ? -60.145 29.445  -11.021 1.00 32.01  ? 37   PHE A CB  1 
ATOM   259  C CG  . PHE A 1 36  ? -59.016 29.510  -12.018 1.00 28.62  ? 37   PHE A CG  1 
ATOM   260  C CD1 . PHE A 1 36  ? -58.436 28.343  -12.516 1.00 28.88  ? 37   PHE A CD1 1 
ATOM   261  C CD2 . PHE A 1 36  ? -58.577 30.733  -12.507 1.00 26.61  ? 37   PHE A CD2 1 
ATOM   262  C CE1 . PHE A 1 36  ? -57.415 28.399  -13.465 1.00 34.52  ? 37   PHE A CE1 1 
ATOM   263  C CE2 . PHE A 1 36  ? -57.555 30.801  -13.461 1.00 32.88  ? 37   PHE A CE2 1 
ATOM   264  C CZ  . PHE A 1 36  ? -56.974 29.630  -13.943 1.00 30.32  ? 37   PHE A CZ  1 
ATOM   265  N N   . ALA A 1 37  ? -57.514 28.600  -8.862  1.00 30.86  ? 38   ALA A N   1 
ATOM   266  C CA  . ALA A 1 37  ? -56.567 27.570  -8.456  1.00 26.90  ? 38   ALA A CA  1 
ATOM   267  C C   . ALA A 1 37  ? -55.776 28.064  -7.256  1.00 34.06  ? 38   ALA A C   1 
ATOM   268  O O   . ALA A 1 37  ? -55.658 29.268  -7.020  1.00 33.77  ? 38   ALA A O   1 
ATOM   269  C CB  . ALA A 1 37  ? -55.598 27.202  -9.587  1.00 24.21  ? 38   ALA A CB  1 
ATOM   270  N N   . GLU A 1 38  ? -55.237 27.116  -6.498  1.00 33.74  ? 39   GLU A N   1 
ATOM   271  C CA  . GLU A 1 38  ? -54.238 27.462  -5.502  1.00 32.61  ? 39   GLU A CA  1 
ATOM   272  C C   . GLU A 1 38  ? -53.019 28.060  -6.199  1.00 33.99  ? 39   GLU A C   1 
ATOM   273  O O   . GLU A 1 38  ? -52.649 27.610  -7.289  1.00 39.53  ? 39   GLU A O   1 
ATOM   274  C CB  . GLU A 1 38  ? -53.831 26.230  -4.694  1.00 37.56  ? 39   GLU A CB  1 
ATOM   275  C CG  . GLU A 1 38  ? -54.931 25.720  -3.804  1.00 46.48  ? 39   GLU A CG  1 
ATOM   276  C CD  . GLU A 1 38  ? -55.282 26.707  -2.711  1.00 51.98  ? 39   GLU A CD  1 
ATOM   277  O OE1 . GLU A 1 38  ? -54.348 27.272  -2.102  1.00 56.69  ? 39   GLU A OE1 1 
ATOM   278  O OE2 . GLU A 1 38  ? -56.490 26.926  -2.465  1.00 52.28  ? 39   GLU A OE2 1 
ATOM   279  N N   . PRO A 1 39  ? -52.386 29.027  -5.598  1.00 37.85  ? 40   PRO A N   1 
ATOM   280  C CA  . PRO A 1 39  ? -51.265 29.620  -6.288  1.00 31.08  ? 40   PRO A CA  1 
ATOM   281  C C   . PRO A 1 39  ? -50.162 28.631  -6.570  1.00 35.23  ? 40   PRO A C   1 
ATOM   282  O O   . PRO A 1 39  ? -49.670 28.010  -5.702  1.00 31.84  ? 40   PRO A O   1 
ATOM   283  C CB  . PRO A 1 39  ? -50.813 30.682  -5.310  1.00 30.57  ? 40   PRO A CB  1 
ATOM   284  C CG  . PRO A 1 39  ? -52.040 31.068  -4.624  1.00 30.02  ? 40   PRO A CG  1 
ATOM   285  C CD  . PRO A 1 39  ? -52.832 29.831  -4.471  1.00 32.37  ? 40   PRO A CD  1 
ATOM   286  N N   . PRO A 1 40  ? -49.719 28.546  -7.808  1.00 32.64  ? 41   PRO A N   1 
ATOM   287  C CA  . PRO A 1 40  ? -48.689 27.572  -8.132  1.00 34.35  ? 41   PRO A CA  1 
ATOM   288  C C   . PRO A 1 40  ? -47.299 28.043  -7.848  1.00 38.24  ? 41   PRO A C   1 
ATOM   289  O O   . PRO A 1 40  ? -46.519 28.209  -8.721  1.00 43.02  ? 41   PRO A O   1 
ATOM   290  C CB  . PRO A 1 40  ? -48.878 27.398  -9.607  1.00 30.00  ? 41   PRO A CB  1 
ATOM   291  C CG  . PRO A 1 40  ? -49.324 28.707  -10.043 1.00 36.70  ? 41   PRO A CG  1 
ATOM   292  C CD  . PRO A 1 40  ? -50.237 29.192  -8.996  1.00 29.33  ? 41   PRO A CD  1 
ATOM   293  N N   . MET A 1 41  ? -46.981 28.155  -6.586  1.00 39.24  ? 42   MET A N   1 
ATOM   294  C CA  . MET A 1 41  ? -45.700 28.648  -6.174  1.00 43.97  ? 42   MET A CA  1 
ATOM   295  C C   . MET A 1 41  ? -44.945 27.669  -5.346  1.00 43.77  ? 42   MET A C   1 
ATOM   296  O O   . MET A 1 41  ? -45.505 26.761  -4.839  1.00 47.10  ? 42   MET A O   1 
ATOM   297  C CB  . MET A 1 41  ? -45.880 29.856  -5.297  1.00 51.58  ? 42   MET A CB  1 
ATOM   298  C CG  . MET A 1 41  ? -47.117 30.645  -5.524  1.00 63.32  ? 42   MET A CG  1 
ATOM   299  S SD  . MET A 1 41  ? -46.553 32.323  -5.614  1.00 80.47  ? 42   MET A SD  1 
ATOM   300  C CE  . MET A 1 41  ? -45.626 32.399  -4.110  1.00 86.66  ? 42   MET A CE  1 
ATOM   301  N N   . GLY A 1 42  ? -43.654 27.879  -5.239  1.00 41.97  ? 43   GLY A N   1 
ATOM   302  C CA  . GLY A 1 42  ? -42.846 27.034  -4.425  1.00 43.71  ? 43   GLY A CA  1 
ATOM   303  C C   . GLY A 1 42  ? -42.862 25.629  -4.922  1.00 45.92  ? 43   GLY A C   1 
ATOM   304  O O   . GLY A 1 42  ? -42.450 25.378  -6.007  1.00 40.78  ? 43   GLY A O   1 
ATOM   305  N N   . PRO A 1 43  ? -43.289 24.708  -4.076  1.00 45.80  ? 44   PRO A N   1 
ATOM   306  C CA  . PRO A 1 43  ? -43.348 23.303  -4.508  1.00 42.38  ? 44   PRO A CA  1 
ATOM   307  C C   . PRO A 1 43  ? -44.393 23.048  -5.583  1.00 45.57  ? 44   PRO A C   1 
ATOM   308  O O   . PRO A 1 43  ? -44.323 22.009  -6.252  1.00 39.83  ? 44   PRO A O   1 
ATOM   309  C CB  . PRO A 1 43  ? -43.665 22.544  -3.206  1.00 44.66  ? 44   PRO A CB  1 
ATOM   310  C CG  . PRO A 1 43  ? -44.321 23.570  -2.313  1.00 37.87  ? 44   PRO A CG  1 
ATOM   311  C CD  . PRO A 1 43  ? -43.673 24.885  -2.661  1.00 38.79  ? 44   PRO A CD  1 
ATOM   312  N N   . ARG A 1 44  ? -45.334 23.968  -5.793  1.00 44.67  ? 45   ARG A N   1 
ATOM   313  C CA  . ARG A 1 44  ? -46.370 23.813  -6.808  1.00 42.51  ? 45   ARG A CA  1 
ATOM   314  C C   . ARG A 1 44  ? -45.951 24.307  -8.190  1.00 40.92  ? 45   ARG A C   1 
ATOM   315  O O   . ARG A 1 44  ? -46.718 24.144  -9.147  1.00 31.90  ? 45   ARG A O   1 
ATOM   316  C CB  . ARG A 1 44  ? -47.647 24.544  -6.383  1.00 40.15  ? 45   ARG A CB  1 
ATOM   317  C CG  . ARG A 1 44  ? -48.223 24.088  -5.051  1.00 50.25  ? 45   ARG A CG  1 
ATOM   318  C CD  . ARG A 1 44  ? -49.587 24.721  -4.810  1.00 57.95  ? 45   ARG A CD  1 
ATOM   319  N NE  . ARG A 1 44  ? -50.553 23.788  -4.238  1.00 67.10  ? 45   ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 44  ? -50.711 23.587  -2.934  1.00 79.52  ? 45   ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 44  ? -49.966 24.255  -2.062  1.00 83.42  ? 45   ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 44  ? -51.615 22.721  -2.499  1.00 84.80  ? 45   ARG A NH2 1 
ATOM   323  N N   . ARG A 1 45  ? -44.769 24.900  -8.331  1.00 41.42  ? 46   ARG A N   1 
ATOM   324  C CA  . ARG A 1 45  ? -44.346 25.358  -9.647  1.00 40.81  ? 46   ARG A CA  1 
ATOM   325  C C   . ARG A 1 45  ? -44.020 24.160  -10.538 1.00 42.13  ? 46   ARG A C   1 
ATOM   326  O O   . ARG A 1 45  ? -43.377 23.202  -10.100 1.00 38.91  ? 46   ARG A O   1 
ATOM   327  C CB  . ARG A 1 45  ? -43.138 26.293  -9.528  1.00 36.72  ? 46   ARG A CB  1 
ATOM   328  C CG  . ARG A 1 45  ? -42.309 26.411  -10.799 1.00 41.74  ? 46   ARG A CG  1 
ATOM   329  C CD  . ARG A 1 45  ? -40.914 26.940  -10.521 1.00 44.11  ? 46   ARG A CD  1 
ATOM   330  N NE  . ARG A 1 45  ? -40.910 28.348  -10.139 1.00 40.93  ? 46   ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 45  ? -39.812 29.036  -9.829  1.00 39.73  ? 46   ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 45  ? -38.621 28.448  -9.853  1.00 33.88  ? 46   ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 45  ? -39.901 30.314  -9.484  1.00 35.31  ? 46   ARG A NH2 1 
ATOM   334  N N   . PHE A 1 46  ? -44.484 24.220  -11.790 1.00 34.68  ? 47   PHE A N   1 
ATOM   335  C CA  . PHE A 1 46  ? -44.409 23.183  -12.829 1.00 34.32  ? 47   PHE A CA  1 
ATOM   336  C C   . PHE A 1 46  ? -45.471 22.108  -12.636 1.00 37.95  ? 47   PHE A C   1 
ATOM   337  O O   . PHE A 1 46  ? -45.576 21.214  -13.484 1.00 42.32  ? 47   PHE A O   1 
ATOM   338  C CB  . PHE A 1 46  ? -43.043 22.480  -12.917 1.00 33.04  ? 47   PHE A CB  1 
ATOM   339  C CG  . PHE A 1 46  ? -41.882 23.416  -13.058 1.00 34.96  ? 47   PHE A CG  1 
ATOM   340  C CD1 . PHE A 1 46  ? -40.866 23.423  -12.115 1.00 32.19  ? 47   PHE A CD1 1 
ATOM   341  C CD2 . PHE A 1 46  ? -41.801 24.282  -14.134 1.00 30.76  ? 47   PHE A CD2 1 
ATOM   342  C CE1 . PHE A 1 46  ? -39.785 24.276  -12.244 1.00 33.86  ? 47   PHE A CE1 1 
ATOM   343  C CE2 . PHE A 1 46  ? -40.723 25.141  -14.269 1.00 34.56  ? 47   PHE A CE2 1 
ATOM   344  C CZ  . PHE A 1 46  ? -39.715 25.139  -13.322 1.00 39.16  ? 47   PHE A CZ  1 
ATOM   345  N N   . LEU A 1 47  ? -46.251 22.153  -11.571 1.00 36.09  ? 48   LEU A N   1 
ATOM   346  C CA  . LEU A 1 47  ? -47.224 21.102  -11.320 1.00 40.36  ? 48   LEU A CA  1 
ATOM   347  C C   . LEU A 1 47  ? -48.587 21.470  -11.893 1.00 40.41  ? 48   LEU A C   1 
ATOM   348  O O   . LEU A 1 47  ? -48.878 22.648  -12.140 1.00 36.04  ? 48   LEU A O   1 
ATOM   349  C CB  . LEU A 1 47  ? -47.341 20.847  -9.818  1.00 32.41  ? 48   LEU A CB  1 
ATOM   350  C CG  . LEU A 1 47  ? -46.115 20.222  -9.145  1.00 43.44  ? 48   LEU A CG  1 
ATOM   351  C CD1 . LEU A 1 47  ? -46.383 19.937  -7.677  1.00 37.93  ? 48   LEU A CD1 1 
ATOM   352  C CD2 . LEU A 1 47  ? -45.683 18.949  -9.860  1.00 43.35  ? 48   LEU A CD2 1 
ATOM   353  N N   . PRO A 1 48  ? -49.441 20.472  -12.123 1.00 33.86  ? 49   PRO A N   1 
ATOM   354  C CA  . PRO A 1 48  ? -50.812 20.765  -12.532 1.00 34.12  ? 49   PRO A CA  1 
ATOM   355  C C   . PRO A 1 48  ? -51.508 21.621  -11.500 1.00 39.45  ? 49   PRO A C   1 
ATOM   356  O O   . PRO A 1 48  ? -51.240 21.510  -10.288 1.00 38.43  ? 49   PRO A O   1 
ATOM   357  C CB  . PRO A 1 48  ? -51.453 19.372  -12.627 1.00 37.90  ? 49   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 48  ? -50.317 18.448  -12.881 1.00 38.55  ? 49   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 48  ? -49.148 19.027  -12.140 1.00 31.18  ? 49   PRO A CD  1 
ATOM   360  N N   . PRO A 1 49  ? -52.442 22.472  -11.922 1.00 39.24  ? 50   PRO A N   1 
ATOM   361  C CA  . PRO A 1 49  ? -53.107 23.367  -10.967 1.00 34.75  ? 50   PRO A CA  1 
ATOM   362  C C   . PRO A 1 49  ? -54.018 22.598  -10.023 1.00 40.42  ? 50   PRO A C   1 
ATOM   363  O O   . PRO A 1 49  ? -54.721 21.670  -10.428 1.00 43.66  ? 50   PRO A O   1 
ATOM   364  C CB  . PRO A 1 49  ? -53.910 24.313  -11.867 1.00 30.94  ? 50   PRO A CB  1 
ATOM   365  C CG  . PRO A 1 49  ? -54.222 23.466  -13.093 1.00 30.55  ? 50   PRO A CG  1 
ATOM   366  C CD  . PRO A 1 49  ? -53.012 22.571  -13.281 1.00 31.70  ? 50   PRO A CD  1 
ATOM   367  N N   . GLU A 1 50  ? -54.081 22.999  -8.758  1.00 37.74  ? 51   GLU A N   1 
ATOM   368  C CA  . GLU A 1 50  ? -55.005 22.393  -7.788  1.00 41.50  ? 51   GLU A CA  1 
ATOM   369  C C   . GLU A 1 50  ? -56.171 23.332  -7.644  1.00 39.24  ? 51   GLU A C   1 
ATOM   370  O O   . GLU A 1 50  ? -55.993 24.489  -7.588  1.00 41.24  ? 51   GLU A O   1 
ATOM   371  C CB  . GLU A 1 50  ? -54.440 22.212  -6.380  1.00 53.96  ? 51   GLU A CB  1 
ATOM   372  C CG  . GLU A 1 50  ? -53.314 21.238  -6.101  1.00 75.73  ? 51   GLU A CG  1 
ATOM   373  C CD  . GLU A 1 50  ? -52.867 21.285  -4.629  1.00 97.55  ? 51   GLU A CD  1 
ATOM   374  O OE1 . GLU A 1 50  ? -53.281 22.188  -3.854  1.00 105.69 ? 51   GLU A OE1 1 
ATOM   375  O OE2 . GLU A 1 50  ? -52.107 20.381  -4.232  1.00 104.97 ? 51   GLU A OE2 1 
ATOM   376  N N   . PRO A 1 51  ? -57.376 22.829  -7.585  1.00 40.17  ? 52   PRO A N   1 
ATOM   377  C CA  . PRO A 1 51  ? -58.550 23.700  -7.456  1.00 39.60  ? 52   PRO A CA  1 
ATOM   378  C C   . PRO A 1 51  ? -58.460 24.583  -6.220  1.00 40.14  ? 52   PRO A C   1 
ATOM   379  O O   . PRO A 1 51  ? -57.940 24.181  -5.176  1.00 39.96  ? 52   PRO A O   1 
ATOM   380  C CB  . PRO A 1 51  ? -59.719 22.712  -7.356  1.00 40.62  ? 52   PRO A CB  1 
ATOM   381  C CG  . PRO A 1 51  ? -59.203 21.450  -8.001  1.00 41.60  ? 52   PRO A CG  1 
ATOM   382  C CD  . PRO A 1 51  ? -57.741 21.404  -7.664  1.00 40.64  ? 52   PRO A CD  1 
ATOM   383  N N   . LYS A 1 52  ? -58.979 25.800  -6.351  1.00 37.54  ? 53   LYS A N   1 
ATOM   384  C CA  . LYS A 1 52  ? -58.947 26.752  -5.250  1.00 39.82  ? 53   LYS A CA  1 
ATOM   385  C C   . LYS A 1 52  ? -59.783 26.248  -4.073  1.00 39.77  ? 53   LYS A C   1 
ATOM   386  O O   . LYS A 1 52  ? -60.956 25.897  -4.224  1.00 42.82  ? 53   LYS A O   1 
ATOM   387  C CB  . LYS A 1 52  ? -59.450 28.115  -5.741  1.00 38.45  ? 53   LYS A CB  1 
ATOM   388  C CG  . LYS A 1 52  ? -59.512 29.198  -4.675  1.00 38.76  ? 53   LYS A CG  1 
ATOM   389  C CD  . LYS A 1 52  ? -58.134 29.543  -4.124  1.00 39.80  ? 53   LYS A CD  1 
ATOM   390  C CE  . LYS A 1 52  ? -58.200 30.748  -3.186  1.00 39.94  ? 53   LYS A CE  1 
ATOM   391  N NZ  . LYS A 1 52  ? -56.930 30.960  -2.428  1.00 45.88  ? 53   LYS A NZ  1 
ATOM   392  N N   . GLN A 1 53  ? -59.201 26.182  -2.901  1.00 37.58  ? 54   GLN A N   1 
ATOM   393  C CA  . GLN A 1 53  ? -59.901 25.749  -1.709  1.00 46.01  ? 54   GLN A CA  1 
ATOM   394  C C   . GLN A 1 53  ? -60.937 26.746  -1.261  1.00 42.95  ? 54   GLN A C   1 
ATOM   395  O O   . GLN A 1 53  ? -60.757 27.922  -1.417  1.00 40.42  ? 54   GLN A O   1 
ATOM   396  C CB  . GLN A 1 53  ? -58.913 25.507  -0.594  1.00 50.73  ? 54   GLN A CB  1 
ATOM   397  C CG  . GLN A 1 53  ? -58.076 24.267  -0.784  1.00 68.11  ? 54   GLN A CG  1 
ATOM   398  C CD  . GLN A 1 53  ? -56.739 24.325  -0.069  1.00 84.53  ? 54   GLN A CD  1 
ATOM   399  O OE1 . GLN A 1 53  ? -55.779 23.689  -0.485  1.00 88.84  ? 54   GLN A OE1 1 
ATOM   400  N NE2 . GLN A 1 53  ? -56.671 25.078  1.010   1.00 89.32  ? 54   GLN A NE2 1 
ATOM   401  N N   . PRO A 1 54  ? -62.034 26.265  -0.701  1.00 45.36  ? 55   PRO A N   1 
ATOM   402  C CA  . PRO A 1 54  ? -63.066 27.203  -0.246  1.00 48.18  ? 55   PRO A CA  1 
ATOM   403  C C   . PRO A 1 54  ? -62.524 28.184  0.782   1.00 48.18  ? 55   PRO A C   1 
ATOM   404  O O   . PRO A 1 54  ? -61.589 27.884  1.526   1.00 44.51  ? 55   PRO A O   1 
ATOM   405  C CB  . PRO A 1 54  ? -64.132 26.288  0.372   1.00 51.49  ? 55   PRO A CB  1 
ATOM   406  C CG  . PRO A 1 54  ? -63.911 24.959  -0.272  1.00 54.77  ? 55   PRO A CG  1 
ATOM   407  C CD  . PRO A 1 54  ? -62.431 24.861  -0.491  1.00 50.19  ? 55   PRO A CD  1 
ATOM   408  N N   . TRP A 1 55  ? -63.133 29.370  0.813   1.00 45.59  ? 56   TRP A N   1 
ATOM   409  C CA  . TRP A 1 55  ? -62.749 30.444  1.718   1.00 42.71  ? 56   TRP A CA  1 
ATOM   410  C C   . TRP A 1 55  ? -63.975 30.954  2.462   1.00 41.72  ? 56   TRP A C   1 
ATOM   411  O O   . TRP A 1 55  ? -65.098 30.890  1.957   1.00 44.69  ? 56   TRP A O   1 
ATOM   412  C CB  . TRP A 1 55  ? -62.100 31.610  0.957   1.00 37.12  ? 56   TRP A CB  1 
ATOM   413  C CG  . TRP A 1 55  ? -63.034 32.242  -0.038  1.00 39.77  ? 56   TRP A CG  1 
ATOM   414  C CD1 . TRP A 1 55  ? -63.921 33.253  0.199   1.00 38.15  ? 56   TRP A CD1 1 
ATOM   415  C CD2 . TRP A 1 55  ? -63.184 31.895  -1.423  1.00 32.25  ? 56   TRP A CD2 1 
ATOM   416  N NE1 . TRP A 1 55  ? -64.609 33.559  -0.952  1.00 33.31  ? 56   TRP A NE1 1 
ATOM   417  C CE2 . TRP A 1 55  ? -64.177 32.740  -1.960  1.00 32.05  ? 56   TRP A CE2 1 
ATOM   418  C CE3 . TRP A 1 55  ? -62.573 30.955  -2.259  1.00 34.49  ? 56   TRP A CE3 1 
ATOM   419  C CZ2 . TRP A 1 55  ? -64.574 32.675  -3.299  1.00 30.51  ? 56   TRP A CZ2 1 
ATOM   420  C CZ3 . TRP A 1 55  ? -62.968 30.892  -3.596  1.00 35.78  ? 56   TRP A CZ3 1 
ATOM   421  C CH2 . TRP A 1 55  ? -63.957 31.747  -4.097  1.00 32.62  ? 56   TRP A CH2 1 
ATOM   422  N N   . SER A 1 56  ? -63.752 31.472  3.663   1.00 43.85  ? 57   SER A N   1 
ATOM   423  C CA  . SER A 1 56  ? -64.802 32.187  4.370   1.00 47.67  ? 57   SER A CA  1 
ATOM   424  C C   . SER A 1 56  ? -64.689 33.683  4.084   1.00 44.98  ? 57   SER A C   1 
ATOM   425  O O   . SER A 1 56  ? -63.665 34.172  3.603   1.00 45.99  ? 57   SER A O   1 
ATOM   426  C CB  . SER A 1 56  ? -64.731 31.921  5.875   1.00 43.39  ? 57   SER A CB  1 
ATOM   427  O OG  . SER A 1 56  ? -63.594 32.543  6.439   1.00 51.77  ? 57   SER A OG  1 
ATOM   428  N N   . GLY A 1 57  ? -65.764 34.407  4.379   1.00 41.68  ? 58   GLY A N   1 
ATOM   429  C CA  . GLY A 1 57  ? -65.820 35.818  4.060   1.00 42.51  ? 58   GLY A CA  1 
ATOM   430  C C   . GLY A 1 57  ? -66.011 36.069  2.572   1.00 47.31  ? 58   GLY A C   1 
ATOM   431  O O   . GLY A 1 57  ? -66.290 35.163  1.775   1.00 45.80  ? 58   GLY A O   1 
ATOM   432  N N   . VAL A 1 58  ? -65.842 37.336  2.196   1.00 39.74  ? 59   VAL A N   1 
ATOM   433  C CA  . VAL A 1 58  ? -66.076 37.803  0.832   1.00 42.39  ? 59   VAL A CA  1 
ATOM   434  C C   . VAL A 1 58  ? -64.741 38.169  0.202   1.00 41.65  ? 59   VAL A C   1 
ATOM   435  O O   . VAL A 1 58  ? -63.999 39.002  0.738   1.00 41.49  ? 59   VAL A O   1 
ATOM   436  C CB  . VAL A 1 58  ? -67.031 39.007  0.795   1.00 42.51  ? 59   VAL A CB  1 
ATOM   437  C CG1 . VAL A 1 58  ? -67.489 39.247  -0.636  1.00 35.98  ? 59   VAL A CG1 1 
ATOM   438  C CG2 . VAL A 1 58  ? -68.215 38.792  1.719   1.00 37.03  ? 59   VAL A CG2 1 
ATOM   439  N N   . VAL A 1 59  ? -64.449 37.562  -0.945  1.00 37.25  ? 60   VAL A N   1 
ATOM   440  C CA  . VAL A 1 59  ? -63.286 37.914  -1.752  1.00 37.42  ? 60   VAL A CA  1 
ATOM   441  C C   . VAL A 1 59  ? -63.672 39.045  -2.698  1.00 37.38  ? 60   VAL A C   1 
ATOM   442  O O   . VAL A 1 59  ? -64.647 38.933  -3.452  1.00 41.35  ? 60   VAL A O   1 
ATOM   443  C CB  . VAL A 1 59  ? -62.769 36.693  -2.534  1.00 34.18  ? 60   VAL A CB  1 
ATOM   444  C CG1 . VAL A 1 59  ? -61.842 37.134  -3.676  1.00 30.85  ? 60   VAL A CG1 1 
ATOM   445  C CG2 . VAL A 1 59  ? -62.056 35.725  -1.604  1.00 34.23  ? 60   VAL A CG2 1 
ATOM   446  N N   . ASP A 1 60  ? -62.912 40.136  -2.658  1.00 31.47  ? 61   ASP A N   1 
ATOM   447  C CA  . ASP A 1 60  ? -63.136 41.264  -3.554  1.00 30.06  ? 61   ASP A CA  1 
ATOM   448  C C   . ASP A 1 60  ? -62.568 40.923  -4.926  1.00 35.28  ? 61   ASP A C   1 
ATOM   449  O O   . ASP A 1 60  ? -61.346 40.850  -5.101  1.00 32.53  ? 61   ASP A O   1 
ATOM   450  C CB  . ASP A 1 60  ? -62.485 42.527  -3.004  1.00 28.79  ? 61   ASP A CB  1 
ATOM   451  C CG  . ASP A 1 60  ? -63.230 43.098  -1.818  1.00 43.77  ? 61   ASP A CG  1 
ATOM   452  O OD1 . ASP A 1 60  ? -64.372 43.569  -2.007  1.00 41.09  ? 61   ASP A OD1 1 
ATOM   453  O OD2 . ASP A 1 60  ? -62.672 43.073  -0.698  1.00 46.90  ? 61   ASP A OD2 1 
ATOM   454  N N   . ALA A 1 61  ? -63.449 40.703  -5.897  1.00 31.61  ? 62   ALA A N   1 
ATOM   455  C CA  . ALA A 1 61  ? -63.028 40.520  -7.283  1.00 30.73  ? 62   ALA A CA  1 
ATOM   456  C C   . ALA A 1 61  ? -63.238 41.832  -8.036  1.00 30.99  ? 62   ALA A C   1 
ATOM   457  O O   . ALA A 1 61  ? -64.101 41.962  -8.905  1.00 32.51  ? 62   ALA A O   1 
ATOM   458  C CB  . ALA A 1 61  ? -63.793 39.365  -7.926  1.00 29.41  ? 62   ALA A CB  1 
ATOM   459  N N   . THR A 1 62  ? -62.425 42.826  -7.666  1.00 26.24  ? 63   THR A N   1 
ATOM   460  C CA  . THR A 1 62  ? -62.657 44.201  -8.081  1.00 29.29  ? 63   THR A CA  1 
ATOM   461  C C   . THR A 1 62  ? -61.578 44.775  -8.993  1.00 31.37  ? 63   THR A C   1 
ATOM   462  O O   . THR A 1 62  ? -61.643 45.966  -9.319  1.00 29.06  ? 63   THR A O   1 
ATOM   463  C CB  . THR A 1 62  ? -62.798 45.102  -6.849  1.00 33.21  ? 63   THR A CB  1 
ATOM   464  O OG1 . THR A 1 62  ? -61.598 45.020  -6.071  1.00 39.48  ? 63   THR A OG1 1 
ATOM   465  C CG2 . THR A 1 62  ? -64.009 44.686  -5.986  1.00 29.29  ? 63   THR A CG2 1 
ATOM   466  N N   . THR A 1 63  ? -60.589 43.985  -9.403  1.00 33.86  ? 64   THR A N   1 
ATOM   467  C CA  . THR A 1 63  ? -59.520 44.472  -10.268 1.00 31.27  ? 64   THR A CA  1 
ATOM   468  C C   . THR A 1 63  ? -58.766 43.269  -10.811 1.00 33.13  ? 64   THR A C   1 
ATOM   469  O O   . THR A 1 63  ? -58.769 42.192  -10.207 1.00 34.82  ? 64   THR A O   1 
ATOM   470  C CB  . THR A 1 63  ? -58.568 45.425  -9.526  1.00 38.44  ? 64   THR A CB  1 
ATOM   471  O OG1 . THR A 1 63  ? -57.888 46.253  -10.474 1.00 40.09  ? 64   THR A OG1 1 
ATOM   472  C CG2 . THR A 1 63  ? -57.529 44.654  -8.715  1.00 39.16  ? 64   THR A CG2 1 
ATOM   473  N N   . PHE A 1 64  ? -58.141 43.460  -11.973 1.00 29.34  ? 65   PHE A N   1 
ATOM   474  C CA  . PHE A 1 64  ? -57.341 42.401  -12.571 1.00 30.77  ? 65   PHE A CA  1 
ATOM   475  C C   . PHE A 1 64  ? -56.195 42.021  -11.640 1.00 33.90  ? 65   PHE A C   1 
ATOM   476  O O   . PHE A 1 64  ? -55.560 42.880  -11.023 1.00 28.74  ? 65   PHE A O   1 
ATOM   477  C CB  . PHE A 1 64  ? -56.781 42.844  -13.930 1.00 31.30  ? 65   PHE A CB  1 
ATOM   478  C CG  . PHE A 1 64  ? -57.811 42.917  -15.028 1.00 27.56  ? 65   PHE A CG  1 
ATOM   479  C CD1 . PHE A 1 64  ? -58.452 41.769  -15.477 1.00 19.44  ? 65   PHE A CD1 1 
ATOM   480  C CD2 . PHE A 1 64  ? -58.127 44.135  -15.623 1.00 26.78  ? 65   PHE A CD2 1 
ATOM   481  C CE1 . PHE A 1 64  ? -59.402 41.833  -16.486 1.00 29.54  ? 65   PHE A CE1 1 
ATOM   482  C CE2 . PHE A 1 64  ? -59.078 44.210  -16.634 1.00 25.09  ? 65   PHE A CE2 1 
ATOM   483  C CZ  . PHE A 1 64  ? -59.716 43.056  -17.068 1.00 28.74  ? 65   PHE A CZ  1 
ATOM   484  N N   . GLN A 1 65  ? -55.928 40.723  -11.546 1.00 32.00  ? 66   GLN A N   1 
ATOM   485  C CA  . GLN A 1 65  ? -54.841 40.216  -10.727 1.00 26.40  ? 66   GLN A CA  1 
ATOM   486  C C   . GLN A 1 65  ? -53.542 40.190  -11.537 1.00 30.81  ? 66   GLN A C   1 
ATOM   487  O O   . GLN A 1 65  ? -53.488 40.629  -12.691 1.00 27.64  ? 66   GLN A O   1 
ATOM   488  C CB  . GLN A 1 65  ? -55.205 38.838  -10.183 1.00 28.92  ? 66   GLN A CB  1 
ATOM   489  C CG  . GLN A 1 65  ? -55.532 38.836  -8.704  1.00 35.16  ? 66   GLN A CG  1 
ATOM   490  C CD  . GLN A 1 65  ? -54.292 38.899  -7.847  1.00 39.76  ? 66   GLN A CD  1 
ATOM   491  O OE1 . GLN A 1 65  ? -53.170 38.965  -8.356  1.00 43.35  ? 66   GLN A OE1 1 
ATOM   492  N NE2 . GLN A 1 65  ? -54.481 38.869  -6.536  1.00 36.80  ? 66   GLN A NE2 1 
ATOM   493  N N   . SER A 1 66  ? -52.486 39.640  -10.942 1.00 27.12  ? 67   SER A N   1 
ATOM   494  C CA  . SER A 1 66  ? -51.154 39.725  -11.521 1.00 30.68  ? 67   SER A CA  1 
ATOM   495  C C   . SER A 1 66  ? -51.064 38.987  -12.857 1.00 28.49  ? 67   SER A C   1 
ATOM   496  O O   . SER A 1 66  ? -51.831 38.066  -13.155 1.00 27.78  ? 67   SER A O   1 
ATOM   497  C CB  . SER A 1 66  ? -50.114 39.160  -10.553 1.00 26.25  ? 67   SER A CB  1 
ATOM   498  O OG  . SER A 1 66  ? -50.027 39.958  -9.384  1.00 32.49  ? 67   SER A OG  1 
ATOM   499  N N   . VAL A 1 67  ? -50.101 39.415  -13.662 1.00 29.37  ? 68   VAL A N   1 
ATOM   500  C CA  . VAL A 1 67  ? -49.749 38.735  -14.903 1.00 30.58  ? 68   VAL A CA  1 
ATOM   501  C C   . VAL A 1 67  ? -48.784 37.597  -14.587 1.00 31.27  ? 68   VAL A C   1 
ATOM   502  O O   . VAL A 1 67  ? -47.898 37.734  -13.734 1.00 28.71  ? 68   VAL A O   1 
ATOM   503  C CB  . VAL A 1 67  ? -49.133 39.744  -15.892 1.00 31.19  ? 68   VAL A CB  1 
ATOM   504  C CG1 . VAL A 1 67  ? -48.635 39.055  -17.127 1.00 31.66  ? 68   VAL A CG1 1 
ATOM   505  C CG2 . VAL A 1 67  ? -50.149 40.834  -16.249 1.00 31.53  ? 68   VAL A CG2 1 
ATOM   506  N N   . CYS A 1 68  ? -48.957 36.457  -15.253 1.00 24.15  ? 69   CYS A N   1 
ATOM   507  C CA  . CYS A 1 68  ? -48.016 35.360  -15.062 1.00 26.11  ? 69   CYS A CA  1 
ATOM   508  C C   . CYS A 1 68  ? -46.634 35.769  -15.570 1.00 28.39  ? 69   CYS A C   1 
ATOM   509  O O   . CYS A 1 68  ? -46.505 36.524  -16.537 1.00 32.84  ? 69   CYS A O   1 
ATOM   510  C CB  . CYS A 1 68  ? -48.506 34.097  -15.776 1.00 26.65  ? 69   CYS A CB  1 
ATOM   511  S SG  . CYS A 1 68  ? -50.092 33.413  -15.160 1.00 35.15  ? 69   CYS A SG  1 
ATOM   512  N N   . TYR A 1 69  ? -45.595 35.285  -14.886 1.00 28.43  ? 70   TYR A N   1 
ATOM   513  C CA  . TYR A 1 69  ? -44.223 35.634  -15.242 1.00 29.32  ? 70   TYR A CA  1 
ATOM   514  C C   . TYR A 1 69  ? -43.955 35.351  -16.715 1.00 28.01  ? 70   TYR A C   1 
ATOM   515  O O   . TYR A 1 69  ? -44.284 34.274  -17.224 1.00 29.74  ? 70   TYR A O   1 
ATOM   516  C CB  . TYR A 1 69  ? -43.237 34.850  -14.371 1.00 28.39  ? 70   TYR A CB  1 
ATOM   517  C CG  . TYR A 1 69  ? -42.652 35.667  -13.247 1.00 34.80  ? 70   TYR A CG  1 
ATOM   518  C CD1 . TYR A 1 69  ? -41.554 36.495  -13.454 1.00 30.17  ? 70   TYR A CD1 1 
ATOM   519  C CD2 . TYR A 1 69  ? -43.212 35.625  -11.977 1.00 36.14  ? 70   TYR A CD2 1 
ATOM   520  C CE1 . TYR A 1 69  ? -41.028 37.255  -12.412 1.00 31.42  ? 70   TYR A CE1 1 
ATOM   521  C CE2 . TYR A 1 69  ? -42.697 36.376  -10.940 1.00 34.49  ? 70   TYR A CE2 1 
ATOM   522  C CZ  . TYR A 1 69  ? -41.608 37.185  -11.157 1.00 36.40  ? 70   TYR A CZ  1 
ATOM   523  O OH  . TYR A 1 69  ? -41.110 37.923  -10.100 1.00 45.89  ? 70   TYR A OH  1 
ATOM   524  N N   . GLN A 1 70  ? -43.349 36.321  -17.392 1.00 24.68  ? 71   GLN A N   1 
ATOM   525  C CA  . GLN A 1 70  ? -43.138 36.215  -18.830 1.00 29.23  ? 71   GLN A CA  1 
ATOM   526  C C   . GLN A 1 70  ? -42.082 37.215  -19.271 1.00 30.51  ? 71   GLN A C   1 
ATOM   527  O O   . GLN A 1 70  ? -41.879 38.251  -18.631 1.00 32.17  ? 71   GLN A O   1 
ATOM   528  C CB  . GLN A 1 70  ? -44.433 36.467  -19.603 1.00 27.06  ? 71   GLN A CB  1 
ATOM   529  C CG  . GLN A 1 70  ? -45.072 37.834  -19.331 1.00 28.51  ? 71   GLN A CG  1 
ATOM   530  C CD  . GLN A 1 70  ? -46.428 37.958  -20.001 1.00 30.04  ? 71   GLN A CD  1 
ATOM   531  O OE1 . GLN A 1 70  ? -46.579 38.612  -21.036 1.00 34.73  ? 71   GLN A OE1 1 
ATOM   532  N NE2 . GLN A 1 70  ? -47.415 37.290  -19.432 1.00 28.34  ? 71   GLN A NE2 1 
ATOM   533  N N   . TYR A 1 71  ? -41.510 36.975  -20.413 1.00 32.35  ? 72   TYR A N   1 
ATOM   534  C CA  . TYR A 1 71  ? -40.599 37.865  -21.018 1.00 39.17  ? 72   TYR A CA  1 
ATOM   535  C C   . TYR A 1 71  ? -41.383 39.080  -21.468 1.00 38.05  ? 72   TYR A C   1 
ATOM   536  O O   . TYR A 1 71  ? -42.484 38.985  -21.880 1.00 40.26  ? 72   TYR A O   1 
ATOM   537  C CB  . TYR A 1 71  ? -39.934 37.173  -22.189 1.00 38.11  ? 72   TYR A CB  1 
ATOM   538  C CG  . TYR A 1 71  ? -39.176 38.081  -23.059 1.00 37.01  ? 72   TYR A CG  1 
ATOM   539  C CD1 . TYR A 1 71  ? -37.941 38.501  -22.710 1.00 39.03  ? 72   TYR A CD1 1 
ATOM   540  C CD2 . TYR A 1 71  ? -39.709 38.550  -24.208 1.00 38.56  ? 72   TYR A CD2 1 
ATOM   541  C CE1 . TYR A 1 71  ? -37.235 39.358  -23.492 1.00 45.73  ? 72   TYR A CE1 1 
ATOM   542  C CE2 . TYR A 1 71  ? -39.016 39.408  -25.005 1.00 44.53  ? 72   TYR A CE2 1 
ATOM   543  C CZ  . TYR A 1 71  ? -37.776 39.818  -24.636 1.00 48.74  ? 72   TYR A CZ  1 
ATOM   544  O OH  . TYR A 1 71  ? -37.079 40.671  -25.427 1.00 54.15  ? 72   TYR A OH  1 
ATOM   545  N N   . VAL A 1 72  ? -40.790 40.234  -21.352 1.00 37.63  ? 73   VAL A N   1 
ATOM   546  C CA  . VAL A 1 72  ? -41.426 41.476  -21.726 1.00 42.91  ? 73   VAL A CA  1 
ATOM   547  C C   . VAL A 1 72  ? -40.730 41.992  -22.955 1.00 45.35  ? 73   VAL A C   1 
ATOM   548  O O   . VAL A 1 72  ? -39.558 42.115  -22.945 1.00 49.70  ? 73   VAL A O   1 
ATOM   549  C CB  . VAL A 1 72  ? -41.276 42.492  -20.609 1.00 47.75  ? 73   VAL A CB  1 
ATOM   550  C CG1 . VAL A 1 72  ? -41.865 43.810  -21.024 1.00 56.73  ? 73   VAL A CG1 1 
ATOM   551  C CG2 . VAL A 1 72  ? -41.979 42.000  -19.396 1.00 46.44  ? 73   VAL A CG2 1 
ATOM   552  N N   . ASP A 1 73  ? -41.446 42.261  -24.028 1.00 41.13  ? 74   ASP A N   1 
ATOM   553  C CA  . ASP A 1 73  ? -40.826 42.722  -25.260 1.00 38.49  ? 74   ASP A CA  1 
ATOM   554  C C   . ASP A 1 73  ? -40.269 44.115  -25.188 1.00 41.77  ? 74   ASP A C   1 
ATOM   555  O O   . ASP A 1 73  ? -40.906 44.975  -24.709 1.00 47.94  ? 74   ASP A O   1 
ATOM   556  C CB  . ASP A 1 73  ? -41.800 42.662  -26.416 1.00 50.12  ? 74   ASP A CB  1 
ATOM   557  C CG  . ASP A 1 73  ? -41.150 42.992  -27.726 1.00 66.07  ? 74   ASP A CG  1 
ATOM   558  O OD1 . ASP A 1 73  ? -41.501 43.985  -28.333 1.00 70.93  ? 74   ASP A OD1 1 
ATOM   559  O OD2 . ASP A 1 73  ? -40.245 42.274  -28.156 1.00 74.12  ? 74   ASP A OD2 1 
ATOM   560  N N   . THR A 1 74  ? -39.086 44.334  -25.731 1.00 48.93  ? 75   THR A N   1 
ATOM   561  C CA  . THR A 1 74  ? -38.423 45.635  -25.691 1.00 56.72  ? 75   THR A CA  1 
ATOM   562  C C   . THR A 1 74  ? -37.923 46.057  -27.067 1.00 58.34  ? 75   THR A C   1 
ATOM   563  O O   . THR A 1 74  ? -36.983 46.851  -27.172 1.00 60.53  ? 75   THR A O   1 
ATOM   564  C CB  . THR A 1 74  ? -37.257 45.630  -24.701 1.00 62.57  ? 75   THR A CB  1 
ATOM   565  O OG1 . THR A 1 74  ? -36.327 44.597  -25.060 1.00 63.98  ? 75   THR A OG1 1 
ATOM   566  C CG2 . THR A 1 74  ? -37.755 45.404  -23.279 1.00 63.69  ? 75   THR A CG2 1 
ATOM   567  N N   . LEU A 1 75  ? -38.553 45.561  -28.134 1.00 55.23  ? 76   LEU A N   1 
ATOM   568  C CA  . LEU A 1 75  ? -38.031 45.825  -29.470 1.00 55.92  ? 76   LEU A CA  1 
ATOM   569  C C   . LEU A 1 75  ? -38.194 47.298  -29.846 1.00 55.04  ? 76   LEU A C   1 
ATOM   570  O O   . LEU A 1 75  ? -37.248 47.932  -30.331 1.00 61.11  ? 76   LEU A O   1 
ATOM   571  C CB  . LEU A 1 75  ? -38.710 44.903  -30.487 1.00 59.73  ? 76   LEU A CB  1 
ATOM   572  C CG  . LEU A 1 75  ? -38.127 44.926  -31.907 1.00 68.18  ? 76   LEU A CG  1 
ATOM   573  C CD1 . LEU A 1 75  ? -38.590 46.137  -32.601 1.00 77.82  ? 76   LEU A CD1 1 
ATOM   574  C CD2 . LEU A 1 75  ? -36.611 44.957  -31.914 1.00 66.41  ? 76   LEU A CD2 1 
ATOM   575  N N   . TYR A 1 76  ? -39.386 47.864  -29.638 1.00 51.84  ? 77   TYR A N   1 
ATOM   576  C CA  . TYR A 1 76  ? -39.627 49.293  -29.850 1.00 57.16  ? 77   TYR A CA  1 
ATOM   577  C C   . TYR A 1 76  ? -40.161 49.866  -28.544 1.00 60.53  ? 77   TYR A C   1 
ATOM   578  O O   . TYR A 1 76  ? -41.383 49.925  -28.335 1.00 55.90  ? 77   TYR A O   1 
ATOM   579  C CB  . TYR A 1 76  ? -40.598 49.549  -31.003 1.00 56.59  ? 77   TYR A CB  1 
ATOM   580  C CG  . TYR A 1 76  ? -40.130 49.077  -32.366 1.00 60.97  ? 77   TYR A CG  1 
ATOM   581  C CD1 . TYR A 1 76  ? -40.883 48.169  -33.104 1.00 63.98  ? 77   TYR A CD1 1 
ATOM   582  C CD2 . TYR A 1 76  ? -38.929 49.523  -32.904 1.00 62.49  ? 77   TYR A CD2 1 
ATOM   583  C CE1 . TYR A 1 76  ? -40.464 47.738  -34.359 1.00 68.91  ? 77   TYR A CE1 1 
ATOM   584  C CE2 . TYR A 1 76  ? -38.498 49.094  -34.149 1.00 67.58  ? 77   TYR A CE2 1 
ATOM   585  C CZ  . TYR A 1 76  ? -39.267 48.199  -34.872 1.00 69.21  ? 77   TYR A CZ  1 
ATOM   586  O OH  . TYR A 1 76  ? -38.841 47.769  -36.109 1.00 68.36  ? 77   TYR A OH  1 
ATOM   587  N N   . PRO A 1 77  ? -39.284 50.290  -27.634 1.00 65.76  ? 78   PRO A N   1 
ATOM   588  C CA  . PRO A 1 77  ? -39.745 50.724  -26.306 1.00 63.33  ? 78   PRO A CA  1 
ATOM   589  C C   . PRO A 1 77  ? -40.585 51.990  -26.402 1.00 61.43  ? 78   PRO A C   1 
ATOM   590  O O   . PRO A 1 77  ? -40.227 52.940  -27.103 1.00 60.84  ? 78   PRO A O   1 
ATOM   591  C CB  . PRO A 1 77  ? -38.440 50.969  -25.536 1.00 65.40  ? 78   PRO A CB  1 
ATOM   592  C CG  . PRO A 1 77  ? -37.378 50.260  -26.326 1.00 68.93  ? 78   PRO A CG  1 
ATOM   593  C CD  . PRO A 1 77  ? -37.820 50.348  -27.752 1.00 69.17  ? 78   PRO A CD  1 
ATOM   594  N N   . GLY A 1 78  ? -41.708 51.994  -25.687 1.00 61.92  ? 79   GLY A N   1 
ATOM   595  C CA  . GLY A 1 78  ? -42.630 53.108  -25.721 1.00 65.56  ? 79   GLY A CA  1 
ATOM   596  C C   . GLY A 1 78  ? -43.513 53.163  -26.945 1.00 67.09  ? 79   GLY A C   1 
ATOM   597  O O   . GLY A 1 78  ? -44.330 54.085  -27.061 1.00 69.12  ? 79   GLY A O   1 
ATOM   598  N N   . PHE A 1 79  ? -43.373 52.213  -27.862 1.00 64.87  ? 80   PHE A N   1 
ATOM   599  C CA  . PHE A 1 79  ? -44.195 52.177  -29.058 1.00 55.57  ? 80   PHE A CA  1 
ATOM   600  C C   . PHE A 1 79  ? -45.523 51.503  -28.740 1.00 49.50  ? 80   PHE A C   1 
ATOM   601  O O   . PHE A 1 79  ? -45.552 50.406  -28.173 1.00 48.71  ? 80   PHE A O   1 
ATOM   602  C CB  . PHE A 1 79  ? -43.452 51.439  -30.170 1.00 53.79  ? 80   PHE A CB  1 
ATOM   603  C CG  . PHE A 1 79  ? -44.237 51.284  -31.434 1.00 49.02  ? 80   PHE A CG  1 
ATOM   604  C CD1 . PHE A 1 79  ? -44.673 52.397  -32.135 1.00 46.65  ? 80   PHE A CD1 1 
ATOM   605  C CD2 . PHE A 1 79  ? -44.517 50.021  -31.936 1.00 44.49  ? 80   PHE A CD2 1 
ATOM   606  C CE1 . PHE A 1 79  ? -45.392 52.253  -33.313 1.00 48.44  ? 80   PHE A CE1 1 
ATOM   607  C CE2 . PHE A 1 79  ? -45.231 49.868  -33.112 1.00 44.41  ? 80   PHE A CE2 1 
ATOM   608  C CZ  . PHE A 1 79  ? -45.671 50.985  -33.801 1.00 45.40  ? 80   PHE A CZ  1 
ATOM   609  N N   . GLU A 1 80  ? -46.623 52.165  -29.100 1.00 51.61  ? 81   GLU A N   1 
ATOM   610  C CA  . GLU A 1 80  ? -47.946 51.636  -28.782 1.00 51.81  ? 81   GLU A CA  1 
ATOM   611  C C   . GLU A 1 80  ? -48.148 50.239  -29.356 1.00 51.19  ? 81   GLU A C   1 
ATOM   612  O O   . GLU A 1 80  ? -48.763 49.379  -28.715 1.00 47.02  ? 81   GLU A O   1 
ATOM   613  C CB  . GLU A 1 80  ? -49.021 52.588  -29.306 1.00 68.65  ? 81   GLU A CB  1 
ATOM   614  C CG  . GLU A 1 80  ? -50.339 52.463  -28.582 1.00 87.10  ? 81   GLU A CG  1 
ATOM   615  C CD  . GLU A 1 80  ? -50.164 52.401  -27.073 1.00 104.74 ? 81   GLU A CD  1 
ATOM   616  O OE1 . GLU A 1 80  ? -50.741 51.484  -26.455 1.00 112.76 ? 81   GLU A OE1 1 
ATOM   617  O OE2 . GLU A 1 80  ? -49.455 53.262  -26.503 1.00 111.56 ? 81   GLU A OE2 1 
ATOM   618  N N   . GLY A 1 81  ? -47.625 49.987  -30.557 1.00 52.34  ? 82   GLY A N   1 
ATOM   619  C CA  . GLY A 1 81  ? -47.819 48.691  -31.179 1.00 47.67  ? 82   GLY A CA  1 
ATOM   620  C C   . GLY A 1 81  ? -47.191 47.541  -30.414 1.00 46.98  ? 82   GLY A C   1 
ATOM   621  O O   . GLY A 1 81  ? -47.685 46.414  -30.480 1.00 57.31  ? 82   GLY A O   1 
ATOM   622  N N   . THR A 1 82  ? -46.084 47.796  -29.700 1.00 48.62  ? 83   THR A N   1 
ATOM   623  C CA  . THR A 1 82  ? -45.511 46.791  -28.803 1.00 51.68  ? 83   THR A CA  1 
ATOM   624  C C   . THR A 1 82  ? -46.177 46.810  -27.435 1.00 47.01  ? 83   THR A C   1 
ATOM   625  O O   . THR A 1 82  ? -46.497 45.756  -26.877 1.00 45.99  ? 83   THR A O   1 
ATOM   626  C CB  . THR A 1 82  ? -44.007 47.006  -28.597 1.00 61.25  ? 83   THR A CB  1 
ATOM   627  O OG1 . THR A 1 82  ? -43.748 48.382  -28.272 1.00 79.27  ? 83   THR A OG1 1 
ATOM   628  C CG2 . THR A 1 82  ? -43.219 46.598  -29.781 1.00 59.00  ? 83   THR A CG2 1 
ATOM   629  N N   . GLU A 1 83  ? -46.356 48.004  -26.869 1.00 42.72  ? 84   GLU A N   1 
ATOM   630  C CA  . GLU A 1 83  ? -46.716 48.111  -25.460 1.00 50.23  ? 84   GLU A CA  1 
ATOM   631  C C   . GLU A 1 83  ? -48.093 47.533  -25.178 1.00 48.83  ? 84   GLU A C   1 
ATOM   632  O O   . GLU A 1 83  ? -48.327 47.007  -24.084 1.00 45.99  ? 84   GLU A O   1 
ATOM   633  C CB  . GLU A 1 83  ? -46.641 49.572  -25.000 1.00 48.58  ? 84   GLU A CB  1 
ATOM   634  C CG  . GLU A 1 83  ? -45.232 50.187  -25.014 1.00 57.48  ? 84   GLU A CG  1 
ATOM   635  C CD  . GLU A 1 83  ? -44.179 49.337  -24.302 1.00 68.38  ? 84   GLU A CD  1 
ATOM   636  O OE1 . GLU A 1 83  ? -44.532 48.497  -23.442 1.00 67.42  ? 84   GLU A OE1 1 
ATOM   637  O OE2 . GLU A 1 83  ? -42.980 49.511  -24.613 1.00 73.28  ? 84   GLU A OE2 1 
ATOM   638  N N   . MET A 1 84  ? -49.003 47.586  -26.151 1.00 40.92  ? 85   MET A N   1 
ATOM   639  C CA  . MET A 1 84  ? -50.357 47.092  -25.926 1.00 32.24  ? 85   MET A CA  1 
ATOM   640  C C   . MET A 1 84  ? -50.397 45.604  -25.601 1.00 32.20  ? 85   MET A C   1 
ATOM   641  O O   . MET A 1 84  ? -51.401 45.141  -25.053 1.00 33.86  ? 85   MET A O   1 
ATOM   642  C CB  . MET A 1 84  ? -51.234 47.375  -27.146 1.00 37.12  ? 85   MET A CB  1 
ATOM   643  C CG  . MET A 1 84  ? -50.733 46.741  -28.441 1.00 45.33  ? 85   MET A CG  1 
ATOM   644  S SD  . MET A 1 84  ? -51.796 47.129  -29.849 1.00 48.95  ? 85   MET A SD  1 
ATOM   645  C CE  . MET A 1 84  ? -53.261 46.186  -29.412 1.00 35.80  ? 85   MET A CE  1 
ATOM   646  N N   . TRP A 1 85  ? -49.342 44.847  -25.919 1.00 30.03  ? 86   TRP A N   1 
ATOM   647  C CA  . TRP A 1 85  ? -49.283 43.416  -25.631 1.00 32.13  ? 86   TRP A CA  1 
ATOM   648  C C   . TRP A 1 85  ? -48.477 43.080  -24.379 1.00 34.92  ? 86   TRP A C   1 
ATOM   649  O O   . TRP A 1 85  ? -48.421 41.907  -23.990 1.00 34.23  ? 86   TRP A O   1 
ATOM   650  C CB  . TRP A 1 85  ? -48.697 42.658  -26.827 1.00 30.00  ? 86   TRP A CB  1 
ATOM   651  C CG  . TRP A 1 85  ? -49.350 42.999  -28.127 1.00 37.94  ? 86   TRP A CG  1 
ATOM   652  C CD1 . TRP A 1 85  ? -48.800 43.701  -29.158 1.00 34.22  ? 86   TRP A CD1 1 
ATOM   653  C CD2 . TRP A 1 85  ? -50.680 42.655  -28.539 1.00 38.12  ? 86   TRP A CD2 1 
ATOM   654  N NE1 . TRP A 1 85  ? -49.702 43.815  -30.193 1.00 35.65  ? 86   TRP A NE1 1 
ATOM   655  C CE2 . TRP A 1 85  ? -50.864 43.182  -29.838 1.00 39.48  ? 86   TRP A CE2 1 
ATOM   656  C CE3 . TRP A 1 85  ? -51.732 41.953  -27.940 1.00 31.05  ? 86   TRP A CE3 1 
ATOM   657  C CZ2 . TRP A 1 85  ? -52.056 43.030  -30.546 1.00 33.88  ? 86   TRP A CZ2 1 
ATOM   658  C CZ3 . TRP A 1 85  ? -52.918 41.801  -28.648 1.00 34.64  ? 86   TRP A CZ3 1 
ATOM   659  C CH2 . TRP A 1 85  ? -53.070 42.337  -29.933 1.00 33.96  ? 86   TRP A CH2 1 
ATOM   660  N N   . ASN A 1 86  ? -47.849 44.064  -23.750 1.00 28.57  ? 87   ASN A N   1 
ATOM   661  C CA  . ASN A 1 86  ? -46.992 43.836  -22.599 1.00 35.88  ? 87   ASN A CA  1 
ATOM   662  C C   . ASN A 1 86  ? -47.799 43.851  -21.309 1.00 34.82  ? 87   ASN A C   1 
ATOM   663  O O   . ASN A 1 86  ? -48.885 44.437  -21.246 1.00 30.20  ? 87   ASN A O   1 
ATOM   664  C CB  . ASN A 1 86  ? -45.898 44.899  -22.547 1.00 37.06  ? 87   ASN A CB  1 
ATOM   665  C CG  . ASN A 1 86  ? -44.749 44.594  -23.488 1.00 44.80  ? 87   ASN A CG  1 
ATOM   666  O OD1 . ASN A 1 86  ? -44.494 43.430  -23.825 1.00 48.22  ? 87   ASN A OD1 1 
ATOM   667  N ND2 . ASN A 1 86  ? -44.033 45.635  -23.901 1.00 41.76  ? 87   ASN A ND2 1 
ATOM   668  N N   . PRO A 1 87  ? -47.306 43.197  -20.260 1.00 36.95  ? 88   PRO A N   1 
ATOM   669  C CA  . PRO A 1 87  ? -48.080 43.128  -19.013 1.00 36.11  ? 88   PRO A CA  1 
ATOM   670  C C   . PRO A 1 87  ? -48.428 44.511  -18.483 1.00 35.16  ? 88   PRO A C   1 
ATOM   671  O O   . PRO A 1 87  ? -47.596 45.421  -18.458 1.00 33.63  ? 88   PRO A O   1 
ATOM   672  C CB  . PRO A 1 87  ? -47.157 42.362  -18.054 1.00 32.56  ? 88   PRO A CB  1 
ATOM   673  C CG  . PRO A 1 87  ? -45.854 42.175  -18.783 1.00 40.04  ? 88   PRO A CG  1 
ATOM   674  C CD  . PRO A 1 87  ? -46.145 42.293  -20.238 1.00 38.46  ? 88   PRO A CD  1 
ATOM   675  N N   . ASN A 1 88  ? -49.690 44.670  -18.092 1.00 30.66  ? 89   ASN A N   1 
ATOM   676  C CA  . ASN A 1 88  ? -50.174 45.885  -17.457 1.00 36.87  ? 89   ASN A CA  1 
ATOM   677  C C   . ASN A 1 88  ? -50.467 45.656  -15.980 1.00 38.95  ? 89   ASN A C   1 
ATOM   678  O O   . ASN A 1 88  ? -51.195 46.437  -15.358 1.00 39.81  ? 89   ASN A O   1 
ATOM   679  C CB  . ASN A 1 88  ? -51.419 46.397  -18.178 1.00 37.60  ? 89   ASN A CB  1 
ATOM   680  C CG  . ASN A 1 88  ? -52.561 45.416  -18.105 1.00 39.07  ? 89   ASN A CG  1 
ATOM   681  O OD1 . ASN A 1 88  ? -52.353 44.218  -17.880 1.00 34.75  ? 89   ASN A OD1 1 
ATOM   682  N ND2 . ASN A 1 88  ? -53.775 45.911  -18.282 1.00 40.83  ? 89   ASN A ND2 1 
ATOM   683  N N   . ARG A 1 89  ? -49.946 44.567  -15.427 1.00 34.12  ? 90   ARG A N   1 
ATOM   684  C CA  . ARG A 1 89  ? -49.951 44.305  -13.998 1.00 38.74  ? 90   ARG A CA  1 
ATOM   685  C C   . ARG A 1 89  ? -48.577 43.771  -13.634 1.00 38.78  ? 90   ARG A C   1 
ATOM   686  O O   . ARG A 1 89  ? -47.806 43.354  -14.502 1.00 38.34  ? 90   ARG A O   1 
ATOM   687  C CB  . ARG A 1 89  ? -51.035 43.293  -13.600 1.00 40.03  ? 90   ARG A CB  1 
ATOM   688  C CG  . ARG A 1 89  ? -52.452 43.813  -13.695 1.00 41.12  ? 90   ARG A CG  1 
ATOM   689  C CD  . ARG A 1 89  ? -52.718 44.834  -12.605 1.00 40.71  ? 90   ARG A CD  1 
ATOM   690  N NE  . ARG A 1 89  ? -54.122 45.222  -12.538 1.00 45.94  ? 90   ARG A NE  1 
ATOM   691  C CZ  . ARG A 1 89  ? -54.692 46.109  -13.347 1.00 51.05  ? 90   ARG A CZ  1 
ATOM   692  N NH1 . ARG A 1 89  ? -53.980 46.698  -14.299 1.00 44.51  ? 90   ARG A NH1 1 
ATOM   693  N NH2 . ARG A 1 89  ? -55.979 46.405  -13.207 1.00 57.53  ? 90   ARG A NH2 1 
ATOM   694  N N   . GLU A 1 90  ? -48.271 43.788  -12.343 1.00 35.86  ? 91   GLU A N   1 
ATOM   695  C CA  . GLU A 1 90  ? -47.015 43.213  -11.888 1.00 39.58  ? 91   GLU A CA  1 
ATOM   696  C C   . GLU A 1 90  ? -46.959 41.725  -12.226 1.00 33.32  ? 91   GLU A C   1 
ATOM   697  O O   . GLU A 1 90  ? -47.981 41.030  -12.259 1.00 28.65  ? 91   GLU A O   1 
ATOM   698  C CB  . GLU A 1 90  ? -46.845 43.434  -10.381 1.00 43.68  ? 91   GLU A CB  1 
ATOM   699  C CG  . GLU A 1 90  ? -47.600 42.443  -9.510  1.00 58.78  ? 91   GLU A CG  1 
ATOM   700  C CD  . GLU A 1 90  ? -47.184 42.507  -8.051  1.00 80.66  ? 91   GLU A CD  1 
ATOM   701  O OE1 . GLU A 1 90  ? -47.118 43.626  -7.497  1.00 91.38  ? 91   GLU A OE1 1 
ATOM   702  O OE2 . GLU A 1 90  ? -46.922 41.438  -7.457  1.00 86.23  ? 91   GLU A OE2 1 
ATOM   703  N N   . LEU A 1 91  ? -45.751 41.245  -12.517 1.00 26.69  ? 92   LEU A N   1 
ATOM   704  C CA  . LEU A 1 91  ? -45.534 39.822  -12.738 1.00 27.49  ? 92   LEU A CA  1 
ATOM   705  C C   . LEU A 1 91  ? -45.530 39.068  -11.414 1.00 35.42  ? 92   LEU A C   1 
ATOM   706  O O   . LEU A 1 91  ? -45.011 39.554  -10.404 1.00 29.15  ? 92   LEU A O   1 
ATOM   707  C CB  . LEU A 1 91  ? -44.211 39.587  -13.472 1.00 29.46  ? 92   LEU A CB  1 
ATOM   708  C CG  . LEU A 1 91  ? -44.001 40.385  -14.758 1.00 36.51  ? 92   LEU A CG  1 
ATOM   709  C CD1 . LEU A 1 91  ? -42.722 39.938  -15.449 1.00 27.53  ? 92   LEU A CD1 1 
ATOM   710  C CD2 . LEU A 1 91  ? -45.205 40.240  -15.684 1.00 33.92  ? 92   LEU A CD2 1 
ATOM   711  N N   . SER A 1 92  ? -46.103 37.868  -11.426 1.00 33.29  ? 93   SER A N   1 
ATOM   712  C CA  . SER A 1 92  ? -46.130 37.032  -10.238 1.00 29.33  ? 93   SER A CA  1 
ATOM   713  C C   . SER A 1 92  ? -46.418 35.595  -10.644 1.00 31.69  ? 93   SER A C   1 
ATOM   714  O O   . SER A 1 92  ? -47.163 35.352  -11.595 1.00 32.72  ? 93   SER A O   1 
ATOM   715  C CB  . SER A 1 92  ? -47.188 37.517  -9.243  1.00 28.45  ? 93   SER A CB  1 
ATOM   716  O OG  . SER A 1 92  ? -47.354 36.581  -8.191  1.00 30.08  ? 93   SER A OG  1 
ATOM   717  N N   . GLU A 1 93  ? -45.828 34.644  -9.919  1.00 32.51  ? 94   GLU A N   1 
ATOM   718  C CA  . GLU A 1 93  ? -46.235 33.259  -10.111 1.00 35.42  ? 94   GLU A CA  1 
ATOM   719  C C   . GLU A 1 93  ? -47.642 33.015  -9.583  1.00 36.27  ? 94   GLU A C   1 
ATOM   720  O O   . GLU A 1 93  ? -48.319 32.092  -10.049 1.00 37.32  ? 94   GLU A O   1 
ATOM   721  C CB  . GLU A 1 93  ? -45.240 32.310  -9.442  1.00 32.69  ? 94   GLU A CB  1 
ATOM   722  C CG  . GLU A 1 93  ? -43.937 32.145  -10.220 1.00 35.15  ? 94   GLU A CG  1 
ATOM   723  C CD  . GLU A 1 93  ? -43.020 31.097  -9.606  1.00 39.29  ? 94   GLU A CD  1 
ATOM   724  O OE1 . GLU A 1 93  ? -43.124 29.907  -9.982  1.00 36.65  ? 94   GLU A OE1 1 
ATOM   725  O OE2 . GLU A 1 93  ? -42.194 31.466  -8.743  1.00 43.90  ? 94   GLU A OE2 1 
ATOM   726  N N   . ASP A 1 94  ? -48.096 33.832  -8.634  1.00 32.32  ? 95   ASP A N   1 
ATOM   727  C CA  . ASP A 1 94  ? -49.469 33.795  -8.134  1.00 35.62  ? 95   ASP A CA  1 
ATOM   728  C C   . ASP A 1 94  ? -50.327 34.565  -9.132  1.00 35.39  ? 95   ASP A C   1 
ATOM   729  O O   . ASP A 1 94  ? -50.568 35.764  -8.987  1.00 31.93  ? 95   ASP A O   1 
ATOM   730  C CB  . ASP A 1 94  ? -49.534 34.379  -6.724  1.00 30.33  ? 95   ASP A CB  1 
ATOM   731  C CG  . ASP A 1 94  ? -50.953 34.486  -6.186  1.00 36.26  ? 95   ASP A CG  1 
ATOM   732  O OD1 . ASP A 1 94  ? -51.134 35.176  -5.160  1.00 41.84  ? 95   ASP A OD1 1 
ATOM   733  O OD2 . ASP A 1 94  ? -51.883 33.901  -6.780  1.00 39.65  ? 95   ASP A OD2 1 
ATOM   734  N N   . CYS A 1 95  ? -50.791 33.859  -10.171 1.00 29.12  ? 96   CYS A N   1 
ATOM   735  C CA  . CYS A 1 95  ? -51.459 34.519  -11.284 1.00 30.99  ? 96   CYS A CA  1 
ATOM   736  C C   . CYS A 1 95  ? -52.668 33.756  -11.808 1.00 28.31  ? 96   CYS A C   1 
ATOM   737  O O   . CYS A 1 95  ? -53.186 34.115  -12.876 1.00 28.43  ? 96   CYS A O   1 
ATOM   738  C CB  . CYS A 1 95  ? -50.471 34.736  -12.437 1.00 31.18  ? 96   CYS A CB  1 
ATOM   739  S SG  . CYS A 1 95  ? -49.844 33.182  -13.138 1.00 33.65  ? 96   CYS A SG  1 
ATOM   740  N N   . LEU A 1 96  ? -53.133 32.715  -11.115 1.00 23.15  ? 97   LEU A N   1 
ATOM   741  C CA  . LEU A 1 96  ? -54.215 31.872  -11.639 1.00 24.08  ? 97   LEU A CA  1 
ATOM   742  C C   . LEU A 1 96  ? -55.563 32.435  -11.180 1.00 29.28  ? 97   LEU A C   1 
ATOM   743  O O   . LEU A 1 96  ? -56.185 31.976  -10.218 1.00 27.76  ? 97   LEU A O   1 
ATOM   744  C CB  . LEU A 1 96  ? -54.007 30.419  -11.223 1.00 24.42  ? 97   LEU A CB  1 
ATOM   745  C CG  . LEU A 1 96  ? -52.844 29.740  -11.979 1.00 31.92  ? 97   LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 96  ? -52.770 28.235  -11.741 1.00 25.25  ? 97   LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 96  ? -52.891 30.028  -13.490 1.00 26.63  ? 97   LEU A CD2 1 
ATOM   748  N N   . TYR A 1 97  ? -56.016 33.459  -11.905 1.00 28.25  ? 98   TYR A N   1 
ATOM   749  C CA  . TYR A 1 97  ? -57.279 34.133  -11.648 1.00 26.94  ? 98   TYR A CA  1 
ATOM   750  C C   . TYR A 1 97  ? -58.039 34.279  -12.955 1.00 32.95  ? 98   TYR A C   1 
ATOM   751  O O   . TYR A 1 97  ? -57.438 34.344  -14.033 1.00 29.94  ? 98   TYR A O   1 
ATOM   752  C CB  . TYR A 1 97  ? -57.063 35.522  -11.010 1.00 19.67  ? 98   TYR A CB  1 
ATOM   753  C CG  . TYR A 1 97  ? -56.272 35.464  -9.726  1.00 30.31  ? 98   TYR A CG  1 
ATOM   754  C CD1 . TYR A 1 97  ? -54.879 35.466  -9.749  1.00 25.93  ? 98   TYR A CD1 1 
ATOM   755  C CD2 . TYR A 1 97  ? -56.912 35.408  -8.490  1.00 33.64  ? 98   TYR A CD2 1 
ATOM   756  C CE1 . TYR A 1 97  ? -54.144 35.406  -8.584  1.00 25.42  ? 98   TYR A CE1 1 
ATOM   757  C CE2 . TYR A 1 97  ? -56.183 35.359  -7.305  1.00 27.61  ? 98   TYR A CE2 1 
ATOM   758  C CZ  . TYR A 1 97  ? -54.802 35.356  -7.365  1.00 31.44  ? 98   TYR A CZ  1 
ATOM   759  O OH  . TYR A 1 97  ? -54.075 35.295  -6.211  1.00 35.09  ? 98   TYR A OH  1 
ATOM   760  N N   . LEU A 1 98  ? -59.367 34.331  -12.855 1.00 28.79  ? 99   LEU A N   1 
ATOM   761  C CA  . LEU A 1 98  ? -60.208 34.538  -14.022 1.00 28.24  ? 99   LEU A CA  1 
ATOM   762  C C   . LEU A 1 98  ? -61.160 35.702  -13.782 1.00 32.58  ? 99   LEU A C   1 
ATOM   763  O O   . LEU A 1 98  ? -61.306 36.206  -12.661 1.00 28.32  ? 99   LEU A O   1 
ATOM   764  C CB  . LEU A 1 98  ? -60.987 33.268  -14.395 1.00 31.70  ? 99   LEU A CB  1 
ATOM   765  C CG  . LEU A 1 98  ? -61.879 32.584  -13.366 1.00 29.71  ? 99   LEU A CG  1 
ATOM   766  C CD1 . LEU A 1 98  ? -63.259 33.226  -13.291 1.00 28.75  ? 99   LEU A CD1 1 
ATOM   767  C CD2 . LEU A 1 98  ? -61.992 31.115  -13.729 1.00 27.66  ? 99   LEU A CD2 1 
ATOM   768  N N   . ASN A 1 99  ? -61.820 36.111  -14.868 1.00 28.18  ? 100  ASN A N   1 
ATOM   769  C CA  . ASN A 1 99  ? -62.632 37.317  -14.923 1.00 29.82  ? 100  ASN A CA  1 
ATOM   770  C C   . ASN A 1 99  ? -63.988 36.983  -15.523 1.00 30.25  ? 100  ASN A C   1 
ATOM   771  O O   . ASN A 1 99  ? -64.070 36.232  -16.499 1.00 30.02  ? 100  ASN A O   1 
ATOM   772  C CB  . ASN A 1 99  ? -61.963 38.390  -15.777 1.00 26.35  ? 100  ASN A CB  1 
ATOM   773  C CG  . ASN A 1 99  ? -60.527 38.641  -15.372 1.00 35.28  ? 100  ASN A CG  1 
ATOM   774  O OD1 . ASN A 1 99  ? -60.252 39.079  -14.258 1.00 34.28  ? 100  ASN A OD1 1 
ATOM   775  N ND2 . ASN A 1 99  ? -59.597 38.356  -16.281 1.00 31.66  ? 100  ASN A ND2 1 
ATOM   776  N N   . VAL A 1 100 ? -65.045 37.554  -14.951 1.00 28.10  ? 101  VAL A N   1 
ATOM   777  C CA  . VAL A 1 100 ? -66.408 37.366  -15.436 1.00 26.20  ? 101  VAL A CA  1 
ATOM   778  C C   . VAL A 1 100 ? -67.049 38.733  -15.617 1.00 34.85  ? 101  VAL A C   1 
ATOM   779  O O   . VAL A 1 100 ? -67.071 39.542  -14.681 1.00 38.33  ? 101  VAL A O   1 
ATOM   780  C CB  . VAL A 1 100 ? -67.261 36.517  -14.475 1.00 31.33  ? 101  VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 100 ? -68.672 36.366  -15.031 1.00 24.47  ? 101  VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 100 ? -66.620 35.161  -14.226 1.00 22.85  ? 101  VAL A CG2 1 
ATOM   783  N N   . TRP A 1 101 ? -67.571 38.987  -16.814 1.00 36.35  ? 102  TRP A N   1 
ATOM   784  C CA  . TRP A 1 101 ? -68.398 40.153  -17.092 1.00 26.75  ? 102  TRP A CA  1 
ATOM   785  C C   . TRP A 1 101 ? -69.817 39.676  -17.357 1.00 32.37  ? 102  TRP A C   1 
ATOM   786  O O   . TRP A 1 101 ? -70.021 38.715  -18.108 1.00 33.09  ? 102  TRP A O   1 
ATOM   787  C CB  . TRP A 1 101 ? -67.891 40.923  -18.307 1.00 29.23  ? 102  TRP A CB  1 
ATOM   788  C CG  . TRP A 1 101 ? -66.613 41.671  -18.152 1.00 28.72  ? 102  TRP A CG  1 
ATOM   789  C CD1 . TRP A 1 101 ? -66.476 42.986  -17.816 1.00 29.77  ? 102  TRP A CD1 1 
ATOM   790  C CD2 . TRP A 1 101 ? -65.285 41.175  -18.394 1.00 23.82  ? 102  TRP A CD2 1 
ATOM   791  N NE1 . TRP A 1 101 ? -65.145 43.337  -17.820 1.00 32.34  ? 102  TRP A NE1 1 
ATOM   792  C CE2 . TRP A 1 101 ? -64.394 42.245  -18.168 1.00 23.85  ? 102  TRP A CE2 1 
ATOM   793  C CE3 . TRP A 1 101 ? -64.765 39.930  -18.772 1.00 25.13  ? 102  TRP A CE3 1 
ATOM   794  C CZ2 . TRP A 1 101 ? -63.011 42.111  -18.310 1.00 26.39  ? 102  TRP A CZ2 1 
ATOM   795  C CZ3 . TRP A 1 101 ? -63.385 39.796  -18.913 1.00 21.50  ? 102  TRP A CZ3 1 
ATOM   796  C CH2 . TRP A 1 101 ? -62.527 40.884  -18.685 1.00 24.54  ? 102  TRP A CH2 1 
ATOM   797  N N   . THR A 1 102 ? -70.792 40.346  -16.756 1.00 30.45  ? 103  THR A N   1 
ATOM   798  C CA  . THR A 1 102 ? -72.180 39.956  -16.937 1.00 29.97  ? 103  THR A CA  1 
ATOM   799  C C   . THR A 1 102 ? -73.038 41.210  -17.017 1.00 36.00  ? 103  THR A C   1 
ATOM   800  O O   . THR A 1 102 ? -72.629 42.276  -16.538 1.00 38.03  ? 103  THR A O   1 
ATOM   801  C CB  . THR A 1 102 ? -72.649 39.038  -15.795 1.00 36.87  ? 103  THR A CB  1 
ATOM   802  O OG1 . THR A 1 102 ? -73.865 38.376  -16.167 1.00 42.07  ? 103  THR A OG1 1 
ATOM   803  C CG2 . THR A 1 102 ? -72.858 39.827  -14.494 1.00 35.26  ? 103  THR A CG2 1 
ATOM   804  N N   . PRO A 1 103 ? -74.201 41.131  -17.667 1.00 34.30  ? 104  PRO A N   1 
ATOM   805  C CA  . PRO A 1 103 ? -75.090 42.298  -17.737 1.00 37.06  ? 104  PRO A CA  1 
ATOM   806  C C   . PRO A 1 103 ? -75.533 42.789  -16.366 1.00 44.78  ? 104  PRO A C   1 
ATOM   807  O O   . PRO A 1 103 ? -75.523 42.061  -15.371 1.00 40.13  ? 104  PRO A O   1 
ATOM   808  C CB  . PRO A 1 103 ? -76.280 41.782  -18.551 1.00 34.89  ? 104  PRO A CB  1 
ATOM   809  C CG  . PRO A 1 103 ? -75.663 40.759  -19.460 1.00 34.45  ? 104  PRO A CG  1 
ATOM   810  C CD  . PRO A 1 103 ? -74.567 40.102  -18.659 1.00 35.80  ? 104  PRO A CD  1 
ATOM   811  N N   . TYR A 1 104 ? -75.931 44.055  -16.332 1.00 52.17  ? 105  TYR A N   1 
ATOM   812  C CA  . TYR A 1 104 ? -76.419 44.705  -15.116 1.00 50.95  ? 105  TYR A CA  1 
ATOM   813  C C   . TYR A 1 104 ? -77.838 45.206  -15.350 1.00 56.22  ? 105  TYR A C   1 
ATOM   814  O O   . TYR A 1 104 ? -78.034 46.145  -16.145 1.00 58.04  ? 105  TYR A O   1 
ATOM   815  C CB  . TYR A 1 104 ? -75.499 45.860  -14.718 1.00 48.99  ? 105  TYR A CB  1 
ATOM   816  C CG  . TYR A 1 104 ? -75.743 46.423  -13.332 1.00 54.41  ? 105  TYR A CG  1 
ATOM   817  C CD1 . TYR A 1 104 ? -74.867 46.150  -12.289 1.00 52.29  ? 105  TYR A CD1 1 
ATOM   818  C CD2 . TYR A 1 104 ? -76.838 47.236  -13.070 1.00 55.78  ? 105  TYR A CD2 1 
ATOM   819  C CE1 . TYR A 1 104 ? -75.076 46.661  -11.027 1.00 49.77  ? 105  TYR A CE1 1 
ATOM   820  C CE2 . TYR A 1 104 ? -77.057 47.752  -11.811 1.00 58.63  ? 105  TYR A CE2 1 
ATOM   821  C CZ  . TYR A 1 104 ? -76.171 47.460  -10.792 1.00 57.74  ? 105  TYR A CZ  1 
ATOM   822  O OH  . TYR A 1 104 ? -76.381 47.972  -9.534  1.00 57.88  ? 105  TYR A OH  1 
ATOM   823  N N   . PRO A 1 105 ? -78.862 44.640  -14.688 1.00 57.90  ? 106  PRO A N   1 
ATOM   824  C CA  . PRO A 1 105 ? -78.756 43.574  -13.684 1.00 54.15  ? 106  PRO A CA  1 
ATOM   825  C C   . PRO A 1 105 ? -78.473 42.210  -14.304 1.00 54.02  ? 106  PRO A C   1 
ATOM   826  O O   . PRO A 1 105 ? -78.476 42.086  -15.530 1.00 54.44  ? 106  PRO A O   1 
ATOM   827  C CB  . PRO A 1 105 ? -80.131 43.592  -13.019 1.00 53.61  ? 106  PRO A CB  1 
ATOM   828  C CG  . PRO A 1 105 ? -81.043 44.016  -14.112 1.00 54.71  ? 106  PRO A CG  1 
ATOM   829  C CD  . PRO A 1 105 ? -80.266 45.009  -14.944 1.00 57.14  ? 106  PRO A CD  1 
ATOM   830  N N   . ARG A 1 106 ? -78.219 41.210  -13.460 1.00 53.25  ? 107  ARG A N   1 
ATOM   831  C CA  . ARG A 1 106 ? -77.902 39.863  -13.917 1.00 53.94  ? 107  ARG A CA  1 
ATOM   832  C C   . ARG A 1 106 ? -78.981 39.358  -14.861 1.00 55.80  ? 107  ARG A C   1 
ATOM   833  O O   . ARG A 1 106 ? -80.157 39.708  -14.706 1.00 56.88  ? 107  ARG A O   1 
ATOM   834  C CB  . ARG A 1 106 ? -77.760 38.904  -12.738 1.00 57.92  ? 107  ARG A CB  1 
ATOM   835  C CG  . ARG A 1 106 ? -76.337 38.591  -12.373 1.00 62.94  ? 107  ARG A CG  1 
ATOM   836  C CD  . ARG A 1 106 ? -76.280 37.825  -11.075 1.00 66.54  ? 107  ARG A CD  1 
ATOM   837  N NE  . ARG A 1 106 ? -75.680 38.624  -10.017 1.00 67.51  ? 107  ARG A NE  1 
ATOM   838  C CZ  . ARG A 1 106 ? -75.723 38.299  -8.732  1.00 70.91  ? 107  ARG A CZ  1 
ATOM   839  N NH1 . ARG A 1 106 ? -76.334 37.184  -8.354  1.00 68.41  ? 107  ARG A NH1 1 
ATOM   840  N NH2 . ARG A 1 106 ? -75.153 39.084  -7.829  1.00 75.56  ? 107  ARG A NH2 1 
ATOM   841  N N   . PRO A 1 107 ? -78.618 38.560  -15.860 1.00 57.97  ? 108  PRO A N   1 
ATOM   842  C CA  . PRO A 1 107 ? -79.634 37.983  -16.742 1.00 60.59  ? 108  PRO A CA  1 
ATOM   843  C C   . PRO A 1 107 ? -80.700 37.243  -15.947 1.00 67.94  ? 108  PRO A C   1 
ATOM   844  O O   . PRO A 1 107 ? -80.424 36.639  -14.906 1.00 61.64  ? 108  PRO A O   1 
ATOM   845  C CB  . PRO A 1 107 ? -78.825 37.035  -17.628 1.00 52.18  ? 108  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 107 ? -77.462 37.664  -17.680 1.00 48.41  ? 108  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 107 ? -77.247 38.275  -16.322 1.00 49.94  ? 108  PRO A CD  1 
ATOM   848  N N   . THR A 1 108 ? -81.940 37.324  -16.429 1.00 76.31  ? 109  THR A N   1 
ATOM   849  C CA  . THR A 1 108 ? -83.016 36.556  -15.818 1.00 82.02  ? 109  THR A CA  1 
ATOM   850  C C   . THR A 1 108 ? -83.028 35.127  -16.344 1.00 80.06  ? 109  THR A C   1 
ATOM   851  O O   . THR A 1 108 ? -83.195 34.176  -15.572 1.00 87.34  ? 109  THR A O   1 
ATOM   852  C CB  . THR A 1 108 ? -84.362 37.239  -16.069 1.00 86.77  ? 109  THR A CB  1 
ATOM   853  O OG1 . THR A 1 108 ? -84.440 37.660  -17.437 1.00 96.99  ? 109  THR A OG1 1 
ATOM   854  C CG2 . THR A 1 108 ? -84.511 38.454  -15.172 1.00 78.13  ? 109  THR A CG2 1 
ATOM   855  N N   . SER A 1 109 ? -82.837 34.962  -17.648 1.00 69.31  ? 110  SER A N   1 
ATOM   856  C CA  . SER A 1 109 ? -82.722 33.703  -18.359 1.00 67.63  ? 110  SER A CA  1 
ATOM   857  C C   . SER A 1 109 ? -81.254 33.315  -18.494 1.00 65.69  ? 110  SER A C   1 
ATOM   858  O O   . SER A 1 109 ? -80.385 34.186  -18.592 1.00 66.43  ? 110  SER A O   1 
ATOM   859  C CB  . SER A 1 109 ? -83.348 33.820  -19.746 1.00 73.86  ? 110  SER A CB  1 
ATOM   860  O OG  . SER A 1 109 ? -84.487 34.664  -19.723 1.00 83.19  ? 110  SER A OG  1 
ATOM   861  N N   . PRO A 1 110 ? -80.949 32.019  -18.481 1.00 63.42  ? 111  PRO A N   1 
ATOM   862  C CA  . PRO A 1 110 ? -79.569 31.583  -18.734 1.00 58.31  ? 111  PRO A CA  1 
ATOM   863  C C   . PRO A 1 110 ? -79.056 32.142  -20.053 1.00 56.88  ? 111  PRO A C   1 
ATOM   864  O O   . PRO A 1 110 ? -79.739 32.096  -21.079 1.00 53.39  ? 111  PRO A O   1 
ATOM   865  C CB  . PRO A 1 110 ? -79.682 30.056  -18.769 1.00 60.03  ? 111  PRO A CB  1 
ATOM   866  C CG  . PRO A 1 110 ? -80.880 29.752  -17.933 1.00 61.27  ? 111  PRO A CG  1 
ATOM   867  C CD  . PRO A 1 110 ? -81.837 30.892  -18.147 1.00 63.29  ? 111  PRO A CD  1 
ATOM   868  N N   . THR A 1 111 ? -77.840 32.679  -20.016 1.00 52.31  ? 112  THR A N   1 
ATOM   869  C CA  . THR A 1 111 ? -77.271 33.479  -21.080 1.00 48.41  ? 112  THR A CA  1 
ATOM   870  C C   . THR A 1 111 ? -76.027 32.807  -21.653 1.00 46.54  ? 112  THR A C   1 
ATOM   871  O O   . THR A 1 111 ? -75.213 32.271  -20.892 1.00 45.19  ? 112  THR A O   1 
ATOM   872  C CB  . THR A 1 111 ? -76.917 34.875  -20.537 1.00 59.12  ? 112  THR A CB  1 
ATOM   873  O OG1 . THR A 1 111 ? -78.126 35.591  -20.259 1.00 68.94  ? 112  THR A OG1 1 
ATOM   874  C CG2 . THR A 1 111 ? -76.082 35.669  -21.520 1.00 58.02  ? 112  THR A CG2 1 
ATOM   875  N N   . PRO A 1 112 ? -75.860 32.805  -22.979 1.00 48.82  ? 113  PRO A N   1 
ATOM   876  C CA  . PRO A 1 112 ? -74.679 32.167  -23.575 1.00 45.76  ? 113  PRO A CA  1 
ATOM   877  C C   . PRO A 1 112 ? -73.385 32.813  -23.105 1.00 40.78  ? 113  PRO A C   1 
ATOM   878  O O   . PRO A 1 112 ? -73.322 34.014  -22.825 1.00 40.02  ? 113  PRO A O   1 
ATOM   879  C CB  . PRO A 1 112 ? -74.889 32.363  -25.081 1.00 50.60  ? 113  PRO A CB  1 
ATOM   880  C CG  . PRO A 1 112 ? -75.889 33.476  -25.187 1.00 58.02  ? 113  PRO A CG  1 
ATOM   881  C CD  . PRO A 1 112 ? -76.785 33.305  -24.008 1.00 53.78  ? 113  PRO A CD  1 
ATOM   882  N N   . VAL A 1 113 ? -72.342 31.987  -23.028 1.00 31.11  ? 114  VAL A N   1 
ATOM   883  C CA  . VAL A 1 113 ? -71.071 32.350  -22.418 1.00 31.04  ? 114  VAL A CA  1 
ATOM   884  C C   . VAL A 1 113 ? -69.985 32.345  -23.485 1.00 33.84  ? 114  VAL A C   1 
ATOM   885  O O   . VAL A 1 113 ? -69.873 31.386  -24.257 1.00 33.86  ? 114  VAL A O   1 
ATOM   886  C CB  . VAL A 1 113 ? -70.706 31.384  -21.278 1.00 33.82  ? 114  VAL A CB  1 
ATOM   887  C CG1 . VAL A 1 113 ? -69.397 31.803  -20.633 1.00 28.84  ? 114  VAL A CG1 1 
ATOM   888  C CG2 . VAL A 1 113 ? -71.846 31.310  -20.252 1.00 29.15  ? 114  VAL A CG2 1 
ATOM   889  N N   . LEU A 1 114 ? -69.185 33.407  -23.518 1.00 34.56  ? 115  LEU A N   1 
ATOM   890  C CA  . LEU A 1 114 ? -67.979 33.476  -24.333 1.00 29.17  ? 115  LEU A CA  1 
ATOM   891  C C   . LEU A 1 114 ? -66.761 33.405  -23.418 1.00 35.19  ? 115  LEU A C   1 
ATOM   892  O O   . LEU A 1 114 ? -66.669 34.164  -22.448 1.00 36.94  ? 115  LEU A O   1 
ATOM   893  C CB  . LEU A 1 114 ? -67.950 34.765  -25.153 1.00 31.41  ? 115  LEU A CB  1 
ATOM   894  C CG  . LEU A 1 114 ? -68.793 34.774  -26.424 1.00 34.35  ? 115  LEU A CG  1 
ATOM   895  C CD1 . LEU A 1 114 ? -69.120 36.198  -26.836 1.00 33.21  ? 115  LEU A CD1 1 
ATOM   896  C CD2 . LEU A 1 114 ? -68.037 34.056  -27.524 1.00 37.84  ? 115  LEU A CD2 1 
ATOM   897  N N   . VAL A 1 115 ? -65.836 32.496  -23.720 1.00 29.94  ? 116  VAL A N   1 
ATOM   898  C CA  . VAL A 1 115 ? -64.632 32.300  -22.916 1.00 31.67  ? 116  VAL A CA  1 
ATOM   899  C C   . VAL A 1 115 ? -63.415 32.616  -23.774 1.00 34.47  ? 116  VAL A C   1 
ATOM   900  O O   . VAL A 1 115 ? -63.167 31.937  -24.776 1.00 34.92  ? 116  VAL A O   1 
ATOM   901  C CB  . VAL A 1 115 ? -64.541 30.874  -22.357 1.00 30.03  ? 116  VAL A CB  1 
ATOM   902  C CG1 . VAL A 1 115 ? -63.285 30.733  -21.499 1.00 28.10  ? 116  VAL A CG1 1 
ATOM   903  C CG2 . VAL A 1 115 ? -65.792 30.542  -21.557 1.00 24.53  ? 116  VAL A CG2 1 
ATOM   904  N N   . TRP A 1 116 ? -62.642 33.624  -23.362 1.00 33.01  ? 117  TRP A N   1 
ATOM   905  C CA  . TRP A 1 116 ? -61.498 34.119  -24.120 1.00 27.06  ? 117  TRP A CA  1 
ATOM   906  C C   . TRP A 1 116 ? -60.200 33.499  -23.619 1.00 28.87  ? 117  TRP A C   1 
ATOM   907  O O   . TRP A 1 116 ? -59.952 33.458  -22.408 1.00 29.33  ? 117  TRP A O   1 
ATOM   908  C CB  . TRP A 1 116 ? -61.402 35.640  -24.018 1.00 25.06  ? 117  TRP A CB  1 
ATOM   909  C CG  . TRP A 1 116 ? -60.170 36.210  -24.663 1.00 28.52  ? 117  TRP A CG  1 
ATOM   910  C CD1 . TRP A 1 116 ? -59.087 36.758  -24.033 1.00 28.39  ? 117  TRP A CD1 1 
ATOM   911  C CD2 . TRP A 1 116 ? -59.904 36.298  -26.067 1.00 26.86  ? 117  TRP A CD2 1 
ATOM   912  N NE1 . TRP A 1 116 ? -58.164 37.184  -24.959 1.00 29.92  ? 117  TRP A NE1 1 
ATOM   913  C CE2 . TRP A 1 116 ? -58.641 36.912  -26.216 1.00 28.69  ? 117  TRP A CE2 1 
ATOM   914  C CE3 . TRP A 1 116 ? -60.609 35.915  -27.214 1.00 26.35  ? 117  TRP A CE3 1 
ATOM   915  C CZ2 . TRP A 1 116 ? -58.069 37.151  -27.467 1.00 26.56  ? 117  TRP A CZ2 1 
ATOM   916  C CZ3 . TRP A 1 116 ? -60.044 36.160  -28.459 1.00 25.34  ? 117  TRP A CZ3 1 
ATOM   917  C CH2 . TRP A 1 116 ? -58.784 36.773  -28.573 1.00 25.74  ? 117  TRP A CH2 1 
ATOM   918  N N   . ILE A 1 117 ? -59.358 33.061  -24.552 1.00 25.15  ? 118  ILE A N   1 
ATOM   919  C CA  . ILE A 1 117 ? -58.028 32.543  -24.245 1.00 27.59  ? 118  ILE A CA  1 
ATOM   920  C C   . ILE A 1 117 ? -57.033 33.386  -25.029 1.00 28.62  ? 118  ILE A C   1 
ATOM   921  O O   . ILE A 1 117 ? -57.010 33.335  -26.266 1.00 27.01  ? 118  ILE A O   1 
ATOM   922  C CB  . ILE A 1 117 ? -57.886 31.056  -24.598 1.00 24.28  ? 118  ILE A CB  1 
ATOM   923  C CG1 . ILE A 1 117 ? -59.017 30.238  -23.960 1.00 27.83  ? 118  ILE A CG1 1 
ATOM   924  C CG2 . ILE A 1 117 ? -56.534 30.536  -24.153 1.00 24.48  ? 118  ILE A CG2 1 
ATOM   925  C CD1 . ILE A 1 117 ? -58.922 28.731  -24.229 1.00 26.71  ? 118  ILE A CD1 1 
ATOM   926  N N   . TYR A 1 118 ? -56.203 34.150  -24.322 1.00 24.16  ? 119  TYR A N   1 
ATOM   927  C CA  . TYR A 1 118 ? -55.289 35.050  -25.010 1.00 22.37  ? 119  TYR A CA  1 
ATOM   928  C C   . TYR A 1 118 ? -54.154 34.283  -25.679 1.00 22.52  ? 119  TYR A C   1 
ATOM   929  O O   . TYR A 1 118 ? -53.802 33.164  -25.289 1.00 24.53  ? 119  TYR A O   1 
ATOM   930  C CB  . TYR A 1 118 ? -54.700 36.084  -24.048 1.00 22.39  ? 119  TYR A CB  1 
ATOM   931  C CG  . TYR A 1 118 ? -53.990 35.518  -22.836 1.00 26.63  ? 119  TYR A CG  1 
ATOM   932  C CD1 . TYR A 1 118 ? -52.711 34.959  -22.934 1.00 26.31  ? 119  TYR A CD1 1 
ATOM   933  C CD2 . TYR A 1 118 ? -54.584 35.573  -21.578 1.00 24.16  ? 119  TYR A CD2 1 
ATOM   934  C CE1 . TYR A 1 118 ? -52.058 34.454  -21.805 1.00 31.07  ? 119  TYR A CE1 1 
ATOM   935  C CE2 . TYR A 1 118 ? -53.938 35.074  -20.448 1.00 28.76  ? 119  TYR A CE2 1 
ATOM   936  C CZ  . TYR A 1 118 ? -52.681 34.514  -20.566 1.00 29.38  ? 119  TYR A CZ  1 
ATOM   937  O OH  . TYR A 1 118 ? -52.057 34.019  -19.436 1.00 29.32  ? 119  TYR A OH  1 
ATOM   938  N N   . GLY A 1 119 ? -53.511 34.959  -26.588 1.00 22.39  ? 120  GLY A N   1 
ATOM   939  C CA  . GLY A 1 119 ? -52.365 34.478  -27.290 1.00 24.06  ? 120  GLY A CA  1 
ATOM   940  C C   . GLY A 1 119 ? -51.089 35.100  -26.814 1.00 29.62  ? 120  GLY A C   1 
ATOM   941  O O   . GLY A 1 119 ? -51.050 35.820  -25.878 1.00 32.07  ? 120  GLY A O   1 
ATOM   942  N N   . GLY A 1 120 ? -50.027 34.855  -27.527 1.00 30.59  ? 121  GLY A N   1 
ATOM   943  C CA  . GLY A 1 120 ? -48.745 35.375  -27.174 1.00 23.30  ? 121  GLY A CA  1 
ATOM   944  C C   . GLY A 1 120 ? -47.686 34.325  -27.156 1.00 31.73  ? 121  GLY A C   1 
ATOM   945  O O   . GLY A 1 120 ? -46.813 34.348  -26.357 1.00 32.39  ? 121  GLY A O   1 
ATOM   946  N N   . GLY A 1 121 ? -47.816 33.398  -28.089 1.00 29.44  ? 122  GLY A N   1 
ATOM   947  C CA  . GLY A 1 121 ? -46.873 32.340  -28.363 1.00 26.46  ? 122  GLY A CA  1 
ATOM   948  C C   . GLY A 1 121 ? -46.516 31.395  -27.260 1.00 30.37  ? 122  GLY A C   1 
ATOM   949  O O   . GLY A 1 121 ? -45.484 30.832  -27.288 1.00 28.63  ? 122  GLY A O   1 
ATOM   950  N N   . PHE A 1 122 ? -47.424 31.221  -26.331 1.00 24.71  ? 123  PHE A N   1 
ATOM   951  C CA  . PHE A 1 122 ? -47.295 30.410  -25.118 1.00 27.20  ? 123  PHE A CA  1 
ATOM   952  C C   . PHE A 1 122 ? -46.182 30.891  -24.187 1.00 29.96  ? 123  PHE A C   1 
ATOM   953  O O   . PHE A 1 122 ? -45.851 30.201  -23.217 1.00 28.83  ? 123  PHE A O   1 
ATOM   954  C CB  . PHE A 1 122 ? -47.083 28.926  -25.439 1.00 25.85  ? 123  PHE A CB  1 
ATOM   955  C CG  . PHE A 1 122 ? -48.255 28.275  -26.114 1.00 29.21  ? 123  PHE A CG  1 
ATOM   956  C CD1 . PHE A 1 122 ? -49.432 28.046  -25.422 1.00 19.63  ? 123  PHE A CD1 1 
ATOM   957  C CD2 . PHE A 1 122 ? -48.176 27.890  -27.446 1.00 29.06  ? 123  PHE A CD2 1 
ATOM   958  C CE1 . PHE A 1 122 ? -50.516 27.439  -26.045 1.00 26.17  ? 123  PHE A CE1 1 
ATOM   959  C CE2 . PHE A 1 122 ? -49.250 27.279  -28.076 1.00 24.98  ? 123  PHE A CE2 1 
ATOM   960  C CZ  . PHE A 1 122 ? -50.423 27.052  -27.374 1.00 24.79  ? 123  PHE A CZ  1 
ATOM   961  N N   . TYR A 1 123 ? -45.597 32.060  -24.444 1.00 23.23  ? 124  TYR A N   1 
ATOM   962  C CA  . TYR A 1 123 ? -44.599 32.624  -23.553 1.00 29.92  ? 124  TYR A CA  1 
ATOM   963  C C   . TYR A 1 123 ? -45.008 33.969  -22.964 1.00 30.79  ? 124  TYR A C   1 
ATOM   964  O O   . TYR A 1 123 ? -44.240 34.540  -22.179 1.00 32.24  ? 124  TYR A O   1 
ATOM   965  C CB  . TYR A 1 123 ? -43.260 32.781  -24.284 1.00 29.03  ? 124  TYR A CB  1 
ATOM   966  C CG  . TYR A 1 123 ? -43.251 33.934  -25.261 1.00 32.48  ? 124  TYR A CG  1 
ATOM   967  C CD1 . TYR A 1 123 ? -42.877 35.216  -24.858 1.00 26.00  ? 124  TYR A CD1 1 
ATOM   968  C CD2 . TYR A 1 123 ? -43.610 33.743  -26.590 1.00 33.51  ? 124  TYR A CD2 1 
ATOM   969  C CE1 . TYR A 1 123 ? -42.877 36.274  -25.750 1.00 33.56  ? 124  TYR A CE1 1 
ATOM   970  C CE2 . TYR A 1 123 ? -43.606 34.794  -27.488 1.00 36.19  ? 124  TYR A CE2 1 
ATOM   971  C CZ  . TYR A 1 123 ? -43.240 36.056  -27.064 1.00 39.01  ? 124  TYR A CZ  1 
ATOM   972  O OH  . TYR A 1 123 ? -43.236 37.103  -27.958 1.00 47.89  ? 124  TYR A OH  1 
ATOM   973  N N   . SER A 1 124 ? -46.170 34.502  -23.326 1.00 25.44  ? 125  SER A N   1 
ATOM   974  C CA  . SER A 1 124 ? -46.578 35.827  -22.877 1.00 28.03  ? 125  SER A CA  1 
ATOM   975  C C   . SER A 1 124 ? -48.093 35.932  -22.979 1.00 27.88  ? 125  SER A C   1 
ATOM   976  O O   . SER A 1 124 ? -48.773 34.999  -23.417 1.00 27.55  ? 125  SER A O   1 
ATOM   977  C CB  . SER A 1 124 ? -45.907 36.918  -23.709 1.00 27.19  ? 125  SER A CB  1 
ATOM   978  O OG  . SER A 1 124 ? -46.268 36.755  -25.067 1.00 26.37  ? 125  SER A OG  1 
ATOM   979  N N   . GLY A 1 125 ? -48.609 37.092  -22.601 1.00 23.44  ? 126  GLY A N   1 
ATOM   980  C CA  . GLY A 1 125 ? -50.024 37.389  -22.633 1.00 19.60  ? 126  GLY A CA  1 
ATOM   981  C C   . GLY A 1 125 ? -50.614 37.473  -21.233 1.00 26.75  ? 126  GLY A C   1 
ATOM   982  O O   . GLY A 1 125 ? -50.008 37.064  -20.237 1.00 23.13  ? 126  GLY A O   1 
ATOM   983  N N   . ALA A 1 126 ? -51.824 38.020  -21.167 1.00 27.97  ? 127  ALA A N   1 
ATOM   984  C CA  . ALA A 1 126 ? -52.541 38.197  -19.911 1.00 32.81  ? 127  ALA A CA  1 
ATOM   985  C C   . ALA A 1 126 ? -53.979 38.563  -20.233 1.00 33.62  ? 127  ALA A C   1 
ATOM   986  O O   . ALA A 1 126 ? -54.257 39.149  -21.284 1.00 30.44  ? 127  ALA A O   1 
ATOM   987  C CB  . ALA A 1 126 ? -51.902 39.281  -19.035 1.00 28.60  ? 127  ALA A CB  1 
ATOM   988  N N   . SER A 1 127 ? -54.892 38.215  -19.326 1.00 25.55  ? 128  SER A N   1 
ATOM   989  C CA  . SER A 1 127 ? -56.288 38.526  -19.595 1.00 29.65  ? 128  SER A CA  1 
ATOM   990  C C   . SER A 1 127 ? -56.622 39.970  -19.269 1.00 29.56  ? 128  SER A C   1 
ATOM   991  O O   . SER A 1 127 ? -57.752 40.400  -19.518 1.00 26.79  ? 128  SER A O   1 
ATOM   992  C CB  . SER A 1 127 ? -57.227 37.618  -18.799 1.00 22.10  ? 128  SER A CB  1 
ATOM   993  O OG  . SER A 1 127 ? -56.906 37.635  -17.418 1.00 25.86  ? 128  SER A OG  1 
ATOM   994  N N   . SER A 1 128 ? -55.675 40.718  -18.712 1.00 24.84  ? 129  SER A N   1 
ATOM   995  C CA  . SER A 1 128 ? -55.929 42.070  -18.240 1.00 25.97  ? 129  SER A CA  1 
ATOM   996  C C   . SER A 1 128 ? -55.613 43.133  -19.277 1.00 29.86  ? 129  SER A C   1 
ATOM   997  O O   . SER A 1 128 ? -55.826 44.318  -18.999 1.00 28.16  ? 129  SER A O   1 
ATOM   998  C CB  . SER A 1 128 ? -55.108 42.352  -16.979 1.00 21.73  ? 129  SER A CB  1 
ATOM   999  O OG  . SER A 1 128 ? -53.731 42.103  -17.202 1.00 28.05  ? 129  SER A OG  1 
ATOM   1000 N N   . LEU A 1 129 ? -55.093 42.755  -20.444 1.00 27.29  ? 130  LEU A N   1 
ATOM   1001 C CA  . LEU A 1 129 ? -54.748 43.758  -21.445 1.00 35.01  ? 130  LEU A CA  1 
ATOM   1002 C C   . LEU A 1 129 ? -55.986 44.542  -21.866 1.00 33.43  ? 130  LEU A C   1 
ATOM   1003 O O   . LEU A 1 129 ? -57.084 43.989  -21.975 1.00 32.11  ? 130  LEU A O   1 
ATOM   1004 C CB  . LEU A 1 129 ? -54.089 43.104  -22.666 1.00 30.12  ? 130  LEU A CB  1 
ATOM   1005 C CG  . LEU A 1 129 ? -52.909 42.173  -22.376 1.00 37.31  ? 130  LEU A CG  1 
ATOM   1006 C CD1 . LEU A 1 129 ? -52.373 41.587  -23.669 1.00 29.49  ? 130  LEU A CD1 1 
ATOM   1007 C CD2 . LEU A 1 129 ? -51.805 42.893  -21.595 1.00 32.94  ? 130  LEU A CD2 1 
ATOM   1008 N N   . ASP A 1 130 ? -55.795 45.845  -22.094 1.00 32.41  ? 131  ASP A N   1 
ATOM   1009 C CA  . ASP A 1 130 ? -56.904 46.729  -22.446 1.00 35.30  ? 131  ASP A CA  1 
ATOM   1010 C C   . ASP A 1 130 ? -57.704 46.194  -23.625 1.00 31.50  ? 131  ASP A C   1 
ATOM   1011 O O   . ASP A 1 130 ? -58.935 46.304  -23.656 1.00 36.04  ? 131  ASP A O   1 
ATOM   1012 C CB  . ASP A 1 130 ? -56.375 48.127  -22.772 1.00 35.71  ? 131  ASP A CB  1 
ATOM   1013 C CG  . ASP A 1 130 ? -55.844 48.850  -21.552 1.00 49.12  ? 131  ASP A CG  1 
ATOM   1014 O OD1 . ASP A 1 130 ? -56.190 48.445  -20.421 1.00 47.83  ? 131  ASP A OD1 1 
ATOM   1015 O OD2 . ASP A 1 130 ? -55.076 49.821  -21.724 1.00 57.13  ? 131  ASP A OD2 1 
ATOM   1016 N N   . VAL A 1 131 ? -57.021 45.602  -24.604 1.00 28.61  ? 132  VAL A N   1 
ATOM   1017 C CA  . VAL A 1 131 ? -57.685 45.154  -25.819 1.00 37.17  ? 132  VAL A CA  1 
ATOM   1018 C C   . VAL A 1 131 ? -58.546 43.915  -25.599 1.00 33.35  ? 132  VAL A C   1 
ATOM   1019 O O   . VAL A 1 131 ? -59.293 43.526  -26.501 1.00 34.78  ? 132  VAL A O   1 
ATOM   1020 C CB  . VAL A 1 131 ? -56.603 44.953  -26.906 1.00 36.95  ? 132  VAL A CB  1 
ATOM   1021 C CG1 . VAL A 1 131 ? -55.828 43.660  -26.685 1.00 34.26  ? 132  VAL A CG1 1 
ATOM   1022 C CG2 . VAL A 1 131 ? -57.199 45.004  -28.278 1.00 43.24  ? 132  VAL A CG2 1 
ATOM   1023 N N   . TYR A 1 132 ? -58.484 43.298  -24.418 1.00 29.93  ? 133  TYR A N   1 
ATOM   1024 C CA  . TYR A 1 132 ? -59.327 42.156  -24.078 1.00 29.03  ? 133  TYR A CA  1 
ATOM   1025 C C   . TYR A 1 132 ? -60.463 42.532  -23.132 1.00 32.57  ? 133  TYR A C   1 
ATOM   1026 O O   . TYR A 1 132 ? -61.103 41.642  -22.562 1.00 33.57  ? 133  TYR A O   1 
ATOM   1027 C CB  . TYR A 1 132 ? -58.493 41.032  -23.449 1.00 26.10  ? 133  TYR A CB  1 
ATOM   1028 C CG  . TYR A 1 132 ? -57.324 40.539  -24.283 1.00 30.41  ? 133  TYR A CG  1 
ATOM   1029 C CD1 . TYR A 1 132 ? -56.209 39.969  -23.673 1.00 25.93  ? 133  TYR A CD1 1 
ATOM   1030 C CD2 . TYR A 1 132 ? -57.335 40.627  -25.671 1.00 30.14  ? 133  TYR A CD2 1 
ATOM   1031 C CE1 . TYR A 1 132 ? -55.134 39.516  -24.411 1.00 20.05  ? 133  TYR A CE1 1 
ATOM   1032 C CE2 . TYR A 1 132 ? -56.258 40.169  -26.426 1.00 31.50  ? 133  TYR A CE2 1 
ATOM   1033 C CZ  . TYR A 1 132 ? -55.161 39.615  -25.783 1.00 30.72  ? 133  TYR A CZ  1 
ATOM   1034 O OH  . TYR A 1 132 ? -54.085 39.159  -26.504 1.00 26.50  ? 133  TYR A OH  1 
ATOM   1035 N N   . ASP A 1 133 ? -60.717 43.825  -22.947 1.00 37.01  ? 134  ASP A N   1 
ATOM   1036 C CA  . ASP A 1 133 ? -61.775 44.289  -22.058 1.00 39.91  ? 134  ASP A CA  1 
ATOM   1037 C C   . ASP A 1 133 ? -63.134 43.769  -22.517 1.00 38.17  ? 134  ASP A C   1 
ATOM   1038 O O   . ASP A 1 133 ? -63.605 44.116  -23.605 1.00 38.98  ? 134  ASP A O   1 
ATOM   1039 C CB  . ASP A 1 133 ? -61.768 45.818  -22.024 1.00 42.62  ? 134  ASP A CB  1 
ATOM   1040 C CG  . ASP A 1 133 ? -62.648 46.393  -20.925 1.00 44.14  ? 134  ASP A CG  1 
ATOM   1041 O OD1 . ASP A 1 133 ? -63.481 45.658  -20.350 1.00 41.70  ? 134  ASP A OD1 1 
ATOM   1042 O OD2 . ASP A 1 133 ? -62.510 47.605  -20.649 1.00 47.59  ? 134  ASP A OD2 1 
ATOM   1043 N N   . GLY A 1 134 ? -63.775 42.959  -21.672 1.00 33.73  ? 135  GLY A N   1 
ATOM   1044 C CA  . GLY A 1 134 ? -65.045 42.332  -21.992 1.00 30.89  ? 135  GLY A CA  1 
ATOM   1045 C C   . GLY A 1 134 ? -66.284 43.190  -21.836 1.00 31.08  ? 135  GLY A C   1 
ATOM   1046 O O   . GLY A 1 134 ? -67.381 42.737  -22.183 1.00 35.44  ? 135  GLY A O   1 
ATOM   1047 N N   . ARG A 1 135 ? -66.149 44.429  -21.356 1.00 29.80  ? 136  ARG A N   1 
ATOM   1048 C CA  . ARG A 1 135 ? -67.330 45.207  -20.990 1.00 35.75  ? 136  ARG A CA  1 
ATOM   1049 C C   . ARG A 1 135 ? -68.175 45.571  -22.210 1.00 38.63  ? 136  ARG A C   1 
ATOM   1050 O O   . ARG A 1 135 ? -69.408 45.593  -22.126 1.00 39.36  ? 136  ARG A O   1 
ATOM   1051 C CB  . ARG A 1 135 ? -66.914 46.463  -20.213 1.00 35.61  ? 136  ARG A CB  1 
ATOM   1052 C CG  . ARG A 1 135 ? -66.457 47.630  -21.082 1.00 45.20  ? 136  ARG A CG  1 
ATOM   1053 C CD  . ARG A 1 135 ? -66.115 48.858  -20.260 1.00 41.55  ? 136  ARG A CD  1 
ATOM   1054 N NE  . ARG A 1 135 ? -64.861 48.688  -19.539 1.00 44.74  ? 136  ARG A NE  1 
ATOM   1055 C CZ  . ARG A 1 135 ? -64.492 49.418  -18.490 1.00 53.68  ? 136  ARG A CZ  1 
ATOM   1056 N NH1 . ARG A 1 135 ? -65.282 50.383  -18.029 1.00 55.47  ? 136  ARG A NH1 1 
ATOM   1057 N NH2 . ARG A 1 135 ? -63.328 49.183  -17.901 1.00 49.98  ? 136  ARG A NH2 1 
ATOM   1058 N N   . PHE A 1 136 ? -67.539 45.842  -23.356 1.00 37.56  ? 137  PHE A N   1 
ATOM   1059 C CA  . PHE A 1 136 ? -68.293 46.286  -24.529 1.00 40.16  ? 137  PHE A CA  1 
ATOM   1060 C C   . PHE A 1 136 ? -69.066 45.135  -25.160 1.00 29.28  ? 137  PHE A C   1 
ATOM   1061 O O   . PHE A 1 136 ? -70.234 45.294  -25.532 1.00 36.77  ? 137  PHE A O   1 
ATOM   1062 C CB  . PHE A 1 136 ? -67.353 46.933  -25.549 1.00 31.35  ? 137  PHE A CB  1 
ATOM   1063 C CG  . PHE A 1 136 ? -66.453 47.976  -24.954 1.00 33.92  ? 137  PHE A CG  1 
ATOM   1064 C CD1 . PHE A 1 136 ? -65.116 47.703  -24.723 1.00 35.37  ? 137  PHE A CD1 1 
ATOM   1065 C CD2 . PHE A 1 136 ? -66.952 49.222  -24.596 1.00 39.16  ? 137  PHE A CD2 1 
ATOM   1066 C CE1 . PHE A 1 136 ? -64.285 48.654  -24.154 1.00 36.17  ? 137  PHE A CE1 1 
ATOM   1067 C CE2 . PHE A 1 136 ? -66.122 50.182  -24.031 1.00 40.52  ? 137  PHE A CE2 1 
ATOM   1068 C CZ  . PHE A 1 136 ? -64.786 49.896  -23.813 1.00 40.81  ? 137  PHE A CZ  1 
ATOM   1069 N N   . LEU A 1 137 ? -68.433 43.967  -25.273 1.00 33.21  ? 138  LEU A N   1 
ATOM   1070 C CA  . LEU A 1 137 ? -69.115 42.785  -25.792 1.00 36.28  ? 138  LEU A CA  1 
ATOM   1071 C C   . LEU A 1 137 ? -70.343 42.439  -24.954 1.00 39.23  ? 138  LEU A C   1 
ATOM   1072 O O   . LEU A 1 137 ? -71.419 42.154  -25.496 1.00 40.55  ? 138  LEU A O   1 
ATOM   1073 C CB  . LEU A 1 137 ? -68.131 41.616  -25.823 1.00 35.33  ? 138  LEU A CB  1 
ATOM   1074 C CG  . LEU A 1 137 ? -68.255 40.505  -26.856 1.00 45.84  ? 138  LEU A CG  1 
ATOM   1075 C CD1 . LEU A 1 137 ? -68.824 41.028  -28.150 1.00 44.41  ? 138  LEU A CD1 1 
ATOM   1076 C CD2 . LEU A 1 137 ? -66.881 39.897  -27.092 1.00 45.78  ? 138  LEU A CD2 1 
ATOM   1077 N N   . VAL A 1 138 ? -70.204 42.466  -23.626 1.00 35.14  ? 139  VAL A N   1 
ATOM   1078 C CA  . VAL A 1 138 ? -71.307 42.065  -22.759 1.00 34.48  ? 139  VAL A CA  1 
ATOM   1079 C C   . VAL A 1 138 ? -72.432 43.088  -22.821 1.00 38.66  ? 139  VAL A C   1 
ATOM   1080 O O   . VAL A 1 138 ? -73.616 42.732  -22.883 1.00 37.99  ? 139  VAL A O   1 
ATOM   1081 C CB  . VAL A 1 138 ? -70.792 41.856  -21.325 1.00 37.98  ? 139  VAL A CB  1 
ATOM   1082 C CG1 . VAL A 1 138 ? -71.940 41.891  -20.320 1.00 33.74  ? 139  VAL A CG1 1 
ATOM   1083 C CG2 . VAL A 1 138 ? -70.008 40.548  -21.243 1.00 33.61  ? 139  VAL A CG2 1 
ATOM   1084 N N   . GLN A 1 139 ? -72.083 44.373  -22.845 1.00 36.13  ? 140  GLN A N   1 
ATOM   1085 C CA  . GLN A 1 139 ? -73.105 45.405  -22.969 1.00 37.31  ? 140  GLN A CA  1 
ATOM   1086 C C   . GLN A 1 139 ? -73.817 45.324  -24.314 1.00 43.10  ? 140  GLN A C   1 
ATOM   1087 O O   . GLN A 1 139 ? -75.051 45.370  -24.372 1.00 41.25  ? 140  GLN A O   1 
ATOM   1088 C CB  . GLN A 1 139 ? -72.485 46.789  -22.772 1.00 34.28  ? 140  GLN A CB  1 
ATOM   1089 C CG  . GLN A 1 139 ? -73.487 47.831  -22.292 1.00 47.61  ? 140  GLN A CG  1 
ATOM   1090 C CD  . GLN A 1 139 ? -74.449 48.278  -23.379 1.00 63.53  ? 140  GLN A CD  1 
ATOM   1091 O OE1 . GLN A 1 139 ? -74.049 48.492  -24.524 1.00 70.87  ? 140  GLN A OE1 1 
ATOM   1092 N NE2 . GLN A 1 139 ? -75.724 48.431  -23.022 1.00 64.01  ? 140  GLN A NE2 1 
ATOM   1093 N N   . ALA A 1 140 ? -73.060 45.207  -25.412 1.00 37.11  ? 141  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 140 ? -73.681 45.290  -26.732 1.00 42.91  ? 141  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 140 ? -74.529 44.061  -27.040 1.00 45.78  ? 141  ALA A C   1 
ATOM   1096 O O   . ALA A 1 140 ? -75.588 44.178  -27.665 1.00 45.02  ? 141  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 140 ? -72.619 45.479  -27.816 1.00 35.13  ? 141  ALA A CB  1 
ATOM   1098 N N   . GLU A 1 141 ? -74.087 42.874  -26.622 1.00 44.71  ? 142  GLU A N   1 
ATOM   1099 C CA  . GLU A 1 141 ? -74.717 41.638  -27.068 1.00 44.71  ? 142  GLU A CA  1 
ATOM   1100 C C   . GLU A 1 141 ? -75.347 40.816  -25.952 1.00 47.83  ? 142  GLU A C   1 
ATOM   1101 O O   . GLU A 1 141 ? -75.901 39.748  -26.239 1.00 49.24  ? 142  GLU A O   1 
ATOM   1102 C CB  . GLU A 1 141 ? -73.700 40.773  -27.825 1.00 40.25  ? 142  GLU A CB  1 
ATOM   1103 C CG  . GLU A 1 141 ? -73.241 41.393  -29.128 1.00 39.89  ? 142  GLU A CG  1 
ATOM   1104 C CD  . GLU A 1 141 ? -74.370 41.529  -30.131 1.00 49.32  ? 142  GLU A CD  1 
ATOM   1105 O OE1 . GLU A 1 141 ? -75.286 40.677  -30.123 1.00 51.06  ? 142  GLU A OE1 1 
ATOM   1106 O OE2 . GLU A 1 141 ? -74.348 42.493  -30.927 1.00 55.99  ? 142  GLU A OE2 1 
ATOM   1107 N N   . ARG A 1 142 ? -75.281 41.278  -24.702 1.00 46.31  ? 143  ARG A N   1 
ATOM   1108 C CA  . ARG A 1 142 ? -75.908 40.604  -23.563 1.00 46.80  ? 143  ARG A CA  1 
ATOM   1109 C C   . ARG A 1 142 ? -75.474 39.145  -23.473 1.00 47.94  ? 143  ARG A C   1 
ATOM   1110 O O   . ARG A 1 142 ? -76.290 38.223  -23.436 1.00 60.60  ? 143  ARG A O   1 
ATOM   1111 C CB  . ARG A 1 142 ? -77.432 40.713  -23.627 1.00 51.74  ? 143  ARG A CB  1 
ATOM   1112 C CG  . ARG A 1 142 ? -77.948 42.136  -23.656 1.00 67.61  ? 143  ARG A CG  1 
ATOM   1113 C CD  . ARG A 1 142 ? -77.856 42.794  -22.294 1.00 82.53  ? 143  ARG A CD  1 
ATOM   1114 N NE  . ARG A 1 142 ? -78.612 44.041  -22.254 1.00 93.03  ? 143  ARG A NE  1 
ATOM   1115 C CZ  . ARG A 1 142 ? -78.074 45.230  -22.003 1.00 93.60  ? 143  ARG A CZ  1 
ATOM   1116 N NH1 . ARG A 1 142 ? -76.773 45.331  -21.762 1.00 91.62  ? 143  ARG A NH1 1 
ATOM   1117 N NH2 . ARG A 1 142 ? -78.836 46.314  -21.989 1.00 93.81  ? 143  ARG A NH2 1 
ATOM   1118 N N   . THR A 1 143 ? -74.169 38.940  -23.469 1.00 41.62  ? 144  THR A N   1 
ATOM   1119 C CA  . THR A 1 143 ? -73.572 37.653  -23.169 1.00 38.91  ? 144  THR A CA  1 
ATOM   1120 C C   . THR A 1 143 ? -72.897 37.739  -21.813 1.00 39.26  ? 144  THR A C   1 
ATOM   1121 O O   . THR A 1 143 ? -72.773 38.814  -21.221 1.00 42.43  ? 144  THR A O   1 
ATOM   1122 C CB  . THR A 1 143 ? -72.543 37.252  -24.234 1.00 41.56  ? 144  THR A CB  1 
ATOM   1123 O OG1 . THR A 1 143 ? -71.728 38.387  -24.553 1.00 48.48  ? 144  THR A OG1 1 
ATOM   1124 C CG2 . THR A 1 143 ? -73.237 36.753  -25.504 1.00 44.84  ? 144  THR A CG2 1 
ATOM   1125 N N   . VAL A 1 144 ? -72.457 36.590  -21.325 1.00 37.85  ? 145  VAL A N   1 
ATOM   1126 C CA  . VAL A 1 144 ? -71.482 36.530  -20.246 1.00 32.08  ? 145  VAL A CA  1 
ATOM   1127 C C   . VAL A 1 144 ? -70.128 36.241  -20.881 1.00 29.01  ? 145  VAL A C   1 
ATOM   1128 O O   . VAL A 1 144 ? -70.015 35.343  -21.726 1.00 31.83  ? 145  VAL A O   1 
ATOM   1129 C CB  . VAL A 1 144 ? -71.859 35.455  -19.209 1.00 33.74  ? 145  VAL A CB  1 
ATOM   1130 C CG1 . VAL A 1 144 ? -70.805 35.379  -18.119 1.00 26.22  ? 145  VAL A CG1 1 
ATOM   1131 C CG2 . VAL A 1 144 ? -73.233 35.742  -18.612 1.00 29.28  ? 145  VAL A CG2 1 
ATOM   1132 N N   . LEU A 1 145 ? -69.104 37.012  -20.511 1.00 29.97  ? 146  LEU A N   1 
ATOM   1133 C CA  . LEU A 1 145 ? -67.751 36.775  -21.006 1.00 29.66  ? 146  LEU A CA  1 
ATOM   1134 C C   . LEU A 1 145 ? -66.838 36.414  -19.846 1.00 35.13  ? 146  LEU A C   1 
ATOM   1135 O O   . LEU A 1 145 ? -66.835 37.091  -18.811 1.00 38.22  ? 146  LEU A O   1 
ATOM   1136 C CB  . LEU A 1 145 ? -67.189 37.974  -21.789 1.00 33.75  ? 146  LEU A CB  1 
ATOM   1137 C CG  . LEU A 1 145 ? -66.145 37.521  -22.840 1.00 49.53  ? 146  LEU A CG  1 
ATOM   1138 C CD1 . LEU A 1 145 ? -65.905 38.587  -23.869 1.00 49.59  ? 146  LEU A CD1 1 
ATOM   1139 C CD2 . LEU A 1 145 ? -64.786 37.124  -22.267 1.00 50.58  ? 146  LEU A CD2 1 
ATOM   1140 N N   . VAL A 1 146 ? -66.067 35.345  -20.038 1.00 31.51  ? 147  VAL A N   1 
ATOM   1141 C CA  . VAL A 1 146 ? -65.075 34.863  -19.091 1.00 28.14  ? 147  VAL A CA  1 
ATOM   1142 C C   . VAL A 1 146 ? -63.715 34.893  -19.773 1.00 35.27  ? 147  VAL A C   1 
ATOM   1143 O O   . VAL A 1 146 ? -63.597 34.534  -20.949 1.00 33.96  ? 147  VAL A O   1 
ATOM   1144 C CB  . VAL A 1 146 ? -65.412 33.436  -18.614 1.00 30.63  ? 147  VAL A CB  1 
ATOM   1145 C CG1 . VAL A 1 146 ? -64.457 32.994  -17.496 1.00 20.69  ? 147  VAL A CG1 1 
ATOM   1146 C CG2 . VAL A 1 146 ? -66.858 33.363  -18.160 1.00 27.09  ? 147  VAL A CG2 1 
ATOM   1147 N N   . SER A 1 147 ? -62.694 35.330  -19.043 1.00 36.16  ? 148  SER A N   1 
ATOM   1148 C CA  . SER A 1 147 ? -61.314 35.172  -19.490 1.00 32.41  ? 148  SER A CA  1 
ATOM   1149 C C   . SER A 1 147 ? -60.479 34.714  -18.306 1.00 32.73  ? 148  SER A C   1 
ATOM   1150 O O   . SER A 1 147 ? -60.796 35.027  -17.153 1.00 31.73  ? 148  SER A O   1 
ATOM   1151 C CB  . SER A 1 147 ? -60.730 36.462  -20.086 1.00 28.35  ? 148  SER A CB  1 
ATOM   1152 O OG  . SER A 1 147 ? -60.692 37.514  -19.135 1.00 31.28  ? 148  SER A OG  1 
ATOM   1153 N N   . MET A 1 148 ? -59.419 33.955  -18.586 1.00 30.90  ? 149  MET A N   1 
ATOM   1154 C CA  . MET A 1 148 ? -58.569 33.449  -17.519 1.00 29.16  ? 149  MET A CA  1 
ATOM   1155 C C   . MET A 1 148 ? -57.103 33.711  -17.826 1.00 34.40  ? 149  MET A C   1 
ATOM   1156 O O   . MET A 1 148 ? -56.700 33.834  -18.987 1.00 30.66  ? 149  MET A O   1 
ATOM   1157 C CB  . MET A 1 148 ? -58.795 31.938  -17.275 1.00 24.56  ? 149  MET A CB  1 
ATOM   1158 C CG  . MET A 1 148 ? -57.939 31.009  -18.126 1.00 26.23  ? 149  MET A CG  1 
ATOM   1159 S SD  . MET A 1 148 ? -58.323 31.188  -19.883 1.00 32.25  ? 149  MET A SD  1 
ATOM   1160 C CE  . MET A 1 148 ? -59.911 30.378  -19.990 1.00 27.48  ? 149  MET A CE  1 
ATOM   1161 N N   . ASN A 1 149 ? -56.313 33.814  -16.760 1.00 25.89  ? 150  ASN A N   1 
ATOM   1162 C CA  . ASN A 1 149 ? -54.865 33.740  -16.862 1.00 26.19  ? 150  ASN A CA  1 
ATOM   1163 C C   . ASN A 1 149 ? -54.446 32.277  -16.850 1.00 30.63  ? 150  ASN A C   1 
ATOM   1164 O O   . ASN A 1 149 ? -55.033 31.456  -16.139 1.00 27.10  ? 150  ASN A O   1 
ATOM   1165 C CB  . ASN A 1 149 ? -54.193 34.451  -15.692 1.00 23.48  ? 150  ASN A CB  1 
ATOM   1166 C CG  . ASN A 1 149 ? -53.876 35.899  -15.981 1.00 30.99  ? 150  ASN A CG  1 
ATOM   1167 O OD1 . ASN A 1 149 ? -54.283 36.434  -17.010 1.00 40.82  ? 150  ASN A OD1 1 
ATOM   1168 N ND2 . ASN A 1 149 ? -53.117 36.530  -15.102 1.00 26.35  ? 150  ASN A ND2 1 
ATOM   1169 N N   . TYR A 1 150 ? -53.426 31.958  -17.631 1.00 29.22  ? 151  TYR A N   1 
ATOM   1170 C CA  . TYR A 1 150 ? -52.829 30.635  -17.609 1.00 24.52  ? 151  TYR A CA  1 
ATOM   1171 C C   . TYR A 1 150 ? -51.321 30.803  -17.676 1.00 23.39  ? 151  TYR A C   1 
ATOM   1172 O O   . TYR A 1 150 ? -50.818 31.776  -18.246 1.00 26.07  ? 151  TYR A O   1 
ATOM   1173 C CB  . TYR A 1 150 ? -53.341 29.751  -18.761 1.00 26.05  ? 151  TYR A CB  1 
ATOM   1174 C CG  . TYR A 1 150 ? -53.012 30.245  -20.154 1.00 22.19  ? 151  TYR A CG  1 
ATOM   1175 C CD1 . TYR A 1 150 ? -53.868 31.105  -20.836 1.00 24.19  ? 151  TYR A CD1 1 
ATOM   1176 C CD2 . TYR A 1 150 ? -51.850 29.831  -20.800 1.00 24.47  ? 151  TYR A CD2 1 
ATOM   1177 C CE1 . TYR A 1 150 ? -53.570 31.546  -22.123 1.00 20.36  ? 151  TYR A CE1 1 
ATOM   1178 C CE2 . TYR A 1 150 ? -51.542 30.270  -22.087 1.00 23.89  ? 151  TYR A CE2 1 
ATOM   1179 C CZ  . TYR A 1 150 ? -52.399 31.123  -22.739 1.00 25.70  ? 151  TYR A CZ  1 
ATOM   1180 O OH  . TYR A 1 150 ? -52.079 31.553  -24.010 1.00 28.19  ? 151  TYR A OH  1 
ATOM   1181 N N   . ARG A 1 151 ? -50.604 29.866  -17.061 1.00 24.21  ? 152  ARG A N   1 
ATOM   1182 C CA  . ARG A 1 151 ? -49.156 29.978  -16.978 1.00 29.19  ? 152  ARG A CA  1 
ATOM   1183 C C   . ARG A 1 151 ? -48.534 29.851  -18.362 1.00 27.12  ? 152  ARG A C   1 
ATOM   1184 O O   . ARG A 1 151 ? -48.948 29.019  -19.177 1.00 27.25  ? 152  ARG A O   1 
ATOM   1185 C CB  . ARG A 1 151 ? -48.592 28.912  -16.035 1.00 22.69  ? 152  ARG A CB  1 
ATOM   1186 C CG  . ARG A 1 151 ? -48.788 29.229  -14.542 1.00 19.90  ? 152  ARG A CG  1 
ATOM   1187 C CD  . ARG A 1 151 ? -48.368 28.045  -13.673 1.00 28.15  ? 152  ARG A CD  1 
ATOM   1188 N NE  . ARG A 1 151 ? -49.397 27.009  -13.641 1.00 28.40  ? 152  ARG A NE  1 
ATOM   1189 C CZ  . ARG A 1 151 ? -49.244 25.809  -13.089 1.00 31.43  ? 152  ARG A CZ  1 
ATOM   1190 N NH1 . ARG A 1 151 ? -48.092 25.473  -12.518 1.00 28.44  ? 152  ARG A NH1 1 
ATOM   1191 N NH2 . ARG A 1 151 ? -50.244 24.937  -13.114 1.00 31.28  ? 152  ARG A NH2 1 
ATOM   1192 N N   . VAL A 1 152 ? -47.540 30.694  -18.633 1.00 24.40  ? 153  VAL A N   1 
ATOM   1193 C CA  . VAL A 1 152 ? -46.865 30.675  -19.927 1.00 33.75  ? 153  VAL A CA  1 
ATOM   1194 C C   . VAL A 1 152 ? -45.380 30.426  -19.714 1.00 35.60  ? 153  VAL A C   1 
ATOM   1195 O O   . VAL A 1 152 ? -44.907 30.362  -18.573 1.00 30.17  ? 153  VAL A O   1 
ATOM   1196 C CB  . VAL A 1 152 ? -47.097 31.984  -20.705 1.00 33.87  ? 153  VAL A CB  1 
ATOM   1197 C CG1 . VAL A 1 152 ? -48.541 32.069  -21.194 1.00 23.96  ? 153  VAL A CG1 1 
ATOM   1198 C CG2 . VAL A 1 152 ? -46.737 33.180  -19.850 1.00 17.61  ? 153  VAL A CG2 1 
ATOM   1199 N N   . GLY A 1 153 ? -44.640 30.280  -20.813 1.00 30.89  ? 154  GLY A N   1 
ATOM   1200 C CA  . GLY A 1 153 ? -43.211 30.056  -20.718 1.00 23.96  ? 154  GLY A CA  1 
ATOM   1201 C C   . GLY A 1 153 ? -42.894 28.774  -19.968 1.00 28.88  ? 154  GLY A C   1 
ATOM   1202 O O   . GLY A 1 153 ? -43.662 27.805  -19.975 1.00 29.69  ? 154  GLY A O   1 
ATOM   1203 N N   . ALA A 1 154 ? -41.737 28.768  -19.303 1.00 26.57  ? 155  ALA A N   1 
ATOM   1204 C CA  . ALA A 1 154 ? -41.319 27.570  -18.582 1.00 34.17  ? 155  ALA A CA  1 
ATOM   1205 C C   . ALA A 1 154 ? -42.334 27.193  -17.510 1.00 36.19  ? 155  ALA A C   1 
ATOM   1206 O O   . ALA A 1 154 ? -42.593 26.007  -17.277 1.00 35.42  ? 155  ALA A O   1 
ATOM   1207 C CB  . ALA A 1 154 ? -39.939 27.782  -17.960 1.00 30.02  ? 155  ALA A CB  1 
ATOM   1208 N N   . PHE A 1 155 ? -42.930 28.191  -16.856 1.00 28.64  ? 156  PHE A N   1 
ATOM   1209 C CA  . PHE A 1 155 ? -43.847 27.927  -15.756 1.00 30.97  ? 156  PHE A CA  1 
ATOM   1210 C C   . PHE A 1 155 ? -45.102 27.200  -16.212 1.00 29.03  ? 156  PHE A C   1 
ATOM   1211 O O   . PHE A 1 155 ? -45.739 26.520  -15.399 1.00 31.89  ? 156  PHE A O   1 
ATOM   1212 C CB  . PHE A 1 155 ? -44.201 29.239  -15.054 1.00 23.87  ? 156  PHE A CB  1 
ATOM   1213 C CG  . PHE A 1 155 ? -43.004 30.084  -14.738 1.00 31.79  ? 156  PHE A CG  1 
ATOM   1214 C CD1 . PHE A 1 155 ? -42.323 29.925  -13.532 1.00 30.74  ? 156  PHE A CD1 1 
ATOM   1215 C CD2 . PHE A 1 155 ? -42.542 31.021  -15.647 1.00 33.46  ? 156  PHE A CD2 1 
ATOM   1216 C CE1 . PHE A 1 155 ? -41.209 30.686  -13.241 1.00 33.86  ? 156  PHE A CE1 1 
ATOM   1217 C CE2 . PHE A 1 155 ? -41.421 31.790  -15.358 1.00 38.25  ? 156  PHE A CE2 1 
ATOM   1218 C CZ  . PHE A 1 155 ? -40.756 31.620  -14.150 1.00 40.58  ? 156  PHE A CZ  1 
ATOM   1219 N N   . GLY A 1 156 ? -45.460 27.306  -17.486 1.00 30.66  ? 157  GLY A N   1 
ATOM   1220 C CA  . GLY A 1 156 ? -46.638 26.626  -17.979 1.00 30.99  ? 157  GLY A CA  1 
ATOM   1221 C C   . GLY A 1 156 ? -46.374 25.451  -18.895 1.00 28.24  ? 157  GLY A C   1 
ATOM   1222 O O   . GLY A 1 156 ? -47.247 24.592  -19.067 1.00 29.25  ? 157  GLY A O   1 
ATOM   1223 N N   . PHE A 1 157 ? -45.181 25.380  -19.497 1.00 24.96  ? 158  PHE A N   1 
ATOM   1224 C CA  . PHE A 1 157 ? -44.982 24.379  -20.540 1.00 33.94  ? 158  PHE A CA  1 
ATOM   1225 C C   . PHE A 1 157 ? -43.601 23.739  -20.545 1.00 34.52  ? 158  PHE A C   1 
ATOM   1226 O O   . PHE A 1 157 ? -43.302 22.966  -21.468 1.00 34.45  ? 158  PHE A O   1 
ATOM   1227 C CB  . PHE A 1 157 ? -45.282 24.982  -21.925 1.00 24.05  ? 158  PHE A CB  1 
ATOM   1228 C CG  . PHE A 1 157 ? -46.676 25.531  -22.043 1.00 23.81  ? 158  PHE A CG  1 
ATOM   1229 C CD1 . PHE A 1 157 ? -47.744 24.691  -22.346 1.00 23.47  ? 158  PHE A CD1 1 
ATOM   1230 C CD2 . PHE A 1 157 ? -46.923 26.879  -21.849 1.00 24.71  ? 158  PHE A CD2 1 
ATOM   1231 C CE1 . PHE A 1 157 ? -49.035 25.194  -22.443 1.00 28.93  ? 158  PHE A CE1 1 
ATOM   1232 C CE2 . PHE A 1 157 ? -48.208 27.392  -21.951 1.00 26.72  ? 158  PHE A CE2 1 
ATOM   1233 C CZ  . PHE A 1 157 ? -49.266 26.549  -22.248 1.00 26.88  ? 158  PHE A CZ  1 
ATOM   1234 N N   . LEU A 1 158 ? -42.750 24.015  -19.561 1.00 27.53  ? 159  LEU A N   1 
ATOM   1235 C CA  . LEU A 1 158 ? -41.548 23.208  -19.417 1.00 31.79  ? 159  LEU A CA  1 
ATOM   1236 C C   . LEU A 1 158 ? -41.966 21.779  -19.109 1.00 35.87  ? 159  LEU A C   1 
ATOM   1237 O O   . LEU A 1 158 ? -42.816 21.540  -18.247 1.00 35.91  ? 159  LEU A O   1 
ATOM   1238 C CB  . LEU A 1 158 ? -40.641 23.755  -18.317 1.00 31.05  ? 159  LEU A CB  1 
ATOM   1239 C CG  . LEU A 1 158 ? -39.341 22.978  -18.065 1.00 36.66  ? 159  LEU A CG  1 
ATOM   1240 C CD1 . LEU A 1 158 ? -38.208 23.921  -17.703 1.00 35.27  ? 159  LEU A CD1 1 
ATOM   1241 C CD2 . LEU A 1 158 ? -39.513 21.928  -16.971 1.00 30.69  ? 159  LEU A CD2 1 
ATOM   1242 N N   . ALA A 1 159 ? -41.395 20.827  -19.834 1.00 37.89  ? 160  ALA A N   1 
ATOM   1243 C CA  . ALA A 1 159 ? -41.823 19.444  -19.717 1.00 35.55  ? 160  ALA A CA  1 
ATOM   1244 C C   . ALA A 1 159 ? -40.610 18.541  -19.628 1.00 40.19  ? 160  ALA A C   1 
ATOM   1245 O O   . ALA A 1 159 ? -39.713 18.607  -20.474 1.00 38.82  ? 160  ALA A O   1 
ATOM   1246 C CB  . ALA A 1 159 ? -42.703 19.031  -20.900 1.00 33.17  ? 160  ALA A CB  1 
ATOM   1247 N N   . LEU A 1 160 ? -40.579 17.723  -18.590 1.00 37.02  ? 161  LEU A N   1 
ATOM   1248 C CA  . LEU A 1 160 ? -39.709 16.562  -18.548 1.00 41.97  ? 161  LEU A CA  1 
ATOM   1249 C C   . LEU A 1 160 ? -40.620 15.352  -18.693 1.00 44.65  ? 161  LEU A C   1 
ATOM   1250 O O   . LEU A 1 160 ? -41.035 14.765  -17.685 1.00 46.68  ? 161  LEU A O   1 
ATOM   1251 C CB  . LEU A 1 160 ? -38.901 16.522  -17.250 1.00 43.00  ? 161  LEU A CB  1 
ATOM   1252 C CG  . LEU A 1 160 ? -37.839 17.618  -17.156 1.00 42.83  ? 161  LEU A CG  1 
ATOM   1253 C CD1 . LEU A 1 160 ? -37.304 17.714  -15.751 1.00 49.04  ? 161  LEU A CD1 1 
ATOM   1254 C CD2 . LEU A 1 160 ? -36.713 17.337  -18.143 1.00 45.38  ? 161  LEU A CD2 1 
ATOM   1255 N N   . PRO A 1 161 ? -40.968 14.974  -19.924 1.00 39.44  ? 162  PRO A N   1 
ATOM   1256 C CA  . PRO A 1 161 ? -42.042 13.993  -20.130 1.00 40.55  ? 162  PRO A CA  1 
ATOM   1257 C C   . PRO A 1 161 ? -41.813 12.710  -19.347 1.00 49.21  ? 162  PRO A C   1 
ATOM   1258 O O   . PRO A 1 161 ? -40.691 12.211  -19.238 1.00 53.01  ? 162  PRO A O   1 
ATOM   1259 C CB  . PRO A 1 161 ? -42.008 13.746  -21.642 1.00 43.22  ? 162  PRO A CB  1 
ATOM   1260 C CG  . PRO A 1 161 ? -41.420 15.001  -22.207 1.00 41.83  ? 162  PRO A CG  1 
ATOM   1261 C CD  . PRO A 1 161 ? -40.407 15.458  -21.196 1.00 43.07  ? 162  PRO A CD  1 
ATOM   1262 N N   . GLY A 1 162 ? -42.901 12.190  -18.780 1.00 51.19  ? 163  GLY A N   1 
ATOM   1263 C CA  . GLY A 1 162 ? -42.859 11.053  -17.897 1.00 52.34  ? 163  GLY A CA  1 
ATOM   1264 C C   . GLY A 1 162 ? -42.644 11.399  -16.435 1.00 57.18  ? 163  GLY A C   1 
ATOM   1265 O O   . GLY A 1 162 ? -43.054 10.629  -15.560 1.00 59.27  ? 163  GLY A O   1 
ATOM   1266 N N   . SER A 1 163 ? -42.043 12.517  -16.097 1.00 56.41  ? 164  SER A N   1 
ATOM   1267 C CA  . SER A 1 163 ? -41.867 12.890  -14.693 1.00 55.59  ? 164  SER A CA  1 
ATOM   1268 C C   . SER A 1 163 ? -43.083 13.416  -13.968 1.00 53.59  ? 164  SER A C   1 
ATOM   1269 O O   . SER A 1 163 ? -43.954 13.956  -14.551 1.00 50.98  ? 164  SER A O   1 
ATOM   1270 C CB  . SER A 1 163 ? -40.810 13.941  -14.550 1.00 59.39  ? 164  SER A CB  1 
ATOM   1271 O OG  . SER A 1 163 ? -41.347 15.182  -14.866 1.00 56.32  ? 164  SER A OG  1 
ATOM   1272 N N   . ARG A 1 164 ? -43.156 13.138  -12.685 1.00 52.79  ? 165  ARG A N   1 
ATOM   1273 C CA  . ARG A 1 164 ? -44.179 13.638  -11.787 1.00 51.71  ? 165  ARG A CA  1 
ATOM   1274 C C   . ARG A 1 164 ? -44.061 15.119  -11.470 1.00 44.93  ? 165  ARG A C   1 
ATOM   1275 O O   . ARG A 1 164 ? -45.015 15.818  -11.375 1.00 37.39  ? 165  ARG A O   1 
ATOM   1276 C CB  . ARG A 1 164 ? -44.102 12.859  -10.490 1.00 70.19  ? 165  ARG A CB  1 
ATOM   1277 C CG  . ARG A 1 164 ? -45.293 12.996  -9.566  1.00 92.44  ? 165  ARG A CG  1 
ATOM   1278 C CD  . ARG A 1 164 ? -45.017 13.924  -8.391  1.00 107.14 ? 165  ARG A CD  1 
ATOM   1279 N NE  . ARG A 1 164 ? -43.626 13.847  -7.962  1.00 112.95 ? 165  ARG A NE  1 
ATOM   1280 C CZ  . ARG A 1 164 ? -43.193 13.117  -6.939  1.00 115.05 ? 165  ARG A CZ  1 
ATOM   1281 N NH1 . ARG A 1 164 ? -41.903 13.115  -6.636  1.00 117.00 ? 165  ARG A NH1 1 
ATOM   1282 N NH2 . ARG A 1 164 ? -44.042 12.390  -6.227  1.00 112.77 ? 165  ARG A NH2 1 
ATOM   1283 N N   . GLU A 1 165 ? -42.849 15.565  -11.282 1.00 44.15  ? 166  GLU A N   1 
ATOM   1284 C CA  . GLU A 1 165 ? -42.576 16.934  -10.939 1.00 48.46  ? 166  GLU A CA  1 
ATOM   1285 C C   . GLU A 1 165 ? -42.775 18.021  -11.980 1.00 46.01  ? 166  GLU A C   1 
ATOM   1286 O O   . GLU A 1 165 ? -42.942 19.150  -11.639 1.00 45.45  ? 166  GLU A O   1 
ATOM   1287 C CB  . GLU A 1 165 ? -41.238 17.052  -10.243 1.00 58.70  ? 166  GLU A CB  1 
ATOM   1288 C CG  . GLU A 1 165 ? -41.177 16.295  -8.927  1.00 75.02  ? 166  GLU A CG  1 
ATOM   1289 C CD  . GLU A 1 165 ? -42.260 16.686  -7.929  1.00 87.33  ? 166  GLU A CD  1 
ATOM   1290 O OE1 . GLU A 1 165 ? -42.327 17.859  -7.535  1.00 88.60  ? 166  GLU A OE1 1 
ATOM   1291 O OE2 . GLU A 1 165 ? -43.044 15.814  -7.517  1.00 94.16  ? 166  GLU A OE2 1 
ATOM   1292 N N   . ALA A 1 166 ? -42.697 17.672  -13.240 1.00 39.34  ? 167  ALA A N   1 
ATOM   1293 C CA  . ALA A 1 166 ? -42.848 18.626  -14.343 1.00 40.87  ? 167  ALA A CA  1 
ATOM   1294 C C   . ALA A 1 166 ? -43.401 17.895  -15.558 1.00 42.79  ? 167  ALA A C   1 
ATOM   1295 O O   . ALA A 1 166 ? -42.694 17.667  -16.545 1.00 35.71  ? 167  ALA A O   1 
ATOM   1296 C CB  . ALA A 1 166 ? -41.516 19.298  -14.671 1.00 36.24  ? 167  ALA A CB  1 
ATOM   1297 N N   . PRO A 1 167 ? -44.680 17.511  -15.518 1.00 45.74  ? 168  PRO A N   1 
ATOM   1298 C CA  . PRO A 1 167 ? -45.239 16.676  -16.596 1.00 39.19  ? 168  PRO A CA  1 
ATOM   1299 C C   . PRO A 1 167 ? -45.492 17.429  -17.893 1.00 43.92  ? 168  PRO A C   1 
ATOM   1300 O O   . PRO A 1 167 ? -45.720 16.788  -18.929 1.00 46.11  ? 168  PRO A O   1 
ATOM   1301 C CB  . PRO A 1 167 ? -46.552 16.169  -15.989 1.00 39.78  ? 168  PRO A CB  1 
ATOM   1302 C CG  . PRO A 1 167 ? -46.966 17.289  -15.052 1.00 38.52  ? 168  PRO A CG  1 
ATOM   1303 C CD  . PRO A 1 167 ? -45.681 17.841  -14.485 1.00 39.52  ? 168  PRO A CD  1 
ATOM   1304 N N   . GLY A 1 168 ? -45.465 18.752  -17.879 1.00 37.66  ? 169  GLY A N   1 
ATOM   1305 C CA  . GLY A 1 168 ? -45.723 19.518  -19.077 1.00 32.82  ? 169  GLY A CA  1 
ATOM   1306 C C   . GLY A 1 168 ? -47.199 19.817  -19.274 1.00 39.13  ? 169  GLY A C   1 
ATOM   1307 O O   . GLY A 1 168 ? -48.081 19.200  -18.676 1.00 39.69  ? 169  GLY A O   1 
ATOM   1308 N N   . ASN A 1 169 ? -47.456 20.807  -20.125 1.00 32.43  ? 170  ASN A N   1 
ATOM   1309 C CA  . ASN A 1 169 ? -48.803 21.224  -20.497 1.00 30.60  ? 170  ASN A CA  1 
ATOM   1310 C C   . ASN A 1 169 ? -49.633 21.742  -19.327 1.00 34.15  ? 170  ASN A C   1 
ATOM   1311 O O   . ASN A 1 169 ? -50.862 21.809  -19.439 1.00 34.12  ? 170  ASN A O   1 
ATOM   1312 C CB  . ASN A 1 169 ? -49.562 20.099  -21.212 1.00 33.60  ? 170  ASN A CB  1 
ATOM   1313 C CG  . ASN A 1 169 ? -48.882 19.679  -22.500 1.00 41.73  ? 170  ASN A CG  1 
ATOM   1314 O OD1 . ASN A 1 169 ? -48.327 20.495  -23.243 1.00 41.90  ? 170  ASN A OD1 1 
ATOM   1315 N ND2 . ASN A 1 169 ? -48.966 18.399  -22.792 1.00 30.82  ? 170  ASN A ND2 1 
ATOM   1316 N N   . VAL A 1 170 ? -49.008 22.155  -18.215 1.00 27.36  ? 171  VAL A N   1 
ATOM   1317 C CA  . VAL A 1 170 ? -49.818 22.584  -17.072 1.00 32.02  ? 171  VAL A CA  1 
ATOM   1318 C C   . VAL A 1 170 ? -50.546 23.890  -17.381 1.00 32.23  ? 171  VAL A C   1 
ATOM   1319 O O   . VAL A 1 170 ? -51.638 24.137  -16.854 1.00 26.55  ? 171  VAL A O   1 
ATOM   1320 C CB  . VAL A 1 170 ? -48.970 22.693  -15.788 1.00 32.35  ? 171  VAL A CB  1 
ATOM   1321 C CG1 . VAL A 1 170 ? -48.319 21.343  -15.455 1.00 31.33  ? 171  VAL A CG1 1 
ATOM   1322 C CG2 . VAL A 1 170 ? -47.938 23.807  -15.897 1.00 31.05  ? 171  VAL A CG2 1 
ATOM   1323 N N   . GLY A 1 171 ? -49.980 24.729  -18.254 1.00 31.12  ? 172  GLY A N   1 
ATOM   1324 C CA  . GLY A 1 171 ? -50.703 25.905  -18.710 1.00 23.09  ? 172  GLY A CA  1 
ATOM   1325 C C   . GLY A 1 171 ? -52.003 25.564  -19.414 1.00 32.69  ? 172  GLY A C   1 
ATOM   1326 O O   . GLY A 1 171 ? -52.985 26.308  -19.314 1.00 33.83  ? 172  GLY A O   1 
ATOM   1327 N N   . LEU A 1 172 ? -52.034 24.439  -20.134 1.00 25.09  ? 173  LEU A N   1 
ATOM   1328 C CA  . LEU A 1 172 ? -53.287 23.999  -20.740 1.00 27.16  ? 173  LEU A CA  1 
ATOM   1329 C C   . LEU A 1 172 ? -54.233 23.467  -19.677 1.00 29.05  ? 173  LEU A C   1 
ATOM   1330 O O   . LEU A 1 172 ? -55.453 23.647  -19.770 1.00 30.26  ? 173  LEU A O   1 
ATOM   1331 C CB  . LEU A 1 172 ? -53.024 22.930  -21.800 1.00 26.09  ? 173  LEU A CB  1 
ATOM   1332 C CG  . LEU A 1 172 ? -52.486 23.378  -23.156 1.00 31.87  ? 173  LEU A CG  1 
ATOM   1333 C CD1 . LEU A 1 172 ? -52.101 22.161  -23.990 1.00 29.93  ? 173  LEU A CD1 1 
ATOM   1334 C CD2 . LEU A 1 172 ? -53.528 24.219  -23.870 1.00 29.33  ? 173  LEU A CD2 1 
ATOM   1335 N N   . LEU A 1 173 ? -53.687 22.802  -18.661 1.00 24.61  ? 174  LEU A N   1 
ATOM   1336 C CA  . LEU A 1 173 ? -54.521 22.370  -17.549 1.00 33.28  ? 174  LEU A CA  1 
ATOM   1337 C C   . LEU A 1 173 ? -55.050 23.559  -16.757 1.00 33.34  ? 174  LEU A C   1 
ATOM   1338 O O   . LEU A 1 173 ? -56.151 23.482  -16.200 1.00 37.18  ? 174  LEU A O   1 
ATOM   1339 C CB  . LEU A 1 173 ? -53.749 21.412  -16.649 1.00 25.96  ? 174  LEU A CB  1 
ATOM   1340 C CG  . LEU A 1 173 ? -53.450 20.063  -17.323 1.00 41.71  ? 174  LEU A CG  1 
ATOM   1341 C CD1 . LEU A 1 173 ? -52.589 19.183  -16.430 1.00 39.32  ? 174  LEU A CD1 1 
ATOM   1342 C CD2 . LEU A 1 173 ? -54.725 19.326  -17.752 1.00 30.47  ? 174  LEU A CD2 1 
ATOM   1343 N N   . ASP A 1 174 ? -54.298 24.666  -16.710 1.00 31.38  ? 175  ASP A N   1 
ATOM   1344 C CA  . ASP A 1 174 ? -54.833 25.898  -16.133 1.00 30.00  ? 175  ASP A CA  1 
ATOM   1345 C C   . ASP A 1 174 ? -56.100 26.320  -16.866 1.00 33.51  ? 175  ASP A C   1 
ATOM   1346 O O   . ASP A 1 174 ? -57.130 26.603  -16.243 1.00 31.68  ? 175  ASP A O   1 
ATOM   1347 C CB  . ASP A 1 174 ? -53.791 27.027  -16.187 1.00 23.91  ? 175  ASP A CB  1 
ATOM   1348 C CG  . ASP A 1 174 ? -52.559 26.766  -15.313 1.00 32.71  ? 175  ASP A CG  1 
ATOM   1349 O OD1 . ASP A 1 174 ? -51.535 27.449  -15.538 1.00 34.63  ? 175  ASP A OD1 1 
ATOM   1350 O OD2 . ASP A 1 174 ? -52.596 25.897  -14.412 1.00 31.70  ? 175  ASP A OD2 1 
ATOM   1351 N N   . GLN A 1 175 ? -56.040 26.354  -18.201 1.00 30.79  ? 176  GLN A N   1 
ATOM   1352 C CA  . GLN A 1 175 ? -57.212 26.688  -19.004 1.00 28.47  ? 176  GLN A CA  1 
ATOM   1353 C C   . GLN A 1 175 ? -58.364 25.724  -18.737 1.00 30.10  ? 176  GLN A C   1 
ATOM   1354 O O   . GLN A 1 175 ? -59.507 26.147  -18.526 1.00 31.37  ? 176  GLN A O   1 
ATOM   1355 C CB  . GLN A 1 175 ? -56.842 26.680  -20.485 1.00 27.99  ? 176  GLN A CB  1 
ATOM   1356 C CG  . GLN A 1 175 ? -55.743 27.650  -20.866 1.00 25.03  ? 176  GLN A CG  1 
ATOM   1357 C CD  . GLN A 1 175 ? -55.299 27.440  -22.297 1.00 29.42  ? 176  GLN A CD  1 
ATOM   1358 O OE1 . GLN A 1 175 ? -55.940 26.705  -23.046 1.00 29.94  ? 176  GLN A OE1 1 
ATOM   1359 N NE2 . GLN A 1 175 ? -54.198 28.081  -22.685 1.00 24.31  ? 176  GLN A NE2 1 
ATOM   1360 N N   . ARG A 1 176 ? -58.081 24.442  -18.709 1.00 26.07  ? 177  ARG A N   1 
ATOM   1361 C CA  . ARG A 1 176 ? -59.101 23.451  -18.476 1.00 28.06  ? 177  ARG A CA  1 
ATOM   1362 C C   . ARG A 1 176 ? -59.738 23.618  -17.120 1.00 33.09  ? 177  ARG A C   1 
ATOM   1363 O O   . ARG A 1 176 ? -60.912 23.483  -17.000 1.00 28.07  ? 177  ARG A O   1 
ATOM   1364 C CB  . ARG A 1 176 ? -58.572 22.036  -18.649 1.00 30.40  ? 177  ARG A CB  1 
ATOM   1365 C CG  . ARG A 1 176 ? -59.572 20.945  -18.354 1.00 34.34  ? 177  ARG A CG  1 
ATOM   1366 C CD  . ARG A 1 176 ? -58.971 19.580  -18.468 1.00 36.56  ? 177  ARG A CD  1 
ATOM   1367 N NE  . ARG A 1 176 ? -58.859 19.172  -19.836 1.00 43.94  ? 177  ARG A NE  1 
ATOM   1368 C CZ  . ARG A 1 176 ? -58.083 18.208  -20.255 1.00 47.08  ? 177  ARG A CZ  1 
ATOM   1369 N NH1 . ARG A 1 176 ? -57.344 17.564  -19.409 1.00 43.36  ? 177  ARG A NH1 1 
ATOM   1370 N NH2 . ARG A 1 176 ? -58.047 17.914  -21.521 1.00 44.16  ? 177  ARG A NH2 1 
ATOM   1371 N N   . LEU A 1 177 ? -58.947 23.918  -16.107 1.00 33.88  ? 178  LEU A N   1 
ATOM   1372 C CA  . LEU A 1 177 ? -59.507 24.151  -14.778 1.00 32.32  ? 178  LEU A CA  1 
ATOM   1373 C C   . LEU A 1 177 ? -60.458 25.339  -14.799 1.00 35.82  ? 178  LEU A C   1 
ATOM   1374 O O   . LEU A 1 177 ? -61.549 25.284  -14.215 1.00 31.72  ? 178  LEU A O   1 
ATOM   1375 C CB  . LEU A 1 177 ? -58.390 24.366  -13.753 1.00 27.99  ? 178  LEU A CB  1 
ATOM   1376 C CG  . LEU A 1 177 ? -58.831 24.589  -12.297 1.00 32.86  ? 178  LEU A CG  1 
ATOM   1377 C CD1 . LEU A 1 177 ? -59.780 23.487  -11.850 1.00 28.68  ? 178  LEU A CD1 1 
ATOM   1378 C CD2 . LEU A 1 177 ? -57.637 24.665  -11.337 1.00 29.40  ? 178  LEU A CD2 1 
ATOM   1379 N N   . ALA A 1 178 ? -60.074 26.413  -15.497 1.00 26.01  ? 179  ALA A N   1 
ATOM   1380 C CA  . ALA A 1 178 ? -60.964 27.559  -15.637 1.00 28.23  ? 179  ALA A CA  1 
ATOM   1381 C C   . ALA A 1 178 ? -62.262 27.158  -16.327 1.00 34.89  ? 179  ALA A C   1 
ATOM   1382 O O   . ALA A 1 178 ? -63.355 27.540  -15.886 1.00 33.37  ? 179  ALA A O   1 
ATOM   1383 C CB  . ALA A 1 178 ? -60.260 28.678  -16.407 1.00 25.53  ? 179  ALA A CB  1 
ATOM   1384 N N   . LEU A 1 179 ? -62.160 26.363  -17.397 1.00 29.31  ? 180  LEU A N   1 
ATOM   1385 C CA  . LEU A 1 179 ? -63.353 25.863  -18.074 1.00 33.28  ? 180  LEU A CA  1 
ATOM   1386 C C   . LEU A 1 179 ? -64.211 25.018  -17.136 1.00 37.75  ? 180  LEU A C   1 
ATOM   1387 O O   . LEU A 1 179 ? -65.445 25.095  -17.176 1.00 37.00  ? 180  LEU A O   1 
ATOM   1388 C CB  . LEU A 1 179 ? -62.951 25.057  -19.312 1.00 32.19  ? 180  LEU A CB  1 
ATOM   1389 C CG  . LEU A 1 179 ? -62.273 25.876  -20.411 1.00 33.29  ? 180  LEU A CG  1 
ATOM   1390 C CD1 . LEU A 1 179 ? -62.049 25.045  -21.677 1.00 33.68  ? 180  LEU A CD1 1 
ATOM   1391 C CD2 . LEU A 1 179 ? -63.112 27.108  -20.706 1.00 37.88  ? 180  LEU A CD2 1 
ATOM   1392 N N   . GLN A 1 180 ? -63.577 24.202  -16.288 1.00 34.59  ? 181  GLN A N   1 
ATOM   1393 C CA  . GLN A 1 180 ? -64.335 23.451  -15.293 1.00 37.24  ? 181  GLN A CA  1 
ATOM   1394 C C   . GLN A 1 180 ? -65.006 24.393  -14.301 1.00 35.10  ? 181  GLN A C   1 
ATOM   1395 O O   . GLN A 1 180 ? -66.133 24.143  -13.857 1.00 37.43  ? 181  GLN A O   1 
ATOM   1396 C CB  . GLN A 1 180 ? -63.419 22.458  -14.575 1.00 41.16  ? 181  GLN A CB  1 
ATOM   1397 C CG  . GLN A 1 180 ? -63.041 21.250  -15.422 1.00 54.51  ? 181  GLN A CG  1 
ATOM   1398 C CD  . GLN A 1 180 ? -61.892 20.449  -14.834 1.00 58.06  ? 181  GLN A CD  1 
ATOM   1399 O OE1 . GLN A 1 180 ? -61.239 20.883  -13.886 1.00 65.15  ? 181  GLN A OE1 1 
ATOM   1400 N NE2 . GLN A 1 180 ? -61.640 19.273  -15.396 1.00 51.84  ? 181  GLN A NE2 1 
ATOM   1401 N N   . TRP A 1 181 ? -64.333 25.489  -13.954 1.00 28.52  ? 182  TRP A N   1 
ATOM   1402 C CA  . TRP A 1 181 ? -64.930 26.473  -13.059 1.00 36.04  ? 182  TRP A CA  1 
ATOM   1403 C C   . TRP A 1 181 ? -66.177 27.092  -13.684 1.00 34.97  ? 182  TRP A C   1 
ATOM   1404 O O   . TRP A 1 181 ? -67.180 27.325  -12.996 1.00 34.21  ? 182  TRP A O   1 
ATOM   1405 C CB  . TRP A 1 181 ? -63.888 27.539  -12.724 1.00 32.68  ? 182  TRP A CB  1 
ATOM   1406 C CG  . TRP A 1 181 ? -64.299 28.526  -11.697 1.00 33.20  ? 182  TRP A CG  1 
ATOM   1407 C CD1 . TRP A 1 181 ? -63.984 28.507  -10.371 1.00 32.16  ? 182  TRP A CD1 1 
ATOM   1408 C CD2 . TRP A 1 181 ? -65.074 29.711  -11.912 1.00 34.54  ? 182  TRP A CD2 1 
ATOM   1409 N NE1 . TRP A 1 181 ? -64.529 29.600  -9.741  1.00 34.85  ? 182  TRP A NE1 1 
ATOM   1410 C CE2 . TRP A 1 181 ? -65.203 30.355  -10.665 1.00 38.29  ? 182  TRP A CE2 1 
ATOM   1411 C CE3 . TRP A 1 181 ? -65.672 30.289  -13.038 1.00 35.34  ? 182  TRP A CE3 1 
ATOM   1412 C CZ2 . TRP A 1 181 ? -65.912 31.548  -10.509 1.00 37.94  ? 182  TRP A CZ2 1 
ATOM   1413 C CZ3 . TRP A 1 181 ? -66.378 31.472  -12.883 1.00 34.19  ? 182  TRP A CZ3 1 
ATOM   1414 C CH2 . TRP A 1 181 ? -66.492 32.088  -11.628 1.00 35.01  ? 182  TRP A CH2 1 
ATOM   1415 N N   . VAL A 1 182 ? -66.130 27.353  -14.993 1.00 35.18  ? 183  VAL A N   1 
ATOM   1416 C CA  . VAL A 1 182 ? -67.271 27.929  -15.701 1.00 27.48  ? 183  VAL A CA  1 
ATOM   1417 C C   . VAL A 1 182 ? -68.474 26.993  -15.632 1.00 37.83  ? 183  VAL A C   1 
ATOM   1418 O O   . VAL A 1 182 ? -69.593 27.414  -15.315 1.00 41.24  ? 183  VAL A O   1 
ATOM   1419 C CB  . VAL A 1 182 ? -66.875 28.252  -17.154 1.00 31.50  ? 183  VAL A CB  1 
ATOM   1420 C CG1 . VAL A 1 182 ? -68.090 28.670  -17.976 1.00 25.20  ? 183  VAL A CG1 1 
ATOM   1421 C CG2 . VAL A 1 182 ? -65.800 29.344  -17.164 1.00 28.51  ? 183  VAL A CG2 1 
ATOM   1422 N N   . GLN A 1 183 ? -68.256 25.703  -15.913 1.00 33.73  ? 184  GLN A N   1 
ATOM   1423 C CA  . GLN A 1 183 ? -69.340 24.728  -15.817 1.00 37.31  ? 184  GLN A CA  1 
ATOM   1424 C C   . GLN A 1 183 ? -69.960 24.714  -14.425 1.00 46.37  ? 184  GLN A C   1 
ATOM   1425 O O   . GLN A 1 183 ? -71.183 24.586  -14.282 1.00 48.54  ? 184  GLN A O   1 
ATOM   1426 C CB  . GLN A 1 183 ? -68.826 23.334  -16.176 1.00 35.77  ? 184  GLN A CB  1 
ATOM   1427 C CG  . GLN A 1 183 ? -68.656 23.110  -17.672 1.00 40.89  ? 184  GLN A CG  1 
ATOM   1428 C CD  . GLN A 1 183 ? -69.934 23.379  -18.436 1.00 43.68  ? 184  GLN A CD  1 
ATOM   1429 O OE1 . GLN A 1 183 ? -70.950 22.717  -18.220 1.00 47.45  ? 184  GLN A OE1 1 
ATOM   1430 N NE2 . GLN A 1 183 ? -69.897 24.366  -19.321 1.00 43.93  ? 184  GLN A NE2 1 
ATOM   1431 N N   . GLU A 1 184 ? -69.139 24.845  -13.386 1.00 40.79  ? 185  GLU A N   1 
ATOM   1432 C CA  . GLU A 1 184 ? -69.663 24.707  -12.036 1.00 45.29  ? 185  GLU A CA  1 
ATOM   1433 C C   . GLU A 1 184 ? -70.247 26.000  -11.489 1.00 39.15  ? 185  GLU A C   1 
ATOM   1434 O O   . GLU A 1 184 ? -71.060 25.946  -10.564 1.00 38.84  ? 185  GLU A O   1 
ATOM   1435 C CB  . GLU A 1 184 ? -68.568 24.196  -11.095 1.00 52.70  ? 185  GLU A CB  1 
ATOM   1436 C CG  . GLU A 1 184 ? -68.268 22.711  -11.251 1.00 71.45  ? 185  GLU A CG  1 
ATOM   1437 C CD  . GLU A 1 184 ? -67.119 22.243  -10.373 1.00 83.36  ? 185  GLU A CD  1 
ATOM   1438 O OE1 . GLU A 1 184 ? -66.851 22.898  -9.343  1.00 87.05  ? 185  GLU A OE1 1 
ATOM   1439 O OE2 . GLU A 1 184 ? -66.489 21.217  -10.710 1.00 86.83  ? 185  GLU A OE2 1 
ATOM   1440 N N   . ASN A 1 185 ? -69.884 27.154  -12.049 1.00 35.73  ? 186  ASN A N   1 
ATOM   1441 C CA  . ASN A 1 185 ? -70.164 28.422  -11.388 1.00 33.76  ? 186  ASN A CA  1 
ATOM   1442 C C   . ASN A 1 185 ? -70.802 29.493  -12.257 1.00 39.01  ? 186  ASN A C   1 
ATOM   1443 O O   . ASN A 1 185 ? -71.331 30.461  -11.695 1.00 40.32  ? 186  ASN A O   1 
ATOM   1444 C CB  . ASN A 1 185 ? -68.871 28.998  -10.795 1.00 37.11  ? 186  ASN A CB  1 
ATOM   1445 C CG  . ASN A 1 185 ? -68.316 28.140  -9.685  1.00 37.27  ? 186  ASN A CG  1 
ATOM   1446 O OD1 . ASN A 1 185 ? -69.011 27.832  -8.716  1.00 38.39  ? 186  ASN A OD1 1 
ATOM   1447 N ND2 . ASN A 1 185 ? -67.055 27.750  -9.815  1.00 32.44  ? 186  ASN A ND2 1 
ATOM   1448 N N   . VAL A 1 186 ? -70.774 29.373  -13.590 1.00 32.59  ? 187  VAL A N   1 
ATOM   1449 C CA  . VAL A 1 186 ? -71.193 30.497  -14.421 1.00 30.41  ? 187  VAL A CA  1 
ATOM   1450 C C   . VAL A 1 186 ? -72.682 30.769  -14.279 1.00 36.56  ? 187  VAL A C   1 
ATOM   1451 O O   . VAL A 1 186 ? -73.119 31.908  -14.487 1.00 38.26  ? 187  VAL A O   1 
ATOM   1452 C CB  . VAL A 1 186 ? -70.812 30.276  -15.902 1.00 32.05  ? 187  VAL A CB  1 
ATOM   1453 C CG1 . VAL A 1 186 ? -71.850 29.418  -16.614 1.00 29.61  ? 187  VAL A CG1 1 
ATOM   1454 C CG2 . VAL A 1 186 ? -70.649 31.613  -16.615 1.00 28.54  ? 187  VAL A CG2 1 
ATOM   1455 N N   . ALA A 1 187 ? -73.473 29.760  -13.894 1.00 32.60  ? 188  ALA A N   1 
ATOM   1456 C CA  . ALA A 1 187 ? -74.907 29.971  -13.726 1.00 40.48  ? 188  ALA A CA  1 
ATOM   1457 C C   . ALA A 1 187 ? -75.202 30.939  -12.589 1.00 45.43  ? 188  ALA A C   1 
ATOM   1458 O O   . ALA A 1 187 ? -76.251 31.593  -12.595 1.00 48.26  ? 188  ALA A O   1 
ATOM   1459 C CB  . ALA A 1 187 ? -75.615 28.636  -13.487 1.00 36.69  ? 188  ALA A CB  1 
ATOM   1460 N N   . ALA A 1 188 ? -74.300 31.045  -11.607 1.00 45.19  ? 189  ALA A N   1 
ATOM   1461 C CA  . ALA A 1 188 ? -74.498 31.999  -10.522 1.00 44.83  ? 189  ALA A CA  1 
ATOM   1462 C C   . ALA A 1 188 ? -74.433 33.437  -11.011 1.00 45.08  ? 189  ALA A C   1 
ATOM   1463 O O   . ALA A 1 188 ? -74.975 34.329  -10.349 1.00 49.01  ? 189  ALA A O   1 
ATOM   1464 C CB  . ALA A 1 188 ? -73.465 31.779  -9.415  1.00 35.87  ? 189  ALA A CB  1 
ATOM   1465 N N   . PHE A 1 189 ? -73.786 33.678  -12.149 1.00 37.86  ? 190  PHE A N   1 
ATOM   1466 C CA  . PHE A 1 189 ? -73.745 34.992  -12.774 1.00 37.53  ? 190  PHE A CA  1 
ATOM   1467 C C   . PHE A 1 189 ? -74.791 35.157  -13.868 1.00 42.42  ? 190  PHE A C   1 
ATOM   1468 O O   . PHE A 1 189 ? -74.820 36.204  -14.523 1.00 46.77  ? 190  PHE A O   1 
ATOM   1469 C CB  . PHE A 1 189 ? -72.356 35.261  -13.366 1.00 37.58  ? 190  PHE A CB  1 
ATOM   1470 C CG  . PHE A 1 189 ? -71.233 35.087  -12.391 1.00 38.78  ? 190  PHE A CG  1 
ATOM   1471 C CD1 . PHE A 1 189 ? -70.697 33.833  -12.147 1.00 38.25  ? 190  PHE A CD1 1 
ATOM   1472 C CD2 . PHE A 1 189 ? -70.700 36.184  -11.724 1.00 36.73  ? 190  PHE A CD2 1 
ATOM   1473 C CE1 . PHE A 1 189 ? -69.656 33.671  -11.249 1.00 34.05  ? 190  PHE A CE1 1 
ATOM   1474 C CE2 . PHE A 1 189 ? -69.657 36.032  -10.829 1.00 31.21  ? 190  PHE A CE2 1 
ATOM   1475 C CZ  . PHE A 1 189 ? -69.134 34.772  -10.590 1.00 32.26  ? 190  PHE A CZ  1 
ATOM   1476 N N   . GLY A 1 190 ? -75.639 34.155  -14.092 1.00 42.82  ? 191  GLY A N   1 
ATOM   1477 C CA  . GLY A 1 190 ? -76.609 34.201  -15.164 1.00 44.12  ? 191  GLY A CA  1 
ATOM   1478 C C   . GLY A 1 190 ? -76.172 33.529  -16.448 1.00 43.94  ? 191  GLY A C   1 
ATOM   1479 O O   . GLY A 1 190 ? -76.917 33.570  -17.437 1.00 47.53  ? 191  GLY A O   1 
ATOM   1480 N N   . GLY A 1 191 ? -74.995 32.913  -16.468 1.00 40.71  ? 192  GLY A N   1 
ATOM   1481 C CA  . GLY A 1 191 ? -74.535 32.238  -17.658 1.00 38.38  ? 192  GLY A CA  1 
ATOM   1482 C C   . GLY A 1 191 ? -75.120 30.847  -17.800 1.00 44.24  ? 192  GLY A C   1 
ATOM   1483 O O   . GLY A 1 191 ? -75.545 30.216  -16.833 1.00 46.87  ? 192  GLY A O   1 
ATOM   1484 N N   . ASP A 1 192 ? -75.141 30.371  -19.046 1.00 42.81  ? 193  ASP A N   1 
ATOM   1485 C CA  . ASP A 1 192 ? -75.669 29.054  -19.364 1.00 43.28  ? 193  ASP A CA  1 
ATOM   1486 C C   . ASP A 1 192 ? -74.515 28.085  -19.557 1.00 44.84  ? 193  ASP A C   1 
ATOM   1487 O O   . ASP A 1 192 ? -73.846 28.139  -20.601 1.00 46.66  ? 193  ASP A O   1 
ATOM   1488 C CB  . ASP A 1 192 ? -76.525 29.120  -20.628 1.00 45.82  ? 193  ASP A CB  1 
ATOM   1489 C CG  . ASP A 1 192 ? -77.272 27.824  -20.910 1.00 51.67  ? 193  ASP A CG  1 
ATOM   1490 O OD1 . ASP A 1 192 ? -76.913 26.763  -20.352 1.00 53.48  ? 193  ASP A OD1 1 
ATOM   1491 O OD2 . ASP A 1 192 ? -78.237 27.876  -21.698 1.00 56.37  ? 193  ASP A OD2 1 
ATOM   1492 N N   . PRO A 1 193 ? -74.255 27.174  -18.617 1.00 44.87  ? 194  PRO A N   1 
ATOM   1493 C CA  . PRO A 1 193 ? -73.175 26.196  -18.833 1.00 41.85  ? 194  PRO A CA  1 
ATOM   1494 C C   . PRO A 1 193 ? -73.422 25.271  -20.016 1.00 42.57  ? 194  PRO A C   1 
ATOM   1495 O O   . PRO A 1 193 ? -72.476 24.620  -20.479 1.00 40.39  ? 194  PRO A O   1 
ATOM   1496 C CB  . PRO A 1 193 ? -73.123 25.423  -17.505 1.00 41.88  ? 194  PRO A CB  1 
ATOM   1497 C CG  . PRO A 1 193 ? -74.471 25.624  -16.889 1.00 40.06  ? 194  PRO A CG  1 
ATOM   1498 C CD  . PRO A 1 193 ? -74.905 27.004  -17.305 1.00 43.19  ? 194  PRO A CD  1 
ATOM   1499 N N   . THR A 1 194 ? -74.649 25.195  -20.532 1.00 39.99  ? 195  THR A N   1 
ATOM   1500 C CA  . THR A 1 194 ? -74.923 24.411  -21.730 1.00 44.84  ? 195  THR A CA  1 
ATOM   1501 C C   . THR A 1 194 ? -74.804 25.228  -23.016 1.00 47.36  ? 195  THR A C   1 
ATOM   1502 O O   . THR A 1 194 ? -75.167 24.725  -24.081 1.00 50.15  ? 195  THR A O   1 
ATOM   1503 C CB  . THR A 1 194 ? -76.314 23.764  -21.652 1.00 45.52  ? 195  THR A CB  1 
ATOM   1504 O OG1 . THR A 1 194 ? -77.318 24.727  -21.994 1.00 49.62  ? 195  THR A OG1 1 
ATOM   1505 C CG2 . THR A 1 194 ? -76.584 23.231  -20.247 1.00 46.90  ? 195  THR A CG2 1 
ATOM   1506 N N   . SER A 1 195 ? -74.275 26.473  -22.950 1.00 46.17  ? 196  SER A N   1 
ATOM   1507 C CA  . SER A 1 195 ? -73.982 27.273  -24.156 1.00 41.73  ? 196  SER A CA  1 
ATOM   1508 C C   . SER A 1 195 ? -72.701 28.085  -23.915 1.00 39.07  ? 196  SER A C   1 
ATOM   1509 O O   . SER A 1 195 ? -72.735 29.270  -23.574 1.00 37.13  ? 196  SER A O   1 
ATOM   1510 C CB  . SER A 1 195 ? -75.150 28.176  -24.538 1.00 47.80  ? 196  SER A CB  1 
ATOM   1511 O OG  . SER A 1 195 ? -74.891 28.804  -25.782 1.00 54.60  ? 196  SER A OG  1 
ATOM   1512 N N   . VAL A 1 196 ? -71.558 27.436  -24.124 1.00 29.81  ? 197  VAL A N   1 
ATOM   1513 C CA  . VAL A 1 196 ? -70.242 28.005  -23.863 1.00 37.45  ? 197  VAL A CA  1 
ATOM   1514 C C   . VAL A 1 196 ? -69.439 27.960  -25.155 1.00 36.97  ? 197  VAL A C   1 
ATOM   1515 O O   . VAL A 1 196 ? -69.243 26.884  -25.735 1.00 36.94  ? 197  VAL A O   1 
ATOM   1516 C CB  . VAL A 1 196 ? -69.508 27.250  -22.746 1.00 34.06  ? 197  VAL A CB  1 
ATOM   1517 C CG1 . VAL A 1 196 ? -68.042 27.673  -22.700 1.00 28.21  ? 197  VAL A CG1 1 
ATOM   1518 C CG2 . VAL A 1 196 ? -70.201 27.480  -21.401 1.00 32.85  ? 197  VAL A CG2 1 
ATOM   1519 N N   . THR A 1 197 ? -68.972 29.120  -25.599 1.00 37.87  ? 198  THR A N   1 
ATOM   1520 C CA  . THR A 1 197 ? -68.192 29.252  -26.820 1.00 34.42  ? 198  THR A CA  1 
ATOM   1521 C C   . THR A 1 197 ? -66.786 29.710  -26.455 1.00 36.57  ? 198  THR A C   1 
ATOM   1522 O O   . THR A 1 197 ? -66.609 30.812  -25.925 1.00 36.66  ? 198  THR A O   1 
ATOM   1523 C CB  . THR A 1 197 ? -68.852 30.246  -27.777 1.00 33.13  ? 198  THR A CB  1 
ATOM   1524 O OG1 . THR A 1 197 ? -70.164 29.790  -28.125 1.00 36.37  ? 198  THR A OG1 1 
ATOM   1525 C CG2 . THR A 1 197 ? -68.035 30.389  -29.042 1.00 30.02  ? 198  THR A CG2 1 
ATOM   1526 N N   . LEU A 1 198 ? -65.787 28.934  -26.803 1.00 33.43  ? 199  LEU A N   1 
ATOM   1527 C CA  . LEU A 1 198 ? -64.429 29.335  -26.588 1.00 32.27  ? 199  LEU A CA  1 
ATOM   1528 C C   . LEU A 1 198 ? -63.935 30.153  -27.754 1.00 38.75  ? 199  LEU A C   1 
ATOM   1529 O O   . LEU A 1 198 ? -64.285 29.891  -28.846 1.00 38.66  ? 199  LEU A O   1 
ATOM   1530 C CB  . LEU A 1 198 ? -63.532 28.136  -26.508 1.00 31.74  ? 199  LEU A CB  1 
ATOM   1531 C CG  . LEU A 1 198 ? -63.708 27.075  -25.475 1.00 37.36  ? 199  LEU A CG  1 
ATOM   1532 C CD1 . LEU A 1 198 ? -62.589 26.092  -25.592 1.00 34.94  ? 199  LEU A CD1 1 
ATOM   1533 C CD2 . LEU A 1 198 ? -63.680 27.739  -24.142 1.00 38.65  ? 199  LEU A CD2 1 
ATOM   1534 N N   . PHE A 1 199 ? -63.175 31.187  -27.505 1.00 31.35  ? 200  PHE A N   1 
ATOM   1535 C CA  . PHE A 1 199 ? -62.559 31.936  -28.564 1.00 31.09  ? 200  PHE A CA  1 
ATOM   1536 C C   . PHE A 1 199 ? -61.168 32.358  -28.133 1.00 33.71  ? 200  PHE A C   1 
ATOM   1537 O O   . PHE A 1 199 ? -60.933 32.537  -26.995 1.00 32.78  ? 200  PHE A O   1 
ATOM   1538 C CB  . PHE A 1 199 ? -63.442 33.038  -29.191 1.00 26.74  ? 200  PHE A CB  1 
ATOM   1539 C CG  . PHE A 1 199 ? -63.652 34.279  -28.363 1.00 28.78  ? 200  PHE A CG  1 
ATOM   1540 C CD1 . PHE A 1 199 ? -63.585 35.489  -28.950 1.00 32.04  ? 200  PHE A CD1 1 
ATOM   1541 C CD2 . PHE A 1 199 ? -64.008 34.221  -27.050 1.00 29.97  ? 200  PHE A CD2 1 
ATOM   1542 C CE1 . PHE A 1 199 ? -63.818 36.627  -28.251 1.00 36.34  ? 200  PHE A CE1 1 
ATOM   1543 C CE2 . PHE A 1 199 ? -64.232 35.351  -26.338 1.00 36.00  ? 200  PHE A CE2 1 
ATOM   1544 C CZ  . PHE A 1 199 ? -64.129 36.566  -26.938 1.00 36.14  ? 200  PHE A CZ  1 
ATOM   1545 N N   . GLY A 1 200 ? -60.248 32.402  -29.065 1.00 27.36  ? 201  GLY A N   1 
ATOM   1546 C CA  . GLY A 1 200 ? -58.886 32.754  -28.819 1.00 24.22  ? 201  GLY A CA  1 
ATOM   1547 C C   . GLY A 1 200 ? -58.179 33.173  -30.069 1.00 31.90  ? 201  GLY A C   1 
ATOM   1548 O O   . GLY A 1 200 ? -58.645 32.986  -31.134 1.00 31.89  ? 201  GLY A O   1 
ATOM   1549 N N   . GLU A 1 201 ? -57.034 33.773  -29.906 1.00 29.08  ? 202  GLU A N   1 
ATOM   1550 C CA  . GLU A 1 201 ? -56.249 34.238  -31.005 1.00 27.43  ? 202  GLU A CA  1 
ATOM   1551 C C   . GLU A 1 201 ? -54.804 33.791  -30.922 1.00 34.92  ? 202  GLU A C   1 
ATOM   1552 O O   . GLU A 1 201 ? -54.292 33.718  -29.868 1.00 28.21  ? 202  GLU A O   1 
ATOM   1553 C CB  . GLU A 1 201 ? -56.366 35.748  -31.038 1.00 27.59  ? 202  GLU A CB  1 
ATOM   1554 C CG  . GLU A 1 201 ? -55.942 36.436  -32.274 1.00 27.03  ? 202  GLU A CG  1 
ATOM   1555 C CD  . GLU A 1 201 ? -54.529 36.855  -32.215 1.00 38.49  ? 202  GLU A CD  1 
ATOM   1556 O OE1 . GLU A 1 201 ? -53.994 37.164  -33.241 1.00 35.97  ? 202  GLU A OE1 1 
ATOM   1557 O OE2 . GLU A 1 201 ? -53.951 36.883  -31.159 1.00 34.58  ? 202  GLU A OE2 1 
ATOM   1558 N N   . SER A 1 202 ? -54.186 33.466  -32.059 1.00 31.45  ? 203  SER A N   1 
ATOM   1559 C CA  . SER A 1 202 ? -52.791 33.003  -32.160 1.00 32.20  ? 203  SER A CA  1 
ATOM   1560 C C   . SER A 1 202 ? -52.613 31.814  -31.218 1.00 30.46  ? 203  SER A C   1 
ATOM   1561 O O   . SER A 1 202 ? -53.295 30.794  -31.416 1.00 29.05  ? 203  SER A O   1 
ATOM   1562 C CB  . SER A 1 202 ? -51.847 34.192  -31.938 1.00 32.99  ? 203  SER A CB  1 
ATOM   1563 O OG  . SER A 1 202 ? -50.483 33.859  -32.200 1.00 39.37  ? 203  SER A OG  1 
ATOM   1564 N N   . ALA A 1 203 ? -51.740 31.877  -30.204 1.00 30.99  ? 204  ALA A N   1 
ATOM   1565 C CA  . ALA A 1 203 ? -51.595 30.734  -29.303 1.00 26.61  ? 204  ALA A CA  1 
ATOM   1566 C C   . ALA A 1 203 ? -52.887 30.442  -28.550 1.00 28.20  ? 204  ALA A C   1 
ATOM   1567 O O   . ALA A 1 203 ? -53.127 29.295  -28.147 1.00 25.98  ? 204  ALA A O   1 
ATOM   1568 C CB  . ALA A 1 203 ? -50.454 30.965  -28.316 1.00 27.75  ? 204  ALA A CB  1 
ATOM   1569 N N   . GLY A 1 204 ? -53.730 31.458  -28.345 1.00 28.23  ? 205  GLY A N   1 
ATOM   1570 C CA  . GLY A 1 204 ? -55.042 31.205  -27.771 1.00 26.39  ? 205  GLY A CA  1 
ATOM   1571 C C   . GLY A 1 204 ? -55.923 30.391  -28.700 1.00 33.31  ? 205  GLY A C   1 
ATOM   1572 O O   . GLY A 1 204 ? -56.673 29.515  -28.254 1.00 28.01  ? 205  GLY A O   1 
ATOM   1573 N N   . ALA A 1 205 ? -55.834 30.658  -30.008 1.00 26.06  ? 206  ALA A N   1 
ATOM   1574 C CA  . ALA A 1 205 ? -56.567 29.849  -30.975 1.00 29.41  ? 206  ALA A CA  1 
ATOM   1575 C C   . ALA A 1 205 ? -56.031 28.422  -31.005 1.00 32.51  ? 206  ALA A C   1 
ATOM   1576 O O   . ALA A 1 205 ? -56.808 27.460  -31.062 1.00 27.70  ? 206  ALA A O   1 
ATOM   1577 C CB  . ALA A 1 205 ? -56.499 30.492  -32.363 1.00 27.70  ? 206  ALA A CB  1 
ATOM   1578 N N   . ALA A 1 206 ? -54.705 28.262  -30.951 1.00 25.63  ? 207  ALA A N   1 
ATOM   1579 C CA  . ALA A 1 206 ? -54.142 26.921  -30.873 1.00 27.78  ? 207  ALA A CA  1 
ATOM   1580 C C   . ALA A 1 206 ? -54.601 26.210  -29.603 1.00 31.93  ? 207  ALA A C   1 
ATOM   1581 O O   . ALA A 1 206 ? -54.907 25.011  -29.634 1.00 30.50  ? 207  ALA A O   1 
ATOM   1582 C CB  . ALA A 1 206 ? -52.616 26.983  -30.947 1.00 22.86  ? 207  ALA A CB  1 
ATOM   1583 N N   . SER A 1 207 ? -54.678 26.938  -28.481 1.00 20.04  ? 208  SER A N   1 
ATOM   1584 C CA  . SER A 1 207 ? -55.204 26.348  -27.252 1.00 22.96  ? 208  SER A CA  1 
ATOM   1585 C C   . SER A 1 207 ? -56.642 25.883  -27.446 1.00 27.37  ? 208  SER A C   1 
ATOM   1586 O O   . SER A 1 207 ? -56.995 24.754  -27.080 1.00 27.14  ? 208  SER A O   1 
ATOM   1587 C CB  . SER A 1 207 ? -55.126 27.350  -26.094 1.00 25.11  ? 208  SER A CB  1 
ATOM   1588 O OG  . SER A 1 207 ? -53.794 27.732  -25.811 1.00 25.69  ? 208  SER A OG  1 
ATOM   1589 N N   . VAL A 1 208 ? -57.491 26.748  -28.022 1.00 22.05  ? 209  VAL A N   1 
ATOM   1590 C CA  . VAL A 1 208 ? -58.879 26.368  -28.287 1.00 24.10  ? 209  VAL A CA  1 
ATOM   1591 C C   . VAL A 1 208 ? -58.921 25.056  -29.057 1.00 32.96  ? 209  VAL A C   1 
ATOM   1592 O O   . VAL A 1 208 ? -59.642 24.120  -28.691 1.00 36.05  ? 209  VAL A O   1 
ATOM   1593 C CB  . VAL A 1 208 ? -59.618 27.482  -29.053 1.00 27.33  ? 209  VAL A CB  1 
ATOM   1594 C CG1 . VAL A 1 208 ? -60.932 26.949  -29.604 1.00 27.54  ? 209  VAL A CG1 1 
ATOM   1595 C CG2 . VAL A 1 208 ? -59.875 28.684  -28.160 1.00 28.32  ? 209  VAL A CG2 1 
ATOM   1596 N N   . GLY A 1 209 ? -58.122 24.966  -30.124 1.00 28.03  ? 210  GLY A N   1 
ATOM   1597 C CA  . GLY A 1 209 ? -58.100 23.751  -30.922 1.00 34.63  ? 210  GLY A CA  1 
ATOM   1598 C C   . GLY A 1 209 ? -57.650 22.535  -30.135 1.00 34.23  ? 210  GLY A C   1 
ATOM   1599 O O   . GLY A 1 209 ? -58.186 21.437  -30.310 1.00 33.01  ? 210  GLY A O   1 
ATOM   1600 N N   . MET A 1 210 ? -56.670 22.711  -29.248 1.00 31.75  ? 211  MET A N   1 
ATOM   1601 C CA  . MET A 1 210 ? -56.225 21.577  -28.445 1.00 37.37  ? 211  MET A CA  1 
ATOM   1602 C C   . MET A 1 210 ? -57.314 21.098  -27.492 1.00 33.89  ? 211  MET A C   1 
ATOM   1603 O O   . MET A 1 210 ? -57.403 19.896  -27.217 1.00 37.90  ? 211  MET A O   1 
ATOM   1604 C CB  . MET A 1 210 ? -54.946 21.941  -27.693 1.00 32.46  ? 211  MET A CB  1 
ATOM   1605 C CG  . MET A 1 210 ? -53.724 21.944  -28.616 1.00 33.33  ? 211  MET A CG  1 
ATOM   1606 S SD  . MET A 1 210 ? -52.264 22.632  -27.832 1.00 42.07  ? 211  MET A SD  1 
ATOM   1607 C CE  . MET A 1 210 ? -51.343 23.255  -29.239 1.00 35.35  ? 211  MET A CE  1 
ATOM   1608 N N   . HIS A 1 211 ? -58.161 22.007  -26.996 1.00 25.93  ? 212  HIS A N   1 
ATOM   1609 C CA  . HIS A 1 211 ? -59.288 21.575  -26.178 1.00 29.71  ? 212  HIS A CA  1 
ATOM   1610 C C   . HIS A 1 211 ? -60.306 20.799  -27.006 1.00 37.49  ? 212  HIS A C   1 
ATOM   1611 O O   . HIS A 1 211 ? -60.946 19.873  -26.495 1.00 43.53  ? 212  HIS A O   1 
ATOM   1612 C CB  . HIS A 1 211 ? -59.943 22.782  -25.503 1.00 32.67  ? 212  HIS A CB  1 
ATOM   1613 C CG  . HIS A 1 211 ? -59.095 23.414  -24.441 1.00 32.58  ? 212  HIS A CG  1 
ATOM   1614 N ND1 . HIS A 1 211 ? -58.784 22.776  -23.257 1.00 35.79  ? 212  HIS A ND1 1 
ATOM   1615 C CD2 . HIS A 1 211 ? -58.489 24.625  -24.385 1.00 30.65  ? 212  HIS A CD2 1 
ATOM   1616 C CE1 . HIS A 1 211 ? -58.028 23.569  -22.516 1.00 34.28  ? 212  HIS A CE1 1 
ATOM   1617 N NE2 . HIS A 1 211 ? -57.833 24.696  -23.178 1.00 33.35  ? 212  HIS A NE2 1 
ATOM   1618 N N   . LEU A 1 212 ? -60.460 21.153  -28.284 1.00 33.68  ? 213  LEU A N   1 
ATOM   1619 C CA  . LEU A 1 212 ? -61.318 20.374  -29.168 1.00 35.18  ? 213  LEU A CA  1 
ATOM   1620 C C   . LEU A 1 212 ? -60.823 18.941  -29.286 1.00 36.14  ? 213  LEU A C   1 
ATOM   1621 O O   . LEU A 1 212 ? -61.624 18.001  -29.361 1.00 43.72  ? 213  LEU A O   1 
ATOM   1622 C CB  . LEU A 1 212 ? -61.370 21.020  -30.555 1.00 43.59  ? 213  LEU A CB  1 
ATOM   1623 C CG  . LEU A 1 212 ? -62.279 22.230  -30.736 1.00 46.27  ? 213  LEU A CG  1 
ATOM   1624 C CD1 . LEU A 1 212 ? -61.969 22.927  -32.052 1.00 41.44  ? 213  LEU A CD1 1 
ATOM   1625 C CD2 . LEU A 1 212 ? -63.734 21.798  -30.674 1.00 54.24  ? 213  LEU A CD2 1 
ATOM   1626 N N   . LEU A 1 213 ? -59.506 18.757  -29.315 1.00 33.68  ? 214  LEU A N   1 
ATOM   1627 C CA  . LEU A 1 213 ? -58.894 17.466  -29.595 1.00 38.77  ? 214  LEU A CA  1 
ATOM   1628 C C   . LEU A 1 213 ? -58.536 16.690  -28.333 1.00 41.80  ? 214  LEU A C   1 
ATOM   1629 O O   . LEU A 1 213 ? -57.941 15.612  -28.429 1.00 49.88  ? 214  LEU A O   1 
ATOM   1630 C CB  . LEU A 1 213 ? -57.652 17.668  -30.468 1.00 35.05  ? 214  LEU A CB  1 
ATOM   1631 C CG  . LEU A 1 213 ? -57.864 18.542  -31.710 1.00 37.15  ? 214  LEU A CG  1 
ATOM   1632 C CD1 . LEU A 1 213 ? -56.534 18.997  -32.291 1.00 39.38  ? 214  LEU A CD1 1 
ATOM   1633 C CD2 . LEU A 1 213 ? -58.678 17.800  -32.768 1.00 32.40  ? 214  LEU A CD2 1 
ATOM   1634 N N   . SER A 1 214 ? -58.886 17.202  -27.164 1.00 36.02  ? 215  SER A N   1 
ATOM   1635 C CA  . SER A 1 214 ? -58.626 16.527  -25.894 1.00 35.51  ? 215  SER A CA  1 
ATOM   1636 C C   . SER A 1 214 ? -59.963 16.193  -25.256 1.00 37.27  ? 215  SER A C   1 
ATOM   1637 O O   . SER A 1 214 ? -60.662 17.114  -24.791 1.00 40.06  ? 215  SER A O   1 
ATOM   1638 C CB  . SER A 1 214 ? -57.794 17.416  -24.971 1.00 37.66  ? 215  SER A CB  1 
ATOM   1639 O OG  . SER A 1 214 ? -57.246 16.681  -23.893 1.00 42.79  ? 215  SER A OG  1 
ATOM   1640 N N   . PRO A 1 215 ? -60.364 14.923  -25.214 1.00 31.33  ? 216  PRO A N   1 
ATOM   1641 C CA  . PRO A 1 215 ? -61.723 14.568  -24.746 1.00 41.48  ? 216  PRO A CA  1 
ATOM   1642 C C   . PRO A 1 215 ? -62.066 15.147  -23.379 1.00 45.42  ? 216  PRO A C   1 
ATOM   1643 O O   . PRO A 1 215 ? -63.197 15.623  -23.194 1.00 44.35  ? 216  PRO A O   1 
ATOM   1644 C CB  . PRO A 1 215 ? -61.696 13.031  -24.726 1.00 35.45  ? 216  PRO A CB  1 
ATOM   1645 C CG  . PRO A 1 215 ? -60.737 12.682  -25.856 1.00 35.05  ? 216  PRO A CG  1 
ATOM   1646 C CD  . PRO A 1 215 ? -59.661 13.765  -25.802 1.00 42.36  ? 216  PRO A CD  1 
ATOM   1647 N N   . PRO A 1 216 ? -61.157 15.144  -22.389 1.00 43.89  ? 217  PRO A N   1 
ATOM   1648 C CA  . PRO A 1 216 ? -61.546 15.729  -21.091 1.00 48.01  ? 217  PRO A CA  1 
ATOM   1649 C C   . PRO A 1 216 ? -61.905 17.203  -21.174 1.00 43.46  ? 217  PRO A C   1 
ATOM   1650 O O   . PRO A 1 216 ? -62.688 17.683  -20.347 1.00 45.32  ? 217  PRO A O   1 
ATOM   1651 C CB  . PRO A 1 216 ? -60.313 15.492  -20.204 1.00 46.07  ? 217  PRO A CB  1 
ATOM   1652 C CG  . PRO A 1 216 ? -59.629 14.330  -20.826 1.00 46.88  ? 217  PRO A CG  1 
ATOM   1653 C CD  . PRO A 1 216 ? -59.815 14.535  -22.303 1.00 47.41  ? 217  PRO A CD  1 
ATOM   1654 N N   . SER A 1 217 ? -61.366 17.938  -22.150 1.00 39.50  ? 218  SER A N   1 
ATOM   1655 C CA  . SER A 1 217 ? -61.758 19.332  -22.340 1.00 42.28  ? 218  SER A CA  1 
ATOM   1656 C C   . SER A 1 217 ? -63.039 19.450  -23.152 1.00 44.34  ? 218  SER A C   1 
ATOM   1657 O O   . SER A 1 217 ? -63.862 20.337  -22.889 1.00 37.98  ? 218  SER A O   1 
ATOM   1658 C CB  . SER A 1 217 ? -60.645 20.116  -23.046 1.00 38.45  ? 218  SER A CB  1 
ATOM   1659 O OG  . SER A 1 217 ? -59.477 20.224  -22.251 1.00 44.11  ? 218  SER A OG  1 
ATOM   1660 N N   . ARG A 1 218 ? -63.223 18.551  -24.119 1.00 51.05  ? 219  ARG A N   1 
ATOM   1661 C CA  . ARG A 1 218 ? -64.277 18.686  -25.115 1.00 54.35  ? 219  ARG A CA  1 
ATOM   1662 C C   . ARG A 1 218 ? -65.671 18.672  -24.497 1.00 48.74  ? 219  ARG A C   1 
ATOM   1663 O O   . ARG A 1 218 ? -66.600 19.243  -25.076 1.00 51.93  ? 219  ARG A O   1 
ATOM   1664 C CB  . ARG A 1 218 ? -64.118 17.570  -26.156 1.00 59.48  ? 219  ARG A CB  1 
ATOM   1665 C CG  . ARG A 1 218 ? -65.114 17.600  -27.298 1.00 64.91  ? 219  ARG A CG  1 
ATOM   1666 C CD  . ARG A 1 218 ? -65.098 18.928  -28.040 1.00 65.82  ? 219  ARG A CD  1 
ATOM   1667 N NE  . ARG A 1 218 ? -66.145 18.954  -29.058 1.00 69.74  ? 219  ARG A NE  1 
ATOM   1668 C CZ  . ARG A 1 218 ? -67.334 19.523  -28.892 1.00 68.72  ? 219  ARG A CZ  1 
ATOM   1669 N NH1 . ARG A 1 218 ? -67.627 20.130  -27.749 1.00 64.17  ? 219  ARG A NH1 1 
ATOM   1670 N NH2 . ARG A 1 218 ? -68.230 19.491  -29.870 1.00 67.21  ? 219  ARG A NH2 1 
ATOM   1671 N N   . GLY A 1 219 ? -65.839 18.058  -23.336 1.00 44.32  ? 220  GLY A N   1 
ATOM   1672 C CA  . GLY A 1 219 ? -67.130 18.102  -22.682 1.00 42.40  ? 220  GLY A CA  1 
ATOM   1673 C C   . GLY A 1 219 ? -67.470 19.400  -21.984 1.00 44.02  ? 220  GLY A C   1 
ATOM   1674 O O   . GLY A 1 219 ? -68.598 19.549  -21.508 1.00 46.46  ? 220  GLY A O   1 
ATOM   1675 N N   . LEU A 1 220 ? -66.542 20.357  -21.919 1.00 37.64  ? 221  LEU A N   1 
ATOM   1676 C CA  . LEU A 1 220 ? -66.751 21.593  -21.177 1.00 36.03  ? 221  LEU A CA  1 
ATOM   1677 C C   . LEU A 1 220 ? -67.178 22.767  -22.052 1.00 43.57  ? 221  LEU A C   1 
ATOM   1678 O O   . LEU A 1 220 ? -67.334 23.876  -21.533 1.00 41.52  ? 221  LEU A O   1 
ATOM   1679 C CB  . LEU A 1 220 ? -65.475 21.968  -20.410 1.00 29.47  ? 221  LEU A CB  1 
ATOM   1680 C CG  . LEU A 1 220 ? -64.832 20.859  -19.574 1.00 35.56  ? 221  LEU A CG  1 
ATOM   1681 C CD1 . LEU A 1 220 ? -63.429 21.240  -19.129 1.00 33.94  ? 221  LEU A CD1 1 
ATOM   1682 C CD2 . LEU A 1 220 ? -65.701 20.521  -18.371 1.00 34.32  ? 221  LEU A CD2 1 
ATOM   1683 N N   . PHE A 1 221 ? -67.362 22.568  -23.356 1.00 43.80  ? 222  PHE A N   1 
ATOM   1684 C CA  . PHE A 1 221 ? -67.829 23.658  -24.207 1.00 35.39  ? 222  PHE A CA  1 
ATOM   1685 C C   . PHE A 1 221 ? -68.544 23.079  -25.417 1.00 38.64  ? 222  PHE A C   1 
ATOM   1686 O O   . PHE A 1 221 ? -68.559 21.865  -25.634 1.00 46.54  ? 222  PHE A O   1 
ATOM   1687 C CB  . PHE A 1 221 ? -66.679 24.584  -24.624 1.00 35.66  ? 222  PHE A CB  1 
ATOM   1688 C CG  . PHE A 1 221 ? -65.602 23.909  -25.426 1.00 36.00  ? 222  PHE A CG  1 
ATOM   1689 C CD1 . PHE A 1 221 ? -64.658 23.101  -24.805 1.00 34.74  ? 222  PHE A CD1 1 
ATOM   1690 C CD2 . PHE A 1 221 ? -65.510 24.108  -26.797 1.00 37.25  ? 222  PHE A CD2 1 
ATOM   1691 C CE1 . PHE A 1 221 ? -63.657 22.482  -25.540 1.00 32.87  ? 222  PHE A CE1 1 
ATOM   1692 C CE2 . PHE A 1 221 ? -64.506 23.497  -27.537 1.00 37.56  ? 222  PHE A CE2 1 
ATOM   1693 C CZ  . PHE A 1 221 ? -63.579 22.685  -26.907 1.00 35.36  ? 222  PHE A CZ  1 
ATOM   1694 N N   . HIS A 1 222 ? -69.202 23.946  -26.158 1.00 38.24  ? 223  HIS A N   1 
ATOM   1695 C CA  . HIS A 1 222 ? -69.987 23.578  -27.312 1.00 37.35  ? 223  HIS A CA  1 
ATOM   1696 C C   . HIS A 1 222 ? -69.589 24.099  -28.666 1.00 42.19  ? 223  HIS A C   1 
ATOM   1697 O O   . HIS A 1 222 ? -69.881 23.473  -29.633 1.00 43.64  ? 223  HIS A O   1 
ATOM   1698 C CB  . HIS A 1 222 ? -71.402 24.014  -27.048 1.00 38.25  ? 223  HIS A CB  1 
ATOM   1699 C CG  . HIS A 1 222 ? -71.803 23.772  -25.647 1.00 52.22  ? 223  HIS A CG  1 
ATOM   1700 N ND1 . HIS A 1 222 ? -71.877 24.769  -24.713 1.00 54.28  ? 223  HIS A ND1 1 
ATOM   1701 C CD2 . HIS A 1 222 ? -72.038 22.621  -24.990 1.00 48.79  ? 223  HIS A CD2 1 
ATOM   1702 C CE1 . HIS A 1 222 ? -72.170 24.243  -23.550 1.00 50.26  ? 223  HIS A CE1 1 
ATOM   1703 N NE2 . HIS A 1 222 ? -72.275 22.944  -23.694 1.00 49.49  ? 223  HIS A NE2 1 
ATOM   1704 N N   . ARG A 1 223 ? -68.938 25.242  -28.706 1.00 38.90  ? 224  ARG A N   1 
ATOM   1705 C CA  . ARG A 1 223 ? -68.530 25.896  -29.923 1.00 36.89  ? 224  ARG A CA  1 
ATOM   1706 C C   . ARG A 1 223 ? -67.160 26.506  -29.783 1.00 37.36  ? 224  ARG A C   1 
ATOM   1707 O O   . ARG A 1 223 ? -66.729 26.765  -28.701 1.00 36.19  ? 224  ARG A O   1 
ATOM   1708 C CB  . ARG A 1 223 ? -69.557 26.919  -30.304 1.00 39.87  ? 224  ARG A CB  1 
ATOM   1709 C CG  . ARG A 1 223 ? -70.828 26.264  -30.725 1.00 45.30  ? 224  ARG A CG  1 
ATOM   1710 C CD  . ARG A 1 223 ? -71.834 27.228  -31.233 1.00 49.31  ? 224  ARG A CD  1 
ATOM   1711 N NE  . ARG A 1 223 ? -72.588 27.793  -30.172 1.00 57.57  ? 224  ARG A NE  1 
ATOM   1712 C CZ  . ARG A 1 223 ? -73.447 27.127  -29.438 1.00 70.77  ? 224  ARG A CZ  1 
ATOM   1713 N NH1 . ARG A 1 223 ? -73.644 25.862  -29.636 1.00 66.76  ? 224  ARG A NH1 1 
ATOM   1714 N NH2 . ARG A 1 223 ? -74.082 27.736  -28.478 1.00 77.05  ? 224  ARG A NH2 1 
ATOM   1715 N N   . ALA A 1 224 ? -66.497 26.760  -30.895 1.00 37.49  ? 225  ALA A N   1 
ATOM   1716 C CA  . ALA A 1 224 ? -65.121 27.227  -30.864 1.00 40.39  ? 225  ALA A CA  1 
ATOM   1717 C C   . ALA A 1 224 ? -64.904 28.262  -31.955 1.00 38.31  ? 225  ALA A C   1 
ATOM   1718 O O   . ALA A 1 224 ? -65.425 28.128  -33.066 1.00 35.23  ? 225  ALA A O   1 
ATOM   1719 C CB  . ALA A 1 224 ? -64.137 26.060  -31.039 1.00 43.05  ? 225  ALA A CB  1 
ATOM   1720 N N   . VAL A 1 225 ? -64.142 29.298  -31.622 1.00 35.31  ? 226  VAL A N   1 
ATOM   1721 C CA  . VAL A 1 225 ? -63.681 30.296  -32.576 1.00 26.31  ? 226  VAL A CA  1 
ATOM   1722 C C   . VAL A 1 225 ? -62.163 30.305  -32.527 1.00 31.92  ? 226  VAL A C   1 
ATOM   1723 O O   . VAL A 1 225 ? -61.579 30.439  -31.446 1.00 30.58  ? 226  VAL A O   1 
ATOM   1724 C CB  . VAL A 1 225 ? -64.240 31.697  -32.265 1.00 32.05  ? 226  VAL A CB  1 
ATOM   1725 C CG1 . VAL A 1 225 ? -63.803 32.687  -33.336 1.00 29.96  ? 226  VAL A CG1 1 
ATOM   1726 C CG2 . VAL A 1 225 ? -65.763 31.664  -32.108 1.00 32.45  ? 226  VAL A CG2 1 
ATOM   1727 N N   . LEU A 1 226 ? -61.528 30.164  -33.693 1.00 33.03  ? 227  LEU A N   1 
ATOM   1728 C CA  . LEU A 1 226 ? -60.072 30.150  -33.814 1.00 33.52  ? 227  LEU A CA  1 
ATOM   1729 C C   . LEU A 1 226 ? -59.650 31.317  -34.698 1.00 33.06  ? 227  LEU A C   1 
ATOM   1730 O O   . LEU A 1 226 ? -59.847 31.282  -35.919 1.00 33.73  ? 227  LEU A O   1 
ATOM   1731 C CB  . LEU A 1 226 ? -59.576 28.821  -34.387 1.00 33.38  ? 227  LEU A CB  1 
ATOM   1732 C CG  . LEU A 1 226 ? -59.746 27.608  -33.467 1.00 34.98  ? 227  LEU A CG  1 
ATOM   1733 C CD1 . LEU A 1 226 ? -61.104 26.958  -33.656 1.00 31.55  ? 227  LEU A CD1 1 
ATOM   1734 C CD2 . LEU A 1 226 ? -58.640 26.601  -33.697 1.00 31.03  ? 227  LEU A CD2 1 
ATOM   1735 N N   . GLN A 1 227 ? -59.071 32.347  -34.085 1.00 29.47  ? 228  GLN A N   1 
ATOM   1736 C CA  . GLN A 1 227 ? -58.649 33.550  -34.794 1.00 30.47  ? 228  GLN A CA  1 
ATOM   1737 C C   . GLN A 1 227 ? -57.139 33.514  -35.005 1.00 27.86  ? 228  GLN A C   1 
ATOM   1738 O O   . GLN A 1 227 ? -56.375 33.548  -34.034 1.00 32.39  ? 228  GLN A O   1 
ATOM   1739 C CB  . GLN A 1 227 ? -59.058 34.804  -34.017 1.00 26.03  ? 228  GLN A CB  1 
ATOM   1740 C CG  . GLN A 1 227 ? -60.541 34.848  -33.654 1.00 34.16  ? 228  GLN A CG  1 
ATOM   1741 C CD  . GLN A 1 227 ? -60.904 35.990  -32.711 1.00 41.09  ? 228  GLN A CD  1 
ATOM   1742 O OE1 . GLN A 1 227 ? -61.941 35.943  -32.045 1.00 39.72  ? 228  GLN A OE1 1 
ATOM   1743 N NE2 . GLN A 1 227 ? -60.060 37.022  -32.654 1.00 38.27  ? 228  GLN A NE2 1 
ATOM   1744 N N   . SER A 1 228 ? -56.713 33.439  -36.267 1.00 30.10  ? 229  SER A N   1 
ATOM   1745 C CA  . SER A 1 228 ? -55.291 33.532  -36.630 1.00 30.28  ? 229  SER A CA  1 
ATOM   1746 C C   . SER A 1 228 ? -54.432 32.527  -35.865 1.00 30.25  ? 229  SER A C   1 
ATOM   1747 O O   . SER A 1 228 ? -53.347 32.854  -35.374 1.00 27.84  ? 229  SER A O   1 
ATOM   1748 C CB  . SER A 1 228 ? -54.758 34.953  -36.409 1.00 30.04  ? 229  SER A CB  1 
ATOM   1749 O OG  . SER A 1 228 ? -55.566 35.926  -37.040 1.00 36.46  ? 229  SER A OG  1 
ATOM   1750 N N   . GLY A 1 229 ? -54.913 31.299  -35.747 1.00 26.65  ? 230  GLY A N   1 
ATOM   1751 C CA  . GLY A 1 229 ? -54.126 30.270  -35.075 1.00 26.53  ? 230  GLY A CA  1 
ATOM   1752 C C   . GLY A 1 229 ? -54.849 28.939  -35.118 1.00 29.36  ? 230  GLY A C   1 
ATOM   1753 O O   . GLY A 1 229 ? -56.075 28.874  -35.264 1.00 32.87  ? 230  GLY A O   1 
ATOM   1754 N N   . ALA A 1 230 ? -54.060 27.874  -34.983 1.00 23.45  ? 231  ALA A N   1 
ATOM   1755 C CA  . ALA A 1 230 ? -54.570 26.512  -35.078 1.00 31.58  ? 231  ALA A CA  1 
ATOM   1756 C C   . ALA A 1 230 ? -53.632 25.590  -34.315 1.00 31.02  ? 231  ALA A C   1 
ATOM   1757 O O   . ALA A 1 230 ? -52.425 25.847  -34.271 1.00 30.32  ? 231  ALA A O   1 
ATOM   1758 C CB  . ALA A 1 230 ? -54.686 26.061  -36.543 1.00 22.16  ? 231  ALA A CB  1 
ATOM   1759 N N   . PRO A 1 231 ? -54.148 24.513  -33.709 1.00 32.12  ? 232  PRO A N   1 
ATOM   1760 C CA  . PRO A 1 231 ? -53.275 23.617  -32.932 1.00 30.07  ? 232  PRO A CA  1 
ATOM   1761 C C   . PRO A 1 231 ? -52.257 22.877  -33.781 1.00 34.48  ? 232  PRO A C   1 
ATOM   1762 O O   . PRO A 1 231 ? -51.245 22.414  -33.240 1.00 36.69  ? 232  PRO A O   1 
ATOM   1763 C CB  . PRO A 1 231 ? -54.264 22.636  -32.291 1.00 28.03  ? 232  PRO A CB  1 
ATOM   1764 C CG  . PRO A 1 231 ? -55.405 22.597  -33.269 1.00 30.83  ? 232  PRO A CG  1 
ATOM   1765 C CD  . PRO A 1 231 ? -55.533 24.014  -33.765 1.00 30.92  ? 232  PRO A CD  1 
ATOM   1766 N N   . ASN A 1 232 ? -52.501 22.728  -35.079 1.00 28.28  ? 233  ASN A N   1 
ATOM   1767 C CA  . ASN A 1 232 ? -51.574 22.069  -35.982 1.00 30.65  ? 233  ASN A CA  1 
ATOM   1768 C C   . ASN A 1 232 ? -50.522 23.019  -36.542 1.00 34.91  ? 233  ASN A C   1 
ATOM   1769 O O   . ASN A 1 232 ? -49.802 22.644  -37.473 1.00 35.40  ? 233  ASN A O   1 
ATOM   1770 C CB  . ASN A 1 232 ? -52.344 21.410  -37.132 1.00 32.50  ? 233  ASN A CB  1 
ATOM   1771 C CG  . ASN A 1 232 ? -53.416 22.311  -37.707 1.00 32.70  ? 233  ASN A CG  1 
ATOM   1772 O OD1 . ASN A 1 232 ? -54.140 22.964  -36.964 1.00 37.54  ? 233  ASN A OD1 1 
ATOM   1773 N ND2 . ASN A 1 232 ? -53.524 22.349  -39.043 1.00 28.79  ? 233  ASN A ND2 1 
ATOM   1774 N N   . GLY A 1 233 ? -50.425 24.238  -36.014 1.00 36.05  ? 234  GLY A N   1 
ATOM   1775 C CA  . GLY A 1 233 ? -49.385 25.156  -36.413 1.00 35.26  ? 234  GLY A CA  1 
ATOM   1776 C C   . GLY A 1 233 ? -48.014 24.627  -36.045 1.00 37.47  ? 234  GLY A C   1 
ATOM   1777 O O   . GLY A 1 233 ? -47.826 24.008  -34.993 1.00 36.18  ? 234  GLY A O   1 
ATOM   1778 N N   . PRO A 1 234 ? -47.019 24.869  -36.906 1.00 33.53  ? 235  PRO A N   1 
ATOM   1779 C CA  . PRO A 1 234 ? -45.681 24.296  -36.669 1.00 32.36  ? 235  PRO A CA  1 
ATOM   1780 C C   . PRO A 1 234 ? -44.986 24.844  -35.422 1.00 35.55  ? 235  PRO A C   1 
ATOM   1781 O O   . PRO A 1 234 ? -44.007 24.242  -34.965 1.00 38.05  ? 235  PRO A O   1 
ATOM   1782 C CB  . PRO A 1 234 ? -44.913 24.657  -37.950 1.00 37.85  ? 235  PRO A CB  1 
ATOM   1783 C CG  . PRO A 1 234 ? -45.599 25.887  -38.467 1.00 38.43  ? 235  PRO A CG  1 
ATOM   1784 C CD  . PRO A 1 234 ? -47.055 25.748  -38.088 1.00 28.93  ? 235  PRO A CD  1 
ATOM   1785 N N   . TRP A 1 235 ? -45.427 25.962  -34.870 1.00 27.91  ? 236  TRP A N   1 
ATOM   1786 C CA  . TRP A 1 235 ? -44.892 26.544  -33.646 1.00 26.33  ? 236  TRP A CA  1 
ATOM   1787 C C   . TRP A 1 235 ? -45.674 26.160  -32.383 1.00 28.05  ? 236  TRP A C   1 
ATOM   1788 O O   . TRP A 1 235 ? -45.260 26.426  -31.330 1.00 27.44  ? 236  TRP A O   1 
ATOM   1789 C CB  . TRP A 1 235 ? -44.957 28.067  -33.765 1.00 24.66  ? 236  TRP A CB  1 
ATOM   1790 C CG  . TRP A 1 235 ? -46.291 28.503  -34.232 1.00 31.75  ? 236  TRP A CG  1 
ATOM   1791 C CD1 . TRP A 1 235 ? -46.664 28.670  -35.482 1.00 34.41  ? 236  TRP A CD1 1 
ATOM   1792 C CD2 . TRP A 1 235 ? -47.445 28.738  -33.446 1.00 29.58  ? 236  TRP A CD2 1 
ATOM   1793 N NE1 . TRP A 1 235 ? -47.949 28.993  -35.557 1.00 31.58  ? 236  TRP A NE1 1 
ATOM   1794 C CE2 . TRP A 1 235 ? -48.469 29.026  -34.311 1.00 33.45  ? 236  TRP A CE2 1 
ATOM   1795 C CE3 . TRP A 1 235 ? -47.709 28.706  -32.098 1.00 34.27  ? 236  TRP A CE3 1 
ATOM   1796 C CZ2 . TRP A 1 235 ? -49.723 29.321  -33.882 1.00 34.75  ? 236  TRP A CZ2 1 
ATOM   1797 C CZ3 . TRP A 1 235 ? -48.929 28.969  -31.680 1.00 31.22  ? 236  TRP A CZ3 1 
ATOM   1798 C CH2 . TRP A 1 235 ? -49.933 29.282  -32.554 1.00 34.21  ? 236  TRP A CH2 1 
ATOM   1799 N N   . ALA A 1 236 ? -46.744 25.412  -32.498 1.00 31.91  ? 237  ALA A N   1 
ATOM   1800 C CA  . ALA A 1 236 ? -47.671 25.256  -31.390 1.00 32.85  ? 237  ALA A CA  1 
ATOM   1801 C C   . ALA A 1 236 ? -47.442 23.996  -30.569 1.00 35.81  ? 237  ALA A C   1 
ATOM   1802 O O   . ALA A 1 236 ? -47.926 23.926  -29.434 1.00 36.47  ? 237  ALA A O   1 
ATOM   1803 C CB  . ALA A 1 236 ? -49.114 25.274  -31.912 1.00 27.23  ? 237  ALA A CB  1 
ATOM   1804 N N   . THR A 1 237 ? -46.716 23.011  -31.099 1.00 31.79  ? 238  THR A N   1 
ATOM   1805 C CA  . THR A 1 237 ? -46.430 21.781  -30.374 1.00 36.82  ? 238  THR A CA  1 
ATOM   1806 C C   . THR A 1 237 ? -44.956 21.435  -30.497 1.00 40.57  ? 238  THR A C   1 
ATOM   1807 O O   . THR A 1 237 ? -44.249 21.918  -31.385 1.00 36.55  ? 238  THR A O   1 
ATOM   1808 C CB  . THR A 1 237 ? -47.245 20.586  -30.887 1.00 35.72  ? 238  THR A CB  1 
ATOM   1809 O OG1 . THR A 1 237 ? -47.086 20.462  -32.310 1.00 33.63  ? 238  THR A OG1 1 
ATOM   1810 C CG2 . THR A 1 237 ? -48.712 20.761  -30.532 1.00 33.30  ? 238  THR A CG2 1 
ATOM   1811 N N   . VAL A 1 238 ? -44.511 20.555  -29.603 1.00 38.59  ? 239  VAL A N   1 
ATOM   1812 C CA  . VAL A 1 238 ? -43.156 20.028  -29.640 1.00 28.95  ? 239  VAL A CA  1 
ATOM   1813 C C   . VAL A 1 238 ? -43.201 18.569  -29.200 1.00 37.55  ? 239  VAL A C   1 
ATOM   1814 O O   . VAL A 1 238 ? -44.073 18.163  -28.425 1.00 42.11  ? 239  VAL A O   1 
ATOM   1815 C CB  . VAL A 1 238 ? -42.212 20.893  -28.767 1.00 34.94  ? 239  VAL A CB  1 
ATOM   1816 C CG1 . VAL A 1 238 ? -42.393 20.584  -27.279 1.00 32.11  ? 239  VAL A CG1 1 
ATOM   1817 C CG2 . VAL A 1 238 ? -40.779 20.722  -29.196 1.00 38.67  ? 239  VAL A CG2 1 
ATOM   1818 N N   . GLY A 1 239 ? -42.282 17.767  -29.736 1.00 37.33  ? 240  GLY A N   1 
ATOM   1819 C CA  . GLY A 1 239 ? -42.205 16.369  -29.364 1.00 34.76  ? 240  GLY A CA  1 
ATOM   1820 C C   . GLY A 1 239 ? -41.621 16.170  -27.972 1.00 37.52  ? 240  GLY A C   1 
ATOM   1821 O O   . GLY A 1 239 ? -41.051 17.074  -27.360 1.00 37.14  ? 240  GLY A O   1 
ATOM   1822 N N   . MET A 1 240 ? -41.764 14.940  -27.470 1.00 36.42  ? 241  MET A N   1 
ATOM   1823 C CA  . MET A 1 240 ? -41.342 14.640  -26.104 1.00 41.44  ? 241  MET A CA  1 
ATOM   1824 C C   . MET A 1 240 ? -39.840 14.816  -25.931 1.00 38.18  ? 241  MET A C   1 
ATOM   1825 O O   . MET A 1 240 ? -39.384 15.372  -24.923 1.00 33.92  ? 241  MET A O   1 
ATOM   1826 C CB  . MET A 1 240 ? -41.754 13.217  -25.725 1.00 44.07  ? 241  MET A CB  1 
ATOM   1827 C CG  . MET A 1 240 ? -43.188 13.100  -25.242 1.00 46.28  ? 241  MET A CG  1 
ATOM   1828 S SD  . MET A 1 240 ? -43.672 11.394  -24.908 1.00 54.83  ? 241  MET A SD  1 
ATOM   1829 C CE  . MET A 1 240 ? -43.623 10.697  -26.553 1.00 60.63  ? 241  MET A CE  1 
ATOM   1830 N N   . GLY A 1 241 ? -39.057 14.346  -26.901 1.00 33.65  ? 242  GLY A N   1 
ATOM   1831 C CA  . GLY A 1 241 ? -37.612 14.433  -26.782 1.00 35.59  ? 242  GLY A CA  1 
ATOM   1832 C C   . GLY A 1 241 ? -37.092 15.856  -26.866 1.00 42.76  ? 242  GLY A C   1 
ATOM   1833 O O   . GLY A 1 241 ? -36.201 16.242  -26.107 1.00 42.44  ? 242  GLY A O   1 
ATOM   1834 N N   . GLU A 1 242 ? -37.633 16.656  -27.789 1.00 45.51  ? 243  GLU A N   1 
ATOM   1835 C CA  . GLU A 1 242 ? -37.169 18.035  -27.893 1.00 45.21  ? 243  GLU A CA  1 
ATOM   1836 C C   . GLU A 1 242 ? -37.623 18.862  -26.697 1.00 35.67  ? 243  GLU A C   1 
ATOM   1837 O O   . GLU A 1 242 ? -36.890 19.752  -26.255 1.00 39.15  ? 243  GLU A O   1 
ATOM   1838 C CB  . GLU A 1 242 ? -37.642 18.662  -29.212 1.00 41.69  ? 243  GLU A CB  1 
ATOM   1839 C CG  . GLU A 1 242 ? -37.379 20.169  -29.357 1.00 38.29  ? 243  GLU A CG  1 
ATOM   1840 C CD  . GLU A 1 242 ? -35.914 20.514  -29.581 1.00 44.71  ? 243  GLU A CD  1 
ATOM   1841 O OE1 . GLU A 1 242 ? -35.133 19.609  -29.941 1.00 51.94  ? 243  GLU A OE1 1 
ATOM   1842 O OE2 . GLU A 1 242 ? -35.549 21.698  -29.412 1.00 46.63  ? 243  GLU A OE2 1 
ATOM   1843 N N   . ALA A 1 243 ? -38.811 18.576  -26.155 1.00 30.84  ? 244  ALA A N   1 
ATOM   1844 C CA  . ALA A 1 243 ? -39.228 19.212  -24.907 1.00 36.23  ? 244  ALA A CA  1 
ATOM   1845 C C   . ALA A 1 243 ? -38.249 18.902  -23.783 1.00 34.56  ? 244  ALA A C   1 
ATOM   1846 O O   . ALA A 1 243 ? -37.813 19.800  -23.058 1.00 33.20  ? 244  ALA A O   1 
ATOM   1847 C CB  . ALA A 1 243 ? -40.637 18.760  -24.523 1.00 29.55  ? 244  ALA A CB  1 
ATOM   1848 N N   . ARG A 1 244 ? -37.880 17.628  -23.636 1.00 33.02  ? 245  ARG A N   1 
ATOM   1849 C CA  . ARG A 1 244 ? -36.924 17.249  -22.603 1.00 42.28  ? 245  ARG A CA  1 
ATOM   1850 C C   . ARG A 1 244 ? -35.583 17.939  -22.815 1.00 45.35  ? 245  ARG A C   1 
ATOM   1851 O O   . ARG A 1 244 ? -34.958 18.408  -21.856 1.00 44.88  ? 245  ARG A O   1 
ATOM   1852 C CB  . ARG A 1 244 ? -36.752 15.730  -22.589 1.00 36.61  ? 245  ARG A CB  1 
ATOM   1853 C CG  . ARG A 1 244 ? -35.650 15.221  -21.673 1.00 37.36  ? 245  ARG A CG  1 
ATOM   1854 C CD  . ARG A 1 244 ? -35.814 13.728  -21.424 1.00 46.29  ? 245  ARG A CD  1 
ATOM   1855 N NE  . ARG A 1 244 ? -36.870 13.486  -20.452 1.00 49.95  ? 245  ARG A NE  1 
ATOM   1856 C CZ  . ARG A 1 244 ? -36.719 13.599  -19.137 1.00 48.26  ? 245  ARG A CZ  1 
ATOM   1857 N NH1 . ARG A 1 244 ? -35.543 13.933  -18.611 1.00 40.88  ? 245  ARG A NH1 1 
ATOM   1858 N NH2 . ARG A 1 244 ? -37.752 13.364  -18.350 1.00 43.32  ? 245  ARG A NH2 1 
ATOM   1859 N N   . ARG A 1 245 ? -35.122 18.003  -24.068 1.00 45.02  ? 246  ARG A N   1 
ATOM   1860 C CA  . ARG A 1 245 ? -33.845 18.645  -24.359 1.00 46.53  ? 246  ARG A CA  1 
ATOM   1861 C C   . ARG A 1 245 ? -33.879 20.117  -23.980 1.00 43.63  ? 246  ARG A C   1 
ATOM   1862 O O   . ARG A 1 245 ? -32.891 20.665  -23.477 1.00 34.51  ? 246  ARG A O   1 
ATOM   1863 C CB  . ARG A 1 245 ? -33.503 18.481  -25.843 1.00 35.07  ? 246  ARG A CB  1 
ATOM   1864 C CG  . ARG A 1 245 ? -32.164 19.081  -26.246 1.00 49.56  ? 246  ARG A CG  1 
ATOM   1865 C CD  . ARG A 1 245 ? -32.065 19.304  -27.755 1.00 49.63  ? 246  ARG A CD  1 
ATOM   1866 N NE  . ARG A 1 245 ? -32.851 20.455  -28.191 1.00 51.43  ? 246  ARG A NE  1 
ATOM   1867 C CZ  . ARG A 1 245 ? -32.474 21.720  -28.035 1.00 52.85  ? 246  ARG A CZ  1 
ATOM   1868 N NH1 . ARG A 1 245 ? -31.318 22.007  -27.444 1.00 53.26  ? 246  ARG A NH1 1 
ATOM   1869 N NH2 . ARG A 1 245 ? -33.256 22.700  -28.466 1.00 48.12  ? 246  ARG A NH2 1 
ATOM   1870 N N   . ARG A 1 246 ? -35.018 20.769  -24.204 1.00 34.65  ? 247  ARG A N   1 
ATOM   1871 C CA  . ARG A 1 246 ? -35.144 22.183  -23.882 1.00 33.72  ? 247  ARG A CA  1 
ATOM   1872 C C   . ARG A 1 246 ? -35.210 22.404  -22.376 1.00 41.53  ? 247  ARG A C   1 
ATOM   1873 O O   . ARG A 1 246 ? -34.552 23.308  -21.847 1.00 40.15  ? 247  ARG A O   1 
ATOM   1874 C CB  . ARG A 1 246 ? -36.376 22.754  -24.581 1.00 32.37  ? 247  ARG A CB  1 
ATOM   1875 C CG  . ARG A 1 246 ? -36.225 22.808  -26.103 1.00 35.34  ? 247  ARG A CG  1 
ATOM   1876 C CD  . ARG A 1 246 ? -37.442 23.456  -26.752 1.00 32.82  ? 247  ARG A CD  1 
ATOM   1877 N NE  . ARG A 1 246 ? -37.434 23.291  -28.202 1.00 42.56  ? 247  ARG A NE  1 
ATOM   1878 C CZ  . ARG A 1 246 ? -38.366 23.777  -29.017 1.00 41.80  ? 247  ARG A CZ  1 
ATOM   1879 N NH1 . ARG A 1 246 ? -39.389 24.468  -28.528 1.00 33.86  ? 247  ARG A NH1 1 
ATOM   1880 N NH2 . ARG A 1 246 ? -38.275 23.574  -30.325 1.00 38.39  ? 247  ARG A NH2 1 
ATOM   1881 N N   . ALA A 1 247 ? -35.997 21.585  -21.670 1.00 42.27  ? 248  ALA A N   1 
ATOM   1882 C CA  . ALA A 1 247 ? -36.041 21.682  -20.216 1.00 36.18  ? 248  ALA A CA  1 
ATOM   1883 C C   . ALA A 1 247 ? -34.666 21.443  -19.622 1.00 39.06  ? 248  ALA A C   1 
ATOM   1884 O O   . ALA A 1 247 ? -34.238 22.163  -18.713 1.00 40.38  ? 248  ALA A O   1 
ATOM   1885 C CB  . ALA A 1 247 ? -37.052 20.683  -19.649 1.00 32.22  ? 248  ALA A CB  1 
ATOM   1886 N N   . THR A 1 248 ? -33.946 20.448  -20.145 1.00 41.96  ? 249  THR A N   1 
ATOM   1887 C CA  . THR A 1 248 ? -32.617 20.147  -19.626 1.00 45.15  ? 249  THR A CA  1 
ATOM   1888 C C   . THR A 1 248 ? -31.641 21.273  -19.939 1.00 45.96  ? 249  THR A C   1 
ATOM   1889 O O   . THR A 1 248 ? -30.764 21.589  -19.125 1.00 45.16  ? 249  THR A O   1 
ATOM   1890 C CB  . THR A 1 248 ? -32.126 18.818  -20.202 1.00 48.77  ? 249  THR A CB  1 
ATOM   1891 O OG1 . THR A 1 248 ? -33.015 17.772  -19.791 1.00 48.35  ? 249  THR A OG1 1 
ATOM   1892 C CG2 . THR A 1 248 ? -30.712 18.495  -19.712 1.00 41.17  ? 249  THR A CG2 1 
ATOM   1893 N N   . GLN A 1 249 ? -31.788 21.902  -21.106 1.00 44.33  ? 250  GLN A N   1 
ATOM   1894 C CA  . GLN A 1 249 ? -30.894 22.993  -21.477 1.00 45.87  ? 250  GLN A CA  1 
ATOM   1895 C C   . GLN A 1 249 ? -31.111 24.205  -20.580 1.00 41.76  ? 250  GLN A C   1 
ATOM   1896 O O   . GLN A 1 249 ? -30.148 24.811  -20.097 1.00 42.10  ? 250  GLN A O   1 
ATOM   1897 C CB  . GLN A 1 249 ? -31.097 23.357  -22.949 1.00 53.63  ? 250  GLN A CB  1 
ATOM   1898 C CG  . GLN A 1 249 ? -30.537 24.711  -23.353 1.00 62.51  ? 250  GLN A CG  1 
ATOM   1899 C CD  . GLN A 1 249 ? -29.053 24.672  -23.665 1.00 74.24  ? 250  GLN A CD  1 
ATOM   1900 O OE1 . GLN A 1 249 ? -28.305 23.867  -23.108 1.00 78.33  ? 250  GLN A OE1 1 
ATOM   1901 N NE2 . GLN A 1 249 ? -28.620 25.547  -24.567 1.00 78.55  ? 250  GLN A NE2 1 
ATOM   1902 N N   . LEU A 1 250 ? -32.373 24.572  -20.344 1.00 35.82  ? 251  LEU A N   1 
ATOM   1903 C CA  . LEU A 1 250 ? -32.664 25.656  -19.413 1.00 37.79  ? 251  LEU A CA  1 
ATOM   1904 C C   . LEU A 1 250 ? -32.100 25.348  -18.032 1.00 45.82  ? 251  LEU A C   1 
ATOM   1905 O O   . LEU A 1 250 ? -31.406 26.178  -17.432 1.00 43.22  ? 251  LEU A O   1 
ATOM   1906 C CB  . LEU A 1 250 ? -34.171 25.896  -19.338 1.00 37.71  ? 251  LEU A CB  1 
ATOM   1907 C CG  . LEU A 1 250 ? -34.617 26.881  -18.257 1.00 40.83  ? 251  LEU A CG  1 
ATOM   1908 C CD1 . LEU A 1 250 ? -34.221 28.294  -18.657 1.00 39.90  ? 251  LEU A CD1 1 
ATOM   1909 C CD2 . LEU A 1 250 ? -36.120 26.800  -18.019 1.00 31.18  ? 251  LEU A CD2 1 
ATOM   1910 N N   . ALA A 1 251 ? -32.375 24.144  -17.520 1.00 47.68  ? 252  ALA A N   1 
ATOM   1911 C CA  . ALA A 1 251 ? -31.850 23.755  -16.215 1.00 49.65  ? 252  ALA A CA  1 
ATOM   1912 C C   . ALA A 1 251 ? -30.336 23.882  -16.176 1.00 50.58  ? 252  ALA A C   1 
ATOM   1913 O O   . ALA A 1 251 ? -29.768 24.397  -15.204 1.00 46.31  ? 252  ALA A O   1 
ATOM   1914 C CB  . ALA A 1 251 ? -32.278 22.326  -15.882 1.00 45.37  ? 252  ALA A CB  1 
ATOM   1915 N N   . HIS A 1 252 ? -29.668 23.437  -17.240 1.00 49.90  ? 253  HIS A N   1 
ATOM   1916 C CA  . HIS A 1 252 ? -28.219 23.571  -17.323 1.00 52.57  ? 253  HIS A CA  1 
ATOM   1917 C C   . HIS A 1 252 ? -27.793 25.034  -17.301 1.00 53.04  ? 253  HIS A C   1 
ATOM   1918 O O   . HIS A 1 252 ? -26.801 25.388  -16.655 1.00 58.39  ? 253  HIS A O   1 
ATOM   1919 C CB  . HIS A 1 252 ? -27.713 22.885  -18.591 1.00 59.11  ? 253  HIS A CB  1 
ATOM   1920 C CG  . HIS A 1 252 ? -26.227 22.919  -18.738 1.00 71.80  ? 253  HIS A CG  1 
ATOM   1921 N ND1 . HIS A 1 252 ? -25.395 22.050  -18.066 1.00 77.79  ? 253  HIS A ND1 1 
ATOM   1922 C CD2 . HIS A 1 252 ? -25.422 23.723  -19.471 1.00 75.07  ? 253  HIS A CD2 1 
ATOM   1923 C CE1 . HIS A 1 252 ? -24.140 22.314  -18.384 1.00 80.27  ? 253  HIS A CE1 1 
ATOM   1924 N NE2 . HIS A 1 252 ? -24.128 23.325  -19.234 1.00 78.55  ? 253  HIS A NE2 1 
ATOM   1925 N N   . LEU A 1 253 ? -28.535 25.902  -17.998 1.00 52.51  ? 254  LEU A N   1 
ATOM   1926 C CA  . LEU A 1 253 ? -28.145 27.306  -18.093 1.00 51.66  ? 254  LEU A CA  1 
ATOM   1927 C C   . LEU A 1 253 ? -28.249 28.023  -16.753 1.00 55.05  ? 254  LEU A C   1 
ATOM   1928 O O   . LEU A 1 253 ? -27.498 28.973  -16.504 1.00 59.10  ? 254  LEU A O   1 
ATOM   1929 C CB  . LEU A 1 253 ? -29.002 28.026  -19.134 1.00 43.41  ? 254  LEU A CB  1 
ATOM   1930 C CG  . LEU A 1 253 ? -28.612 27.758  -20.588 1.00 49.92  ? 254  LEU A CG  1 
ATOM   1931 C CD1 . LEU A 1 253 ? -29.673 28.279  -21.541 1.00 44.89  ? 254  LEU A CD1 1 
ATOM   1932 C CD2 . LEU A 1 253 ? -27.255 28.370  -20.895 1.00 53.27  ? 254  LEU A CD2 1 
ATOM   1933 N N   . VAL A 1 254 ? -29.165 27.597  -15.884 1.00 49.16  ? 255  VAL A N   1 
ATOM   1934 C CA  . VAL A 1 254 ? -29.344 28.231  -14.586 1.00 45.71  ? 255  VAL A CA  1 
ATOM   1935 C C   . VAL A 1 254 ? -28.623 27.472  -13.476 1.00 53.92  ? 255  VAL A C   1 
ATOM   1936 O O   . VAL A 1 254 ? -28.836 27.760  -12.296 1.00 57.85  ? 255  VAL A O   1 
ATOM   1937 C CB  . VAL A 1 254 ? -30.835 28.403  -14.255 1.00 42.66  ? 255  VAL A CB  1 
ATOM   1938 C CG1 . VAL A 1 254 ? -31.515 29.242  -15.323 1.00 41.28  ? 255  VAL A CG1 1 
ATOM   1939 C CG2 . VAL A 1 254 ? -31.514 27.050  -14.118 1.00 41.06  ? 255  VAL A CG2 1 
ATOM   1940 N N   . GLY A 1 255 ? -27.781 26.502  -13.826 1.00 54.20  ? 256  GLY A N   1 
ATOM   1941 C CA  . GLY A 1 255 ? -26.974 25.803  -12.844 1.00 55.08  ? 256  GLY A CA  1 
ATOM   1942 C C   . GLY A 1 255 ? -27.593 24.571  -12.221 1.00 60.16  ? 256  GLY A C   1 
ATOM   1943 O O   . GLY A 1 255 ? -27.156 24.165  -11.138 1.00 71.19  ? 256  GLY A O   1 
ATOM   1944 N N   . CYS A 1 256 ? -28.544 23.960  -12.891 1.00 56.44  ? 257  CYS A N   1 
ATOM   1945 C CA  . CYS A 1 256 ? -29.211 22.780  -12.401 1.00 55.76  ? 257  CYS A CA  1 
ATOM   1946 C C   . CYS A 1 256 ? -29.031 21.578  -13.278 1.00 62.99  ? 257  CYS A C   1 
ATOM   1947 O O   . CYS A 1 256 ? -29.205 21.639  -14.446 1.00 59.24  ? 257  CYS A O   1 
ATOM   1948 C CB  . CYS A 1 256 ? -30.694 23.025  -12.339 1.00 51.51  ? 257  CYS A CB  1 
ATOM   1949 S SG  . CYS A 1 256 ? -31.228 24.113  -11.072 1.00 59.06  ? 257  CYS A SG  1 
ATOM   1950 N N   . PRO A 1 257 ? -28.698 20.439  -12.701 1.00 83.47  ? 258  PRO A N   1 
ATOM   1951 C CA  . PRO A 1 257 ? -28.120 20.372  -11.380 1.00 95.32  ? 258  PRO A CA  1 
ATOM   1952 C C   . PRO A 1 257 ? -26.676 20.807  -11.479 1.00 107.26 ? 258  PRO A C   1 
ATOM   1953 O O   . PRO A 1 257 ? -26.135 20.975  -12.562 1.00 121.41 ? 258  PRO A O   1 
ATOM   1954 C CB  . PRO A 1 257 ? -28.209 18.898  -11.074 1.00 96.97  ? 258  PRO A CB  1 
ATOM   1955 C CG  . PRO A 1 257 ? -27.972 18.263  -12.395 1.00 93.56  ? 258  PRO A CG  1 
ATOM   1956 C CD  . PRO A 1 257 ? -28.412 19.214  -13.456 1.00 85.99  ? 258  PRO A CD  1 
ATOM   1957 N N   . PRO A 1 258 ? -26.045 20.996  -10.334 1.00 104.55 ? 259  PRO A N   1 
ATOM   1958 C CA  . PRO A 1 258 ? -24.665 21.447  -10.255 1.00 99.46  ? 259  PRO A CA  1 
ATOM   1959 C C   . PRO A 1 258 ? -23.691 20.318  -10.452 1.00 96.89  ? 259  PRO A C   1 
ATOM   1960 O O   . PRO A 1 258 ? -22.875 20.447  -11.353 1.00 94.50  ? 259  PRO A O   1 
ATOM   1961 C CB  . PRO A 1 258 ? -24.571 22.004  -8.845  1.00 101.16 ? 259  PRO A CB  1 
ATOM   1962 C CG  . PRO A 1 258 ? -25.674 21.364  -8.084  1.00 102.85 ? 259  PRO A CG  1 
ATOM   1963 C CD  . PRO A 1 258 ? -26.577 20.636  -9.019  1.00 103.75 ? 259  PRO A CD  1 
ATOM   1964 N N   . GLY A 1 262 ? -28.250 16.619  -16.612 1.00 97.60  ? 263  GLY A N   1 
ATOM   1965 C CA  . GLY A 1 262 ? -29.558 16.012  -16.564 1.00 89.36  ? 263  GLY A CA  1 
ATOM   1966 C C   . GLY A 1 262 ? -29.846 15.281  -15.275 1.00 88.79  ? 263  GLY A C   1 
ATOM   1967 O O   . GLY A 1 262 ? -30.193 15.901  -14.301 1.00 86.02  ? 263  GLY A O   1 
ATOM   1968 N N   . GLY A 1 263 ? -29.693 13.960  -15.275 1.00 91.86  ? 264  GLY A N   1 
ATOM   1969 C CA  . GLY A 1 263 ? -29.914 13.133  -14.099 1.00 93.19  ? 264  GLY A CA  1 
ATOM   1970 C C   . GLY A 1 263 ? -31.338 12.784  -13.750 1.00 85.96  ? 264  GLY A C   1 
ATOM   1971 O O   . GLY A 1 263 ? -32.165 12.711  -14.608 1.00 81.99  ? 264  GLY A O   1 
ATOM   1972 N N   . ASN A 1 264 ? -31.596 12.542  -12.464 1.00 86.99  ? 265  ASN A N   1 
ATOM   1973 C CA  . ASN A 1 264 ? -32.922 12.236  -11.908 1.00 82.71  ? 265  ASN A CA  1 
ATOM   1974 C C   . ASN A 1 264 ? -33.807 13.436  -12.112 1.00 67.67  ? 265  ASN A C   1 
ATOM   1975 O O   . ASN A 1 264 ? -33.420 14.522  -11.814 1.00 58.70  ? 265  ASN A O   1 
ATOM   1976 C CB  . ASN A 1 264 ? -32.751 11.969  -10.400 1.00 102.86 ? 265  ASN A CB  1 
ATOM   1977 C CG  . ASN A 1 264 ? -33.878 11.163  -9.778  1.00 125.91 ? 265  ASN A CG  1 
ATOM   1978 O OD1 . ASN A 1 264 ? -35.038 11.449  -9.969  1.00 123.82 ? 265  ASN A OD1 1 
ATOM   1979 N ND2 . ASN A 1 264 ? -33.522 10.169  -8.985  1.00 154.46 ? 265  ASN A ND2 1 
ATOM   1980 N N   . ASP A 1 265 ? -35.008 13.240  -12.597 1.00 53.16  ? 266  ASP A N   1 
ATOM   1981 C CA  . ASP A 1 265 ? -35.867 14.371  -12.834 1.00 52.49  ? 266  ASP A CA  1 
ATOM   1982 C C   . ASP A 1 265 ? -36.315 15.146  -11.607 1.00 54.85  ? 266  ASP A C   1 
ATOM   1983 O O   . ASP A 1 265 ? -36.355 16.337  -11.592 1.00 54.58  ? 266  ASP A O   1 
ATOM   1984 C CB  . ASP A 1 265 ? -37.079 13.912  -13.624 1.00 55.63  ? 266  ASP A CB  1 
ATOM   1985 C CG  . ASP A 1 265 ? -36.815 13.816  -15.085 1.00 56.06  ? 266  ASP A CG  1 
ATOM   1986 O OD1 . ASP A 1 265 ? -37.568 13.127  -15.752 1.00 50.13  ? 266  ASP A OD1 1 
ATOM   1987 O OD2 . ASP A 1 265 ? -35.869 14.413  -15.573 1.00 72.86  ? 266  ASP A OD2 1 
ATOM   1988 N N   . THR A 1 266 ? -36.606 14.425  -10.568 1.00 58.92  ? 267  THR A N   1 
ATOM   1989 C CA  . THR A 1 266 ? -37.127 14.934  -9.320  1.00 57.69  ? 267  THR A CA  1 
ATOM   1990 C C   . THR A 1 266 ? -36.170 15.915  -8.707  1.00 55.61  ? 267  THR A C   1 
ATOM   1991 O O   . THR A 1 266 ? -36.537 16.919  -8.201  1.00 52.59  ? 267  THR A O   1 
ATOM   1992 C CB  . THR A 1 266 ? -37.335 13.791  -8.338  1.00 62.23  ? 267  THR A CB  1 
ATOM   1993 O OG1 . THR A 1 266 ? -38.547 13.123  -8.640  1.00 70.47  ? 267  THR A OG1 1 
ATOM   1994 C CG2 . THR A 1 266 ? -37.461 14.308  -6.999  1.00 57.02  ? 267  THR A CG2 1 
ATOM   1995 N N   . GLU A 1 267 ? -34.922 15.590  -8.800  1.00 54.37  ? 268  GLU A N   1 
ATOM   1996 C CA  . GLU A 1 267 ? -33.829 16.364  -8.325  1.00 54.82  ? 268  GLU A CA  1 
ATOM   1997 C C   . GLU A 1 267 ? -33.547 17.604  -9.170  1.00 57.39  ? 268  GLU A C   1 
ATOM   1998 O O   . GLU A 1 267 ? -33.196 18.636  -8.679  1.00 54.85  ? 268  GLU A O   1 
ATOM   1999 C CB  . GLU A 1 267 ? -32.634 15.464  -8.293  1.00 74.99  ? 268  GLU A CB  1 
ATOM   2000 C CG  . GLU A 1 267 ? -31.758 15.664  -7.105  1.00 102.81 ? 268  GLU A CG  1 
ATOM   2001 C CD  . GLU A 1 267 ? -30.579 16.514  -7.429  1.00 131.43 ? 268  GLU A CD  1 
ATOM   2002 O OE1 . GLU A 1 267 ? -30.611 17.170  -8.472  1.00 144.25 ? 268  GLU A OE1 1 
ATOM   2003 O OE2 . GLU A 1 267 ? -29.612 16.526  -6.645  1.00 142.56 ? 268  GLU A OE2 1 
ATOM   2004 N N   . LEU A 1 268 ? -33.631 17.450  -10.474 1.00 50.51  ? 269  LEU A N   1 
ATOM   2005 C CA  . LEU A 1 268 ? -33.433 18.568  -11.390 1.00 51.36  ? 269  LEU A CA  1 
ATOM   2006 C C   . LEU A 1 268 ? -34.538 19.606  -11.234 1.00 52.07  ? 269  LEU A C   1 
ATOM   2007 O O   . LEU A 1 268 ? -34.268 20.813  -11.206 1.00 41.81  ? 269  LEU A O   1 
ATOM   2008 C CB  . LEU A 1 268 ? -33.365 18.066  -12.834 1.00 55.89  ? 269  LEU A CB  1 
ATOM   2009 C CG  . LEU A 1 268 ? -33.162 19.124  -13.924 1.00 56.43  ? 269  LEU A CG  1 
ATOM   2010 C CD1 . LEU A 1 268 ? -32.283 18.587  -15.028 1.00 58.76  ? 269  LEU A CD1 1 
ATOM   2011 C CD2 . LEU A 1 268 ? -34.482 19.587  -14.501 1.00 60.05  ? 269  LEU A CD2 1 
ATOM   2012 N N   . VAL A 1 269 ? -35.790 19.155  -11.139 1.00 43.78  ? 270  VAL A N   1 
ATOM   2013 C CA  . VAL A 1 269 ? -36.891 20.091  -10.938 1.00 46.64  ? 270  VAL A CA  1 
ATOM   2014 C C   . VAL A 1 269 ? -36.780 20.752  -9.567  1.00 47.08  ? 270  VAL A C   1 
ATOM   2015 O O   . VAL A 1 269 ? -37.085 21.940  -9.408  1.00 47.15  ? 270  VAL A O   1 
ATOM   2016 C CB  . VAL A 1 269 ? -38.241 19.375  -11.127 1.00 47.54  ? 270  VAL A CB  1 
ATOM   2017 C CG1 . VAL A 1 269 ? -39.391 20.329  -10.868 1.00 46.26  ? 270  VAL A CG1 1 
ATOM   2018 C CG2 . VAL A 1 269 ? -38.343 18.804  -12.531 1.00 43.86  ? 270  VAL A CG2 1 
ATOM   2019 N N   . ALA A 1 270 ? -36.317 20.010  -8.560  1.00 45.32  ? 271  ALA A N   1 
ATOM   2020 C CA  . ALA A 1 270 ? -36.122 20.623  -7.251  1.00 52.50  ? 271  ALA A CA  1 
ATOM   2021 C C   . ALA A 1 270 ? -35.103 21.758  -7.323  1.00 51.14  ? 271  ALA A C   1 
ATOM   2022 O O   . ALA A 1 270 ? -35.288 22.802  -6.691  1.00 49.55  ? 271  ALA A O   1 
ATOM   2023 C CB  . ALA A 1 270 ? -35.708 19.572  -6.222  1.00 51.18  ? 271  ALA A CB  1 
ATOM   2024 N N   . CYS A 1 271 ? -34.036 21.592  -8.110  1.00 49.20  ? 272  CYS A N   1 
ATOM   2025 C CA  . CYS A 1 271 ? -33.105 22.702  -8.306  1.00 50.66  ? 272  CYS A CA  1 
ATOM   2026 C C   . CYS A 1 271 ? -33.778 23.856  -9.042  1.00 47.32  ? 272  CYS A C   1 
ATOM   2027 O O   . CYS A 1 271 ? -33.633 25.025  -8.659  1.00 50.49  ? 272  CYS A O   1 
ATOM   2028 C CB  . CYS A 1 271 ? -31.862 22.237  -9.065  1.00 59.64  ? 272  CYS A CB  1 
ATOM   2029 S SG  . CYS A 1 271 ? -30.655 23.564  -9.310  1.00 74.25  ? 272  CYS A SG  1 
ATOM   2030 N N   . LEU A 1 272 ? -34.521 23.545  -10.109 1.00 43.82  ? 273  LEU A N   1 
ATOM   2031 C CA  . LEU A 1 272 ? -35.223 24.593  -10.842 1.00 44.91  ? 273  LEU A CA  1 
ATOM   2032 C C   . LEU A 1 272 ? -36.153 25.379  -9.928  1.00 46.19  ? 273  LEU A C   1 
ATOM   2033 O O   . LEU A 1 272 ? -36.295 26.598  -10.083 1.00 45.03  ? 273  LEU A O   1 
ATOM   2034 C CB  . LEU A 1 272 ? -36.003 23.986  -12.010 1.00 38.64  ? 273  LEU A CB  1 
ATOM   2035 C CG  . LEU A 1 272 ? -35.219 23.733  -13.301 1.00 44.23  ? 273  LEU A CG  1 
ATOM   2036 C CD1 . LEU A 1 272 ? -36.075 22.982  -14.305 1.00 39.80  ? 273  LEU A CD1 1 
ATOM   2037 C CD2 . LEU A 1 272 ? -34.725 25.036  -13.900 1.00 44.09  ? 273  LEU A CD2 1 
ATOM   2038 N N   . ARG A 1 273 ? -36.765 24.708  -8.950  1.00 44.20  ? 274  ARG A N   1 
ATOM   2039 C CA  . ARG A 1 273 ? -37.703 25.381  -8.063  1.00 48.35  ? 274  ARG A CA  1 
ATOM   2040 C C   . ARG A 1 273 ? -37.032 26.397  -7.151  1.00 48.95  ? 274  ARG A C   1 
ATOM   2041 O O   . ARG A 1 273 ? -37.701 27.331  -6.698  1.00 50.96  ? 274  ARG A O   1 
ATOM   2042 C CB  . ARG A 1 273 ? -38.455 24.361  -7.216  1.00 50.43  ? 274  ARG A CB  1 
ATOM   2043 C CG  . ARG A 1 273 ? -39.776 23.960  -7.821  1.00 49.93  ? 274  ARG A CG  1 
ATOM   2044 C CD  . ARG A 1 273 ? -40.301 22.696  -7.198  1.00 52.94  ? 274  ARG A CD  1 
ATOM   2045 N NE  . ARG A 1 273 ? -41.439 22.188  -7.947  1.00 55.33  ? 274  ARG A NE  1 
ATOM   2046 C CZ  . ARG A 1 273 ? -41.653 20.901  -8.191  1.00 58.77  ? 274  ARG A CZ  1 
ATOM   2047 N NH1 . ARG A 1 273 ? -40.800 19.990  -7.737  1.00 62.94  ? 274  ARG A NH1 1 
ATOM   2048 N NH2 . ARG A 1 273 ? -42.718 20.529  -8.889  1.00 45.82  ? 274  ARG A NH2 1 
ATOM   2049 N N   . THR A 1 274 ? -35.738 26.234  -6.857  1.00 48.75  ? 275  THR A N   1 
ATOM   2050 C CA  . THR A 1 274 ? -35.038 27.214  -6.032  1.00 49.96  ? 275  THR A CA  1 
ATOM   2051 C C   . THR A 1 274 ? -34.608 28.447  -6.816  1.00 53.20  ? 275  THR A C   1 
ATOM   2052 O O   . THR A 1 274 ? -34.101 29.399  -6.213  1.00 56.89  ? 275  THR A O   1 
ATOM   2053 C CB  . THR A 1 274 ? -33.803 26.593  -5.373  1.00 49.87  ? 275  THR A CB  1 
ATOM   2054 O OG1 . THR A 1 274 ? -32.767 26.446  -6.353  1.00 47.97  ? 275  THR A OG1 1 
ATOM   2055 C CG2 . THR A 1 274 ? -34.134 25.233  -4.748  1.00 48.32  ? 275  THR A CG2 1 
ATOM   2056 N N   . ARG A 1 275 ? -34.792 28.454  -8.131  1.00 44.20  ? 276  ARG A N   1 
ATOM   2057 C CA  . ARG A 1 275 ? -34.332 29.619  -8.871  1.00 44.00  ? 276  ARG A CA  1 
ATOM   2058 C C   . ARG A 1 275 ? -35.419 30.689  -8.919  1.00 46.41  ? 276  ARG A C   1 
ATOM   2059 O O   . ARG A 1 275 ? -36.602 30.368  -9.096  1.00 42.58  ? 276  ARG A O   1 
ATOM   2060 C CB  . ARG A 1 275 ? -33.930 29.226  -10.288 1.00 43.98  ? 276  ARG A CB  1 
ATOM   2061 C CG  . ARG A 1 275 ? -32.846 28.159  -10.325 1.00 50.06  ? 276  ARG A CG  1 
ATOM   2062 C CD  . ARG A 1 275 ? -31.480 28.807  -10.221 1.00 51.30  ? 276  ARG A CD  1 
ATOM   2063 N NE  . ARG A 1 275 ? -30.393 27.841  -10.105 1.00 60.21  ? 276  ARG A NE  1 
ATOM   2064 C CZ  . ARG A 1 275 ? -30.106 27.164  -8.999  1.00 66.83  ? 276  ARG A CZ  1 
ATOM   2065 N NH1 . ARG A 1 275 ? -30.827 27.347  -7.901  1.00 74.98  ? 276  ARG A NH1 1 
ATOM   2066 N NH2 . ARG A 1 275 ? -29.094 26.308  -8.989  1.00 64.13  ? 276  ARG A NH2 1 
ATOM   2067 N N   . PRO A 1 276 ? -35.037 31.956  -8.747  1.00 45.34  ? 277  PRO A N   1 
ATOM   2068 C CA  . PRO A 1 276 ? -36.020 33.040  -8.868  1.00 43.25  ? 277  PRO A CA  1 
ATOM   2069 C C   . PRO A 1 276 ? -36.708 32.996  -10.225 1.00 42.81  ? 277  PRO A C   1 
ATOM   2070 O O   . PRO A 1 276 ? -36.096 32.664  -11.242 1.00 39.23  ? 277  PRO A O   1 
ATOM   2071 C CB  . PRO A 1 276 ? -35.176 34.309  -8.697  1.00 38.15  ? 277  PRO A CB  1 
ATOM   2072 C CG  . PRO A 1 276 ? -33.974 33.865  -7.927  1.00 40.17  ? 277  PRO A CG  1 
ATOM   2073 C CD  . PRO A 1 276 ? -33.699 32.454  -8.386  1.00 39.26  ? 277  PRO A CD  1 
ATOM   2074 N N   . ALA A 1 277 ? -38.004 33.314  -10.221 1.00 38.22  ? 278  ALA A N   1 
ATOM   2075 C CA  . ALA A 1 277 ? -38.792 33.239  -11.446 1.00 40.40  ? 278  ALA A CA  1 
ATOM   2076 C C   . ALA A 1 277 ? -38.171 34.078  -12.554 1.00 43.21  ? 278  ALA A C   1 
ATOM   2077 O O   . ALA A 1 277 ? -38.074 33.628  -13.703 1.00 35.54  ? 278  ALA A O   1 
ATOM   2078 C CB  . ALA A 1 277 ? -40.228 33.688  -11.169 1.00 32.33  ? 278  ALA A CB  1 
ATOM   2079 N N   . GLN A 1 278 ? -37.724 35.295  -12.222 1.00 40.71  ? 279  GLN A N   1 
ATOM   2080 C CA  . GLN A 1 278 ? -37.139 36.174  -13.230 1.00 38.97  ? 279  GLN A CA  1 
ATOM   2081 C C   . GLN A 1 278 ? -35.882 35.573  -13.843 1.00 37.98  ? 279  GLN A C   1 
ATOM   2082 O O   . GLN A 1 278 ? -35.589 35.820  -15.018 1.00 39.14  ? 279  GLN A O   1 
ATOM   2083 C CB  . GLN A 1 278 ? -36.833 37.544  -12.618 1.00 35.45  ? 279  GLN A CB  1 
ATOM   2084 C CG  . GLN A 1 278 ? -36.525 38.614  -13.654 1.00 46.09  ? 279  GLN A CG  1 
ATOM   2085 C CD  . GLN A 1 278 ? -37.702 38.877  -14.581 1.00 52.53  ? 279  GLN A CD  1 
ATOM   2086 O OE1 . GLN A 1 278 ? -37.555 38.866  -15.806 1.00 52.63  ? 279  GLN A OE1 1 
ATOM   2087 N NE2 . GLN A 1 278 ? -38.876 39.113  -14.001 1.00 47.36  ? 279  GLN A NE2 1 
ATOM   2088 N N   . VAL A 1 279 ? -35.130 34.785  -13.069 1.00 37.87  ? 280  VAL A N   1 
ATOM   2089 C CA  . VAL A 1 279 ? -33.934 34.143  -13.606 1.00 35.42  ? 280  VAL A CA  1 
ATOM   2090 C C   . VAL A 1 279 ? -34.306 33.169  -14.719 1.00 42.65  ? 280  VAL A C   1 
ATOM   2091 O O   . VAL A 1 279 ? -33.667 33.142  -15.775 1.00 49.08  ? 280  VAL A O   1 
ATOM   2092 C CB  . VAL A 1 279 ? -33.140 33.452  -12.480 1.00 35.98  ? 280  VAL A CB  1 
ATOM   2093 C CG1 . VAL A 1 279 ? -32.047 32.564  -13.058 1.00 37.76  ? 280  VAL A CG1 1 
ATOM   2094 C CG2 . VAL A 1 279 ? -32.538 34.490  -11.532 1.00 37.73  ? 280  VAL A CG2 1 
ATOM   2095 N N   . LEU A 1 280 ? -35.357 32.369  -14.517 1.00 41.69  ? 281  LEU A N   1 
ATOM   2096 C CA  . LEU A 1 280 ? -35.778 31.453  -15.575 1.00 39.24  ? 281  LEU A CA  1 
ATOM   2097 C C   . LEU A 1 280 ? -36.195 32.219  -16.826 1.00 39.84  ? 281  LEU A C   1 
ATOM   2098 O O   . LEU A 1 280 ? -35.797 31.866  -17.945 1.00 35.61  ? 281  LEU A O   1 
ATOM   2099 C CB  . LEU A 1 280 ? -36.918 30.564  -15.085 1.00 39.28  ? 281  LEU A CB  1 
ATOM   2100 C CG  . LEU A 1 280 ? -36.668 29.683  -13.859 1.00 39.19  ? 281  LEU A CG  1 
ATOM   2101 C CD1 . LEU A 1 280 ? -37.868 28.779  -13.634 1.00 39.09  ? 281  LEU A CD1 1 
ATOM   2102 C CD2 . LEU A 1 280 ? -35.396 28.855  -14.009 1.00 31.55  ? 281  LEU A CD2 1 
ATOM   2103 N N   . VAL A 1 281 ? -36.968 33.295  -16.651 1.00 36.99  ? 282  VAL A N   1 
ATOM   2104 C CA  . VAL A 1 281 ? -37.439 34.085  -17.786 1.00 36.83  ? 282  VAL A CA  1 
ATOM   2105 C C   . VAL A 1 281 ? -36.267 34.644  -18.586 1.00 42.42  ? 282  VAL A C   1 
ATOM   2106 O O   . VAL A 1 281 ? -36.266 34.602  -19.823 1.00 40.00  ? 282  VAL A O   1 
ATOM   2107 C CB  . VAL A 1 281 ? -38.372 35.207  -17.297 1.00 35.11  ? 282  VAL A CB  1 
ATOM   2108 C CG1 . VAL A 1 281 ? -38.602 36.218  -18.399 1.00 31.01  ? 282  VAL A CG1 1 
ATOM   2109 C CG2 . VAL A 1 281 ? -39.685 34.626  -16.816 1.00 30.13  ? 282  VAL A CG2 1 
ATOM   2110 N N   . ASN A 1 282 ? -35.250 35.176  -17.900 1.00 39.19  ? 283  ASN A N   1 
ATOM   2111 C CA  . ASN A 1 282 ? -34.138 35.782  -18.625 1.00 42.15  ? 283  ASN A CA  1 
ATOM   2112 C C   . ASN A 1 282 ? -33.276 34.760  -19.353 1.00 47.02  ? 283  ASN A C   1 
ATOM   2113 O O   . ASN A 1 282 ? -32.484 35.152  -20.217 1.00 47.28  ? 283  ASN A O   1 
ATOM   2114 C CB  . ASN A 1 282 ? -33.255 36.606  -17.686 1.00 37.12  ? 283  ASN A CB  1 
ATOM   2115 C CG  . ASN A 1 282 ? -34.017 37.705  -16.962 1.00 41.85  ? 283  ASN A CG  1 
ATOM   2116 O OD1 . ASN A 1 282 ? -35.056 38.179  -17.423 1.00 47.99  ? 283  ASN A OD1 1 
ATOM   2117 N ND2 . ASN A 1 282 ? -33.489 38.121  -15.821 1.00 43.78  ? 283  ASN A ND2 1 
ATOM   2118 N N   . HIS A 1 283 ? -33.408 33.489  -19.048 1.00 38.71  ? 284  HIS A N   1 
ATOM   2119 C CA  . HIS A 1 283 ? -32.669 32.493  -19.760 1.00 34.66  ? 284  HIS A CA  1 
ATOM   2120 C C   . HIS A 1 283 ? -33.486 31.693  -20.761 1.00 38.88  ? 284  HIS A C   1 
ATOM   2121 O O   . HIS A 1 283 ? -32.947 30.913  -21.458 1.00 37.63  ? 284  HIS A O   1 
ATOM   2122 C CB  . HIS A 1 283 ? -32.053 31.519  -18.779 1.00 35.50  ? 284  HIS A CB  1 
ATOM   2123 C CG  . HIS A 1 283 ? -30.913 32.077  -17.999 1.00 47.82  ? 284  HIS A CG  1 
ATOM   2124 N ND1 . HIS A 1 283 ? -31.077 32.705  -16.794 1.00 52.31  ? 284  HIS A ND1 1 
ATOM   2125 C CD2 . HIS A 1 283 ? -29.593 32.085  -18.244 1.00 45.15  ? 284  HIS A CD2 1 
ATOM   2126 C CE1 . HIS A 1 283 ? -29.911 33.093  -16.340 1.00 51.16  ? 284  HIS A CE1 1 
ATOM   2127 N NE2 . HIS A 1 283 ? -28.993 32.724  -17.199 1.00 52.59  ? 284  HIS A NE2 1 
ATOM   2128 N N   . GLU A 1 284 ? -34.777 31.920  -20.849 1.00 39.96  ? 285  GLU A N   1 
ATOM   2129 C CA  . GLU A 1 284 ? -35.623 31.083  -21.695 1.00 47.68  ? 285  GLU A CA  1 
ATOM   2130 C C   . GLU A 1 284 ? -35.276 31.241  -23.170 1.00 49.00  ? 285  GLU A C   1 
ATOM   2131 O O   . GLU A 1 284 ? -35.468 30.307  -23.955 1.00 44.67  ? 285  GLU A O   1 
ATOM   2132 C CB  . GLU A 1 284 ? -37.100 31.400  -21.445 1.00 49.32  ? 285  GLU A CB  1 
ATOM   2133 C CG  . GLU A 1 284 ? -37.770 32.252  -22.516 1.00 59.23  ? 285  GLU A CG  1 
ATOM   2134 C CD  . GLU A 1 284 ? -39.263 32.438  -22.280 1.00 59.04  ? 285  GLU A CD  1 
ATOM   2135 O OE1 . GLU A 1 284 ? -39.835 33.396  -22.838 1.00 60.79  ? 285  GLU A OE1 1 
ATOM   2136 O OE2 . GLU A 1 284 ? -39.868 31.620  -21.555 1.00 54.70  ? 285  GLU A OE2 1 
ATOM   2137 N N   . TRP A 1 285 ? -34.734 32.395  -23.556 1.00 52.57  ? 286  TRP A N   1 
ATOM   2138 C CA  . TRP A 1 285 ? -34.455 32.678  -24.957 1.00 65.55  ? 286  TRP A CA  1 
ATOM   2139 C C   . TRP A 1 285 ? -33.266 31.878  -25.483 1.00 65.26  ? 286  TRP A C   1 
ATOM   2140 O O   . TRP A 1 285 ? -33.177 31.649  -26.695 1.00 68.79  ? 286  TRP A O   1 
ATOM   2141 C CB  . TRP A 1 285 ? -34.255 34.194  -25.098 1.00 86.76  ? 286  TRP A CB  1 
ATOM   2142 C CG  . TRP A 1 285 ? -33.486 34.713  -26.278 1.00 109.98 ? 286  TRP A CG  1 
ATOM   2143 C CD1 . TRP A 1 285 ? -32.397 35.539  -26.236 1.00 119.92 ? 286  TRP A CD1 1 
ATOM   2144 C CD2 . TRP A 1 285 ? -33.778 34.511  -27.670 1.00 117.73 ? 286  TRP A CD2 1 
ATOM   2145 N NE1 . TRP A 1 285 ? -31.975 35.835  -27.509 1.00 125.80 ? 286  TRP A NE1 1 
ATOM   2146 C CE2 . TRP A 1 285 ? -32.805 35.216  -28.407 1.00 123.29 ? 286  TRP A CE2 1 
ATOM   2147 C CE3 . TRP A 1 285 ? -34.756 33.790  -28.363 1.00 112.13 ? 286  TRP A CE3 1 
ATOM   2148 C CZ2 . TRP A 1 285 ? -32.781 35.219  -29.801 1.00 119.89 ? 286  TRP A CZ2 1 
ATOM   2149 C CZ3 . TRP A 1 285 ? -34.727 33.791  -29.745 1.00 108.98 ? 286  TRP A CZ3 1 
ATOM   2150 C CH2 . TRP A 1 285 ? -33.750 34.503  -30.448 1.00 113.26 ? 286  TRP A CH2 1 
ATOM   2151 N N   . HIS A 1 286 ? -32.388 31.398  -24.601 1.00 56.38  ? 287  HIS A N   1 
ATOM   2152 C CA  . HIS A 1 286 ? -31.174 30.692  -24.994 1.00 60.57  ? 287  HIS A CA  1 
ATOM   2153 C C   . HIS A 1 286 ? -31.395 29.200  -25.210 1.00 60.61  ? 287  HIS A C   1 
ATOM   2154 O O   . HIS A 1 286 ? -30.430 28.467  -25.446 1.00 70.10  ? 287  HIS A O   1 
ATOM   2155 C CB  . HIS A 1 286 ? -30.081 30.906  -23.943 1.00 68.32  ? 287  HIS A CB  1 
ATOM   2156 C CG  . HIS A 1 286 ? -29.674 32.338  -23.781 1.00 84.88  ? 287  HIS A CG  1 
ATOM   2157 N ND1 . HIS A 1 286 ? -30.516 33.391  -24.072 1.00 89.81  ? 287  HIS A ND1 1 
ATOM   2158 C CD2 . HIS A 1 286 ? -28.511 32.892  -23.365 1.00 91.57  ? 287  HIS A CD2 1 
ATOM   2159 C CE1 . HIS A 1 286 ? -29.891 34.531  -23.840 1.00 92.24  ? 287  HIS A CE1 1 
ATOM   2160 N NE2 . HIS A 1 286 ? -28.673 34.256  -23.410 1.00 92.84  ? 287  HIS A NE2 1 
ATOM   2161 N N   . VAL A 1 287 ? -32.643 28.743  -25.170 1.00 54.76  ? 288  VAL A N   1 
ATOM   2162 C CA  . VAL A 1 287 ? -32.940 27.317  -25.192 1.00 57.01  ? 288  VAL A CA  1 
ATOM   2163 C C   . VAL A 1 287 ? -33.181 26.767  -26.600 1.00 65.70  ? 288  VAL A C   1 
ATOM   2164 O O   . VAL A 1 287 ? -32.982 25.565  -26.831 1.00 78.25  ? 288  VAL A O   1 
ATOM   2165 C CB  . VAL A 1 287 ? -34.142 27.087  -24.252 1.00 54.17  ? 288  VAL A CB  1 
ATOM   2166 C CG1 . VAL A 1 287 ? -34.936 25.870  -24.628 1.00 49.20  ? 288  VAL A CG1 1 
ATOM   2167 C CG2 . VAL A 1 287 ? -33.666 26.983  -22.812 1.00 59.29  ? 288  VAL A CG2 1 
ATOM   2168 N N   . LEU A 1 288 ? -33.534 27.618  -27.560 1.00 63.01  ? 289  LEU A N   1 
ATOM   2169 C CA  . LEU A 1 288 ? -34.058 27.169  -28.844 1.00 66.62  ? 289  LEU A CA  1 
ATOM   2170 C C   . LEU A 1 288 ? -32.972 26.630  -29.772 1.00 84.53  ? 289  LEU A C   1 
ATOM   2171 O O   . LEU A 1 288 ? -31.845 27.129  -29.785 1.00 92.97  ? 289  LEU A O   1 
ATOM   2172 C CB  . LEU A 1 288 ? -34.777 28.306  -29.541 1.00 61.05  ? 289  LEU A CB  1 
ATOM   2173 C CG  . LEU A 1 288 ? -36.283 28.203  -29.413 1.00 71.90  ? 289  LEU A CG  1 
ATOM   2174 C CD1 . LEU A 1 288 ? -36.554 27.742  -28.040 1.00 81.43  ? 289  LEU A CD1 1 
ATOM   2175 C CD2 . LEU A 1 288 ? -36.893 29.554  -29.666 1.00 75.69  ? 289  LEU A CD2 1 
ATOM   2176 N N   . PRO A 1 289 ? -33.320 25.619  -30.556 1.00 92.33  ? 290  PRO A N   1 
ATOM   2177 C CA  . PRO A 1 289 ? -32.431 24.975  -31.508 1.00 97.29  ? 290  PRO A CA  1 
ATOM   2178 C C   . PRO A 1 289 ? -31.989 25.868  -32.651 1.00 103.31 ? 290  PRO A C   1 
ATOM   2179 O O   . PRO A 1 289 ? -30.840 25.840  -33.019 1.00 106.23 ? 290  PRO A O   1 
ATOM   2180 C CB  . PRO A 1 289 ? -33.276 23.820  -32.038 1.00 94.23  ? 290  PRO A CB  1 
ATOM   2181 C CG  . PRO A 1 289 ? -34.668 24.272  -31.909 1.00 89.37  ? 290  PRO A CG  1 
ATOM   2182 C CD  . PRO A 1 289 ? -34.700 25.136  -30.679 1.00 89.05  ? 290  PRO A CD  1 
ATOM   2183 N N   . GLN A 1 290 ? -32.876 26.666  -33.211 1.00 106.08 ? 291  GLN A N   1 
ATOM   2184 C CA  . GLN A 1 290 ? -32.447 27.493  -34.315 1.00 112.24 ? 291  GLN A CA  1 
ATOM   2185 C C   . GLN A 1 290 ? -32.875 28.927  -34.201 1.00 106.55 ? 291  GLN A C   1 
ATOM   2186 O O   . GLN A 1 290 ? -33.809 29.251  -33.493 1.00 94.17  ? 291  GLN A O   1 
ATOM   2187 C CB  . GLN A 1 290 ? -32.871 26.896  -35.660 1.00 118.96 ? 291  GLN A CB  1 
ATOM   2188 C CG  . GLN A 1 290 ? -34.149 27.443  -36.267 1.00 124.20 ? 291  GLN A CG  1 
ATOM   2189 C CD  . GLN A 1 290 ? -34.075 27.619  -37.786 1.00 123.80 ? 291  GLN A CD  1 
ATOM   2190 O OE1 . GLN A 1 290 ? -34.547 26.773  -38.555 1.00 124.66 ? 291  GLN A OE1 1 
ATOM   2191 N NE2 . GLN A 1 290 ? -33.485 28.730  -38.221 1.00 119.25 ? 291  GLN A NE2 1 
ATOM   2192 N N   . GLU A 1 291 ? -32.156 29.803  -34.881 1.00 114.43 ? 292  GLU A N   1 
ATOM   2193 C CA  . GLU A 1 291 ? -32.542 31.182  -34.866 1.00 117.96 ? 292  GLU A CA  1 
ATOM   2194 C C   . GLU A 1 291 ? -33.866 31.228  -35.569 1.00 116.10 ? 292  GLU A C   1 
ATOM   2195 O O   . GLU A 1 291 ? -34.051 30.668  -36.632 1.00 119.70 ? 292  GLU A O   1 
ATOM   2196 C CB  . GLU A 1 291 ? -31.551 32.062  -35.583 1.00 125.37 ? 292  GLU A CB  1 
ATOM   2197 C CG  . GLU A 1 291 ? -31.747 33.511  -35.212 1.00 128.03 ? 292  GLU A CG  1 
ATOM   2198 C CD  . GLU A 1 291 ? -32.153 33.670  -33.759 1.00 125.89 ? 292  GLU A CD  1 
ATOM   2199 O OE1 . GLU A 1 291 ? -33.302 33.332  -33.417 1.00 123.19 ? 292  GLU A OE1 1 
ATOM   2200 O OE2 . GLU A 1 291 ? -31.329 34.144  -32.955 1.00 126.03 ? 292  GLU A OE2 1 
ATOM   2201 N N   . SER A 1 292 ? -34.793 31.940  -34.978 1.00 107.09 ? 293  SER A N   1 
ATOM   2202 C CA  . SER A 1 292 ? -36.095 31.986  -35.535 1.00 94.00  ? 293  SER A CA  1 
ATOM   2203 C C   . SER A 1 292 ? -36.726 33.296  -35.291 1.00 89.99  ? 293  SER A C   1 
ATOM   2204 O O   . SER A 1 292 ? -36.338 34.033  -34.425 1.00 92.08  ? 293  SER A O   1 
ATOM   2205 C CB  . SER A 1 292 ? -36.925 30.929  -34.856 1.00 83.46  ? 293  SER A CB  1 
ATOM   2206 O OG  . SER A 1 292 ? -38.273 31.115  -35.137 1.00 83.27  ? 293  SER A OG  1 
ATOM   2207 N N   . VAL A 1 293 ? -37.686 33.608  -36.114 1.00 84.71  ? 294  VAL A N   1 
ATOM   2208 C CA  . VAL A 1 293 ? -38.447 34.797  -35.901 1.00 85.57  ? 294  VAL A CA  1 
ATOM   2209 C C   . VAL A 1 293 ? -39.654 34.430  -35.039 1.00 83.34  ? 294  VAL A C   1 
ATOM   2210 O O   . VAL A 1 293 ? -40.183 35.243  -34.330 1.00 79.38  ? 294  VAL A O   1 
ATOM   2211 C CB  . VAL A 1 293 ? -38.828 35.436  -37.240 1.00 85.16  ? 294  VAL A CB  1 
ATOM   2212 C CG1 . VAL A 1 293 ? -40.235 35.108  -37.651 1.00 77.20  ? 294  VAL A CG1 1 
ATOM   2213 C CG2 . VAL A 1 293 ? -38.638 36.921  -37.167 1.00 91.22  ? 294  VAL A CG2 1 
ATOM   2214 N N   . PHE A 1 294 ? -40.036 33.164  -35.067 1.00 82.47  ? 295  PHE A N   1 
ATOM   2215 C CA  . PHE A 1 294 ? -41.174 32.708  -34.361 1.00 78.57  ? 295  PHE A CA  1 
ATOM   2216 C C   . PHE A 1 294 ? -40.933 31.939  -33.152 1.00 94.02  ? 295  PHE A C   1 
ATOM   2217 O O   . PHE A 1 294 ? -41.100 32.456  -32.096 1.00 114.31 ? 295  PHE A O   1 
ATOM   2218 C CB  . PHE A 1 294 ? -41.890 31.693  -35.211 1.00 69.44  ? 295  PHE A CB  1 
ATOM   2219 C CG  . PHE A 1 294 ? -42.935 32.272  -36.048 1.00 66.96  ? 295  PHE A CG  1 
ATOM   2220 C CD1 . PHE A 1 294 ? -42.669 32.627  -37.307 1.00 64.06  ? 295  PHE A CD1 1 
ATOM   2221 C CD2 . PHE A 1 294 ? -44.170 32.491  -35.543 1.00 65.30  ? 295  PHE A CD2 1 
ATOM   2222 C CE1 . PHE A 1 294 ? -43.638 33.180  -38.071 1.00 73.07  ? 295  PHE A CE1 1 
ATOM   2223 C CE2 . PHE A 1 294 ? -45.139 33.046  -36.291 1.00 62.72  ? 295  PHE A CE2 1 
ATOM   2224 C CZ  . PHE A 1 294 ? -44.872 33.393  -37.561 1.00 70.56  ? 295  PHE A CZ  1 
ATOM   2225 N N   . ARG A 1 295 ? -40.310 30.801  -33.322 1.00 93.82  ? 296  ARG A N   1 
ATOM   2226 C CA  . ARG A 1 295 ? -40.326 29.813  -32.282 1.00 98.13  ? 296  ARG A CA  1 
ATOM   2227 C C   . ARG A 1 295 ? -40.044 30.263  -30.875 1.00 99.71  ? 296  ARG A C   1 
ATOM   2228 O O   . ARG A 1 295 ? -39.323 31.190  -30.602 1.00 110.24 ? 296  ARG A O   1 
ATOM   2229 C CB  . ARG A 1 295 ? -39.570 28.570  -32.712 1.00 100.50 ? 296  ARG A CB  1 
ATOM   2230 C CG  . ARG A 1 295 ? -39.992 28.097  -34.088 1.00 102.70 ? 296  ARG A CG  1 
ATOM   2231 C CD  . ARG A 1 295 ? -41.444 27.639  -34.232 1.00 100.77 ? 296  ARG A CD  1 
ATOM   2232 N NE  . ARG A 1 295 ? -41.654 26.841  -35.446 1.00 108.12 ? 296  ARG A NE  1 
ATOM   2233 C CZ  . ARG A 1 295 ? -42.227 27.256  -36.579 1.00 114.78 ? 296  ARG A CZ  1 
ATOM   2234 N NH1 . ARG A 1 295 ? -42.706 28.462  -36.725 1.00 108.35 ? 296  ARG A NH1 1 
ATOM   2235 N NH2 . ARG A 1 295 ? -42.319 26.430  -37.593 1.00 126.54 ? 296  ARG A NH2 1 
ATOM   2236 N N   . PHE A 1 296 ? -40.863 29.658  -30.032 1.00 80.84  ? 297  PHE A N   1 
ATOM   2237 C CA  . PHE A 1 296 ? -40.996 29.884  -28.639 1.00 54.62  ? 297  PHE A CA  1 
ATOM   2238 C C   . PHE A 1 296 ? -40.450 28.710  -27.887 1.00 46.82  ? 297  PHE A C   1 
ATOM   2239 O O   . PHE A 1 296 ? -40.643 27.612  -28.268 1.00 46.07  ? 297  PHE A O   1 
ATOM   2240 C CB  . PHE A 1 296 ? -42.461 30.002  -28.399 1.00 57.29  ? 297  PHE A CB  1 
ATOM   2241 C CG  . PHE A 1 296 ? -43.223 30.651  -29.512 1.00 45.62  ? 297  PHE A CG  1 
ATOM   2242 C CD1 . PHE A 1 296 ? -43.037 31.962  -29.831 1.00 38.25  ? 297  PHE A CD1 1 
ATOM   2243 C CD2 . PHE A 1 296 ? -44.146 29.953  -30.202 1.00 39.02  ? 297  PHE A CD2 1 
ATOM   2244 C CE1 . PHE A 1 296 ? -43.761 32.553  -30.806 1.00 33.10  ? 297  PHE A CE1 1 
ATOM   2245 C CE2 . PHE A 1 296 ? -44.864 30.541  -31.185 1.00 34.94  ? 297  PHE A CE2 1 
ATOM   2246 C CZ  . PHE A 1 296 ? -44.668 31.836  -31.489 1.00 37.18  ? 297  PHE A CZ  1 
ATOM   2247 N N   . SER A 1 297 ? -39.760 28.952  -26.805 1.00 43.93  ? 298  SER A N   1 
ATOM   2248 C CA  . SER A 1 297 ? -39.119 27.887  -26.114 1.00 41.50  ? 298  SER A CA  1 
ATOM   2249 C C   . SER A 1 297 ? -39.946 26.791  -25.484 1.00 36.49  ? 298  SER A C   1 
ATOM   2250 O O   . SER A 1 297 ? -39.587 25.669  -25.576 1.00 34.79  ? 298  SER A O   1 
ATOM   2251 C CB  . SER A 1 297 ? -38.203 28.485  -25.085 1.00 49.00  ? 298  SER A CB  1 
ATOM   2252 O OG  . SER A 1 297 ? -37.324 29.352  -25.713 1.00 52.98  ? 298  SER A OG  1 
ATOM   2253 N N   . PHE A 1 298 ? -41.040 27.122  -24.847 1.00 28.44  ? 299  PHE A N   1 
ATOM   2254 C CA  . PHE A 1 298 ? -41.852 26.132  -24.161 1.00 28.75  ? 299  PHE A CA  1 
ATOM   2255 C C   . PHE A 1 298 ? -43.281 26.250  -24.655 1.00 32.66  ? 299  PHE A C   1 
ATOM   2256 O O   . PHE A 1 298 ? -43.920 27.296  -24.489 1.00 33.94  ? 299  PHE A O   1 
ATOM   2257 C CB  . PHE A 1 298 ? -41.747 26.314  -22.646 1.00 30.11  ? 299  PHE A CB  1 
ATOM   2258 C CG  . PHE A 1 298 ? -40.333 26.225  -22.153 1.00 31.96  ? 299  PHE A CG  1 
ATOM   2259 C CD1 . PHE A 1 298 ? -39.615 27.368  -21.844 1.00 30.69  ? 299  PHE A CD1 1 
ATOM   2260 C CD2 . PHE A 1 298 ? -39.702 24.994  -22.054 1.00 27.45  ? 299  PHE A CD2 1 
ATOM   2261 C CE1 . PHE A 1 298 ? -38.301 27.283  -21.407 1.00 33.35  ? 299  PHE A CE1 1 
ATOM   2262 C CE2 . PHE A 1 298 ? -38.389 24.900  -21.621 1.00 32.80  ? 299  PHE A CE2 1 
ATOM   2263 C CZ  . PHE A 1 298 ? -37.687 26.047  -21.294 1.00 35.63  ? 299  PHE A CZ  1 
ATOM   2264 N N   . VAL A 1 299 ? -43.762 25.183  -25.284 1.00 30.59  ? 300  VAL A N   1 
ATOM   2265 C CA  . VAL A 1 299 ? -45.070 25.134  -25.927 1.00 32.50  ? 300  VAL A CA  1 
ATOM   2266 C C   . VAL A 1 299 ? -45.701 23.803  -25.538 1.00 32.31  ? 300  VAL A C   1 
ATOM   2267 O O   . VAL A 1 299 ? -45.028 22.965  -24.917 1.00 25.88  ? 300  VAL A O   1 
ATOM   2268 C CB  . VAL A 1 299 ? -44.942 25.283  -27.451 1.00 33.97  ? 300  VAL A CB  1 
ATOM   2269 C CG1 . VAL A 1 299 ? -44.309 26.617  -27.788 1.00 26.71  ? 300  VAL A CG1 1 
ATOM   2270 C CG2 . VAL A 1 299 ? -44.132 24.124  -28.036 1.00 27.05  ? 300  VAL A CG2 1 
ATOM   2271 N N   . PRO A 1 300 ? -46.973 23.566  -25.852 1.00 31.79  ? 301  PRO A N   1 
ATOM   2272 C CA  . PRO A 1 300 ? -47.563 22.263  -25.541 1.00 29.72  ? 301  PRO A CA  1 
ATOM   2273 C C   . PRO A 1 300 ? -46.774 21.098  -26.134 1.00 35.03  ? 301  PRO A C   1 
ATOM   2274 O O   . PRO A 1 300 ? -46.247 21.170  -27.248 1.00 32.68  ? 301  PRO A O   1 
ATOM   2275 C CB  . PRO A 1 300 ? -48.969 22.372  -26.134 1.00 28.91  ? 301  PRO A CB  1 
ATOM   2276 C CG  . PRO A 1 300 ? -49.299 23.823  -25.946 1.00 28.48  ? 301  PRO A CG  1 
ATOM   2277 C CD  . PRO A 1 300 ? -48.009 24.555  -26.210 1.00 26.99  ? 301  PRO A CD  1 
ATOM   2278 N N   . VAL A 1 301 ? -46.685 20.018  -25.360 1.00 35.93  ? 302  VAL A N   1 
ATOM   2279 C CA  . VAL A 1 301 ? -45.943 18.819  -25.730 1.00 35.13  ? 302  VAL A CA  1 
ATOM   2280 C C   . VAL A 1 301 ? -46.932 17.707  -26.051 1.00 34.75  ? 302  VAL A C   1 
ATOM   2281 O O   . VAL A 1 301 ? -47.923 17.513  -25.338 1.00 37.45  ? 302  VAL A O   1 
ATOM   2282 C CB  . VAL A 1 301 ? -44.967 18.392  -24.611 1.00 32.86  ? 302  VAL A CB  1 
ATOM   2283 C CG1 . VAL A 1 301 ? -45.693 18.212  -23.279 1.00 28.37  ? 302  VAL A CG1 1 
ATOM   2284 C CG2 . VAL A 1 301 ? -44.237 17.111  -25.000 1.00 33.78  ? 302  VAL A CG2 1 
ATOM   2285 N N   . VAL A 1 302 ? -46.671 16.990  -27.142 1.00 33.26  ? 303  VAL A N   1 
ATOM   2286 C CA  . VAL A 1 302 ? -47.474 15.836  -27.534 1.00 37.44  ? 303  VAL A CA  1 
ATOM   2287 C C   . VAL A 1 302 ? -46.861 14.626  -26.835 1.00 41.19  ? 303  VAL A C   1 
ATOM   2288 O O   . VAL A 1 302 ? -45.865 14.062  -27.295 1.00 39.30  ? 303  VAL A O   1 
ATOM   2289 C CB  . VAL A 1 302 ? -47.514 15.662  -29.055 1.00 38.21  ? 303  VAL A CB  1 
ATOM   2290 C CG1 . VAL A 1 302 ? -48.284 14.394  -29.443 1.00 35.74  ? 303  VAL A CG1 1 
ATOM   2291 C CG2 . VAL A 1 302 ? -48.125 16.894  -29.709 1.00 35.62  ? 303  VAL A CG2 1 
ATOM   2292 N N   . ASP A 1 303 ? -47.454 14.234  -25.708 1.00 40.13  ? 304  ASP A N   1 
ATOM   2293 C CA  . ASP A 1 303 ? -46.914 13.168  -24.872 1.00 47.77  ? 304  ASP A CA  1 
ATOM   2294 C C   . ASP A 1 303 ? -47.912 12.045  -24.629 1.00 49.65  ? 304  ASP A C   1 
ATOM   2295 O O   . ASP A 1 303 ? -47.698 11.227  -23.730 1.00 54.25  ? 304  ASP A O   1 
ATOM   2296 C CB  . ASP A 1 303 ? -46.441 13.735  -23.532 1.00 50.80  ? 304  ASP A CB  1 
ATOM   2297 C CG  . ASP A 1 303 ? -47.590 14.213  -22.659 1.00 55.13  ? 304  ASP A CG  1 
ATOM   2298 O OD1 . ASP A 1 303 ? -48.703 14.444  -23.183 1.00 52.34  ? 304  ASP A OD1 1 
ATOM   2299 O OD2 . ASP A 1 303 ? -47.371 14.370  -21.440 1.00 63.63  ? 304  ASP A OD2 1 
ATOM   2300 N N   . GLY A 1 304 ? -49.000 11.992  -25.393 1.00 44.90  ? 305  GLY A N   1 
ATOM   2301 C CA  . GLY A 1 304 ? -49.988 10.954  -25.230 1.00 45.93  ? 305  GLY A CA  1 
ATOM   2302 C C   . GLY A 1 304 ? -51.011 11.203  -24.147 1.00 50.34  ? 305  GLY A C   1 
ATOM   2303 O O   . GLY A 1 304 ? -51.965 10.422  -24.034 1.00 58.73  ? 305  GLY A O   1 
ATOM   2304 N N   . ASP A 1 305 ? -50.889 12.277  -23.381 1.00 39.85  ? 306  ASP A N   1 
ATOM   2305 C CA  . ASP A 1 305 ? -51.841 12.527  -22.319 1.00 45.30  ? 306  ASP A CA  1 
ATOM   2306 C C   . ASP A 1 305 ? -52.833 13.595  -22.691 1.00 43.17  ? 306  ASP A C   1 
ATOM   2307 O O   . ASP A 1 305 ? -53.881 13.275  -23.173 1.00 47.22  ? 306  ASP A O   1 
ATOM   2308 C CB  . ASP A 1 305 ? -51.091 12.929  -21.071 1.00 52.48  ? 306  ASP A CB  1 
ATOM   2309 C CG  . ASP A 1 305 ? -51.950 12.948  -19.854 1.00 58.59  ? 306  ASP A CG  1 
ATOM   2310 O OD1 . ASP A 1 305 ? -53.111 12.617  -19.951 1.00 61.96  ? 306  ASP A OD1 1 
ATOM   2311 O OD2 . ASP A 1 305 ? -51.451 13.259  -18.786 1.00 60.85  ? 306  ASP A OD2 1 
ATOM   2312 N N   . PHE A 1 306 ? -52.514 14.864  -22.503 1.00 35.78  ? 307  PHE A N   1 
ATOM   2313 C CA  . PHE A 1 306 ? -53.450 15.898  -22.940 1.00 40.41  ? 307  PHE A CA  1 
ATOM   2314 C C   . PHE A 1 306 ? -53.804 15.723  -24.413 1.00 41.97  ? 307  PHE A C   1 
ATOM   2315 O O   . PHE A 1 306 ? -54.978 15.813  -24.795 1.00 42.51  ? 307  PHE A O   1 
ATOM   2316 C CB  . PHE A 1 306 ? -52.869 17.289  -22.684 1.00 31.41  ? 307  PHE A CB  1 
ATOM   2317 C CG  . PHE A 1 306 ? -53.892 18.392  -22.742 1.00 31.69  ? 307  PHE A CG  1 
ATOM   2318 C CD1 . PHE A 1 306 ? -54.403 18.822  -23.960 1.00 37.60  ? 307  PHE A CD1 1 
ATOM   2319 C CD2 . PHE A 1 306 ? -54.342 19.001  -21.581 1.00 33.16  ? 307  PHE A CD2 1 
ATOM   2320 C CE1 . PHE A 1 306 ? -55.348 19.831  -24.018 1.00 30.75  ? 307  PHE A CE1 1 
ATOM   2321 C CE2 . PHE A 1 306 ? -55.289 20.017  -21.630 1.00 34.23  ? 307  PHE A CE2 1 
ATOM   2322 C CZ  . PHE A 1 306 ? -55.792 20.431  -22.854 1.00 36.74  ? 307  PHE A CZ  1 
ATOM   2323 N N   . LEU A 1 307 ? -52.806 15.454  -25.248 1.00 35.96  ? 308  LEU A N   1 
ATOM   2324 C CA  . LEU A 1 307 ? -53.011 15.136  -26.657 1.00 39.82  ? 308  LEU A CA  1 
ATOM   2325 C C   . LEU A 1 307 ? -52.459 13.741  -26.925 1.00 40.62  ? 308  LEU A C   1 
ATOM   2326 O O   . LEU A 1 307 ? -51.249 13.509  -26.814 1.00 40.20  ? 308  LEU A O   1 
ATOM   2327 C CB  . LEU A 1 307 ? -52.351 16.185  -27.547 1.00 36.06  ? 308  LEU A CB  1 
ATOM   2328 C CG  . LEU A 1 307 ? -52.803 17.612  -27.240 1.00 42.18  ? 308  LEU A CG  1 
ATOM   2329 C CD1 . LEU A 1 307 ? -51.791 18.639  -27.723 1.00 37.28  ? 308  LEU A CD1 1 
ATOM   2330 C CD2 . LEU A 1 307 ? -54.195 17.871  -27.820 1.00 39.60  ? 308  LEU A CD2 1 
ATOM   2331 N N   . SER A 1 308 ? -53.352 12.813  -27.271 1.00 39.98  ? 309  SER A N   1 
ATOM   2332 C CA  . SER A 1 308 ? -52.958 11.425  -27.479 1.00 47.06  ? 309  SER A CA  1 
ATOM   2333 C C   . SER A 1 308 ? -52.127 11.236  -28.742 1.00 51.70  ? 309  SER A C   1 
ATOM   2334 O O   . SER A 1 308 ? -51.467 10.202  -28.888 1.00 59.52  ? 309  SER A O   1 
ATOM   2335 C CB  . SER A 1 308 ? -54.202 10.538  -27.536 1.00 51.65  ? 309  SER A CB  1 
ATOM   2336 O OG  . SER A 1 308 ? -55.008 10.874  -28.653 1.00 56.82  ? 309  SER A OG  1 
ATOM   2337 N N   . ASP A 1 309 ? -52.150 12.204  -29.652 1.00 51.84  ? 310  ASP A N   1 
ATOM   2338 C CA  . ASP A 1 309 ? -51.371 12.159  -30.880 1.00 52.85  ? 310  ASP A CA  1 
ATOM   2339 C C   . ASP A 1 309 ? -51.116 13.597  -31.311 1.00 48.00  ? 310  ASP A C   1 
ATOM   2340 O O   . ASP A 1 309 ? -51.532 14.546  -30.639 1.00 42.94  ? 310  ASP A O   1 
ATOM   2341 C CB  . ASP A 1 309 ? -52.100 11.355  -31.965 1.00 54.75  ? 310  ASP A CB  1 
ATOM   2342 C CG  . ASP A 1 309 ? -51.157 10.788  -33.012 1.00 62.65  ? 310  ASP A CG  1 
ATOM   2343 O OD1 . ASP A 1 309 ? -51.512 9.766   -33.632 1.00 67.87  ? 310  ASP A OD1 1 
ATOM   2344 O OD2 . ASP A 1 309 ? -50.067 11.360  -33.219 1.00 65.40  ? 310  ASP A OD2 1 
ATOM   2345 N N   . THR A 1 310 ? -50.510 13.768  -32.454 1.00 43.88  ? 311  THR A N   1 
ATOM   2346 C CA  . THR A 1 310 ? -50.296 15.099  -32.940 1.00 44.98  ? 311  THR A CA  1 
ATOM   2347 C C   . THR A 1 310 ? -51.633 15.668  -33.285 1.00 42.98  ? 311  THR A C   1 
ATOM   2348 O O   . THR A 1 310 ? -52.567 14.976  -33.543 1.00 51.44  ? 311  THR A O   1 
ATOM   2349 C CB  . THR A 1 310 ? -49.398 15.144  -34.181 1.00 44.93  ? 311  THR A CB  1 
ATOM   2350 O OG1 . THR A 1 310 ? -50.028 14.466  -35.244 1.00 48.49  ? 311  THR A OG1 1 
ATOM   2351 C CG2 . THR A 1 310 ? -48.119 14.480  -33.916 1.00 39.90  ? 311  THR A CG2 1 
ATOM   2352 N N   . PRO A 1 311 ? -51.737 16.958  -33.248 1.00 38.01  ? 312  PRO A N   1 
ATOM   2353 C CA  . PRO A 1 311 ? -52.990 17.580  -33.587 1.00 42.26  ? 312  PRO A CA  1 
ATOM   2354 C C   . PRO A 1 311 ? -53.377 17.269  -35.007 1.00 54.77  ? 312  PRO A C   1 
ATOM   2355 O O   . PRO A 1 311 ? -54.517 17.154  -35.294 1.00 55.60  ? 312  PRO A O   1 
ATOM   2356 C CB  . PRO A 1 311 ? -52.683 19.047  -33.422 1.00 36.21  ? 312  PRO A CB  1 
ATOM   2357 C CG  . PRO A 1 311 ? -51.626 19.072  -32.416 1.00 36.67  ? 312  PRO A CG  1 
ATOM   2358 C CD  . PRO A 1 311 ? -50.789 17.899  -32.677 1.00 38.22  ? 312  PRO A CD  1 
ATOM   2359 N N   . GLU A 1 312 ? -52.418 17.197  -35.891 1.00 83.01  ? 313  GLU A N   1 
ATOM   2360 C CA  . GLU A 1 312 ? -52.701 16.917  -37.269 1.00 69.16  ? 313  GLU A CA  1 
ATOM   2361 C C   . GLU A 1 312 ? -53.355 15.549  -37.405 1.00 59.72  ? 313  GLU A C   1 
ATOM   2362 O O   . GLU A 1 312 ? -54.319 15.382  -38.101 1.00 49.65  ? 313  GLU A O   1 
ATOM   2363 C CB  . GLU A 1 312 ? -51.392 16.960  -38.032 1.00 74.44  ? 313  GLU A CB  1 
ATOM   2364 C CG  . GLU A 1 312 ? -51.422 17.696  -39.345 1.00 100.10 ? 313  GLU A CG  1 
ATOM   2365 C CD  . GLU A 1 312 ? -50.715 19.050  -39.322 1.00 123.90 ? 313  GLU A CD  1 
ATOM   2366 O OE1 . GLU A 1 312 ? -49.812 19.262  -38.477 1.00 131.87 ? 313  GLU A OE1 1 
ATOM   2367 O OE2 . GLU A 1 312 ? -51.054 19.904  -40.175 1.00 132.66 ? 313  GLU A OE2 1 
ATOM   2368 N N   . ALA A 1 313 ? -52.821 14.573  -36.710 1.00 55.10  ? 314  ALA A N   1 
ATOM   2369 C CA  . ALA A 1 313 ? -53.383 13.268  -36.721 1.00 50.67  ? 314  ALA A CA  1 
ATOM   2370 C C   . ALA A 1 313 ? -54.737 13.245  -36.083 1.00 48.78  ? 314  ALA A C   1 
ATOM   2371 O O   . ALA A 1 313 ? -55.627 12.592  -36.547 1.00 52.73  ? 314  ALA A O   1 
ATOM   2372 C CB  . ALA A 1 313 ? -52.470 12.337  -35.992 1.00 49.40  ? 314  ALA A CB  1 
ATOM   2373 N N   . LEU A 1 314 ? -54.872 13.935  -34.974 1.00 41.42  ? 315  LEU A N   1 
ATOM   2374 C CA  . LEU A 1 314 ? -56.159 13.991  -34.290 1.00 48.38  ? 315  LEU A CA  1 
ATOM   2375 C C   . LEU A 1 314 ? -57.200 14.712  -35.134 1.00 47.78  ? 315  LEU A C   1 
ATOM   2376 O O   . LEU A 1 314 ? -58.368 14.310  -35.163 1.00 43.64  ? 315  LEU A O   1 
ATOM   2377 C CB  . LEU A 1 314 ? -56.006 14.666  -32.927 1.00 40.59  ? 315  LEU A CB  1 
ATOM   2378 C CG  . LEU A 1 314 ? -55.217 13.842  -31.913 1.00 47.48  ? 315  LEU A CG  1 
ATOM   2379 C CD1 . LEU A 1 314 ? -54.842 14.684  -30.701 1.00 41.02  ? 315  LEU A CD1 1 
ATOM   2380 C CD2 . LEU A 1 314 ? -56.018 12.612  -31.505 1.00 49.70  ? 315  LEU A CD2 1 
ATOM   2381 N N   . ILE A 1 315 ? -56.798 15.777  -35.829 1.00 39.85  ? 316  ILE A N   1 
ATOM   2382 C CA  . ILE A 1 315 ? -57.712 16.455  -36.744 1.00 46.44  ? 316  ILE A CA  1 
ATOM   2383 C C   . ILE A 1 315 ? -58.123 15.516  -37.875 1.00 52.74  ? 316  ILE A C   1 
ATOM   2384 O O   . ILE A 1 315 ? -59.316 15.327  -38.143 1.00 51.52  ? 316  ILE A O   1 
ATOM   2385 C CB  . ILE A 1 315 ? -57.068 17.746  -37.280 1.00 42.56  ? 316  ILE A CB  1 
ATOM   2386 C CG1 . ILE A 1 315 ? -57.040 18.820  -36.189 1.00 43.01  ? 316  ILE A CG1 1 
ATOM   2387 C CG2 . ILE A 1 315 ? -57.820 18.259  -38.496 1.00 41.40  ? 316  ILE A CG2 1 
ATOM   2388 C CD1 . ILE A 1 315 ? -56.151 20.015  -36.519 1.00 38.98  ? 316  ILE A CD1 1 
ATOM   2389 N N   . ASN A 1 316 ? -57.139 14.892  -38.536 1.00 55.72  ? 317  ASN A N   1 
ATOM   2390 C CA  . ASN A 1 316 ? -57.425 14.052  -39.700 1.00 57.20  ? 317  ASN A CA  1 
ATOM   2391 C C   . ASN A 1 316 ? -58.311 12.864  -39.348 1.00 61.32  ? 317  ASN A C   1 
ATOM   2392 O O   . ASN A 1 316 ? -59.114 12.424  -40.179 1.00 66.67  ? 317  ASN A O   1 
ATOM   2393 C CB  . ASN A 1 316 ? -56.125 13.550  -40.335 1.00 49.11  ? 317  ASN A CB  1 
ATOM   2394 C CG  . ASN A 1 316 ? -55.322 14.661  -40.992 1.00 57.54  ? 317  ASN A CG  1 
ATOM   2395 O OD1 . ASN A 1 316 ? -55.843 15.743  -41.272 1.00 61.65  ? 317  ASN A OD1 1 
ATOM   2396 N ND2 . ASN A 1 316 ? -54.046 14.394  -41.245 1.00 58.95  ? 317  ASN A ND2 1 
ATOM   2397 N N   . ALA A 1 317 ? -58.190 12.334  -38.135 1.00 59.00  ? 318  ALA A N   1 
ATOM   2398 C CA  . ALA A 1 317 ? -58.913 11.133  -37.746 1.00 57.15  ? 318  ALA A CA  1 
ATOM   2399 C C   . ALA A 1 317 ? -60.137 11.428  -36.893 1.00 61.16  ? 318  ALA A C   1 
ATOM   2400 O O   . ALA A 1 317 ? -60.744 10.497  -36.356 1.00 66.51  ? 318  ALA A O   1 
ATOM   2401 C CB  . ALA A 1 317 ? -57.980 10.177  -37.003 1.00 59.26  ? 318  ALA A CB  1 
ATOM   2402 N N   . GLY A 1 318 ? -60.519 12.691  -36.761 1.00 59.75  ? 319  GLY A N   1 
ATOM   2403 C CA  . GLY A 1 318 ? -61.575 13.061  -35.844 1.00 60.11  ? 319  GLY A CA  1 
ATOM   2404 C C   . GLY A 1 318 ? -62.963 13.028  -36.459 1.00 59.27  ? 319  GLY A C   1 
ATOM   2405 O O   . GLY A 1 318 ? -63.149 13.270  -37.648 1.00 61.92  ? 319  GLY A O   1 
ATOM   2406 N N   . ASP A 1 319 ? -63.940 12.715  -35.614 1.00 56.26  ? 320  ASP A N   1 
ATOM   2407 C CA  . ASP A 1 319 ? -65.357 12.807  -35.951 1.00 58.95  ? 320  ASP A CA  1 
ATOM   2408 C C   . ASP A 1 319 ? -65.888 14.072  -35.288 1.00 52.68  ? 320  ASP A C   1 
ATOM   2409 O O   . ASP A 1 319 ? -65.950 14.156  -34.057 1.00 51.96  ? 320  ASP A O   1 
ATOM   2410 C CB  . ASP A 1 319 ? -66.110 11.565  -35.472 1.00 64.84  ? 320  ASP A CB  1 
ATOM   2411 C CG  . ASP A 1 319 ? -67.579 11.555  -35.886 1.00 71.84  ? 320  ASP A CG  1 
ATOM   2412 O OD1 . ASP A 1 319 ? -68.195 12.633  -36.025 1.00 71.13  ? 320  ASP A OD1 1 
ATOM   2413 O OD2 . ASP A 1 319 ? -68.129 10.446  -36.061 1.00 79.79  ? 320  ASP A OD2 1 
ATOM   2414 N N   . PHE A 1 320 ? -66.280 15.052  -36.099 1.00 46.10  ? 321  PHE A N   1 
ATOM   2415 C CA  . PHE A 1 320 ? -66.645 16.361  -35.576 1.00 48.51  ? 321  PHE A CA  1 
ATOM   2416 C C   . PHE A 1 320 ? -68.119 16.695  -35.785 1.00 49.11  ? 321  PHE A C   1 
ATOM   2417 O O   . PHE A 1 320 ? -68.486 17.874  -35.801 1.00 48.59  ? 321  PHE A O   1 
ATOM   2418 C CB  . PHE A 1 320 ? -65.748 17.432  -36.193 1.00 45.66  ? 321  PHE A CB  1 
ATOM   2419 C CG  . PHE A 1 320 ? -64.285 17.223  -35.910 1.00 48.02  ? 321  PHE A CG  1 
ATOM   2420 C CD1 . PHE A 1 320 ? -63.755 17.535  -34.669 1.00 45.39  ? 321  PHE A CD1 1 
ATOM   2421 C CD2 . PHE A 1 320 ? -63.443 16.699  -36.880 1.00 47.43  ? 321  PHE A CD2 1 
ATOM   2422 C CE1 . PHE A 1 320 ? -62.407 17.341  -34.405 1.00 46.52  ? 321  PHE A CE1 1 
ATOM   2423 C CE2 . PHE A 1 320 ? -62.093 16.505  -36.621 1.00 43.31  ? 321  PHE A CE2 1 
ATOM   2424 C CZ  . PHE A 1 320 ? -61.577 16.825  -35.382 1.00 43.56  ? 321  PHE A CZ  1 
ATOM   2425 N N   . HIS A 1 321 ? -68.973 15.683  -35.925 1.00 50.68  ? 322  HIS A N   1 
ATOM   2426 C CA  . HIS A 1 321 ? -70.406 15.925  -36.015 1.00 56.40  ? 322  HIS A CA  1 
ATOM   2427 C C   . HIS A 1 321 ? -70.928 16.534  -34.719 1.00 60.71  ? 322  HIS A C   1 
ATOM   2428 O O   . HIS A 1 321 ? -70.566 16.106  -33.620 1.00 65.60  ? 322  HIS A O   1 
ATOM   2429 C CB  . HIS A 1 321 ? -71.149 14.622  -36.316 1.00 60.51  ? 322  HIS A CB  1 
ATOM   2430 C CG  . HIS A 1 321 ? -71.071 14.201  -37.750 1.00 65.27  ? 322  HIS A CG  1 
ATOM   2431 N ND1 . HIS A 1 321 ? -70.150 13.282  -38.208 1.00 67.52  ? 322  HIS A ND1 1 
ATOM   2432 C CD2 . HIS A 1 321 ? -71.796 14.577  -38.830 1.00 66.50  ? 322  HIS A CD2 1 
ATOM   2433 C CE1 . HIS A 1 321 ? -70.313 13.108  -39.507 1.00 68.45  ? 322  HIS A CE1 1 
ATOM   2434 N NE2 . HIS A 1 321 ? -71.306 13.881  -39.909 1.00 68.29  ? 322  HIS A NE2 1 
ATOM   2435 N N   . GLY A 1 322 ? -71.789 17.538  -34.855 1.00 58.04  ? 323  GLY A N   1 
ATOM   2436 C CA  . GLY A 1 322 ? -72.326 18.246  -33.712 1.00 58.61  ? 323  GLY A CA  1 
ATOM   2437 C C   . GLY A 1 322 ? -71.528 19.452  -33.274 1.00 59.49  ? 323  GLY A C   1 
ATOM   2438 O O   . GLY A 1 322 ? -71.783 19.983  -32.185 1.00 59.71  ? 323  GLY A O   1 
ATOM   2439 N N   . LEU A 1 323 ? -70.574 19.904  -34.082 1.00 56.29  ? 324  LEU A N   1 
ATOM   2440 C CA  . LEU A 1 323 ? -69.692 21.001  -33.724 1.00 49.50  ? 324  LEU A CA  1 
ATOM   2441 C C   . LEU A 1 323 ? -69.804 22.117  -34.752 1.00 48.23  ? 324  LEU A C   1 
ATOM   2442 O O   . LEU A 1 323 ? -69.845 21.863  -35.961 1.00 50.12  ? 324  LEU A O   1 
ATOM   2443 C CB  . LEU A 1 323 ? -68.237 20.526  -33.622 1.00 44.86  ? 324  LEU A CB  1 
ATOM   2444 C CG  . LEU A 1 323 ? -67.151 21.592  -33.447 1.00 40.19  ? 324  LEU A CG  1 
ATOM   2445 C CD1 . LEU A 1 323 ? -67.234 22.233  -32.073 1.00 36.41  ? 324  LEU A CD1 1 
ATOM   2446 C CD2 . LEU A 1 323 ? -65.766 20.991  -33.675 1.00 36.96  ? 324  LEU A CD2 1 
ATOM   2447 N N   . GLN A 1 324 ? -69.866 23.349  -34.260 1.00 41.76  ? 325  GLN A N   1 
ATOM   2448 C CA  . GLN A 1 324 ? -69.752 24.544  -35.084 1.00 35.97  ? 325  GLN A CA  1 
ATOM   2449 C C   . GLN A 1 324 ? -68.457 25.251  -34.708 1.00 36.53  ? 325  GLN A C   1 
ATOM   2450 O O   . GLN A 1 324 ? -68.166 25.419  -33.520 1.00 42.35  ? 325  GLN A O   1 
ATOM   2451 C CB  . GLN A 1 324 ? -70.949 25.476  -34.877 1.00 44.79  ? 325  GLN A CB  1 
ATOM   2452 C CG  . GLN A 1 324 ? -72.309 24.822  -35.097 1.00 50.65  ? 325  GLN A CG  1 
ATOM   2453 C CD  . GLN A 1 324 ? -72.905 24.270  -33.808 1.00 60.88  ? 325  GLN A CD  1 
ATOM   2454 O OE1 . GLN A 1 324 ? -73.281 25.021  -32.910 1.00 65.92  ? 325  GLN A OE1 1 
ATOM   2455 N NE2 . GLN A 1 324 ? -72.997 22.948  -33.719 1.00 66.23  ? 325  GLN A NE2 1 
ATOM   2456 N N   . VAL A 1 325 ? -67.660 25.628  -35.709 1.00 35.21  ? 326  VAL A N   1 
ATOM   2457 C CA  . VAL A 1 325 ? -66.477 26.438  -35.460 1.00 36.20  ? 326  VAL A CA  1 
ATOM   2458 C C   . VAL A 1 325 ? -66.455 27.603  -36.435 1.00 37.79  ? 326  VAL A C   1 
ATOM   2459 O O   . VAL A 1 325 ? -66.974 27.531  -37.554 1.00 33.90  ? 326  VAL A O   1 
ATOM   2460 C CB  . VAL A 1 325 ? -65.139 25.654  -35.535 1.00 34.22  ? 326  VAL A CB  1 
ATOM   2461 C CG1 . VAL A 1 325 ? -65.221 24.357  -34.764 1.00 42.36  ? 326  VAL A CG1 1 
ATOM   2462 C CG2 . VAL A 1 325 ? -64.713 25.417  -36.959 1.00 43.55  ? 326  VAL A CG2 1 
ATOM   2463 N N   . LEU A 1 326 ? -65.859 28.694  -35.972 1.00 36.36  ? 327  LEU A N   1 
ATOM   2464 C CA  . LEU A 1 326 ? -65.655 29.918  -36.728 1.00 30.57  ? 327  LEU A CA  1 
ATOM   2465 C C   . LEU A 1 326 ? -64.156 30.175  -36.714 1.00 32.92  ? 327  LEU A C   1 
ATOM   2466 O O   . LEU A 1 326 ? -63.539 30.191  -35.641 1.00 36.10  ? 327  LEU A O   1 
ATOM   2467 C CB  . LEU A 1 326 ? -66.426 31.074  -36.075 1.00 35.04  ? 327  LEU A CB  1 
ATOM   2468 C CG  . LEU A 1 326 ? -66.180 32.518  -36.502 1.00 39.41  ? 327  LEU A CG  1 
ATOM   2469 C CD1 . LEU A 1 326 ? -66.618 32.714  -37.917 1.00 39.62  ? 327  LEU A CD1 1 
ATOM   2470 C CD2 . LEU A 1 326 ? -66.898 33.490  -35.580 1.00 46.68  ? 327  LEU A CD2 1 
ATOM   2471 N N   . VAL A 1 327 ? -63.557 30.307  -37.896 1.00 28.19  ? 328  VAL A N   1 
ATOM   2472 C CA  . VAL A 1 327 ? -62.113 30.469  -38.015 1.00 33.66  ? 328  VAL A CA  1 
ATOM   2473 C C   . VAL A 1 327 ? -61.820 31.559  -39.034 1.00 34.70  ? 328  VAL A C   1 
ATOM   2474 O O   . VAL A 1 327 ? -62.633 31.862  -39.910 1.00 34.98  ? 328  VAL A O   1 
ATOM   2475 C CB  . VAL A 1 327 ? -61.392 29.159  -38.425 1.00 31.23  ? 328  VAL A CB  1 
ATOM   2476 C CG1 . VAL A 1 327 ? -61.726 28.026  -37.478 1.00 25.96  ? 328  VAL A CG1 1 
ATOM   2477 C CG2 . VAL A 1 327 ? -61.765 28.776  -39.841 1.00 35.69  ? 328  VAL A CG2 1 
ATOM   2478 N N   . GLY A 1 328 ? -60.632 32.143  -38.919 1.00 28.87  ? 329  GLY A N   1 
ATOM   2479 C CA  . GLY A 1 328 ? -60.249 33.188  -39.846 1.00 26.49  ? 329  GLY A CA  1 
ATOM   2480 C C   . GLY A 1 328 ? -58.855 33.682  -39.551 1.00 29.96  ? 329  GLY A C   1 
ATOM   2481 O O   . GLY A 1 328 ? -58.197 33.247  -38.600 1.00 28.28  ? 329  GLY A O   1 
ATOM   2482 N N   . VAL A 1 329 ? -58.409 34.601  -40.405 1.00 28.96  ? 330  VAL A N   1 
ATOM   2483 C CA  . VAL A 1 329 ? -57.082 35.193  -40.337 1.00 29.46  ? 330  VAL A CA  1 
ATOM   2484 C C   . VAL A 1 329 ? -57.215 36.664  -40.711 1.00 30.25  ? 330  VAL A C   1 
ATOM   2485 O O   . VAL A 1 329 ? -58.241 37.104  -41.237 1.00 32.79  ? 330  VAL A O   1 
ATOM   2486 C CB  . VAL A 1 329 ? -56.083 34.486  -41.282 1.00 28.57  ? 330  VAL A CB  1 
ATOM   2487 C CG1 . VAL A 1 329 ? -55.886 33.031  -40.880 1.00 25.05  ? 330  VAL A CG1 1 
ATOM   2488 C CG2 . VAL A 1 329 ? -56.569 34.570  -42.722 1.00 21.01  ? 330  VAL A CG2 1 
ATOM   2489 N N   . VAL A 1 330 ? -56.162 37.430  -40.433 1.00 22.47  ? 331  VAL A N   1 
ATOM   2490 C CA  . VAL A 1 330 ? -56.078 38.795  -40.936 1.00 25.72  ? 331  VAL A CA  1 
ATOM   2491 C C   . VAL A 1 330 ? -55.454 38.757  -42.323 1.00 34.24  ? 331  VAL A C   1 
ATOM   2492 O O   . VAL A 1 330 ? -54.905 37.730  -42.740 1.00 30.58  ? 331  VAL A O   1 
ATOM   2493 C CB  . VAL A 1 330 ? -55.268 39.701  -39.999 1.00 27.72  ? 331  VAL A CB  1 
ATOM   2494 C CG1 . VAL A 1 330 ? -55.895 39.714  -38.612 1.00 28.42  ? 331  VAL A CG1 1 
ATOM   2495 C CG2 . VAL A 1 330 ? -53.812 39.248  -39.965 1.00 22.78  ? 331  VAL A CG2 1 
ATOM   2496 N N   . LYS A 1 331 ? -55.553 39.833  -43.052 1.00 35.25  ? 332  LYS A N   1 
ATOM   2497 C CA  . LYS A 1 331 ? -55.051 39.917  -44.395 1.00 36.53  ? 332  LYS A CA  1 
ATOM   2498 C C   . LYS A 1 331 ? -53.550 39.753  -44.559 1.00 38.31  ? 332  LYS A C   1 
ATOM   2499 O O   . LYS A 1 331 ? -53.114 39.232  -45.528 1.00 35.55  ? 332  LYS A O   1 
ATOM   2500 C CB  . LYS A 1 331 ? -55.560 41.194  -45.066 1.00 40.83  ? 332  LYS A CB  1 
ATOM   2501 C CG  . LYS A 1 331 ? -55.184 41.372  -46.520 1.00 48.57  ? 332  LYS A CG  1 
ATOM   2502 C CD  . LYS A 1 331 ? -55.738 42.658  -47.116 1.00 60.62  ? 332  LYS A CD  1 
ATOM   2503 C CE  . LYS A 1 331 ? -54.860 43.234  -48.208 1.00 67.63  ? 332  LYS A CE  1 
ATOM   2504 N NZ  . LYS A 1 331 ? -53.678 44.020  -47.741 1.00 70.10  ? 332  LYS A NZ  1 
ATOM   2505 N N   . ASP A 1 332 ? -52.778 40.188  -43.592 1.00 37.96  ? 333  ASP A N   1 
ATOM   2506 C CA  . ASP A 1 332 ? -51.314 40.169  -43.706 1.00 32.51  ? 333  ASP A CA  1 
ATOM   2507 C C   . ASP A 1 332 ? -50.713 39.520  -42.454 1.00 35.38  ? 333  ASP A C   1 
ATOM   2508 O O   . ASP A 1 332 ? -50.091 40.177  -41.617 1.00 34.82  ? 333  ASP A O   1 
ATOM   2509 C CB  . ASP A 1 332 ? -50.774 41.577  -43.943 1.00 39.75  ? 333  ASP A CB  1 
ATOM   2510 C CG  . ASP A 1 332 ? -51.340 42.204  -45.212 1.00 46.80  ? 333  ASP A CG  1 
ATOM   2511 O OD1 . ASP A 1 332 ? -52.331 42.955  -45.108 1.00 50.11  ? 333  ASP A OD1 1 
ATOM   2512 O OD2 . ASP A 1 332 ? -50.811 41.927  -46.314 1.00 47.48  ? 333  ASP A OD2 1 
ATOM   2513 N N   . GLU A 1 333 ? -50.875 38.200  -42.359 1.00 33.01  ? 334  GLU A N   1 
ATOM   2514 C CA  . GLU A 1 333 ? -50.467 37.472  -41.165 1.00 29.92  ? 334  GLU A CA  1 
ATOM   2515 C C   . GLU A 1 333 ? -48.962 37.522  -40.937 1.00 31.25  ? 334  GLU A C   1 
ATOM   2516 O O   . GLU A 1 333 ? -48.513 37.528  -39.785 1.00 33.46  ? 334  GLU A O   1 
ATOM   2517 C CB  . GLU A 1 333 ? -50.931 36.018  -41.261 1.00 31.78  ? 334  GLU A CB  1 
ATOM   2518 C CG  . GLU A 1 333 ? -52.424 35.827  -41.040 1.00 37.38  ? 334  GLU A CG  1 
ATOM   2519 C CD  . GLU A 1 333 ? -52.838 36.006  -39.580 1.00 39.14  ? 334  GLU A CD  1 
ATOM   2520 O OE1 . GLU A 1 333 ? -51.954 36.177  -38.710 1.00 37.63  ? 334  GLU A OE1 1 
ATOM   2521 O OE2 . GLU A 1 333 ? -54.057 35.970  -39.301 1.00 40.27  ? 334  GLU A OE2 1 
ATOM   2522 N N   . GLY A 1 334 ? -48.166 37.551  -42.007 1.00 22.67  ? 335  GLY A N   1 
ATOM   2523 C CA  . GLY A 1 334 ? -46.730 37.416  -41.840 1.00 26.81  ? 335  GLY A CA  1 
ATOM   2524 C C   . GLY A 1 334 ? -46.003 38.687  -41.468 1.00 33.53  ? 335  GLY A C   1 
ATOM   2525 O O   . GLY A 1 334 ? -44.915 38.612  -40.888 1.00 39.75  ? 335  GLY A O   1 
ATOM   2526 N N   . SER A 1 335 ? -46.593 39.850  -41.758 1.00 33.80  ? 336  SER A N   1 
ATOM   2527 C CA  . SER A 1 335 ? -45.860 41.111  -41.662 1.00 34.95  ? 336  SER A CA  1 
ATOM   2528 C C   . SER A 1 335 ? -45.383 41.394  -40.235 1.00 39.28  ? 336  SER A C   1 
ATOM   2529 O O   . SER A 1 335 ? -44.230 41.791  -40.021 1.00 37.19  ? 336  SER A O   1 
ATOM   2530 C CB  . SER A 1 335 ? -46.728 42.257  -42.186 1.00 33.66  ? 336  SER A CB  1 
ATOM   2531 O OG  . SER A 1 335 ? -47.812 42.521  -41.312 1.00 43.20  ? 336  SER A OG  1 
ATOM   2532 N N   . TYR A 1 336 ? -46.259 41.206  -39.242 1.00 38.00  ? 337  TYR A N   1 
ATOM   2533 C CA  . TYR A 1 336 ? -45.894 41.527  -37.863 1.00 41.35  ? 337  TYR A CA  1 
ATOM   2534 C C   . TYR A 1 336 ? -44.639 40.779  -37.421 1.00 40.29  ? 337  TYR A C   1 
ATOM   2535 O O   . TYR A 1 336 ? -43.763 41.352  -36.761 1.00 41.21  ? 337  TYR A O   1 
ATOM   2536 C CB  . TYR A 1 336 ? -47.060 41.208  -36.927 1.00 43.23  ? 337  TYR A CB  1 
ATOM   2537 C CG  . TYR A 1 336 ? -46.768 41.457  -35.471 1.00 49.19  ? 337  TYR A CG  1 
ATOM   2538 C CD1 . TYR A 1 336 ? -46.979 42.705  -34.910 1.00 61.92  ? 337  TYR A CD1 1 
ATOM   2539 C CD2 . TYR A 1 336 ? -46.283 40.441  -34.652 1.00 58.66  ? 337  TYR A CD2 1 
ATOM   2540 C CE1 . TYR A 1 336 ? -46.715 42.942  -33.578 1.00 69.08  ? 337  TYR A CE1 1 
ATOM   2541 C CE2 . TYR A 1 336 ? -46.011 40.669  -33.313 1.00 65.59  ? 337  TYR A CE2 1 
ATOM   2542 C CZ  . TYR A 1 336 ? -46.232 41.921  -32.783 1.00 73.20  ? 337  TYR A CZ  1 
ATOM   2543 O OH  . TYR A 1 336 ? -45.968 42.155  -31.452 1.00 83.40  ? 337  TYR A OH  1 
ATOM   2544 N N   . PHE A 1 337 ? -44.531 39.500  -37.777 1.00 34.08  ? 338  PHE A N   1 
ATOM   2545 C CA  . PHE A 1 337 ? -43.412 38.694  -37.301 1.00 38.20  ? 338  PHE A CA  1 
ATOM   2546 C C   . PHE A 1 337 ? -42.090 39.104  -37.941 1.00 40.66  ? 338  PHE A C   1 
ATOM   2547 O O   . PHE A 1 337 ? -41.048 39.022  -37.287 1.00 44.71  ? 338  PHE A O   1 
ATOM   2548 C CB  . PHE A 1 337 ? -43.705 37.213  -37.546 1.00 31.82  ? 338  PHE A CB  1 
ATOM   2549 C CG  . PHE A 1 337 ? -44.999 36.761  -36.940 1.00 39.07  ? 338  PHE A CG  1 
ATOM   2550 C CD1 . PHE A 1 337 ? -46.128 36.591  -37.724 1.00 40.68  ? 338  PHE A CD1 1 
ATOM   2551 C CD2 . PHE A 1 337 ? -45.097 36.546  -35.570 1.00 45.39  ? 338  PHE A CD2 1 
ATOM   2552 C CE1 . PHE A 1 337 ? -47.328 36.189  -37.161 1.00 38.85  ? 338  PHE A CE1 1 
ATOM   2553 C CE2 . PHE A 1 337 ? -46.292 36.146  -34.997 1.00 40.48  ? 338  PHE A CE2 1 
ATOM   2554 C CZ  . PHE A 1 337 ? -47.411 35.965  -35.796 1.00 41.54  ? 338  PHE A CZ  1 
ATOM   2555 N N   . LEU A 1 338 ? -42.107 39.586  -39.189 1.00 33.14  ? 339  LEU A N   1 
ATOM   2556 C CA  . LEU A 1 338 ? -40.851 39.842  -39.889 1.00 37.62  ? 339  LEU A CA  1 
ATOM   2557 C C   . LEU A 1 338 ? -40.024 40.948  -39.235 1.00 46.97  ? 339  LEU A C   1 
ATOM   2558 O O   . LEU A 1 338 ? -38.789 40.901  -39.288 1.00 44.87  ? 339  LEU A O   1 
ATOM   2559 C CB  . LEU A 1 338 ? -41.127 40.175  -41.354 1.00 37.39  ? 339  LEU A CB  1 
ATOM   2560 C CG  . LEU A 1 338 ? -41.657 38.970  -42.137 1.00 40.45  ? 339  LEU A CG  1 
ATOM   2561 C CD1 . LEU A 1 338 ? -41.823 39.261  -43.623 1.00 43.28  ? 339  LEU A CD1 1 
ATOM   2562 C CD2 . LEU A 1 338 ? -40.731 37.779  -41.927 1.00 42.92  ? 339  LEU A CD2 1 
ATOM   2563 N N   . VAL A 1 339 ? -40.664 41.937  -38.605 1.00 46.94  ? 340  VAL A N   1 
ATOM   2564 C CA  . VAL A 1 339 ? -39.921 43.046  -38.008 1.00 57.15  ? 340  VAL A CA  1 
ATOM   2565 C C   . VAL A 1 339 ? -39.247 42.601  -36.716 1.00 58.69  ? 340  VAL A C   1 
ATOM   2566 O O   . VAL A 1 339 ? -38.565 43.395  -36.059 1.00 59.92  ? 340  VAL A O   1 
ATOM   2567 C CB  . VAL A 1 339 ? -40.822 44.267  -37.742 1.00 58.48  ? 340  VAL A CB  1 
ATOM   2568 C CG1 . VAL A 1 339 ? -41.562 44.678  -39.004 1.00 56.65  ? 340  VAL A CG1 1 
ATOM   2569 C CG2 . VAL A 1 339 ? -41.790 43.974  -36.605 1.00 55.62  ? 340  VAL A CG2 1 
ATOM   2570 N N   . TYR A 1 340 ? -39.422 41.332  -36.346 1.00 55.71  ? 341  TYR A N   1 
ATOM   2571 C CA  . TYR A 1 340 ? -38.864 40.789  -35.115 1.00 57.66  ? 341  TYR A CA  1 
ATOM   2572 C C   . TYR A 1 340 ? -37.633 39.923  -35.355 1.00 62.96  ? 341  TYR A C   1 
ATOM   2573 O O   . TYR A 1 340 ? -37.397 38.969  -34.605 1.00 65.52  ? 341  TYR A O   1 
ATOM   2574 C CB  . TYR A 1 340 ? -39.925 39.990  -34.361 1.00 59.40  ? 341  TYR A CB  1 
ATOM   2575 C CG  . TYR A 1 340 ? -40.758 40.845  -33.444 1.00 62.54  ? 341  TYR A CG  1 
ATOM   2576 C CD1 . TYR A 1 340 ? -40.476 40.918  -32.085 1.00 68.77  ? 341  TYR A CD1 1 
ATOM   2577 C CD2 . TYR A 1 340 ? -41.823 41.586  -33.936 1.00 60.99  ? 341  TYR A CD2 1 
ATOM   2578 C CE1 . TYR A 1 340 ? -41.232 41.707  -31.240 1.00 70.62  ? 341  TYR A CE1 1 
ATOM   2579 C CE2 . TYR A 1 340 ? -42.592 42.370  -33.098 1.00 68.58  ? 341  TYR A CE2 1 
ATOM   2580 C CZ  . TYR A 1 340 ? -42.287 42.434  -31.750 1.00 73.23  ? 341  TYR A CZ  1 
ATOM   2581 O OH  . TYR A 1 340 ? -43.043 43.218  -30.910 1.00 77.15  ? 341  TYR A OH  1 
ATOM   2582 N N   . GLY A 1 341 ? -36.840 40.226  -36.379 1.00 64.09  ? 342  GLY A N   1 
ATOM   2583 C CA  . GLY A 1 341 ? -35.578 39.529  -36.535 1.00 62.01  ? 342  GLY A CA  1 
ATOM   2584 C C   . GLY A 1 341 ? -35.218 39.128  -37.949 1.00 62.55  ? 342  GLY A C   1 
ATOM   2585 O O   . GLY A 1 341 ? -34.071 38.751  -38.209 1.00 66.43  ? 342  GLY A O   1 
ATOM   2586 N N   . ALA A 1 342 ? -36.177 39.188  -38.868 1.00 56.05  ? 343  ALA A N   1 
ATOM   2587 C CA  . ALA A 1 342 ? -35.870 38.868  -40.252 1.00 51.32  ? 343  ALA A CA  1 
ATOM   2588 C C   . ALA A 1 342 ? -34.894 39.900  -40.814 1.00 54.40  ? 343  ALA A C   1 
ATOM   2589 O O   . ALA A 1 342 ? -35.026 41.097  -40.531 1.00 47.91  ? 343  ALA A O   1 
ATOM   2590 C CB  . ALA A 1 342 ? -37.139 38.825  -41.102 1.00 46.29  ? 343  ALA A CB  1 
ATOM   2591 N N   . PRO A 1 343 ? -33.897 39.468  -41.584 1.00 62.69  ? 344  PRO A N   1 
ATOM   2592 C CA  . PRO A 1 343 ? -32.928 40.419  -42.146 1.00 64.75  ? 344  PRO A CA  1 
ATOM   2593 C C   . PRO A 1 343 ? -33.599 41.436  -43.061 1.00 60.31  ? 344  PRO A C   1 
ATOM   2594 O O   . PRO A 1 343 ? -34.396 41.085  -43.933 1.00 60.62  ? 344  PRO A O   1 
ATOM   2595 C CB  . PRO A 1 343 ? -31.956 39.519  -42.920 1.00 71.91  ? 344  PRO A CB  1 
ATOM   2596 C CG  . PRO A 1 343 ? -32.123 38.157  -42.314 1.00 72.78  ? 344  PRO A CG  1 
ATOM   2597 C CD  . PRO A 1 343 ? -33.557 38.069  -41.898 1.00 67.44  ? 344  PRO A CD  1 
ATOM   2598 N N   . GLY A 1 344 ? -33.267 42.707  -42.848 1.00 59.79  ? 345  GLY A N   1 
ATOM   2599 C CA  . GLY A 1 344 ? -33.727 43.797  -43.679 1.00 61.18  ? 345  GLY A CA  1 
ATOM   2600 C C   . GLY A 1 344 ? -34.988 44.488  -43.210 1.00 59.40  ? 345  GLY A C   1 
ATOM   2601 O O   . GLY A 1 344 ? -35.387 45.491  -43.817 1.00 58.88  ? 345  GLY A O   1 
ATOM   2602 N N   . PHE A 1 345 ? -35.620 44.005  -42.148 1.00 56.54  ? 346  PHE A N   1 
ATOM   2603 C CA  . PHE A 1 345 ? -36.945 44.476  -41.778 1.00 54.02  ? 346  PHE A CA  1 
ATOM   2604 C C   . PHE A 1 345 ? -36.889 45.466  -40.626 1.00 53.57  ? 346  PHE A C   1 
ATOM   2605 O O   . PHE A 1 345 ? -36.055 45.355  -39.722 1.00 55.18  ? 346  PHE A O   1 
ATOM   2606 C CB  . PHE A 1 345 ? -37.859 43.302  -41.428 1.00 47.18  ? 346  PHE A CB  1 
ATOM   2607 C CG  . PHE A 1 345 ? -38.449 42.643  -42.634 1.00 48.78  ? 346  PHE A CG  1 
ATOM   2608 C CD1 . PHE A 1 345 ? -39.710 42.998  -43.087 1.00 43.45  ? 346  PHE A CD1 1 
ATOM   2609 C CD2 . PHE A 1 345 ? -37.723 41.701  -43.347 1.00 45.63  ? 346  PHE A CD2 1 
ATOM   2610 C CE1 . PHE A 1 345 ? -40.249 42.406  -44.215 1.00 44.86  ? 346  PHE A CE1 1 
ATOM   2611 C CE2 . PHE A 1 345 ? -38.257 41.103  -44.472 1.00 45.31  ? 346  PHE A CE2 1 
ATOM   2612 C CZ  . PHE A 1 345 ? -39.521 41.456  -44.909 1.00 46.44  ? 346  PHE A CZ  1 
ATOM   2613 N N   . SER A 1 346 ? -37.781 46.448  -40.686 1.00 50.49  ? 347  SER A N   1 
ATOM   2614 C CA  . SER A 1 346 ? -37.977 47.407  -39.615 1.00 49.11  ? 347  SER A CA  1 
ATOM   2615 C C   . SER A 1 346 ? -39.332 48.061  -39.816 1.00 53.92  ? 347  SER A C   1 
ATOM   2616 O O   . SER A 1 346 ? -39.795 48.224  -40.949 1.00 55.77  ? 347  SER A O   1 
ATOM   2617 C CB  . SER A 1 346 ? -36.873 48.467  -39.586 1.00 45.66  ? 347  SER A CB  1 
ATOM   2618 O OG  . SER A 1 346 ? -37.163 49.474  -38.629 1.00 57.11  ? 347  SER A OG  1 
ATOM   2619 N N   . LYS A 1 347 ? -39.968 48.426  -38.704 1.00 52.33  ? 348  LYS A N   1 
ATOM   2620 C CA  . LYS A 1 347 ? -41.187 49.216  -38.791 1.00 52.84  ? 348  LYS A CA  1 
ATOM   2621 C C   . LYS A 1 347 ? -40.903 50.665  -39.149 1.00 49.10  ? 348  LYS A C   1 
ATOM   2622 O O   . LYS A 1 347 ? -41.844 51.423  -39.398 1.00 53.55  ? 348  LYS A O   1 
ATOM   2623 C CB  . LYS A 1 347 ? -41.950 49.165  -37.468 1.00 52.32  ? 348  LYS A CB  1 
ATOM   2624 C CG  . LYS A 1 347 ? -41.394 50.130  -36.442 1.00 56.16  ? 348  LYS A CG  1 
ATOM   2625 C CD  . LYS A 1 347 ? -42.414 50.500  -35.389 1.00 59.33  ? 348  LYS A CD  1 
ATOM   2626 C CE  . LYS A 1 347 ? -41.825 51.501  -34.409 1.00 54.38  ? 348  LYS A CE  1 
ATOM   2627 N NZ  . LYS A 1 347 ? -42.139 52.895  -34.809 1.00 57.83  ? 348  LYS A NZ  1 
ATOM   2628 N N   . ASP A 1 348 ? -39.653 51.049  -39.081 1.00 45.15  ? 349  ASP A N   1 
ATOM   2629 C CA  . ASP A 1 348 ? -39.274 52.406  -39.368 1.00 52.88  ? 349  ASP A CA  1 
ATOM   2630 C C   . ASP A 1 348 ? -38.806 52.686  -40.790 1.00 59.55  ? 349  ASP A C   1 
ATOM   2631 O O   . ASP A 1 348 ? -38.472 53.795  -41.107 1.00 64.21  ? 349  ASP A O   1 
ATOM   2632 C CB  . ASP A 1 348 ? -38.264 52.886  -38.337 1.00 60.44  ? 349  ASP A CB  1 
ATOM   2633 C CG  . ASP A 1 348 ? -38.847 52.957  -36.944 1.00 67.58  ? 349  ASP A CG  1 
ATOM   2634 O OD1 . ASP A 1 348 ? -38.184 52.519  -36.003 1.00 68.59  ? 349  ASP A OD1 1 
ATOM   2635 O OD2 . ASP A 1 348 ? -39.961 53.451  -36.791 1.00 66.67  ? 349  ASP A OD2 1 
ATOM   2636 N N   . ASN A 1 349 ? -38.778 51.665  -41.628 1.00 54.50  ? 350  ASN A N   1 
ATOM   2637 C CA  . ASN A 1 349 ? -38.397 51.770  -43.023 1.00 60.87  ? 350  ASN A CA  1 
ATOM   2638 C C   . ASN A 1 349 ? -39.276 50.874  -43.860 1.00 58.06  ? 350  ASN A C   1 
ATOM   2639 O O   . ASN A 1 349 ? -40.172 50.252  -43.365 1.00 55.81  ? 350  ASN A O   1 
ATOM   2640 C CB  . ASN A 1 349 ? -36.890 51.599  -43.291 1.00 60.85  ? 350  ASN A CB  1 
ATOM   2641 C CG  . ASN A 1 349 ? -36.413 50.194  -43.136 1.00 72.66  ? 350  ASN A CG  1 
ATOM   2642 O OD1 . ASN A 1 349 ? -37.143 49.281  -43.395 1.00 79.64  ? 350  ASN A OD1 1 
ATOM   2643 N ND2 . ASN A 1 349 ? -35.168 50.018  -42.729 1.00 89.96  ? 350  ASN A ND2 1 
ATOM   2644 N N   . GLU A 1 350 ? -39.091 50.915  -45.150 1.00 57.88  ? 351  GLU A N   1 
ATOM   2645 C CA  . GLU A 1 350 ? -39.878 50.117  -46.049 1.00 52.65  ? 351  GLU A CA  1 
ATOM   2646 C C   . GLU A 1 350 ? -39.565 48.646  -46.081 1.00 50.38  ? 351  GLU A C   1 
ATOM   2647 O O   . GLU A 1 350 ? -40.306 47.918  -46.624 1.00 52.94  ? 351  GLU A O   1 
ATOM   2648 C CB  . GLU A 1 350 ? -39.776 50.693  -47.430 1.00 55.52  ? 351  GLU A CB  1 
ATOM   2649 C CG  . GLU A 1 350 ? -40.381 52.053  -47.522 1.00 63.31  ? 351  GLU A CG  1 
ATOM   2650 C CD  . GLU A 1 350 ? -41.843 52.047  -47.222 1.00 80.96  ? 351  GLU A CD  1 
ATOM   2651 O OE1 . GLU A 1 350 ? -42.234 52.490  -46.137 1.00 88.22  ? 351  GLU A OE1 1 
ATOM   2652 O OE2 . GLU A 1 350 ? -42.609 51.602  -48.072 1.00 85.92  ? 351  GLU A OE2 1 
ATOM   2653 N N   . SER A 1 351 ? -38.446 48.248  -45.518 1.00 49.97  ? 352  SER A N   1 
ATOM   2654 C CA  . SER A 1 351 ? -37.947 46.875  -45.485 1.00 49.63  ? 352  SER A CA  1 
ATOM   2655 C C   . SER A 1 351 ? -37.969 46.247  -46.878 1.00 49.08  ? 352  SER A C   1 
ATOM   2656 O O   . SER A 1 351 ? -38.407 45.110  -47.072 1.00 50.13  ? 352  SER A O   1 
ATOM   2657 C CB  . SER A 1 351 ? -38.727 46.018  -44.484 1.00 45.46  ? 352  SER A CB  1 
ATOM   2658 O OG  . SER A 1 351 ? -38.979 46.707  -43.270 1.00 46.65  ? 352  SER A OG  1 
ATOM   2659 N N   . LEU A 1 352 ? -37.496 47.012  -47.859 1.00 50.99  ? 353  LEU A N   1 
ATOM   2660 C CA  . LEU A 1 352 ? -37.347 46.521  -49.227 1.00 53.42  ? 353  LEU A CA  1 
ATOM   2661 C C   . LEU A 1 352 ? -36.077 45.680  -49.287 1.00 54.36  ? 353  LEU A C   1 
ATOM   2662 O O   . LEU A 1 352 ? -34.974 46.203  -49.455 1.00 63.20  ? 353  LEU A O   1 
ATOM   2663 C CB  . LEU A 1 352 ? -37.311 47.684  -50.212 1.00 51.98  ? 353  LEU A CB  1 
ATOM   2664 C CG  . LEU A 1 352 ? -38.558 48.573  -50.161 1.00 52.15  ? 353  LEU A CG  1 
ATOM   2665 C CD1 . LEU A 1 352 ? -38.242 49.985  -50.650 1.00 54.34  ? 353  LEU A CD1 1 
ATOM   2666 C CD2 . LEU A 1 352 ? -39.711 47.958  -50.950 1.00 49.19  ? 353  LEU A CD2 1 
ATOM   2667 N N   . ILE A 1 353 ? -36.237 44.369  -49.156 1.00 45.48  ? 354  ILE A N   1 
ATOM   2668 C CA  . ILE A 1 353 ? -35.117 43.468  -48.928 1.00 42.15  ? 354  ILE A CA  1 
ATOM   2669 C C   . ILE A 1 353 ? -34.518 43.027  -50.256 1.00 45.29  ? 354  ILE A C   1 
ATOM   2670 O O   . ILE A 1 353 ? -35.166 43.048  -51.305 1.00 46.81  ? 354  ILE A O   1 
ATOM   2671 C CB  . ILE A 1 353 ? -35.556 42.247  -48.095 1.00 42.43  ? 354  ILE A CB  1 
ATOM   2672 C CG1 . ILE A 1 353 ? -36.710 41.522  -48.803 1.00 36.44  ? 354  ILE A CG1 1 
ATOM   2673 C CG2 . ILE A 1 353 ? -35.933 42.677  -46.668 1.00 39.13  ? 354  ILE A CG2 1 
ATOM   2674 C CD1 . ILE A 1 353 ? -37.257 40.308  -48.056 1.00 33.29  ? 354  ILE A CD1 1 
ATOM   2675 N N   . SER A 1 354 ? -33.259 42.603  -50.200 1.00 46.49  ? 355  SER A N   1 
ATOM   2676 C CA  . SER A 1 354 ? -32.586 42.021  -51.346 1.00 45.37  ? 355  SER A CA  1 
ATOM   2677 C C   . SER A 1 354 ? -32.986 40.559  -51.504 1.00 48.22  ? 355  SER A C   1 
ATOM   2678 O O   . SER A 1 354 ? -33.702 39.985  -50.679 1.00 49.00  ? 355  SER A O   1 
ATOM   2679 C CB  . SER A 1 354 ? -31.070 42.135  -51.188 1.00 49.49  ? 355  SER A CB  1 
ATOM   2680 O OG  . SER A 1 354 ? -30.599 41.208  -50.223 1.00 55.15  ? 355  SER A OG  1 
ATOM   2681 N N   . ARG A 1 355 ? -32.501 39.940  -52.551 1.00 48.23  ? 356  ARG A N   1 
ATOM   2682 C CA  . ARG A 1 355 ? -32.746 38.554  -52.767 1.00 52.29  ? 356  ARG A CA  1 
ATOM   2683 C C   . ARG A 1 355 ? -32.083 37.707  -51.719 1.00 52.76  ? 356  ARG A C   1 
ATOM   2684 O O   . ARG A 1 355 ? -32.646 36.771  -51.242 1.00 48.94  ? 356  ARG A O   1 
ATOM   2685 C CB  . ARG A 1 355 ? -32.256 38.172  -54.137 1.00 51.24  ? 356  ARG A CB  1 
ATOM   2686 C CG  . ARG A 1 355 ? -32.385 36.725  -54.492 1.00 53.34  ? 356  ARG A CG  1 
ATOM   2687 C CD  . ARG A 1 355 ? -33.613 36.476  -55.309 1.00 56.42  ? 356  ARG A CD  1 
ATOM   2688 N NE  . ARG A 1 355 ? -33.794 35.067  -55.556 1.00 53.94  ? 356  ARG A NE  1 
ATOM   2689 C CZ  . ARG A 1 355 ? -34.965 34.510  -55.719 1.00 41.31  ? 356  ARG A CZ  1 
ATOM   2690 N NH1 . ARG A 1 355 ? -36.019 35.233  -55.648 1.00 37.98  ? 356  ARG A NH1 1 
ATOM   2691 N NH2 . ARG A 1 355 ? -35.067 33.247  -55.950 1.00 39.81  ? 356  ARG A NH2 1 
ATOM   2692 N N   . ALA A 1 356 ? -30.863 38.035  -51.365 1.00 53.07  ? 357  ALA A N   1 
ATOM   2693 C CA  . ALA A 1 356 ? -30.147 37.280  -50.344 1.00 47.81  ? 357  ALA A CA  1 
ATOM   2694 C C   . ALA A 1 356 ? -30.828 37.407  -48.987 1.00 47.54  ? 357  ALA A C   1 
ATOM   2695 O O   . ALA A 1 356 ? -30.871 36.441  -48.215 1.00 50.01  ? 357  ALA A O   1 
ATOM   2696 C CB  . ALA A 1 356 ? -28.694 37.746  -50.272 1.00 42.23  ? 357  ALA A CB  1 
ATOM   2697 N N   . GLU A 1 357 ? -31.370 38.589  -48.677 1.00 46.05  ? 358  GLU A N   1 
ATOM   2698 C CA  . GLU A 1 357 ? -32.122 38.748  -47.435 1.00 51.05  ? 358  GLU A CA  1 
ATOM   2699 C C   . GLU A 1 357 ? -33.415 37.946  -47.478 1.00 49.42  ? 358  GLU A C   1 
ATOM   2700 O O   . GLU A 1 357 ? -33.845 37.389  -46.461 1.00 42.94  ? 358  GLU A O   1 
ATOM   2701 C CB  . GLU A 1 357 ? -32.418 40.226  -47.176 1.00 56.92  ? 358  GLU A CB  1 
ATOM   2702 C CG  . GLU A 1 357 ? -31.178 41.102  -47.054 1.00 67.59  ? 358  GLU A CG  1 
ATOM   2703 C CD  . GLU A 1 357 ? -31.508 42.545  -46.709 1.00 73.81  ? 358  GLU A CD  1 
ATOM   2704 O OE1 . GLU A 1 357 ? -31.146 42.991  -45.598 1.00 77.42  ? 358  GLU A OE1 1 
ATOM   2705 O OE2 . GLU A 1 357 ? -32.126 43.233  -47.549 1.00 75.98  ? 358  GLU A OE2 1 
ATOM   2706 N N   . PHE A 1 358 ? -34.052 37.888  -48.648 1.00 46.65  ? 359  PHE A N   1 
ATOM   2707 C CA  . PHE A 1 358 ? -35.219 37.033  -48.822 1.00 43.62  ? 359  PHE A CA  1 
ATOM   2708 C C   . PHE A 1 358 ? -34.866 35.582  -48.514 1.00 43.12  ? 359  PHE A C   1 
ATOM   2709 O O   . PHE A 1 358 ? -35.582 34.901  -47.769 1.00 36.91  ? 359  PHE A O   1 
ATOM   2710 C CB  . PHE A 1 358 ? -35.761 37.191  -50.248 1.00 44.22  ? 359  PHE A CB  1 
ATOM   2711 C CG  . PHE A 1 358 ? -36.861 36.226  -50.604 1.00 35.29  ? 359  PHE A CG  1 
ATOM   2712 C CD1 . PHE A 1 358 ? -38.124 36.354  -50.051 1.00 40.41  ? 359  PHE A CD1 1 
ATOM   2713 C CD2 . PHE A 1 358 ? -36.642 35.217  -51.522 1.00 43.02  ? 359  PHE A CD2 1 
ATOM   2714 C CE1 . PHE A 1 358 ? -39.141 35.471  -50.386 1.00 39.77  ? 359  PHE A CE1 1 
ATOM   2715 C CE2 . PHE A 1 358 ? -37.658 34.327  -51.861 1.00 39.41  ? 359  PHE A CE2 1 
ATOM   2716 C CZ  . PHE A 1 358 ? -38.906 34.457  -51.292 1.00 33.35  ? 359  PHE A CZ  1 
ATOM   2717 N N   . LEU A 1 359 ? -33.736 35.105  -49.051 1.00 40.80  ? 360  LEU A N   1 
ATOM   2718 C CA  . LEU A 1 359 ? -33.324 33.724  -48.812 1.00 43.89  ? 360  LEU A CA  1 
ATOM   2719 C C   . LEU A 1 359 ? -33.061 33.474  -47.333 1.00 49.56  ? 360  LEU A C   1 
ATOM   2720 O O   . LEU A 1 359 ? -33.466 32.439  -46.788 1.00 54.87  ? 360  LEU A O   1 
ATOM   2721 C CB  . LEU A 1 359 ? -32.094 33.378  -49.659 1.00 48.46  ? 360  LEU A CB  1 
ATOM   2722 C CG  . LEU A 1 359 ? -32.126 33.665  -51.174 1.00 56.58  ? 360  LEU A CG  1 
ATOM   2723 C CD1 . LEU A 1 359 ? -30.804 33.303  -51.852 1.00 58.61  ? 360  LEU A CD1 1 
ATOM   2724 C CD2 . LEU A 1 359 ? -33.282 32.969  -51.880 1.00 53.69  ? 360  LEU A CD2 1 
ATOM   2725 N N   . ALA A 1 360 ? -32.407 34.421  -46.657 1.00 46.46  ? 361  ALA A N   1 
ATOM   2726 C CA  . ALA A 1 360 ? -32.153 34.259  -45.230 1.00 43.78  ? 361  ALA A CA  1 
ATOM   2727 C C   . ALA A 1 360 ? -33.435 34.363  -44.417 1.00 48.24  ? 361  ALA A C   1 
ATOM   2728 O O   . ALA A 1 360 ? -33.544 33.751  -43.348 1.00 56.32  ? 361  ALA A O   1 
ATOM   2729 C CB  . ALA A 1 360 ? -31.142 35.299  -44.754 1.00 43.89  ? 361  ALA A CB  1 
ATOM   2730 N N   . GLY A 1 361 ? -34.410 35.134  -44.898 1.00 44.91  ? 362  GLY A N   1 
ATOM   2731 C CA  . GLY A 1 361 ? -35.657 35.265  -44.165 1.00 40.13  ? 362  GLY A CA  1 
ATOM   2732 C C   . GLY A 1 361 ? -36.487 33.997  -44.191 1.00 40.89  ? 362  GLY A C   1 
ATOM   2733 O O   . GLY A 1 361 ? -37.149 33.661  -43.205 1.00 44.05  ? 362  GLY A O   1 
ATOM   2734 N N   . VAL A 1 362 ? -36.475 33.280  -45.319 1.00 40.65  ? 363  VAL A N   1 
ATOM   2735 C CA  . VAL A 1 362 ? -37.209 32.020  -45.395 1.00 39.81  ? 363  VAL A CA  1 
ATOM   2736 C C   . VAL A 1 362 ? -36.725 31.061  -44.315 1.00 39.83  ? 363  VAL A C   1 
ATOM   2737 O O   . VAL A 1 362 ? -37.524 30.379  -43.661 1.00 45.04  ? 363  VAL A O   1 
ATOM   2738 C CB  . VAL A 1 362 ? -37.074 31.408  -46.802 1.00 43.64  ? 363  VAL A CB  1 
ATOM   2739 C CG1 . VAL A 1 362 ? -37.544 29.962  -46.800 1.00 36.29  ? 363  VAL A CG1 1 
ATOM   2740 C CG2 . VAL A 1 362 ? -37.872 32.225  -47.811 1.00 40.12  ? 363  VAL A CG2 1 
ATOM   2741 N N   . ARG A 1 363 ? -35.423 31.000  -44.076 1.00 41.41  ? 364  ARG A N   1 
ATOM   2742 C CA  . ARG A 1 363 ? -34.872 30.100  -43.055 1.00 49.04  ? 364  ARG A CA  1 
ATOM   2743 C C   . ARG A 1 363 ? -35.316 30.426  -41.661 1.00 51.51  ? 364  ARG A C   1 
ATOM   2744 O O   . ARG A 1 363 ? -35.567 29.580  -40.871 1.00 51.15  ? 364  ARG A O   1 
ATOM   2745 C CB  . ARG A 1 363 ? -33.361 30.064  -43.039 1.00 54.13  ? 364  ARG A CB  1 
ATOM   2746 C CG  . ARG A 1 363 ? -32.681 29.639  -44.307 1.00 58.57  ? 364  ARG A CG  1 
ATOM   2747 C CD  . ARG A 1 363 ? -33.422 28.567  -45.048 1.00 60.50  ? 364  ARG A CD  1 
ATOM   2748 N NE  . ARG A 1 363 ? -33.132 27.230  -44.572 1.00 63.45  ? 364  ARG A NE  1 
ATOM   2749 C CZ  . ARG A 1 363 ? -32.244 26.424  -45.124 1.00 60.53  ? 364  ARG A CZ  1 
ATOM   2750 N NH1 . ARG A 1 363 ? -31.541 26.835  -46.166 1.00 59.38  ? 364  ARG A NH1 1 
ATOM   2751 N NH2 . ARG A 1 363 ? -32.062 25.218  -44.631 1.00 57.43  ? 364  ARG A NH2 1 
ATOM   2752 N N   . VAL A 1 364 ? -35.341 31.687  -41.348 1.00 51.67  ? 365  VAL A N   1 
ATOM   2753 C CA  . VAL A 1 364 ? -35.859 32.097  -40.059 1.00 54.57  ? 365  VAL A CA  1 
ATOM   2754 C C   . VAL A 1 364 ? -37.381 32.019  -39.919 1.00 54.67  ? 365  VAL A C   1 
ATOM   2755 O O   . VAL A 1 364 ? -37.877 31.761  -38.859 1.00 53.79  ? 365  VAL A O   1 
ATOM   2756 C CB  . VAL A 1 364 ? -35.301 33.420  -39.518 1.00 58.18  ? 365  VAL A CB  1 
ATOM   2757 C CG1 . VAL A 1 364 ? -33.860 33.259  -39.165 1.00 60.01  ? 365  VAL A CG1 1 
ATOM   2758 C CG2 . VAL A 1 364 ? -35.484 34.552  -40.476 1.00 60.07  ? 365  VAL A CG2 1 
ATOM   2759 N N   . GLY A 1 365 ? -38.120 32.286  -40.982 1.00 46.93  ? 366  GLY A N   1 
ATOM   2760 C CA  . GLY A 1 365 ? -39.568 32.261  -40.922 1.00 43.45  ? 366  GLY A CA  1 
ATOM   2761 C C   . GLY A 1 365 ? -40.129 30.856  -41.027 1.00 45.81  ? 366  GLY A C   1 
ATOM   2762 O O   . GLY A 1 365 ? -41.259 30.597  -40.601 1.00 45.95  ? 366  GLY A O   1 
ATOM   2763 N N   . VAL A 1 366 ? -39.324 29.944  -41.531 1.00 38.92  ? 367  VAL A N   1 
ATOM   2764 C CA  . VAL A 1 366 ? -39.707 28.571  -41.679 1.00 38.27  ? 367  VAL A CA  1 
ATOM   2765 C C   . VAL A 1 366 ? -38.598 27.762  -41.098 1.00 45.00  ? 367  VAL A C   1 
ATOM   2766 O O   . VAL A 1 366 ? -37.852 27.140  -41.803 1.00 41.41  ? 367  VAL A O   1 
ATOM   2767 C CB  . VAL A 1 366 ? -39.865 28.186  -43.150 1.00 42.43  ? 367  VAL A CB  1 
ATOM   2768 C CG1 . VAL A 1 366 ? -40.397 26.794  -43.276 1.00 39.04  ? 367  VAL A CG1 1 
ATOM   2769 C CG2 . VAL A 1 366 ? -40.753 29.156  -43.859 1.00 32.58  ? 367  VAL A CG2 1 
ATOM   2770 N N   . PRO A 1 367 ? -38.483 27.785  -39.787 1.00 43.48  ? 368  PRO A N   1 
ATOM   2771 C CA  . PRO A 1 367 ? -37.447 27.093  -39.060 1.00 49.25  ? 368  PRO A CA  1 
ATOM   2772 C C   . PRO A 1 367 ? -37.632 25.606  -39.044 1.00 61.48  ? 368  PRO A C   1 
ATOM   2773 O O   . PRO A 1 367 ? -38.716 25.049  -39.098 1.00 79.65  ? 368  PRO A O   1 
ATOM   2774 C CB  . PRO A 1 367 ? -37.578 27.664  -37.673 1.00 53.25  ? 368  PRO A CB  1 
ATOM   2775 C CG  . PRO A 1 367 ? -38.994 27.963  -37.547 1.00 49.75  ? 368  PRO A CG  1 
ATOM   2776 C CD  . PRO A 1 367 ? -39.435 28.416  -38.883 1.00 46.21  ? 368  PRO A CD  1 
ATOM   2777 N N   . GLN A 1 368 ? -36.499 24.971  -38.973 1.00 50.72  ? 369  GLN A N   1 
ATOM   2778 C CA  . GLN A 1 368 ? -36.390 23.539  -38.942 1.00 73.46  ? 369  GLN A CA  1 
ATOM   2779 C C   . GLN A 1 368 ? -36.881 22.671  -40.108 1.00 72.73  ? 369  GLN A C   1 
ATOM   2780 O O   . GLN A 1 368 ? -37.416 21.622  -39.880 1.00 77.94  ? 369  GLN A O   1 
ATOM   2781 C CB  . GLN A 1 368 ? -36.816 22.961  -37.582 1.00 90.58  ? 369  GLN A CB  1 
ATOM   2782 C CG  . GLN A 1 368 ? -36.133 23.601  -36.383 1.00 96.81  ? 369  GLN A CG  1 
ATOM   2783 C CD  . GLN A 1 368 ? -34.617 23.534  -36.409 1.00 100.89 ? 369  GLN A CD  1 
ATOM   2784 O OE1 . GLN A 1 368 ? -33.948 24.506  -36.104 1.00 98.06  ? 369  GLN A OE1 1 
ATOM   2785 N NE2 . GLN A 1 368 ? -34.075 22.387  -36.753 1.00 107.27 ? 369  GLN A NE2 1 
ATOM   2786 N N   . VAL A 1 369 ? -36.752 23.150  -41.331 1.00 62.82  ? 370  VAL A N   1 
ATOM   2787 C CA  . VAL A 1 369 ? -36.954 22.341  -42.498 1.00 57.21  ? 370  VAL A CA  1 
ATOM   2788 C C   . VAL A 1 369 ? -35.623 22.169  -43.176 1.00 58.33  ? 370  VAL A C   1 
ATOM   2789 O O   . VAL A 1 369 ? -34.698 22.905  -42.956 1.00 62.84  ? 370  VAL A O   1 
ATOM   2790 C CB  . VAL A 1 369 ? -37.992 22.903  -43.465 1.00 55.18  ? 370  VAL A CB  1 
ATOM   2791 C CG1 . VAL A 1 369 ? -39.344 23.006  -42.808 1.00 50.04  ? 370  VAL A CG1 1 
ATOM   2792 C CG2 . VAL A 1 369 ? -37.552 24.207  -44.070 1.00 49.38  ? 370  VAL A CG2 1 
ATOM   2793 N N   . SER A 1 370 ? -35.516 21.142  -43.970 1.00 58.27  ? 371  SER A N   1 
ATOM   2794 C CA  . SER A 1 370 ? -34.272 20.851  -44.673 1.00 63.70  ? 371  SER A CA  1 
ATOM   2795 C C   . SER A 1 370 ? -34.007 21.875  -45.777 1.00 67.40  ? 371  SER A C   1 
ATOM   2796 O O   . SER A 1 370 ? -34.913 22.565  -46.251 1.00 66.71  ? 371  SER A O   1 
ATOM   2797 C CB  . SER A 1 370 ? -34.317 19.447  -45.274 1.00 65.86  ? 371  SER A CB  1 
ATOM   2798 O OG  . SER A 1 370 ? -35.540 19.219  -45.956 1.00 64.89  ? 371  SER A OG  1 
ATOM   2799 N N   . ASP A 1 371 ? -32.798 21.887  -46.280 1.00 75.30  ? 372  ASP A N   1 
ATOM   2800 C CA  . ASP A 1 371 ? -32.418 22.790  -47.325 1.00 77.09  ? 372  ASP A CA  1 
ATOM   2801 C C   . ASP A 1 371 ? -33.263 22.518  -48.513 1.00 70.03  ? 372  ASP A C   1 
ATOM   2802 O O   . ASP A 1 371 ? -33.668 23.401  -49.231 1.00 63.66  ? 372  ASP A O   1 
ATOM   2803 C CB  . ASP A 1 371 ? -31.005 22.471  -47.698 1.00 88.12  ? 372  ASP A CB  1 
ATOM   2804 C CG  . ASP A 1 371 ? -30.078 22.736  -46.597 1.00 97.53  ? 372  ASP A CG  1 
ATOM   2805 O OD1 . ASP A 1 371 ? -30.301 23.736  -45.911 1.00 101.85 ? 372  ASP A OD1 1 
ATOM   2806 O OD2 . ASP A 1 371 ? -29.137 21.955  -46.408 1.00 102.74 ? 372  ASP A OD2 1 
ATOM   2807 N N   . LEU A 1 372 ? -33.495 21.252  -48.730 1.00 69.09  ? 373  LEU A N   1 
ATOM   2808 C CA  . LEU A 1 372 ? -34.293 20.847  -49.854 1.00 67.84  ? 373  LEU A CA  1 
ATOM   2809 C C   . LEU A 1 372 ? -35.655 21.445  -49.719 1.00 65.78  ? 373  LEU A C   1 
ATOM   2810 O O   . LEU A 1 372 ? -36.238 21.899  -50.679 1.00 65.55  ? 373  LEU A O   1 
ATOM   2811 C CB  . LEU A 1 372 ? -34.373 19.337  -49.926 1.00 70.86  ? 373  LEU A CB  1 
ATOM   2812 C CG  . LEU A 1 372 ? -34.905 18.581  -51.136 1.00 73.77  ? 373  LEU A CG  1 
ATOM   2813 C CD1 . LEU A 1 372 ? -36.282 18.047  -50.905 1.00 71.72  ? 373  LEU A CD1 1 
ATOM   2814 C CD2 . LEU A 1 372 ? -34.882 19.336  -52.437 1.00 79.44  ? 373  LEU A CD2 1 
ATOM   2815 N N   . ALA A 1 373 ? -36.177 21.447  -48.515 1.00 61.23  ? 374  ALA A N   1 
ATOM   2816 C CA  . ALA A 1 373 ? -37.495 22.048  -48.325 1.00 52.73  ? 374  ALA A CA  1 
ATOM   2817 C C   . ALA A 1 373 ? -37.442 23.562  -48.485 1.00 47.54  ? 374  ALA A C   1 
ATOM   2818 O O   . ALA A 1 373 ? -38.338 24.158  -49.098 1.00 43.02  ? 374  ALA A O   1 
ATOM   2819 C CB  . ALA A 1 373 ? -38.055 21.678  -46.951 1.00 48.30  ? 374  ALA A CB  1 
ATOM   2820 N N   . ALA A 1 374 ? -36.408 24.201  -47.929 1.00 42.28  ? 375  ALA A N   1 
ATOM   2821 C CA  . ALA A 1 374 ? -36.247 25.640  -48.100 1.00 46.75  ? 375  ALA A CA  1 
ATOM   2822 C C   . ALA A 1 374 ? -36.100 25.992  -49.570 1.00 59.18  ? 375  ALA A C   1 
ATOM   2823 O O   . ALA A 1 374 ? -36.583 27.037  -50.020 1.00 63.42  ? 375  ALA A O   1 
ATOM   2824 C CB  . ALA A 1 374 ? -35.040 26.136  -47.307 1.00 45.95  ? 375  ALA A CB  1 
ATOM   2825 N N   . GLU A 1 375 ? -35.460 25.149  -50.372 1.00 62.09  ? 376  GLU A N   1 
ATOM   2826 C CA  . GLU A 1 375 ? -35.381 25.410  -51.798 1.00 64.99  ? 376  GLU A CA  1 
ATOM   2827 C C   . GLU A 1 375 ? -36.759 25.339  -52.399 1.00 54.78  ? 376  GLU A C   1 
ATOM   2828 O O   . GLU A 1 375 ? -37.117 26.140  -53.220 1.00 56.86  ? 376  GLU A O   1 
ATOM   2829 C CB  . GLU A 1 375 ? -34.522 24.390  -52.534 1.00 81.45  ? 376  GLU A CB  1 
ATOM   2830 C CG  . GLU A 1 375 ? -33.018 24.507  -52.414 1.00 99.51  ? 376  GLU A CG  1 
ATOM   2831 C CD  . GLU A 1 375 ? -32.472 25.905  -52.558 1.00 115.15 ? 376  GLU A CD  1 
ATOM   2832 O OE1 . GLU A 1 375 ? -31.727 26.326  -51.657 1.00 119.44 ? 376  GLU A OE1 1 
ATOM   2833 O OE2 . GLU A 1 375 ? -32.766 26.577  -53.557 1.00 120.82 ? 376  GLU A OE2 1 
ATOM   2834 N N   . ALA A 1 376 ? -37.529 24.341  -52.024 1.00 42.40  ? 377  ALA A N   1 
ATOM   2835 C CA  . ALA A 1 376 ? -38.898 24.297  -52.530 1.00 43.90  ? 377  ALA A CA  1 
ATOM   2836 C C   . ALA A 1 376 ? -39.666 25.577  -52.212 1.00 48.76  ? 377  ALA A C   1 
ATOM   2837 O O   . ALA A 1 376 ? -40.515 26.001  -53.008 1.00 45.79  ? 377  ALA A O   1 
ATOM   2838 C CB  . ALA A 1 376 ? -39.636 23.085  -51.952 1.00 37.02  ? 377  ALA A CB  1 
ATOM   2839 N N   . VAL A 1 377 ? -39.396 26.201  -51.059 1.00 44.12  ? 378  VAL A N   1 
ATOM   2840 C CA  . VAL A 1 377 ? -40.141 27.396  -50.668 1.00 37.68  ? 378  VAL A CA  1 
ATOM   2841 C C   . VAL A 1 377 ? -39.761 28.576  -51.554 1.00 35.78  ? 378  VAL A C   1 
ATOM   2842 O O   . VAL A 1 377 ? -40.628 29.312  -52.041 1.00 33.95  ? 378  VAL A O   1 
ATOM   2843 C CB  . VAL A 1 377 ? -39.906 27.724  -49.183 1.00 31.98  ? 378  VAL A CB  1 
ATOM   2844 C CG1 . VAL A 1 377 ? -40.653 28.998  -48.817 1.00 25.22  ? 378  VAL A CG1 1 
ATOM   2845 C CG2 . VAL A 1 377 ? -40.335 26.570  -48.293 1.00 29.57  ? 378  VAL A CG2 1 
ATOM   2846 N N   . VAL A 1 378 ? -38.490 28.703  -51.789 1.00 40.98  ? 379  VAL A N   1 
ATOM   2847 C CA  . VAL A 1 378 ? -37.978 29.747  -52.608 1.00 49.45  ? 379  VAL A CA  1 
ATOM   2848 C C   . VAL A 1 378 ? -38.482 29.669  -54.020 1.00 50.88  ? 379  VAL A C   1 
ATOM   2849 O O   . VAL A 1 378 ? -38.804 30.646  -54.592 1.00 52.13  ? 379  VAL A O   1 
ATOM   2850 C CB  . VAL A 1 378 ? -36.483 29.698  -52.596 1.00 54.40  ? 379  VAL A CB  1 
ATOM   2851 C CG1 . VAL A 1 378 ? -35.944 30.358  -53.824 1.00 58.61  ? 379  VAL A CG1 1 
ATOM   2852 C CG2 . VAL A 1 378 ? -35.981 30.389  -51.364 1.00 48.31  ? 379  VAL A CG2 1 
ATOM   2853 N N   . LEU A 1 379 ? -38.552 28.488  -54.576 1.00 51.60  ? 380  LEU A N   1 
ATOM   2854 C CA  . LEU A 1 379 ? -39.067 28.286  -55.897 1.00 61.15  ? 380  LEU A CA  1 
ATOM   2855 C C   . LEU A 1 379 ? -40.507 28.627  -55.997 1.00 60.78  ? 380  LEU A C   1 
ATOM   2856 O O   . LEU A 1 379 ? -40.973 29.121  -56.986 1.00 64.58  ? 380  LEU A O   1 
ATOM   2857 C CB  . LEU A 1 379 ? -38.928 26.827  -56.286 1.00 72.65  ? 380  LEU A CB  1 
ATOM   2858 C CG  . LEU A 1 379 ? -40.148 26.189  -56.945 1.00 85.67  ? 380  LEU A CG  1 
ATOM   2859 C CD1 . LEU A 1 379 ? -40.082 26.199  -58.457 1.00 88.12  ? 380  LEU A CD1 1 
ATOM   2860 C CD2 . LEU A 1 379 ? -40.376 24.789  -56.427 1.00 92.04  ? 380  LEU A CD2 1 
ATOM   2861 N N   . HIS A 1 380 ? -41.245 28.269  -54.981 1.00 54.00  ? 381  HIS A N   1 
ATOM   2862 C CA  . HIS A 1 380 ? -42.621 28.523  -55.000 1.00 48.71  ? 381  HIS A CA  1 
ATOM   2863 C C   . HIS A 1 380 ? -42.967 29.967  -54.884 1.00 45.84  ? 381  HIS A C   1 
ATOM   2864 O O   . HIS A 1 380 ? -43.864 30.420  -55.517 1.00 48.51  ? 381  HIS A O   1 
ATOM   2865 C CB  . HIS A 1 380 ? -43.253 27.721  -53.918 1.00 57.78  ? 381  HIS A CB  1 
ATOM   2866 C CG  . HIS A 1 380 ? -44.335 26.865  -54.414 1.00 71.51  ? 381  HIS A CG  1 
ATOM   2867 N ND1 . HIS A 1 380 ? -45.645 27.096  -54.112 1.00 77.76  ? 381  HIS A ND1 1 
ATOM   2868 C CD2 . HIS A 1 380 ? -44.312 25.817  -55.258 1.00 75.64  ? 381  HIS A CD2 1 
ATOM   2869 C CE1 . HIS A 1 380 ? -46.390 26.203  -54.722 1.00 80.33  ? 381  HIS A CE1 1 
ATOM   2870 N NE2 . HIS A 1 380 ? -45.605 25.411  -55.422 1.00 79.96  ? 381  HIS A NE2 1 
ATOM   2871 N N   . TYR A 1 381 ? -42.251 30.673  -54.044 1.00 37.17  ? 382  TYR A N   1 
ATOM   2872 C CA  . TYR A 1 381 ? -42.544 32.044  -53.791 1.00 35.43  ? 382  TYR A CA  1 
ATOM   2873 C C   . TYR A 1 381 ? -41.836 33.079  -54.641 1.00 32.60  ? 382  TYR A C   1 
ATOM   2874 O O   . TYR A 1 381 ? -42.106 34.216  -54.544 1.00 33.50  ? 382  TYR A O   1 
ATOM   2875 C CB  . TYR A 1 381 ? -42.424 32.312  -52.296 1.00 30.05  ? 382  TYR A CB  1 
ATOM   2876 C CG  . TYR A 1 381 ? -43.556 31.764  -51.504 1.00 30.07  ? 382  TYR A CG  1 
ATOM   2877 C CD1 . TYR A 1 381 ? -44.583 32.567  -51.115 1.00 32.56  ? 382  TYR A CD1 1 
ATOM   2878 C CD2 . TYR A 1 381 ? -43.591 30.454  -51.133 1.00 29.09  ? 382  TYR A CD2 1 
ATOM   2879 C CE1 . TYR A 1 381 ? -45.610 32.085  -50.390 1.00 32.44  ? 382  TYR A CE1 1 
ATOM   2880 C CE2 . TYR A 1 381 ? -44.610 29.969  -50.416 1.00 30.24  ? 382  TYR A CE2 1 
ATOM   2881 C CZ  . TYR A 1 381 ? -45.612 30.794  -50.056 1.00 34.84  ? 382  TYR A CZ  1 
ATOM   2882 O OH  . TYR A 1 381 ? -46.611 30.284  -49.365 1.00 31.56  ? 382  TYR A OH  1 
ATOM   2883 N N   . THR A 1 382 ? -40.942 32.657  -55.494 1.00 34.61  ? 383  THR A N   1 
ATOM   2884 C CA  . THR A 1 382 ? -40.233 33.573  -56.377 1.00 34.70  ? 383  THR A CA  1 
ATOM   2885 C C   . THR A 1 382 ? -41.046 33.790  -57.645 1.00 37.55  ? 383  THR A C   1 
ATOM   2886 O O   . THR A 1 382 ? -41.526 32.827  -58.251 1.00 37.44  ? 383  THR A O   1 
ATOM   2887 C CB  . THR A 1 382 ? -38.851 33.020  -56.735 1.00 38.05  ? 383  THR A CB  1 
ATOM   2888 O OG1 . THR A 1 382 ? -38.019 32.998  -55.563 1.00 40.06  ? 383  THR A OG1 1 
ATOM   2889 C CG2 . THR A 1 382 ? -38.194 33.854  -57.838 1.00 31.58  ? 383  THR A CG2 1 
ATOM   2890 N N   . ASP A 1 383 ? -41.216 35.053  -58.035 1.00 36.30  ? 384  ASP A N   1 
ATOM   2891 C CA  . ASP A 1 383 ? -41.696 35.377  -59.375 1.00 38.25  ? 384  ASP A CA  1 
ATOM   2892 C C   . ASP A 1 383 ? -40.485 35.366  -60.297 1.00 40.22  ? 384  ASP A C   1 
ATOM   2893 O O   . ASP A 1 383 ? -39.619 36.240  -60.203 1.00 42.25  ? 384  ASP A O   1 
ATOM   2894 C CB  . ASP A 1 383 ? -42.402 36.732  -59.391 1.00 41.96  ? 384  ASP A CB  1 
ATOM   2895 C CG  . ASP A 1 383 ? -42.985 37.089  -60.766 1.00 48.73  ? 384  ASP A CG  1 
ATOM   2896 O OD1 . ASP A 1 383 ? -43.956 37.875  -60.808 1.00 51.54  ? 384  ASP A OD1 1 
ATOM   2897 O OD2 . ASP A 1 383 ? -42.481 36.601  -61.805 1.00 51.68  ? 384  ASP A OD2 1 
ATOM   2898 N N   . TRP A 1 384 ? -40.416 34.383  -61.190 1.00 35.99  ? 385  TRP A N   1 
ATOM   2899 C CA  . TRP A 1 384 ? -39.219 34.222  -62.006 1.00 37.32  ? 385  TRP A CA  1 
ATOM   2900 C C   . TRP A 1 384 ? -39.164 35.184  -63.182 1.00 40.05  ? 385  TRP A C   1 
ATOM   2901 O O   . TRP A 1 384 ? -38.186 35.155  -63.937 1.00 41.12  ? 385  TRP A O   1 
ATOM   2902 C CB  . TRP A 1 384 ? -39.103 32.768  -62.462 1.00 37.45  ? 385  TRP A CB  1 
ATOM   2903 C CG  . TRP A 1 384 ? -38.930 31.885  -61.268 1.00 41.15  ? 385  TRP A CG  1 
ATOM   2904 C CD1 . TRP A 1 384 ? -39.900 31.184  -60.618 1.00 40.32  ? 385  TRP A CD1 1 
ATOM   2905 C CD2 . TRP A 1 384 ? -37.721 31.670  -60.534 1.00 43.61  ? 385  TRP A CD2 1 
ATOM   2906 N NE1 . TRP A 1 384 ? -39.367 30.522  -59.539 1.00 39.76  ? 385  TRP A NE1 1 
ATOM   2907 C CE2 . TRP A 1 384 ? -38.028 30.803  -59.468 1.00 42.90  ? 385  TRP A CE2 1 
ATOM   2908 C CE3 . TRP A 1 384 ? -36.404 32.117  -60.684 1.00 46.19  ? 385  TRP A CE3 1 
ATOM   2909 C CZ2 . TRP A 1 384 ? -37.069 30.374  -58.556 1.00 48.74  ? 385  TRP A CZ2 1 
ATOM   2910 C CZ3 . TRP A 1 384 ? -35.451 31.690  -59.777 1.00 42.60  ? 385  TRP A CZ3 1 
ATOM   2911 C CH2 . TRP A 1 384 ? -35.789 30.825  -58.728 1.00 49.08  ? 385  TRP A CH2 1 
ATOM   2912 N N   . LEU A 1 385 ? -40.167 36.049  -63.341 1.00 40.57  ? 386  LEU A N   1 
ATOM   2913 C CA  . LEU A 1 385 ? -40.040 37.202  -64.223 1.00 46.05  ? 386  LEU A CA  1 
ATOM   2914 C C   . LEU A 1 385 ? -39.502 38.424  -63.498 1.00 42.78  ? 386  LEU A C   1 
ATOM   2915 O O   . LEU A 1 385 ? -39.016 39.355  -64.152 1.00 41.53  ? 386  LEU A O   1 
ATOM   2916 C CB  . LEU A 1 385 ? -41.393 37.546  -64.851 1.00 53.62  ? 386  LEU A CB  1 
ATOM   2917 C CG  . LEU A 1 385 ? -41.889 36.564  -65.913 1.00 55.41  ? 386  LEU A CG  1 
ATOM   2918 C CD1 . LEU A 1 385 ? -43.213 37.028  -66.501 1.00 58.13  ? 386  LEU A CD1 1 
ATOM   2919 C CD2 . LEU A 1 385 ? -40.836 36.385  -66.997 1.00 53.83  ? 386  LEU A CD2 1 
ATOM   2920 N N   . HIS A 1 386 ? -39.580 38.436  -62.164 1.00 44.41  ? 387  HIS A N   1 
ATOM   2921 C CA  . HIS A 1 386 ? -39.085 39.542  -61.342 1.00 42.11  ? 387  HIS A CA  1 
ATOM   2922 C C   . HIS A 1 386 ? -38.394 38.979  -60.105 1.00 45.79  ? 387  HIS A C   1 
ATOM   2923 O O   . HIS A 1 386 ? -38.785 39.267  -58.971 1.00 34.91  ? 387  HIS A O   1 
ATOM   2924 C CB  . HIS A 1 386 ? -40.232 40.474  -60.952 1.00 41.23  ? 387  HIS A CB  1 
ATOM   2925 C CG  . HIS A 1 386 ? -41.033 40.962  -62.117 1.00 46.61  ? 387  HIS A CG  1 
ATOM   2926 N ND1 . HIS A 1 386 ? -40.710 42.106  -62.811 1.00 53.14  ? 387  HIS A ND1 1 
ATOM   2927 C CD2 . HIS A 1 386 ? -42.135 40.455  -62.718 1.00 50.92  ? 387  HIS A CD2 1 
ATOM   2928 C CE1 . HIS A 1 386 ? -41.578 42.286  -63.790 1.00 53.07  ? 387  HIS A CE1 1 
ATOM   2929 N NE2 . HIS A 1 386 ? -42.453 41.297  -63.757 1.00 51.72  ? 387  HIS A NE2 1 
ATOM   2930 N N   . PRO A 1 387 ? -37.345 38.171  -60.290 1.00 48.58  ? 388  PRO A N   1 
ATOM   2931 C CA  . PRO A 1 387 ? -36.791 37.427  -59.144 1.00 39.87  ? 388  PRO A CA  1 
ATOM   2932 C C   . PRO A 1 387 ? -36.126 38.295  -58.090 1.00 46.10  ? 388  PRO A C   1 
ATOM   2933 O O   . PRO A 1 387 ? -35.929 37.820  -56.965 1.00 46.87  ? 388  PRO A O   1 
ATOM   2934 C CB  . PRO A 1 387 ? -35.776 36.480  -59.798 1.00 41.36  ? 388  PRO A CB  1 
ATOM   2935 C CG  . PRO A 1 387 ? -35.390 37.166  -61.071 1.00 44.94  ? 388  PRO A CG  1 
ATOM   2936 C CD  . PRO A 1 387 ? -36.615 37.891  -61.541 1.00 37.62  ? 388  PRO A CD  1 
ATOM   2937 N N   . GLU A 1 388 ? -35.782 39.545  -58.399 1.00 43.85  ? 389  GLU A N   1 
ATOM   2938 C CA  . GLU A 1 388 ? -34.990 40.366  -57.490 1.00 49.48  ? 389  GLU A CA  1 
ATOM   2939 C C   . GLU A 1 388 ? -35.676 41.677  -57.124 1.00 48.21  ? 389  GLU A C   1 
ATOM   2940 O O   . GLU A 1 388 ? -35.020 42.584  -56.606 1.00 52.62  ? 389  GLU A O   1 
ATOM   2941 C CB  . GLU A 1 388 ? -33.613 40.647  -58.094 1.00 59.76  ? 389  GLU A CB  1 
ATOM   2942 C CG  . GLU A 1 388 ? -32.988 39.445  -58.773 1.00 74.61  ? 389  GLU A CG  1 
ATOM   2943 C CD  . GLU A 1 388 ? -31.566 39.193  -58.319 1.00 88.74  ? 389  GLU A CD  1 
ATOM   2944 O OE1 . GLU A 1 388 ? -30.944 38.234  -58.823 1.00 94.21  ? 389  GLU A OE1 1 
ATOM   2945 O OE2 . GLU A 1 388 ? -31.072 39.952  -57.460 1.00 94.88  ? 389  GLU A OE2 1 
ATOM   2946 N N   . ASP A 1 389 ? -36.969 41.802  -57.378 1.00 36.82  ? 390  ASP A N   1 
ATOM   2947 C CA  . ASP A 1 389 ? -37.666 43.046  -57.068 1.00 45.39  ? 390  ASP A CA  1 
ATOM   2948 C C   . ASP A 1 389 ? -37.833 43.185  -55.556 1.00 45.39  ? 390  ASP A C   1 
ATOM   2949 O O   . ASP A 1 389 ? -38.548 42.378  -54.948 1.00 41.34  ? 390  ASP A O   1 
ATOM   2950 C CB  . ASP A 1 389 ? -39.019 43.072  -57.774 1.00 49.05  ? 390  ASP A CB  1 
ATOM   2951 C CG  . ASP A 1 389 ? -39.812 44.335  -57.483 1.00 63.68  ? 390  ASP A CG  1 
ATOM   2952 O OD1 . ASP A 1 389 ? -39.233 45.311  -56.966 1.00 72.69  ? 390  ASP A OD1 1 
ATOM   2953 O OD2 . ASP A 1 389 ? -41.028 44.348  -57.767 1.00 69.78  ? 390  ASP A OD2 1 
ATOM   2954 N N   . PRO A 1 390 ? -37.213 44.184  -54.915 1.00 48.28  ? 391  PRO A N   1 
ATOM   2955 C CA  . PRO A 1 390 ? -37.277 44.260  -53.444 1.00 42.69  ? 391  PRO A CA  1 
ATOM   2956 C C   . PRO A 1 390 ? -38.690 44.317  -52.895 1.00 41.09  ? 391  PRO A C   1 
ATOM   2957 O O   . PRO A 1 390 ? -38.993 43.620  -51.920 1.00 43.32  ? 391  PRO A O   1 
ATOM   2958 C CB  . PRO A 1 390 ? -36.495 45.543  -53.126 1.00 43.58  ? 391  PRO A CB  1 
ATOM   2959 C CG  . PRO A 1 390 ? -35.612 45.751  -54.310 1.00 43.93  ? 391  PRO A CG  1 
ATOM   2960 C CD  . PRO A 1 390 ? -36.407 45.276  -55.487 1.00 43.05  ? 391  PRO A CD  1 
ATOM   2961 N N   . ALA A 1 391 ? -39.572 45.118  -53.498 1.00 42.07  ? 392  ALA A N   1 
ATOM   2962 C CA  . ALA A 1 391 ? -40.947 45.190  -53.013 1.00 41.13  ? 392  ALA A CA  1 
ATOM   2963 C C   . ALA A 1 391 ? -41.652 43.842  -53.135 1.00 43.09  ? 392  ALA A C   1 
ATOM   2964 O O   . ALA A 1 391 ? -42.395 43.438  -52.234 1.00 44.56  ? 392  ALA A O   1 
ATOM   2965 C CB  . ALA A 1 391 ? -41.714 46.272  -53.776 1.00 40.20  ? 392  ALA A CB  1 
ATOM   2966 N N   . ARG A 1 392 ? -41.432 43.133  -54.246 1.00 47.98  ? 393  ARG A N   1 
ATOM   2967 C CA  . ARG A 1 392 ? -42.031 41.813  -54.419 1.00 46.00  ? 393  ARG A CA  1 
ATOM   2968 C C   . ARG A 1 392 ? -41.422 40.796  -53.462 1.00 40.56  ? 393  ARG A C   1 
ATOM   2969 O O   . ARG A 1 392 ? -42.121 39.901  -52.970 1.00 34.32  ? 393  ARG A O   1 
ATOM   2970 C CB  . ARG A 1 392 ? -41.865 41.348  -55.868 1.00 42.47  ? 393  ARG A CB  1 
ATOM   2971 C CG  . ARG A 1 392 ? -42.893 41.910  -56.837 1.00 41.42  ? 393  ARG A CG  1 
ATOM   2972 C CD  . ARG A 1 392 ? -42.569 41.470  -58.262 1.00 44.75  ? 393  ARG A CD  1 
ATOM   2973 N NE  . ARG A 1 392 ? -43.627 41.800  -59.214 1.00 52.96  ? 393  ARG A NE  1 
ATOM   2974 C CZ  . ARG A 1 392 ? -43.506 42.698  -60.189 1.00 62.14  ? 393  ARG A CZ  1 
ATOM   2975 N NH1 . ARG A 1 392 ? -42.371 43.366  -60.346 1.00 62.55  ? 393  ARG A NH1 1 
ATOM   2976 N NH2 . ARG A 1 392 ? -44.519 42.924  -61.014 1.00 68.81  ? 393  ARG A NH2 1 
ATOM   2977 N N   . LEU A 1 393 ? -40.116 40.909  -53.196 1.00 36.56  ? 394  LEU A N   1 
ATOM   2978 C CA  . LEU A 1 393 ? -39.468 40.007  -52.248 1.00 36.84  ? 394  LEU A CA  1 
ATOM   2979 C C   . LEU A 1 393 ? -40.006 40.209  -50.838 1.00 38.73  ? 394  LEU A C   1 
ATOM   2980 O O   . LEU A 1 393 ? -40.271 39.239  -50.114 1.00 31.11  ? 394  LEU A O   1 
ATOM   2981 C CB  . LEU A 1 393 ? -37.960 40.227  -52.276 1.00 39.39  ? 394  LEU A CB  1 
ATOM   2982 C CG  . LEU A 1 393 ? -37.283 39.826  -53.579 1.00 39.93  ? 394  LEU A CG  1 
ATOM   2983 C CD1 . LEU A 1 393 ? -35.842 40.289  -53.572 1.00 39.89  ? 394  LEU A CD1 1 
ATOM   2984 C CD2 . LEU A 1 393 ? -37.373 38.319  -53.750 1.00 31.40  ? 394  LEU A CD2 1 
ATOM   2985 N N   . ARG A 1 394 ? -40.256 41.447  -50.442 1.00 41.31  ? 395  ARG A N   1 
ATOM   2986 C CA  . ARG A 1 394 ? -40.793 41.736  -49.134 1.00 43.74  ? 395  ARG A CA  1 
ATOM   2987 C C   . ARG A 1 394 ? -42.167 41.154  -48.951 1.00 39.92  ? 395  ARG A C   1 
ATOM   2988 O O   . ARG A 1 394 ? -42.462 40.560  -47.974 1.00 33.74  ? 395  ARG A O   1 
ATOM   2989 C CB  . ARG A 1 394 ? -40.850 43.220  -48.894 1.00 50.67  ? 395  ARG A CB  1 
ATOM   2990 C CG  . ARG A 1 394 ? -41.449 43.596  -47.569 1.00 49.68  ? 395  ARG A CG  1 
ATOM   2991 C CD  . ARG A 1 394 ? -41.767 45.058  -47.478 1.00 50.04  ? 395  ARG A CD  1 
ATOM   2992 N NE  . ARG A 1 394 ? -42.778 45.437  -48.416 1.00 48.38  ? 395  ARG A NE  1 
ATOM   2993 C CZ  . ARG A 1 394 ? -42.916 46.655  -48.881 1.00 53.87  ? 395  ARG A CZ  1 
ATOM   2994 N NH1 . ARG A 1 394 ? -43.856 46.915  -49.727 1.00 51.92  ? 395  ARG A NH1 1 
ATOM   2995 N NH2 . ARG A 1 394 ? -42.106 47.596  -48.513 1.00 58.94  ? 395  ARG A NH2 1 
ATOM   2996 N N   . GLU A 1 395 ? -42.999 41.312  -49.949 1.00 38.25  ? 396  GLU A N   1 
ATOM   2997 C CA  . GLU A 1 395 ? -44.322 40.757  -49.958 1.00 39.84  ? 396  GLU A CA  1 
ATOM   2998 C C   . GLU A 1 395 ? -44.346 39.238  -49.950 1.00 41.85  ? 396  GLU A C   1 
ATOM   2999 O O   . GLU A 1 395 ? -45.172 38.640  -49.326 1.00 41.09  ? 396  GLU A O   1 
ATOM   3000 C CB  . GLU A 1 395 ? -45.084 41.264  -51.152 1.00 44.50  ? 396  GLU A CB  1 
ATOM   3001 C CG  . GLU A 1 395 ? -46.235 42.188  -50.861 1.00 75.59  ? 396  GLU A CG  1 
ATOM   3002 C CD  . GLU A 1 395 ? -45.823 43.585  -50.427 1.00 106.06 ? 396  GLU A CD  1 
ATOM   3003 O OE1 . GLU A 1 395 ? -45.903 44.512  -51.241 1.00 124.83 ? 396  GLU A OE1 1 
ATOM   3004 O OE2 . GLU A 1 395 ? -45.424 43.771  -49.270 1.00 124.50 ? 396  GLU A OE2 1 
ATOM   3005 N N   . ALA A 1 396 ? -43.456 38.628  -50.700 1.00 39.38  ? 397  ALA A N   1 
ATOM   3006 C CA  . ALA A 1 396 ? -43.367 37.177  -50.757 1.00 37.28  ? 397  ALA A CA  1 
ATOM   3007 C C   . ALA A 1 396 ? -42.899 36.616  -49.426 1.00 34.74  ? 397  ALA A C   1 
ATOM   3008 O O   . ALA A 1 396 ? -43.422 35.601  -48.958 1.00 38.25  ? 397  ALA A O   1 
ATOM   3009 C CB  . ALA A 1 396 ? -42.427 36.753  -51.886 1.00 29.24  ? 397  ALA A CB  1 
ATOM   3010 N N   . LEU A 1 397 ? -41.923 37.274  -48.795 1.00 34.54  ? 398  LEU A N   1 
ATOM   3011 C CA  . LEU A 1 397 ? -41.468 36.830  -47.483 1.00 37.83  ? 398  LEU A CA  1 
ATOM   3012 C C   . LEU A 1 397 ? -42.600 36.884  -46.467 1.00 38.49  ? 398  LEU A C   1 
ATOM   3013 O O   . LEU A 1 397 ? -42.738 35.982  -45.632 1.00 30.58  ? 398  LEU A O   1 
ATOM   3014 C CB  . LEU A 1 397 ? -40.284 37.675  -47.010 1.00 39.71  ? 398  LEU A CB  1 
ATOM   3015 C CG  . LEU A 1 397 ? -39.564 37.110  -45.779 1.00 40.40  ? 398  LEU A CG  1 
ATOM   3016 C CD1 . LEU A 1 397 ? -39.366 35.606  -45.925 1.00 36.27  ? 398  LEU A CD1 1 
ATOM   3017 C CD2 . LEU A 1 397 ? -38.233 37.798  -45.523 1.00 42.70  ? 398  LEU A CD2 1 
ATOM   3018 N N   . SER A 1 398 ? -43.429 37.929  -46.532 1.00 31.58  ? 399  SER A N   1 
ATOM   3019 C CA  . SER A 1 398 ? -44.569 38.025  -45.628 1.00 36.83  ? 399  SER A CA  1 
ATOM   3020 C C   . SER A 1 398 ? -45.540 36.872  -45.845 1.00 38.36  ? 399  SER A C   1 
ATOM   3021 O O   . SER A 1 398 ? -46.063 36.299  -44.881 1.00 33.55  ? 399  SER A O   1 
ATOM   3022 C CB  . SER A 1 398 ? -45.276 39.367  -45.821 1.00 35.32  ? 399  SER A CB  1 
ATOM   3023 O OG  . SER A 1 398 ? -46.325 39.521  -44.881 1.00 42.51  ? 399  SER A OG  1 
ATOM   3024 N N   . ASP A 1 399 ? -45.791 36.519  -47.107 1.00 31.43  ? 400  ASP A N   1 
ATOM   3025 C CA  . ASP A 1 399 ? -46.700 35.417  -47.397 1.00 34.49  ? 400  ASP A CA  1 
ATOM   3026 C C   . ASP A 1 399 ? -46.105 34.077  -46.978 1.00 33.08  ? 400  ASP A C   1 
ATOM   3027 O O   . ASP A 1 399 ? -46.831 33.205  -46.494 1.00 31.43  ? 400  ASP A O   1 
ATOM   3028 C CB  . ASP A 1 399 ? -47.073 35.407  -48.883 1.00 34.05  ? 400  ASP A CB  1 
ATOM   3029 C CG  . ASP A 1 399 ? -47.776 36.683  -49.321 1.00 46.21  ? 400  ASP A CG  1 
ATOM   3030 O OD1 . ASP A 1 399 ? -48.477 37.296  -48.486 1.00 56.85  ? 400  ASP A OD1 1 
ATOM   3031 O OD2 . ASP A 1 399 ? -47.661 37.053  -50.506 1.00 54.75  ? 400  ASP A OD2 1 
ATOM   3032 N N   . VAL A 1 400 ? -44.792 33.895  -47.160 1.00 27.91  ? 401  VAL A N   1 
ATOM   3033 C CA  . VAL A 1 400 ? -44.122 32.678  -46.696 1.00 29.16  ? 401  VAL A CA  1 
ATOM   3034 C C   . VAL A 1 400 ? -44.388 32.472  -45.211 1.00 37.76  ? 401  VAL A C   1 
ATOM   3035 O O   . VAL A 1 400 ? -44.878 31.423  -44.771 1.00 32.34  ? 401  VAL A O   1 
ATOM   3036 C CB  . VAL A 1 400 ? -42.609 32.756  -46.965 1.00 30.38  ? 401  VAL A CB  1 
ATOM   3037 C CG1 . VAL A 1 400 ? -41.885 31.643  -46.221 1.00 23.56  ? 401  VAL A CG1 1 
ATOM   3038 C CG2 . VAL A 1 400 ? -42.309 32.692  -48.453 1.00 24.49  ? 401  VAL A CG2 1 
ATOM   3039 N N   . VAL A 1 401 ? -44.065 33.490  -44.420 1.00 36.77  ? 402  VAL A N   1 
ATOM   3040 C CA  . VAL A 1 401 ? -44.154 33.373  -42.974 1.00 31.10  ? 402  VAL A CA  1 
ATOM   3041 C C   . VAL A 1 401 ? -45.603 33.223  -42.538 1.00 29.78  ? 402  VAL A C   1 
ATOM   3042 O O   . VAL A 1 401 ? -45.925 32.384  -41.688 1.00 28.92  ? 402  VAL A O   1 
ATOM   3043 C CB  . VAL A 1 401 ? -43.473 34.589  -42.332 1.00 34.01  ? 402  VAL A CB  1 
ATOM   3044 C CG1 . VAL A 1 401 ? -43.819 34.677  -40.874 1.00 33.05  ? 402  VAL A CG1 1 
ATOM   3045 C CG2 . VAL A 1 401 ? -41.972 34.497  -42.545 1.00 31.22  ? 402  VAL A CG2 1 
ATOM   3046 N N   . GLY A 1 402 ? -46.504 34.001  -43.140 1.00 23.68  ? 403  GLY A N   1 
ATOM   3047 C CA  . GLY A 1 402 ? -47.904 33.920  -42.764 1.00 22.80  ? 403  GLY A CA  1 
ATOM   3048 C C   . GLY A 1 402 ? -48.575 32.635  -43.213 1.00 32.79  ? 403  GLY A C   1 
ATOM   3049 O O   . GLY A 1 402 ? -49.364 32.049  -42.464 1.00 34.62  ? 403  GLY A O   1 
ATOM   3050 N N   . ASP A 1 403 ? -48.293 32.189  -44.447 1.00 25.08  ? 404  ASP A N   1 
ATOM   3051 C CA  . ASP A 1 403 ? -48.882 30.941  -44.933 1.00 28.00  ? 404  ASP A CA  1 
ATOM   3052 C C   . ASP A 1 403 ? -48.452 29.768  -44.065 1.00 28.93  ? 404  ASP A C   1 
ATOM   3053 O O   . ASP A 1 403 ? -49.284 28.979  -43.602 1.00 29.04  ? 404  ASP A O   1 
ATOM   3054 C CB  . ASP A 1 403 ? -48.483 30.671  -46.393 1.00 29.81  ? 404  ASP A CB  1 
ATOM   3055 C CG  . ASP A 1 403 ? -49.105 31.658  -47.372 1.00 34.67  ? 404  ASP A CG  1 
ATOM   3056 O OD1 . ASP A 1 403 ? -50.095 32.325  -47.005 1.00 39.65  ? 404  ASP A OD1 1 
ATOM   3057 O OD2 . ASP A 1 403 ? -48.597 31.765  -48.510 1.00 35.20  ? 404  ASP A OD2 1 
ATOM   3058 N N   . HIS A 1 404 ? -47.143 29.637  -43.847 1.00 25.13  ? 405  HIS A N   1 
ATOM   3059 C CA  . HIS A 1 404 ? -46.606 28.484  -43.138 1.00 29.13  ? 405  HIS A CA  1 
ATOM   3060 C C   . HIS A 1 404 ? -47.103 28.431  -41.697 1.00 31.20  ? 405  HIS A C   1 
ATOM   3061 O O   . HIS A 1 404 ? -47.411 27.353  -41.176 1.00 29.18  ? 405  HIS A O   1 
ATOM   3062 C CB  . HIS A 1 404 ? -45.080 28.535  -43.186 1.00 26.25  ? 405  HIS A CB  1 
ATOM   3063 C CG  . HIS A 1 404 ? -44.407 27.513  -42.326 1.00 32.35  ? 405  HIS A CG  1 
ATOM   3064 N ND1 . HIS A 1 404 ? -44.641 26.160  -42.454 1.00 34.50  ? 405  HIS A ND1 1 
ATOM   3065 C CD2 . HIS A 1 404 ? -43.490 27.646  -41.338 1.00 31.70  ? 405  HIS A CD2 1 
ATOM   3066 C CE1 . HIS A 1 404 ? -43.895 25.503  -41.583 1.00 30.92  ? 405  HIS A CE1 1 
ATOM   3067 N NE2 . HIS A 1 404 ? -43.191 26.381  -40.891 1.00 35.43  ? 405  HIS A NE2 1 
ATOM   3068 N N   . ASN A 1 405 ? -47.214 29.582  -41.047 1.00 28.61  ? 406  ASN A N   1 
ATOM   3069 C CA  . ASN A 1 405 ? -47.459 29.623  -39.612 1.00 31.22  ? 406  ASN A CA  1 
ATOM   3070 C C   . ASN A 1 405 ? -48.916 29.831  -39.232 1.00 31.09  ? 406  ASN A C   1 
ATOM   3071 O O   . ASN A 1 405 ? -49.328 29.362  -38.170 1.00 26.70  ? 406  ASN A O   1 
ATOM   3072 C CB  . ASN A 1 405 ? -46.600 30.724  -38.998 1.00 27.62  ? 406  ASN A CB  1 
ATOM   3073 C CG  . ASN A 1 405 ? -45.125 30.394  -39.078 1.00 35.24  ? 406  ASN A CG  1 
ATOM   3074 O OD1 . ASN A 1 405 ? -44.668 29.417  -38.486 1.00 43.87  ? 406  ASN A OD1 1 
ATOM   3075 N ND2 . ASN A 1 405 ? -44.380 31.180  -39.851 1.00 28.21  ? 406  ASN A ND2 1 
ATOM   3076 N N   . VAL A 1 406 ? -49.717 30.497  -40.065 1.00 26.80  ? 407  VAL A N   1 
ATOM   3077 C CA  . VAL A 1 406 ? -51.083 30.823  -39.669 1.00 31.82  ? 407  VAL A CA  1 
ATOM   3078 C C   . VAL A 1 406 ? -52.100 30.340  -40.700 1.00 37.32  ? 407  VAL A C   1 
ATOM   3079 O O   . VAL A 1 406 ? -52.947 29.491  -40.397 1.00 39.38  ? 407  VAL A O   1 
ATOM   3080 C CB  . VAL A 1 406 ? -51.237 32.337  -39.421 1.00 30.75  ? 407  VAL A CB  1 
ATOM   3081 C CG1 . VAL A 1 406 ? -52.643 32.656  -38.936 1.00 31.38  ? 407  VAL A CG1 1 
ATOM   3082 C CG2 . VAL A 1 406 ? -50.219 32.810  -38.406 1.00 31.43  ? 407  VAL A CG2 1 
ATOM   3083 N N   . VAL A 1 407 ? -52.031 30.873  -41.922 1.00 35.12  ? 408  VAL A N   1 
ATOM   3084 C CA  . VAL A 1 407 ? -53.132 30.692  -42.867 1.00 34.48  ? 408  VAL A CA  1 
ATOM   3085 C C   . VAL A 1 407 ? -53.296 29.221  -43.233 1.00 30.97  ? 408  VAL A C   1 
ATOM   3086 O O   . VAL A 1 407 ? -54.405 28.674  -43.198 1.00 36.40  ? 408  VAL A O   1 
ATOM   3087 C CB  . VAL A 1 407 ? -52.927 31.563  -44.119 1.00 32.33  ? 408  VAL A CB  1 
ATOM   3088 C CG1 . VAL A 1 407 ? -54.096 31.374  -45.077 1.00 25.28  ? 408  VAL A CG1 1 
ATOM   3089 C CG2 . VAL A 1 407 ? -52.799 33.023  -43.733 1.00 32.69  ? 408  VAL A CG2 1 
ATOM   3090 N N   . CYS A 1 408 ? -52.204 28.557  -43.575 1.00 24.85  ? 409  CYS A N   1 
ATOM   3091 C CA  . CYS A 1 408 ? -52.359 27.196  -44.076 1.00 27.50  ? 409  CYS A CA  1 
ATOM   3092 C C   . CYS A 1 408 ? -52.700 26.221  -42.948 1.00 30.76  ? 409  CYS A C   1 
ATOM   3093 O O   . CYS A 1 408 ? -53.537 25.333  -43.157 1.00 31.89  ? 409  CYS A O   1 
ATOM   3094 C CB  . CYS A 1 408 ? -51.109 26.775  -44.854 1.00 32.98  ? 409  CYS A CB  1 
ATOM   3095 S SG  . CYS A 1 408 ? -50.889 27.760  -46.393 1.00 39.23  ? 409  CYS A SG  1 
ATOM   3096 N N   . PRO A 1 409 ? -52.121 26.346  -41.742 1.00 31.96  ? 410  PRO A N   1 
ATOM   3097 C CA  . PRO A 1 409 ? -52.648 25.537  -40.628 1.00 27.22  ? 410  PRO A CA  1 
ATOM   3098 C C   . PRO A 1 409 ? -54.129 25.767  -40.366 1.00 26.18  ? 410  PRO A C   1 
ATOM   3099 O O   . PRO A 1 409 ? -54.859 24.799  -40.119 1.00 25.02  ? 410  PRO A O   1 
ATOM   3100 C CB  . PRO A 1 409 ? -51.774 25.964  -39.440 1.00 27.52  ? 410  PRO A CB  1 
ATOM   3101 C CG  . PRO A 1 409 ? -50.484 26.342  -40.061 1.00 30.06  ? 410  PRO A CG  1 
ATOM   3102 C CD  . PRO A 1 409 ? -50.853 27.006  -41.371 1.00 29.30  ? 410  PRO A CD  1 
ATOM   3103 N N   . VAL A 1 410 ? -54.597 27.020  -40.436 1.00 24.83  ? 411  VAL A N   1 
ATOM   3104 C CA  . VAL A 1 410 ? -56.024 27.302  -40.275 1.00 21.95  ? 411  VAL A CA  1 
ATOM   3105 C C   . VAL A 1 410 ? -56.831 26.648  -41.394 1.00 32.12  ? 411  VAL A C   1 
ATOM   3106 O O   . VAL A 1 410 ? -57.871 26.024  -41.148 1.00 35.60  ? 411  VAL A O   1 
ATOM   3107 C CB  . VAL A 1 410 ? -56.264 28.825  -40.214 1.00 26.27  ? 411  VAL A CB  1 
ATOM   3108 C CG1 . VAL A 1 410 ? -57.746 29.152  -40.378 1.00 20.61  ? 411  VAL A CG1 1 
ATOM   3109 C CG2 . VAL A 1 410 ? -55.735 29.406  -38.893 1.00 21.19  ? 411  VAL A CG2 1 
ATOM   3110 N N   . ALA A 1 411 ? -56.412 26.797  -42.628 1.00 30.67  ? 412  ALA A N   1 
ATOM   3111 C CA  . ALA A 1 411 ? -57.127 26.230  -43.743 1.00 27.99  ? 412  ALA A CA  1 
ATOM   3112 C C   . ALA A 1 411 ? -57.187 24.735  -43.692 1.00 32.31  ? 412  ALA A C   1 
ATOM   3113 O O   . ALA A 1 411 ? -58.160 24.158  -44.039 1.00 35.01  ? 412  ALA A O   1 
ATOM   3114 C CB  . ALA A 1 411 ? -56.529 26.697  -45.040 1.00 25.45  ? 412  ALA A CB  1 
ATOM   3115 N N   . GLN A 1 412 ? -56.116 24.110  -43.293 1.00 30.45  ? 413  GLN A N   1 
ATOM   3116 C CA  . GLN A 1 412 ? -56.153 22.699  -43.171 1.00 32.21  ? 413  GLN A CA  1 
ATOM   3117 C C   . GLN A 1 412 ? -57.153 22.218  -42.131 1.00 40.28  ? 413  GLN A C   1 
ATOM   3118 O O   . GLN A 1 412 ? -57.853 21.293  -42.360 1.00 39.87  ? 413  GLN A O   1 
ATOM   3119 C CB  . GLN A 1 412 ? -54.814 22.183  -42.828 1.00 35.02  ? 413  GLN A CB  1 
ATOM   3120 C CG  . GLN A 1 412 ? -54.927 20.814  -42.298 1.00 37.85  ? 413  GLN A CG  1 
ATOM   3121 C CD  . GLN A 1 412 ? -54.108 19.896  -43.074 1.00 66.97  ? 413  GLN A CD  1 
ATOM   3122 O OE1 . GLN A 1 412 ? -54.614 19.181  -43.920 1.00 76.74  ? 413  GLN A OE1 1 
ATOM   3123 N NE2 . GLN A 1 412 ? -52.810 19.944  -42.849 1.00 77.82  ? 413  GLN A NE2 1 
ATOM   3124 N N   . LEU A 1 413 ? -57.189 22.862  -40.983 1.00 32.86  ? 414  LEU A N   1 
ATOM   3125 C CA  . LEU A 1 413 ? -58.116 22.529  -39.952 1.00 35.19  ? 414  LEU A CA  1 
ATOM   3126 C C   . LEU A 1 413 ? -59.546 22.773  -40.390 1.00 36.07  ? 414  LEU A C   1 
ATOM   3127 O O   . LEU A 1 413 ? -60.391 21.969  -40.204 1.00 33.93  ? 414  LEU A O   1 
ATOM   3128 C CB  . LEU A 1 413 ? -57.786 23.318  -38.697 1.00 35.36  ? 414  LEU A CB  1 
ATOM   3129 C CG  . LEU A 1 413 ? -58.735 23.277  -37.524 1.00 38.76  ? 414  LEU A CG  1 
ATOM   3130 C CD1 . LEU A 1 413 ? -57.988 23.322  -36.234 1.00 40.34  ? 414  LEU A CD1 1 
ATOM   3131 C CD2 . LEU A 1 413 ? -59.612 24.470  -37.602 1.00 43.44  ? 414  LEU A CD2 1 
ATOM   3132 N N   . ALA A 1 414 ? -59.784 23.893  -41.016 1.00 35.74  ? 415  ALA A N   1 
ATOM   3133 C CA  . ALA A 1 414 ? -61.123 24.214  -41.502 1.00 34.35  ? 415  ALA A CA  1 
ATOM   3134 C C   . ALA A 1 414 ? -61.610 23.171  -42.499 1.00 37.12  ? 415  ALA A C   1 
ATOM   3135 O O   . ALA A 1 414 ? -62.748 22.693  -42.411 1.00 39.13  ? 415  ALA A O   1 
ATOM   3136 C CB  . ALA A 1 414 ? -61.125 25.604  -42.138 1.00 36.23  ? 415  ALA A CB  1 
ATOM   3137 N N   . GLY A 1 415 ? -60.754 22.799  -43.453 1.00 31.82  ? 416  GLY A N   1 
ATOM   3138 C CA  . GLY A 1 415 ? -61.156 21.826  -44.457 1.00 34.10  ? 416  GLY A CA  1 
ATOM   3139 C C   . GLY A 1 415 ? -61.419 20.448  -43.880 1.00 37.95  ? 416  GLY A C   1 
ATOM   3140 O O   . GLY A 1 415 ? -62.395 19.788  -44.248 1.00 46.54  ? 416  GLY A O   1 
ATOM   3141 N N   . ARG A 1 416 ? -60.560 19.994  -42.966 1.00 35.53  ? 417  ARG A N   1 
ATOM   3142 C CA  . ARG A 1 416 ? -60.753 18.671  -42.382 1.00 39.04  ? 417  ARG A CA  1 
ATOM   3143 C C   . ARG A 1 416 ? -61.990 18.633  -41.494 1.00 45.87  ? 417  ARG A C   1 
ATOM   3144 O O   . ARG A 1 416 ? -62.757 17.662  -41.529 1.00 46.09  ? 417  ARG A O   1 
ATOM   3145 C CB  . ARG A 1 416 ? -59.505 18.261  -41.603 1.00 37.81  ? 417  ARG A CB  1 
ATOM   3146 C CG  . ARG A 1 416 ? -58.396 17.746  -42.492 1.00 45.33  ? 417  ARG A CG  1 
ATOM   3147 C CD  . ARG A 1 416 ? -58.936 16.664  -43.408 1.00 48.86  ? 417  ARG A CD  1 
ATOM   3148 N NE  . ARG A 1 416 ? -57.877 15.874  -44.022 1.00 59.59  ? 417  ARG A NE  1 
ATOM   3149 C CZ  . ARG A 1 416 ? -57.682 14.579  -43.796 1.00 64.63  ? 417  ARG A CZ  1 
ATOM   3150 N NH1 . ARG A 1 416 ? -58.480 13.914  -42.968 1.00 60.83  ? 417  ARG A NH1 1 
ATOM   3151 N NH2 . ARG A 1 416 ? -56.688 13.947  -44.405 1.00 72.83  ? 417  ARG A NH2 1 
ATOM   3152 N N   . LEU A 1 417 ? -62.211 19.686  -40.704 1.00 40.63  ? 418  LEU A N   1 
ATOM   3153 C CA  . LEU A 1 417 ? -63.389 19.735  -39.845 1.00 37.64  ? 418  LEU A CA  1 
ATOM   3154 C C   . LEU A 1 417 ? -64.671 19.741  -40.674 1.00 43.25  ? 418  LEU A C   1 
ATOM   3155 O O   . LEU A 1 417 ? -65.619 18.998  -40.383 1.00 43.06  ? 418  LEU A O   1 
ATOM   3156 C CB  . LEU A 1 417 ? -63.318 20.964  -38.934 1.00 34.65  ? 418  LEU A CB  1 
ATOM   3157 C CG  . LEU A 1 417 ? -62.818 20.731  -37.497 1.00 43.32  ? 418  LEU A CG  1 
ATOM   3158 C CD1 . LEU A 1 417 ? -61.510 19.957  -37.470 1.00 46.95  ? 418  LEU A CD1 1 
ATOM   3159 C CD2 . LEU A 1 417 ? -62.655 22.046  -36.774 1.00 35.49  ? 418  LEU A CD2 1 
ATOM   3160 N N   . ALA A 1 418 ? -64.714 20.571  -41.721 1.00 40.05  ? 419  ALA A N   1 
ATOM   3161 C CA  . ALA A 1 418 ? -65.888 20.622  -42.591 1.00 40.13  ? 419  ALA A CA  1 
ATOM   3162 C C   . ALA A 1 418 ? -66.173 19.262  -43.212 1.00 43.79  ? 419  ALA A C   1 
ATOM   3163 O O   . ALA A 1 418 ? -67.322 18.807  -43.243 1.00 49.03  ? 419  ALA A O   1 
ATOM   3164 C CB  . ALA A 1 418 ? -65.685 21.672  -43.684 1.00 36.19  ? 419  ALA A CB  1 
ATOM   3165 N N   . ALA A 1 419 ? -65.131 18.592  -43.707 1.00 43.56  ? 420  ALA A N   1 
ATOM   3166 C CA  . ALA A 1 419 ? -65.317 17.300  -44.356 1.00 46.05  ? 420  ALA A CA  1 
ATOM   3167 C C   . ALA A 1 419 ? -65.697 16.202  -43.374 1.00 52.94  ? 420  ALA A C   1 
ATOM   3168 O O   . ALA A 1 419 ? -66.257 15.183  -43.791 1.00 56.39  ? 420  ALA A O   1 
ATOM   3169 C CB  . ALA A 1 419 ? -64.045 16.909  -45.111 1.00 39.85  ? 420  ALA A CB  1 
ATOM   3170 N N   . GLN A 1 420 ? -65.426 16.388  -42.083 1.00 53.87  ? 421  GLN A N   1 
ATOM   3171 C CA  . GLN A 1 420 ? -65.614 15.337  -41.093 1.00 50.38  ? 421  GLN A CA  1 
ATOM   3172 C C   . GLN A 1 420 ? -66.759 15.633  -40.126 1.00 50.71  ? 421  GLN A C   1 
ATOM   3173 O O   . GLN A 1 420 ? -66.765 15.135  -38.997 1.00 54.16  ? 421  GLN A O   1 
ATOM   3174 C CB  . GLN A 1 420 ? -64.315 15.098  -40.331 1.00 49.34  ? 421  GLN A CB  1 
ATOM   3175 C CG  . GLN A 1 420 ? -63.380 14.125  -41.024 1.00 53.96  ? 421  GLN A CG  1 
ATOM   3176 C CD  . GLN A 1 420 ? -61.927 14.512  -40.865 1.00 58.74  ? 421  GLN A CD  1 
ATOM   3177 O OE1 . GLN A 1 420 ? -61.213 14.719  -41.847 1.00 60.05  ? 421  GLN A OE1 1 
ATOM   3178 N NE2 . GLN A 1 420 ? -61.483 14.627  -39.618 1.00 59.70  ? 421  GLN A NE2 1 
ATOM   3179 N N   . GLY A 1 421 ? -67.737 16.437  -40.544 1.00 48.48  ? 422  GLY A N   1 
ATOM   3180 C CA  . GLY A 1 421 ? -68.992 16.546  -39.818 1.00 48.06  ? 422  GLY A CA  1 
ATOM   3181 C C   . GLY A 1 421 ? -69.273 17.880  -39.157 1.00 50.30  ? 422  GLY A C   1 
ATOM   3182 O O   . GLY A 1 421 ? -70.409 18.099  -38.721 1.00 55.57  ? 422  GLY A O   1 
ATOM   3183 N N   . ALA A 1 422 ? -68.301 18.775  -39.058 1.00 44.17  ? 423  ALA A N   1 
ATOM   3184 C CA  . ALA A 1 422 ? -68.540 20.064  -38.426 1.00 48.52  ? 423  ALA A CA  1 
ATOM   3185 C C   . ALA A 1 422 ? -69.035 21.088  -39.446 1.00 48.95  ? 423  ALA A C   1 
ATOM   3186 O O   . ALA A 1 422 ? -68.788 20.971  -40.648 1.00 44.67  ? 423  ALA A O   1 
ATOM   3187 C CB  . ALA A 1 422 ? -67.263 20.568  -37.756 1.00 47.64  ? 423  ALA A CB  1 
ATOM   3188 N N   . ARG A 1 423 ? -69.688 22.132  -38.955 1.00 45.87  ? 424  ARG A N   1 
ATOM   3189 C CA  . ARG A 1 423 ? -70.127 23.233  -39.781 1.00 46.54  ? 424  ARG A CA  1 
ATOM   3190 C C   . ARG A 1 423 ? -69.098 24.332  -39.529 1.00 45.69  ? 424  ARG A C   1 
ATOM   3191 O O   . ARG A 1 423 ? -68.901 24.704  -38.416 1.00 39.24  ? 424  ARG A O   1 
ATOM   3192 C CB  . ARG A 1 423 ? -71.532 23.679  -39.416 1.00 49.42  ? 424  ARG A CB  1 
ATOM   3193 C CG  . ARG A 1 423 ? -72.115 24.703  -40.372 1.00 67.80  ? 424  ARG A CG  1 
ATOM   3194 C CD  . ARG A 1 423 ? -73.628 24.711  -40.469 1.00 83.78  ? 424  ARG A CD  1 
ATOM   3195 N NE  . ARG A 1 423 ? -74.235 25.651  -39.533 1.00 100.23 ? 424  ARG A NE  1 
ATOM   3196 C CZ  . ARG A 1 423 ? -74.934 25.311  -38.458 1.00 104.13 ? 424  ARG A CZ  1 
ATOM   3197 N NH1 . ARG A 1 423 ? -75.157 24.041  -38.166 1.00 108.02 ? 424  ARG A NH1 1 
ATOM   3198 N NH2 . ARG A 1 423 ? -75.415 26.245  -37.677 1.00 96.92  ? 424  ARG A NH2 1 
ATOM   3199 N N   . VAL A 1 424 ? -68.473 24.843  -40.585 1.00 40.26  ? 425  VAL A N   1 
ATOM   3200 C CA  . VAL A 1 424 ? -67.387 25.807  -40.476 1.00 39.08  ? 425  VAL A CA  1 
ATOM   3201 C C   . VAL A 1 424 ? -67.831 27.133  -41.074 1.00 42.45  ? 425  VAL A C   1 
ATOM   3202 O O   . VAL A 1 424 ? -68.562 27.166  -42.070 1.00 45.55  ? 425  VAL A O   1 
ATOM   3203 C CB  . VAL A 1 424 ? -66.114 25.304  -41.181 1.00 40.21  ? 425  VAL A CB  1 
ATOM   3204 C CG1 . VAL A 1 424 ? -64.983 26.311  -41.022 1.00 27.92  ? 425  VAL A CG1 1 
ATOM   3205 C CG2 . VAL A 1 424 ? -65.717 23.945  -40.657 1.00 29.06  ? 425  VAL A CG2 1 
ATOM   3206 N N   . TYR A 1 425 ? -67.385 28.224  -40.461 1.00 36.31  ? 426  TYR A N   1 
ATOM   3207 C CA  . TYR A 1 425 ? -67.469 29.552  -41.043 1.00 33.91  ? 426  TYR A CA  1 
ATOM   3208 C C   . TYR A 1 425 ? -66.069 30.146  -41.066 1.00 36.26  ? 426  TYR A C   1 
ATOM   3209 O O   . TYR A 1 425 ? -65.319 30.014  -40.097 1.00 41.03  ? 426  TYR A O   1 
ATOM   3210 C CB  . TYR A 1 425 ? -68.435 30.438  -40.255 1.00 35.52  ? 426  TYR A CB  1 
ATOM   3211 C CG  . TYR A 1 425 ? -69.865 29.968  -40.359 1.00 35.63  ? 426  TYR A CG  1 
ATOM   3212 C CD1 . TYR A 1 425 ? -70.655 30.343  -41.435 1.00 30.42  ? 426  TYR A CD1 1 
ATOM   3213 C CD2 . TYR A 1 425 ? -70.421 29.134  -39.393 1.00 35.51  ? 426  TYR A CD2 1 
ATOM   3214 C CE1 . TYR A 1 425 ? -71.964 29.911  -41.547 1.00 35.74  ? 426  TYR A CE1 1 
ATOM   3215 C CE2 . TYR A 1 425 ? -71.732 28.695  -39.495 1.00 35.88  ? 426  TYR A CE2 1 
ATOM   3216 C CZ  . TYR A 1 425 ? -72.496 29.088  -40.577 1.00 41.22  ? 426  TYR A CZ  1 
ATOM   3217 O OH  . TYR A 1 425 ? -73.796 28.662  -40.696 1.00 48.24  ? 426  TYR A OH  1 
ATOM   3218 N N   . ALA A 1 426 ? -65.706 30.778  -42.182 1.00 34.26  ? 427  ALA A N   1 
ATOM   3219 C CA  . ALA A 1 426 ? -64.358 31.298  -42.360 1.00 31.27  ? 427  ALA A CA  1 
ATOM   3220 C C   . ALA A 1 426 ? -64.410 32.755  -42.787 1.00 31.89  ? 427  ALA A C   1 
ATOM   3221 O O   . ALA A 1 426 ? -65.301 33.161  -43.542 1.00 34.69  ? 427  ALA A O   1 
ATOM   3222 C CB  . ALA A 1 426 ? -63.569 30.477  -43.391 1.00 27.55  ? 427  ALA A CB  1 
ATOM   3223 N N   . TYR A 1 427 ? -63.445 33.536  -42.304 1.00 28.66  ? 428  TYR A N   1 
ATOM   3224 C CA  . TYR A 1 427 ? -63.343 34.952  -42.625 1.00 35.46  ? 428  TYR A CA  1 
ATOM   3225 C C   . TYR A 1 427 ? -61.892 35.300  -42.925 1.00 37.75  ? 428  TYR A C   1 
ATOM   3226 O O   . TYR A 1 427 ? -60.961 34.614  -42.492 1.00 30.60  ? 428  TYR A O   1 
ATOM   3227 C CB  . TYR A 1 427 ? -63.856 35.850  -41.477 1.00 32.52  ? 428  TYR A CB  1 
ATOM   3228 C CG  . TYR A 1 427 ? -62.985 35.808  -40.224 1.00 32.81  ? 428  TYR A CG  1 
ATOM   3229 C CD1 . TYR A 1 427 ? -61.851 36.614  -40.103 1.00 30.55  ? 428  TYR A CD1 1 
ATOM   3230 C CD2 . TYR A 1 427 ? -63.295 34.959  -39.165 1.00 28.53  ? 428  TYR A CD2 1 
ATOM   3231 C CE1 . TYR A 1 427 ? -61.046 36.565  -38.971 1.00 29.34  ? 428  TYR A CE1 1 
ATOM   3232 C CE2 . TYR A 1 427 ? -62.501 34.913  -38.021 1.00 32.07  ? 428  TYR A CE2 1 
ATOM   3233 C CZ  . TYR A 1 427 ? -61.374 35.714  -37.936 1.00 31.92  ? 428  TYR A CZ  1 
ATOM   3234 O OH  . TYR A 1 427 ? -60.577 35.663  -36.816 1.00 34.01  ? 428  TYR A OH  1 
ATOM   3235 N N   . VAL A 1 428 ? -61.715 36.395  -43.660 1.00 36.87  ? 429  VAL A N   1 
ATOM   3236 C CA  . VAL A 1 428 ? -60.455 37.126  -43.706 1.00 36.47  ? 429  VAL A CA  1 
ATOM   3237 C C   . VAL A 1 428 ? -60.753 38.556  -43.275 1.00 36.85  ? 429  VAL A C   1 
ATOM   3238 O O   . VAL A 1 428 ? -61.604 39.226  -43.876 1.00 38.47  ? 429  VAL A O   1 
ATOM   3239 C CB  . VAL A 1 428 ? -59.808 37.090  -45.101 1.00 35.42  ? 429  VAL A CB  1 
ATOM   3240 C CG1 . VAL A 1 428 ? -58.544 37.928  -45.100 1.00 32.45  ? 429  VAL A CG1 1 
ATOM   3241 C CG2 . VAL A 1 428 ? -59.473 35.661  -45.487 1.00 30.31  ? 429  VAL A CG2 1 
ATOM   3242 N N   . PHE A 1 429 ? -60.073 39.014  -42.226 1.00 31.77  ? 430  PHE A N   1 
ATOM   3243 C CA  . PHE A 1 429 ? -60.276 40.358  -41.697 1.00 28.64  ? 430  PHE A CA  1 
ATOM   3244 C C   . PHE A 1 429 ? -59.362 41.317  -42.449 1.00 31.08  ? 430  PHE A C   1 
ATOM   3245 O O   . PHE A 1 429 ? -58.136 41.179  -42.401 1.00 35.31  ? 430  PHE A O   1 
ATOM   3246 C CB  . PHE A 1 429 ? -60.019 40.390  -40.187 1.00 27.37  ? 430  PHE A CB  1 
ATOM   3247 C CG  . PHE A 1 429 ? -60.073 41.771  -39.587 1.00 33.51  ? 430  PHE A CG  1 
ATOM   3248 C CD1 . PHE A 1 429 ? -61.245 42.247  -39.008 1.00 33.90  ? 430  PHE A CD1 1 
ATOM   3249 C CD2 . PHE A 1 429 ? -58.939 42.571  -39.551 1.00 32.91  ? 430  PHE A CD2 1 
ATOM   3250 C CE1 . PHE A 1 429 ? -61.294 43.517  -38.447 1.00 35.88  ? 430  PHE A CE1 1 
ATOM   3251 C CE2 . PHE A 1 429 ? -58.978 43.834  -38.987 1.00 33.07  ? 430  PHE A CE2 1 
ATOM   3252 C CZ  . PHE A 1 429 ? -60.156 44.310  -38.437 1.00 33.99  ? 430  PHE A CZ  1 
ATOM   3253 N N   . GLU A 1 430 ? -59.957 42.289  -43.144 1.00 29.44  ? 431  GLU A N   1 
ATOM   3254 C CA  . GLU A 1 430 ? -59.230 43.078  -44.133 1.00 36.93  ? 431  GLU A CA  1 
ATOM   3255 C C   . GLU A 1 430 ? -59.294 44.576  -43.869 1.00 42.22  ? 431  GLU A C   1 
ATOM   3256 O O   . GLU A 1 430 ? -58.976 45.363  -44.762 1.00 48.05  ? 431  GLU A O   1 
ATOM   3257 C CB  . GLU A 1 430 ? -59.754 42.790  -45.540 1.00 28.89  ? 431  GLU A CB  1 
ATOM   3258 C CG  . GLU A 1 430 ? -59.512 41.368  -46.016 1.00 45.97  ? 431  GLU A CG  1 
ATOM   3259 C CD  . GLU A 1 430 ? -59.900 41.161  -47.471 1.00 55.41  ? 431  GLU A CD  1 
ATOM   3260 O OE1 . GLU A 1 430 ? -60.528 42.067  -48.064 1.00 57.90  ? 431  GLU A OE1 1 
ATOM   3261 O OE2 . GLU A 1 430 ? -59.576 40.088  -48.020 1.00 59.48  ? 431  GLU A OE2 1 
ATOM   3262 N N   . HIS A 1 431 ? -59.695 44.996  -42.677 1.00 39.28  ? 432  HIS A N   1 
ATOM   3263 C CA  . HIS A 1 431 ? -59.752 46.416  -42.362 1.00 42.90  ? 432  HIS A CA  1 
ATOM   3264 C C   . HIS A 1 431 ? -58.487 46.828  -41.628 1.00 41.04  ? 432  HIS A C   1 
ATOM   3265 O O   . HIS A 1 431 ? -58.113 46.208  -40.630 1.00 38.34  ? 432  HIS A O   1 
ATOM   3266 C CB  . HIS A 1 431 ? -60.972 46.764  -41.512 1.00 38.42  ? 432  HIS A CB  1 
ATOM   3267 C CG  . HIS A 1 431 ? -60.993 48.192  -41.064 1.00 43.96  ? 432  HIS A CG  1 
ATOM   3268 N ND1 . HIS A 1 431 ? -61.186 49.242  -41.938 1.00 46.52  ? 432  HIS A ND1 1 
ATOM   3269 C CD2 . HIS A 1 431 ? -60.830 48.747  -39.839 1.00 46.88  ? 432  HIS A CD2 1 
ATOM   3270 C CE1 . HIS A 1 431 ? -61.149 50.381  -41.268 1.00 46.79  ? 432  HIS A CE1 1 
ATOM   3271 N NE2 . HIS A 1 431 ? -60.934 50.109  -39.993 1.00 46.27  ? 432  HIS A NE2 1 
ATOM   3272 N N   . ARG A 1 432 ? -57.834 47.873  -42.119 1.00 42.71  ? 433  ARG A N   1 
ATOM   3273 C CA  . ARG A 1 432 ? -56.698 48.457  -41.423 1.00 46.63  ? 433  ARG A CA  1 
ATOM   3274 C C   . ARG A 1 432 ? -57.206 49.616  -40.575 1.00 51.01  ? 433  ARG A C   1 
ATOM   3275 O O   . ARG A 1 432 ? -57.710 50.610  -41.111 1.00 53.43  ? 433  ARG A O   1 
ATOM   3276 C CB  . ARG A 1 432 ? -55.632 48.921  -42.412 1.00 48.69  ? 433  ARG A CB  1 
ATOM   3277 C CG  . ARG A 1 432 ? -54.396 49.483  -41.750 1.00 46.56  ? 433  ARG A CG  1 
ATOM   3278 C CD  . ARG A 1 432 ? -53.390 49.948  -42.774 1.00 48.45  ? 433  ARG A CD  1 
ATOM   3279 N NE  . ARG A 1 432 ? -52.417 50.854  -42.179 1.00 57.17  ? 433  ARG A NE  1 
ATOM   3280 C CZ  . ARG A 1 432 ? -51.243 50.470  -41.690 1.00 57.02  ? 433  ARG A CZ  1 
ATOM   3281 N NH1 . ARG A 1 432 ? -50.893 49.188  -41.724 1.00 44.52  ? 433  ARG A NH1 1 
ATOM   3282 N NH2 . ARG A 1 432 ? -50.422 51.370  -41.164 1.00 60.24  ? 433  ARG A NH2 1 
ATOM   3283 N N   . ALA A 1 433 ? -57.085 49.480  -39.257 1.00 48.48  ? 434  ALA A N   1 
ATOM   3284 C CA  . ALA A 1 433 ? -57.637 50.472  -38.345 1.00 43.97  ? 434  ALA A CA  1 
ATOM   3285 C C   . ALA A 1 433 ? -57.016 51.843  -38.580 1.00 42.05  ? 434  ALA A C   1 
ATOM   3286 O O   . ALA A 1 433 ? -55.811 51.967  -38.812 1.00 44.60  ? 434  ALA A O   1 
ATOM   3287 C CB  . ALA A 1 433 ? -57.412 50.034  -36.896 1.00 35.74  ? 434  ALA A CB  1 
ATOM   3288 N N   . SER A 1 434 ? -57.856 52.880  -38.523 1.00 40.43  ? 435  SER A N   1 
ATOM   3289 C CA  . SER A 1 434 ? -57.367 54.250  -38.617 1.00 44.97  ? 435  SER A CA  1 
ATOM   3290 C C   . SER A 1 434 ? -56.404 54.591  -37.488 1.00 50.64  ? 435  SER A C   1 
ATOM   3291 O O   . SER A 1 434 ? -55.572 55.494  -37.645 1.00 52.08  ? 435  SER A O   1 
ATOM   3292 C CB  . SER A 1 434 ? -58.544 55.232  -38.603 1.00 47.33  ? 435  SER A CB  1 
ATOM   3293 O OG  . SER A 1 434 ? -59.129 55.318  -37.309 1.00 51.15  ? 435  SER A OG  1 
ATOM   3294 N N   . THR A 1 435 ? -56.499 53.893  -36.358 1.00 51.47  ? 436  THR A N   1 
ATOM   3295 C CA  . THR A 1 435 ? -55.632 54.119  -35.208 1.00 53.55  ? 436  THR A CA  1 
ATOM   3296 C C   . THR A 1 435 ? -54.305 53.380  -35.307 1.00 54.48  ? 436  THR A C   1 
ATOM   3297 O O   . THR A 1 435 ? -53.449 53.572  -34.438 1.00 56.72  ? 436  THR A O   1 
ATOM   3298 C CB  . THR A 1 435 ? -56.345 53.688  -33.924 1.00 53.22  ? 436  THR A CB  1 
ATOM   3299 O OG1 . THR A 1 435 ? -56.896 52.377  -34.111 1.00 52.09  ? 436  THR A OG1 1 
ATOM   3300 C CG2 . THR A 1 435 ? -57.463 54.666  -33.571 1.00 49.81  ? 436  THR A CG2 1 
ATOM   3301 N N   . LEU A 1 436 ? -54.115 52.554  -36.337 1.00 51.06  ? 437  LEU A N   1 
ATOM   3302 C CA  . LEU A 1 436 ? -52.966 51.657  -36.392 1.00 51.79  ? 437  LEU A CA  1 
ATOM   3303 C C   . LEU A 1 436 ? -51.654 52.432  -36.446 1.00 55.37  ? 437  LEU A C   1 
ATOM   3304 O O   . LEU A 1 436 ? -51.467 53.310  -37.297 1.00 55.34  ? 437  LEU A O   1 
ATOM   3305 C CB  . LEU A 1 436 ? -53.083 50.735  -37.605 1.00 52.65  ? 437  LEU A CB  1 
ATOM   3306 C CG  . LEU A 1 436 ? -52.219 49.476  -37.546 1.00 54.72  ? 437  LEU A CG  1 
ATOM   3307 C CD1 . LEU A 1 436 ? -52.623 48.625  -36.360 1.00 51.94  ? 437  LEU A CD1 1 
ATOM   3308 C CD2 . LEU A 1 436 ? -52.343 48.688  -38.829 1.00 56.58  ? 437  LEU A CD2 1 
ATOM   3309 N N   . SER A 1 437 ? -50.736 52.086  -35.541 1.00 55.10  ? 438  SER A N   1 
ATOM   3310 C CA  . SER A 1 437 ? -49.444 52.752  -35.424 1.00 61.39  ? 438  SER A CA  1 
ATOM   3311 C C   . SER A 1 437 ? -48.345 52.091  -36.249 1.00 57.58  ? 438  SER A C   1 
ATOM   3312 O O   . SER A 1 437 ? -47.259 52.667  -36.381 1.00 58.08  ? 438  SER A O   1 
ATOM   3313 C CB  . SER A 1 437 ? -49.012 52.801  -33.951 1.00 70.16  ? 438  SER A CB  1 
ATOM   3314 O OG  . SER A 1 437 ? -49.228 51.551  -33.313 1.00 72.20  ? 438  SER A OG  1 
ATOM   3315 N N   . TRP A 1 438 ? -48.594 50.903  -36.793 1.00 56.38  ? 439  TRP A N   1 
ATOM   3316 C CA  . TRP A 1 438 ? -47.652 50.211  -37.659 1.00 55.06  ? 439  TRP A CA  1 
ATOM   3317 C C   . TRP A 1 438 ? -47.583 50.882  -39.029 1.00 52.98  ? 439  TRP A C   1 
ATOM   3318 O O   . TRP A 1 438 ? -48.498 51.613  -39.414 1.00 55.64  ? 439  TRP A O   1 
ATOM   3319 C CB  . TRP A 1 438 ? -48.065 48.749  -37.799 1.00 50.72  ? 439  TRP A CB  1 
ATOM   3320 C CG  . TRP A 1 438 ? -47.869 48.003  -36.539 1.00 50.23  ? 439  TRP A CG  1 
ATOM   3321 C CD1 . TRP A 1 438 ? -48.829 47.626  -35.643 1.00 53.35  ? 439  TRP A CD1 1 
ATOM   3322 C CD2 . TRP A 1 438 ? -46.623 47.567  -36.000 1.00 52.38  ? 439  TRP A CD2 1 
ATOM   3323 N NE1 . TRP A 1 438 ? -48.251 46.967  -34.583 1.00 52.20  ? 439  TRP A NE1 1 
ATOM   3324 C CE2 . TRP A 1 438 ? -46.897 46.918  -34.782 1.00 57.34  ? 439  TRP A CE2 1 
ATOM   3325 C CE3 . TRP A 1 438 ? -45.299 47.658  -36.433 1.00 53.45  ? 439  TRP A CE3 1 
ATOM   3326 C CZ2 . TRP A 1 438 ? -45.897 46.364  -34.003 1.00 60.90  ? 439  TRP A CZ2 1 
ATOM   3327 C CZ3 . TRP A 1 438 ? -44.314 47.107  -35.663 1.00 48.89  ? 439  TRP A CZ3 1 
ATOM   3328 C CH2 . TRP A 1 438 ? -44.613 46.472  -34.467 1.00 60.09  ? 439  TRP A CH2 1 
ATOM   3329 N N   . PRO A 1 439 ? -46.501 50.661  -39.780 1.00 55.87  ? 440  PRO A N   1 
ATOM   3330 C CA  . PRO A 1 439 ? -46.380 51.270  -41.114 1.00 51.07  ? 440  PRO A CA  1 
ATOM   3331 C C   . PRO A 1 439 ? -47.400 50.706  -42.090 1.00 54.60  ? 440  PRO A C   1 
ATOM   3332 O O   . PRO A 1 439 ? -48.060 49.694  -41.848 1.00 60.18  ? 440  PRO A O   1 
ATOM   3333 C CB  . PRO A 1 439 ? -44.960 50.915  -41.569 1.00 50.52  ? 440  PRO A CB  1 
ATOM   3334 C CG  . PRO A 1 439 ? -44.307 50.284  -40.433 1.00 57.05  ? 440  PRO A CG  1 
ATOM   3335 C CD  . PRO A 1 439 ? -45.308 49.880  -39.413 1.00 58.39  ? 440  PRO A CD  1 
ATOM   3336 N N   . LEU A 1 440 ? -47.485 51.370  -43.245 1.00 58.06  ? 441  LEU A N   1 
ATOM   3337 C CA  . LEU A 1 440 ? -48.466 50.992  -44.255 1.00 54.62  ? 441  LEU A CA  1 
ATOM   3338 C C   . LEU A 1 440 ? -48.103 49.686  -44.946 1.00 53.92  ? 441  LEU A C   1 
ATOM   3339 O O   . LEU A 1 440 ? -48.999 48.933  -45.345 1.00 56.48  ? 441  LEU A O   1 
ATOM   3340 C CB  . LEU A 1 440 ? -48.604 52.106  -45.291 1.00 62.69  ? 441  LEU A CB  1 
ATOM   3341 C CG  . LEU A 1 440 ? -49.856 52.976  -45.198 1.00 68.82  ? 441  LEU A CG  1 
ATOM   3342 C CD1 . LEU A 1 440 ? -49.722 54.188  -46.109 1.00 70.97  ? 441  LEU A CD1 1 
ATOM   3343 C CD2 . LEU A 1 440 ? -51.091 52.165  -45.552 1.00 68.93  ? 441  LEU A CD2 1 
ATOM   3344 N N   . TRP A 1 441 ? -46.808 49.404  -45.115 1.00 50.57  ? 442  TRP A N   1 
ATOM   3345 C CA  . TRP A 1 441 ? -46.423 48.197  -45.837 1.00 51.05  ? 442  TRP A CA  1 
ATOM   3346 C C   . TRP A 1 441 ? -46.844 46.932  -45.099 1.00 48.63  ? 442  TRP A C   1 
ATOM   3347 O O   . TRP A 1 441 ? -47.037 45.895  -45.741 1.00 51.97  ? 442  TRP A O   1 
ATOM   3348 C CB  . TRP A 1 441 ? -44.908 48.187  -46.119 1.00 49.10  ? 442  TRP A CB  1 
ATOM   3349 C CG  . TRP A 1 441 ? -44.004 48.064  -44.910 1.00 50.08  ? 442  TRP A CG  1 
ATOM   3350 C CD1 . TRP A 1 441 ? -43.347 49.079  -44.266 1.00 53.28  ? 442  TRP A CD1 1 
ATOM   3351 C CD2 . TRP A 1 441 ? -43.648 46.858  -44.219 1.00 49.76  ? 442  TRP A CD2 1 
ATOM   3352 N NE1 . TRP A 1 441 ? -42.612 48.578  -43.214 1.00 54.38  ? 442  TRP A NE1 1 
ATOM   3353 C CE2 . TRP A 1 441 ? -42.778 47.218  -43.165 1.00 53.10  ? 442  TRP A CE2 1 
ATOM   3354 C CE3 . TRP A 1 441 ? -43.977 45.509  -44.390 1.00 49.02  ? 442  TRP A CE3 1 
ATOM   3355 C CZ2 . TRP A 1 441 ? -42.242 46.277  -42.283 1.00 55.36  ? 442  TRP A CZ2 1 
ATOM   3356 C CZ3 . TRP A 1 441 ? -43.445 44.583  -43.519 1.00 51.87  ? 442  TRP A CZ3 1 
ATOM   3357 C CH2 . TRP A 1 441 ? -42.585 44.968  -42.476 1.00 54.66  ? 442  TRP A CH2 1 
ATOM   3358 N N   . MET A 1 442 ? -47.019 46.998  -43.777 1.00 42.86  ? 443  MET A N   1 
ATOM   3359 C CA  . MET A 1 442 ? -47.437 45.825  -43.021 1.00 45.67  ? 443  MET A CA  1 
ATOM   3360 C C   . MET A 1 442 ? -48.904 45.465  -43.243 1.00 45.20  ? 443  MET A C   1 
ATOM   3361 O O   . MET A 1 442 ? -49.314 44.364  -42.860 1.00 39.85  ? 443  MET A O   1 
ATOM   3362 C CB  . MET A 1 442 ? -47.159 46.048  -41.535 1.00 49.04  ? 443  MET A CB  1 
ATOM   3363 C CG  . MET A 1 442 ? -45.688 46.282  -41.234 1.00 49.84  ? 443  MET A CG  1 
ATOM   3364 S SD  . MET A 1 442 ? -45.336 46.383  -39.472 1.00 47.11  ? 443  MET A SD  1 
ATOM   3365 C CE  . MET A 1 442 ? -46.226 44.959  -38.857 1.00 39.43  ? 443  MET A CE  1 
ATOM   3366 N N   . GLY A 1 443 ? -49.692 46.349  -43.855 1.00 40.68  ? 444  GLY A N   1 
ATOM   3367 C CA  . GLY A 1 443 ? -51.073 46.007  -44.177 1.00 34.11  ? 444  GLY A CA  1 
ATOM   3368 C C   . GLY A 1 443 ? -51.914 45.850  -42.923 1.00 35.68  ? 444  GLY A C   1 
ATOM   3369 O O   . GLY A 1 443 ? -51.902 46.700  -42.025 1.00 35.22  ? 444  GLY A O   1 
ATOM   3370 N N   . VAL A 1 444 ? -52.665 44.756  -42.856 1.00 34.00  ? 445  VAL A N   1 
ATOM   3371 C CA  . VAL A 1 444 ? -53.452 44.433  -41.668 1.00 36.53  ? 445  VAL A CA  1 
ATOM   3372 C C   . VAL A 1 444 ? -52.696 43.362  -40.887 1.00 31.92  ? 445  VAL A C   1 
ATOM   3373 O O   . VAL A 1 444 ? -52.797 42.170  -41.212 1.00 34.39  ? 445  VAL A O   1 
ATOM   3374 C CB  . VAL A 1 444 ? -54.873 43.981  -42.044 1.00 38.59  ? 445  VAL A CB  1 
ATOM   3375 C CG1 . VAL A 1 444 ? -55.727 43.829  -40.799 1.00 36.45  ? 445  VAL A CG1 1 
ATOM   3376 C CG2 . VAL A 1 444 ? -55.516 44.983  -43.011 1.00 33.16  ? 445  VAL A CG2 1 
ATOM   3377 N N   . PRO A 1 445 ? -51.925 43.730  -39.869 1.00 32.27  ? 446  PRO A N   1 
ATOM   3378 C CA  . PRO A 1 445 ? -51.019 42.770  -39.236 1.00 34.81  ? 446  PRO A CA  1 
ATOM   3379 C C   . PRO A 1 445 ? -51.752 41.824  -38.295 1.00 35.40  ? 446  PRO A C   1 
ATOM   3380 O O   . PRO A 1 445 ? -52.908 42.023  -37.919 1.00 33.96  ? 446  PRO A O   1 
ATOM   3381 C CB  . PRO A 1 445 ? -50.033 43.657  -38.459 1.00 36.89  ? 446  PRO A CB  1 
ATOM   3382 C CG  . PRO A 1 445 ? -50.348 45.078  -38.865 1.00 33.88  ? 446  PRO A CG  1 
ATOM   3383 C CD  . PRO A 1 445 ? -51.781 45.071  -39.285 1.00 30.11  ? 446  PRO A CD  1 
ATOM   3384 N N   . HIS A 1 446 ? -51.030 40.775  -37.920 1.00 34.43  ? 447  HIS A N   1 
ATOM   3385 C CA  . HIS A 1 446 ? -51.505 39.790  -36.961 1.00 36.58  ? 447  HIS A CA  1 
ATOM   3386 C C   . HIS A 1 446 ? -51.958 40.452  -35.664 1.00 36.00  ? 447  HIS A C   1 
ATOM   3387 O O   . HIS A 1 446 ? -51.265 41.312  -35.116 1.00 36.32  ? 447  HIS A O   1 
ATOM   3388 C CB  . HIS A 1 446 ? -50.372 38.802  -36.691 1.00 34.56  ? 447  HIS A CB  1 
ATOM   3389 C CG  . HIS A 1 446 ? -50.711 37.733  -35.708 1.00 39.50  ? 447  HIS A CG  1 
ATOM   3390 N ND1 . HIS A 1 446 ? -51.301 36.544  -36.080 1.00 37.64  ? 447  HIS A ND1 1 
ATOM   3391 C CD2 . HIS A 1 446 ? -50.518 37.659  -34.369 1.00 38.40  ? 447  HIS A CD2 1 
ATOM   3392 C CE1 . HIS A 1 446 ? -51.461 35.784  -35.012 1.00 36.67  ? 447  HIS A CE1 1 
ATOM   3393 N NE2 . HIS A 1 446 ? -50.997 36.439  -33.961 1.00 42.64  ? 447  HIS A NE2 1 
ATOM   3394 N N   . GLY A 1 447 ? -53.137 40.055  -35.182 1.00 31.70  ? 448  GLY A N   1 
ATOM   3395 C CA  . GLY A 1 447 ? -53.630 40.510  -33.898 1.00 31.86  ? 448  GLY A CA  1 
ATOM   3396 C C   . GLY A 1 447 ? -54.508 41.748  -33.913 1.00 38.04  ? 448  GLY A C   1 
ATOM   3397 O O   . GLY A 1 447 ? -55.041 42.119  -32.860 1.00 34.79  ? 448  GLY A O   1 
ATOM   3398 N N   . TYR A 1 448 ? -54.692 42.404  -35.055 1.00 29.14  ? 449  TYR A N   1 
ATOM   3399 C CA  . TYR A 1 448 ? -55.348 43.703  -35.037 1.00 28.75  ? 449  TYR A CA  1 
ATOM   3400 C C   . TYR A 1 448 ? -56.811 43.639  -35.451 1.00 30.55  ? 449  TYR A C   1 
ATOM   3401 O O   . TYR A 1 448 ? -57.440 44.683  -35.649 1.00 33.95  ? 449  TYR A O   1 
ATOM   3402 C CB  . TYR A 1 448 ? -54.539 44.697  -35.873 1.00 32.37  ? 449  TYR A CB  1 
ATOM   3403 C CG  . TYR A 1 448 ? -53.341 45.109  -35.050 1.00 37.30  ? 449  TYR A CG  1 
ATOM   3404 C CD1 . TYR A 1 448 ? -53.458 46.094  -34.078 1.00 34.65  ? 449  TYR A CD1 1 
ATOM   3405 C CD2 . TYR A 1 448 ? -52.127 44.431  -35.155 1.00 34.41  ? 449  TYR A CD2 1 
ATOM   3406 C CE1 . TYR A 1 448 ? -52.382 46.447  -33.277 1.00 33.25  ? 449  TYR A CE1 1 
ATOM   3407 C CE2 . TYR A 1 448 ? -51.041 44.775  -34.354 1.00 31.40  ? 449  TYR A CE2 1 
ATOM   3408 C CZ  . TYR A 1 448 ? -51.180 45.785  -33.413 1.00 35.70  ? 449  TYR A CZ  1 
ATOM   3409 O OH  . TYR A 1 448 ? -50.124 46.148  -32.602 1.00 40.08  ? 449  TYR A OH  1 
ATOM   3410 N N   . GLU A 1 449 ? -57.375 42.436  -35.536 1.00 31.54  ? 450  GLU A N   1 
ATOM   3411 C CA  . GLU A 1 449 ? -58.818 42.262  -35.524 1.00 32.18  ? 450  GLU A CA  1 
ATOM   3412 C C   . GLU A 1 449 ? -59.386 42.169  -34.108 1.00 33.51  ? 450  GLU A C   1 
ATOM   3413 O O   . GLU A 1 449 ? -60.585 42.405  -33.920 1.00 35.38  ? 450  GLU A O   1 
ATOM   3414 C CB  . GLU A 1 449 ? -59.195 41.003  -36.318 1.00 29.16  ? 450  GLU A CB  1 
ATOM   3415 C CG  . GLU A 1 449 ? -59.297 39.729  -35.479 1.00 35.67  ? 450  GLU A CG  1 
ATOM   3416 C CD  . GLU A 1 449 ? -57.942 39.131  -35.090 1.00 41.12  ? 450  GLU A CD  1 
ATOM   3417 O OE1 . GLU A 1 449 ? -56.902 39.824  -35.190 1.00 40.02  ? 450  GLU A OE1 1 
ATOM   3418 O OE2 . GLU A 1 449 ? -57.926 37.946  -34.684 1.00 41.17  ? 450  GLU A OE2 1 
ATOM   3419 N N   . ILE A 1 450 ? -58.571 41.880  -33.125 1.00 37.56  ? 451  ILE A N   1 
ATOM   3420 C CA  . ILE A 1 450 ? -59.056 41.654  -31.795 1.00 33.91  ? 451  ILE A CA  1 
ATOM   3421 C C   . ILE A 1 450 ? -59.765 42.836  -31.204 1.00 34.58  ? 451  ILE A C   1 
ATOM   3422 O O   . ILE A 1 450 ? -60.805 42.695  -30.674 1.00 33.46  ? 451  ILE A O   1 
ATOM   3423 C CB  . ILE A 1 450 ? -57.911 41.252  -30.873 1.00 34.31  ? 451  ILE A CB  1 
ATOM   3424 C CG1 . ILE A 1 450 ? -57.365 39.902  -31.277 1.00 31.25  ? 451  ILE A CG1 1 
ATOM   3425 C CG2 . ILE A 1 450 ? -58.358 41.249  -29.437 1.00 29.65  ? 451  ILE A CG2 1 
ATOM   3426 C CD1 . ILE A 1 450 ? -56.135 39.484  -30.533 1.00 27.55  ? 451  ILE A CD1 1 
ATOM   3427 N N   . GLU A 1 451 ? -59.217 44.007  -31.385 1.00 32.86  ? 452  GLU A N   1 
ATOM   3428 C CA  . GLU A 1 451 ? -59.827 45.220  -30.844 1.00 33.07  ? 452  GLU A CA  1 
ATOM   3429 C C   . GLU A 1 451 ? -61.226 45.459  -31.406 1.00 29.93  ? 452  GLU A C   1 
ATOM   3430 O O   . GLU A 1 451 ? -62.075 46.041  -30.722 1.00 33.73  ? 452  GLU A O   1 
ATOM   3431 C CB  . GLU A 1 451 ? -58.932 46.429  -31.124 1.00 37.39  ? 452  GLU A CB  1 
ATOM   3432 C CG  . GLU A 1 451 ? -58.585 46.633  -32.606 1.00 38.39  ? 452  GLU A CG  1 
ATOM   3433 C CD  . GLU A 1 451 ? -57.394 47.562  -32.800 1.00 47.25  ? 452  GLU A CD  1 
ATOM   3434 O OE1 . GLU A 1 451 ? -56.295 47.238  -32.296 1.00 47.53  ? 452  GLU A OE1 1 
ATOM   3435 O OE2 . GLU A 1 451 ? -57.556 48.620  -33.444 1.00 50.54  ? 452  GLU A OE2 1 
ATOM   3436 N N   . PHE A 1 452 ? -61.492 45.017  -32.637 1.00 28.52  ? 453  PHE A N   1 
ATOM   3437 C CA  . PHE A 1 452 ? -62.830 45.182  -33.192 1.00 29.31  ? 453  PHE A CA  1 
ATOM   3438 C C   . PHE A 1 452 ? -63.785 44.122  -32.659 1.00 34.67  ? 453  PHE A C   1 
ATOM   3439 O O   . PHE A 1 452 ? -64.960 44.415  -32.410 1.00 38.26  ? 453  PHE A O   1 
ATOM   3440 C CB  . PHE A 1 452 ? -62.776 45.156  -34.725 1.00 28.61  ? 453  PHE A CB  1 
ATOM   3441 C CG  . PHE A 1 452 ? -62.217 46.416  -35.316 1.00 30.40  ? 453  PHE A CG  1 
ATOM   3442 C CD1 . PHE A 1 452 ? -60.857 46.539  -35.554 1.00 29.91  ? 453  PHE A CD1 1 
ATOM   3443 C CD2 . PHE A 1 452 ? -63.041 47.495  -35.588 1.00 32.08  ? 453  PHE A CD2 1 
ATOM   3444 C CE1 . PHE A 1 452 ? -60.335 47.709  -36.068 1.00 32.28  ? 453  PHE A CE1 1 
ATOM   3445 C CE2 . PHE A 1 452 ? -62.520 48.670  -36.107 1.00 30.54  ? 453  PHE A CE2 1 
ATOM   3446 C CZ  . PHE A 1 452 ? -61.167 48.774  -36.346 1.00 32.36  ? 453  PHE A CZ  1 
ATOM   3447 N N   . ILE A 1 453 ? -63.297 42.893  -32.471 1.00 32.37  ? 454  ILE A N   1 
ATOM   3448 C CA  . ILE A 1 453 ? -64.134 41.838  -31.906 1.00 34.66  ? 454  ILE A CA  1 
ATOM   3449 C C   . ILE A 1 453 ? -64.585 42.218  -30.498 1.00 36.96  ? 454  ILE A C   1 
ATOM   3450 O O   . ILE A 1 453 ? -65.735 41.980  -30.107 1.00 34.61  ? 454  ILE A O   1 
ATOM   3451 C CB  . ILE A 1 453 ? -63.378 40.493  -31.916 1.00 39.05  ? 454  ILE A CB  1 
ATOM   3452 C CG1 . ILE A 1 453 ? -62.931 40.116  -33.339 1.00 34.41  ? 454  ILE A CG1 1 
ATOM   3453 C CG2 . ILE A 1 453 ? -64.226 39.391  -31.299 1.00 34.56  ? 454  ILE A CG2 1 
ATOM   3454 C CD1 . ILE A 1 453 ? -64.056 40.069  -34.338 1.00 45.53  ? 454  ILE A CD1 1 
ATOM   3455 N N   . PHE A 1 454 ? -63.698 42.824  -29.720 1.00 31.18  ? 455  PHE A N   1 
ATOM   3456 C CA  . PHE A 1 454 ? -64.024 43.202  -28.355 1.00 31.05  ? 455  PHE A CA  1 
ATOM   3457 C C   . PHE A 1 454 ? -64.688 44.570  -28.261 1.00 38.63  ? 455  PHE A C   1 
ATOM   3458 O O   . PHE A 1 454 ? -64.961 45.030  -27.147 1.00 35.39  ? 455  PHE A O   1 
ATOM   3459 C CB  . PHE A 1 454 ? -62.762 43.169  -27.492 1.00 32.44  ? 455  PHE A CB  1 
ATOM   3460 C CG  . PHE A 1 454 ? -62.442 41.807  -26.936 1.00 31.65  ? 455  PHE A CG  1 
ATOM   3461 C CD1 . PHE A 1 454 ? -61.696 40.899  -27.671 1.00 29.80  ? 455  PHE A CD1 1 
ATOM   3462 C CD2 . PHE A 1 454 ? -62.875 41.441  -25.670 1.00 29.27  ? 455  PHE A CD2 1 
ATOM   3463 C CE1 . PHE A 1 454 ? -61.391 39.645  -27.156 1.00 32.49  ? 455  PHE A CE1 1 
ATOM   3464 C CE2 . PHE A 1 454 ? -62.575 40.191  -25.147 1.00 26.67  ? 455  PHE A CE2 1 
ATOM   3465 C CZ  . PHE A 1 454 ? -61.830 39.290  -25.890 1.00 28.29  ? 455  PHE A CZ  1 
ATOM   3466 N N   . GLY A 1 455 ? -64.952 45.227  -29.394 1.00 32.16  ? 456  GLY A N   1 
ATOM   3467 C CA  . GLY A 1 455 ? -65.671 46.484  -29.376 1.00 27.62  ? 456  GLY A CA  1 
ATOM   3468 C C   . GLY A 1 455 ? -64.906 47.659  -28.816 1.00 39.35  ? 456  GLY A C   1 
ATOM   3469 O O   . GLY A 1 455 ? -65.524 48.643  -28.399 1.00 33.88  ? 456  GLY A O   1 
ATOM   3470 N N   . ILE A 1 456 ? -63.577 47.592  -28.802 1.00 36.64  ? 457  ILE A N   1 
ATOM   3471 C CA  . ILE A 1 456 ? -62.729 48.664  -28.278 1.00 33.46  ? 457  ILE A CA  1 
ATOM   3472 C C   . ILE A 1 456 ? -63.010 50.013  -28.945 1.00 33.99  ? 457  ILE A C   1 
ATOM   3473 O O   . ILE A 1 456 ? -62.907 51.043  -28.267 1.00 37.80  ? 457  ILE A O   1 
ATOM   3474 C CB  . ILE A 1 456 ? -61.241 48.292  -28.403 1.00 36.35  ? 457  ILE A CB  1 
ATOM   3475 C CG1 . ILE A 1 456 ? -60.971 46.952  -27.717 1.00 37.78  ? 457  ILE A CG1 1 
ATOM   3476 C CG2 . ILE A 1 456 ? -60.361 49.364  -27.777 1.00 32.17  ? 457  ILE A CG2 1 
ATOM   3477 C CD1 . ILE A 1 456 ? -61.450 46.908  -26.271 1.00 38.48  ? 457  ILE A CD1 1 
ATOM   3478 N N   . PRO A 1 457 ? -63.360 50.091  -30.238 1.00 30.66  ? 458  PRO A N   1 
ATOM   3479 C CA  . PRO A 1 457 ? -63.671 51.413  -30.811 1.00 32.15  ? 458  PRO A CA  1 
ATOM   3480 C C   . PRO A 1 457 ? -64.798 52.157  -30.111 1.00 39.94  ? 458  PRO A C   1 
ATOM   3481 O O   . PRO A 1 457 ? -64.865 53.386  -30.229 1.00 43.27  ? 458  PRO A O   1 
ATOM   3482 C CB  . PRO A 1 457 ? -64.024 51.087  -32.265 1.00 36.66  ? 458  PRO A CB  1 
ATOM   3483 C CG  . PRO A 1 457 ? -63.181 49.908  -32.572 1.00 33.25  ? 458  PRO A CG  1 
ATOM   3484 C CD  . PRO A 1 457 ? -63.198 49.083  -31.306 1.00 29.15  ? 458  PRO A CD  1 
ATOM   3485 N N   . LEU A 1 458 ? -65.670 51.471  -29.369 1.00 40.64  ? 459  LEU A N   1 
ATOM   3486 C CA  . LEU A 1 458 ? -66.720 52.160  -28.626 1.00 43.55  ? 459  LEU A CA  1 
ATOM   3487 C C   . LEU A 1 458 ? -66.197 52.890  -27.394 1.00 49.46  ? 459  LEU A C   1 
ATOM   3488 O O   . LEU A 1 458 ? -66.960 53.633  -26.767 1.00 53.23  ? 459  LEU A O   1 
ATOM   3489 C CB  . LEU A 1 458 ? -67.805 51.167  -28.204 1.00 43.03  ? 459  LEU A CB  1 
ATOM   3490 C CG  . LEU A 1 458 ? -68.467 50.394  -29.347 1.00 44.44  ? 459  LEU A CG  1 
ATOM   3491 C CD1 . LEU A 1 458 ? -69.568 49.489  -28.817 1.00 40.37  ? 459  LEU A CD1 1 
ATOM   3492 C CD2 . LEU A 1 458 ? -69.012 51.357  -30.391 1.00 45.98  ? 459  LEU A CD2 1 
ATOM   3493 N N   . ASP A 1 459 ? -64.938 52.693  -27.030 1.00 46.89  ? 460  ASP A N   1 
ATOM   3494 C CA  . ASP A 1 459 ? -64.371 53.364  -25.866 1.00 47.61  ? 460  ASP A CA  1 
ATOM   3495 C C   . ASP A 1 459 ? -64.306 54.863  -26.128 1.00 47.61  ? 460  ASP A C   1 
ATOM   3496 O O   . ASP A 1 459 ? -63.612 55.287  -27.061 1.00 43.34  ? 460  ASP A O   1 
ATOM   3497 C CB  . ASP A 1 459 ? -62.981 52.804  -25.571 1.00 52.13  ? 460  ASP A CB  1 
ATOM   3498 C CG  . ASP A 1 459 ? -62.396 53.311  -24.259 1.00 55.31  ? 460  ASP A CG  1 
ATOM   3499 O OD1 . ASP A 1 459 ? -61.426 52.694  -23.775 1.00 60.76  ? 460  ASP A OD1 1 
ATOM   3500 O OD2 . ASP A 1 459 ? -62.880 54.323  -23.716 1.00 58.54  ? 460  ASP A OD2 1 
ATOM   3501 N N   . PRO A 1 460 ? -64.991 55.694  -25.336 1.00 54.06  ? 461  PRO A N   1 
ATOM   3502 C CA  . PRO A 1 460 ? -65.006 57.139  -25.626 1.00 57.09  ? 461  PRO A CA  1 
ATOM   3503 C C   . PRO A 1 460 ? -63.628 57.775  -25.633 1.00 64.28  ? 461  PRO A C   1 
ATOM   3504 O O   . PRO A 1 460 ? -63.432 58.798  -26.302 1.00 72.65  ? 461  PRO A O   1 
ATOM   3505 C CB  . PRO A 1 460 ? -65.887 57.710  -24.505 1.00 60.48  ? 461  PRO A CB  1 
ATOM   3506 C CG  . PRO A 1 460 ? -65.873 56.665  -23.420 1.00 61.89  ? 461  PRO A CG  1 
ATOM   3507 C CD  . PRO A 1 460 ? -65.795 55.358  -24.148 1.00 60.82  ? 461  PRO A CD  1 
ATOM   3508 N N   . SER A 1 461 ? -62.661 57.193  -24.923 1.00 60.09  ? 462  SER A N   1 
ATOM   3509 C CA  . SER A 1 461 ? -61.318 57.761  -24.869 1.00 56.61  ? 462  SER A CA  1 
ATOM   3510 C C   . SER A 1 461 ? -60.474 57.464  -26.108 1.00 52.59  ? 462  SER A C   1 
ATOM   3511 O O   . SER A 1 461 ? -59.437 58.107  -26.292 1.00 57.63  ? 462  SER A O   1 
ATOM   3512 C CB  . SER A 1 461 ? -60.594 57.259  -23.619 1.00 56.50  ? 462  SER A CB  1 
ATOM   3513 O OG  . SER A 1 461 ? -60.403 55.860  -23.693 1.00 61.71  ? 462  SER A OG  1 
ATOM   3514 N N   . ARG A 1 462 ? -60.939 56.564  -26.938 1.00 49.44  ? 463  ARG A N   1 
ATOM   3515 C CA  . ARG A 1 462 ? -60.262 56.292  -28.162 1.00 51.44  ? 463  ARG A CA  1 
ATOM   3516 C C   . ARG A 1 462 ? -60.823 57.180  -29.248 1.00 53.74  ? 463  ARG A C   1 
ATOM   3517 O O   . ARG A 1 462 ? -61.795 57.846  -29.072 1.00 62.49  ? 463  ARG A O   1 
ATOM   3518 C CB  . ARG A 1 462 ? -60.302 54.823  -28.482 1.00 51.79  ? 463  ARG A CB  1 
ATOM   3519 C CG  . ARG A 1 462 ? -60.055 54.039  -27.236 1.00 55.16  ? 463  ARG A CG  1 
ATOM   3520 C CD  . ARG A 1 462 ? -59.190 52.853  -27.448 1.00 58.17  ? 463  ARG A CD  1 
ATOM   3521 N NE  . ARG A 1 462 ? -58.746 52.348  -26.183 1.00 61.68  ? 463  ARG A NE  1 
ATOM   3522 C CZ  . ARG A 1 462 ? -57.606 51.721  -26.030 1.00 71.64  ? 463  ARG A CZ  1 
ATOM   3523 N NH1 . ARG A 1 462 ? -56.832 51.534  -27.065 1.00 77.38  ? 463  ARG A NH1 1 
ATOM   3524 N NH2 . ARG A 1 462 ? -57.233 51.312  -24.853 1.00 74.00  ? 463  ARG A NH2 1 
ATOM   3525 N N   . ASN A 1 463 ? -60.140 57.200  -30.358 1.00 52.16  ? 464  ASN A N   1 
ATOM   3526 C CA  . ASN A 1 463 ? -60.413 58.002  -31.489 1.00 52.39  ? 464  ASN A CA  1 
ATOM   3527 C C   . ASN A 1 463 ? -60.723 57.292  -32.770 1.00 47.03  ? 464  ASN A C   1 
ATOM   3528 O O   . ASN A 1 463 ? -60.294 57.711  -33.790 1.00 45.19  ? 464  ASN A O   1 
ATOM   3529 C CB  . ASN A 1 463 ? -59.276 58.988  -31.635 1.00 63.39  ? 464  ASN A CB  1 
ATOM   3530 C CG  . ASN A 1 463 ? -59.058 59.805  -30.371 1.00 90.90  ? 464  ASN A CG  1 
ATOM   3531 O OD1 . ASN A 1 463 ? -60.002 60.202  -29.720 1.00 102.12 ? 464  ASN A OD1 1 
ATOM   3532 N ND2 . ASN A 1 463 ? -57.820 60.046  -30.017 1.00 108.06 ? 464  ASN A ND2 1 
ATOM   3533 N N   . TYR A 1 464 ? -61.445 56.200  -32.696 1.00 38.86  ? 465  TYR A N   1 
ATOM   3534 C CA  . TYR A 1 464 ? -61.822 55.510  -33.923 1.00 38.01  ? 465  TYR A CA  1 
ATOM   3535 C C   . TYR A 1 464 ? -62.896 56.323  -34.635 1.00 44.48  ? 465  TYR A C   1 
ATOM   3536 O O   . TYR A 1 464 ? -63.601 57.127  -34.018 1.00 41.51  ? 465  TYR A O   1 
ATOM   3537 C CB  . TYR A 1 464 ? -62.333 54.095  -33.660 1.00 37.08  ? 465  TYR A CB  1 
ATOM   3538 C CG  . TYR A 1 464 ? -61.296 53.114  -33.171 1.00 39.99  ? 465  TYR A CG  1 
ATOM   3539 C CD1 . TYR A 1 464 ? -60.723 52.184  -34.038 1.00 32.62  ? 465  TYR A CD1 1 
ATOM   3540 C CD2 . TYR A 1 464 ? -60.897 53.105  -31.841 1.00 41.02  ? 465  TYR A CD2 1 
ATOM   3541 C CE1 . TYR A 1 464 ? -59.774 51.276  -33.585 1.00 39.03  ? 465  TYR A CE1 1 
ATOM   3542 C CE2 . TYR A 1 464 ? -59.950 52.205  -31.378 1.00 43.28  ? 465  TYR A CE2 1 
ATOM   3543 C CZ  . TYR A 1 464 ? -59.391 51.295  -32.253 1.00 45.63  ? 465  TYR A CZ  1 
ATOM   3544 O OH  . TYR A 1 464 ? -58.450 50.403  -31.794 1.00 47.58  ? 465  TYR A OH  1 
ATOM   3545 N N   . THR A 1 465 ? -63.014 56.130  -35.943 1.00 40.09  ? 466  THR A N   1 
ATOM   3546 C CA  . THR A 1 465 ? -64.055 56.860  -36.647 1.00 46.35  ? 466  THR A CA  1 
ATOM   3547 C C   . THR A 1 465 ? -65.421 56.226  -36.389 1.00 45.09  ? 466  THR A C   1 
ATOM   3548 O O   . THR A 1 465 ? -65.533 55.095  -35.907 1.00 41.16  ? 466  THR A O   1 
ATOM   3549 C CB  . THR A 1 465 ? -63.772 56.910  -38.148 1.00 48.14  ? 466  THR A CB  1 
ATOM   3550 O OG1 . THR A 1 465 ? -64.217 55.687  -38.748 1.00 44.34  ? 466  THR A OG1 1 
ATOM   3551 C CG2 . THR A 1 465 ? -62.278 57.107  -38.410 1.00 49.98  ? 466  THR A CG2 1 
ATOM   3552 N N   . ALA A 1 466 ? -66.472 56.985  -36.712 1.00 44.69  ? 467  ALA A N   1 
ATOM   3553 C CA  . ALA A 1 466 ? -67.833 56.494  -36.512 1.00 48.62  ? 467  ALA A CA  1 
ATOM   3554 C C   . ALA A 1 466 ? -68.085 55.209  -37.294 1.00 49.62  ? 467  ALA A C   1 
ATOM   3555 O O   . ALA A 1 466 ? -68.745 54.288  -36.797 1.00 50.35  ? 467  ALA A O   1 
ATOM   3556 C CB  . ALA A 1 466 ? -68.837 57.572  -36.911 1.00 46.77  ? 467  ALA A CB  1 
ATOM   3557 N N   A GLU A 1 467 ? -67.581 55.119  -38.527 0.51 45.75  ? 468  GLU A N   1 
ATOM   3558 N N   B GLU A 1 467 ? -67.552 55.132  -38.515 0.49 45.86  ? 468  GLU A N   1 
ATOM   3559 C CA  A GLU A 1 467 ? -67.845 53.907  -39.297 0.51 47.57  ? 468  GLU A CA  1 
ATOM   3560 C CA  B GLU A 1 467 ? -67.759 53.965  -39.361 0.49 47.64  ? 468  GLU A CA  1 
ATOM   3561 C C   A GLU A 1 467 ? -67.108 52.707  -38.719 0.51 44.48  ? 468  GLU A C   1 
ATOM   3562 C C   B GLU A 1 467 ? -67.075 52.734  -38.782 0.49 44.56  ? 468  GLU A C   1 
ATOM   3563 O O   A GLU A 1 467 ? -67.595 51.576  -38.823 0.51 46.85  ? 468  GLU A O   1 
ATOM   3564 O O   B GLU A 1 467 ? -67.566 51.612  -38.950 0.49 47.22  ? 468  GLU A O   1 
ATOM   3565 C CB  A GLU A 1 467 ? -67.485 54.107  -40.771 0.51 50.14  ? 468  GLU A CB  1 
ATOM   3566 C CB  B GLU A 1 467 ? -67.251 54.262  -40.777 0.49 50.19  ? 468  GLU A CB  1 
ATOM   3567 C CG  A GLU A 1 467 ? -66.054 54.515  -41.028 0.51 50.87  ? 468  GLU A CG  1 
ATOM   3568 C CG  B GLU A 1 467 ? -67.991 55.400  -41.511 0.49 52.91  ? 468  GLU A CG  1 
ATOM   3569 C CD  A GLU A 1 467 ? -65.825 54.939  -42.462 0.51 54.03  ? 468  GLU A CD  1 
ATOM   3570 C CD  B GLU A 1 467 ? -67.804 56.780  -40.869 0.49 54.96  ? 468  GLU A CD  1 
ATOM   3571 O OE1 A GLU A 1 467 ? -66.816 55.236  -43.160 0.51 55.98  ? 468  GLU A OE1 1 
ATOM   3572 O OE1 B GLU A 1 467 ? -66.800 56.985  -40.149 0.49 50.67  ? 468  GLU A OE1 1 
ATOM   3573 O OE2 A GLU A 1 467 ? -64.653 54.978  -42.890 0.51 55.45  ? 468  GLU A OE2 1 
ATOM   3574 O OE2 B GLU A 1 467 ? -68.672 57.661  -41.077 0.49 55.72  ? 468  GLU A OE2 1 
ATOM   3575 N N   . GLU A 1 468 ? -65.950 52.924  -38.092 1.00 39.28  ? 469  GLU A N   1 
ATOM   3576 C CA  . GLU A 1 468 ? -65.289 51.811  -37.423 1.00 39.80  ? 469  GLU A CA  1 
ATOM   3577 C C   . GLU A 1 468 ? -66.075 51.346  -36.200 1.00 39.64  ? 469  GLU A C   1 
ATOM   3578 O O   . GLU A 1 468 ? -66.028 50.159  -35.854 1.00 32.77  ? 469  GLU A O   1 
ATOM   3579 C CB  . GLU A 1 468 ? -63.867 52.202  -37.026 1.00 45.62  ? 469  GLU A CB  1 
ATOM   3580 C CG  . GLU A 1 468 ? -63.022 52.674  -38.190 1.00 48.85  ? 469  GLU A CG  1 
ATOM   3581 C CD  . GLU A 1 468 ? -61.592 52.957  -37.791 1.00 48.14  ? 469  GLU A CD  1 
ATOM   3582 O OE1 . GLU A 1 468 ? -61.350 53.963  -37.084 1.00 46.61  ? 469  GLU A OE1 1 
ATOM   3583 O OE2 . GLU A 1 468 ? -60.709 52.170  -38.189 1.00 53.10  ? 469  GLU A OE2 1 
ATOM   3584 N N   . LYS A 1 469 ? -66.805 52.254  -35.541 1.00 35.97  ? 470  LYS A N   1 
ATOM   3585 C CA  . LYS A 1 469 ? -67.654 51.842  -34.424 1.00 41.16  ? 470  LYS A CA  1 
ATOM   3586 C C   . LYS A 1 469 ? -68.823 50.995  -34.906 1.00 39.24  ? 470  LYS A C   1 
ATOM   3587 O O   . LYS A 1 469 ? -69.187 50.009  -34.256 1.00 34.37  ? 470  LYS A O   1 
ATOM   3588 C CB  . LYS A 1 469 ? -68.152 53.064  -33.648 1.00 37.43  ? 470  LYS A CB  1 
ATOM   3589 C CG  . LYS A 1 469 ? -67.058 54.066  -33.407 1.00 41.59  ? 470  LYS A CG  1 
ATOM   3590 C CD  . LYS A 1 469 ? -67.374 55.082  -32.345 1.00 39.62  ? 470  LYS A CD  1 
ATOM   3591 C CE  . LYS A 1 469 ? -66.249 56.092  -32.305 1.00 40.59  ? 470  LYS A CE  1 
ATOM   3592 N NZ  . LYS A 1 469 ? -66.446 57.143  -31.297 1.00 43.41  ? 470  LYS A NZ  1 
ATOM   3593 N N   . ILE A 1 470 ? -69.346 51.315  -36.070 1.00 42.93  ? 471  ILE A N   1 
ATOM   3594 C CA  . ILE A 1 470 ? -70.396 50.549  -36.685 1.00 43.17  ? 471  ILE A CA  1 
ATOM   3595 C C   . ILE A 1 470 ? -69.849 49.200  -37.062 1.00 43.82  ? 471  ILE A C   1 
ATOM   3596 O O   . ILE A 1 470 ? -70.479 48.194  -36.846 1.00 46.45  ? 471  ILE A O   1 
ATOM   3597 C CB  . ILE A 1 470 ? -70.902 51.220  -37.964 1.00 49.73  ? 471  ILE A CB  1 
ATOM   3598 C CG1 . ILE A 1 470 ? -71.365 52.627  -37.696 1.00 55.73  ? 471  ILE A CG1 1 
ATOM   3599 C CG2 . ILE A 1 470 ? -71.979 50.386  -38.625 1.00 50.96  ? 471  ILE A CG2 1 
ATOM   3600 C CD1 . ILE A 1 470 ? -72.671 52.735  -36.979 1.00 69.51  ? 471  ILE A CD1 1 
ATOM   3601 N N   . PHE A 1 471 ? -68.661 49.209  -37.642 1.00 43.71  ? 472  PHE A N   1 
ATOM   3602 C CA  . PHE A 1 471 ? -67.974 47.975  -38.010 1.00 36.95  ? 472  PHE A CA  1 
ATOM   3603 C C   . PHE A 1 471 ? -67.748 47.089  -36.787 1.00 34.52  ? 472  PHE A C   1 
ATOM   3604 O O   . PHE A 1 471 ? -68.061 45.892  -36.805 1.00 33.47  ? 472  PHE A O   1 
ATOM   3605 C CB  . PHE A 1 471 ? -66.646 48.314  -38.699 1.00 40.86  ? 472  PHE A CB  1 
ATOM   3606 C CG  . PHE A 1 471 ? -65.867 47.111  -39.165 1.00 40.24  ? 472  PHE A CG  1 
ATOM   3607 C CD1 . PHE A 1 471 ? -66.491 46.088  -39.869 1.00 37.33  ? 472  PHE A CD1 1 
ATOM   3608 C CD2 . PHE A 1 471 ? -64.507 47.007  -38.903 1.00 38.83  ? 472  PHE A CD2 1 
ATOM   3609 C CE1 . PHE A 1 471 ? -65.770 44.979  -40.299 1.00 36.43  ? 472  PHE A CE1 1 
ATOM   3610 C CE2 . PHE A 1 471 ? -63.778 45.899  -39.333 1.00 40.87  ? 472  PHE A CE2 1 
ATOM   3611 C CZ  . PHE A 1 471 ? -64.411 44.885  -40.034 1.00 34.56  ? 472  PHE A CZ  1 
ATOM   3612 N N   . ALA A 1 472 ? -67.218 47.669  -35.703 1.00 33.28  ? 473  ALA A N   1 
ATOM   3613 C CA  . ALA A 1 472 ? -67.027 46.903  -34.470 1.00 34.82  ? 473  ALA A CA  1 
ATOM   3614 C C   . ALA A 1 472 ? -68.335 46.280  -33.992 1.00 33.47  ? 473  ALA A C   1 
ATOM   3615 O O   . ALA A 1 472 ? -68.362 45.115  -33.575 1.00 31.23  ? 473  ALA A O   1 
ATOM   3616 C CB  . ALA A 1 472 ? -66.435 47.792  -33.376 1.00 32.79  ? 473  ALA A CB  1 
ATOM   3617 N N   . GLN A 1 473 ? -69.434 47.035  -34.054 1.00 31.28  ? 474  GLN A N   1 
ATOM   3618 C CA  . GLN A 1 473 ? -70.710 46.488  -33.612 1.00 38.94  ? 474  GLN A CA  1 
ATOM   3619 C C   . GLN A 1 473 ? -71.203 45.384  -34.536 1.00 38.20  ? 474  GLN A C   1 
ATOM   3620 O O   . GLN A 1 473 ? -71.882 44.456  -34.080 1.00 36.31  ? 474  GLN A O   1 
ATOM   3621 C CB  . GLN A 1 473 ? -71.746 47.609  -33.484 1.00 35.53  ? 474  GLN A CB  1 
ATOM   3622 C CG  . GLN A 1 473 ? -71.323 48.680  -32.476 1.00 40.43  ? 474  GLN A CG  1 
ATOM   3623 C CD  . GLN A 1 473 ? -72.268 49.875  -32.422 1.00 46.09  ? 474  GLN A CD  1 
ATOM   3624 O OE1 . GLN A 1 473 ? -72.782 50.318  -33.445 1.00 57.22  ? 474  GLN A OE1 1 
ATOM   3625 N NE2 . GLN A 1 473 ? -72.496 50.398  -31.230 1.00 45.19  ? 474  GLN A NE2 1 
ATOM   3626 N N   . ARG A 1 474 ? -70.862 45.447  -35.826 1.00 37.74  ? 475  ARG A N   1 
ATOM   3627 C CA  . ARG A 1 474 ? -71.249 44.366  -36.725 1.00 38.65  ? 475  ARG A CA  1 
ATOM   3628 C C   . ARG A 1 474 ? -70.511 43.072  -36.387 1.00 35.46  ? 475  ARG A C   1 
ATOM   3629 O O   . ARG A 1 474 ? -71.114 41.992  -36.374 1.00 40.41  ? 475  ARG A O   1 
ATOM   3630 C CB  . ARG A 1 474 ? -71.004 44.776  -38.178 1.00 44.47  ? 475  ARG A CB  1 
ATOM   3631 C CG  . ARG A 1 474 ? -71.363 43.694  -39.175 1.00 55.50  ? 475  ARG A CG  1 
ATOM   3632 C CD  . ARG A 1 474 ? -71.851 44.270  -40.497 1.00 52.49  ? 475  ARG A CD  1 
ATOM   3633 N NE  . ARG A 1 474 ? -70.850 45.135  -41.102 1.00 48.84  ? 475  ARG A NE  1 
ATOM   3634 C CZ  . ARG A 1 474 ? -69.867 44.706  -41.884 1.00 45.44  ? 475  ARG A CZ  1 
ATOM   3635 N NH1 . ARG A 1 474 ? -69.746 43.414  -42.168 1.00 38.89  ? 475  ARG A NH1 1 
ATOM   3636 N NH2 . ARG A 1 474 ? -69.001 45.577  -42.381 1.00 47.18  ? 475  ARG A NH2 1 
ATOM   3637 N N   . LEU A 1 475 ? -69.213 43.160  -36.087 1.00 29.14  ? 476  LEU A N   1 
ATOM   3638 C CA  . LEU A 1 475 ? -68.452 41.952  -35.771 1.00 31.71  ? 476  LEU A CA  1 
ATOM   3639 C C   . LEU A 1 475 ? -68.851 41.371  -34.419 1.00 38.77  ? 476  LEU A C   1 
ATOM   3640 O O   . LEU A 1 475 ? -68.932 40.145  -34.268 1.00 38.20  ? 476  LEU A O   1 
ATOM   3641 C CB  . LEU A 1 475 ? -66.954 42.246  -35.804 1.00 34.28  ? 476  LEU A CB  1 
ATOM   3642 C CG  . LEU A 1 475 ? -66.438 42.801  -37.133 1.00 41.23  ? 476  LEU A CG  1 
ATOM   3643 C CD1 . LEU A 1 475 ? -64.956 43.082  -37.040 1.00 38.68  ? 476  LEU A CD1 1 
ATOM   3644 C CD2 . LEU A 1 475 ? -66.725 41.844  -38.268 1.00 39.71  ? 476  LEU A CD2 1 
ATOM   3645 N N   . MET A 1 476 ? -69.091 42.227  -33.420 1.00 34.25  ? 477  MET A N   1 
ATOM   3646 C CA  . MET A 1 476 ? -69.569 41.726  -32.135 1.00 34.93  ? 477  MET A CA  1 
ATOM   3647 C C   . MET A 1 476 ? -70.862 40.943  -32.313 1.00 37.80  ? 477  MET A C   1 
ATOM   3648 O O   . MET A 1 476 ? -71.071 39.910  -31.664 1.00 33.53  ? 477  MET A O   1 
ATOM   3649 C CB  . MET A 1 476 ? -69.776 42.886  -31.157 1.00 33.20  ? 477  MET A CB  1 
ATOM   3650 C CG  . MET A 1 476 ? -68.488 43.549  -30.683 1.00 38.00  ? 477  MET A CG  1 
ATOM   3651 S SD  . MET A 1 476 ? -68.753 44.572  -29.217 1.00 45.10  ? 477  MET A SD  1 
ATOM   3652 C CE  . MET A 1 476 ? -69.702 45.923  -29.925 1.00 44.44  ? 477  MET A CE  1 
ATOM   3653 N N   . ARG A 1 477 ? -71.711 41.424  -33.199 1.00 37.67  ? 478  ARG A N   1 
ATOM   3654 C CA  . ARG A 1 477 ? -72.950 40.770  -33.538 1.00 41.67  ? 478  ARG A CA  1 
ATOM   3655 C C   . ARG A 1 477 ? -72.726 39.405  -34.200 1.00 43.87  ? 478  ARG A C   1 
ATOM   3656 O O   . ARG A 1 477 ? -73.313 38.466  -33.804 1.00 41.62  ? 478  ARG A O   1 
ATOM   3657 C CB  . ARG A 1 477 ? -73.800 41.708  -34.382 1.00 43.98  ? 478  ARG A CB  1 
ATOM   3658 C CG  . ARG A 1 477 ? -75.092 41.150  -34.924 1.00 49.70  ? 478  ARG A CG  1 
ATOM   3659 C CD  . ARG A 1 477 ? -76.076 40.745  -33.857 1.00 66.86  ? 478  ARG A CD  1 
ATOM   3660 N NE  . ARG A 1 477 ? -76.374 41.852  -32.975 1.00 68.72  ? 478  ARG A NE  1 
ATOM   3661 C CZ  . ARG A 1 477 ? -77.303 42.752  -33.196 1.00 75.19  ? 478  ARG A CZ  1 
ATOM   3662 N NH1 . ARG A 1 477 ? -78.063 42.667  -34.256 1.00 69.97  ? 478  ARG A NH1 1 
ATOM   3663 N NH2 . ARG A 1 477 ? -77.475 43.733  -32.352 1.00 85.81  ? 478  ARG A NH2 1 
ATOM   3664 N N   . TYR A 1 478 ? -71.819 39.320  -35.160 1.00 42.07  ? 479  TYR A N   1 
ATOM   3665 C CA  . TYR A 1 478 ? -71.432 38.053  -35.782 1.00 39.77  ? 479  TYR A CA  1 
ATOM   3666 C C   . TYR A 1 478 ? -70.943 37.060  -34.735 1.00 36.38  ? 479  TYR A C   1 
ATOM   3667 O O   . TYR A 1 478 ? -71.408 35.914  -34.679 1.00 31.88  ? 479  TYR A O   1 
ATOM   3668 C CB  . TYR A 1 478 ? -70.333 38.276  -36.827 1.00 37.03  ? 479  TYR A CB  1 
ATOM   3669 C CG  . TYR A 1 478 ? -70.762 38.951  -38.112 1.00 35.45  ? 479  TYR A CG  1 
ATOM   3670 C CD1 . TYR A 1 478 ? -71.991 38.678  -38.696 1.00 39.42  ? 479  TYR A CD1 1 
ATOM   3671 C CD2 . TYR A 1 478 ? -69.919 39.854  -38.749 1.00 35.57  ? 479  TYR A CD2 1 
ATOM   3672 C CE1 . TYR A 1 478 ? -72.372 39.297  -39.873 1.00 44.75  ? 479  TYR A CE1 1 
ATOM   3673 C CE2 . TYR A 1 478 ? -70.288 40.476  -39.921 1.00 37.21  ? 479  TYR A CE2 1 
ATOM   3674 C CZ  . TYR A 1 478 ? -71.514 40.196  -40.479 1.00 44.67  ? 479  TYR A CZ  1 
ATOM   3675 O OH  . TYR A 1 478 ? -71.878 40.821  -41.648 1.00 41.44  ? 479  TYR A OH  1 
ATOM   3676 N N   . TRP A 1 479 ? -69.992 37.488  -33.898 1.00 31.38  ? 480  TRP A N   1 
ATOM   3677 C CA  . TRP A 1 479 ? -69.443 36.608  -32.869 1.00 34.23  ? 480  TRP A CA  1 
ATOM   3678 C C   . TRP A 1 479 ? -70.521 36.154  -31.887 1.00 37.88  ? 480  TRP A C   1 
ATOM   3679 O O   . TRP A 1 479 ? -70.550 34.986  -31.482 1.00 33.60  ? 480  TRP A O   1 
ATOM   3680 C CB  . TRP A 1 479 ? -68.301 37.318  -32.131 1.00 29.23  ? 480  TRP A CB  1 
ATOM   3681 C CG  . TRP A 1 479 ? -66.917 36.917  -32.610 1.00 33.06  ? 480  TRP A CG  1 
ATOM   3682 C CD1 . TRP A 1 479 ? -65.924 36.348  -31.862 1.00 32.55  ? 480  TRP A CD1 1 
ATOM   3683 C CD2 . TRP A 1 479 ? -66.383 37.057  -33.941 1.00 26.75  ? 480  TRP A CD2 1 
ATOM   3684 N NE1 . TRP A 1 479 ? -64.807 36.125  -32.642 1.00 32.12  ? 480  TRP A NE1 1 
ATOM   3685 C CE2 . TRP A 1 479 ? -65.064 36.552  -33.919 1.00 26.80  ? 480  TRP A CE2 1 
ATOM   3686 C CE3 . TRP A 1 479 ? -66.892 37.563  -35.144 1.00 31.53  ? 480  TRP A CE3 1 
ATOM   3687 C CZ2 . TRP A 1 479 ? -64.249 36.532  -35.057 1.00 32.48  ? 480  TRP A CZ2 1 
ATOM   3688 C CZ3 . TRP A 1 479 ? -66.077 37.546  -36.277 1.00 32.03  ? 480  TRP A CZ3 1 
ATOM   3689 C CH2 . TRP A 1 479 ? -64.771 37.034  -36.224 1.00 32.85  ? 480  TRP A CH2 1 
ATOM   3690 N N   . ALA A 1 480 ? -71.425 37.058  -31.502 1.00 36.03  ? 481  ALA A N   1 
ATOM   3691 C CA  . ALA A 1 480 ? -72.442 36.695  -30.520 1.00 43.50  ? 481  ALA A CA  1 
ATOM   3692 C C   . ALA A 1 480 ? -73.537 35.840  -31.140 1.00 45.48  ? 481  ALA A C   1 
ATOM   3693 O O   . ALA A 1 480 ? -74.062 34.929  -30.485 1.00 42.54  ? 481  ALA A O   1 
ATOM   3694 C CB  . ALA A 1 480 ? -73.042 37.946  -29.884 1.00 28.70  ? 481  ALA A CB  1 
ATOM   3695 N N   . ASN A 1 481 ? -73.911 36.134  -32.389 1.00 43.18  ? 482  ASN A N   1 
ATOM   3696 C CA  . ASN A 1 481 ? -74.823 35.249  -33.105 1.00 44.76  ? 482  ASN A CA  1 
ATOM   3697 C C   . ASN A 1 481 ? -74.270 33.835  -33.139 1.00 43.54  ? 482  ASN A C   1 
ATOM   3698 O O   . ASN A 1 481 ? -75.002 32.863  -32.913 1.00 44.01  ? 482  ASN A O   1 
ATOM   3699 C CB  . ASN A 1 481 ? -75.055 35.750  -34.533 1.00 41.08  ? 482  ASN A CB  1 
ATOM   3700 C CG  . ASN A 1 481 ? -75.982 36.945  -34.597 1.00 43.07  ? 482  ASN A CG  1 
ATOM   3701 O OD1 . ASN A 1 481 ? -76.622 37.316  -33.608 1.00 36.62  ? 482  ASN A OD1 1 
ATOM   3702 N ND2 . ASN A 1 481 ? -76.075 37.546  -35.777 1.00 38.47  ? 482  ASN A ND2 1 
ATOM   3703 N N   . PHE A 1 482 ? -72.968 33.708  -33.405 1.00 36.41  ? 483  PHE A N   1 
ATOM   3704 C CA  . PHE A 1 482 ? -72.352 32.391  -33.468 1.00 36.86  ? 483  PHE A CA  1 
ATOM   3705 C C   . PHE A 1 482 ? -72.371 31.712  -32.106 1.00 38.09  ? 483  PHE A C   1 
ATOM   3706 O O   . PHE A 1 482 ? -72.663 30.515  -32.007 1.00 39.86  ? 483  PHE A O   1 
ATOM   3707 C CB  . PHE A 1 482 ? -70.922 32.501  -33.998 1.00 35.04  ? 483  PHE A CB  1 
ATOM   3708 C CG  . PHE A 1 482 ? -70.193 31.192  -34.012 1.00 35.24  ? 483  PHE A CG  1 
ATOM   3709 C CD1 . PHE A 1 482 ? -70.467 30.242  -34.986 1.00 32.80  ? 483  PHE A CD1 1 
ATOM   3710 C CD2 . PHE A 1 482 ? -69.259 30.895  -33.032 1.00 31.69  ? 483  PHE A CD2 1 
ATOM   3711 C CE1 . PHE A 1 482 ? -69.806 29.025  -34.992 1.00 27.36  ? 483  PHE A CE1 1 
ATOM   3712 C CE2 . PHE A 1 482 ? -68.593 29.679  -33.032 1.00 32.52  ? 483  PHE A CE2 1 
ATOM   3713 C CZ  . PHE A 1 482 ? -68.868 28.744  -34.014 1.00 32.53  ? 483  PHE A CZ  1 
ATOM   3714 N N   . ALA A 1 483 ? -72.072 32.465  -31.043 1.00 35.93  ? 484  ALA A N   1 
ATOM   3715 C CA  . ALA A 1 483 ? -72.111 31.900  -29.696 1.00 36.51  ? 484  ALA A CA  1 
ATOM   3716 C C   . ALA A 1 483 ? -73.507 31.398  -29.340 1.00 38.27  ? 484  ALA A C   1 
ATOM   3717 O O   . ALA A 1 483 ? -73.653 30.320  -28.757 1.00 41.53  ? 484  ALA A O   1 
ATOM   3718 C CB  . ALA A 1 483 ? -71.637 32.937  -28.677 1.00 31.84  ? 484  ALA A CB  1 
ATOM   3719 N N   . ARG A 1 484 ? -74.547 32.156  -29.697 1.00 36.58  ? 485  ARG A N   1 
ATOM   3720 C CA  . ARG A 1 484 ? -75.910 31.745  -29.368 1.00 44.93  ? 485  ARG A CA  1 
ATOM   3721 C C   . ARG A 1 484 ? -76.392 30.584  -30.234 1.00 47.68  ? 485  ARG A C   1 
ATOM   3722 O O   . ARG A 1 484 ? -77.004 29.638  -29.725 1.00 51.24  ? 485  ARG A O   1 
ATOM   3723 C CB  . ARG A 1 484 ? -76.870 32.924  -29.514 1.00 41.91  ? 485  ARG A CB  1 
ATOM   3724 C CG  . ARG A 1 484 ? -76.512 34.122  -28.661 1.00 40.80  ? 485  ARG A CG  1 
ATOM   3725 C CD  . ARG A 1 484 ? -77.517 35.243  -28.849 1.00 42.27  ? 485  ARG A CD  1 
ATOM   3726 N NE  . ARG A 1 484 ? -77.138 36.098  -29.969 1.00 51.37  ? 485  ARG A NE  1 
ATOM   3727 C CZ  . ARG A 1 484 ? -76.659 37.328  -29.835 1.00 44.73  ? 485  ARG A CZ  1 
ATOM   3728 N NH1 . ARG A 1 484 ? -76.499 37.846  -28.625 1.00 45.34  ? 485  ARG A NH1 1 
ATOM   3729 N NH2 . ARG A 1 484 ? -76.335 38.037  -30.905 1.00 42.49  ? 485  ARG A NH2 1 
ATOM   3730 N N   . THR A 1 485 ? -76.141 30.641  -31.545 1.00 40.63  ? 486  THR A N   1 
ATOM   3731 C CA  . THR A 1 485 ? -76.814 29.761  -32.492 1.00 44.29  ? 486  THR A CA  1 
ATOM   3732 C C   . THR A 1 485 ? -75.891 28.845  -33.281 1.00 47.43  ? 486  THR A C   1 
ATOM   3733 O O   . THR A 1 485 ? -76.389 27.942  -33.963 1.00 48.95  ? 486  THR A O   1 
ATOM   3734 C CB  . THR A 1 485 ? -77.640 30.585  -33.495 1.00 45.04  ? 486  THR A CB  1 
ATOM   3735 O OG1 . THR A 1 485 ? -76.760 31.215  -34.439 1.00 44.63  ? 486  THR A OG1 1 
ATOM   3736 C CG2 . THR A 1 485 ? -78.468 31.650  -32.775 1.00 36.39  ? 486  THR A CG2 1 
ATOM   3737 N N   . GLY A 1 486 ? -74.576 29.035  -33.211 1.00 44.81  ? 487  GLY A N   1 
ATOM   3738 C CA  . GLY A 1 486 ? -73.680 28.328  -34.101 1.00 37.41  ? 487  GLY A CA  1 
ATOM   3739 C C   . GLY A 1 486 ? -73.658 28.867  -35.510 1.00 43.94  ? 487  GLY A C   1 
ATOM   3740 O O   . GLY A 1 486 ? -73.077 28.228  -36.396 1.00 42.72  ? 487  GLY A O   1 
ATOM   3741 N N   . ASP A 1 487 ? -74.273 30.023  -35.743 1.00 46.17  ? 488  ASP A N   1 
ATOM   3742 C CA  . ASP A 1 487 ? -74.408 30.633  -37.056 1.00 47.62  ? 488  ASP A CA  1 
ATOM   3743 C C   . ASP A 1 487 ? -74.266 32.141  -36.894 1.00 44.33  ? 488  ASP A C   1 
ATOM   3744 O O   . ASP A 1 487 ? -75.072 32.766  -36.194 1.00 47.10  ? 488  ASP A O   1 
ATOM   3745 C CB  . ASP A 1 487 ? -75.762 30.265  -37.673 1.00 49.87  ? 488  ASP A CB  1 
ATOM   3746 C CG  . ASP A 1 487 ? -75.936 30.781  -39.095 1.00 49.00  ? 488  ASP A CG  1 
ATOM   3747 O OD1 . ASP A 1 487 ? -76.853 30.283  -39.786 1.00 55.03  ? 488  ASP A OD1 1 
ATOM   3748 O OD2 . ASP A 1 487 ? -75.172 31.670  -39.532 1.00 48.61  ? 488  ASP A OD2 1 
ATOM   3749 N N   . PRO A 1 488 ? -73.267 32.762  -37.528 1.00 45.23  ? 489  PRO A N   1 
ATOM   3750 C CA  . PRO A 1 488 ? -73.091 34.217  -37.377 1.00 42.35  ? 489  PRO A CA  1 
ATOM   3751 C C   . PRO A 1 488 ? -74.178 35.051  -38.053 1.00 43.32  ? 489  PRO A C   1 
ATOM   3752 O O   . PRO A 1 488 ? -74.252 36.255  -37.778 1.00 42.96  ? 489  PRO A O   1 
ATOM   3753 C CB  . PRO A 1 488 ? -71.717 34.471  -38.015 1.00 39.85  ? 489  PRO A CB  1 
ATOM   3754 C CG  . PRO A 1 488 ? -71.571 33.353  -39.026 1.00 43.08  ? 489  PRO A CG  1 
ATOM   3755 C CD  . PRO A 1 488 ? -72.238 32.158  -38.396 1.00 45.50  ? 489  PRO A CD  1 
ATOM   3756 N N   . ASN A 1 489 ? -75.021 34.458  -38.902 1.00 36.07  ? 490  ASN A N   1 
ATOM   3757 C CA  . ASN A 1 489 ? -76.049 35.196  -39.627 1.00 49.16  ? 490  ASN A CA  1 
ATOM   3758 C C   . ASN A 1 489 ? -77.310 35.403  -38.783 1.00 58.27  ? 490  ASN A C   1 
ATOM   3759 O O   . ASN A 1 489 ? -77.475 34.845  -37.695 1.00 52.79  ? 490  ASN A O   1 
ATOM   3760 C CB  . ASN A 1 489 ? -76.459 34.461  -40.911 1.00 44.82  ? 490  ASN A CB  1 
ATOM   3761 C CG  . ASN A 1 489 ? -75.348 34.372  -41.932 1.00 48.84  ? 490  ASN A CG  1 
ATOM   3762 O OD1 . ASN A 1 489 ? -75.071 35.332  -42.650 1.00 60.29  ? 490  ASN A OD1 1 
ATOM   3763 N ND2 . ASN A 1 489 ? -74.744 33.195  -42.046 1.00 40.84  ? 490  ASN A ND2 1 
ATOM   3764 N N   . GLU A 1 490 ? -77.999 36.470  -39.131 1.00 83.24  ? 491  GLU A N   1 
ATOM   3765 C CA  . GLU A 1 490 ? -79.188 36.955  -38.429 1.00 100.24 ? 491  GLU A CA  1 
ATOM   3766 C C   . GLU A 1 490 ? -80.465 36.135  -38.520 1.00 111.57 ? 491  GLU A C   1 
ATOM   3767 O O   . GLU A 1 490 ? -81.138 35.930  -37.514 1.00 115.43 ? 491  GLU A O   1 
ATOM   3768 C CB  . GLU A 1 490 ? -79.467 38.388  -38.854 1.00 102.64 ? 491  GLU A CB  1 
ATOM   3769 C CG  . GLU A 1 490 ? -78.356 39.352  -38.495 1.00 106.28 ? 491  GLU A CG  1 
ATOM   3770 C CD  . GLU A 1 490 ? -78.322 39.720  -37.013 1.00 109.40 ? 491  GLU A CD  1 
ATOM   3771 O OE1 . GLU A 1 490 ? -79.006 39.086  -36.198 1.00 110.95 ? 491  GLU A OE1 1 
ATOM   3772 O OE2 . GLU A 1 490 ? -77.601 40.653  -36.670 1.00 108.69 ? 491  GLU A OE2 1 
ATOM   3773 N N   . ALA A 1 496 ? -80.146 41.037  -46.061 1.00 127.74 ? 497  ALA A N   1 
ATOM   3774 C CA  . ALA A 1 496 ? -78.775 41.077  -45.547 1.00 122.36 ? 497  ALA A CA  1 
ATOM   3775 C C   . ALA A 1 496 ? -77.894 39.996  -46.126 1.00 116.25 ? 497  ALA A C   1 
ATOM   3776 O O   . ALA A 1 496 ? -78.247 38.823  -46.094 1.00 116.17 ? 497  ALA A O   1 
ATOM   3777 C CB  . ALA A 1 496 ? -78.766 40.977  -44.036 1.00 117.36 ? 497  ALA A CB  1 
ATOM   3778 N N   . PRO A 1 497 ? -76.711 40.388  -46.600 1.00 106.41 ? 498  PRO A N   1 
ATOM   3779 C CA  . PRO A 1 497 ? -75.699 39.528  -47.219 1.00 96.57  ? 498  PRO A CA  1 
ATOM   3780 C C   . PRO A 1 497 ? -75.438 38.338  -46.351 1.00 80.19  ? 498  PRO A C   1 
ATOM   3781 O O   . PRO A 1 497 ? -75.200 38.515  -45.198 1.00 79.66  ? 498  PRO A O   1 
ATOM   3782 C CB  . PRO A 1 497 ? -74.468 40.407  -47.238 1.00 98.83  ? 498  PRO A CB  1 
ATOM   3783 C CG  . PRO A 1 497 ? -74.996 41.780  -47.186 1.00 101.92 ? 498  PRO A CG  1 
ATOM   3784 C CD  . PRO A 1 497 ? -76.186 41.714  -46.305 1.00 104.67 ? 498  PRO A CD  1 
ATOM   3785 N N   . GLN A 1 498 ? -75.472 37.143  -46.884 1.00 64.31  ? 499  GLN A N   1 
ATOM   3786 C CA  . GLN A 1 498 ? -75.268 36.005  -46.047 1.00 58.30  ? 499  GLN A CA  1 
ATOM   3787 C C   . GLN A 1 498 ? -73.854 35.496  -46.008 1.00 57.53  ? 499  GLN A C   1 
ATOM   3788 O O   . GLN A 1 498 ? -73.095 35.694  -46.896 1.00 58.93  ? 499  GLN A O   1 
ATOM   3789 C CB  . GLN A 1 498 ? -76.206 34.905  -46.436 1.00 58.34  ? 499  GLN A CB  1 
ATOM   3790 C CG  . GLN A 1 498 ? -77.646 35.243  -46.145 1.00 65.02  ? 499  GLN A CG  1 
ATOM   3791 C CD  . GLN A 1 498 ? -77.946 35.405  -44.679 1.00 72.76  ? 499  GLN A CD  1 
ATOM   3792 O OE1 . GLN A 1 498 ? -78.141 36.495  -44.200 1.00 73.03  ? 499  GLN A OE1 1 
ATOM   3793 N NE2 . GLN A 1 498 ? -78.019 34.308  -43.978 1.00 73.09  ? 499  GLN A NE2 1 
ATOM   3794 N N   . TRP A 1 499 ? -73.516 34.880  -44.904 1.00 50.80  ? 500  TRP A N   1 
ATOM   3795 C CA  . TRP A 1 499 ? -72.209 34.284  -44.687 1.00 46.86  ? 500  TRP A CA  1 
ATOM   3796 C C   . TRP A 1 499 ? -72.337 32.778  -44.890 1.00 48.27  ? 500  TRP A C   1 
ATOM   3797 O O   . TRP A 1 499 ? -72.874 32.084  -44.014 1.00 54.77  ? 500  TRP A O   1 
ATOM   3798 C CB  . TRP A 1 499 ? -71.727 34.609  -43.269 1.00 46.40  ? 500  TRP A CB  1 
ATOM   3799 C CG  . TRP A 1 499 ? -70.316 34.236  -42.929 1.00 44.80  ? 500  TRP A CG  1 
ATOM   3800 C CD1 . TRP A 1 499 ? -69.519 33.323  -43.564 1.00 39.65  ? 500  TRP A CD1 1 
ATOM   3801 C CD2 . TRP A 1 499 ? -69.538 34.763  -41.846 1.00 40.43  ? 500  TRP A CD2 1 
ATOM   3802 N NE1 . TRP A 1 499 ? -68.294 33.256  -42.947 1.00 39.33  ? 500  TRP A NE1 1 
ATOM   3803 C CE2 . TRP A 1 499 ? -68.281 34.124  -41.885 1.00 37.27  ? 500  TRP A CE2 1 
ATOM   3804 C CE3 . TRP A 1 499 ? -69.785 35.714  -40.846 1.00 34.46  ? 500  TRP A CE3 1 
ATOM   3805 C CZ2 . TRP A 1 499 ? -67.269 34.410  -40.968 1.00 35.51  ? 500  TRP A CZ2 1 
ATOM   3806 C CZ3 . TRP A 1 499 ? -68.777 35.996  -39.927 1.00 35.29  ? 500  TRP A CZ3 1 
ATOM   3807 C CH2 . TRP A 1 499 ? -67.535 35.346  -39.996 1.00 37.56  ? 500  TRP A CH2 1 
ATOM   3808 N N   . PRO A 1 500 ? -71.883 32.226  -46.012 1.00 48.33  ? 501  PRO A N   1 
ATOM   3809 C CA  . PRO A 1 500 ? -72.073 30.791  -46.265 1.00 46.59  ? 501  PRO A CA  1 
ATOM   3810 C C   . PRO A 1 500 ? -71.078 29.964  -45.472 1.00 42.65  ? 501  PRO A C   1 
ATOM   3811 O O   . PRO A 1 500 ? -69.995 30.455  -45.120 1.00 38.68  ? 501  PRO A O   1 
ATOM   3812 C CB  . PRO A 1 500 ? -71.822 30.668  -47.775 1.00 45.37  ? 501  PRO A CB  1 
ATOM   3813 C CG  . PRO A 1 500 ? -70.843 31.754  -48.064 1.00 47.17  ? 501  PRO A CG  1 
ATOM   3814 C CD  . PRO A 1 500 ? -71.160 32.891  -47.111 1.00 47.21  ? 501  PRO A CD  1 
ATOM   3815 N N   . PRO A 1 501 ? -71.406 28.710  -45.166 1.00 42.20  ? 502  PRO A N   1 
ATOM   3816 C CA  . PRO A 1 501 ? -70.435 27.839  -44.494 1.00 40.59  ? 502  PRO A CA  1 
ATOM   3817 C C   . PRO A 1 501 ? -69.238 27.530  -45.380 1.00 42.25  ? 502  PRO A C   1 
ATOM   3818 O O   . PRO A 1 501 ? -69.325 27.510  -46.610 1.00 48.57  ? 502  PRO A O   1 
ATOM   3819 C CB  . PRO A 1 501 ? -71.239 26.566  -44.196 1.00 39.61  ? 502  PRO A CB  1 
ATOM   3820 C CG  . PRO A 1 501 ? -72.674 27.008  -44.207 1.00 42.76  ? 502  PRO A CG  1 
ATOM   3821 C CD  . PRO A 1 501 ? -72.733 28.079  -45.266 1.00 42.46  ? 502  PRO A CD  1 
ATOM   3822 N N   . TYR A 1 502 ? -68.105 27.290  -44.729 1.00 43.03  ? 503  TYR A N   1 
ATOM   3823 C CA  . TYR A 1 502 ? -66.910 26.837  -45.422 1.00 38.78  ? 503  TYR A CA  1 
ATOM   3824 C C   . TYR A 1 502 ? -66.984 25.329  -45.635 1.00 42.82  ? 503  TYR A C   1 
ATOM   3825 O O   . TYR A 1 502 ? -67.310 24.579  -44.712 1.00 51.29  ? 503  TYR A O   1 
ATOM   3826 C CB  . TYR A 1 502 ? -65.670 27.207  -44.610 1.00 38.90  ? 503  TYR A CB  1 
ATOM   3827 C CG  . TYR A 1 502 ? -64.354 26.842  -45.250 1.00 36.50  ? 503  TYR A CG  1 
ATOM   3828 C CD1 . TYR A 1 502 ? -63.794 25.586  -45.060 1.00 36.25  ? 503  TYR A CD1 1 
ATOM   3829 C CD2 . TYR A 1 502 ? -63.655 27.762  -46.027 1.00 36.65  ? 503  TYR A CD2 1 
ATOM   3830 C CE1 . TYR A 1 502 ? -62.586 25.246  -45.635 1.00 39.90  ? 503  TYR A CE1 1 
ATOM   3831 C CE2 . TYR A 1 502 ? -62.440 27.434  -46.605 1.00 38.92  ? 503  TYR A CE2 1 
ATOM   3832 C CZ  . TYR A 1 502 ? -61.911 26.172  -46.405 1.00 40.93  ? 503  TYR A CZ  1 
ATOM   3833 O OH  . TYR A 1 502 ? -60.704 25.825  -46.969 1.00 39.30  ? 503  TYR A OH  1 
ATOM   3834 N N   . THR A 1 503 ? -66.689 24.887  -46.855 1.00 48.64  ? 504  THR A N   1 
ATOM   3835 C CA  . THR A 1 503 ? -66.644 23.470  -47.184 1.00 50.07  ? 504  THR A CA  1 
ATOM   3836 C C   . THR A 1 503 ? -65.329 23.161  -47.886 1.00 49.85  ? 504  THR A C   1 
ATOM   3837 O O   . THR A 1 503 ? -64.684 24.045  -48.452 1.00 49.48  ? 504  THR A O   1 
ATOM   3838 C CB  . THR A 1 503 ? -67.819 23.059  -48.078 1.00 49.28  ? 504  THR A CB  1 
ATOM   3839 O OG1 . THR A 1 503 ? -67.850 23.906  -49.233 1.00 50.75  ? 504  THR A OG1 1 
ATOM   3840 C CG2 . THR A 1 503 ? -69.136 23.190  -47.323 1.00 48.86  ? 504  THR A CG2 1 
ATOM   3841 N N   . ALA A 1 504 ? -64.937 21.885  -47.847 1.00 51.22  ? 505  ALA A N   1 
ATOM   3842 C CA  . ALA A 1 504 ? -63.661 21.494  -48.438 1.00 49.02  ? 505  ALA A CA  1 
ATOM   3843 C C   . ALA A 1 504 ? -63.641 21.719  -49.947 1.00 51.62  ? 505  ALA A C   1 
ATOM   3844 O O   . ALA A 1 504 ? -62.574 21.963  -50.524 1.00 53.39  ? 505  ALA A O   1 
ATOM   3845 C CB  . ALA A 1 504 ? -63.359 20.032  -48.108 1.00 50.33  ? 505  ALA A CB  1 
ATOM   3846 N N   . GLY A 1 505 ? -64.798 21.656  -50.600 1.00 51.76  ? 506  GLY A N   1 
ATOM   3847 C CA  . GLY A 1 505 ? -64.860 21.861  -52.035 1.00 48.46  ? 506  GLY A CA  1 
ATOM   3848 C C   . GLY A 1 505 ? -64.956 23.317  -52.448 1.00 48.61  ? 506  GLY A C   1 
ATOM   3849 O O   . GLY A 1 505 ? -64.048 23.845  -53.095 1.00 47.64  ? 506  GLY A O   1 
ATOM   3850 N N   . ALA A 1 506 ? -66.052 23.983  -52.077 1.00 49.70  ? 507  ALA A N   1 
ATOM   3851 C CA  . ALA A 1 506 ? -66.238 25.369  -52.494 1.00 44.67  ? 507  ALA A CA  1 
ATOM   3852 C C   . ALA A 1 506 ? -65.317 26.322  -51.738 1.00 46.36  ? 507  ALA A C   1 
ATOM   3853 O O   . ALA A 1 506 ? -64.946 27.369  -52.275 1.00 48.23  ? 507  ALA A O   1 
ATOM   3854 C CB  . ALA A 1 506 ? -67.702 25.780  -52.322 1.00 38.74  ? 507  ALA A CB  1 
ATOM   3855 N N   . GLN A 1 507 ? -64.945 25.989  -50.500 1.00 39.17  ? 508  GLN A N   1 
ATOM   3856 C CA  . GLN A 1 507 ? -63.966 26.765  -49.729 1.00 39.91  ? 508  GLN A CA  1 
ATOM   3857 C C   . GLN A 1 507 ? -64.355 28.241  -49.608 1.00 36.26  ? 508  GLN A C   1 
ATOM   3858 O O   . GLN A 1 507 ? -63.510 29.135  -49.680 1.00 40.41  ? 508  GLN A O   1 
ATOM   3859 C CB  . GLN A 1 507 ? -62.564 26.622  -50.333 1.00 39.83  ? 508  GLN A CB  1 
ATOM   3860 C CG  . GLN A 1 507 ? -62.149 25.181  -50.601 1.00 44.74  ? 508  GLN A CG  1 
ATOM   3861 C CD  . GLN A 1 507 ? -60.863 25.076  -51.409 1.00 48.46  ? 508  GLN A CD  1 
ATOM   3862 O OE1 . GLN A 1 507 ? -59.869 25.745  -51.116 1.00 48.59  ? 508  GLN A OE1 1 
ATOM   3863 N NE2 . GLN A 1 507 ? -60.878 24.234  -52.431 1.00 48.28  ? 508  GLN A NE2 1 
ATOM   3864 N N   . GLN A 1 508 ? -65.639 28.505  -49.404 1.00 30.83  ? 509  GLN A N   1 
ATOM   3865 C CA  . GLN A 1 508 ? -66.120 29.878  -49.337 1.00 36.76  ? 509  GLN A CA  1 
ATOM   3866 C C   . GLN A 1 508 ? -65.813 30.516  -47.989 1.00 37.02  ? 509  GLN A C   1 
ATOM   3867 O O   . GLN A 1 508 ? -65.951 29.885  -46.935 1.00 35.36  ? 509  GLN A O   1 
ATOM   3868 C CB  . GLN A 1 508 ? -67.621 29.929  -49.599 1.00 33.02  ? 509  GLN A CB  1 
ATOM   3869 C CG  . GLN A 1 508 ? -67.999 29.414  -50.966 1.00 37.63  ? 509  GLN A CG  1 
ATOM   3870 C CD  . GLN A 1 508 ? -69.490 29.300  -51.146 1.00 46.97  ? 509  GLN A CD  1 
ATOM   3871 O OE1 . GLN A 1 508 ? -70.114 28.356  -50.662 1.00 56.78  ? 509  GLN A OE1 1 
ATOM   3872 N NE2 . GLN A 1 508 ? -70.073 30.255  -51.854 1.00 51.65  ? 509  GLN A NE2 1 
ATOM   3873 N N   . TYR A 1 509 ? -65.390 31.778  -48.036 1.00 35.51  ? 510  TYR A N   1 
ATOM   3874 C CA  . TYR A 1 509 ? -65.183 32.600  -46.855 1.00 38.69  ? 510  TYR A CA  1 
ATOM   3875 C C   . TYR A 1 509 ? -65.647 34.014  -47.173 1.00 42.53  ? 510  TYR A C   1 
ATOM   3876 O O   . TYR A 1 509 ? -65.903 34.357  -48.332 1.00 39.94  ? 510  TYR A O   1 
ATOM   3877 C CB  . TYR A 1 509 ? -63.716 32.603  -46.419 1.00 37.09  ? 510  TYR A CB  1 
ATOM   3878 C CG  . TYR A 1 509 ? -62.809 33.352  -47.367 1.00 39.60  ? 510  TYR A CG  1 
ATOM   3879 C CD1 . TYR A 1 509 ? -62.251 32.720  -48.477 1.00 42.51  ? 510  TYR A CD1 1 
ATOM   3880 C CD2 . TYR A 1 509 ? -62.512 34.696  -47.160 1.00 33.75  ? 510  TYR A CD2 1 
ATOM   3881 C CE1 . TYR A 1 509 ? -61.415 33.409  -49.352 1.00 34.05  ? 510  TYR A CE1 1 
ATOM   3882 C CE2 . TYR A 1 509 ? -61.688 35.391  -48.026 1.00 35.05  ? 510  TYR A CE2 1 
ATOM   3883 C CZ  . TYR A 1 509 ? -61.136 34.745  -49.115 1.00 41.04  ? 510  TYR A CZ  1 
ATOM   3884 O OH  . TYR A 1 509 ? -60.312 35.451  -49.960 1.00 40.91  ? 510  TYR A OH  1 
ATOM   3885 N N   . VAL A 1 510 ? -65.739 34.849  -46.138 1.00 34.82  ? 511  VAL A N   1 
ATOM   3886 C CA  . VAL A 1 510 ? -66.172 36.228  -46.314 1.00 37.86  ? 511  VAL A CA  1 
ATOM   3887 C C   . VAL A 1 510 ? -65.057 37.171  -45.880 1.00 38.68  ? 511  VAL A C   1 
ATOM   3888 O O   . VAL A 1 510 ? -64.237 36.851  -45.013 1.00 32.22  ? 511  VAL A O   1 
ATOM   3889 C CB  . VAL A 1 510 ? -67.477 36.540  -45.545 1.00 39.47  ? 511  VAL A CB  1 
ATOM   3890 C CG1 . VAL A 1 510 ? -68.599 35.615  -46.000 1.00 37.00  ? 511  VAL A CG1 1 
ATOM   3891 C CG2 . VAL A 1 510 ? -67.262 36.458  -44.033 1.00 27.87  ? 511  VAL A CG2 1 
ATOM   3892 N N   . SER A 1 511 ? -65.029 38.344  -46.506 1.00 37.87  ? 512  SER A N   1 
ATOM   3893 C CA  . SER A 1 511 ? -64.125 39.414  -46.109 1.00 38.51  ? 512  SER A CA  1 
ATOM   3894 C C   . SER A 1 511 ? -64.820 40.325  -45.101 1.00 40.00  ? 512  SER A C   1 
ATOM   3895 O O   . SER A 1 511 ? -65.969 40.730  -45.308 1.00 38.11  ? 512  SER A O   1 
ATOM   3896 C CB  . SER A 1 511 ? -63.681 40.217  -47.329 1.00 36.66  ? 512  SER A CB  1 
ATOM   3897 O OG  . SER A 1 511 ? -64.809 40.746  -48.003 1.00 45.54  ? 512  SER A OG  1 
ATOM   3898 N N   . LEU A 1 512 ? -64.130 40.634  -44.008 1.00 36.62  ? 513  LEU A N   1 
ATOM   3899 C CA  . LEU A 1 512 ? -64.639 41.532  -42.975 1.00 34.24  ? 513  LEU A CA  1 
ATOM   3900 C C   . LEU A 1 512 ? -63.916 42.866  -43.105 1.00 32.89  ? 513  LEU A C   1 
ATOM   3901 O O   . LEU A 1 512 ? -62.715 42.959  -42.824 1.00 36.25  ? 513  LEU A O   1 
ATOM   3902 C CB  . LEU A 1 512 ? -64.447 40.943  -41.578 1.00 32.51  ? 513  LEU A CB  1 
ATOM   3903 C CG  . LEU A 1 512 ? -64.932 39.516  -41.325 1.00 37.02  ? 513  LEU A CG  1 
ATOM   3904 C CD1 . LEU A 1 512 ? -64.557 39.038  -39.923 1.00 27.88  ? 513  LEU A CD1 1 
ATOM   3905 C CD2 . LEU A 1 512 ? -66.435 39.431  -41.537 1.00 38.44  ? 513  LEU A CD2 1 
ATOM   3906 N N   . ASP A 1 513 ? -64.638 43.888  -43.549 1.00 30.72  ? 514  ASP A N   1 
ATOM   3907 C CA  . ASP A 1 513 ? -64.120 45.249  -43.562 1.00 38.33  ? 514  ASP A CA  1 
ATOM   3908 C C   . ASP A 1 513 ? -65.320 46.192  -43.530 1.00 34.89  ? 514  ASP A C   1 
ATOM   3909 O O   . ASP A 1 513 ? -66.437 45.768  -43.215 1.00 43.78  ? 514  ASP A O   1 
ATOM   3910 C CB  . ASP A 1 513 ? -63.182 45.468  -44.765 1.00 45.42  ? 514  ASP A CB  1 
ATOM   3911 C CG  . ASP A 1 513 ? -63.854 45.200  -46.107 1.00 56.40  ? 514  ASP A CG  1 
ATOM   3912 O OD1 . ASP A 1 513 ? -65.074 44.942  -46.147 1.00 60.60  ? 514  ASP A OD1 1 
ATOM   3913 O OD2 . ASP A 1 513 ? -63.148 45.249  -47.136 1.00 61.96  ? 514  ASP A OD2 1 
ATOM   3914 N N   . LEU A 1 514 ? -65.098 47.464  -43.864 1.00 36.69  ? 515  LEU A N   1 
ATOM   3915 C CA  . LEU A 1 514 ? -66.172 48.448  -43.780 1.00 44.18  ? 515  LEU A CA  1 
ATOM   3916 C C   . LEU A 1 514 ? -67.281 48.210  -44.798 1.00 50.73  ? 515  LEU A C   1 
ATOM   3917 O O   . LEU A 1 514 ? -68.413 48.654  -44.571 1.00 57.54  ? 515  LEU A O   1 
ATOM   3918 C CB  . LEU A 1 514 ? -65.614 49.862  -43.946 1.00 40.45  ? 515  LEU A CB  1 
ATOM   3919 C CG  . LEU A 1 514 ? -64.562 50.279  -42.916 1.00 47.79  ? 515  LEU A CG  1 
ATOM   3920 C CD1 . LEU A 1 514 ? -64.021 51.661  -43.262 1.00 37.43  ? 515  LEU A CD1 1 
ATOM   3921 C CD2 . LEU A 1 514 ? -65.118 50.230  -41.485 1.00 43.71  ? 515  LEU A CD2 1 
ATOM   3922 N N   . ARG A 1 515 ? -66.989 47.532  -45.904 1.00 47.25  ? 516  ARG A N   1 
ATOM   3923 C CA  . ARG A 1 515 ? -67.989 47.217  -46.916 1.00 47.35  ? 516  ARG A CA  1 
ATOM   3924 C C   . ARG A 1 515 ? -68.836 46.036  -46.459 1.00 45.04  ? 516  ARG A C   1 
ATOM   3925 O O   . ARG A 1 515 ? -68.480 45.333  -45.510 1.00 44.73  ? 516  ARG A O   1 
ATOM   3926 C CB  . ARG A 1 515 ? -67.296 46.913  -48.243 1.00 50.24  ? 516  ARG A CB  1 
ATOM   3927 C CG  . ARG A 1 515 ? -66.298 47.970  -48.690 1.00 61.58  ? 516  ARG A CG  1 
ATOM   3928 C CD  . ARG A 1 515 ? -65.369 47.435  -49.772 1.00 71.71  ? 516  ARG A CD  1 
ATOM   3929 N NE  . ARG A 1 515 ? -64.688 46.208  -49.362 1.00 77.31  ? 516  ARG A NE  1 
ATOM   3930 C CZ  . ARG A 1 515 ? -64.828 45.035  -49.973 1.00 78.26  ? 516  ARG A CZ  1 
ATOM   3931 N NH1 . ARG A 1 515 ? -65.628 44.926  -51.025 1.00 83.75  ? 516  ARG A NH1 1 
ATOM   3932 N NH2 . ARG A 1 515 ? -64.170 43.968  -49.534 1.00 71.23  ? 516  ARG A NH2 1 
ATOM   3933 N N   . PRO A 1 516 ? -69.977 45.791  -47.107 1.00 48.91  ? 517  PRO A N   1 
ATOM   3934 C CA  . PRO A 1 516 ? -70.756 44.588  -46.786 1.00 53.38  ? 517  PRO A CA  1 
ATOM   3935 C C   . PRO A 1 516 ? -69.972 43.322  -47.103 1.00 52.20  ? 517  PRO A C   1 
ATOM   3936 O O   . PRO A 1 516 ? -68.969 43.345  -47.819 1.00 52.59  ? 517  PRO A O   1 
ATOM   3937 C CB  . PRO A 1 516 ? -71.997 44.711  -47.683 1.00 55.74  ? 517  PRO A CB  1 
ATOM   3938 C CG  . PRO A 1 516 ? -72.076 46.157  -48.033 1.00 51.60  ? 517  PRO A CG  1 
ATOM   3939 C CD  . PRO A 1 516 ? -70.659 46.630  -48.109 1.00 48.05  ? 517  PRO A CD  1 
ATOM   3940 N N   . LEU A 1 517 ? -70.450 42.202  -46.557 1.00 48.98  ? 518  LEU A N   1 
ATOM   3941 C CA  . LEU A 1 517 ? -69.771 40.923  -46.743 1.00 45.56  ? 518  LEU A CA  1 
ATOM   3942 C C   . LEU A 1 517 ? -69.615 40.595  -48.221 1.00 48.20  ? 518  LEU A C   1 
ATOM   3943 O O   . LEU A 1 517 ? -70.574 40.666  -48.995 1.00 47.69  ? 518  LEU A O   1 
ATOM   3944 C CB  . LEU A 1 517 ? -70.540 39.799  -46.049 1.00 40.66  ? 518  LEU A CB  1 
ATOM   3945 C CG  . LEU A 1 517 ? -70.602 39.812  -44.524 1.00 45.27  ? 518  LEU A CG  1 
ATOM   3946 C CD1 . LEU A 1 517 ? -71.306 38.566  -44.023 1.00 49.97  ? 518  LEU A CD1 1 
ATOM   3947 C CD2 . LEU A 1 517 ? -69.214 39.919  -43.924 1.00 44.18  ? 518  LEU A CD2 1 
ATOM   3948 N N   . GLU A 1 518 ? -68.395 40.242  -48.607 1.00 51.04  ? 519  GLU A N   1 
ATOM   3949 C CA  . GLU A 1 518 ? -68.098 39.711  -49.927 1.00 51.88  ? 519  GLU A CA  1 
ATOM   3950 C C   . GLU A 1 518 ? -67.710 38.250  -49.761 1.00 49.38  ? 519  GLU A C   1 
ATOM   3951 O O   . GLU A 1 518 ? -66.862 37.925  -48.922 1.00 43.95  ? 519  GLU A O   1 
ATOM   3952 C CB  . GLU A 1 518 ? -66.971 40.506  -50.595 1.00 52.14  ? 519  GLU A CB  1 
ATOM   3953 C CG  . GLU A 1 518 ? -66.763 40.209  -52.069 1.00 60.29  ? 519  GLU A CG  1 
ATOM   3954 C CD  . GLU A 1 518 ? -65.439 40.755  -52.586 1.00 74.67  ? 519  GLU A CD  1 
ATOM   3955 O OE1 . GLU A 1 518 ? -64.699 41.366  -51.787 1.00 79.09  ? 519  GLU A OE1 1 
ATOM   3956 O OE2 . GLU A 1 518 ? -65.131 40.561  -53.783 1.00 81.32  ? 519  GLU A OE2 1 
ATOM   3957 N N   . VAL A 1 519 ? -68.357 37.372  -50.526 1.00 48.51  ? 520  VAL A N   1 
ATOM   3958 C CA  . VAL A 1 519 ? -68.039 35.948  -50.516 1.00 48.09  ? 520  VAL A CA  1 
ATOM   3959 C C   . VAL A 1 519 ? -66.924 35.693  -51.521 1.00 46.45  ? 520  VAL A C   1 
ATOM   3960 O O   . VAL A 1 519 ? -66.996 36.137  -52.672 1.00 57.44  ? 520  VAL A O   1 
ATOM   3961 C CB  . VAL A 1 519 ? -69.279 35.095  -50.839 1.00 48.83  ? 520  VAL A CB  1 
ATOM   3962 C CG1 . VAL A 1 519 ? -68.902 33.611  -50.908 1.00 38.78  ? 520  VAL A CG1 1 
ATOM   3963 C CG2 . VAL A 1 519 ? -70.373 35.325  -49.803 1.00 40.35  ? 520  VAL A CG2 1 
ATOM   3964 N N   . ARG A 1 520 ? -65.884 34.993  -51.078 1.00 41.72  ? 521  ARG A N   1 
ATOM   3965 C CA  . ARG A 1 520 ? -64.756 34.602  -51.909 1.00 39.63  ? 521  ARG A CA  1 
ATOM   3966 C C   . ARG A 1 520 ? -64.456 33.133  -51.651 1.00 41.14  ? 521  ARG A C   1 
ATOM   3967 O O   . ARG A 1 520 ? -64.946 32.544  -50.685 1.00 43.81  ? 521  ARG A O   1 
ATOM   3968 C CB  . ARG A 1 520 ? -63.522 35.459  -51.607 1.00 41.16  ? 521  ARG A CB  1 
ATOM   3969 C CG  . ARG A 1 520 ? -63.836 36.930  -51.477 1.00 47.42  ? 521  ARG A CG  1 
ATOM   3970 C CD  . ARG A 1 520 ? -62.676 37.793  -51.916 1.00 51.58  ? 521  ARG A CD  1 
ATOM   3971 N NE  . ARG A 1 520 ? -62.901 39.184  -51.543 1.00 58.68  ? 521  ARG A NE  1 
ATOM   3972 C CZ  . ARG A 1 520 ? -62.116 39.878  -50.726 1.00 55.70  ? 521  ARG A CZ  1 
ATOM   3973 N NH1 . ARG A 1 520 ? -61.045 39.312  -50.191 1.00 47.83  ? 521  ARG A NH1 1 
ATOM   3974 N NH2 . ARG A 1 520 ? -62.409 41.140  -50.443 1.00 61.40  ? 521  ARG A NH2 1 
ATOM   3975 N N   . ARG A 1 521 ? -63.615 32.569  -52.495 1.00 49.25  ? 522  ARG A N   1 
ATOM   3976 C CA  . ARG A 1 521 ? -63.199 31.203  -52.313 1.00 50.88  ? 522  ARG A CA  1 
ATOM   3977 C C   . ARG A 1 521 ? -61.705 30.987  -52.337 1.00 45.87  ? 522  ARG A C   1 
ATOM   3978 O O   . ARG A 1 521 ? -61.010 31.626  -53.059 1.00 48.07  ? 522  ARG A O   1 
ATOM   3979 C CB  . ARG A 1 521 ? -63.989 30.210  -53.159 1.00 50.59  ? 522  ARG A CB  1 
ATOM   3980 C CG  . ARG A 1 521 ? -64.060 30.450  -54.625 1.00 50.98  ? 522  ARG A CG  1 
ATOM   3981 C CD  . ARG A 1 521 ? -65.063 29.509  -55.257 1.00 60.45  ? 522  ARG A CD  1 
ATOM   3982 N NE  . ARG A 1 521 ? -64.848 28.127  -54.902 1.00 56.23  ? 522  ARG A NE  1 
ATOM   3983 C CZ  . ARG A 1 521 ? -64.199 27.247  -55.635 1.00 58.25  ? 522  ARG A CZ  1 
ATOM   3984 N NH1 . ARG A 1 521 ? -63.690 27.596  -56.778 1.00 59.11  ? 522  ARG A NH1 1 
ATOM   3985 N NH2 . ARG A 1 521 ? -64.055 26.022  -55.225 1.00 54.71  ? 522  ARG A NH2 1 
ATOM   3986 N N   . GLY A 1 522 ? -61.225 30.112  -51.470 1.00 44.33  ? 523  GLY A N   1 
ATOM   3987 C CA  . GLY A 1 522 ? -59.814 29.823  -51.398 1.00 42.46  ? 523  GLY A CA  1 
ATOM   3988 C C   . GLY A 1 522 ? -59.122 30.575  -50.286 1.00 42.51  ? 523  GLY A C   1 
ATOM   3989 O O   . GLY A 1 522 ? -58.889 31.782  -50.396 1.00 49.24  ? 523  GLY A O   1 
ATOM   3990 N N   . LEU A 1 523 ? -58.797 29.877  -49.198 1.00 39.74  ? 524  LEU A N   1 
ATOM   3991 C CA  . LEU A 1 523 ? -57.916 30.427  -48.167 1.00 40.01  ? 524  LEU A CA  1 
ATOM   3992 C C   . LEU A 1 523 ? -56.477 30.164  -48.605 1.00 42.23  ? 524  LEU A C   1 
ATOM   3993 O O   . LEU A 1 523 ? -55.824 29.212  -48.170 1.00 39.80  ? 524  LEU A O   1 
ATOM   3994 C CB  . LEU A 1 523 ? -58.218 29.811  -46.806 1.00 38.50  ? 524  LEU A CB  1 
ATOM   3995 C CG  . LEU A 1 523 ? -59.524 30.230  -46.129 1.00 45.98  ? 524  LEU A CG  1 
ATOM   3996 C CD1 . LEU A 1 523 ? -59.798 29.357  -44.918 1.00 49.19  ? 524  LEU A CD1 1 
ATOM   3997 C CD2 . LEU A 1 523 ? -59.474 31.695  -45.729 1.00 44.59  ? 524  LEU A CD2 1 
ATOM   3998 N N   . ARG A 1 524 ? -55.985 31.030  -49.496 1.00 42.26  ? 525  ARG A N   1 
ATOM   3999 C CA  . ARG A 1 524 ? -54.675 30.849  -50.129 1.00 40.42  ? 525  ARG A CA  1 
ATOM   4000 C C   . ARG A 1 524 ? -54.534 29.429  -50.683 1.00 37.24  ? 525  ARG A C   1 
ATOM   4001 O O   . ARG A 1 524 ? -53.556 28.720  -50.416 1.00 38.31  ? 525  ARG A O   1 
ATOM   4002 C CB  . ARG A 1 524 ? -53.544 31.169  -49.145 1.00 40.20  ? 525  ARG A CB  1 
ATOM   4003 C CG  . ARG A 1 524 ? -53.561 32.587  -48.596 1.00 47.05  ? 525  ARG A CG  1 
ATOM   4004 C CD  . ARG A 1 524 ? -52.855 33.536  -49.540 1.00 54.05  ? 525  ARG A CD  1 
ATOM   4005 N NE  . ARG A 1 524 ? -51.427 33.243  -49.632 1.00 55.26  ? 525  ARG A NE  1 
ATOM   4006 C CZ  . ARG A 1 524 ? -50.630 33.700  -50.593 1.00 52.52  ? 525  ARG A CZ  1 
ATOM   4007 N NH1 . ARG A 1 524 ? -51.121 34.475  -51.554 1.00 52.50  ? 525  ARG A NH1 1 
ATOM   4008 N NH2 . ARG A 1 524 ? -49.343 33.376  -50.602 1.00 42.78  ? 525  ARG A NH2 1 
ATOM   4009 N N   . ALA A 1 525 ? -55.545 29.013  -51.452 1.00 32.82  ? 526  ALA A N   1 
ATOM   4010 C CA  . ALA A 1 525 ? -55.665 27.617  -51.871 1.00 34.78  ? 526  ALA A CA  1 
ATOM   4011 C C   . ALA A 1 525 ? -54.398 27.108  -52.552 1.00 41.69  ? 526  ALA A C   1 
ATOM   4012 O O   . ALA A 1 525 ? -53.885 26.039  -52.199 1.00 47.07  ? 526  ALA A O   1 
ATOM   4013 C CB  . ALA A 1 525 ? -56.871 27.454  -52.799 1.00 43.33  ? 526  ALA A CB  1 
ATOM   4014 N N   . GLN A 1 526 ? -53.879 27.856  -53.538 1.00 32.37  ? 527  GLN A N   1 
ATOM   4015 C CA  . GLN A 1 526 ? -52.671 27.410  -54.231 1.00 39.89  ? 527  GLN A CA  1 
ATOM   4016 C C   . GLN A 1 526 ? -51.500 27.304  -53.266 1.00 36.78  ? 527  GLN A C   1 
ATOM   4017 O O   . GLN A 1 526 ? -50.803 26.283  -53.226 1.00 40.43  ? 527  GLN A O   1 
ATOM   4018 C CB  . GLN A 1 526 ? -52.316 28.357  -55.380 1.00 36.65  ? 527  GLN A CB  1 
ATOM   4019 C CG  . GLN A 1 526 ? -53.226 28.265  -56.572 1.00 34.82  ? 527  GLN A CG  1 
ATOM   4020 C CD  . GLN A 1 526 ? -53.309 26.869  -57.149 1.00 45.71  ? 527  GLN A CD  1 
ATOM   4021 O OE1 . GLN A 1 526 ? -52.335 26.330  -57.686 1.00 53.37  ? 527  GLN A OE1 1 
ATOM   4022 N NE2 . GLN A 1 526 ? -54.482 26.277  -57.052 1.00 47.00  ? 527  GLN A NE2 1 
ATOM   4023 N N   . ALA A 1 527 ? -51.262 28.360  -52.487 1.00 32.28  ? 528  ALA A N   1 
ATOM   4024 C CA  . ALA A 1 527 ? -50.151 28.350  -51.540 1.00 40.73  ? 528  ALA A CA  1 
ATOM   4025 C C   . ALA A 1 527 ? -50.296 27.223  -50.530 1.00 41.78  ? 528  ALA A C   1 
ATOM   4026 O O   . ALA A 1 527 ? -49.329 26.508  -50.238 1.00 48.90  ? 528  ALA A O   1 
ATOM   4027 C CB  . ALA A 1 527 ? -50.063 29.697  -50.819 1.00 43.74  ? 528  ALA A CB  1 
ATOM   4028 N N   . CYS A 1 528 ? -51.498 27.039  -49.991 1.00 32.84  ? 529  CYS A N   1 
ATOM   4029 C CA  . CYS A 1 528 ? -51.648 26.077  -48.909 1.00 34.81  ? 529  CYS A CA  1 
ATOM   4030 C C   . CYS A 1 528 ? -51.593 24.641  -49.404 1.00 39.03  ? 529  CYS A C   1 
ATOM   4031 O O   . CYS A 1 528 ? -51.292 23.743  -48.610 1.00 35.17  ? 529  CYS A O   1 
ATOM   4032 C CB  . CYS A 1 528 ? -52.936 26.364  -48.140 1.00 30.18  ? 529  CYS A CB  1 
ATOM   4033 S SG  . CYS A 1 528 ? -52.762 27.892  -47.165 1.00 38.49  ? 529  CYS A SG  1 
ATOM   4034 N N   . ALA A 1 529 ? -51.837 24.404  -50.699 1.00 31.96  ? 530  ALA A N   1 
ATOM   4035 C CA  . ALA A 1 529 ? -51.590 23.072  -51.242 1.00 32.88  ? 530  ALA A CA  1 
ATOM   4036 C C   . ALA A 1 529 ? -50.115 22.715  -51.157 1.00 31.57  ? 530  ALA A C   1 
ATOM   4037 O O   . ALA A 1 529 ? -49.769 21.547  -50.941 1.00 31.54  ? 530  ALA A O   1 
ATOM   4038 C CB  . ALA A 1 529 ? -52.077 22.972  -52.691 1.00 28.09  ? 530  ALA A CB  1 
ATOM   4039 N N   . PHE A 1 530 ? -49.232 23.702  -51.307 1.00 28.51  ? 531  PHE A N   1 
ATOM   4040 C CA  . PHE A 1 530 ? -47.810 23.437  -51.129 1.00 28.53  ? 531  PHE A CA  1 
ATOM   4041 C C   . PHE A 1 530 ? -47.515 23.027  -49.691 1.00 38.05  ? 531  PHE A C   1 
ATOM   4042 O O   . PHE A 1 530 ? -46.897 21.985  -49.443 1.00 38.78  ? 531  PHE A O   1 
ATOM   4043 C CB  . PHE A 1 530 ? -46.993 24.669  -51.532 1.00 37.03  ? 531  PHE A CB  1 
ATOM   4044 C CG  . PHE A 1 530 ? -45.552 24.606  -51.107 1.00 47.39  ? 531  PHE A CG  1 
ATOM   4045 C CD1 . PHE A 1 530 ? -44.626 23.894  -51.851 1.00 50.88  ? 531  PHE A CD1 1 
ATOM   4046 C CD2 . PHE A 1 530 ? -45.126 25.253  -49.956 1.00 46.35  ? 531  PHE A CD2 1 
ATOM   4047 C CE1 . PHE A 1 530 ? -43.300 23.828  -51.456 1.00 52.86  ? 531  PHE A CE1 1 
ATOM   4048 C CE2 . PHE A 1 530 ? -43.804 25.188  -49.554 1.00 50.53  ? 531  PHE A CE2 1 
ATOM   4049 C CZ  . PHE A 1 530 ? -42.890 24.478  -50.305 1.00 54.63  ? 531  PHE A CZ  1 
ATOM   4050 N N   . TRP A 1 531 ? -47.981 23.826  -48.724 1.00 33.93  ? 532  TRP A N   1 
ATOM   4051 C CA  . TRP A 1 531 ? -47.666 23.556  -47.324 1.00 35.69  ? 532  TRP A CA  1 
ATOM   4052 C C   . TRP A 1 531 ? -48.385 22.314  -46.807 1.00 39.05  ? 532  TRP A C   1 
ATOM   4053 O O   . TRP A 1 531 ? -47.825 21.561  -46.000 1.00 35.97  ? 532  TRP A O   1 
ATOM   4054 C CB  . TRP A 1 531 ? -48.023 24.770  -46.465 1.00 33.50  ? 532  TRP A CB  1 
ATOM   4055 C CG  . TRP A 1 531 ? -47.184 25.966  -46.779 1.00 32.78  ? 532  TRP A CG  1 
ATOM   4056 C CD1 . TRP A 1 531 ? -47.564 27.079  -47.477 1.00 27.97  ? 532  TRP A CD1 1 
ATOM   4057 C CD2 . TRP A 1 531 ? -45.814 26.165  -46.420 1.00 32.23  ? 532  TRP A CD2 1 
ATOM   4058 N NE1 . TRP A 1 531 ? -46.517 27.962  -47.563 1.00 31.49  ? 532  TRP A NE1 1 
ATOM   4059 C CE2 . TRP A 1 531 ? -45.430 27.425  -46.924 1.00 29.19  ? 532  TRP A CE2 1 
ATOM   4060 C CE3 . TRP A 1 531 ? -44.877 25.405  -45.715 1.00 31.71  ? 532  TRP A CE3 1 
ATOM   4061 C CZ2 . TRP A 1 531 ? -44.150 27.940  -46.747 1.00 27.38  ? 532  TRP A CZ2 1 
ATOM   4062 C CZ3 . TRP A 1 531 ? -43.603 25.918  -45.542 1.00 29.21  ? 532  TRP A CZ3 1 
ATOM   4063 C CH2 . TRP A 1 531 ? -43.251 27.172  -46.058 1.00 30.13  ? 532  TRP A CH2 1 
ATOM   4064 N N   . ASN A 1 532 ? -49.621 22.078  -47.251 1.00 36.14  ? 533  ASN A N   1 
ATOM   4065 C CA  . ASN A 1 532 ? -50.440 21.039  -46.641 1.00 38.44  ? 533  ASN A CA  1 
ATOM   4066 C C   . ASN A 1 532 ? -50.436 19.720  -47.399 1.00 45.94  ? 533  ASN A C   1 
ATOM   4067 O O   . ASN A 1 532 ? -50.785 18.692  -46.810 1.00 53.09  ? 533  ASN A O   1 
ATOM   4068 C CB  . ASN A 1 532 ? -51.888 21.524  -46.486 1.00 33.95  ? 533  ASN A CB  1 
ATOM   4069 C CG  . ASN A 1 532 ? -52.005 22.681  -45.515 1.00 33.16  ? 533  ASN A CG  1 
ATOM   4070 O OD1 . ASN A 1 532 ? -51.208 22.796  -44.588 1.00 38.44  ? 533  ASN A OD1 1 
ATOM   4071 N ND2 . ASN A 1 532 ? -52.997 23.548  -45.722 1.00 29.66  ? 533  ASN A ND2 1 
ATOM   4072 N N   . ARG A 1 533 ? -50.042 19.709  -48.668 1.00 48.61  ? 534  ARG A N   1 
ATOM   4073 C CA  . ARG A 1 533 ? -50.123 18.489  -49.466 1.00 51.14  ? 534  ARG A CA  1 
ATOM   4074 C C   . ARG A 1 533 ? -48.781 17.993  -49.980 1.00 53.11  ? 534  ARG A C   1 
ATOM   4075 O O   . ARG A 1 533 ? -48.523 16.787  -49.938 1.00 52.46  ? 534  ARG A O   1 
ATOM   4076 C CB  . ARG A 1 533 ? -51.073 18.704  -50.652 1.00 46.23  ? 534  ARG A CB  1 
ATOM   4077 C CG  . ARG A 1 533 ? -52.456 19.147  -50.234 1.00 42.74  ? 534  ARG A CG  1 
ATOM   4078 C CD  . ARG A 1 533 ? -53.344 19.428  -51.428 1.00 48.45  ? 534  ARG A CD  1 
ATOM   4079 N NE  . ARG A 1 533 ? -54.689 19.785  -50.992 1.00 51.38  ? 534  ARG A NE  1 
ATOM   4080 C CZ  . ARG A 1 533 ? -55.710 18.935  -50.946 1.00 55.77  ? 534  ARG A CZ  1 
ATOM   4081 N NH1 . ARG A 1 533 ? -55.546 17.673  -51.328 1.00 57.74  ? 534  ARG A NH1 1 
ATOM   4082 N NH2 . ARG A 1 533 ? -56.897 19.352  -50.522 1.00 54.82  ? 534  ARG A NH2 1 
ATOM   4083 N N   . PHE A 1 534 ? -47.917 18.878  -50.475 1.00 57.20  ? 535  PHE A N   1 
ATOM   4084 C CA  . PHE A 1 534 ? -46.654 18.439  -51.083 1.00 58.22  ? 535  PHE A CA  1 
ATOM   4085 C C   . PHE A 1 534 ? -45.531 18.309  -50.057 1.00 64.85  ? 535  PHE A C   1 
ATOM   4086 O O   . PHE A 1 534 ? -45.047 17.205  -49.792 1.00 65.04  ? 535  PHE A O   1 
ATOM   4087 C CB  . PHE A 1 534 ? -46.228 19.396  -52.189 1.00 47.37  ? 535  PHE A CB  1 
ATOM   4088 C CG  . PHE A 1 534 ? -44.824 19.165  -52.651 1.00 62.78  ? 535  PHE A CG  1 
ATOM   4089 C CD1 . PHE A 1 534 ? -43.827 20.092  -52.389 1.00 67.60  ? 535  PHE A CD1 1 
ATOM   4090 C CD2 . PHE A 1 534 ? -44.493 17.999  -53.322 1.00 64.79  ? 535  PHE A CD2 1 
ATOM   4091 C CE1 . PHE A 1 534 ? -42.527 19.869  -52.810 1.00 69.46  ? 535  PHE A CE1 1 
ATOM   4092 C CE2 . PHE A 1 534 ? -43.199 17.774  -53.750 1.00 64.99  ? 535  PHE A CE2 1 
ATOM   4093 C CZ  . PHE A 1 534 ? -42.211 18.705  -53.489 1.00 68.66  ? 535  PHE A CZ  1 
ATOM   4094 N N   . LEU A 1 535 ? -45.095 19.438  -49.495 1.00 67.12  ? 536  LEU A N   1 
ATOM   4095 C CA  . LEU A 1 535 ? -44.024 19.480  -48.505 1.00 74.95  ? 536  LEU A CA  1 
ATOM   4096 C C   . LEU A 1 535 ? -44.169 18.389  -47.442 1.00 82.63  ? 536  LEU A C   1 
ATOM   4097 O O   . LEU A 1 535 ? -43.149 17.827  -47.015 1.00 84.53  ? 536  LEU A O   1 
ATOM   4098 C CB  . LEU A 1 535 ? -43.957 20.865  -47.850 1.00 75.44  ? 536  LEU A CB  1 
ATOM   4099 C CG  . LEU A 1 535 ? -42.773 21.116  -46.906 1.00 81.79  ? 536  LEU A CG  1 
ATOM   4100 C CD1 . LEU A 1 535 ? -42.256 22.536  -47.057 1.00 83.79  ? 536  LEU A CD1 1 
ATOM   4101 C CD2 . LEU A 1 535 ? -43.141 20.838  -45.450 1.00 82.99  ? 536  LEU A CD2 1 
ATOM   4102 N N   . PRO A 1 536 ? -45.385 18.052  -46.982 1.00 80.35  ? 537  PRO A N   1 
ATOM   4103 C CA  . PRO A 1 536 ? -45.502 16.896  -46.081 1.00 83.46  ? 537  PRO A CA  1 
ATOM   4104 C C   . PRO A 1 536 ? -45.097 15.591  -46.726 1.00 87.82  ? 537  PRO A C   1 
ATOM   4105 O O   . PRO A 1 536 ? -44.747 14.656  -46.007 1.00 104.63 ? 537  PRO A O   1 
ATOM   4106 C CB  . PRO A 1 536 ? -46.984 16.871  -45.687 1.00 81.14  ? 537  PRO A CB  1 
ATOM   4107 C CG  . PRO A 1 536 ? -47.525 18.160  -46.062 1.00 77.85  ? 537  PRO A CG  1 
ATOM   4108 C CD  . PRO A 1 536 ? -46.666 18.770  -47.106 1.00 77.24  ? 537  PRO A CD  1 
ATOM   4109 N N   . LYS A 1 537 ? -45.192 15.458  -48.035 1.00 75.00  ? 538  LYS A N   1 
ATOM   4110 C CA  . LYS A 1 537 ? -44.713 14.259  -48.686 1.00 67.36  ? 538  LYS A CA  1 
ATOM   4111 C C   . LYS A 1 537 ? -43.214 14.131  -48.694 1.00 69.18  ? 538  LYS A C   1 
ATOM   4112 O O   . LYS A 1 537 ? -42.645 13.086  -48.522 1.00 80.96  ? 538  LYS A O   1 
ATOM   4113 C CB  . LYS A 1 537 ? -45.221 14.210  -50.086 1.00 66.13  ? 538  LYS A CB  1 
ATOM   4114 C CG  . LYS A 1 537 ? -46.636 13.749  -50.119 1.00 72.37  ? 538  LYS A CG  1 
ATOM   4115 C CD  . LYS A 1 537 ? -47.133 13.743  -51.536 1.00 82.36  ? 538  LYS A CD  1 
ATOM   4116 C CE  . LYS A 1 537 ? -48.461 13.030  -51.600 1.00 90.59  ? 538  LYS A CE  1 
ATOM   4117 N NZ  . LYS A 1 537 ? -49.222 13.289  -50.348 1.00 93.90  ? 538  LYS A NZ  1 
ATOM   4118 N N   . LEU A 1 538 ? -42.592 15.238  -48.987 1.00 71.33  ? 539  LEU A N   1 
ATOM   4119 C CA  . LEU A 1 538 ? -41.174 15.360  -49.083 1.00 80.69  ? 539  LEU A CA  1 
ATOM   4120 C C   . LEU A 1 538 ? -40.480 15.144  -47.788 1.00 89.78  ? 539  LEU A C   1 
ATOM   4121 O O   . LEU A 1 538 ? -39.388 14.658  -47.755 1.00 97.46  ? 539  LEU A O   1 
ATOM   4122 C CB  . LEU A 1 538 ? -40.832 16.723  -49.620 1.00 79.00  ? 539  LEU A CB  1 
ATOM   4123 C CG  . LEU A 1 538 ? -39.389 17.161  -49.563 1.00 82.64  ? 539  LEU A CG  1 
ATOM   4124 C CD1 . LEU A 1 538 ? -39.243 18.305  -50.520 1.00 85.34  ? 539  LEU A CD1 1 
ATOM   4125 C CD2 . LEU A 1 538 ? -39.032 17.612  -48.179 1.00 76.12  ? 539  LEU A CD2 1 
ATOM   4126 N N   . LEU A 1 539 ? -41.094 15.577  -46.712 1.00 94.40  ? 540  LEU A N   1 
ATOM   4127 C CA  . LEU A 1 539 ? -40.499 15.441  -45.409 1.00 104.78 ? 540  LEU A CA  1 
ATOM   4128 C C   . LEU A 1 539 ? -40.264 13.984  -45.086 1.00 112.05 ? 540  LEU A C   1 
ATOM   4129 O O   . LEU A 1 539 ? -39.212 13.619  -44.623 1.00 114.79 ? 540  LEU A O   1 
ATOM   4130 C CB  . LEU A 1 539 ? -41.454 16.035  -44.384 1.00 106.46 ? 540  LEU A CB  1 
ATOM   4131 C CG  . LEU A 1 539 ? -41.172 16.069  -42.888 1.00 107.84 ? 540  LEU A CG  1 
ATOM   4132 C CD1 . LEU A 1 539 ? -42.459 15.787  -42.136 1.00 104.14 ? 540  LEU A CD1 1 
ATOM   4133 C CD2 . LEU A 1 539 ? -40.097 15.091  -42.463 1.00 110.25 ? 540  LEU A CD2 1 
ATOM   4134 N N   . SER A 1 540 ? -41.234 13.140  -45.352 1.00 111.13 ? 541  SER A N   1 
ATOM   4135 C CA  . SER A 1 540 ? -41.041 11.739  -45.104 1.00 113.10 ? 541  SER A CA  1 
ATOM   4136 C C   . SER A 1 540 ? -40.394 11.106  -46.318 1.00 112.94 ? 541  SER A C   1 
ATOM   4137 O O   . SER A 1 540 ? -40.979 10.238  -46.938 1.00 114.61 ? 541  SER A O   1 
ATOM   4138 C CB  . SER A 1 540 ? -42.379 11.087  -44.831 1.00 111.64 ? 541  SER A CB  1 
ATOM   4139 O OG  . SER A 1 540 ? -43.379 11.638  -45.643 1.00 109.45 ? 541  SER A OG  1 
ATOM   4140 N N   . ALA A 1 541 ? -39.167 11.507  -46.636 1.00 111.67 ? 542  ALA A N   1 
ATOM   4141 C CA  . ALA A 1 541 ? -38.499 10.958  -47.804 1.00 111.33 ? 542  ALA A CA  1 
ATOM   4142 C C   . ALA A 1 541 ? -37.029 11.297  -47.782 1.00 112.64 ? 542  ALA A C   1 
ATOM   4143 O O   . ALA A 1 541 ? -36.658 12.438  -47.551 1.00 111.24 ? 542  ALA A O   1 
ATOM   4144 C CB  . ALA A 1 541 ? -39.129 11.505  -49.072 1.00 105.96 ? 542  ALA A CB  1 
ATOM   4145 N N   . GLU B 1 3   ? -29.135 -18.490 15.499  1.00 99.79  ? 4    GLU B N   1 
ATOM   4146 C CA  . GLU B 1 3   ? -29.170 -18.448 14.041  1.00 96.36  ? 4    GLU B CA  1 
ATOM   4147 C C   . GLU B 1 3   ? -29.021 -19.836 13.439  1.00 88.37  ? 4    GLU B C   1 
ATOM   4148 O O   . GLU B 1 3   ? -28.450 -20.722 14.040  1.00 93.93  ? 4    GLU B O   1 
ATOM   4149 C CB  . GLU B 1 3   ? -28.082 -17.516 13.498  1.00 100.36 ? 4    GLU B CB  1 
ATOM   4150 C CG  . GLU B 1 3   ? -28.546 -16.101 13.184  1.00 108.62 ? 4    GLU B CG  1 
ATOM   4151 C CD  . GLU B 1 3   ? -27.644 -15.370 12.189  1.00 116.64 ? 4    GLU B CD  1 
ATOM   4152 O OE1 . GLU B 1 3   ? -28.133 -14.780 11.214  1.00 116.49 ? 4    GLU B OE1 1 
ATOM   4153 O OE2 . GLU B 1 3   ? -26.428 -15.379 12.377  1.00 121.94 ? 4    GLU B OE2 1 
ATOM   4154 N N   . ASP B 1 4   ? -29.575 -20.019 12.256  1.00 79.53  ? 5    ASP B N   1 
ATOM   4155 C CA  . ASP B 1 4   ? -29.471 -21.271 11.519  1.00 70.97  ? 5    ASP B CA  1 
ATOM   4156 C C   . ASP B 1 4   ? -28.180 -21.259 10.708  1.00 65.24  ? 5    ASP B C   1 
ATOM   4157 O O   . ASP B 1 4   ? -28.004 -20.407 9.829   1.00 64.42  ? 5    ASP B O   1 
ATOM   4158 C CB  . ASP B 1 4   ? -30.685 -21.453 10.606  1.00 66.55  ? 5    ASP B CB  1 
ATOM   4159 C CG  . ASP B 1 4   ? -30.806 -22.863 10.059  1.00 66.70  ? 5    ASP B CG  1 
ATOM   4160 O OD1 . ASP B 1 4   ? -31.911 -23.223 9.596   1.00 65.01  ? 5    ASP B OD1 1 
ATOM   4161 O OD2 . ASP B 1 4   ? -29.804 -23.611 10.090  1.00 67.23  ? 5    ASP B OD2 1 
ATOM   4162 N N   . ALA B 1 5   ? -27.280 -22.204 11.004  1.00 59.41  ? 6    ALA B N   1 
ATOM   4163 C CA  . ALA B 1 5   ? -25.997 -22.257 10.307  1.00 55.29  ? 6    ALA B CA  1 
ATOM   4164 C C   . ALA B 1 5   ? -26.163 -22.598 8.833   1.00 58.34  ? 6    ALA B C   1 
ATOM   4165 O O   . ALA B 1 5   ? -25.343 -22.181 8.007   1.00 55.93  ? 6    ALA B O   1 
ATOM   4166 C CB  . ALA B 1 5   ? -25.072 -23.276 10.972  1.00 51.77  ? 6    ALA B CB  1 
ATOM   4167 N N   . GLU B 1 6   ? -27.209 -23.351 8.484   1.00 57.32  ? 7    GLU B N   1 
ATOM   4168 C CA  . GLU B 1 6   ? -27.438 -23.714 7.091   1.00 54.42  ? 7    GLU B CA  1 
ATOM   4169 C C   . GLU B 1 6   ? -27.719 -22.503 6.212   1.00 49.09  ? 7    GLU B C   1 
ATOM   4170 O O   . GLU B 1 6   ? -27.589 -22.597 4.988   1.00 49.31  ? 7    GLU B O   1 
ATOM   4171 C CB  . GLU B 1 6   ? -28.601 -24.700 6.991   1.00 55.12  ? 7    GLU B CB  1 
ATOM   4172 C CG  . GLU B 1 6   ? -28.370 -25.994 7.739   1.00 53.93  ? 7    GLU B CG  1 
ATOM   4173 C CD  . GLU B 1 6   ? -27.282 -26.836 7.107   1.00 61.10  ? 7    GLU B CD  1 
ATOM   4174 O OE1 . GLU B 1 6   ? -27.115 -26.769 5.866   1.00 52.85  ? 7    GLU B OE1 1 
ATOM   4175 O OE2 . GLU B 1 6   ? -26.591 -27.563 7.854   1.00 69.60  ? 7    GLU B OE2 1 
ATOM   4176 N N   . LEU B 1 7   ? -28.098 -21.375 6.803   1.00 46.01  ? 8    LEU B N   1 
ATOM   4177 C CA  . LEU B 1 7   ? -28.487 -20.194 6.048   1.00 43.82  ? 8    LEU B CA  1 
ATOM   4178 C C   . LEU B 1 7   ? -27.397 -19.138 5.990   1.00 43.33  ? 8    LEU B C   1 
ATOM   4179 O O   . LEU B 1 7   ? -27.631 -18.050 5.455   1.00 43.32  ? 8    LEU B O   1 
ATOM   4180 C CB  . LEU B 1 7   ? -29.765 -19.600 6.634   1.00 40.72  ? 8    LEU B CB  1 
ATOM   4181 C CG  . LEU B 1 7   ? -30.901 -20.621 6.576   1.00 42.61  ? 8    LEU B CG  1 
ATOM   4182 C CD1 . LEU B 1 7   ? -32.129 -20.082 7.277   1.00 34.32  ? 8    LEU B CD1 1 
ATOM   4183 C CD2 . LEU B 1 7   ? -31.207 -21.036 5.120   1.00 38.89  ? 8    LEU B CD2 1 
ATOM   4184 N N   . LEU B 1 8   ? -26.215 -19.432 6.514   1.00 41.04  ? 9    LEU B N   1 
ATOM   4185 C CA  . LEU B 1 8   ? -25.074 -18.536 6.423   1.00 38.26  ? 9    LEU B CA  1 
ATOM   4186 C C   . LEU B 1 8   ? -24.052 -19.167 5.493   1.00 40.72  ? 9    LEU B C   1 
ATOM   4187 O O   . LEU B 1 8   ? -23.661 -20.324 5.684   1.00 42.81  ? 9    LEU B O   1 
ATOM   4188 C CB  . LEU B 1 8   ? -24.479 -18.256 7.802   1.00 33.77  ? 9    LEU B CB  1 
ATOM   4189 C CG  . LEU B 1 8   ? -25.473 -17.575 8.748   1.00 41.84  ? 9    LEU B CG  1 
ATOM   4190 C CD1 . LEU B 1 8   ? -25.072 -17.774 10.211  1.00 42.27  ? 9    LEU B CD1 1 
ATOM   4191 C CD2 . LEU B 1 8   ? -25.632 -16.091 8.404   1.00 43.83  ? 9    LEU B CD2 1 
ATOM   4192 N N   . VAL B 1 9   ? -23.658 -18.419 4.472   1.00 38.99  ? 10   VAL B N   1 
ATOM   4193 C CA  . VAL B 1 9   ? -22.714 -18.876 3.463   1.00 38.88  ? 10   VAL B CA  1 
ATOM   4194 C C   . VAL B 1 9   ? -21.701 -17.766 3.241   1.00 35.77  ? 10   VAL B C   1 
ATOM   4195 O O   . VAL B 1 9   ? -22.062 -16.585 3.179   1.00 35.60  ? 10   VAL B O   1 
ATOM   4196 C CB  . VAL B 1 9   ? -23.423 -19.239 2.136   1.00 39.03  ? 10   VAL B CB  1 
ATOM   4197 C CG1 . VAL B 1 9   ? -22.410 -19.569 1.056   1.00 47.05  ? 10   VAL B CG1 1 
ATOM   4198 C CG2 . VAL B 1 9   ? -24.361 -20.406 2.340   1.00 43.20  ? 10   VAL B CG2 1 
ATOM   4199 N N   . THR B 1 10  ? -20.434 -18.139 3.139   1.00 34.84  ? 11   THR B N   1 
ATOM   4200 C CA  . THR B 1 10  ? -19.399 -17.219 2.696   1.00 40.48  ? 11   THR B CA  1 
ATOM   4201 C C   . THR B 1 10  ? -19.059 -17.540 1.244   1.00 36.86  ? 11   THR B C   1 
ATOM   4202 O O   . THR B 1 10  ? -18.720 -18.683 0.915   1.00 38.81  ? 11   THR B O   1 
ATOM   4203 C CB  . THR B 1 10  ? -18.158 -17.310 3.582   1.00 40.91  ? 11   THR B CB  1 
ATOM   4204 O OG1 . THR B 1 10  ? -18.518 -17.006 4.936   1.00 43.93  ? 11   THR B OG1 1 
ATOM   4205 C CG2 . THR B 1 10  ? -17.103 -16.322 3.109   1.00 41.39  ? 11   THR B CG2 1 
ATOM   4206 N N   . VAL B 1 11  ? -19.182 -16.541 0.378   1.00 34.48  ? 12   VAL B N   1 
ATOM   4207 C CA  . VAL B 1 11  ? -18.717 -16.647 -0.998  1.00 36.83  ? 12   VAL B CA  1 
ATOM   4208 C C   . VAL B 1 11  ? -17.462 -15.793 -1.120  1.00 43.77  ? 12   VAL B C   1 
ATOM   4209 O O   . VAL B 1 11  ? -16.986 -15.234 -0.125  1.00 47.28  ? 12   VAL B O   1 
ATOM   4210 C CB  . VAL B 1 11  ? -19.810 -16.220 -1.991  1.00 35.22  ? 12   VAL B CB  1 
ATOM   4211 C CG1 . VAL B 1 11  ? -21.006 -17.163 -1.881  1.00 32.71  ? 12   VAL B CG1 1 
ATOM   4212 C CG2 . VAL B 1 11  ? -20.241 -14.781 -1.712  1.00 25.16  ? 12   VAL B CG2 1 
ATOM   4213 N N   . ARG B 1 12  ? -16.918 -15.679 -2.332  1.00 40.23  ? 13   ARG B N   1 
ATOM   4214 C CA  . ARG B 1 12  ? -15.625 -15.015 -2.486  1.00 40.97  ? 13   ARG B CA  1 
ATOM   4215 C C   . ARG B 1 12  ? -15.680 -13.550 -2.073  1.00 38.09  ? 13   ARG B C   1 
ATOM   4216 O O   . ARG B 1 12  ? -14.697 -13.023 -1.540  1.00 42.40  ? 13   ARG B O   1 
ATOM   4217 C CB  . ARG B 1 12  ? -15.128 -15.157 -3.928  1.00 40.64  ? 13   ARG B CB  1 
ATOM   4218 C CG  . ARG B 1 12  ? -14.343 -16.449 -4.135  1.00 54.74  ? 13   ARG B CG  1 
ATOM   4219 C CD  . ARG B 1 12  ? -13.799 -16.611 -5.539  1.00 70.02  ? 13   ARG B CD  1 
ATOM   4220 N NE  . ARG B 1 12  ? -13.513 -18.015 -5.822  1.00 84.53  ? 13   ARG B NE  1 
ATOM   4221 C CZ  . ARG B 1 12  ? -12.677 -18.439 -6.764  1.00 94.04  ? 13   ARG B CZ  1 
ATOM   4222 N NH1 . ARG B 1 12  ? -12.034 -17.564 -7.525  1.00 96.02  ? 13   ARG B NH1 1 
ATOM   4223 N NH2 . ARG B 1 12  ? -12.486 -19.740 -6.945  1.00 98.48  ? 13   ARG B NH2 1 
ATOM   4224 N N   . GLY B 1 13  ? -16.813 -12.884 -2.286  1.00 34.01  ? 14   GLY B N   1 
ATOM   4225 C CA  . GLY B 1 13  ? -16.944 -11.484 -1.941  1.00 39.95  ? 14   GLY B CA  1 
ATOM   4226 C C   . GLY B 1 13  ? -17.331 -11.177 -0.509  1.00 43.63  ? 14   GLY B C   1 
ATOM   4227 O O   . GLY B 1 13  ? -17.291 -10.008 -0.115  1.00 41.55  ? 14   GLY B O   1 
ATOM   4228 N N   . GLY B 1 14  ? -17.712 -12.175 0.281   1.00 38.41  ? 15   GLY B N   1 
ATOM   4229 C CA  . GLY B 1 14  ? -18.100 -11.941 1.655   1.00 40.72  ? 15   GLY B CA  1 
ATOM   4230 C C   . GLY B 1 14  ? -19.193 -12.902 2.085   1.00 40.27  ? 15   GLY B C   1 
ATOM   4231 O O   . GLY B 1 14  ? -19.411 -13.937 1.461   1.00 38.16  ? 15   GLY B O   1 
ATOM   4232 N N   . ARG B 1 15  ? -19.882 -12.522 3.159   1.00 35.91  ? 16   ARG B N   1 
ATOM   4233 C CA  . ARG B 1 15  ? -20.839 -13.386 3.832   1.00 38.67  ? 16   ARG B CA  1 
ATOM   4234 C C   . ARG B 1 15  ? -22.269 -13.051 3.428   1.00 39.03  ? 16   ARG B C   1 
ATOM   4235 O O   . ARG B 1 15  ? -22.608 -11.894 3.163   1.00 35.57  ? 16   ARG B O   1 
ATOM   4236 C CB  . ARG B 1 15  ? -20.683 -13.272 5.349   1.00 40.01  ? 16   ARG B CB  1 
ATOM   4237 C CG  . ARG B 1 15  ? -19.371 -13.845 5.866   1.00 49.51  ? 16   ARG B CG  1 
ATOM   4238 C CD  . ARG B 1 15  ? -19.229 -13.655 7.366   1.00 53.86  ? 16   ARG B CD  1 
ATOM   4239 N NE  . ARG B 1 15  ? -19.095 -12.244 7.708   1.00 61.60  ? 16   ARG B NE  1 
ATOM   4240 C CZ  . ARG B 1 15  ? -19.501 -11.714 8.857   1.00 69.16  ? 16   ARG B CZ  1 
ATOM   4241 N NH1 . ARG B 1 15  ? -20.074 -12.481 9.774   1.00 70.45  ? 16   ARG B NH1 1 
ATOM   4242 N NH2 . ARG B 1 15  ? -19.344 -10.418 9.084   1.00 71.68  ? 16   ARG B NH2 1 
ATOM   4243 N N   . LEU B 1 16  ? -23.110 -14.088 3.395   1.00 40.22  ? 17   LEU B N   1 
ATOM   4244 C CA  . LEU B 1 16  ? -24.519 -13.971 3.043   1.00 37.48  ? 17   LEU B CA  1 
ATOM   4245 C C   . LEU B 1 16  ? -25.388 -14.650 4.092   1.00 34.18  ? 17   LEU B C   1 
ATOM   4246 O O   . LEU B 1 16  ? -24.952 -15.571 4.791   1.00 36.58  ? 17   LEU B O   1 
ATOM   4247 C CB  . LEU B 1 16  ? -24.828 -14.616 1.681   1.00 37.28  ? 17   LEU B CB  1 
ATOM   4248 C CG  . LEU B 1 16  ? -23.832 -14.479 0.539   1.00 40.91  ? 17   LEU B CG  1 
ATOM   4249 C CD1 . LEU B 1 16  ? -24.108 -15.531 -0.525  1.00 34.48  ? 17   LEU B CD1 1 
ATOM   4250 C CD2 . LEU B 1 16  ? -23.943 -13.088 -0.044  1.00 44.71  ? 17   LEU B CD2 1 
ATOM   4251 N N   A ARG B 1 17  ? -26.618 -14.215 4.148   0.53 30.96  ? 18   ARG B N   1 
ATOM   4252 N N   B ARG B 1 17  ? -26.622 -14.216 4.163   0.47 30.62  ? 18   ARG B N   1 
ATOM   4253 C CA  A ARG B 1 17  ? -27.626 -14.822 4.953   0.53 35.47  ? 18   ARG B CA  1 
ATOM   4254 C CA  B ARG B 1 17  ? -27.633 -14.819 4.983   0.47 35.49  ? 18   ARG B CA  1 
ATOM   4255 C C   A ARG B 1 17  ? -28.803 -15.162 4.049   0.53 34.90  ? 18   ARG B C   1 
ATOM   4256 C C   B ARG B 1 17  ? -28.812 -15.158 4.074   0.47 34.93  ? 18   ARG B C   1 
ATOM   4257 O O   A ARG B 1 17  ? -29.466 -14.283 3.635   0.53 33.85  ? 18   ARG B O   1 
ATOM   4258 O O   B ARG B 1 17  ? -29.459 -14.279 3.634   0.47 34.06  ? 18   ARG B O   1 
ATOM   4259 C CB  A ARG B 1 17  ? -28.077 -13.890 6.060   0.53 38.12  ? 18   ARG B CB  1 
ATOM   4260 C CB  B ARG B 1 17  ? -28.063 -13.873 6.101   0.47 38.25  ? 18   ARG B CB  1 
ATOM   4261 C CG  A ARG B 1 17  ? -29.070 -14.551 6.971   0.53 45.85  ? 18   ARG B CG  1 
ATOM   4262 C CG  B ARG B 1 17  ? -29.052 -14.449 7.092   0.47 47.35  ? 18   ARG B CG  1 
ATOM   4263 C CD  A ARG B 1 17  ? -29.598 -13.644 8.054   0.53 52.70  ? 18   ARG B CD  1 
ATOM   4264 C CD  B ARG B 1 17  ? -29.039 -13.702 8.427   0.47 53.20  ? 18   ARG B CD  1 
ATOM   4265 N NE  A ARG B 1 17  ? -28.539 -13.195 8.932   0.53 54.44  ? 18   ARG B NE  1 
ATOM   4266 N NE  B ARG B 1 17  ? -28.686 -12.310 8.223   0.47 55.17  ? 18   ARG B NE  1 
ATOM   4267 C CZ  A ARG B 1 17  ? -28.063 -11.969 8.927   0.53 52.69  ? 18   ARG B CZ  1 
ATOM   4268 C CZ  B ARG B 1 17  ? -29.531 -11.401 7.756   0.47 51.68  ? 18   ARG B CZ  1 
ATOM   4269 N NH1 A ARG B 1 17  ? -27.083 -11.647 9.736   0.53 45.99  ? 18   ARG B NH1 1 
ATOM   4270 N NH1 B ARG B 1 17  ? -30.789 -11.735 7.512   0.47 46.96  ? 18   ARG B NH1 1 
ATOM   4271 N NH2 A ARG B 1 17  ? -28.579 -11.069 8.110   0.53 54.78  ? 18   ARG B NH2 1 
ATOM   4272 N NH2 B ARG B 1 17  ? -29.133 -10.162 7.549   0.47 45.77  ? 18   ARG B NH2 1 
ATOM   4273 N N   . GLY B 1 18  ? -29.230 -16.413 4.048   1.00 32.59  ? 19   GLY B N   1 
ATOM   4274 C CA  . GLY B 1 18  ? -30.356 -16.848 3.263   1.00 35.14  ? 19   GLY B CA  1 
ATOM   4275 C C   . GLY B 1 18  ? -31.608 -17.031 4.093   1.00 35.83  ? 19   GLY B C   1 
ATOM   4276 O O   . GLY B 1 18  ? -31.708 -16.575 5.237   1.00 38.10  ? 19   GLY B O   1 
ATOM   4277 N N   . ILE B 1 19  ? -32.576 -17.721 3.505   1.00 36.31  ? 20   ILE B N   1 
ATOM   4278 C CA  . ILE B 1 19  ? -33.898 -17.890 4.087   1.00 35.94  ? 20   ILE B CA  1 
ATOM   4279 C C   . ILE B 1 19  ? -34.315 -19.341 3.895   1.00 36.48  ? 20   ILE B C   1 
ATOM   4280 O O   . ILE B 1 19  ? -34.010 -19.957 2.867   1.00 42.95  ? 20   ILE B O   1 
ATOM   4281 C CB  . ILE B 1 19  ? -34.917 -16.920 3.445   1.00 43.19  ? 20   ILE B CB  1 
ATOM   4282 C CG1 . ILE B 1 19  ? -36.276 -17.005 4.147   1.00 44.20  ? 20   ILE B CG1 1 
ATOM   4283 C CG2 . ILE B 1 19  ? -35.050 -17.163 1.930   1.00 34.02  ? 20   ILE B CG2 1 
ATOM   4284 C CD1 . ILE B 1 19  ? -37.057 -15.700 4.125   1.00 36.52  ? 20   ILE B CD1 1 
ATOM   4285 N N   . ARG B 1 20  ? -34.997 -19.892 4.891   1.00 39.28  ? 21   ARG B N   1 
ATOM   4286 C CA  . ARG B 1 20  ? -35.569 -21.229 4.799   1.00 34.90  ? 21   ARG B CA  1 
ATOM   4287 C C   . ARG B 1 20  ? -36.978 -21.112 4.224   1.00 33.40  ? 21   ARG B C   1 
ATOM   4288 O O   . ARG B 1 20  ? -37.818 -20.398 4.777   1.00 42.01  ? 21   ARG B O   1 
ATOM   4289 C CB  . ARG B 1 20  ? -35.586 -21.894 6.178   1.00 41.54  ? 21   ARG B CB  1 
ATOM   4290 C CG  . ARG B 1 20  ? -36.074 -23.328 6.173   1.00 47.75  ? 21   ARG B CG  1 
ATOM   4291 C CD  . ARG B 1 20  ? -35.801 -24.047 7.499   1.00 53.85  ? 21   ARG B CD  1 
ATOM   4292 N NE  . ARG B 1 20  ? -35.983 -23.197 8.679   1.00 61.74  ? 21   ARG B NE  1 
ATOM   4293 C CZ  . ARG B 1 20  ? -37.162 -22.804 9.158   1.00 62.09  ? 21   ARG B CZ  1 
ATOM   4294 N NH1 . ARG B 1 20  ? -38.292 -23.174 8.564   1.00 58.27  ? 21   ARG B NH1 1 
ATOM   4295 N NH2 . ARG B 1 20  ? -37.208 -22.033 10.237  1.00 57.60  ? 21   ARG B NH2 1 
ATOM   4296 N N   . LEU B 1 21  ? -37.227 -21.783 3.102   1.00 37.65  ? 22   LEU B N   1 
ATOM   4297 C CA  . LEU B 1 21  ? -38.529 -21.777 2.452   1.00 37.09  ? 22   LEU B CA  1 
ATOM   4298 C C   . LEU B 1 21  ? -39.232 -23.108 2.674   1.00 39.65  ? 22   LEU B C   1 
ATOM   4299 O O   . LEU B 1 21  ? -38.590 -24.140 2.873   1.00 49.25  ? 22   LEU B O   1 
ATOM   4300 C CB  . LEU B 1 21  ? -38.401 -21.524 0.943   1.00 39.45  ? 22   LEU B CB  1 
ATOM   4301 C CG  . LEU B 1 21  ? -37.700 -20.236 0.514   1.00 38.17  ? 22   LEU B CG  1 
ATOM   4302 C CD1 . LEU B 1 21  ? -37.638 -20.164 -0.998  1.00 37.28  ? 22   LEU B CD1 1 
ATOM   4303 C CD2 . LEU B 1 21  ? -38.421 -19.030 1.090   1.00 35.17  ? 22   LEU B CD2 1 
ATOM   4304 N N   . LYS B 1 22  ? -40.559 -23.082 2.618   1.00 44.20  ? 23   LYS B N   1 
ATOM   4305 C CA  . LYS B 1 22  ? -41.361 -24.291 2.733   1.00 41.30  ? 23   LYS B CA  1 
ATOM   4306 C C   . LYS B 1 22  ? -41.853 -24.732 1.360   1.00 41.88  ? 23   LYS B C   1 
ATOM   4307 O O   . LYS B 1 22  ? -42.142 -23.902 0.494   1.00 42.05  ? 23   LYS B O   1 
ATOM   4308 C CB  . LYS B 1 22  ? -42.549 -24.065 3.666   1.00 42.31  ? 23   LYS B CB  1 
ATOM   4309 C CG  . LYS B 1 22  ? -42.146 -23.661 5.072   1.00 52.41  ? 23   LYS B CG  1 
ATOM   4310 C CD  . LYS B 1 22  ? -43.342 -23.609 6.010   1.00 54.15  ? 23   LYS B CD  1 
ATOM   4311 C CE  . LYS B 1 22  ? -44.415 -22.685 5.469   1.00 60.32  ? 23   LYS B CE  1 
ATOM   4312 N NZ  . LYS B 1 22  ? -45.748 -22.991 6.055   1.00 69.37  ? 23   LYS B NZ  1 
ATOM   4313 N N   . THR B 1 23  ? -41.905 -26.038 1.157   1.00 31.85  ? 24   THR B N   1 
ATOM   4314 C CA  . THR B 1 23  ? -42.572 -26.678 0.036   1.00 40.05  ? 24   THR B CA  1 
ATOM   4315 C C   . THR B 1 23  ? -43.427 -27.786 0.622   1.00 37.78  ? 24   THR B C   1 
ATOM   4316 O O   . THR B 1 23  ? -43.233 -28.174 1.779   1.00 35.75  ? 24   THR B O   1 
ATOM   4317 C CB  . THR B 1 23  ? -41.584 -27.265 -0.988  1.00 35.57  ? 24   THR B CB  1 
ATOM   4318 O OG1 . THR B 1 23  ? -41.175 -28.573 -0.564  1.00 33.35  ? 24   THR B OG1 1 
ATOM   4319 C CG2 . THR B 1 23  ? -40.366 -26.376 -1.153  1.00 32.48  ? 24   THR B CG2 1 
ATOM   4320 N N   . PRO B 1 24  ? -44.388 -28.318 -0.141  1.00 39.26  ? 25   PRO B N   1 
ATOM   4321 C CA  . PRO B 1 24  ? -45.164 -29.463 0.369   1.00 36.76  ? 25   PRO B CA  1 
ATOM   4322 C C   . PRO B 1 24  ? -44.331 -30.718 0.551   1.00 37.78  ? 25   PRO B C   1 
ATOM   4323 O O   . PRO B 1 24  ? -44.799 -31.659 1.204   1.00 45.21  ? 25   PRO B O   1 
ATOM   4324 C CB  . PRO B 1 24  ? -46.247 -29.669 -0.698  1.00 42.03  ? 25   PRO B CB  1 
ATOM   4325 C CG  . PRO B 1 24  ? -46.262 -28.401 -1.498  1.00 42.26  ? 25   PRO B CG  1 
ATOM   4326 C CD  . PRO B 1 24  ? -44.875 -27.859 -1.453  1.00 37.61  ? 25   PRO B CD  1 
ATOM   4327 N N   . GLY B 1 25  ? -43.124 -30.766 -0.008  1.00 39.03  ? 26   GLY B N   1 
ATOM   4328 C CA  . GLY B 1 25  ? -42.215 -31.869 0.197   1.00 43.97  ? 26   GLY B CA  1 
ATOM   4329 C C   . GLY B 1 25  ? -41.146 -31.644 1.242   1.00 43.47  ? 26   GLY B C   1 
ATOM   4330 O O   . GLY B 1 25  ? -40.301 -32.523 1.437   1.00 42.72  ? 26   GLY B O   1 
ATOM   4331 N N   . GLY B 1 26  ? -41.151 -30.500 1.926   1.00 37.21  ? 27   GLY B N   1 
ATOM   4332 C CA  . GLY B 1 26  ? -40.135 -30.198 2.907   1.00 37.26  ? 27   GLY B CA  1 
ATOM   4333 C C   . GLY B 1 26  ? -39.377 -28.923 2.590   1.00 43.52  ? 27   GLY B C   1 
ATOM   4334 O O   . GLY B 1 26  ? -39.585 -28.281 1.553   1.00 32.02  ? 27   GLY B O   1 
ATOM   4335 N N   . PRO B 1 27  ? -38.474 -28.536 3.483   1.00 33.19  ? 28   PRO B N   1 
ATOM   4336 C CA  . PRO B 1 27  ? -37.822 -27.226 3.360   1.00 32.01  ? 28   PRO B CA  1 
ATOM   4337 C C   . PRO B 1 27  ? -36.757 -27.191 2.272   1.00 37.86  ? 28   PRO B C   1 
ATOM   4338 O O   . PRO B 1 27  ? -36.303 -28.205 1.740   1.00 35.71  ? 28   PRO B O   1 
ATOM   4339 C CB  . PRO B 1 27  ? -37.205 -27.000 4.743   1.00 33.04  ? 28   PRO B CB  1 
ATOM   4340 C CG  . PRO B 1 27  ? -37.081 -28.372 5.333   1.00 34.36  ? 28   PRO B CG  1 
ATOM   4341 C CD  . PRO B 1 27  ? -38.217 -29.173 4.785   1.00 34.79  ? 28   PRO B CD  1 
ATOM   4342 N N   . VAL B 1 28  ? -36.352 -25.967 1.961   1.00 29.37  ? 29   VAL B N   1 
ATOM   4343 C CA  . VAL B 1 28  ? -35.342 -25.677 0.957   1.00 27.94  ? 29   VAL B CA  1 
ATOM   4344 C C   . VAL B 1 28  ? -34.597 -24.433 1.424   1.00 37.65  ? 29   VAL B C   1 
ATOM   4345 O O   . VAL B 1 28  ? -35.179 -23.566 2.085   1.00 36.64  ? 29   VAL B O   1 
ATOM   4346 C CB  . VAL B 1 28  ? -36.003 -25.492 -0.434  1.00 31.97  ? 29   VAL B CB  1 
ATOM   4347 C CG1 . VAL B 1 28  ? -35.200 -24.581 -1.314  1.00 35.71  ? 29   VAL B CG1 1 
ATOM   4348 C CG2 . VAL B 1 28  ? -36.224 -26.843 -1.120  1.00 32.64  ? 29   VAL B CG2 1 
ATOM   4349 N N   . SER B 1 29  ? -33.300 -24.362 1.122   1.00 29.68  ? 30   SER B N   1 
ATOM   4350 C CA  . SER B 1 29  ? -32.504 -23.178 1.414   1.00 31.32  ? 30   SER B CA  1 
ATOM   4351 C C   . SER B 1 29  ? -32.481 -22.267 0.193   1.00 36.84  ? 30   SER B C   1 
ATOM   4352 O O   . SER B 1 29  ? -32.237 -22.728 -0.924  1.00 36.06  ? 30   SER B O   1 
ATOM   4353 C CB  . SER B 1 29  ? -31.076 -23.554 1.806   1.00 32.77  ? 30   SER B CB  1 
ATOM   4354 O OG  . SER B 1 29  ? -31.057 -24.481 2.876   1.00 43.11  ? 30   SER B OG  1 
ATOM   4355 N N   . ALA B 1 30  ? -32.714 -20.976 0.413   1.00 34.28  ? 31   ALA B N   1 
ATOM   4356 C CA  . ALA B 1 30  ? -32.746 -19.992 -0.657  1.00 30.95  ? 31   ALA B CA  1 
ATOM   4357 C C   . ALA B 1 30  ? -31.870 -18.802 -0.297  1.00 35.71  ? 31   ALA B C   1 
ATOM   4358 O O   . ALA B 1 30  ? -31.892 -18.319 0.840   1.00 32.54  ? 31   ALA B O   1 
ATOM   4359 C CB  . ALA B 1 30  ? -34.171 -19.509 -0.933  1.00 27.32  ? 31   ALA B CB  1 
ATOM   4360 N N   . PHE B 1 31  ? -31.104 -18.331 -1.275  1.00 31.16  ? 32   PHE B N   1 
ATOM   4361 C CA  . PHE B 1 31  ? -30.268 -17.144 -1.131  1.00 26.47  ? 32   PHE B CA  1 
ATOM   4362 C C   . PHE B 1 31  ? -30.637 -16.235 -2.298  1.00 31.57  ? 32   PHE B C   1 
ATOM   4363 O O   . PHE B 1 31  ? -30.218 -16.471 -3.437  1.00 32.62  ? 32   PHE B O   1 
ATOM   4364 C CB  . PHE B 1 31  ? -28.787 -17.513 -1.113  1.00 27.66  ? 32   PHE B CB  1 
ATOM   4365 C CG  . PHE B 1 31  ? -28.428 -18.498 -0.027  1.00 30.30  ? 32   PHE B CG  1 
ATOM   4366 C CD1 . PHE B 1 31  ? -27.897 -18.061 1.174   1.00 31.11  ? 32   PHE B CD1 1 
ATOM   4367 C CD2 . PHE B 1 31  ? -28.634 -19.861 -0.206  1.00 31.28  ? 32   PHE B CD2 1 
ATOM   4368 C CE1 . PHE B 1 31  ? -27.579 -18.964 2.186   1.00 36.04  ? 32   PHE B CE1 1 
ATOM   4369 C CE2 . PHE B 1 31  ? -28.314 -20.766 0.793   1.00 32.07  ? 32   PHE B CE2 1 
ATOM   4370 C CZ  . PHE B 1 31  ? -27.788 -20.317 1.993   1.00 29.75  ? 32   PHE B CZ  1 
ATOM   4371 N N   . LEU B 1 32  ? -31.456 -15.223 -2.019  1.00 28.71  ? 33   LEU B N   1 
ATOM   4372 C CA  . LEU B 1 32  ? -32.064 -14.390 -3.044  1.00 29.63  ? 33   LEU B CA  1 
ATOM   4373 C C   . LEU B 1 32  ? -31.453 -12.996 -3.025  1.00 31.26  ? 33   LEU B C   1 
ATOM   4374 O O   . LEU B 1 32  ? -31.222 -12.423 -1.957  1.00 32.05  ? 33   LEU B O   1 
ATOM   4375 C CB  . LEU B 1 32  ? -33.578 -14.302 -2.837  1.00 30.65  ? 33   LEU B CB  1 
ATOM   4376 C CG  . LEU B 1 32  ? -34.284 -15.633 -2.551  1.00 33.45  ? 33   LEU B CG  1 
ATOM   4377 C CD1 . LEU B 1 32  ? -35.753 -15.395 -2.236  1.00 29.55  ? 33   LEU B CD1 1 
ATOM   4378 C CD2 . LEU B 1 32  ? -34.136 -16.587 -3.730  1.00 25.79  ? 33   LEU B CD2 1 
ATOM   4379 N N   . GLY B 1 33  ? -31.200 -12.450 -4.208  1.00 27.76  ? 34   GLY B N   1 
ATOM   4380 C CA  . GLY B 1 33  ? -30.621 -11.121 -4.303  1.00 22.37  ? 34   GLY B CA  1 
ATOM   4381 C C   . GLY B 1 33  ? -29.150 -11.040 -3.957  1.00 28.99  ? 34   GLY B C   1 
ATOM   4382 O O   . GLY B 1 33  ? -28.731 -10.090 -3.287  1.00 32.32  ? 34   GLY B O   1 
ATOM   4383 N N   . ILE B 1 34  ? -28.352 -12.016 -4.388  1.00 29.09  ? 35   ILE B N   1 
ATOM   4384 C CA  . ILE B 1 34  ? -26.899 -11.983 -4.226  1.00 31.87  ? 35   ILE B CA  1 
ATOM   4385 C C   . ILE B 1 34  ? -26.303 -11.092 -5.309  1.00 33.24  ? 35   ILE B C   1 
ATOM   4386 O O   . ILE B 1 34  ? -26.461 -11.384 -6.501  1.00 32.47  ? 35   ILE B O   1 
ATOM   4387 C CB  . ILE B 1 34  ? -26.285 -13.387 -4.315  1.00 33.00  ? 35   ILE B CB  1 
ATOM   4388 C CG1 . ILE B 1 34  ? -26.968 -14.354 -3.354  1.00 35.76  ? 35   ILE B CG1 1 
ATOM   4389 C CG2 . ILE B 1 34  ? -24.767 -13.323 -4.090  1.00 23.81  ? 35   ILE B CG2 1 
ATOM   4390 C CD1 . ILE B 1 34  ? -26.515 -15.787 -3.546  1.00 27.76  ? 35   ILE B CD1 1 
ATOM   4391 N N   . PRO B 1 35  ? -25.602 -10.019 -4.956  1.00 34.06  ? 36   PRO B N   1 
ATOM   4392 C CA  . PRO B 1 35  ? -24.975 -9.180  -5.988  1.00 25.37  ? 36   PRO B CA  1 
ATOM   4393 C C   . PRO B 1 35  ? -23.803 -9.902  -6.637  1.00 30.67  ? 36   PRO B C   1 
ATOM   4394 O O   . PRO B 1 35  ? -22.894 -10.372 -5.950  1.00 29.25  ? 36   PRO B O   1 
ATOM   4395 C CB  . PRO B 1 35  ? -24.511 -7.944  -5.209  1.00 27.41  ? 36   PRO B CB  1 
ATOM   4396 C CG  . PRO B 1 35  ? -24.294 -8.450  -3.800  1.00 31.51  ? 36   PRO B CG  1 
ATOM   4397 C CD  . PRO B 1 35  ? -25.278 -9.581  -3.585  1.00 27.26  ? 36   PRO B CD  1 
ATOM   4398 N N   . PHE B 1 36  ? -23.820 -9.986  -7.969  1.00 29.23  ? 37   PHE B N   1 
ATOM   4399 C CA  . PHE B 1 36  ? -22.704 -10.580 -8.692  1.00 26.89  ? 37   PHE B CA  1 
ATOM   4400 C C   . PHE B 1 36  ? -21.953 -9.574  -9.550  1.00 29.63  ? 37   PHE B C   1 
ATOM   4401 O O   . PHE B 1 36  ? -20.925 -9.927  -10.139 1.00 35.01  ? 37   PHE B O   1 
ATOM   4402 C CB  . PHE B 1 36  ? -23.168 -11.776 -9.543  1.00 25.45  ? 37   PHE B CB  1 
ATOM   4403 C CG  . PHE B 1 36  ? -24.071 -11.418 -10.704 1.00 23.86  ? 37   PHE B CG  1 
ATOM   4404 C CD1 . PHE B 1 36  ? -23.539 -11.186 -11.969 1.00 23.02  ? 37   PHE B CD1 1 
ATOM   4405 C CD2 . PHE B 1 36  ? -25.452 -11.367 -10.542 1.00 22.20  ? 37   PHE B CD2 1 
ATOM   4406 C CE1 . PHE B 1 36  ? -24.366 -10.872 -13.048 1.00 22.20  ? 37   PHE B CE1 1 
ATOM   4407 C CE2 . PHE B 1 36  ? -26.291 -11.055 -11.615 1.00 21.86  ? 37   PHE B CE2 1 
ATOM   4408 C CZ  . PHE B 1 36  ? -25.743 -10.809 -12.872 1.00 26.73  ? 37   PHE B CZ  1 
ATOM   4409 N N   . ALA B 1 37  ? -22.411 -8.327  -9.609  1.00 29.87  ? 38   ALA B N   1 
ATOM   4410 C CA  . ALA B 1 37  ? -21.702 -7.300  -10.356 1.00 29.39  ? 38   ALA B CA  1 
ATOM   4411 C C   . ALA B 1 37  ? -21.881 -5.961  -9.662  1.00 30.02  ? 38   ALA B C   1 
ATOM   4412 O O   . ALA B 1 37  ? -22.824 -5.762  -8.892  1.00 28.99  ? 38   ALA B O   1 
ATOM   4413 C CB  . ALA B 1 37  ? -22.197 -7.215  -11.806 1.00 22.72  ? 38   ALA B CB  1 
ATOM   4414 N N   . GLU B 1 38  ? -20.966 -5.039  -9.949  1.00 33.61  ? 39   GLU B N   1 
ATOM   4415 C CA  . GLU B 1 38  ? -21.163 -3.658  -9.534  1.00 37.25  ? 39   GLU B CA  1 
ATOM   4416 C C   . GLU B 1 38  ? -22.385 -3.074  -10.241 1.00 38.19  ? 39   GLU B C   1 
ATOM   4417 O O   . GLU B 1 38  ? -22.614 -3.364  -11.422 1.00 33.49  ? 39   GLU B O   1 
ATOM   4418 C CB  . GLU B 1 38  ? -19.927 -2.814  -9.852  1.00 32.87  ? 39   GLU B CB  1 
ATOM   4419 C CG  . GLU B 1 38  ? -18.732 -3.141  -8.981  1.00 44.14  ? 39   GLU B CG  1 
ATOM   4420 C CD  . GLU B 1 38  ? -18.972 -2.795  -7.524  1.00 47.51  ? 39   GLU B CD  1 
ATOM   4421 O OE1 . GLU B 1 38  ? -19.336 -1.637  -7.237  1.00 49.35  ? 39   GLU B OE1 1 
ATOM   4422 O OE2 . GLU B 1 38  ? -18.820 -3.690  -6.668  1.00 46.54  ? 39   GLU B OE2 1 
ATOM   4423 N N   . PRO B 1 39  ? -23.188 -2.263  -9.558  1.00 40.77  ? 40   PRO B N   1 
ATOM   4424 C CA  . PRO B 1 39  ? -24.397 -1.696  -10.180 1.00 33.34  ? 40   PRO B CA  1 
ATOM   4425 C C   . PRO B 1 39  ? -24.058 -0.922  -11.440 1.00 36.97  ? 40   PRO B C   1 
ATOM   4426 O O   . PRO B 1 39  ? -23.261 0.028   -11.402 1.00 43.22  ? 40   PRO B O   1 
ATOM   4427 C CB  . PRO B 1 39  ? -24.951 -0.769  -9.086  1.00 34.66  ? 40   PRO B CB  1 
ATOM   4428 C CG  . PRO B 1 39  ? -24.432 -1.360  -7.807  1.00 34.02  ? 40   PRO B CG  1 
ATOM   4429 C CD  . PRO B 1 39  ? -23.055 -1.868  -8.143  1.00 34.05  ? 40   PRO B CD  1 
ATOM   4430 N N   . PRO B 1 40  ? -24.642 -1.299  -12.584 1.00 32.39  ? 41   PRO B N   1 
ATOM   4431 C CA  . PRO B 1 40  ? -24.275 -0.684  -13.880 1.00 37.81  ? 41   PRO B CA  1 
ATOM   4432 C C   . PRO B 1 40  ? -24.979 0.648   -14.105 1.00 42.25  ? 41   PRO B C   1 
ATOM   4433 O O   . PRO B 1 40  ? -25.809 0.815   -15.002 1.00 47.03  ? 41   PRO B O   1 
ATOM   4434 C CB  . PRO B 1 40  ? -24.712 -1.758  -14.881 1.00 35.33  ? 41   PRO B CB  1 
ATOM   4435 C CG  . PRO B 1 40  ? -25.935 -2.358  -14.236 1.00 29.20  ? 41   PRO B CG  1 
ATOM   4436 C CD  . PRO B 1 40  ? -25.673 -2.341  -12.741 1.00 29.67  ? 41   PRO B CD  1 
ATOM   4437 N N   . MET B 1 41  ? -24.639 1.633   -13.278 1.00 40.54  ? 42   MET B N   1 
ATOM   4438 C CA  . MET B 1 41  ? -25.353 2.899   -13.229 1.00 47.06  ? 42   MET B CA  1 
ATOM   4439 C C   . MET B 1 41  ? -24.430 4.055   -13.574 1.00 44.99  ? 42   MET B C   1 
ATOM   4440 O O   . MET B 1 41  ? -23.202 3.942   -13.510 1.00 47.99  ? 42   MET B O   1 
ATOM   4441 C CB  . MET B 1 41  ? -25.960 3.137   -11.844 1.00 55.10  ? 42   MET B CB  1 
ATOM   4442 C CG  . MET B 1 41  ? -26.527 1.893   -11.220 1.00 61.00  ? 42   MET B CG  1 
ATOM   4443 S SD  . MET B 1 41  ? -27.732 2.305   -9.967  1.00 72.57  ? 42   MET B SD  1 
ATOM   4444 C CE  . MET B 1 41  ? -28.950 3.186   -10.934 1.00 73.77  ? 42   MET B CE  1 
ATOM   4445 N N   . GLY B 1 42  ? -25.051 5.184   -13.922 1.00 37.87  ? 43   GLY B N   1 
ATOM   4446 C CA  . GLY B 1 42  ? -24.332 6.394   -14.241 1.00 41.89  ? 43   GLY B CA  1 
ATOM   4447 C C   . GLY B 1 42  ? -23.369 6.183   -15.390 1.00 45.18  ? 43   GLY B C   1 
ATOM   4448 O O   . GLY B 1 42  ? -23.759 5.815   -16.502 1.00 39.57  ? 43   GLY B O   1 
ATOM   4449 N N   . PRO B 1 43  ? -22.078 6.396   -15.132 1.00 43.19  ? 44   PRO B N   1 
ATOM   4450 C CA  . PRO B 1 43  ? -21.077 6.143   -16.179 1.00 39.38  ? 44   PRO B CA  1 
ATOM   4451 C C   . PRO B 1 43  ? -20.979 4.685   -16.580 1.00 42.05  ? 44   PRO B C   1 
ATOM   4452 O O   . PRO B 1 43  ? -20.416 4.399   -17.643 1.00 40.86  ? 44   PRO B O   1 
ATOM   4453 C CB  . PRO B 1 43  ? -19.770 6.639   -15.544 1.00 42.49  ? 44   PRO B CB  1 
ATOM   4454 C CG  . PRO B 1 43  ? -20.016 6.556   -14.062 1.00 38.92  ? 44   PRO B CG  1 
ATOM   4455 C CD  . PRO B 1 43  ? -21.472 6.884   -13.881 1.00 33.22  ? 44   PRO B CD  1 
ATOM   4456 N N   . ARG B 1 44  ? -21.515 3.758   -15.784 1.00 43.99  ? 45   ARG B N   1 
ATOM   4457 C CA  . ARG B 1 44  ? -21.439 2.335   -16.095 1.00 41.97  ? 45   ARG B CA  1 
ATOM   4458 C C   . ARG B 1 44  ? -22.601 1.836   -16.948 1.00 40.49  ? 45   ARG B C   1 
ATOM   4459 O O   . ARG B 1 44  ? -22.595 0.666   -17.354 1.00 32.34  ? 45   ARG B O   1 
ATOM   4460 C CB  . ARG B 1 44  ? -21.367 1.510   -14.803 1.00 36.50  ? 45   ARG B CB  1 
ATOM   4461 C CG  . ARG B 1 44  ? -20.060 1.674   -14.043 1.00 51.98  ? 45   ARG B CG  1 
ATOM   4462 C CD  . ARG B 1 44  ? -19.736 0.438   -13.214 1.00 68.28  ? 45   ARG B CD  1 
ATOM   4463 N NE  . ARG B 1 44  ? -19.216 0.778   -11.890 1.00 81.42  ? 45   ARG B NE  1 
ATOM   4464 C CZ  . ARG B 1 44  ? -17.942 1.064   -11.634 1.00 91.18  ? 45   ARG B CZ  1 
ATOM   4465 N NH1 . ARG B 1 44  ? -17.047 1.048   -12.613 1.00 94.50  ? 45   ARG B NH1 1 
ATOM   4466 N NH2 . ARG B 1 44  ? -17.561 1.358   -10.399 1.00 95.21  ? 45   ARG B NH2 1 
ATOM   4467 N N   . ARG B 1 45  ? -23.592 2.677   -17.231 1.00 38.79  ? 46   ARG B N   1 
ATOM   4468 C CA  . ARG B 1 45  ? -24.681 2.257   -18.101 1.00 37.33  ? 46   ARG B CA  1 
ATOM   4469 C C   . ARG B 1 45  ? -24.170 2.043   -19.521 1.00 34.13  ? 46   ARG B C   1 
ATOM   4470 O O   . ARG B 1 45  ? -23.396 2.850   -20.044 1.00 36.47  ? 46   ARG B O   1 
ATOM   4471 C CB  . ARG B 1 45  ? -25.798 3.296   -18.094 1.00 32.00  ? 46   ARG B CB  1 
ATOM   4472 C CG  . ARG B 1 45  ? -26.830 3.086   -19.177 1.00 32.61  ? 46   ARG B CG  1 
ATOM   4473 C CD  . ARG B 1 45  ? -27.698 4.314   -19.350 1.00 34.97  ? 46   ARG B CD  1 
ATOM   4474 N NE  . ARG B 1 45  ? -28.697 4.432   -18.292 1.00 36.22  ? 46   ARG B NE  1 
ATOM   4475 C CZ  . ARG B 1 45  ? -29.471 5.498   -18.123 1.00 38.61  ? 46   ARG B CZ  1 
ATOM   4476 N NH1 . ARG B 1 45  ? -29.361 6.531   -18.947 1.00 43.80  ? 46   ARG B NH1 1 
ATOM   4477 N NH2 . ARG B 1 45  ? -30.360 5.534   -17.138 1.00 30.81  ? 46   ARG B NH2 1 
ATOM   4478 N N   . PHE B 1 46  ? -24.598 0.938   -20.136 1.00 27.43  ? 47   PHE B N   1 
ATOM   4479 C CA  . PHE B 1 46  ? -24.222 0.450   -21.459 1.00 33.98  ? 47   PHE B CA  1 
ATOM   4480 C C   . PHE B 1 46  ? -22.867 -0.263  -21.456 1.00 31.61  ? 47   PHE B C   1 
ATOM   4481 O O   . PHE B 1 46  ? -22.494 -0.840  -22.480 1.00 35.14  ? 47   PHE B O   1 
ATOM   4482 C CB  . PHE B 1 46  ? -24.194 1.553   -22.538 1.00 32.87  ? 47   PHE B CB  1 
ATOM   4483 C CG  . PHE B 1 46  ? -25.471 2.341   -22.638 1.00 34.08  ? 47   PHE B CG  1 
ATOM   4484 C CD1 . PHE B 1 46  ? -26.683 1.698   -22.841 1.00 31.21  ? 47   PHE B CD1 1 
ATOM   4485 C CD2 . PHE B 1 46  ? -25.457 3.723   -22.538 1.00 34.08  ? 47   PHE B CD2 1 
ATOM   4486 C CE1 . PHE B 1 46  ? -27.858 2.417   -22.940 1.00 30.96  ? 47   PHE B CE1 1 
ATOM   4487 C CE2 . PHE B 1 46  ? -26.628 4.453   -22.636 1.00 31.58  ? 47   PHE B CE2 1 
ATOM   4488 C CZ  . PHE B 1 46  ? -27.832 3.799   -22.836 1.00 32.06  ? 47   PHE B CZ  1 
ATOM   4489 N N   . LEU B 1 47  ? -22.120 -0.254  -20.354 1.00 29.13  ? 48   LEU B N   1 
ATOM   4490 C CA  . LEU B 1 47  ? -20.810 -0.886  -20.372 1.00 36.94  ? 48   LEU B CA  1 
ATOM   4491 C C   . LEU B 1 47  ? -20.875 -2.321  -19.863 1.00 35.53  ? 48   LEU B C   1 
ATOM   4492 O O   . LEU B 1 47  ? -21.810 -2.698  -19.146 1.00 28.89  ? 48   LEU B O   1 
ATOM   4493 C CB  . LEU B 1 47  ? -19.829 -0.073  -19.531 1.00 39.36  ? 48   LEU B CB  1 
ATOM   4494 C CG  . LEU B 1 47  ? -19.616 1.356   -20.017 1.00 42.28  ? 48   LEU B CG  1 
ATOM   4495 C CD1 . LEU B 1 47  ? -18.713 2.074   -19.038 1.00 39.26  ? 48   LEU B CD1 1 
ATOM   4496 C CD2 . LEU B 1 47  ? -19.023 1.355   -21.419 1.00 36.56  ? 48   LEU B CD2 1 
ATOM   4497 N N   . PRO B 1 48  ? -19.899 -3.152  -20.235 1.00 34.68  ? 49   PRO B N   1 
ATOM   4498 C CA  . PRO B 1 48  ? -19.829 -4.519  -19.696 1.00 28.87  ? 49   PRO B CA  1 
ATOM   4499 C C   . PRO B 1 48  ? -19.881 -4.512  -18.181 1.00 30.77  ? 49   PRO B C   1 
ATOM   4500 O O   . PRO B 1 48  ? -19.420 -3.553  -17.541 1.00 33.44  ? 49   PRO B O   1 
ATOM   4501 C CB  . PRO B 1 48  ? -18.468 -5.025  -20.198 1.00 26.14  ? 49   PRO B CB  1 
ATOM   4502 C CG  . PRO B 1 48  ? -18.236 -4.271  -21.450 1.00 33.39  ? 49   PRO B CG  1 
ATOM   4503 C CD  . PRO B 1 48  ? -18.823 -2.897  -21.211 1.00 32.05  ? 49   PRO B CD  1 
ATOM   4504 N N   . PRO B 1 49  ? -20.433 -5.559  -17.571 1.00 31.15  ? 50   PRO B N   1 
ATOM   4505 C CA  . PRO B 1 49  ? -20.527 -5.588  -16.108 1.00 26.97  ? 50   PRO B CA  1 
ATOM   4506 C C   . PRO B 1 49  ? -19.165 -5.792  -15.470 1.00 32.59  ? 50   PRO B C   1 
ATOM   4507 O O   . PRO B 1 49  ? -18.297 -6.485  -16.003 1.00 33.83  ? 50   PRO B O   1 
ATOM   4508 C CB  . PRO B 1 49  ? -21.433 -6.793  -15.838 1.00 23.29  ? 50   PRO B CB  1 
ATOM   4509 C CG  . PRO B 1 49  ? -21.117 -7.723  -16.990 1.00 25.73  ? 50   PRO B CG  1 
ATOM   4510 C CD  . PRO B 1 49  ? -20.925 -6.808  -18.180 1.00 27.07  ? 50   PRO B CD  1 
ATOM   4511 N N   A GLU B 1 50  ? -18.983 -5.172  -14.312 0.45 34.61  ? 51   GLU B N   1 
ATOM   4512 N N   B GLU B 1 50  ? -18.996 -5.292  -14.268 0.55 34.35  ? 51   GLU B N   1 
ATOM   4513 C CA  A GLU B 1 50  ? -17.759 -5.431  -13.578 0.45 39.10  ? 51   GLU B CA  1 
ATOM   4514 C CA  B GLU B 1 50  ? -17.770 -5.421  -13.505 0.55 39.15  ? 51   GLU B CA  1 
ATOM   4515 C C   A GLU B 1 50  ? -18.053 -6.286  -12.352 0.45 36.24  ? 51   GLU B C   1 
ATOM   4516 C C   B GLU B 1 50  ? -18.049 -6.293  -12.334 0.55 36.14  ? 51   GLU B C   1 
ATOM   4517 O O   A GLU B 1 50  ? -19.117 -6.141  -11.740 0.45 34.76  ? 51   GLU B O   1 
ATOM   4518 O O   B GLU B 1 50  ? -19.077 -6.198  -11.795 0.55 34.42  ? 51   GLU B O   1 
ATOM   4519 C CB  A GLU B 1 50  ? -17.079 -4.126  -13.145 0.45 45.32  ? 51   GLU B CB  1 
ATOM   4520 C CB  B GLU B 1 50  ? -17.341 -4.074  -12.952 0.55 44.98  ? 51   GLU B CB  1 
ATOM   4521 C CG  A GLU B 1 50  ? -16.448 -3.351  -14.303 0.45 52.69  ? 51   GLU B CG  1 
ATOM   4522 C CG  B GLU B 1 50  ? -16.547 -3.196  -13.886 0.55 53.02  ? 51   GLU B CG  1 
ATOM   4523 C CD  A GLU B 1 50  ? -15.344 -4.130  -15.011 0.45 52.88  ? 51   GLU B CD  1 
ATOM   4524 C CD  B GLU B 1 50  ? -16.829 -1.704  -13.713 0.55 57.96  ? 51   GLU B CD  1 
ATOM   4525 O OE1 A GLU B 1 50  ? -14.470 -4.693  -14.319 0.45 53.49  ? 51   GLU B OE1 1 
ATOM   4526 O OE1 B GLU B 1 50  ? -16.552 -1.123  -12.658 0.55 50.66  ? 51   GLU B OE1 1 
ATOM   4527 O OE2 A GLU B 1 50  ? -15.350 -4.177  -16.261 0.45 50.85  ? 51   GLU B OE2 1 
ATOM   4528 O OE2 B GLU B 1 50  ? -17.344 -1.093  -14.664 0.55 67.70  ? 51   GLU B OE2 1 
ATOM   4529 N N   . PRO B 1 51  ? -17.147 -7.190  -11.985 1.00 38.02  ? 52   PRO B N   1 
ATOM   4530 C CA  . PRO B 1 51  ? -17.399 -8.066  -10.831 1.00 36.89  ? 52   PRO B CA  1 
ATOM   4531 C C   . PRO B 1 51  ? -17.643 -7.269  -9.557  1.00 36.18  ? 52   PRO B C   1 
ATOM   4532 O O   . PRO B 1 51  ? -17.028 -6.227  -9.324  1.00 37.26  ? 52   PRO B O   1 
ATOM   4533 C CB  . PRO B 1 51  ? -16.118 -8.903  -10.733 1.00 35.90  ? 52   PRO B CB  1 
ATOM   4534 C CG  . PRO B 1 51  ? -15.509 -8.834  -12.108 1.00 40.34  ? 52   PRO B CG  1 
ATOM   4535 C CD  . PRO B 1 51  ? -15.853 -7.471  -12.633 1.00 37.24  ? 52   PRO B CD  1 
ATOM   4536 N N   . LYS B 1 52  ? -18.584 -7.754  -8.752  1.00 32.10  ? 53   LYS B N   1 
ATOM   4537 C CA  . LYS B 1 52  ? -18.908 -7.094  -7.499  1.00 32.63  ? 53   LYS B CA  1 
ATOM   4538 C C   . LYS B 1 52  ? -17.684 -7.075  -6.601  1.00 34.57  ? 53   LYS B C   1 
ATOM   4539 O O   . LYS B 1 52  ? -17.059 -8.110  -6.366  1.00 38.11  ? 53   LYS B O   1 
ATOM   4540 C CB  . LYS B 1 52  ? -20.065 -7.820  -6.806  1.00 33.47  ? 53   LYS B CB  1 
ATOM   4541 C CG  . LYS B 1 52  ? -20.397 -7.301  -5.422  1.00 38.76  ? 53   LYS B CG  1 
ATOM   4542 C CD  . LYS B 1 52  ? -21.138 -5.974  -5.491  1.00 37.98  ? 53   LYS B CD  1 
ATOM   4543 C CE  . LYS B 1 52  ? -21.583 -5.524  -4.108  1.00 35.42  ? 53   LYS B CE  1 
ATOM   4544 N NZ  . LYS B 1 52  ? -22.326 -4.235  -4.179  1.00 40.31  ? 53   LYS B NZ  1 
ATOM   4545 N N   . GLN B 1 53  ? -17.322 -5.890  -6.128  1.00 38.38  ? 54   GLN B N   1 
ATOM   4546 C CA  A GLN B 1 53  ? -16.211 -5.779  -5.202  0.57 42.93  ? 54   GLN B CA  1 
ATOM   4547 C CA  B GLN B 1 53  ? -16.212 -5.777  -5.201  0.43 42.82  ? 54   GLN B CA  1 
ATOM   4548 C C   . GLN B 1 53  ? -16.595 -6.385  -3.851  1.00 41.08  ? 54   GLN B C   1 
ATOM   4549 O O   . GLN B 1 53  ? -17.770 -6.390  -3.474  1.00 40.01  ? 54   GLN B O   1 
ATOM   4550 C CB  A GLN B 1 53  ? -15.799 -4.319  -5.029  0.57 45.18  ? 54   GLN B CB  1 
ATOM   4551 C CB  B GLN B 1 53  ? -15.807 -4.315  -5.027  0.43 45.21  ? 54   GLN B CB  1 
ATOM   4552 C CG  A GLN B 1 53  ? -14.922 -3.780  -6.156  0.57 46.97  ? 54   GLN B CG  1 
ATOM   4553 C CG  B GLN B 1 53  ? -15.352 -3.645  -6.319  0.43 46.39  ? 54   GLN B CG  1 
ATOM   4554 C CD  A GLN B 1 53  ? -13.639 -4.571  -6.323  0.57 46.45  ? 54   GLN B CD  1 
ATOM   4555 C CD  B GLN B 1 53  ? -15.352 -2.131  -6.231  0.43 49.99  ? 54   GLN B CD  1 
ATOM   4556 O OE1 A GLN B 1 53  ? -13.430 -5.228  -7.343  0.57 42.30  ? 54   GLN B OE1 1 
ATOM   4557 O OE1 B GLN B 1 53  ? -15.336 -1.559  -5.141  0.43 53.59  ? 54   GLN B OE1 1 
ATOM   4558 N NE2 A GLN B 1 53  ? -12.775 -4.514  -5.316  0.57 47.41  ? 54   GLN B NE2 1 
ATOM   4559 N NE2 B GLN B 1 53  ? -15.375 -1.472  -7.384  0.43 49.63  ? 54   GLN B NE2 1 
ATOM   4560 N N   . PRO B 1 54  ? -15.625 -6.921  -3.115  1.00 41.97  ? 55   PRO B N   1 
ATOM   4561 C CA  . PRO B 1 54  ? -15.932 -7.535  -1.817  1.00 39.39  ? 55   PRO B CA  1 
ATOM   4562 C C   . PRO B 1 54  ? -16.574 -6.558  -0.845  1.00 42.51  ? 55   PRO B C   1 
ATOM   4563 O O   . PRO B 1 54  ? -16.366 -5.343  -0.907  1.00 43.82  ? 55   PRO B O   1 
ATOM   4564 C CB  . PRO B 1 54  ? -14.560 -7.992  -1.312  1.00 39.70  ? 55   PRO B CB  1 
ATOM   4565 C CG  . PRO B 1 54  ? -13.780 -8.230  -2.560  1.00 42.06  ? 55   PRO B CG  1 
ATOM   4566 C CD  . PRO B 1 54  ? -14.239 -7.187  -3.539  1.00 42.93  ? 55   PRO B CD  1 
ATOM   4567 N N   . TRP B 1 55  ? -17.351 -7.116  0.078   1.00 41.06  ? 56   TRP B N   1 
ATOM   4568 C CA  . TRP B 1 55  ? -18.056 -6.347  1.091   1.00 39.51  ? 56   TRP B CA  1 
ATOM   4569 C C   . TRP B 1 55  ? -17.717 -6.876  2.477   1.00 43.88  ? 56   TRP B C   1 
ATOM   4570 O O   . TRP B 1 55  ? -17.341 -8.041  2.644   1.00 41.47  ? 56   TRP B O   1 
ATOM   4571 C CB  . TRP B 1 55  ? -19.565 -6.413  0.871   1.00 37.08  ? 56   TRP B CB  1 
ATOM   4572 C CG  . TRP B 1 55  ? -20.112 -7.807  0.950   1.00 39.70  ? 56   TRP B CG  1 
ATOM   4573 C CD1 . TRP B 1 55  ? -20.527 -8.459  2.073   1.00 40.72  ? 56   TRP B CD1 1 
ATOM   4574 C CD2 . TRP B 1 55  ? -20.301 -8.723  -0.138  1.00 37.41  ? 56   TRP B CD2 1 
ATOM   4575 N NE1 . TRP B 1 55  ? -20.961 -9.721  1.755   1.00 38.16  ? 56   TRP B NE1 1 
ATOM   4576 C CE2 . TRP B 1 55  ? -20.836 -9.908  0.404   1.00 37.53  ? 56   TRP B CE2 1 
ATOM   4577 C CE3 . TRP B 1 55  ? -20.069 -8.656  -1.518  1.00 32.84  ? 56   TRP B CE3 1 
ATOM   4578 C CZ2 . TRP B 1 55  ? -21.149 -11.015 -0.382  1.00 34.69  ? 56   TRP B CZ2 1 
ATOM   4579 C CZ3 . TRP B 1 55  ? -20.378 -9.761  -2.300  1.00 32.16  ? 56   TRP B CZ3 1 
ATOM   4580 C CH2 . TRP B 1 55  ? -20.912 -10.924 -1.729  1.00 34.38  ? 56   TRP B CH2 1 
ATOM   4581 N N   . SER B 1 56  ? -17.850 -6.011  3.471   1.00 51.41  ? 57   SER B N   1 
ATOM   4582 C CA  . SER B 1 56  ? -17.773 -6.427  4.861   1.00 56.26  ? 57   SER B CA  1 
ATOM   4583 C C   . SER B 1 56  ? -19.183 -6.596  5.414   1.00 54.87  ? 57   SER B C   1 
ATOM   4584 O O   . SER B 1 56  ? -20.158 -6.081  4.859   1.00 57.36  ? 57   SER B O   1 
ATOM   4585 C CB  . SER B 1 56  ? -16.981 -5.416  5.693   1.00 58.92  ? 57   SER B CB  1 
ATOM   4586 O OG  . SER B 1 56  ? -17.429 -4.098  5.442   1.00 63.71  ? 57   SER B OG  1 
ATOM   4587 N N   . GLY B 1 57  ? -19.287 -7.347  6.507   1.00 51.54  ? 58   GLY B N   1 
ATOM   4588 C CA  . GLY B 1 57  ? -20.593 -7.660  7.050   1.00 47.19  ? 58   GLY B CA  1 
ATOM   4589 C C   . GLY B 1 57  ? -21.305 -8.748  6.261   1.00 48.61  ? 58   GLY B C   1 
ATOM   4590 O O   . GLY B 1 57  ? -20.719 -9.467  5.448   1.00 50.45  ? 58   GLY B O   1 
ATOM   4591 N N   . VAL B 1 58  ? -22.604 -8.860  6.514   1.00 46.45  ? 59   VAL B N   1 
ATOM   4592 C CA  . VAL B 1 58  ? -23.428 -9.935  5.978   1.00 41.20  ? 59   VAL B CA  1 
ATOM   4593 C C   . VAL B 1 58  ? -24.473 -9.327  5.059   1.00 44.93  ? 59   VAL B C   1 
ATOM   4594 O O   . VAL B 1 58  ? -25.300 -8.518  5.500   1.00 46.83  ? 59   VAL B O   1 
ATOM   4595 C CB  . VAL B 1 58  ? -24.097 -10.750 7.094   1.00 39.63  ? 59   VAL B CB  1 
ATOM   4596 C CG1 . VAL B 1 58  ? -24.586 -12.096 6.556   1.00 39.74  ? 59   VAL B CG1 1 
ATOM   4597 C CG2 . VAL B 1 58  ? -23.130 -10.934 8.258   1.00 34.34  ? 59   VAL B CG2 1 
ATOM   4598 N N   . VAL B 1 59  ? -24.432 -9.712  3.783   1.00 38.99  ? 60   VAL B N   1 
ATOM   4599 C CA  . VAL B 1 59  ? -25.469 -9.307  2.846   1.00 37.04  ? 60   VAL B CA  1 
ATOM   4600 C C   . VAL B 1 59  ? -26.742 -10.080 3.160   1.00 41.39  ? 60   VAL B C   1 
ATOM   4601 O O   . VAL B 1 59  ? -26.719 -11.306 3.339   1.00 41.62  ? 60   VAL B O   1 
ATOM   4602 C CB  . VAL B 1 59  ? -25.010 -9.539  1.398   1.00 40.31  ? 60   VAL B CB  1 
ATOM   4603 C CG1 . VAL B 1 59  ? -26.205 -9.622  0.456   1.00 40.27  ? 60   VAL B CG1 1 
ATOM   4604 C CG2 . VAL B 1 59  ? -24.075 -8.429  0.961   1.00 34.64  ? 60   VAL B CG2 1 
ATOM   4605 N N   . ASP B 1 60  ? -27.851 -9.401  3.192   1.00 43.89  ? 61   ASP B N   1 
ATOM   4606 C CA  . ASP B 1 60  ? -29.073 -10.077 3.480   1.00 52.52  ? 61   ASP B CA  1 
ATOM   4607 C C   . ASP B 1 60  ? -29.637 -10.604 2.181   1.00 45.69  ? 61   ASP B C   1 
ATOM   4608 O O   . ASP B 1 60  ? -30.068 -9.882  1.358   1.00 39.79  ? 61   ASP B O   1 
ATOM   4609 C CB  . ASP B 1 60  ? -30.004 -9.095  4.156   1.00 68.30  ? 61   ASP B CB  1 
ATOM   4610 C CG  . ASP B 1 60  ? -31.415 -9.266  3.775   1.00 82.68  ? 61   ASP B CG  1 
ATOM   4611 O OD1 . ASP B 1 60  ? -31.958 -10.348 3.932   1.00 89.40  ? 61   ASP B OD1 1 
ATOM   4612 O OD2 . ASP B 1 60  ? -32.004 -8.284  3.342   1.00 88.72  ? 61   ASP B OD2 1 
ATOM   4613 N N   . ALA B 1 61  ? -29.637 -11.907 2.044   1.00 40.23  ? 62   ALA B N   1 
ATOM   4614 C CA  . ALA B 1 61  ? -30.094 -12.566 0.828   1.00 40.52  ? 62   ALA B CA  1 
ATOM   4615 C C   . ALA B 1 61  ? -31.398 -13.322 1.068   1.00 37.93  ? 62   ALA B C   1 
ATOM   4616 O O   . ALA B 1 61  ? -31.509 -14.503 0.725   1.00 37.16  ? 62   ALA B O   1 
ATOM   4617 C CB  . ALA B 1 61  ? -29.015 -13.513 0.295   1.00 36.02  ? 62   ALA B CB  1 
ATOM   4618 N N   . THR B 1 62  ? -32.391 -12.653 1.651   1.00 34.60  ? 63   THR B N   1 
ATOM   4619 C CA  . THR B 1 62  ? -33.649 -13.289 2.015   1.00 35.68  ? 63   THR B CA  1 
ATOM   4620 C C   . THR B 1 62  ? -34.818 -12.860 1.141   1.00 40.43  ? 63   THR B C   1 
ATOM   4621 O O   . THR B 1 62  ? -35.946 -13.301 1.386   1.00 43.60  ? 63   THR B O   1 
ATOM   4622 C CB  . THR B 1 62  ? -33.996 -12.990 3.478   1.00 41.38  ? 63   THR B CB  1 
ATOM   4623 O OG1 . THR B 1 62  ? -34.198 -11.582 3.625   1.00 41.28  ? 63   THR B OG1 1 
ATOM   4624 C CG2 . THR B 1 62  ? -32.881 -13.451 4.424   1.00 31.12  ? 63   THR B CG2 1 
ATOM   4625 N N   . THR B 1 63  ? -34.588 -11.994 0.174   1.00 40.51  ? 64   THR B N   1 
ATOM   4626 C CA  . THR B 1 63  ? -35.635 -11.505 -0.688  1.00 39.18  ? 64   THR B CA  1 
ATOM   4627 C C   . THR B 1 63  ? -35.138 -11.179 -2.091  1.00 30.81  ? 64   THR B C   1 
ATOM   4628 O O   . THR B 1 63  ? -34.033 -10.874 -2.254  1.00 35.83  ? 64   THR B O   1 
ATOM   4629 C CB  . THR B 1 63  ? -36.276 -10.272 -0.035  1.00 46.83  ? 64   THR B CB  1 
ATOM   4630 O OG1 . THR B 1 63  ? -37.367 -9.811  -0.821  1.00 63.84  ? 64   THR B OG1 1 
ATOM   4631 C CG2 . THR B 1 63  ? -35.319 -9.180  0.067   1.00 35.54  ? 64   THR B CG2 1 
ATOM   4632 N N   . PHE B 1 64  ? -35.969 -11.280 -3.100  1.00 25.23  ? 65   PHE B N   1 
ATOM   4633 C CA  . PHE B 1 64  ? -35.562 -10.938 -4.459  1.00 34.35  ? 65   PHE B CA  1 
ATOM   4634 C C   . PHE B 1 64  ? -35.199 -9.458  -4.555  1.00 34.79  ? 65   PHE B C   1 
ATOM   4635 O O   . PHE B 1 64  ? -35.791 -8.602  -3.893  1.00 39.57  ? 65   PHE B O   1 
ATOM   4636 C CB  . PHE B 1 64  ? -36.676 -11.240 -5.467  1.00 30.30  ? 65   PHE B CB  1 
ATOM   4637 C CG  . PHE B 1 64  ? -36.964 -12.716 -5.687  1.00 30.23  ? 65   PHE B CG  1 
ATOM   4638 C CD1 . PHE B 1 64  ? -36.054 -13.538 -6.340  1.00 28.56  ? 65   PHE B CD1 1 
ATOM   4639 C CD2 . PHE B 1 64  ? -38.191 -13.254 -5.312  1.00 26.01  ? 65   PHE B CD2 1 
ATOM   4640 C CE1 . PHE B 1 64  ? -36.341 -14.882 -6.570  1.00 26.32  ? 65   PHE B CE1 1 
ATOM   4641 C CE2 . PHE B 1 64  ? -38.484 -14.595 -5.537  1.00 24.32  ? 65   PHE B CE2 1 
ATOM   4642 C CZ  . PHE B 1 64  ? -37.554 -15.409 -6.168  1.00 27.64  ? 65   PHE B CZ  1 
ATOM   4643 N N   . GLN B 1 65  ? -34.237 -9.151  -5.418  1.00 32.85  ? 66   GLN B N   1 
ATOM   4644 C CA  . GLN B 1 65  ? -33.811 -7.774  -5.621  1.00 35.85  ? 66   GLN B CA  1 
ATOM   4645 C C   . GLN B 1 65  ? -34.620 -7.128  -6.750  1.00 35.22  ? 66   GLN B C   1 
ATOM   4646 O O   . GLN B 1 65  ? -35.562 -7.716  -7.291  1.00 37.14  ? 66   GLN B O   1 
ATOM   4647 C CB  . GLN B 1 65  ? -32.311 -7.734  -5.892  1.00 35.52  ? 66   GLN B CB  1 
ATOM   4648 C CG  . GLN B 1 65  ? -31.477 -7.468  -4.656  1.00 34.09  ? 66   GLN B CG  1 
ATOM   4649 C CD  . GLN B 1 65  ? -31.570 -6.025  -4.206  1.00 42.93  ? 66   GLN B CD  1 
ATOM   4650 O OE1 . GLN B 1 65  ? -32.107 -5.171  -4.918  1.00 45.47  ? 66   GLN B OE1 1 
ATOM   4651 N NE2 . GLN B 1 65  ? -31.039 -5.741  -3.024  1.00 38.90  ? 66   GLN B NE2 1 
ATOM   4652 N N   . SER B 1 66  ? -34.244 -5.909  -7.129  1.00 30.21  ? 67   SER B N   1 
ATOM   4653 C CA  . SER B 1 66  ? -34.997 -5.143  -8.113  1.00 33.64  ? 67   SER B CA  1 
ATOM   4654 C C   . SER B 1 66  ? -34.979 -5.808  -9.490  1.00 28.49  ? 67   SER B C   1 
ATOM   4655 O O   . SER B 1 66  ? -34.087 -6.587  -9.831  1.00 36.68  ? 67   SER B O   1 
ATOM   4656 C CB  . SER B 1 66  ? -34.430 -3.732  -8.238  1.00 38.49  ? 67   SER B CB  1 
ATOM   4657 O OG  . SER B 1 66  ? -34.164 -3.182  -6.967  1.00 50.02  ? 67   SER B OG  1 
ATOM   4658 N N   . VAL B 1 67  ? -35.987 -5.473  -10.284 1.00 30.74  ? 68   VAL B N   1 
ATOM   4659 C CA  . VAL B 1 67  ? -36.092 -5.890  -11.677 1.00 30.26  ? 68   VAL B CA  1 
ATOM   4660 C C   . VAL B 1 67  ? -35.406 -4.849  -12.549 1.00 21.19  ? 68   VAL B C   1 
ATOM   4661 O O   . VAL B 1 67  ? -35.584 -3.643  -12.353 1.00 25.95  ? 68   VAL B O   1 
ATOM   4662 C CB  . VAL B 1 67  ? -37.570 -6.068  -12.070 1.00 29.49  ? 68   VAL B CB  1 
ATOM   4663 C CG1 . VAL B 1 67  ? -37.704 -6.488  -13.526 1.00 33.05  ? 68   VAL B CG1 1 
ATOM   4664 C CG2 . VAL B 1 67  ? -38.236 -7.078  -11.152 1.00 30.80  ? 68   VAL B CG2 1 
ATOM   4665 N N   . CYS B 1 68  ? -34.608 -5.302  -13.507 1.00 25.79  ? 69   CYS B N   1 
ATOM   4666 C CA  . CYS B 1 68  ? -33.963 -4.364  -14.416 1.00 31.26  ? 69   CYS B CA  1 
ATOM   4667 C C   . CYS B 1 68  ? -35.009 -3.603  -15.226 1.00 33.18  ? 69   CYS B C   1 
ATOM   4668 O O   . CYS B 1 68  ? -36.076 -4.133  -15.557 1.00 30.74  ? 69   CYS B O   1 
ATOM   4669 C CB  . CYS B 1 68  ? -32.997 -5.089  -15.349 1.00 26.24  ? 69   CYS B CB  1 
ATOM   4670 S SG  . CYS B 1 68  ? -31.649 -6.048  -14.625 1.00 37.20  ? 69   CYS B SG  1 
ATOM   4671 N N   . TYR B 1 69  ? -34.693 -2.341  -15.532 1.00 30.16  ? 70   TYR B N   1 
ATOM   4672 C CA  . TYR B 1 69  ? -35.643 -1.447  -16.191 1.00 33.76  ? 70   TYR B CA  1 
ATOM   4673 C C   . TYR B 1 69  ? -36.167 -2.045  -17.490 1.00 31.53  ? 70   TYR B C   1 
ATOM   4674 O O   . TYR B 1 69  ? -35.389 -2.472  -18.346 1.00 31.73  ? 70   TYR B O   1 
ATOM   4675 C CB  . TYR B 1 69  ? -34.986 -0.094  -16.471 1.00 37.50  ? 70   TYR B CB  1 
ATOM   4676 C CG  . TYR B 1 69  ? -35.424 0.972   -15.507 1.00 38.90  ? 70   TYR B CG  1 
ATOM   4677 C CD1 . TYR B 1 69  ? -36.597 1.697   -15.718 1.00 38.14  ? 70   TYR B CD1 1 
ATOM   4678 C CD2 . TYR B 1 69  ? -34.683 1.239   -14.361 1.00 36.10  ? 70   TYR B CD2 1 
ATOM   4679 C CE1 . TYR B 1 69  ? -37.010 2.673   -14.814 1.00 42.34  ? 70   TYR B CE1 1 
ATOM   4680 C CE2 . TYR B 1 69  ? -35.085 2.211   -13.455 1.00 39.15  ? 70   TYR B CE2 1 
ATOM   4681 C CZ  . TYR B 1 69  ? -36.247 2.921   -13.682 1.00 47.78  ? 70   TYR B CZ  1 
ATOM   4682 O OH  . TYR B 1 69  ? -36.634 3.886   -12.776 1.00 58.91  ? 70   TYR B OH  1 
ATOM   4683 N N   . GLN B 1 70  ? -37.491 -2.051  -17.645 1.00 31.94  ? 71   GLN B N   1 
ATOM   4684 C CA  . GLN B 1 70  ? -38.104 -2.666  -18.814 1.00 29.95  ? 71   GLN B CA  1 
ATOM   4685 C C   . GLN B 1 70  ? -39.507 -2.114  -19.013 1.00 34.40  ? 71   GLN B C   1 
ATOM   4686 O O   . GLN B 1 70  ? -40.143 -1.616  -18.078 1.00 35.18  ? 71   GLN B O   1 
ATOM   4687 C CB  . GLN B 1 70  ? -38.155 -4.192  -18.680 1.00 28.80  ? 71   GLN B CB  1 
ATOM   4688 C CG  . GLN B 1 70  ? -38.983 -4.678  -17.483 1.00 26.05  ? 71   GLN B CG  1 
ATOM   4689 C CD  . GLN B 1 70  ? -38.778 -6.157  -17.206 1.00 31.62  ? 71   GLN B CD  1 
ATOM   4690 O OE1 . GLN B 1 70  ? -39.667 -6.974  -17.450 1.00 31.77  ? 71   GLN B OE1 1 
ATOM   4691 N NE2 . GLN B 1 70  ? -37.600 -6.509  -16.695 1.00 25.11  ? 71   GLN B NE2 1 
ATOM   4692 N N   . TYR B 1 71  ? -39.973 -2.212  -20.255 1.00 32.36  ? 72   TYR B N   1 
ATOM   4693 C CA  . TYR B 1 71  ? -41.358 -1.903  -20.581 1.00 32.64  ? 72   TYR B CA  1 
ATOM   4694 C C   . TYR B 1 71  ? -42.292 -2.825  -19.808 1.00 33.93  ? 72   TYR B C   1 
ATOM   4695 O O   . TYR B 1 71  ? -41.982 -3.998  -19.583 1.00 40.88  ? 72   TYR B O   1 
ATOM   4696 C CB  . TYR B 1 71  ? -41.584 -2.051  -22.094 1.00 38.22  ? 72   TYR B CB  1 
ATOM   4697 C CG  . TYR B 1 71  ? -43.033 -1.905  -22.509 1.00 39.06  ? 72   TYR B CG  1 
ATOM   4698 C CD1 . TYR B 1 71  ? -43.625 -0.650  -22.596 1.00 40.79  ? 72   TYR B CD1 1 
ATOM   4699 C CD2 . TYR B 1 71  ? -43.814 -3.022  -22.803 1.00 37.24  ? 72   TYR B CD2 1 
ATOM   4700 C CE1 . TYR B 1 71  ? -44.959 -0.505  -22.961 1.00 42.92  ? 72   TYR B CE1 1 
ATOM   4701 C CE2 . TYR B 1 71  ? -45.150 -2.889  -23.169 1.00 40.33  ? 72   TYR B CE2 1 
ATOM   4702 C CZ  . TYR B 1 71  ? -45.716 -1.625  -23.247 1.00 45.04  ? 72   TYR B CZ  1 
ATOM   4703 O OH  . TYR B 1 71  ? -47.040 -1.476  -23.608 1.00 49.32  ? 72   TYR B OH  1 
ATOM   4704 N N   . VAL B 1 72  ? -43.439 -2.292  -19.390 1.00 34.84  ? 73   VAL B N   1 
ATOM   4705 C CA  . VAL B 1 72  ? -44.437 -3.055  -18.642 1.00 38.57  ? 73   VAL B CA  1 
ATOM   4706 C C   . VAL B 1 72  ? -45.664 -3.222  -19.528 1.00 40.09  ? 73   VAL B C   1 
ATOM   4707 O O   . VAL B 1 72  ? -46.287 -2.234  -19.934 1.00 45.61  ? 73   VAL B O   1 
ATOM   4708 C CB  . VAL B 1 72  ? -44.795 -2.375  -17.313 1.00 42.47  ? 73   VAL B CB  1 
ATOM   4709 C CG1 . VAL B 1 72  ? -45.932 -3.115  -16.617 1.00 42.71  ? 73   VAL B CG1 1 
ATOM   4710 C CG2 . VAL B 1 72  ? -43.580 -2.326  -16.420 1.00 39.84  ? 73   VAL B CG2 1 
ATOM   4711 N N   . ASP B 1 73  ? -46.014 -4.472  -19.825 1.00 39.78  ? 74   ASP B N   1 
ATOM   4712 C CA  . ASP B 1 73  ? -47.115 -4.750  -20.741 1.00 45.43  ? 74   ASP B CA  1 
ATOM   4713 C C   . ASP B 1 73  ? -48.447 -4.338  -20.118 1.00 47.97  ? 74   ASP B C   1 
ATOM   4714 O O   . ASP B 1 73  ? -48.796 -4.799  -19.028 1.00 49.78  ? 74   ASP B O   1 
ATOM   4715 C CB  . ASP B 1 73  ? -47.129 -6.229  -21.111 1.00 51.27  ? 74   ASP B CB  1 
ATOM   4716 C CG  . ASP B 1 73  ? -48.312 -6.595  -21.979 1.00 62.96  ? 74   ASP B CG  1 
ATOM   4717 O OD1 . ASP B 1 73  ? -48.556 -5.892  -22.980 1.00 67.50  ? 74   ASP B OD1 1 
ATOM   4718 O OD2 . ASP B 1 73  ? -49.002 -7.581  -21.656 1.00 68.68  ? 74   ASP B OD2 1 
ATOM   4719 N N   . THR B 1 74  ? -49.196 -3.481  -20.821 1.00 49.51  ? 75   THR B N   1 
ATOM   4720 C CA  . THR B 1 74  ? -50.460 -2.938  -20.328 1.00 55.66  ? 75   THR B CA  1 
ATOM   4721 C C   . THR B 1 74  ? -51.644 -3.300  -21.224 1.00 54.75  ? 75   THR B C   1 
ATOM   4722 O O   . THR B 1 74  ? -52.660 -2.599  -21.216 1.00 53.72  ? 75   THR B O   1 
ATOM   4723 C CB  . THR B 1 74  ? -50.373 -1.415  -20.191 1.00 56.58  ? 75   THR B CB  1 
ATOM   4724 O OG1 . THR B 1 74  ? -50.065 -0.839  -21.468 1.00 55.18  ? 75   THR B OG1 1 
ATOM   4725 C CG2 . THR B 1 74  ? -49.296 -1.025  -19.198 1.00 54.23  ? 75   THR B CG2 1 
ATOM   4726 N N   . LEU B 1 75  ? -51.548 -4.393  -21.980 1.00 56.08  ? 76   LEU B N   1 
ATOM   4727 C CA  . LEU B 1 75  ? -52.549 -4.666  -23.007 1.00 55.97  ? 76   LEU B CA  1 
ATOM   4728 C C   . LEU B 1 75  ? -53.849 -5.213  -22.419 1.00 57.37  ? 76   LEU B C   1 
ATOM   4729 O O   . LEU B 1 75  ? -54.939 -4.854  -22.883 1.00 62.42  ? 76   LEU B O   1 
ATOM   4730 C CB  . LEU B 1 75  ? -51.968 -5.619  -24.048 1.00 56.77  ? 76   LEU B CB  1 
ATOM   4731 C CG  . LEU B 1 75  ? -52.904 -6.167  -25.122 1.00 65.49  ? 76   LEU B CG  1 
ATOM   4732 C CD1 . LEU B 1 75  ? -52.898 -5.251  -26.334 1.00 65.12  ? 76   LEU B CD1 1 
ATOM   4733 C CD2 . LEU B 1 75  ? -52.455 -7.563  -25.509 1.00 66.34  ? 76   LEU B CD2 1 
ATOM   4734 N N   . TYR B 1 76  ? -53.767 -6.077  -21.408 1.00 50.61  ? 77   TYR B N   1 
ATOM   4735 C CA  . TYR B 1 76  ? -54.940 -6.543  -20.663 1.00 50.81  ? 77   TYR B CA  1 
ATOM   4736 C C   . TYR B 1 76  ? -54.689 -6.273  -19.185 1.00 50.57  ? 77   TYR B C   1 
ATOM   4737 O O   . TYR B 1 76  ? -54.281 -7.175  -18.438 1.00 48.21  ? 77   TYR B O   1 
ATOM   4738 C CB  . TYR B 1 76  ? -55.215 -8.028  -20.908 1.00 50.54  ? 77   TYR B CB  1 
ATOM   4739 C CG  . TYR B 1 76  ? -55.555 -8.395  -22.337 1.00 56.74  ? 77   TYR B CG  1 
ATOM   4740 C CD1 . TYR B 1 76  ? -54.851 -9.394  -23.002 1.00 53.75  ? 77   TYR B CD1 1 
ATOM   4741 C CD2 . TYR B 1 76  ? -56.593 -7.766  -23.015 1.00 59.02  ? 77   TYR B CD2 1 
ATOM   4742 C CE1 . TYR B 1 76  ? -55.156 -9.744  -24.307 1.00 52.20  ? 77   TYR B CE1 1 
ATOM   4743 C CE2 . TYR B 1 76  ? -56.910 -8.112  -24.320 1.00 58.04  ? 77   TYR B CE2 1 
ATOM   4744 C CZ  . TYR B 1 76  ? -56.187 -9.102  -24.961 1.00 56.39  ? 77   TYR B CZ  1 
ATOM   4745 O OH  . TYR B 1 76  ? -56.495 -9.450  -26.261 1.00 60.12  ? 77   TYR B OH  1 
ATOM   4746 N N   . PRO B 1 77  ? -54.918 -5.042  -18.728 1.00 56.32  ? 78   PRO B N   1 
ATOM   4747 C CA  . PRO B 1 77  ? -54.584 -4.688  -17.338 1.00 54.71  ? 78   PRO B CA  1 
ATOM   4748 C C   . PRO B 1 77  ? -55.327 -5.560  -16.334 1.00 49.81  ? 78   PRO B C   1 
ATOM   4749 O O   . PRO B 1 77  ? -56.550 -5.698  -16.389 1.00 53.12  ? 78   PRO B O   1 
ATOM   4750 C CB  . PRO B 1 77  ? -55.016 -3.220  -17.234 1.00 58.08  ? 78   PRO B CB  1 
ATOM   4751 C CG  . PRO B 1 77  ? -55.018 -2.720  -18.645 1.00 59.10  ? 78   PRO B CG  1 
ATOM   4752 C CD  . PRO B 1 77  ? -55.447 -3.892  -19.481 1.00 57.91  ? 78   PRO B CD  1 
ATOM   4753 N N   . GLY B 1 78  ? -54.571 -6.144  -15.404 1.00 48.44  ? 79   GLY B N   1 
ATOM   4754 C CA  . GLY B 1 78  ? -55.134 -6.985  -14.370 1.00 50.29  ? 79   GLY B CA  1 
ATOM   4755 C C   . GLY B 1 78  ? -55.360 -8.423  -14.773 1.00 54.46  ? 79   GLY B C   1 
ATOM   4756 O O   . GLY B 1 78  ? -55.695 -9.247  -13.912 1.00 58.14  ? 79   GLY B O   1 
ATOM   4757 N N   . PHE B 1 79  ? -55.185 -8.754  -16.046 1.00 53.05  ? 80   PHE B N   1 
ATOM   4758 C CA  . PHE B 1 79  ? -55.400 -10.111 -16.522 1.00 45.49  ? 80   PHE B CA  1 
ATOM   4759 C C   . PHE B 1 79  ? -54.225 -10.991 -16.112 1.00 39.74  ? 80   PHE B C   1 
ATOM   4760 O O   . PHE B 1 79  ? -53.061 -10.636 -16.339 1.00 39.47  ? 80   PHE B O   1 
ATOM   4761 C CB  . PHE B 1 79  ? -55.577 -10.101 -18.041 1.00 47.44  ? 80   PHE B CB  1 
ATOM   4762 C CG  . PHE B 1 79  ? -55.709 -11.463 -18.654 1.00 44.72  ? 80   PHE B CG  1 
ATOM   4763 C CD1 . PHE B 1 79  ? -56.678 -12.348 -18.215 1.00 47.64  ? 80   PHE B CD1 1 
ATOM   4764 C CD2 . PHE B 1 79  ? -54.854 -11.859 -19.671 1.00 40.36  ? 80   PHE B CD2 1 
ATOM   4765 C CE1 . PHE B 1 79  ? -56.800 -13.606 -18.785 1.00 45.17  ? 80   PHE B CE1 1 
ATOM   4766 C CE2 . PHE B 1 79  ? -54.970 -13.115 -20.247 1.00 38.77  ? 80   PHE B CE2 1 
ATOM   4767 C CZ  . PHE B 1 79  ? -55.945 -13.989 -19.800 1.00 43.00  ? 80   PHE B CZ  1 
ATOM   4768 N N   . GLU B 1 80  ? -54.536 -12.140 -15.503 1.00 39.82  ? 81   GLU B N   1 
ATOM   4769 C CA  . GLU B 1 80  ? -53.490 -13.040 -15.021 1.00 39.30  ? 81   GLU B CA  1 
ATOM   4770 C C   . GLU B 1 80  ? -52.545 -13.463 -16.137 1.00 44.16  ? 81   GLU B C   1 
ATOM   4771 O O   . GLU B 1 80  ? -51.347 -13.659 -15.895 1.00 44.62  ? 81   GLU B O   1 
ATOM   4772 C CB  . GLU B 1 80  ? -54.127 -14.274 -14.374 1.00 62.73  ? 81   GLU B CB  1 
ATOM   4773 C CG  . GLU B 1 80  ? -53.456 -14.725 -13.084 1.00 85.53  ? 81   GLU B CG  1 
ATOM   4774 C CD  . GLU B 1 80  ? -52.407 -15.797 -13.317 1.00 95.87  ? 81   GLU B CD  1 
ATOM   4775 O OE1 . GLU B 1 80  ? -52.568 -16.580 -14.277 1.00 96.16  ? 81   GLU B OE1 1 
ATOM   4776 O OE2 . GLU B 1 80  ? -51.423 -15.855 -12.547 1.00 96.89  ? 81   GLU B OE2 1 
ATOM   4777 N N   . GLY B 1 81  ? -53.063 -13.602 -17.362 1.00 50.14  ? 82   GLY B N   1 
ATOM   4778 C CA  . GLY B 1 81  ? -52.239 -14.086 -18.457 1.00 44.99  ? 82   GLY B CA  1 
ATOM   4779 C C   . GLY B 1 81  ? -51.087 -13.159 -18.785 1.00 42.92  ? 82   GLY B C   1 
ATOM   4780 O O   . GLY B 1 81  ? -49.985 -13.612 -19.094 1.00 55.84  ? 82   GLY B O   1 
ATOM   4781 N N   . THR B 1 82  ? -51.318 -11.851 -18.703 1.00 42.78  ? 83   THR B N   1 
ATOM   4782 C CA  . THR B 1 82  ? -50.256 -10.892 -18.976 1.00 42.05  ? 83   THR B CA  1 
ATOM   4783 C C   . THR B 1 82  ? -49.473 -10.511 -17.722 1.00 41.22  ? 83   THR B C   1 
ATOM   4784 O O   . THR B 1 82  ? -48.250 -10.343 -17.789 1.00 40.17  ? 83   THR B O   1 
ATOM   4785 C CB  . THR B 1 82  ? -50.837 -9.633  -19.628 1.00 43.45  ? 83   THR B CB  1 
ATOM   4786 O OG1 . THR B 1 82  ? -51.845 -9.077  -18.779 1.00 50.90  ? 83   THR B OG1 1 
ATOM   4787 C CG2 . THR B 1 82  ? -51.465 -9.972  -20.972 1.00 50.70  ? 83   THR B CG2 1 
ATOM   4788 N N   . GLU B 1 83  ? -50.148 -10.386 -16.575 1.00 35.98  ? 84   GLU B N   1 
ATOM   4789 C CA  . GLU B 1 83  ? -49.475 -9.894  -15.375 1.00 38.75  ? 84   GLU B CA  1 
ATOM   4790 C C   . GLU B 1 83  ? -48.460 -10.879 -14.808 1.00 35.89  ? 84   GLU B C   1 
ATOM   4791 O O   . GLU B 1 83  ? -47.498 -10.447 -14.166 1.00 31.89  ? 84   GLU B O   1 
ATOM   4792 C CB  . GLU B 1 83  ? -50.498 -9.528  -14.297 1.00 38.37  ? 84   GLU B CB  1 
ATOM   4793 C CG  . GLU B 1 83  ? -51.361 -8.301  -14.631 1.00 41.98  ? 84   GLU B CG  1 
ATOM   4794 C CD  . GLU B 1 83  ? -50.578 -7.018  -14.950 1.00 55.42  ? 84   GLU B CD  1 
ATOM   4795 O OE1 . GLU B 1 83  ? -49.320 -6.988  -14.906 1.00 60.51  ? 84   GLU B OE1 1 
ATOM   4796 O OE2 . GLU B 1 83  ? -51.254 -6.014  -15.262 1.00 58.73  ? 84   GLU B OE2 1 
ATOM   4797 N N   . MET B 1 84  ? -48.623 -12.180 -15.053 1.00 34.53  ? 85   MET B N   1 
ATOM   4798 C CA  . MET B 1 84  ? -47.653 -13.139 -14.539 1.00 28.93  ? 85   MET B CA  1 
ATOM   4799 C C   . MET B 1 84  ? -46.268 -12.954 -15.155 1.00 35.56  ? 85   MET B C   1 
ATOM   4800 O O   . MET B 1 84  ? -45.294 -13.507 -14.630 1.00 39.99  ? 85   MET B O   1 
ATOM   4801 C CB  . MET B 1 84  ? -48.141 -14.565 -14.782 1.00 33.62  ? 85   MET B CB  1 
ATOM   4802 C CG  . MET B 1 84  ? -48.204 -14.962 -16.262 1.00 40.65  ? 85   MET B CG  1 
ATOM   4803 S SD  . MET B 1 84  ? -49.127 -16.476 -16.544 1.00 45.64  ? 85   MET B SD  1 
ATOM   4804 C CE  . MET B 1 84  ? -47.804 -17.662 -16.474 1.00 35.39  ? 85   MET B CE  1 
ATOM   4805 N N   . TRP B 1 85  ? -46.150 -12.193 -16.249 1.00 34.84  ? 86   TRP B N   1 
ATOM   4806 C CA  . TRP B 1 85  ? -44.847 -11.917 -16.853 1.00 31.15  ? 86   TRP B CA  1 
ATOM   4807 C C   . TRP B 1 85  ? -44.318 -10.528 -16.529 1.00 29.41  ? 86   TRP B C   1 
ATOM   4808 O O   . TRP B 1 85  ? -43.154 -10.243 -16.825 1.00 31.22  ? 86   TRP B O   1 
ATOM   4809 C CB  . TRP B 1 85  ? -44.908 -12.080 -18.383 1.00 27.83  ? 86   TRP B CB  1 
ATOM   4810 C CG  . TRP B 1 85  ? -45.521 -13.366 -18.806 1.00 33.03  ? 86   TRP B CG  1 
ATOM   4811 C CD1 . TRP B 1 85  ? -46.743 -13.534 -19.385 1.00 28.31  ? 86   TRP B CD1 1 
ATOM   4812 C CD2 . TRP B 1 85  ? -44.953 -14.679 -18.672 1.00 28.82  ? 86   TRP B CD2 1 
ATOM   4813 N NE1 . TRP B 1 85  ? -46.972 -14.871 -19.634 1.00 27.26  ? 86   TRP B NE1 1 
ATOM   4814 C CE2 . TRP B 1 85  ? -45.891 -15.595 -19.203 1.00 32.54  ? 86   TRP B CE2 1 
ATOM   4815 C CE3 . TRP B 1 85  ? -43.744 -15.168 -18.160 1.00 26.86  ? 86   TRP B CE3 1 
ATOM   4816 C CZ2 . TRP B 1 85  ? -45.660 -16.972 -19.234 1.00 26.83  ? 86   TRP B CZ2 1 
ATOM   4817 C CZ3 . TRP B 1 85  ? -43.513 -16.542 -18.191 1.00 26.48  ? 86   TRP B CZ3 1 
ATOM   4818 C CH2 . TRP B 1 85  ? -44.467 -17.426 -18.727 1.00 30.70  ? 86   TRP B CH2 1 
ATOM   4819 N N   . ASN B 1 86  ? -45.133 -9.667  -15.936 1.00 33.30  ? 87   ASN B N   1 
ATOM   4820 C CA  . ASN B 1 86  ? -44.708 -8.311  -15.649 1.00 33.41  ? 87   ASN B CA  1 
ATOM   4821 C C   . ASN B 1 86  ? -43.876 -8.257  -14.368 1.00 32.30  ? 87   ASN B C   1 
ATOM   4822 O O   . ASN B 1 86  ? -43.908 -9.183  -13.552 1.00 34.05  ? 87   ASN B O   1 
ATOM   4823 C CB  . ASN B 1 86  ? -45.922 -7.396  -15.547 1.00 37.35  ? 87   ASN B CB  1 
ATOM   4824 C CG  . ASN B 1 86  ? -46.341 -6.846  -16.902 1.00 40.13  ? 87   ASN B CG  1 
ATOM   4825 O OD1 . ASN B 1 86  ? -45.513 -6.678  -17.804 1.00 37.59  ? 87   ASN B OD1 1 
ATOM   4826 N ND2 . ASN B 1 86  ? -47.618 -6.519  -17.034 1.00 40.11  ? 87   ASN B ND2 1 
ATOM   4827 N N   . PRO B 1 87  ? -43.097 -7.188  -14.182 1.00 34.12  ? 88   PRO B N   1 
ATOM   4828 C CA  . PRO B 1 87  ? -42.250 -7.092  -12.984 1.00 33.54  ? 88   PRO B CA  1 
ATOM   4829 C C   . PRO B 1 87  ? -43.065 -7.185  -11.705 1.00 37.73  ? 88   PRO B C   1 
ATOM   4830 O O   . PRO B 1 87  ? -44.123 -6.566  -11.572 1.00 41.97  ? 88   PRO B O   1 
ATOM   4831 C CB  . PRO B 1 87  ? -41.597 -5.714  -13.126 1.00 30.59  ? 88   PRO B CB  1 
ATOM   4832 C CG  . PRO B 1 87  ? -41.575 -5.466  -14.604 1.00 34.39  ? 88   PRO B CG  1 
ATOM   4833 C CD  . PRO B 1 87  ? -42.840 -6.085  -15.130 1.00 34.09  ? 88   PRO B CD  1 
ATOM   4834 N N   . ASN B 1 88  ? -42.556 -7.972  -10.758 1.00 31.00  ? 89   ASN B N   1 
ATOM   4835 C CA  . ASN B 1 88  ? -43.135 -8.073  -9.426  1.00 32.37  ? 89   ASN B CA  1 
ATOM   4836 C C   . ASN B 1 88  ? -42.226 -7.470  -8.357  1.00 37.50  ? 89   ASN B C   1 
ATOM   4837 O O   . ASN B 1 88  ? -42.430 -7.723  -7.165  1.00 40.22  ? 89   ASN B O   1 
ATOM   4838 C CB  . ASN B 1 88  ? -43.445 -9.533  -9.095  1.00 34.63  ? 89   ASN B CB  1 
ATOM   4839 C CG  . ASN B 1 88  ? -42.214 -10.409 -9.141  1.00 33.57  ? 89   ASN B CG  1 
ATOM   4840 O OD1 . ASN B 1 88  ? -41.180 -10.035 -9.705  1.00 30.57  ? 89   ASN B OD1 1 
ATOM   4841 N ND2 . ASN B 1 88  ? -42.320 -11.593 -8.556  1.00 36.93  ? 89   ASN B ND2 1 
ATOM   4842 N N   . ARG B 1 89  ? -41.299 -6.648  -8.770  1.00 38.19  ? 90   ARG B N   1 
ATOM   4843 C CA  . ARG B 1 89  ? -40.424 -5.887  -7.901  1.00 34.57  ? 90   ARG B CA  1 
ATOM   4844 C C   . ARG B 1 89  ? -40.201 -4.536  -8.538  1.00 39.93  ? 90   ARG B C   1 
ATOM   4845 O O   . ARG B 1 89  ? -40.489 -4.329  -9.671  1.00 39.45  ? 90   ARG B O   1 
ATOM   4846 C CB  . ARG B 1 89  ? -39.102 -6.583  -7.599  1.00 29.60  ? 90   ARG B CB  1 
ATOM   4847 C CG  . ARG B 1 89  ? -39.178 -7.828  -6.762  1.00 36.61  ? 90   ARG B CG  1 
ATOM   4848 C CD  . ARG B 1 89  ? -39.531 -7.557  -5.323  1.00 38.55  ? 90   ARG B CD  1 
ATOM   4849 N NE  . ARG B 1 89  ? -39.498 -8.759  -4.520  1.00 40.26  ? 90   ARG B NE  1 
ATOM   4850 C CZ  . ARG B 1 89  ? -40.424 -9.694  -4.527  1.00 40.94  ? 90   ARG B CZ  1 
ATOM   4851 N NH1 . ARG B 1 89  ? -41.460 -9.587  -5.298  1.00 38.22  ? 90   ARG B NH1 1 
ATOM   4852 N NH2 . ARG B 1 89  ? -40.302 -10.738 -3.765  1.00 34.90  ? 90   ARG B NH2 1 
ATOM   4853 N N   . GLU B 1 90  ? -39.689 -3.591  -7.760  1.00 43.50  ? 91   GLU B N   1 
ATOM   4854 C CA  . GLU B 1 90  ? -39.441 -2.252  -8.284  1.00 45.68  ? 91   GLU B CA  1 
ATOM   4855 C C   . GLU B 1 90  ? -38.343 -2.247  -9.346  1.00 37.54  ? 91   GLU B C   1 
ATOM   4856 O O   . GLU B 1 90  ? -37.334 -2.938  -9.210  1.00 35.06  ? 91   GLU B O   1 
ATOM   4857 C CB  . GLU B 1 90  ? -39.077 -1.293  -7.149  1.00 57.24  ? 91   GLU B CB  1 
ATOM   4858 C CG  . GLU B 1 90  ? -38.797 0.130   -7.605  1.00 90.70  ? 91   GLU B CG  1 
ATOM   4859 C CD  . GLU B 1 90  ? -38.431 1.049   -6.456  1.00 108.45 ? 91   GLU B CD  1 
ATOM   4860 O OE1 . GLU B 1 90  ? -38.395 0.574   -5.301  1.00 114.18 ? 91   GLU B OE1 1 
ATOM   4861 O OE2 . GLU B 1 90  ? -38.180 2.246   -6.707  1.00 113.75 ? 91   GLU B OE2 1 
ATOM   4862 N N   . LEU B 1 91  ? -38.545 -1.463  -10.402 1.00 29.00  ? 92   LEU B N   1 
ATOM   4863 C CA  . LEU B 1 91  ? -37.559 -1.346  -11.462 1.00 34.07  ? 92   LEU B CA  1 
ATOM   4864 C C   . LEU B 1 91  ? -36.348 -0.561  -10.976 1.00 35.31  ? 92   LEU B C   1 
ATOM   4865 O O   . LEU B 1 91  ? -36.474 0.398   -10.213 1.00 36.22  ? 92   LEU B O   1 
ATOM   4866 C CB  . LEU B 1 91  ? -38.163 -0.664  -12.690 1.00 30.08  ? 92   LEU B CB  1 
ATOM   4867 C CG  . LEU B 1 91  ? -39.442 -1.279  -13.267 1.00 37.81  ? 92   LEU B CG  1 
ATOM   4868 C CD1 . LEU B 1 91  ? -39.963 -0.445  -14.433 1.00 32.24  ? 92   LEU B CD1 1 
ATOM   4869 C CD2 . LEU B 1 91  ? -39.196 -2.712  -13.712 1.00 34.21  ? 92   LEU B CD2 1 
ATOM   4870 N N   . SER B 1 92  ? -35.170 -0.968  -11.436 1.00 34.36  ? 93   SER B N   1 
ATOM   4871 C CA  . SER B 1 92  ? -33.944 -0.272  -11.084 1.00 32.49  ? 93   SER B CA  1 
ATOM   4872 C C   . SER B 1 92  ? -32.854 -0.703  -12.051 1.00 31.44  ? 93   SER B C   1 
ATOM   4873 O O   . SER B 1 92  ? -32.840 -1.845  -12.520 1.00 35.27  ? 93   SER B O   1 
ATOM   4874 C CB  . SER B 1 92  ? -33.531 -0.570  -9.632  1.00 30.23  ? 93   SER B CB  1 
ATOM   4875 O OG  . SER B 1 92  ? -32.300 0.045   -9.294  1.00 33.01  ? 93   SER B OG  1 
ATOM   4876 N N   . GLU B 1 93  ? -31.949 0.227   -12.357 1.00 32.99  ? 94   GLU B N   1 
ATOM   4877 C CA  . GLU B 1 93  ? -30.726 -0.160  -13.048 1.00 34.72  ? 94   GLU B CA  1 
ATOM   4878 C C   . GLU B 1 93  ? -29.793 -0.938  -12.129 1.00 36.64  ? 94   GLU B C   1 
ATOM   4879 O O   . GLU B 1 93  ? -28.949 -1.694  -12.617 1.00 36.62  ? 94   GLU B O   1 
ATOM   4880 C CB  . GLU B 1 93  ? -30.018 1.076   -13.605 1.00 33.04  ? 94   GLU B CB  1 
ATOM   4881 C CG  . GLU B 1 93  ? -30.763 1.753   -14.756 1.00 35.39  ? 94   GLU B CG  1 
ATOM   4882 C CD  . GLU B 1 93  ? -29.951 2.861   -15.409 1.00 36.50  ? 94   GLU B CD  1 
ATOM   4883 O OE1 . GLU B 1 93  ? -30.121 4.036   -15.016 1.00 35.37  ? 94   GLU B OE1 1 
ATOM   4884 O OE2 . GLU B 1 93  ? -29.150 2.560   -16.320 1.00 30.78  ? 94   GLU B OE2 1 
ATOM   4885 N N   . ASP B 1 94  ? -29.935 -0.769  -10.813 1.00 30.91  ? 95   ASP B N   1 
ATOM   4886 C CA  . ASP B 1 94  ? -29.224 -1.572  -9.821  1.00 33.07  ? 95   ASP B CA  1 
ATOM   4887 C C   . ASP B 1 94  ? -29.988 -2.885  -9.665  1.00 31.06  ? 95   ASP B C   1 
ATOM   4888 O O   . ASP B 1 94  ? -30.817 -3.068  -8.769  1.00 31.66  ? 95   ASP B O   1 
ATOM   4889 C CB  . ASP B 1 94  ? -29.118 -0.807  -8.508  1.00 33.47  ? 95   ASP B CB  1 
ATOM   4890 C CG  . ASP B 1 94  ? -28.316 -1.546  -7.452  1.00 39.15  ? 95   ASP B CG  1 
ATOM   4891 O OD1 . ASP B 1 94  ? -28.130 -0.967  -6.356  1.00 37.02  ? 95   ASP B OD1 1 
ATOM   4892 O OD2 . ASP B 1 94  ? -27.874 -2.690  -7.705  1.00 36.58  ? 95   ASP B OD2 1 
ATOM   4893 N N   . CYS B 1 95  ? -29.692 -3.820  -10.558 1.00 26.64  ? 96   CYS B N   1 
ATOM   4894 C CA  . CYS B 1 95  ? -30.533 -4.998  -10.718 1.00 24.28  ? 96   CYS B CA  1 
ATOM   4895 C C   . CYS B 1 95  ? -29.755 -6.275  -10.977 1.00 26.56  ? 96   CYS B C   1 
ATOM   4896 O O   . CYS B 1 95  ? -30.380 -7.316  -11.199 1.00 27.94  ? 96   CYS B O   1 
ATOM   4897 C CB  . CYS B 1 95  ? -31.514 -4.793  -11.880 1.00 24.97  ? 96   CYS B CB  1 
ATOM   4898 S SG  . CYS B 1 95  ? -30.672 -4.658  -13.485 1.00 28.71  ? 96   CYS B SG  1 
ATOM   4899 N N   . LEU B 1 96  ? -28.424 -6.235  -10.992 1.00 25.72  ? 97   LEU B N   1 
ATOM   4900 C CA  . LEU B 1 96  ? -27.651 -7.420  -11.351 1.00 28.54  ? 97   LEU B CA  1 
ATOM   4901 C C   . LEU B 1 96  ? -27.411 -8.255  -10.098 1.00 31.56  ? 97   LEU B C   1 
ATOM   4902 O O   . LEU B 1 96  ? -26.370 -8.189  -9.437  1.00 27.08  ? 97   LEU B O   1 
ATOM   4903 C CB  . LEU B 1 96  ? -26.362 -7.040  -12.065 1.00 24.88  ? 97   LEU B CB  1 
ATOM   4904 C CG  . LEU B 1 96  ? -26.598 -6.325  -13.402 1.00 30.28  ? 97   LEU B CG  1 
ATOM   4905 C CD1 . LEU B 1 96  ? -25.289 -5.965  -14.115 1.00 28.92  ? 97   LEU B CD1 1 
ATOM   4906 C CD2 . LEU B 1 96  ? -27.506 -7.174  -14.299 1.00 23.11  ? 97   LEU B CD2 1 
ATOM   4907 N N   . TYR B 1 97  ? -28.421 -9.059  -9.773  1.00 25.62  ? 98   TYR B N   1 
ATOM   4908 C CA  . TYR B 1 97  ? -28.363 -10.001 -8.671  1.00 28.72  ? 98   TYR B CA  1 
ATOM   4909 C C   . TYR B 1 97  ? -28.749 -11.369 -9.207  1.00 26.54  ? 98   TYR B C   1 
ATOM   4910 O O   . TYR B 1 97  ? -29.397 -11.486 -10.250 1.00 29.56  ? 98   TYR B O   1 
ATOM   4911 C CB  . TYR B 1 97  ? -29.283 -9.564  -7.499  1.00 22.94  ? 98   TYR B CB  1 
ATOM   4912 C CG  . TYR B 1 97  ? -28.945 -8.177  -6.989  1.00 29.50  ? 98   TYR B CG  1 
ATOM   4913 C CD1 . TYR B 1 97  ? -29.369 -7.038  -7.677  1.00 28.43  ? 98   TYR B CD1 1 
ATOM   4914 C CD2 . TYR B 1 97  ? -28.178 -8.001  -5.841  1.00 28.35  ? 98   TYR B CD2 1 
ATOM   4915 C CE1 . TYR B 1 97  ? -29.040 -5.767  -7.233  1.00 29.09  ? 98   TYR B CE1 1 
ATOM   4916 C CE2 . TYR B 1 97  ? -27.847 -6.727  -5.383  1.00 26.78  ? 98   TYR B CE2 1 
ATOM   4917 C CZ  . TYR B 1 97  ? -28.278 -5.618  -6.084  1.00 32.97  ? 98   TYR B CZ  1 
ATOM   4918 O OH  . TYR B 1 97  ? -27.951 -4.357  -5.644  1.00 33.72  ? 98   TYR B OH  1 
ATOM   4919 N N   . LEU B 1 98  ? -28.309 -12.409 -8.508  1.00 29.17  ? 99   LEU B N   1 
ATOM   4920 C CA  . LEU B 1 98  ? -28.703 -13.773 -8.822  1.00 25.87  ? 99   LEU B CA  1 
ATOM   4921 C C   . LEU B 1 98  ? -29.229 -14.435 -7.555  1.00 29.95  ? 99   LEU B C   1 
ATOM   4922 O O   . LEU B 1 98  ? -29.118 -13.895 -6.449  1.00 25.68  ? 99   LEU B O   1 
ATOM   4923 C CB  . LEU B 1 98  ? -27.537 -14.575 -9.437  1.00 19.22  ? 99   LEU B CB  1 
ATOM   4924 C CG  . LEU B 1 98  ? -26.163 -14.567 -8.761  1.00 24.60  ? 99   LEU B CG  1 
ATOM   4925 C CD1 . LEU B 1 98  ? -26.120 -15.520 -7.558  1.00 20.43  ? 99   LEU B CD1 1 
ATOM   4926 C CD2 . LEU B 1 98  ? -25.080 -14.926 -9.767  1.00 22.17  ? 99   LEU B CD2 1 
ATOM   4927 N N   . ASN B 1 99  ? -29.810 -15.619 -7.723  1.00 27.65  ? 100  ASN B N   1 
ATOM   4928 C CA  . ASN B 1 99  ? -30.441 -16.337 -6.628  1.00 30.55  ? 100  ASN B CA  1 
ATOM   4929 C C   . ASN B 1 99  ? -30.014 -17.797 -6.653  1.00 32.25  ? 100  ASN B C   1 
ATOM   4930 O O   . ASN B 1 99  ? -29.825 -18.373 -7.727  1.00 28.11  ? 100  ASN B O   1 
ATOM   4931 C CB  . ASN B 1 99  ? -31.967 -16.226 -6.723  1.00 28.55  ? 100  ASN B CB  1 
ATOM   4932 C CG  . ASN B 1 99  ? -32.423 -14.856 -7.213  1.00 32.16  ? 100  ASN B CG  1 
ATOM   4933 O OD1 . ASN B 1 99  ? -32.399 -13.865 -6.472  1.00 32.81  ? 100  ASN B OD1 1 
ATOM   4934 N ND2 . ASN B 1 99  ? -32.815 -14.793 -8.479  1.00 30.03  ? 100  ASN B ND2 1 
ATOM   4935 N N   . VAL B 1 100 ? -29.868 -18.397 -5.471  1.00 27.96  ? 101  VAL B N   1 
ATOM   4936 C CA  . VAL B 1 100 ? -29.479 -19.797 -5.348  1.00 28.55  ? 101  VAL B CA  1 
ATOM   4937 C C   . VAL B 1 100 ? -30.488 -20.509 -4.461  1.00 30.40  ? 101  VAL B C   1 
ATOM   4938 O O   . VAL B 1 100 ? -30.757 -20.064 -3.340  1.00 29.26  ? 101  VAL B O   1 
ATOM   4939 C CB  . VAL B 1 100 ? -28.061 -19.961 -4.764  1.00 29.77  ? 101  VAL B CB  1 
ATOM   4940 C CG1 . VAL B 1 100 ? -27.695 -21.440 -4.678  1.00 29.03  ? 101  VAL B CG1 1 
ATOM   4941 C CG2 . VAL B 1 100 ? -27.041 -19.195 -5.582  1.00 25.87  ? 101  VAL B CG2 1 
ATOM   4942 N N   . TRP B 1 101 ? -31.042 -21.608 -4.960  1.00 29.73  ? 102  TRP B N   1 
ATOM   4943 C CA  . TRP B 1 101 ? -31.837 -22.531 -4.165  1.00 25.46  ? 102  TRP B CA  1 
ATOM   4944 C C   . TRP B 1 101 ? -31.061 -23.832 -4.001  1.00 32.63  ? 102  TRP B C   1 
ATOM   4945 O O   . TRP B 1 101 ? -30.499 -24.353 -4.971  1.00 31.21  ? 102  TRP B O   1 
ATOM   4946 C CB  . TRP B 1 101 ? -33.181 -22.843 -4.822  1.00 27.47  ? 102  TRP B CB  1 
ATOM   4947 C CG  . TRP B 1 101 ? -34.188 -21.746 -4.868  1.00 29.63  ? 102  TRP B CG  1 
ATOM   4948 C CD1 . TRP B 1 101 ? -35.205 -21.529 -3.975  1.00 32.38  ? 102  TRP B CD1 1 
ATOM   4949 C CD2 . TRP B 1 101 ? -34.327 -20.745 -5.887  1.00 20.94  ? 102  TRP B CD2 1 
ATOM   4950 N NE1 . TRP B 1 101 ? -35.954 -20.441 -4.368  1.00 30.04  ? 102  TRP B NE1 1 
ATOM   4951 C CE2 . TRP B 1 101 ? -35.439 -19.946 -5.539  1.00 25.20  ? 102  TRP B CE2 1 
ATOM   4952 C CE3 . TRP B 1 101 ? -33.619 -20.444 -7.057  1.00 25.94  ? 102  TRP B CE3 1 
ATOM   4953 C CZ2 . TRP B 1 101 ? -35.856 -18.864 -6.317  1.00 29.11  ? 102  TRP B CZ2 1 
ATOM   4954 C CZ3 . TRP B 1 101 ? -34.039 -19.366 -7.834  1.00 28.23  ? 102  TRP B CZ3 1 
ATOM   4955 C CH2 . TRP B 1 101 ? -35.147 -18.590 -7.456  1.00 29.87  ? 102  TRP B CH2 1 
ATOM   4956 N N   . THR B 1 102 ? -31.049 -24.360 -2.779  1.00 29.16  ? 103  THR B N   1 
ATOM   4957 C CA  . THR B 1 102 ? -30.345 -25.586 -2.432  1.00 34.77  ? 103  THR B CA  1 
ATOM   4958 C C   . THR B 1 102 ? -31.236 -26.427 -1.533  1.00 36.27  ? 103  THR B C   1 
ATOM   4959 O O   . THR B 1 102 ? -32.115 -25.883 -0.852  1.00 40.35  ? 103  THR B O   1 
ATOM   4960 C CB  . THR B 1 102 ? -29.025 -25.301 -1.694  1.00 37.26  ? 103  THR B CB  1 
ATOM   4961 O OG1 . THR B 1 102 ? -29.302 -24.720 -0.415  1.00 47.85  ? 103  THR B OG1 1 
ATOM   4962 C CG2 . THR B 1 102 ? -28.138 -24.366 -2.492  1.00 35.00  ? 103  THR B CG2 1 
ATOM   4963 N N   . PRO B 1 103 ? -31.049 -27.749 -1.514  1.00 30.87  ? 104  PRO B N   1 
ATOM   4964 C CA  . PRO B 1 103 ? -31.747 -28.561 -0.512  1.00 33.68  ? 104  PRO B CA  1 
ATOM   4965 C C   . PRO B 1 103 ? -31.406 -28.107 0.898   1.00 41.16  ? 104  PRO B C   1 
ATOM   4966 O O   . PRO B 1 103 ? -30.352 -27.516 1.153   1.00 46.80  ? 104  PRO B O   1 
ATOM   4967 C CB  . PRO B 1 103 ? -31.231 -29.981 -0.777  1.00 33.64  ? 104  PRO B CB  1 
ATOM   4968 C CG  . PRO B 1 103 ? -30.883 -29.994 -2.218  1.00 32.29  ? 104  PRO B CG  1 
ATOM   4969 C CD  . PRO B 1 103 ? -30.484 -28.584 -2.593  1.00 30.31  ? 104  PRO B CD  1 
ATOM   4970 N N   . TYR B 1 104 ? -32.323 -28.380 1.813   1.00 39.18  ? 105  TYR B N   1 
ATOM   4971 C CA  . TYR B 1 104 ? -32.097 -28.149 3.226   1.00 33.70  ? 105  TYR B CA  1 
ATOM   4972 C C   . TYR B 1 104 ? -32.034 -29.485 3.949   1.00 38.89  ? 105  TYR B C   1 
ATOM   4973 O O   . TYR B 1 104 ? -32.950 -30.303 3.797   1.00 43.28  ? 105  TYR B O   1 
ATOM   4974 C CB  . TYR B 1 104 ? -33.213 -27.278 3.818   1.00 32.29  ? 105  TYR B CB  1 
ATOM   4975 C CG  . TYR B 1 104 ? -32.994 -26.903 5.271   1.00 39.09  ? 105  TYR B CG  1 
ATOM   4976 C CD1 . TYR B 1 104 ? -33.125 -27.850 6.289   1.00 39.15  ? 105  TYR B CD1 1 
ATOM   4977 C CD2 . TYR B 1 104 ? -32.655 -25.603 5.626   1.00 41.84  ? 105  TYR B CD2 1 
ATOM   4978 C CE1 . TYR B 1 104 ? -32.918 -27.510 7.615   1.00 39.50  ? 105  TYR B CE1 1 
ATOM   4979 C CE2 . TYR B 1 104 ? -32.455 -25.252 6.949   1.00 45.44  ? 105  TYR B CE2 1 
ATOM   4980 C CZ  . TYR B 1 104 ? -32.587 -26.208 7.937   1.00 46.56  ? 105  TYR B CZ  1 
ATOM   4981 O OH  . TYR B 1 104 ? -32.384 -25.852 9.248   1.00 56.53  ? 105  TYR B OH  1 
ATOM   4982 N N   . PRO B 1 105 ? -30.975 -29.761 4.724   1.00 43.25  ? 106  PRO B N   1 
ATOM   4983 C CA  . PRO B 1 105 ? -29.785 -28.921 4.904   1.00 44.07  ? 106  PRO B CA  1 
ATOM   4984 C C   . PRO B 1 105 ? -28.921 -28.904 3.644   1.00 42.63  ? 106  PRO B C   1 
ATOM   4985 O O   . PRO B 1 105 ? -29.101 -29.766 2.782   1.00 38.28  ? 106  PRO B O   1 
ATOM   4986 C CB  . PRO B 1 105 ? -29.055 -29.598 6.069   1.00 39.21  ? 106  PRO B CB  1 
ATOM   4987 C CG  . PRO B 1 105 ? -29.456 -31.027 5.969   1.00 37.49  ? 106  PRO B CG  1 
ATOM   4988 C CD  . PRO B 1 105 ? -30.885 -31.015 5.493   1.00 40.40  ? 106  PRO B CD  1 
ATOM   4989 N N   . ARG B 1 106 ? -28.022 -27.931 3.540   1.00 45.79  ? 107  ARG B N   1 
ATOM   4990 C CA  . ARG B 1 106 ? -27.219 -27.793 2.335   1.00 48.08  ? 107  ARG B CA  1 
ATOM   4991 C C   . ARG B 1 106 ? -26.458 -29.089 2.063   1.00 41.43  ? 107  ARG B C   1 
ATOM   4992 O O   . ARG B 1 106 ? -25.972 -29.734 2.999   1.00 48.71  ? 107  ARG B O   1 
ATOM   4993 C CB  . ARG B 1 106 ? -26.244 -26.623 2.471   1.00 54.28  ? 107  ARG B CB  1 
ATOM   4994 C CG  . ARG B 1 106 ? -26.921 -25.280 2.701   1.00 58.27  ? 107  ARG B CG  1 
ATOM   4995 C CD  . ARG B 1 106 ? -26.094 -24.151 2.116   1.00 58.15  ? 107  ARG B CD  1 
ATOM   4996 N NE  . ARG B 1 106 ? -24.679 -24.279 2.462   1.00 53.85  ? 107  ARG B NE  1 
ATOM   4997 C CZ  . ARG B 1 106 ? -24.114 -23.706 3.519   1.00 56.06  ? 107  ARG B CZ  1 
ATOM   4998 N NH1 . ARG B 1 106 ? -24.841 -22.965 4.345   1.00 56.64  ? 107  ARG B NH1 1 
ATOM   4999 N NH2 . ARG B 1 106 ? -22.820 -23.873 3.754   1.00 58.73  ? 107  ARG B NH2 1 
ATOM   5000 N N   . PRO B 1 107 ? -26.349 -29.506 0.804   1.00 38.48  ? 108  PRO B N   1 
ATOM   5001 C CA  . PRO B 1 107 ? -25.670 -30.767 0.507   1.00 40.73  ? 108  PRO B CA  1 
ATOM   5002 C C   . PRO B 1 107 ? -24.213 -30.699 0.915   1.00 48.51  ? 108  PRO B C   1 
ATOM   5003 O O   . PRO B 1 107 ? -23.598 -29.630 0.944   1.00 48.22  ? 108  PRO B O   1 
ATOM   5004 C CB  . PRO B 1 107 ? -25.809 -30.906 -1.015  1.00 40.36  ? 108  PRO B CB  1 
ATOM   5005 C CG  . PRO B 1 107 ? -26.859 -29.934 -1.402  1.00 36.73  ? 108  PRO B CG  1 
ATOM   5006 C CD  . PRO B 1 107 ? -26.723 -28.800 -0.424  1.00 38.83  ? 108  PRO B CD  1 
ATOM   5007 N N   . THR B 1 108 ? -23.670 -31.865 1.242   1.00 51.17  ? 109  THR B N   1 
ATOM   5008 C CA  . THR B 1 108 ? -22.260 -31.997 1.564   1.00 54.58  ? 109  THR B CA  1 
ATOM   5009 C C   . THR B 1 108 ? -21.535 -32.883 0.560   1.00 57.02  ? 109  THR B C   1 
ATOM   5010 O O   . THR B 1 108 ? -20.367 -33.215 0.779   1.00 60.95  ? 109  THR B O   1 
ATOM   5011 C CB  . THR B 1 108 ? -22.099 -32.532 2.987   1.00 54.87  ? 109  THR B CB  1 
ATOM   5012 O OG1 . THR B 1 108 ? -22.888 -33.716 3.144   1.00 53.94  ? 109  THR B OG1 1 
ATOM   5013 C CG2 . THR B 1 108 ? -22.549 -31.481 4.002   1.00 49.05  ? 109  THR B CG2 1 
ATOM   5014 N N   . SER B 1 109 ? -22.210 -33.287 -0.526  1.00 50.28  ? 110  SER B N   1 
ATOM   5015 C CA  . SER B 1 109 ? -21.639 -33.852 -1.740  1.00 48.10  ? 110  SER B CA  1 
ATOM   5016 C C   . SER B 1 109 ? -21.952 -32.931 -2.911  1.00 48.97  ? 110  SER B C   1 
ATOM   5017 O O   . SER B 1 109 ? -23.036 -32.342 -2.952  1.00 45.73  ? 110  SER B O   1 
ATOM   5018 C CB  . SER B 1 109 ? -22.189 -35.259 -2.052  1.00 45.62  ? 110  SER B CB  1 
ATOM   5019 O OG  . SER B 1 109 ? -21.949 -36.166 -0.992  1.00 66.21  ? 110  SER B OG  1 
ATOM   5020 N N   . PRO B 1 110 ? -21.025 -32.768 -3.861  1.00 44.60  ? 111  PRO B N   1 
ATOM   5021 C CA  . PRO B 1 110 ? -21.307 -31.931 -5.037  1.00 43.73  ? 111  PRO B CA  1 
ATOM   5022 C C   . PRO B 1 110 ? -22.585 -32.345 -5.752  1.00 49.59  ? 111  PRO B C   1 
ATOM   5023 O O   . PRO B 1 110 ? -22.741 -33.501 -6.158  1.00 57.13  ? 111  PRO B O   1 
ATOM   5024 C CB  . PRO B 1 110 ? -20.072 -32.144 -5.922  1.00 36.43  ? 111  PRO B CB  1 
ATOM   5025 C CG  . PRO B 1 110 ? -18.977 -32.479 -4.951  1.00 42.64  ? 111  PRO B CG  1 
ATOM   5026 C CD  . PRO B 1 110 ? -19.634 -33.250 -3.837  1.00 41.11  ? 111  PRO B CD  1 
ATOM   5027 N N   . THR B 1 111 ? -23.506 -31.400 -5.899  1.00 41.62  ? 112  THR B N   1 
ATOM   5028 C CA  . THR B 1 111 ? -24.842 -31.543 -6.443  1.00 45.77  ? 112  THR B CA  1 
ATOM   5029 C C   . THR B 1 111 ? -24.940 -30.873 -7.815  1.00 43.34  ? 112  THR B C   1 
ATOM   5030 O O   . THR B 1 111 ? -24.440 -29.755 -7.984  1.00 34.66  ? 112  THR B O   1 
ATOM   5031 C CB  . THR B 1 111 ? -25.852 -30.904 -5.481  1.00 44.84  ? 112  THR B CB  1 
ATOM   5032 O OG1 . THR B 1 111 ? -25.760 -31.540 -4.202  1.00 51.88  ? 112  THR B OG1 1 
ATOM   5033 C CG2 . THR B 1 111 ? -27.256 -31.037 -5.999  1.00 41.53  ? 112  THR B CG2 1 
ATOM   5034 N N   . PRO B 1 112 ? -25.561 -31.523 -8.809  1.00 45.09  ? 113  PRO B N   1 
ATOM   5035 C CA  . PRO B 1 112 ? -25.688 -30.900 -10.136 1.00 42.29  ? 113  PRO B CA  1 
ATOM   5036 C C   . PRO B 1 112 ? -26.448 -29.583 -10.070 1.00 34.69  ? 113  PRO B C   1 
ATOM   5037 O O   . PRO B 1 112 ? -27.361 -29.401 -9.258  1.00 39.80  ? 113  PRO B O   1 
ATOM   5038 C CB  . PRO B 1 112 ? -26.458 -31.945 -10.952 1.00 40.40  ? 113  PRO B CB  1 
ATOM   5039 C CG  . PRO B 1 112 ? -27.132 -32.808 -9.931  1.00 46.85  ? 113  PRO B CG  1 
ATOM   5040 C CD  . PRO B 1 112 ? -26.181 -32.856 -8.772  1.00 45.94  ? 113  PRO B CD  1 
ATOM   5041 N N   . VAL B 1 113 ? -26.057 -28.656 -10.941 1.00 27.01  ? 114  VAL B N   1 
ATOM   5042 C CA  . VAL B 1 113 ? -26.539 -27.280 -10.908 1.00 24.78  ? 114  VAL B CA  1 
ATOM   5043 C C   . VAL B 1 113 ? -27.339 -27.007 -12.175 1.00 30.09  ? 114  VAL B C   1 
ATOM   5044 O O   . VAL B 1 113 ? -26.911 -27.368 -13.277 1.00 25.59  ? 114  VAL B O   1 
ATOM   5045 C CB  . VAL B 1 113 ? -25.375 -26.280 -10.773 1.00 24.04  ? 114  VAL B CB  1 
ATOM   5046 C CG1 . VAL B 1 113 ? -25.890 -24.845 -10.847 1.00 24.28  ? 114  VAL B CG1 1 
ATOM   5047 C CG2 . VAL B 1 113 ? -24.617 -26.524 -9.480  1.00 25.13  ? 114  VAL B CG2 1 
ATOM   5048 N N   . LEU B 1 114 ? -28.503 -26.386 -12.007 1.00 26.90  ? 115  LEU B N   1 
ATOM   5049 C CA  . LEU B 1 114 ? -29.318 -25.876 -13.098 1.00 22.58  ? 115  LEU B CA  1 
ATOM   5050 C C   . LEU B 1 114 ? -29.298 -24.355 -13.037 1.00 28.91  ? 115  LEU B C   1 
ATOM   5051 O O   . LEU B 1 114 ? -29.481 -23.773 -11.962 1.00 30.18  ? 115  LEU B O   1 
ATOM   5052 C CB  . LEU B 1 114 ? -30.752 -26.404 -12.996 1.00 26.11  ? 115  LEU B CB  1 
ATOM   5053 C CG  . LEU B 1 114 ? -31.021 -27.807 -13.556 1.00 36.13  ? 115  LEU B CG  1 
ATOM   5054 C CD1 . LEU B 1 114 ? -32.192 -28.455 -12.837 1.00 35.57  ? 115  LEU B CD1 1 
ATOM   5055 C CD2 . LEU B 1 114 ? -31.282 -27.754 -15.071 1.00 33.90  ? 115  LEU B CD2 1 
ATOM   5056 N N   . VAL B 1 115 ? -29.039 -23.712 -14.172 1.00 25.72  ? 116  VAL B N   1 
ATOM   5057 C CA  . VAL B 1 115 ? -29.001 -22.254 -14.245 1.00 29.25  ? 116  VAL B CA  1 
ATOM   5058 C C   . VAL B 1 115 ? -30.067 -21.811 -15.232 1.00 27.84  ? 116  VAL B C   1 
ATOM   5059 O O   . VAL B 1 115 ? -30.038 -22.207 -16.403 1.00 31.33  ? 116  VAL B O   1 
ATOM   5060 C CB  . VAL B 1 115 ? -27.616 -21.719 -14.645 1.00 23.04  ? 116  VAL B CB  1 
ATOM   5061 C CG1 . VAL B 1 115 ? -27.658 -20.193 -14.767 1.00 17.03  ? 116  VAL B CG1 1 
ATOM   5062 C CG2 . VAL B 1 115 ? -26.571 -22.134 -13.620 1.00 27.52  ? 116  VAL B CG2 1 
ATOM   5063 N N   . TRP B 1 116 ? -31.004 -21.002 -14.753 1.00 26.67  ? 117  TRP B N   1 
ATOM   5064 C CA  . TRP B 1 116 ? -32.152 -20.554 -15.522 1.00 22.80  ? 117  TRP B CA  1 
ATOM   5065 C C   . TRP B 1 116 ? -31.876 -19.173 -16.105 1.00 31.13  ? 117  TRP B C   1 
ATOM   5066 O O   . TRP B 1 116 ? -31.421 -18.272 -15.391 1.00 26.50  ? 117  TRP B O   1 
ATOM   5067 C CB  . TRP B 1 116 ? -33.402 -20.509 -14.640 1.00 20.42  ? 117  TRP B CB  1 
ATOM   5068 C CG  . TRP B 1 116 ? -34.588 -19.915 -15.328 1.00 21.42  ? 117  TRP B CG  1 
ATOM   5069 C CD1 . TRP B 1 116 ? -35.164 -18.705 -15.077 1.00 24.15  ? 117  TRP B CD1 1 
ATOM   5070 C CD2 . TRP B 1 116 ? -35.343 -20.508 -16.390 1.00 23.73  ? 117  TRP B CD2 1 
ATOM   5071 N NE1 . TRP B 1 116 ? -36.241 -18.510 -15.914 1.00 28.83  ? 117  TRP B NE1 1 
ATOM   5072 C CE2 . TRP B 1 116 ? -36.369 -19.602 -16.731 1.00 25.89  ? 117  TRP B CE2 1 
ATOM   5073 C CE3 . TRP B 1 116 ? -35.253 -21.718 -17.085 1.00 23.97  ? 117  TRP B CE3 1 
ATOM   5074 C CZ2 . TRP B 1 116 ? -37.296 -19.868 -17.737 1.00 28.63  ? 117  TRP B CZ2 1 
ATOM   5075 C CZ3 . TRP B 1 116 ? -36.178 -21.980 -18.089 1.00 29.18  ? 117  TRP B CZ3 1 
ATOM   5076 C CH2 . TRP B 1 116 ? -37.181 -21.059 -18.403 1.00 27.01  ? 117  TRP B CH2 1 
ATOM   5077 N N   . ILE B 1 117 ? -32.151 -19.011 -17.397 1.00 29.81  ? 118  ILE B N   1 
ATOM   5078 C CA  . ILE B 1 117 ? -32.080 -17.716 -18.065 1.00 25.10  ? 118  ILE B CA  1 
ATOM   5079 C C   . ILE B 1 117 ? -33.471 -17.400 -18.589 1.00 23.03  ? 118  ILE B C   1 
ATOM   5080 O O   . ILE B 1 117 ? -33.975 -18.097 -19.478 1.00 31.04  ? 118  ILE B O   1 
ATOM   5081 C CB  . ILE B 1 117 ? -31.053 -17.715 -19.206 1.00 22.08  ? 118  ILE B CB  1 
ATOM   5082 C CG1 . ILE B 1 117 ? -29.678 -18.160 -18.706 1.00 25.52  ? 118  ILE B CG1 1 
ATOM   5083 C CG2 . ILE B 1 117 ? -30.974 -16.336 -19.843 1.00 23.54  ? 118  ILE B CG2 1 
ATOM   5084 C CD1 . ILE B 1 117 ? -28.623 -18.230 -19.822 1.00 24.37  ? 118  ILE B CD1 1 
ATOM   5085 N N   . TYR B 1 118 ? -34.095 -16.359 -18.048 1.00 22.25  ? 119  TYR B N   1 
ATOM   5086 C CA  . TYR B 1 118 ? -35.476 -16.080 -18.423 1.00 21.89  ? 119  TYR B CA  1 
ATOM   5087 C C   . TYR B 1 118 ? -35.556 -15.462 -19.817 1.00 26.01  ? 119  TYR B C   1 
ATOM   5088 O O   . TYR B 1 118 ? -34.599 -14.863 -20.318 1.00 23.21  ? 119  TYR B O   1 
ATOM   5089 C CB  . TYR B 1 118 ? -36.140 -15.150 -17.408 1.00 22.16  ? 119  TYR B CB  1 
ATOM   5090 C CG  . TYR B 1 118 ? -35.397 -13.847 -17.153 1.00 29.10  ? 119  TYR B CG  1 
ATOM   5091 C CD1 . TYR B 1 118 ? -34.711 -13.635 -15.957 1.00 24.00  ? 119  TYR B CD1 1 
ATOM   5092 C CD2 . TYR B 1 118 ? -35.410 -12.818 -18.091 1.00 27.33  ? 119  TYR B CD2 1 
ATOM   5093 C CE1 . TYR B 1 118 ? -34.034 -12.438 -15.712 1.00 24.01  ? 119  TYR B CE1 1 
ATOM   5094 C CE2 . TYR B 1 118 ? -34.734 -11.629 -17.863 1.00 27.68  ? 119  TYR B CE2 1 
ATOM   5095 C CZ  . TYR B 1 118 ? -34.047 -11.441 -16.677 1.00 30.72  ? 119  TYR B CZ  1 
ATOM   5096 O OH  . TYR B 1 118 ? -33.386 -10.246 -16.474 1.00 27.13  ? 119  TYR B OH  1 
ATOM   5097 N N   . GLY B 1 119 ? -36.726 -15.587 -20.392 1.00 22.85  ? 120  GLY B N   1 
ATOM   5098 C CA  . GLY B 1 119 ? -37.109 -15.003 -21.654 1.00 23.53  ? 120  GLY B CA  1 
ATOM   5099 C C   . GLY B 1 119 ? -37.753 -13.641 -21.540 1.00 29.59  ? 120  GLY B C   1 
ATOM   5100 O O   . GLY B 1 119 ? -37.837 -13.097 -20.492 1.00 35.48  ? 120  GLY B O   1 
ATOM   5101 N N   . GLY B 1 120 ? -38.236 -13.116 -22.649 1.00 35.16  ? 121  GLY B N   1 
ATOM   5102 C CA  . GLY B 1 120 ? -38.868 -11.814 -22.748 1.00 29.08  ? 121  GLY B CA  1 
ATOM   5103 C C   . GLY B 1 120 ? -38.387 -10.847 -23.807 1.00 30.58  ? 121  GLY B C   1 
ATOM   5104 O O   . GLY B 1 120 ? -38.347 -9.674  -23.611 1.00 29.14  ? 121  GLY B O   1 
ATOM   5105 N N   . GLY B 1 121 ? -38.029 -11.410 -24.943 1.00 32.24  ? 122  GLY B N   1 
ATOM   5106 C CA  . GLY B 1 121 ? -37.640 -10.726 -26.143 1.00 27.35  ? 122  GLY B CA  1 
ATOM   5107 C C   . GLY B 1 121 ? -36.472 -9.839  -25.998 1.00 31.34  ? 122  GLY B C   1 
ATOM   5108 O O   . GLY B 1 121 ? -36.273 -8.966  -26.794 1.00 24.53  ? 122  GLY B O   1 
ATOM   5109 N N   . PHE B 1 122 ? -35.670 -10.142 -25.002 1.00 22.23  ? 123  PHE B N   1 
ATOM   5110 C CA  . PHE B 1 122 ? -34.518 -9.306  -24.670 1.00 21.81  ? 123  PHE B CA  1 
ATOM   5111 C C   . PHE B 1 122 ? -34.912 -7.890  -24.265 1.00 26.57  ? 123  PHE B C   1 
ATOM   5112 O O   . PHE B 1 122 ? -34.034 -7.037  -24.094 1.00 27.22  ? 123  PHE B O   1 
ATOM   5113 C CB  . PHE B 1 122 ? -33.498 -9.242  -25.821 1.00 23.10  ? 123  PHE B CB  1 
ATOM   5114 C CG  . PHE B 1 122 ? -32.803 -10.547 -26.102 1.00 23.03  ? 123  PHE B CG  1 
ATOM   5115 C CD1 . PHE B 1 122 ? -31.898 -11.078 -25.193 1.00 19.15  ? 123  PHE B CD1 1 
ATOM   5116 C CD2 . PHE B 1 122 ? -33.039 -11.233 -27.291 1.00 22.11  ? 123  PHE B CD2 1 
ATOM   5117 C CE1 . PHE B 1 122 ? -31.246 -12.281 -25.457 1.00 23.40  ? 123  PHE B CE1 1 
ATOM   5118 C CE2 . PHE B 1 122 ? -32.390 -12.437 -27.564 1.00 21.98  ? 123  PHE B CE2 1 
ATOM   5119 C CZ  . PHE B 1 122 ? -31.491 -12.959 -26.648 1.00 22.27  ? 123  PHE B CZ  1 
ATOM   5120 N N   . TYR B 1 123 ? -36.205 -7.608  -24.105 1.00 21.64  ? 124  TYR B N   1 
ATOM   5121 C CA  . TYR B 1 123 ? -36.642 -6.306  -23.623 1.00 30.57  ? 124  TYR B CA  1 
ATOM   5122 C C   . TYR B 1 123 ? -37.306 -6.359  -22.255 1.00 31.38  ? 124  TYR B C   1 
ATOM   5123 O O   . TYR B 1 123 ? -37.630 -5.299  -21.708 1.00 31.99  ? 124  TYR B O   1 
ATOM   5124 C CB  . TYR B 1 123 ? -37.608 -5.651  -24.628 1.00 22.81  ? 124  TYR B CB  1 
ATOM   5125 C CG  . TYR B 1 123 ? -38.975 -6.307  -24.702 1.00 35.50  ? 124  TYR B CG  1 
ATOM   5126 C CD1 . TYR B 1 123 ? -40.000 -5.934  -23.836 1.00 37.41  ? 124  TYR B CD1 1 
ATOM   5127 C CD2 . TYR B 1 123 ? -39.246 -7.292  -25.647 1.00 38.74  ? 124  TYR B CD2 1 
ATOM   5128 C CE1 . TYR B 1 123 ? -41.250 -6.533  -23.899 1.00 38.10  ? 124  TYR B CE1 1 
ATOM   5129 C CE2 . TYR B 1 123 ? -40.497 -7.894  -25.719 1.00 43.11  ? 124  TYR B CE2 1 
ATOM   5130 C CZ  . TYR B 1 123 ? -41.491 -7.510  -24.840 1.00 50.75  ? 124  TYR B CZ  1 
ATOM   5131 O OH  . TYR B 1 123 ? -42.732 -8.102  -24.900 1.00 64.80  ? 124  TYR B OH  1 
ATOM   5132 N N   . SER B 1 124 ? -37.521 -7.544  -21.689 1.00 31.06  ? 125  SER B N   1 
ATOM   5133 C CA  . SER B 1 124 ? -38.270 -7.672  -20.444 1.00 29.85  ? 125  SER B CA  1 
ATOM   5134 C C   . SER B 1 124 ? -37.883 -8.976  -19.759 1.00 29.67  ? 125  SER B C   1 
ATOM   5135 O O   . SER B 1 124 ? -37.119 -9.784  -20.298 1.00 24.94  ? 125  SER B O   1 
ATOM   5136 C CB  . SER B 1 124 ? -39.777 -7.627  -20.703 1.00 30.09  ? 125  SER B CB  1 
ATOM   5137 O OG  . SER B 1 124 ? -40.187 -8.787  -21.412 1.00 27.11  ? 125  SER B OG  1 
ATOM   5138 N N   . GLY B 1 125 ? -38.447 -9.187  -18.570 1.00 29.83  ? 126  GLY B N   1 
ATOM   5139 C CA  . GLY B 1 125 ? -38.187 -10.392 -17.810 1.00 19.03  ? 126  GLY B CA  1 
ATOM   5140 C C   . GLY B 1 125 ? -37.519 -10.144 -16.467 1.00 25.94  ? 126  GLY B C   1 
ATOM   5141 O O   . GLY B 1 125 ? -36.956 -9.071  -16.238 1.00 25.24  ? 126  GLY B O   1 
ATOM   5142 N N   . ALA B 1 126 ? -37.578 -11.132 -15.575 1.00 21.41  ? 127  ALA B N   1 
ATOM   5143 C CA  . ALA B 1 126 ? -37.001 -11.045 -14.240 1.00 27.39  ? 127  ALA B CA  1 
ATOM   5144 C C   . ALA B 1 126 ? -36.893 -12.449 -13.667 1.00 28.64  ? 127  ALA B C   1 
ATOM   5145 O O   . ALA B 1 126 ? -37.713 -13.321 -13.971 1.00 26.24  ? 127  ALA B O   1 
ATOM   5146 C CB  . ALA B 1 126 ? -37.841 -10.169 -13.303 1.00 19.63  ? 127  ALA B CB  1 
ATOM   5147 N N   . SER B 1 127 ? -35.874 -12.659 -12.835 1.00 22.25  ? 128  SER B N   1 
ATOM   5148 C CA  . SER B 1 127 ? -35.701 -13.961 -12.204 1.00 28.57  ? 128  SER B CA  1 
ATOM   5149 C C   . SER B 1 127 ? -36.608 -14.149 -10.992 1.00 31.11  ? 128  SER B C   1 
ATOM   5150 O O   . SER B 1 127 ? -36.648 -15.248 -10.427 1.00 27.89  ? 128  SER B O   1 
ATOM   5151 C CB  . SER B 1 127 ? -34.241 -14.151 -11.793 1.00 31.61  ? 128  SER B CB  1 
ATOM   5152 O OG  . SER B 1 127 ? -33.878 -13.220 -10.788 1.00 35.81  ? 128  SER B OG  1 
ATOM   5153 N N   . SER B 1 128 ? -37.344 -13.115 -10.598 1.00 25.25  ? 129  SER B N   1 
ATOM   5154 C CA  . SER B 1 128 ? -38.188 -13.132 -9.412  1.00 31.58  ? 129  SER B CA  1 
ATOM   5155 C C   . SER B 1 128 ? -39.638 -13.488 -9.704  1.00 32.50  ? 129  SER B C   1 
ATOM   5156 O O   . SER B 1 128 ? -40.440 -13.548 -8.765  1.00 29.48  ? 129  SER B O   1 
ATOM   5157 C CB  . SER B 1 128 ? -38.135 -11.766 -8.725  1.00 29.79  ? 129  SER B CB  1 
ATOM   5158 O OG  . SER B 1 128 ? -38.477 -10.738 -9.643  1.00 30.68  ? 129  SER B OG  1 
ATOM   5159 N N   . LEU B 1 129 ? -40.002 -13.696 -10.968 1.00 30.40  ? 130  LEU B N   1 
ATOM   5160 C CA  . LEU B 1 129 ? -41.370 -14.077 -11.300 1.00 34.08  ? 130  LEU B CA  1 
ATOM   5161 C C   . LEU B 1 129 ? -41.750 -15.379 -10.602 1.00 33.97  ? 130  LEU B C   1 
ATOM   5162 O O   . LEU B 1 129 ? -40.931 -16.290 -10.444 1.00 34.04  ? 130  LEU B O   1 
ATOM   5163 C CB  . LEU B 1 129 ? -41.527 -14.244 -12.813 1.00 30.71  ? 130  LEU B CB  1 
ATOM   5164 C CG  . LEU B 1 129 ? -41.201 -13.050 -13.719 1.00 37.72  ? 130  LEU B CG  1 
ATOM   5165 C CD1 . LEU B 1 129 ? -41.810 -13.230 -15.098 1.00 30.32  ? 130  LEU B CD1 1 
ATOM   5166 C CD2 . LEU B 1 129 ? -41.657 -11.725 -13.108 1.00 30.84  ? 130  LEU B CD2 1 
ATOM   5167 N N   . ASP B 1 130 ? -43.023 -15.460 -10.207 1.00 31.08  ? 131  ASP B N   1 
ATOM   5168 C CA  . ASP B 1 130 ? -43.528 -16.623 -9.483  1.00 28.18  ? 131  ASP B CA  1 
ATOM   5169 C C   . ASP B 1 130 ? -43.309 -17.922 -10.254 1.00 33.29  ? 131  ASP B C   1 
ATOM   5170 O O   . ASP B 1 130 ? -43.027 -18.963 -9.650  1.00 35.62  ? 131  ASP B O   1 
ATOM   5171 C CB  . ASP B 1 130 ? -45.016 -16.435 -9.173  1.00 32.30  ? 131  ASP B CB  1 
ATOM   5172 C CG  . ASP B 1 130 ? -45.263 -15.379 -8.100  1.00 45.13  ? 131  ASP B CG  1 
ATOM   5173 O OD1 . ASP B 1 130 ? -46.436 -15.017 -7.862  1.00 51.32  ? 131  ASP B OD1 1 
ATOM   5174 O OD2 . ASP B 1 130 ? -44.281 -14.901 -7.499  1.00 48.91  ? 131  ASP B OD2 1 
ATOM   5175 N N   . VAL B 1 131 ? -43.437 -17.892 -11.585 1.00 28.48  ? 132  VAL B N   1 
ATOM   5176 C CA  . VAL B 1 131 ? -43.305 -19.130 -12.346 1.00 33.41  ? 132  VAL B CA  1 
ATOM   5177 C C   . VAL B 1 131 ? -41.872 -19.618 -12.439 1.00 24.22  ? 132  VAL B C   1 
ATOM   5178 O O   . VAL B 1 131 ? -41.646 -20.721 -12.947 1.00 30.77  ? 132  VAL B O   1 
ATOM   5179 C CB  . VAL B 1 131 ? -43.864 -19.019 -13.782 1.00 39.11  ? 132  VAL B CB  1 
ATOM   5180 C CG1 . VAL B 1 131 ? -45.377 -18.994 -13.759 1.00 47.10  ? 132  VAL B CG1 1 
ATOM   5181 C CG2 . VAL B 1 131 ? -43.298 -17.809 -14.498 1.00 31.28  ? 132  VAL B CG2 1 
ATOM   5182 N N   . TYR B 1 132 ? -40.896 -18.835 -11.973 1.00 23.97  ? 133  TYR B N   1 
ATOM   5183 C CA  . TYR B 1 132 ? -39.502 -19.263 -11.959 1.00 24.95  ? 133  TYR B CA  1 
ATOM   5184 C C   . TYR B 1 132 ? -39.020 -19.624 -10.557 1.00 29.30  ? 133  TYR B C   1 
ATOM   5185 O O   . TYR B 1 132 ? -37.806 -19.688 -10.327 1.00 34.54  ? 133  TYR B O   1 
ATOM   5186 C CB  . TYR B 1 132 ? -38.588 -18.184 -12.545 1.00 20.27  ? 133  TYR B CB  1 
ATOM   5187 C CG  . TYR B 1 132 ? -38.974 -17.701 -13.919 1.00 28.12  ? 133  TYR B CG  1 
ATOM   5188 C CD1 . TYR B 1 132 ? -38.707 -16.393 -14.306 1.00 25.82  ? 133  TYR B CD1 1 
ATOM   5189 C CD2 . TYR B 1 132 ? -39.597 -18.544 -14.831 1.00 31.48  ? 133  TYR B CD2 1 
ATOM   5190 C CE1 . TYR B 1 132 ? -39.053 -15.932 -15.552 1.00 27.37  ? 133  TYR B CE1 1 
ATOM   5191 C CE2 . TYR B 1 132 ? -39.947 -18.092 -16.090 1.00 31.03  ? 133  TYR B CE2 1 
ATOM   5192 C CZ  . TYR B 1 132 ? -39.668 -16.777 -16.444 1.00 30.05  ? 133  TYR B CZ  1 
ATOM   5193 O OH  . TYR B 1 132 ? -40.005 -16.277 -17.683 1.00 23.76  ? 133  TYR B OH  1 
ATOM   5194 N N   . ASP B 1 133 ? -39.942 -19.840 -9.618  1.00 31.04  ? 134  ASP B N   1 
ATOM   5195 C CA  . ASP B 1 133 ? -39.580 -20.212 -8.251  1.00 31.92  ? 134  ASP B CA  1 
ATOM   5196 C C   . ASP B 1 133 ? -38.903 -21.578 -8.250  1.00 29.64  ? 134  ASP B C   1 
ATOM   5197 O O   . ASP B 1 133 ? -39.532 -22.591 -8.577  1.00 27.90  ? 134  ASP B O   1 
ATOM   5198 C CB  . ASP B 1 133 ? -40.829 -20.230 -7.369  1.00 35.11  ? 134  ASP B CB  1 
ATOM   5199 C CG  . ASP B 1 133 ? -40.515 -20.393 -5.876  1.00 42.34  ? 134  ASP B CG  1 
ATOM   5200 O OD1 . ASP B 1 133 ? -39.365 -20.720 -5.497  1.00 37.99  ? 134  ASP B OD1 1 
ATOM   5201 O OD2 . ASP B 1 133 ? -41.451 -20.193 -5.074  1.00 47.45  ? 134  ASP B OD2 1 
ATOM   5202 N N   . GLY B 1 134 ? -37.630 -21.610 -7.866  1.00 23.86  ? 135  GLY B N   1 
ATOM   5203 C CA  . GLY B 1 134 ? -36.863 -22.835 -7.906  1.00 23.61  ? 135  GLY B CA  1 
ATOM   5204 C C   . GLY B 1 134 ? -37.084 -23.815 -6.773  1.00 30.83  ? 135  GLY B C   1 
ATOM   5205 O O   . GLY B 1 134 ? -36.447 -24.874 -6.768  1.00 28.62  ? 135  GLY B O   1 
ATOM   5206 N N   . ARG B 1 135 ? -37.982 -23.520 -5.826  1.00 28.47  ? 136  ARG B N   1 
ATOM   5207 C CA  . ARG B 1 135 ? -38.040 -24.319 -4.603  1.00 34.24  ? 136  ARG B CA  1 
ATOM   5208 C C   . ARG B 1 135 ? -38.516 -25.747 -4.856  1.00 35.34  ? 136  ARG B C   1 
ATOM   5209 O O   . ARG B 1 135 ? -38.088 -26.668 -4.149  1.00 31.56  ? 136  ARG B O   1 
ATOM   5210 C CB  . ARG B 1 135 ? -38.933 -23.632 -3.561  1.00 33.67  ? 136  ARG B CB  1 
ATOM   5211 C CG  . ARG B 1 135 ? -40.423 -23.800 -3.780  1.00 30.81  ? 136  ARG B CG  1 
ATOM   5212 C CD  . ARG B 1 135 ? -41.207 -23.077 -2.700  1.00 34.12  ? 136  ARG B CD  1 
ATOM   5213 N NE  . ARG B 1 135 ? -41.074 -21.629 -2.814  1.00 31.20  ? 136  ARG B NE  1 
ATOM   5214 C CZ  . ARG B 1 135 ? -41.401 -20.765 -1.859  1.00 39.10  ? 136  ARG B CZ  1 
ATOM   5215 N NH1 . ARG B 1 135 ? -41.879 -21.197 -0.694  1.00 40.06  ? 136  ARG B NH1 1 
ATOM   5216 N NH2 . ARG B 1 135 ? -41.241 -19.463 -2.062  1.00 36.07  ? 136  ARG B NH2 1 
ATOM   5217 N N   . PHE B 1 136 ? -39.383 -25.963 -5.853  1.00 26.87  ? 137  PHE B N   1 
ATOM   5218 C CA  . PHE B 1 136 ? -39.943 -27.299 -6.055  1.00 32.05  ? 137  PHE B CA  1 
ATOM   5219 C C   . PHE B 1 136 ? -38.990 -28.208 -6.822  1.00 33.34  ? 137  PHE B C   1 
ATOM   5220 O O   . PHE B 1 136 ? -38.845 -29.386 -6.474  1.00 34.88  ? 137  PHE B O   1 
ATOM   5221 C CB  . PHE B 1 136 ? -41.297 -27.215 -6.770  1.00 31.71  ? 137  PHE B CB  1 
ATOM   5222 C CG  . PHE B 1 136 ? -42.266 -26.265 -6.121  1.00 36.87  ? 137  PHE B CG  1 
ATOM   5223 C CD1 . PHE B 1 136 ? -42.919 -26.611 -4.946  1.00 33.73  ? 137  PHE B CD1 1 
ATOM   5224 C CD2 . PHE B 1 136 ? -42.532 -25.030 -6.692  1.00 35.60  ? 137  PHE B CD2 1 
ATOM   5225 C CE1 . PHE B 1 136 ? -43.809 -25.740 -4.342  1.00 34.33  ? 137  PHE B CE1 1 
ATOM   5226 C CE2 . PHE B 1 136 ? -43.423 -24.153 -6.091  1.00 32.99  ? 137  PHE B CE2 1 
ATOM   5227 C CZ  . PHE B 1 136 ? -44.064 -24.514 -4.914  1.00 30.23  ? 137  PHE B CZ  1 
ATOM   5228 N N   . LEU B 1 137 ? -38.339 -27.685 -7.863  1.00 28.36  ? 138  LEU B N   1 
ATOM   5229 C CA  . LEU B 1 137 ? -37.303 -28.445 -8.554  1.00 34.02  ? 138  LEU B CA  1 
ATOM   5230 C C   . LEU B 1 137 ? -36.233 -28.906 -7.575  1.00 31.52  ? 138  LEU B C   1 
ATOM   5231 O O   . LEU B 1 137 ? -35.808 -30.067 -7.587  1.00 31.14  ? 138  LEU B O   1 
ATOM   5232 C CB  . LEU B 1 137 ? -36.673 -27.587 -9.654  1.00 27.77  ? 138  LEU B CB  1 
ATOM   5233 C CG  . LEU B 1 137 ? -37.090 -27.882 -11.083 1.00 34.87  ? 138  LEU B CG  1 
ATOM   5234 C CD1 . LEU B 1 137 ? -36.502 -26.836 -12.032 1.00 35.28  ? 138  LEU B CD1 1 
ATOM   5235 C CD2 . LEU B 1 137 ? -36.640 -29.285 -11.446 1.00 33.80  ? 138  LEU B CD2 1 
ATOM   5236 N N   . VAL B 1 138 ? -35.797 -28.000 -6.705  1.00 28.08  ? 139  VAL B N   1 
ATOM   5237 C CA  . VAL B 1 138 ? -34.675 -28.297 -5.827  1.00 30.76  ? 139  VAL B CA  1 
ATOM   5238 C C   . VAL B 1 138 ? -35.058 -29.352 -4.796  1.00 34.56  ? 139  VAL B C   1 
ATOM   5239 O O   . VAL B 1 138 ? -34.296 -30.291 -4.536  1.00 34.61  ? 139  VAL B O   1 
ATOM   5240 C CB  . VAL B 1 138 ? -34.184 -26.992 -5.183  1.00 33.05  ? 139  VAL B CB  1 
ATOM   5241 C CG1 . VAL B 1 138 ? -33.372 -27.275 -3.950  1.00 27.79  ? 139  VAL B CG1 1 
ATOM   5242 C CG2 . VAL B 1 138 ? -33.387 -26.207 -6.201  1.00 22.37  ? 139  VAL B CG2 1 
ATOM   5243 N N   . GLN B 1 139 ? -36.251 -29.236 -4.212  1.00 31.87  ? 140  GLN B N   1 
ATOM   5244 C CA  . GLN B 1 139 ? -36.689 -30.240 -3.249  1.00 36.60  ? 140  GLN B CA  1 
ATOM   5245 C C   . GLN B 1 139 ? -36.915 -31.590 -3.924  1.00 38.15  ? 140  GLN B C   1 
ATOM   5246 O O   . GLN B 1 139 ? -36.469 -32.629 -3.422  1.00 35.56  ? 140  GLN B O   1 
ATOM   5247 C CB  . GLN B 1 139 ? -37.963 -29.772 -2.543  1.00 32.32  ? 140  GLN B CB  1 
ATOM   5248 C CG  . GLN B 1 139 ? -38.312 -30.584 -1.302  1.00 31.15  ? 140  GLN B CG  1 
ATOM   5249 C CD  . GLN B 1 139 ? -38.933 -31.930 -1.632  1.00 35.87  ? 140  GLN B CD  1 
ATOM   5250 O OE1 . GLN B 1 139 ? -39.710 -32.051 -2.577  1.00 34.77  ? 140  GLN B OE1 1 
ATOM   5251 N NE2 . GLN B 1 139 ? -38.591 -32.950 -0.849  1.00 36.22  ? 140  GLN B NE2 1 
ATOM   5252 N N   . ALA B 1 140 ? -37.622 -31.596 -5.056  1.00 37.18  ? 141  ALA B N   1 
ATOM   5253 C CA  . ALA B 1 140 ? -38.022 -32.858 -5.671  1.00 41.49  ? 141  ALA B CA  1 
ATOM   5254 C C   . ALA B 1 140 ? -36.832 -33.600 -6.265  1.00 35.41  ? 141  ALA B C   1 
ATOM   5255 O O   . ALA B 1 140 ? -36.752 -34.829 -6.171  1.00 31.93  ? 141  ALA B O   1 
ATOM   5256 C CB  . ALA B 1 140 ? -39.076 -32.612 -6.750  1.00 39.92  ? 141  ALA B CB  1 
ATOM   5257 N N   . GLU B 1 141 ? -35.900 -32.883 -6.882  1.00 28.14  ? 142  GLU B N   1 
ATOM   5258 C CA  . GLU B 1 141 ? -34.859 -33.536 -7.656  1.00 32.17  ? 142  GLU B CA  1 
ATOM   5259 C C   . GLU B 1 141 ? -33.459 -33.341 -7.096  1.00 33.85  ? 142  GLU B C   1 
ATOM   5260 O O   . GLU B 1 141 ? -32.496 -33.823 -7.706  1.00 34.04  ? 142  GLU B O   1 
ATOM   5261 C CB  . GLU B 1 141 ? -34.916 -33.065 -9.119  1.00 32.13  ? 142  GLU B CB  1 
ATOM   5262 C CG  . GLU B 1 141 ? -36.140 -33.597 -9.877  1.00 32.61  ? 142  GLU B CG  1 
ATOM   5263 C CD  . GLU B 1 141 ? -36.196 -35.122 -9.901  1.00 39.73  ? 142  GLU B CD  1 
ATOM   5264 O OE1 . GLU B 1 141 ? -35.126 -35.766 -9.821  1.00 42.35  ? 142  GLU B OE1 1 
ATOM   5265 O OE2 . GLU B 1 141 ? -37.309 -35.682 -9.999  1.00 45.76  ? 142  GLU B OE2 1 
ATOM   5266 N N   . ARG B 1 142 ? -33.318 -32.676 -5.950  1.00 37.97  ? 143  ARG B N   1 
ATOM   5267 C CA  . ARG B 1 142 ? -32.037 -32.559 -5.256  1.00 38.60  ? 143  ARG B CA  1 
ATOM   5268 C C   . ARG B 1 142 ? -30.967 -31.994 -6.180  1.00 34.49  ? 143  ARG B C   1 
ATOM   5269 O O   . ARG B 1 142 ? -29.894 -32.569 -6.363  1.00 42.59  ? 143  ARG B O   1 
ATOM   5270 C CB  . ARG B 1 142 ? -31.595 -33.903 -4.680  1.00 35.23  ? 143  ARG B CB  1 
ATOM   5271 C CG  . ARG B 1 142 ? -32.699 -34.681 -4.008  1.00 44.92  ? 143  ARG B CG  1 
ATOM   5272 C CD  . ARG B 1 142 ? -32.787 -34.319 -2.558  1.00 51.45  ? 143  ARG B CD  1 
ATOM   5273 N NE  . ARG B 1 142 ? -31.582 -34.674 -1.819  1.00 56.12  ? 143  ARG B NE  1 
ATOM   5274 C CZ  . ARG B 1 142 ? -31.275 -34.166 -0.630  1.00 56.54  ? 143  ARG B CZ  1 
ATOM   5275 N NH1 . ARG B 1 142 ? -32.087 -33.280 -0.070  1.00 45.61  ? 143  ARG B NH1 1 
ATOM   5276 N NH2 . ARG B 1 142 ? -30.163 -34.535 -0.005  1.00 57.93  ? 143  ARG B NH2 1 
ATOM   5277 N N   . THR B 1 143 ? -31.287 -30.872 -6.797  1.00 32.48  ? 144  THR B N   1 
ATOM   5278 C CA  . THR B 1 143 ? -30.327 -30.098 -7.560  1.00 35.66  ? 144  THR B CA  1 
ATOM   5279 C C   . THR B 1 143 ? -30.116 -28.761 -6.870  1.00 32.04  ? 144  THR B C   1 
ATOM   5280 O O   . THR B 1 143 ? -30.876 -28.368 -5.982  1.00 34.45  ? 144  THR B O   1 
ATOM   5281 C CB  . THR B 1 143 ? -30.816 -29.873 -8.995  1.00 42.63  ? 144  THR B CB  1 
ATOM   5282 O OG1 . THR B 1 143 ? -32.126 -29.297 -8.950  1.00 48.38  ? 144  THR B OG1 1 
ATOM   5283 C CG2 . THR B 1 143 ? -30.867 -31.183 -9.768  1.00 42.17  ? 144  THR B CG2 1 
ATOM   5284 N N   . VAL B 1 144 ? -29.069 -28.063 -7.289  1.00 26.99  ? 145  VAL B N   1 
ATOM   5285 C CA  . VAL B 1 144 ? -28.906 -26.649 -6.984  1.00 25.59  ? 145  VAL B CA  1 
ATOM   5286 C C   . VAL B 1 144 ? -29.435 -25.869 -8.176  1.00 30.69  ? 145  VAL B C   1 
ATOM   5287 O O   . VAL B 1 144 ? -29.141 -26.214 -9.330  1.00 34.58  ? 145  VAL B O   1 
ATOM   5288 C CB  . VAL B 1 144 ? -27.437 -26.294 -6.708  1.00 28.90  ? 145  VAL B CB  1 
ATOM   5289 C CG1 . VAL B 1 144 ? -27.280 -24.789 -6.539  1.00 30.10  ? 145  VAL B CG1 1 
ATOM   5290 C CG2 . VAL B 1 144 ? -26.940 -27.014 -5.490  1.00 25.08  ? 145  VAL B CG2 1 
ATOM   5291 N N   . LEU B 1 145 ? -30.220 -24.831 -7.913  1.00 24.40  ? 146  LEU B N   1 
ATOM   5292 C CA  . LEU B 1 145 ? -30.794 -24.022 -8.978  1.00 24.16  ? 146  LEU B CA  1 
ATOM   5293 C C   . LEU B 1 145 ? -30.343 -22.576 -8.827  1.00 28.42  ? 146  LEU B C   1 
ATOM   5294 O O   . LEU B 1 145 ? -30.469 -21.985 -7.748  1.00 31.59  ? 146  LEU B O   1 
ATOM   5295 C CB  . LEU B 1 145 ? -32.324 -24.102 -8.994  1.00 25.02  ? 146  LEU B CB  1 
ATOM   5296 C CG  . LEU B 1 145 ? -32.889 -23.602 -10.332 1.00 41.22  ? 146  LEU B CG  1 
ATOM   5297 C CD1 . LEU B 1 145 ? -34.038 -24.468 -10.804 1.00 44.31  ? 146  LEU B CD1 1 
ATOM   5298 C CD2 . LEU B 1 145 ? -33.327 -22.147 -10.237 1.00 43.50  ? 146  LEU B CD2 1 
ATOM   5299 N N   . VAL B 1 146 ? -29.834 -22.016 -9.919  1.00 25.03  ? 147  VAL B N   1 
ATOM   5300 C CA  . VAL B 1 146 ? -29.342 -20.648 -9.977  1.00 23.19  ? 147  VAL B CA  1 
ATOM   5301 C C   . VAL B 1 146 ? -30.148 -19.908 -11.033 1.00 27.52  ? 147  VAL B C   1 
ATOM   5302 O O   . VAL B 1 146 ? -30.466 -20.470 -12.088 1.00 28.13  ? 147  VAL B O   1 
ATOM   5303 C CB  . VAL B 1 146 ? -27.837 -20.587 -10.324 1.00 26.71  ? 147  VAL B CB  1 
ATOM   5304 C CG1 . VAL B 1 146 ? -27.364 -19.141 -10.380 1.00 19.43  ? 147  VAL B CG1 1 
ATOM   5305 C CG2 . VAL B 1 146 ? -27.015 -21.397 -9.331  1.00 24.46  ? 147  VAL B CG2 1 
ATOM   5306 N N   . SER B 1 147 ? -30.484 -18.652 -10.748 1.00 26.72  ? 148  SER B N   1 
ATOM   5307 C CA  . SER B 1 147 ? -31.072 -17.772 -11.746 1.00 25.50  ? 148  SER B CA  1 
ATOM   5308 C C   . SER B 1 147 ? -30.517 -16.370 -11.548 1.00 31.83  ? 148  SER B C   1 
ATOM   5309 O O   . SER B 1 147 ? -30.231 -15.955 -10.421 1.00 26.08  ? 148  SER B O   1 
ATOM   5310 C CB  . SER B 1 147 ? -32.598 -17.758 -11.664 1.00 22.36  ? 148  SER B CB  1 
ATOM   5311 O OG  . SER B 1 147 ? -33.030 -17.223 -10.429 1.00 27.17  ? 148  SER B OG  1 
ATOM   5312 N N   . MET B 1 148 ? -30.351 -15.646 -12.659 1.00 25.37  ? 149  MET B N   1 
ATOM   5313 C CA  . MET B 1 148 ? -29.757 -14.319 -12.643 1.00 22.46  ? 149  MET B CA  1 
ATOM   5314 C C   . MET B 1 148 ? -30.662 -13.328 -13.359 1.00 27.24  ? 149  MET B C   1 
ATOM   5315 O O   . MET B 1 148 ? -31.405 -13.679 -14.283 1.00 23.70  ? 149  MET B O   1 
ATOM   5316 C CB  . MET B 1 148 ? -28.346 -14.311 -13.287 1.00 31.13  ? 149  MET B CB  1 
ATOM   5317 C CG  . MET B 1 148 ? -28.298 -14.047 -14.791 1.00 43.12  ? 149  MET B CG  1 
ATOM   5318 S SD  . MET B 1 148 ? -29.097 -15.385 -15.683 1.00 32.97  ? 149  MET B SD  1 
ATOM   5319 C CE  . MET B 1 148 ? -27.828 -16.648 -15.744 1.00 41.18  ? 149  MET B CE  1 
ATOM   5320 N N   . ASN B 1 149 ? -30.607 -12.084 -12.897 1.00 25.66  ? 150  ASN B N   1 
ATOM   5321 C CA  . ASN B 1 149 ? -31.106 -10.955 -13.660 1.00 28.50  ? 150  ASN B CA  1 
ATOM   5322 C C   . ASN B 1 149 ? -30.019 -10.477 -14.617 1.00 29.37  ? 150  ASN B C   1 
ATOM   5323 O O   . ASN B 1 149 ? -28.839 -10.423 -14.259 1.00 32.02  ? 150  ASN B O   1 
ATOM   5324 C CB  . ASN B 1 149 ? -31.512 -9.817  -12.728 1.00 23.41  ? 150  ASN B CB  1 
ATOM   5325 C CG  . ASN B 1 149 ? -32.921 -9.972  -12.181 1.00 29.87  ? 150  ASN B CG  1 
ATOM   5326 O OD1 . ASN B 1 149 ? -33.597 -10.987 -12.393 1.00 22.73  ? 150  ASN B OD1 1 
ATOM   5327 N ND2 . ASN B 1 149 ? -33.375 -8.947  -11.470 1.00 32.49  ? 150  ASN B ND2 1 
ATOM   5328 N N   . TYR B 1 150 ? -30.420 -10.129 -15.833 1.00 26.67  ? 151  TYR B N   1 
ATOM   5329 C CA  . TYR B 1 150 ? -29.521 -9.518  -16.803 1.00 25.59  ? 151  TYR B CA  1 
ATOM   5330 C C   . TYR B 1 150 ? -30.237 -8.347  -17.455 1.00 25.51  ? 151  TYR B C   1 
ATOM   5331 O O   . TYR B 1 150 ? -31.462 -8.357  -17.595 1.00 25.12  ? 151  TYR B O   1 
ATOM   5332 C CB  . TYR B 1 150 ? -29.053 -10.528 -17.866 1.00 21.69  ? 151  TYR B CB  1 
ATOM   5333 C CG  . TYR B 1 150 ? -30.170 -11.094 -18.706 1.00 24.37  ? 151  TYR B CG  1 
ATOM   5334 C CD1 . TYR B 1 150 ? -30.889 -12.209 -18.282 1.00 21.05  ? 151  TYR B CD1 1 
ATOM   5335 C CD2 . TYR B 1 150 ? -30.501 -10.524 -19.931 1.00 24.82  ? 151  TYR B CD2 1 
ATOM   5336 C CE1 . TYR B 1 150 ? -31.921 -12.736 -19.055 1.00 21.46  ? 151  TYR B CE1 1 
ATOM   5337 C CE2 . TYR B 1 150 ? -31.526 -11.042 -20.709 1.00 25.63  ? 151  TYR B CE2 1 
ATOM   5338 C CZ  . TYR B 1 150 ? -32.231 -12.145 -20.268 1.00 25.34  ? 151  TYR B CZ  1 
ATOM   5339 O OH  . TYR B 1 150 ? -33.248 -12.657 -21.041 1.00 23.22  ? 151  TYR B OH  1 
ATOM   5340 N N   . ARG B 1 151 ? -29.466 -7.327  -17.831 1.00 26.50  ? 152  ARG B N   1 
ATOM   5341 C CA  . ARG B 1 151 ? -30.046 -6.108  -18.383 1.00 27.14  ? 152  ARG B CA  1 
ATOM   5342 C C   . ARG B 1 151 ? -30.745 -6.381  -19.711 1.00 28.05  ? 152  ARG B C   1 
ATOM   5343 O O   . ARG B 1 151 ? -30.216 -7.090  -20.573 1.00 27.81  ? 152  ARG B O   1 
ATOM   5344 C CB  . ARG B 1 151 ? -28.962 -5.048  -18.584 1.00 26.45  ? 152  ARG B CB  1 
ATOM   5345 C CG  . ARG B 1 151 ? -28.365 -4.500  -17.297 1.00 29.15  ? 152  ARG B CG  1 
ATOM   5346 C CD  . ARG B 1 151 ? -27.154 -3.629  -17.594 1.00 26.66  ? 152  ARG B CD  1 
ATOM   5347 N NE  . ARG B 1 151 ? -25.931 -4.423  -17.688 1.00 30.69  ? 152  ARG B NE  1 
ATOM   5348 C CZ  . ARG B 1 151 ? -24.742 -3.926  -18.008 1.00 30.75  ? 152  ARG B CZ  1 
ATOM   5349 N NH1 . ARG B 1 151 ? -24.607 -2.624  -18.241 1.00 25.23  ? 152  ARG B NH1 1 
ATOM   5350 N NH2 . ARG B 1 151 ? -23.684 -4.725  -18.072 1.00 28.92  ? 152  ARG B NH2 1 
ATOM   5351 N N   . VAL B 1 152 ? -31.935 -5.798  -19.885 1.00 26.31  ? 153  VAL B N   1 
ATOM   5352 C CA  . VAL B 1 152 ? -32.671 -5.953  -21.136 1.00 25.01  ? 153  VAL B CA  1 
ATOM   5353 C C   . VAL B 1 152 ? -32.891 -4.580  -21.763 1.00 27.14  ? 153  VAL B C   1 
ATOM   5354 O O   . VAL B 1 152 ? -32.507 -3.549  -21.199 1.00 28.76  ? 153  VAL B O   1 
ATOM   5355 C CB  . VAL B 1 152 ? -34.015 -6.685  -20.923 1.00 29.44  ? 153  VAL B CB  1 
ATOM   5356 C CG1 . VAL B 1 152 ? -33.781 -8.117  -20.431 1.00 19.23  ? 153  VAL B CG1 1 
ATOM   5357 C CG2 . VAL B 1 152 ? -34.948 -5.918  -20.002 1.00 21.31  ? 153  VAL B CG2 1 
ATOM   5358 N N   . GLY B 1 153 ? -33.507 -4.560  -22.942 1.00 30.03  ? 154  GLY B N   1 
ATOM   5359 C CA  . GLY B 1 153 ? -33.753 -3.320  -23.649 1.00 23.57  ? 154  GLY B CA  1 
ATOM   5360 C C   . GLY B 1 153 ? -32.456 -2.614  -23.995 1.00 27.36  ? 154  GLY B C   1 
ATOM   5361 O O   . GLY B 1 153 ? -31.401 -3.234  -24.164 1.00 30.79  ? 154  GLY B O   1 
ATOM   5362 N N   . ALA B 1 154 ? -32.532 -1.283  -24.088 1.00 26.15  ? 155  ALA B N   1 
ATOM   5363 C CA  . ALA B 1 154 ? -31.343 -0.500  -24.406 1.00 31.91  ? 155  ALA B CA  1 
ATOM   5364 C C   . ALA B 1 154 ? -30.235 -0.737  -23.386 1.00 31.04  ? 155  ALA B C   1 
ATOM   5365 O O   . ALA B 1 154 ? -29.055 -0.798  -23.746 1.00 31.96  ? 155  ALA B O   1 
ATOM   5366 C CB  . ALA B 1 154 ? -31.699 0.985   -24.478 1.00 25.14  ? 155  ALA B CB  1 
ATOM   5367 N N   . PHE B 1 155 ? -30.601 -0.895  -22.110 1.00 24.49  ? 156  PHE B N   1 
ATOM   5368 C CA  . PHE B 1 155 ? -29.608 -1.046  -21.049 1.00 27.80  ? 156  PHE B CA  1 
ATOM   5369 C C   . PHE B 1 155 ? -28.740 -2.276  -21.256 1.00 27.14  ? 156  PHE B C   1 
ATOM   5370 O O   . PHE B 1 155 ? -27.566 -2.274  -20.867 1.00 23.07  ? 156  PHE B O   1 
ATOM   5371 C CB  . PHE B 1 155 ? -30.308 -1.096  -19.684 1.00 24.13  ? 156  PHE B CB  1 
ATOM   5372 C CG  . PHE B 1 155 ? -31.314 0.003   -19.502 1.00 26.97  ? 156  PHE B CG  1 
ATOM   5373 C CD1 . PHE B 1 155 ? -30.936 1.224   -18.970 1.00 28.58  ? 156  PHE B CD1 1 
ATOM   5374 C CD2 . PHE B 1 155 ? -32.626 -0.165  -19.919 1.00 30.27  ? 156  PHE B CD2 1 
ATOM   5375 C CE1 . PHE B 1 155 ? -31.856 2.251   -18.833 1.00 36.25  ? 156  PHE B CE1 1 
ATOM   5376 C CE2 . PHE B 1 155 ? -33.547 0.851   -19.784 1.00 29.94  ? 156  PHE B CE2 1 
ATOM   5377 C CZ  . PHE B 1 155 ? -33.163 2.061   -19.241 1.00 33.16  ? 156  PHE B CZ  1 
ATOM   5378 N N   . GLY B 1 156 ? -29.279 -3.320  -21.884 1.00 30.48  ? 157  GLY B N   1 
ATOM   5379 C CA  . GLY B 1 156 ? -28.501 -4.522  -22.112 1.00 24.10  ? 157  GLY B CA  1 
ATOM   5380 C C   . GLY B 1 156 ? -28.007 -4.715  -23.533 1.00 29.02  ? 157  GLY B C   1 
ATOM   5381 O O   . GLY B 1 156 ? -27.049 -5.467  -23.752 1.00 27.34  ? 157  GLY B O   1 
ATOM   5382 N N   . PHE B 1 157 ? -28.638 -4.051  -24.516 1.00 27.97  ? 158  PHE B N   1 
ATOM   5383 C CA  . PHE B 1 157 ? -28.347 -4.383  -25.907 1.00 27.42  ? 158  PHE B CA  1 
ATOM   5384 C C   . PHE B 1 157 ? -28.296 -3.188  -26.856 1.00 34.27  ? 158  PHE B C   1 
ATOM   5385 O O   . PHE B 1 157 ? -28.223 -3.393  -28.075 1.00 30.42  ? 158  PHE B O   1 
ATOM   5386 C CB  . PHE B 1 157 ? -29.361 -5.425  -26.400 1.00 25.05  ? 158  PHE B CB  1 
ATOM   5387 C CG  . PHE B 1 157 ? -29.293 -6.709  -25.624 1.00 31.79  ? 158  PHE B CG  1 
ATOM   5388 C CD1 . PHE B 1 157 ? -30.174 -6.950  -24.577 1.00 29.38  ? 158  PHE B CD1 1 
ATOM   5389 C CD2 . PHE B 1 157 ? -28.301 -7.644  -25.891 1.00 29.03  ? 158  PHE B CD2 1 
ATOM   5390 C CE1 . PHE B 1 157 ? -30.088 -8.121  -23.822 1.00 24.24  ? 158  PHE B CE1 1 
ATOM   5391 C CE2 . PHE B 1 157 ? -28.206 -8.816  -25.147 1.00 31.00  ? 158  PHE B CE2 1 
ATOM   5392 C CZ  . PHE B 1 157 ? -29.101 -9.054  -24.107 1.00 24.46  ? 158  PHE B CZ  1 
ATOM   5393 N N   . LEU B 1 158 ? -28.302 -1.953  -26.359 1.00 34.99  ? 159  LEU B N   1 
ATOM   5394 C CA  . LEU B 1 158 ? -27.961 -0.834  -27.226 1.00 34.98  ? 159  LEU B CA  1 
ATOM   5395 C C   . LEU B 1 158 ? -26.505 -0.958  -27.657 1.00 38.45  ? 159  LEU B C   1 
ATOM   5396 O O   . LEU B 1 158 ? -25.617 -1.182  -26.828 1.00 32.50  ? 159  LEU B O   1 
ATOM   5397 C CB  . LEU B 1 158 ? -28.192 0.496   -26.513 1.00 35.45  ? 159  LEU B CB  1 
ATOM   5398 C CG  . LEU B 1 158 ? -27.980 1.734   -27.383 1.00 37.03  ? 159  LEU B CG  1 
ATOM   5399 C CD1 . LEU B 1 158 ? -29.172 2.673   -27.273 1.00 37.40  ? 159  LEU B CD1 1 
ATOM   5400 C CD2 . LEU B 1 158 ? -26.688 2.449   -27.007 1.00 35.20  ? 159  LEU B CD2 1 
ATOM   5401 N N   . ALA B 1 159 ? -26.258 -0.825  -28.958 1.00 32.60  ? 160  ALA B N   1 
ATOM   5402 C CA  . ALA B 1 159 ? -24.912 -0.989  -29.490 1.00 35.72  ? 160  ALA B CA  1 
ATOM   5403 C C   . ALA B 1 159 ? -24.586 0.121   -30.476 1.00 38.60  ? 160  ALA B C   1 
ATOM   5404 O O   . ALA B 1 159 ? -25.345 0.369   -31.416 1.00 38.29  ? 160  ALA B O   1 
ATOM   5405 C CB  . ALA B 1 159 ? -24.746 -2.352  -30.175 1.00 30.64  ? 160  ALA B CB  1 
ATOM   5406 N N   . LEU B 1 160 ? -23.463 0.786   -30.247 1.00 43.39  ? 161  LEU B N   1 
ATOM   5407 C CA  . LEU B 1 160 ? -22.799 1.589   -31.262 1.00 43.66  ? 161  LEU B CA  1 
ATOM   5408 C C   . LEU B 1 160 ? -21.546 0.823   -31.674 1.00 48.13  ? 161  LEU B C   1 
ATOM   5409 O O   . LEU B 1 160 ? -20.460 1.075   -31.133 1.00 46.69  ? 161  LEU B O   1 
ATOM   5410 C CB  . LEU B 1 160 ? -22.459 2.982   -30.732 1.00 41.04  ? 161  LEU B CB  1 
ATOM   5411 C CG  . LEU B 1 160 ? -23.625 3.968   -30.619 1.00 42.84  ? 161  LEU B CG  1 
ATOM   5412 C CD1 . LEU B 1 160 ? -23.152 5.286   -30.020 1.00 38.05  ? 161  LEU B CD1 1 
ATOM   5413 C CD2 . LEU B 1 160 ? -24.283 4.196   -31.986 1.00 39.59  ? 161  LEU B CD2 1 
ATOM   5414 N N   . PRO B 1 161 ? -21.663 -0.126  -32.607 1.00 46.30  ? 162  PRO B N   1 
ATOM   5415 C CA  . PRO B 1 161 ? -20.578 -1.093  -32.827 1.00 46.42  ? 162  PRO B CA  1 
ATOM   5416 C C   . PRO B 1 161 ? -19.246 -0.423  -33.126 1.00 47.39  ? 162  PRO B C   1 
ATOM   5417 O O   . PRO B 1 161 ? -19.161 0.523   -33.910 1.00 41.02  ? 162  PRO B O   1 
ATOM   5418 C CB  . PRO B 1 161 ? -21.078 -1.915  -34.019 1.00 44.96  ? 162  PRO B CB  1 
ATOM   5419 C CG  . PRO B 1 161 ? -22.568 -1.813  -33.938 1.00 44.83  ? 162  PRO B CG  1 
ATOM   5420 C CD  . PRO B 1 161 ? -22.842 -0.420  -33.438 1.00 40.87  ? 162  PRO B CD  1 
ATOM   5421 N N   . GLY B 1 162 ? -18.198 -0.923  -32.472 1.00 53.83  ? 163  GLY B N   1 
ATOM   5422 C CA  . GLY B 1 162 ? -16.882 -0.343  -32.562 1.00 55.67  ? 163  GLY B CA  1 
ATOM   5423 C C   . GLY B 1 162 ? -16.550 0.639   -31.460 1.00 54.58  ? 163  GLY B C   1 
ATOM   5424 O O   . GLY B 1 162 ? -15.367 0.906   -31.222 1.00 57.13  ? 163  GLY B O   1 
ATOM   5425 N N   . SER B 1 163 ? -17.555 1.178   -30.780 1.00 51.22  ? 164  SER B N   1 
ATOM   5426 C CA  . SER B 1 163 ? -17.320 2.105   -29.687 1.00 51.50  ? 164  SER B CA  1 
ATOM   5427 C C   . SER B 1 163 ? -17.020 1.354   -28.396 1.00 55.21  ? 164  SER B C   1 
ATOM   5428 O O   . SER B 1 163 ? -17.490 0.236   -28.173 1.00 54.25  ? 164  SER B O   1 
ATOM   5429 C CB  . SER B 1 163 ? -18.533 3.009   -29.479 1.00 51.13  ? 164  SER B CB  1 
ATOM   5430 O OG  . SER B 1 163 ? -19.563 2.312   -28.802 1.00 54.98  ? 164  SER B OG  1 
ATOM   5431 N N   . ARG B 1 164 ? -16.160 1.956   -27.599 1.00 58.26  ? 165  ARG B N   1 
ATOM   5432 C CA  . ARG B 1 164 ? -15.841 1.503   -26.270 1.00 63.73  ? 165  ARG B CA  1 
ATOM   5433 C C   . ARG B 1 164 ? -16.980 1.784   -25.345 1.00 61.16  ? 165  ARG B C   1 
ATOM   5434 O O   . ARG B 1 164 ? -17.242 1.066   -24.434 1.00 61.16  ? 165  ARG B O   1 
ATOM   5435 C CB  . ARG B 1 164 ? -14.591 2.140   -25.727 1.00 80.17  ? 165  ARG B CB  1 
ATOM   5436 C CG  . ARG B 1 164 ? -13.397 1.207   -25.726 1.00 98.90  ? 165  ARG B CG  1 
ATOM   5437 C CD  . ARG B 1 164 ? -12.259 1.743   -24.872 1.00 112.79 ? 165  ARG B CD  1 
ATOM   5438 N NE  . ARG B 1 164 ? -11.420 0.664   -24.380 1.00 118.31 ? 165  ARG B NE  1 
ATOM   5439 C CZ  . ARG B 1 164 ? -11.614 0.035   -23.229 1.00 117.81 ? 165  ARG B CZ  1 
ATOM   5440 N NH1 . ARG B 1 164 ? -12.608 0.389   -22.439 1.00 116.44 ? 165  ARG B NH1 1 
ATOM   5441 N NH2 . ARG B 1 164 ? -10.800 -0.940  -22.861 1.00 117.58 ? 165  ARG B NH2 1 
ATOM   5442 N N   . GLU B 1 165 ? -17.635 2.898   -25.559 1.00 57.53  ? 166  GLU B N   1 
ATOM   5443 C CA  A GLU B 1 165 ? -18.794 3.365   -24.641 0.46 55.34  ? 166  GLU B CA  1 
ATOM   5444 C CA  B GLU B 1 165 ? -18.773 3.308   -24.753 0.54 55.44  ? 166  GLU B CA  1 
ATOM   5445 C C   . GLU B 1 165 ? -20.183 2.602   -24.653 1.00 51.79  ? 166  GLU B C   1 
ATOM   5446 O O   . GLU B 1 165 ? -21.097 2.644   -23.771 1.00 50.88  ? 166  GLU B O   1 
ATOM   5447 C CB  A GLU B 1 165 ? -19.035 4.881   -24.755 0.46 56.88  ? 166  GLU B CB  1 
ATOM   5448 C CB  B GLU B 1 165 ? -19.076 4.778   -24.948 0.54 56.46  ? 166  GLU B CB  1 
ATOM   5449 C CG  A GLU B 1 165 ? -17.967 5.716   -24.058 0.46 60.77  ? 166  GLU B CG  1 
ATOM   5450 C CG  B GLU B 1 165 ? -17.983 5.696   -24.520 0.54 60.77  ? 166  GLU B CG  1 
ATOM   5451 C CD  A GLU B 1 165 ? -17.805 5.351   -22.595 0.46 56.31  ? 166  GLU B CD  1 
ATOM   5452 C CD  B GLU B 1 165 ? -17.113 6.092   -25.680 0.54 70.94  ? 166  GLU B CD  1 
ATOM   5453 O OE1 A GLU B 1 165 ? -18.720 5.649   -21.797 0.46 50.55  ? 166  GLU B OE1 1 
ATOM   5454 O OE1 B GLU B 1 165 ? -17.470 5.722   -26.821 0.54 82.31  ? 166  GLU B OE1 1 
ATOM   5455 O OE2 A GLU B 1 165 ? -16.754 4.781   -22.233 0.46 55.40  ? 166  GLU B OE2 1 
ATOM   5456 O OE2 B GLU B 1 165 ? -16.076 6.752   -25.456 0.54 77.04  ? 166  GLU B OE2 1 
ATOM   5457 N N   . ALA B 1 166 ? -20.406 1.982   -25.794 1.00 45.15  ? 167  ALA B N   1 
ATOM   5458 C CA  . ALA B 1 166 ? -21.636 1.203   -25.959 1.00 39.38  ? 167  ALA B CA  1 
ATOM   5459 C C   . ALA B 1 166 ? -21.356 0.055   -26.918 1.00 39.53  ? 167  ALA B C   1 
ATOM   5460 O O   . ALA B 1 166 ? -21.796 0.061   -28.076 1.00 34.46  ? 167  ALA B O   1 
ATOM   5461 C CB  . ALA B 1 166 ? -22.781 2.085   -26.460 1.00 36.77  ? 167  ALA B CB  1 
ATOM   5462 N N   . PRO B 1 167 ? -20.618 -0.965  -26.458 1.00 40.49  ? 168  PRO B N   1 
ATOM   5463 C CA  . PRO B 1 167 ? -20.170 -2.027  -27.375 1.00 39.83  ? 168  PRO B CA  1 
ATOM   5464 C C   . PRO B 1 167 ? -21.235 -3.048  -27.737 1.00 43.15  ? 168  PRO B C   1 
ATOM   5465 O O   . PRO B 1 167 ? -21.032 -3.802  -28.697 1.00 40.32  ? 168  PRO B O   1 
ATOM   5466 C CB  . PRO B 1 167 ? -19.028 -2.697  -26.600 1.00 39.78  ? 168  PRO B CB  1 
ATOM   5467 C CG  . PRO B 1 167 ? -19.398 -2.485  -25.167 1.00 41.26  ? 168  PRO B CG  1 
ATOM   5468 C CD  . PRO B 1 167 ? -20.100 -1.154  -25.091 1.00 36.01  ? 168  PRO B CD  1 
ATOM   5469 N N   . GLY B 1 168 ? -22.341 -3.118  -27.005 1.00 40.54  ? 169  GLY B N   1 
ATOM   5470 C CA  . GLY B 1 168 ? -23.391 -4.064  -27.317 1.00 32.10  ? 169  GLY B CA  1 
ATOM   5471 C C   . GLY B 1 168 ? -23.237 -5.380  -26.573 1.00 34.54  ? 169  GLY B C   1 
ATOM   5472 O O   . GLY B 1 168 ? -22.161 -5.748  -26.105 1.00 40.20  ? 169  GLY B O   1 
ATOM   5473 N N   . ASN B 1 169 ? -24.328 -6.097  -26.442 1.00 29.21  ? 170  ASN B N   1 
ATOM   5474 C CA  . ASN B 1 169 ? -24.366 -7.399  -25.843 1.00 26.93  ? 170  ASN B CA  1 
ATOM   5475 C C   . ASN B 1 169 ? -23.991 -7.432  -24.388 1.00 30.08  ? 170  ASN B C   1 
ATOM   5476 O O   . ASN B 1 169 ? -23.641 -8.442  -23.925 1.00 28.05  ? 170  ASN B O   1 
ATOM   5477 C CB  . ASN B 1 169 ? -23.432 -8.352  -26.574 1.00 22.96  ? 170  ASN B CB  1 
ATOM   5478 C CG  . ASN B 1 169 ? -23.790 -8.579  -28.014 1.00 33.68  ? 170  ASN B CG  1 
ATOM   5479 O OD1 . ASN B 1 169 ? -24.904 -8.705  -28.370 1.00 41.07  ? 170  ASN B OD1 1 
ATOM   5480 N ND2 . ASN B 1 169 ? -22.811 -8.666  -28.821 1.00 30.19  ? 170  ASN B ND2 1 
ATOM   5481 N N   . VAL B 1 170 ? -24.087 -6.333  -23.669 1.00 28.76  ? 171  VAL B N   1 
ATOM   5482 C CA  . VAL B 1 170 ? -23.667 -6.353  -22.269 1.00 30.13  ? 171  VAL B CA  1 
ATOM   5483 C C   . VAL B 1 170 ? -24.635 -7.180  -21.419 1.00 30.35  ? 171  VAL B C   1 
ATOM   5484 O O   . VAL B 1 170 ? -24.236 -7.755  -20.399 1.00 27.71  ? 171  VAL B O   1 
ATOM   5485 C CB  . VAL B 1 170 ? -23.490 -4.916  -21.728 1.00 33.38  ? 171  VAL B CB  1 
ATOM   5486 C CG1 . VAL B 1 170 ? -22.454 -4.155  -22.560 1.00 30.84  ? 171  VAL B CG1 1 
ATOM   5487 C CG2 . VAL B 1 170 ? -24.813 -4.153  -21.676 1.00 27.10  ? 171  VAL B CG2 1 
ATOM   5488 N N   . GLY B 1 171 ? -25.903 -7.287  -21.829 1.00 29.08  ? 172  GLY B N   1 
ATOM   5489 C CA  . GLY B 1 171 ? -26.811 -8.192  -21.140 1.00 18.12  ? 172  GLY B CA  1 
ATOM   5490 C C   . GLY B 1 171 ? -26.361 -9.639  -21.225 1.00 32.19  ? 172  GLY B C   1 
ATOM   5491 O O   . GLY B 1 171 ? -26.526 -10.413 -20.274 1.00 29.68  ? 172  GLY B O   1 
ATOM   5492 N N   . LEU B 1 172 ? -25.782 -10.025 -22.367 1.00 24.30  ? 173  LEU B N   1 
ATOM   5493 C CA  . LEU B 1 172 ? -25.199 -11.356 -22.501 1.00 26.33  ? 173  LEU B CA  1 
ATOM   5494 C C   . LEU B 1 172 ? -23.970 -11.494 -21.617 1.00 25.63  ? 173  LEU B C   1 
ATOM   5495 O O   . LEU B 1 172 ? -23.735 -12.556 -21.025 1.00 24.89  ? 173  LEU B O   1 
ATOM   5496 C CB  . LEU B 1 172 ? -24.833 -11.629 -23.964 1.00 25.26  ? 173  LEU B CB  1 
ATOM   5497 C CG  . LEU B 1 172 ? -25.930 -12.000 -24.969 1.00 27.35  ? 173  LEU B CG  1 
ATOM   5498 C CD1 . LEU B 1 172 ? -25.359 -12.207 -26.377 1.00 24.45  ? 173  LEU B CD1 1 
ATOM   5499 C CD2 . LEU B 1 172 ? -26.655 -13.257 -24.512 1.00 27.71  ? 173  LEU B CD2 1 
ATOM   5500 N N   . LEU B 1 173 ? -23.166 -10.432 -21.527 1.00 22.37  ? 174  LEU B N   1 
ATOM   5501 C CA  . LEU B 1 173 ? -22.027 -10.457 -20.622 1.00 27.06  ? 174  LEU B CA  1 
ATOM   5502 C C   . LEU B 1 173 ? -22.486 -10.526 -19.170 1.00 28.26  ? 174  LEU B C   1 
ATOM   5503 O O   . LEU B 1 173 ? -21.824 -11.171 -18.348 1.00 29.35  ? 174  LEU B O   1 
ATOM   5504 C CB  . LEU B 1 173 ? -21.132 -9.241  -20.868 1.00 24.13  ? 174  LEU B CB  1 
ATOM   5505 C CG  . LEU B 1 173 ? -20.465 -9.145  -22.252 1.00 30.29  ? 174  LEU B CG  1 
ATOM   5506 C CD1 . LEU B 1 173 ? -19.595 -7.900  -22.359 1.00 28.89  ? 174  LEU B CD1 1 
ATOM   5507 C CD2 . LEU B 1 173 ? -19.638 -10.381 -22.569 1.00 22.96  ? 174  LEU B CD2 1 
ATOM   5508 N N   . ASP B 1 174 ? -23.628 -9.908  -18.844 1.00 27.31  ? 175  ASP B N   1 
ATOM   5509 C CA  . ASP B 1 174 ? -24.204 -10.084 -17.513 1.00 28.48  ? 175  ASP B CA  1 
ATOM   5510 C C   . ASP B 1 174 ? -24.436 -11.561 -17.231 1.00 29.14  ? 175  ASP B C   1 
ATOM   5511 O O   . ASP B 1 174 ? -24.066 -12.071 -16.166 1.00 24.94  ? 175  ASP B O   1 
ATOM   5512 C CB  . ASP B 1 174 ? -25.524 -9.319  -17.365 1.00 23.83  ? 175  ASP B CB  1 
ATOM   5513 C CG  . ASP B 1 174 ? -25.357 -7.820  -17.487 1.00 29.81  ? 175  ASP B CG  1 
ATOM   5514 O OD1 . ASP B 1 174 ? -24.228 -7.330  -17.256 1.00 29.12  ? 175  ASP B OD1 1 
ATOM   5515 O OD2 . ASP B 1 174 ? -26.381 -7.131  -17.719 1.00 30.04  ? 175  ASP B OD2 1 
ATOM   5516 N N   . GLN B 1 175 ? -25.048 -12.268 -18.186 1.00 27.51  ? 176  GLN B N   1 
ATOM   5517 C CA  . GLN B 1 175 ? -25.278 -13.697 -18.002 1.00 28.61  ? 176  GLN B CA  1 
ATOM   5518 C C   . GLN B 1 175 ? -23.959 -14.450 -17.838 1.00 32.33  ? 176  GLN B C   1 
ATOM   5519 O O   . GLN B 1 175 ? -23.849 -15.347 -16.993 1.00 29.70  ? 176  GLN B O   1 
ATOM   5520 C CB  . GLN B 1 175 ? -26.076 -14.260 -19.178 1.00 23.44  ? 176  GLN B CB  1 
ATOM   5521 C CG  . GLN B 1 175 ? -27.462 -13.664 -19.389 1.00 22.07  ? 176  GLN B CG  1 
ATOM   5522 C CD  . GLN B 1 175 ? -28.076 -14.118 -20.712 1.00 28.99  ? 176  GLN B CD  1 
ATOM   5523 O OE1 . GLN B 1 175 ? -27.536 -15.002 -21.378 1.00 22.09  ? 176  GLN B OE1 1 
ATOM   5524 N NE2 . GLN B 1 175 ? -29.182 -13.488 -21.116 1.00 23.08  ? 176  GLN B NE2 1 
ATOM   5525 N N   . ARG B 1 176 ? -22.942 -14.088 -18.628 1.00 25.02  ? 177  ARG B N   1 
ATOM   5526 C CA  . ARG B 1 176 ? -21.667 -14.799 -18.558 1.00 26.58  ? 177  ARG B CA  1 
ATOM   5527 C C   . ARG B 1 176 ? -20.987 -14.584 -17.215 1.00 27.59  ? 177  ARG B C   1 
ATOM   5528 O O   . ARG B 1 176 ? -20.390 -15.515 -16.660 1.00 24.60  ? 177  ARG B O   1 
ATOM   5529 C CB  . ARG B 1 176 ? -20.739 -14.354 -19.684 1.00 22.09  ? 177  ARG B CB  1 
ATOM   5530 C CG  . ARG B 1 176 ? -19.303 -14.842 -19.535 1.00 27.27  ? 177  ARG B CG  1 
ATOM   5531 C CD  . ARG B 1 176 ? -18.436 -14.397 -20.707 1.00 27.82  ? 177  ARG B CD  1 
ATOM   5532 N NE  . ARG B 1 176 ? -18.848 -15.043 -21.952 1.00 34.97  ? 177  ARG B NE  1 
ATOM   5533 C CZ  . ARG B 1 176 ? -18.476 -14.644 -23.167 1.00 35.41  ? 177  ARG B CZ  1 
ATOM   5534 N NH1 . ARG B 1 176 ? -17.681 -13.592 -23.312 1.00 31.11  ? 177  ARG B NH1 1 
ATOM   5535 N NH2 . ARG B 1 176 ? -18.901 -15.298 -24.241 1.00 28.58  ? 177  ARG B NH2 1 
ATOM   5536 N N   . LEU B 1 177 ? -21.053 -13.359 -16.688 1.00 26.67  ? 178  LEU B N   1 
ATOM   5537 C CA  . LEU B 1 177 ? -20.477 -13.086 -15.378 1.00 27.87  ? 178  LEU B CA  1 
ATOM   5538 C C   . LEU B 1 177 ? -21.170 -13.905 -14.300 1.00 28.84  ? 178  LEU B C   1 
ATOM   5539 O O   . LEU B 1 177 ? -20.512 -14.455 -13.409 1.00 26.61  ? 178  LEU B O   1 
ATOM   5540 C CB  . LEU B 1 177 ? -20.564 -11.591 -15.061 1.00 26.58  ? 178  LEU B CB  1 
ATOM   5541 C CG  . LEU B 1 177 ? -19.931 -11.165 -13.730 1.00 30.99  ? 178  LEU B CG  1 
ATOM   5542 C CD1 . LEU B 1 177 ? -18.450 -11.506 -13.683 1.00 21.15  ? 178  LEU B CD1 1 
ATOM   5543 C CD2 . LEU B 1 177 ? -20.135 -9.680  -13.489 1.00 33.75  ? 178  LEU B CD2 1 
ATOM   5544 N N   . ALA B 1 178 ? -22.498 -14.009 -14.371 1.00 25.24  ? 179  ALA B N   1 
ATOM   5545 C CA  . ALA B 1 178 ? -23.226 -14.866 -13.440 1.00 22.94  ? 179  ALA B CA  1 
ATOM   5546 C C   . ALA B 1 178 ? -22.758 -16.314 -13.547 1.00 27.55  ? 179  ALA B C   1 
ATOM   5547 O O   . ALA B 1 178 ? -22.594 -17.001 -12.529 1.00 29.05  ? 179  ALA B O   1 
ATOM   5548 C CB  . ALA B 1 178 ? -24.732 -14.759 -13.700 1.00 18.01  ? 179  ALA B CB  1 
ATOM   5549 N N   . LEU B 1 179 ? -22.530 -16.793 -14.774 1.00 25.76  ? 180  LEU B N   1 
ATOM   5550 C CA  . LEU B 1 179 ? -21.970 -18.130 -14.962 1.00 26.31  ? 180  LEU B CA  1 
ATOM   5551 C C   . LEU B 1 179 ? -20.557 -18.225 -14.399 1.00 27.42  ? 180  LEU B C   1 
ATOM   5552 O O   . LEU B 1 179 ? -20.177 -19.260 -13.839 1.00 27.88  ? 180  LEU B O   1 
ATOM   5553 C CB  . LEU B 1 179 ? -21.983 -18.505 -16.445 1.00 25.92  ? 180  LEU B CB  1 
ATOM   5554 C CG  . LEU B 1 179 ? -23.383 -18.738 -17.023 1.00 28.04  ? 180  LEU B CG  1 
ATOM   5555 C CD1 . LEU B 1 179 ? -23.325 -19.097 -18.502 1.00 29.35  ? 180  LEU B CD1 1 
ATOM   5556 C CD2 . LEU B 1 179 ? -24.097 -19.815 -16.224 1.00 25.54  ? 180  LEU B CD2 1 
ATOM   5557 N N   . GLN B 1 180 ? -19.754 -17.166 -14.548 1.00 26.30  ? 181  GLN B N   1 
ATOM   5558 C CA  . GLN B 1 180 ? -18.438 -17.166 -13.922 1.00 26.27  ? 181  GLN B CA  1 
ATOM   5559 C C   . GLN B 1 180 ? -18.573 -17.192 -12.405 1.00 32.29  ? 181  GLN B C   1 
ATOM   5560 O O   . GLN B 1 180 ? -17.827 -17.896 -11.714 1.00 32.61  ? 181  GLN B O   1 
ATOM   5561 C CB  . GLN B 1 180 ? -17.634 -15.944 -14.374 1.00 30.28  ? 181  GLN B CB  1 
ATOM   5562 C CG  . GLN B 1 180 ? -17.049 -16.051 -15.774 1.00 53.82  ? 181  GLN B CG  1 
ATOM   5563 C CD  . GLN B 1 180 ? -16.626 -14.702 -16.343 1.00 64.66  ? 181  GLN B CD  1 
ATOM   5564 O OE1 . GLN B 1 180 ? -16.784 -13.664 -15.698 1.00 72.78  ? 181  GLN B OE1 1 
ATOM   5565 N NE2 . GLN B 1 180 ? -16.081 -14.715 -17.553 1.00 64.06  ? 181  GLN B NE2 1 
ATOM   5566 N N   . TRP B 1 181 ? -19.536 -16.437 -11.874 1.00 26.16  ? 182  TRP B N   1 
ATOM   5567 C CA  . TRP B 1 181 ? -19.793 -16.449 -10.441 1.00 31.31  ? 182  TRP B CA  1 
ATOM   5568 C C   . TRP B 1 181 ? -20.141 -17.852 -9.965  1.00 32.79  ? 182  TRP B C   1 
ATOM   5569 O O   . TRP B 1 181 ? -19.658 -18.301 -8.917  1.00 33.39  ? 182  TRP B O   1 
ATOM   5570 C CB  . TRP B 1 181 ? -20.919 -15.468 -10.114 1.00 25.58  ? 182  TRP B CB  1 
ATOM   5571 C CG  . TRP B 1 181 ? -21.176 -15.289 -8.646  1.00 33.64  ? 182  TRP B CG  1 
ATOM   5572 C CD1 . TRP B 1 181 ? -20.687 -14.298 -7.845  1.00 30.65  ? 182  TRP B CD1 1 
ATOM   5573 C CD2 . TRP B 1 181 ? -21.991 -16.121 -7.802  1.00 28.27  ? 182  TRP B CD2 1 
ATOM   5574 N NE1 . TRP B 1 181 ? -21.149 -14.455 -6.563  1.00 28.84  ? 182  TRP B NE1 1 
ATOM   5575 C CE2 . TRP B 1 181 ? -21.947 -15.568 -6.506  1.00 28.05  ? 182  TRP B CE2 1 
ATOM   5576 C CE3 . TRP B 1 181 ? -22.755 -17.276 -8.019  1.00 28.93  ? 182  TRP B CE3 1 
ATOM   5577 C CZ2 . TRP B 1 181 ? -22.631 -16.132 -5.423  1.00 31.21  ? 182  TRP B CZ2 1 
ATOM   5578 C CZ3 . TRP B 1 181 ? -23.440 -17.839 -6.939  1.00 29.04  ? 182  TRP B CZ3 1 
ATOM   5579 C CH2 . TRP B 1 181 ? -23.370 -17.263 -5.659  1.00 31.63  ? 182  TRP B CH2 1 
ATOM   5580 N N   . VAL B 1 182 ? -20.962 -18.565 -10.738 1.00 27.89  ? 183  VAL B N   1 
ATOM   5581 C CA  . VAL B 1 182 ? -21.336 -19.927 -10.376 1.00 28.14  ? 183  VAL B CA  1 
ATOM   5582 C C   . VAL B 1 182 ? -20.101 -20.818 -10.304 1.00 35.93  ? 183  VAL B C   1 
ATOM   5583 O O   . VAL B 1 182 ? -19.920 -21.569 -9.335  1.00 32.29  ? 183  VAL B O   1 
ATOM   5584 C CB  . VAL B 1 182 ? -22.397 -20.458 -11.359 1.00 29.40  ? 183  VAL B CB  1 
ATOM   5585 C CG1 . VAL B 1 182 ? -22.491 -21.980 -11.305 1.00 21.38  ? 183  VAL B CG1 1 
ATOM   5586 C CG2 . VAL B 1 182 ? -23.749 -19.830 -11.031 1.00 18.95  ? 183  VAL B CG2 1 
ATOM   5587 N N   . GLN B 1 183 ? -19.207 -20.716 -11.295 1.00 26.19  ? 184  GLN B N   1 
ATOM   5588 C CA  . GLN B 1 183 ? -17.978 -21.508 -11.259 1.00 31.48  ? 184  GLN B CA  1 
ATOM   5589 C C   . GLN B 1 183 ? -17.171 -21.226 -9.995  1.00 32.71  ? 184  GLN B C   1 
ATOM   5590 O O   . GLN B 1 183 ? -16.618 -22.147 -9.382  1.00 35.80  ? 184  GLN B O   1 
ATOM   5591 C CB  . GLN B 1 183 ? -17.128 -21.236 -12.505 1.00 30.10  ? 184  GLN B CB  1 
ATOM   5592 C CG  . GLN B 1 183 ? -17.651 -21.905 -13.775 1.00 33.39  ? 184  GLN B CG  1 
ATOM   5593 C CD  . GLN B 1 183 ? -17.664 -23.418 -13.659 1.00 35.86  ? 184  GLN B CD  1 
ATOM   5594 O OE1 . GLN B 1 183 ? -16.623 -24.040 -13.454 1.00 36.93  ? 184  GLN B OE1 1 
ATOM   5595 N NE2 . GLN B 1 183 ? -18.846 -24.017 -13.777 1.00 27.85  ? 184  GLN B NE2 1 
ATOM   5596 N N   . GLU B 1 184 ? -17.107 -19.963 -9.574  1.00 26.89  ? 185  GLU B N   1 
ATOM   5597 C CA  . GLU B 1 184 ? -16.247 -19.627 -8.446  1.00 34.31  ? 185  GLU B CA  1 
ATOM   5598 C C   . GLU B 1 184 ? -16.907 -19.888 -7.093  1.00 34.93  ? 185  GLU B C   1 
ATOM   5599 O O   . GLU B 1 184 ? -16.199 -20.128 -6.116  1.00 34.21  ? 185  GLU B O   1 
ATOM   5600 C CB  . GLU B 1 184 ? -15.812 -18.165 -8.534  1.00 39.66  ? 185  GLU B CB  1 
ATOM   5601 C CG  . GLU B 1 184 ? -14.739 -17.908 -9.576  1.00 60.26  ? 185  GLU B CG  1 
ATOM   5602 C CD  . GLU B 1 184 ? -14.501 -16.428 -9.812  1.00 74.48  ? 185  GLU B CD  1 
ATOM   5603 O OE1 . GLU B 1 184 ? -14.155 -16.054 -10.955 1.00 74.41  ? 185  GLU B OE1 1 
ATOM   5604 O OE2 . GLU B 1 184 ? -14.665 -15.640 -8.854  1.00 81.07  ? 185  GLU B OE2 1 
ATOM   5605 N N   . ASN B 1 185 ? -18.242 -19.862 -7.005  1.00 31.37  ? 186  ASN B N   1 
ATOM   5606 C CA  . ASN B 1 185 ? -18.908 -19.878 -5.708  1.00 33.55  ? 186  ASN B CA  1 
ATOM   5607 C C   . ASN B 1 185 ? -19.948 -20.971 -5.506  1.00 31.94  ? 186  ASN B C   1 
ATOM   5608 O O   . ASN B 1 185 ? -20.408 -21.137 -4.370  1.00 35.56  ? 186  ASN B O   1 
ATOM   5609 C CB  . ASN B 1 185 ? -19.586 -18.524 -5.435  1.00 35.48  ? 186  ASN B CB  1 
ATOM   5610 C CG  . ASN B 1 185 ? -18.656 -17.351 -5.663  1.00 37.26  ? 186  ASN B CG  1 
ATOM   5611 O OD1 . ASN B 1 185 ? -17.741 -17.091 -4.874  1.00 36.71  ? 186  ASN B OD1 1 
ATOM   5612 N ND2 . ASN B 1 185 ? -18.891 -16.628 -6.752  1.00 33.09  ? 186  ASN B ND2 1 
ATOM   5613 N N   . VAL B 1 186 ? -20.332 -21.722 -6.540  1.00 32.40  ? 187  VAL B N   1 
ATOM   5614 C CA  . VAL B 1 186 ? -21.469 -22.619 -6.361  1.00 30.78  ? 187  VAL B CA  1 
ATOM   5615 C C   . VAL B 1 186 ? -21.151 -23.723 -5.361  1.00 33.26  ? 187  VAL B C   1 
ATOM   5616 O O   . VAL B 1 186 ? -22.044 -24.177 -4.631  1.00 35.37  ? 187  VAL B O   1 
ATOM   5617 C CB  . VAL B 1 186 ? -21.959 -23.184 -7.711  1.00 25.57  ? 187  VAL B CB  1 
ATOM   5618 C CG1 . VAL B 1 186 ? -21.079 -24.343 -8.214  1.00 22.60  ? 187  VAL B CG1 1 
ATOM   5619 C CG2 . VAL B 1 186 ? -23.416 -23.598 -7.571  1.00 21.52  ? 187  VAL B CG2 1 
ATOM   5620 N N   . ALA B 1 187 ? -19.880 -24.141 -5.267  1.00 32.64  ? 188  ALA B N   1 
ATOM   5621 C CA  . ALA B 1 187 ? -19.523 -25.208 -4.335  1.00 34.47  ? 188  ALA B CA  1 
ATOM   5622 C C   . ALA B 1 187 ? -19.814 -24.824 -2.887  1.00 36.67  ? 188  ALA B C   1 
ATOM   5623 O O   . ALA B 1 187 ? -20.097 -25.700 -2.063  1.00 37.93  ? 188  ALA B O   1 
ATOM   5624 C CB  . ALA B 1 187 ? -18.047 -25.584 -4.494  1.00 28.86  ? 188  ALA B CB  1 
ATOM   5625 N N   . ALA B 1 188 ? -19.746 -23.529 -2.555  1.00 34.63  ? 189  ALA B N   1 
ATOM   5626 C CA  . ALA B 1 188 ? -20.035 -23.097 -1.188  1.00 42.86  ? 189  ALA B CA  1 
ATOM   5627 C C   . ALA B 1 188 ? -21.469 -23.400 -0.782  1.00 40.31  ? 189  ALA B C   1 
ATOM   5628 O O   . ALA B 1 188 ? -21.775 -23.410 0.413   1.00 40.73  ? 189  ALA B O   1 
ATOM   5629 C CB  . ALA B 1 188 ? -19.766 -21.599 -1.025  1.00 26.79  ? 189  ALA B CB  1 
ATOM   5630 N N   . PHE B 1 189 ? -22.351 -23.641 -1.748  1.00 34.62  ? 190  PHE B N   1 
ATOM   5631 C CA  . PHE B 1 189 ? -23.733 -24.010 -1.492  1.00 32.74  ? 190  PHE B CA  1 
ATOM   5632 C C   . PHE B 1 189 ? -23.972 -25.506 -1.628  1.00 34.91  ? 190  PHE B C   1 
ATOM   5633 O O   . PHE B 1 189 ? -25.115 -25.950 -1.481  1.00 33.24  ? 190  PHE B O   1 
ATOM   5634 C CB  . PHE B 1 189 ? -24.664 -23.260 -2.454  1.00 28.59  ? 190  PHE B CB  1 
ATOM   5635 C CG  . PHE B 1 189 ? -24.538 -21.764 -2.379  1.00 32.31  ? 190  PHE B CG  1 
ATOM   5636 C CD1 . PHE B 1 189 ? -23.566 -21.096 -3.112  1.00 34.65  ? 190  PHE B CD1 1 
ATOM   5637 C CD2 . PHE B 1 189 ? -25.395 -21.022 -1.578  1.00 30.60  ? 190  PHE B CD2 1 
ATOM   5638 C CE1 . PHE B 1 189 ? -23.445 -19.712 -3.042  1.00 30.71  ? 190  PHE B CE1 1 
ATOM   5639 C CE2 . PHE B 1 189 ? -25.284 -19.637 -1.505  1.00 33.56  ? 190  PHE B CE2 1 
ATOM   5640 C CZ  . PHE B 1 189 ? -24.308 -18.981 -2.237  1.00 30.90  ? 190  PHE B CZ  1 
ATOM   5641 N N   . GLY B 1 190 ? -22.932 -26.288 -1.914  1.00 32.30  ? 191  GLY B N   1 
ATOM   5642 C CA  . GLY B 1 190 ? -23.092 -27.694 -2.229  1.00 36.18  ? 191  GLY B CA  1 
ATOM   5643 C C   . GLY B 1 190 ? -23.242 -28.015 -3.703  1.00 40.46  ? 191  GLY B C   1 
ATOM   5644 O O   . GLY B 1 190 ? -23.507 -29.175 -4.045  1.00 40.45  ? 191  GLY B O   1 
ATOM   5645 N N   . GLY B 1 191 ? -23.080 -27.037 -4.588  1.00 34.26  ? 192  GLY B N   1 
ATOM   5646 C CA  . GLY B 1 191 ? -23.210 -27.285 -6.009  1.00 35.96  ? 192  GLY B CA  1 
ATOM   5647 C C   . GLY B 1 191 ? -21.925 -27.795 -6.640  1.00 36.23  ? 192  GLY B C   1 
ATOM   5648 O O   . GLY B 1 191 ? -20.825 -27.501 -6.179  1.00 42.87  ? 192  GLY B O   1 
ATOM   5649 N N   . ASP B 1 192 ? -22.089 -28.570 -7.717  1.00 32.17  ? 193  ASP B N   1 
ATOM   5650 C CA  . ASP B 1 192 ? -20.964 -29.113 -8.468  1.00 34.15  ? 193  ASP B CA  1 
ATOM   5651 C C   . ASP B 1 192 ? -20.665 -28.197 -9.646  1.00 34.83  ? 193  ASP B C   1 
ATOM   5652 O O   . ASP B 1 192 ? -21.411 -28.217 -10.633 1.00 37.24  ? 193  ASP B O   1 
ATOM   5653 C CB  . ASP B 1 192 ? -21.283 -30.517 -8.966  1.00 35.48  ? 193  ASP B CB  1 
ATOM   5654 C CG  . ASP B 1 192 ? -20.075 -31.224 -9.571  1.00 39.17  ? 193  ASP B CG  1 
ATOM   5655 O OD1 . ASP B 1 192 ? -20.124 -32.467 -9.671  1.00 47.49  ? 193  ASP B OD1 1 
ATOM   5656 O OD2 . ASP B 1 192 ? -19.079 -30.558 -9.942  1.00 39.73  ? 193  ASP B OD2 1 
ATOM   5657 N N   . PRO B 1 193 ? -19.584 -27.414 -9.614  1.00 32.91  ? 194  PRO B N   1 
ATOM   5658 C CA  . PRO B 1 193 ? -19.273 -26.545 -10.760 1.00 30.76  ? 194  PRO B CA  1 
ATOM   5659 C C   . PRO B 1 193 ? -18.886 -27.297 -12.027 1.00 36.39  ? 194  PRO B C   1 
ATOM   5660 O O   . PRO B 1 193 ? -18.853 -26.677 -13.101 1.00 30.18  ? 194  PRO B O   1 
ATOM   5661 C CB  . PRO B 1 193 ? -18.103 -25.696 -10.246 1.00 32.30  ? 194  PRO B CB  1 
ATOM   5662 C CG  . PRO B 1 193 ? -17.453 -26.553 -9.212  1.00 27.53  ? 194  PRO B CG  1 
ATOM   5663 C CD  . PRO B 1 193 ? -18.579 -27.303 -8.544  1.00 30.86  ? 194  PRO B CD  1 
ATOM   5664 N N   . THR B 1 194 ? -18.586 -28.594 -11.948 1.00 34.54  ? 195  THR B N   1 
ATOM   5665 C CA  . THR B 1 194 ? -18.271 -29.387 -13.133 1.00 36.95  ? 195  THR B CA  1 
ATOM   5666 C C   . THR B 1 194 ? -19.503 -30.057 -13.742 1.00 37.30  ? 195  THR B C   1 
ATOM   5667 O O   . THR B 1 194 ? -19.361 -30.853 -14.675 1.00 40.77  ? 195  THR B O   1 
ATOM   5668 C CB  . THR B 1 194 ? -17.216 -30.451 -12.805 1.00 39.75  ? 195  THR B CB  1 
ATOM   5669 O OG1 . THR B 1 194 ? -17.825 -31.515 -12.066 1.00 39.29  ? 195  THR B OG1 1 
ATOM   5670 C CG2 . THR B 1 194 ? -16.064 -29.860 -11.980 1.00 33.38  ? 195  THR B CG2 1 
ATOM   5671 N N   . SER B 1 195 ? -20.716 -29.738 -13.245 1.00 36.52  ? 196  SER B N   1 
ATOM   5672 C CA  . SER B 1 195 ? -21.977 -30.266 -13.788 1.00 37.69  ? 196  SER B CA  1 
ATOM   5673 C C   . SER B 1 195 ? -23.012 -29.133 -13.773 1.00 33.82  ? 196  SER B C   1 
ATOM   5674 O O   . SER B 1 195 ? -23.885 -29.055 -12.902 1.00 34.72  ? 196  SER B O   1 
ATOM   5675 C CB  . SER B 1 195 ? -22.460 -31.481 -12.994 1.00 40.93  ? 196  SER B CB  1 
ATOM   5676 O OG  . SER B 1 195 ? -23.664 -32.001 -13.538 1.00 48.31  ? 196  SER B OG  1 
ATOM   5677 N N   . VAL B 1 196 ? -22.916 -28.240 -14.752 1.00 26.87  ? 197  VAL B N   1 
ATOM   5678 C CA  . VAL B 1 196 ? -23.791 -27.076 -14.847 1.00 25.56  ? 197  VAL B CA  1 
ATOM   5679 C C   . VAL B 1 196 ? -24.597 -27.192 -16.136 1.00 31.83  ? 197  VAL B C   1 
ATOM   5680 O O   . VAL B 1 196 ? -24.022 -27.321 -17.225 1.00 31.75  ? 197  VAL B O   1 
ATOM   5681 C CB  . VAL B 1 196 ? -22.992 -25.763 -14.803 1.00 22.87  ? 197  VAL B CB  1 
ATOM   5682 C CG1 . VAL B 1 196 ? -23.913 -24.561 -15.068 1.00 20.03  ? 197  VAL B CG1 1 
ATOM   5683 C CG2 . VAL B 1 196 ? -22.289 -25.618 -13.460 1.00 26.50  ? 197  VAL B CG2 1 
ATOM   5684 N N   . THR B 1 197 ? -25.922 -27.137 -16.015 1.00 31.43  ? 198  THR B N   1 
ATOM   5685 C CA  . THR B 1 197 ? -26.832 -27.240 -17.148 1.00 24.58  ? 198  THR B CA  1 
ATOM   5686 C C   . THR B 1 197 ? -27.586 -25.923 -17.298 1.00 26.48  ? 198  THR B C   1 
ATOM   5687 O O   . THR B 1 197 ? -28.359 -25.546 -16.409 1.00 27.80  ? 198  THR B O   1 
ATOM   5688 C CB  . THR B 1 197 ? -27.827 -28.385 -16.949 1.00 28.48  ? 198  THR B CB  1 
ATOM   5689 O OG1 . THR B 1 197 ? -27.128 -29.636 -16.913 1.00 33.06  ? 198  THR B OG1 1 
ATOM   5690 C CG2 . THR B 1 197 ? -28.847 -28.407 -18.101 1.00 22.81  ? 198  THR B CG2 1 
ATOM   5691 N N   . LEU B 1 198 ? -27.491 -25.314 -18.444 1.00 25.20  ? 199  LEU B N   1 
ATOM   5692 C CA  . LEU B 1 198 ? -28.214 -24.121 -18.722 1.00 25.67  ? 199  LEU B CA  1 
ATOM   5693 C C   . LEU B 1 198 ? -29.565 -24.410 -19.332 1.00 28.55  ? 199  LEU B C   1 
ATOM   5694 O O   . LEU B 1 198 ? -29.678 -25.263 -20.153 1.00 33.22  ? 199  LEU B O   1 
ATOM   5695 C CB  . LEU B 1 198 ? -27.448 -23.294 -19.706 1.00 26.39  ? 199  LEU B CB  1 
ATOM   5696 C CG  . LEU B 1 198 ? -26.095 -22.754 -19.364 1.00 38.33  ? 199  LEU B CG  1 
ATOM   5697 C CD1 . LEU B 1 198 ? -25.602 -21.859 -20.452 1.00 33.14  ? 199  LEU B CD1 1 
ATOM   5698 C CD2 . LEU B 1 198 ? -26.200 -21.981 -18.087 1.00 38.52  ? 199  LEU B CD2 1 
ATOM   5699 N N   . PHE B 1 199 ? -30.593 -23.762 -18.819 1.00 23.35  ? 200  PHE B N   1 
ATOM   5700 C CA  . PHE B 1 199 ? -31.922 -23.832 -19.378 1.00 21.11  ? 200  PHE B CA  1 
ATOM   5701 C C   . PHE B 1 199 ? -32.526 -22.438 -19.450 1.00 21.60  ? 200  PHE B C   1 
ATOM   5702 O O   . PHE B 1 199 ? -32.248 -21.599 -18.660 1.00 32.62  ? 200  PHE B O   1 
ATOM   5703 C CB  . PHE B 1 199 ? -32.818 -24.942 -18.809 1.00 27.71  ? 200  PHE B CB  1 
ATOM   5704 C CG  . PHE B 1 199 ? -33.326 -24.728 -17.419 1.00 28.27  ? 200  PHE B CG  1 
ATOM   5705 C CD1 . PHE B 1 199 ? -34.602 -25.035 -17.117 1.00 28.17  ? 200  PHE B CD1 1 
ATOM   5706 C CD2 . PHE B 1 199 ? -32.530 -24.249 -16.434 1.00 26.89  ? 200  PHE B CD2 1 
ATOM   5707 C CE1 . PHE B 1 199 ? -35.093 -24.865 -15.857 1.00 35.10  ? 200  PHE B CE1 1 
ATOM   5708 C CE2 . PHE B 1 199 ? -33.003 -24.085 -15.178 1.00 28.44  ? 200  PHE B CE2 1 
ATOM   5709 C CZ  . PHE B 1 199 ? -34.293 -24.385 -14.887 1.00 27.95  ? 200  PHE B CZ  1 
ATOM   5710 N N   . GLY B 1 200 ? -33.276 -22.209 -20.496 1.00 28.05  ? 201  GLY B N   1 
ATOM   5711 C CA  . GLY B 1 200 ? -33.909 -20.960 -20.780 1.00 23.71  ? 201  GLY B CA  1 
ATOM   5712 C C   . GLY B 1 200 ? -35.043 -21.124 -21.734 1.00 27.35  ? 201  GLY B C   1 
ATOM   5713 O O   . GLY B 1 200 ? -35.096 -22.058 -22.454 1.00 28.91  ? 201  GLY B O   1 
ATOM   5714 N N   . GLU B 1 201 ? -35.913 -20.147 -21.770 1.00 26.70  ? 202  GLU B N   1 
ATOM   5715 C CA  . GLU B 1 201 ? -37.089 -20.187 -22.622 1.00 27.88  ? 202  GLU B CA  1 
ATOM   5716 C C   . GLU B 1 201 ? -37.173 -18.909 -23.450 1.00 32.21  ? 202  GLU B C   1 
ATOM   5717 O O   . GLU B 1 201 ? -36.845 -17.825 -22.959 1.00 29.98  ? 202  GLU B O   1 
ATOM   5718 C CB  . GLU B 1 201 ? -38.341 -20.403 -21.763 1.00 21.20  ? 202  GLU B CB  1 
ATOM   5719 C CG  . GLU B 1 201 ? -39.621 -20.727 -22.514 1.00 24.23  ? 202  GLU B CG  1 
ATOM   5720 C CD  . GLU B 1 201 ? -40.357 -19.479 -22.937 1.00 38.12  ? 202  GLU B CD  1 
ATOM   5721 O OE1 . GLU B 1 201 ? -40.062 -18.406 -22.377 1.00 40.13  ? 202  GLU B OE1 1 
ATOM   5722 O OE2 . GLU B 1 201 ? -41.245 -19.569 -23.810 1.00 46.53  ? 202  GLU B OE2 1 
ATOM   5723 N N   . SER B 1 202 ? -37.588 -19.051 -24.718 1.00 32.98  ? 203  SER B N   1 
ATOM   5724 C CA  . SER B 1 202 ? -37.750 -17.939 -25.670 1.00 27.32  ? 203  SER B CA  1 
ATOM   5725 C C   . SER B 1 202 ? -36.419 -17.195 -25.770 1.00 24.92  ? 203  SER B C   1 
ATOM   5726 O O   . SER B 1 202 ? -35.410 -17.821 -26.141 1.00 29.38  ? 203  SER B O   1 
ATOM   5727 C CB  . SER B 1 202 ? -38.971 -17.110 -25.249 1.00 30.19  ? 203  SER B CB  1 
ATOM   5728 O OG  . SER B 1 202 ? -39.310 -16.112 -26.205 1.00 43.01  ? 203  SER B OG  1 
ATOM   5729 N N   . ALA B 1 203 ? -36.347 -15.899 -25.451 1.00 24.34  ? 204  ALA B N   1 
ATOM   5730 C CA  . ALA B 1 203 ? -35.068 -15.199 -25.524 1.00 25.68  ? 204  ALA B CA  1 
ATOM   5731 C C   . ALA B 1 203 ? -34.046 -15.774 -24.552 1.00 28.06  ? 204  ALA B C   1 
ATOM   5732 O O   . ALA B 1 203 ? -32.837 -15.644 -24.790 1.00 24.38  ? 204  ALA B O   1 
ATOM   5733 C CB  . ALA B 1 203 ? -35.268 -13.703 -25.270 1.00 22.34  ? 204  ALA B CB  1 
ATOM   5734 N N   . GLY B 1 204 ? -34.504 -16.420 -23.475 1.00 21.87  ? 205  GLY B N   1 
ATOM   5735 C CA  . GLY B 1 204 ? -33.589 -17.159 -22.619 1.00 21.27  ? 205  GLY B CA  1 
ATOM   5736 C C   . GLY B 1 204 ? -32.988 -18.370 -23.307 1.00 24.96  ? 205  GLY B C   1 
ATOM   5737 O O   . GLY B 1 204 ? -31.804 -18.674 -23.128 1.00 25.56  ? 205  GLY B O   1 
ATOM   5738 N N   . ALA B 1 205 ? -33.794 -19.081 -24.105 1.00 28.78  ? 206  ALA B N   1 
ATOM   5739 C CA  . ALA B 1 205 ? -33.261 -20.173 -24.917 1.00 29.10  ? 206  ALA B CA  1 
ATOM   5740 C C   . ALA B 1 205 ? -32.306 -19.653 -25.988 1.00 29.72  ? 206  ALA B C   1 
ATOM   5741 O O   . ALA B 1 205 ? -31.252 -20.255 -26.235 1.00 27.61  ? 206  ALA B O   1 
ATOM   5742 C CB  . ALA B 1 205 ? -34.401 -20.967 -25.554 1.00 28.31  ? 206  ALA B CB  1 
ATOM   5743 N N   . ALA B 1 206 ? -32.659 -18.546 -26.645 1.00 31.30  ? 207  ALA B N   1 
ATOM   5744 C CA  . ALA B 1 206 ? -31.722 -17.918 -27.574 1.00 30.50  ? 207  ALA B CA  1 
ATOM   5745 C C   . ALA B 1 206 ? -30.418 -17.556 -26.870 1.00 32.02  ? 207  ALA B C   1 
ATOM   5746 O O   . ALA B 1 206 ? -29.330 -17.736 -27.433 1.00 29.92  ? 207  ALA B O   1 
ATOM   5747 C CB  . ALA B 1 206 ? -32.356 -16.680 -28.209 1.00 21.41  ? 207  ALA B CB  1 
ATOM   5748 N N   . SER B 1 207 ? -30.507 -17.064 -25.629 1.00 25.14  ? 208  SER B N   1 
ATOM   5749 C CA  . SER B 1 207 ? -29.304 -16.775 -24.849 1.00 22.45  ? 208  SER B CA  1 
ATOM   5750 C C   . SER B 1 207 ? -28.471 -18.033 -24.631 1.00 23.77  ? 208  SER B C   1 
ATOM   5751 O O   . SER B 1 207 ? -27.254 -18.028 -24.851 1.00 25.45  ? 208  SER B O   1 
ATOM   5752 C CB  . SER B 1 207 ? -29.684 -16.147 -23.508 1.00 21.40  ? 208  SER B CB  1 
ATOM   5753 O OG  . SER B 1 207 ? -30.295 -14.877 -23.682 1.00 23.67  ? 208  SER B OG  1 
ATOM   5754 N N   . VAL B 1 208 ? -29.109 -19.121 -24.181 1.00 20.89  ? 209  VAL B N   1 
ATOM   5755 C CA  . VAL B 1 208 ? -28.396 -20.389 -24.013 1.00 26.37  ? 209  VAL B CA  1 
ATOM   5756 C C   . VAL B 1 208 ? -27.664 -20.757 -25.299 1.00 29.68  ? 209  VAL B C   1 
ATOM   5757 O O   . VAL B 1 208 ? -26.477 -21.109 -25.284 1.00 28.36  ? 209  VAL B O   1 
ATOM   5758 C CB  . VAL B 1 208 ? -29.364 -21.508 -23.589 1.00 24.43  ? 209  VAL B CB  1 
ATOM   5759 C CG1 . VAL B 1 208 ? -28.654 -22.857 -23.649 1.00 19.97  ? 209  VAL B CG1 1 
ATOM   5760 C CG2 . VAL B 1 208 ? -29.916 -21.251 -22.206 1.00 21.67  ? 209  VAL B CG2 1 
ATOM   5761 N N   . GLY B 1 209 ? -28.364 -20.668 -26.434 1.00 26.99  ? 210  GLY B N   1 
ATOM   5762 C CA  . GLY B 1 209 ? -27.733 -20.991 -27.705 1.00 18.60  ? 210  GLY B CA  1 
ATOM   5763 C C   . GLY B 1 209 ? -26.530 -20.115 -27.996 1.00 28.59  ? 210  GLY B C   1 
ATOM   5764 O O   . GLY B 1 209 ? -25.518 -20.584 -28.527 1.00 30.15  ? 210  GLY B O   1 
ATOM   5765 N N   . MET B 1 210 ? -26.612 -18.835 -27.634 1.00 26.06  ? 211  MET B N   1 
ATOM   5766 C CA  . MET B 1 210 ? -25.511 -17.922 -27.922 1.00 26.58  ? 211  MET B CA  1 
ATOM   5767 C C   . MET B 1 210 ? -24.297 -18.208 -27.054 1.00 32.47  ? 211  MET B C   1 
ATOM   5768 O O   . MET B 1 210 ? -23.159 -18.052 -27.515 1.00 30.21  ? 211  MET B O   1 
ATOM   5769 C CB  . MET B 1 210 ? -25.975 -16.479 -27.753 1.00 28.81  ? 211  MET B CB  1 
ATOM   5770 C CG  . MET B 1 210 ? -26.737 -15.985 -28.972 1.00 35.30  ? 211  MET B CG  1 
ATOM   5771 S SD  . MET B 1 210 ? -27.530 -14.413 -28.682 1.00 45.37  ? 211  MET B SD  1 
ATOM   5772 C CE  . MET B 1 210 ? -28.910 -14.519 -29.830 1.00 39.46  ? 211  MET B CE  1 
ATOM   5773 N N   . HIS B 1 211 ? -24.517 -18.625 -25.802 1.00 24.77  ? 212  HIS B N   1 
ATOM   5774 C CA  . HIS B 1 211 ? -23.412 -19.084 -24.972 1.00 20.56  ? 212  HIS B CA  1 
ATOM   5775 C C   . HIS B 1 211 ? -22.805 -20.377 -25.525 1.00 26.94  ? 212  HIS B C   1 
ATOM   5776 O O   . HIS B 1 211 ? -21.587 -20.587 -25.431 1.00 27.01  ? 212  HIS B O   1 
ATOM   5777 C CB  . HIS B 1 211 ? -23.884 -19.237 -23.512 1.00 20.00  ? 212  HIS B CB  1 
ATOM   5778 C CG  . HIS B 1 211 ? -23.978 -17.933 -22.774 1.00 24.43  ? 212  HIS B CG  1 
ATOM   5779 N ND1 . HIS B 1 211 ? -22.881 -17.167 -22.441 1.00 26.63  ? 212  HIS B ND1 1 
ATOM   5780 C CD2 . HIS B 1 211 ? -25.044 -17.303 -22.233 1.00 26.02  ? 212  HIS B CD2 1 
ATOM   5781 C CE1 . HIS B 1 211 ? -23.277 -16.101 -21.765 1.00 28.67  ? 212  HIS B CE1 1 
ATOM   5782 N NE2 . HIS B 1 211 ? -24.586 -16.165 -21.619 1.00 30.82  ? 212  HIS B NE2 1 
ATOM   5783 N N   . LEU B 1 212 ? -23.628 -21.235 -26.141 1.00 30.72  ? 213  LEU B N   1 
ATOM   5784 C CA  . LEU B 1 212 ? -23.111 -22.431 -26.806 1.00 35.03  ? 213  LEU B CA  1 
ATOM   5785 C C   . LEU B 1 212 ? -22.165 -22.082 -27.945 1.00 36.85  ? 213  LEU B C   1 
ATOM   5786 O O   . LEU B 1 212 ? -21.218 -22.830 -28.223 1.00 42.01  ? 213  LEU B O   1 
ATOM   5787 C CB  . LEU B 1 212 ? -24.263 -23.282 -27.357 1.00 38.07  ? 213  LEU B CB  1 
ATOM   5788 C CG  . LEU B 1 212 ? -24.919 -24.281 -26.406 1.00 44.96  ? 213  LEU B CG  1 
ATOM   5789 C CD1 . LEU B 1 212 ? -26.092 -24.983 -27.084 1.00 41.89  ? 213  LEU B CD1 1 
ATOM   5790 C CD2 . LEU B 1 212 ? -23.896 -25.291 -25.906 1.00 44.45  ? 213  LEU B CD2 1 
ATOM   5791 N N   . LEU B 1 213 ? -22.406 -20.966 -28.622 1.00 32.79  ? 214  LEU B N   1 
ATOM   5792 C CA  . LEU B 1 213 ? -21.630 -20.594 -29.792 1.00 33.17  ? 214  LEU B CA  1 
ATOM   5793 C C   . LEU B 1 213 ? -20.591 -19.517 -29.505 1.00 36.96  ? 214  LEU B C   1 
ATOM   5794 O O   . LEU B 1 213 ? -19.955 -19.024 -30.442 1.00 40.14  ? 214  LEU B O   1 
ATOM   5795 C CB  . LEU B 1 213 ? -22.563 -20.152 -30.917 1.00 29.29  ? 214  LEU B CB  1 
ATOM   5796 C CG  . LEU B 1 213 ? -23.689 -21.146 -31.225 1.00 34.18  ? 214  LEU B CG  1 
ATOM   5797 C CD1 . LEU B 1 213 ? -24.848 -20.454 -31.912 1.00 27.81  ? 214  LEU B CD1 1 
ATOM   5798 C CD2 . LEU B 1 213 ? -23.186 -22.326 -32.059 1.00 27.62  ? 214  LEU B CD2 1 
ATOM   5799 N N   . SER B 1 214 ? -20.394 -19.154 -28.242 1.00 30.80  ? 215  SER B N   1 
ATOM   5800 C CA  . SER B 1 214 ? -19.370 -18.182 -27.857 1.00 29.03  ? 215  SER B CA  1 
ATOM   5801 C C   . SER B 1 214 ? -18.344 -18.877 -26.975 1.00 37.31  ? 215  SER B C   1 
ATOM   5802 O O   . SER B 1 214 ? -18.664 -19.235 -25.824 1.00 35.18  ? 215  SER B O   1 
ATOM   5803 C CB  . SER B 1 214 ? -19.995 -16.992 -27.131 1.00 32.26  ? 215  SER B CB  1 
ATOM   5804 O OG  . SER B 1 214 ? -19.073 -15.925 -27.026 1.00 35.18  ? 215  SER B OG  1 
ATOM   5805 N N   . PRO B 1 215 ? -17.124 -19.095 -27.461 1.00 35.15  ? 216  PRO B N   1 
ATOM   5806 C CA  . PRO B 1 215 ? -16.152 -19.952 -26.740 1.00 35.41  ? 216  PRO B CA  1 
ATOM   5807 C C   . PRO B 1 215 ? -15.855 -19.486 -25.319 1.00 41.20  ? 216  PRO B C   1 
ATOM   5808 O O   . PRO B 1 215 ? -15.673 -20.335 -24.433 1.00 44.01  ? 216  PRO B O   1 
ATOM   5809 C CB  . PRO B 1 215 ? -14.903 -19.886 -27.633 1.00 37.48  ? 216  PRO B CB  1 
ATOM   5810 C CG  . PRO B 1 215 ? -15.470 -19.674 -29.027 1.00 33.12  ? 216  PRO B CG  1 
ATOM   5811 C CD  . PRO B 1 215 ? -16.686 -18.791 -28.837 1.00 32.96  ? 216  PRO B CD  1 
ATOM   5812 N N   . PRO B 1 216 ? -15.773 -18.177 -25.037 1.00 37.77  ? 217  PRO B N   1 
ATOM   5813 C CA  . PRO B 1 216 ? -15.576 -17.766 -23.630 1.00 37.80  ? 217  PRO B CA  1 
ATOM   5814 C C   . PRO B 1 216 ? -16.679 -18.229 -22.696 1.00 41.44  ? 217  PRO B C   1 
ATOM   5815 O O   . PRO B 1 216 ? -16.445 -18.340 -21.487 1.00 37.71  ? 217  PRO B O   1 
ATOM   5816 C CB  . PRO B 1 216 ? -15.522 -16.237 -23.708 1.00 34.92  ? 217  PRO B CB  1 
ATOM   5817 C CG  . PRO B 1 216 ? -15.043 -15.961 -25.071 1.00 37.64  ? 217  PRO B CG  1 
ATOM   5818 C CD  . PRO B 1 216 ? -15.641 -17.021 -25.943 1.00 36.01  ? 217  PRO B CD  1 
ATOM   5819 N N   . SER B 1 217 ? -17.870 -18.508 -23.212 1.00 35.83  ? 218  SER B N   1 
ATOM   5820 C CA  . SER B 1 217 ? -18.950 -19.015 -22.383 1.00 33.52  ? 218  SER B CA  1 
ATOM   5821 C C   . SER B 1 217 ? -18.999 -20.530 -22.347 1.00 39.68  ? 218  SER B C   1 
ATOM   5822 O O   . SER B 1 217 ? -19.598 -21.102 -21.429 1.00 40.52  ? 218  SER B O   1 
ATOM   5823 C CB  . SER B 1 217 ? -20.282 -18.489 -22.904 1.00 26.93  ? 218  SER B CB  1 
ATOM   5824 O OG  . SER B 1 217 ? -20.310 -17.082 -22.771 1.00 32.74  ? 218  SER B OG  1 
ATOM   5825 N N   . ARG B 1 218 ? -18.365 -21.184 -23.315 1.00 38.86  ? 219  ARG B N   1 
ATOM   5826 C CA  A ARG B 1 218 ? -18.531 -22.623 -23.450 0.63 44.42  ? 219  ARG B CA  1 
ATOM   5827 C CA  B ARG B 1 218 ? -18.506 -22.626 -23.463 0.37 44.55  ? 219  ARG B CA  1 
ATOM   5828 C C   . ARG B 1 218 ? -17.868 -23.382 -22.305 1.00 44.03  ? 219  ARG B C   1 
ATOM   5829 O O   . ARG B 1 218 ? -18.327 -24.472 -21.945 1.00 41.34  ? 219  ARG B O   1 
ATOM   5830 C CB  A ARG B 1 218 ? -17.989 -23.074 -24.806 0.63 48.07  ? 219  ARG B CB  1 
ATOM   5831 C CB  B ARG B 1 218 ? -17.897 -23.064 -24.795 0.37 48.06  ? 219  ARG B CB  1 
ATOM   5832 C CG  A ARG B 1 218 ? -18.350 -24.498 -25.186 0.63 49.70  ? 219  ARG B CG  1 
ATOM   5833 C CG  B ARG B 1 218 ? -18.407 -24.393 -25.307 0.37 49.24  ? 219  ARG B CG  1 
ATOM   5834 C CD  A ARG B 1 218 ? -19.850 -24.743 -25.152 0.63 47.38  ? 219  ARG B CD  1 
ATOM   5835 C CD  B ARG B 1 218 ? -19.838 -24.286 -25.793 0.37 47.29  ? 219  ARG B CD  1 
ATOM   5836 N NE  A ARG B 1 218 ? -20.154 -26.170 -25.202 0.63 45.97  ? 219  ARG B NE  1 
ATOM   5837 N NE  B ARG B 1 218 ? -20.311 -25.538 -26.378 0.37 46.92  ? 219  ARG B NE  1 
ATOM   5838 C CZ  A ARG B 1 218 ? -20.321 -26.939 -24.131 0.63 42.35  ? 219  ARG B CZ  1 
ATOM   5839 C CZ  B ARG B 1 218 ? -20.136 -25.882 -27.650 0.37 41.97  ? 219  ARG B CZ  1 
ATOM   5840 N NH1 A ARG B 1 218 ? -20.220 -26.420 -22.913 0.63 29.73  ? 219  ARG B NH1 1 
ATOM   5841 N NH1 B ARG B 1 218 ? -19.497 -25.068 -28.478 0.37 38.10  ? 219  ARG B NH1 1 
ATOM   5842 N NH2 A ARG B 1 218 ? -20.589 -28.230 -24.279 0.63 44.57  ? 219  ARG B NH2 1 
ATOM   5843 N NH2 B ARG B 1 218 ? -20.602 -27.039 -28.098 0.37 41.63  ? 219  ARG B NH2 1 
ATOM   5844 N N   . GLY B 1 219 ? -16.812 -22.830 -21.711 1.00 38.52  ? 220  GLY B N   1 
ATOM   5845 C CA  . GLY B 1 219 ? -16.176 -23.486 -20.587 1.00 31.14  ? 220  GLY B CA  1 
ATOM   5846 C C   . GLY B 1 219 ? -16.883 -23.330 -19.258 1.00 39.80  ? 220  GLY B C   1 
ATOM   5847 O O   . GLY B 1 219 ? -16.396 -23.841 -18.247 1.00 51.33  ? 220  GLY B O   1 
ATOM   5848 N N   . LEU B 1 220 ? -18.029 -22.654 -19.224 1.00 34.97  ? 221  LEU B N   1 
ATOM   5849 C CA  . LEU B 1 220 ? -18.732 -22.374 -17.981 1.00 38.32  ? 221  LEU B CA  1 
ATOM   5850 C C   . LEU B 1 220 ? -19.933 -23.281 -17.744 1.00 38.35  ? 221  LEU B C   1 
ATOM   5851 O O   . LEU B 1 220 ? -20.625 -23.108 -16.738 1.00 36.78  ? 221  LEU B O   1 
ATOM   5852 C CB  . LEU B 1 220 ? -19.185 -20.908 -17.956 1.00 31.69  ? 221  LEU B CB  1 
ATOM   5853 C CG  . LEU B 1 220 ? -18.099 -19.893 -18.315 1.00 34.49  ? 221  LEU B CG  1 
ATOM   5854 C CD1 . LEU B 1 220 ? -18.634 -18.474 -18.244 1.00 34.41  ? 221  LEU B CD1 1 
ATOM   5855 C CD2 . LEU B 1 220 ? -16.926 -20.065 -17.374 1.00 21.89  ? 221  LEU B CD2 1 
ATOM   5856 N N   . PHE B 1 221 ? -20.207 -24.229 -18.635 1.00 32.30  ? 222  PHE B N   1 
ATOM   5857 C CA  . PHE B 1 221 ? -21.330 -25.140 -18.446 1.00 32.92  ? 222  PHE B CA  1 
ATOM   5858 C C   . PHE B 1 221 ? -21.085 -26.384 -19.291 1.00 31.08  ? 222  PHE B C   1 
ATOM   5859 O O   . PHE B 1 221 ? -20.106 -26.473 -20.036 1.00 30.83  ? 222  PHE B O   1 
ATOM   5860 C CB  . PHE B 1 221 ? -22.662 -24.462 -18.785 1.00 29.55  ? 222  PHE B CB  1 
ATOM   5861 C CG  . PHE B 1 221 ? -22.817 -24.098 -20.244 1.00 30.66  ? 222  PHE B CG  1 
ATOM   5862 C CD1 . PHE B 1 221 ? -22.190 -22.971 -20.765 1.00 28.07  ? 222  PHE B CD1 1 
ATOM   5863 C CD2 . PHE B 1 221 ? -23.617 -24.866 -21.086 1.00 30.38  ? 222  PHE B CD2 1 
ATOM   5864 C CE1 . PHE B 1 221 ? -22.338 -22.623 -22.114 1.00 32.06  ? 222  PHE B CE1 1 
ATOM   5865 C CE2 . PHE B 1 221 ? -23.780 -24.523 -22.434 1.00 34.93  ? 222  PHE B CE2 1 
ATOM   5866 C CZ  . PHE B 1 221 ? -23.138 -23.400 -22.947 1.00 35.07  ? 222  PHE B CZ  1 
ATOM   5867 N N   . HIS B 1 222 ? -21.986 -27.356 -19.171 1.00 27.45  ? 223  HIS B N   1 
ATOM   5868 C CA  . HIS B 1 222 ? -21.707 -28.662 -19.752 1.00 32.28  ? 223  HIS B CA  1 
ATOM   5869 C C   . HIS B 1 222 ? -22.867 -29.194 -20.579 1.00 32.03  ? 223  HIS B C   1 
ATOM   5870 O O   . HIS B 1 222 ? -22.661 -29.999 -21.492 1.00 40.27  ? 223  HIS B O   1 
ATOM   5871 C CB  . HIS B 1 222 ? -21.332 -29.634 -18.634 1.00 35.56  ? 223  HIS B CB  1 
ATOM   5872 C CG  . HIS B 1 222 ? -20.309 -29.074 -17.697 1.00 47.86  ? 223  HIS B CG  1 
ATOM   5873 N ND1 . HIS B 1 222 ? -20.642 -28.264 -16.630 1.00 44.80  ? 223  HIS B ND1 1 
ATOM   5874 C CD2 . HIS B 1 222 ? -18.958 -29.157 -17.701 1.00 41.10  ? 223  HIS B CD2 1 
ATOM   5875 C CE1 . HIS B 1 222 ? -19.541 -27.891 -16.005 1.00 37.42  ? 223  HIS B CE1 1 
ATOM   5876 N NE2 . HIS B 1 222 ? -18.506 -28.422 -16.632 1.00 44.86  ? 223  HIS B NE2 1 
ATOM   5877 N N   . ARG B 1 223 ? -24.082 -28.753 -20.275 1.00 30.32  ? 224  ARG B N   1 
ATOM   5878 C CA  . ARG B 1 223 ? -25.270 -29.198 -20.984 1.00 31.36  ? 224  ARG B CA  1 
ATOM   5879 C C   . ARG B 1 223 ? -26.192 -28.005 -21.170 1.00 29.27  ? 224  ARG B C   1 
ATOM   5880 O O   . ARG B 1 223 ? -26.059 -26.989 -20.487 1.00 31.83  ? 224  ARG B O   1 
ATOM   5881 C CB  . ARG B 1 223 ? -25.985 -30.326 -20.230 1.00 31.74  ? 224  ARG B CB  1 
ATOM   5882 C CG  . ARG B 1 223 ? -25.280 -31.654 -20.334 1.00 34.85  ? 224  ARG B CG  1 
ATOM   5883 C CD  . ARG B 1 223 ? -25.884 -32.692 -19.401 1.00 42.99  ? 224  ARG B CD  1 
ATOM   5884 N NE  . ARG B 1 223 ? -25.469 -32.489 -18.020 1.00 54.81  ? 224  ARG B NE  1 
ATOM   5885 C CZ  . ARG B 1 223 ? -24.285 -32.848 -17.537 1.00 62.16  ? 224  ARG B CZ  1 
ATOM   5886 N NH1 . ARG B 1 223 ? -23.396 -33.434 -18.330 1.00 64.21  ? 224  ARG B NH1 1 
ATOM   5887 N NH2 . ARG B 1 223 ? -23.989 -32.619 -16.264 1.00 61.17  ? 224  ARG B NH2 1 
ATOM   5888 N N   . ALA B 1 224 ? -27.134 -28.131 -22.103 1.00 26.03  ? 225  ALA B N   1 
ATOM   5889 C CA  . ALA B 1 224 ? -27.980 -27.005 -22.464 1.00 25.31  ? 225  ALA B CA  1 
ATOM   5890 C C   . ALA B 1 224 ? -29.395 -27.470 -22.774 1.00 29.42  ? 225  ALA B C   1 
ATOM   5891 O O   . ALA B 1 224 ? -29.599 -28.514 -23.400 1.00 26.63  ? 225  ALA B O   1 
ATOM   5892 C CB  . ALA B 1 224 ? -27.406 -26.250 -23.668 1.00 26.25  ? 225  ALA B CB  1 
ATOM   5893 N N   . VAL B 1 225 ? -30.368 -26.677 -22.333 1.00 20.55  ? 226  VAL B N   1 
ATOM   5894 C CA  . VAL B 1 225 ? -31.776 -26.886 -22.639 1.00 21.42  ? 226  VAL B CA  1 
ATOM   5895 C C   . VAL B 1 225 ? -32.314 -25.606 -23.257 1.00 26.04  ? 226  VAL B C   1 
ATOM   5896 O O   . VAL B 1 225 ? -32.167 -24.526 -22.674 1.00 25.50  ? 226  VAL B O   1 
ATOM   5897 C CB  . VAL B 1 225 ? -32.591 -27.257 -21.388 1.00 25.05  ? 226  VAL B CB  1 
ATOM   5898 C CG1 . VAL B 1 225 ? -34.013 -27.680 -21.766 1.00 24.53  ? 226  VAL B CG1 1 
ATOM   5899 C CG2 . VAL B 1 225 ? -31.874 -28.341 -20.589 1.00 20.81  ? 226  VAL B CG2 1 
ATOM   5900 N N   . LEU B 1 226 ? -32.931 -25.729 -24.432 1.00 20.60  ? 227  LEU B N   1 
ATOM   5901 C CA  . LEU B 1 226 ? -33.508 -24.602 -25.157 1.00 28.90  ? 227  LEU B CA  1 
ATOM   5902 C C   . LEU B 1 226 ? -34.997 -24.860 -25.356 1.00 28.84  ? 227  LEU B C   1 
ATOM   5903 O O   . LEU B 1 226 ? -35.378 -25.823 -26.029 1.00 34.82  ? 227  LEU B O   1 
ATOM   5904 C CB  . LEU B 1 226 ? -32.811 -24.405 -26.505 1.00 27.25  ? 227  LEU B CB  1 
ATOM   5905 C CG  . LEU B 1 226 ? -31.347 -23.960 -26.463 1.00 30.37  ? 227  LEU B CG  1 
ATOM   5906 C CD1 . LEU B 1 226 ? -30.408 -25.155 -26.303 1.00 22.96  ? 227  LEU B CD1 1 
ATOM   5907 C CD2 . LEU B 1 226 ? -31.014 -23.179 -27.723 1.00 29.53  ? 227  LEU B CD2 1 
ATOM   5908 N N   . GLN B 1 227 ? -35.834 -23.997 -24.783 1.00 23.58  ? 228  GLN B N   1 
ATOM   5909 C CA  . GLN B 1 227 ? -37.286 -24.156 -24.817 1.00 25.54  ? 228  GLN B CA  1 
ATOM   5910 C C   . GLN B 1 227 ? -37.882 -22.966 -25.568 1.00 26.64  ? 228  GLN B C   1 
ATOM   5911 O O   . GLN B 1 227 ? -37.766 -21.824 -25.113 1.00 28.95  ? 228  GLN B O   1 
ATOM   5912 C CB  . GLN B 1 227 ? -37.840 -24.264 -23.388 1.00 26.90  ? 228  GLN B CB  1 
ATOM   5913 C CG  . GLN B 1 227 ? -36.924 -25.034 -22.429 1.00 28.20  ? 228  GLN B CG  1 
ATOM   5914 C CD  . GLN B 1 227 ? -37.353 -24.956 -20.951 1.00 46.32  ? 228  GLN B CD  1 
ATOM   5915 O OE1 . GLN B 1 227 ? -36.679 -25.500 -20.070 1.00 55.63  ? 228  GLN B OE1 1 
ATOM   5916 N NE2 . GLN B 1 227 ? -38.458 -24.274 -20.678 1.00 41.16  ? 228  GLN B NE2 1 
ATOM   5917 N N   . SER B 1 228 ? -38.484 -23.226 -26.738 1.00 29.76  ? 229  SER B N   1 
ATOM   5918 C CA  . SER B 1 228 ? -39.219 -22.207 -27.510 1.00 25.34  ? 229  SER B CA  1 
ATOM   5919 C C   . SER B 1 228 ? -38.336 -21.028 -27.879 1.00 25.40  ? 229  SER B C   1 
ATOM   5920 O O   . SER B 1 228 ? -38.768 -19.875 -27.863 1.00 33.15  ? 229  SER B O   1 
ATOM   5921 C CB  . SER B 1 228 ? -40.466 -21.733 -26.764 1.00 29.01  ? 229  SER B CB  1 
ATOM   5922 O OG  . SER B 1 228 ? -41.297 -22.838 -26.452 1.00 26.17  ? 229  SER B OG  1 
ATOM   5923 N N   . GLY B 1 229 ? -37.098 -21.326 -28.235 1.00 22.31  ? 230  GLY B N   1 
ATOM   5924 C CA  . GLY B 1 229 ? -36.176 -20.294 -28.644 1.00 29.74  ? 230  GLY B CA  1 
ATOM   5925 C C   . GLY B 1 229 ? -34.918 -20.918 -29.189 1.00 30.73  ? 230  GLY B C   1 
ATOM   5926 O O   . GLY B 1 229 ? -34.575 -22.060 -28.868 1.00 31.89  ? 230  GLY B O   1 
ATOM   5927 N N   . ALA B 1 230 ? -34.235 -20.147 -30.024 1.00 23.28  ? 231  ALA B N   1 
ATOM   5928 C CA  . ALA B 1 230 ? -33.001 -20.597 -30.642 1.00 27.00  ? 231  ALA B CA  1 
ATOM   5929 C C   . ALA B 1 230 ? -32.217 -19.359 -31.033 1.00 30.57  ? 231  ALA B C   1 
ATOM   5930 O O   . ALA B 1 230 ? -32.821 -18.328 -31.347 1.00 25.30  ? 231  ALA B O   1 
ATOM   5931 C CB  . ALA B 1 230 ? -33.286 -21.484 -31.863 1.00 20.61  ? 231  ALA B CB  1 
ATOM   5932 N N   . PRO B 1 231 ? -30.884 -19.408 -30.995 1.00 30.07  ? 232  PRO B N   1 
ATOM   5933 C CA  . PRO B 1 231 ? -30.108 -18.213 -31.348 1.00 25.23  ? 232  PRO B CA  1 
ATOM   5934 C C   . PRO B 1 231 ? -30.236 -17.828 -32.809 1.00 32.03  ? 232  PRO B C   1 
ATOM   5935 O O   . PRO B 1 231 ? -29.966 -16.667 -33.145 1.00 27.11  ? 232  PRO B O   1 
ATOM   5936 C CB  . PRO B 1 231 ? -28.671 -18.615 -30.993 1.00 26.61  ? 232  PRO B CB  1 
ATOM   5937 C CG  . PRO B 1 231 ? -28.664 -20.105 -31.159 1.00 29.21  ? 232  PRO B CG  1 
ATOM   5938 C CD  . PRO B 1 231 ? -30.016 -20.548 -30.655 1.00 30.93  ? 232  PRO B CD  1 
ATOM   5939 N N   . ASN B 1 232 ? -30.639 -18.758 -33.683 1.00 27.82  ? 233  ASN B N   1 
ATOM   5940 C CA  . ASN B 1 232 ? -30.878 -18.468 -35.094 1.00 25.76  ? 233  ASN B CA  1 
ATOM   5941 C C   . ASN B 1 232 ? -32.300 -17.984 -35.378 1.00 31.44  ? 233  ASN B C   1 
ATOM   5942 O O   . ASN B 1 232 ? -32.674 -17.861 -36.548 1.00 28.83  ? 233  ASN B O   1 
ATOM   5943 C CB  . ASN B 1 232 ? -30.582 -19.706 -35.951 1.00 22.82  ? 233  ASN B CB  1 
ATOM   5944 C CG  . ASN B 1 232 ? -31.212 -20.964 -35.389 1.00 30.34  ? 233  ASN B CG  1 
ATOM   5945 O OD1 . ASN B 1 232 ? -31.123 -21.225 -34.196 1.00 30.05  ? 233  ASN B OD1 1 
ATOM   5946 N ND2 . ASN B 1 232 ? -31.849 -21.747 -36.243 1.00 28.85  ? 233  ASN B ND2 1 
ATOM   5947 N N   . GLY B 1 233 ? -33.106 -17.716 -34.351 1.00 36.10  ? 234  GLY B N   1 
ATOM   5948 C CA  . GLY B 1 233 ? -34.410 -17.132 -34.565 1.00 39.42  ? 234  GLY B CA  1 
ATOM   5949 C C   . GLY B 1 233 ? -34.309 -15.769 -35.226 1.00 39.96  ? 234  GLY B C   1 
ATOM   5950 O O   . GLY B 1 233 ? -33.372 -15.005 -34.977 1.00 41.47  ? 234  GLY B O   1 
ATOM   5951 N N   . PRO B 1 234 ? -35.257 -15.417 -36.070 1.00 39.55  ? 235  PRO B N   1 
ATOM   5952 C CA  . PRO B 1 234 ? -35.201 -14.167 -36.806 1.00 36.22  ? 235  PRO B CA  1 
ATOM   5953 C C   . PRO B 1 234 ? -35.229 -12.936 -35.937 1.00 38.08  ? 235  PRO B C   1 
ATOM   5954 O O   . PRO B 1 234 ? -34.759 -11.917 -36.317 1.00 39.40  ? 235  PRO B O   1 
ATOM   5955 C CB  . PRO B 1 234 ? -36.397 -14.244 -37.735 1.00 31.26  ? 235  PRO B CB  1 
ATOM   5956 C CG  . PRO B 1 234 ? -37.266 -15.250 -37.179 1.00 46.62  ? 235  PRO B CG  1 
ATOM   5957 C CD  . PRO B 1 234 ? -36.413 -16.214 -36.453 1.00 41.46  ? 235  PRO B CD  1 
ATOM   5958 N N   . TRP B 1 235 ? -35.779 -13.057 -34.765 1.00 31.49  ? 236  TRP B N   1 
ATOM   5959 C CA  . TRP B 1 235 ? -35.879 -11.968 -33.828 1.00 32.91  ? 236  TRP B CA  1 
ATOM   5960 C C   . TRP B 1 235 ? -34.739 -11.854 -32.832 1.00 37.26  ? 236  TRP B C   1 
ATOM   5961 O O   . TRP B 1 235 ? -34.675 -10.930 -32.104 1.00 37.71  ? 236  TRP B O   1 
ATOM   5962 C CB  . TRP B 1 235 ? -37.140 -12.193 -33.007 1.00 31.99  ? 236  TRP B CB  1 
ATOM   5963 C CG  . TRP B 1 235 ? -37.278 -13.612 -32.498 1.00 35.62  ? 236  TRP B CG  1 
ATOM   5964 C CD1 . TRP B 1 235 ? -37.935 -14.582 -33.079 1.00 33.27  ? 236  TRP B CD1 1 
ATOM   5965 C CD2 . TRP B 1 235 ? -36.710 -14.164 -31.322 1.00 27.49  ? 236  TRP B CD2 1 
ATOM   5966 N NE1 . TRP B 1 235 ? -37.845 -15.716 -32.375 1.00 31.21  ? 236  TRP B NE1 1 
ATOM   5967 C CE2 . TRP B 1 235 ? -37.067 -15.493 -31.291 1.00 30.91  ? 236  TRP B CE2 1 
ATOM   5968 C CE3 . TRP B 1 235 ? -35.896 -13.669 -30.321 1.00 28.38  ? 236  TRP B CE3 1 
ATOM   5969 C CZ2 . TRP B 1 235 ? -36.686 -16.332 -30.278 1.00 30.15  ? 236  TRP B CZ2 1 
ATOM   5970 C CZ3 . TRP B 1 235 ? -35.521 -14.482 -29.336 1.00 31.36  ? 236  TRP B CZ3 1 
ATOM   5971 C CH2 . TRP B 1 235 ? -35.909 -15.805 -29.308 1.00 30.30  ? 236  TRP B CH2 1 
ATOM   5972 N N   . ALA B 1 236 ? -33.794 -12.755 -32.880 1.00 31.74  ? 237  ALA B N   1 
ATOM   5973 C CA  . ALA B 1 236 ? -32.823 -12.909 -31.804 1.00 34.45  ? 237  ALA B CA  1 
ATOM   5974 C C   . ALA B 1 236 ? -31.544 -12.101 -31.991 1.00 31.95  ? 237  ALA B C   1 
ATOM   5975 O O   . ALA B 1 236 ? -30.850 -11.845 -31.001 1.00 28.23  ? 237  ALA B O   1 
ATOM   5976 C CB  . ALA B 1 236 ? -32.454 -14.388 -31.640 1.00 32.03  ? 237  ALA B CB  1 
ATOM   5977 N N   . THR B 1 237 ? -31.198 -11.711 -33.218 1.00 26.61  ? 238  THR B N   1 
ATOM   5978 C CA  . THR B 1 237 ? -29.953 -10.999 -33.468 1.00 31.13  ? 238  THR B CA  1 
ATOM   5979 C C   . THR B 1 237 ? -30.208 -9.847  -34.427 1.00 32.15  ? 238  THR B C   1 
ATOM   5980 O O   . THR B 1 237 ? -31.239 -9.782  -35.103 1.00 35.23  ? 238  THR B O   1 
ATOM   5981 C CB  . THR B 1 237 ? -28.850 -11.915 -34.041 1.00 29.69  ? 238  THR B CB  1 
ATOM   5982 O OG1 . THR B 1 237 ? -29.353 -12.648 -35.164 1.00 33.46  ? 238  THR B OG1 1 
ATOM   5983 C CG2 . THR B 1 237 ? -28.353 -12.895 -32.987 1.00 34.06  ? 238  THR B CG2 1 
ATOM   5984 N N   . VAL B 1 238 ? -29.239 -8.935  -34.489 1.00 34.36  ? 239  VAL B N   1 
ATOM   5985 C CA  . VAL B 1 238 ? -29.286 -7.800  -35.401 1.00 36.49  ? 239  VAL B CA  1 
ATOM   5986 C C   . VAL B 1 238 ? -27.875 -7.537  -35.917 1.00 36.98  ? 239  VAL B C   1 
ATOM   5987 O O   . VAL B 1 238 ? -26.883 -7.806  -35.232 1.00 34.02  ? 239  VAL B O   1 
ATOM   5988 C CB  . VAL B 1 238 ? -29.900 -6.552  -34.710 1.00 36.92  ? 239  VAL B CB  1 
ATOM   5989 C CG1 . VAL B 1 238 ? -28.954 -5.968  -33.663 1.00 32.00  ? 239  VAL B CG1 1 
ATOM   5990 C CG2 . VAL B 1 238 ? -30.280 -5.513  -35.723 1.00 37.63  ? 239  VAL B CG2 1 
ATOM   5991 N N   . GLY B 1 239 ? -27.789 -7.041  -37.162 1.00 40.41  ? 240  GLY B N   1 
ATOM   5992 C CA  . GLY B 1 239 ? -26.508 -6.672  -37.730 1.00 32.36  ? 240  GLY B CA  1 
ATOM   5993 C C   . GLY B 1 239 ? -25.986 -5.351  -37.185 1.00 43.22  ? 240  GLY B C   1 
ATOM   5994 O O   . GLY B 1 239 ? -26.720 -4.561  -36.588 1.00 42.82  ? 240  GLY B O   1 
ATOM   5995 N N   . MET B 1 240 ? -24.686 -5.115  -37.408 1.00 43.55  ? 241  MET B N   1 
ATOM   5996 C CA  . MET B 1 240 ? -24.030 -3.940  -36.838 1.00 38.46  ? 241  MET B CA  1 
ATOM   5997 C C   . MET B 1 240 ? -24.631 -2.648  -37.374 1.00 43.62  ? 241  MET B C   1 
ATOM   5998 O O   . MET B 1 240 ? -24.846 -1.693  -36.618 1.00 41.78  ? 241  MET B O   1 
ATOM   5999 C CB  . MET B 1 240 ? -22.533 -3.972  -37.131 1.00 43.07  ? 241  MET B CB  1 
ATOM   6000 C CG  . MET B 1 240 ? -21.741 -4.960  -36.305 1.00 48.58  ? 241  MET B CG  1 
ATOM   6001 S SD  . MET B 1 240 ? -20.078 -5.131  -36.981 1.00 59.19  ? 241  MET B SD  1 
ATOM   6002 C CE  . MET B 1 240 ? -19.110 -4.233  -35.783 1.00 65.00  ? 241  MET B CE  1 
ATOM   6003 N N   . GLY B 1 241 ? -24.893 -2.596  -38.680 1.00 41.30  ? 242  GLY B N   1 
ATOM   6004 C CA  . GLY B 1 241 ? -25.429 -1.380  -39.267 1.00 41.32  ? 242  GLY B CA  1 
ATOM   6005 C C   . GLY B 1 241 ? -26.822 -1.058  -38.763 1.00 43.39  ? 242  GLY B C   1 
ATOM   6006 O O   . GLY B 1 241 ? -27.147 0.104   -38.505 1.00 42.26  ? 242  GLY B O   1 
ATOM   6007 N N   . GLU B 1 242 ? -27.662 -2.082  -38.603 1.00 38.39  ? 243  GLU B N   1 
ATOM   6008 C CA  . GLU B 1 242 ? -29.011 -1.832  -38.113 1.00 39.84  ? 243  GLU B CA  1 
ATOM   6009 C C   . GLU B 1 242 ? -28.992 -1.485  -36.628 1.00 39.79  ? 243  GLU B C   1 
ATOM   6010 O O   . GLU B 1 242 ? -29.742 -0.610  -36.181 1.00 38.35  ? 243  GLU B O   1 
ATOM   6011 C CB  . GLU B 1 242 ? -29.910 -3.038  -38.405 1.00 36.67  ? 243  GLU B CB  1 
ATOM   6012 C CG  . GLU B 1 242 ? -31.293 -2.972  -37.760 1.00 47.17  ? 243  GLU B CG  1 
ATOM   6013 C CD  . GLU B 1 242 ? -32.235 -1.986  -38.431 1.00 53.37  ? 243  GLU B CD  1 
ATOM   6014 O OE1 . GLU B 1 242 ? -33.319 -1.725  -37.865 1.00 55.13  ? 243  GLU B OE1 1 
ATOM   6015 O OE2 . GLU B 1 242 ? -31.895 -1.466  -39.514 1.00 60.91  ? 243  GLU B OE2 1 
ATOM   6016 N N   . ALA B 1 243 ? -28.118 -2.133  -35.855 1.00 41.09  ? 244  ALA B N   1 
ATOM   6017 C CA  . ALA B 1 243 ? -27.998 -1.790  -34.440 1.00 38.12  ? 244  ALA B CA  1 
ATOM   6018 C C   . ALA B 1 243 ? -27.571 -0.337  -34.264 1.00 40.05  ? 244  ALA B C   1 
ATOM   6019 O O   . ALA B 1 243 ? -28.115 0.375   -33.412 1.00 38.87  ? 244  ALA B O   1 
ATOM   6020 C CB  . ALA B 1 243 ? -27.015 -2.733  -33.744 1.00 31.01  ? 244  ALA B CB  1 
ATOM   6021 N N   . ARG B 1 244 ? -26.613 0.125   -35.075 1.00 42.70  ? 245  ARG B N   1 
ATOM   6022 C CA  . ARG B 1 244 ? -26.194 1.524   -35.009 1.00 45.14  ? 245  ARG B CA  1 
ATOM   6023 C C   . ARG B 1 244 ? -27.335 2.459   -35.384 1.00 44.41  ? 245  ARG B C   1 
ATOM   6024 O O   . ARG B 1 244 ? -27.514 3.514   -34.764 1.00 43.17  ? 245  ARG B O   1 
ATOM   6025 C CB  . ARG B 1 244 ? -24.992 1.768   -35.925 1.00 43.81  ? 245  ARG B CB  1 
ATOM   6026 C CG  . ARG B 1 244 ? -24.745 3.251   -36.240 1.00 46.84  ? 245  ARG B CG  1 
ATOM   6027 C CD  . ARG B 1 244 ? -23.371 3.488   -36.870 1.00 49.44  ? 245  ARG B CD  1 
ATOM   6028 N NE  . ARG B 1 244 ? -22.294 2.988   -36.019 1.00 52.72  ? 245  ARG B NE  1 
ATOM   6029 C CZ  . ARG B 1 244 ? -21.727 3.686   -35.041 1.00 52.24  ? 245  ARG B CZ  1 
ATOM   6030 N NH1 . ARG B 1 244 ? -22.127 4.927   -34.793 1.00 53.54  ? 245  ARG B NH1 1 
ATOM   6031 N NH2 . ARG B 1 244 ? -20.757 3.145   -34.313 1.00 49.05  ? 245  ARG B NH2 1 
ATOM   6032 N N   . ARG B 1 245 ? -28.114 2.096   -36.400 1.00 42.64  ? 246  ARG B N   1 
ATOM   6033 C CA  . ARG B 1 245 ? -29.242 2.936   -36.783 1.00 48.03  ? 246  ARG B CA  1 
ATOM   6034 C C   . ARG B 1 245 ? -30.261 3.034   -35.653 1.00 43.84  ? 246  ARG B C   1 
ATOM   6035 O O   . ARG B 1 245 ? -30.773 4.122   -35.364 1.00 43.29  ? 246  ARG B O   1 
ATOM   6036 C CB  . ARG B 1 245 ? -29.895 2.396   -38.056 1.00 50.28  ? 246  ARG B CB  1 
ATOM   6037 C CG  . ARG B 1 245 ? -30.947 3.323   -38.640 1.00 59.11  ? 246  ARG B CG  1 
ATOM   6038 C CD  . ARG B 1 245 ? -31.876 2.597   -39.609 1.00 66.39  ? 246  ARG B CD  1 
ATOM   6039 N NE  . ARG B 1 245 ? -32.741 1.612   -38.957 1.00 69.13  ? 246  ARG B NE  1 
ATOM   6040 C CZ  . ARG B 1 245 ? -33.780 1.906   -38.179 1.00 64.93  ? 246  ARG B CZ  1 
ATOM   6041 N NH1 . ARG B 1 245 ? -34.101 3.168   -37.925 1.00 67.19  ? 246  ARG B NH1 1 
ATOM   6042 N NH2 . ARG B 1 245 ? -34.501 0.929   -37.649 1.00 64.15  ? 246  ARG B NH2 1 
ATOM   6043 N N   . ARG B 1 246 ? -30.555 1.910   -34.993 1.00 36.81  ? 247  ARG B N   1 
ATOM   6044 C CA  . ARG B 1 246 ? -31.532 1.921   -33.907 1.00 39.35  ? 247  ARG B CA  1 
ATOM   6045 C C   . ARG B 1 246 ? -31.034 2.725   -32.713 1.00 41.53  ? 247  ARG B C   1 
ATOM   6046 O O   . ARG B 1 246 ? -31.790 3.508   -32.126 1.00 40.72  ? 247  ARG B O   1 
ATOM   6047 C CB  . ARG B 1 246 ? -31.883 0.498   -33.487 1.00 38.70  ? 247  ARG B CB  1 
ATOM   6048 C CG  . ARG B 1 246 ? -32.468 -0.324  -34.606 1.00 38.10  ? 247  ARG B CG  1 
ATOM   6049 C CD  . ARG B 1 246 ? -32.827 -1.732  -34.158 1.00 33.05  ? 247  ARG B CD  1 
ATOM   6050 N NE  . ARG B 1 246 ? -33.323 -2.525  -35.279 1.00 35.24  ? 247  ARG B NE  1 
ATOM   6051 C CZ  . ARG B 1 246 ? -33.762 -3.771  -35.168 1.00 36.32  ? 247  ARG B CZ  1 
ATOM   6052 N NH1 . ARG B 1 246 ? -33.793 -4.343  -33.976 1.00 34.32  ? 247  ARG B NH1 1 
ATOM   6053 N NH2 . ARG B 1 246 ? -34.185 -4.437  -36.238 1.00 35.36  ? 247  ARG B NH2 1 
ATOM   6054 N N   . ALA B 1 247 ? -29.770 2.528   -32.323 1.00 42.37  ? 248  ALA B N   1 
ATOM   6055 C CA  . ALA B 1 247 ? -29.191 3.332   -31.249 1.00 37.53  ? 248  ALA B CA  1 
ATOM   6056 C C   . ALA B 1 247 ? -29.254 4.817   -31.577 1.00 42.28  ? 248  ALA B C   1 
ATOM   6057 O O   . ALA B 1 247 ? -29.536 5.646   -30.703 1.00 45.66  ? 248  ALA B O   1 
ATOM   6058 C CB  . ALA B 1 247 ? -27.744 2.906   -30.991 1.00 33.31  ? 248  ALA B CB  1 
ATOM   6059 N N   . THR B 1 248 ? -29.006 5.168   -32.839 1.00 43.59  ? 249  THR B N   1 
ATOM   6060 C CA  . THR B 1 248 ? -29.020 6.573   -33.230 1.00 40.89  ? 249  THR B CA  1 
ATOM   6061 C C   . THR B 1 248 ? -30.432 7.147   -33.188 1.00 44.09  ? 249  THR B C   1 
ATOM   6062 O O   . THR B 1 248 ? -30.624 8.305   -32.792 1.00 47.14  ? 249  THR B O   1 
ATOM   6063 C CB  . THR B 1 248 ? -28.408 6.730   -34.623 1.00 47.54  ? 249  THR B CB  1 
ATOM   6064 O OG1 . THR B 1 248 ? -27.034 6.321   -34.585 1.00 49.09  ? 249  THR B OG1 1 
ATOM   6065 C CG2 . THR B 1 248 ? -28.495 8.179   -35.102 1.00 44.95  ? 249  THR B CG2 1 
ATOM   6066 N N   . GLN B 1 249 ? -31.437 6.351   -33.574 1.00 34.51  ? 250  GLN B N   1 
ATOM   6067 C CA  . GLN B 1 249 ? -32.802 6.869   -33.617 1.00 42.23  ? 250  GLN B CA  1 
ATOM   6068 C C   . GLN B 1 249 ? -33.366 7.079   -32.214 1.00 40.23  ? 250  GLN B C   1 
ATOM   6069 O O   . GLN B 1 249 ? -34.087 8.054   -31.971 1.00 42.56  ? 250  GLN B O   1 
ATOM   6070 C CB  . GLN B 1 249 ? -33.715 5.953   -34.434 1.00 40.98  ? 250  GLN B CB  1 
ATOM   6071 C CG  . GLN B 1 249 ? -35.207 6.252   -34.242 1.00 52.47  ? 250  GLN B CG  1 
ATOM   6072 C CD  . GLN B 1 249 ? -35.719 7.335   -35.193 1.00 61.20  ? 250  GLN B CD  1 
ATOM   6073 O OE1 . GLN B 1 249 ? -34.935 8.012   -35.863 1.00 68.25  ? 250  GLN B OE1 1 
ATOM   6074 N NE2 . GLN B 1 249 ? -37.037 7.514   -35.236 1.00 71.03  ? 250  GLN B NE2 1 
ATOM   6075 N N   . LEU B 1 250 ? -33.055 6.185   -31.271 1.00 40.54  ? 251  LEU B N   1 
ATOM   6076 C CA  . LEU B 1 250 ? -33.507 6.429   -29.903 1.00 48.74  ? 251  LEU B CA  1 
ATOM   6077 C C   . LEU B 1 250 ? -32.830 7.660   -29.318 1.00 45.89  ? 251  LEU B C   1 
ATOM   6078 O O   . LEU B 1 250 ? -33.465 8.430   -28.588 1.00 44.81  ? 251  LEU B O   1 
ATOM   6079 C CB  . LEU B 1 250 ? -33.285 5.201   -29.011 1.00 43.59  ? 251  LEU B CB  1 
ATOM   6080 C CG  . LEU B 1 250 ? -33.444 5.496   -27.510 1.00 37.41  ? 251  LEU B CG  1 
ATOM   6081 C CD1 . LEU B 1 250 ? -34.877 5.401   -26.979 1.00 31.98  ? 251  LEU B CD1 1 
ATOM   6082 C CD2 . LEU B 1 250 ? -32.548 4.564   -26.712 1.00 31.49  ? 251  LEU B CD2 1 
ATOM   6083 N N   . ALA B 1 251 ? -31.557 7.885   -29.654 1.00 45.93  ? 252  ALA B N   1 
ATOM   6084 C CA  . ALA B 1 251 ? -30.902 9.123   -29.241 1.00 47.63  ? 252  ALA B CA  1 
ATOM   6085 C C   . ALA B 1 251 ? -31.660 10.337  -29.757 1.00 47.28  ? 252  ALA B C   1 
ATOM   6086 O O   . ALA B 1 251 ? -31.852 11.315  -29.026 1.00 46.94  ? 252  ALA B O   1 
ATOM   6087 C CB  . ALA B 1 251 ? -29.457 9.156   -29.731 1.00 41.17  ? 252  ALA B CB  1 
ATOM   6088 N N   . HIS B 1 252 ? -32.103 10.289  -31.014 1.00 45.00  ? 253  HIS B N   1 
ATOM   6089 C CA  . HIS B 1 252 ? -32.895 11.384  -31.558 1.00 47.08  ? 253  HIS B CA  1 
ATOM   6090 C C   . HIS B 1 252 ? -34.222 11.519  -30.823 1.00 47.61  ? 253  HIS B C   1 
ATOM   6091 O O   . HIS B 1 252 ? -34.655 12.634  -30.507 1.00 47.84  ? 253  HIS B O   1 
ATOM   6092 C CB  . HIS B 1 252 ? -33.132 11.170  -33.052 1.00 49.59  ? 253  HIS B CB  1 
ATOM   6093 C CG  . HIS B 1 252 ? -34.255 11.991  -33.605 1.00 65.67  ? 253  HIS B CG  1 
ATOM   6094 N ND1 . HIS B 1 252 ? -34.075 13.273  -34.081 1.00 70.18  ? 253  HIS B ND1 1 
ATOM   6095 C CD2 . HIS B 1 252 ? -35.574 11.717  -33.750 1.00 67.47  ? 253  HIS B CD2 1 
ATOM   6096 C CE1 . HIS B 1 252 ? -35.234 13.752  -34.496 1.00 72.23  ? 253  HIS B CE1 1 
ATOM   6097 N NE2 . HIS B 1 252 ? -36.160 12.828  -34.305 1.00 69.96  ? 253  HIS B NE2 1 
ATOM   6098 N N   . LEU B 1 253 ? -34.875 10.390  -30.530 1.00 46.91  ? 254  LEU B N   1 
ATOM   6099 C CA  . LEU B 1 253 ? -36.209 10.429  -29.941 1.00 46.69  ? 254  LEU B CA  1 
ATOM   6100 C C   . LEU B 1 253 ? -36.204 11.005  -28.531 1.00 45.57  ? 254  LEU B C   1 
ATOM   6101 O O   . LEU B 1 253 ? -37.204 11.592  -28.106 1.00 52.91  ? 254  LEU B O   1 
ATOM   6102 C CB  . LEU B 1 253 ? -36.828 9.031   -29.929 1.00 43.49  ? 254  LEU B CB  1 
ATOM   6103 C CG  . LEU B 1 253 ? -37.277 8.476   -31.282 1.00 46.99  ? 254  LEU B CG  1 
ATOM   6104 C CD1 . LEU B 1 253 ? -37.432 6.970   -31.198 1.00 40.01  ? 254  LEU B CD1 1 
ATOM   6105 C CD2 . LEU B 1 253 ? -38.565 9.134   -31.761 1.00 37.56  ? 254  LEU B CD2 1 
ATOM   6106 N N   . VAL B 1 254 ? -35.109 10.850  -27.792 1.00 36.89  ? 255  VAL B N   1 
ATOM   6107 C CA  . VAL B 1 254 ? -35.014 11.387  -26.439 1.00 36.26  ? 255  VAL B CA  1 
ATOM   6108 C C   . VAL B 1 254 ? -34.229 12.703  -26.407 1.00 36.62  ? 255  VAL B C   1 
ATOM   6109 O O   . VAL B 1 254 ? -33.759 13.118  -25.348 1.00 39.92  ? 255  VAL B O   1 
ATOM   6110 C CB  . VAL B 1 254 ? -34.424 10.357  -25.461 1.00 35.03  ? 255  VAL B CB  1 
ATOM   6111 C CG1 . VAL B 1 254 ? -35.281 9.099   -25.445 1.00 30.77  ? 255  VAL B CG1 1 
ATOM   6112 C CG2 . VAL B 1 254 ? -32.983 10.019  -25.818 1.00 34.51  ? 255  VAL B CG2 1 
ATOM   6113 N N   . GLY B 1 255 ? -34.093 13.372  -27.548 1.00 40.75  ? 256  GLY B N   1 
ATOM   6114 C CA  . GLY B 1 255 ? -33.452 14.680  -27.585 1.00 47.63  ? 256  GLY B CA  1 
ATOM   6115 C C   . GLY B 1 255 ? -31.946 14.680  -27.415 1.00 48.66  ? 256  GLY B C   1 
ATOM   6116 O O   . GLY B 1 255 ? -31.399 15.607  -26.805 1.00 54.30  ? 256  GLY B O   1 
ATOM   6117 N N   . CYS B 1 256 ? -31.284 13.691  -27.962 1.00 49.90  ? 257  CYS B N   1 
ATOM   6118 C CA  . CYS B 1 256 ? -29.857 13.611  -27.900 1.00 54.10  ? 257  CYS B CA  1 
ATOM   6119 C C   . CYS B 1 256 ? -29.328 13.698  -29.290 1.00 68.66  ? 257  CYS B C   1 
ATOM   6120 O O   . CYS B 1 256 ? -29.965 13.301  -30.213 1.00 67.42  ? 257  CYS B O   1 
ATOM   6121 C CB  . CYS B 1 256 ? -29.407 12.328  -27.242 1.00 50.84  ? 257  CYS B CB  1 
ATOM   6122 S SG  . CYS B 1 256 ? -29.431 12.404  -25.463 1.00 56.58  ? 257  CYS B SG  1 
ATOM   6123 N N   . PRO B 1 257 ? -28.125 14.206  -29.430 1.00 87.66  ? 258  PRO B N   1 
ATOM   6124 C CA  . PRO B 1 257 ? -27.421 14.434  -30.678 1.00 96.95  ? 258  PRO B CA  1 
ATOM   6125 C C   . PRO B 1 257 ? -27.109 13.155  -31.394 1.00 102.80 ? 258  PRO B C   1 
ATOM   6126 O O   . PRO B 1 257 ? -26.902 12.164  -30.750 1.00 100.68 ? 258  PRO B O   1 
ATOM   6127 C CB  . PRO B 1 257 ? -26.112 15.051  -30.215 1.00 97.03  ? 258  PRO B CB  1 
ATOM   6128 C CG  . PRO B 1 257 ? -26.372 15.547  -28.854 1.00 94.43  ? 258  PRO B CG  1 
ATOM   6129 C CD  . PRO B 1 257 ? -27.292 14.542  -28.284 1.00 89.97  ? 258  PRO B CD  1 
ATOM   6130 N N   . PRO B 1 258 ? -27.091 13.179  -32.725 1.00 105.16 ? 259  PRO B N   1 
ATOM   6131 C CA  . PRO B 1 258 ? -26.751 12.018  -33.535 1.00 101.72 ? 259  PRO B CA  1 
ATOM   6132 C C   . PRO B 1 258 ? -25.352 11.572  -33.198 1.00 100.49 ? 259  PRO B C   1 
ATOM   6133 O O   . PRO B 1 258 ? -24.737 10.899  -34.004 1.00 101.34 ? 259  PRO B O   1 
ATOM   6134 C CB  . PRO B 1 258 ? -26.738 12.584  -34.931 1.00 102.69 ? 259  PRO B CB  1 
ATOM   6135 C CG  . PRO B 1 258 ? -26.384 14.021  -34.728 1.00 106.73 ? 259  PRO B CG  1 
ATOM   6136 C CD  . PRO B 1 258 ? -27.198 14.388  -33.546 1.00 107.43 ? 259  PRO B CD  1 
ATOM   6137 N N   . ASN B 1 264 ? -20.589 11.680  -33.399 1.00 83.32  ? 265  ASN B N   1 
ATOM   6138 C CA  . ASN B 1 264 ? -19.611 11.105  -32.497 1.00 83.47  ? 265  ASN B CA  1 
ATOM   6139 C C   . ASN B 1 264 ? -20.228 10.188  -31.447 1.00 72.20  ? 265  ASN B C   1 
ATOM   6140 O O   . ASN B 1 264 ? -21.068 10.607  -30.691 1.00 68.55  ? 265  ASN B O   1 
ATOM   6141 C CB  . ASN B 1 264 ? -18.857 12.222  -31.847 1.00 92.92  ? 265  ASN B CB  1 
ATOM   6142 C CG  . ASN B 1 264 ? -17.924 11.740  -30.802 1.00 101.81 ? 265  ASN B CG  1 
ATOM   6143 O OD1 . ASN B 1 264 ? -17.991 12.181  -29.686 1.00 103.73 ? 265  ASN B OD1 1 
ATOM   6144 N ND2 . ASN B 1 264 ? -17.050 10.826  -31.156 1.00 108.19 ? 265  ASN B ND2 1 
ATOM   6145 N N   . ASP B 1 265 ? -19.781 8.944   -31.391 1.00 63.58  ? 266  ASP B N   1 
ATOM   6146 C CA  . ASP B 1 265 ? -20.363 7.964   -30.478 1.00 57.35  ? 266  ASP B CA  1 
ATOM   6147 C C   . ASP B 1 265 ? -20.197 8.385   -29.022 1.00 52.81  ? 266  ASP B C   1 
ATOM   6148 O O   . ASP B 1 265 ? -21.120 8.230   -28.214 1.00 49.17  ? 266  ASP B O   1 
ATOM   6149 C CB  . ASP B 1 265 ? -19.732 6.590   -30.711 1.00 58.93  ? 266  ASP B CB  1 
ATOM   6150 C CG  . ASP B 1 265 ? -20.137 5.978   -32.039 1.00 65.42  ? 266  ASP B CG  1 
ATOM   6151 O OD1 . ASP B 1 265 ? -19.420 5.074   -32.521 1.00 70.40  ? 266  ASP B OD1 1 
ATOM   6152 O OD2 . ASP B 1 265 ? -21.167 6.404   -32.604 1.00 67.10  ? 266  ASP B OD2 1 
ATOM   6153 N N   . THR B 1 266 ? -19.023 8.913   -28.670 1.00 53.41  ? 267  THR B N   1 
ATOM   6154 C CA  . THR B 1 266 ? -18.783 9.379   -27.306 1.00 52.67  ? 267  THR B CA  1 
ATOM   6155 C C   . THR B 1 266 ? -19.823 10.412  -26.881 1.00 53.77  ? 267  THR B C   1 
ATOM   6156 O O   . THR B 1 266 ? -20.465 10.269  -25.832 1.00 49.82  ? 267  THR B O   1 
ATOM   6157 C CB  . THR B 1 266 ? -17.372 9.961   -27.208 1.00 54.12  ? 267  THR B CB  1 
ATOM   6158 O OG1 . THR B 1 266 ? -16.414 8.958   -27.569 1.00 58.87  ? 267  THR B OG1 1 
ATOM   6159 C CG2 . THR B 1 266 ? -17.091 10.450  -25.798 1.00 50.54  ? 267  THR B CG2 1 
ATOM   6160 N N   . GLU B 1 267 ? -19.985 11.469  -27.682 1.00 57.89  ? 268  GLU B N   1 
ATOM   6161 C CA  . GLU B 1 267 ? -21.018 12.476  -27.442 1.00 59.77  ? 268  GLU B CA  1 
ATOM   6162 C C   . GLU B 1 267 ? -22.379 11.833  -27.228 1.00 52.85  ? 268  GLU B C   1 
ATOM   6163 O O   . GLU B 1 267 ? -23.093 12.147  -26.268 1.00 50.91  ? 268  GLU B O   1 
ATOM   6164 C CB  . GLU B 1 267 ? -21.108 13.413  -28.642 1.00 73.25  ? 268  GLU B CB  1 
ATOM   6165 C CG  . GLU B 1 267 ? -20.312 14.682  -28.603 1.00 92.39  ? 268  GLU B CG  1 
ATOM   6166 C CD  . GLU B 1 267 ? -20.425 15.412  -29.930 1.00 109.70 ? 268  GLU B CD  1 
ATOM   6167 O OE1 . GLU B 1 267 ? -21.566 15.739  -30.328 1.00 112.27 ? 268  GLU B OE1 1 
ATOM   6168 O OE2 . GLU B 1 267 ? -19.385 15.631  -30.587 1.00 117.87 ? 268  GLU B OE2 1 
ATOM   6169 N N   . LEU B 1 268 ? -22.761 10.945  -28.146 1.00 50.24  ? 269  LEU B N   1 
ATOM   6170 C CA  . LEU B 1 268 ? -24.112 10.397  -28.160 1.00 48.08  ? 269  LEU B CA  1 
ATOM   6171 C C   . LEU B 1 268 ? -24.387 9.584   -26.901 1.00 45.43  ? 269  LEU B C   1 
ATOM   6172 O O   . LEU B 1 268 ? -25.413 9.771   -26.234 1.00 42.72  ? 269  LEU B O   1 
ATOM   6173 C CB  . LEU B 1 268 ? -24.291 9.548   -29.421 1.00 49.71  ? 269  LEU B CB  1 
ATOM   6174 C CG  . LEU B 1 268 ? -25.665 9.118   -29.935 1.00 49.50  ? 269  LEU B CG  1 
ATOM   6175 C CD1 . LEU B 1 268 ? -25.568 8.751   -31.402 1.00 55.30  ? 269  LEU B CD1 1 
ATOM   6176 C CD2 . LEU B 1 268 ? -26.160 7.927   -29.159 1.00 48.28  ? 269  LEU B CD2 1 
ATOM   6177 N N   . VAL B 1 269 ? -23.477 8.672   -26.558 1.00 45.15  ? 270  VAL B N   1 
ATOM   6178 C CA  . VAL B 1 269 ? -23.682 7.841   -25.378 1.00 39.59  ? 270  VAL B CA  1 
ATOM   6179 C C   . VAL B 1 269 ? -23.695 8.700   -24.120 1.00 44.27  ? 270  VAL B C   1 
ATOM   6180 O O   . VAL B 1 269 ? -24.481 8.458   -23.196 1.00 42.32  ? 270  VAL B O   1 
ATOM   6181 C CB  . VAL B 1 269 ? -22.611 6.740   -25.303 1.00 37.24  ? 270  VAL B CB  1 
ATOM   6182 C CG1 . VAL B 1 269 ? -22.809 5.890   -24.050 1.00 34.56  ? 270  VAL B CG1 1 
ATOM   6183 C CG2 . VAL B 1 269 ? -22.660 5.870   -26.549 1.00 35.11  ? 270  VAL B CG2 1 
ATOM   6184 N N   . ALA B 1 270 ? -22.835 9.724   -24.069 1.00 41.65  ? 271  ALA B N   1 
ATOM   6185 C CA  . ALA B 1 270 ? -22.792 10.581  -22.887 1.00 45.83  ? 271  ALA B CA  1 
ATOM   6186 C C   . ALA B 1 270 ? -24.131 11.268  -22.660 1.00 46.83  ? 271  ALA B C   1 
ATOM   6187 O O   . ALA B 1 270 ? -24.595 11.382  -21.519 1.00 45.45  ? 271  ALA B O   1 
ATOM   6188 C CB  . ALA B 1 270 ? -21.671 11.613  -23.019 1.00 39.46  ? 271  ALA B CB  1 
ATOM   6189 N N   . CYS B 1 271 ? -24.773 11.725  -23.737 1.00 48.51  ? 272  CYS B N   1 
ATOM   6190 C CA  . CYS B 1 271 ? -26.095 12.325  -23.600 1.00 50.11  ? 272  CYS B CA  1 
ATOM   6191 C C   . CYS B 1 271 ? -27.124 11.289  -23.161 1.00 46.53  ? 272  CYS B C   1 
ATOM   6192 O O   . CYS B 1 271 ? -27.971 11.575  -22.306 1.00 47.25  ? 272  CYS B O   1 
ATOM   6193 C CB  . CYS B 1 271 ? -26.512 12.988  -24.916 1.00 56.48  ? 272  CYS B CB  1 
ATOM   6194 S SG  . CYS B 1 271 ? -28.155 13.774  -24.876 1.00 63.24  ? 272  CYS B SG  1 
ATOM   6195 N N   . LEU B 1 272 ? -27.062 10.079  -23.727 1.00 43.74  ? 273  LEU B N   1 
ATOM   6196 C CA  . LEU B 1 272 ? -27.991 9.023   -23.330 1.00 36.80  ? 273  LEU B CA  1 
ATOM   6197 C C   . LEU B 1 272 ? -27.874 8.685   -21.849 1.00 34.91  ? 273  LEU B C   1 
ATOM   6198 O O   . LEU B 1 272 ? -28.879 8.361   -21.205 1.00 39.23  ? 273  LEU B O   1 
ATOM   6199 C CB  . LEU B 1 272 ? -27.753 7.765   -24.162 1.00 39.01  ? 273  LEU B CB  1 
ATOM   6200 C CG  . LEU B 1 272 ? -28.203 7.791   -25.620 1.00 42.64  ? 273  LEU B CG  1 
ATOM   6201 C CD1 . LEU B 1 272 ? -27.709 6.541   -26.326 1.00 40.99  ? 273  LEU B CD1 1 
ATOM   6202 C CD2 . LEU B 1 272 ? -29.715 7.903   -25.704 1.00 45.03  ? 273  LEU B CD2 1 
ATOM   6203 N N   . ARG B 1 273 ? -26.684 8.792   -21.316 1.00 34.52  ? 274  ARG B N   1 
ATOM   6204 C CA  . ARG B 1 273 ? -26.448 8.520   -19.929 1.00 39.34  ? 274  ARG B CA  1 
ATOM   6205 C C   . ARG B 1 273 ? -27.115 9.495   -19.004 1.00 39.55  ? 274  ARG B C   1 
ATOM   6206 O O   . ARG B 1 273 ? -27.381 9.165   -17.892 1.00 41.97  ? 274  ARG B O   1 
ATOM   6207 C CB  . ARG B 1 273 ? -24.982 8.384   -19.605 1.00 35.92  ? 274  ARG B CB  1 
ATOM   6208 C CG  . ARG B 1 273 ? -24.329 7.190   -20.209 1.00 41.37  ? 274  ARG B CG  1 
ATOM   6209 C CD  . ARG B 1 273 ? -22.991 7.019   -19.574 1.00 49.44  ? 274  ARG B CD  1 
ATOM   6210 N NE  . ARG B 1 273 ? -22.385 5.808   -20.006 1.00 59.51  ? 274  ARG B NE  1 
ATOM   6211 C CZ  . ARG B 1 273 ? -21.377 5.729   -20.846 1.00 60.60  ? 274  ARG B CZ  1 
ATOM   6212 N NH1 . ARG B 1 273 ? -20.906 4.567   -21.177 1.00 47.38  ? 274  ARG B NH1 1 
ATOM   6213 N NH2 . ARG B 1 273 ? -20.831 6.812   -21.328 1.00 70.11  ? 274  ARG B NH2 1 
ATOM   6214 N N   . THR B 1 274 ? -27.369 10.693  -19.469 1.00 37.45  ? 275  THR B N   1 
ATOM   6215 C CA  . THR B 1 274 ? -28.040 11.692  -18.643 1.00 35.42  ? 275  THR B CA  1 
ATOM   6216 C C   . THR B 1 274 ? -29.547 11.486  -18.588 1.00 37.68  ? 275  THR B C   1 
ATOM   6217 O O   . THR B 1 274 ? -30.208 12.102  -17.749 1.00 39.85  ? 275  THR B O   1 
ATOM   6218 C CB  . THR B 1 274 ? -27.755 13.115  -19.147 1.00 37.61  ? 275  THR B CB  1 
ATOM   6219 O OG1 . THR B 1 274 ? -28.356 13.309  -20.434 1.00 41.51  ? 275  THR B OG1 1 
ATOM   6220 C CG2 . THR B 1 274 ? -26.247 13.376  -19.241 1.00 35.76  ? 275  THR B CG2 1 
ATOM   6221 N N   . ARG B 1 275 ? -30.108 10.640  -19.453 1.00 38.92  ? 276  ARG B N   1 
ATOM   6222 C CA  . ARG B 1 275 ? -31.558 10.505  -19.477 1.00 38.91  ? 276  ARG B CA  1 
ATOM   6223 C C   . ARG B 1 275 ? -32.013 9.536   -18.390 1.00 38.52  ? 276  ARG B C   1 
ATOM   6224 O O   . ARG B 1 275 ? -31.368 8.508   -18.169 1.00 42.53  ? 276  ARG B O   1 
ATOM   6225 C CB  . ARG B 1 275 ? -32.034 10.014  -20.844 1.00 41.16  ? 276  ARG B CB  1 
ATOM   6226 C CG  . ARG B 1 275 ? -31.792 11.003  -21.980 1.00 44.32  ? 276  ARG B CG  1 
ATOM   6227 C CD  . ARG B 1 275 ? -32.549 12.286  -21.730 1.00 45.48  ? 276  ARG B CD  1 
ATOM   6228 N NE  . ARG B 1 275 ? -32.555 13.189  -22.878 1.00 45.78  ? 276  ARG B NE  1 
ATOM   6229 C CZ  . ARG B 1 275 ? -31.788 14.272  -22.983 1.00 47.15  ? 276  ARG B CZ  1 
ATOM   6230 N NH1 . ARG B 1 275 ? -30.936 14.586  -22.015 1.00 43.80  ? 276  ARG B NH1 1 
ATOM   6231 N NH2 . ARG B 1 275 ? -31.871 15.043  -24.061 1.00 47.48  ? 276  ARG B NH2 1 
ATOM   6232 N N   . PRO B 1 276 ? -33.100 9.852   -17.683 1.00 37.83  ? 277  PRO B N   1 
ATOM   6233 C CA  . PRO B 1 276 ? -33.655 8.897   -16.720 1.00 39.38  ? 277  PRO B CA  1 
ATOM   6234 C C   . PRO B 1 276 ? -33.934 7.559   -17.387 1.00 41.35  ? 277  PRO B C   1 
ATOM   6235 O O   . PRO B 1 276 ? -34.309 7.490   -18.561 1.00 39.57  ? 277  PRO B O   1 
ATOM   6236 C CB  . PRO B 1 276 ? -34.949 9.572   -16.253 1.00 42.06  ? 277  PRO B CB  1 
ATOM   6237 C CG  . PRO B 1 276 ? -34.703 11.025  -16.453 1.00 45.03  ? 277  PRO B CG  1 
ATOM   6238 C CD  . PRO B 1 276 ? -33.845 11.122  -17.694 1.00 41.28  ? 277  PRO B CD  1 
ATOM   6239 N N   . ALA B 1 277 ? -33.841 6.471   -16.681 1.00 39.53  ? 278  ALA B N   1 
ATOM   6240 C CA  . ALA B 1 277 ? -34.042 5.185   -17.292 1.00 40.32  ? 278  ALA B CA  1 
ATOM   6241 C C   . ALA B 1 277 ? -35.405 4.969   -17.886 1.00 49.28  ? 278  ALA B C   1 
ATOM   6242 O O   . ALA B 1 277 ? -35.569 4.321   -18.890 1.00 54.65  ? 278  ALA B O   1 
ATOM   6243 C CB  . ALA B 1 277 ? -33.712 4.096   -16.327 1.00 32.89  ? 278  ALA B CB  1 
ATOM   6244 N N   . GLN B 1 278 ? -36.405 5.527   -17.242 1.00 48.19  ? 279  GLN B N   1 
ATOM   6245 C CA  . GLN B 1 278 ? -37.756 5.399   -17.703 1.00 40.38  ? 279  GLN B CA  1 
ATOM   6246 C C   . GLN B 1 278 ? -38.000 6.006   -19.085 1.00 38.99  ? 279  GLN B C   1 
ATOM   6247 O O   . GLN B 1 278 ? -38.806 5.531   -19.815 1.00 32.19  ? 279  GLN B O   1 
ATOM   6248 C CB  . GLN B 1 278 ? -38.745 5.855   -16.661 1.00 34.32  ? 279  GLN B CB  1 
ATOM   6249 C CG  . GLN B 1 278 ? -40.164 5.564   -17.054 1.00 40.62  ? 279  GLN B CG  1 
ATOM   6250 C CD  . GLN B 1 278 ? -40.494 4.110   -16.999 1.00 48.75  ? 279  GLN B CD  1 
ATOM   6251 O OE1 . GLN B 1 278 ? -40.253 3.471   -16.020 1.00 56.62  ? 279  GLN B OE1 1 
ATOM   6252 N NE2 . GLN B 1 278 ? -41.067 3.599   -18.038 1.00 43.71  ? 279  GLN B NE2 1 
ATOM   6253 N N   . VAL B 1 279 ? -37.321 7.080   -19.377 1.00 34.42  ? 280  VAL B N   1 
ATOM   6254 C CA  . VAL B 1 279 ? -37.388 7.744   -20.622 1.00 35.33  ? 280  VAL B CA  1 
ATOM   6255 C C   . VAL B 1 279 ? -36.907 6.869   -21.767 1.00 38.47  ? 280  VAL B C   1 
ATOM   6256 O O   . VAL B 1 279 ? -37.506 6.866   -22.796 1.00 35.69  ? 280  VAL B O   1 
ATOM   6257 C CB  . VAL B 1 279 ? -36.598 9.046   -20.575 1.00 39.36  ? 280  VAL B CB  1 
ATOM   6258 C CG1 . VAL B 1 279 ? -36.553 9.681   -21.922 1.00 36.62  ? 280  VAL B CG1 1 
ATOM   6259 C CG2 . VAL B 1 279 ? -37.181 10.001  -19.586 1.00 29.15  ? 280  VAL B CG2 1 
ATOM   6260 N N   . LEU B 1 280 ? -35.836 6.121   -21.599 1.00 30.44  ? 281  LEU B N   1 
ATOM   6261 C CA  . LEU B 1 280 ? -35.404 5.242   -22.649 1.00 36.27  ? 281  LEU B CA  1 
ATOM   6262 C C   . LEU B 1 280 ? -36.428 4.163   -22.888 1.00 40.53  ? 281  LEU B C   1 
ATOM   6263 O O   . LEU B 1 280 ? -36.722 3.852   -23.994 1.00 42.72  ? 281  LEU B O   1 
ATOM   6264 C CB  . LEU B 1 280 ? -34.035 4.670   -22.406 1.00 27.10  ? 281  LEU B CB  1 
ATOM   6265 C CG  . LEU B 1 280 ? -32.914 5.615   -22.076 1.00 31.69  ? 281  LEU B CG  1 
ATOM   6266 C CD1 . LEU B 1 280 ? -31.665 4.809   -21.977 1.00 36.70  ? 281  LEU B CD1 1 
ATOM   6267 C CD2 . LEU B 1 280 ? -32.736 6.756   -23.049 1.00 27.35  ? 281  LEU B CD2 1 
ATOM   6268 N N   . VAL B 1 281 ? -36.992 3.626   -21.836 1.00 32.85  ? 282  VAL B N   1 
ATOM   6269 C CA  . VAL B 1 281 ? -37.988 2.643   -21.980 1.00 35.93  ? 282  VAL B CA  1 
ATOM   6270 C C   . VAL B 1 281 ? -39.204 3.157   -22.713 1.00 38.64  ? 282  VAL B C   1 
ATOM   6271 O O   . VAL B 1 281 ? -39.758 2.446   -23.463 1.00 41.93  ? 282  VAL B O   1 
ATOM   6272 C CB  . VAL B 1 281 ? -38.421 2.108   -20.625 1.00 34.89  ? 282  VAL B CB  1 
ATOM   6273 C CG1 . VAL B 1 281 ? -39.683 1.318   -20.730 1.00 33.39  ? 282  VAL B CG1 1 
ATOM   6274 C CG2 . VAL B 1 281 ? -37.329 1.287   -20.001 1.00 31.32  ? 282  VAL B CG2 1 
ATOM   6275 N N   . ASN B 1 282 ? -39.609 4.389   -22.492 1.00 35.51  ? 283  ASN B N   1 
ATOM   6276 C CA  . ASN B 1 282 ? -40.819 4.961   -23.068 1.00 38.74  ? 283  ASN B CA  1 
ATOM   6277 C C   . ASN B 1 282 ? -40.719 5.127   -24.574 1.00 47.14  ? 283  ASN B C   1 
ATOM   6278 O O   . ASN B 1 282 ? -41.751 5.163   -25.252 1.00 53.78  ? 283  ASN B O   1 
ATOM   6279 C CB  . ASN B 1 282 ? -41.126 6.309   -22.412 1.00 42.77  ? 283  ASN B CB  1 
ATOM   6280 C CG  . ASN B 1 282 ? -41.584 6.161   -20.970 1.00 47.03  ? 283  ASN B CG  1 
ATOM   6281 O OD1 . ASN B 1 282 ? -41.888 5.057   -20.520 1.00 47.63  ? 283  ASN B OD1 1 
ATOM   6282 N ND2 . ASN B 1 282 ? -41.640 7.272   -20.241 1.00 45.65  ? 283  ASN B ND2 1 
ATOM   6283 N N   . HIS B 1 283 ? -39.534 5.247   -25.105 1.00 43.84  ? 284  HIS B N   1 
ATOM   6284 C CA  . HIS B 1 283 ? -39.366 5.369   -26.517 1.00 48.28  ? 284  HIS B CA  1 
ATOM   6285 C C   . HIS B 1 283 ? -38.803 4.148   -27.233 1.00 48.45  ? 284  HIS B C   1 
ATOM   6286 O O   . HIS B 1 283 ? -38.620 4.175   -28.411 1.00 48.79  ? 284  HIS B O   1 
ATOM   6287 C CB  . HIS B 1 283 ? -38.411 6.512   -26.774 1.00 48.86  ? 284  HIS B CB  1 
ATOM   6288 C CG  . HIS B 1 283 ? -38.993 7.849   -26.488 1.00 53.36  ? 284  HIS B CG  1 
ATOM   6289 N ND1 . HIS B 1 283 ? -38.872 8.462   -25.271 1.00 55.77  ? 284  HIS B ND1 1 
ATOM   6290 C CD2 . HIS B 1 283 ? -39.731 8.674   -27.253 1.00 47.32  ? 284  HIS B CD2 1 
ATOM   6291 C CE1 . HIS B 1 283 ? -39.499 9.612   -25.300 1.00 54.92  ? 284  HIS B CE1 1 
ATOM   6292 N NE2 . HIS B 1 283 ? -40.021 9.767   -26.494 1.00 54.69  ? 284  HIS B NE2 1 
ATOM   6293 N N   . GLU B 1 284 ? -38.579 3.068   -26.528 1.00 40.12  ? 285  GLU B N   1 
ATOM   6294 C CA  . GLU B 1 284 ? -37.865 1.934   -27.109 1.00 43.17  ? 285  GLU B CA  1 
ATOM   6295 C C   . GLU B 1 284 ? -38.635 1.309   -28.268 1.00 47.51  ? 285  GLU B C   1 
ATOM   6296 O O   . GLU B 1 284 ? -38.023 0.816   -29.223 1.00 47.48  ? 285  GLU B O   1 
ATOM   6297 C CB  . GLU B 1 284 ? -37.535 0.905   -26.025 1.00 43.53  ? 285  GLU B CB  1 
ATOM   6298 C CG  . GLU B 1 284 ? -38.424 -0.305  -25.966 1.00 53.29  ? 285  GLU B CG  1 
ATOM   6299 C CD  . GLU B 1 284 ? -37.807 -1.430  -25.153 1.00 62.26  ? 285  GLU B CD  1 
ATOM   6300 O OE1 . GLU B 1 284 ? -38.564 -2.138  -24.459 1.00 68.92  ? 285  GLU B OE1 1 
ATOM   6301 O OE2 . GLU B 1 284 ? -36.571 -1.613  -25.206 1.00 61.07  ? 285  GLU B OE2 1 
ATOM   6302 N N   . TRP B 1 285 ? -39.964 1.361   -28.238 1.00 45.34  ? 286  TRP B N   1 
ATOM   6303 C CA  . TRP B 1 285 ? -40.719 0.708   -29.296 1.00 55.47  ? 286  TRP B CA  1 
ATOM   6304 C C   . TRP B 1 285 ? -40.657 1.478   -30.611 1.00 59.38  ? 286  TRP B C   1 
ATOM   6305 O O   . TRP B 1 285 ? -40.713 0.863   -31.682 1.00 62.50  ? 286  TRP B O   1 
ATOM   6306 C CB  . TRP B 1 285 ? -42.171 0.509   -28.857 1.00 70.41  ? 286  TRP B CB  1 
ATOM   6307 C CG  . TRP B 1 285 ? -43.135 0.311   -29.998 1.00 97.87  ? 286  TRP B CG  1 
ATOM   6308 C CD1 . TRP B 1 285 ? -43.700 1.282   -30.770 1.00 109.48 ? 286  TRP B CD1 1 
ATOM   6309 C CD2 . TRP B 1 285 ? -43.646 -0.936  -30.493 1.00 105.42 ? 286  TRP B CD2 1 
ATOM   6310 N NE1 . TRP B 1 285 ? -44.530 0.722   -31.712 1.00 113.89 ? 286  TRP B NE1 1 
ATOM   6311 C CE2 . TRP B 1 285 ? -44.514 -0.640  -31.561 1.00 111.46 ? 286  TRP B CE2 1 
ATOM   6312 C CE3 . TRP B 1 285 ? -43.454 -2.270  -30.136 1.00 103.16 ? 286  TRP B CE3 1 
ATOM   6313 C CZ2 . TRP B 1 285 ? -45.186 -1.631  -32.274 1.00 112.63 ? 286  TRP B CZ2 1 
ATOM   6314 C CZ3 . TRP B 1 285 ? -44.122 -3.251  -30.839 1.00 104.97 ? 286  TRP B CZ3 1 
ATOM   6315 C CH2 . TRP B 1 285 ? -44.977 -2.929  -31.897 1.00 109.55 ? 286  TRP B CH2 1 
ATOM   6316 N N   . HIS B 1 286 ? -40.478 2.767   -30.537 1.00 58.13  ? 287  HIS B N   1 
ATOM   6317 C CA  . HIS B 1 286 ? -40.490 3.583   -31.698 1.00 70.80  ? 287  HIS B CA  1 
ATOM   6318 C C   . HIS B 1 286 ? -39.281 3.490   -32.569 1.00 71.91  ? 287  HIS B C   1 
ATOM   6319 O O   . HIS B 1 286 ? -39.229 4.142   -33.562 1.00 80.23  ? 287  HIS B O   1 
ATOM   6320 C CB  . HIS B 1 286 ? -40.893 4.997   -31.339 1.00 83.38  ? 287  HIS B CB  1 
ATOM   6321 C CG  . HIS B 1 286 ? -42.159 5.047   -30.552 1.00 97.58  ? 287  HIS B CG  1 
ATOM   6322 N ND1 . HIS B 1 286 ? -43.370 5.386   -31.106 1.00 104.87 ? 287  HIS B ND1 1 
ATOM   6323 C CD2 . HIS B 1 286 ? -42.416 4.718   -29.267 1.00 99.96  ? 287  HIS B CD2 1 
ATOM   6324 C CE1 . HIS B 1 286 ? -44.313 5.295   -30.189 1.00 106.26 ? 287  HIS B CE1 1 
ATOM   6325 N NE2 . HIS B 1 286 ? -43.759 4.894   -29.063 1.00 102.99 ? 287  HIS B NE2 1 
ATOM   6326 N N   . VAL B 1 287 ? -38.277 2.739   -32.179 1.00 64.52  ? 288  VAL B N   1 
ATOM   6327 C CA  . VAL B 1 287 ? -37.105 2.566   -33.038 1.00 61.32  ? 288  VAL B CA  1 
ATOM   6328 C C   . VAL B 1 287 ? -37.314 1.545   -34.135 1.00 63.15  ? 288  VAL B C   1 
ATOM   6329 O O   . VAL B 1 287 ? -36.518 1.511   -35.079 1.00 65.87  ? 288  VAL B O   1 
ATOM   6330 C CB  . VAL B 1 287 ? -35.826 2.100   -32.322 1.00 55.52  ? 288  VAL B CB  1 
ATOM   6331 C CG1 . VAL B 1 287 ? -35.523 2.952   -31.187 1.00 55.44  ? 288  VAL B CG1 1 
ATOM   6332 C CG2 . VAL B 1 287 ? -35.959 0.676   -31.887 1.00 53.08  ? 288  VAL B CG2 1 
ATOM   6333 N N   . LEU B 1 288 ? -38.282 0.665   -34.023 1.00 71.72  ? 289  LEU B N   1 
ATOM   6334 C CA  . LEU B 1 288 ? -38.440 -0.349  -35.045 1.00 81.41  ? 289  LEU B CA  1 
ATOM   6335 C C   . LEU B 1 288 ? -38.811 0.267   -36.371 1.00 105.85 ? 289  LEU B C   1 
ATOM   6336 O O   . LEU B 1 288 ? -39.590 1.213   -36.432 1.00 111.40 ? 289  LEU B O   1 
ATOM   6337 C CB  . LEU B 1 288 ? -39.443 -1.397  -34.637 1.00 73.90  ? 289  LEU B CB  1 
ATOM   6338 C CG  . LEU B 1 288 ? -38.969 -2.374  -33.575 1.00 70.31  ? 289  LEU B CG  1 
ATOM   6339 C CD1 . LEU B 1 288 ? -40.077 -3.314  -33.154 1.00 71.56  ? 289  LEU B CD1 1 
ATOM   6340 C CD2 . LEU B 1 288 ? -37.719 -3.120  -33.990 1.00 63.09  ? 289  LEU B CD2 1 
ATOM   6341 N N   . PRO B 1 289 ? -38.271 -0.289  -37.454 1.00 120.84 ? 290  PRO B N   1 
ATOM   6342 C CA  . PRO B 1 289 ? -38.522 0.329   -38.758 1.00 126.56 ? 290  PRO B CA  1 
ATOM   6343 C C   . PRO B 1 289 ? -39.964 0.138   -39.199 1.00 129.52 ? 290  PRO B C   1 
ATOM   6344 O O   . PRO B 1 289 ? -40.658 1.108   -39.522 1.00 137.38 ? 290  PRO B O   1 
ATOM   6345 C CB  . PRO B 1 289 ? -37.529 -0.395  -39.675 1.00 126.06 ? 290  PRO B CB  1 
ATOM   6346 C CG  . PRO B 1 289 ? -37.409 -1.748  -39.065 1.00 121.53 ? 290  PRO B CG  1 
ATOM   6347 C CD  . PRO B 1 289 ? -37.452 -1.509  -37.575 1.00 119.03 ? 290  PRO B CD  1 
ATOM   6348 N N   . GLN B 1 290 ? -40.429 -1.105  -39.181 1.00 123.12 ? 291  GLN B N   1 
ATOM   6349 C CA  . GLN B 1 290 ? -41.771 -1.456  -39.608 1.00 121.99 ? 291  GLN B CA  1 
ATOM   6350 C C   . GLN B 1 290 ? -42.584 -1.969  -38.427 1.00 117.47 ? 291  GLN B C   1 
ATOM   6351 O O   . GLN B 1 290 ? -42.044 -2.451  -37.427 1.00 109.03 ? 291  GLN B O   1 
ATOM   6352 C CB  . GLN B 1 290 ? -41.730 -2.511  -40.720 1.00 123.69 ? 291  GLN B CB  1 
ATOM   6353 C CG  . GLN B 1 290 ? -41.358 -1.950  -42.086 1.00 127.34 ? 291  GLN B CG  1 
ATOM   6354 C CD  . GLN B 1 290 ? -42.569 -1.678  -42.961 1.00 130.79 ? 291  GLN B CD  1 
ATOM   6355 O OE1 . GLN B 1 290 ? -43.581 -1.154  -42.495 1.00 131.97 ? 291  GLN B OE1 1 
ATOM   6356 N NE2 . GLN B 1 290 ? -42.469 -2.035  -44.238 1.00 130.99 ? 291  GLN B NE2 1 
ATOM   6357 N N   . GLU B 1 291 ? -43.903 -1.847  -38.559 1.00 121.68 ? 292  GLU B N   1 
ATOM   6358 C CA  . GLU B 1 291 ? -44.814 -2.348  -37.540 1.00 122.43 ? 292  GLU B CA  1 
ATOM   6359 C C   . GLU B 1 291 ? -44.725 -3.868  -37.452 1.00 114.93 ? 292  GLU B C   1 
ATOM   6360 O O   . GLU B 1 291 ? -44.659 -4.560  -38.471 1.00 113.48 ? 292  GLU B O   1 
ATOM   6361 C CB  . GLU B 1 291 ? -46.244 -1.910  -37.864 1.00 135.24 ? 292  GLU B CB  1 
ATOM   6362 C CG  . GLU B 1 291 ? -47.305 -2.502  -36.955 1.00 143.53 ? 292  GLU B CG  1 
ATOM   6363 C CD  . GLU B 1 291 ? -47.024 -2.249  -35.485 1.00 145.49 ? 292  GLU B CD  1 
ATOM   6364 O OE1 . GLU B 1 291 ? -46.478 -1.174  -35.152 1.00 145.37 ? 292  GLU B OE1 1 
ATOM   6365 O OE2 . GLU B 1 291 ? -47.347 -3.130  -34.660 1.00 146.05 ? 292  GLU B OE2 1 
ATOM   6366 N N   . SER B 1 292 ? -44.723 -4.393  -36.226 1.00 108.12 ? 293  SER B N   1 
ATOM   6367 C CA  . SER B 1 292 ? -44.504 -5.820  -36.027 1.00 101.18 ? 293  SER B CA  1 
ATOM   6368 C C   . SER B 1 292 ? -45.212 -6.304  -34.765 1.00 93.67  ? 293  SER B C   1 
ATOM   6369 O O   . SER B 1 292 ? -45.451 -5.527  -33.838 1.00 96.00  ? 293  SER B O   1 
ATOM   6370 C CB  . SER B 1 292 ? -43.005 -6.131  -35.941 1.00 98.04  ? 293  SER B CB  1 
ATOM   6371 O OG  . SER B 1 292 ? -42.792 -7.482  -35.578 1.00 98.63  ? 293  SER B OG  1 
ATOM   6372 N N   . VAL B 1 293 ? -45.545 -7.604  -34.739 1.00 87.44  ? 294  VAL B N   1 
ATOM   6373 C CA  . VAL B 1 293 ? -46.006 -8.241  -33.502 1.00 81.95  ? 294  VAL B CA  1 
ATOM   6374 C C   . VAL B 1 293 ? -44.878 -8.339  -32.483 1.00 85.07  ? 294  VAL B C   1 
ATOM   6375 O O   . VAL B 1 293 ? -45.132 -8.401  -31.274 1.00 85.70  ? 294  VAL B O   1 
ATOM   6376 C CB  . VAL B 1 293 ? -46.587 -9.650  -33.742 1.00 77.12  ? 294  VAL B CB  1 
ATOM   6377 C CG1 . VAL B 1 293 ? -48.026 -9.614  -34.208 1.00 83.12  ? 294  VAL B CG1 1 
ATOM   6378 C CG2 . VAL B 1 293 ? -45.749 -10.384 -34.719 1.00 75.36  ? 294  VAL B CG2 1 
ATOM   6379 N N   . PHE B 1 294 ? -43.639 -8.342  -32.918 1.00 83.43  ? 295  PHE B N   1 
ATOM   6380 C CA  . PHE B 1 294 ? -42.539 -8.464  -31.985 1.00 79.69  ? 295  PHE B CA  1 
ATOM   6381 C C   . PHE B 1 294 ? -41.867 -7.139  -31.727 1.00 88.54  ? 295  PHE B C   1 
ATOM   6382 O O   . PHE B 1 294 ? -41.297 -6.565  -32.612 1.00 94.47  ? 295  PHE B O   1 
ATOM   6383 C CB  . PHE B 1 294 ? -41.543 -9.458  -32.541 1.00 70.91  ? 295  PHE B CB  1 
ATOM   6384 C CG  . PHE B 1 294 ? -42.148 -10.777 -32.841 1.00 73.96  ? 295  PHE B CG  1 
ATOM   6385 C CD1 . PHE B 1 294 ? -42.756 -11.005 -34.034 1.00 73.66  ? 295  PHE B CD1 1 
ATOM   6386 C CD2 . PHE B 1 294 ? -42.151 -11.775 -31.904 1.00 74.27  ? 295  PHE B CD2 1 
ATOM   6387 C CE1 . PHE B 1 294 ? -43.341 -12.211 -34.291 1.00 72.51  ? 295  PHE B CE1 1 
ATOM   6388 C CE2 . PHE B 1 294 ? -42.728 -12.987 -32.164 1.00 72.50  ? 295  PHE B CE2 1 
ATOM   6389 C CZ  . PHE B 1 294 ? -43.328 -13.196 -33.354 1.00 69.97  ? 295  PHE B CZ  1 
ATOM   6390 N N   . ARG B 1 295 ? -41.851 -6.723  -30.475 1.00 87.90  ? 296  ARG B N   1 
ATOM   6391 C CA  . ARG B 1 295 ? -41.264 -5.452  -30.093 1.00 89.89  ? 296  ARG B CA  1 
ATOM   6392 C C   . ARG B 1 295 ? -39.798 -5.514  -29.728 1.00 86.96  ? 296  ARG B C   1 
ATOM   6393 O O   . ARG B 1 295 ? -39.344 -4.794  -28.876 1.00 105.57 ? 296  ARG B O   1 
ATOM   6394 C CB  . ARG B 1 295 ? -42.051 -4.846  -28.935 1.00 91.76  ? 296  ARG B CB  1 
ATOM   6395 C CG  . ARG B 1 295 ? -41.625 -5.251  -27.534 1.00 88.81  ? 296  ARG B CG  1 
ATOM   6396 C CD  . ARG B 1 295 ? -41.142 -4.052  -26.734 1.00 81.30  ? 296  ARG B CD  1 
ATOM   6397 N NE  . ARG B 1 295 ? -42.229 -3.115  -26.571 1.00 71.28  ? 296  ARG B NE  1 
ATOM   6398 C CZ  . ARG B 1 295 ? -42.147 -1.902  -26.077 1.00 66.74  ? 296  ARG B CZ  1 
ATOM   6399 N NH1 . ARG B 1 295 ? -43.222 -1.189  -26.008 1.00 71.13  ? 296  ARG B NH1 1 
ATOM   6400 N NH2 . ARG B 1 295 ? -41.029 -1.412  -25.644 1.00 64.27  ? 296  ARG B NH2 1 
ATOM   6401 N N   . PHE B 1 296 ? -39.016 -6.315  -30.403 1.00 67.45  ? 297  PHE B N   1 
ATOM   6402 C CA  . PHE B 1 296 ? -37.640 -6.399  -29.991 1.00 51.35  ? 297  PHE B CA  1 
ATOM   6403 C C   . PHE B 1 296 ? -36.765 -5.372  -30.677 1.00 46.91  ? 297  PHE B C   1 
ATOM   6404 O O   . PHE B 1 296 ? -36.274 -5.590  -31.720 1.00 50.78  ? 297  PHE B O   1 
ATOM   6405 C CB  . PHE B 1 296 ? -37.087 -7.791  -30.199 1.00 51.90  ? 297  PHE B CB  1 
ATOM   6406 C CG  . PHE B 1 296 ? -38.012 -8.912  -29.823 1.00 51.42  ? 297  PHE B CG  1 
ATOM   6407 C CD1 . PHE B 1 296 ? -37.655 -10.176 -30.097 1.00 49.51  ? 297  PHE B CD1 1 
ATOM   6408 C CD2 . PHE B 1 296 ? -39.196 -8.717  -29.197 1.00 55.74  ? 297  PHE B CD2 1 
ATOM   6409 C CE1 . PHE B 1 296 ? -38.468 -11.204 -29.785 1.00 56.64  ? 297  PHE B CE1 1 
ATOM   6410 C CE2 . PHE B 1 296 ? -40.022 -9.727  -28.901 1.00 58.81  ? 297  PHE B CE2 1 
ATOM   6411 C CZ  . PHE B 1 296 ? -39.654 -10.985 -29.184 1.00 59.70  ? 297  PHE B CZ  1 
ATOM   6412 N N   . SER B 1 297 ? -36.510 -4.274  -30.001 1.00 45.20  ? 298  SER B N   1 
ATOM   6413 C CA  . SER B 1 297 ? -35.720 -3.172  -30.539 1.00 46.33  ? 298  SER B CA  1 
ATOM   6414 C C   . SER B 1 297 ? -34.221 -3.381  -30.342 1.00 41.54  ? 298  SER B C   1 
ATOM   6415 O O   . SER B 1 297 ? -33.428 -3.116  -31.253 1.00 40.14  ? 298  SER B O   1 
ATOM   6416 C CB  . SER B 1 297 ? -36.163 -1.878  -29.870 1.00 52.84  ? 298  SER B CB  1 
ATOM   6417 O OG  . SER B 1 297 ? -37.487 -1.551  -30.257 1.00 58.06  ? 298  SER B OG  1 
ATOM   6418 N N   . PHE B 1 298 ? -33.812 -3.838  -29.162 1.00 28.93  ? 299  PHE B N   1 
ATOM   6419 C CA  . PHE B 1 298 ? -32.404 -4.007  -28.827 1.00 31.96  ? 299  PHE B CA  1 
ATOM   6420 C C   . PHE B 1 298 ? -32.182 -5.467  -28.464 1.00 36.17  ? 299  PHE B C   1 
ATOM   6421 O O   . PHE B 1 298 ? -32.706 -5.950  -27.452 1.00 31.49  ? 299  PHE B O   1 
ATOM   6422 C CB  . PHE B 1 298 ? -32.001 -3.055  -27.702 1.00 32.23  ? 299  PHE B CB  1 
ATOM   6423 C CG  . PHE B 1 298 ? -32.223 -1.615  -28.053 1.00 32.82  ? 299  PHE B CG  1 
ATOM   6424 C CD1 . PHE B 1 298 ? -31.360 -0.965  -28.922 1.00 33.22  ? 299  PHE B CD1 1 
ATOM   6425 C CD2 . PHE B 1 298 ? -33.330 -0.929  -27.569 1.00 29.28  ? 299  PHE B CD2 1 
ATOM   6426 C CE1 . PHE B 1 298 ? -31.573 0.362   -29.283 1.00 35.37  ? 299  PHE B CE1 1 
ATOM   6427 C CE2 . PHE B 1 298 ? -33.551 0.395   -27.918 1.00 31.94  ? 299  PHE B CE2 1 
ATOM   6428 C CZ  . PHE B 1 298 ? -32.672 1.043   -28.778 1.00 37.54  ? 299  PHE B CZ  1 
ATOM   6429 N N   . VAL B 1 299 ? -31.437 -6.168  -29.314 1.00 29.65  ? 300  VAL B N   1 
ATOM   6430 C CA  . VAL B 1 299 ? -31.201 -7.604  -29.194 1.00 29.68  ? 300  VAL B CA  1 
ATOM   6431 C C   . VAL B 1 299 ? -29.703 -7.849  -29.355 1.00 29.51  ? 300  VAL B C   1 
ATOM   6432 O O   . VAL B 1 299 ? -28.954 -6.903  -29.638 1.00 26.44  ? 300  VAL B O   1 
ATOM   6433 C CB  . VAL B 1 299 ? -32.032 -8.390  -30.230 1.00 35.52  ? 300  VAL B CB  1 
ATOM   6434 C CG1 . VAL B 1 299 ? -33.515 -8.107  -30.051 1.00 25.99  ? 300  VAL B CG1 1 
ATOM   6435 C CG2 . VAL B 1 299 ? -31.584 -8.073  -31.665 1.00 26.10  ? 300  VAL B CG2 1 
ATOM   6436 N N   . PRO B 1 300 ? -29.213 -9.068  -29.148 1.00 28.28  ? 301  PRO B N   1 
ATOM   6437 C CA  . PRO B 1 300 ? -27.803 -9.347  -29.434 1.00 25.39  ? 301  PRO B CA  1 
ATOM   6438 C C   . PRO B 1 300 ? -27.393 -8.905  -30.833 1.00 29.03  ? 301  PRO B C   1 
ATOM   6439 O O   . PRO B 1 300 ? -28.146 -9.055  -31.796 1.00 32.44  ? 301  PRO B O   1 
ATOM   6440 C CB  . PRO B 1 300 ? -27.713 -10.867 -29.269 1.00 23.28  ? 301  PRO B CB  1 
ATOM   6441 C CG  . PRO B 1 300 ? -28.666 -11.129 -28.143 1.00 26.97  ? 301  PRO B CG  1 
ATOM   6442 C CD  . PRO B 1 300 ? -29.819 -10.146 -28.339 1.00 27.77  ? 301  PRO B CD  1 
ATOM   6443 N N   . VAL B 1 301 ? -26.189 -8.334  -30.929 1.00 30.24  ? 302  VAL B N   1 
ATOM   6444 C CA  . VAL B 1 301 ? -25.630 -7.845  -32.187 1.00 35.55  ? 302  VAL B CA  1 
ATOM   6445 C C   . VAL B 1 301 ? -24.487 -8.760  -32.612 1.00 37.21  ? 302  VAL B C   1 
ATOM   6446 O O   . VAL B 1 301 ? -23.709 -9.235  -31.774 1.00 35.88  ? 302  VAL B O   1 
ATOM   6447 C CB  . VAL B 1 301 ? -25.150 -6.379  -32.072 1.00 33.69  ? 302  VAL B CB  1 
ATOM   6448 C CG1 . VAL B 1 301 ? -23.996 -6.243  -31.084 1.00 31.44  ? 302  VAL B CG1 1 
ATOM   6449 C CG2 . VAL B 1 301 ? -24.742 -5.834  -33.437 1.00 32.08  ? 302  VAL B CG2 1 
ATOM   6450 N N   . VAL B 1 302 ? -24.396 -9.017  -33.915 1.00 41.07  ? 303  VAL B N   1 
ATOM   6451 C CA  . VAL B 1 302 ? -23.319 -9.820  -34.490 1.00 36.90  ? 303  VAL B CA  1 
ATOM   6452 C C   . VAL B 1 302 ? -22.214 -8.854  -34.902 1.00 40.53  ? 303  VAL B C   1 
ATOM   6453 O O   . VAL B 1 302 ? -22.262 -8.260  -35.984 1.00 44.94  ? 303  VAL B O   1 
ATOM   6454 C CB  . VAL B 1 302 ? -23.806 -10.657 -35.674 1.00 37.83  ? 303  VAL B CB  1 
ATOM   6455 C CG1 . VAL B 1 302 ? -22.647 -11.445 -36.293 1.00 34.90  ? 303  VAL B CG1 1 
ATOM   6456 C CG2 . VAL B 1 302 ? -24.909 -11.600 -35.232 1.00 36.20  ? 303  VAL B CG2 1 
ATOM   6457 N N   . ASP B 1 303 ? -21.249 -8.705  -34.034 1.00 40.17  ? 304  ASP B N   1 
ATOM   6458 C CA  . ASP B 1 303 ? -20.154 -7.813  -34.222 1.00 52.03  ? 304  ASP B CA  1 
ATOM   6459 C C   . ASP B 1 303 ? -18.783 -8.413  -34.321 1.00 51.90  ? 304  ASP B C   1 
ATOM   6460 O O   . ASP B 1 303 ? -17.829 -7.701  -34.303 1.00 56.30  ? 304  ASP B O   1 
ATOM   6461 C CB  . ASP B 1 303 ? -20.135 -6.889  -33.042 1.00 59.82  ? 304  ASP B CB  1 
ATOM   6462 C CG  . ASP B 1 303 ? -20.048 -7.623  -31.740 1.00 64.81  ? 304  ASP B CG  1 
ATOM   6463 O OD1 . ASP B 1 303 ? -20.275 -8.846  -31.657 1.00 58.85  ? 304  ASP B OD1 1 
ATOM   6464 O OD2 . ASP B 1 303 ? -19.746 -6.942  -30.781 1.00 70.16  ? 304  ASP B OD2 1 
ATOM   6465 N N   . GLY B 1 304 ? -18.685 -9.719  -34.393 1.00 44.79  ? 305  GLY B N   1 
ATOM   6466 C CA  . GLY B 1 304 ? -17.408 -10.403 -34.437 1.00 47.23  ? 305  GLY B CA  1 
ATOM   6467 C C   . GLY B 1 304 ? -16.760 -10.651 -33.092 1.00 47.14  ? 305  GLY B C   1 
ATOM   6468 O O   . GLY B 1 304 ? -15.715 -11.314 -33.042 1.00 50.58  ? 305  GLY B O   1 
ATOM   6469 N N   . ASP B 1 305 ? -17.361 -10.195 -32.011 1.00 36.74  ? 306  ASP B N   1 
ATOM   6470 C CA  . ASP B 1 305 ? -16.785 -10.360 -30.702 1.00 43.68  ? 306  ASP B CA  1 
ATOM   6471 C C   . ASP B 1 305 ? -17.465 -11.457 -29.936 1.00 40.30  ? 306  ASP B C   1 
ATOM   6472 O O   . ASP B 1 305 ? -17.004 -12.544 -29.956 1.00 46.19  ? 306  ASP B O   1 
ATOM   6473 C CB  . ASP B 1 305 ? -16.899 -9.054  -29.960 1.00 46.38  ? 306  ASP B CB  1 
ATOM   6474 C CG  . ASP B 1 305 ? -16.091 -9.027  -28.725 1.00 53.36  ? 306  ASP B CG  1 
ATOM   6475 O OD1 . ASP B 1 305 ? -15.363 -9.968  -28.474 1.00 55.27  ? 306  ASP B OD1 1 
ATOM   6476 O OD2 . ASP B 1 305 ? -16.168 -8.051  -28.002 1.00 57.85  ? 306  ASP B OD2 1 
ATOM   6477 N N   . PHE B 1 306 ? -18.559 -11.183 -29.260 1.00 36.12  ? 307  PHE B N   1 
ATOM   6478 C CA  . PHE B 1 306 ? -19.301 -12.250 -28.595 1.00 35.26  ? 307  PHE B CA  1 
ATOM   6479 C C   . PHE B 1 306 ? -19.712 -13.324 -29.590 1.00 33.46  ? 307  PHE B C   1 
ATOM   6480 O O   . PHE B 1 306 ? -19.539 -14.522 -29.339 1.00 37.24  ? 307  PHE B O   1 
ATOM   6481 C CB  . PHE B 1 306 ? -20.530 -11.679 -27.887 1.00 27.27  ? 307  PHE B CB  1 
ATOM   6482 C CG  . PHE B 1 306 ? -21.070 -12.565 -26.799 1.00 31.60  ? 307  PHE B CG  1 
ATOM   6483 C CD1 . PHE B 1 306 ? -21.856 -13.672 -27.101 1.00 31.19  ? 307  PHE B CD1 1 
ATOM   6484 C CD2 . PHE B 1 306 ? -20.787 -12.292 -25.472 1.00 31.63  ? 307  PHE B CD2 1 
ATOM   6485 C CE1 . PHE B 1 306 ? -22.349 -14.487 -26.090 1.00 28.69  ? 307  PHE B CE1 1 
ATOM   6486 C CE2 . PHE B 1 306 ? -21.273 -13.094 -24.462 1.00 28.01  ? 307  PHE B CE2 1 
ATOM   6487 C CZ  . PHE B 1 306 ? -22.055 -14.197 -24.770 1.00 27.19  ? 307  PHE B CZ  1 
ATOM   6488 N N   . LEU B 1 307 ? -20.274 -12.913 -30.720 1.00 35.08  ? 308  LEU B N   1 
ATOM   6489 C CA  . LEU B 1 307 ? -20.575 -13.802 -31.835 1.00 41.02  ? 308  LEU B CA  1 
ATOM   6490 C C   . LEU B 1 307 ? -19.634 -13.436 -32.977 1.00 41.19  ? 308  LEU B C   1 
ATOM   6491 O O   . LEU B 1 307 ? -19.782 -12.373 -33.590 1.00 43.23  ? 308  LEU B O   1 
ATOM   6492 C CB  . LEU B 1 307 ? -22.034 -13.670 -32.263 1.00 42.50  ? 308  LEU B CB  1 
ATOM   6493 C CG  . LEU B 1 307 ? -23.095 -13.976 -31.206 1.00 43.41  ? 308  LEU B CG  1 
ATOM   6494 C CD1 . LEU B 1 307 ? -24.479 -13.615 -31.732 1.00 38.83  ? 308  LEU B CD1 1 
ATOM   6495 C CD2 . LEU B 1 307 ? -23.023 -15.444 -30.773 1.00 39.28  ? 308  LEU B CD2 1 
ATOM   6496 N N   . SER B 1 308 ? -18.658 -14.305 -33.252 1.00 37.21  ? 309  SER B N   1 
ATOM   6497 C CA  . SER B 1 308 ? -17.731 -14.062 -34.352 1.00 39.93  ? 309  SER B CA  1 
ATOM   6498 C C   . SER B 1 308 ? -18.402 -14.168 -35.714 1.00 43.80  ? 309  SER B C   1 
ATOM   6499 O O   . SER B 1 308 ? -17.812 -13.744 -36.711 1.00 49.94  ? 309  SER B O   1 
ATOM   6500 C CB  . SER B 1 308 ? -16.553 -15.036 -34.280 1.00 42.54  ? 309  SER B CB  1 
ATOM   6501 O OG  . SER B 1 308 ? -16.987 -16.376 -34.410 1.00 49.85  ? 309  SER B OG  1 
ATOM   6502 N N   . ASP B 1 309 ? -19.608 -14.724 -35.779 1.00 45.00  ? 310  ASP B N   1 
ATOM   6503 C CA  . ASP B 1 309 ? -20.380 -14.798 -37.010 1.00 45.13  ? 310  ASP B CA  1 
ATOM   6504 C C   . ASP B 1 309 ? -21.850 -14.882 -36.622 1.00 42.99  ? 310  ASP B C   1 
ATOM   6505 O O   . ASP B 1 309 ? -22.195 -14.885 -35.437 1.00 42.42  ? 310  ASP B O   1 
ATOM   6506 C CB  . ASP B 1 309 ? -19.944 -15.991 -37.874 1.00 47.09  ? 310  ASP B CB  1 
ATOM   6507 C CG  . ASP B 1 309 ? -20.164 -15.748 -39.365 1.00 57.64  ? 310  ASP B CG  1 
ATOM   6508 O OD1 . ASP B 1 309 ? -21.125 -15.028 -39.717 1.00 56.90  ? 310  ASP B OD1 1 
ATOM   6509 O OD2 . ASP B 1 309 ? -19.381 -16.282 -40.186 1.00 59.63  ? 310  ASP B OD2 1 
ATOM   6510 N N   . THR B 1 310 ? -22.723 -14.933 -37.626 1.00 39.87  ? 311  THR B N   1 
ATOM   6511 C CA  . THR B 1 310 ? -24.135 -15.140 -37.346 1.00 38.01  ? 311  THR B CA  1 
ATOM   6512 C C   . THR B 1 310 ? -24.335 -16.507 -36.694 1.00 38.00  ? 311  THR B C   1 
ATOM   6513 O O   . THR B 1 310 ? -23.580 -17.446 -36.965 1.00 43.04  ? 311  THR B O   1 
ATOM   6514 C CB  . THR B 1 310 ? -24.966 -15.062 -38.625 1.00 44.35  ? 311  THR B CB  1 
ATOM   6515 O OG1 . THR B 1 310 ? -24.753 -16.247 -39.404 1.00 45.62  ? 311  THR B OG1 1 
ATOM   6516 C CG2 . THR B 1 310 ? -24.585 -13.837 -39.447 1.00 35.12  ? 311  THR B CG2 1 
ATOM   6517 N N   . PRO B 1 311 ? -25.343 -16.648 -35.826 1.00 33.92  ? 312  PRO B N   1 
ATOM   6518 C CA  . PRO B 1 311 ? -25.585 -17.967 -35.217 1.00 34.68  ? 312  PRO B CA  1 
ATOM   6519 C C   . PRO B 1 311 ? -25.818 -19.065 -36.243 1.00 38.24  ? 312  PRO B C   1 
ATOM   6520 O O   . PRO B 1 311 ? -25.385 -20.203 -36.032 1.00 43.04  ? 312  PRO B O   1 
ATOM   6521 C CB  . PRO B 1 311 ? -26.818 -17.721 -34.334 1.00 32.73  ? 312  PRO B CB  1 
ATOM   6522 C CG  . PRO B 1 311 ? -26.760 -16.257 -34.017 1.00 33.68  ? 312  PRO B CG  1 
ATOM   6523 C CD  . PRO B 1 311 ? -26.221 -15.607 -35.262 1.00 35.27  ? 312  PRO B CD  1 
ATOM   6524 N N   . GLU B 1 312 ? -26.437 -18.765 -37.360 1.00 46.28  ? 313  GLU B N   1 
ATOM   6525 C CA  . GLU B 1 312 ? -26.634 -19.754 -38.389 1.00 48.18  ? 313  GLU B CA  1 
ATOM   6526 C C   . GLU B 1 312 ? -25.302 -20.217 -38.960 1.00 45.83  ? 313  GLU B C   1 
ATOM   6527 O O   . GLU B 1 312 ? -25.077 -21.376 -39.103 1.00 44.77  ? 313  GLU B O   1 
ATOM   6528 C CB  . GLU B 1 312 ? -27.504 -19.201 -39.494 1.00 55.94  ? 313  GLU B CB  1 
ATOM   6529 C CG  . GLU B 1 312 ? -28.277 -20.251 -40.243 1.00 73.79  ? 313  GLU B CG  1 
ATOM   6530 C CD  . GLU B 1 312 ? -28.142 -20.147 -41.753 1.00 87.45  ? 313  GLU B CD  1 
ATOM   6531 O OE1 . GLU B 1 312 ? -28.014 -21.212 -42.401 1.00 97.04  ? 313  GLU B OE1 1 
ATOM   6532 O OE2 . GLU B 1 312 ? -28.161 -19.019 -42.293 1.00 89.23  ? 313  GLU B OE2 1 
ATOM   6533 N N   . ALA B 1 313 ? -24.406 -19.300 -39.229 1.00 41.80  ? 314  ALA B N   1 
ATOM   6534 C CA  . ALA B 1 313 ? -23.090 -19.679 -39.727 1.00 40.21  ? 314  ALA B CA  1 
ATOM   6535 C C   . ALA B 1 313 ? -22.306 -20.454 -38.675 1.00 43.36  ? 314  ALA B C   1 
ATOM   6536 O O   . ALA B 1 313 ? -21.624 -21.437 -38.994 1.00 44.64  ? 314  ALA B O   1 
ATOM   6537 C CB  . ALA B 1 313 ? -22.318 -18.438 -40.172 1.00 37.52  ? 314  ALA B CB  1 
ATOM   6538 N N   . LEU B 1 314 ? -22.395 -20.032 -37.411 1.00 41.23  ? 315  LEU B N   1 
ATOM   6539 C CA  . LEU B 1 314 ? -21.684 -20.739 -36.351 1.00 38.46  ? 315  LEU B CA  1 
ATOM   6540 C C   . LEU B 1 314 ? -22.262 -22.131 -36.138 1.00 37.93  ? 315  LEU B C   1 
ATOM   6541 O O   . LEU B 1 314 ? -21.518 -23.085 -35.881 1.00 37.96  ? 315  LEU B O   1 
ATOM   6542 C CB  . LEU B 1 314 ? -21.732 -19.931 -35.056 1.00 38.61  ? 315  LEU B CB  1 
ATOM   6543 C CG  . LEU B 1 314 ? -20.947 -18.623 -35.099 1.00 41.03  ? 315  LEU B CG  1 
ATOM   6544 C CD1 . LEU B 1 314 ? -21.163 -17.830 -33.818 1.00 38.97  ? 315  LEU B CD1 1 
ATOM   6545 C CD2 . LEU B 1 314 ? -19.464 -18.903 -35.343 1.00 39.64  ? 315  LEU B CD2 1 
ATOM   6546 N N   . ILE B 1 315 ? -23.584 -22.267 -36.257 1.00 40.38  ? 316  ILE B N   1 
ATOM   6547 C CA  . ILE B 1 315 ? -24.225 -23.568 -36.089 1.00 44.74  ? 316  ILE B CA  1 
ATOM   6548 C C   . ILE B 1 315 ? -23.782 -24.528 -37.190 1.00 50.59  ? 316  ILE B C   1 
ATOM   6549 O O   . ILE B 1 315 ? -23.376 -25.664 -36.915 1.00 49.09  ? 316  ILE B O   1 
ATOM   6550 C CB  . ILE B 1 315 ? -25.758 -23.406 -36.052 1.00 40.95  ? 316  ILE B CB  1 
ATOM   6551 C CG1 . ILE B 1 315 ? -26.210 -22.840 -34.708 1.00 43.26  ? 316  ILE B CG1 1 
ATOM   6552 C CG2 . ILE B 1 315 ? -26.456 -24.719 -36.284 1.00 37.81  ? 316  ILE B CG2 1 
ATOM   6553 C CD1 . ILE B 1 315 ? -27.562 -22.168 -34.781 1.00 42.70  ? 316  ILE B CD1 1 
ATOM   6554 N N   . ASN B 1 316 ? -23.830 -24.079 -38.451 1.00 50.15  ? 317  ASN B N   1 
ATOM   6555 C CA  . ASN B 1 316 ? -23.483 -24.945 -39.577 1.00 52.27  ? 317  ASN B CA  1 
ATOM   6556 C C   . ASN B 1 316 ? -22.025 -25.385 -39.561 1.00 51.20  ? 317  ASN B C   1 
ATOM   6557 O O   . ASN B 1 316 ? -21.701 -26.428 -40.138 1.00 55.34  ? 317  ASN B O   1 
ATOM   6558 C CB  . ASN B 1 316 ? -23.774 -24.239 -40.904 1.00 51.22  ? 317  ASN B CB  1 
ATOM   6559 C CG  . ASN B 1 316 ? -25.236 -23.904 -41.076 1.00 58.91  ? 317  ASN B CG  1 
ATOM   6560 O OD1 . ASN B 1 316 ? -26.093 -24.430 -40.366 1.00 65.26  ? 317  ASN B OD1 1 
ATOM   6561 N ND2 . ASN B 1 316 ? -25.532 -23.020 -42.022 1.00 62.58  ? 317  ASN B ND2 1 
ATOM   6562 N N   . ALA B 1 317 ? -21.141 -24.620 -38.922 1.00 47.29  ? 318  ALA B N   1 
ATOM   6563 C CA  . ALA B 1 317 ? -19.716 -24.910 -38.946 1.00 46.59  ? 318  ALA B CA  1 
ATOM   6564 C C   . ALA B 1 317 ? -19.218 -25.634 -37.700 1.00 55.41  ? 318  ALA B C   1 
ATOM   6565 O O   . ALA B 1 317 ? -18.089 -26.133 -37.706 1.00 68.25  ? 318  ALA B O   1 
ATOM   6566 C CB  . ALA B 1 317 ? -18.918 -23.611 -39.125 1.00 41.69  ? 318  ALA B CB  1 
ATOM   6567 N N   . GLY B 1 318 ? -20.027 -25.723 -36.649 1.00 47.87  ? 319  GLY B N   1 
ATOM   6568 C CA  . GLY B 1 318 ? -19.522 -26.180 -35.370 1.00 44.54  ? 319  GLY B CA  1 
ATOM   6569 C C   . GLY B 1 318 ? -19.353 -27.687 -35.285 1.00 45.57  ? 319  GLY B C   1 
ATOM   6570 O O   . GLY B 1 318 ? -20.072 -28.465 -35.917 1.00 41.14  ? 319  GLY B O   1 
ATOM   6571 N N   . ASP B 1 319 ? -18.363 -28.093 -34.488 1.00 45.46  ? 320  ASP B N   1 
ATOM   6572 C CA  . ASP B 1 319 ? -18.190 -29.482 -34.075 1.00 43.79  ? 320  ASP B CA  1 
ATOM   6573 C C   . ASP B 1 319 ? -18.879 -29.613 -32.726 1.00 39.65  ? 320  ASP B C   1 
ATOM   6574 O O   . ASP B 1 319 ? -18.436 -29.018 -31.739 1.00 41.40  ? 320  ASP B O   1 
ATOM   6575 C CB  . ASP B 1 319 ? -16.704 -29.841 -33.992 1.00 44.71  ? 320  ASP B CB  1 
ATOM   6576 C CG  . ASP B 1 319 ? -16.448 -31.284 -33.538 1.00 52.84  ? 320  ASP B CG  1 
ATOM   6577 O OD1 . ASP B 1 319 ? -15.323 -31.790 -33.771 1.00 56.57  ? 320  ASP B OD1 1 
ATOM   6578 O OD2 . ASP B 1 319 ? -17.349 -31.919 -32.946 1.00 55.07  ? 320  ASP B OD2 1 
ATOM   6579 N N   . PHE B 1 320 ? -19.972 -30.374 -32.676 1.00 39.79  ? 321  PHE B N   1 
ATOM   6580 C CA  . PHE B 1 320 ? -20.771 -30.454 -31.457 1.00 43.13  ? 321  PHE B CA  1 
ATOM   6581 C C   . PHE B 1 320 ? -20.694 -31.817 -30.782 1.00 39.43  ? 321  PHE B C   1 
ATOM   6582 O O   . PHE B 1 320 ? -21.512 -32.106 -29.904 1.00 40.10  ? 321  PHE B O   1 
ATOM   6583 C CB  . PHE B 1 320 ? -22.223 -30.079 -31.760 1.00 40.88  ? 321  PHE B CB  1 
ATOM   6584 C CG  . PHE B 1 320 ? -22.387 -28.650 -32.188 1.00 38.77  ? 321  PHE B CG  1 
ATOM   6585 C CD1 . PHE B 1 320 ? -22.644 -28.334 -33.512 1.00 41.11  ? 321  PHE B CD1 1 
ATOM   6586 C CD2 . PHE B 1 320 ? -22.265 -27.622 -31.272 1.00 32.87  ? 321  PHE B CD2 1 
ATOM   6587 C CE1 . PHE B 1 320 ? -22.777 -27.015 -33.915 1.00 38.18  ? 321  PHE B CE1 1 
ATOM   6588 C CE2 . PHE B 1 320 ? -22.402 -26.305 -31.664 1.00 36.06  ? 321  PHE B CE2 1 
ATOM   6589 C CZ  . PHE B 1 320 ? -22.661 -26.001 -32.993 1.00 37.93  ? 321  PHE B CZ  1 
ATOM   6590 N N   . HIS B 1 321 ? -19.735 -32.658 -31.172 1.00 39.02  ? 322  HIS B N   1 
ATOM   6591 C CA  . HIS B 1 321 ? -19.468 -33.888 -30.437 1.00 41.10  ? 322  HIS B CA  1 
ATOM   6592 C C   . HIS B 1 321 ? -19.176 -33.574 -28.975 1.00 48.61  ? 322  HIS B C   1 
ATOM   6593 O O   . HIS B 1 321 ? -18.478 -32.606 -28.658 1.00 46.01  ? 322  HIS B O   1 
ATOM   6594 C CB  . HIS B 1 321 ? -18.284 -34.631 -31.055 1.00 42.52  ? 322  HIS B CB  1 
ATOM   6595 C CG  . HIS B 1 321 ? -18.592 -35.258 -32.376 1.00 48.12  ? 322  HIS B CG  1 
ATOM   6596 N ND1 . HIS B 1 321 ? -19.127 -36.523 -32.491 1.00 46.00  ? 322  HIS B ND1 1 
ATOM   6597 C CD2 . HIS B 1 321 ? -18.445 -34.794 -33.640 1.00 41.51  ? 322  HIS B CD2 1 
ATOM   6598 C CE1 . HIS B 1 321 ? -19.295 -36.813 -33.770 1.00 49.95  ? 322  HIS B CE1 1 
ATOM   6599 N NE2 . HIS B 1 321 ? -18.888 -35.780 -34.488 1.00 49.42  ? 322  HIS B NE2 1 
ATOM   6600 N N   . GLY B 1 322 ? -19.732 -34.390 -28.081 1.00 37.70  ? 323  GLY B N   1 
ATOM   6601 C CA  . GLY B 1 322 ? -19.572 -34.194 -26.654 1.00 35.84  ? 323  GLY B CA  1 
ATOM   6602 C C   . GLY B 1 322 ? -20.624 -33.322 -26.003 1.00 41.02  ? 323  GLY B C   1 
ATOM   6603 O O   . GLY B 1 322 ? -20.601 -33.161 -24.776 1.00 43.86  ? 323  GLY B O   1 
ATOM   6604 N N   . LEU B 1 323 ? -21.543 -32.755 -26.777 1.00 41.45  ? 324  LEU B N   1 
ATOM   6605 C CA  . LEU B 1 323 ? -22.596 -31.902 -26.253 1.00 40.61  ? 324  LEU B CA  1 
ATOM   6606 C C   . LEU B 1 323 ? -23.915 -32.665 -26.270 1.00 33.07  ? 324  LEU B C   1 
ATOM   6607 O O   . LEU B 1 323 ? -24.245 -33.323 -27.263 1.00 36.03  ? 324  LEU B O   1 
ATOM   6608 C CB  . LEU B 1 323 ? -22.710 -30.610 -27.066 1.00 40.47  ? 324  LEU B CB  1 
ATOM   6609 C CG  . LEU B 1 323 ? -24.004 -29.829 -26.836 1.00 41.28  ? 324  LEU B CG  1 
ATOM   6610 C CD1 . LEU B 1 323 ? -23.983 -29.206 -25.444 1.00 37.79  ? 324  LEU B CD1 1 
ATOM   6611 C CD2 . LEU B 1 323 ? -24.174 -28.756 -27.885 1.00 40.15  ? 324  LEU B CD2 1 
ATOM   6612 N N   . GLN B 1 324 ? -24.648 -32.605 -25.164 1.00 28.21  ? 325  GLN B N   1 
ATOM   6613 C CA  . GLN B 1 324 ? -26.022 -33.082 -25.118 1.00 36.54  ? 325  GLN B CA  1 
ATOM   6614 C C   . GLN B 1 324 ? -26.929 -31.879 -24.957 1.00 33.94  ? 325  GLN B C   1 
ATOM   6615 O O   . GLN B 1 324 ? -26.601 -30.934 -24.231 1.00 33.96  ? 325  GLN B O   1 
ATOM   6616 C CB  . GLN B 1 324 ? -26.270 -34.065 -23.972 1.00 38.43  ? 325  GLN B CB  1 
ATOM   6617 C CG  . GLN B 1 324 ? -25.433 -35.313 -24.046 1.00 42.42  ? 325  GLN B CG  1 
ATOM   6618 C CD  . GLN B 1 324 ? -24.105 -35.122 -23.366 1.00 48.39  ? 325  GLN B CD  1 
ATOM   6619 O OE1 . GLN B 1 324 ? -24.034 -34.617 -22.242 1.00 54.68  ? 325  GLN B OE1 1 
ATOM   6620 N NE2 . GLN B 1 324 ? -23.036 -35.500 -24.052 1.00 45.89  ? 325  GLN B NE2 1 
ATOM   6621 N N   . VAL B 1 325 ? -28.010 -31.877 -25.680 1.00 32.79  ? 326  VAL B N   1 
ATOM   6622 C CA  . VAL B 1 325 ? -28.915 -30.793 -25.652 1.00 36.84  ? 326  VAL B CA  1 
ATOM   6623 C C   . VAL B 1 325 ? -30.366 -31.249 -25.641 1.00 31.49  ? 326  VAL B C   1 
ATOM   6624 O O   . VAL B 1 325 ? -30.674 -32.247 -26.208 1.00 37.07  ? 326  VAL B O   1 
ATOM   6625 C CB  . VAL B 1 325 ? -28.542 -29.833 -26.795 1.00 39.23  ? 326  VAL B CB  1 
ATOM   6626 C CG1 . VAL B 1 325 ? -28.897 -30.380 -28.141 1.00 51.81  ? 326  VAL B CG1 1 
ATOM   6627 C CG2 . VAL B 1 325 ? -29.130 -28.496 -26.609 1.00 38.97  ? 326  VAL B CG2 1 
ATOM   6628 N N   . LEU B 1 326 ? -31.222 -30.523 -24.939 1.00 28.94  ? 327  LEU B N   1 
ATOM   6629 C CA  . LEU B 1 326 ? -32.651 -30.798 -24.869 1.00 27.99  ? 327  LEU B CA  1 
ATOM   6630 C C   . LEU B 1 326 ? -33.381 -29.589 -25.445 1.00 29.05  ? 327  LEU B C   1 
ATOM   6631 O O   . LEU B 1 326 ? -33.182 -28.461 -24.977 1.00 31.30  ? 327  LEU B O   1 
ATOM   6632 C CB  . LEU B 1 326 ? -33.079 -31.069 -23.421 1.00 32.03  ? 327  LEU B CB  1 
ATOM   6633 C CG  . LEU B 1 326 ? -34.564 -31.239 -23.068 1.00 35.99  ? 327  LEU B CG  1 
ATOM   6634 C CD1 . LEU B 1 326 ? -35.127 -32.466 -23.733 1.00 38.63  ? 327  LEU B CD1 1 
ATOM   6635 C CD2 . LEU B 1 326 ? -34.778 -31.316 -21.558 1.00 39.73  ? 327  LEU B CD2 1 
ATOM   6636 N N   . VAL B 1 327 ? -34.197 -29.812 -26.475 1.00 25.96  ? 328  VAL B N   1 
ATOM   6637 C CA  . VAL B 1 327 ? -34.947 -28.735 -27.112 1.00 25.89  ? 328  VAL B CA  1 
ATOM   6638 C C   . VAL B 1 327 ? -36.386 -29.173 -27.320 1.00 23.52  ? 328  VAL B C   1 
ATOM   6639 O O   . VAL B 1 327 ? -36.685 -30.364 -27.450 1.00 28.44  ? 328  VAL B O   1 
ATOM   6640 C CB  . VAL B 1 327 ? -34.327 -28.298 -28.455 1.00 28.84  ? 328  VAL B CB  1 
ATOM   6641 C CG1 . VAL B 1 327 ? -32.860 -27.949 -28.274 1.00 26.93  ? 328  VAL B CG1 1 
ATOM   6642 C CG2 . VAL B 1 327 ? -34.521 -29.391 -29.514 1.00 20.72  ? 328  VAL B CG2 1 
ATOM   6643 N N   . GLY B 1 328 ? -37.286 -28.197 -27.360 1.00 21.61  ? 329  GLY B N   1 
ATOM   6644 C CA  . GLY B 1 328 ? -38.676 -28.532 -27.609 1.00 22.46  ? 329  GLY B CA  1 
ATOM   6645 C C   . GLY B 1 328 ? -39.496 -27.279 -27.795 1.00 26.88  ? 329  GLY B C   1 
ATOM   6646 O O   . GLY B 1 328 ? -38.982 -26.159 -27.727 1.00 24.60  ? 329  GLY B O   1 
ATOM   6647 N N   . VAL B 1 329 ? -40.797 -27.484 -28.035 1.00 29.86  ? 330  VAL B N   1 
ATOM   6648 C CA  . VAL B 1 329 ? -41.726 -26.398 -28.332 1.00 25.79  ? 330  VAL B CA  1 
ATOM   6649 C C   . VAL B 1 329 ? -43.068 -26.692 -27.679 1.00 25.75  ? 330  VAL B C   1 
ATOM   6650 O O   . VAL B 1 329 ? -43.370 -27.830 -27.314 1.00 29.66  ? 330  VAL B O   1 
ATOM   6651 C CB  . VAL B 1 329 ? -41.910 -26.180 -29.858 1.00 24.95  ? 330  VAL B CB  1 
ATOM   6652 C CG1 . VAL B 1 329 ? -40.664 -25.557 -30.457 1.00 20.74  ? 330  VAL B CG1 1 
ATOM   6653 C CG2 . VAL B 1 329 ? -42.247 -27.495 -30.569 1.00 23.43  ? 330  VAL B CG2 1 
ATOM   6654 N N   . VAL B 1 330 ? -43.886 -25.641 -27.537 1.00 23.32  ? 331  VAL B N   1 
ATOM   6655 C CA  . VAL B 1 330 ? -45.281 -25.853 -27.166 1.00 28.59  ? 331  VAL B CA  1 
ATOM   6656 C C   . VAL B 1 330 ? -46.095 -26.135 -28.424 1.00 31.29  ? 331  VAL B C   1 
ATOM   6657 O O   . VAL B 1 330 ? -45.655 -25.891 -29.552 1.00 30.87  ? 331  VAL B O   1 
ATOM   6658 C CB  . VAL B 1 330 ? -45.869 -24.667 -26.379 1.00 33.15  ? 331  VAL B CB  1 
ATOM   6659 C CG1 . VAL B 1 330 ? -45.212 -24.560 -24.994 1.00 31.48  ? 331  VAL B CG1 1 
ATOM   6660 C CG2 . VAL B 1 330 ? -45.759 -23.375 -27.161 1.00 27.58  ? 331  VAL B CG2 1 
ATOM   6661 N N   . LYS B 1 331 ? -47.253 -26.706 -28.262 1.00 34.64  ? 332  LYS B N   1 
ATOM   6662 C CA  . LYS B 1 331 ? -48.086 -27.053 -29.369 1.00 35.91  ? 332  LYS B CA  1 
ATOM   6663 C C   . LYS B 1 331 ? -48.558 -25.910 -30.235 1.00 31.66  ? 332  LYS B C   1 
ATOM   6664 O O   . LYS B 1 331 ? -48.688 -26.070 -31.390 1.00 32.20  ? 332  LYS B O   1 
ATOM   6665 C CB  . LYS B 1 331 ? -49.226 -27.906 -28.896 1.00 41.34  ? 332  LYS B CB  1 
ATOM   6666 C CG  . LYS B 1 331 ? -50.186 -28.320 -29.951 1.00 38.39  ? 332  LYS B CG  1 
ATOM   6667 C CD  . LYS B 1 331 ? -50.836 -29.586 -29.489 1.00 53.19  ? 332  LYS B CD  1 
ATOM   6668 C CE  . LYS B 1 331 ? -52.326 -29.487 -29.568 1.00 67.10  ? 332  LYS B CE  1 
ATOM   6669 N NZ  . LYS B 1 331 ? -52.808 -29.742 -30.936 1.00 76.12  ? 332  LYS B NZ  1 
ATOM   6670 N N   . ASP B 1 332 ? -48.805 -24.761 -29.657 1.00 35.40  ? 333  ASP B N   1 
ATOM   6671 C CA  . ASP B 1 332 ? -49.295 -23.613 -30.438 1.00 36.34  ? 333  ASP B CA  1 
ATOM   6672 C C   . ASP B 1 332 ? -48.401 -22.396 -30.181 1.00 33.48  ? 333  ASP B C   1 
ATOM   6673 O O   . ASP B 1 332 ? -48.785 -21.473 -29.459 1.00 32.78  ? 333  ASP B O   1 
ATOM   6674 C CB  . ASP B 1 332 ? -50.763 -23.325 -30.109 1.00 34.86  ? 333  ASP B CB  1 
ATOM   6675 C CG  . ASP B 1 332 ? -51.655 -24.540 -30.327 1.00 45.57  ? 333  ASP B CG  1 
ATOM   6676 O OD1 . ASP B 1 332 ? -51.899 -25.282 -29.349 1.00 49.23  ? 333  ASP B OD1 1 
ATOM   6677 O OD2 . ASP B 1 332 ? -52.104 -24.760 -31.475 1.00 48.73  ? 333  ASP B OD2 1 
ATOM   6678 N N   . GLU B 1 333 ? -47.219 -22.386 -30.812 1.00 34.75  ? 334  GLU B N   1 
ATOM   6679 C CA  . GLU B 1 333 ? -46.227 -21.344 -30.541 1.00 28.22  ? 334  GLU B CA  1 
ATOM   6680 C C   . GLU B 1 333 ? -46.698 -19.961 -30.974 1.00 30.94  ? 334  GLU B C   1 
ATOM   6681 O O   . GLU B 1 333 ? -46.328 -18.960 -30.350 1.00 32.96  ? 334  GLU B O   1 
ATOM   6682 C CB  . GLU B 1 333 ? -44.904 -21.675 -31.239 1.00 30.92  ? 334  GLU B CB  1 
ATOM   6683 C CG  . GLU B 1 333 ? -44.061 -22.730 -30.526 1.00 41.24  ? 334  GLU B CG  1 
ATOM   6684 C CD  . GLU B 1 333 ? -43.458 -22.225 -29.216 1.00 44.06  ? 334  GLU B CD  1 
ATOM   6685 O OE1 . GLU B 1 333 ? -43.547 -21.007 -28.944 1.00 43.49  ? 334  GLU B OE1 1 
ATOM   6686 O OE2 . GLU B 1 333 ? -42.891 -23.046 -28.457 1.00 43.20  ? 334  GLU B OE2 1 
ATOM   6687 N N   . GLY B 1 334 ? -47.509 -19.877 -32.024 1.00 22.55  ? 335  GLY B N   1 
ATOM   6688 C CA  . GLY B 1 334 ? -47.852 -18.587 -32.587 1.00 26.57  ? 335  GLY B CA  1 
ATOM   6689 C C   . GLY B 1 334 ? -49.027 -17.861 -31.960 1.00 28.76  ? 335  GLY B C   1 
ATOM   6690 O O   . GLY B 1 334 ? -49.101 -16.632 -32.045 1.00 33.80  ? 335  GLY B O   1 
ATOM   6691 N N   . SER B 1 335 ? -49.945 -18.598 -31.323 1.00 31.79  ? 336  SER B N   1 
ATOM   6692 C CA  . SER B 1 335 ? -51.229 -18.014 -30.930 1.00 38.10  ? 336  SER B CA  1 
ATOM   6693 C C   . SER B 1 335 ? -51.056 -16.845 -29.965 1.00 38.72  ? 336  SER B C   1 
ATOM   6694 O O   . SER B 1 335 ? -51.762 -15.834 -30.068 1.00 40.36  ? 336  SER B O   1 
ATOM   6695 C CB  . SER B 1 335 ? -52.116 -19.083 -30.298 1.00 38.61  ? 336  SER B CB  1 
ATOM   6696 O OG  . SER B 1 335 ? -51.552 -19.549 -29.084 1.00 34.68  ? 336  SER B OG  1 
ATOM   6697 N N   A TYR B 1 336 ? -50.122 -16.959 -29.016 0.47 42.49  ? 337  TYR B N   1 
ATOM   6698 N N   B TYR B 1 336 ? -50.122 -16.974 -29.022 0.53 42.82  ? 337  TYR B N   1 
ATOM   6699 C CA  A TYR B 1 336 ? -49.962 -15.917 -28.004 0.47 46.32  ? 337  TYR B CA  1 
ATOM   6700 C CA  B TYR B 1 336 ? -49.926 -15.945 -28.009 0.53 46.23  ? 337  TYR B CA  1 
ATOM   6701 C C   A TYR B 1 336 ? -49.526 -14.593 -28.626 0.47 52.82  ? 337  TYR B C   1 
ATOM   6702 C C   B TYR B 1 336 ? -49.532 -14.611 -28.634 0.53 52.73  ? 337  TYR B C   1 
ATOM   6703 O O   A TYR B 1 336 ? -49.949 -13.521 -28.178 0.47 69.12  ? 337  TYR B O   1 
ATOM   6704 O O   B TYR B 1 336 ? -49.986 -13.550 -28.190 0.53 71.73  ? 337  TYR B O   1 
ATOM   6705 C CB  A TYR B 1 336 ? -48.962 -16.376 -26.940 0.47 49.55  ? 337  TYR B CB  1 
ATOM   6706 C CB  B TYR B 1 336 ? -48.861 -16.408 -27.019 0.53 49.24  ? 337  TYR B CB  1 
ATOM   6707 C CG  A TYR B 1 336 ? -48.408 -15.280 -26.046 0.47 58.36  ? 337  TYR B CG  1 
ATOM   6708 C CG  B TYR B 1 336 ? -48.559 -15.401 -25.950 0.53 58.33  ? 337  TYR B CG  1 
ATOM   6709 C CD1 A TYR B 1 336 ? -49.077 -14.892 -24.889 0.47 65.58  ? 337  TYR B CD1 1 
ATOM   6710 C CD1 B TYR B 1 336 ? -49.327 -15.340 -24.798 0.53 64.79  ? 337  TYR B CD1 1 
ATOM   6711 C CD2 A TYR B 1 336 ? -47.201 -14.656 -26.345 0.47 62.33  ? 337  TYR B CD2 1 
ATOM   6712 C CD2 B TYR B 1 336 ? -47.513 -14.500 -26.096 0.53 63.91  ? 337  TYR B CD2 1 
ATOM   6713 C CE1 A TYR B 1 336 ? -48.566 -13.898 -24.065 0.47 70.87  ? 337  TYR B CE1 1 
ATOM   6714 C CE1 B TYR B 1 336 ? -49.059 -14.416 -23.819 0.53 69.47  ? 337  TYR B CE1 1 
ATOM   6715 C CE2 A TYR B 1 336 ? -46.684 -13.662 -25.528 0.47 67.41  ? 337  TYR B CE2 1 
ATOM   6716 C CE2 B TYR B 1 336 ? -47.238 -13.572 -25.123 0.53 68.67  ? 337  TYR B CE2 1 
ATOM   6717 C CZ  A TYR B 1 336 ? -47.369 -13.288 -24.391 0.47 70.99  ? 337  TYR B CZ  1 
ATOM   6718 C CZ  B TYR B 1 336 ? -48.015 -13.535 -23.987 0.53 71.64  ? 337  TYR B CZ  1 
ATOM   6719 O OH  A TYR B 1 336 ? -46.852 -12.302 -23.579 0.47 73.95  ? 337  TYR B OH  1 
ATOM   6720 O OH  B TYR B 1 336 ? -47.737 -12.610 -23.014 0.53 79.83  ? 337  TYR B OH  1 
ATOM   6721 N N   . PHE B 1 337 ? -48.683 -14.643 -29.662 1.00 43.52  ? 338  PHE B N   1 
ATOM   6722 C CA  . PHE B 1 337 ? -48.186 -13.411 -30.263 1.00 41.63  ? 338  PHE B CA  1 
ATOM   6723 C C   . PHE B 1 337 ? -49.239 -12.699 -31.106 1.00 46.55  ? 338  PHE B C   1 
ATOM   6724 O O   . PHE B 1 337 ? -49.148 -11.478 -31.280 1.00 46.26  ? 338  PHE B O   1 
ATOM   6725 C CB  . PHE B 1 337 ? -46.941 -13.715 -31.096 1.00 41.66  ? 338  PHE B CB  1 
ATOM   6726 C CG  . PHE B 1 337 ? -45.848 -14.368 -30.306 1.00 38.61  ? 338  PHE B CG  1 
ATOM   6727 C CD1 . PHE B 1 337 ? -45.021 -13.612 -29.490 1.00 37.99  ? 338  PHE B CD1 1 
ATOM   6728 C CD2 . PHE B 1 337 ? -45.669 -15.740 -30.347 1.00 39.87  ? 338  PHE B CD2 1 
ATOM   6729 C CE1 . PHE B 1 337 ? -44.019 -14.210 -28.746 1.00 34.50  ? 338  PHE B CE1 1 
ATOM   6730 C CE2 . PHE B 1 337 ? -44.669 -16.349 -29.602 1.00 40.63  ? 338  PHE B CE2 1 
ATOM   6731 C CZ  . PHE B 1 337 ? -43.845 -15.584 -28.802 1.00 35.24  ? 338  PHE B CZ  1 
ATOM   6732 N N   . LEU B 1 338 ? -50.272 -13.411 -31.563 1.00 38.88  ? 339  LEU B N   1 
ATOM   6733 C CA  . LEU B 1 338 ? -51.250 -12.808 -32.462 1.00 44.66  ? 339  LEU B CA  1 
ATOM   6734 C C   . LEU B 1 338 ? -52.076 -11.717 -31.782 1.00 51.14  ? 339  LEU B C   1 
ATOM   6735 O O   . LEU B 1 338 ? -52.484 -10.753 -32.442 1.00 50.68  ? 339  LEU B O   1 
ATOM   6736 C CB  . LEU B 1 338 ? -52.157 -13.896 -33.035 1.00 45.85  ? 339  LEU B CB  1 
ATOM   6737 C CG  . LEU B 1 338 ? -51.395 -14.887 -33.919 1.00 48.72  ? 339  LEU B CG  1 
ATOM   6738 C CD1 . LEU B 1 338 ? -52.286 -16.014 -34.408 1.00 49.36  ? 339  LEU B CD1 1 
ATOM   6739 C CD2 . LEU B 1 338 ? -50.786 -14.152 -35.094 1.00 44.12  ? 339  LEU B CD2 1 
ATOM   6740 N N   . VAL B 1 339 ? -52.335 -11.831 -30.474 1.00 49.16  ? 340  VAL B N   1 
ATOM   6741 C CA  . VAL B 1 339 ? -53.182 -10.826 -29.828 1.00 59.01  ? 340  VAL B CA  1 
ATOM   6742 C C   . VAL B 1 339 ? -52.446 -9.528  -29.533 1.00 58.02  ? 340  VAL B C   1 
ATOM   6743 O O   . VAL B 1 339 ? -53.086 -8.542  -29.145 1.00 60.02  ? 340  VAL B O   1 
ATOM   6744 C CB  . VAL B 1 339 ? -53.827 -11.370 -28.538 1.00 58.57  ? 340  VAL B CB  1 
ATOM   6745 C CG1 . VAL B 1 339 ? -54.509 -12.685 -28.828 1.00 60.49  ? 340  VAL B CG1 1 
ATOM   6746 C CG2 . VAL B 1 339 ? -52.816 -11.524 -27.416 1.00 54.93  ? 340  VAL B CG2 1 
ATOM   6747 N N   . TYR B 1 340 ? -51.128 -9.482  -29.737 1.00 55.24  ? 341  TYR B N   1 
ATOM   6748 C CA  . TYR B 1 340 ? -50.364 -8.251  -29.575 1.00 57.28  ? 341  TYR B CA  1 
ATOM   6749 C C   . TYR B 1 340 ? -50.275 -7.440  -30.865 1.00 64.68  ? 341  TYR B C   1 
ATOM   6750 O O   . TYR B 1 340 ? -49.259 -6.773  -31.110 1.00 70.15  ? 341  TYR B O   1 
ATOM   6751 C CB  . TYR B 1 340 ? -48.972 -8.563  -29.018 1.00 54.20  ? 341  TYR B CB  1 
ATOM   6752 C CG  . TYR B 1 340 ? -48.980 -8.742  -27.513 1.00 53.47  ? 341  TYR B CG  1 
ATOM   6753 C CD1 . TYR B 1 340 ? -48.698 -7.681  -26.662 1.00 55.16  ? 341  TYR B CD1 1 
ATOM   6754 C CD2 . TYR B 1 340 ? -49.297 -9.968  -26.939 1.00 53.88  ? 341  TYR B CD2 1 
ATOM   6755 C CE1 . TYR B 1 340 ? -48.717 -7.847  -25.284 1.00 58.42  ? 341  TYR B CE1 1 
ATOM   6756 C CE2 . TYR B 1 340 ? -49.323 -10.144 -25.570 1.00 61.22  ? 341  TYR B CE2 1 
ATOM   6757 C CZ  . TYR B 1 340 ? -49.031 -9.081  -24.744 1.00 63.31  ? 341  TYR B CZ  1 
ATOM   6758 O OH  . TYR B 1 340 ? -49.056 -9.260  -23.381 1.00 70.76  ? 341  TYR B OH  1 
ATOM   6759 N N   . GLY B 1 341 ? -51.314 -7.486  -31.700 1.00 64.75  ? 342  GLY B N   1 
ATOM   6760 C CA  . GLY B 1 341 ? -51.465 -6.513  -32.763 1.00 68.59  ? 342  GLY B CA  1 
ATOM   6761 C C   . GLY B 1 341 ? -51.843 -7.047  -34.132 1.00 67.86  ? 342  GLY B C   1 
ATOM   6762 O O   . GLY B 1 341 ? -52.037 -6.260  -35.063 1.00 67.93  ? 342  GLY B O   1 
ATOM   6763 N N   . ALA B 1 342 ? -51.921 -8.363  -34.293 1.00 63.59  ? 343  ALA B N   1 
ATOM   6764 C CA  . ALA B 1 342 ? -52.377 -8.907  -35.564 1.00 51.70  ? 343  ALA B CA  1 
ATOM   6765 C C   . ALA B 1 342 ? -53.841 -8.532  -35.765 1.00 55.96  ? 343  ALA B C   1 
ATOM   6766 O O   . ALA B 1 342 ? -54.637 -8.630  -34.819 1.00 58.39  ? 343  ALA B O   1 
ATOM   6767 C CB  . ALA B 1 342 ? -52.203 -10.423 -35.615 1.00 42.96  ? 343  ALA B CB  1 
ATOM   6768 N N   . PRO B 1 343 ? -54.230 -8.080  -36.955 1.00 57.45  ? 344  PRO B N   1 
ATOM   6769 C CA  . PRO B 1 343 ? -55.596 -7.573  -37.141 1.00 56.61  ? 344  PRO B CA  1 
ATOM   6770 C C   . PRO B 1 343 ? -56.641 -8.659  -36.924 1.00 53.54  ? 344  PRO B C   1 
ATOM   6771 O O   . PRO B 1 343 ? -56.494 -9.795  -37.382 1.00 52.76  ? 344  PRO B O   1 
ATOM   6772 C CB  . PRO B 1 343 ? -55.594 -7.071  -38.589 1.00 58.35  ? 344  PRO B CB  1 
ATOM   6773 C CG  . PRO B 1 343 ? -54.143 -6.855  -38.915 1.00 59.94  ? 344  PRO B CG  1 
ATOM   6774 C CD  . PRO B 1 343 ? -53.402 -7.907  -38.159 1.00 55.45  ? 344  PRO B CD  1 
ATOM   6775 N N   . GLY B 1 344 ? -57.698 -8.297  -36.197 1.00 51.28  ? 345  GLY B N   1 
ATOM   6776 C CA  . GLY B 1 344 ? -58.804 -9.192  -35.935 1.00 51.78  ? 345  GLY B CA  1 
ATOM   6777 C C   . GLY B 1 344 ? -58.654 -10.085 -34.721 1.00 53.08  ? 345  GLY B C   1 
ATOM   6778 O O   . GLY B 1 344 ? -59.600 -10.811 -34.389 1.00 58.59  ? 345  GLY B O   1 
ATOM   6779 N N   . PHE B 1 345 ? -57.516 -10.054 -34.039 1.00 52.23  ? 346  PHE B N   1 
ATOM   6780 C CA  . PHE B 1 345 ? -57.262 -10.977 -32.944 1.00 51.32  ? 346  PHE B CA  1 
ATOM   6781 C C   . PHE B 1 345 ? -57.523 -10.330 -31.591 1.00 56.00  ? 346  PHE B C   1 
ATOM   6782 O O   . PHE B 1 345 ? -57.240 -9.146  -31.382 1.00 54.55  ? 346  PHE B O   1 
ATOM   6783 C CB  . PHE B 1 345 ? -55.832 -11.504 -33.006 1.00 50.24  ? 346  PHE B CB  1 
ATOM   6784 C CG  . PHE B 1 345 ? -55.647 -12.593 -34.016 1.00 53.26  ? 346  PHE B CG  1 
ATOM   6785 C CD1 . PHE B 1 345 ? -55.691 -13.925 -33.632 1.00 48.91  ? 346  PHE B CD1 1 
ATOM   6786 C CD2 . PHE B 1 345 ? -55.443 -12.288 -35.352 1.00 52.01  ? 346  PHE B CD2 1 
ATOM   6787 C CE1 . PHE B 1 345 ? -55.532 -14.934 -34.564 1.00 46.57  ? 346  PHE B CE1 1 
ATOM   6788 C CE2 . PHE B 1 345 ? -55.274 -13.291 -36.288 1.00 52.68  ? 346  PHE B CE2 1 
ATOM   6789 C CZ  . PHE B 1 345 ? -55.319 -14.617 -35.893 1.00 47.44  ? 346  PHE B CZ  1 
ATOM   6790 N N   . SER B 1 346 ? -58.068 -11.127 -30.675 1.00 60.85  ? 347  SER B N   1 
ATOM   6791 C CA  . SER B 1 346 ? -58.302 -10.719 -29.299 1.00 56.44  ? 347  SER B CA  1 
ATOM   6792 C C   . SER B 1 346 ? -58.478 -11.975 -28.460 1.00 54.99  ? 347  SER B C   1 
ATOM   6793 O O   . SER B 1 346 ? -58.968 -13.000 -28.945 1.00 55.95  ? 347  SER B O   1 
ATOM   6794 C CB  . SER B 1 346 ? -59.532 -9.812  -29.174 1.00 54.23  ? 347  SER B CB  1 
ATOM   6795 O OG  . SER B 1 346 ? -60.060 -9.841  -27.861 1.00 63.11  ? 347  SER B OG  1 
ATOM   6796 N N   . LYS B 1 347 ? -58.156 -11.873 -27.197 1.00 51.11  ? 348  LYS B N   1 
ATOM   6797 C CA  . LYS B 1 347 ? -58.358 -12.953 -26.283 1.00 48.58  ? 348  LYS B CA  1 
ATOM   6798 C C   . LYS B 1 347 ? -59.823 -13.059 -25.950 1.00 50.07  ? 348  LYS B C   1 
ATOM   6799 O O   . LYS B 1 347 ? -60.276 -14.045 -25.460 1.00 51.34  ? 348  LYS B O   1 
ATOM   6800 C CB  . LYS B 1 347 ? -57.576 -12.701 -25.016 1.00 45.42  ? 348  LYS B CB  1 
ATOM   6801 C CG  . LYS B 1 347 ? -58.305 -11.905 -23.972 1.00 43.66  ? 348  LYS B CG  1 
ATOM   6802 C CD  . LYS B 1 347 ? -57.465 -11.775 -22.736 1.00 51.97  ? 348  LYS B CD  1 
ATOM   6803 C CE  . LYS B 1 347 ? -58.167 -11.054 -21.621 1.00 53.15  ? 348  LYS B CE  1 
ATOM   6804 N NZ  . LYS B 1 347 ? -59.088 -12.000 -20.981 1.00 56.98  ? 348  LYS B NZ  1 
ATOM   6805 N N   . ASP B 1 348 ? -60.554 -11.999 -26.210 1.00 51.69  ? 349  ASP B N   1 
ATOM   6806 C CA  . ASP B 1 348 ? -61.963 -11.959 -25.864 1.00 52.89  ? 349  ASP B CA  1 
ATOM   6807 C C   . ASP B 1 348 ? -62.906 -12.294 -27.025 1.00 64.52  ? 349  ASP B C   1 
ATOM   6808 O O   . ASP B 1 348 ? -64.109 -12.430 -26.781 1.00 73.44  ? 349  ASP B O   1 
ATOM   6809 C CB  . ASP B 1 348 ? -62.310 -10.585 -25.277 1.00 55.98  ? 349  ASP B CB  1 
ATOM   6810 C CG  . ASP B 1 348 ? -61.547 -10.290 -23.962 1.00 62.91  ? 349  ASP B CG  1 
ATOM   6811 O OD1 . ASP B 1 348 ? -61.474 -11.168 -23.072 1.00 61.81  ? 349  ASP B OD1 1 
ATOM   6812 O OD2 . ASP B 1 348 ? -61.014 -9.165  -23.837 1.00 65.48  ? 349  ASP B OD2 1 
ATOM   6813 N N   . ASN B 1 349 ? -62.401 -12.752 -28.122 1.00 62.24  ? 350  ASN B N   1 
ATOM   6814 C CA  . ASN B 1 349 ? -63.297 -13.285 -29.095 1.00 65.30  ? 350  ASN B CA  1 
ATOM   6815 C C   . ASN B 1 349 ? -62.656 -14.547 -29.674 1.00 66.80  ? 350  ASN B C   1 
ATOM   6816 O O   . ASN B 1 349 ? -61.733 -15.085 -29.127 1.00 64.15  ? 350  ASN B O   1 
ATOM   6817 C CB  . ASN B 1 349 ? -63.886 -12.255 -30.054 1.00 62.85  ? 350  ASN B CB  1 
ATOM   6818 C CG  . ASN B 1 349 ? -62.889 -11.675 -30.967 1.00 94.70  ? 350  ASN B CG  1 
ATOM   6819 O OD1 . ASN B 1 349 ? -62.008 -12.366 -31.395 1.00 111.36 ? 350  ASN B OD1 1 
ATOM   6820 N ND2 . ASN B 1 349 ? -63.037 -10.407 -31.311 1.00 112.10 ? 350  ASN B ND2 1 
ATOM   6821 N N   . GLU B 1 350 ? -63.257 -15.114 -30.671 1.00 62.91  ? 351  GLU B N   1 
ATOM   6822 C CA  . GLU B 1 350 ? -62.760 -16.310 -31.333 1.00 59.63  ? 351  GLU B CA  1 
ATOM   6823 C C   . GLU B 1 350 ? -61.710 -15.988 -32.381 1.00 55.13  ? 351  GLU B C   1 
ATOM   6824 O O   . GLU B 1 350 ? -61.099 -16.917 -32.906 1.00 52.11  ? 351  GLU B O   1 
ATOM   6825 C CB  . GLU B 1 350 ? -63.925 -17.050 -31.990 1.00 65.51  ? 351  GLU B CB  1 
ATOM   6826 C CG  . GLU B 1 350 ? -64.755 -17.851 -31.011 1.00 76.06  ? 351  GLU B CG  1 
ATOM   6827 C CD  . GLU B 1 350 ? -64.152 -19.206 -30.733 1.00 85.28  ? 351  GLU B CD  1 
ATOM   6828 O OE1 . GLU B 1 350 ? -63.650 -19.422 -29.610 1.00 84.80  ? 351  GLU B OE1 1 
ATOM   6829 O OE2 . GLU B 1 350 ? -64.181 -20.056 -31.646 1.00 90.63  ? 351  GLU B OE2 1 
ATOM   6830 N N   . SER B 1 351 ? -61.503 -14.702 -32.700 1.00 43.23  ? 352  SER B N   1 
ATOM   6831 C CA  . SER B 1 351 ? -60.452 -14.269 -33.627 1.00 45.37  ? 352  SER B CA  1 
ATOM   6832 C C   . SER B 1 351 ? -60.584 -14.976 -34.972 1.00 50.74  ? 352  SER B C   1 
ATOM   6833 O O   . SER B 1 351 ? -59.607 -15.464 -35.545 1.00 51.13  ? 352  SER B O   1 
ATOM   6834 C CB  . SER B 1 351 ? -59.061 -14.486 -33.028 1.00 41.68  ? 352  SER B CB  1 
ATOM   6835 O OG  . SER B 1 351 ? -58.942 -13.840 -31.775 1.00 45.73  ? 352  SER B OG  1 
ATOM   6836 N N   . LEU B 1 352 ? -61.820 -15.049 -35.463 1.00 53.86  ? 353  LEU B N   1 
ATOM   6837 C CA  . LEU B 1 352 ? -62.117 -15.607 -36.778 1.00 54.73  ? 353  LEU B CA  1 
ATOM   6838 C C   . LEU B 1 352 ? -61.893 -14.502 -37.800 1.00 55.59  ? 353  LEU B C   1 
ATOM   6839 O O   . LEU B 1 352 ? -62.702 -13.582 -37.928 1.00 63.39  ? 353  LEU B O   1 
ATOM   6840 C CB  . LEU B 1 352 ? -63.544 -16.140 -36.819 1.00 53.77  ? 353  LEU B CB  1 
ATOM   6841 C CG  . LEU B 1 352 ? -63.739 -17.362 -35.922 1.00 55.14  ? 353  LEU B CG  1 
ATOM   6842 C CD1 . LEU B 1 352 ? -65.215 -17.643 -35.687 1.00 54.71  ? 353  LEU B CD1 1 
ATOM   6843 C CD2 . LEU B 1 352 ? -63.044 -18.562 -36.528 1.00 57.49  ? 353  LEU B CD2 1 
ATOM   6844 N N   . ILE B 1 353 ? -60.790 -14.587 -38.528 1.00 49.78  ? 354  ILE B N   1 
ATOM   6845 C CA  . ILE B 1 353 ? -60.311 -13.479 -39.333 1.00 52.99  ? 354  ILE B CA  1 
ATOM   6846 C C   . ILE B 1 353 ? -60.708 -13.667 -40.792 1.00 54.45  ? 354  ILE B C   1 
ATOM   6847 O O   . ILE B 1 353 ? -60.936 -14.779 -41.275 1.00 53.60  ? 354  ILE B O   1 
ATOM   6848 C CB  . ILE B 1 353 ? -58.781 -13.317 -39.201 1.00 50.94  ? 354  ILE B CB  1 
ATOM   6849 C CG1 . ILE B 1 353 ? -58.081 -14.611 -39.622 1.00 45.45  ? 354  ILE B CG1 1 
ATOM   6850 C CG2 . ILE B 1 353 ? -58.412 -12.930 -37.771 1.00 46.77  ? 354  ILE B CG2 1 
ATOM   6851 C CD1 . ILE B 1 353 ? -56.576 -14.497 -39.713 1.00 46.37  ? 354  ILE B CD1 1 
ATOM   6852 N N   . SER B 1 354 ? -60.789 -12.547 -41.504 1.00 54.64  ? 355  SER B N   1 
ATOM   6853 C CA  . SER B 1 354 ? -60.958 -12.542 -42.945 1.00 48.83  ? 355  SER B CA  1 
ATOM   6854 C C   . SER B 1 354 ? -59.666 -12.981 -43.631 1.00 51.13  ? 355  SER B C   1 
ATOM   6855 O O   . SER B 1 354 ? -58.611 -13.116 -43.006 1.00 47.48  ? 355  SER B O   1 
ATOM   6856 C CB  . SER B 1 354 ? -61.346 -11.145 -43.425 1.00 50.79  ? 355  SER B CB  1 
ATOM   6857 O OG  . SER B 1 354 ? -60.184 -10.402 -43.768 1.00 63.43  ? 355  SER B OG  1 
ATOM   6858 N N   . ARG B 1 355 ? -59.752 -13.185 -44.950 1.00 49.64  ? 356  ARG B N   1 
ATOM   6859 C CA  . ARG B 1 355 ? -58.540 -13.455 -45.716 1.00 50.40  ? 356  ARG B CA  1 
ATOM   6860 C C   . ARG B 1 355 ? -57.673 -12.204 -45.831 1.00 51.54  ? 356  ARG B C   1 
ATOM   6861 O O   . ARG B 1 355 ? -56.440 -12.289 -45.763 1.00 51.82  ? 356  ARG B O   1 
ATOM   6862 C CB  . ARG B 1 355 ? -58.892 -14.006 -47.099 1.00 47.92  ? 356  ARG B CB  1 
ATOM   6863 C CG  . ARG B 1 355 ? -57.666 -14.235 -47.964 1.00 48.01  ? 356  ARG B CG  1 
ATOM   6864 C CD  . ARG B 1 355 ? -57.838 -15.385 -48.935 1.00 52.49  ? 356  ARG B CD  1 
ATOM   6865 N NE  . ARG B 1 355 ? -56.583 -15.667 -49.625 1.00 52.63  ? 356  ARG B NE  1 
ATOM   6866 C CZ  . ARG B 1 355 ? -55.762 -16.661 -49.306 1.00 50.03  ? 356  ARG B CZ  1 
ATOM   6867 N NH1 . ARG B 1 355 ? -56.059 -17.479 -48.302 1.00 43.71  ? 356  ARG B NH1 1 
ATOM   6868 N NH2 . ARG B 1 355 ? -54.641 -16.834 -49.990 1.00 57.84  ? 356  ARG B NH2 1 
ATOM   6869 N N   . ALA B 1 356 ? -58.296 -11.034 -46.003 1.00 51.41  ? 357  ALA B N   1 
ATOM   6870 C CA  . ALA B 1 356 ? -57.538 -9.787  -45.980 1.00 52.68  ? 357  ALA B CA  1 
ATOM   6871 C C   . ALA B 1 356 ? -56.807 -9.608  -44.653 1.00 52.71  ? 357  ALA B C   1 
ATOM   6872 O O   . ALA B 1 356 ? -55.661 -9.142  -44.625 1.00 52.99  ? 357  ALA B O   1 
ATOM   6873 C CB  . ALA B 1 356 ? -58.466 -8.601  -46.245 1.00 54.18  ? 357  ALA B CB  1 
ATOM   6874 N N   . GLU B 1 357 ? -57.447 -9.985  -43.541 1.00 48.87  ? 358  GLU B N   1 
ATOM   6875 C CA  . GLU B 1 357 ? -56.780 -9.902  -42.246 1.00 53.69  ? 358  GLU B CA  1 
ATOM   6876 C C   . GLU B 1 357 ? -55.673 -10.939 -42.130 1.00 53.52  ? 358  GLU B C   1 
ATOM   6877 O O   . GLU B 1 357 ? -54.619 -10.667 -41.541 1.00 48.98  ? 358  GLU B O   1 
ATOM   6878 C CB  . GLU B 1 357 ? -57.792 -10.072 -41.113 1.00 52.95  ? 358  GLU B CB  1 
ATOM   6879 C CG  . GLU B 1 357 ? -58.789 -8.928  -41.002 1.00 59.88  ? 358  GLU B CG  1 
ATOM   6880 C CD  . GLU B 1 357 ? -59.845 -9.173  -39.939 1.00 68.21  ? 358  GLU B CD  1 
ATOM   6881 O OE1 . GLU B 1 357 ? -60.359 -10.307 -39.861 1.00 69.06  ? 358  GLU B OE1 1 
ATOM   6882 O OE2 . GLU B 1 357 ? -60.158 -8.233  -39.175 1.00 72.80  ? 358  GLU B OE2 1 
ATOM   6883 N N   . PHE B 1 358 ? -55.897 -12.136 -42.678 1.00 53.31  ? 359  PHE B N   1 
ATOM   6884 C CA  . PHE B 1 358 ? -54.848 -13.148 -42.681 1.00 47.05  ? 359  PHE B CA  1 
ATOM   6885 C C   . PHE B 1 358 ? -53.622 -12.634 -43.417 1.00 46.29  ? 359  PHE B C   1 
ATOM   6886 O O   . PHE B 1 358 ? -52.499 -12.685 -42.897 1.00 45.11  ? 359  PHE B O   1 
ATOM   6887 C CB  . PHE B 1 358 ? -55.365 -14.445 -43.314 1.00 43.79  ? 359  PHE B CB  1 
ATOM   6888 C CG  . PHE B 1 358 ? -54.279 -15.427 -43.674 1.00 42.24  ? 359  PHE B CG  1 
ATOM   6889 C CD1 . PHE B 1 358 ? -53.665 -16.195 -42.699 1.00 40.29  ? 359  PHE B CD1 1 
ATOM   6890 C CD2 . PHE B 1 358 ? -53.884 -15.594 -44.990 1.00 39.56  ? 359  PHE B CD2 1 
ATOM   6891 C CE1 . PHE B 1 358 ? -52.666 -17.099 -43.028 1.00 40.12  ? 359  PHE B CE1 1 
ATOM   6892 C CE2 . PHE B 1 358 ? -52.889 -16.499 -45.322 1.00 37.59  ? 359  PHE B CE2 1 
ATOM   6893 C CZ  . PHE B 1 358 ? -52.281 -17.250 -44.338 1.00 38.29  ? 359  PHE B CZ  1 
ATOM   6894 N N   . LEU B 1 359 ? -53.834 -12.055 -44.582 1.00 47.00  ? 360  LEU B N   1 
ATOM   6895 C CA  . LEU B 1 359 ? -52.746 -11.498 -45.361 1.00 51.30  ? 360  LEU B CA  1 
ATOM   6896 C C   . LEU B 1 359 ? -52.099 -10.357 -44.632 1.00 55.66  ? 360  LEU B C   1 
ATOM   6897 O O   . LEU B 1 359 ? -50.916 -10.239 -44.626 1.00 56.91  ? 360  LEU B O   1 
ATOM   6898 C CB  . LEU B 1 359 ? -53.201 -11.039 -46.741 1.00 46.72  ? 360  LEU B CB  1 
ATOM   6899 C CG  . LEU B 1 359 ? -53.936 -12.054 -47.617 1.00 56.65  ? 360  LEU B CG  1 
ATOM   6900 C CD1 . LEU B 1 359 ? -54.708 -11.455 -48.764 1.00 55.74  ? 360  LEU B CD1 1 
ATOM   6901 C CD2 . LEU B 1 359 ? -53.068 -13.181 -48.120 1.00 65.20  ? 360  LEU B CD2 1 
ATOM   6902 N N   . ALA B 1 360 ? -52.894 -9.490  -44.046 1.00 52.73  ? 361  ALA B N   1 
ATOM   6903 C CA  . ALA B 1 360 ? -52.342 -8.419  -43.223 1.00 51.46  ? 361  ALA B CA  1 
ATOM   6904 C C   . ALA B 1 360 ? -51.515 -8.978  -42.074 1.00 52.94  ? 361  ALA B C   1 
ATOM   6905 O O   . ALA B 1 360 ? -50.432 -8.465  -41.770 1.00 57.72  ? 361  ALA B O   1 
ATOM   6906 C CB  . ALA B 1 360 ? -53.464 -7.532  -42.684 1.00 52.50  ? 361  ALA B CB  1 
ATOM   6907 N N   . GLY B 1 361 ? -52.007 -10.034 -41.424 1.00 47.43  ? 362  GLY B N   1 
ATOM   6908 C CA  . GLY B 1 361 ? -51.297 -10.577 -40.279 1.00 45.68  ? 362  GLY B CA  1 
ATOM   6909 C C   . GLY B 1 361 ? -49.984 -11.231 -40.651 1.00 45.86  ? 362  GLY B C   1 
ATOM   6910 O O   . GLY B 1 361 ? -49.066 -11.303 -39.826 1.00 41.22  ? 362  GLY B O   1 
ATOM   6911 N N   . VAL B 1 362 ? -49.873 -11.717 -41.891 1.00 45.36  ? 363  VAL B N   1 
ATOM   6912 C CA  . VAL B 1 362 ? -48.635 -12.353 -42.328 1.00 44.99  ? 363  VAL B CA  1 
ATOM   6913 C C   . VAL B 1 362 ? -47.494 -11.342 -42.347 1.00 45.02  ? 363  VAL B C   1 
ATOM   6914 O O   . VAL B 1 362 ? -46.378 -11.635 -41.901 1.00 43.28  ? 363  VAL B O   1 
ATOM   6915 C CB  . VAL B 1 362 ? -48.829 -13.016 -43.703 1.00 47.58  ? 363  VAL B CB  1 
ATOM   6916 C CG1 . VAL B 1 362 ? -47.486 -13.252 -44.365 1.00 44.14  ? 363  VAL B CG1 1 
ATOM   6917 C CG2 . VAL B 1 362 ? -49.593 -14.326 -43.557 1.00 47.15  ? 363  VAL B CG2 1 
ATOM   6918 N N   . ARG B 1 363 ? -47.768 -10.143 -42.814 1.00 47.09  ? 364  ARG B N   1 
ATOM   6919 C CA  . ARG B 1 363 ? -46.752 -9.110  -42.881 1.00 53.94  ? 364  ARG B CA  1 
ATOM   6920 C C   . ARG B 1 363 ? -46.293 -8.664  -41.527 1.00 60.72  ? 364  ARG B C   1 
ATOM   6921 O O   . ARG B 1 363 ? -45.210 -8.216  -41.355 1.00 65.43  ? 364  ARG B O   1 
ATOM   6922 C CB  . ARG B 1 363 ? -47.187 -7.888  -43.657 1.00 53.97  ? 364  ARG B CB  1 
ATOM   6923 C CG  . ARG B 1 363 ? -47.434 -8.030  -45.139 1.00 62.67  ? 364  ARG B CG  1 
ATOM   6924 C CD  . ARG B 1 363 ? -46.485 -8.960  -45.868 1.00 72.92  ? 364  ARG B CD  1 
ATOM   6925 N NE  . ARG B 1 363 ? -45.235 -8.392  -46.370 1.00 84.39  ? 364  ARG B NE  1 
ATOM   6926 C CZ  . ARG B 1 363 ? -45.060 -7.886  -47.580 1.00 84.22  ? 364  ARG B CZ  1 
ATOM   6927 N NH1 . ARG B 1 363 ? -46.065 -7.812  -48.419 1.00 78.83  ? 364  ARG B NH1 1 
ATOM   6928 N NH2 . ARG B 1 363 ? -43.875 -7.459  -47.951 1.00 85.71  ? 364  ARG B NH2 1 
ATOM   6929 N N   . VAL B 1 364 ? -47.150 -8.784  -40.560 1.00 55.06  ? 365  VAL B N   1 
ATOM   6930 C CA  . VAL B 1 364 ? -46.827 -8.302  -39.232 1.00 47.97  ? 365  VAL B CA  1 
ATOM   6931 C C   . VAL B 1 364 ? -46.184 -9.402  -38.392 1.00 52.18  ? 365  VAL B C   1 
ATOM   6932 O O   . VAL B 1 364 ? -45.364 -9.109  -37.515 1.00 51.74  ? 365  VAL B O   1 
ATOM   6933 C CB  . VAL B 1 364 ? -48.101 -7.720  -38.591 1.00 48.62  ? 365  VAL B CB  1 
ATOM   6934 C CG1 . VAL B 1 364 ? -48.052 -7.807  -37.119 1.00 49.44  ? 365  VAL B CG1 1 
ATOM   6935 C CG2 . VAL B 1 364 ? -48.266 -6.263  -39.002 1.00 54.68  ? 365  VAL B CG2 1 
ATOM   6936 N N   . GLY B 1 365 ? -46.480 -10.667 -38.689 1.00 51.00  ? 366  GLY B N   1 
ATOM   6937 C CA  . GLY B 1 365 ? -45.835 -11.781 -38.020 1.00 47.65  ? 366  GLY B CA  1 
ATOM   6938 C C   . GLY B 1 365 ? -44.528 -12.213 -38.659 1.00 48.73  ? 366  GLY B C   1 
ATOM   6939 O O   . GLY B 1 365 ? -43.703 -12.871 -38.018 1.00 52.04  ? 366  GLY B O   1 
ATOM   6940 N N   . VAL B 1 366 ? -44.333 -11.866 -39.927 1.00 45.43  ? 367  VAL B N   1 
ATOM   6941 C CA  . VAL B 1 366 ? -43.071 -12.105 -40.625 1.00 45.97  ? 367  VAL B CA  1 
ATOM   6942 C C   . VAL B 1 366 ? -42.527 -10.742 -41.034 1.00 46.15  ? 367  VAL B C   1 
ATOM   6943 O O   . VAL B 1 366 ? -42.593 -10.372 -42.216 1.00 50.35  ? 367  VAL B O   1 
ATOM   6944 C CB  . VAL B 1 366 ? -43.262 -13.043 -41.825 1.00 46.85  ? 367  VAL B CB  1 
ATOM   6945 C CG1 . VAL B 1 366 ? -41.917 -13.552 -42.316 1.00 47.67  ? 367  VAL B CG1 1 
ATOM   6946 C CG2 . VAL B 1 366 ? -44.155 -14.205 -41.429 1.00 41.76  ? 367  VAL B CG2 1 
ATOM   6947 N N   . PRO B 1 367 ? -41.956 -10.044 -40.093 1.00 46.30  ? 368  PRO B N   1 
ATOM   6948 C CA  . PRO B 1 367 ? -41.649 -8.647  -40.265 1.00 51.45  ? 368  PRO B CA  1 
ATOM   6949 C C   . PRO B 1 367 ? -40.793 -8.143  -41.353 1.00 64.46  ? 368  PRO B C   1 
ATOM   6950 O O   . PRO B 1 367 ? -41.263 -7.164  -41.883 1.00 82.23  ? 368  PRO B O   1 
ATOM   6951 C CB  . PRO B 1 367 ? -40.991 -8.284  -38.958 1.00 51.23  ? 368  PRO B CB  1 
ATOM   6952 C CG  . PRO B 1 367 ? -41.537 -9.223  -38.006 1.00 45.59  ? 368  PRO B CG  1 
ATOM   6953 C CD  . PRO B 1 367 ? -41.720 -10.484 -38.732 1.00 43.35  ? 368  PRO B CD  1 
ATOM   6954 N N   . GLN B 1 368 ? -39.683 -8.714  -41.745 1.00 62.41  ? 369  GLN B N   1 
ATOM   6955 C CA  . GLN B 1 368 ? -38.968 -8.003  -42.781 1.00 81.11  ? 369  GLN B CA  1 
ATOM   6956 C C   . GLN B 1 368 ? -38.671 -8.832  -43.966 1.00 81.54  ? 369  GLN B C   1 
ATOM   6957 O O   . GLN B 1 368 ? -37.541 -9.075  -44.283 1.00 87.28  ? 369  GLN B O   1 
ATOM   6958 C CB  . GLN B 1 368 ? -37.696 -7.388  -42.217 1.00 91.10  ? 369  GLN B CB  1 
ATOM   6959 C CG  . GLN B 1 368 ? -37.938 -6.256  -41.235 1.00 95.87  ? 369  GLN B CG  1 
ATOM   6960 C CD  . GLN B 1 368 ? -37.896 -4.893  -41.877 1.00 100.61 ? 369  GLN B CD  1 
ATOM   6961 O OE1 . GLN B 1 368 ? -38.899 -4.199  -41.973 1.00 102.12 ? 369  GLN B OE1 1 
ATOM   6962 N NE2 . GLN B 1 368 ? -36.725 -4.502  -42.312 1.00 103.29 ? 369  GLN B NE2 1 
ATOM   6963 N N   . VAL B 1 369 ? -39.721 -9.206  -44.659 1.00 72.99  ? 370  VAL B N   1 
ATOM   6964 C CA  . VAL B 1 369 ? -39.513 -10.006 -45.857 1.00 66.63  ? 370  VAL B CA  1 
ATOM   6965 C C   . VAL B 1 369 ? -40.156 -9.284  -47.033 1.00 70.75  ? 370  VAL B C   1 
ATOM   6966 O O   . VAL B 1 369 ? -41.097 -8.502  -46.868 1.00 72.79  ? 370  VAL B O   1 
ATOM   6967 C CB  . VAL B 1 369 ? -40.072 -11.447 -45.729 1.00 56.79  ? 370  VAL B CB  1 
ATOM   6968 C CG1 . VAL B 1 369 ? -39.317 -12.227 -44.663 1.00 55.21  ? 370  VAL B CG1 1 
ATOM   6969 C CG2 . VAL B 1 369 ? -41.570 -11.433 -45.451 1.00 51.24  ? 370  VAL B CG2 1 
ATOM   6970 N N   . SER B 1 370 ? -39.631 -9.547  -48.226 1.00 79.05  ? 371  SER B N   1 
ATOM   6971 C CA  . SER B 1 370 ? -40.136 -8.938  -49.445 1.00 75.63  ? 371  SER B CA  1 
ATOM   6972 C C   . SER B 1 370 ? -41.542 -9.436  -49.764 1.00 76.17  ? 371  SER B C   1 
ATOM   6973 O O   . SER B 1 370 ? -41.972 -10.501 -49.310 1.00 69.63  ? 371  SER B O   1 
ATOM   6974 C CB  . SER B 1 370 ? -39.207 -9.253  -50.615 1.00 75.74  ? 371  SER B CB  1 
ATOM   6975 O OG  . SER B 1 370 ? -38.954 -10.647 -50.687 1.00 70.57  ? 371  SER B OG  1 
ATOM   6976 N N   . ASP B 1 371 ? -42.222 -8.764  -50.665 1.00 82.70  ? 372  ASP B N   1 
ATOM   6977 C CA  . ASP B 1 371 ? -43.549 -9.167  -51.048 1.00 77.14  ? 372  ASP B CA  1 
ATOM   6978 C C   . ASP B 1 371 ? -43.467 -10.524 -51.647 1.00 64.34  ? 372  ASP B C   1 
ATOM   6979 O O   . ASP B 1 371 ? -44.294 -11.364 -51.426 1.00 50.47  ? 372  ASP B O   1 
ATOM   6980 C CB  . ASP B 1 371 ? -44.036 -8.186  -52.064 1.00 83.72  ? 372  ASP B CB  1 
ATOM   6981 C CG  . ASP B 1 371 ? -43.929 -6.800  -51.577 1.00 91.89  ? 372  ASP B CG  1 
ATOM   6982 O OD1 . ASP B 1 371 ? -44.186 -6.593  -50.382 1.00 92.29  ? 372  ASP B OD1 1 
ATOM   6983 O OD2 . ASP B 1 371 ? -43.591 -5.920  -52.376 1.00 98.03  ? 372  ASP B OD2 1 
ATOM   6984 N N   . LEU B 1 372 ? -42.458 -10.723 -52.448 1.00 68.16  ? 373  LEU B N   1 
ATOM   6985 C CA  . LEU B 1 372 ? -42.243 -12.054 -53.001 1.00 69.09  ? 373  LEU B CA  1 
ATOM   6986 C C   . LEU B 1 372 ? -42.214 -13.112 -51.906 1.00 65.88  ? 373  LEU B C   1 
ATOM   6987 O O   . LEU B 1 372 ? -42.882 -14.149 -52.005 1.00 60.00  ? 373  LEU B O   1 
ATOM   6988 C CB  . LEU B 1 372 ? -40.939 -12.076 -53.794 1.00 68.56  ? 373  LEU B CB  1 
ATOM   6989 C CG  . LEU B 1 372 ? -40.917 -13.090 -54.926 1.00 72.94  ? 373  LEU B CG  1 
ATOM   6990 C CD1 . LEU B 1 372 ? -41.857 -12.628 -56.032 1.00 77.91  ? 373  LEU B CD1 1 
ATOM   6991 C CD2 . LEU B 1 372 ? -39.504 -13.287 -55.445 1.00 78.52  ? 373  LEU B CD2 1 
ATOM   6992 N N   . ALA B 1 373 ? -41.434 -12.873 -50.852 1.00 67.92  ? 374  ALA B N   1 
ATOM   6993 C CA  . ALA B 1 373 ? -41.368 -13.855 -49.777 1.00 62.80  ? 374  ALA B CA  1 
ATOM   6994 C C   . ALA B 1 373 ? -42.707 -13.976 -49.068 1.00 50.87  ? 374  ALA B C   1 
ATOM   6995 O O   . ALA B 1 373 ? -43.134 -15.085 -48.725 1.00 41.89  ? 374  ALA B O   1 
ATOM   6996 C CB  . ALA B 1 373 ? -40.263 -13.495 -48.787 1.00 61.79  ? 374  ALA B CB  1 
ATOM   6997 N N   . ALA B 1 374 ? -43.405 -12.884 -48.863 1.00 44.56  ? 375  ALA B N   1 
ATOM   6998 C CA  . ALA B 1 374 ? -44.677 -12.942 -48.183 1.00 49.34  ? 375  ALA B CA  1 
ATOM   6999 C C   . ALA B 1 374 ? -45.692 -13.747 -48.952 1.00 59.55  ? 375  ALA B C   1 
ATOM   7000 O O   . ALA B 1 374 ? -46.491 -14.466 -48.400 1.00 61.35  ? 375  ALA B O   1 
ATOM   7001 C CB  . ALA B 1 374 ? -45.195 -11.568 -47.892 1.00 41.63  ? 375  ALA B CB  1 
ATOM   7002 N N   . GLU B 1 375 ? -45.637 -13.609 -50.261 1.00 58.68  ? 376  GLU B N   1 
ATOM   7003 C CA  . GLU B 1 375 ? -46.496 -14.306 -51.174 1.00 56.50  ? 376  GLU B CA  1 
ATOM   7004 C C   . GLU B 1 375 ? -46.233 -15.767 -51.081 1.00 50.85  ? 376  GLU B C   1 
ATOM   7005 O O   . GLU B 1 375 ? -47.112 -16.560 -51.084 1.00 54.62  ? 376  GLU B O   1 
ATOM   7006 C CB  . GLU B 1 375 ? -46.135 -13.828 -52.569 1.00 74.74  ? 376  GLU B CB  1 
ATOM   7007 C CG  . GLU B 1 375 ? -47.281 -13.644 -53.532 1.00 87.52  ? 376  GLU B CG  1 
ATOM   7008 C CD  . GLU B 1 375 ? -48.289 -12.651 -53.038 1.00 104.32 ? 376  GLU B CD  1 
ATOM   7009 O OE1 . GLU B 1 375 ? -47.947 -11.466 -52.912 1.00 110.40 ? 376  GLU B OE1 1 
ATOM   7010 O OE2 . GLU B 1 375 ? -49.428 -13.058 -52.775 1.00 112.10 ? 376  GLU B OE2 1 
ATOM   7011 N N   . ALA B 1 376 ? -44.983 -16.126 -51.012 1.00 45.60  ? 377  ALA B N   1 
ATOM   7012 C CA  . ALA B 1 376 ? -44.636 -17.497 -50.863 1.00 50.93  ? 377  ALA B CA  1 
ATOM   7013 C C   . ALA B 1 376 ? -45.213 -18.016 -49.563 1.00 53.07  ? 377  ALA B C   1 
ATOM   7014 O O   . ALA B 1 376 ? -45.529 -19.172 -49.475 1.00 50.70  ? 377  ALA B O   1 
ATOM   7015 C CB  . ALA B 1 376 ? -43.145 -17.683 -50.906 1.00 48.63  ? 377  ALA B CB  1 
ATOM   7016 N N   . VAL B 1 377 ? -45.272 -17.186 -48.536 1.00 50.55  ? 378  VAL B N   1 
ATOM   7017 C CA  . VAL B 1 377 ? -45.831 -17.644 -47.267 1.00 41.95  ? 378  VAL B CA  1 
ATOM   7018 C C   . VAL B 1 377 ? -47.315 -17.939 -47.420 1.00 40.20  ? 378  VAL B C   1 
ATOM   7019 O O   . VAL B 1 377 ? -47.808 -18.979 -46.971 1.00 36.09  ? 378  VAL B O   1 
ATOM   7020 C CB  . VAL B 1 377 ? -45.586 -16.612 -46.152 1.00 33.78  ? 378  VAL B CB  1 
ATOM   7021 C CG1 . VAL B 1 377 ? -46.210 -17.100 -44.843 1.00 30.57  ? 378  VAL B CG1 1 
ATOM   7022 C CG2 . VAL B 1 377 ? -44.106 -16.358 -45.983 1.00 29.32  ? 378  VAL B CG2 1 
ATOM   7023 N N   . VAL B 1 378 ? -48.049 -17.030 -48.062 1.00 39.14  ? 379  VAL B N   1 
ATOM   7024 C CA  . VAL B 1 378 ? -49.484 -17.222 -48.179 1.00 52.97  ? 379  VAL B CA  1 
ATOM   7025 C C   . VAL B 1 378 ? -49.830 -18.325 -49.174 1.00 57.34  ? 379  VAL B C   1 
ATOM   7026 O O   . VAL B 1 378 ? -50.911 -18.912 -49.077 1.00 58.53  ? 379  VAL B O   1 
ATOM   7027 C CB  . VAL B 1 378 ? -50.175 -15.897 -48.547 1.00 57.74  ? 379  VAL B CB  1 
ATOM   7028 C CG1 . VAL B 1 378 ? -50.023 -14.900 -47.420 1.00 54.26  ? 379  VAL B CG1 1 
ATOM   7029 C CG2 . VAL B 1 378 ? -49.631 -15.349 -49.828 1.00 64.86  ? 379  VAL B CG2 1 
ATOM   7030 N N   . LEU B 1 379 ? -48.937 -18.645 -50.077 1.00 54.49  ? 380  LEU B N   1 
ATOM   7031 C CA  . LEU B 1 379 ? -49.150 -19.782 -50.893 1.00 56.64  ? 380  LEU B CA  1 
ATOM   7032 C C   . LEU B 1 379 ? -49.019 -21.074 -50.135 1.00 53.61  ? 380  LEU B C   1 
ATOM   7033 O O   . LEU B 1 379 ? -49.824 -21.947 -50.271 1.00 59.28  ? 380  LEU B O   1 
ATOM   7034 C CB  . LEU B 1 379 ? -48.141 -19.795 -52.023 1.00 65.08  ? 380  LEU B CB  1 
ATOM   7035 C CG  . LEU B 1 379 ? -47.441 -21.091 -52.411 1.00 65.91  ? 380  LEU B CG  1 
ATOM   7036 C CD1 . LEU B 1 379 ? -48.248 -21.953 -53.365 1.00 63.98  ? 380  LEU B CD1 1 
ATOM   7037 C CD2 . LEU B 1 379 ? -46.090 -20.718 -52.984 1.00 66.50  ? 380  LEU B CD2 1 
ATOM   7038 N N   . HIS B 1 380 ? -48.005 -21.175 -49.294 1.00 47.61  ? 381  HIS B N   1 
ATOM   7039 C CA  A HIS B 1 380 ? -47.760 -22.418 -48.581 0.49 46.25  ? 381  HIS B CA  1 
ATOM   7040 C CA  B HIS B 1 380 ? -47.723 -22.392 -48.545 0.51 46.25  ? 381  HIS B CA  1 
ATOM   7041 C C   . HIS B 1 380 ? -48.769 -22.645 -47.469 1.00 46.07  ? 381  HIS B C   1 
ATOM   7042 O O   . HIS B 1 380 ? -49.043 -23.800 -47.124 1.00 55.06  ? 381  HIS B O   1 
ATOM   7043 C CB  A HIS B 1 380 ? -46.340 -22.433 -48.028 0.49 47.55  ? 381  HIS B CB  1 
ATOM   7044 C CB  B HIS B 1 380 ? -46.328 -22.282 -47.923 0.51 47.48  ? 381  HIS B CB  1 
ATOM   7045 C CG  A HIS B 1 380 ? -45.353 -23.028 -48.974 0.49 48.60  ? 381  HIS B CG  1 
ATOM   7046 C CG  B HIS B 1 380 ? -45.703 -23.597 -47.580 0.51 46.97  ? 381  HIS B CG  1 
ATOM   7047 N ND1 A HIS B 1 380 ? -44.806 -22.315 -50.018 0.49 50.69  ? 381  HIS B ND1 1 
ATOM   7048 N ND1 B HIS B 1 380 ? -45.837 -24.185 -46.341 0.51 48.74  ? 381  HIS B ND1 1 
ATOM   7049 C CD2 A HIS B 1 380 ? -44.842 -24.277 -49.060 0.49 48.54  ? 381  HIS B CD2 1 
ATOM   7050 C CD2 B HIS B 1 380 ? -44.926 -24.432 -48.310 0.51 49.41  ? 381  HIS B CD2 1 
ATOM   7051 C CE1 A HIS B 1 380 ? -43.990 -23.097 -50.700 0.49 51.04  ? 381  HIS B CE1 1 
ATOM   7052 C CE1 B HIS B 1 380 ? -45.175 -25.328 -46.323 0.51 48.73  ? 381  HIS B CE1 1 
ATOM   7053 N NE2 A HIS B 1 380 ? -43.987 -24.291 -50.134 0.49 51.02  ? 381  HIS B NE2 1 
ATOM   7054 N NE2 B HIS B 1 380 ? -44.612 -25.501 -47.506 0.51 50.35  ? 381  HIS B NE2 1 
ATOM   7055 N N   . TYR B 1 381 ? -49.351 -21.582 -46.923 1.00 40.88  ? 382  TYR B N   1 
ATOM   7056 C CA  . TYR B 1 381 ? -50.219 -21.701 -45.763 1.00 38.87  ? 382  TYR B CA  1 
ATOM   7057 C C   . TYR B 1 381 ? -51.691 -21.544 -46.102 1.00 38.79  ? 382  TYR B C   1 
ATOM   7058 O O   . TYR B 1 381 ? -52.524 -21.506 -45.192 1.00 41.28  ? 382  TYR B O   1 
ATOM   7059 C CB  . TYR B 1 381 ? -49.799 -20.690 -44.698 1.00 28.84  ? 382  TYR B CB  1 
ATOM   7060 C CG  . TYR B 1 381 ? -48.558 -21.121 -43.951 1.00 38.47  ? 382  TYR B CG  1 
ATOM   7061 C CD1 . TYR B 1 381 ? -47.288 -20.835 -44.442 1.00 28.66  ? 382  TYR B CD1 1 
ATOM   7062 C CD2 . TYR B 1 381 ? -48.657 -21.825 -42.755 1.00 37.00  ? 382  TYR B CD2 1 
ATOM   7063 C CE1 . TYR B 1 381 ? -46.149 -21.235 -43.755 1.00 34.98  ? 382  TYR B CE1 1 
ATOM   7064 C CE2 . TYR B 1 381 ? -47.526 -22.228 -42.062 1.00 32.55  ? 382  TYR B CE2 1 
ATOM   7065 C CZ  . TYR B 1 381 ? -46.279 -21.931 -42.562 1.00 35.09  ? 382  TYR B CZ  1 
ATOM   7066 O OH  . TYR B 1 381 ? -45.166 -22.343 -41.862 1.00 29.68  ? 382  TYR B OH  1 
ATOM   7067 N N   . THR B 1 382 ? -52.038 -21.479 -47.382 1.00 36.89  ? 383  THR B N   1 
ATOM   7068 C CA  . THR B 1 382 ? -53.430 -21.452 -47.796 1.00 33.89  ? 383  THR B CA  1 
ATOM   7069 C C   . THR B 1 382 ? -53.868 -22.857 -48.181 1.00 43.27  ? 383  THR B C   1 
ATOM   7070 O O   . THR B 1 382 ? -53.157 -23.554 -48.913 1.00 46.27  ? 383  THR B O   1 
ATOM   7071 C CB  . THR B 1 382 ? -53.642 -20.485 -48.961 1.00 35.64  ? 383  THR B CB  1 
ATOM   7072 O OG1 . THR B 1 382 ? -53.527 -19.144 -48.489 1.00 57.47  ? 383  THR B OG1 1 
ATOM   7073 C CG2 . THR B 1 382 ? -55.019 -20.681 -49.594 1.00 36.90  ? 383  THR B CG2 1 
ATOM   7074 N N   . ASP B 1 383 ? -55.017 -23.278 -47.654 1.00 40.47  ? 384  ASP B N   1 
ATOM   7075 C CA  . ASP B 1 383 ? -55.748 -24.415 -48.202 1.00 43.84  ? 384  ASP B CA  1 
ATOM   7076 C C   . ASP B 1 383 ? -56.602 -23.894 -49.350 1.00 39.52  ? 384  ASP B C   1 
ATOM   7077 O O   . ASP B 1 383 ? -57.610 -23.218 -49.125 1.00 41.00  ? 384  ASP B O   1 
ATOM   7078 C CB  . ASP B 1 383 ? -56.604 -25.083 -47.127 1.00 48.06  ? 384  ASP B CB  1 
ATOM   7079 C CG  . ASP B 1 383 ? -57.313 -26.344 -47.627 1.00 53.02  ? 384  ASP B CG  1 
ATOM   7080 O OD1 . ASP B 1 383 ? -57.477 -26.520 -48.853 1.00 57.13  ? 384  ASP B OD1 1 
ATOM   7081 O OD2 . ASP B 1 383 ? -57.716 -27.168 -46.783 1.00 57.50  ? 384  ASP B OD2 1 
ATOM   7082 N N   . TRP B 1 384 ? -56.210 -24.215 -50.579 1.00 39.41  ? 385  TRP B N   1 
ATOM   7083 C CA  . TRP B 1 384 ? -56.871 -23.699 -51.770 1.00 41.11  ? 385  TRP B CA  1 
ATOM   7084 C C   . TRP B 1 384 ? -58.196 -24.385 -52.062 1.00 45.75  ? 385  TRP B C   1 
ATOM   7085 O O   . TRP B 1 384 ? -58.863 -24.030 -53.043 1.00 48.71  ? 385  TRP B O   1 
ATOM   7086 C CB  . TRP B 1 384 ? -55.914 -23.804 -52.956 1.00 41.25  ? 385  TRP B CB  1 
ATOM   7087 C CG  . TRP B 1 384 ? -54.728 -22.941 -52.716 1.00 43.96  ? 385  TRP B CG  1 
ATOM   7088 C CD1 . TRP B 1 384 ? -53.502 -23.334 -52.263 1.00 38.14  ? 385  TRP B CD1 1 
ATOM   7089 C CD2 . TRP B 1 384 ? -54.672 -21.516 -52.845 1.00 39.54  ? 385  TRP B CD2 1 
ATOM   7090 N NE1 . TRP B 1 384 ? -52.679 -22.242 -52.122 1.00 37.91  ? 385  TRP B NE1 1 
ATOM   7091 C CE2 . TRP B 1 384 ? -53.373 -21.115 -52.480 1.00 38.03  ? 385  TRP B CE2 1 
ATOM   7092 C CE3 . TRP B 1 384 ? -55.593 -20.541 -53.244 1.00 41.14  ? 385  TRP B CE3 1 
ATOM   7093 C CZ2 . TRP B 1 384 ? -52.972 -19.782 -52.500 1.00 37.84  ? 385  TRP B CZ2 1 
ATOM   7094 C CZ3 . TRP B 1 384 ? -55.191 -19.217 -53.266 1.00 40.59  ? 385  TRP B CZ3 1 
ATOM   7095 C CH2 . TRP B 1 384 ? -53.892 -18.852 -52.898 1.00 39.14  ? 385  TRP B CH2 1 
ATOM   7096 N N   . LEU B 1 385 ? -58.600 -25.345 -51.238 1.00 46.06  ? 386  LEU B N   1 
ATOM   7097 C CA  . LEU B 1 385 ? -59.977 -25.813 -51.258 1.00 52.54  ? 386  LEU B CA  1 
ATOM   7098 C C   . LEU B 1 385 ? -60.863 -25.039 -50.290 1.00 52.04  ? 386  LEU B C   1 
ATOM   7099 O O   . LEU B 1 385 ? -62.087 -25.056 -50.445 1.00 51.01  ? 386  LEU B O   1 
ATOM   7100 C CB  . LEU B 1 385 ? -60.030 -27.309 -50.934 1.00 54.42  ? 386  LEU B CB  1 
ATOM   7101 C CG  . LEU B 1 385 ? -59.462 -28.212 -52.034 1.00 54.66  ? 386  LEU B CG  1 
ATOM   7102 C CD1 . LEU B 1 385 ? -59.432 -29.665 -51.594 1.00 56.09  ? 386  LEU B CD1 1 
ATOM   7103 C CD2 . LEU B 1 385 ? -60.253 -28.054 -53.323 1.00 51.39  ? 386  LEU B CD2 1 
ATOM   7104 N N   . HIS B 1 386 ? -60.267 -24.356 -49.312 1.00 52.33  ? 387  HIS B N   1 
ATOM   7105 C CA  . HIS B 1 386 ? -60.994 -23.545 -48.333 1.00 52.68  ? 387  HIS B CA  1 
ATOM   7106 C C   . HIS B 1 386 ? -60.211 -22.262 -48.094 1.00 49.93  ? 387  HIS B C   1 
ATOM   7107 O O   . HIS B 1 386 ? -59.711 -22.012 -46.992 1.00 40.77  ? 387  HIS B O   1 
ATOM   7108 C CB  . HIS B 1 386 ? -61.192 -24.314 -47.024 1.00 51.55  ? 387  HIS B CB  1 
ATOM   7109 C CG  . HIS B 1 386 ? -61.889 -25.625 -47.195 1.00 51.07  ? 387  HIS B CG  1 
ATOM   7110 N ND1 . HIS B 1 386 ? -61.226 -26.832 -47.147 1.00 50.22  ? 387  HIS B ND1 1 
ATOM   7111 C CD2 . HIS B 1 386 ? -63.188 -25.916 -47.437 1.00 52.02  ? 387  HIS B CD2 1 
ATOM   7112 C CE1 . HIS B 1 386 ? -62.089 -27.811 -47.346 1.00 51.04  ? 387  HIS B CE1 1 
ATOM   7113 N NE2 . HIS B 1 386 ? -63.286 -27.283 -47.524 1.00 55.39  ? 387  HIS B NE2 1 
ATOM   7114 N N   . PRO B 1 387 ? -60.087 -21.414 -49.118 1.00 50.62  ? 388  PRO B N   1 
ATOM   7115 C CA  . PRO B 1 387 ? -59.176 -20.265 -49.003 1.00 43.69  ? 388  PRO B CA  1 
ATOM   7116 C C   . PRO B 1 387 ? -59.684 -19.171 -48.079 1.00 50.66  ? 388  PRO B C   1 
ATOM   7117 O O   . PRO B 1 387 ? -58.887 -18.316 -47.672 1.00 52.02  ? 388  PRO B O   1 
ATOM   7118 C CB  . PRO B 1 387 ? -59.064 -19.753 -50.447 1.00 42.37  ? 388  PRO B CB  1 
ATOM   7119 C CG  . PRO B 1 387 ? -60.068 -20.567 -51.267 1.00 44.33  ? 388  PRO B CG  1 
ATOM   7120 C CD  . PRO B 1 387 ? -60.931 -21.323 -50.317 1.00 44.84  ? 388  PRO B CD  1 
ATOM   7121 N N   . GLU B 1 388 ? -60.974 -19.164 -47.736 1.00 50.03  ? 389  GLU B N   1 
ATOM   7122 C CA  . GLU B 1 388 ? -61.573 -18.067 -46.984 1.00 52.94  ? 389  GLU B CA  1 
ATOM   7123 C C   . GLU B 1 388 ? -62.226 -18.509 -45.678 1.00 53.34  ? 389  GLU B C   1 
ATOM   7124 O O   . GLU B 1 388 ? -62.961 -17.720 -45.072 1.00 54.10  ? 389  GLU B O   1 
ATOM   7125 C CB  . GLU B 1 388 ? -62.600 -17.339 -47.856 1.00 58.60  ? 389  GLU B CB  1 
ATOM   7126 C CG  . GLU B 1 388 ? -62.131 -17.110 -49.281 1.00 71.31  ? 389  GLU B CG  1 
ATOM   7127 C CD  . GLU B 1 388 ? -62.256 -15.664 -49.717 1.00 82.95  ? 389  GLU B CD  1 
ATOM   7128 O OE1 . GLU B 1 388 ? -62.832 -14.860 -48.953 1.00 88.01  ? 389  GLU B OE1 1 
ATOM   7129 O OE2 . GLU B 1 388 ? -61.773 -15.331 -50.821 1.00 86.07  ? 389  GLU B OE2 1 
ATOM   7130 N N   . ASP B 1 389 ? -61.985 -19.733 -45.229 1.00 43.43  ? 390  ASP B N   1 
ATOM   7131 C CA  . ASP B 1 389 ? -62.574 -20.221 -43.988 1.00 51.33  ? 390  ASP B CA  1 
ATOM   7132 C C   . ASP B 1 389 ? -61.934 -19.513 -42.798 1.00 47.76  ? 390  ASP B C   1 
ATOM   7133 O O   . ASP B 1 389 ? -60.737 -19.706 -42.554 1.00 43.88  ? 390  ASP B O   1 
ATOM   7134 C CB  . ASP B 1 389 ? -62.389 -21.736 -43.884 1.00 54.22  ? 390  ASP B CB  1 
ATOM   7135 C CG  . ASP B 1 389 ? -63.037 -22.323 -42.643 1.00 66.68  ? 390  ASP B CG  1 
ATOM   7136 O OD1 . ASP B 1 389 ? -63.847 -21.623 -42.003 1.00 76.71  ? 390  ASP B OD1 1 
ATOM   7137 O OD2 . ASP B 1 389 ? -62.729 -23.484 -42.300 1.00 71.15  ? 390  ASP B OD2 1 
ATOM   7138 N N   . PRO B 1 390 ? -62.676 -18.699 -42.039 1.00 49.24  ? 391  PRO B N   1 
ATOM   7139 C CA  . PRO B 1 390 ? -62.043 -17.935 -40.944 1.00 47.37  ? 391  PRO B CA  1 
ATOM   7140 C C   . PRO B 1 390 ? -61.333 -18.792 -39.907 1.00 43.76  ? 391  PRO B C   1 
ATOM   7141 O O   . PRO B 1 390 ? -60.231 -18.430 -39.473 1.00 47.50  ? 391  PRO B O   1 
ATOM   7142 C CB  . PRO B 1 390 ? -63.225 -17.165 -40.340 1.00 48.86  ? 391  PRO B CB  1 
ATOM   7143 C CG  . PRO B 1 390 ? -64.196 -17.021 -41.500 1.00 50.72  ? 391  PRO B CG  1 
ATOM   7144 C CD  . PRO B 1 390 ? -64.086 -18.319 -42.243 1.00 46.51  ? 391  PRO B CD  1 
ATOM   7145 N N   . ALA B 1 391 ? -61.915 -19.924 -39.502 1.00 43.63  ? 392  ALA B N   1 
ATOM   7146 C CA  . ALA B 1 391 ? -61.246 -20.773 -38.516 1.00 46.47  ? 392  ALA B CA  1 
ATOM   7147 C C   . ALA B 1 391 ? -59.935 -21.331 -39.057 1.00 46.46  ? 392  ALA B C   1 
ATOM   7148 O O   . ALA B 1 391 ? -58.934 -21.395 -38.333 1.00 45.21  ? 392  ALA B O   1 
ATOM   7149 C CB  . ALA B 1 391 ? -62.168 -21.910 -38.074 1.00 45.56  ? 392  ALA B CB  1 
ATOM   7150 N N   . ARG B 1 392 ? -59.921 -21.750 -40.325 1.00 47.67  ? 393  ARG B N   1 
ATOM   7151 C CA  . ARG B 1 392 ? -58.680 -22.238 -40.916 1.00 45.79  ? 393  ARG B CA  1 
ATOM   7152 C C   . ARG B 1 392 ? -57.664 -21.112 -41.059 1.00 41.16  ? 393  ARG B C   1 
ATOM   7153 O O   . ARG B 1 392 ? -56.462 -21.321 -40.845 1.00 33.82  ? 393  ARG B O   1 
ATOM   7154 C CB  . ARG B 1 392 ? -58.961 -22.890 -42.269 1.00 47.74  ? 393  ARG B CB  1 
ATOM   7155 C CG  . ARG B 1 392 ? -59.441 -24.335 -42.200 1.00 48.16  ? 393  ARG B CG  1 
ATOM   7156 C CD  . ARG B 1 392 ? -59.757 -24.840 -43.610 1.00 49.20  ? 393  ARG B CD  1 
ATOM   7157 N NE  . ARG B 1 392 ? -60.172 -26.242 -43.649 1.00 49.81  ? 393  ARG B NE  1 
ATOM   7158 C CZ  . ARG B 1 392 ? -61.434 -26.643 -43.785 1.00 59.51  ? 393  ARG B CZ  1 
ATOM   7159 N NH1 . ARG B 1 392 ? -62.409 -25.750 -43.892 1.00 64.11  ? 393  ARG B NH1 1 
ATOM   7160 N NH2 . ARG B 1 392 ? -61.720 -27.936 -43.818 1.00 63.93  ? 393  ARG B NH2 1 
ATOM   7161 N N   . LEU B 1 393 ? -58.127 -19.906 -41.403 1.00 41.73  ? 394  LEU B N   1 
ATOM   7162 C CA  . LEU B 1 393 ? -57.215 -18.772 -41.538 1.00 41.08  ? 394  LEU B CA  1 
ATOM   7163 C C   . LEU B 1 393 ? -56.593 -18.398 -40.195 1.00 38.44  ? 394  LEU B C   1 
ATOM   7164 O O   . LEU B 1 393 ? -55.380 -18.159 -40.110 1.00 32.44  ? 394  LEU B O   1 
ATOM   7165 C CB  . LEU B 1 393 ? -57.949 -17.581 -42.154 1.00 37.38  ? 394  LEU B CB  1 
ATOM   7166 C CG  . LEU B 1 393 ? -58.382 -17.761 -43.615 1.00 45.75  ? 394  LEU B CG  1 
ATOM   7167 C CD1 . LEU B 1 393 ? -59.389 -16.703 -44.043 1.00 39.85  ? 394  LEU B CD1 1 
ATOM   7168 C CD2 . LEU B 1 393 ? -57.174 -17.747 -44.533 1.00 36.64  ? 394  LEU B CD2 1 
ATOM   7169 N N   . ARG B 1 394 ? -57.398 -18.356 -39.131 1.00 37.58  ? 395  ARG B N   1 
ATOM   7170 C CA  . ARG B 1 394 ? -56.848 -18.089 -37.804 1.00 38.89  ? 395  ARG B CA  1 
ATOM   7171 C C   . ARG B 1 394 ? -55.740 -19.080 -37.463 1.00 35.13  ? 395  ARG B C   1 
ATOM   7172 O O   . ARG B 1 394 ? -54.630 -18.691 -37.085 1.00 33.35  ? 395  ARG B O   1 
ATOM   7173 C CB  . ARG B 1 394 ? -57.959 -18.140 -36.756 1.00 35.13  ? 395  ARG B CB  1 
ATOM   7174 C CG  . ARG B 1 394 ? -57.469 -17.945 -35.329 1.00 44.28  ? 395  ARG B CG  1 
ATOM   7175 C CD  . ARG B 1 394 ? -58.574 -18.255 -34.330 1.00 43.82  ? 395  ARG B CD  1 
ATOM   7176 N NE  . ARG B 1 394 ? -58.903 -19.678 -34.316 1.00 46.57  ? 395  ARG B NE  1 
ATOM   7177 C CZ  . ARG B 1 394 ? -60.099 -20.168 -33.997 1.00 48.84  ? 395  ARG B CZ  1 
ATOM   7178 N NH1 . ARG B 1 394 ? -61.091 -19.350 -33.672 1.00 47.34  ? 395  ARG B NH1 1 
ATOM   7179 N NH2 . ARG B 1 394 ? -60.305 -21.477 -34.008 1.00 50.33  ? 395  ARG B NH2 1 
ATOM   7180 N N   . GLU B 1 395 ? -56.016 -20.374 -37.626 1.00 37.12  ? 396  GLU B N   1 
ATOM   7181 C CA  . GLU B 1 395 ? -55.018 -21.382 -37.289 1.00 39.87  ? 396  GLU B CA  1 
ATOM   7182 C C   . GLU B 1 395 ? -53.810 -21.304 -38.218 1.00 37.62  ? 396  GLU B C   1 
ATOM   7183 O O   . GLU B 1 395 ? -52.669 -21.494 -37.777 1.00 34.29  ? 396  GLU B O   1 
ATOM   7184 C CB  . GLU B 1 395 ? -55.658 -22.772 -37.321 1.00 44.40  ? 396  GLU B CB  1 
ATOM   7185 C CG  . GLU B 1 395 ? -56.019 -23.310 -35.930 1.00 71.77  ? 396  GLU B CG  1 
ATOM   7186 C CD  . GLU B 1 395 ? -57.097 -22.490 -35.224 1.00 82.97  ? 396  GLU B CD  1 
ATOM   7187 O OE1 . GLU B 1 395 ? -58.292 -22.675 -35.543 1.00 87.14  ? 396  GLU B OE1 1 
ATOM   7188 O OE2 . GLU B 1 395 ? -56.750 -21.664 -34.348 1.00 84.43  ? 396  GLU B OE2 1 
ATOM   7189 N N   . ALA B 1 396 ? -54.036 -21.000 -39.501 1.00 37.99  ? 397  ALA B N   1 
ATOM   7190 C CA  . ALA B 1 396 ? -52.926 -20.899 -40.445 1.00 36.39  ? 397  ALA B CA  1 
ATOM   7191 C C   . ALA B 1 396 ? -51.973 -19.772 -40.063 1.00 34.44  ? 397  ALA B C   1 
ATOM   7192 O O   . ALA B 1 396 ? -50.750 -19.956 -40.075 1.00 32.44  ? 397  ALA B O   1 
ATOM   7193 C CB  . ALA B 1 396 ? -53.453 -20.703 -41.874 1.00 32.54  ? 397  ALA B CB  1 
ATOM   7194 N N   . LEU B 1 397 ? -52.509 -18.597 -39.716 1.00 29.68  ? 398  LEU B N   1 
ATOM   7195 C CA  . LEU B 1 397 ? -51.637 -17.502 -39.305 1.00 32.82  ? 398  LEU B CA  1 
ATOM   7196 C C   . LEU B 1 397 ? -50.915 -17.817 -37.998 1.00 36.36  ? 398  LEU B C   1 
ATOM   7197 O O   . LEU B 1 397 ? -49.762 -17.409 -37.810 1.00 34.64  ? 398  LEU B O   1 
ATOM   7198 C CB  . LEU B 1 397 ? -52.434 -16.207 -39.175 1.00 34.13  ? 398  LEU B CB  1 
ATOM   7199 C CG  . LEU B 1 397 ? -51.579 -14.988 -38.839 1.00 37.48  ? 398  LEU B CG  1 
ATOM   7200 C CD1 . LEU B 1 397 ? -50.698 -14.639 -40.035 1.00 37.07  ? 398  LEU B CD1 1 
ATOM   7201 C CD2 . LEU B 1 397 ? -52.471 -13.818 -38.468 1.00 39.75  ? 398  LEU B CD2 1 
ATOM   7202 N N   . SER B 1 398 ? -51.565 -18.543 -37.086 1.00 33.10  ? 399  SER B N   1 
ATOM   7203 C CA  . SER B 1 398 ? -50.857 -18.998 -35.896 1.00 33.68  ? 399  SER B CA  1 
ATOM   7204 C C   . SER B 1 398 ? -49.690 -19.899 -36.281 1.00 35.81  ? 399  SER B C   1 
ATOM   7205 O O   . SER B 1 398 ? -48.596 -19.785 -35.717 1.00 36.35  ? 399  SER B O   1 
ATOM   7206 C CB  . SER B 1 398 ? -51.824 -19.715 -34.949 1.00 34.02  ? 399  SER B CB  1 
ATOM   7207 O OG  . SER B 1 398 ? -51.152 -20.240 -33.819 1.00 44.86  ? 399  SER B OG  1 
ATOM   7208 N N   . ASP B 1 399 ? -49.897 -20.772 -37.271 1.00 37.22  ? 400  ASP B N   1 
ATOM   7209 C CA  . ASP B 1 399 ? -48.809 -21.616 -37.762 1.00 38.55  ? 400  ASP B CA  1 
ATOM   7210 C C   . ASP B 1 399 ? -47.709 -20.790 -38.421 1.00 35.11  ? 400  ASP B C   1 
ATOM   7211 O O   . ASP B 1 399 ? -46.522 -21.043 -38.192 1.00 27.69  ? 400  ASP B O   1 
ATOM   7212 C CB  . ASP B 1 399 ? -49.349 -22.658 -38.742 1.00 46.42  ? 400  ASP B CB  1 
ATOM   7213 C CG  . ASP B 1 399 ? -50.231 -23.695 -38.067 1.00 57.15  ? 400  ASP B CG  1 
ATOM   7214 O OD1 . ASP B 1 399 ? -51.110 -24.260 -38.752 1.00 63.44  ? 400  ASP B OD1 1 
ATOM   7215 O OD2 . ASP B 1 399 ? -50.050 -23.944 -36.856 1.00 59.04  ? 400  ASP B OD2 1 
ATOM   7216 N N   . VAL B 1 400 ? -48.077 -19.800 -39.241 1.00 29.84  ? 401  VAL B N   1 
ATOM   7217 C CA  . VAL B 1 400 ? -47.071 -18.939 -39.864 1.00 32.48  ? 401  VAL B CA  1 
ATOM   7218 C C   . VAL B 1 400 ? -46.175 -18.324 -38.799 1.00 30.10  ? 401  VAL B C   1 
ATOM   7219 O O   . VAL B 1 400 ? -44.943 -18.430 -38.850 1.00 27.25  ? 401  VAL B O   1 
ATOM   7220 C CB  . VAL B 1 400 ? -47.742 -17.844 -40.717 1.00 34.73  ? 401  VAL B CB  1 
ATOM   7221 C CG1 . VAL B 1 400 ? -46.719 -16.796 -41.127 1.00 26.54  ? 401  VAL B CG1 1 
ATOM   7222 C CG2 . VAL B 1 400 ? -48.423 -18.441 -41.939 1.00 26.97  ? 401  VAL B CG2 1 
ATOM   7223 N N   . VAL B 1 401 ? -46.791 -17.689 -37.804 1.00 32.21  ? 402  VAL B N   1 
ATOM   7224 C CA  . VAL B 1 401 ? -46.031 -16.943 -36.812 1.00 30.07  ? 402  VAL B CA  1 
ATOM   7225 C C   . VAL B 1 401 ? -45.207 -17.888 -35.942 1.00 31.03  ? 402  VAL B C   1 
ATOM   7226 O O   . VAL B 1 401 ? -44.033 -17.625 -35.654 1.00 29.78  ? 402  VAL B O   1 
ATOM   7227 C CB  . VAL B 1 401 ? -46.990 -16.071 -35.983 1.00 31.72  ? 402  VAL B CB  1 
ATOM   7228 C CG1 . VAL B 1 401 ? -46.305 -15.569 -34.731 1.00 29.87  ? 402  VAL B CG1 1 
ATOM   7229 C CG2 . VAL B 1 401 ? -47.526 -14.917 -36.839 1.00 31.41  ? 402  VAL B CG2 1 
ATOM   7230 N N   . GLY B 1 402 ? -45.791 -19.019 -35.544 1.00 32.80  ? 403  GLY B N   1 
ATOM   7231 C CA  . GLY B 1 402 ? -45.060 -19.965 -34.715 1.00 31.79  ? 403  GLY B CA  1 
ATOM   7232 C C   . GLY B 1 402 ? -43.954 -20.693 -35.460 1.00 33.12  ? 403  GLY B C   1 
ATOM   7233 O O   . GLY B 1 402 ? -42.889 -20.959 -34.894 1.00 32.21  ? 403  GLY B O   1 
ATOM   7234 N N   . ASP B 1 403 ? -44.189 -21.040 -36.732 1.00 29.50  ? 404  ASP B N   1 
ATOM   7235 C CA  . ASP B 1 403 ? -43.165 -21.746 -37.501 1.00 29.36  ? 404  ASP B CA  1 
ATOM   7236 C C   . ASP B 1 403 ? -41.973 -20.841 -37.771 1.00 33.36  ? 404  ASP B C   1 
ATOM   7237 O O   . ASP B 1 403 ? -40.817 -21.229 -37.560 1.00 33.59  ? 404  ASP B O   1 
ATOM   7238 C CB  . ASP B 1 403 ? -43.741 -22.265 -38.823 1.00 29.31  ? 404  ASP B CB  1 
ATOM   7239 C CG  . ASP B 1 403 ? -44.801 -23.338 -38.626 1.00 29.82  ? 404  ASP B CG  1 
ATOM   7240 O OD1 . ASP B 1 403 ? -45.575 -23.586 -39.573 1.00 35.21  ? 404  ASP B OD1 1 
ATOM   7241 O OD2 . ASP B 1 403 ? -44.871 -23.925 -37.524 1.00 37.52  ? 404  ASP B OD2 1 
ATOM   7242 N N   . HIS B 1 404 ? -42.243 -19.622 -38.233 1.00 33.07  ? 405  HIS B N   1 
ATOM   7243 C CA  . HIS B 1 404 ? -41.174 -18.712 -38.615 1.00 34.47  ? 405  HIS B CA  1 
ATOM   7244 C C   . HIS B 1 404 ? -40.323 -18.308 -37.417 1.00 30.68  ? 405  HIS B C   1 
ATOM   7245 O O   . HIS B 1 404 ? -39.097 -18.203 -37.526 1.00 33.47  ? 405  HIS B O   1 
ATOM   7246 C CB  . HIS B 1 404 ? -41.778 -17.480 -39.281 1.00 33.66  ? 405  HIS B CB  1 
ATOM   7247 C CG  . HIS B 1 404 ? -40.795 -16.383 -39.531 1.00 33.84  ? 405  HIS B CG  1 
ATOM   7248 N ND1 . HIS B 1 404 ? -39.662 -16.560 -40.297 1.00 35.01  ? 405  HIS B ND1 1 
ATOM   7249 C CD2 . HIS B 1 404 ? -40.773 -15.094 -39.114 1.00 30.72  ? 405  HIS B CD2 1 
ATOM   7250 C CE1 . HIS B 1 404 ? -38.992 -15.422 -40.355 1.00 34.44  ? 405  HIS B CE1 1 
ATOM   7251 N NE2 . HIS B 1 404 ? -39.645 -14.517 -39.646 1.00 36.73  ? 405  HIS B NE2 1 
ATOM   7252 N N   . ASN B 1 405 ? -40.949 -18.072 -36.268 1.00 29.35  ? 406  ASN B N   1 
ATOM   7253 C CA  . ASN B 1 405 ? -40.246 -17.474 -35.141 1.00 34.59  ? 406  ASN B CA  1 
ATOM   7254 C C   . ASN B 1 405 ? -39.714 -18.478 -34.128 1.00 30.34  ? 406  ASN B C   1 
ATOM   7255 O O   . ASN B 1 405 ? -38.728 -18.177 -33.454 1.00 29.71  ? 406  ASN B O   1 
ATOM   7256 C CB  . ASN B 1 405 ? -41.158 -16.484 -34.417 1.00 29.19  ? 406  ASN B CB  1 
ATOM   7257 C CG  . ASN B 1 405 ? -41.446 -15.254 -35.245 1.00 31.23  ? 406  ASN B CG  1 
ATOM   7258 O OD1 . ASN B 1 405 ? -40.690 -14.291 -35.220 1.00 45.04  ? 406  ASN B OD1 1 
ATOM   7259 N ND2 . ASN B 1 405 ? -42.563 -15.270 -35.964 1.00 32.90  ? 406  ASN B ND2 1 
ATOM   7260 N N   . VAL B 1 406 ? -40.333 -19.651 -33.985 1.00 26.63  ? 407  VAL B N   1 
ATOM   7261 C CA  . VAL B 1 406 ? -39.939 -20.576 -32.929 1.00 25.06  ? 407  VAL B CA  1 
ATOM   7262 C C   . VAL B 1 406 ? -39.634 -21.974 -33.455 1.00 25.06  ? 407  VAL B C   1 
ATOM   7263 O O   . VAL B 1 406 ? -38.521 -22.480 -33.278 1.00 27.36  ? 407  VAL B O   1 
ATOM   7264 C CB  . VAL B 1 406 ? -41.018 -20.663 -31.834 1.00 31.73  ? 407  VAL B CB  1 
ATOM   7265 C CG1 . VAL B 1 406 ? -40.551 -21.619 -30.752 1.00 25.26  ? 407  VAL B CG1 1 
ATOM   7266 C CG2 . VAL B 1 406 ? -41.309 -19.286 -31.241 1.00 25.37  ? 407  VAL B CG2 1 
ATOM   7267 N N   . VAL B 1 407 ? -40.623 -22.622 -34.078 1.00 23.20  ? 408  VAL B N   1 
ATOM   7268 C CA  . VAL B 1 407 ? -40.525 -24.060 -34.335 1.00 29.33  ? 408  VAL B CA  1 
ATOM   7269 C C   . VAL B 1 407 ? -39.410 -24.367 -35.325 1.00 31.48  ? 408  VAL B C   1 
ATOM   7270 O O   . VAL B 1 407 ? -38.572 -25.249 -35.092 1.00 34.97  ? 408  VAL B O   1 
ATOM   7271 C CB  . VAL B 1 407 ? -41.867 -24.617 -34.833 1.00 28.79  ? 408  VAL B CB  1 
ATOM   7272 C CG1 . VAL B 1 407 ? -41.765 -26.126 -35.027 1.00 26.10  ? 408  VAL B CG1 1 
ATOM   7273 C CG2 . VAL B 1 407 ? -42.970 -24.281 -33.857 1.00 22.87  ? 408  VAL B CG2 1 
ATOM   7274 N N   . CYS B 1 408 ? -39.395 -23.670 -36.450 1.00 21.53  ? 409  CYS B N   1 
ATOM   7275 C CA  . CYS B 1 408 ? -38.392 -23.980 -37.467 1.00 28.91  ? 409  CYS B CA  1 
ATOM   7276 C C   . CYS B 1 408 ? -36.984 -23.506 -37.123 1.00 28.79  ? 409  CYS B C   1 
ATOM   7277 O O   . CYS B 1 408 ? -36.018 -24.189 -37.481 1.00 32.30  ? 409  CYS B O   1 
ATOM   7278 C CB  . CYS B 1 408 ? -38.828 -23.443 -38.837 1.00 22.51  ? 409  CYS B CB  1 
ATOM   7279 S SG  . CYS B 1 408 ? -40.441 -24.089 -39.352 1.00 35.33  ? 409  CYS B SG  1 
ATOM   7280 N N   . PRO B 1 409 ? -36.802 -22.369 -36.450 1.00 32.33  ? 410  PRO B N   1 
ATOM   7281 C CA  . PRO B 1 409 ? -35.459 -22.088 -35.922 1.00 32.74  ? 410  PRO B CA  1 
ATOM   7282 C C   . PRO B 1 409 ? -34.975 -23.164 -34.965 1.00 30.30  ? 410  PRO B C   1 
ATOM   7283 O O   . PRO B 1 409 ? -33.802 -23.555 -35.018 1.00 29.41  ? 410  PRO B O   1 
ATOM   7284 C CB  . PRO B 1 409 ? -35.635 -20.727 -35.242 1.00 28.55  ? 410  PRO B CB  1 
ATOM   7285 C CG  . PRO B 1 409 ? -36.721 -20.074 -36.022 1.00 23.97  ? 410  PRO B CG  1 
ATOM   7286 C CD  . PRO B 1 409 ? -37.673 -21.183 -36.380 1.00 31.86  ? 410  PRO B CD  1 
ATOM   7287 N N   . VAL B 1 410 ? -35.863 -23.681 -34.111 1.00 23.38  ? 411  VAL B N   1 
ATOM   7288 C CA  . VAL B 1 410 ? -35.482 -24.745 -33.189 1.00 26.05  ? 411  VAL B CA  1 
ATOM   7289 C C   . VAL B 1 410 ? -35.202 -26.038 -33.950 1.00 34.52  ? 411  VAL B C   1 
ATOM   7290 O O   . VAL B 1 410 ? -34.238 -26.754 -33.652 1.00 36.38  ? 411  VAL B O   1 
ATOM   7291 C CB  . VAL B 1 410 ? -36.576 -24.929 -32.120 1.00 27.63  ? 411  VAL B CB  1 
ATOM   7292 C CG1 . VAL B 1 410 ? -36.456 -26.281 -31.448 1.00 20.75  ? 411  VAL B CG1 1 
ATOM   7293 C CG2 . VAL B 1 410 ? -36.513 -23.805 -31.085 1.00 22.18  ? 411  VAL B CG2 1 
ATOM   7294 N N   . ALA B 1 411 ? -36.029 -26.349 -34.954 1.00 33.17  ? 412  ALA B N   1 
ATOM   7295 C CA  . ALA B 1 411 ? -35.825 -27.561 -35.743 1.00 33.95  ? 412  ALA B CA  1 
ATOM   7296 C C   . ALA B 1 411 ? -34.522 -27.497 -36.533 1.00 32.13  ? 412  ALA B C   1 
ATOM   7297 O O   . ALA B 1 411 ? -33.809 -28.502 -36.650 1.00 34.99  ? 412  ALA B O   1 
ATOM   7298 C CB  . ALA B 1 411 ? -37.011 -27.784 -36.683 1.00 32.86  ? 412  ALA B CB  1 
ATOM   7299 N N   A GLN B 1 412 ? -34.197 -26.329 -37.085 0.54 27.60  ? 413  GLN B N   1 
ATOM   7300 N N   B GLN B 1 412 ? -34.191 -26.324 -37.080 0.46 27.86  ? 413  GLN B N   1 
ATOM   7301 C CA  A GLN B 1 412 ? -32.930 -26.186 -37.792 0.54 29.81  ? 413  GLN B CA  1 
ATOM   7302 C CA  B GLN B 1 412 ? -32.929 -26.180 -37.799 0.46 30.03  ? 413  GLN B CA  1 
ATOM   7303 C C   A GLN B 1 412 ? -31.754 -26.378 -36.847 0.54 33.66  ? 413  GLN B C   1 
ATOM   7304 C C   B GLN B 1 412 ? -31.741 -26.348 -36.862 0.46 33.58  ? 413  GLN B C   1 
ATOM   7305 O O   A GLN B 1 412 ? -30.789 -27.076 -37.178 0.54 36.22  ? 413  GLN B O   1 
ATOM   7306 O O   B GLN B 1 412 ? -30.754 -27.003 -37.214 0.46 36.27  ? 413  GLN B O   1 
ATOM   7307 C CB  A GLN B 1 412 ? -32.856 -24.820 -38.468 0.54 32.42  ? 413  GLN B CB  1 
ATOM   7308 C CB  B GLN B 1 412 ? -32.875 -24.823 -38.504 0.46 32.56  ? 413  GLN B CB  1 
ATOM   7309 C CG  A GLN B 1 412 ? -31.660 -24.660 -39.384 0.54 38.20  ? 413  GLN B CG  1 
ATOM   7310 C CG  B GLN B 1 412 ? -31.559 -24.540 -39.234 0.46 37.65  ? 413  GLN B CG  1 
ATOM   7311 C CD  A GLN B 1 412 ? -31.548 -23.258 -39.923 0.54 45.82  ? 413  GLN B CD  1 
ATOM   7312 C CD  B GLN B 1 412 ? -31.390 -25.357 -40.510 0.46 39.73  ? 413  GLN B CD  1 
ATOM   7313 O OE1 A GLN B 1 412 ? -31.547 -22.294 -39.162 0.54 65.34  ? 413  GLN B OE1 1 
ATOM   7314 O OE1 B GLN B 1 412 ? -32.351 -25.920 -41.039 0.46 39.85  ? 413  GLN B OE1 1 
ATOM   7315 N NE2 A GLN B 1 412 ? -31.465 -23.131 -41.243 0.54 51.89  ? 413  GLN B NE2 1 
ATOM   7316 N NE2 B GLN B 1 412 ? -30.162 -25.415 -41.015 0.46 35.62  ? 413  GLN B NE2 1 
ATOM   7317 N N   . LEU B 1 413 ? -31.821 -25.769 -35.662 1.00 32.21  ? 414  LEU B N   1 
ATOM   7318 C CA  . LEU B 1 413 ? -30.759 -25.946 -34.681 1.00 28.82  ? 414  LEU B CA  1 
ATOM   7319 C C   . LEU B 1 413 ? -30.617 -27.414 -34.287 1.00 32.38  ? 414  LEU B C   1 
ATOM   7320 O O   . LEU B 1 413 ? -29.509 -27.962 -34.277 1.00 30.91  ? 414  LEU B O   1 
ATOM   7321 C CB  . LEU B 1 413 ? -31.041 -25.076 -33.452 1.00 30.06  ? 414  LEU B CB  1 
ATOM   7322 C CG  . LEU B 1 413 ? -30.140 -25.279 -32.235 1.00 36.21  ? 414  LEU B CG  1 
ATOM   7323 C CD1 . LEU B 1 413 ? -28.881 -24.458 -32.376 1.00 42.28  ? 414  LEU B CD1 1 
ATOM   7324 C CD2 . LEU B 1 413 ? -30.866 -24.910 -30.969 1.00 38.19  ? 414  LEU B CD2 1 
ATOM   7325 N N   . ALA B 1 414 ? -31.738 -28.073 -33.981 1.00 24.46  ? 415  ALA B N   1 
ATOM   7326 C CA  . ALA B 1 414 ? -31.689 -29.468 -33.550 1.00 22.23  ? 415  ALA B CA  1 
ATOM   7327 C C   . ALA B 1 414 ? -31.093 -30.372 -34.627 1.00 34.13  ? 415  ALA B C   1 
ATOM   7328 O O   . ALA B 1 414 ? -30.284 -31.260 -34.328 1.00 40.08  ? 415  ALA B O   1 
ATOM   7329 C CB  . ALA B 1 414 ? -33.093 -29.941 -33.171 1.00 25.29  ? 415  ALA B CB  1 
ATOM   7330 N N   . GLY B 1 415 ? -31.475 -30.157 -35.888 1.00 31.64  ? 416  GLY B N   1 
ATOM   7331 C CA  . GLY B 1 415 ? -30.968 -31.001 -36.958 1.00 26.11  ? 416  GLY B CA  1 
ATOM   7332 C C   . GLY B 1 415 ? -29.487 -30.802 -37.209 1.00 35.23  ? 416  GLY B C   1 
ATOM   7333 O O   . GLY B 1 415 ? -28.750 -31.768 -37.444 1.00 36.27  ? 416  GLY B O   1 
ATOM   7334 N N   . ARG B 1 416 ? -29.026 -29.550 -37.159 1.00 34.19  ? 417  ARG B N   1 
ATOM   7335 C CA  . ARG B 1 416 ? -27.610 -29.280 -37.383 1.00 30.56  ? 417  ARG B CA  1 
ATOM   7336 C C   . ARG B 1 416 ? -26.757 -29.814 -36.242 1.00 36.69  ? 417  ARG B C   1 
ATOM   7337 O O   . ARG B 1 416 ? -25.673 -30.362 -36.477 1.00 41.90  ? 417  ARG B O   1 
ATOM   7338 C CB  . ARG B 1 416 ? -27.383 -27.781 -37.554 1.00 33.76  ? 417  ARG B CB  1 
ATOM   7339 C CG  . ARG B 1 416 ? -28.030 -27.194 -38.793 1.00 45.57  ? 417  ARG B CG  1 
ATOM   7340 C CD  . ARG B 1 416 ? -27.699 -28.009 -40.024 1.00 52.41  ? 417  ARG B CD  1 
ATOM   7341 N NE  . ARG B 1 416 ? -26.617 -27.390 -40.778 1.00 65.26  ? 417  ARG B NE  1 
ATOM   7342 C CZ  . ARG B 1 416 ? -25.628 -28.065 -41.348 1.00 72.49  ? 417  ARG B CZ  1 
ATOM   7343 N NH1 . ARG B 1 416 ? -25.580 -29.389 -41.245 1.00 76.99  ? 417  ARG B NH1 1 
ATOM   7344 N NH2 . ARG B 1 416 ? -24.682 -27.416 -42.013 1.00 68.84  ? 417  ARG B NH2 1 
ATOM   7345 N N   . LEU B 1 417 ? -27.192 -29.631 -35.018 1.00 29.39  ? 418  LEU B N   1 
ATOM   7346 C CA  . LEU B 1 417 ? -26.432 -30.143 -33.909 1.00 35.15  ? 418  LEU B CA  1 
ATOM   7347 C C   . LEU B 1 417 ? -26.359 -31.664 -33.901 1.00 35.68  ? 418  LEU B C   1 
ATOM   7348 O O   . LEU B 1 417 ? -25.338 -32.193 -33.685 1.00 45.96  ? 418  LEU B O   1 
ATOM   7349 C CB  . LEU B 1 417 ? -26.927 -29.599 -32.591 1.00 29.96  ? 418  LEU B CB  1 
ATOM   7350 C CG  . LEU B 1 417 ? -26.908 -28.108 -32.356 1.00 39.02  ? 418  LEU B CG  1 
ATOM   7351 C CD1 . LEU B 1 417 ? -27.644 -27.762 -31.108 1.00 31.83  ? 418  LEU B CD1 1 
ATOM   7352 C CD2 . LEU B 1 417 ? -25.530 -27.567 -32.298 1.00 42.87  ? 418  LEU B CD2 1 
ATOM   7353 N N   . ALA B 1 418 ? -27.436 -32.364 -34.177 1.00 31.71  ? 419  ALA B N   1 
ATOM   7354 C CA  . ALA B 1 418 ? -27.404 -33.824 -34.234 1.00 37.54  ? 419  ALA B CA  1 
ATOM   7355 C C   . ALA B 1 418 ? -26.473 -34.309 -35.340 1.00 40.57  ? 419  ALA B C   1 
ATOM   7356 O O   . ALA B 1 418 ? -25.628 -35.183 -35.119 1.00 48.43  ? 419  ALA B O   1 
ATOM   7357 C CB  . ALA B 1 418 ? -28.817 -34.377 -34.438 1.00 31.64  ? 419  ALA B CB  1 
ATOM   7358 N N   . ALA B 1 419 ? -26.601 -33.733 -36.535 1.00 35.98  ? 420  ALA B N   1 
ATOM   7359 C CA  . ALA B 1 419 ? -25.759 -34.139 -37.654 1.00 46.08  ? 420  ALA B CA  1 
ATOM   7360 C C   . ALA B 1 419 ? -24.289 -33.821 -37.429 1.00 51.26  ? 420  ALA B C   1 
ATOM   7361 O O   . ALA B 1 419 ? -23.442 -34.338 -38.167 1.00 59.84  ? 420  ALA B O   1 
ATOM   7362 C CB  . ALA B 1 419 ? -26.233 -33.473 -38.952 1.00 32.94  ? 420  ALA B CB  1 
ATOM   7363 N N   . GLN B 1 420 ? -23.958 -32.999 -36.433 1.00 44.24  ? 421  GLN B N   1 
ATOM   7364 C CA  . GLN B 1 420 ? -22.581 -32.576 -36.216 1.00 39.61  ? 421  GLN B CA  1 
ATOM   7365 C C   . GLN B 1 420 ? -22.074 -32.958 -34.830 1.00 42.99  ? 421  GLN B C   1 
ATOM   7366 O O   . GLN B 1 420 ? -21.163 -32.322 -34.293 1.00 48.48  ? 421  GLN B O   1 
ATOM   7367 C CB  . GLN B 1 420 ? -22.439 -31.079 -36.471 1.00 41.69  ? 421  GLN B CB  1 
ATOM   7368 C CG  . GLN B 1 420 ? -22.731 -30.732 -37.928 1.00 53.85  ? 421  GLN B CG  1 
ATOM   7369 C CD  . GLN B 1 420 ? -23.037 -29.269 -38.148 1.00 59.05  ? 421  GLN B CD  1 
ATOM   7370 O OE1 . GLN B 1 420 ? -23.835 -28.920 -39.016 1.00 62.22  ? 421  GLN B OE1 1 
ATOM   7371 N NE2 . GLN B 1 420 ? -22.396 -28.402 -37.372 1.00 59.10  ? 421  GLN B NE2 1 
ATOM   7372 N N   . GLY B 1 421 ? -22.651 -34.008 -34.246 1.00 38.63  ? 422  GLY B N   1 
ATOM   7373 C CA  . GLY B 1 421 ? -22.038 -34.709 -33.137 1.00 40.80  ? 422  GLY B CA  1 
ATOM   7374 C C   . GLY B 1 421 ? -22.794 -34.633 -31.836 1.00 40.17  ? 422  GLY B C   1 
ATOM   7375 O O   . GLY B 1 421 ? -22.472 -35.389 -30.911 1.00 41.21  ? 422  GLY B O   1 
ATOM   7376 N N   . ALA B 1 422 ? -23.777 -33.750 -31.723 1.00 34.72  ? 423  ALA B N   1 
ATOM   7377 C CA  . ALA B 1 422 ? -24.490 -33.593 -30.467 1.00 33.88  ? 423  ALA B CA  1 
ATOM   7378 C C   . ALA B 1 422 ? -25.555 -34.670 -30.318 1.00 36.76  ? 423  ALA B C   1 
ATOM   7379 O O   . ALA B 1 422 ? -26.108 -35.171 -31.302 1.00 44.47  ? 423  ALA B O   1 
ATOM   7380 C CB  . ALA B 1 422 ? -25.132 -32.206 -30.384 1.00 32.97  ? 423  ALA B CB  1 
ATOM   7381 N N   . ARG B 1 423 ? -25.838 -35.028 -29.070 1.00 35.65  ? 424  ARG B N   1 
ATOM   7382 C CA  . ARG B 1 423 ? -26.986 -35.863 -28.741 1.00 37.77  ? 424  ARG B CA  1 
ATOM   7383 C C   . ARG B 1 423 ? -28.130 -34.934 -28.340 1.00 35.74  ? 424  ARG B C   1 
ATOM   7384 O O   . ARG B 1 423 ? -28.041 -34.228 -27.329 1.00 37.77  ? 424  ARG B O   1 
ATOM   7385 C CB  . ARG B 1 423 ? -26.653 -36.860 -27.629 1.00 35.70  ? 424  ARG B CB  1 
ATOM   7386 C CG  . ARG B 1 423 ? -27.663 -38.002 -27.536 1.00 45.01  ? 424  ARG B CG  1 
ATOM   7387 C CD  . ARG B 1 423 ? -27.146 -39.167 -26.711 1.00 55.96  ? 424  ARG B CD  1 
ATOM   7388 N NE  . ARG B 1 423 ? -27.255 -38.918 -25.274 1.00 59.57  ? 424  ARG B NE  1 
ATOM   7389 C CZ  . ARG B 1 423 ? -26.241 -39.013 -24.419 1.00 54.86  ? 424  ARG B CZ  1 
ATOM   7390 N NH1 . ARG B 1 423 ? -25.036 -39.360 -24.851 1.00 52.17  ? 424  ARG B NH1 1 
ATOM   7391 N NH2 . ARG B 1 423 ? -26.432 -38.771 -23.132 1.00 59.41  ? 424  ARG B NH2 1 
ATOM   7392 N N   . VAL B 1 424 ? -29.198 -34.940 -29.135 1.00 30.75  ? 425  VAL B N   1 
ATOM   7393 C CA  . VAL B 1 424 ? -30.320 -34.021 -28.993 1.00 31.75  ? 425  VAL B CA  1 
ATOM   7394 C C   . VAL B 1 424 ? -31.548 -34.823 -28.594 1.00 30.69  ? 425  VAL B C   1 
ATOM   7395 O O   . VAL B 1 424 ? -31.807 -35.892 -29.158 1.00 30.10  ? 425  VAL B O   1 
ATOM   7396 C CB  . VAL B 1 424 ? -30.590 -33.257 -30.310 1.00 31.45  ? 425  VAL B CB  1 
ATOM   7397 C CG1 . VAL B 1 424 ? -31.703 -32.230 -30.134 1.00 30.04  ? 425  VAL B CG1 1 
ATOM   7398 C CG2 . VAL B 1 424 ? -29.314 -32.632 -30.878 1.00 23.47  ? 425  VAL B CG2 1 
ATOM   7399 N N   . TYR B 1 425 ? -32.318 -34.299 -27.642 1.00 26.19  ? 426  TYR B N   1 
ATOM   7400 C CA  . TYR B 1 425 ? -33.650 -34.811 -27.339 1.00 29.88  ? 426  TYR B CA  1 
ATOM   7401 C C   . TYR B 1 425 ? -34.661 -33.706 -27.617 1.00 35.23  ? 426  TYR B C   1 
ATOM   7402 O O   . TYR B 1 425 ? -34.451 -32.557 -27.215 1.00 36.24  ? 426  TYR B O   1 
ATOM   7403 C CB  . TYR B 1 425 ? -33.746 -35.303 -25.884 1.00 24.08  ? 426  TYR B CB  1 
ATOM   7404 C CG  . TYR B 1 425 ? -32.750 -36.398 -25.570 1.00 27.84  ? 426  TYR B CG  1 
ATOM   7405 C CD1 . TYR B 1 425 ? -31.433 -36.095 -25.230 1.00 30.77  ? 426  TYR B CD1 1 
ATOM   7406 C CD2 . TYR B 1 425 ? -33.116 -37.738 -25.637 1.00 24.26  ? 426  TYR B CD2 1 
ATOM   7407 C CE1 . TYR B 1 425 ? -30.509 -37.104 -24.950 1.00 28.34  ? 426  TYR B CE1 1 
ATOM   7408 C CE2 . TYR B 1 425 ? -32.200 -38.751 -25.364 1.00 29.31  ? 426  TYR B CE2 1 
ATOM   7409 C CZ  . TYR B 1 425 ? -30.903 -38.429 -25.022 1.00 30.04  ? 426  TYR B CZ  1 
ATOM   7410 O OH  . TYR B 1 425 ? -30.004 -39.443 -24.757 1.00 31.13  ? 426  TYR B OH  1 
ATOM   7411 N N   . ALA B 1 426 ? -35.743 -34.048 -28.317 1.00 30.43  ? 427  ALA B N   1 
ATOM   7412 C CA  . ALA B 1 426 ? -36.756 -33.076 -28.712 1.00 27.62  ? 427  ALA B CA  1 
ATOM   7413 C C   . ALA B 1 426 ? -38.120 -33.431 -28.130 1.00 32.72  ? 427  ALA B C   1 
ATOM   7414 O O   . ALA B 1 426 ? -38.475 -34.613 -28.027 1.00 23.70  ? 427  ALA B O   1 
ATOM   7415 C CB  . ALA B 1 426 ? -36.857 -32.974 -30.240 1.00 27.46  ? 427  ALA B CB  1 
ATOM   7416 N N   . TYR B 1 427 ? -38.890 -32.400 -27.771 1.00 20.96  ? 428  TYR B N   1 
ATOM   7417 C CA  . TYR B 1 427 ? -40.248 -32.570 -27.265 1.00 24.42  ? 428  TYR B CA  1 
ATOM   7418 C C   . TYR B 1 427 ? -41.182 -31.548 -27.913 1.00 28.06  ? 428  TYR B C   1 
ATOM   7419 O O   . TYR B 1 427 ? -40.759 -30.485 -28.367 1.00 26.51  ? 428  TYR B O   1 
ATOM   7420 C CB  . TYR B 1 427 ? -40.306 -32.417 -25.723 1.00 20.08  ? 428  TYR B CB  1 
ATOM   7421 C CG  . TYR B 1 427 ? -39.967 -31.012 -25.245 1.00 24.97  ? 428  TYR B CG  1 
ATOM   7422 C CD1 . TYR B 1 427 ? -40.934 -30.017 -25.215 1.00 26.58  ? 428  TYR B CD1 1 
ATOM   7423 C CD2 . TYR B 1 427 ? -38.675 -30.679 -24.837 1.00 26.20  ? 428  TYR B CD2 1 
ATOM   7424 C CE1 . TYR B 1 427 ? -40.638 -28.729 -24.801 1.00 23.01  ? 428  TYR B CE1 1 
ATOM   7425 C CE2 . TYR B 1 427 ? -38.366 -29.381 -24.412 1.00 24.32  ? 428  TYR B CE2 1 
ATOM   7426 C CZ  . TYR B 1 427 ? -39.357 -28.414 -24.405 1.00 28.20  ? 428  TYR B CZ  1 
ATOM   7427 O OH  . TYR B 1 427 ? -39.087 -27.126 -24.006 1.00 33.90  ? 428  TYR B OH  1 
ATOM   7428 N N   . VAL B 1 428 ? -42.473 -31.863 -27.925 1.00 27.22  ? 429  VAL B N   1 
ATOM   7429 C CA  . VAL B 1 428 ? -43.515 -30.853 -28.066 1.00 26.42  ? 429  VAL B CA  1 
ATOM   7430 C C   . VAL B 1 428 ? -44.415 -30.962 -26.845 1.00 30.53  ? 429  VAL B C   1 
ATOM   7431 O O   . VAL B 1 428 ? -44.843 -32.064 -26.477 1.00 29.33  ? 429  VAL B O   1 
ATOM   7432 C CB  . VAL B 1 428 ? -44.326 -31.013 -29.367 1.00 29.98  ? 429  VAL B CB  1 
ATOM   7433 C CG1 . VAL B 1 428 ? -45.423 -29.963 -29.443 1.00 29.14  ? 429  VAL B CG1 1 
ATOM   7434 C CG2 . VAL B 1 428 ? -43.406 -30.950 -30.576 1.00 32.52  ? 429  VAL B CG2 1 
ATOM   7435 N N   . PHE B 1 429 ? -44.676 -29.829 -26.206 1.00 30.16  ? 430  PHE B N   1 
ATOM   7436 C CA  . PHE B 1 429 ? -45.463 -29.794 -24.983 1.00 29.33  ? 430  PHE B CA  1 
ATOM   7437 C C   . PHE B 1 429 ? -46.920 -29.562 -25.359 1.00 28.97  ? 430  PHE B C   1 
ATOM   7438 O O   . PHE B 1 429 ? -47.261 -28.511 -25.912 1.00 29.70  ? 430  PHE B O   1 
ATOM   7439 C CB  . PHE B 1 429 ? -44.943 -28.701 -24.053 1.00 25.97  ? 430  PHE B CB  1 
ATOM   7440 C CG  . PHE B 1 429 ? -45.680 -28.604 -22.754 1.00 30.92  ? 430  PHE B CG  1 
ATOM   7441 C CD1 . PHE B 1 429 ? -45.297 -29.375 -21.665 1.00 34.06  ? 430  PHE B CD1 1 
ATOM   7442 C CD2 . PHE B 1 429 ? -46.748 -27.731 -22.612 1.00 35.42  ? 430  PHE B CD2 1 
ATOM   7443 C CE1 . PHE B 1 429 ? -45.973 -29.283 -20.459 1.00 32.03  ? 430  PHE B CE1 1 
ATOM   7444 C CE2 . PHE B 1 429 ? -47.428 -27.631 -21.408 1.00 34.85  ? 430  PHE B CE2 1 
ATOM   7445 C CZ  . PHE B 1 429 ? -47.039 -28.410 -20.331 1.00 35.55  ? 430  PHE B CZ  1 
ATOM   7446 N N   . GLU B 1 430 ? -47.736 -30.554 -25.122 1.00 32.08  ? 431  GLU B N   1 
ATOM   7447 C CA  . GLU B 1 430 ? -49.124 -30.556 -25.537 1.00 38.82  ? 431  GLU B CA  1 
ATOM   7448 C C   . GLU B 1 430 ? -50.219 -30.520 -24.518 1.00 34.11  ? 431  GLU B C   1 
ATOM   7449 O O   . GLU B 1 430 ? -51.306 -30.841 -24.824 1.00 36.30  ? 431  GLU B O   1 
ATOM   7450 C CB  . GLU B 1 430 ? -49.359 -31.760 -26.410 1.00 34.07  ? 431  GLU B CB  1 
ATOM   7451 C CG  . GLU B 1 430 ? -48.488 -31.804 -27.628 1.00 45.94  ? 431  GLU B CG  1 
ATOM   7452 C CD  . GLU B 1 430 ? -48.796 -32.957 -28.546 1.00 55.78  ? 431  GLU B CD  1 
ATOM   7453 O OE1 . GLU B 1 430 ? -49.723 -33.718 -28.322 1.00 57.79  ? 431  GLU B OE1 1 
ATOM   7454 O OE2 . GLU B 1 430 ? -48.092 -33.112 -29.515 1.00 59.23  ? 431  GLU B OE2 1 
ATOM   7455 N N   . HIS B 1 431 ? -49.915 -30.190 -23.300 1.00 33.22  ? 432  HIS B N   1 
ATOM   7456 C CA  . HIS B 1 431 ? -50.919 -30.165 -22.244 1.00 38.09  ? 432  HIS B CA  1 
ATOM   7457 C C   . HIS B 1 431 ? -51.378 -28.734 -22.004 1.00 37.12  ? 432  HIS B C   1 
ATOM   7458 O O   . HIS B 1 431 ? -50.561 -27.852 -21.725 1.00 37.51  ? 432  HIS B O   1 
ATOM   7459 C CB  . HIS B 1 431 ? -50.393 -30.761 -20.942 1.00 34.16  ? 432  HIS B CB  1 
ATOM   7460 C CG  . HIS B 1 431 ? -51.337 -30.586 -19.796 1.00 42.08  ? 432  HIS B CG  1 
ATOM   7461 N ND1 . HIS B 1 431 ? -52.560 -31.219 -19.742 1.00 45.34  ? 432  HIS B ND1 1 
ATOM   7462 C CD2 . HIS B 1 431 ? -51.256 -29.825 -18.680 1.00 37.97  ? 432  HIS B CD2 1 
ATOM   7463 C CE1 . HIS B 1 431 ? -53.183 -30.871 -18.631 1.00 38.42  ? 432  HIS B CE1 1 
ATOM   7464 N NE2 . HIS B 1 431 ? -52.415 -30.023 -17.971 1.00 43.31  ? 432  HIS B NE2 1 
ATOM   7465 N N   . ARG B 1 432 ? -52.675 -28.512 -22.024 1.00 39.16  ? 433  ARG B N   1 
ATOM   7466 C CA  . ARG B 1 432 ? -53.226 -27.209 -21.740 1.00 41.68  ? 433  ARG B CA  1 
ATOM   7467 C C   . ARG B 1 432 ? -53.547 -27.248 -20.277 1.00 40.53  ? 433  ARG B C   1 
ATOM   7468 O O   . ARG B 1 432 ? -54.252 -28.106 -19.843 1.00 44.62  ? 433  ARG B O   1 
ATOM   7469 C CB  . ARG B 1 432 ? -54.491 -26.946 -22.537 1.00 44.92  ? 433  ARG B CB  1 
ATOM   7470 C CG  . ARG B 1 432 ? -55.047 -25.563 -22.330 1.00 50.83  ? 433  ARG B CG  1 
ATOM   7471 C CD  . ARG B 1 432 ? -56.428 -25.304 -22.874 1.00 56.13  ? 433  ARG B CD  1 
ATOM   7472 N NE  . ARG B 1 432 ? -56.321 -24.135 -23.707 1.00 59.28  ? 433  ARG B NE  1 
ATOM   7473 C CZ  . ARG B 1 432 ? -56.790 -22.933 -23.455 1.00 55.71  ? 433  ARG B CZ  1 
ATOM   7474 N NH1 . ARG B 1 432 ? -56.539 -21.983 -24.317 1.00 44.44  ? 433  ARG B NH1 1 
ATOM   7475 N NH2 . ARG B 1 432 ? -57.516 -22.688 -22.402 1.00 50.35  ? 433  ARG B NH2 1 
ATOM   7476 N N   . ALA B 1 433 ? -53.007 -26.320 -19.522 1.00 39.83  ? 434  ALA B N   1 
ATOM   7477 C CA  . ALA B 1 433 ? -53.217 -26.289 -18.082 1.00 45.02  ? 434  ALA B CA  1 
ATOM   7478 C C   . ALA B 1 433 ? -54.685 -26.049 -17.757 1.00 47.94  ? 434  ALA B C   1 
ATOM   7479 O O   . ALA B 1 433 ? -55.343 -25.197 -18.360 1.00 50.59  ? 434  ALA B O   1 
ATOM   7480 C CB  . ALA B 1 433 ? -52.355 -25.201 -17.442 1.00 45.03  ? 434  ALA B CB  1 
ATOM   7481 N N   . SER B 1 434 ? -55.198 -26.817 -16.796 1.00 45.56  ? 435  SER B N   1 
ATOM   7482 C CA  . SER B 1 434 ? -56.565 -26.622 -16.331 1.00 48.05  ? 435  SER B CA  1 
ATOM   7483 C C   . SER B 1 434 ? -56.794 -25.227 -15.760 1.00 53.74  ? 435  SER B C   1 
ATOM   7484 O O   . SER B 1 434 ? -57.945 -24.781 -15.686 1.00 54.99  ? 435  SER B O   1 
ATOM   7485 C CB  . SER B 1 434 ? -56.900 -27.679 -15.283 1.00 51.84  ? 435  SER B CB  1 
ATOM   7486 O OG  . SER B 1 434 ? -56.292 -27.353 -14.046 1.00 55.08  ? 435  SER B OG  1 
ATOM   7487 N N   . THR B 1 435 ? -55.730 -24.532 -15.356 1.00 52.12  ? 436  THR B N   1 
ATOM   7488 C CA  . THR B 1 435 ? -55.818 -23.192 -14.789 1.00 51.92  ? 436  THR B CA  1 
ATOM   7489 C C   . THR B 1 435 ? -55.612 -22.093 -15.829 1.00 50.26  ? 436  THR B C   1 
ATOM   7490 O O   . THR B 1 435 ? -55.572 -20.913 -15.469 1.00 49.70  ? 436  THR B O   1 
ATOM   7491 C CB  . THR B 1 435 ? -54.792 -23.032 -13.665 1.00 49.14  ? 436  THR B CB  1 
ATOM   7492 O OG1 . THR B 1 435 ? -53.469 -23.117 -14.216 1.00 44.42  ? 436  THR B OG1 1 
ATOM   7493 C CG2 . THR B 1 435 ? -54.970 -24.126 -12.608 1.00 45.61  ? 436  THR B CG2 1 
ATOM   7494 N N   . LEU B 1 436 ? -55.490 -22.452 -17.105 1.00 46.13  ? 437  LEU B N   1 
ATOM   7495 C CA  . LEU B 1 436 ? -55.124 -21.490 -18.138 1.00 44.92  ? 437  LEU B CA  1 
ATOM   7496 C C   . LEU B 1 436 ? -56.187 -20.409 -18.302 1.00 49.53  ? 437  LEU B C   1 
ATOM   7497 O O   . LEU B 1 436 ? -57.377 -20.707 -18.454 1.00 52.01  ? 437  LEU B O   1 
ATOM   7498 C CB  . LEU B 1 436 ? -54.916 -22.218 -19.461 1.00 52.05  ? 437  LEU B CB  1 
ATOM   7499 C CG  . LEU B 1 436 ? -53.840 -21.629 -20.361 1.00 56.13  ? 437  LEU B CG  1 
ATOM   7500 C CD1 . LEU B 1 436 ? -52.550 -21.483 -19.584 1.00 59.25  ? 437  LEU B CD1 1 
ATOM   7501 C CD2 . LEU B 1 436 ? -53.631 -22.506 -21.581 1.00 54.07  ? 437  LEU B CD2 1 
ATOM   7502 N N   . SER B 1 437 ? -55.750 -19.148 -18.299 1.00 49.68  ? 438  SER B N   1 
ATOM   7503 C CA  . SER B 1 437 ? -56.671 -18.018 -18.385 1.00 58.42  ? 438  SER B CA  1 
ATOM   7504 C C   . SER B 1 437 ? -56.892 -17.525 -19.812 1.00 53.87  ? 438  SER B C   1 
ATOM   7505 O O   . SER B 1 437 ? -57.812 -16.734 -20.037 1.00 56.12  ? 438  SER B O   1 
ATOM   7506 C CB  . SER B 1 437 ? -56.169 -16.856 -17.517 1.00 63.11  ? 438  SER B CB  1 
ATOM   7507 O OG  . SER B 1 437 ? -54.818 -16.542 -17.811 1.00 67.49  ? 438  SER B OG  1 
ATOM   7508 N N   . TRP B 1 438 ? -56.091 -17.974 -20.749 1.00 51.95  ? 439  TRP B N   1 
ATOM   7509 C CA  . TRP B 1 438 ? -56.276 -17.636 -22.132 1.00 52.44  ? 439  TRP B CA  1 
ATOM   7510 C C   . TRP B 1 438 ? -57.357 -18.525 -22.705 1.00 54.63  ? 439  TRP B C   1 
ATOM   7511 O O   . TRP B 1 438 ? -57.558 -19.626 -22.271 1.00 53.41  ? 439  TRP B O   1 
ATOM   7512 C CB  . TRP B 1 438 ? -54.992 -17.788 -22.912 1.00 46.03  ? 439  TRP B CB  1 
ATOM   7513 C CG  . TRP B 1 438 ? -53.908 -16.902 -22.492 1.00 47.12  ? 439  TRP B CG  1 
ATOM   7514 C CD1 . TRP B 1 438 ? -52.888 -17.223 -21.699 1.00 45.48  ? 439  TRP B CD1 1 
ATOM   7515 C CD2 . TRP B 1 438 ? -53.703 -15.559 -22.874 1.00 46.67  ? 439  TRP B CD2 1 
ATOM   7516 N NE1 . TRP B 1 438 ? -52.069 -16.172 -21.537 1.00 42.09  ? 439  TRP B NE1 1 
ATOM   7517 C CE2 . TRP B 1 438 ? -52.549 -15.128 -22.252 1.00 50.36  ? 439  TRP B CE2 1 
ATOM   7518 C CE3 . TRP B 1 438 ? -54.388 -14.675 -23.669 1.00 43.71  ? 439  TRP B CE3 1 
ATOM   7519 C CZ2 . TRP B 1 438 ? -52.060 -13.866 -22.410 1.00 52.55  ? 439  TRP B CZ2 1 
ATOM   7520 C CZ3 . TRP B 1 438 ? -53.902 -13.436 -23.829 1.00 51.82  ? 439  TRP B CZ3 1 
ATOM   7521 C CH2 . TRP B 1 438 ? -52.757 -13.030 -23.202 1.00 55.52  ? 439  TRP B CH2 1 
ATOM   7522 N N   . PRO B 1 439 ? -58.014 -18.052 -23.744 1.00 55.30  ? 440  PRO B N   1 
ATOM   7523 C CA  . PRO B 1 439 ? -59.104 -18.763 -24.377 1.00 51.90  ? 440  PRO B CA  1 
ATOM   7524 C C   . PRO B 1 439 ? -58.663 -19.985 -25.074 1.00 55.05  ? 440  PRO B C   1 
ATOM   7525 O O   . PRO B 1 439 ? -57.553 -20.125 -25.484 1.00 52.75  ? 440  PRO B O   1 
ATOM   7526 C CB  . PRO B 1 439 ? -59.615 -17.786 -25.386 1.00 55.00  ? 440  PRO B CB  1 
ATOM   7527 C CG  . PRO B 1 439 ? -58.482 -16.934 -25.669 1.00 57.41  ? 440  PRO B CG  1 
ATOM   7528 C CD  . PRO B 1 439 ? -57.749 -16.779 -24.402 1.00 56.89  ? 440  PRO B CD  1 
ATOM   7529 N N   . LEU B 1 440 ? -59.624 -20.839 -25.285 1.00 58.31  ? 441  LEU B N   1 
ATOM   7530 C CA  . LEU B 1 440 ? -59.439 -22.117 -25.874 1.00 57.39  ? 441  LEU B CA  1 
ATOM   7531 C C   . LEU B 1 440 ? -58.854 -22.135 -27.262 1.00 53.49  ? 441  LEU B C   1 
ATOM   7532 O O   . LEU B 1 440 ? -58.165 -23.048 -27.604 1.00 54.24  ? 441  LEU B O   1 
ATOM   7533 C CB  . LEU B 1 440 ? -60.756 -22.835 -25.873 1.00 64.06  ? 441  LEU B CB  1 
ATOM   7534 C CG  . LEU B 1 440 ? -60.550 -24.325 -25.873 1.00 73.09  ? 441  LEU B CG  1 
ATOM   7535 C CD1 . LEU B 1 440 ? -60.190 -24.752 -24.481 1.00 69.32  ? 441  LEU B CD1 1 
ATOM   7536 C CD2 . LEU B 1 440 ? -61.770 -25.071 -26.355 1.00 82.97  ? 441  LEU B CD2 1 
ATOM   7537 N N   . TRP B 1 441 ? -59.178 -21.176 -28.089 1.00 46.73  ? 442  TRP B N   1 
ATOM   7538 C CA  . TRP B 1 441 ? -58.659 -21.189 -29.455 1.00 45.53  ? 442  TRP B CA  1 
ATOM   7539 C C   . TRP B 1 441 ? -57.145 -21.027 -29.497 1.00 41.82  ? 442  TRP B C   1 
ATOM   7540 O O   . TRP B 1 441 ? -56.525 -21.364 -30.513 1.00 44.75  ? 442  TRP B O   1 
ATOM   7541 C CB  . TRP B 1 441 ? -59.344 -20.114 -30.318 1.00 47.42  ? 442  TRP B CB  1 
ATOM   7542 C CG  . TRP B 1 441 ? -58.972 -18.679 -30.010 1.00 51.72  ? 442  TRP B CG  1 
ATOM   7543 C CD1 . TRP B 1 441 ? -59.705 -17.781 -29.283 1.00 56.40  ? 442  TRP B CD1 1 
ATOM   7544 C CD2 . TRP B 1 441 ? -57.794 -17.975 -30.441 1.00 46.68  ? 442  TRP B CD2 1 
ATOM   7545 N NE1 . TRP B 1 441 ? -59.052 -16.570 -29.223 1.00 52.40  ? 442  TRP B NE1 1 
ATOM   7546 C CE2 . TRP B 1 441 ? -57.878 -16.663 -29.925 1.00 43.75  ? 442  TRP B CE2 1 
ATOM   7547 C CE3 . TRP B 1 441 ? -56.674 -18.329 -31.208 1.00 39.22  ? 442  TRP B CE3 1 
ATOM   7548 C CZ2 . TRP B 1 441 ? -56.885 -15.705 -30.148 1.00 42.56  ? 442  TRP B CZ2 1 
ATOM   7549 C CZ3 . TRP B 1 441 ? -55.685 -17.378 -31.425 1.00 37.20  ? 442  TRP B CZ3 1 
ATOM   7550 C CH2 . TRP B 1 441 ? -55.799 -16.081 -30.897 1.00 47.52  ? 442  TRP B CH2 1 
ATOM   7551 N N   . MET B 1 442 ? -56.535 -20.539 -28.418 1.00 41.04  ? 443  MET B N   1 
ATOM   7552 C CA  . MET B 1 442 ? -55.086 -20.400 -28.358 1.00 39.90  ? 443  MET B CA  1 
ATOM   7553 C C   . MET B 1 442 ? -54.359 -21.717 -28.108 1.00 36.45  ? 443  MET B C   1 
ATOM   7554 O O   . MET B 1 442 ? -53.138 -21.770 -28.289 1.00 36.40  ? 443  MET B O   1 
ATOM   7555 C CB  . MET B 1 442 ? -54.706 -19.394 -27.275 1.00 41.46  ? 443  MET B CB  1 
ATOM   7556 C CG  . MET B 1 442 ? -55.171 -17.981 -27.557 1.00 46.46  ? 443  MET B CG  1 
ATOM   7557 S SD  . MET B 1 442 ? -54.257 -16.768 -26.573 1.00 54.20  ? 443  MET B SD  1 
ATOM   7558 C CE  . MET B 1 442 ? -55.308 -15.347 -26.818 1.00 60.94  ? 443  MET B CE  1 
ATOM   7559 N N   . GLY B 1 443 ? -55.065 -22.769 -27.700 1.00 34.60  ? 444  GLY B N   1 
ATOM   7560 C CA  . GLY B 1 443 ? -54.409 -24.057 -27.495 1.00 38.20  ? 444  GLY B CA  1 
ATOM   7561 C C   . GLY B 1 443 ? -53.427 -24.009 -26.337 1.00 40.32  ? 444  GLY B C   1 
ATOM   7562 O O   . GLY B 1 443 ? -53.742 -23.518 -25.247 1.00 39.27  ? 444  GLY B O   1 
ATOM   7563 N N   . VAL B 1 444 ? -52.227 -24.536 -26.567 1.00 34.99  ? 445  VAL B N   1 
ATOM   7564 C CA  . VAL B 1 444 ? -51.140 -24.493 -25.587 1.00 36.51  ? 445  VAL B CA  1 
ATOM   7565 C C   . VAL B 1 444 ? -50.186 -23.375 -25.991 1.00 33.51  ? 445  VAL B C   1 
ATOM   7566 O O   . VAL B 1 444 ? -49.336 -23.576 -26.870 1.00 34.28  ? 445  VAL B O   1 
ATOM   7567 C CB  . VAL B 1 444 ? -50.410 -25.843 -25.497 1.00 33.17  ? 445  VAL B CB  1 
ATOM   7568 C CG1 . VAL B 1 444 ? -49.336 -25.795 -24.426 1.00 31.66  ? 445  VAL B CG1 1 
ATOM   7569 C CG2 . VAL B 1 444 ? -51.405 -26.975 -25.225 1.00 37.81  ? 445  VAL B CG2 1 
ATOM   7570 N N   . PRO B 1 445 ? -50.287 -22.192 -25.397 1.00 33.18  ? 446  PRO B N   1 
ATOM   7571 C CA  . PRO B 1 445 ? -49.564 -21.034 -25.925 1.00 32.13  ? 446  PRO B CA  1 
ATOM   7572 C C   . PRO B 1 445 ? -48.122 -20.989 -25.442 1.00 34.31  ? 446  PRO B C   1 
ATOM   7573 O O   . PRO B 1 445 ? -47.704 -21.705 -24.529 1.00 29.27  ? 446  PRO B O   1 
ATOM   7574 C CB  . PRO B 1 445 ? -50.362 -19.836 -25.381 1.00 29.35  ? 446  PRO B CB  1 
ATOM   7575 C CG  . PRO B 1 445 ? -51.670 -20.432 -24.920 1.00 35.98  ? 446  PRO B CG  1 
ATOM   7576 C CD  . PRO B 1 445 ? -51.270 -21.775 -24.389 1.00 32.68  ? 446  PRO B CD  1 
ATOM   7577 N N   . HIS B 1 446 ? -47.370 -20.115 -26.043 1.00 34.05  ? 447  HIS B N   1 
ATOM   7578 C CA  . HIS B 1 446 ? -46.005 -19.964 -25.725 1.00 32.71  ? 447  HIS B CA  1 
ATOM   7579 C C   . HIS B 1 446 ? -45.788 -19.570 -24.288 1.00 34.32  ? 447  HIS B C   1 
ATOM   7580 O O   . HIS B 1 446 ? -46.409 -18.688 -23.797 1.00 36.50  ? 447  HIS B O   1 
ATOM   7581 C CB  . HIS B 1 446 ? -45.520 -18.851 -26.601 1.00 31.82  ? 447  HIS B CB  1 
ATOM   7582 C CG  . HIS B 1 446 ? -44.094 -18.507 -26.423 1.00 39.76  ? 447  HIS B CG  1 
ATOM   7583 N ND1 . HIS B 1 446 ? -43.090 -19.195 -27.047 1.00 40.72  ? 447  HIS B ND1 1 
ATOM   7584 C CD2 . HIS B 1 446 ? -43.499 -17.520 -25.733 1.00 37.67  ? 447  HIS B CD2 1 
ATOM   7585 C CE1 . HIS B 1 446 ? -41.938 -18.640 -26.762 1.00 38.85  ? 447  HIS B CE1 1 
ATOM   7586 N NE2 . HIS B 1 446 ? -42.160 -17.633 -25.953 1.00 44.73  ? 447  HIS B NE2 1 
ATOM   7587 N N   . GLY B 1 447 ? -44.874 -20.260 -23.641 1.00 29.63  ? 448  GLY B N   1 
ATOM   7588 C CA  . GLY B 1 447 ? -44.484 -19.961 -22.279 1.00 33.02  ? 448  GLY B CA  1 
ATOM   7589 C C   . GLY B 1 447 ? -45.166 -20.786 -21.207 1.00 39.71  ? 448  GLY B C   1 
ATOM   7590 O O   . GLY B 1 447 ? -44.766 -20.701 -20.038 1.00 40.32  ? 448  GLY B O   1 
ATOM   7591 N N   . TYR B 1 448 ? -46.166 -21.593 -21.558 1.00 35.87  ? 449  TYR B N   1 
ATOM   7592 C CA  . TYR B 1 448 ? -47.001 -22.236 -20.555 1.00 31.31  ? 449  TYR B CA  1 
ATOM   7593 C C   . TYR B 1 448 ? -46.608 -23.682 -20.296 1.00 33.17  ? 449  TYR B C   1 
ATOM   7594 O O   . TYR B 1 448 ? -47.357 -24.415 -19.642 1.00 34.64  ? 449  TYR B O   1 
ATOM   7595 C CB  . TYR B 1 448 ? -48.473 -22.099 -20.940 1.00 32.37  ? 449  TYR B CB  1 
ATOM   7596 C CG  . TYR B 1 448 ? -48.906 -20.692 -20.628 1.00 37.34  ? 449  TYR B CG  1 
ATOM   7597 C CD1 . TYR B 1 448 ? -48.823 -19.689 -21.590 1.00 25.58  ? 449  TYR B CD1 1 
ATOM   7598 C CD2 . TYR B 1 448 ? -49.283 -20.338 -19.337 1.00 27.90  ? 449  TYR B CD2 1 
ATOM   7599 C CE1 . TYR B 1 448 ? -49.165 -18.384 -21.292 1.00 29.06  ? 449  TYR B CE1 1 
ATOM   7600 C CE2 . TYR B 1 448 ? -49.629 -19.033 -19.025 1.00 30.75  ? 449  TYR B CE2 1 
ATOM   7601 C CZ  . TYR B 1 448 ? -49.567 -18.059 -20.005 1.00 33.36  ? 449  TYR B CZ  1 
ATOM   7602 O OH  . TYR B 1 448 ? -49.913 -16.756 -19.708 1.00 36.26  ? 449  TYR B OH  1 
ATOM   7603 N N   . GLU B 1 449 ? -45.428 -24.091 -20.759 1.00 30.05  ? 450  GLU B N   1 
ATOM   7604 C CA  . GLU B 1 449 ? -44.775 -25.280 -20.234 1.00 33.67  ? 450  GLU B CA  1 
ATOM   7605 C C   . GLU B 1 449 ? -43.890 -24.977 -19.020 1.00 33.30  ? 450  GLU B C   1 
ATOM   7606 O O   . GLU B 1 449 ? -43.618 -25.886 -18.226 1.00 35.08  ? 450  GLU B O   1 
ATOM   7607 C CB  . GLU B 1 449 ? -43.950 -25.937 -21.346 1.00 27.23  ? 450  GLU B CB  1 
ATOM   7608 C CG  . GLU B 1 449 ? -42.519 -25.470 -21.389 1.00 30.47  ? 450  GLU B CG  1 
ATOM   7609 C CD  . GLU B 1 449 ? -42.300 -24.119 -22.077 1.00 34.88  ? 450  GLU B CD  1 
ATOM   7610 O OE1 . GLU B 1 449 ? -41.159 -23.874 -22.528 1.00 35.94  ? 450  GLU B OE1 1 
ATOM   7611 O OE2 . GLU B 1 449 ? -43.248 -23.306 -22.167 1.00 35.96  ? 450  GLU B OE2 1 
ATOM   7612 N N   . ILE B 1 450 ? -43.480 -23.714 -18.838 1.00 29.39  ? 451  ILE B N   1 
ATOM   7613 C CA  . ILE B 1 450 ? -42.522 -23.350 -17.787 1.00 30.91  ? 451  ILE B CA  1 
ATOM   7614 C C   . ILE B 1 450 ? -43.046 -23.737 -16.404 1.00 32.09  ? 451  ILE B C   1 
ATOM   7615 O O   . ILE B 1 450 ? -42.312 -24.293 -15.578 1.00 30.66  ? 451  ILE B O   1 
ATOM   7616 C CB  . ILE B 1 450 ? -42.205 -21.843 -17.853 1.00 29.49  ? 451  ILE B CB  1 
ATOM   7617 C CG1 . ILE B 1 450 ? -41.598 -21.462 -19.211 1.00 28.93  ? 451  ILE B CG1 1 
ATOM   7618 C CG2 . ILE B 1 450 ? -41.280 -21.432 -16.706 1.00 26.79  ? 451  ILE B CG2 1 
ATOM   7619 C CD1 . ILE B 1 450 ? -41.280 -19.968 -19.331 1.00 26.49  ? 451  ILE B CD1 1 
ATOM   7620 N N   . GLU B 1 451 ? -44.316 -23.429 -16.123 1.00 33.18  ? 452  GLU B N   1 
ATOM   7621 C CA  . GLU B 1 451 ? -44.855 -23.655 -14.782 1.00 36.20  ? 452  GLU B CA  1 
ATOM   7622 C C   . GLU B 1 451 ? -44.834 -25.133 -14.396 1.00 37.28  ? 452  GLU B C   1 
ATOM   7623 O O   . GLU B 1 451 ? -44.669 -25.461 -13.214 1.00 39.44  ? 452  GLU B O   1 
ATOM   7624 C CB  . GLU B 1 451 ? -46.278 -23.095 -14.685 1.00 34.43  ? 452  GLU B CB  1 
ATOM   7625 C CG  . GLU B 1 451 ? -47.255 -23.683 -15.705 1.00 37.97  ? 452  GLU B CG  1 
ATOM   7626 C CD  . GLU B 1 451 ? -48.501 -22.814 -15.909 1.00 47.68  ? 452  GLU B CD  1 
ATOM   7627 O OE1 . GLU B 1 451 ? -48.363 -21.602 -16.187 1.00 45.35  ? 452  GLU B OE1 1 
ATOM   7628 O OE2 . GLU B 1 451 ? -49.625 -23.346 -15.789 1.00 49.02  ? 452  GLU B OE2 1 
ATOM   7629 N N   . PHE B 1 452 ? -44.989 -26.034 -15.370 1.00 31.12  ? 453  PHE B N   1 
ATOM   7630 C CA  . PHE B 1 452 ? -44.936 -27.463 -15.081 1.00 31.77  ? 453  PHE B CA  1 
ATOM   7631 C C   . PHE B 1 452 ? -43.518 -27.944 -14.820 1.00 35.30  ? 453  PHE B C   1 
ATOM   7632 O O   . PHE B 1 452 ? -43.314 -28.835 -13.990 1.00 34.22  ? 453  PHE B O   1 
ATOM   7633 C CB  . PHE B 1 452 ? -45.566 -28.257 -16.231 1.00 28.87  ? 453  PHE B CB  1 
ATOM   7634 C CG  . PHE B 1 452 ? -47.057 -28.233 -16.197 1.00 37.03  ? 453  PHE B CG  1 
ATOM   7635 C CD1 . PHE B 1 452 ? -47.759 -29.170 -15.454 1.00 40.42  ? 453  PHE B CD1 1 
ATOM   7636 C CD2 . PHE B 1 452 ? -47.760 -27.233 -16.848 1.00 27.08  ? 453  PHE B CD2 1 
ATOM   7637 C CE1 . PHE B 1 452 ? -49.138 -29.128 -15.383 1.00 38.07  ? 453  PHE B CE1 1 
ATOM   7638 C CE2 . PHE B 1 452 ? -49.142 -27.184 -16.779 1.00 30.84  ? 453  PHE B CE2 1 
ATOM   7639 C CZ  . PHE B 1 452 ? -49.832 -28.135 -16.049 1.00 31.28  ? 453  PHE B CZ  1 
ATOM   7640 N N   . ILE B 1 453 ? -42.536 -27.360 -15.502 1.00 30.00  ? 454  ILE B N   1 
ATOM   7641 C CA  . ILE B 1 453 ? -41.156 -27.791 -15.341 1.00 26.80  ? 454  ILE B CA  1 
ATOM   7642 C C   . ILE B 1 453 ? -40.556 -27.272 -14.046 1.00 30.42  ? 454  ILE B C   1 
ATOM   7643 O O   . ILE B 1 453 ? -39.689 -27.930 -13.456 1.00 35.31  ? 454  ILE B O   1 
ATOM   7644 C CB  . ILE B 1 453 ? -40.374 -27.356 -16.582 1.00 37.66  ? 454  ILE B CB  1 
ATOM   7645 C CG1 . ILE B 1 453 ? -40.863 -28.231 -17.718 1.00 38.75  ? 454  ILE B CG1 1 
ATOM   7646 C CG2 . ILE B 1 453 ? -38.864 -27.479 -16.380 1.00 37.89  ? 454  ILE B CG2 1 
ATOM   7647 C CD1 . ILE B 1 453 ? -40.355 -27.856 -18.967 1.00 37.69  ? 454  ILE B CD1 1 
ATOM   7648 N N   . PHE B 1 454 ? -41.021 -26.122 -13.561 1.00 25.79  ? 455  PHE B N   1 
ATOM   7649 C CA  . PHE B 1 454 ? -40.640 -25.648 -12.239 1.00 25.81  ? 455  PHE B CA  1 
ATOM   7650 C C   . PHE B 1 454 ? -41.498 -26.245 -11.131 1.00 32.22  ? 455  PHE B C   1 
ATOM   7651 O O   . PHE B 1 454 ? -41.342 -25.845 -9.976  1.00 26.85  ? 455  PHE B O   1 
ATOM   7652 C CB  . PHE B 1 454 ? -40.702 -24.119 -12.180 1.00 24.66  ? 455  PHE B CB  1 
ATOM   7653 C CG  . PHE B 1 454 ? -39.488 -23.449 -12.748 1.00 31.88  ? 455  PHE B CG  1 
ATOM   7654 C CD1 . PHE B 1 454 ? -39.341 -23.299 -14.125 1.00 23.13  ? 455  PHE B CD1 1 
ATOM   7655 C CD2 . PHE B 1 454 ? -38.482 -22.986 -11.914 1.00 29.57  ? 455  PHE B CD2 1 
ATOM   7656 C CE1 . PHE B 1 454 ? -38.215 -22.686 -14.654 1.00 28.27  ? 455  PHE B CE1 1 
ATOM   7657 C CE2 . PHE B 1 454 ? -37.348 -22.370 -12.438 1.00 29.78  ? 455  PHE B CE2 1 
ATOM   7658 C CZ  . PHE B 1 454 ? -37.218 -22.219 -13.809 1.00 32.29  ? 455  PHE B CZ  1 
ATOM   7659 N N   . GLY B 1 455 ? -42.396 -27.176 -11.446 1.00 34.39  ? 456  GLY B N   1 
ATOM   7660 C CA  . GLY B 1 455 ? -43.168 -27.835 -10.407 1.00 29.33  ? 456  GLY B CA  1 
ATOM   7661 C C   . GLY B 1 455 ? -44.192 -26.966 -9.718  1.00 32.97  ? 456  GLY B C   1 
ATOM   7662 O O   . GLY B 1 455 ? -44.646 -27.312 -8.620  1.00 30.04  ? 456  GLY B O   1 
ATOM   7663 N N   . ILE B 1 456 ? -44.572 -25.846 -10.328 1.00 32.72  ? 457  ILE B N   1 
ATOM   7664 C CA  . ILE B 1 456 ? -45.563 -24.928 -9.761  1.00 31.57  ? 457  ILE B CA  1 
ATOM   7665 C C   . ILE B 1 456 ? -46.870 -25.641 -9.407  1.00 35.45  ? 457  ILE B C   1 
ATOM   7666 O O   . ILE B 1 456 ? -47.489 -25.288 -8.392  1.00 40.03  ? 457  ILE B O   1 
ATOM   7667 C CB  . ILE B 1 456 ? -45.829 -23.748 -10.714 1.00 37.12  ? 457  ILE B CB  1 
ATOM   7668 C CG1 . ILE B 1 456 ? -44.525 -23.030 -11.061 1.00 29.83  ? 457  ILE B CG1 1 
ATOM   7669 C CG2 . ILE B 1 456 ? -46.813 -22.764 -10.094 1.00 38.70  ? 457  ILE B CG2 1 
ATOM   7670 C CD1 . ILE B 1 456 ? -43.740 -22.561 -9.841  1.00 34.86  ? 457  ILE B CD1 1 
ATOM   7671 N N   . PRO B 1 457 ? -47.349 -26.627 -10.182 1.00 36.02  ? 458  PRO B N   1 
ATOM   7672 C CA  . PRO B 1 457 ? -48.577 -27.331 -9.767  1.00 42.25  ? 458  PRO B CA  1 
ATOM   7673 C C   . PRO B 1 457 ? -48.499 -27.981 -8.392  1.00 38.80  ? 458  PRO B C   1 
ATOM   7674 O O   . PRO B 1 457 ? -49.548 -28.275 -7.807  1.00 42.45  ? 458  PRO B O   1 
ATOM   7675 C CB  . PRO B 1 457 ? -48.773 -28.374 -10.874 1.00 40.71  ? 458  PRO B CB  1 
ATOM   7676 C CG  . PRO B 1 457 ? -48.207 -27.716 -12.078 1.00 38.02  ? 458  PRO B CG  1 
ATOM   7677 C CD  . PRO B 1 457 ? -47.002 -26.958 -11.580 1.00 33.02  ? 458  PRO B CD  1 
ATOM   7678 N N   . LEU B 1 458 ? -47.306 -28.206 -7.843  1.00 35.37  ? 459  LEU B N   1 
ATOM   7679 C CA  . LEU B 1 458 ? -47.223 -28.767 -6.501  1.00 36.82  ? 459  LEU B CA  1 
ATOM   7680 C C   . LEU B 1 458 ? -47.600 -27.764 -5.415  1.00 46.07  ? 459  LEU B C   1 
ATOM   7681 O O   . LEU B 1 458 ? -47.794 -28.171 -4.264  1.00 49.73  ? 459  LEU B O   1 
ATOM   7682 C CB  . LEU B 1 458 ? -45.814 -29.303 -6.236  1.00 32.88  ? 459  LEU B CB  1 
ATOM   7683 C CG  . LEU B 1 458 ? -45.327 -30.432 -7.141  1.00 51.23  ? 459  LEU B CG  1 
ATOM   7684 C CD1 . LEU B 1 458 ? -43.982 -30.926 -6.645  1.00 47.04  ? 459  LEU B CD1 1 
ATOM   7685 C CD2 . LEU B 1 458 ? -46.348 -31.559 -7.182  1.00 54.20  ? 459  LEU B CD2 1 
ATOM   7686 N N   . ASP B 1 459 ? -47.715 -26.484 -5.708  1.00 44.16  ? 460  ASP B N   1 
ATOM   7687 C CA  . ASP B 1 459 ? -48.054 -25.504 -4.707  1.00 42.54  ? 460  ASP B CA  1 
ATOM   7688 C C   . ASP B 1 459 ? -49.489 -25.715 -4.321  1.00 48.48  ? 460  ASP B C   1 
ATOM   7689 O O   . ASP B 1 459 ? -50.351 -25.613 -5.144  1.00 47.35  ? 460  ASP B O   1 
ATOM   7690 C CB  . ASP B 1 459 ? -47.871 -24.153 -5.347  1.00 46.32  ? 460  ASP B CB  1 
ATOM   7691 C CG  . ASP B 1 459 ? -48.120 -23.020 -4.428  1.00 55.75  ? 460  ASP B CG  1 
ATOM   7692 O OD1 . ASP B 1 459 ? -47.656 -21.930 -4.691  1.00 60.20  ? 460  ASP B OD1 1 
ATOM   7693 O OD2 . ASP B 1 459 ? -48.798 -23.204 -3.447  1.00 59.68  ? 460  ASP B OD2 1 
ATOM   7694 N N   . PRO B 1 460 ? -49.756 -25.962 -3.037  1.00 49.17  ? 461  PRO B N   1 
ATOM   7695 C CA  . PRO B 1 460 ? -51.127 -26.279 -2.602  1.00 60.98  ? 461  PRO B CA  1 
ATOM   7696 C C   . PRO B 1 460 ? -52.096 -25.129 -2.791  1.00 66.72  ? 461  PRO B C   1 
ATOM   7697 O O   . PRO B 1 460 ? -53.295 -25.366 -2.982  1.00 77.41  ? 461  PRO B O   1 
ATOM   7698 C CB  . PRO B 1 460 ? -50.959 -26.638 -1.116  1.00 59.58  ? 461  PRO B CB  1 
ATOM   7699 C CG  . PRO B 1 460 ? -49.477 -26.763 -0.885  1.00 66.74  ? 461  PRO B CG  1 
ATOM   7700 C CD  . PRO B 1 460 ? -48.811 -25.912 -1.913  1.00 58.43  ? 461  PRO B CD  1 
ATOM   7701 N N   . SER B 1 461 ? -51.615 -23.887 -2.751  1.00 60.36  ? 462  SER B N   1 
ATOM   7702 C CA  . SER B 1 461 ? -52.483 -22.726 -2.903  1.00 59.07  ? 462  SER B CA  1 
ATOM   7703 C C   . SER B 1 461 ? -52.951 -22.513 -4.336  1.00 57.68  ? 462  SER B C   1 
ATOM   7704 O O   . SER B 1 461 ? -53.720 -21.578 -4.582  1.00 61.51  ? 462  SER B O   1 
ATOM   7705 C CB  . SER B 1 461 ? -51.765 -21.471 -2.406  1.00 61.08  ? 462  SER B CB  1 
ATOM   7706 O OG  . SER B 1 461 ? -50.837 -21.011 -3.373  1.00 66.29  ? 462  SER B OG  1 
ATOM   7707 N N   . ARG B 1 462 ? -52.508 -23.332 -5.283  1.00 51.98  ? 463  ARG B N   1 
ATOM   7708 C CA  . ARG B 1 462 ? -52.978 -23.266 -6.658  1.00 57.00  ? 463  ARG B CA  1 
ATOM   7709 C C   . ARG B 1 462 ? -53.933 -24.422 -6.927  1.00 58.88  ? 463  ARG B C   1 
ATOM   7710 O O   . ARG B 1 462 ? -54.036 -25.370 -6.145  1.00 62.84  ? 463  ARG B O   1 
ATOM   7711 C CB  . ARG B 1 462 ? -51.796 -23.276 -7.632  1.00 51.46  ? 463  ARG B CB  1 
ATOM   7712 C CG  . ARG B 1 462 ? -50.770 -22.212 -7.290  1.00 56.36  ? 463  ARG B CG  1 
ATOM   7713 C CD  . ARG B 1 462 ? -49.868 -21.870 -8.454  1.00 60.59  ? 463  ARG B CD  1 
ATOM   7714 N NE  . ARG B 1 462 ? -48.789 -20.978 -8.037  1.00 64.89  ? 463  ARG B NE  1 
ATOM   7715 C CZ  . ARG B 1 462 ? -48.713 -19.692 -8.362  1.00 67.46  ? 463  ARG B CZ  1 
ATOM   7716 N NH1 . ARG B 1 462 ? -49.651 -19.143 -9.122  1.00 70.46  ? 463  ARG B NH1 1 
ATOM   7717 N NH2 . ARG B 1 462 ? -47.697 -18.957 -7.933  1.00 70.64  ? 463  ARG B NH2 1 
ATOM   7718 N N   . ASN B 1 463 ? -54.644 -24.335 -8.049  1.00 58.07  ? 464  ASN B N   1 
ATOM   7719 C CA  . ASN B 1 463 ? -55.801 -25.187 -8.289  1.00 63.01  ? 464  ASN B CA  1 
ATOM   7720 C C   . ASN B 1 463 ? -55.551 -26.233 -9.370  1.00 55.29  ? 464  ASN B C   1 
ATOM   7721 O O   . ASN B 1 463 ? -56.473 -26.620 -10.089 1.00 66.46  ? 464  ASN B O   1 
ATOM   7722 C CB  . ASN B 1 463 ? -57.017 -24.331 -8.640  1.00 72.99  ? 464  ASN B CB  1 
ATOM   7723 C CG  . ASN B 1 463 ? -57.434 -23.421 -7.497  1.00 84.81  ? 464  ASN B CG  1 
ATOM   7724 O OD1 . ASN B 1 463 ? -57.414 -23.823 -6.334  1.00 88.89  ? 464  ASN B OD1 1 
ATOM   7725 N ND2 . ASN B 1 463 ? -57.810 -22.189 -7.823  1.00 89.49  ? 464  ASN B ND2 1 
ATOM   7726 N N   . TYR B 1 464 ? -54.317 -26.712 -9.489  1.00 45.89  ? 465  TYR B N   1 
ATOM   7727 C CA  . TYR B 1 464 ? -54.035 -27.768 -10.450 1.00 44.07  ? 465  TYR B CA  1 
ATOM   7728 C C   . TYR B 1 464 ? -54.599 -29.100 -9.960  1.00 46.43  ? 465  TYR B C   1 
ATOM   7729 O O   . TYR B 1 464 ? -54.763 -29.327 -8.759  1.00 48.18  ? 465  TYR B O   1 
ATOM   7730 C CB  . TYR B 1 464 ? -52.531 -27.887 -10.685 1.00 40.93  ? 465  TYR B CB  1 
ATOM   7731 C CG  . TYR B 1 464 ? -51.907 -26.700 -11.384 1.00 38.99  ? 465  TYR B CG  1 
ATOM   7732 C CD1 . TYR B 1 464 ? -51.440 -25.609 -10.659 1.00 34.68  ? 465  TYR B CD1 1 
ATOM   7733 C CD2 . TYR B 1 464 ? -51.772 -26.676 -12.771 1.00 40.46  ? 465  TYR B CD2 1 
ATOM   7734 C CE1 . TYR B 1 464 ? -50.860 -24.527 -11.289 1.00 41.61  ? 465  TYR B CE1 1 
ATOM   7735 C CE2 . TYR B 1 464 ? -51.193 -25.595 -13.415 1.00 42.69  ? 465  TYR B CE2 1 
ATOM   7736 C CZ  . TYR B 1 464 ? -50.738 -24.523 -12.668 1.00 47.10  ? 465  TYR B CZ  1 
ATOM   7737 O OH  . TYR B 1 464 ? -50.160 -23.445 -13.297 1.00 46.51  ? 465  TYR B OH  1 
ATOM   7738 N N   . THR B 1 465 ? -54.896 -29.986 -10.908 1.00 46.45  ? 466  THR B N   1 
ATOM   7739 C CA  . THR B 1 465 ? -55.429 -31.304 -10.594 1.00 50.08  ? 466  THR B CA  1 
ATOM   7740 C C   . THR B 1 465 ? -54.327 -32.241 -10.101 1.00 52.89  ? 466  THR B C   1 
ATOM   7741 O O   . THR B 1 465 ? -53.129 -31.981 -10.255 1.00 48.82  ? 466  THR B O   1 
ATOM   7742 C CB  . THR B 1 465 ? -56.111 -31.916 -11.817 1.00 51.14  ? 466  THR B CB  1 
ATOM   7743 O OG1 . THR B 1 465 ? -55.109 -32.378 -12.738 1.00 47.43  ? 466  THR B OG1 1 
ATOM   7744 C CG2 . THR B 1 465 ? -57.010 -30.895 -12.495 1.00 43.72  ? 466  THR B CG2 1 
ATOM   7745 N N   . ALA B 1 466 ? -54.750 -33.354 -9.551  1.00 48.60  ? 467  ALA B N   1 
ATOM   7746 C CA  . ALA B 1 466 ? -53.847 -34.351 -9.071  1.00 49.29  ? 467  ALA B CA  1 
ATOM   7747 C C   . ALA B 1 466 ? -53.055 -34.906 -10.222 1.00 49.57  ? 467  ALA B C   1 
ATOM   7748 O O   . ALA B 1 466 ? -51.913 -35.217 -10.086 1.00 52.45  ? 467  ALA B O   1 
ATOM   7749 C CB  . ALA B 1 466 ? -54.601 -35.443 -8.375  1.00 46.28  ? 467  ALA B CB  1 
ATOM   7750 N N   . GLU B 1 467 ? -53.708 -35.070 -11.343 1.00 45.31  ? 468  GLU B N   1 
ATOM   7751 C CA  . GLU B 1 467 ? -53.082 -35.566 -12.531 1.00 46.90  ? 468  GLU B CA  1 
ATOM   7752 C C   . GLU B 1 467 ? -51.984 -34.607 -13.011 1.00 45.36  ? 468  GLU B C   1 
ATOM   7753 O O   . GLU B 1 467 ? -50.990 -35.042 -13.494 1.00 39.14  ? 468  GLU B O   1 
ATOM   7754 C CB  . GLU B 1 467 ? -54.127 -35.772 -13.615 1.00 53.79  ? 468  GLU B CB  1 
ATOM   7755 C CG  . GLU B 1 467 ? -55.269 -36.731 -13.288 1.00 84.53  ? 468  GLU B CG  1 
ATOM   7756 C CD  . GLU B 1 467 ? -56.222 -36.286 -12.156 1.00 95.77  ? 468  GLU B CD  1 
ATOM   7757 O OE1 . GLU B 1 467 ? -56.438 -37.088 -11.234 1.00 98.48  ? 468  GLU B OE1 1 
ATOM   7758 O OE2 . GLU B 1 467 ? -56.790 -35.184 -12.175 1.00 100.04 ? 468  GLU B OE2 1 
ATOM   7759 N N   . GLU B 1 468 ? -52.212 -33.310 -12.890 1.00 44.77  ? 469  GLU B N   1 
ATOM   7760 C CA  . GLU B 1 468 ? -51.249 -32.302 -13.327 1.00 41.92  ? 469  GLU B CA  1 
ATOM   7761 C C   . GLU B 1 468 ? -50.011 -32.282 -12.441 1.00 42.06  ? 469  GLU B C   1 
ATOM   7762 O O   . GLU B 1 468 ? -48.906 -32.007 -12.928 1.00 42.08  ? 469  GLU B O   1 
ATOM   7763 C CB  . GLU B 1 468 ? -51.907 -30.922 -13.364 1.00 42.43  ? 469  GLU B CB  1 
ATOM   7764 C CG  . GLU B 1 468 ? -52.944 -30.797 -14.475 1.00 48.40  ? 469  GLU B CG  1 
ATOM   7765 C CD  . GLU B 1 468 ? -53.553 -29.409 -14.588 1.00 54.84  ? 469  GLU B CD  1 
ATOM   7766 O OE1 . GLU B 1 468 ? -53.516 -28.833 -15.698 1.00 53.76  ? 469  GLU B OE1 1 
ATOM   7767 O OE2 . GLU B 1 468 ? -54.078 -28.900 -13.574 1.00 55.33  ? 469  GLU B OE2 1 
ATOM   7768 N N   . LYS B 1 469 ? -50.165 -32.585 -11.150 1.00 38.07  ? 470  LYS B N   1 
ATOM   7769 C CA  . LYS B 1 469 ? -49.004 -32.627 -10.267 1.00 39.82  ? 470  LYS B CA  1 
ATOM   7770 C C   . LYS B 1 469 ? -48.123 -33.832 -10.568 1.00 36.88  ? 470  LYS B C   1 
ATOM   7771 O O   . LYS B 1 469 ? -46.893 -33.711 -10.614 1.00 38.08  ? 470  LYS B O   1 
ATOM   7772 C CB  . LYS B 1 469 ? -49.459 -32.630 -8.812  1.00 40.62  ? 470  LYS B CB  1 
ATOM   7773 C CG  . LYS B 1 469 ? -50.345 -31.449 -8.496  1.00 48.00  ? 470  LYS B CG  1 
ATOM   7774 C CD  . LYS B 1 469 ? -51.262 -31.742 -7.343  1.00 51.79  ? 470  LYS B CD  1 
ATOM   7775 C CE  . LYS B 1 469 ? -50.854 -30.922 -6.150  1.00 60.84  ? 470  LYS B CE  1 
ATOM   7776 N NZ  . LYS B 1 469 ? -52.024 -30.313 -5.476  1.00 71.98  ? 470  LYS B NZ  1 
ATOM   7777 N N   . ILE B 1 470 ? -48.733 -35.000 -10.787 1.00 37.23  ? 471  ILE B N   1 
ATOM   7778 C CA  . ILE B 1 470 ? -47.976 -36.156 -11.259 1.00 43.87  ? 471  ILE B CA  1 
ATOM   7779 C C   . ILE B 1 470 ? -47.218 -35.794 -12.529 1.00 38.44  ? 471  ILE B C   1 
ATOM   7780 O O   . ILE B 1 470 ? -46.020 -36.068 -12.660 1.00 40.96  ? 471  ILE B O   1 
ATOM   7781 C CB  . ILE B 1 470 ? -48.914 -37.358 -11.477 1.00 50.12  ? 471  ILE B CB  1 
ATOM   7782 C CG1 . ILE B 1 470 ? -49.414 -37.892 -10.137 1.00 49.54  ? 471  ILE B CG1 1 
ATOM   7783 C CG2 . ILE B 1 470 ? -48.213 -38.468 -12.244 1.00 45.39  ? 471  ILE B CG2 1 
ATOM   7784 C CD1 . ILE B 1 470 ? -50.614 -38.798 -10.267 1.00 56.16  ? 471  ILE B CD1 1 
ATOM   7785 N N   . PHE B 1 471 ? -47.906 -35.130 -13.461 1.00 38.60  ? 472  PHE B N   1 
ATOM   7786 C CA  . PHE B 1 471 ? -47.290 -34.701 -14.715 1.00 40.75  ? 472  PHE B CA  1 
ATOM   7787 C C   . PHE B 1 471 ? -46.119 -33.753 -14.464 1.00 38.13  ? 472  PHE B C   1 
ATOM   7788 O O   . PHE B 1 471 ? -45.033 -33.918 -15.037 1.00 32.59  ? 472  PHE B O   1 
ATOM   7789 C CB  . PHE B 1 471 ? -48.360 -34.042 -15.590 1.00 40.70  ? 472  PHE B CB  1 
ATOM   7790 C CG  . PHE B 1 471 ? -47.860 -33.531 -16.912 1.00 36.90  ? 472  PHE B CG  1 
ATOM   7791 C CD1 . PHE B 1 471 ? -47.092 -34.333 -17.742 1.00 38.90  ? 472  PHE B CD1 1 
ATOM   7792 C CD2 . PHE B 1 471 ? -48.203 -32.257 -17.345 1.00 36.54  ? 472  PHE B CD2 1 
ATOM   7793 C CE1 . PHE B 1 471 ? -46.653 -33.864 -18.973 1.00 40.00  ? 472  PHE B CE1 1 
ATOM   7794 C CE2 . PHE B 1 471 ? -47.765 -31.777 -18.572 1.00 35.50  ? 472  PHE B CE2 1 
ATOM   7795 C CZ  . PHE B 1 471 ? -46.988 -32.582 -19.390 1.00 35.72  ? 472  PHE B CZ  1 
ATOM   7796 N N   . ALA B 1 472 ? -46.324 -32.747 -13.607 1.00 33.13  ? 473  ALA B N   1 
ATOM   7797 C CA  . ALA B 1 472 ? -45.237 -31.837 -13.250 1.00 34.92  ? 473  ALA B CA  1 
ATOM   7798 C C   . ALA B 1 472 ? -44.041 -32.595 -12.680 1.00 40.81  ? 473  ALA B C   1 
ATOM   7799 O O   . ALA B 1 472 ? -42.884 -32.271 -12.985 1.00 35.29  ? 473  ALA B O   1 
ATOM   7800 C CB  . ALA B 1 472 ? -45.735 -30.795 -12.243 1.00 35.39  ? 473  ALA B CB  1 
ATOM   7801 N N   . GLN B 1 473 ? -44.300 -33.612 -11.850 1.00 29.10  ? 474  GLN B N   1 
ATOM   7802 C CA  . GLN B 1 473 ? -43.203 -34.386 -11.278 1.00 33.89  ? 474  GLN B CA  1 
ATOM   7803 C C   . GLN B 1 473 ? -42.464 -35.170 -12.355 1.00 33.01  ? 474  GLN B C   1 
ATOM   7804 O O   . GLN B 1 473 ? -41.234 -35.296 -12.301 1.00 36.39  ? 474  GLN B O   1 
ATOM   7805 C CB  . GLN B 1 473 ? -43.731 -35.311 -10.179 1.00 37.70  ? 474  GLN B CB  1 
ATOM   7806 C CG  . GLN B 1 473 ? -44.244 -34.548 -8.971  1.00 33.52  ? 474  GLN B CG  1 
ATOM   7807 C CD  . GLN B 1 473 ? -44.890 -35.430 -7.920  1.00 42.17  ? 474  GLN B CD  1 
ATOM   7808 O OE1 . GLN B 1 473 ? -45.779 -36.219 -8.234  1.00 40.17  ? 474  GLN B OE1 1 
ATOM   7809 N NE2 . GLN B 1 473 ? -44.428 -35.327 -6.675  1.00 37.38  ? 474  GLN B NE2 1 
ATOM   7810 N N   . ARG B 1 474 ? -43.198 -35.689 -13.347 1.00 36.61  ? 475  ARG B N   1 
ATOM   7811 C CA  . ARG B 1 474 ? -42.569 -36.342 -14.496 1.00 41.89  ? 475  ARG B CA  1 
ATOM   7812 C C   . ARG B 1 474 ? -41.621 -35.397 -15.224 1.00 35.43  ? 475  ARG B C   1 
ATOM   7813 O O   . ARG B 1 474 ? -40.485 -35.763 -15.546 1.00 32.98  ? 475  ARG B O   1 
ATOM   7814 C CB  . ARG B 1 474 ? -43.636 -36.846 -15.470 1.00 42.01  ? 475  ARG B CB  1 
ATOM   7815 C CG  . ARG B 1 474 ? -44.252 -38.178 -15.125 1.00 46.90  ? 475  ARG B CG  1 
ATOM   7816 C CD  . ARG B 1 474 ? -45.239 -38.605 -16.203 1.00 48.07  ? 475  ARG B CD  1 
ATOM   7817 N NE  . ARG B 1 474 ? -44.599 -38.663 -17.511 1.00 45.79  ? 475  ARG B NE  1 
ATOM   7818 C CZ  . ARG B 1 474 ? -45.188 -38.298 -18.645 1.00 43.70  ? 475  ARG B CZ  1 
ATOM   7819 N NH1 . ARG B 1 474 ? -46.434 -37.847 -18.629 1.00 43.73  ? 475  ARG B NH1 1 
ATOM   7820 N NH2 . ARG B 1 474 ? -44.527 -38.377 -19.794 1.00 31.93  ? 475  ARG B NH2 1 
ATOM   7821 N N   . LEU B 1 475 ? -42.088 -34.182 -15.527 1.00 32.50  ? 476  LEU B N   1 
ATOM   7822 C CA  . LEU B 1 475 ? -41.255 -33.251 -16.280 1.00 32.36  ? 476  LEU B CA  1 
ATOM   7823 C C   . LEU B 1 475 ? -40.022 -32.848 -15.482 1.00 33.61  ? 476  LEU B C   1 
ATOM   7824 O O   . LEU B 1 475 ? -38.926 -32.729 -16.042 1.00 32.45  ? 476  LEU B O   1 
ATOM   7825 C CB  . LEU B 1 475 ? -42.068 -32.019 -16.679 1.00 30.08  ? 476  LEU B CB  1 
ATOM   7826 C CG  . LEU B 1 475 ? -43.237 -32.259 -17.636 1.00 41.73  ? 476  LEU B CG  1 
ATOM   7827 C CD1 . LEU B 1 475 ? -43.771 -30.951 -18.179 1.00 44.72  ? 476  LEU B CD1 1 
ATOM   7828 C CD2 . LEU B 1 475 ? -42.816 -33.158 -18.779 1.00 39.92  ? 476  LEU B CD2 1 
ATOM   7829 N N   . MET B 1 476 ? -40.181 -32.630 -14.170 1.00 28.64  ? 477  MET B N   1 
ATOM   7830 C CA  . MET B 1 476 ? -39.029 -32.294 -13.337 1.00 29.26  ? 477  MET B CA  1 
ATOM   7831 C C   . MET B 1 476 ? -37.999 -33.416 -13.352 1.00 31.72  ? 477  MET B C   1 
ATOM   7832 O O   . MET B 1 476 ? -36.789 -33.159 -13.362 1.00 28.28  ? 477  MET B O   1 
ATOM   7833 C CB  . MET B 1 476 ? -39.475 -32.002 -11.903 1.00 34.79  ? 477  MET B CB  1 
ATOM   7834 C CG  . MET B 1 476 ? -40.230 -30.694 -11.722 1.00 35.59  ? 477  MET B CG  1 
ATOM   7835 S SD  . MET B 1 476 ? -40.380 -30.223 -9.985  1.00 42.25  ? 477  MET B SD  1 
ATOM   7836 C CE  . MET B 1 476 ? -41.434 -31.532 -9.355  1.00 42.49  ? 477  MET B CE  1 
ATOM   7837 N N   . ARG B 1 477 ? -38.466 -34.671 -13.361 1.00 29.74  ? 478  ARG B N   1 
ATOM   7838 C CA  . ARG B 1 477 ? -37.559 -35.813 -13.415 1.00 27.39  ? 478  ARG B CA  1 
ATOM   7839 C C   . ARG B 1 477 ? -36.831 -35.885 -14.757 1.00 32.57  ? 478  ARG B C   1 
ATOM   7840 O O   . ARG B 1 477 ? -35.616 -36.116 -14.786 1.00 34.93  ? 478  ARG B O   1 
ATOM   7841 C CB  . ARG B 1 477 ? -38.333 -37.107 -13.137 1.00 25.46  ? 478  ARG B CB  1 
ATOM   7842 C CG  . ARG B 1 477 ? -37.504 -38.390 -13.250 1.00 30.06  ? 478  ARG B CG  1 
ATOM   7843 C CD  . ARG B 1 477 ? -36.396 -38.443 -12.206 1.00 35.00  ? 478  ARG B CD  1 
ATOM   7844 N NE  . ARG B 1 477 ? -36.933 -38.298 -10.855 1.00 38.38  ? 478  ARG B NE  1 
ATOM   7845 C CZ  . ARG B 1 477 ? -37.449 -39.297 -10.149 1.00 44.70  ? 478  ARG B CZ  1 
ATOM   7846 N NH1 . ARG B 1 477 ? -37.493 -40.524 -10.655 1.00 48.01  ? 478  ARG B NH1 1 
ATOM   7847 N NH2 . ARG B 1 477 ? -37.922 -39.069 -8.935  1.00 42.98  ? 478  ARG B NH2 1 
ATOM   7848 N N   . TYR B 1 478 ? -37.547 -35.694 -15.877 1.00 23.84  ? 479  TYR B N   1 
ATOM   7849 C CA  . TYR B 1 478 ? -36.879 -35.625 -17.183 1.00 27.86  ? 479  TYR B CA  1 
ATOM   7850 C C   . TYR B 1 478 ? -35.795 -34.553 -17.179 1.00 29.70  ? 479  TYR B C   1 
ATOM   7851 O O   . TYR B 1 478 ? -34.644 -34.810 -17.552 1.00 30.94  ? 479  TYR B O   1 
ATOM   7852 C CB  . TYR B 1 478 ? -37.880 -35.322 -18.307 1.00 24.29  ? 479  TYR B CB  1 
ATOM   7853 C CG  . TYR B 1 478 ? -38.869 -36.418 -18.644 1.00 32.00  ? 479  TYR B CG  1 
ATOM   7854 C CD1 . TYR B 1 478 ? -38.479 -37.749 -18.716 1.00 29.32  ? 479  TYR B CD1 1 
ATOM   7855 C CD2 . TYR B 1 478 ? -40.200 -36.113 -18.900 1.00 32.59  ? 479  TYR B CD2 1 
ATOM   7856 C CE1 . TYR B 1 478 ? -39.393 -38.747 -19.026 1.00 32.93  ? 479  TYR B CE1 1 
ATOM   7857 C CE2 . TYR B 1 478 ? -41.120 -37.100 -19.207 1.00 32.86  ? 479  TYR B CE2 1 
ATOM   7858 C CZ  . TYR B 1 478 ? -40.715 -38.413 -19.272 1.00 36.95  ? 479  TYR B CZ  1 
ATOM   7859 O OH  . TYR B 1 478 ? -41.648 -39.384 -19.578 1.00 37.44  ? 479  TYR B OH  1 
ATOM   7860 N N   . TRP B 1 479 ? -36.150 -33.339 -16.750 1.00 27.81  ? 480  TRP B N   1 
ATOM   7861 C CA  . TRP B 1 479 ? -35.213 -32.224 -16.811 1.00 30.87  ? 480  TRP B CA  1 
ATOM   7862 C C   . TRP B 1 479 ? -33.997 -32.479 -15.926 1.00 35.41  ? 480  TRP B C   1 
ATOM   7863 O O   . TRP B 1 479 ? -32.857 -32.239 -16.341 1.00 33.52  ? 480  TRP B O   1 
ATOM   7864 C CB  . TRP B 1 479 ? -35.927 -30.930 -16.412 1.00 28.19  ? 480  TRP B CB  1 
ATOM   7865 C CG  . TRP B 1 479 ? -36.270 -30.055 -17.584 1.00 30.59  ? 480  TRP B CG  1 
ATOM   7866 C CD1 . TRP B 1 479 ? -35.783 -28.807 -17.840 1.00 31.95  ? 480  TRP B CD1 1 
ATOM   7867 C CD2 . TRP B 1 479 ? -37.164 -30.367 -18.667 1.00 26.12  ? 480  TRP B CD2 1 
ATOM   7868 N NE1 . TRP B 1 479 ? -36.316 -28.321 -19.012 1.00 26.99  ? 480  TRP B NE1 1 
ATOM   7869 C CE2 . TRP B 1 479 ? -37.167 -29.256 -19.539 1.00 24.52  ? 480  TRP B CE2 1 
ATOM   7870 C CE3 . TRP B 1 479 ? -37.965 -31.471 -18.981 1.00 23.48  ? 480  TRP B CE3 1 
ATOM   7871 C CZ2 . TRP B 1 479 ? -37.931 -29.222 -20.710 1.00 25.29  ? 480  TRP B CZ2 1 
ATOM   7872 C CZ3 . TRP B 1 479 ? -38.731 -31.433 -20.142 1.00 28.53  ? 480  TRP B CZ3 1 
ATOM   7873 C CH2 . TRP B 1 479 ? -38.706 -30.315 -20.992 1.00 26.58  ? 480  TRP B CH2 1 
ATOM   7874 N N   . ALA B 1 480 ? -34.215 -32.996 -14.715 1.00 30.61  ? 481  ALA B N   1 
ATOM   7875 C CA  . ALA B 1 480 ? -33.095 -33.226 -13.806 1.00 28.62  ? 481  ALA B CA  1 
ATOM   7876 C C   . ALA B 1 480 ? -32.281 -34.445 -14.223 1.00 30.91  ? 481  ALA B C   1 
ATOM   7877 O O   . ALA B 1 480 ? -31.052 -34.461 -14.061 1.00 30.85  ? 481  ALA B O   1 
ATOM   7878 C CB  . ALA B 1 480 ? -33.600 -33.380 -12.375 1.00 24.54  ? 481  ALA B CB  1 
ATOM   7879 N N   . ASN B 1 481 ? -32.944 -35.479 -14.749 1.00 28.75  ? 482  ASN B N   1 
ATOM   7880 C CA  . ASN B 1 481 ? -32.210 -36.597 -15.335 1.00 30.99  ? 482  ASN B CA  1 
ATOM   7881 C C   . ASN B 1 481 ? -31.251 -36.105 -16.403 1.00 29.28  ? 482  ASN B C   1 
ATOM   7882 O O   . ASN B 1 481 ? -30.085 -36.525 -16.454 1.00 26.93  ? 482  ASN B O   1 
ATOM   7883 C CB  . ASN B 1 481 ? -33.175 -37.614 -15.934 1.00 31.47  ? 482  ASN B CB  1 
ATOM   7884 C CG  . ASN B 1 481 ? -33.741 -38.555 -14.900 1.00 38.24  ? 482  ASN B CG  1 
ATOM   7885 O OD1 . ASN B 1 481 ? -33.423 -38.465 -13.708 1.00 36.24  ? 482  ASN B OD1 1 
ATOM   7886 N ND2 . ASN B 1 481 ? -34.589 -39.468 -15.349 1.00 33.71  ? 482  ASN B ND2 1 
ATOM   7887 N N   . PHE B 1 482 ? -31.730 -35.204 -17.266 1.00 22.89  ? 483  PHE B N   1 
ATOM   7888 C CA  . PHE B 1 482 ? -30.883 -34.663 -18.321 1.00 26.54  ? 483  PHE B CA  1 
ATOM   7889 C C   . PHE B 1 482 ? -29.735 -33.852 -17.733 1.00 31.40  ? 483  PHE B C   1 
ATOM   7890 O O   . PHE B 1 482 ? -28.593 -33.950 -18.198 1.00 31.20  ? 483  PHE B O   1 
ATOM   7891 C CB  . PHE B 1 482 ? -31.717 -33.811 -19.283 1.00 23.68  ? 483  PHE B CB  1 
ATOM   7892 C CG  . PHE B 1 482 ? -30.898 -33.128 -20.338 1.00 27.42  ? 483  PHE B CG  1 
ATOM   7893 C CD1 . PHE B 1 482 ? -30.527 -31.801 -20.191 1.00 22.85  ? 483  PHE B CD1 1 
ATOM   7894 C CD2 . PHE B 1 482 ? -30.476 -33.820 -21.467 1.00 27.29  ? 483  PHE B CD2 1 
ATOM   7895 C CE1 . PHE B 1 482 ? -29.749 -31.169 -21.154 1.00 25.84  ? 483  PHE B CE1 1 
ATOM   7896 C CE2 . PHE B 1 482 ? -29.702 -33.191 -22.437 1.00 28.73  ? 483  PHE B CE2 1 
ATOM   7897 C CZ  . PHE B 1 482 ? -29.337 -31.864 -22.275 1.00 28.87  ? 483  PHE B CZ  1 
ATOM   7898 N N   . ALA B 1 483 ? -30.014 -33.056 -16.698 1.00 23.53  ? 484  ALA B N   1 
ATOM   7899 C CA  . ALA B 1 483 ? -28.947 -32.304 -16.044 1.00 27.75  ? 484  ALA B CA  1 
ATOM   7900 C C   . ALA B 1 483 ? -27.901 -33.236 -15.436 1.00 31.81  ? 484  ALA B C   1 
ATOM   7901 O O   . ALA B 1 483 ? -26.698 -32.959 -15.502 1.00 30.96  ? 484  ALA B O   1 
ATOM   7902 C CB  . ALA B 1 483 ? -29.536 -31.388 -14.972 1.00 22.50  ? 484  ALA B CB  1 
ATOM   7903 N N   . ARG B 1 484 ? -28.337 -34.344 -14.838 1.00 32.52  ? 485  ARG B N   1 
ATOM   7904 C CA  . ARG B 1 484 ? -27.393 -35.245 -14.186 1.00 31.62  ? 485  ARG B CA  1 
ATOM   7905 C C   . ARG B 1 484 ? -26.585 -36.063 -15.191 1.00 37.28  ? 485  ARG B C   1 
ATOM   7906 O O   . ARG B 1 484 ? -25.393 -36.292 -14.976 1.00 42.28  ? 485  ARG B O   1 
ATOM   7907 C CB  . ARG B 1 484 ? -28.133 -36.183 -13.226 1.00 30.34  ? 485  ARG B CB  1 
ATOM   7908 C CG  . ARG B 1 484 ? -28.615 -35.533 -11.935 1.00 31.41  ? 485  ARG B CG  1 
ATOM   7909 C CD  . ARG B 1 484 ? -29.257 -36.561 -10.995 1.00 27.90  ? 485  ARG B CD  1 
ATOM   7910 N NE  . ARG B 1 484 ? -30.570 -37.000 -11.467 1.00 33.87  ? 485  ARG B NE  1 
ATOM   7911 C CZ  . ARG B 1 484 ? -31.725 -36.476 -11.067 1.00 35.94  ? 485  ARG B CZ  1 
ATOM   7912 N NH1 . ARG B 1 484 ? -31.740 -35.482 -10.188 1.00 30.35  ? 485  ARG B NH1 1 
ATOM   7913 N NH2 . ARG B 1 484 ? -32.870 -36.942 -11.553 1.00 35.60  ? 485  ARG B NH2 1 
ATOM   7914 N N   . THR B 1 485 ? -27.210 -36.518 -16.288 1.00 35.39  ? 486  THR B N   1 
ATOM   7915 C CA  . THR B 1 485 ? -26.604 -37.523 -17.158 1.00 35.04  ? 486  THR B CA  1 
ATOM   7916 C C   . THR B 1 485 ? -26.513 -37.136 -18.625 1.00 36.14  ? 486  THR B C   1 
ATOM   7917 O O   . THR B 1 485 ? -25.842 -37.846 -19.385 1.00 39.93  ? 486  THR B O   1 
ATOM   7918 C CB  . THR B 1 485 ? -27.383 -38.849 -17.091 1.00 34.94  ? 486  THR B CB  1 
ATOM   7919 O OG1 . THR B 1 485 ? -28.644 -38.695 -17.762 1.00 34.27  ? 486  THR B OG1 1 
ATOM   7920 C CG2 . THR B 1 485 ? -27.612 -39.281 -15.642 1.00 29.13  ? 486  THR B CG2 1 
ATOM   7921 N N   . GLY B 1 486 ? -27.177 -36.068 -19.055 1.00 30.29  ? 487  GLY B N   1 
ATOM   7922 C CA  . GLY B 1 486 ? -27.305 -35.806 -20.474 1.00 30.73  ? 487  GLY B CA  1 
ATOM   7923 C C   . GLY B 1 486 ? -28.332 -36.667 -21.174 1.00 34.97  ? 487  GLY B C   1 
ATOM   7924 O O   . GLY B 1 486 ? -28.376 -36.679 -22.410 1.00 34.43  ? 487  GLY B O   1 
ATOM   7925 N N   . ASP B 1 487 ? -29.162 -37.377 -20.422 1.00 39.27  ? 488  ASP B N   1 
ATOM   7926 C CA  . ASP B 1 487 ? -30.180 -38.269 -20.955 1.00 38.29  ? 488  ASP B CA  1 
ATOM   7927 C C   . ASP B 1 487 ? -31.412 -38.158 -20.064 1.00 35.14  ? 488  ASP B C   1 
ATOM   7928 O O   . ASP B 1 487 ? -31.321 -38.410 -18.856 1.00 38.63  ? 488  ASP B O   1 
ATOM   7929 C CB  . ASP B 1 487 ? -29.643 -39.704 -21.012 1.00 35.22  ? 488  ASP B CB  1 
ATOM   7930 C CG  . ASP B 1 487 ? -30.634 -40.687 -21.616 1.00 40.10  ? 488  ASP B CG  1 
ATOM   7931 O OD1 . ASP B 1 487 ? -30.276 -41.877 -21.763 1.00 45.95  ? 488  ASP B OD1 1 
ATOM   7932 O OD2 . ASP B 1 487 ? -31.770 -40.283 -21.932 1.00 40.23  ? 488  ASP B OD2 1 
ATOM   7933 N N   . PRO B 1 488 ? -32.573 -37.774 -20.611 1.00 32.14  ? 489  PRO B N   1 
ATOM   7934 C CA  . PRO B 1 488 ? -33.768 -37.596 -19.759 1.00 31.62  ? 489  PRO B CA  1 
ATOM   7935 C C   . PRO B 1 488 ? -34.402 -38.901 -19.284 1.00 32.81  ? 489  PRO B C   1 
ATOM   7936 O O   . PRO B 1 488 ? -35.210 -38.864 -18.345 1.00 34.62  ? 489  PRO B O   1 
ATOM   7937 C CB  . PRO B 1 488 ? -34.731 -36.815 -20.665 1.00 29.42  ? 489  PRO B CB  1 
ATOM   7938 C CG  . PRO B 1 488 ? -34.295 -37.186 -22.091 1.00 31.73  ? 489  PRO B CG  1 
ATOM   7939 C CD  . PRO B 1 488 ? -32.799 -37.350 -22.009 1.00 32.06  ? 489  PRO B CD  1 
ATOM   7940 N N   . ASN B 1 489 ? -34.054 -40.039 -19.880 1.00 31.00  ? 490  ASN B N   1 
ATOM   7941 C CA  . ASN B 1 489 ? -34.741 -41.297 -19.624 1.00 37.33  ? 490  ASN B CA  1 
ATOM   7942 C C   . ASN B 1 489 ? -34.381 -41.880 -18.254 1.00 44.35  ? 490  ASN B C   1 
ATOM   7943 O O   . ASN B 1 489 ? -33.461 -41.424 -17.573 1.00 42.46  ? 490  ASN B O   1 
ATOM   7944 C CB  . ASN B 1 489 ? -34.408 -42.306 -20.720 1.00 34.81  ? 490  ASN B CB  1 
ATOM   7945 C CG  . ASN B 1 489 ? -35.039 -41.946 -22.045 1.00 38.51  ? 490  ASN B CG  1 
ATOM   7946 O OD1 . ASN B 1 489 ? -36.243 -42.116 -22.228 1.00 44.16  ? 490  ASN B OD1 1 
ATOM   7947 N ND2 . ASN B 1 489 ? -34.228 -41.456 -22.984 1.00 30.73  ? 490  ASN B ND2 1 
ATOM   7948 N N   . GLU B 1 490 ? -35.126 -42.918 -17.866 1.00 60.38  ? 491  GLU B N   1 
ATOM   7949 C CA  . GLU B 1 490 ? -34.833 -43.717 -16.670 1.00 72.01  ? 491  GLU B CA  1 
ATOM   7950 C C   . GLU B 1 490 ? -34.682 -45.205 -16.997 1.00 78.09  ? 491  GLU B C   1 
ATOM   7951 O O   . GLU B 1 490 ? -35.117 -46.074 -16.233 1.00 84.12  ? 491  GLU B O   1 
ATOM   7952 C CB  . GLU B 1 490 ? -35.925 -43.535 -15.617 1.00 77.17  ? 491  GLU B CB  1 
ATOM   7953 C CG  . GLU B 1 490 ? -36.182 -42.093 -15.257 1.00 79.66  ? 491  GLU B CG  1 
ATOM   7954 C CD  . GLU B 1 490 ? -36.805 -41.926 -13.893 1.00 79.94  ? 491  GLU B CD  1 
ATOM   7955 O OE1 . GLU B 1 490 ? -36.048 -41.826 -12.905 1.00 76.50  ? 491  GLU B OE1 1 
ATOM   7956 O OE2 . GLU B 1 490 ? -38.050 -41.888 -13.811 1.00 81.99  ? 491  GLU B OE2 1 
ATOM   7957 N N   . PRO B 1 497 ? -41.473 -46.794 -21.933 1.00 98.40  ? 498  PRO B N   1 
ATOM   7958 C CA  . PRO B 1 497 ? -41.550 -46.024 -23.177 1.00 89.20  ? 498  PRO B CA  1 
ATOM   7959 C C   . PRO B 1 497 ? -40.390 -45.060 -23.195 1.00 74.58  ? 498  PRO B C   1 
ATOM   7960 O O   . PRO B 1 497 ? -40.393 -44.127 -22.445 1.00 88.75  ? 498  PRO B O   1 
ATOM   7961 C CB  . PRO B 1 497 ? -42.870 -45.290 -23.038 1.00 90.73  ? 498  PRO B CB  1 
ATOM   7962 C CG  . PRO B 1 497 ? -43.159 -45.262 -21.576 1.00 95.84  ? 498  PRO B CG  1 
ATOM   7963 C CD  . PRO B 1 497 ? -42.196 -46.137 -20.844 1.00 97.42  ? 498  PRO B CD  1 
ATOM   7964 N N   . GLN B 1 498 ? -39.406 -45.294 -24.029 1.00 51.12  ? 499  GLN B N   1 
ATOM   7965 C CA  . GLN B 1 498 ? -38.260 -44.455 -24.003 1.00 41.70  ? 499  GLN B CA  1 
ATOM   7966 C C   . GLN B 1 498 ? -38.307 -43.258 -24.913 1.00 46.55  ? 499  GLN B C   1 
ATOM   7967 O O   . GLN B 1 498 ? -38.995 -43.237 -25.886 1.00 46.73  ? 499  GLN B O   1 
ATOM   7968 C CB  . GLN B 1 498 ? -37.031 -45.269 -24.306 1.00 38.89  ? 499  GLN B CB  1 
ATOM   7969 C CG  . GLN B 1 498 ? -36.774 -46.383 -23.329 1.00 44.37  ? 499  GLN B CG  1 
ATOM   7970 C CD  . GLN B 1 498 ? -36.196 -45.919 -22.025 1.00 58.36  ? 499  GLN B CD  1 
ATOM   7971 O OE1 . GLN B 1 498 ? -35.065 -45.479 -21.954 1.00 59.66  ? 499  GLN B OE1 1 
ATOM   7972 N NE2 . GLN B 1 498 ? -36.975 -46.036 -20.980 1.00 56.67  ? 499  GLN B NE2 1 
ATOM   7973 N N   . TRP B 1 499 ? -37.564 -42.247 -24.529 1.00 36.09  ? 500  TRP B N   1 
ATOM   7974 C CA  . TRP B 1 499 ? -37.389 -41.017 -25.285 1.00 31.51  ? 500  TRP B CA  1 
ATOM   7975 C C   . TRP B 1 499 ? -36.146 -41.156 -26.159 1.00 35.01  ? 500  TRP B C   1 
ATOM   7976 O O   . TRP B 1 499 ? -35.022 -41.070 -25.645 1.00 42.16  ? 500  TRP B O   1 
ATOM   7977 C CB  . TRP B 1 499 ? -37.246 -39.841 -24.315 1.00 30.13  ? 500  TRP B CB  1 
ATOM   7978 C CG  . TRP B 1 499 ? -37.236 -38.464 -24.895 1.00 30.24  ? 500  TRP B CG  1 
ATOM   7979 C CD1 . TRP B 1 499 ? -36.966 -38.102 -26.187 1.00 30.84  ? 500  TRP B CD1 1 
ATOM   7980 C CD2 . TRP B 1 499 ? -37.494 -37.247 -24.181 1.00 27.15  ? 500  TRP B CD2 1 
ATOM   7981 N NE1 . TRP B 1 499 ? -37.048 -36.733 -26.318 1.00 27.95  ? 500  TRP B NE1 1 
ATOM   7982 C CE2 . TRP B 1 499 ? -37.371 -36.186 -25.102 1.00 26.82  ? 500  TRP B CE2 1 
ATOM   7983 C CE3 . TRP B 1 499 ? -37.826 -36.954 -22.854 1.00 29.53  ? 500  TRP B CE3 1 
ATOM   7984 C CZ2 . TRP B 1 499 ? -37.570 -34.855 -24.737 1.00 27.92  ? 500  TRP B CZ2 1 
ATOM   7985 C CZ3 . TRP B 1 499 ? -38.017 -35.632 -22.491 1.00 27.16  ? 500  TRP B CZ3 1 
ATOM   7986 C CH2 . TRP B 1 499 ? -37.886 -34.599 -23.428 1.00 31.81  ? 500  TRP B CH2 1 
ATOM   7987 N N   . PRO B 1 500 ? -36.280 -41.375 -27.465 1.00 38.13  ? 501  PRO B N   1 
ATOM   7988 C CA  . PRO B 1 500 ? -35.097 -41.555 -28.312 1.00 37.15  ? 501  PRO B CA  1 
ATOM   7989 C C   . PRO B 1 500 ? -34.489 -40.217 -28.694 1.00 36.92  ? 501  PRO B C   1 
ATOM   7990 O O   . PRO B 1 500 ? -35.172 -39.181 -28.672 1.00 35.01  ? 501  PRO B O   1 
ATOM   7991 C CB  . PRO B 1 500 ? -35.659 -42.284 -29.541 1.00 37.77  ? 501  PRO B CB  1 
ATOM   7992 C CG  . PRO B 1 500 ? -37.053 -41.755 -29.648 1.00 36.82  ? 501  PRO B CG  1 
ATOM   7993 C CD  . PRO B 1 500 ? -37.532 -41.486 -28.239 1.00 33.00  ? 501  PRO B CD  1 
ATOM   7994 N N   . PRO B 1 501 ? -33.205 -40.193 -29.040 1.00 37.02  ? 502  PRO B N   1 
ATOM   7995 C CA  . PRO B 1 501 ? -32.588 -38.942 -29.498 1.00 31.81  ? 502  PRO B CA  1 
ATOM   7996 C C   . PRO B 1 501 ? -33.146 -38.476 -30.840 1.00 34.80  ? 502  PRO B C   1 
ATOM   7997 O O   . PRO B 1 501 ? -33.534 -39.272 -31.698 1.00 29.13  ? 502  PRO B O   1 
ATOM   7998 C CB  . PRO B 1 501 ? -31.101 -39.303 -29.619 1.00 38.31  ? 502  PRO B CB  1 
ATOM   7999 C CG  . PRO B 1 501 ? -30.923 -40.517 -28.733 1.00 36.39  ? 502  PRO B CG  1 
ATOM   8000 C CD  . PRO B 1 501 ? -32.216 -41.268 -28.840 1.00 36.37  ? 502  PRO B CD  1 
ATOM   8001 N N   . TYR B 1 502 ? -33.179 -37.156 -31.007 1.00 30.72  ? 503  TYR B N   1 
ATOM   8002 C CA  . TYR B 1 502 ? -33.546 -36.549 -32.278 1.00 33.20  ? 503  TYR B CA  1 
ATOM   8003 C C   . TYR B 1 502 ? -32.390 -36.657 -33.263 1.00 36.98  ? 503  TYR B C   1 
ATOM   8004 O O   . TYR B 1 502 ? -31.236 -36.398 -32.913 1.00 36.84  ? 503  TYR B O   1 
ATOM   8005 C CB  . TYR B 1 502 ? -33.918 -35.080 -32.069 1.00 33.32  ? 503  TYR B CB  1 
ATOM   8006 C CG  . TYR B 1 502 ? -34.377 -34.353 -33.319 1.00 35.33  ? 503  TYR B CG  1 
ATOM   8007 C CD1 . TYR B 1 502 ? -35.727 -34.288 -33.653 1.00 31.26  ? 503  TYR B CD1 1 
ATOM   8008 C CD2 . TYR B 1 502 ? -33.465 -33.711 -34.150 1.00 40.32  ? 503  TYR B CD2 1 
ATOM   8009 C CE1 . TYR B 1 502 ? -36.155 -33.617 -34.792 1.00 34.05  ? 503  TYR B CE1 1 
ATOM   8010 C CE2 . TYR B 1 502 ? -33.882 -33.040 -35.296 1.00 38.73  ? 503  TYR B CE2 1 
ATOM   8011 C CZ  . TYR B 1 502 ? -35.228 -32.995 -35.610 1.00 37.83  ? 503  TYR B CZ  1 
ATOM   8012 O OH  . TYR B 1 502 ? -35.639 -32.321 -36.738 1.00 41.51  ? 503  TYR B OH  1 
ATOM   8013 N N   . THR B 1 503 ? -32.705 -37.038 -34.502 1.00 31.11  ? 504  THR B N   1 
ATOM   8014 C CA  . THR B 1 503 ? -31.709 -37.178 -35.558 1.00 38.44  ? 504  THR B CA  1 
ATOM   8015 C C   . THR B 1 503 ? -32.173 -36.423 -36.797 1.00 42.73  ? 504  THR B C   1 
ATOM   8016 O O   . THR B 1 503 ? -33.366 -36.168 -36.985 1.00 42.17  ? 504  THR B O   1 
ATOM   8017 C CB  . THR B 1 503 ? -31.455 -38.651 -35.913 1.00 43.64  ? 504  THR B CB  1 
ATOM   8018 O OG1 . THR B 1 503 ? -32.694 -39.290 -36.250 1.00 48.77  ? 504  THR B OG1 1 
ATOM   8019 C CG2 . THR B 1 503 ? -30.824 -39.372 -34.732 1.00 42.16  ? 504  THR B CG2 1 
ATOM   8020 N N   . ALA B 1 504 ? -31.213 -36.056 -37.651 1.00 43.03  ? 505  ALA B N   1 
ATOM   8021 C CA  . ALA B 1 504 ? -31.578 -35.330 -38.865 1.00 48.54  ? 505  ALA B CA  1 
ATOM   8022 C C   . ALA B 1 504 ? -32.428 -36.186 -39.796 1.00 48.79  ? 505  ALA B C   1 
ATOM   8023 O O   . ALA B 1 504 ? -33.315 -35.661 -40.477 1.00 42.22  ? 505  ALA B O   1 
ATOM   8024 C CB  . ALA B 1 504 ? -30.327 -34.831 -39.588 1.00 48.32  ? 505  ALA B CB  1 
ATOM   8025 N N   . GLY B 1 505 ? -32.192 -37.498 -39.824 1.00 53.05  ? 506  GLY B N   1 
ATOM   8026 C CA  . GLY B 1 505 ? -32.993 -38.401 -40.633 1.00 46.38  ? 506  GLY B CA  1 
ATOM   8027 C C   . GLY B 1 505 ? -34.321 -38.777 -40.002 1.00 47.24  ? 506  GLY B C   1 
ATOM   8028 O O   . GLY B 1 505 ? -35.383 -38.434 -40.531 1.00 39.36  ? 506  GLY B O   1 
ATOM   8029 N N   . ALA B 1 506 ? -34.288 -39.469 -38.859 1.00 48.76  ? 507  ALA B N   1 
ATOM   8030 C CA  . ALA B 1 506 ? -35.537 -39.952 -38.276 1.00 37.47  ? 507  ALA B CA  1 
ATOM   8031 C C   . ALA B 1 506 ? -36.373 -38.816 -37.698 1.00 35.89  ? 507  ALA B C   1 
ATOM   8032 O O   . ALA B 1 506 ? -37.607 -38.891 -37.725 1.00 43.39  ? 507  ALA B O   1 
ATOM   8033 C CB  . ALA B 1 506 ? -35.253 -41.011 -37.211 1.00 35.99  ? 507  ALA B CB  1 
ATOM   8034 N N   . GLN B 1 507 ? -35.730 -37.767 -37.178 1.00 31.18  ? 508  GLN B N   1 
ATOM   8035 C CA  . GLN B 1 507 ? -36.421 -36.567 -36.681 1.00 38.10  ? 508  GLN B CA  1 
ATOM   8036 C C   . GLN B 1 507 ? -37.426 -36.896 -35.576 1.00 41.98  ? 508  GLN B C   1 
ATOM   8037 O O   . GLN B 1 507 ? -38.512 -36.320 -35.502 1.00 43.68  ? 508  GLN B O   1 
ATOM   8038 C CB  . GLN B 1 507 ? -37.101 -35.809 -37.823 1.00 30.84  ? 508  GLN B CB  1 
ATOM   8039 C CG  . GLN B 1 507 ? -36.155 -35.389 -38.936 1.00 43.05  ? 508  GLN B CG  1 
ATOM   8040 C CD  . GLN B 1 507 ? -36.883 -34.861 -40.161 1.00 44.03  ? 508  GLN B CD  1 
ATOM   8041 O OE1 . GLN B 1 507 ? -37.604 -33.864 -40.095 1.00 43.74  ? 508  GLN B OE1 1 
ATOM   8042 N NE2 . GLN B 1 507 ? -36.704 -35.539 -41.284 1.00 40.57  ? 508  GLN B NE2 1 
ATOM   8043 N N   . GLN B 1 508 ? -37.054 -37.815 -34.694 1.00 37.37  ? 509  GLN B N   1 
ATOM   8044 C CA  . GLN B 1 508 ? -37.971 -38.283 -33.667 1.00 38.90  ? 509  GLN B CA  1 
ATOM   8045 C C   . GLN B 1 508 ? -38.025 -37.328 -32.482 1.00 40.09  ? 509  GLN B C   1 
ATOM   8046 O O   . GLN B 1 508 ? -37.002 -36.792 -32.042 1.00 36.33  ? 509  GLN B O   1 
ATOM   8047 C CB  . GLN B 1 508 ? -37.564 -39.670 -33.189 1.00 35.04  ? 509  GLN B CB  1 
ATOM   8048 C CG  . GLN B 1 508 ? -37.765 -40.737 -34.222 1.00 37.73  ? 509  GLN B CG  1 
ATOM   8049 C CD  . GLN B 1 508 ? -37.301 -42.089 -33.741 1.00 44.66  ? 509  GLN B CD  1 
ATOM   8050 O OE1 . GLN B 1 508 ? -38.108 -42.986 -33.493 1.00 47.51  ? 509  GLN B OE1 1 
ATOM   8051 N NE2 . GLN B 1 508 ? -35.990 -42.245 -33.604 1.00 47.70  ? 509  GLN B NE2 1 
ATOM   8052 N N   . TYR B 1 509 ? -39.235 -37.127 -31.965 1.00 36.97  ? 510  TYR B N   1 
ATOM   8053 C CA  . TYR B 1 509 ? -39.467 -36.355 -30.755 1.00 35.32  ? 510  TYR B CA  1 
ATOM   8054 C C   . TYR B 1 509 ? -40.586 -37.027 -29.970 1.00 37.35  ? 510  TYR B C   1 
ATOM   8055 O O   . TYR B 1 509 ? -41.254 -37.942 -30.464 1.00 39.27  ? 510  TYR B O   1 
ATOM   8056 C CB  . TYR B 1 509 ? -39.815 -34.898 -31.079 1.00 34.33  ? 510  TYR B CB  1 
ATOM   8057 C CG  . TYR B 1 509 ? -41.165 -34.725 -31.746 1.00 36.37  ? 510  TYR B CG  1 
ATOM   8058 C CD1 . TYR B 1 509 ? -41.301 -34.817 -33.127 1.00 31.55  ? 510  TYR B CD1 1 
ATOM   8059 C CD2 . TYR B 1 509 ? -42.301 -34.463 -30.994 1.00 28.81  ? 510  TYR B CD2 1 
ATOM   8060 C CE1 . TYR B 1 509 ? -42.537 -34.655 -33.738 1.00 32.34  ? 510  TYR B CE1 1 
ATOM   8061 C CE2 . TYR B 1 509 ? -43.536 -34.306 -31.594 1.00 38.79  ? 510  TYR B CE2 1 
ATOM   8062 C CZ  . TYR B 1 509 ? -43.648 -34.397 -32.963 1.00 39.54  ? 510  TYR B CZ  1 
ATOM   8063 O OH  . TYR B 1 509 ? -44.879 -34.237 -33.548 1.00 41.78  ? 510  TYR B OH  1 
ATOM   8064 N N   . VAL B 1 510 ? -40.800 -36.568 -28.736 1.00 34.10  ? 511  VAL B N   1 
ATOM   8065 C CA  . VAL B 1 510 ? -41.856 -37.131 -27.904 1.00 33.71  ? 511  VAL B CA  1 
ATOM   8066 C C   . VAL B 1 510 ? -42.866 -36.047 -27.566 1.00 33.88  ? 511  VAL B C   1 
ATOM   8067 O O   . VAL B 1 510 ? -42.540 -34.856 -27.510 1.00 49.87  ? 511  VAL B O   1 
ATOM   8068 C CB  . VAL B 1 510 ? -41.314 -37.782 -26.615 1.00 31.08  ? 511  VAL B CB  1 
ATOM   8069 C CG1 . VAL B 1 510 ? -40.399 -38.933 -26.957 1.00 28.96  ? 511  VAL B CG1 1 
ATOM   8070 C CG2 . VAL B 1 510 ? -40.614 -36.744 -25.736 1.00 32.26  ? 511  VAL B CG2 1 
ATOM   8071 N N   . SER B 1 511 ? -44.111 -36.474 -27.347 1.00 35.98  ? 512  SER B N   1 
ATOM   8072 C CA  . SER B 1 511 ? -45.168 -35.590 -26.876 1.00 31.73  ? 512  SER B CA  1 
ATOM   8073 C C   . SER B 1 511 ? -45.194 -35.600 -25.357 1.00 33.48  ? 512  SER B C   1 
ATOM   8074 O O   . SER B 1 511 ? -45.246 -36.668 -24.740 1.00 33.53  ? 512  SER B O   1 
ATOM   8075 C CB  . SER B 1 511 ? -46.527 -36.012 -27.435 1.00 33.02  ? 512  SER B CB  1 
ATOM   8076 O OG  . SER B 1 511 ? -46.787 -37.371 -27.145 1.00 45.30  ? 512  SER B OG  1 
ATOM   8077 N N   . LEU B 1 512 ? -45.145 -34.411 -24.760 1.00 33.03  ? 513  LEU B N   1 
ATOM   8078 C CA  . LEU B 1 512 ? -45.262 -34.246 -23.315 1.00 35.75  ? 513  LEU B CA  1 
ATOM   8079 C C   . LEU B 1 512 ? -46.701 -33.860 -22.999 1.00 32.30  ? 513  LEU B C   1 
ATOM   8080 O O   . LEU B 1 512 ? -47.128 -32.739 -23.297 1.00 32.79  ? 513  LEU B O   1 
ATOM   8081 C CB  . LEU B 1 512 ? -44.287 -33.187 -22.802 1.00 26.14  ? 513  LEU B CB  1 
ATOM   8082 C CG  . LEU B 1 512 ? -42.800 -33.472 -23.033 1.00 34.88  ? 513  LEU B CG  1 
ATOM   8083 C CD1 . LEU B 1 512 ? -41.904 -32.424 -22.372 1.00 23.67  ? 513  LEU B CD1 1 
ATOM   8084 C CD2 . LEU B 1 512 ? -42.440 -34.863 -22.530 1.00 25.93  ? 513  LEU B CD2 1 
ATOM   8085 N N   . ASP B 1 513 ? -47.448 -34.787 -22.408 1.00 29.56  ? 514  ASP B N   1 
ATOM   8086 C CA  . ASP B 1 513 ? -48.755 -34.471 -21.842 1.00 37.55  ? 514  ASP B CA  1 
ATOM   8087 C C   . ASP B 1 513 ? -49.074 -35.527 -20.787 1.00 37.38  ? 514  ASP B C   1 
ATOM   8088 O O   . ASP B 1 513 ? -48.196 -36.289 -20.370 1.00 44.95  ? 514  ASP B O   1 
ATOM   8089 C CB  . ASP B 1 513 ? -49.814 -34.348 -22.948 1.00 42.05  ? 514  ASP B CB  1 
ATOM   8090 C CG  . ASP B 1 513 ? -50.019 -35.635 -23.723 1.00 54.33  ? 514  ASP B CG  1 
ATOM   8091 O OD1 . ASP B 1 513 ? -49.340 -36.644 -23.431 1.00 59.58  ? 514  ASP B OD1 1 
ATOM   8092 O OD2 . ASP B 1 513 ? -50.862 -35.630 -24.645 1.00 60.91  ? 514  ASP B OD2 1 
ATOM   8093 N N   . LEU B 1 514 ? -50.335 -35.571 -20.346 1.00 34.08  ? 515  LEU B N   1 
ATOM   8094 C CA  . LEU B 1 514 ? -50.707 -36.486 -19.270 1.00 44.05  ? 515  LEU B CA  1 
ATOM   8095 C C   . LEU B 1 514 ? -50.684 -37.941 -19.714 1.00 52.04  ? 515  LEU B C   1 
ATOM   8096 O O   . LEU B 1 514 ? -50.530 -38.839 -18.875 1.00 57.62  ? 515  LEU B O   1 
ATOM   8097 C CB  . LEU B 1 514 ? -52.076 -36.123 -18.706 1.00 45.82  ? 515  LEU B CB  1 
ATOM   8098 C CG  . LEU B 1 514 ? -52.333 -34.629 -18.521 1.00 47.87  ? 515  LEU B CG  1 
ATOM   8099 C CD1 . LEU B 1 514 ? -53.812 -34.400 -18.274 1.00 47.55  ? 515  LEU B CD1 1 
ATOM   8100 C CD2 . LEU B 1 514 ? -51.484 -34.051 -17.383 1.00 44.26  ? 515  LEU B CD2 1 
ATOM   8101 N N   . ARG B 1 515 ? -50.843 -38.196 -21.011 1.00 51.00  ? 516  ARG B N   1 
ATOM   8102 C CA  . ARG B 1 515 ? -50.649 -39.533 -21.546 1.00 51.20  ? 516  ARG B CA  1 
ATOM   8103 C C   . ARG B 1 515 ? -49.173 -39.914 -21.450 1.00 44.91  ? 516  ARG B C   1 
ATOM   8104 O O   . ARG B 1 515 ? -48.304 -39.042 -21.359 1.00 35.77  ? 516  ARG B O   1 
ATOM   8105 C CB  . ARG B 1 515 ? -51.108 -39.598 -23.001 1.00 54.32  ? 516  ARG B CB  1 
ATOM   8106 C CG  . ARG B 1 515 ? -52.600 -39.363 -23.224 1.00 62.97  ? 516  ARG B CG  1 
ATOM   8107 C CD  . ARG B 1 515 ? -52.869 -38.801 -24.619 1.00 73.33  ? 516  ARG B CD  1 
ATOM   8108 N NE  . ARG B 1 515 ? -52.146 -39.527 -25.663 1.00 83.31  ? 516  ARG B NE  1 
ATOM   8109 C CZ  . ARG B 1 515 ? -51.135 -39.028 -26.373 1.00 86.28  ? 516  ARG B CZ  1 
ATOM   8110 N NH1 . ARG B 1 515 ? -50.707 -37.791 -26.160 1.00 82.21  ? 516  ARG B NH1 1 
ATOM   8111 N NH2 . ARG B 1 515 ? -50.547 -39.773 -27.298 1.00 90.73  ? 516  ARG B NH2 1 
ATOM   8112 N N   . PRO B 1 516 ? -48.862 -41.210 -21.464 1.00 47.52  ? 517  PRO B N   1 
ATOM   8113 C CA  . PRO B 1 516 ? -47.455 -41.620 -21.538 1.00 45.51  ? 517  PRO B CA  1 
ATOM   8114 C C   . PRO B 1 516 ? -46.807 -41.105 -22.815 1.00 49.54  ? 517  PRO B C   1 
ATOM   8115 O O   . PRO B 1 516 ? -47.481 -40.714 -23.772 1.00 48.42  ? 517  PRO B O   1 
ATOM   8116 C CB  . PRO B 1 516 ? -47.522 -43.151 -21.524 1.00 47.12  ? 517  PRO B CB  1 
ATOM   8117 C CG  . PRO B 1 516 ? -48.859 -43.470 -20.923 1.00 48.52  ? 517  PRO B CG  1 
ATOM   8118 C CD  . PRO B 1 516 ? -49.771 -42.365 -21.360 1.00 48.14  ? 517  PRO B CD  1 
ATOM   8119 N N   . LEU B 1 517 ? -45.473 -41.106 -22.815 1.00 44.46  ? 518  LEU B N   1 
ATOM   8120 C CA  . LEU B 1 517 ? -44.710 -40.575 -23.940 1.00 41.39  ? 518  LEU B CA  1 
ATOM   8121 C C   . LEU B 1 517 ? -45.128 -41.232 -25.247 1.00 42.43  ? 518  LEU B C   1 
ATOM   8122 O O   . LEU B 1 517 ? -45.297 -42.451 -25.328 1.00 46.18  ? 518  LEU B O   1 
ATOM   8123 C CB  . LEU B 1 517 ? -43.214 -40.796 -23.720 1.00 43.01  ? 518  LEU B CB  1 
ATOM   8124 C CG  . LEU B 1 517 ? -42.514 -39.924 -22.685 1.00 43.25  ? 518  LEU B CG  1 
ATOM   8125 C CD1 . LEU B 1 517 ? -41.016 -40.168 -22.736 1.00 39.75  ? 518  LEU B CD1 1 
ATOM   8126 C CD2 . LEU B 1 517 ? -42.841 -38.457 -22.917 1.00 43.12  ? 518  LEU B CD2 1 
ATOM   8127 N N   . GLU B 1 518 ? -45.301 -40.409 -26.272 1.00 43.15  ? 519  GLU B N   1 
ATOM   8128 C CA  . GLU B 1 518 ? -45.569 -40.875 -27.623 1.00 49.31  ? 519  GLU B CA  1 
ATOM   8129 C C   . GLU B 1 518 ? -44.464 -40.349 -28.524 1.00 44.11  ? 519  GLU B C   1 
ATOM   8130 O O   . GLU B 1 518 ? -44.135 -39.160 -28.472 1.00 41.35  ? 519  GLU B O   1 
ATOM   8131 C CB  . GLU B 1 518 ? -46.943 -40.405 -28.111 1.00 56.75  ? 519  GLU B CB  1 
ATOM   8132 C CG  . GLU B 1 518 ? -47.401 -41.048 -29.413 1.00 69.82  ? 519  GLU B CG  1 
ATOM   8133 C CD  . GLU B 1 518 ? -48.555 -40.300 -30.056 1.00 82.02  ? 519  GLU B CD  1 
ATOM   8134 O OE1 . GLU B 1 518 ? -48.532 -40.108 -31.292 1.00 86.55  ? 519  GLU B OE1 1 
ATOM   8135 O OE2 . GLU B 1 518 ? -49.484 -39.900 -29.325 1.00 87.64  ? 519  GLU B OE2 1 
ATOM   8136 N N   . VAL B 1 519 ? -43.875 -41.232 -29.319 1.00 44.06  ? 520  VAL B N   1 
ATOM   8137 C CA  . VAL B 1 519 ? -42.783 -40.866 -30.213 1.00 42.94  ? 520  VAL B CA  1 
ATOM   8138 C C   . VAL B 1 519 ? -43.359 -40.554 -31.587 1.00 39.47  ? 520  VAL B C   1 
ATOM   8139 O O   . VAL B 1 519 ? -44.114 -41.353 -32.151 1.00 42.92  ? 520  VAL B O   1 
ATOM   8140 C CB  . VAL B 1 519 ? -41.736 -41.989 -30.297 1.00 44.95  ? 520  VAL B CB  1 
ATOM   8141 C CG1 . VAL B 1 519 ? -40.676 -41.647 -31.345 1.00 37.98  ? 520  VAL B CG1 1 
ATOM   8142 C CG2 . VAL B 1 519 ? -41.102 -42.230 -28.925 1.00 40.78  ? 520  VAL B CG2 1 
ATOM   8143 N N   . ARG B 1 520 ? -43.003 -39.390 -32.122 1.00 40.63  ? 521  ARG B N   1 
ATOM   8144 C CA  . ARG B 1 520 ? -43.450 -38.947 -33.433 1.00 45.73  ? 521  ARG B CA  1 
ATOM   8145 C C   . ARG B 1 520 ? -42.248 -38.502 -34.256 1.00 45.60  ? 521  ARG B C   1 
ATOM   8146 O O   . ARG B 1 520 ? -41.146 -38.309 -33.734 1.00 39.93  ? 521  ARG B O   1 
ATOM   8147 C CB  . ARG B 1 520 ? -44.470 -37.812 -33.312 1.00 42.26  ? 521  ARG B CB  1 
ATOM   8148 C CG  . ARG B 1 520 ? -45.684 -38.203 -32.509 1.00 42.53  ? 521  ARG B CG  1 
ATOM   8149 C CD  . ARG B 1 520 ? -46.670 -37.072 -32.428 1.00 47.24  ? 521  ARG B CD  1 
ATOM   8150 N NE  . ARG B 1 520 ? -47.657 -37.309 -31.384 1.00 57.19  ? 521  ARG B NE  1 
ATOM   8151 C CZ  . ARG B 1 520 ? -48.282 -36.339 -30.729 1.00 59.03  ? 521  ARG B CZ  1 
ATOM   8152 N NH1 . ARG B 1 520 ? -48.014 -35.073 -31.023 1.00 55.04  ? 521  ARG B NH1 1 
ATOM   8153 N NH2 . ARG B 1 520 ? -49.169 -36.633 -29.788 1.00 56.02  ? 521  ARG B NH2 1 
ATOM   8154 N N   . ARG B 1 521 ? -42.471 -38.340 -35.557 1.00 43.84  ? 522  ARG B N   1 
ATOM   8155 C CA  . ARG B 1 521 ? -41.431 -37.930 -36.491 1.00 44.92  ? 522  ARG B CA  1 
ATOM   8156 C C   . ARG B 1 521 ? -41.747 -36.549 -37.050 1.00 45.54  ? 522  ARG B C   1 
ATOM   8157 O O   . ARG B 1 521 ? -42.884 -36.284 -37.454 1.00 51.43  ? 522  ARG B O   1 
ATOM   8158 C CB  . ARG B 1 521 ? -41.298 -38.938 -37.633 1.00 42.54  ? 522  ARG B CB  1 
ATOM   8159 C CG  . ARG B 1 521 ? -40.879 -40.325 -37.192 1.00 48.01  ? 522  ARG B CG  1 
ATOM   8160 C CD  . ARG B 1 521 ? -40.304 -41.116 -38.351 1.00 48.59  ? 522  ARG B CD  1 
ATOM   8161 N NE  . ARG B 1 521 ? -39.329 -40.339 -39.112 1.00 49.71  ? 522  ARG B NE  1 
ATOM   8162 C CZ  . ARG B 1 521 ? -39.335 -40.217 -40.436 1.00 55.22  ? 522  ARG B CZ  1 
ATOM   8163 N NH1 . ARG B 1 521 ? -40.266 -40.826 -41.160 1.00 57.74  ? 522  ARG B NH1 1 
ATOM   8164 N NH2 . ARG B 1 521 ? -38.406 -39.488 -41.038 1.00 55.93  ? 522  ARG B NH2 1 
ATOM   8165 N N   . GLY B 1 522 ? -40.745 -35.673 -37.061 1.00 40.17  ? 523  GLY B N   1 
ATOM   8166 C CA  . GLY B 1 522 ? -40.845 -34.411 -37.769 1.00 40.18  ? 523  GLY B CA  1 
ATOM   8167 C C   . GLY B 1 522 ? -41.384 -33.241 -36.975 1.00 39.04  ? 523  GLY B C   1 
ATOM   8168 O O   . GLY B 1 522 ? -42.553 -33.230 -36.580 1.00 44.62  ? 523  GLY B O   1 
ATOM   8169 N N   . LEU B 1 523 ? -40.541 -32.237 -36.743 1.00 39.83  ? 524  LEU B N   1 
ATOM   8170 C CA  . LEU B 1 523 ? -40.971 -30.992 -36.106 1.00 40.27  ? 524  LEU B CA  1 
ATOM   8171 C C   . LEU B 1 523 ? -41.465 -30.067 -37.210 1.00 40.03  ? 524  LEU B C   1 
ATOM   8172 O O   . LEU B 1 523 ? -40.719 -29.236 -37.732 1.00 43.05  ? 524  LEU B O   1 
ATOM   8173 C CB  . LEU B 1 523 ? -39.831 -30.360 -35.316 1.00 32.15  ? 524  LEU B CB  1 
ATOM   8174 C CG  . LEU B 1 523 ? -39.379 -31.067 -34.042 1.00 38.14  ? 524  LEU B CG  1 
ATOM   8175 C CD1 . LEU B 1 523 ? -38.089 -30.450 -33.527 1.00 38.24  ? 524  LEU B CD1 1 
ATOM   8176 C CD2 . LEU B 1 523 ? -40.470 -30.982 -32.997 1.00 39.12  ? 524  LEU B CD2 1 
ATOM   8177 N N   . ARG B 1 524 ? -42.738 -30.221 -37.573 1.00 39.95  ? 525  ARG B N   1 
ATOM   8178 C CA  . ARG B 1 524 ? -43.323 -29.492 -38.698 1.00 40.97  ? 525  ARG B CA  1 
ATOM   8179 C C   . ARG B 1 524 ? -42.404 -29.560 -39.919 1.00 39.32  ? 525  ARG B C   1 
ATOM   8180 O O   . ARG B 1 524 ? -42.004 -28.539 -40.488 1.00 39.04  ? 525  ARG B O   1 
ATOM   8181 C CB  . ARG B 1 524 ? -43.614 -28.043 -38.307 1.00 40.47  ? 525  ARG B CB  1 
ATOM   8182 C CG  . ARG B 1 524 ? -44.359 -27.891 -36.992 1.00 47.74  ? 525  ARG B CG  1 
ATOM   8183 C CD  . ARG B 1 524 ? -45.840 -27.769 -37.233 1.00 56.30  ? 525  ARG B CD  1 
ATOM   8184 N NE  . ARG B 1 524 ? -46.129 -26.734 -38.221 1.00 69.04  ? 525  ARG B NE  1 
ATOM   8185 C CZ  . ARG B 1 524 ? -47.191 -26.732 -39.024 1.00 66.13  ? 525  ARG B CZ  1 
ATOM   8186 N NH1 . ARG B 1 524 ? -48.078 -27.718 -38.962 1.00 71.02  ? 525  ARG B NH1 1 
ATOM   8187 N NH2 . ARG B 1 524 ? -47.362 -25.742 -39.890 1.00 48.85  ? 525  ARG B NH2 1 
ATOM   8188 N N   . ALA B 1 525 ? -42.054 -30.790 -40.310 1.00 30.74  ? 526  ALA B N   1 
ATOM   8189 C CA  . ALA B 1 525 ? -40.993 -30.986 -41.301 1.00 37.43  ? 526  ALA B CA  1 
ATOM   8190 C C   . ALA B 1 525 ? -41.316 -30.304 -42.626 1.00 37.29  ? 526  ALA B C   1 
ATOM   8191 O O   . ALA B 1 525 ? -40.452 -29.638 -43.212 1.00 40.97  ? 526  ALA B O   1 
ATOM   8192 C CB  . ALA B 1 525 ? -40.738 -32.477 -41.518 1.00 41.05  ? 526  ALA B CB  1 
ATOM   8193 N N   . GLN B 1 526 ? -42.550 -30.458 -43.120 1.00 30.83  ? 527  GLN B N   1 
ATOM   8194 C CA  . GLN B 1 526 ? -42.906 -29.833 -44.392 1.00 39.74  ? 527  GLN B CA  1 
ATOM   8195 C C   . GLN B 1 526 ? -42.880 -28.313 -44.290 1.00 37.49  ? 527  GLN B C   1 
ATOM   8196 O O   . GLN B 1 526 ? -42.356 -27.635 -45.182 1.00 48.04  ? 527  GLN B O   1 
ATOM   8197 C CB  . GLN B 1 526 ? -44.275 -30.320 -44.873 1.00 39.66  ? 527  GLN B CB  1 
ATOM   8198 C CG  . GLN B 1 526 ? -44.354 -31.828 -45.058 1.00 46.32  ? 527  GLN B CG  1 
ATOM   8199 C CD  . GLN B 1 526 ? -43.409 -32.337 -46.145 1.00 54.30  ? 527  GLN B CD  1 
ATOM   8200 O OE1 . GLN B 1 526 ? -42.636 -33.269 -45.921 1.00 66.39  ? 527  GLN B OE1 1 
ATOM   8201 N NE2 . GLN B 1 526 ? -43.469 -31.725 -47.320 1.00 60.17  ? 527  GLN B NE2 1 
ATOM   8202 N N   . ALA B 1 527 ? -43.437 -27.759 -43.211 1.00 36.15  ? 528  ALA B N   1 
ATOM   8203 C CA  . ALA B 1 527 ? -43.431 -26.309 -43.041 1.00 35.80  ? 528  ALA B CA  1 
ATOM   8204 C C   . ALA B 1 527 ? -42.012 -25.771 -42.899 1.00 35.91  ? 528  ALA B C   1 
ATOM   8205 O O   . ALA B 1 527 ? -41.662 -24.756 -43.510 1.00 40.24  ? 528  ALA B O   1 
ATOM   8206 C CB  . ALA B 1 527 ? -44.275 -25.919 -41.823 1.00 34.98  ? 528  ALA B CB  1 
ATOM   8207 N N   . CYS B 1 528 ? -41.178 -26.444 -42.110 1.00 28.41  ? 529  CYS B N   1 
ATOM   8208 C CA  . CYS B 1 528 ? -39.838 -25.942 -41.834 1.00 34.00  ? 529  CYS B CA  1 
ATOM   8209 C C   . CYS B 1 528 ? -38.892 -26.092 -43.020 1.00 38.49  ? 529  CYS B C   1 
ATOM   8210 O O   . CYS B 1 528 ? -37.938 -25.311 -43.145 1.00 33.21  ? 529  CYS B O   1 
ATOM   8211 C CB  . CYS B 1 528 ? -39.296 -26.638 -40.588 1.00 36.15  ? 529  CYS B CB  1 
ATOM   8212 S SG  . CYS B 1 528 ? -40.246 -26.115 -39.119 1.00 39.52  ? 529  CYS B SG  1 
ATOM   8213 N N   . ALA B 1 529 ? -39.141 -27.049 -43.910 1.00 31.14  ? 530  ALA B N   1 
ATOM   8214 C CA  . ALA B 1 529 ? -38.396 -27.065 -45.161 1.00 34.97  ? 530  ALA B CA  1 
ATOM   8215 C C   . ALA B 1 529 ? -38.623 -25.778 -45.945 1.00 32.14  ? 530  ALA B C   1 
ATOM   8216 O O   . ALA B 1 529 ? -37.699 -25.270 -46.590 1.00 32.01  ? 530  ALA B O   1 
ATOM   8217 C CB  . ALA B 1 529 ? -38.781 -28.293 -45.981 1.00 28.66  ? 530  ALA B CB  1 
ATOM   8218 N N   . PHE B 1 530 ? -39.830 -25.214 -45.861 1.00 31.22  ? 531  PHE B N   1 
ATOM   8219 C CA  . PHE B 1 530 ? -40.108 -23.929 -46.499 1.00 34.31  ? 531  PHE B CA  1 
ATOM   8220 C C   . PHE B 1 530 ? -39.248 -22.820 -45.898 1.00 34.51  ? 531  PHE B C   1 
ATOM   8221 O O   . PHE B 1 530 ? -38.582 -22.077 -46.627 1.00 33.52  ? 531  PHE B O   1 
ATOM   8222 C CB  . PHE B 1 530 ? -41.602 -23.611 -46.368 1.00 36.22  ? 531  PHE B CB  1 
ATOM   8223 C CG  . PHE B 1 530 ? -41.969 -22.189 -46.692 1.00 40.68  ? 531  PHE B CG  1 
ATOM   8224 C CD1 . PHE B 1 530 ? -41.980 -21.744 -47.996 1.00 42.01  ? 531  PHE B CD1 1 
ATOM   8225 C CD2 . PHE B 1 530 ? -42.350 -21.311 -45.692 1.00 40.75  ? 531  PHE B CD2 1 
ATOM   8226 C CE1 . PHE B 1 530 ? -42.329 -20.444 -48.306 1.00 46.96  ? 531  PHE B CE1 1 
ATOM   8227 C CE2 . PHE B 1 530 ? -42.711 -20.008 -45.997 1.00 45.32  ? 531  PHE B CE2 1 
ATOM   8228 C CZ  . PHE B 1 530 ? -42.692 -19.575 -47.306 1.00 49.64  ? 531  PHE B CZ  1 
ATOM   8229 N N   . TRP B 1 531 ? -39.222 -22.712 -44.561 1.00 28.77  ? 532  TRP B N   1 
ATOM   8230 C CA  . TRP B 1 531 ? -38.486 -21.622 -43.921 1.00 38.73  ? 532  TRP B CA  1 
ATOM   8231 C C   . TRP B 1 531 ? -36.983 -21.865 -43.920 1.00 38.68  ? 532  TRP B C   1 
ATOM   8232 O O   . TRP B 1 531 ? -36.200 -20.925 -44.089 1.00 41.44  ? 532  TRP B O   1 
ATOM   8233 C CB  . TRP B 1 531 ? -38.975 -21.410 -42.486 1.00 27.01  ? 532  TRP B CB  1 
ATOM   8234 C CG  . TRP B 1 531 ? -40.418 -21.024 -42.402 1.00 30.61  ? 532  TRP B CG  1 
ATOM   8235 C CD1 . TRP B 1 531 ? -41.479 -21.853 -42.150 1.00 28.53  ? 532  TRP B CD1 1 
ATOM   8236 C CD2 . TRP B 1 531 ? -40.966 -19.714 -42.576 1.00 30.27  ? 532  TRP B CD2 1 
ATOM   8237 N NE1 . TRP B 1 531 ? -42.650 -21.136 -42.154 1.00 29.38  ? 532  TRP B NE1 1 
ATOM   8238 C CE2 . TRP B 1 531 ? -42.364 -19.821 -42.412 1.00 30.87  ? 532  TRP B CE2 1 
ATOM   8239 C CE3 . TRP B 1 531 ? -40.411 -18.459 -42.849 1.00 25.65  ? 532  TRP B CE3 1 
ATOM   8240 C CZ2 . TRP B 1 531 ? -43.214 -18.719 -42.515 1.00 33.20  ? 532  TRP B CZ2 1 
ATOM   8241 C CZ3 . TRP B 1 531 ? -41.256 -17.369 -42.953 1.00 27.88  ? 532  TRP B CZ3 1 
ATOM   8242 C CH2 . TRP B 1 531 ? -42.643 -17.506 -42.787 1.00 32.98  ? 532  TRP B CH2 1 
ATOM   8243 N N   . ASN B 1 532 ? -36.557 -23.108 -43.726 1.00 34.20  ? 533  ASN B N   1 
ATOM   8244 C CA  . ASN B 1 532 ? -35.142 -23.380 -43.546 1.00 36.84  ? 533  ASN B CA  1 
ATOM   8245 C C   . ASN B 1 532 ? -34.415 -23.720 -44.839 1.00 43.14  ? 533  ASN B C   1 
ATOM   8246 O O   . ASN B 1 532 ? -33.182 -23.646 -44.867 1.00 48.72  ? 533  ASN B O   1 
ATOM   8247 C CB  . ASN B 1 532 ? -34.950 -24.514 -42.533 1.00 35.37  ? 533  ASN B CB  1 
ATOM   8248 C CG  . ASN B 1 532 ? -35.447 -24.142 -41.146 1.00 39.34  ? 533  ASN B CG  1 
ATOM   8249 O OD1 . ASN B 1 532 ? -35.506 -22.964 -40.800 1.00 35.80  ? 533  ASN B OD1 1 
ATOM   8250 N ND2 . ASN B 1 532 ? -35.809 -25.146 -40.345 1.00 35.61  ? 533  ASN B ND2 1 
ATOM   8251 N N   . ARG B 1 533 ? -35.125 -24.074 -45.911 1.00 41.96  ? 534  ARG B N   1 
ATOM   8252 C CA  . ARG B 1 533 ? -34.436 -24.488 -47.130 1.00 54.61  ? 534  ARG B CA  1 
ATOM   8253 C C   . ARG B 1 533 ? -34.736 -23.601 -48.333 1.00 57.37  ? 534  ARG B C   1 
ATOM   8254 O O   . ARG B 1 533 ? -33.803 -23.223 -49.050 1.00 58.04  ? 534  ARG B O   1 
ATOM   8255 C CB  . ARG B 1 533 ? -34.760 -25.963 -47.444 1.00 52.91  ? 534  ARG B CB  1 
ATOM   8256 C CG  . ARG B 1 533 ? -34.307 -26.960 -46.383 1.00 48.91  ? 534  ARG B CG  1 
ATOM   8257 C CD  . ARG B 1 533 ? -34.852 -28.363 -46.648 1.00 55.08  ? 534  ARG B CD  1 
ATOM   8258 N NE  . ARG B 1 533 ? -34.679 -29.234 -45.489 1.00 62.49  ? 534  ARG B NE  1 
ATOM   8259 C CZ  . ARG B 1 533 ? -33.623 -30.018 -45.296 1.00 65.60  ? 534  ARG B CZ  1 
ATOM   8260 N NH1 . ARG B 1 533 ? -32.650 -30.048 -46.199 1.00 56.27  ? 534  ARG B NH1 1 
ATOM   8261 N NH2 . ARG B 1 533 ? -33.542 -30.774 -44.206 1.00 67.73  ? 534  ARG B NH2 1 
ATOM   8262 N N   . PHE B 1 534 ? -36.001 -23.242 -48.585 1.00 59.66  ? 535  PHE B N   1 
ATOM   8263 C CA  . PHE B 1 534 ? -36.323 -22.435 -49.766 1.00 57.52  ? 535  PHE B CA  1 
ATOM   8264 C C   . PHE B 1 534 ? -36.088 -20.952 -49.532 1.00 59.75  ? 535  PHE B C   1 
ATOM   8265 O O   . PHE B 1 534 ? -35.285 -20.324 -50.227 1.00 60.90  ? 535  PHE B O   1 
ATOM   8266 C CB  . PHE B 1 534 ? -37.778 -22.627 -50.193 1.00 44.41  ? 535  PHE B CB  1 
ATOM   8267 C CG  . PHE B 1 534 ? -38.167 -21.806 -51.399 1.00 48.66  ? 535  PHE B CG  1 
ATOM   8268 C CD1 . PHE B 1 534 ? -37.503 -21.957 -52.597 1.00 52.05  ? 535  PHE B CD1 1 
ATOM   8269 C CD2 . PHE B 1 534 ? -39.184 -20.872 -51.329 1.00 55.22  ? 535  PHE B CD2 1 
ATOM   8270 C CE1 . PHE B 1 534 ? -37.848 -21.203 -53.713 1.00 52.36  ? 535  PHE B CE1 1 
ATOM   8271 C CE2 . PHE B 1 534 ? -39.546 -20.128 -52.439 1.00 58.76  ? 535  PHE B CE2 1 
ATOM   8272 C CZ  . PHE B 1 534 ? -38.868 -20.284 -53.630 1.00 58.54  ? 535  PHE B CZ  1 
ATOM   8273 N N   . LEU B 1 535 ? -36.818 -20.371 -48.583 1.00 58.07  ? 536  LEU B N   1 
ATOM   8274 C CA  . LEU B 1 535 ? -36.780 -18.925 -48.394 1.00 63.27  ? 536  LEU B CA  1 
ATOM   8275 C C   . LEU B 1 535 ? -35.380 -18.325 -48.332 1.00 68.98  ? 536  LEU B C   1 
ATOM   8276 O O   . LEU B 1 535 ? -35.189 -17.240 -48.906 1.00 69.27  ? 536  LEU B O   1 
ATOM   8277 C CB  . LEU B 1 535 ? -37.555 -18.541 -47.131 1.00 59.09  ? 536  LEU B CB  1 
ATOM   8278 C CG  . LEU B 1 535 ? -38.285 -17.215 -47.317 1.00 70.87  ? 536  LEU B CG  1 
ATOM   8279 C CD1 . LEU B 1 535 ? -39.562 -17.446 -48.103 1.00 76.75  ? 536  LEU B CD1 1 
ATOM   8280 C CD2 . LEU B 1 535 ? -38.570 -16.537 -45.989 1.00 72.21  ? 536  LEU B CD2 1 
ATOM   8281 N N   . PRO B 1 536 ? -34.434 -19.000 -47.723 1.00 67.62  ? 537  PRO B N   1 
ATOM   8282 C CA  . PRO B 1 536 ? -33.130 -18.379 -47.688 1.00 68.68  ? 537  PRO B CA  1 
ATOM   8283 C C   . PRO B 1 536 ? -32.595 -18.193 -49.098 1.00 73.45  ? 537  PRO B C   1 
ATOM   8284 O O   . PRO B 1 536 ? -32.014 -17.179 -49.389 1.00 74.10  ? 537  PRO B O   1 
ATOM   8285 C CB  . PRO B 1 536 ? -32.303 -19.387 -46.923 1.00 61.64  ? 537  PRO B CB  1 
ATOM   8286 C CG  . PRO B 1 536 ? -33.279 -20.236 -46.233 1.00 57.45  ? 537  PRO B CG  1 
ATOM   8287 C CD  . PRO B 1 536 ? -34.415 -20.339 -47.148 1.00 61.68  ? 537  PRO B CD  1 
ATOM   8288 N N   . LYS B 1 537 ? -32.845 -19.143 -49.988 1.00 72.95  ? 538  LYS B N   1 
ATOM   8289 C CA  . LYS B 1 537 ? -32.411 -19.037 -51.371 1.00 71.19  ? 538  LYS B CA  1 
ATOM   8290 C C   . LYS B 1 537 ? -33.042 -17.875 -52.098 1.00 75.03  ? 538  LYS B C   1 
ATOM   8291 O O   . LYS B 1 537 ? -32.410 -17.149 -52.824 1.00 81.28  ? 538  LYS B O   1 
ATOM   8292 C CB  . LYS B 1 537 ? -32.818 -20.279 -52.119 1.00 70.61  ? 538  LYS B CB  1 
ATOM   8293 C CG  . LYS B 1 537 ? -32.217 -21.525 -51.563 1.00 71.62  ? 538  LYS B CG  1 
ATOM   8294 C CD  . LYS B 1 537 ? -32.250 -22.630 -52.576 1.00 76.83  ? 538  LYS B CD  1 
ATOM   8295 C CE  . LYS B 1 537 ? -31.692 -23.889 -51.972 1.00 78.77  ? 538  LYS B CE  1 
ATOM   8296 N NZ  . LYS B 1 537 ? -30.722 -23.592 -50.908 1.00 78.22  ? 538  LYS B NZ  1 
ATOM   8297 N N   . LEU B 1 538 ? -34.321 -17.721 -51.899 1.00 74.37  ? 539  LEU B N   1 
ATOM   8298 C CA  . LEU B 1 538 ? -35.055 -16.670 -52.521 1.00 83.18  ? 539  LEU B CA  1 
ATOM   8299 C C   . LEU B 1 538 ? -34.640 -15.289 -52.057 1.00 99.55  ? 539  LEU B C   1 
ATOM   8300 O O   . LEU B 1 538 ? -34.527 -14.385 -52.854 1.00 108.26 ? 539  LEU B O   1 
ATOM   8301 C CB  . LEU B 1 538 ? -36.520 -16.921 -52.288 1.00 78.47  ? 539  LEU B CB  1 
ATOM   8302 C CG  . LEU B 1 538 ? -37.579 -15.880 -52.509 1.00 82.42  ? 539  LEU B CG  1 
ATOM   8303 C CD1 . LEU B 1 538 ? -38.908 -16.587 -52.420 1.00 77.91  ? 539  LEU B CD1 1 
ATOM   8304 C CD2 . LEU B 1 538 ? -37.522 -14.820 -51.453 1.00 91.10  ? 539  LEU B CD2 1 
ATOM   8305 N N   . LEU B 1 539 ? -34.367 -15.115 -50.777 1.00 107.12 ? 540  LEU B N   1 
ATOM   8306 C CA  . LEU B 1 539 ? -34.022 -13.784 -50.286 1.00 118.45 ? 540  LEU B CA  1 
ATOM   8307 C C   . LEU B 1 539 ? -32.741 -13.241 -50.914 1.00 123.72 ? 540  LEU B C   1 
ATOM   8308 O O   . LEU B 1 539 ? -32.663 -12.074 -51.225 1.00 131.82 ? 540  LEU B O   1 
ATOM   8309 C CB  . LEU B 1 539 ? -34.047 -13.674 -48.748 1.00 120.00 ? 540  LEU B CB  1 
ATOM   8310 C CG  . LEU B 1 539 ? -35.426 -13.605 -48.047 1.00 119.34 ? 540  LEU B CG  1 
ATOM   8311 C CD1 . LEU B 1 539 ? -35.378 -13.945 -46.571 1.00 111.95 ? 540  LEU B CD1 1 
ATOM   8312 C CD2 . LEU B 1 539 ? -36.225 -12.331 -48.250 1.00 124.43 ? 540  LEU B CD2 1 
ATOM   8313 N N   . SER B 1 540 ? -31.767 -14.101 -51.145 1.00 117.19 ? 541  SER B N   1 
ATOM   8314 C CA  . SER B 1 540 ? -30.511 -13.700 -51.731 1.00 115.92 ? 541  SER B CA  1 
ATOM   8315 C C   . SER B 1 540 ? -30.656 -13.327 -53.195 1.00 119.55 ? 541  SER B C   1 
ATOM   8316 O O   . SER B 1 540 ? -29.694 -12.909 -53.828 1.00 122.89 ? 541  SER B O   1 
ATOM   8317 C CB  . SER B 1 540 ? -29.494 -14.831 -51.622 1.00 111.22 ? 541  SER B CB  1 
ATOM   8318 O OG  . SER B 1 540 ? -29.423 -15.611 -52.803 1.00 108.99 ? 541  SER B OG  1 
ATOM   8319 N N   . ALA B 1 541 ? -31.838 -13.544 -53.749 1.00 117.45 ? 542  ALA B N   1 
ATOM   8320 C CA  . ALA B 1 541 ? -32.049 -13.364 -55.173 1.00 114.01 ? 542  ALA B CA  1 
ATOM   8321 C C   . ALA B 1 541 ? -33.313 -12.567 -55.476 1.00 115.78 ? 542  ALA B C   1 
ATOM   8322 O O   . ALA B 1 541 ? -33.737 -11.723 -54.683 1.00 118.29 ? 542  ALA B O   1 
ATOM   8323 C CB  . ALA B 1 541 ? -32.099 -14.712 -55.840 1.00 108.73 ? 542  ALA B CB  1 
HETATM 8324 C C1  . NAG C 2 .   ? -34.010 49.242  -43.190 1.00 76.02  ? 1    NAG C C1  1 
HETATM 8325 C C2  . NAG C 2 .   ? -32.674 48.959  -43.871 1.00 88.30  ? 1    NAG C C2  1 
HETATM 8326 C C3  . NAG C 2 .   ? -32.010 47.717  -43.295 1.00 89.80  ? 1    NAG C C3  1 
HETATM 8327 C C4  . NAG C 2 .   ? -31.935 47.828  -41.780 1.00 94.16  ? 1    NAG C C4  1 
HETATM 8328 C C5  . NAG C 2 .   ? -33.321 48.096  -41.209 1.00 89.03  ? 1    NAG C C5  1 
HETATM 8329 C C6  . NAG C 2 .   ? -33.268 48.228  -39.692 1.00 94.62  ? 1    NAG C C6  1 
HETATM 8330 C C7  . NAG C 2 .   ? -32.953 49.849  -46.111 1.00 109.24 ? 1    NAG C C7  1 
HETATM 8331 C C8  . NAG C 2 .   ? -31.711 50.171  -46.888 1.00 108.81 ? 1    NAG C C8  1 
HETATM 8332 N N2  . NAG C 2 .   ? -32.869 48.799  -45.299 1.00 99.95  ? 1    NAG C N2  1 
HETATM 8333 O O3  . NAG C 2 .   ? -30.690 47.585  -43.833 1.00 90.58  ? 1    NAG C O3  1 
HETATM 8334 O O4  . NAG C 2 .   ? -31.419 46.609  -41.235 1.00 106.33 ? 1    NAG C O4  1 
HETATM 8335 O O5  . NAG C 2 .   ? -33.863 49.293  -41.769 1.00 77.33  ? 1    NAG C O5  1 
HETATM 8336 O O6  . NAG C 2 .   ? -32.551 49.417  -39.340 1.00 100.32 ? 1    NAG C O6  1 
HETATM 8337 O O7  . NAG C 2 .   ? -33.975 50.507  -46.218 1.00 115.35 ? 1    NAG C O7  1 
HETATM 8338 C C1  . NAG C 2 .   ? -30.228 46.907  -40.483 1.00 114.56 ? 2    NAG C C1  1 
HETATM 8339 C C2  . NAG C 2 .   ? -29.567 45.611  -40.020 1.00 115.82 ? 2    NAG C C2  1 
HETATM 8340 C C3  . NAG C 2 .   ? -28.267 45.891  -39.279 1.00 120.17 ? 2    NAG C C3  1 
HETATM 8341 C C4  . NAG C 2 .   ? -27.375 46.791  -40.119 1.00 123.37 ? 2    NAG C C4  1 
HETATM 8342 C C5  . NAG C 2 .   ? -28.131 48.055  -40.504 1.00 121.57 ? 2    NAG C C5  1 
HETATM 8343 C C6  . NAG C 2 .   ? -27.261 48.969  -41.359 1.00 118.16 ? 2    NAG C C6  1 
HETATM 8344 C C7  . NAG C 2 .   ? -31.181 43.839  -39.613 1.00 109.32 ? 2    NAG C C7  1 
HETATM 8345 C C8  . NAG C 2 .   ? -30.845 43.374  -40.999 1.00 105.54 ? 2    NAG C C8  1 
HETATM 8346 N N2  . NAG C 2 .   ? -30.464 44.864  -39.159 1.00 112.40 ? 2    NAG C N2  1 
HETATM 8347 O O3  . NAG C 2 .   ? -27.591 44.658  -39.013 1.00 119.64 ? 2    NAG C O3  1 
HETATM 8348 O O4  . NAG C 2 .   ? -26.205 47.140  -39.371 1.00 125.12 ? 2    NAG C O4  1 
HETATM 8349 O O5  . NAG C 2 .   ? -29.316 47.718  -41.226 1.00 120.24 ? 2    NAG C O5  1 
HETATM 8350 O O6  . NAG C 2 .   ? -26.019 49.211  -40.687 1.00 115.76 ? 2    NAG C O6  1 
HETATM 8351 O O7  . NAG C 2 .   ? -32.055 43.311  -38.945 1.00 110.41 ? 2    NAG C O7  1 
HETATM 8352 C C1  . FUC C 2 .   ? -33.056 49.905  -38.084 1.00 105.45 ? 3    FUC C C1  1 
HETATM 8353 C C2  . FUC C 2 .   ? -31.913 49.996  -37.078 1.00 108.44 ? 3    FUC C C2  1 
HETATM 8354 C C3  . FUC C 2 .   ? -30.966 51.139  -37.415 1.00 113.83 ? 3    FUC C C3  1 
HETATM 8355 C C4  . FUC C 2 .   ? -31.757 52.426  -37.590 1.00 113.15 ? 3    FUC C C4  1 
HETATM 8356 C C5  . FUC C 2 .   ? -32.858 52.224  -38.623 1.00 107.94 ? 3    FUC C C5  1 
HETATM 8357 C C6  . FUC C 2 .   ? -33.673 53.499  -38.804 1.00 104.40 ? 3    FUC C C6  1 
HETATM 8358 O O2  . FUC C 2 .   ? -31.185 48.762  -37.067 1.00 104.72 ? 3    FUC C O2  1 
HETATM 8359 O O3  . FUC C 2 .   ? -30.013 51.301  -36.360 1.00 116.98 ? 3    FUC C O3  1 
HETATM 8360 O O4  . FUC C 2 .   ? -32.337 52.806  -36.338 1.00 115.72 ? 3    FUC C O4  1 
HETATM 8361 O O5  . FUC C 2 .   ? -33.723 51.162  -38.220 1.00 106.41 ? 3    FUC C O5  1 
HETATM 8362 C C1  . NAG D 2 .   ? -34.713 9.947   -8.189  1.00 112.21 ? 1    NAG D C1  1 
HETATM 8363 C C2  . NAG D 2 .   ? -35.297 8.587   -7.820  1.00 126.43 ? 1    NAG D C2  1 
HETATM 8364 C C3  . NAG D 2 .   ? -36.493 8.729   -6.890  1.00 131.03 ? 1    NAG D C3  1 
HETATM 8365 C C4  . NAG D 2 .   ? -36.122 9.601   -5.701  1.00 135.21 ? 1    NAG D C4  1 
HETATM 8366 C C5  . NAG D 2 .   ? -35.562 10.932  -6.184  1.00 134.15 ? 1    NAG D C5  1 
HETATM 8367 C C6  . NAG D 2 .   ? -35.162 11.813  -5.006  1.00 138.51 ? 1    NAG D C6  1 
HETATM 8368 C C7  . NAG D 2 .   ? -34.793 7.208   -9.752  1.00 133.29 ? 1    NAG D C7  1 
HETATM 8369 C C8  . NAG D 2 .   ? -34.513 5.799   -9.317  1.00 132.22 ? 1    NAG D C8  1 
HETATM 8370 N N2  . NAG D 2 .   ? -35.684 7.870   -9.020  1.00 131.98 ? 1    NAG D N2  1 
HETATM 8371 O O3  . NAG D 2 .   ? -36.900 7.436   -6.429  1.00 130.83 ? 1    NAG D O3  1 
HETATM 8372 O O4  . NAG D 2 .   ? -37.283 9.834   -4.896  1.00 139.42 ? 1    NAG D O4  1 
HETATM 8373 O O5  . NAG D 2 .   ? -34.424 10.717  -7.020  1.00 124.40 ? 1    NAG D O5  1 
HETATM 8374 O O6  . NAG D 2 .   ? -34.027 11.241  -4.347  1.00 138.93 ? 1    NAG D O6  1 
HETATM 8375 O O7  . NAG D 2 .   ? -34.238 7.712   -10.714 1.00 134.26 ? 1    NAG D O7  1 
HETATM 8376 C C1  . NAG D 2 .   ? -37.096 9.197   -3.619  1.00 144.92 ? 2    NAG D C1  1 
HETATM 8377 C C2  . NAG D 2 .   ? -38.307 9.469   -2.734  1.00 146.65 ? 2    NAG D C2  1 
HETATM 8378 C C3  . NAG D 2 .   ? -38.441 8.393   -1.668  1.00 150.22 ? 2    NAG D C3  1 
HETATM 8379 C C4  . NAG D 2 .   ? -37.064 7.854   -1.318  1.00 149.19 ? 2    NAG D C4  1 
HETATM 8380 C C5  . NAG D 2 .   ? -36.438 7.172   -2.529  1.00 148.65 ? 2    NAG D C5  1 
HETATM 8381 C C6  . NAG D 2 .   ? -36.800 5.691   -2.564  1.00 148.15 ? 2    NAG D C6  1 
HETATM 8382 C C7  . NAG D 2 .   ? -38.508 11.886  -2.738  1.00 138.22 ? 2    NAG D C7  1 
HETATM 8383 C C8  . NAG D 2 .   ? -39.616 11.752  -3.740  1.00 136.94 ? 2    NAG D C8  1 
HETATM 8384 N N2  . NAG D 2 .   ? -38.164 10.767  -2.107  1.00 142.08 ? 2    NAG D N2  1 
HETATM 8385 O O3  . NAG D 2 .   ? -39.264 7.329   -2.159  1.00 152.82 ? 2    NAG D O3  1 
HETATM 8386 O O4  . NAG D 2 .   ? -36.224 8.930   -0.887  1.00 147.87 ? 2    NAG D O4  1 
HETATM 8387 O O5  . NAG D 2 .   ? -36.871 7.793   -3.742  1.00 147.88 ? 2    NAG D O5  1 
HETATM 8388 O O6  . NAG D 2 .   ? -36.064 5.045   -3.608  1.00 147.31 ? 2    NAG D O6  1 
HETATM 8389 O O7  . NAG D 2 .   ? -37.957 12.952  -2.517  1.00 136.36 ? 2    NAG D O7  1 
HETATM 8390 C C1  . FUC D 2 .   ? -34.186 11.407  -2.926  1.00 138.87 ? 3    FUC D C1  1 
HETATM 8391 C C2  . FUC D 2 .   ? -33.190 10.511  -2.195  1.00 136.45 ? 3    FUC D C2  1 
HETATM 8392 C C3  . FUC D 2 .   ? -33.424 10.553  -0.690  1.00 137.28 ? 3    FUC D C3  1 
HETATM 8393 C C4  . FUC D 2 .   ? -33.924 11.935  -0.282  1.00 137.14 ? 3    FUC D C4  1 
HETATM 8394 C C5  . FUC D 2 .   ? -33.414 12.971  -1.274  1.00 136.08 ? 3    FUC D C5  1 
HETATM 8395 C C6  . FUC D 2 .   ? -33.676 14.386  -0.772  1.00 130.84 ? 3    FUC D C6  1 
HETATM 8396 O O2  . FUC D 2 .   ? -31.862 10.964  -2.480  1.00 133.12 ? 3    FUC D O2  1 
HETATM 8397 O O3  . FUC D 2 .   ? -34.361 9.535   -0.316  1.00 137.36 ? 3    FUC D O3  1 
HETATM 8398 O O4  . FUC D 2 .   ? -35.356 11.976  -0.253  1.00 136.70 ? 3    FUC D O4  1 
HETATM 8399 O O5  . FUC D 2 .   ? -34.076 12.777  -2.524  1.00 139.59 ? 3    FUC D O5  1 
HETATM 8400 C C1  . NAG E 2 .   ? -63.377 -10.120 -32.512 1.00 73.82  ? 1    NAG E C1  1 
HETATM 8401 C C2  . NAG E 2 .   ? -64.091 -9.411  -33.659 1.00 78.83  ? 1    NAG E C2  1 
HETATM 8402 C C3  . NAG E 2 .   ? -63.144 -8.495  -34.421 1.00 88.76  ? 1    NAG E C3  1 
HETATM 8403 C C4  . NAG E 2 .   ? -62.431 -7.568  -33.450 1.00 94.06  ? 1    NAG E C4  1 
HETATM 8404 C C5  . NAG E 2 .   ? -61.745 -8.382  -32.361 1.00 86.75  ? 1    NAG E C5  1 
HETATM 8405 C C6  . NAG E 2 .   ? -61.036 -7.470  -31.367 1.00 92.53  ? 1    NAG E C6  1 
HETATM 8406 C C7  . NAG E 2 .   ? -65.834 -10.974 -34.298 1.00 97.83  ? 1    NAG E C7  1 
HETATM 8407 C C8  . NAG E 2 .   ? -66.400 -10.710 -32.934 1.00 96.42  ? 1    NAG E C8  1 
HETATM 8408 N N2  . NAG E 2 .   ? -64.670 -10.387 -34.562 1.00 91.17  ? 1    NAG E N2  1 
HETATM 8409 O O3  . NAG E 2 .   ? -63.886 -7.720  -35.369 1.00 90.03  ? 1    NAG E O3  1 
HETATM 8410 O O4  . NAG E 2 .   ? -61.456 -6.793  -34.156 1.00 106.80 ? 1    NAG E O4  1 
HETATM 8411 O O5  . NAG E 2 .   ? -62.702 -9.184  -31.669 1.00 76.87  ? 1    NAG E O5  1 
HETATM 8412 O O6  . NAG E 2 .   ? -62.008 -6.706  -30.643 1.00 100.10 ? 1    NAG E O6  1 
HETATM 8413 O O7  . NAG E 2 .   ? -66.404 -11.681 -35.112 1.00 102.77 ? 1    NAG E O7  1 
HETATM 8414 C C1  . NAG E 2 .   ? -61.794 -5.399  -34.031 1.00 118.76 ? 2    NAG E C1  1 
HETATM 8415 C C2  . NAG E 2 .   ? -60.694 -4.539  -34.648 1.00 122.95 ? 2    NAG E C2  1 
HETATM 8416 C C3  . NAG E 2 .   ? -61.055 -3.061  -34.596 1.00 126.68 ? 2    NAG E C3  1 
HETATM 8417 C C4  . NAG E 2 .   ? -62.438 -2.844  -35.191 1.00 128.64 ? 2    NAG E C4  1 
HETATM 8418 C C5  . NAG E 2 .   ? -63.450 -3.734  -34.484 1.00 129.24 ? 2    NAG E C5  1 
HETATM 8419 C C6  . NAG E 2 .   ? -64.844 -3.543  -35.070 1.00 130.45 ? 2    NAG E C6  1 
HETATM 8420 C C7  . NAG E 2 .   ? -58.497 -5.560  -34.448 1.00 120.52 ? 2    NAG E C7  1 
HETATM 8421 C C8  . NAG E 2 .   ? -57.282 -5.740  -33.585 1.00 120.82 ? 2    NAG E C8  1 
HETATM 8422 N N2  . NAG E 2 .   ? -59.436 -4.754  -33.959 1.00 121.92 ? 2    NAG E N2  1 
HETATM 8423 O O3  . NAG E 2 .   ? -60.090 -2.305  -35.336 1.00 126.71 ? 2    NAG E O3  1 
HETATM 8424 O O4  . NAG E 2 .   ? -62.816 -1.471  -35.038 1.00 127.93 ? 2    NAG E O4  1 
HETATM 8425 O O5  . NAG E 2 .   ? -63.068 -5.105  -34.608 1.00 125.74 ? 2    NAG E O5  1 
HETATM 8426 O O6  . NAG E 2 .   ? -65.796 -4.269  -34.284 1.00 130.53 ? 2    NAG E O6  1 
HETATM 8427 O O7  . NAG E 2 .   ? -58.615 -6.116  -35.527 1.00 119.15 ? 2    NAG E O7  1 
HETATM 8428 C C1  . FUC E 2 .   ? -61.445 -6.330  -29.373 1.00 102.99 ? 3    FUC E C1  1 
HETATM 8429 C C2  . FUC E 2 .   ? -61.365 -4.809  -29.283 1.00 102.30 ? 3    FUC E C2  1 
HETATM 8430 C C3  . FUC E 2 .   ? -62.744 -4.188  -29.118 1.00 105.33 ? 3    FUC E C3  1 
HETATM 8431 C C4  . FUC E 2 .   ? -63.473 -4.852  -27.960 1.00 109.04 ? 3    FUC E C4  1 
HETATM 8432 C C5  . FUC E 2 .   ? -63.507 -6.360  -28.165 1.00 102.87 ? 3    FUC E C5  1 
HETATM 8433 C C6  . FUC E 2 .   ? -64.222 -7.049  -27.008 1.00 97.85  ? 3    FUC E C6  1 
HETATM 8434 O O2  . FUC E 2 .   ? -60.747 -4.291  -30.466 1.00 100.51 ? 3    FUC E O2  1 
HETATM 8435 O O3  . FUC E 2 .   ? -62.612 -2.786  -28.861 1.00 107.11 ? 3    FUC E O3  1 
HETATM 8436 O O4  . FUC E 2 .   ? -62.799 -4.549  -26.734 1.00 117.10 ? 3    FUC E O4  1 
HETATM 8437 O O5  . FUC E 2 .   ? -62.178 -6.874  -28.273 1.00 104.09 ? 3    FUC E O5  1 
HETATM 8438 P P1  . VX  F 3 .   ? -49.392 34.303  -31.598 1.00 36.15  ? 601  VX  A P1  1 
HETATM 8439 O O1  . VX  F 3 .   ? -49.556 33.624  -30.381 1.00 34.42  ? 601  VX  A O1  1 
HETATM 8440 O O2  . VX  F 3 .   ? -48.337 33.404  -32.235 1.00 44.23  ? 601  VX  A O2  1 
HETATM 8441 C C1  . VX  F 3 .   ? -48.594 35.914  -31.348 1.00 33.28  ? 601  VX  A C1  1 
HETATM 8442 C C2  . VX  F 3 .   ? -48.586 32.801  -33.424 1.00 50.54  ? 601  VX  A C2  1 
HETATM 8443 C C3  . VX  F 3 .   ? -47.260 32.270  -33.881 1.00 54.72  ? 601  VX  A C3  1 
HETATM 8444 C C1  . NAG G 4 .   ? -57.229 60.983  -28.934 1.00 89.09  ? 605  NAG A C1  1 
HETATM 8445 C C2  . NAG G 4 .   ? -56.094 60.770  -27.936 1.00 99.42  ? 605  NAG A C2  1 
HETATM 8446 C C3  . NAG G 4 .   ? -55.945 61.963  -27.002 1.00 106.10 ? 605  NAG A C3  1 
HETATM 8447 C C4  . NAG G 4 .   ? -55.839 63.243  -27.815 1.00 108.00 ? 605  NAG A C4  1 
HETATM 8448 C C5  . NAG G 4 .   ? -57.024 63.358  -28.764 1.00 107.00 ? 605  NAG A C5  1 
HETATM 8449 C C6  . NAG G 4 .   ? -56.927 64.627  -29.603 1.00 109.59 ? 605  NAG A C6  1 
HETATM 8450 C C7  . NAG G 4 .   ? -56.012 58.363  -27.644 1.00 95.01  ? 605  NAG A C7  1 
HETATM 8451 C C8  . NAG G 4 .   ? -55.220 58.358  -28.917 1.00 93.02  ? 605  NAG A C8  1 
HETATM 8452 N N2  . NAG G 4 .   ? -56.328 59.564  -27.166 1.00 100.06 ? 605  NAG A N2  1 
HETATM 8453 O O3  . NAG G 4 .   ? -54.769 61.803  -26.202 1.00 108.67 ? 605  NAG A O3  1 
HETATM 8454 O O4  . NAG G 4 .   ? -55.819 64.371  -26.934 1.00 108.74 ? 605  NAG A O4  1 
HETATM 8455 O O5  . NAG G 4 .   ? -57.078 62.222  -29.629 1.00 103.43 ? 605  NAG A O5  1 
HETATM 8456 O O6  . NAG G 4 .   ? -56.752 65.756  -28.740 1.00 111.50 ? 605  NAG A O6  1 
HETATM 8457 O O7  . NAG G 4 .   ? -56.346 57.333  -27.082 1.00 90.24  ? 605  NAG A O7  1 
HETATM 8458 C C21 . 7PE H 5 .   ? -45.291 6.770   -22.489 1.00 93.90  ? 606  7PE A C21 1 
HETATM 8459 C C20 . 7PE H 5 .   ? -44.363 7.933   -22.184 1.00 93.64  ? 606  7PE A C20 1 
HETATM 8460 O O19 . 7PE H 5 .   ? -45.098 9.096   -22.091 1.00 90.76  ? 606  7PE A O19 1 
HETATM 8461 C C18 . 7PE H 5 .   ? -44.929 9.838   -20.941 1.00 86.16  ? 606  7PE A C18 1 
HETATM 8462 C C17 . 7PE H 5 .   ? -46.257 9.735   -20.223 1.00 82.56  ? 606  7PE A C17 1 
HETATM 8463 O O16 . 7PE H 5 .   ? -46.953 10.934  -20.212 1.00 81.99  ? 606  7PE A O16 1 
HETATM 8464 C C15 . 7PE H 5 .   ? -47.839 10.962  -19.149 1.00 80.92  ? 606  7PE A C15 1 
HETATM 8465 C C14 . 7PE H 5 .   ? -49.264 10.890  -19.649 1.00 82.88  ? 606  7PE A C14 1 
HETATM 8466 O O13 . 7PE H 5 .   ? -49.824 9.615   -19.524 1.00 88.54  ? 606  7PE A O13 1 
HETATM 8467 C C12 . 7PE H 5 .   ? -49.970 8.972   -20.751 1.00 92.09  ? 606  7PE A C12 1 
HETATM 8468 C C11 . 7PE H 5 .   ? -48.720 9.206   -21.601 1.00 93.46  ? 606  7PE A C11 1 
HETATM 8469 O O10 . 7PE H 5 .   ? -48.482 8.168   -22.480 1.00 91.29  ? 606  7PE A O10 1 
HETATM 8470 C C9  . 7PE H 5 .   ? -49.627 7.486   -22.903 1.00 93.10  ? 606  7PE A C9  1 
HETATM 8471 C C8  . 7PE H 5 .   ? -49.586 7.203   -24.407 1.00 97.30  ? 606  7PE A C8  1 
HETATM 8472 O O7  . 7PE H 5 .   ? -48.272 7.065   -24.863 1.00 98.33  ? 606  7PE A O7  1 
HETATM 8473 C C6  . 7PE H 5 .   ? -47.637 8.226   -25.294 1.00 98.12  ? 606  7PE A C6  1 
HETATM 8474 C C5  . 7PE H 5 .   ? -48.146 8.557   -26.676 1.00 98.62  ? 606  7PE A C5  1 
HETATM 8475 O O4  . 7PE H 5 .   ? -47.081 8.911   -27.473 1.00 95.51  ? 606  7PE A O4  1 
HETATM 8476 C C3  . 7PE H 5 .   ? -47.058 10.241  -27.864 1.00 91.27  ? 606  7PE A C3  1 
HETATM 8477 C C2  . 7PE H 5 .   ? -47.293 10.294  -29.348 1.00 89.36  ? 606  7PE A C2  1 
HETATM 8478 O O1  . 7PE H 5 .   ? -48.452 9.579   -29.621 1.00 87.57  ? 606  7PE A O1  1 
HETATM 8479 P P1  . VX  I 3 .   ? -39.771 -14.778 -26.221 1.00 38.90  ? 601  VX  B P1  1 
HETATM 8480 O O1  . VX  I 3 .   ? -38.649 -14.118 -25.449 1.00 34.96  ? 601  VX  B O1  1 
HETATM 8481 O O2  . VX  I 3 .   ? -39.810 -14.087 -27.713 1.00 46.98  ? 601  VX  B O2  1 
HETATM 8482 C C1  . VX  I 3 .   ? -41.397 -14.391 -25.408 1.00 34.62  ? 601  VX  B C1  1 
HETATM 8483 C C2  . VX  I 3 .   ? -39.307 -14.813 -28.791 1.00 43.00  ? 601  VX  B C2  1 
HETATM 8484 C C3  . VX  I 3 .   ? -40.454 -15.206 -29.715 1.00 39.94  ? 601  VX  B C3  1 
HETATM 8485 O O   . HOH J 6 .   ? -37.516 6.960   -9.914  1.00 67.83  ? 701  HOH A O   1 
HETATM 8486 O O   . HOH J 6 .   ? -63.373 44.551  0.929   1.00 41.99  ? 702  HOH A O   1 
HETATM 8487 O O   . HOH J 6 .   ? -43.387 10.971  -49.090 1.00 58.40  ? 703  HOH A O   1 
HETATM 8488 O O   . HOH J 6 .   ? -32.980 14.555  -15.747 1.00 59.15  ? 704  HOH A O   1 
HETATM 8489 O O   . HOH J 6 .   ? -72.046 18.741  -36.844 1.00 63.23  ? 705  HOH A O   1 
HETATM 8490 O O   . HOH J 6 .   ? -35.858 38.602  -19.586 1.00 60.07  ? 706  HOH A O   1 
HETATM 8491 O O   . HOH J 6 .   ? -35.656 10.981  -12.817 1.00 46.35  ? 707  HOH A O   1 
HETATM 8492 O O   . HOH J 6 .   ? -40.002 31.035  -19.258 1.00 43.50  ? 708  HOH A O   1 
HETATM 8493 O O   . HOH J 6 .   ? -56.435 66.809  -30.882 1.00 78.77  ? 709  HOH A O   1 
HETATM 8494 O O   . HOH J 6 .   ? -73.956 40.651  -42.880 1.00 45.68  ? 710  HOH A O   1 
HETATM 8495 O O   . HOH J 6 .   ? -50.162 15.633  -24.709 1.00 40.44  ? 711  HOH A O   1 
HETATM 8496 O O   . HOH J 6 .   ? -45.797 43.305  -46.919 1.00 57.67  ? 712  HOH A O   1 
HETATM 8497 O O   . HOH J 6 .   ? -77.241 45.546  -19.362 1.00 79.11  ? 713  HOH A O   1 
HETATM 8498 O O   . HOH J 6 .   ? -55.368 21.397  -2.821  1.00 65.93  ? 714  HOH A O   1 
HETATM 8499 O O   . HOH J 6 .   ? -78.574 32.678  -37.294 1.00 67.44  ? 715  HOH A O   1 
HETATM 8500 O O   . HOH J 6 .   ? -39.136 40.681  -12.103 1.00 61.77  ? 716  HOH A O   1 
HETATM 8501 O O   . HOH J 6 .   ? -75.223 42.146  -12.743 1.00 62.18  ? 717  HOH A O   1 
HETATM 8502 O O   . HOH J 6 .   ? -80.092 48.450  -21.830 1.00 48.08  ? 718  HOH A O   1 
HETATM 8503 O O   . HOH J 6 .   ? -53.951 15.781  -51.577 1.00 63.24  ? 719  HOH A O   1 
HETATM 8504 O O   . HOH J 6 .   ? -73.191 44.556  -31.701 1.00 38.92  ? 720  HOH A O   1 
HETATM 8505 O O   . HOH J 6 .   ? -48.722 21.617  -33.808 1.00 33.90  ? 721  HOH A O   1 
HETATM 8506 O O   . HOH J 6 .   ? -44.945 39.234  -58.941 1.00 54.73  ? 722  HOH A O   1 
HETATM 8507 O O   . HOH J 6 .   ? -77.071 29.004  -27.027 1.00 44.09  ? 723  HOH A O   1 
HETATM 8508 O O   . HOH J 6 .   ? -57.444 22.132  -3.739  1.00 62.12  ? 724  HOH A O   1 
HETATM 8509 O O   . HOH J 6 .   ? -52.498 32.026  -8.399  1.00 30.96  ? 725  HOH A O   1 
HETATM 8510 O O   . HOH J 6 .   ? -35.319 38.763  -44.470 1.00 41.77  ? 726  HOH A O   1 
HETATM 8511 O O   . HOH J 6 .   ? -49.194 13.877  -17.756 1.00 73.62  ? 727  HOH A O   1 
HETATM 8512 O O   . HOH J 6 .   ? -51.363 50.163  -33.035 1.00 63.26  ? 728  HOH A O   1 
HETATM 8513 O O   . HOH J 6 .   ? -67.893 33.298  5.286   1.00 52.31  ? 729  HOH A O   1 
HETATM 8514 O O   . HOH J 6 .   ? -54.998 38.105  -35.410 1.00 32.93  ? 730  HOH A O   1 
HETATM 8515 O O   . HOH J 6 .   ? -42.437 46.444  -57.255 1.00 55.59  ? 731  HOH A O   1 
HETATM 8516 O O   . HOH J 6 .   ? -44.997 40.111  -22.422 1.00 36.29  ? 732  HOH A O   1 
HETATM 8517 O O   . HOH J 6 .   ? -56.836 46.828  -38.466 1.00 44.02  ? 733  HOH A O   1 
HETATM 8518 O O   . HOH J 6 .   ? -58.193 36.650  -37.027 1.00 30.07  ? 734  HOH A O   1 
HETATM 8519 O O   . HOH J 6 .   ? -60.068 39.481  -20.701 1.00 32.92  ? 735  HOH A O   1 
HETATM 8520 O O   . HOH J 6 .   ? -66.396 43.179  -47.559 1.00 48.27  ? 736  HOH A O   1 
HETATM 8521 O O   . HOH J 6 .   ? -41.978 29.585  -6.954  1.00 35.47  ? 737  HOH A O   1 
HETATM 8522 O O   . HOH J 6 .   ? -65.108 16.750  -20.590 1.00 60.87  ? 738  HOH A O   1 
HETATM 8523 O O   . HOH J 6 .   ? -65.864 43.681  -24.900 1.00 33.88  ? 739  HOH A O   1 
HETATM 8524 O O   . HOH J 6 .   ? -57.650 16.960  -16.881 1.00 55.71  ? 740  HOH A O   1 
HETATM 8525 O O   . HOH J 6 .   ? -43.438 29.653  -25.525 1.00 34.73  ? 741  HOH A O   1 
HETATM 8526 O O   . HOH J 6 .   ? -55.253 50.401  -33.589 1.00 48.29  ? 742  HOH A O   1 
HETATM 8527 O O   . HOH J 6 .   ? -38.742 17.973  -7.247  1.00 66.50  ? 743  HOH A O   1 
HETATM 8528 O O   . HOH J 6 .   ? -41.877 33.732  -7.458  1.00 34.61  ? 744  HOH A O   1 
HETATM 8529 O O   . HOH J 6 .   ? -50.070 23.859  -42.469 1.00 40.77  ? 745  HOH A O   1 
HETATM 8530 O O   . HOH J 6 .   ? -59.175 27.060  -48.946 1.00 42.86  ? 746  HOH A O   1 
HETATM 8531 O O   . HOH J 6 .   ? -67.194 25.508  -19.474 1.00 38.20  ? 747  HOH A O   1 
HETATM 8532 O O   . HOH J 6 .   ? -57.148 46.596  -18.808 1.00 42.83  ? 748  HOH A O   1 
HETATM 8533 O O   . HOH J 6 .   ? -56.288 29.049  -0.730  1.00 52.33  ? 749  HOH A O   1 
HETATM 8534 O O   . HOH J 6 .   ? -51.959 38.369  -25.147 1.00 26.38  ? 750  HOH A O   1 
HETATM 8535 O O   . HOH J 6 .   ? -41.813 34.243  -21.162 1.00 26.72  ? 751  HOH A O   1 
HETATM 8536 O O   . HOH J 6 .   ? -67.250 32.698  1.647   1.00 31.48  ? 752  HOH A O   1 
HETATM 8537 O O   . HOH J 6 .   ? -55.061 31.794  -7.560  1.00 24.11  ? 753  HOH A O   1 
HETATM 8538 O O   . HOH J 6 .   ? -29.022 34.568  -47.880 1.00 54.67  ? 754  HOH A O   1 
HETATM 8539 O O   . HOH J 6 .   ? -56.037 39.272  -15.513 1.00 67.52  ? 755  HOH A O   1 
HETATM 8540 O O   . HOH J 6 .   ? -47.659 28.829  -54.195 1.00 56.54  ? 756  HOH A O   1 
HETATM 8541 O O   . HOH J 6 .   ? -52.331 24.862  -8.020  1.00 40.46  ? 757  HOH A O   1 
HETATM 8542 O O   . HOH J 6 .   ? -71.407 26.682  -48.045 1.00 55.15  ? 758  HOH A O   1 
HETATM 8543 O O   . HOH J 6 .   ? -63.402 32.165  9.067   1.00 60.92  ? 759  HOH A O   1 
HETATM 8544 O O   . HOH J 6 .   ? -76.660 44.805  -30.054 1.00 71.63  ? 760  HOH A O   1 
HETATM 8545 O O   . HOH J 6 .   ? -33.814 4.213   -4.771  1.00 75.09  ? 761  HOH A O   1 
HETATM 8546 O O   . HOH J 6 .   ? -56.235 13.899  -27.286 1.00 43.66  ? 762  HOH A O   1 
HETATM 8547 O O   . HOH J 6 .   ? -48.722 40.164  -39.294 1.00 31.95  ? 763  HOH A O   1 
HETATM 8548 O O   . HOH J 6 .   ? -34.505 46.788  -45.995 1.00 59.43  ? 764  HOH A O   1 
HETATM 8549 O O   . HOH J 6 .   ? -51.829 26.599  -1.464  1.00 62.85  ? 765  HOH A O   1 
HETATM 8550 O O   . HOH J 6 .   ? -73.091 22.704  -14.105 1.00 65.62  ? 766  HOH A O   1 
HETATM 8551 O O   . HOH J 6 .   ? -45.530 26.543  -12.721 1.00 34.03  ? 767  HOH A O   1 
HETATM 8552 O O   . HOH J 6 .   ? -71.652 45.506  -2.999  1.00 49.21  ? 768  HOH A O   1 
HETATM 8553 O O   . HOH J 6 .   ? -44.301 35.150  -7.763  1.00 45.76  ? 769  HOH A O   1 
HETATM 8554 O O   . HOH J 6 .   ? -42.478 22.386  -23.967 1.00 29.35  ? 770  HOH A O   1 
HETATM 8555 O O   . HOH J 6 .   ? -59.317 33.621  -52.413 1.00 49.64  ? 771  HOH A O   1 
HETATM 8556 O O   . HOH J 6 .   ? -35.637 34.302  -63.733 1.00 47.50  ? 772  HOH A O   1 
HETATM 8557 O O   . HOH J 6 .   ? -59.403 23.496  -46.564 1.00 47.13  ? 773  HOH A O   1 
HETATM 8558 O O   . HOH J 6 .   ? -30.047 28.378  -31.363 1.00 70.65  ? 774  HOH A O   1 
HETATM 8559 O O   . HOH J 6 .   ? -36.751 22.792  -4.423  1.00 49.99  ? 775  HOH A O   1 
HETATM 8560 O O   . HOH J 6 .   ? -65.598 28.281  -6.510  1.00 45.06  ? 776  HOH A O   1 
HETATM 8561 O O   . HOH J 6 .   ? -39.619 21.581  -22.126 1.00 29.45  ? 777  HOH A O   1 
HETATM 8562 O O   . HOH J 6 .   ? -75.663 29.215  -42.571 1.00 52.47  ? 778  HOH A O   1 
HETATM 8563 O O   . HOH J 6 .   ? -45.510 29.029  -11.093 1.00 31.93  ? 779  HOH A O   1 
HETATM 8564 O O   . HOH J 6 .   ? -41.978 36.775  -55.413 1.00 35.64  ? 780  HOH A O   1 
HETATM 8565 O O   . HOH J 6 .   ? -28.385 42.056  -48.913 1.00 63.42  ? 781  HOH A O   1 
HETATM 8566 O O   . HOH J 6 .   ? -45.270 13.502  -18.853 1.00 64.31  ? 782  HOH A O   1 
HETATM 8567 O O   . HOH J 6 .   ? -34.320 17.045  -30.265 1.00 54.23  ? 783  HOH A O   1 
HETATM 8568 O O   . HOH J 6 .   ? -69.171 23.685  -42.954 1.00 41.07  ? 784  HOH A O   1 
HETATM 8569 O O   . HOH J 6 .   ? -41.034 47.822  -23.768 1.00 63.79  ? 785  HOH A O   1 
HETATM 8570 O O   . HOH J 6 .   ? -44.831 20.750  -16.050 1.00 31.10  ? 786  HOH A O   1 
HETATM 8571 O O   . HOH J 6 .   ? -59.155 39.388  -6.416  1.00 30.92  ? 787  HOH A O   1 
HETATM 8572 O O   . HOH J 6 .   ? -76.292 33.944  -8.007  1.00 49.56  ? 788  HOH A O   1 
HETATM 8573 O O   . HOH J 6 .   ? -67.546 56.493  -28.901 1.00 49.20  ? 789  HOH A O   1 
HETATM 8574 O O   . HOH J 6 .   ? -50.013 50.667  -23.969 1.00 76.84  ? 790  HOH A O   1 
HETATM 8575 O O   . HOH J 6 .   ? -26.950 24.860  -8.156  1.00 71.40  ? 791  HOH A O   1 
HETATM 8576 O O   . HOH J 6 .   ? -47.567 24.979  -42.491 1.00 43.27  ? 792  HOH A O   1 
HETATM 8577 O O   . HOH J 6 .   ? -82.232 37.915  -19.069 1.00 71.23  ? 793  HOH A O   1 
HETATM 8578 O O   . HOH J 6 .   ? -49.879 27.690  -3.000  1.00 57.28  ? 794  HOH A O   1 
HETATM 8579 O O   . HOH J 6 .   ? -22.517 19.272  -13.790 1.00 67.25  ? 795  HOH A O   1 
HETATM 8580 O O   . HOH J 6 .   ? -67.295 43.111  -44.444 1.00 39.88  ? 796  HOH A O   1 
HETATM 8581 O O   . HOH J 6 .   ? -30.706 15.926  -11.615 1.00 48.35  ? 797  HOH A O   1 
HETATM 8582 O O   . HOH J 6 .   ? -68.977 50.690  -41.107 1.00 41.29  ? 798  HOH A O   1 
HETATM 8583 O O   . HOH J 6 .   ? -45.858 32.147  -16.521 1.00 28.96  ? 799  HOH A O   1 
HETATM 8584 O O   . HOH J 6 .   ? -50.966 19.524  -8.422  1.00 65.37  ? 800  HOH A O   1 
HETATM 8585 O O   . HOH J 6 .   ? -74.045 29.408  -6.226  1.00 63.40  ? 801  HOH A O   1 
HETATM 8586 O O   . HOH J 6 .   ? -44.592 52.781  -37.011 1.00 54.64  ? 802  HOH A O   1 
HETATM 8587 O O   . HOH J 6 .   ? -30.333 19.679  -23.376 1.00 52.97  ? 803  HOH A O   1 
HETATM 8588 O O   . HOH J 6 .   ? -63.079 55.450  -30.521 1.00 36.89  ? 804  HOH A O   1 
HETATM 8589 O O   . HOH J 6 .   ? -72.890 48.964  -28.915 1.00 62.35  ? 805  HOH A O   1 
HETATM 8590 O O   . HOH J 6 .   ? -63.989 59.508  -28.904 1.00 39.53  ? 806  HOH A O   1 
HETATM 8591 O O   . HOH J 6 .   ? -43.479 42.797  -12.390 1.00 46.63  ? 807  HOH A O   1 
HETATM 8592 O O   . HOH J 6 .   ? -66.700 28.709  1.441   1.00 54.88  ? 808  HOH A O   1 
HETATM 8593 O O   . HOH J 6 .   ? -63.253 45.602  -17.605 1.00 39.93  ? 809  HOH A O   1 
HETATM 8594 O O   . HOH J 6 .   ? -78.603 30.132  -23.238 1.00 53.98  ? 810  HOH A O   1 
HETATM 8595 O O   . HOH J 6 .   ? -54.558 37.039  -28.201 1.00 30.16  ? 811  HOH A O   1 
HETATM 8596 O O   . HOH J 6 .   ? -67.258 30.673  -44.637 1.00 37.06  ? 812  HOH A O   1 
HETATM 8597 O O   . HOH J 6 .   ? -57.554 34.557  -21.592 1.00 21.99  ? 813  HOH A O   1 
HETATM 8598 O O   . HOH J 6 .   ? -50.177 16.102  -21.537 1.00 48.94  ? 814  HOH A O   1 
HETATM 8599 O O   . HOH J 6 .   ? -45.528 21.463  -22.114 1.00 32.77  ? 815  HOH A O   1 
HETATM 8600 O O   . HOH J 6 .   ? -35.408 25.914  -42.197 1.00 48.45  ? 816  HOH A O   1 
HETATM 8601 O O   . HOH J 6 .   ? -74.093 40.421  -11.390 1.00 50.09  ? 817  HOH A O   1 
HETATM 8602 O O   . HOH J 6 .   ? -58.430 49.130  -44.506 1.00 48.85  ? 818  HOH A O   1 
HETATM 8603 O O   . HOH J 6 .   ? -57.880 41.511  -7.679  1.00 29.32  ? 819  HOH A O   1 
HETATM 8604 O O   . HOH J 6 .   ? -67.876 47.261  -5.672  1.00 49.38  ? 820  HOH A O   1 
HETATM 8605 O O   . HOH J 6 .   ? -49.558 32.793  -24.896 1.00 26.46  ? 821  HOH A O   1 
HETATM 8606 O O   . HOH J 6 .   ? -49.604 39.702  -25.182 1.00 32.15  ? 822  HOH A O   1 
HETATM 8607 O O   . HOH J 6 .   ? -32.922 31.489  -55.948 1.00 45.39  ? 823  HOH A O   1 
HETATM 8608 O O   . HOH J 6 .   ? -50.368 46.562  -22.245 1.00 40.44  ? 824  HOH A O   1 
HETATM 8609 O O   . HOH J 6 .   ? -49.896 38.371  -51.503 1.00 77.11  ? 825  HOH A O   1 
HETATM 8610 O O   . HOH J 6 .   ? -61.793 15.335  -28.580 1.00 67.52  ? 826  HOH A O   1 
HETATM 8611 O O   . HOH J 6 .   ? -57.209 38.731  -48.570 1.00 69.49  ? 827  HOH A O   1 
HETATM 8612 O O   . HOH J 6 .   ? -62.622 17.551  -17.350 1.00 55.83  ? 828  HOH A O   1 
HETATM 8613 O O   . HOH J 6 .   ? -64.689 17.195  -30.654 1.00 63.50  ? 829  HOH A O   1 
HETATM 8614 O O   . HOH J 6 .   ? -59.003 43.081  -20.170 1.00 37.84  ? 830  HOH A O   1 
HETATM 8615 O O   . HOH J 6 .   ? -40.475 27.338  -7.103  1.00 37.88  ? 831  HOH A O   1 
HETATM 8616 O O   . HOH J 6 .   ? -35.821 42.373  -38.158 1.00 60.62  ? 832  HOH A O   1 
HETATM 8617 O O   . HOH J 6 .   ? -46.693 54.755  -30.186 1.00 56.81  ? 833  HOH A O   1 
HETATM 8618 O O   . HOH J 6 .   ? -45.163 44.173  -14.996 1.00 48.94  ? 834  HOH A O   1 
HETATM 8619 O O   . HOH J 6 .   ? -46.937 52.829  -25.328 1.00 68.67  ? 835  HOH A O   1 
HETATM 8620 O O   . HOH J 6 .   ? -31.279 32.977  -41.870 1.00 54.60  ? 836  HOH A O   1 
HETATM 8621 O O   . HOH J 6 .   ? -35.162 35.075  -22.368 1.00 67.83  ? 837  HOH A O   1 
HETATM 8622 O O   . HOH J 6 .   ? -41.372 29.770  -23.954 1.00 49.71  ? 838  HOH A O   1 
HETATM 8623 O O   . HOH J 6 .   ? -66.728 19.929  -46.901 1.00 45.28  ? 839  HOH A O   1 
HETATM 8624 O O   . HOH J 6 .   ? -64.009 58.528  -31.600 1.00 44.29  ? 840  HOH A O   1 
HETATM 8625 O O   . HOH J 6 .   ? -45.351 38.306  -63.220 1.00 56.32  ? 841  HOH A O   1 
HETATM 8626 O O   . HOH J 6 .   ? -58.950 29.426  0.140   1.00 60.57  ? 842  HOH A O   1 
HETATM 8627 O O   . HOH J 6 .   ? -56.478 26.515  -48.670 1.00 35.80  ? 843  HOH A O   1 
HETATM 8628 O O   . HOH J 6 .   ? -72.905 26.998  -13.771 1.00 38.42  ? 844  HOH A O   1 
HETATM 8629 O O   . HOH J 6 .   ? -69.290 54.801  -27.851 1.00 44.18  ? 845  HOH A O   1 
HETATM 8630 O O   . HOH J 6 .   ? -44.878 45.590  -19.205 1.00 42.48  ? 846  HOH A O   1 
HETATM 8631 O O   . HOH J 6 .   ? -53.154 46.845  -22.049 1.00 37.23  ? 847  HOH A O   1 
HETATM 8632 O O   . HOH J 6 .   ? -43.658 13.145  -28.805 1.00 36.30  ? 848  HOH A O   1 
HETATM 8633 O O   . HOH J 6 .   ? -53.924 46.375  -24.671 1.00 41.00  ? 849  HOH A O   1 
HETATM 8634 O O   . HOH J 6 .   ? -64.229 14.701  -31.871 1.00 56.50  ? 850  HOH A O   1 
HETATM 8635 O O   . HOH J 6 .   ? -53.480 39.785  -15.400 1.00 26.86  ? 851  HOH A O   1 
HETATM 8636 O O   . HOH J 6 .   ? -41.725 22.109  -32.680 1.00 74.68  ? 852  HOH A O   1 
HETATM 8637 O O   . HOH J 6 .   ? -50.299 38.812  -46.915 1.00 68.99  ? 853  HOH A O   1 
HETATM 8638 O O   . HOH J 6 .   ? -67.838 26.736  -48.955 1.00 42.93  ? 854  HOH A O   1 
HETATM 8639 O O   . HOH J 6 .   ? -69.807 48.210  -41.666 1.00 47.87  ? 855  HOH A O   1 
HETATM 8640 O O   . HOH J 6 .   ? -52.115 36.752  -44.541 1.00 33.78  ? 856  HOH A O   1 
HETATM 8641 O O   . HOH J 6 .   ? -72.184 30.380  -26.143 1.00 32.01  ? 857  HOH A O   1 
HETATM 8642 O O   . HOH J 6 .   ? -57.570 38.903  -13.008 1.00 29.69  ? 858  HOH A O   1 
HETATM 8643 O O   . HOH J 6 .   ? -44.685 39.201  -54.016 1.00 43.53  ? 859  HOH A O   1 
HETATM 8644 O O   . HOH J 6 .   ? -47.059 30.792  -12.261 1.00 29.85  ? 860  HOH A O   1 
HETATM 8645 O O   . HOH J 6 .   ? -50.737 36.112  -17.642 1.00 29.02  ? 861  HOH A O   1 
HETATM 8646 O O   . HOH J 6 .   ? -56.408 44.432  -31.745 1.00 36.05  ? 862  HOH A O   1 
HETATM 8647 O O   . HOH J 6 .   ? -43.483 19.281  -5.330  1.00 59.52  ? 863  HOH A O   1 
HETATM 8648 O O   . HOH J 6 .   ? -51.091 42.620  -9.467  1.00 45.21  ? 864  HOH A O   1 
HETATM 8649 O O   . HOH J 6 .   ? -39.661 39.794  -17.646 1.00 30.43  ? 865  HOH A O   1 
HETATM 8650 O O   . HOH J 6 .   ? -78.042 41.324  -29.614 1.00 60.41  ? 866  HOH A O   1 
HETATM 8651 O O   . HOH J 6 .   ? -75.860 22.054  -24.904 1.00 59.21  ? 867  HOH A O   1 
HETATM 8652 O O   . HOH J 6 .   ? -56.613 52.150  -30.427 1.00 72.60  ? 868  HOH A O   1 
HETATM 8653 O O   . HOH J 6 .   ? -47.866 15.758  -11.781 1.00 40.47  ? 869  HOH A O   1 
HETATM 8654 O O   . HOH J 6 .   ? -38.707 10.671  -14.753 1.00 65.25  ? 870  HOH A O   1 
HETATM 8655 O O   . HOH J 6 .   ? -74.791 49.695  -35.421 1.00 67.79  ? 871  HOH A O   1 
HETATM 8656 O O   . HOH J 6 .   ? -71.225 37.653  -2.040  1.00 41.87  ? 872  HOH A O   1 
HETATM 8657 O O   . HOH J 6 .   ? -42.044 54.759  -32.607 1.00 62.70  ? 873  HOH A O   1 
HETATM 8658 O O   . HOH J 6 .   ? -32.785 14.712  -18.959 1.00 64.00  ? 874  HOH A O   1 
HETATM 8659 O O   . HOH J 6 .   ? -39.367 34.268  -7.861  1.00 43.06  ? 875  HOH A O   1 
HETATM 8660 O O   . HOH J 6 .   ? -61.008 31.691  4.542   1.00 72.97  ? 876  HOH A O   1 
HETATM 8661 O O   . HOH J 6 .   ? -61.341 14.598  -44.733 1.00 56.72  ? 877  HOH A O   1 
HETATM 8662 O O   . HOH J 6 .   ? -76.992 38.300  -4.952  1.00 70.94  ? 878  HOH A O   1 
HETATM 8663 O O   . HOH J 6 .   ? -48.829 37.938  -44.801 1.00 41.28  ? 879  HOH A O   1 
HETATM 8664 O O   . HOH J 6 .   ? -47.071 39.120  -26.536 1.00 40.11  ? 880  HOH A O   1 
HETATM 8665 O O   . HOH J 6 .   ? -63.351 29.657  -7.094  1.00 38.68  ? 881  HOH A O   1 
HETATM 8666 O O   . HOH J 6 .   ? -36.034 41.232  -60.742 1.00 41.05  ? 882  HOH A O   1 
HETATM 8667 O O   . HOH J 6 .   ? -73.517 36.355  -2.416  1.00 42.92  ? 883  HOH A O   1 
HETATM 8668 O O   . HOH J 6 .   ? -73.576 41.636  -37.872 1.00 50.54  ? 884  HOH A O   1 
HETATM 8669 O O   . HOH J 6 .   ? -44.962 51.960  -45.285 1.00 63.86  ? 885  HOH A O   1 
HETATM 8670 O O   . HOH J 6 .   ? -55.701 15.408  -20.466 1.00 50.16  ? 886  HOH A O   1 
HETATM 8671 O O   . HOH J 6 .   ? -75.277 25.040  -26.974 1.00 48.58  ? 887  HOH A O   1 
HETATM 8672 O O   . HOH J 6 .   ? -57.618 55.740  -30.373 1.00 59.23  ? 888  HOH A O   1 
HETATM 8673 O O   . HOH J 6 .   ? -71.540 47.974  -25.917 1.00 52.12  ? 889  HOH A O   1 
HETATM 8674 O O   . HOH J 6 .   ? -56.979 38.530  -5.070  1.00 36.58  ? 890  HOH A O   1 
HETATM 8675 O O   . HOH J 6 .   ? -51.920 28.499  -37.149 1.00 58.62  ? 891  HOH A O   1 
HETATM 8676 O O   . HOH J 6 .   ? -65.490 25.342  -8.515  1.00 53.43  ? 892  HOH A O   1 
HETATM 8677 O O   . HOH J 6 .   ? -32.930 29.947  -48.210 1.00 46.73  ? 893  HOH A O   1 
HETATM 8678 O O   . HOH J 6 .   ? -67.259 20.168  -50.101 1.00 57.22  ? 894  HOH A O   1 
HETATM 8679 O O   . HOH J 6 .   ? -53.612 43.125  -8.858  1.00 41.10  ? 895  HOH A O   1 
HETATM 8680 O O   . HOH J 6 .   ? -42.721 39.853  -27.095 1.00 55.31  ? 896  HOH A O   1 
HETATM 8681 O O   . HOH J 6 .   ? -28.963 41.824  -44.034 1.00 69.06  ? 897  HOH A O   1 
HETATM 8682 O O   . HOH J 6 .   ? -42.555 41.142  -10.188 1.00 52.43  ? 898  HOH A O   1 
HETATM 8683 O O   . HOH J 6 .   ? -78.733 35.156  -32.246 1.00 50.79  ? 899  HOH A O   1 
HETATM 8684 O O   . HOH J 6 .   ? -69.721 43.527  -50.654 1.00 73.22  ? 900  HOH A O   1 
HETATM 8685 O O   . HOH J 6 .   ? -69.798 24.527  -2.012  1.00 68.20  ? 901  HOH A O   1 
HETATM 8686 O O   . HOH J 6 .   ? -64.321 38.996  4.097   1.00 43.96  ? 902  HOH A O   1 
HETATM 8687 O O   . HOH J 6 .   ? -78.716 25.738  -24.383 1.00 58.87  ? 903  HOH A O   1 
HETATM 8688 O O   . HOH J 6 .   ? -47.833 34.371  -52.938 1.00 64.82  ? 904  HOH A O   1 
HETATM 8689 O O   . HOH J 6 .   ? -69.875 19.251  -25.217 1.00 56.92  ? 905  HOH A O   1 
HETATM 8690 O O   . HOH J 6 .   ? -58.371 57.920  -36.126 1.00 57.01  ? 906  HOH A O   1 
HETATM 8691 O O   . HOH J 6 .   ? -38.949 15.114  -29.943 1.00 48.20  ? 907  HOH A O   1 
HETATM 8692 O O   . HOH J 6 .   ? -51.807 49.060  -46.269 1.00 64.66  ? 908  HOH A O   1 
HETATM 8693 O O   . HOH J 6 .   ? -45.716 32.608  -13.630 1.00 33.78  ? 909  HOH A O   1 
HETATM 8694 O O   . HOH J 6 .   ? -76.200 48.076  -19.843 1.00 68.26  ? 910  HOH A O   1 
HETATM 8695 O O   . HOH J 6 .   ? -55.160 24.012  -47.690 1.00 49.53  ? 911  HOH A O   1 
HETATM 8696 O O   . HOH J 6 .   ? -48.985 40.303  -21.385 1.00 41.88  ? 912  HOH A O   1 
HETATM 8697 O O   . HOH J 6 .   ? -49.899 45.143  -10.271 1.00 44.70  ? 913  HOH A O   1 
HETATM 8698 O O   . HOH J 6 .   ? -57.204 31.015  -52.891 1.00 43.79  ? 914  HOH A O   1 
HETATM 8699 O O   . HOH J 6 .   ? -75.189 33.851  -5.482  1.00 51.21  ? 915  HOH A O   1 
HETATM 8700 O O   . HOH J 6 .   ? -48.071 40.246  -48.376 1.00 62.50  ? 916  HOH A O   1 
HETATM 8701 O O   . HOH J 6 .   ? -37.298 42.550  -21.046 1.00 50.33  ? 917  HOH A O   1 
HETATM 8702 O O   . HOH J 6 .   ? -70.626 38.239  -52.262 1.00 48.33  ? 918  HOH A O   1 
HETATM 8703 O O   . HOH J 6 .   ? -46.575 40.806  -61.467 1.00 66.94  ? 919  HOH A O   1 
HETATM 8704 O O   . HOH J 6 .   ? -47.835 42.180  -46.230 1.00 56.17  ? 920  HOH A O   1 
HETATM 8705 O O   . HOH J 6 .   ? -31.320 45.974  -46.271 1.00 69.14  ? 921  HOH A O   1 
HETATM 8706 O O   . HOH J 6 .   ? -77.566 37.007  -25.961 1.00 52.12  ? 922  HOH A O   1 
HETATM 8707 O O   . HOH J 6 .   ? -68.765 49.488  -8.251  1.00 49.05  ? 923  HOH A O   1 
HETATM 8708 O O   . HOH J 6 .   ? -45.122 43.128  -27.265 1.00 48.63  ? 924  HOH A O   1 
HETATM 8709 O O   . HOH J 6 .   ? -38.245 40.343  -19.782 1.00 34.49  ? 925  HOH A O   1 
HETATM 8710 O O   . HOH J 6 .   ? -59.593 12.902  -32.817 1.00 55.10  ? 926  HOH A O   1 
HETATM 8711 O O   . HOH J 6 .   ? -40.552 18.563  -32.053 1.00 41.87  ? 927  HOH A O   1 
HETATM 8712 O O   . HOH J 6 .   ? -61.733 25.674  -8.995  1.00 48.15  ? 928  HOH A O   1 
HETATM 8713 O O   . HOH J 6 .   ? -49.711 23.951  -9.252  1.00 39.69  ? 929  HOH A O   1 
HETATM 8714 O O   . HOH J 6 .   ? -73.448 55.780  -20.927 1.00 72.11  ? 930  HOH A O   1 
HETATM 8715 O O   . HOH J 6 .   ? -59.803 13.947  -30.111 1.00 51.50  ? 931  HOH A O   1 
HETATM 8716 O O   . HOH J 6 .   ? -33.069 47.202  -51.567 1.00 68.91  ? 932  HOH A O   1 
HETATM 8717 O O   . HOH J 6 .   ? -53.611 49.190  -19.042 1.00 49.61  ? 933  HOH A O   1 
HETATM 8718 O O   . HOH J 6 .   ? -60.662 47.877  -11.441 1.00 52.56  ? 934  HOH A O   1 
HETATM 8719 O O   . HOH J 6 .   ? -45.825 38.784  -6.506  1.00 73.18  ? 935  HOH A O   1 
HETATM 8720 O O   . HOH J 6 .   ? -81.170 27.174  -21.444 1.00 64.91  ? 936  HOH A O   1 
HETATM 8721 O O   . HOH J 6 .   ? -66.883 58.008  -14.155 1.00 66.98  ? 937  HOH A O   1 
HETATM 8722 O O   . HOH J 6 .   ? -46.067 15.900  -7.245  1.00 72.18  ? 938  HOH A O   1 
HETATM 8723 O O   . HOH J 6 .   ? -42.094 32.859  -18.782 1.00 35.28  ? 939  HOH A O   1 
HETATM 8724 O O   . HOH J 6 .   ? -64.486 35.145  7.732   1.00 49.24  ? 940  HOH A O   1 
HETATM 8725 O O   . HOH J 6 .   ? -52.724 30.985  -53.005 1.00 38.79  ? 941  HOH A O   1 
HETATM 8726 O O   . HOH J 6 .   ? -45.721 36.555  -29.639 1.00 63.53  ? 942  HOH A O   1 
HETATM 8727 O O   . HOH J 6 .   ? -38.365 36.592  -9.534  1.00 45.00  ? 943  HOH A O   1 
HETATM 8728 O O   . HOH J 6 .   ? -31.209 30.375  -6.086  1.00 79.78  ? 944  HOH A O   1 
HETATM 8729 O O   . HOH J 6 .   ? -55.255 30.446  -54.393 1.00 60.45  ? 945  HOH A O   1 
HETATM 8730 O O   . HOH J 6 .   ? -45.376 40.933  -25.349 1.00 35.17  ? 946  HOH A O   1 
HETATM 8731 O O   . HOH J 6 .   ? -62.194 48.634  -44.758 1.00 55.36  ? 947  HOH A O   1 
HETATM 8732 O O   . HOH J 6 .   ? -44.813 21.344  -34.426 1.00 57.27  ? 948  HOH A O   1 
HETATM 8733 O O   . HOH J 6 .   ? -42.409 27.715  -59.294 1.00 70.70  ? 949  HOH A O   1 
HETATM 8734 O O   . HOH J 6 .   ? -32.482 42.134  -54.693 1.00 58.46  ? 950  HOH A O   1 
HETATM 8735 O O   . HOH J 6 .   ? -42.823 37.623  -7.569  1.00 58.97  ? 951  HOH A O   1 
HETATM 8736 O O   . HOH J 6 .   ? -55.029 10.226  -23.925 1.00 59.51  ? 952  HOH A O   1 
HETATM 8737 O O   . HOH J 6 .   ? -63.678 12.100  -32.603 1.00 60.73  ? 953  HOH A O   1 
HETATM 8738 O O   . HOH J 6 .   ? -29.620 19.760  -16.909 1.00 48.47  ? 954  HOH A O   1 
HETATM 8739 O O   . HOH J 6 .   ? -39.781 31.850  -25.519 1.00 66.05  ? 955  HOH A O   1 
HETATM 8740 O O   . HOH J 6 .   ? -39.853 22.738  -24.597 1.00 46.40  ? 956  HOH A O   1 
HETATM 8741 O O   . HOH J 6 .   ? -61.253 46.988  -17.177 1.00 45.00  ? 957  HOH A O   1 
HETATM 8742 O O   . HOH J 6 .   ? -39.043 20.570  -5.236  1.00 67.26  ? 958  HOH A O   1 
HETATM 8743 O O   . HOH J 6 .   ? -56.827 33.582  -51.881 1.00 50.38  ? 959  HOH A O   1 
HETATM 8744 O O   . HOH J 6 .   ? -29.140 39.900  -53.168 1.00 73.96  ? 960  HOH A O   1 
HETATM 8745 O O   . HOH J 6 .   ? -75.962 48.858  -26.974 1.00 67.28  ? 961  HOH A O   1 
HETATM 8746 O O   . HOH J 6 .   ? -72.619 42.901  -44.391 1.00 58.94  ? 962  HOH A O   1 
HETATM 8747 O O   . HOH J 6 .   ? -47.404 22.121  -39.444 1.00 78.18  ? 963  HOH A O   1 
HETATM 8748 O O   . HOH J 6 .   ? -54.041 34.706  -3.118  1.00 58.52  ? 964  HOH A O   1 
HETATM 8749 O O   . HOH J 6 .   ? -59.118 46.348  -13.477 1.00 53.46  ? 965  HOH A O   1 
HETATM 8750 O O   . HOH J 6 .   ? -55.412 32.311  -4.838  1.00 36.77  ? 966  HOH A O   1 
HETATM 8751 O O   . HOH J 6 .   ? -65.623 59.842  -37.742 1.00 50.01  ? 967  HOH A O   1 
HETATM 8752 O O   . HOH J 6 .   ? -53.642 15.538  -18.774 1.00 61.49  ? 968  HOH A O   1 
HETATM 8753 O O   . HOH J 6 .   ? -65.786 14.779  -24.802 1.00 66.44  ? 969  HOH A O   1 
HETATM 8754 O O   . HOH J 6 .   ? -52.615 37.972  -4.145  1.00 48.80  ? 970  HOH A O   1 
HETATM 8755 O O   . HOH J 6 .   ? -79.489 43.897  -17.919 1.00 65.37  ? 971  HOH A O   1 
HETATM 8756 O O   . HOH J 6 .   ? -32.753 9.396   -12.976 1.00 56.82  ? 972  HOH A O   1 
HETATM 8757 O O   . HOH J 6 .   ? -72.063 38.546  0.809   1.00 48.44  ? 973  HOH A O   1 
HETATM 8758 O O   . HOH J 6 .   ? -72.117 28.027  -8.017  1.00 65.86  ? 974  HOH A O   1 
HETATM 8759 O O   . HOH J 6 .   ? -39.923 37.686  -56.437 1.00 35.14  ? 975  HOH A O   1 
HETATM 8760 O O   . HOH J 6 .   ? -73.634 47.655  -36.833 1.00 50.82  ? 976  HOH A O   1 
HETATM 8761 O O   . HOH J 6 .   ? -54.960 49.809  -29.009 1.00 70.01  ? 977  HOH A O   1 
HETATM 8762 O O   . HOH J 6 .   ? -53.977 49.375  -31.728 1.00 55.70  ? 978  HOH A O   1 
HETATM 8763 O O   . HOH J 6 .   ? -45.968 12.565  -16.635 1.00 64.98  ? 979  HOH A O   1 
HETATM 8764 O O   . HOH J 6 .   ? -62.953 34.273  -55.141 1.00 58.64  ? 980  HOH A O   1 
HETATM 8765 O O   . HOH J 6 .   ? -72.702 53.223  -17.745 1.00 55.19  ? 981  HOH A O   1 
HETATM 8766 O O   . HOH J 6 .   ? -73.172 29.324  -50.959 1.00 67.98  ? 982  HOH A O   1 
HETATM 8767 O O   . HOH J 6 .   ? -56.999 47.495  -16.075 1.00 55.83  ? 983  HOH A O   1 
HETATM 8768 O O   . HOH J 6 .   ? -73.107 50.373  -7.370  1.00 71.22  ? 984  HOH A O   1 
HETATM 8769 O O   . HOH J 6 .   ? -67.222 14.564  -46.820 1.00 66.45  ? 985  HOH A O   1 
HETATM 8770 O O   . HOH J 6 .   ? -30.978 33.466  -55.602 1.00 70.01  ? 986  HOH A O   1 
HETATM 8771 O O   . HOH J 6 .   ? -50.661 49.639  -15.372 1.00 70.67  ? 987  HOH A O   1 
HETATM 8772 O O   . HOH J 6 .   ? -61.284 20.963  -53.335 1.00 56.13  ? 988  HOH A O   1 
HETATM 8773 O O   . HOH J 6 .   ? -80.362 32.757  -14.840 1.00 60.13  ? 989  HOH A O   1 
HETATM 8774 O O   . HOH J 6 .   ? -57.273 34.367  -49.256 1.00 60.71  ? 990  HOH A O   1 
HETATM 8775 O O   . HOH J 6 .   ? -35.989 45.388  -36.028 1.00 75.50  ? 991  HOH A O   1 
HETATM 8776 O O   . HOH J 6 .   ? -38.742 12.391  -22.884 1.00 45.77  ? 992  HOH A O   1 
HETATM 8777 O O   . HOH J 6 .   ? -71.514 47.605  -44.516 1.00 66.27  ? 993  HOH A O   1 
HETATM 8778 O O   . HOH J 6 .   ? -68.437 54.974  -20.865 1.00 57.29  ? 994  HOH A O   1 
HETATM 8779 O O   . HOH J 6 .   ? -46.124 9.523   -15.850 1.00 60.59  ? 995  HOH A O   1 
HETATM 8780 O O   . HOH J 6 .   ? -33.795 36.265  -36.091 1.00 64.27  ? 996  HOH A O   1 
HETATM 8781 O O   . HOH J 6 .   ? -72.906 20.389  -21.733 1.00 55.82  ? 997  HOH A O   1 
HETATM 8782 O O   . HOH J 6 .   ? -65.352 29.581  -58.803 1.00 57.43  ? 998  HOH A O   1 
HETATM 8783 O O   . HOH J 6 .   ? -79.718 41.589  -20.365 1.00 60.77  ? 999  HOH A O   1 
HETATM 8784 O O   . HOH J 6 .   ? -73.699 28.078  -10.310 1.00 60.80  ? 1000 HOH A O   1 
HETATM 8785 O O   . HOH J 6 .   ? -69.382 38.505  6.000   1.00 73.88  ? 1001 HOH A O   1 
HETATM 8786 O O   . HOH J 6 .   ? -78.907 40.193  -27.542 1.00 69.33  ? 1002 HOH A O   1 
HETATM 8787 O O   . HOH J 6 .   ? -80.026 30.920  -29.325 1.00 71.13  ? 1003 HOH A O   1 
HETATM 8788 O O   . HOH J 6 .   ? -29.205 28.932  -28.896 1.00 72.64  ? 1004 HOH A O   1 
HETATM 8789 O O   . HOH J 6 .   ? -76.330 31.789  -45.337 1.00 70.78  ? 1005 HOH A O   1 
HETATM 8790 O O   . HOH J 6 .   ? -56.651 20.703  -14.430 1.00 58.36  ? 1006 HOH A O   1 
HETATM 8791 O O   . HOH J 6 .   ? -26.413 13.409  -15.054 1.00 68.07  ? 1007 HOH A O   1 
HETATM 8792 O O   . HOH J 6 .   ? -37.130 21.712  -32.842 1.00 60.03  ? 1008 HOH A O   1 
HETATM 8793 O O   . HOH J 6 .   ? -49.327 19.493  -42.997 1.00 65.21  ? 1009 HOH A O   1 
HETATM 8794 O O   . HOH J 6 .   ? -57.085 32.292  0.630   1.00 60.98  ? 1010 HOH A O   1 
HETATM 8795 O O   . HOH J 6 .   ? -58.543 41.861  -50.752 1.00 71.09  ? 1011 HOH A O   1 
HETATM 8796 O O   . HOH J 6 .   ? -61.569 36.337  2.144   1.00 43.08  ? 1012 HOH A O   1 
HETATM 8797 O O   . HOH J 6 .   ? -73.715 50.362  -27.284 1.00 72.76  ? 1013 HOH A O   1 
HETATM 8798 O O   . HOH J 6 .   ? -52.591 56.844  -36.873 1.00 69.45  ? 1014 HOH A O   1 
HETATM 8799 O O   . HOH J 6 .   ? -59.972 49.546  -21.702 1.00 72.89  ? 1015 HOH A O   1 
HETATM 8800 O O   . HOH J 6 .   ? -49.889 35.130  -54.617 1.00 63.08  ? 1016 HOH A O   1 
HETATM 8801 O O   . HOH J 6 .   ? -52.801 7.750   -25.912 1.00 67.12  ? 1017 HOH A O   1 
HETATM 8802 O O   . HOH J 6 .   ? -28.609 35.688  -20.345 1.00 63.66  ? 1018 HOH A O   1 
HETATM 8803 O O   . HOH J 6 .   ? -52.801 64.481  -25.381 1.00 79.54  ? 1019 HOH A O   1 
HETATM 8804 O O   . HOH J 6 .   ? -62.856 27.083  -6.777  1.00 50.97  ? 1020 HOH A O   1 
HETATM 8805 O O   . HOH J 6 .   ? -48.975 26.442  -58.244 1.00 69.35  ? 1021 HOH A O   1 
HETATM 8806 O O   . HOH J 6 .   ? -78.503 25.231  -17.750 1.00 66.65  ? 1022 HOH A O   1 
HETATM 8807 O O   . HOH J 6 .   ? -54.887 17.263  -46.736 1.00 70.92  ? 1023 HOH A O   1 
HETATM 8808 O O   . HOH J 6 .   ? -32.212 20.137  -31.647 1.00 67.59  ? 1024 HOH A O   1 
HETATM 8809 O O   . HOH J 6 .   ? -67.189 41.549  3.888   1.00 57.00  ? 1025 HOH A O   1 
HETATM 8810 O O   . HOH J 6 .   ? -31.096 30.640  -39.773 1.00 61.58  ? 1026 HOH A O   1 
HETATM 8811 O O   . HOH J 6 .   ? -57.857 22.968  -50.933 1.00 37.22  ? 1027 HOH A O   1 
HETATM 8812 O O   . HOH J 6 .   ? -48.393 55.036  -39.707 1.00 69.99  ? 1028 HOH A O   1 
HETATM 8813 O O   . HOH J 6 .   ? -63.565 27.741  4.348   1.00 66.74  ? 1029 HOH A O   1 
HETATM 8814 O O   . HOH J 6 .   ? -62.615 12.184  -21.359 1.00 61.16  ? 1030 HOH A O   1 
HETATM 8815 O O   . HOH J 6 .   ? -45.502 9.570   -13.351 1.00 73.42  ? 1031 HOH A O   1 
HETATM 8816 O O   . HOH J 6 .   ? -58.290 18.458  -15.011 1.00 68.74  ? 1032 HOH A O   1 
HETATM 8817 O O   . HOH J 6 .   ? -67.046 23.373  -55.351 1.00 58.32  ? 1033 HOH A O   1 
HETATM 8818 O O   . HOH J 6 .   ? -72.330 48.214  -41.752 1.00 62.98  ? 1034 HOH A O   1 
HETATM 8819 O O   . HOH J 6 .   ? -59.679 45.990  -19.405 1.00 57.60  ? 1035 HOH A O   1 
HETATM 8820 O O   . HOH J 6 .   ? -62.477 60.268  -35.071 1.00 75.65  ? 1036 HOH A O   1 
HETATM 8821 O O   . HOH J 6 .   ? -55.383 23.209  -50.769 1.00 46.87  ? 1037 HOH A O   1 
HETATM 8822 O O   . HOH J 6 .   ? -78.629 33.866  -11.381 1.00 64.70  ? 1038 HOH A O   1 
HETATM 8823 O O   . HOH J 6 .   ? -77.273 26.421  -26.753 1.00 55.21  ? 1039 HOH A O   1 
HETATM 8824 O O   . HOH J 6 .   ? -37.897 35.138  -25.185 1.00 77.05  ? 1040 HOH A O   1 
HETATM 8825 O O   . HOH J 6 .   ? -35.141 42.778  -22.267 1.00 63.95  ? 1041 HOH A O   1 
HETATM 8826 O O   . HOH J 6 .   ? -40.000 23.488  -3.528  1.00 54.59  ? 1042 HOH A O   1 
HETATM 8827 O O   . HOH J 6 .   ? -44.482 49.418  -52.178 1.00 78.13  ? 1043 HOH A O   1 
HETATM 8828 O O   . HOH J 6 .   ? -63.115 21.977  -9.859  1.00 60.17  ? 1044 HOH A O   1 
HETATM 8829 O O   . HOH J 6 .   ? -55.426 42.323  -6.662  1.00 34.50  ? 1045 HOH A O   1 
HETATM 8830 O O   . HOH J 6 .   ? -49.952 35.398  -45.155 1.00 43.47  ? 1046 HOH A O   1 
HETATM 8831 O O   . HOH J 6 .   ? -73.322 20.850  -36.617 1.00 60.93  ? 1047 HOH A O   1 
HETATM 8832 O O   . HOH J 6 .   ? -38.001 30.698  -5.473  1.00 47.57  ? 1048 HOH A O   1 
HETATM 8833 O O   . HOH J 6 .   ? -26.127 34.233  -20.871 1.00 68.01  ? 1049 HOH A O   1 
HETATM 8834 O O   . HOH J 6 .   ? -51.178 37.900  -29.103 1.00 51.71  ? 1050 HOH A O   1 
HETATM 8835 O O   . HOH J 6 .   ? -44.845 17.222  -32.215 1.00 54.91  ? 1051 HOH A O   1 
HETATM 8836 O O   . HOH J 6 .   ? -30.551 36.501  -14.487 1.00 69.83  ? 1052 HOH A O   1 
HETATM 8837 O O   . HOH J 6 .   ? -39.796 25.990  -3.633  1.00 60.55  ? 1053 HOH A O   1 
HETATM 8838 O O   . HOH J 6 .   ? -35.530 27.740  -56.415 1.00 45.66  ? 1054 HOH A O   1 
HETATM 8839 O O   . HOH J 6 .   ? -36.878 42.421  -15.967 1.00 70.91  ? 1055 HOH A O   1 
HETATM 8840 O O   . HOH J 6 .   ? -56.814 22.359  -46.899 1.00 50.52  ? 1056 HOH A O   1 
HETATM 8841 O O   . HOH J 6 .   ? -56.489 10.592  -42.970 1.00 63.50  ? 1057 HOH A O   1 
HETATM 8842 O O   . HOH J 6 .   ? -46.093 32.343  -57.685 1.00 76.12  ? 1058 HOH A O   1 
HETATM 8843 O O   . HOH J 6 .   ? -41.495 25.207  -31.434 1.00 65.04  ? 1059 HOH A O   1 
HETATM 8844 O O   . HOH J 6 .   ? -47.743 47.232  -14.205 1.00 66.40  ? 1060 HOH A O   1 
HETATM 8845 O O   . HOH J 6 .   ? -59.179 22.275  -0.367  1.00 76.55  ? 1061 HOH A O   1 
HETATM 8846 O O   . HOH J 6 .   ? -52.827 26.985  -61.291 1.00 64.69  ? 1062 HOH A O   1 
HETATM 8847 O O   . HOH J 6 .   ? -76.898 28.844  -10.161 1.00 58.87  ? 1063 HOH A O   1 
HETATM 8848 O O   . HOH J 6 .   ? -32.073 34.981  -60.249 1.00 69.19  ? 1064 HOH A O   1 
HETATM 8849 O O   . HOH J 6 .   ? -60.553 17.142  -46.286 1.00 65.77  ? 1065 HOH A O   1 
HETATM 8850 O O   . HOH J 6 .   ? -67.039 51.087  -9.072  1.00 54.00  ? 1066 HOH A O   1 
HETATM 8851 O O   . HOH J 6 .   ? -74.145 14.706  -34.205 1.00 67.85  ? 1067 HOH A O   1 
HETATM 8852 O O   . HOH J 6 .   ? -40.393 16.550  -4.600  1.00 65.53  ? 1068 HOH A O   1 
HETATM 8853 O O   . HOH J 6 .   ? -53.543 18.725  -8.401  1.00 70.04  ? 1069 HOH A O   1 
HETATM 8854 O O   . HOH J 6 .   ? -74.228 11.482  -39.582 1.00 78.11  ? 1070 HOH A O   1 
HETATM 8855 O O   . HOH J 6 .   ? -42.468 30.274  -2.538  1.00 71.32  ? 1071 HOH A O   1 
HETATM 8856 O O   . HOH J 6 .   ? -74.266 47.050  -30.888 1.00 54.60  ? 1072 HOH A O   1 
HETATM 8857 O O   . HOH J 6 .   ? -50.240 45.626  -48.014 1.00 56.07  ? 1073 HOH A O   1 
HETATM 8858 O O   . HOH J 6 .   ? -75.119 22.605  -28.316 1.00 70.80  ? 1074 HOH A O   1 
HETATM 8859 O O   . HOH J 6 .   ? -30.348 28.783  -4.399  1.00 79.75  ? 1075 HOH A O   1 
HETATM 8860 O O   . HOH J 6 .   ? -65.532 53.102  -20.962 1.00 73.49  ? 1076 HOH A O   1 
HETATM 8861 O O   . HOH J 6 .   ? -54.225 49.091  -25.632 1.00 57.76  ? 1077 HOH A O   1 
HETATM 8862 O O   . HOH J 6 .   ? -76.987 25.014  -31.581 1.00 66.65  ? 1078 HOH A O   1 
HETATM 8863 O O   . HOH J 6 .   ? -63.448 24.286  -10.415 1.00 57.00  ? 1079 HOH A O   1 
HETATM 8864 O O   . HOH J 6 .   ? -75.282 46.181  -34.438 1.00 62.15  ? 1080 HOH A O   1 
HETATM 8865 O O   . HOH J 6 .   ? -66.036 58.354  -11.209 1.00 73.20  ? 1081 HOH A O   1 
HETATM 8866 O O   . HOH J 6 .   ? -46.370 34.925  -60.320 1.00 61.33  ? 1082 HOH A O   1 
HETATM 8867 O O   . HOH J 6 .   ? -55.095 19.213  -13.394 1.00 61.60  ? 1083 HOH A O   1 
HETATM 8868 O O   . HOH J 6 .   ? -46.192 20.498  -36.091 1.00 70.99  ? 1084 HOH A O   1 
HETATM 8869 O O   . HOH J 6 .   ? -63.102 31.228  -58.049 1.00 67.96  ? 1085 HOH A O   1 
HETATM 8870 O O   . HOH J 6 .   ? -73.343 45.568  -44.062 1.00 58.82  ? 1086 HOH A O   1 
HETATM 8871 O O   . HOH J 6 .   ? -43.546 38.585  -31.574 1.00 66.75  ? 1087 HOH A O   1 
HETATM 8872 O O   . HOH J 6 .   ? -39.945 42.090  -16.334 1.00 60.43  ? 1088 HOH A O   1 
HETATM 8873 O O   . HOH J 6 .   ? -28.919 36.591  -17.918 1.00 67.28  ? 1089 HOH A O   1 
HETATM 8874 O O   . HOH J 6 .   ? -37.410 38.602  -28.805 1.00 74.96  ? 1090 HOH A O   1 
HETATM 8875 O O   . HOH J 6 .   ? -51.556 17.232  -19.077 1.00 56.01  ? 1091 HOH A O   1 
HETATM 8876 O O   . HOH J 6 .   ? -60.097 15.689  -16.337 1.00 66.95  ? 1092 HOH A O   1 
HETATM 8877 O O   . HOH J 6 .   ? -47.871 39.042  -29.770 1.00 46.00  ? 1093 HOH A O   1 
HETATM 8878 O O   . HOH J 6 .   ? -74.997 25.359  -13.243 1.00 60.87  ? 1094 HOH A O   1 
HETATM 8879 O O   . HOH J 6 .   ? -43.883 18.568  -33.870 1.00 71.26  ? 1095 HOH A O   1 
HETATM 8880 O O   . HOH J 6 .   ? -78.700 47.513  -31.603 1.00 61.43  ? 1096 HOH A O   1 
HETATM 8881 O O   . HOH J 6 .   ? -45.160 34.496  -57.330 1.00 60.79  ? 1097 HOH A O   1 
HETATM 8882 O O   . HOH J 6 .   ? -66.319 14.860  -29.327 1.00 63.26  ? 1098 HOH A O   1 
HETATM 8883 O O   . HOH J 6 .   ? -37.907 25.688  -33.842 1.00 71.30  ? 1099 HOH A O   1 
HETATM 8884 O O   . HOH J 6 .   ? -44.227 45.123  -12.279 1.00 68.29  ? 1100 HOH A O   1 
HETATM 8885 O O   . HOH J 6 .   ? -58.676 61.535  -34.232 1.00 64.41  ? 1101 HOH A O   1 
HETATM 8886 O O   . HOH J 6 .   ? -47.696 31.257  -53.827 1.00 62.23  ? 1102 HOH A O   1 
HETATM 8887 O O   . HOH J 6 .   ? -66.242 20.017  -14.725 1.00 66.21  ? 1103 HOH A O   1 
HETATM 8888 O O   . HOH J 6 .   ? -74.946 45.418  -36.821 1.00 56.21  ? 1104 HOH A O   1 
HETATM 8889 O O   . HOH J 6 .   ? -48.534 12.937  -15.749 1.00 64.91  ? 1105 HOH A O   1 
HETATM 8890 O O   . HOH J 6 .   ? -76.129 30.463  -7.838  1.00 65.83  ? 1106 HOH A O   1 
HETATM 8891 O O   . HOH J 6 .   ? -40.096 6.776   -9.125  1.00 68.28  ? 1107 HOH A O   1 
HETATM 8892 O O   . HOH J 6 .   ? -72.961 20.520  -41.356 1.00 68.72  ? 1108 HOH A O   1 
HETATM 8893 O O   . HOH J 6 .   ? -77.262 39.790  -1.970  1.00 72.17  ? 1109 HOH A O   1 
HETATM 8894 O O   . HOH J 6 .   ? -80.726 33.776  -30.626 1.00 71.37  ? 1110 HOH A O   1 
HETATM 8895 O O   . HOH J 6 .   ? -50.173 39.310  -30.820 1.00 47.16  ? 1111 HOH A O   1 
HETATM 8896 O O   . HOH J 6 .   ? -44.217 38.366  -56.451 1.00 46.59  ? 1112 HOH A O   1 
HETATM 8897 O O   . HOH J 6 .   ? -43.040 22.064  -40.300 1.00 77.57  ? 1113 HOH A O   1 
HETATM 8898 O O   . HOH J 6 .   ? -50.726 16.143  -15.563 1.00 58.45  ? 1114 HOH A O   1 
HETATM 8899 O O   . HOH J 6 .   ? -43.511 44.379  -17.066 1.00 49.63  ? 1115 HOH A O   1 
HETATM 8900 O O   . HOH J 6 .   ? -59.298 59.597  -38.511 1.00 62.21  ? 1116 HOH A O   1 
HETATM 8901 O O   . HOH J 6 .   ? -74.237 37.130  0.111   1.00 55.89  ? 1117 HOH A O   1 
HETATM 8902 O O   . HOH J 6 .   ? -79.426 31.787  -26.557 1.00 65.02  ? 1118 HOH A O   1 
HETATM 8903 O O   . HOH J 6 .   ? -61.898 14.120  -31.790 1.00 59.36  ? 1119 HOH A O   1 
HETATM 8904 O O   . HOH J 6 .   ? -55.769 35.914  -47.290 1.00 58.57  ? 1120 HOH A O   1 
HETATM 8905 O O   . HOH J 6 .   ? -49.315 16.728  -9.317  1.00 55.23  ? 1121 HOH A O   1 
HETATM 8906 O O   . HOH J 6 .   ? -76.061 44.877  -48.120 1.00 68.47  ? 1122 HOH A O   1 
HETATM 8907 O O   . HOH J 6 .   ? -49.042 14.680  -13.704 1.00 52.84  ? 1123 HOH A O   1 
HETATM 8908 O O   . HOH J 6 .   ? -79.610 35.063  -25.256 1.00 58.56  ? 1124 HOH A O   1 
HETATM 8909 O O   . HOH J 6 .   ? -40.314 47.540  -20.276 1.00 72.76  ? 1125 HOH A O   1 
HETATM 8910 O O   . HOH J 6 .   ? -72.586 35.064  -52.817 1.00 66.44  ? 1126 HOH A O   1 
HETATM 8911 O O   . HOH J 6 .   ? -53.700 16.335  -14.155 1.00 65.62  ? 1127 HOH A O   1 
HETATM 8912 O O   . HOH K 6 .   ? -54.797 -21.051 -33.270 1.00 68.44  ? 701  HOH B O   1 
HETATM 8913 O O   . HOH K 6 .   ? -17.091 -5.924  -28.076 1.00 62.42  ? 702  HOH B O   1 
HETATM 8914 O O   . HOH K 6 .   ? -55.130 -7.685  -46.388 1.00 62.90  ? 703  HOH B O   1 
HETATM 8915 O O   . HOH K 6 .   ? -16.113 0.526   -15.877 1.00 62.59  ? 704  HOH B O   1 
HETATM 8916 O O   . HOH K 6 .   ? -57.827 -26.489 -12.029 1.00 54.36  ? 705  HOH B O   1 
HETATM 8917 O O   . HOH K 6 .   ? -22.493 -35.570 1.654   1.00 62.12  ? 706  HOH B O   1 
HETATM 8918 O O   . HOH K 6 .   ? -17.327 -8.190  7.686   1.00 67.24  ? 707  HOH B O   1 
HETATM 8919 O O   . HOH K 6 .   ? -54.168 -22.534 -9.640  1.00 55.54  ? 708  HOH B O   1 
HETATM 8920 O O   . HOH K 6 .   ? -31.084 -40.832 -17.622 1.00 52.35  ? 709  HOH B O   1 
HETATM 8921 O O   . HOH K 6 .   ? -45.840 -21.127 -6.128  1.00 60.06  ? 710  HOH B O   1 
HETATM 8922 O O   . HOH K 6 .   ? -18.533 -10.129 4.554   1.00 51.24  ? 711  HOH B O   1 
HETATM 8923 O O   . HOH K 6 .   ? -32.751 -32.513 2.697   1.00 32.05  ? 712  HOH B O   1 
HETATM 8924 O O   . HOH K 6 .   ? -35.052 -8.343  -14.827 1.00 48.65  ? 713  HOH B O   1 
HETATM 8925 O O   . HOH K 6 .   ? -48.510 -3.465  -23.859 1.00 59.13  ? 714  HOH B O   1 
HETATM 8926 O O   . HOH K 6 .   ? -54.765 -38.714 -10.369 1.00 70.87  ? 715  HOH B O   1 
HETATM 8927 O O   . HOH K 6 .   ? -41.855 -14.663 -6.899  1.00 38.55  ? 716  HOH B O   1 
HETATM 8928 O O   . HOH K 6 .   ? -41.384 -41.878 -19.705 1.00 48.80  ? 717  HOH B O   1 
HETATM 8929 O O   . HOH K 6 .   ? -27.836 -6.930  2.727   1.00 62.93  ? 718  HOH B O   1 
HETATM 8930 O O   . HOH K 6 .   ? -39.153 -25.070 -8.772  1.00 26.98  ? 719  HOH B O   1 
HETATM 8931 O O   . HOH K 6 .   ? -38.000 -2.801  -22.091 1.00 31.31  ? 720  HOH B O   1 
HETATM 8932 O O   . HOH K 6 .   ? -43.091 2.963   -21.251 1.00 51.22  ? 721  HOH B O   1 
HETATM 8933 O O   . HOH K 6 .   ? -23.003 -31.929 -23.094 1.00 55.95  ? 722  HOH B O   1 
HETATM 8934 O O   . HOH K 6 .   ? -16.650 -16.483 6.565   1.00 59.00  ? 723  HOH B O   1 
HETATM 8935 O O   . HOH K 6 .   ? -32.515 8.503   -36.472 1.00 69.36  ? 724  HOH B O   1 
HETATM 8936 O O   . HOH K 6 .   ? -30.483 -26.569 -43.262 1.00 76.28  ? 725  HOH B O   1 
HETATM 8937 O O   . HOH K 6 .   ? -48.455 -19.146 -28.467 1.00 35.34  ? 726  HOH B O   1 
HETATM 8938 O O   . HOH K 6 .   ? -13.711 -21.861 -6.230  1.00 58.61  ? 727  HOH B O   1 
HETATM 8939 O O   . HOH K 6 .   ? -39.852 -47.490 -25.253 1.00 71.80  ? 728  HOH B O   1 
HETATM 8940 O O   . HOH K 6 .   ? -40.902 -25.194 -24.701 1.00 23.30  ? 729  HOH B O   1 
HETATM 8941 O O   . HOH K 6 .   ? -63.106 -24.508 -39.988 1.00 60.44  ? 730  HOH B O   1 
HETATM 8942 O O   . HOH K 6 .   ? -56.110 -32.943 -15.027 1.00 47.75  ? 731  HOH B O   1 
HETATM 8943 O O   . HOH K 6 .   ? -19.661 -6.044  -25.628 1.00 48.66  ? 732  HOH B O   1 
HETATM 8944 O O   . HOH K 6 .   ? -38.660 -17.173 -19.826 1.00 29.24  ? 733  HOH B O   1 
HETATM 8945 O O   . HOH K 6 .   ? -19.833 -8.398  -28.669 1.00 41.19  ? 734  HOH B O   1 
HETATM 8946 O O   . HOH K 6 .   ? -34.498 -37.819 -8.408  1.00 43.64  ? 735  HOH B O   1 
HETATM 8947 O O   . HOH K 6 .   ? -30.516 -15.039 -35.059 1.00 35.71  ? 736  HOH B O   1 
HETATM 8948 O O   . HOH K 6 .   ? -33.462 -28.242 -40.957 1.00 64.82  ? 737  HOH B O   1 
HETATM 8949 O O   . HOH K 6 .   ? -38.411 -36.675 -6.865  1.00 45.71  ? 738  HOH B O   1 
HETATM 8950 O O   . HOH K 6 .   ? -16.978 4.907   -31.707 1.00 72.05  ? 739  HOH B O   1 
HETATM 8951 O O   . HOH K 6 .   ? -39.814 -35.055 -9.830  1.00 27.24  ? 740  HOH B O   1 
HETATM 8952 O O   . HOH K 6 .   ? -19.423 -5.858  -28.451 1.00 53.94  ? 741  HOH B O   1 
HETATM 8953 O O   . HOH K 6 .   ? -18.332 5.470   -18.748 1.00 59.81  ? 742  HOH B O   1 
HETATM 8954 O O   . HOH K 6 .   ? -21.024 -21.999 -14.429 1.00 30.38  ? 743  HOH B O   1 
HETATM 8955 O O   . HOH K 6 .   ? -47.951 -38.366 -24.792 1.00 46.35  ? 744  HOH B O   1 
HETATM 8956 O O   . HOH K 6 .   ? -51.696 -26.853 -7.461  1.00 35.88  ? 745  HOH B O   1 
HETATM 8957 O O   . HOH K 6 .   ? -21.578 1.158   -9.775  1.00 54.31  ? 746  HOH B O   1 
HETATM 8958 O O   . HOH K 6 .   ? -46.752 -24.871 7.547   1.00 40.46  ? 747  HOH B O   1 
HETATM 8959 O O   . HOH K 6 .   ? -27.497 -8.136  6.846   1.00 57.44  ? 748  HOH B O   1 
HETATM 8960 O O   . HOH K 6 .   ? -38.002 -32.257 -38.071 1.00 40.11  ? 749  HOH B O   1 
HETATM 8961 O O   . HOH K 6 .   ? -50.772 -25.480 -20.596 1.00 41.96  ? 750  HOH B O   1 
HETATM 8962 O O   . HOH K 6 .   ? -42.636 -21.742 -24.265 1.00 30.45  ? 751  HOH B O   1 
HETATM 8963 O O   . HOH K 6 .   ? -22.204 -35.607 -28.313 1.00 54.58  ? 752  HOH B O   1 
HETATM 8964 O O   . HOH K 6 .   ? -54.392 -28.546 -6.277  1.00 61.06  ? 753  HOH B O   1 
HETATM 8965 O O   . HOH K 6 .   ? -32.907 -11.316 -6.912  1.00 29.83  ? 754  HOH B O   1 
HETATM 8966 O O   . HOH K 6 .   ? -52.883 -18.112 -16.948 1.00 78.40  ? 755  HOH B O   1 
HETATM 8967 O O   . HOH K 6 .   ? -28.980 -32.327 2.146   1.00 51.88  ? 756  HOH B O   1 
HETATM 8968 O O   . HOH K 6 .   ? -35.708 -20.986 -39.053 1.00 41.03  ? 757  HOH B O   1 
HETATM 8969 O O   . HOH K 6 .   ? -31.523 -44.134 -22.360 1.00 61.07  ? 758  HOH B O   1 
HETATM 8970 O O   . HOH K 6 .   ? -29.146 -4.137  -30.442 1.00 40.92  ? 759  HOH B O   1 
HETATM 8971 O O   . HOH K 6 .   ? -49.190 -30.318 -3.565  1.00 69.04  ? 760  HOH B O   1 
HETATM 8972 O O   . HOH K 6 .   ? -48.102 -5.077  -13.520 1.00 58.99  ? 761  HOH B O   1 
HETATM 8973 O O   . HOH K 6 .   ? -15.112 -9.340  1.985   1.00 60.17  ? 762  HOH B O   1 
HETATM 8974 O O   . HOH K 6 .   ? -16.335 -12.075 -21.582 1.00 45.31  ? 763  HOH B O   1 
HETATM 8975 O O   . HOH K 6 .   ? -42.354 -5.397  -43.556 1.00 78.89  ? 764  HOH B O   1 
HETATM 8976 O O   . HOH K 6 .   ? -23.205 11.553  -19.249 1.00 60.24  ? 765  HOH B O   1 
HETATM 8977 O O   . HOH K 6 .   ? -41.727 1.250   -34.836 1.00 73.97  ? 766  HOH B O   1 
HETATM 8978 O O   . HOH K 6 .   ? -35.551 -6.440  -27.264 1.00 30.02  ? 767  HOH B O   1 
HETATM 8979 O O   . HOH K 6 .   ? -42.531 -2.782  -10.426 1.00 54.45  ? 768  HOH B O   1 
HETATM 8980 O O   . HOH K 6 .   ? -29.057 -36.738 -31.405 1.00 32.41  ? 769  HOH B O   1 
HETATM 8981 O O   . HOH K 6 .   ? -17.604 -27.133 -20.702 1.00 54.31  ? 770  HOH B O   1 
HETATM 8982 O O   . HOH K 6 .   ? -25.348 -5.895  -8.024  1.00 30.28  ? 771  HOH B O   1 
HETATM 8983 O O   . HOH K 6 .   ? -34.038 -31.060 -38.479 1.00 46.09  ? 772  HOH B O   1 
HETATM 8984 O O   . HOH K 6 .   ? -42.234 -10.455 -20.949 1.00 39.07  ? 773  HOH B O   1 
HETATM 8985 O O   . HOH K 6 .   ? -35.505 -3.626  -27.092 1.00 40.73  ? 774  HOH B O   1 
HETATM 8986 O O   . HOH K 6 .   ? -27.855 0.165   -16.612 1.00 27.31  ? 775  HOH B O   1 
HETATM 8987 O O   . HOH K 6 .   ? -31.486 4.807   -12.838 1.00 43.11  ? 776  HOH B O   1 
HETATM 8988 O O   . HOH K 6 .   ? -26.460 -37.192 -33.034 1.00 49.16  ? 777  HOH B O   1 
HETATM 8989 O O   . HOH K 6 .   ? -26.512 -0.582  -19.016 1.00 27.69  ? 778  HOH B O   1 
HETATM 8990 O O   . HOH K 6 .   ? -32.318 -28.892 -48.604 1.00 61.81  ? 779  HOH B O   1 
HETATM 8991 O O   . HOH K 6 .   ? -27.815 5.396   -14.715 1.00 39.60  ? 780  HOH B O   1 
HETATM 8992 O O   . HOH K 6 .   ? -23.154 -26.395 1.783   1.00 53.42  ? 781  HOH B O   1 
HETATM 8993 O O   . HOH K 6 .   ? -42.691 -8.343  -44.700 1.00 49.27  ? 782  HOH B O   1 
HETATM 8994 O O   . HOH K 6 .   ? -45.446 -10.965 -12.237 1.00 30.99  ? 783  HOH B O   1 
HETATM 8995 O O   . HOH K 6 .   ? -19.095 -22.962 -34.702 1.00 64.10  ? 784  HOH B O   1 
HETATM 8996 O O   . HOH K 6 .   ? -35.739 -17.749 -10.869 1.00 26.20  ? 785  HOH B O   1 
HETATM 8997 O O   . HOH K 6 .   ? -58.687 -21.875 -54.662 1.00 47.80  ? 786  HOH B O   1 
HETATM 8998 O O   . HOH K 6 .   ? -38.585 -18.788 -3.777  1.00 40.85  ? 787  HOH B O   1 
HETATM 8999 O O   . HOH K 6 .   ? -52.082 -21.410 -15.795 1.00 50.46  ? 788  HOH B O   1 
HETATM 9000 O O   . HOH K 6 .   ? -56.486 -13.801 -51.586 1.00 68.56  ? 789  HOH B O   1 
HETATM 9001 O O   . HOH K 6 .   ? -33.263 -20.225 -38.826 1.00 51.54  ? 790  HOH B O   1 
HETATM 9002 O O   . HOH K 6 .   ? -34.515 -39.400 -34.243 1.00 29.20  ? 791  HOH B O   1 
HETATM 9003 O O   . HOH K 6 .   ? -42.265 -33.862 -5.941  1.00 44.31  ? 792  HOH B O   1 
HETATM 9004 O O   . HOH K 6 .   ? -38.792 -16.842 -8.865  1.00 43.59  ? 793  HOH B O   1 
HETATM 9005 O O   . HOH K 6 .   ? -26.703 -4.198  -9.637  1.00 29.45  ? 794  HOH B O   1 
HETATM 9006 O O   . HOH K 6 .   ? -32.740 -15.901 -15.238 1.00 23.64  ? 795  HOH B O   1 
HETATM 9007 O O   . HOH K 6 .   ? -16.273 -1.253  -23.399 1.00 48.90  ? 796  HOH B O   1 
HETATM 9008 O O   . HOH K 6 .   ? -20.833 -17.548 6.261   1.00 38.72  ? 797  HOH B O   1 
HETATM 9009 O O   . HOH K 6 .   ? -38.625 -12.242 -2.236  1.00 41.55  ? 798  HOH B O   1 
HETATM 9010 O O   . HOH K 6 .   ? -19.737 -20.665 3.896   1.00 47.10  ? 799  HOH B O   1 
HETATM 9011 O O   . HOH K 6 .   ? -42.209 -6.655  -18.390 1.00 30.85  ? 800  HOH B O   1 
HETATM 9012 O O   . HOH K 6 .   ? -30.163 -39.147 -13.103 1.00 37.08  ? 801  HOH B O   1 
HETATM 9013 O O   . HOH K 6 .   ? -15.113 2.678   -21.647 1.00 78.00  ? 802  HOH B O   1 
HETATM 9014 O O   . HOH K 6 .   ? -25.292 -28.861 5.508   1.00 42.56  ? 803  HOH B O   1 
HETATM 9015 O O   . HOH K 6 .   ? -31.533 -2.618  -6.160  1.00 31.83  ? 804  HOH B O   1 
HETATM 9016 O O   . HOH K 6 .   ? -18.708 -13.459 -4.184  1.00 45.26  ? 805  HOH B O   1 
HETATM 9017 O O   . HOH K 6 .   ? -39.586 -13.644 -18.349 1.00 31.44  ? 806  HOH B O   1 
HETATM 9018 O O   . HOH K 6 .   ? -32.790 -41.905 -31.981 1.00 41.11  ? 807  HOH B O   1 
HETATM 9019 O O   . HOH K 6 .   ? -45.897 -21.298 -17.373 1.00 32.27  ? 808  HOH B O   1 
HETATM 9020 O O   . HOH K 6 .   ? -57.427 -27.015 -44.048 1.00 53.80  ? 809  HOH B O   1 
HETATM 9021 O O   . HOH K 6 .   ? -17.172 -2.071  -29.655 1.00 61.43  ? 810  HOH B O   1 
HETATM 9022 O O   . HOH K 6 .   ? -14.856 -4.631  -9.928  1.00 57.30  ? 811  HOH B O   1 
HETATM 9023 O O   . HOH K 6 .   ? -36.194 -36.578 -29.330 1.00 28.34  ? 812  HOH B O   1 
HETATM 9024 O O   . HOH K 6 .   ? -39.662 12.371  -29.106 1.00 50.03  ? 813  HOH B O   1 
HETATM 9025 O O   . HOH K 6 .   ? -42.681 1.178   -37.631 1.00 57.13  ? 814  HOH B O   1 
HETATM 9026 O O   . HOH K 6 .   ? -23.477 -1.610  -24.954 1.00 36.34  ? 815  HOH B O   1 
HETATM 9027 O O   . HOH K 6 .   ? -23.568 14.623  -25.117 1.00 61.92  ? 816  HOH B O   1 
HETATM 9028 O O   . HOH K 6 .   ? -21.554 3.493   -11.327 1.00 46.24  ? 817  HOH B O   1 
HETATM 9029 O O   . HOH K 6 .   ? -55.571 -23.945 -40.950 1.00 50.35  ? 818  HOH B O   1 
HETATM 9030 O O   . HOH K 6 .   ? -46.211 -37.434 -22.224 1.00 24.83  ? 819  HOH B O   1 
HETATM 9031 O O   . HOH K 6 .   ? -26.268 -30.075 -14.308 1.00 32.28  ? 820  HOH B O   1 
HETATM 9032 O O   . HOH K 6 .   ? -20.936 -3.224  -13.633 1.00 31.97  ? 821  HOH B O   1 
HETATM 9033 O O   . HOH K 6 .   ? -33.271 -43.229 -25.612 1.00 48.06  ? 822  HOH B O   1 
HETATM 9034 O O   . HOH K 6 .   ? -29.427 -7.897  -1.721  1.00 37.58  ? 823  HOH B O   1 
HETATM 9035 O O   . HOH K 6 .   ? -40.721 -8.937  -15.780 1.00 41.18  ? 824  HOH B O   1 
HETATM 9036 O O   . HOH K 6 .   ? -14.726 -13.500 -31.629 1.00 51.06  ? 825  HOH B O   1 
HETATM 9037 O O   . HOH K 6 .   ? -58.712 -29.736 -47.220 1.00 58.98  ? 826  HOH B O   1 
HETATM 9038 O O   . HOH K 6 .   ? -57.029 -21.400 -46.531 1.00 37.32  ? 827  HOH B O   1 
HETATM 9039 O O   . HOH K 6 .   ? -17.002 -2.177  -17.334 1.00 53.52  ? 828  HOH B O   1 
HETATM 9040 O O   . HOH K 6 .   ? -28.384 -0.540  -30.790 1.00 30.31  ? 829  HOH B O   1 
HETATM 9041 O O   . HOH K 6 .   ? -63.286 -20.686 -48.142 1.00 45.02  ? 830  HOH B O   1 
HETATM 9042 O O   . HOH K 6 .   ? -29.979 -0.632  -41.384 1.00 53.23  ? 831  HOH B O   1 
HETATM 9043 O O   . HOH K 6 .   ? -36.144 15.011  -30.374 1.00 53.78  ? 832  HOH B O   1 
HETATM 9044 O O   . HOH K 6 .   ? -43.753 7.170   -27.418 1.00 79.32  ? 833  HOH B O   1 
HETATM 9045 O O   . HOH K 6 .   ? -37.618 -18.994 -39.780 1.00 36.59  ? 834  HOH B O   1 
HETATM 9046 O O   . HOH K 6 .   ? -32.648 -3.089  -18.410 1.00 52.03  ? 835  HOH B O   1 
HETATM 9047 O O   . HOH K 6 .   ? -30.955 -42.063 -25.150 1.00 46.18  ? 836  HOH B O   1 
HETATM 9048 O O   . HOH K 6 .   ? -35.046 -0.107  -23.381 1.00 46.75  ? 837  HOH B O   1 
HETATM 9049 O O   . HOH K 6 .   ? -37.951 -42.472 -20.018 1.00 58.81  ? 838  HOH B O   1 
HETATM 9050 O O   . HOH K 6 .   ? -18.660 -16.729 -31.434 1.00 42.75  ? 839  HOH B O   1 
HETATM 9051 O O   . HOH K 6 .   ? -33.021 -45.159 -23.865 1.00 56.73  ? 840  HOH B O   1 
HETATM 9052 O O   . HOH K 6 .   ? -20.703 9.452   -20.350 1.00 59.09  ? 841  HOH B O   1 
HETATM 9053 O O   . HOH K 6 .   ? -45.544 -30.803 3.784   1.00 53.84  ? 842  HOH B O   1 
HETATM 9054 O O   . HOH K 6 .   ? -36.618 -35.331 -2.626  1.00 31.75  ? 843  HOH B O   1 
HETATM 9055 O O   . HOH K 6 .   ? -23.258 -7.865  -38.595 1.00 56.84  ? 844  HOH B O   1 
HETATM 9056 O O   . HOH K 6 .   ? -41.298 -11.716 -18.363 1.00 28.83  ? 845  HOH B O   1 
HETATM 9057 O O   . HOH K 6 .   ? -24.819 -4.309  -5.514  1.00 42.36  ? 846  HOH B O   1 
HETATM 9058 O O   . HOH K 6 .   ? -33.860 -0.708  -41.406 1.00 59.13  ? 847  HOH B O   1 
HETATM 9059 O O   . HOH K 6 .   ? -54.340 -11.093 -38.756 1.00 41.22  ? 848  HOH B O   1 
HETATM 9060 O O   . HOH K 6 .   ? -31.370 6.229   -37.159 1.00 51.73  ? 849  HOH B O   1 
HETATM 9061 O O   . HOH K 6 .   ? -45.290 -15.331 -12.461 1.00 34.48  ? 850  HOH B O   1 
HETATM 9062 O O   . HOH K 6 .   ? -26.746 2.581   -39.825 1.00 69.89  ? 851  HOH B O   1 
HETATM 9063 O O   . HOH K 6 .   ? -17.739 -23.411 -6.978  1.00 33.86  ? 852  HOH B O   1 
HETATM 9064 O O   . HOH K 6 .   ? -65.186 -26.325 -43.982 1.00 70.30  ? 853  HOH B O   1 
HETATM 9065 O O   . HOH K 6 .   ? -57.681 -25.561 -28.838 1.00 62.23  ? 854  HOH B O   1 
HETATM 9066 O O   . HOH K 6 .   ? -26.465 6.656   -16.916 1.00 37.91  ? 855  HOH B O   1 
HETATM 9067 O O   . HOH K 6 .   ? -62.586 -9.045  -37.524 1.00 67.46  ? 856  HOH B O   1 
HETATM 9068 O O   . HOH K 6 .   ? -54.013 -14.795 -51.874 1.00 48.67  ? 857  HOH B O   1 
HETATM 9069 O O   . HOH K 6 .   ? -20.277 -2.284  -4.626  1.00 51.84  ? 858  HOH B O   1 
HETATM 9070 O O   . HOH K 6 .   ? -52.949 -22.289 -32.625 1.00 67.98  ? 859  HOH B O   1 
HETATM 9071 O O   . HOH K 6 .   ? -35.641 -1.694  -21.080 1.00 37.40  ? 860  HOH B O   1 
HETATM 9072 O O   . HOH K 6 .   ? -50.946 -35.829 -7.468  1.00 66.21  ? 861  HOH B O   1 
HETATM 9073 O O   . HOH K 6 .   ? -38.351 -29.864 -39.206 1.00 38.56  ? 862  HOH B O   1 
HETATM 9074 O O   . HOH K 6 .   ? -22.639 -15.609 6.482   1.00 37.24  ? 863  HOH B O   1 
HETATM 9075 O O   . HOH K 6 .   ? -21.076 -21.644 -41.799 1.00 59.95  ? 864  HOH B O   1 
HETATM 9076 O O   . HOH K 6 .   ? -46.481 -24.691 -32.591 1.00 35.41  ? 865  HOH B O   1 
HETATM 9077 O O   . HOH K 6 .   ? -50.403 -19.690 -15.555 1.00 48.90  ? 866  HOH B O   1 
HETATM 9078 O O   . HOH K 6 .   ? -17.125 -12.688 -25.976 1.00 46.97  ? 867  HOH B O   1 
HETATM 9079 O O   . HOH K 6 .   ? -36.017 -9.278  -9.877  1.00 38.28  ? 868  HOH B O   1 
HETATM 9080 O O   . HOH K 6 .   ? -50.488 -37.461 -14.956 1.00 58.57  ? 869  HOH B O   1 
HETATM 9081 O O   . HOH K 6 .   ? -54.150 -8.004  -32.059 1.00 60.51  ? 870  HOH B O   1 
HETATM 9082 O O   . HOH K 6 .   ? -40.686 9.796   -21.224 1.00 46.71  ? 871  HOH B O   1 
HETATM 9083 O O   . HOH K 6 .   ? -26.453 -5.632  -28.413 1.00 32.11  ? 872  HOH B O   1 
HETATM 9084 O O   . HOH K 6 .   ? -31.802 -9.406  -0.885  1.00 48.40  ? 873  HOH B O   1 
HETATM 9085 O O   . HOH K 6 .   ? -34.362 -30.032 0.639   1.00 28.54  ? 874  HOH B O   1 
HETATM 9086 O O   . HOH K 6 .   ? -44.232 -20.670 -4.521  1.00 69.74  ? 875  HOH B O   1 
HETATM 9087 O O   . HOH K 6 .   ? -18.582 -11.558 -9.785  1.00 41.94  ? 876  HOH B O   1 
HETATM 9088 O O   . HOH K 6 .   ? -20.532 -11.842 -5.218  1.00 33.07  ? 877  HOH B O   1 
HETATM 9089 O O   . HOH K 6 .   ? -61.617 -19.569 -27.578 1.00 60.24  ? 878  HOH B O   1 
HETATM 9090 O O   . HOH K 6 .   ? -39.016 -11.729 -39.303 1.00 46.24  ? 879  HOH B O   1 
HETATM 9091 O O   . HOH K 6 .   ? -45.487 -4.534  -13.089 1.00 45.53  ? 880  HOH B O   1 
HETATM 9092 O O   . HOH K 6 .   ? -43.364 7.249   -17.934 1.00 78.69  ? 881  HOH B O   1 
HETATM 9093 O O   . HOH K 6 .   ? -40.985 -34.472 -3.477  1.00 46.84  ? 882  HOH B O   1 
HETATM 9094 O O   . HOH K 6 .   ? -25.782 -33.827 1.306   1.00 72.19  ? 883  HOH B O   1 
HETATM 9095 O O   . HOH K 6 .   ? -33.438 -40.610 -11.780 1.00 61.07  ? 884  HOH B O   1 
HETATM 9096 O O   . HOH K 6 .   ? -29.570 -34.786 -8.180  1.00 43.63  ? 885  HOH B O   1 
HETATM 9097 O O   . HOH K 6 .   ? -54.234 -30.800 -22.837 1.00 52.57  ? 886  HOH B O   1 
HETATM 9098 O O   . HOH K 6 .   ? -14.820 -20.661 -20.937 1.00 53.94  ? 887  HOH B O   1 
HETATM 9099 O O   . HOH K 6 .   ? -61.585 -8.057  -42.823 1.00 67.01  ? 888  HOH B O   1 
HETATM 9100 O O   . HOH K 6 .   ? -35.577 -11.288 -22.226 1.00 22.75  ? 889  HOH B O   1 
HETATM 9101 O O   . HOH K 6 .   ? -21.276 -1.815  -16.156 1.00 39.31  ? 890  HOH B O   1 
HETATM 9102 O O   . HOH K 6 .   ? -29.898 17.035  -23.333 1.00 47.09  ? 891  HOH B O   1 
HETATM 9103 O O   . HOH K 6 .   ? -18.671 -29.131 -5.131  1.00 59.41  ? 892  HOH B O   1 
HETATM 9104 O O   . HOH K 6 .   ? -32.209 2.864   -11.184 1.00 36.65  ? 893  HOH B O   1 
HETATM 9105 O O   . HOH K 6 .   ? -40.890 -15.625 -22.331 1.00 60.68  ? 894  HOH B O   1 
HETATM 9106 O O   . HOH K 6 .   ? -41.523 -20.372 3.006   1.00 55.16  ? 895  HOH B O   1 
HETATM 9107 O O   . HOH K 6 .   ? -28.436 -36.798 -37.229 1.00 48.90  ? 896  HOH B O   1 
HETATM 9108 O O   . HOH K 6 .   ? -33.200 6.588   -13.843 1.00 41.82  ? 897  HOH B O   1 
HETATM 9109 O O   . HOH K 6 .   ? -41.761 0.834   -17.427 1.00 31.99  ? 898  HOH B O   1 
HETATM 9110 O O   . HOH K 6 .   ? -18.764 -3.400  2.546   1.00 60.31  ? 899  HOH B O   1 
HETATM 9111 O O   . HOH K 6 .   ? -45.197 -37.450 -38.796 1.00 60.17  ? 900  HOH B O   1 
HETATM 9112 O O   . HOH K 6 .   ? -50.008 -5.582  -41.910 1.00 63.91  ? 901  HOH B O   1 
HETATM 9113 O O   . HOH K 6 .   ? -44.382 -41.778 -20.191 1.00 56.69  ? 902  HOH B O   1 
HETATM 9114 O O   . HOH K 6 .   ? -45.991 0.637   -19.454 1.00 53.96  ? 903  HOH B O   1 
HETATM 9115 O O   . HOH K 6 .   ? -16.594 -30.970 -30.191 1.00 51.05  ? 904  HOH B O   1 
HETATM 9116 O O   . HOH K 6 .   ? -30.193 -6.872  -38.826 1.00 41.44  ? 905  HOH B O   1 
HETATM 9117 O O   . HOH K 6 .   ? -50.564 -13.124 -11.921 1.00 70.52  ? 906  HOH B O   1 
HETATM 9118 O O   . HOH K 6 .   ? -31.726 -11.906 -37.063 1.00 66.89  ? 907  HOH B O   1 
HETATM 9119 O O   . HOH K 6 .   ? -18.857 -4.126  -1.960  1.00 64.59  ? 908  HOH B O   1 
HETATM 9120 O O   . HOH K 6 .   ? -64.210 -13.191 -33.836 1.00 67.52  ? 909  HOH B O   1 
HETATM 9121 O O   . HOH K 6 .   ? -40.811 -43.430 -34.541 1.00 63.09  ? 910  HOH B O   1 
HETATM 9122 O O   . HOH K 6 .   ? -44.532 -32.124 -41.738 1.00 56.12  ? 911  HOH B O   1 
HETATM 9123 O O   . HOH K 6 .   ? -46.604 -9.317  -19.992 1.00 60.18  ? 912  HOH B O   1 
HETATM 9124 O O   . HOH K 6 .   ? -43.644 -33.129 -39.524 1.00 43.65  ? 913  HOH B O   1 
HETATM 9125 O O   . HOH K 6 .   ? -29.370 -1.766  -15.526 1.00 26.51  ? 914  HOH B O   1 
HETATM 9126 O O   . HOH K 6 .   ? -13.927 -11.658 0.950   1.00 56.70  ? 915  HOH B O   1 
HETATM 9127 O O   . HOH K 6 .   ? -15.008 -16.491 -19.700 1.00 57.11  ? 916  HOH B O   1 
HETATM 9128 O O   . HOH K 6 .   ? -28.972 -17.630 10.035  1.00 62.36  ? 917  HOH B O   1 
HETATM 9129 O O   . HOH K 6 .   ? -33.602 -32.730 -40.669 1.00 43.00  ? 918  HOH B O   1 
HETATM 9130 O O   . HOH K 6 .   ? -13.580 -19.856 -3.514  1.00 62.11  ? 919  HOH B O   1 
HETATM 9131 O O   . HOH K 6 .   ? -49.450 -25.501 -41.971 1.00 63.70  ? 920  HOH B O   1 
HETATM 9132 O O   . HOH K 6 .   ? -56.468 -19.555 -7.718  1.00 67.98  ? 921  HOH B O   1 
HETATM 9133 O O   . HOH K 6 .   ? -28.934 17.243  -26.740 1.00 74.00  ? 922  HOH B O   1 
HETATM 9134 O O   . HOH K 6 .   ? -35.408 -7.669  -33.644 1.00 52.06  ? 923  HOH B O   1 
HETATM 9135 O O   . HOH K 6 .   ? -48.895 -22.151 -33.648 1.00 44.40  ? 924  HOH B O   1 
HETATM 9136 O O   . HOH K 6 .   ? -22.856 -33.521 -9.206  1.00 55.79  ? 925  HOH B O   1 
HETATM 9137 O O   . HOH K 6 .   ? -40.282 -17.111 -3.592  1.00 45.24  ? 926  HOH B O   1 
HETATM 9138 O O   . HOH K 6 .   ? -27.117 -4.549  -40.159 1.00 43.79  ? 927  HOH B O   1 
HETATM 9139 O O   . HOH K 6 .   ? -14.947 -12.326 -13.786 1.00 75.45  ? 928  HOH B O   1 
HETATM 9140 O O   . HOH K 6 .   ? -47.631 -31.832 -32.157 1.00 60.94  ? 929  HOH B O   1 
HETATM 9141 O O   . HOH K 6 .   ? -57.710 -25.095 -20.155 1.00 50.60  ? 930  HOH B O   1 
HETATM 9142 O O   . HOH K 6 .   ? -45.280 -34.405 -36.750 1.00 63.45  ? 931  HOH B O   1 
HETATM 9143 O O   . HOH K 6 .   ? -15.830 -27.329 -15.930 1.00 55.41  ? 932  HOH B O   1 
HETATM 9144 O O   . HOH K 6 .   ? -49.991 -24.958 -33.825 1.00 43.75  ? 933  HOH B O   1 
HETATM 9145 O O   . HOH K 6 .   ? -39.267 -7.707  -34.467 1.00 65.73  ? 934  HOH B O   1 
HETATM 9146 O O   . HOH K 6 .   ? -14.895 -7.683  -33.754 1.00 69.42  ? 935  HOH B O   1 
HETATM 9147 O O   . HOH K 6 .   ? -43.994 -8.385  -19.729 1.00 26.61  ? 936  HOH B O   1 
HETATM 9148 O O   . HOH K 6 .   ? -23.922 -39.868 -27.579 1.00 68.09  ? 937  HOH B O   1 
HETATM 9149 O O   . HOH K 6 .   ? -62.077 -12.714 -46.772 1.00 65.91  ? 938  HOH B O   1 
HETATM 9150 O O   . HOH K 6 .   ? -42.342 -29.944 -2.954  1.00 58.37  ? 939  HOH B O   1 
HETATM 9151 O O   . HOH K 6 .   ? -26.574 -32.636 3.441   1.00 64.05  ? 940  HOH B O   1 
HETATM 9152 O O   . HOH K 6 .   ? -16.676 -14.180 -7.179  1.00 54.28  ? 941  HOH B O   1 
HETATM 9153 O O   . HOH K 6 .   ? -25.967 -1.834  -4.467  1.00 44.92  ? 942  HOH B O   1 
HETATM 9154 O O   . HOH K 6 .   ? -54.171 -27.220 -29.640 1.00 68.35  ? 943  HOH B O   1 
HETATM 9155 O O   . HOH K 6 .   ? -44.178 -7.188  -22.434 1.00 65.62  ? 944  HOH B O   1 
HETATM 9156 O O   . HOH K 6 .   ? -22.653 8.730   -34.030 1.00 68.18  ? 945  HOH B O   1 
HETATM 9157 O O   . HOH K 6 .   ? -31.781 -1.786  -16.070 1.00 32.09  ? 946  HOH B O   1 
HETATM 9158 O O   . HOH K 6 .   ? -65.807 -14.307 -32.062 1.00 67.28  ? 947  HOH B O   1 
HETATM 9159 O O   . HOH K 6 .   ? -42.267 -17.660 0.126   1.00 47.15  ? 948  HOH B O   1 
HETATM 9160 O O   . HOH K 6 .   ? -52.667 -23.957 -35.355 1.00 49.41  ? 949  HOH B O   1 
HETATM 9161 O O   . HOH K 6 .   ? -53.025 -33.548 -21.606 1.00 54.59  ? 950  HOH B O   1 
HETATM 9162 O O   . HOH K 6 .   ? -30.174 -39.660 -39.194 1.00 53.26  ? 951  HOH B O   1 
HETATM 9163 O O   . HOH K 6 .   ? -55.433 -22.104 -44.611 1.00 28.59  ? 952  HOH B O   1 
HETATM 9164 O O   . HOH K 6 .   ? -35.396 -18.616 7.612   1.00 46.01  ? 953  HOH B O   1 
HETATM 9165 O O   . HOH K 6 .   ? -20.244 -26.602 0.828   1.00 56.95  ? 954  HOH B O   1 
HETATM 9166 O O   . HOH K 6 .   ? -44.479 -44.203 -29.265 1.00 49.96  ? 955  HOH B O   1 
HETATM 9167 O O   . HOH K 6 .   ? -16.426 -18.773 -32.635 1.00 50.77  ? 956  HOH B O   1 
HETATM 9168 O O   . HOH K 6 .   ? -19.353 8.975   -23.320 1.00 74.20  ? 957  HOH B O   1 
HETATM 9169 O O   . HOH K 6 .   ? -46.232 -23.002 -34.970 1.00 53.03  ? 958  HOH B O   1 
HETATM 9170 O O   . HOH K 6 .   ? -14.513 -14.585 1.517   1.00 53.49  ? 959  HOH B O   1 
HETATM 9171 O O   . HOH K 6 .   ? -48.009 -25.225 -44.483 1.00 56.68  ? 960  HOH B O   1 
HETATM 9172 O O   . HOH K 6 .   ? -44.904 -13.125 -10.725 1.00 33.89  ? 961  HOH B O   1 
HETATM 9173 O O   . HOH K 6 .   ? -18.880 -3.409  -30.855 1.00 56.30  ? 962  HOH B O   1 
HETATM 9174 O O   . HOH K 6 .   ? -42.027 -13.203 -4.231  1.00 47.76  ? 963  HOH B O   1 
HETATM 9175 O O   . HOH K 6 .   ? -48.874 -41.168 -17.825 1.00 64.62  ? 964  HOH B O   1 
HETATM 9176 O O   . HOH K 6 .   ? -51.085 -18.548 -5.146  1.00 66.59  ? 965  HOH B O   1 
HETATM 9177 O O   . HOH K 6 .   ? -22.804 -38.341 -31.586 1.00 63.23  ? 966  HOH B O   1 
HETATM 9178 O O   . HOH K 6 .   ? -18.665 -30.294 -37.925 1.00 56.23  ? 967  HOH B O   1 
HETATM 9179 O O   . HOH K 6 .   ? -22.889 -37.248 -26.558 1.00 61.80  ? 968  HOH B O   1 
HETATM 9180 O O   . HOH K 6 .   ? -31.675 -41.435 -38.179 1.00 72.97  ? 969  HOH B O   1 
HETATM 9181 O O   . HOH K 6 .   ? -36.669 -29.526 -43.183 1.00 33.24  ? 970  HOH B O   1 
HETATM 9182 O O   . HOH K 6 .   ? -20.222 -17.280 -42.954 1.00 57.20  ? 971  HOH B O   1 
HETATM 9183 O O   . HOH K 6 .   ? -59.653 -10.151 -18.607 1.00 60.31  ? 972  HOH B O   1 
HETATM 9184 O O   . HOH K 6 .   ? -41.130 -30.934 -5.049  1.00 57.77  ? 973  HOH B O   1 
HETATM 9185 O O   . HOH K 6 .   ? -45.237 -8.055  -5.986  1.00 71.75  ? 974  HOH B O   1 
HETATM 9186 O O   . HOH K 6 .   ? -18.137 -22.336 -28.757 1.00 52.07  ? 975  HOH B O   1 
HETATM 9187 O O   . HOH K 6 .   ? -42.109 -11.058 -24.363 1.00 58.06  ? 976  HOH B O   1 
HETATM 9188 O O   . HOH K 6 .   ? -34.883 2.937   -9.551  1.00 70.31  ? 977  HOH B O   1 
HETATM 9189 O O   . HOH K 6 .   ? -18.712 -21.427 -31.892 1.00 54.39  ? 978  HOH B O   1 
HETATM 9190 O O   . HOH K 6 .   ? -49.323 -24.761 -51.396 1.00 69.80  ? 979  HOH B O   1 
HETATM 9191 O O   . HOH K 6 .   ? -22.959 13.332  -32.351 1.00 68.48  ? 980  HOH B O   1 
HETATM 9192 O O   . HOH K 6 .   ? -13.925 -23.542 -8.879  1.00 63.01  ? 981  HOH B O   1 
HETATM 9193 O O   . HOH K 6 .   ? -16.388 -17.448 -37.229 1.00 59.78  ? 982  HOH B O   1 
HETATM 9194 O O   . HOH K 6 .   ? -36.048 6.489   -14.312 1.00 37.98  ? 983  HOH B O   1 
HETATM 9195 O O   . HOH K 6 .   ? -23.935 -37.606 -36.001 1.00 74.91  ? 984  HOH B O   1 
HETATM 9196 O O   . HOH K 6 .   ? -36.130 -20.524 12.715  1.00 52.36  ? 985  HOH B O   1 
HETATM 9197 O O   . HOH K 6 .   ? -24.505 -4.868  -2.074  1.00 64.68  ? 986  HOH B O   1 
HETATM 9198 O O   . HOH K 6 .   ? -48.727 -38.207 -16.438 1.00 63.86  ? 987  HOH B O   1 
HETATM 9199 O O   . HOH K 6 .   ? -27.895 -23.956 13.483  1.00 67.52  ? 988  HOH B O   1 
HETATM 9200 O O   . HOH K 6 .   ? -41.611 -27.471 4.324   1.00 36.43  ? 989  HOH B O   1 
HETATM 9201 O O   . HOH K 6 .   ? -45.578 -29.286 -41.568 1.00 52.35  ? 990  HOH B O   1 
HETATM 9202 O O   . HOH K 6 .   ? -39.369 -11.731 -36.385 1.00 73.22  ? 991  HOH B O   1 
HETATM 9203 O O   . HOH K 6 .   ? -33.367 -16.538 -39.282 1.00 71.45  ? 992  HOH B O   1 
HETATM 9204 O O   . HOH K 6 .   ? -60.149 -19.016 -20.650 1.00 66.65  ? 993  HOH B O   1 
HETATM 9205 O O   . HOH K 6 .   ? -29.974 1.356   -5.397  1.00 60.11  ? 994  HOH B O   1 
HETATM 9206 O O   . HOH K 6 .   ? -57.818 -33.493 -8.935  1.00 60.06  ? 995  HOH B O   1 
HETATM 9207 O O   . HOH K 6 .   ? -43.502 0.847   -19.352 1.00 38.05  ? 996  HOH B O   1 
HETATM 9208 O O   . HOH K 6 .   ? -17.837 8.225   -33.750 1.00 69.50  ? 997  HOH B O   1 
HETATM 9209 O O   . HOH K 6 .   ? -14.549 -23.214 -25.011 1.00 74.24  ? 998  HOH B O   1 
HETATM 9210 O O   . HOH K 6 .   ? -45.329 -11.869 -7.655  1.00 55.73  ? 999  HOH B O   1 
HETATM 9211 O O   . HOH K 6 .   ? -40.307 -18.462 4.788   1.00 62.13  ? 1000 HOH B O   1 
HETATM 9212 O O   . HOH K 6 .   ? -56.724 -35.324 -15.325 1.00 52.44  ? 1001 HOH B O   1 
HETATM 9213 O O   . HOH K 6 .   ? -33.813 -35.916 -43.581 1.00 60.09  ? 1002 HOH B O   1 
HETATM 9214 O O   . HOH K 6 .   ? -18.619 -24.561 -31.465 1.00 62.76  ? 1003 HOH B O   1 
HETATM 9215 O O   . HOH K 6 .   ? -45.034 -39.876 -36.601 1.00 46.99  ? 1004 HOH B O   1 
HETATM 9216 O O   . HOH K 6 .   ? -33.845 -15.749 7.430   1.00 53.88  ? 1005 HOH B O   1 
HETATM 9217 O O   . HOH K 6 .   ? -36.007 -28.310 -40.480 1.00 50.52  ? 1006 HOH B O   1 
HETATM 9218 O O   . HOH K 6 .   ? -28.634 -16.477 -37.566 1.00 56.83  ? 1007 HOH B O   1 
HETATM 9219 O O   . HOH K 6 .   ? -33.830 -7.502  -35.470 1.00 57.09  ? 1008 HOH B O   1 
HETATM 9220 O O   . HOH K 6 .   ? -23.936 -4.680  -40.894 1.00 59.98  ? 1009 HOH B O   1 
HETATM 9221 O O   . HOH K 6 .   ? -30.367 -2.477  -31.878 1.00 45.89  ? 1010 HOH B O   1 
HETATM 9222 O O   . HOH K 6 .   ? -16.752 -26.185 -32.501 1.00 68.71  ? 1011 HOH B O   1 
HETATM 9223 O O   . HOH K 6 .   ? -40.973 0.609   -10.368 1.00 42.18  ? 1012 HOH B O   1 
HETATM 9224 O O   . HOH K 6 .   ? -45.087 -23.777 -0.744  1.00 53.51  ? 1013 HOH B O   1 
HETATM 9225 O O   . HOH K 6 .   ? -18.626 -11.072 -18.394 1.00 48.77  ? 1014 HOH B O   1 
HETATM 9226 O O   . HOH K 6 .   ? -44.595 -38.808 -11.818 1.00 54.50  ? 1015 HOH B O   1 
HETATM 9227 O O   . HOH K 6 .   ? -54.570 -32.150 -6.113  1.00 67.15  ? 1016 HOH B O   1 
HETATM 9228 O O   . HOH K 6 .   ? -19.822 -29.015 -40.363 1.00 76.25  ? 1017 HOH B O   1 
HETATM 9229 O O   . HOH K 6 .   ? -21.017 -33.646 -40.150 1.00 64.87  ? 1018 HOH B O   1 
HETATM 9230 O O   . HOH K 6 .   ? -49.072 -6.795  -47.921 1.00 75.49  ? 1019 HOH B O   1 
HETATM 9231 O O   . HOH K 6 .   ? -46.425 -34.383 0.653   1.00 54.52  ? 1020 HOH B O   1 
HETATM 9232 O O   . HOH K 6 .   ? -17.431 -9.911  -25.688 1.00 58.23  ? 1021 HOH B O   1 
HETATM 9233 O O   . HOH K 6 .   ? -35.614 -45.124 -32.187 1.00 73.27  ? 1022 HOH B O   1 
HETATM 9234 O O   . HOH K 6 .   ? -23.037 -5.263  3.638   1.00 65.76  ? 1023 HOH B O   1 
HETATM 9235 O O   . HOH K 6 .   ? -26.301 -40.809 -20.596 1.00 54.26  ? 1024 HOH B O   1 
HETATM 9236 O O   . HOH K 6 .   ? -16.657 -19.467 -2.966  1.00 40.98  ? 1025 HOH B O   1 
HETATM 9237 O O   . HOH K 6 .   ? -27.313 -4.212  -2.476  1.00 60.92  ? 1026 HOH B O   1 
HETATM 9238 O O   . HOH K 6 .   ? -16.971 -22.087 -3.658  1.00 46.76  ? 1027 HOH B O   1 
HETATM 9239 O O   . HOH K 6 .   ? -22.282 -15.191 -42.742 1.00 64.67  ? 1028 HOH B O   1 
HETATM 9240 O O   . HOH K 6 .   ? -29.638 11.563  -33.941 1.00 73.71  ? 1029 HOH B O   1 
HETATM 9241 O O   . HOH K 6 .   ? -28.180 -31.345 -41.123 1.00 61.87  ? 1030 HOH B O   1 
HETATM 9242 O O   . HOH K 6 .   ? -44.603 -19.287 -6.815  1.00 57.55  ? 1031 HOH B O   1 
HETATM 9243 O O   . HOH K 6 .   ? -40.259 -40.702 -7.354  1.00 60.59  ? 1032 HOH B O   1 
HETATM 9244 O O   . HOH K 6 .   ? -18.231 -10.988 -7.355  1.00 48.84  ? 1033 HOH B O   1 
HETATM 9245 O O   . HOH K 6 .   ? -40.342 -6.761  -52.425 1.00 66.75  ? 1034 HOH B O   1 
HETATM 9246 O O   . HOH K 6 .   ? -35.056 -9.764  -46.283 1.00 67.64  ? 1035 HOH B O   1 
HETATM 9247 O O   . HOH K 6 .   ? -15.691 -19.137 -0.214  1.00 57.13  ? 1036 HOH B O   1 
HETATM 9248 O O   . HOH K 6 .   ? -39.888 -4.006  -4.523  1.00 70.04  ? 1037 HOH B O   1 
HETATM 9249 O O   . HOH K 6 .   ? -57.458 -13.413 -14.768 1.00 57.07  ? 1038 HOH B O   1 
HETATM 9250 O O   . HOH K 6 .   ? -14.103 -3.305  -2.104  1.00 71.25  ? 1039 HOH B O   1 
HETATM 9251 O O   . HOH K 6 .   ? -40.234 -39.028 -15.743 1.00 61.00  ? 1040 HOH B O   1 
HETATM 9252 O O   . HOH K 6 .   ? -40.805 -17.234 -6.341  1.00 57.09  ? 1041 HOH B O   1 
HETATM 9253 O O   . HOH K 6 .   ? -22.179 -14.914 9.083   1.00 64.30  ? 1042 HOH B O   1 
HETATM 9254 O O   . HOH K 6 .   ? -16.566 -31.054 -7.872  1.00 69.81  ? 1043 HOH B O   1 
HETATM 9255 O O   . HOH K 6 .   ? -19.647 -22.774 2.848   1.00 55.57  ? 1044 HOH B O   1 
HETATM 9256 O O   . HOH K 6 .   ? -36.401 -31.781 -42.364 1.00 47.78  ? 1045 HOH B O   1 
HETATM 9257 O O   . HOH K 6 .   ? -63.235 -16.242 -26.417 1.00 66.97  ? 1046 HOH B O   1 
HETATM 9258 O O   . HOH K 6 .   ? -44.896 -31.285 -35.287 1.00 72.33  ? 1047 HOH B O   1 
HETATM 9259 O O   . HOH K 6 .   ? -38.111 -18.518 7.489   1.00 64.35  ? 1048 HOH B O   1 
HETATM 9260 O O   . HOH K 6 .   ? -31.334 -41.258 -15.034 1.00 54.48  ? 1049 HOH B O   1 
HETATM 9261 O O   . HOH K 6 .   ? -19.063 -37.635 -28.284 1.00 47.30  ? 1050 HOH B O   1 
HETATM 9262 O O   . HOH K 6 .   ? -49.558 -10.368 -47.661 1.00 73.07  ? 1051 HOH B O   1 
HETATM 9263 O O   . HOH K 6 .   ? -16.376 -11.640 5.833   1.00 63.88  ? 1052 HOH B O   1 
HETATM 9264 O O   . HOH K 6 .   ? -60.345 -15.396 -22.384 1.00 67.76  ? 1053 HOH B O   1 
HETATM 9265 O O   . HOH K 6 .   ? -13.903 -8.893  -7.218  1.00 68.94  ? 1054 HOH B O   1 
HETATM 9266 O O   . HOH K 6 .   ? -31.517 -28.995 -39.862 1.00 65.93  ? 1055 HOH B O   1 
HETATM 9267 O O   . HOH K 6 .   ? -20.426 -20.306 6.660   1.00 69.12  ? 1056 HOH B O   1 
HETATM 9268 O O   . HOH K 6 .   ? -20.028 -34.549 -37.433 1.00 77.05  ? 1057 HOH B O   1 
HETATM 9269 O O   . HOH K 6 .   ? -38.979 -14.278 0.220   1.00 58.42  ? 1058 HOH B O   1 
HETATM 9270 O O   . HOH K 6 .   ? -62.574 -19.746 -24.011 1.00 75.74  ? 1059 HOH B O   1 
HETATM 9271 O O   . HOH K 6 .   ? -48.408 -15.361 -11.052 1.00 66.85  ? 1060 HOH B O   1 
HETATM 9272 O O   . HOH K 6 .   ? -28.213 9.292   -14.595 1.00 55.88  ? 1061 HOH B O   1 
HETATM 9273 O O   . HOH K 6 .   ? -21.777 0.141   -37.831 1.00 61.45  ? 1062 HOH B O   1 
HETATM 9274 O O   . HOH K 6 .   ? -59.101 -19.370 -6.387  1.00 76.70  ? 1063 HOH B O   1 
HETATM 9275 O O   . HOH K 6 .   ? -19.280 -28.999 -2.419  1.00 60.59  ? 1064 HOH B O   1 
HETATM 9276 O O   . HOH K 6 .   ? -22.352 -36.805 -16.449 1.00 60.64  ? 1065 HOH B O   1 
HETATM 9277 O O   . HOH K 6 .   ? -41.114 -35.791 -7.409  1.00 36.46  ? 1066 HOH B O   1 
HETATM 9278 O O   . HOH K 6 .   ? -20.337 -28.971 0.087   1.00 75.97  ? 1067 HOH B O   1 
HETATM 9279 O O   . HOH K 6 .   ? -51.186 -33.787 -31.446 1.00 66.48  ? 1068 HOH B O   1 
HETATM 9280 O O   . HOH K 6 .   ? -15.553 -12.954 -11.542 1.00 59.93  ? 1069 HOH B O   1 
HETATM 9281 O O   . HOH K 6 .   ? -27.947 -2.134  -42.044 1.00 65.83  ? 1070 HOH B O   1 
HETATM 9282 O O   . HOH K 6 .   ? -44.865 -21.887 -2.309  1.00 70.19  ? 1071 HOH B O   1 
HETATM 9283 O O   . HOH K 6 .   ? -30.375 -32.176 -43.997 1.00 70.02  ? 1072 HOH B O   1 
HETATM 9284 O O   . HOH K 6 .   ? -32.091 -43.505 -15.144 1.00 50.08  ? 1073 HOH B O   1 
HETATM 9285 O O   . HOH K 6 .   ? -66.224 -9.240  -30.494 1.00 69.22  ? 1074 HOH B O   1 
HETATM 9286 O O   . HOH K 6 .   ? -46.274 -2.204  -27.372 1.00 68.13  ? 1075 HOH B O   1 
HETATM 9287 O O   . HOH K 6 .   ? -18.861 7.010   -35.423 1.00 66.92  ? 1076 HOH B O   1 
HETATM 9288 O O   . HOH K 6 .   ? -56.185 -30.969 -16.601 1.00 62.76  ? 1077 HOH B O   1 
HETATM 9289 O O   . HOH K 6 .   ? -44.206 -11.826 -5.567  1.00 75.93  ? 1078 HOH B O   1 
HETATM 9290 O O   . HOH K 6 .   ? -43.497 -12.980 -22.651 1.00 44.75  ? 1079 HOH B O   1 
HETATM 9291 O O   . HOH K 6 .   ? -45.573 -10.348 -26.249 1.00 73.77  ? 1080 HOH B O   1 
HETATM 9292 O O   . HOH K 6 .   ? -47.115 -28.765 -33.087 1.00 58.98  ? 1081 HOH B O   1 
HETATM 9293 O O   . HOH K 6 .   ? -55.932 -24.838 -30.959 1.00 63.80  ? 1082 HOH B O   1 
HETATM 9294 O O   . HOH K 6 .   ? -41.509 7.977   -29.542 1.00 62.26  ? 1083 HOH B O   1 
HETATM 9295 O O   . HOH K 6 .   ? -18.279 -6.459  9.799   1.00 74.44  ? 1084 HOH B O   1 
HETATM 9296 O O   . HOH K 6 .   ? -22.823 -32.637 -41.232 1.00 58.59  ? 1085 HOH B O   1 
HETATM 9297 O O   . HOH K 6 .   ? -14.346 -13.712 -27.873 1.00 68.64  ? 1086 HOH B O   1 
HETATM 9298 O O   . HOH K 6 .   ? -22.694 -4.538  -0.634  1.00 57.06  ? 1087 HOH B O   1 
HETATM 9299 O O   . HOH K 6 .   ? -58.911 -24.383 -12.265 1.00 65.79  ? 1088 HOH B O   1 
HETATM 9300 O O   . HOH K 6 .   ? -35.116 -25.409 -51.565 1.00 46.14  ? 1089 HOH B O   1 
HETATM 9301 O O   . HOH K 6 .   ? -34.190 -40.108 -9.332  1.00 55.16  ? 1090 HOH B O   1 
HETATM 9302 O O   . HOH K 6 .   ? -21.832 9.531   -16.848 1.00 60.10  ? 1091 HOH B O   1 
HETATM 9303 O O   . HOH K 6 .   ? -33.793 -2.581  -3.091  1.00 62.35  ? 1092 HOH B O   1 
HETATM 9304 O O   . HOH K 6 .   ? -53.421 -40.905 -19.401 1.00 74.37  ? 1093 HOH B O   1 
HETATM 9305 O O   . HOH K 6 .   ? -12.213 -18.620 -24.809 1.00 64.50  ? 1094 HOH B O   1 
HETATM 9306 O O   . HOH K 6 .   ? -47.824 -26.354 -35.073 1.00 72.66  ? 1095 HOH B O   1 
HETATM 9307 O O   . HOH K 6 .   ? -17.447 -13.745 -10.122 1.00 42.21  ? 1096 HOH B O   1 
HETATM 9308 O O   . HOH K 6 .   ? -23.013 -0.724  -4.553  1.00 54.37  ? 1097 HOH B O   1 
HETATM 9309 O O   . HOH K 6 .   ? -31.649 -45.380 -16.891 1.00 63.05  ? 1098 HOH B O   1 
HETATM 9310 O O   . HOH K 6 .   ? -16.641 -24.502 -0.967  1.00 65.72  ? 1099 HOH B O   1 
HETATM 9311 O O   . HOH K 6 .   ? -44.556 4.152   -17.209 1.00 60.99  ? 1100 HOH B O   1 
HETATM 9312 O O   . HOH K 6 .   ? -44.285 -32.356 -3.062  1.00 53.06  ? 1101 HOH B O   1 
HETATM 9313 O O   . HOH K 6 .   ? -16.773 -27.216 -23.756 1.00 67.26  ? 1102 HOH B O   1 
HETATM 9314 O O   . HOH K 6 .   ? -16.422 -2.822  -35.025 1.00 58.92  ? 1103 HOH B O   1 
HETATM 9315 O O   . HOH K 6 .   ? -25.002 6.875   -37.576 1.00 66.82  ? 1104 HOH B O   1 
HETATM 9316 O O   . HOH K 6 .   ? -49.450 -17.056 -53.854 1.00 48.57  ? 1105 HOH B O   1 
HETATM 9317 O O   . HOH K 6 .   ? -17.661 -8.489  -19.000 1.00 57.34  ? 1106 HOH B O   1 
HETATM 9318 O O   . HOH K 6 .   ? -23.269 -26.071 7.459   1.00 65.78  ? 1107 HOH B O   1 
HETATM 9319 O O   . HOH K 6 .   ? -24.678 -19.325 -43.429 1.00 56.70  ? 1108 HOH B O   1 
HETATM 9320 O O   . HOH K 6 .   ? -48.196 -7.559  -11.436 1.00 65.13  ? 1109 HOH B O   1 
HETATM 9321 O O   . HOH K 6 .   ? -61.450 -23.322 -30.076 1.00 69.71  ? 1110 HOH B O   1 
HETATM 9322 O O   . HOH K 6 .   ? -13.264 -12.376 -18.114 1.00 73.74  ? 1111 HOH B O   1 
HETATM 9323 O O   . HOH K 6 .   ? -36.527 -4.749  -4.449  1.00 75.67  ? 1112 HOH B O   1 
HETATM 9324 O O   . HOH K 6 .   ? -56.812 -6.191  -42.698 1.00 66.80  ? 1113 HOH B O   1 
HETATM 9325 O O   . HOH K 6 .   ? -27.522 -10.428 -38.649 1.00 57.32  ? 1114 HOH B O   1 
HETATM 9326 O O   . HOH K 6 .   ? -14.537 -4.570  2.243   1.00 71.45  ? 1115 HOH B O   1 
HETATM 9327 O O   . HOH K 6 .   ? -24.852 15.272  -22.602 1.00 64.70  ? 1116 HOH B O   1 
HETATM 9328 O O   . HOH K 6 .   ? -14.959 -17.885 -14.116 1.00 63.51  ? 1117 HOH B O   1 
HETATM 9329 O O   . HOH K 6 .   ? -42.996 1.273   -14.739 1.00 55.05  ? 1118 HOH B O   1 
HETATM 9330 O O   . HOH K 6 .   ? -35.075 -42.499 -40.943 1.00 70.90  ? 1119 HOH B O   1 
HETATM 9331 O O   . HOH K 6 .   ? -16.029 -23.724 -27.838 1.00 52.62  ? 1120 HOH B O   1 
HETATM 9332 O O   . HOH K 6 .   ? -46.776 -8.447  -9.646  1.00 72.12  ? 1121 HOH B O   1 
HETATM 9333 O O   . HOH K 6 .   ? -44.210 -4.254  -8.485  1.00 66.26  ? 1122 HOH B O   1 
HETATM 9334 O O   . HOH K 6 .   ? -46.120 -25.503 1.699   1.00 56.09  ? 1123 HOH B O   1 
HETATM 9335 O O   . HOH K 6 .   ? -30.889 -37.192 -6.920  1.00 61.85  ? 1124 HOH B O   1 
HETATM 9336 O O   . HOH K 6 .   ? -48.393 -12.547 -11.141 1.00 49.87  ? 1125 HOH B O   1 
HETATM 9337 O O   . HOH K 6 .   ? -30.383 8.348   -14.508 1.00 57.22  ? 1126 HOH B O   1 
HETATM 9338 O O   . HOH K 6 .   ? -14.065 -14.449 -20.768 1.00 70.78  ? 1127 HOH B O   1 
HETATM 9339 O O   . HOH K 6 .   ? -39.070 -49.672 -22.606 1.00 68.44  ? 1128 HOH B O   1 
HETATM 9340 O O   . HOH K 6 .   ? -32.561 -24.379 13.171  1.00 57.78  ? 1129 HOH B O   1 
HETATM 9341 O O   . HOH K 6 .   ? -42.062 11.004  -29.475 1.00 63.49  ? 1130 HOH B O   1 
HETATM 9342 O O   . HOH K 6 .   ? -61.462 -30.598 -48.064 1.00 73.26  ? 1131 HOH B O   1 
HETATM 9343 O O   . HOH K 6 .   ? -19.507 -8.511  -26.035 1.00 56.63  ? 1132 HOH B O   1 
HETATM 9344 O O   . HOH K 6 .   ? -18.843 -30.517 -21.494 1.00 72.67  ? 1133 HOH B O   1 
HETATM 9345 O O   . HOH K 6 .   ? -14.158 -18.049 -17.846 1.00 66.04  ? 1134 HOH B O   1 
HETATM 9346 O O   . HOH K 6 .   ? -15.677 -3.058  -27.286 1.00 62.11  ? 1135 HOH B O   1 
HETATM 9347 O O   . HOH K 6 .   ? -49.082 -18.845 -13.290 1.00 69.74  ? 1136 HOH B O   1 
HETATM 9348 O O   . HOH K 6 .   ? -20.314 -3.551  7.981   1.00 76.15  ? 1137 HOH B O   1 
HETATM 9349 O O   . HOH K 6 .   ? -16.702 -21.996 1.118   1.00 62.85  ? 1138 HOH B O   1 
HETATM 9350 O O   . HOH K 6 .   ? -24.017 9.736   -15.619 1.00 66.52  ? 1139 HOH B O   1 
HETATM 9351 O O   . HOH K 6 .   ? -13.664 -6.741  2.942   1.00 54.30  ? 1140 HOH B O   1 
HETATM 9352 O O   . HOH K 6 .   ? -28.699 1.404   -41.860 1.00 68.43  ? 1141 HOH B O   1 
HETATM 9353 O O   . HOH K 6 .   ? -42.103 -6.972  -2.197  1.00 70.58  ? 1142 HOH B O   1 
HETATM 9354 O O   . HOH K 6 .   ? -52.740 -25.418 -44.910 1.00 74.05  ? 1143 HOH B O   1 
HETATM 9355 O O   . HOH K 6 .   ? -38.333 -43.734 -37.373 1.00 76.54  ? 1144 HOH B O   1 
HETATM 9356 O O   . HOH K 6 .   ? -16.162 -4.923  -32.018 1.00 78.34  ? 1145 HOH B O   1 
HETATM 9357 O O   . HOH K 6 .   ? -19.265 -10.768 -38.897 1.00 55.05  ? 1146 HOH B O   1 
HETATM 9358 O O   . HOH K 6 .   ? -20.684 3.065   -39.663 1.00 72.49  ? 1147 HOH B O   1 
HETATM 9359 O O   . HOH K 6 .   ? -16.584 -27.543 -1.555  1.00 60.46  ? 1148 HOH B O   1 
HETATM 9360 O O   . HOH K 6 .   ? -17.661 -8.821  -38.170 1.00 70.51  ? 1149 HOH B O   1 
HETATM 9361 O O   . HOH K 6 .   ? -15.668 -1.246  -20.363 1.00 65.58  ? 1150 HOH B O   1 
HETATM 9362 O O   . HOH K 6 .   ? -46.290 -42.329 -17.854 1.00 56.93  ? 1151 HOH B O   1 
HETATM 9363 O O   . HOH K 6 .   ? -16.040 -29.636 -37.807 1.00 67.56  ? 1152 HOH B O   1 
HETATM 9364 O O   . HOH K 6 .   ? -41.710 -38.980 -10.431 1.00 50.81  ? 1153 HOH B O   1 
HETATM 9365 O O   . HOH K 6 .   ? -29.390 -38.403 -42.653 1.00 64.15  ? 1154 HOH B O   1 
HETATM 9366 O O   . HOH K 6 .   ? -29.517 6.307   -11.646 1.00 59.55  ? 1155 HOH B O   1 
HETATM 9367 O O   . HOH K 6 .   ? -27.198 -6.422  -1.719  1.00 53.13  ? 1156 HOH B O   1 
HETATM 9368 O O   . HOH K 6 .   ? -31.253 -14.409 -38.487 1.00 62.52  ? 1157 HOH B O   1 
HETATM 9369 O O   . HOH K 6 .   ? -41.618 -39.492 -12.826 1.00 55.99  ? 1158 HOH B O   1 
HETATM 9370 O O   . HOH K 6 .   ? -52.262 -38.055 -7.073  1.00 65.43  ? 1159 HOH B O   1 
HETATM 9371 O O   . HOH K 6 .   ? -18.362 -29.888 2.312   1.00 67.56  ? 1160 HOH B O   1 
HETATM 9372 O O   . HOH K 6 .   ? -21.128 -6.914  10.509  1.00 60.74  ? 1161 HOH B O   1 
HETATM 9373 O O   . HOH K 6 .   ? -17.237 -5.729  -24.661 1.00 55.70  ? 1162 HOH B O   1 
HETATM 9374 O O   . HOH K 6 .   ? -39.007 -5.368  -37.614 1.00 78.35  ? 1163 HOH B O   1 
HETATM 9375 O O   . HOH K 6 .   ? -60.239 -25.407 -38.125 1.00 70.88  ? 1164 HOH B O   1 
HETATM 9376 O O   . HOH K 6 .   ? -22.423 -16.792 12.936  1.00 65.49  ? 1165 HOH B O   1 
HETATM 9377 O O   . HOH K 6 .   ? -55.235 -27.615 -26.759 1.00 47.68  ? 1166 HOH B O   1 
HETATM 9378 O O   . HOH K 6 .   ? -56.005 -24.644 -43.574 1.00 39.75  ? 1167 HOH B O   1 
HETATM 9379 O O   . HOH K 6 .   ? -52.816 -34.565 -5.431  1.00 62.63  ? 1168 HOH B O   1 
HETATM 9380 O O   . HOH K 6 .   ? -15.105 -24.910 -6.394  1.00 52.27  ? 1169 HOH B O   1 
HETATM 9381 O O   . HOH K 6 .   ? -47.086 0.898   -17.004 1.00 74.21  ? 1170 HOH B O   1 
HETATM 9382 O O   . HOH K 6 .   ? -48.027 -40.704 -15.680 1.00 77.99  ? 1171 HOH B O   1 
HETATM 9383 O O   . HOH K 6 .   ? -43.496 -15.319 -22.323 1.00 50.20  ? 1172 HOH B O   1 
HETATM 9384 O O   . HOH K 6 .   ? -16.213 3.879   -15.946 1.00 64.01  ? 1173 HOH B O   1 
HETATM 9385 O O   . HOH K 6 .   ? -53.598 -34.143 -30.571 1.00 75.28  ? 1174 HOH B O   1 
HETATM 9386 O O   . HOH K 6 .   ? -44.866 -29.652 -33.492 1.00 53.89  ? 1175 HOH B O   1 
HETATM 9387 O O   . HOH K 6 .   ? -16.285 -28.264 -5.890  1.00 64.27  ? 1176 HOH B O   1 
HETATM 9388 O O   . HOH K 6 .   ? -15.779 -3.304  -24.763 1.00 46.21  ? 1177 HOH B O   1 
HETATM 9389 O O   . HOH K 6 .   ? -26.168 9.782   -13.463 1.00 72.45  ? 1178 HOH B O   1 
HETATM 9390 O O   . HOH K 6 .   ? -51.746 -39.667 -13.606 1.00 60.94  ? 1179 HOH B O   1 
HETATM 9391 O O   . HOH K 6 .   ? -59.655 -30.249 -15.703 1.00 59.84  ? 1180 HOH B O   1 
HETATM 9392 O O   . HOH K 6 .   ? -11.781 -17.860 -22.298 1.00 68.84  ? 1181 HOH B O   1 
HETATM 9393 O O   . HOH K 6 .   ? -56.732 -33.578 -19.985 1.00 68.01  ? 1182 HOH B O   1 
HETATM 9394 O O   . HOH K 6 .   ? -40.733 12.484  -32.805 1.00 73.19  ? 1183 HOH B O   1 
HETATM 9395 O O   . HOH K 6 .   ? -56.848 -25.918 -39.387 1.00 71.88  ? 1184 HOH B O   1 
HETATM 9396 O O   . HOH K 6 .   ? -67.211 -15.828 -43.568 1.00 74.26  ? 1185 HOH B O   1 
HETATM 9397 O O   . HOH K 6 .   ? -28.005 -39.804 -31.324 1.00 54.00  ? 1186 HOH B O   1 
HETATM 9398 O O   . HOH K 6 .   ? -26.886 -36.258 -8.009  1.00 61.96  ? 1187 HOH B O   1 
HETATM 9399 O O   . HOH K 6 .   ? -27.673 -33.933 -42.039 1.00 58.95  ? 1188 HOH B O   1 
HETATM 9400 O O   . HOH K 6 .   ? -16.050 -6.940  -22.304 1.00 64.93  ? 1189 HOH B O   1 
HETATM 9401 O O   . HOH K 6 .   ? -13.414 -9.025  -19.206 1.00 75.48  ? 1190 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ARG A 2   ? 1.3678 1.6225 1.2308 0.1501  0.1383  -0.2233 3   ARG A N   
2    C CA  . ARG A 2   ? 1.2354 1.4936 1.1253 0.1601  0.1328  -0.2242 3   ARG A CA  
3    C C   . ARG A 2   ? 1.1698 1.4088 1.0641 0.1522  0.1252  -0.2129 3   ARG A C   
4    O O   . ARG A 2   ? 1.1836 1.3878 1.0704 0.1543  0.1157  -0.2137 3   ARG A O   
5    C CB  . ARG A 2   ? 1.2040 1.4425 1.0988 0.1796  0.1255  -0.2376 3   ARG A CB  
6    C CG  . ARG A 2   ? 1.2013 1.4578 1.1210 0.1949  0.1246  -0.2413 3   ARG A CG  
7    C CD  . ARG A 2   ? 1.2345 1.4710 1.1545 0.2144  0.1202  -0.2549 3   ARG A CD  
8    N NE  . ARG A 2   ? 1.2915 1.5468 1.2030 0.2188  0.1282  -0.2663 3   ARG A NE  
9    C CZ  . ARG A 2   ? 1.3293 1.6174 1.2543 0.2302  0.1340  -0.2733 3   ARG A CZ  
10   N NH1 . ARG A 2   ? 1.2967 1.6003 1.2120 0.2337  0.1417  -0.2840 3   ARG A NH1 
11   N NH2 . ARG A 2   ? 1.3592 1.6660 1.3071 0.2387  0.1315  -0.2702 3   ARG A NH2 
12   N N   . GLU A 3   ? 1.0830 1.3458 0.9902 0.1424  0.1299  -0.2033 4   GLU A N   
13   C CA  . GLU A 3   ? 0.9928 1.2426 0.9044 0.1338  0.1243  -0.1925 4   GLU A CA  
14   C C   . GLU A 3   ? 0.8437 1.1158 0.7828 0.1397  0.1223  -0.1911 4   GLU A C   
15   O O   . GLU A 3   ? 0.8002 1.1023 0.7547 0.1479  0.1262  -0.1976 4   GLU A O   
16   C CB  . GLU A 3   ? 1.0356 1.2900 0.9321 0.1126  0.1318  -0.1807 4   GLU A CB  
17   C CG  . GLU A 3   ? 1.1029 1.3324 0.9691 0.1074  0.1309  -0.1795 4   GLU A CG  
18   C CD  . GLU A 3   ? 1.0695 1.2724 0.9244 0.0981  0.1239  -0.1699 4   GLU A CD  
19   O OE1 . GLU A 3   ? 1.0266 1.2244 0.8591 0.0858  0.1283  -0.1612 4   GLU A OE1 
20   O OE2 . GLU A 3   ? 1.0095 1.1954 0.8765 0.1038  0.1141  -0.1705 4   GLU A OE2 
21   N N   . ASP A 4   ? 0.7846 1.0430 0.7294 0.1363  0.1156  -0.1832 5   ASP A N   
22   C CA  . ASP A 4   ? 0.6733 0.9539 0.6417 0.1396  0.1129  -0.1803 5   ASP A CA  
23   C C   . ASP A 4   ? 0.6164 0.9180 0.5876 0.1176  0.1199  -0.1712 5   ASP A C   
24   O O   . ASP A 4   ? 0.6045 0.8843 0.5632 0.1057  0.1187  -0.1628 5   ASP A O   
25   C CB  . ASP A 4   ? 0.7284 0.9781 0.7004 0.1517  0.1009  -0.1776 5   ASP A CB  
26   C CG  . ASP A 4   ? 0.7444 1.0170 0.7389 0.1610  0.0962  -0.1760 5   ASP A CG  
27   O OD1 . ASP A 4   ? 0.7067 0.9561 0.7039 0.1775  0.0871  -0.1752 5   ASP A OD1 
28   O OD2 . ASP A 4   ? 0.7259 1.0386 0.7344 0.1516  0.1014  -0.1755 5   ASP A OD2 
29   N N   . ALA A 5   ? 0.6258 0.9688 0.6138 0.1117  0.1274  -0.1733 6   ALA A N   
30   C CA  . ALA A 5   ? 0.5790 0.9411 0.5708 0.0883  0.1357  -0.1656 6   ALA A CA  
31   C C   . ALA A 5   ? 0.6059 0.9591 0.6055 0.0834  0.1282  -0.1588 6   ALA A C   
32   O O   . ALA A 5   ? 0.6602 1.0089 0.6531 0.0630  0.1334  -0.1502 6   ALA A O   
33   C CB  . ALA A 5   ? 0.5199 0.9298 0.5332 0.0834  0.1437  -0.1715 6   ALA A CB  
34   N N   . GLU A 6   ? 0.5620 0.9103 0.5736 0.1023  0.1163  -0.1618 7   GLU A N   
35   C CA  . GLU A 6   ? 0.5557 0.8975 0.5742 0.0996  0.1091  -0.1556 7   GLU A CA  
36   C C   . GLU A 6   ? 0.5156 0.8161 0.5124 0.0920  0.1073  -0.1475 7   GLU A C   
37   O O   . GLU A 6   ? 0.3880 0.6774 0.3859 0.0787  0.1035  -0.1375 7   GLU A O   
38   C CB  . GLU A 6   ? 0.6320 0.9735 0.6636 0.1241  0.0968  -0.1590 7   GLU A CB  
39   C CG  . GLU A 6   ? 0.7584 1.1467 0.8146 0.1302  0.0954  -0.1659 7   GLU A CG  
40   C CD  . GLU A 6   ? 0.8423 1.2626 0.9134 0.1096  0.0986  -0.1642 7   GLU A CD  
41   O OE1 . GLU A 6   ? 0.8606 1.3220 0.9481 0.1011  0.1044  -0.1709 7   GLU A OE1 
42   O OE2 . GLU A 6   ? 0.8824 1.2865 0.9493 0.1010  0.0956  -0.1571 7   GLU A OE2 
43   N N   . LEU A 7   ? 0.4544 0.7251 0.4316 0.0977  0.1067  -0.1488 8   LEU A N   
44   C CA  . LEU A 7   ? 0.5297 0.7549 0.4880 0.0900  0.1003  -0.1388 8   LEU A CA  
45   C C   . LEU A 7   ? 0.5331 0.7526 0.4718 0.0702  0.1083  -0.1323 8   LEU A C   
46   O O   . LEU A 7   ? 0.5813 0.7659 0.5027 0.0654  0.1027  -0.1253 8   LEU A O   
47   C CB  . LEU A 7   ? 0.5155 0.7095 0.4647 0.1073  0.0931  -0.1451 8   LEU A CB  
48   C CG  . LEU A 7   ? 0.5265 0.7205 0.4908 0.1297  0.0866  -0.1509 8   LEU A CG  
49   C CD1 . LEU A 7   ? 0.5255 0.6852 0.4797 0.1447  0.0819  -0.1584 8   LEU A CD1 
50   C CD2 . LEU A 7   ? 0.4154 0.5988 0.3891 0.1275  0.0784  -0.1394 8   LEU A CD2 
51   N N   . LEU A 8   ? 0.4459 0.6990 0.3867 0.0590  0.1215  -0.1342 9   LEU A N   
52   C CA  . LEU A 8   ? 0.5231 0.7696 0.4421 0.0406  0.1314  -0.1263 9   LEU A CA  
53   C C   . LEU A 8   ? 0.4785 0.7368 0.4062 0.0194  0.1379  -0.1174 9   LEU A C   
54   O O   . LEU A 8   ? 0.5379 0.8351 0.4873 0.0154  0.1451  -0.1238 9   LEU A O   
55   C CB  . LEU A 8   ? 0.4082 0.6726 0.3188 0.0427  0.1417  -0.1324 9   LEU A CB  
56   C CG  . LEU A 8   ? 0.4953 0.7448 0.3964 0.0619  0.1350  -0.1419 9   LEU A CG  
57   C CD1 . LEU A 8   ? 0.4912 0.7587 0.3856 0.0633  0.1449  -0.1471 9   LEU A CD1 
58   C CD2 . LEU A 8   ? 0.4969 0.7093 0.3731 0.0621  0.1276  -0.1382 9   LEU A CD2 
59   N N   . VAL A 9   ? 0.4573 0.6825 0.3693 0.0062  0.1350  -0.1039 10  VAL A N   
60   C CA  . VAL A 9   ? 0.5038 0.7305 0.4204 -0.0148 0.1407  -0.0951 10  VAL A CA  
61   C C   . VAL A 9   ? 0.4734 0.6714 0.3593 -0.0288 0.1479  -0.0824 10  VAL A C   
62   O O   . VAL A 9   ? 0.4983 0.6664 0.3618 -0.0208 0.1409  -0.0778 10  VAL A O   
63   C CB  . VAL A 9   ? 0.5111 0.7218 0.4415 -0.0139 0.1272  -0.0908 10  VAL A CB  
64   C CG1 . VAL A 9   ? 0.4808 0.6882 0.4133 -0.0361 0.1329  -0.0830 10  VAL A CG1 
65   C CG2 . VAL A 9   ? 0.5895 0.8281 0.5468 0.0015  0.1203  -0.1017 10  VAL A CG2 
66   N N   . THR A 10  ? 0.4963 0.7029 0.3806 -0.0497 0.1619  -0.0770 11  THR A N   
67   C CA  . THR A 10  ? 0.5539 0.7287 0.4070 -0.0637 0.1699  -0.0625 11  THR A CA  
68   C C   . THR A 10  ? 0.5309 0.6812 0.3873 -0.0778 0.1665  -0.0530 11  THR A C   
69   O O   . THR A 10  ? 0.5004 0.6709 0.3780 -0.0927 0.1731  -0.0566 11  THR A O   
70   C CB  . THR A 10  ? 0.5355 0.7299 0.3802 -0.0773 0.1901  -0.0613 11  THR A CB  
71   O OG1 . THR A 10  ? 0.5829 0.7953 0.4243 -0.0609 0.1904  -0.0695 11  THR A OG1 
72   C CG2 . THR A 10  ? 0.5239 0.6789 0.3337 -0.0898 0.1977  -0.0435 11  THR A CG2 
73   N N   . VAL A 11  ? 0.5955 0.7043 0.4316 -0.0728 0.1559  -0.0425 12  VAL A N   
74   C CA  . VAL A 11  ? 0.5803 0.6605 0.4140 -0.0846 0.1532  -0.0329 12  VAL A CA  
75   C C   . VAL A 11  ? 0.5770 0.6297 0.3788 -0.0987 0.1668  -0.0191 12  VAL A C   
76   O O   . VAL A 11  ? 0.6384 0.6969 0.4205 -0.0988 0.1778  -0.0169 12  VAL A O   
77   C CB  . VAL A 11  ? 0.5164 0.5692 0.3485 -0.0702 0.1344  -0.0300 12  VAL A CB  
78   C CG1 . VAL A 11  ? 0.4571 0.5318 0.3206 -0.0616 0.1239  -0.0407 12  VAL A CG1 
79   C CG2 . VAL A 11  ? 0.5127 0.5507 0.3227 -0.0540 0.1273  -0.0283 12  VAL A CG2 
80   N N   . ARG A 12  ? 0.6258 0.6468 0.4200 -0.1099 0.1668  -0.0095 13  ARG A N   
81   C CA  . ARG A 12  ? 0.6855 0.6734 0.4460 -0.1221 0.1800  0.0055  13  ARG A CA  
82   C C   . ARG A 12  ? 0.6798 0.6421 0.4043 -0.1051 0.1741  0.0151  13  ARG A C   
83   O O   . ARG A 12  ? 0.7257 0.6722 0.4182 -0.1103 0.1871  0.0259  13  ARG A O   
84   C CB  . ARG A 12  ? 0.7505 0.7053 0.5099 -0.1351 0.1800  0.0128  13  ARG A CB  
85   C CG  . ARG A 12  ? 0.9827 0.9478 0.7545 -0.1624 0.1983  0.0106  13  ARG A CG  
86   C CD  . ARG A 12  ? 1.1862 1.1185 0.9595 -0.1752 0.1971  0.0147  13  ARG A CD  
87   N NE  . ARG A 12  ? 1.3024 1.2634 1.1094 -0.1952 0.2037  0.0023  13  ARG A NE  
88   C CZ  . ARG A 12  ? 1.3816 1.3215 1.1953 -0.2102 0.2047  0.0015  13  ARG A CZ  
89   N NH1 . ARG A 12  ? 1.4509 1.3390 1.2398 -0.2064 0.2001  0.0133  13  ARG A NH1 
90   N NH2 . ARG A 12  ? 1.3727 1.3444 1.2180 -0.2276 0.2094  -0.0125 13  ARG A NH2 
91   N N   . GLY A 13  ? 0.6013 0.5609 0.3302 -0.0851 0.1551  0.0107  14  GLY A N   
92   C CA  . GLY A 13  ? 0.7027 0.6420 0.4009 -0.0686 0.1469  0.0171  14  GLY A CA  
93   C C   . GLY A 13  ? 0.7401 0.7042 0.4299 -0.0583 0.1491  0.0094  14  GLY A C   
94   O O   . GLY A 13  ? 0.6997 0.6493 0.3578 -0.0476 0.1464  0.0152  14  GLY A O   
95   N N   . GLY A 14  ? 0.7196 0.7213 0.4363 -0.0599 0.1534  -0.0042 15  GLY A N   
96   C CA  . GLY A 14  ? 0.6182 0.6447 0.3292 -0.0494 0.1561  -0.0138 15  GLY A CA  
97   C C   . GLY A 14  ? 0.6377 0.6987 0.3858 -0.0431 0.1513  -0.0309 15  GLY A C   
98   O O   . GLY A 14  ? 0.6131 0.6842 0.3897 -0.0499 0.1499  -0.0341 15  GLY A O   
99   N N   . ARG A 15  ? 0.6279 0.7054 0.3733 -0.0286 0.1482  -0.0421 16  ARG A N   
100  C CA  . ARG A 15  ? 0.6138 0.7223 0.3898 -0.0199 0.1454  -0.0583 16  ARG A CA  
101  C C   . ARG A 15  ? 0.5653 0.6604 0.3555 -0.0054 0.1262  -0.0645 16  ARG A C   
102  O O   . ARG A 15  ? 0.5827 0.6539 0.3560 0.0020  0.1156  -0.0619 16  ARG A O   
103  C CB  . ARG A 15  ? 0.6111 0.7447 0.3772 -0.0121 0.1545  -0.0687 16  ARG A CB  
104  C CG  . ARG A 15  ? 0.6568 0.8151 0.4236 -0.0265 0.1748  -0.0661 16  ARG A CG  
105  C CD  . ARG A 15  ? 0.6295 0.8050 0.3887 -0.0161 0.1806  -0.0734 16  ARG A CD  
106  N NE  . ARG A 15  ? 0.7869 0.9381 0.5057 -0.0113 0.1804  -0.0655 16  ARG A NE  
107  C CZ  . ARG A 15  ? 0.8772 1.0313 0.5816 0.0031  0.1777  -0.0742 16  ARG A CZ  
108  N NH1 . ARG A 15  ? 0.8284 1.0059 0.5560 0.0138  0.1754  -0.0907 16  ARG A NH1 
109  N NH2 . ARG A 15  ? 0.9071 1.0392 0.5732 0.0073  0.1766  -0.0668 16  ARG A NH2 
110  N N   . LEU A 16  ? 0.5461 0.6578 0.3674 -0.0015 0.1223  -0.0728 17  LEU A N   
111  C CA  . LEU A 16  ? 0.5439 0.6436 0.3800 0.0113  0.1070  -0.0784 17  LEU A CA  
112  C C   . LEU A 16  ? 0.5221 0.6446 0.3750 0.0254  0.1068  -0.0935 17  LEU A C   
113  O O   . LEU A 16  ? 0.4166 0.5703 0.2806 0.0242  0.1171  -0.0994 17  LEU A O   
114  C CB  . LEU A 16  ? 0.4506 0.5420 0.3056 0.0055  0.1008  -0.0722 17  LEU A CB  
115  C CG  . LEU A 16  ? 0.5145 0.5836 0.3576 -0.0082 0.1013  -0.0582 17  LEU A CG  
116  C CD1 . LEU A 16  ? 0.4052 0.4734 0.2697 -0.0134 0.0966  -0.0555 17  LEU A CD1 
117  C CD2 . LEU A 16  ? 0.5734 0.6133 0.3966 -0.0021 0.0916  -0.0537 17  LEU A CD2 
118  N N   . ARG A 17  ? 0.3918 0.4983 0.2472 0.0387  0.0955  -0.1005 18  ARG A N   
119  C CA  . ARG A 17  ? 0.3888 0.5074 0.2606 0.0540  0.0935  -0.1138 18  ARG A CA  
120  C C   . ARG A 17  ? 0.4736 0.5713 0.3606 0.0600  0.0819  -0.1121 18  ARG A C   
121  O O   . ARG A 17  ? 0.3995 0.4699 0.2796 0.0578  0.0735  -0.1077 18  ARG A O   
122  C CB  . ARG A 17  ? 0.4486 0.5657 0.3060 0.0651  0.0936  -0.1265 18  ARG A CB  
123  C CG  . ARG A 17  ? 0.4904 0.6034 0.3618 0.0822  0.0879  -0.1398 18  ARG A CG  
124  C CD  . ARG A 17  ? 0.5421 0.6487 0.3978 0.0916  0.0867  -0.1538 18  ARG A CD  
125  N NE  . ARG A 17  ? 0.5857 0.7165 0.4263 0.0894  0.0977  -0.1569 18  ARG A NE  
126  C CZ  . ARG A 17  ? 0.6127 0.7383 0.4278 0.0829  0.0989  -0.1537 18  ARG A CZ  
127  N NH1 . ARG A 17  ? 0.5412 0.6433 0.3431 0.0796  0.0893  -0.1501 18  ARG A NH1 
128  N NH2 . ARG A 17  ? 0.6177 0.7610 0.4206 0.0800  0.1092  -0.1529 18  ARG A NH2 
129  N N   . GLY A 18  ? 0.5039 0.6160 0.4113 0.0678  0.0818  -0.1152 19  GLY A N   
130  C CA  . GLY A 18  ? 0.4147 0.5081 0.3343 0.0741  0.0726  -0.1118 19  GLY A CA  
131  C C   . GLY A 18  ? 0.4921 0.5764 0.4175 0.0928  0.0691  -0.1224 19  GLY A C   
132  O O   . GLY A 18  ? 0.5284 0.6179 0.4477 0.1011  0.0723  -0.1340 19  GLY A O   
133  N N   . ILE A 19  ? 0.5344 0.6029 0.4699 0.0997  0.0628  -0.1181 20  ILE A N   
134  C CA  . ILE A 19  ? 0.5841 0.6344 0.5234 0.1174  0.0595  -0.1252 20  ILE A CA  
135  C C   . ILE A 19  ? 0.5868 0.6514 0.5398 0.1298  0.0582  -0.1221 20  ILE A C   
136  O O   . ILE A 19  ? 0.5616 0.6395 0.5211 0.1224  0.0569  -0.1130 20  ILE A O   
137  C CB  . ILE A 19  ? 0.6556 0.6644 0.5896 0.1140  0.0532  -0.1219 20  ILE A CB  
138  C CG1 . ILE A 19  ? 0.7789 0.7633 0.7125 0.1292  0.0522  -0.1323 20  ILE A CG1 
139  C CG2 . ILE A 19  ? 0.4558 0.4525 0.3954 0.1085  0.0491  -0.1080 20  ILE A CG2 
140  C CD1 . ILE A 19  ? 0.8615 0.8059 0.7931 0.1237  0.0477  -0.1299 20  ILE A CD1 
141  N N   . ARG A 20  ? 0.5808 0.6436 0.5374 0.1500  0.0582  -0.1306 21  ARG A N   
142  C CA  . ARG A 20  ? 0.5780 0.6560 0.5458 0.1668  0.0559  -0.1289 21  ARG A CA  
143  C C   . ARG A 20  ? 0.5544 0.5900 0.5178 0.1779  0.0503  -0.1219 21  ARG A C   
144  O O   . ARG A 20  ? 0.5654 0.5708 0.5226 0.1887  0.0506  -0.1283 21  ARG A O   
145  C CB  . ARG A 20  ? 0.4788 0.5865 0.4534 0.1849  0.0601  -0.1428 21  ARG A CB  
146  C CG  . ARG A 20  ? 0.5517 0.6721 0.5372 0.2047  0.0554  -0.1405 21  ARG A CG  
147  C CD  . ARG A 20  ? 0.6999 0.8295 0.6897 0.2194  0.0563  -0.1493 21  ARG A CD  
148  N NE  . ARG A 20  ? 0.8497 0.9684 0.8423 0.2405  0.0495  -0.1445 21  ARG A NE  
149  C CZ  . ARG A 20  ? 0.8330 0.9747 0.8338 0.2566  0.0480  -0.1501 21  ARG A CZ  
150  N NH1 . ARG A 20  ? 0.9223 1.1000 0.9312 0.2530  0.0536  -0.1611 21  ARG A NH1 
151  N NH2 . ARG A 20  ? 0.7494 0.8779 0.7490 0.2765  0.0412  -0.1444 21  ARG A NH2 
152  N N   . LEU A 21  ? 0.5600 0.5923 0.5257 0.1749  0.0461  -0.1093 22  LEU A N   
153  C CA  . LEU A 21  ? 0.5924 0.5837 0.5514 0.1828  0.0424  -0.0999 22  LEU A CA  
154  C C   . LEU A 21  ? 0.6043 0.6003 0.5652 0.2089  0.0395  -0.0983 22  LEU A C   
155  O O   . LEU A 21  ? 0.5089 0.5462 0.4794 0.2158  0.0373  -0.0994 22  LEU A O   
156  C CB  . LEU A 21  ? 0.5570 0.5394 0.5141 0.1661  0.0399  -0.0864 22  LEU A CB  
157  C CG  . LEU A 21  ? 0.5939 0.5679 0.5479 0.1425  0.0413  -0.0858 22  LEU A CG  
158  C CD1 . LEU A 21  ? 0.6180 0.5923 0.5723 0.1302  0.0387  -0.0735 22  LEU A CD1 
159  C CD2 . LEU A 21  ? 0.5461 0.4801 0.4934 0.1407  0.0423  -0.0894 22  LEU A CD2 
160  N N   . LYS A 22  ? 0.6473 0.6003 0.5987 0.2236  0.0394  -0.0962 23  LYS A N   
161  C CA  . LYS A 22  ? 0.6394 0.5866 0.5882 0.2453  0.0354  -0.0887 23  LYS A CA  
162  C C   . LYS A 22  ? 0.6343 0.5704 0.5761 0.2454  0.0323  -0.0732 23  LYS A C   
163  O O   . LYS A 22  ? 0.6835 0.5940 0.6201 0.2265  0.0342  -0.0655 23  LYS A O   
164  C CB  . LYS A 22  ? 0.7305 0.6324 0.6714 0.2533  0.0372  -0.0888 23  LYS A CB  
165  C CG  . LYS A 22  ? 0.8489 0.7644 0.7961 0.2591  0.0394  -0.1039 23  LYS A CG  
166  C CD  . LYS A 22  ? 0.9859 0.8521 0.9263 0.2583  0.0432  -0.1078 23  LYS A CD  
167  C CE  . LYS A 22  ? 1.0717 0.9521 1.0173 0.2660  0.0454  -0.1233 23  LYS A CE  
168  N NZ  . LYS A 22  ? 1.1342 0.9747 1.0757 0.2581  0.0500  -0.1324 23  LYS A NZ  
169  N N   . THR A 23  ? 0.5739 0.5348 0.5174 0.2607  0.0264  -0.0678 24  THR A N   
170  C CA  . THR A 23  ? 0.6988 0.6486 0.6322 0.2654  0.0225  -0.0526 24  THR A CA  
171  C C   . THR A 23  ? 0.7504 0.6946 0.6757 0.2881  0.0174  -0.0464 24  THR A C   
172  O O   . THR A 23  ? 0.7411 0.7030 0.6731 0.3000  0.0158  -0.0556 24  THR A O   
173  C CB  . THR A 23  ? 0.6392 0.6362 0.5828 0.2547  0.0182  -0.0525 24  THR A CB  
174  O OG1 . THR A 23  ? 0.6280 0.6735 0.5821 0.2736  0.0123  -0.0598 24  THR A OG1 
175  C CG2 . THR A 23  ? 0.6299 0.6447 0.5850 0.2252  0.0223  -0.0600 24  THR A CG2 
176  N N   . PRO A 24  ? 0.7840 0.7031 0.6931 0.2948  0.0152  -0.0306 25  PRO A N   
177  C CA  . PRO A 24  ? 0.8327 0.7495 0.7309 0.3180  0.0098  -0.0243 25  PRO A CA  
178  C C   . PRO A 24  ? 0.8169 0.7947 0.7279 0.3317  0.0011  -0.0340 25  PRO A C   
179  O O   . PRO A 24  ? 0.8970 0.8797 0.8050 0.3511  -0.0027 -0.0361 25  PRO A O   
180  C CB  . PRO A 24  ? 0.9273 0.8166 0.8054 0.3188  0.0095  -0.0060 25  PRO A CB  
181  C CG  . PRO A 24  ? 0.9391 0.7938 0.8159 0.2959  0.0180  -0.0021 25  PRO A CG  
182  C CD  . PRO A 24  ? 0.8520 0.7382 0.7493 0.2816  0.0191  -0.0176 25  PRO A CD  
183  N N   . GLY A 25  ? 0.7487 0.7741 0.6751 0.3213  -0.0019 -0.0409 26  GLY A N   
184  C CA  . GLY A 25  ? 0.7381 0.8253 0.6802 0.3301  -0.0094 -0.0521 26  GLY A CA  
185  C C   . GLY A 25  ? 0.7666 0.8887 0.7303 0.3240  -0.0060 -0.0694 26  GLY A C   
186  O O   . GLY A 25  ? 0.8834 1.0565 0.8613 0.3309  -0.0113 -0.0797 26  GLY A O   
187  N N   . GLY A 26  ? 0.6214 0.7188 0.5872 0.3105  0.0028  -0.0736 27  GLY A N   
188  C CA  . GLY A 26  ? 0.6144 0.7428 0.5972 0.3036  0.0075  -0.0893 27  GLY A CA  
189  C C   . GLY A 26  ? 0.5975 0.7222 0.5853 0.2793  0.0159  -0.0940 27  GLY A C   
190  O O   . GLY A 26  ? 0.5814 0.6795 0.5607 0.2682  0.0178  -0.0858 27  GLY A O   
191  N N   . PRO A 27  ? 0.5337 0.6855 0.5338 0.2708  0.0215  -0.1072 28  PRO A N   
192  C CA  . PRO A 27  ? 0.4725 0.6182 0.4729 0.2487  0.0299  -0.1117 28  PRO A CA  
193  C C   . PRO A 27  ? 0.4721 0.6489 0.4811 0.2280  0.0311  -0.1107 28  PRO A C   
194  O O   . PRO A 27  ? 0.4711 0.6945 0.4944 0.2290  0.0281  -0.1146 28  PRO A O   
195  C CB  . PRO A 27  ? 0.4732 0.6420 0.4819 0.2478  0.0353  -0.1250 28  PRO A CB  
196  C CG  . PRO A 27  ? 0.4273 0.6406 0.4497 0.2617  0.0300  -0.1295 28  PRO A CG  
197  C CD  . PRO A 27  ? 0.5139 0.7044 0.5266 0.2811  0.0206  -0.1183 28  PRO A CD  
198  N N   . VAL A 28  ? 0.4357 0.5830 0.4357 0.2043  0.0344  -0.1041 29  VAL A N   
199  C CA  . VAL A 28  ? 0.3984 0.5652 0.4035 0.1774  0.0367  -0.1020 29  VAL A CA  
200  C C   . VAL A 28  ? 0.4045 0.5571 0.4032 0.1594  0.0441  -0.1050 29  VAL A C   
201  O O   . VAL A 28  ? 0.4561 0.5762 0.4447 0.1648  0.0455  -0.1065 29  VAL A O   
202  C CB  . VAL A 28  ? 0.4779 0.6233 0.4760 0.1678  0.0315  -0.0887 29  VAL A CB  
203  C CG1 . VAL A 28  ? 0.4754 0.6228 0.4721 0.1903  0.0234  -0.0835 29  VAL A CG1 
204  C CG2 . VAL A 28  ? 0.4423 0.5374 0.4257 0.1579  0.0331  -0.0806 29  VAL A CG2 
205  N N   . SER A 29  ? 0.3816 0.5587 0.3852 0.1380  0.0490  -0.1064 30  SER A N   
206  C CA  . SER A 29  ? 0.4216 0.5865 0.4156 0.1208  0.0557  -0.1072 30  SER A CA  
207  C C   . SER A 29  ? 0.4503 0.5837 0.4339 0.1038  0.0531  -0.0956 30  SER A C   
208  O O   . SER A 29  ? 0.4370 0.5777 0.4249 0.0947  0.0506  -0.0896 30  SER A O   
209  C CB  . SER A 29  ? 0.3956 0.6018 0.3977 0.1079  0.0647  -0.1143 30  SER A CB  
210  O OG  . SER A 29  ? 0.4059 0.6461 0.4197 0.1241  0.0678  -0.1265 30  SER A OG  
211  N N   . ALA A 30  ? 0.4434 0.5442 0.4142 0.1001  0.0534  -0.0941 31  ALA A N   
212  C CA  . ALA A 30  ? 0.4088 0.4812 0.3705 0.0860  0.0506  -0.0847 31  ALA A CA  
213  C C   . ALA A 30  ? 0.4653 0.5330 0.4156 0.0732  0.0550  -0.0863 31  ALA A C   
214  O O   . ALA A 30  ? 0.4158 0.4825 0.3605 0.0789  0.0576  -0.0945 31  ALA A O   
215  C CB  . ALA A 30  ? 0.3430 0.3786 0.3003 0.0946  0.0453  -0.0808 31  ALA A CB  
216  N N   . PHE A 31  ? 0.4289 0.4932 0.3741 0.0572  0.0556  -0.0788 32  PHE A N   
217  C CA  . PHE A 31  ? 0.3440 0.3996 0.2745 0.0460  0.0586  -0.0772 32  PHE A CA  
218  C C   . PHE A 31  ? 0.4106 0.4372 0.3354 0.0405  0.0521  -0.0692 32  PHE A C   
219  O O   . PHE A 31  ? 0.3892 0.4132 0.3142 0.0310  0.0515  -0.0616 32  PHE A O   
220  C CB  . PHE A 31  ? 0.3826 0.4602 0.3112 0.0326  0.0668  -0.0752 32  PHE A CB  
221  C CG  . PHE A 31  ? 0.4461 0.5574 0.3830 0.0369  0.0744  -0.0842 32  PHE A CG  
222  C CD1 . PHE A 31  ? 0.4364 0.5559 0.3620 0.0365  0.0818  -0.0895 32  PHE A CD1 
223  C CD2 . PHE A 31  ? 0.4018 0.5392 0.3575 0.0427  0.0741  -0.0884 32  PHE A CD2 
224  C CE1 . PHE A 31  ? 0.4359 0.5895 0.3703 0.0410  0.0899  -0.0989 32  PHE A CE1 
225  C CE2 . PHE A 31  ? 0.4529 0.6262 0.4189 0.0480  0.0809  -0.0983 32  PHE A CE2 
226  C CZ  . PHE A 31  ? 0.4676 0.6491 0.4236 0.0466  0.0895  -0.1036 32  PHE A CZ  
227  N N   . LEU A 32  ? 0.4145 0.4206 0.3357 0.0466  0.0475  -0.0726 33  LEU A N   
228  C CA  . LEU A 32  ? 0.4266 0.4088 0.3469 0.0432  0.0415  -0.0674 33  LEU A CA  
229  C C   . LEU A 32  ? 0.4310 0.4054 0.3377 0.0364  0.0398  -0.0670 33  LEU A C   
230  O O   . LEU A 32  ? 0.4509 0.4282 0.3488 0.0393  0.0405  -0.0745 33  LEU A O   
231  C CB  . LEU A 32  ? 0.4604 0.4252 0.3871 0.0526  0.0383  -0.0722 33  LEU A CB  
232  C CG  . LEU A 32  ? 0.4369 0.4041 0.3730 0.0639  0.0394  -0.0721 33  LEU A CG  
233  C CD1 . LEU A 32  ? 0.4327 0.3729 0.3716 0.0707  0.0374  -0.0742 33  LEU A CD1 
234  C CD2 . LEU A 32  ? 0.3231 0.2996 0.2644 0.0608  0.0388  -0.0627 33  LEU A CD2 
235  N N   . GLY A 33  ? 0.4682 0.4332 0.3720 0.0290  0.0369  -0.0589 34  GLY A N   
236  C CA  . GLY A 33  ? 0.4354 0.3926 0.3254 0.0256  0.0337  -0.0579 34  GLY A CA  
237  C C   . GLY A 33  ? 0.4435 0.4088 0.3166 0.0209  0.0392  -0.0544 34  GLY A C   
238  O O   . GLY A 33  ? 0.4112 0.3771 0.2697 0.0234  0.0387  -0.0583 34  GLY A O   
239  N N   . ILE A 34  ? 0.4441 0.4156 0.3181 0.0136  0.0451  -0.0476 35  ILE A N   
240  C CA  . ILE A 34  ? 0.4243 0.3990 0.2814 0.0061  0.0526  -0.0424 35  ILE A CA  
241  C C   . ILE A 34  ? 0.5055 0.4596 0.3480 0.0025  0.0490  -0.0332 35  ILE A C   
242  O O   . ILE A 34  ? 0.5293 0.4739 0.3799 -0.0003 0.0457  -0.0288 35  ILE A O   
243  C CB  . ILE A 34  ? 0.4234 0.4145 0.2899 -0.0022 0.0612  -0.0411 35  ILE A CB  
244  C CG1 . ILE A 34  ? 0.4246 0.4391 0.3062 0.0048  0.0637  -0.0508 35  ILE A CG1 
245  C CG2 . ILE A 34  ? 0.3921 0.3828 0.2410 -0.0131 0.0712  -0.0348 35  ILE A CG2 
246  C CD1 . ILE A 34  ? 0.4359 0.4721 0.3335 -0.0009 0.0690  -0.0519 35  ILE A CD1 
247  N N   . PRO A 35  ? 0.5087 0.4553 0.3284 0.0041  0.0493  -0.0303 36  PRO A N   
248  C CA  . PRO A 35  ? 0.5290 0.4547 0.3329 0.0037  0.0454  -0.0209 36  PRO A CA  
249  C C   . PRO A 35  ? 0.5412 0.4574 0.3384 -0.0078 0.0545  -0.0111 36  PRO A C   
250  O O   . PRO A 35  ? 0.5596 0.4821 0.3477 -0.0156 0.0656  -0.0088 36  PRO A O   
251  C CB  . PRO A 35  ? 0.5322 0.4553 0.3110 0.0109  0.0433  -0.0210 36  PRO A CB  
252  C CG  . PRO A 35  ? 0.4991 0.4401 0.2748 0.0092  0.0524  -0.0266 36  PRO A CG  
253  C CD  . PRO A 35  ? 0.4676 0.4245 0.2727 0.0082  0.0531  -0.0354 36  PRO A CD  
254  N N   . PHE A 36  ? 0.4741 0.3756 0.2765 -0.0099 0.0507  -0.0063 37  PHE A N   
255  C CA  . PHE A 36  ? 0.5087 0.3964 0.3037 -0.0214 0.0589  0.0017  37  PHE A CA  
256  C C   . PHE A 36  ? 0.5314 0.3894 0.3040 -0.0180 0.0561  0.0117  37  PHE A C   
257  O O   . PHE A 36  ? 0.6215 0.4611 0.3827 -0.0276 0.0641  0.0192  37  PHE A O   
258  C CB  . PHE A 36  ? 0.5004 0.3961 0.3196 -0.0281 0.0590  -0.0022 37  PHE A CB  
259  C CG  . PHE A 36  ? 0.4571 0.3439 0.2863 -0.0211 0.0489  -0.0028 37  PHE A CG  
260  C CD1 . PHE A 36  ? 0.4706 0.3349 0.2918 -0.0231 0.0479  0.0031  37  PHE A CD1 
261  C CD2 . PHE A 36  ? 0.4215 0.3214 0.2681 -0.0130 0.0417  -0.0096 37  PHE A CD2 
262  C CE1 . PHE A 36  ? 0.5402 0.3997 0.3716 -0.0165 0.0397  0.0016  37  PHE A CE1 
263  C CE2 . PHE A 36  ? 0.4998 0.3933 0.3562 -0.0081 0.0345  -0.0101 37  PHE A CE2 
264  C CZ  . PHE A 36  ? 0.4757 0.3513 0.3251 -0.0096 0.0335  -0.0048 37  PHE A CZ  
265  N N   . ALA A 37  ? 0.5179 0.3708 0.2837 -0.0044 0.0452  0.0113  38  ALA A N   
266  C CA  . ALA A 37  ? 0.4842 0.3113 0.2266 0.0032  0.0410  0.0204  38  ALA A CA  
267  C C   . ALA A 37  ? 0.5784 0.4105 0.3050 0.0172  0.0327  0.0188  38  ALA A C   
268  O O   . ALA A 37  ? 0.5629 0.4172 0.3029 0.0211  0.0276  0.0083  38  ALA A O   
269  C CB  . ALA A 37  ? 0.4487 0.2667 0.2045 0.0077  0.0331  0.0196  38  ALA A CB  
270  N N   . GLU A 38  ? 0.5918 0.4019 0.2883 0.0252  0.0312  0.0289  39  GLU A N   
271  C CA  . GLU A 38  ? 0.5804 0.3963 0.2621 0.0416  0.0196  0.0265  39  GLU A CA  
272  C C   . GLU A 38  ? 0.5847 0.4146 0.2921 0.0503  0.0056  0.0161  39  GLU A C   
273  O O   . GLU A 38  ? 0.6527 0.4745 0.3748 0.0485  0.0044  0.0173  39  GLU A O   
274  C CB  . GLU A 38  ? 0.6657 0.4528 0.3086 0.0514  0.0197  0.0410  39  GLU A CB  
275  C CG  . GLU A 38  ? 0.7932 0.5664 0.4064 0.0432  0.0346  0.0518  39  GLU A CG  
276  C CD  . GLU A 38  ? 0.8573 0.6549 0.4628 0.0461  0.0347  0.0448  39  GLU A CD  
277  O OE1 . GLU A 38  ? 0.9139 0.7251 0.5149 0.0616  0.0209  0.0377  39  GLU A OE1 
278  O OE2 . GLU A 38  ? 0.8586 0.6640 0.4638 0.0330  0.0485  0.0449  39  GLU A OE2 
279  N N   . PRO A 39  ? 0.6241 0.4759 0.3382 0.0585  -0.0042 0.0048  40  PRO A N   
280  C CA  . PRO A 39  ? 0.5239 0.3915 0.2654 0.0639  -0.0159 -0.0065 40  PRO A CA  
281  C C   . PRO A 39  ? 0.5826 0.4378 0.3181 0.0750  -0.0235 -0.0008 40  PRO A C   
282  O O   . PRO A 39  ? 0.5523 0.3976 0.2599 0.0882  -0.0290 0.0056  40  PRO A O   
283  C CB  . PRO A 39  ? 0.5105 0.4000 0.2509 0.0713  -0.0248 -0.0190 40  PRO A CB  
284  C CG  . PRO A 39  ? 0.5089 0.3988 0.2330 0.0653  -0.0149 -0.0174 40  PRO A CG  
285  C CD  . PRO A 39  ? 0.5557 0.4202 0.2540 0.0616  -0.0040 0.0001  40  PRO A CD  
286  N N   . PRO A 40  ? 0.5419 0.3970 0.3013 0.0717  -0.0240 -0.0029 41  PRO A N   
287  C CA  . PRO A 40  ? 0.5691 0.4122 0.3238 0.0831  -0.0302 0.0019  41  PRO A CA  
288  C C   . PRO A 40  ? 0.6069 0.4733 0.3726 0.0973  -0.0449 -0.0089 41  PRO A C   
289  O O   . PRO A 40  ? 0.6552 0.5338 0.4458 0.0990  -0.0493 -0.0158 41  PRO A O   
290  C CB  . PRO A 40  ? 0.5081 0.3463 0.2855 0.0724  -0.0234 0.0018  41  PRO A CB  
291  C CG  . PRO A 40  ? 0.5770 0.4369 0.3804 0.0609  -0.0205 -0.0081 41  PRO A CG  
292  C CD  . PRO A 40  ? 0.4866 0.3518 0.2762 0.0586  -0.0182 -0.0091 41  PRO A CD  
293  N N   . MET A 41  ? 0.6230 0.4980 0.3697 0.1076  -0.0526 -0.0112 42  MET A N   
294  C CA  . MET A 41  ? 0.6698 0.5732 0.4275 0.1200  -0.0676 -0.0246 42  MET A CA  
295  C C   . MET A 41  ? 0.6794 0.5749 0.4087 0.1421  -0.0781 -0.0176 42  MET A C   
296  O O   . MET A 41  ? 0.7436 0.6081 0.4379 0.1476  -0.0729 -0.0014 42  MET A O   
297  C CB  . MET A 41  ? 0.7589 0.6831 0.5177 0.1162  -0.0705 -0.0363 42  MET A CB  
298  C CG  . MET A 41  ? 0.9012 0.8263 0.6782 0.0973  -0.0589 -0.0403 42  MET A CG  
299  S SD  . MET A 41  ? 1.0968 1.0550 0.9055 0.0921  -0.0663 -0.0635 42  MET A SD  
300  C CE  . MET A 41  ? 1.1785 1.1532 0.9609 0.1096  -0.0812 -0.0710 42  MET A CE  
301  N N   . GLY A 42  ? 0.6419 0.5662 0.3866 0.1550  -0.0928 -0.0304 43  GLY A N   
302  C CA  . GLY A 42  ? 0.6721 0.5965 0.3920 0.1798  -0.1061 -0.0267 43  GLY A CA  
303  C C   . GLY A 42  ? 0.7187 0.6073 0.4187 0.1897  -0.1019 -0.0097 43  GLY A C   
304  O O   . GLY A 42  ? 0.6462 0.5337 0.3695 0.1871  -0.0994 -0.0114 43  GLY A O   
305  N N   . PRO A 43  ? 0.7430 0.5995 0.3977 0.2010  -0.1000 0.0072  44  PRO A N   
306  C CA  . PRO A 43  ? 0.7211 0.5358 0.3533 0.2097  -0.0946 0.0240  44  PRO A CA  
307  C C   . PRO A 43  ? 0.7671 0.5550 0.4093 0.1867  -0.0767 0.0309  44  PRO A C   
308  O O   . PRO A 43  ? 0.7067 0.4647 0.3418 0.1908  -0.0724 0.0396  44  PRO A O   
309  C CB  . PRO A 43  ? 0.7775 0.5633 0.3560 0.2249  -0.0952 0.0406  44  PRO A CB  
310  C CG  . PRO A 43  ? 0.6863 0.4923 0.2603 0.2140  -0.0932 0.0349  44  PRO A CG  
311  C CD  . PRO A 43  ? 0.6659 0.5220 0.2861 0.2076  -0.1028 0.0112  44  PRO A CD  
312  N N   . ARG A 44  ? 0.7463 0.5452 0.4057 0.1638  -0.0669 0.0259  45  ARG A N   
313  C CA  . ARG A 44  ? 0.7216 0.5014 0.3923 0.1424  -0.0513 0.0304  45  ARG A CA  
314  C C   . ARG A 44  ? 0.6808 0.4805 0.3934 0.1341  -0.0515 0.0186  45  ARG A C   
315  O O   . ARG A 44  ? 0.5676 0.3541 0.2904 0.1184  -0.0403 0.0212  45  ARG A O   
316  C CB  . ARG A 44  ? 0.6913 0.4748 0.3594 0.1238  -0.0405 0.0310  45  ARG A CB  
317  C CG  . ARG A 44  ? 0.8400 0.6039 0.4655 0.1288  -0.0365 0.0434  45  ARG A CG  
318  C CD  . ARG A 44  ? 0.9357 0.7039 0.5622 0.1088  -0.0232 0.0434  45  ARG A CD  
319  N NE  . ARG A 44  ? 1.0750 0.8092 0.6655 0.1032  -0.0095 0.0601  45  ARG A NE  
320  C CZ  . ARG A 44  ? 1.2475 0.9733 0.8008 0.1117  -0.0086 0.0687  45  ARG A CZ  
321  N NH1 . ARG A 44  ? 1.2904 1.0413 0.8379 0.1273  -0.0222 0.0606  45  ARG A NH1 
322  N NH2 . ARG A 44  ? 1.3359 1.0288 0.8573 0.1039  0.0066  0.0847  45  ARG A NH2 
323  N N   . ARG A 45  ? 0.6682 0.5006 0.4052 0.1436  -0.0635 0.0053  46  ARG A N   
324  C CA  . ARG A 45  ? 0.6419 0.4922 0.4165 0.1353  -0.0619 -0.0047 46  ARG A CA  
325  C C   . ARG A 45  ? 0.6676 0.4948 0.4383 0.1427  -0.0596 0.0015  46  ARG A C   
326  O O   . ARG A 45  ? 0.6384 0.4516 0.3884 0.1625  -0.0667 0.0070  46  ARG A O   
327  C CB  . ARG A 45  ? 0.5667 0.4591 0.3694 0.1416  -0.0737 -0.0213 46  ARG A CB  
328  C CG  . ARG A 45  ? 0.6134 0.5230 0.4495 0.1400  -0.0734 -0.0300 46  ARG A CG  
329  C CD  . ARG A 45  ? 0.6223 0.5721 0.4815 0.1508  -0.0863 -0.0454 46  ARG A CD  
330  N NE  . ARG A 45  ? 0.5661 0.5433 0.4456 0.1381  -0.0876 -0.0581 46  ARG A NE  
331  C CZ  . ARG A 45  ? 0.5302 0.5456 0.4337 0.1420  -0.0977 -0.0746 46  ARG A CZ  
332  N NH1 . ARG A 45  ? 0.4469 0.4821 0.3583 0.1595  -0.1080 -0.0805 46  ARG A NH1 
333  N NH2 . ARG A 45  ? 0.4623 0.4968 0.3825 0.1286  -0.0976 -0.0865 46  ARG A NH2 
334  N N   . PHE A 46  ? 0.5686 0.3913 0.3577 0.1279  -0.0499 0.0003  47  PHE A N   
335  C CA  . PHE A 46  ? 0.5721 0.3721 0.3597 0.1301  -0.0451 0.0041  47  PHE A CA  
336  C C   . PHE A 46  ? 0.6433 0.3992 0.3993 0.1251  -0.0359 0.0179  47  PHE A C   
337  O O   . PHE A 46  ? 0.7076 0.4400 0.4604 0.1243  -0.0307 0.0204  47  PHE A O   
338  C CB  . PHE A 46  ? 0.5541 0.3586 0.3427 0.1531  -0.0553 0.0007  47  PHE A CB  
339  C CG  . PHE A 46  ? 0.5523 0.4028 0.3733 0.1583  -0.0641 -0.0141 47  PHE A CG  
340  C CD1 . PHE A 46  ? 0.5115 0.3821 0.3293 0.1778  -0.0779 -0.0189 47  PHE A CD1 
341  C CD2 . PHE A 46  ? 0.4803 0.3543 0.3343 0.1435  -0.0584 -0.0234 47  PHE A CD2 
342  C CE1 . PHE A 46  ? 0.5065 0.4226 0.3574 0.1804  -0.0856 -0.0346 47  PHE A CE1 
343  C CE2 . PHE A 46  ? 0.5044 0.4195 0.3891 0.1457  -0.0644 -0.0371 47  PHE A CE2 
344  C CZ  . PHE A 46  ? 0.5552 0.4926 0.4402 0.1630  -0.0779 -0.0436 47  PHE A CZ  
345  N N   . LEU A 47  ? 0.6315 0.3753 0.3644 0.1208  -0.0329 0.0259  48  LEU A N   
346  C CA  . LEU A 47  ? 0.7098 0.4113 0.4124 0.1145  -0.0226 0.0393  48  LEU A CA  
347  C C   . LEU A 47  ? 0.7068 0.4083 0.4204 0.0892  -0.0097 0.0385  48  LEU A C   
348  O O   . LEU A 47  ? 0.6329 0.3657 0.3707 0.0791  -0.0095 0.0301  48  LEU A O   
349  C CB  . LEU A 47  ? 0.6256 0.3128 0.2932 0.1241  -0.0246 0.0499  48  LEU A CB  
350  C CG  . LEU A 47  ? 0.7744 0.4543 0.4218 0.1523  -0.0376 0.0536  48  LEU A CG  
351  C CD1 . LEU A 47  ? 0.7239 0.3861 0.3310 0.1612  -0.0381 0.0661  48  LEU A CD1 
352  C CD2 . LEU A 47  ? 0.7878 0.4336 0.4258 0.1627  -0.0365 0.0585  48  LEU A CD2 
353  N N   . PRO A 48  ? 0.6412 0.3077 0.3377 0.0790  0.0013  0.0465  49  PRO A N   
354  C CA  . PRO A 48  ? 0.6401 0.3100 0.3463 0.0553  0.0131  0.0451  49  PRO A CA  
355  C C   . PRO A 48  ? 0.7033 0.3907 0.4048 0.0488  0.0158  0.0468  49  PRO A C   
356  O O   . PRO A 48  ? 0.7011 0.3809 0.3782 0.0594  0.0129  0.0540  49  PRO A O   
357  C CB  . PRO A 48  ? 0.7108 0.3359 0.3934 0.0474  0.0238  0.0541  49  PRO A CB  
358  C CG  . PRO A 48  ? 0.7309 0.3316 0.4022 0.0666  0.0169  0.0562  49  PRO A CG  
359  C CD  . PRO A 48  ? 0.6305 0.2532 0.3011 0.0885  0.0032  0.0554  49  PRO A CD  
360  N N   . PRO A 49  ? 0.6858 0.3967 0.4085 0.0327  0.0214  0.0402  50  PRO A N   
361  C CA  . PRO A 49  ? 0.6233 0.3534 0.3436 0.0278  0.0241  0.0398  50  PRO A CA  
362  C C   . PRO A 49  ? 0.7133 0.4188 0.4037 0.0199  0.0356  0.0512  50  PRO A C   
363  O O   . PRO A 49  ? 0.7645 0.4464 0.4481 0.0073  0.0460  0.0558  50  PRO A O   
364  C CB  . PRO A 49  ? 0.5559 0.3133 0.3064 0.0141  0.0278  0.0301  50  PRO A CB  
365  C CG  . PRO A 49  ? 0.5535 0.2960 0.3113 0.0050  0.0327  0.0295  50  PRO A CG  
366  C CD  . PRO A 49  ? 0.5794 0.2989 0.3261 0.0193  0.0261  0.0329  50  PRO A CD  
367  N N   . GLU A 50  ? 0.6837 0.3950 0.3555 0.0268  0.0342  0.0550  51  GLU A N   
368  C CA  . GLU A 50  ? 0.7467 0.4394 0.3906 0.0174  0.0475  0.0656  51  GLU A CA  
369  C C   . GLU A 50  ? 0.7026 0.4252 0.3633 0.0022  0.0559  0.0586  51  GLU A C   
370  O O   . GLU A 50  ? 0.7102 0.4649 0.3916 0.0065  0.0485  0.0478  51  GLU A O   
371  C CB  . GLU A 50  ? 0.9204 0.6010 0.5289 0.0344  0.0428  0.0750  51  GLU A CB  
372  C CG  . GLU A 50  ? 1.2147 0.8623 0.8002 0.0521  0.0354  0.0843  51  GLU A CG  
373  C CD  . GLU A 50  ? 1.5046 1.1465 1.0555 0.0725  0.0278  0.0922  51  GLU A CD  
374  O OE1 . GLU A 50  ? 1.6248 1.2485 1.1427 0.0689  0.0385  0.1041  51  GLU A OE1 
375  O OE2 . GLU A 50  ? 1.5916 1.2488 1.1479 0.0924  0.0112  0.0862  51  GLU A OE2 
376  N N   . PRO A 51  ? 0.7200 0.4329 0.3734 -0.0158 0.0717  0.0634  52  PRO A N   
377  C CA  . PRO A 51  ? 0.6963 0.4415 0.3669 -0.0287 0.0798  0.0557  52  PRO A CA  
378  C C   . PRO A 51  ? 0.7012 0.4647 0.3591 -0.0185 0.0771  0.0546  52  PRO A C   
379  O O   . PRO A 51  ? 0.7158 0.4613 0.3411 -0.0077 0.0758  0.0641  52  PRO A O   
380  C CB  . PRO A 51  ? 0.7190 0.4463 0.3782 -0.0492 0.0983  0.0628  52  PRO A CB  
381  C CG  . PRO A 51  ? 0.7479 0.4357 0.3969 -0.0503 0.0983  0.0697  52  PRO A CG  
382  C CD  . PRO A 51  ? 0.7463 0.4191 0.3786 -0.0262 0.0835  0.0747  52  PRO A CD  
383  N N   . LYS A 52  ? 0.6482 0.4472 0.3309 -0.0208 0.0759  0.0424  53  LYS A N   
384  C CA  . LYS A 52  ? 0.6735 0.4922 0.3475 -0.0116 0.0731  0.0379  53  LYS A CA  
385  C C   . LYS A 52  ? 0.6854 0.4967 0.3290 -0.0183 0.0881  0.0470  53  LYS A C   
386  O O   . LYS A 52  ? 0.7212 0.5362 0.3697 -0.0355 0.1032  0.0485  53  LYS A O   
387  C CB  . LYS A 52  ? 0.6333 0.4870 0.3404 -0.0133 0.0706  0.0228  53  LYS A CB  
388  C CG  . LYS A 52  ? 0.6322 0.5069 0.3335 -0.0046 0.0684  0.0151  53  LYS A CG  
389  C CD  . LYS A 52  ? 0.6506 0.5210 0.3408 0.0124  0.0532  0.0127  53  LYS A CD  
390  C CE  . LYS A 52  ? 0.6453 0.5384 0.3339 0.0201  0.0500  0.0010  53  LYS A CE  
391  N NZ  . LYS A 52  ? 0.7262 0.6174 0.3995 0.0356  0.0359  -0.0022 53  LYS A NZ  
392  N N   . GLN A 53  ? 0.6713 0.4736 0.2831 -0.0049 0.0841  0.0529  54  GLN A N   
393  C CA  . GLN A 53  ? 0.7925 0.5855 0.3703 -0.0100 0.0991  0.0634  54  GLN A CA  
394  C C   . GLN A 53  ? 0.7377 0.5667 0.3274 -0.0158 0.1072  0.0524  54  GLN A C   
395  O O   . GLN A 53  ? 0.6888 0.5454 0.3016 -0.0079 0.0968  0.0375  54  GLN A O   
396  C CB  . GLN A 53  ? 0.8723 0.6461 0.4091 0.0088  0.0914  0.0731  54  GLN A CB  
397  C CG  . GLN A 53  ? 1.1148 0.8454 0.6278 0.0121  0.0915  0.0898  54  GLN A CG  
398  C CD  . GLN A 53  ? 1.3324 1.0443 0.8352 -0.0042 0.1098  0.1025  54  GLN A CD  
399  O OE1 . GLN A 53  ? 1.3884 1.0832 0.9039 -0.0201 0.1188  0.1055  54  GLN A OE1 
400  N NE2 . GLN A 53  ? 1.3995 1.1152 0.8792 -0.0006 0.1151  0.1092  54  GLN A NE2 
401  N N   . PRO A 54  ? 0.7731 0.6021 0.3483 -0.0301 0.1268  0.0589  55  PRO A N   
402  C CA  . PRO A 54  ? 0.7924 0.6585 0.3798 -0.0349 0.1357  0.0476  55  PRO A CA  
403  C C   . PRO A 54  ? 0.7920 0.6739 0.3645 -0.0163 0.1258  0.0399  55  PRO A C   
404  O O   . PRO A 54  ? 0.7626 0.6256 0.3030 -0.0023 0.1177  0.0475  55  PRO A O   
405  C CB  . PRO A 54  ? 0.8408 0.7018 0.4136 -0.0514 0.1566  0.0588  55  PRO A CB  
406  C CG  . PRO A 54  ? 0.8954 0.7201 0.4655 -0.0611 0.1589  0.0716  55  PRO A CG  
407  C CD  . PRO A 54  ? 0.8513 0.6496 0.4061 -0.0427 0.1408  0.0756  55  PRO A CD  
408  N N   . TRP A 55  ? 0.7397 0.6569 0.3357 -0.0152 0.1261  0.0237  56  TRP A N   
409  C CA  . TRP A 55  ? 0.7003 0.6355 0.2872 0.0009  0.1174  0.0120  56  TRP A CA  
410  C C   . TRP A 55  ? 0.6792 0.6425 0.2636 -0.0041 0.1332  0.0050  56  TRP A C   
411  O O   . TRP A 55  ? 0.7040 0.6836 0.3105 -0.0184 0.1465  0.0028  56  TRP A O   
412  C CB  . TRP A 55  ? 0.6135 0.5623 0.2347 0.0104  0.0995  -0.0044 56  TRP A CB  
413  C CG  . TRP A 55  ? 0.6266 0.5971 0.2874 0.0016  0.1043  -0.0145 56  TRP A CG  
414  C CD1 . TRP A 55  ? 0.5915 0.5911 0.2670 0.0031  0.1098  -0.0282 56  TRP A CD1 
415  C CD2 . TRP A 55  ? 0.5236 0.4892 0.2126 -0.0079 0.1033  -0.0121 56  TRP A CD2 
416  N NE1 . TRP A 55  ? 0.5138 0.5272 0.2246 -0.0037 0.1117  -0.0336 56  TRP A NE1 
417  C CE2 . TRP A 55  ? 0.5016 0.4953 0.2208 -0.0110 0.1077  -0.0241 56  TRP A CE2 
418  C CE3 . TRP A 55  ? 0.5597 0.5005 0.2503 -0.0128 0.0988  -0.0017 56  TRP A CE3 
419  C CZ2 . TRP A 55  ? 0.4703 0.4692 0.2198 -0.0186 0.1071  -0.0255 56  TRP A CZ2 
420  C CZ3 . TRP A 55  ? 0.5642 0.5098 0.2855 -0.0216 0.0990  -0.0041 56  TRP A CZ3 
421  C CH2 . TRP A 55  ? 0.5049 0.4799 0.2546 -0.0244 0.1027  -0.0157 56  TRP A CH2 
422  N N   . SER A 56  ? 0.7120 0.6840 0.2703 0.0085  0.1313  0.0000  57  SER A N   
423  C CA  . SER A 56  ? 0.7475 0.7528 0.3110 0.0073  0.1423  -0.0109 57  SER A CA  
424  C C   . SER A 56  ? 0.6977 0.7244 0.2870 0.0188  0.1313  -0.0334 57  SER A C   
425  O O   . SER A 56  ? 0.7091 0.7267 0.3114 0.0279  0.1129  -0.0398 57  SER A O   
426  C CB  . SER A 56  ? 0.7027 0.7117 0.2341 0.0116  0.1444  -0.0053 57  SER A CB  
427  O OG  . SER A 56  ? 0.8150 0.8184 0.3336 0.0277  0.1259  -0.0140 57  SER A OG  
428  N N   . GLY A 57  ? 0.6421 0.6977 0.2439 0.0177  0.1420  -0.0455 58  GLY A N   
429  C CA  . GLY A 57  ? 0.6364 0.7107 0.2679 0.0281  0.1323  -0.0661 58  GLY A CA  
430  C C   . GLY A 57  ? 0.6826 0.7599 0.3550 0.0231  0.1276  -0.0691 58  GLY A C   
431  O O   . GLY A 57  ? 0.6628 0.7324 0.3451 0.0099  0.1330  -0.0570 58  GLY A O   
432  N N   . VAL A 58  ? 0.5762 0.6617 0.2721 0.0341  0.1169  -0.0856 59  VAL A N   
433  C CA  . VAL A 58  ? 0.5963 0.6846 0.3299 0.0328  0.1119  -0.0896 59  VAL A CA  
434  C C   . VAL A 58  ? 0.5920 0.6564 0.3339 0.0385  0.0938  -0.0907 59  VAL A C   
435  O O   . VAL A 58  ? 0.5937 0.6532 0.3295 0.0491  0.0840  -0.1020 59  VAL A O   
436  C CB  . VAL A 58  ? 0.5820 0.6965 0.3368 0.0417  0.1158  -0.1067 59  VAL A CB  
437  C CG1 . VAL A 58  ? 0.4859 0.6056 0.2757 0.0398  0.1133  -0.1070 59  VAL A CG1 
438  C CG2 . VAL A 58  ? 0.5075 0.6470 0.2525 0.0384  0.1327  -0.1079 59  VAL A CG2 
439  N N   . VAL A 59  ? 0.5357 0.5870 0.2925 0.0307  0.0901  -0.0804 60  VAL A N   
440  C CA  . VAL A 59  ? 0.5399 0.5721 0.3099 0.0345  0.0751  -0.0813 60  VAL A CA  
441  C C   . VAL A 59  ? 0.5269 0.5661 0.3273 0.0397  0.0721  -0.0915 60  VAL A C   
442  O O   . VAL A 59  ? 0.5672 0.6194 0.3846 0.0357  0.0788  -0.0893 60  VAL A O   
443  C CB  . VAL A 59  ? 0.5051 0.5193 0.2742 0.0250  0.0731  -0.0655 60  VAL A CB  
444  C CG1 . VAL A 59  ? 0.4601 0.4611 0.2508 0.0276  0.0606  -0.0672 60  VAL A CG1 
445  C CG2 . VAL A 59  ? 0.5217 0.5210 0.2581 0.0246  0.0721  -0.0555 60  VAL A CG2 
446  N N   . ASP A 60  ? 0.4530 0.4832 0.2596 0.0489  0.0621  -0.1028 61  ASP A N   
447  C CA  . ASP A 60  ? 0.4272 0.4561 0.2588 0.0551  0.0591  -0.1110 61  ASP A CA  
448  C C   . ASP A 60  ? 0.4929 0.5071 0.3402 0.0497  0.0535  -0.1009 61  ASP A C   
449  O O   . ASP A 60  ? 0.4643 0.4614 0.3105 0.0480  0.0448  -0.0991 61  ASP A O   
450  C CB  . ASP A 60  ? 0.4143 0.4341 0.2456 0.0647  0.0519  -0.1269 61  ASP A CB  
451  C CG  . ASP A 60  ? 0.6025 0.6386 0.4218 0.0727  0.0580  -0.1400 61  ASP A CG  
452  O OD1 . ASP A 60  ? 0.5601 0.6110 0.3900 0.0783  0.0656  -0.1446 61  ASP A OD1 
453  O OD2 . ASP A 60  ? 0.6491 0.6850 0.4480 0.0745  0.0550  -0.1463 61  ASP A OD2 
454  N N   . ALA A 61  ? 0.4383 0.4620 0.3005 0.0472  0.0584  -0.0955 62  ALA A N   
455  C CA  . ALA A 61  ? 0.4263 0.4381 0.3033 0.0440  0.0534  -0.0875 62  ALA A CA  
456  C C   . ALA A 61  ? 0.4253 0.4329 0.3193 0.0545  0.0507  -0.0944 62  ALA A C   
457  O O   . ALA A 61  ? 0.4366 0.4551 0.3434 0.0577  0.0532  -0.0924 62  ALA A O   
458  C CB  . ALA A 61  ? 0.4043 0.4280 0.2850 0.0344  0.0594  -0.0774 62  ALA A CB  
459  N N   . THR A 62  ? 0.3709 0.3621 0.2640 0.0602  0.0455  -0.1031 63  THR A N   
460  C CA  . THR A 62  ? 0.4089 0.3908 0.3131 0.0713  0.0447  -0.1112 63  THR A CA  
461  C C   . THR A 62  ? 0.4412 0.3965 0.3542 0.0702  0.0390  -0.1086 63  THR A C   
462  O O   . THR A 62  ? 0.4148 0.3551 0.3344 0.0788  0.0390  -0.1144 63  THR A O   
463  C CB  . THR A 62  ? 0.4607 0.4438 0.3572 0.0793  0.0457  -0.1269 63  THR A CB  
464  O OG1 . THR A 62  ? 0.5471 0.5192 0.4335 0.0736  0.0400  -0.1317 63  THR A OG1 
465  C CG2 . THR A 62  ? 0.4041 0.4162 0.2926 0.0819  0.0537  -0.1303 63  THR A CG2 
466  N N   . THR A 63  ? 0.4754 0.4232 0.3879 0.0601  0.0351  -0.1002 64  THR A N   
467  C CA  . THR A 63  ? 0.4469 0.3726 0.3686 0.0573  0.0313  -0.0977 64  THR A CA  
468  C C   . THR A 63  ? 0.4702 0.3970 0.3915 0.0475  0.0286  -0.0867 64  THR A C   
469  O O   . THR A 63  ? 0.4911 0.4294 0.4024 0.0429  0.0280  -0.0836 64  THR A O   
470  C CB  . THR A 63  ? 0.5425 0.4533 0.4647 0.0568  0.0278  -0.1109 64  THR A CB  
471  O OG1 . THR A 63  ? 0.5673 0.4550 0.5009 0.0554  0.0279  -0.1097 64  THR A OG1 
472  C CG2 . THR A 63  ? 0.5519 0.4690 0.4669 0.0490  0.0221  -0.1134 64  THR A CG2 
473  N N   . PHE A 64  ? 0.4236 0.3367 0.3545 0.0451  0.0277  -0.0805 65  PHE A N   
474  C CA  . PHE A 64  ? 0.4414 0.3546 0.3731 0.0371  0.0252  -0.0715 65  PHE A CA  
475  C C   . PHE A 64  ? 0.4823 0.3961 0.4097 0.0322  0.0198  -0.0770 65  PHE A C   
476  O O   . PHE A 64  ? 0.4179 0.3257 0.3484 0.0324  0.0172  -0.0880 65  PHE A O   
477  C CB  . PHE A 64  ? 0.4495 0.3481 0.3916 0.0360  0.0263  -0.0655 65  PHE A CB  
478  C CG  . PHE A 64  ? 0.4010 0.3017 0.3445 0.0419  0.0298  -0.0575 65  PHE A CG  
479  C CD1 . PHE A 64  ? 0.2941 0.2100 0.2346 0.0399  0.0301  -0.0504 65  PHE A CD1 
480  C CD2 . PHE A 64  ? 0.3947 0.2813 0.3417 0.0499  0.0327  -0.0575 65  PHE A CD2 
481  C CE1 . PHE A 64  ? 0.4191 0.3417 0.3618 0.0458  0.0319  -0.0452 65  PHE A CE1 
482  C CE2 . PHE A 64  ? 0.3719 0.2628 0.3185 0.0581  0.0344  -0.0503 65  PHE A CE2 
483  C CZ  . PHE A 64  ? 0.4117 0.3233 0.3571 0.0560  0.0334  -0.0449 65  PHE A CZ  
484  N N   . GLN A 65  ? 0.4585 0.3790 0.3782 0.0284  0.0177  -0.0701 66  GLN A N   
485  C CA  . GLN A 65  ? 0.3890 0.3117 0.3026 0.0267  0.0113  -0.0737 66  GLN A CA  
486  C C   . GLN A 65  ? 0.4423 0.3593 0.3690 0.0227  0.0078  -0.0726 66  GLN A C   
487  O O   . GLN A 65  ? 0.4008 0.3100 0.3394 0.0206  0.0114  -0.0688 66  GLN A O   
488  C CB  . GLN A 65  ? 0.4246 0.3536 0.3207 0.0263  0.0115  -0.0658 66  GLN A CB  
489  C CG  . GLN A 65  ? 0.5069 0.4433 0.3858 0.0299  0.0109  -0.0717 66  GLN A CG  
490  C CD  . GLN A 65  ? 0.5662 0.5044 0.4401 0.0327  0.0018  -0.0795 66  GLN A CD  
491  O OE1 . GLN A 65  ? 0.6083 0.5441 0.4946 0.0312  -0.0038 -0.0815 66  GLN A OE1 
492  N NE2 . GLN A 65  ? 0.5325 0.4777 0.3881 0.0372  0.0002  -0.0848 66  GLN A NE2 
493  N N   . SER A 66  ? 0.3949 0.3173 0.3184 0.0226  0.0009  -0.0758 67  SER A N   
494  C CA  . SER A 66  ? 0.4346 0.3574 0.3734 0.0191  -0.0027 -0.0785 67  SER A CA  
495  C C   . SER A 66  ? 0.4068 0.3252 0.3506 0.0169  0.0009  -0.0667 67  SER A C   
496  O O   . SER A 66  ? 0.4020 0.3184 0.3350 0.0182  0.0035  -0.0569 67  SER A O   
497  C CB  . SER A 66  ? 0.3766 0.3110 0.3100 0.0223  -0.0122 -0.0848 67  SER A CB  
498  O OG  . SER A 66  ? 0.4545 0.3951 0.3849 0.0240  -0.0165 -0.0984 67  SER A OG  
499  N N   . VAL A 67  ? 0.4127 0.3301 0.3734 0.0127  0.0017  -0.0689 68  VAL A N   
500  C CA  . VAL A 67  ? 0.4267 0.3425 0.3926 0.0111  0.0046  -0.0599 68  VAL A CA  
501  C C   . VAL A 67  ? 0.4331 0.3585 0.3965 0.0145  -0.0024 -0.0602 68  VAL A C   
502  O O   . VAL A 67  ? 0.3957 0.3319 0.3632 0.0160  -0.0093 -0.0697 68  VAL A O   
503  C CB  . VAL A 67  ? 0.4303 0.3409 0.4140 0.0050  0.0103  -0.0617 68  VAL A CB  
504  C CG1 . VAL A 67  ? 0.4343 0.3461 0.4227 0.0039  0.0135  -0.0539 68  VAL A CG1 
505  C CG2 . VAL A 67  ? 0.4398 0.3363 0.4220 0.0048  0.0170  -0.0595 68  VAL A CG2 
506  N N   . CYS A 68  ? 0.3465 0.2684 0.3025 0.0167  -0.0011 -0.0506 69  CYS A N   
507  C CA  . CYS A 68  ? 0.3705 0.2981 0.3235 0.0222  -0.0073 -0.0503 69  CYS A CA  
508  C C   . CYS A 68  ? 0.3880 0.3282 0.3625 0.0203  -0.0086 -0.0576 69  CYS A C   
509  O O   . CYS A 68  ? 0.4401 0.3789 0.4288 0.0135  -0.0016 -0.0577 69  CYS A O   
510  C CB  . CYS A 68  ? 0.3846 0.3021 0.3259 0.0242  -0.0045 -0.0398 69  CYS A CB  
511  S SG  . CYS A 68  ? 0.5042 0.4094 0.4218 0.0237  -0.0016 -0.0319 69  CYS A SG  
512  N N   . TYR A 69  ? 0.3834 0.3369 0.3599 0.0267  -0.0173 -0.0640 70  TYR A N   
513  C CA  . TYR A 69  ? 0.3806 0.3526 0.3806 0.0247  -0.0190 -0.0734 70  TYR A CA  
514  C C   . TYR A 69  ? 0.3615 0.3314 0.3713 0.0216  -0.0110 -0.0675 70  TYR A C   
515  O O   . TYR A 69  ? 0.3908 0.3514 0.3879 0.0273  -0.0101 -0.0586 70  TYR A O   
516  C CB  . TYR A 69  ? 0.3640 0.3528 0.3617 0.0362  -0.0310 -0.0797 70  TYR A CB  
517  C CG  . TYR A 69  ? 0.4361 0.4434 0.4428 0.0354  -0.0391 -0.0945 70  TYR A CG  
518  C CD1 . TYR A 69  ? 0.3604 0.3897 0.3962 0.0277  -0.0394 -0.1085 70  TYR A CD1 
519  C CD2 . TYR A 69  ? 0.4612 0.4648 0.4471 0.0413  -0.0458 -0.0955 70  TYR A CD2 
520  C CE1 . TYR A 69  ? 0.3670 0.4146 0.4122 0.0257  -0.0473 -0.1248 70  TYR A CE1 
521  C CE2 . TYR A 69  ? 0.4321 0.4536 0.4247 0.0411  -0.0539 -0.1108 70  TYR A CE2 
522  C CZ  . TYR A 69  ? 0.4389 0.4825 0.4617 0.0332  -0.0553 -0.1262 70  TYR A CZ  
523  O OH  . TYR A 69  ? 0.5502 0.6130 0.5803 0.0321  -0.0641 -0.1439 70  TYR A OH  
524  N N   . GLN A 70  ? 0.3096 0.2871 0.3409 0.0121  -0.0043 -0.0728 71  GLN A N   
525  C CA  . GLN A 70  ? 0.3656 0.3409 0.4042 0.0084  0.0052  -0.0668 71  GLN A CA  
526  C C   . GLN A 70  ? 0.3683 0.3578 0.4330 -0.0022 0.0116  -0.0754 71  GLN A C   
527  O O   . GLN A 70  ? 0.3847 0.3773 0.4604 -0.0100 0.0113  -0.0845 71  GLN A O   
528  C CB  . GLN A 70  ? 0.3500 0.3033 0.3748 0.0054  0.0133  -0.0552 71  GLN A CB  
529  C CG  . GLN A 70  ? 0.3715 0.3138 0.3980 -0.0020 0.0176  -0.0565 71  GLN A CG  
530  C CD  . GLN A 70  ? 0.4020 0.3262 0.4132 -0.0009 0.0231  -0.0454 71  GLN A CD  
531  O OE1 . GLN A 70  ? 0.4634 0.3791 0.4770 -0.0048 0.0319  -0.0400 71  GLN A OE1 
532  N NE2 . GLN A 70  ? 0.3875 0.3071 0.3824 0.0047  0.0182  -0.0420 71  GLN A NE2 
533  N N   . TYR A 71  ? 0.3856 0.3834 0.4601 -0.0033 0.0184  -0.0733 72  TYR A N   
534  C CA  . TYR A 71  ? 0.4608 0.4689 0.5584 -0.0159 0.0288  -0.0787 72  TYR A CA  
535  C C   . TYR A 71  ? 0.4569 0.4399 0.5489 -0.0260 0.0395  -0.0716 72  TYR A C   
536  O O   . TYR A 71  ? 0.4987 0.4609 0.5702 -0.0215 0.0417  -0.0597 72  TYR A O   
537  C CB  . TYR A 71  ? 0.4410 0.4615 0.5457 -0.0138 0.0357  -0.0759 72  TYR A CB  
538  C CG  . TYR A 71  ? 0.4183 0.4453 0.5425 -0.0282 0.0506  -0.0778 72  TYR A CG  
539  C CD1 . TYR A 71  ? 0.4252 0.4792 0.5787 -0.0373 0.0517  -0.0924 72  TYR A CD1 
540  C CD2 . TYR A 71  ? 0.4484 0.4552 0.5615 -0.0330 0.0640  -0.0650 72  TYR A CD2 
541  C CE1 . TYR A 71  ? 0.5022 0.5611 0.6742 -0.0532 0.0676  -0.0940 72  TYR A CE1 
542  C CE2 . TYR A 71  ? 0.5184 0.5276 0.6460 -0.0467 0.0795  -0.0648 72  TYR A CE2 
543  C CZ  . TYR A 71  ? 0.5534 0.5877 0.7109 -0.0578 0.0822  -0.0791 72  TYR A CZ  
544  O OH  . TYR A 71  ? 0.6164 0.6521 0.7890 -0.0739 0.0998  -0.0787 72  TYR A OH  
545  N N   . VAL A 72  ? 0.4449 0.4296 0.5553 -0.0393 0.0459  -0.0796 73  VAL A N   
546  C CA  . VAL A 72  ? 0.5229 0.4798 0.6277 -0.0481 0.0565  -0.0733 73  VAL A CA  
547  C C   . VAL A 72  ? 0.5500 0.5056 0.6674 -0.0600 0.0728  -0.0698 73  VAL A C   
548  O O   . VAL A 72  ? 0.5894 0.5670 0.7319 -0.0703 0.0764  -0.0813 73  VAL A O   
549  C CB  . VAL A 72  ? 0.5839 0.5350 0.6952 -0.0544 0.0520  -0.0851 73  VAL A CB  
550  C CG1 . VAL A 72  ? 0.6794 0.6568 0.8195 -0.0651 0.0503  -0.1032 73  VAL A CG1 
551  C CG2 . VAL A 72  ? 0.5733 0.5239 0.6674 -0.0418 0.0380  -0.0862 73  VAL A CG2 
552  N N   . ASP A 73  ? 0.5104 0.4425 0.6101 -0.0584 0.0829  -0.0542 74  ASP A N   
553  C CA  . ASP A 73  ? 0.4758 0.4059 0.5807 -0.0671 0.0993  -0.0475 74  ASP A CA  
554  C C   . ASP A 73  ? 0.5173 0.4330 0.6367 -0.0848 0.1121  -0.0516 74  ASP A C   
555  O O   . ASP A 73  ? 0.6072 0.4960 0.7185 -0.0867 0.1123  -0.0504 74  ASP A O   
556  C CB  . ASP A 73  ? 0.6393 0.5484 0.7169 -0.0579 0.1049  -0.0294 74  ASP A CB  
557  C CG  . ASP A 73  ? 0.8431 0.7468 0.9205 -0.0658 0.1231  -0.0204 74  ASP A CG  
558  O OD1 . ASP A 73  ? 0.9194 0.7933 0.9826 -0.0686 0.1338  -0.0090 74  ASP A OD1 
559  O OD2 . ASP A 73  ? 0.9324 0.8613 1.0226 -0.0684 0.1273  -0.0245 74  ASP A OD2 
560  N N   . THR A 74  ? 0.5950 0.5280 0.7362 -0.0984 0.1238  -0.0570 75  THR A N   
561  C CA  . THR A 74  ? 0.6913 0.6131 0.8507 -0.1192 0.1377  -0.0631 75  THR A CA  
562  C C   . THR A 74  ? 0.7153 0.6279 0.8736 -0.1298 0.1597  -0.0513 75  THR A C   
563  O O   . THR A 74  ? 0.7346 0.6501 0.9152 -0.1502 0.1738  -0.0586 75  THR A O   
564  C CB  . THR A 74  ? 0.7417 0.6995 0.9362 -0.1304 0.1312  -0.0865 75  THR A CB  
565  O OG1 . THR A 74  ? 0.7406 0.7393 0.9508 -0.1269 0.1295  -0.0918 75  THR A OG1 
566  C CG2 . THR A 74  ? 0.7550 0.7177 0.9472 -0.1207 0.1108  -0.0979 75  THR A CG2 
567  N N   . LEU A 75  ? 0.6885 0.5899 0.8203 -0.1171 0.1637  -0.0335 76  LEU A N   
568  C CA  . LEU A 75  ? 0.7001 0.5969 0.8278 -0.1253 0.1844  -0.0220 76  LEU A CA  
569  C C   . LEU A 75  ? 0.7064 0.5601 0.8250 -0.1390 0.2026  -0.0117 76  LEU A C   
570  O O   . LEU A 75  ? 0.7782 0.6319 0.9118 -0.1583 0.2219  -0.0125 76  LEU A O   
571  C CB  . LEU A 75  ? 0.7579 0.6544 0.8571 -0.1068 0.1824  -0.0070 76  LEU A CB  
572  C CG  . LEU A 75  ? 0.8663 0.7655 0.9586 -0.1118 0.2024  0.0040  76  LEU A CG  
573  C CD1 . LEU A 75  ? 1.0105 0.8660 1.0803 -0.1175 0.2190  0.0215  76  LEU A CD1 
574  C CD2 . LEU A 75  ? 0.8211 0.7536 0.9485 -0.1298 0.2139  -0.0095 76  LEU A CD2 
575  N N   . TYR A 76  ? 0.6867 0.5024 0.7806 -0.1292 0.1977  -0.0020 77  TYR A N   
576  C CA  . TYR A 76  ? 0.7731 0.5434 0.8554 -0.1381 0.2117  0.0071  77  TYR A CA  
577  C C   . TYR A 76  ? 0.8188 0.5744 0.9067 -0.1372 0.1989  -0.0048 77  TYR A C   
578  O O   . TYR A 76  ? 0.7754 0.5078 0.8406 -0.1211 0.1902  0.0029  77  TYR A O   
579  C CB  . TYR A 76  ? 0.7899 0.5284 0.8319 -0.1217 0.2171  0.0312  77  TYR A CB  
580  C CG  . TYR A 76  ? 0.8449 0.5957 0.8758 -0.1207 0.2297  0.0435  77  TYR A CG  
581  C CD1 . TYR A 76  ? 0.8902 0.6446 0.8963 -0.1030 0.2264  0.0561  77  TYR A CD1 
582  C CD2 . TYR A 76  ? 0.8562 0.6170 0.9012 -0.1374 0.2445  0.0413  77  TYR A CD2 
583  C CE1 . TYR A 76  ? 0.9525 0.7195 0.9464 -0.1008 0.2373  0.0659  77  TYR A CE1 
584  C CE2 . TYR A 76  ? 0.9202 0.6936 0.9541 -0.1358 0.2559  0.0518  77  TYR A CE2 
585  C CZ  . TYR A 76  ? 0.9484 0.7250 0.9563 -0.1170 0.2520  0.0638  77  TYR A CZ  
586  O OH  . TYR A 76  ? 0.9372 0.7277 0.9325 -0.1144 0.2626  0.0727  77  TYR A OH  
587  N N   . PRO A 77  ? 0.8697 0.6413 0.9874 -0.1533 0.1967  -0.0247 78  PRO A N   
588  C CA  . PRO A 77  ? 0.8398 0.6033 0.9631 -0.1516 0.1831  -0.0387 78  PRO A CA  
589  C C   . PRO A 77  ? 0.8392 0.5570 0.9377 -0.1452 0.1863  -0.0279 78  PRO A C   
590  O O   . PRO A 77  ? 0.8412 0.5375 0.9332 -0.1531 0.2001  -0.0195 78  PRO A O   
591  C CB  . PRO A 77  ? 0.8436 0.6379 1.0034 -0.1711 0.1822  -0.0619 78  PRO A CB  
592  C CG  . PRO A 77  ? 0.8710 0.6995 1.0483 -0.1798 0.1915  -0.0620 78  PRO A CG  
593  C CD  . PRO A 77  ? 0.8925 0.6950 1.0404 -0.1725 0.2056  -0.0369 78  PRO A CD  
594  N N   . GLY A 78  ? 0.8548 0.5584 0.9395 -0.1304 0.1736  -0.0287 79  GLY A N   
595  C CA  . GLY A 78  ? 0.9220 0.5854 0.9834 -0.1208 0.1746  -0.0193 79  GLY A CA  
596  C C   . GLY A 78  ? 0.9604 0.5996 0.9892 -0.1042 0.1805  0.0050  79  GLY A C   
597  O O   . GLY A 78  ? 1.0036 0.6104 1.0121 -0.0937 0.1809  0.0136  79  GLY A O   
598  N N   . PHE A 79  ? 0.9288 0.5841 0.9518 -0.1007 0.1845  0.0154  80  PHE A N   
599  C CA  . PHE A 79  ? 0.8277 0.4652 0.8185 -0.0838 0.1886  0.0375  80  PHE A CA  
600  C C   . PHE A 79  ? 0.7554 0.3948 0.7307 -0.0624 0.1741  0.0406  80  PHE A C   
601  O O   . PHE A 79  ? 0.7329 0.3983 0.7198 -0.0613 0.1645  0.0314  80  PHE A O   
602  C CB  . PHE A 79  ? 0.7989 0.4554 0.7895 -0.0891 0.1991  0.0459  80  PHE A CB  
603  C CG  . PHE A 79  ? 0.7540 0.3979 0.7108 -0.0710 0.2020  0.0671  80  PHE A CG  
604  C CD1 . PHE A 79  ? 0.7431 0.3537 0.6756 -0.0637 0.2088  0.0811  80  PHE A CD1 
605  C CD2 . PHE A 79  ? 0.6918 0.3579 0.6405 -0.0611 0.1978  0.0722  80  PHE A CD2 
606  C CE1 . PHE A 79  ? 0.7791 0.3816 0.6799 -0.0457 0.2100  0.0994  80  PHE A CE1 
607  C CE2 . PHE A 79  ? 0.7039 0.3623 0.6210 -0.0440 0.1992  0.0899  80  PHE A CE2 
608  C CZ  . PHE A 79  ? 0.7345 0.3625 0.6278 -0.0358 0.2047  0.1032  80  PHE A CZ  
609  N N   . GLU A 80  ? 0.7994 0.4130 0.7487 -0.0449 0.1719  0.0527  81  GLU A N   
610  C CA  . GLU A 80  ? 0.8052 0.4226 0.7409 -0.0241 0.1581  0.0544  81  GLU A CA  
611  C C   . GLU A 80  ? 0.7904 0.4345 0.7202 -0.0165 0.1535  0.0598  81  GLU A C   
612  O O   . GLU A 80  ? 0.7266 0.3987 0.6614 -0.0080 0.1376  0.0511  81  GLU A O   
613  C CB  . GLU A 80  ? 1.0365 0.6262 0.9455 -0.0056 0.1578  0.0676  81  GLU A CB  
614  C CG  . GLU A 80  ? 1.2715 0.8636 1.1741 0.0130  0.1436  0.0633  81  GLU A CG  
615  C CD  . GLU A 80  ? 1.4842 1.0854 1.4099 0.0039  0.1362  0.0431  81  GLU A CD  
616  O OE1 . GLU A 80  ? 1.5778 1.1995 1.5071 0.0113  0.1256  0.0360  81  GLU A OE1 
617  O OE2 . GLU A 80  ? 1.5703 1.1589 1.5096 -0.0106 0.1408  0.0337  81  GLU A OE2 
618  N N   . GLY A 81  ? 0.8075 0.4535 0.7276 -0.0191 0.1642  0.0720  82  GLY A N   
619  C CA  . GLY A 81  ? 0.7387 0.4193 0.6532 -0.0105 0.1562  0.0742  82  GLY A CA  
620  C C   . GLY A 81  ? 0.7079 0.4285 0.6486 -0.0195 0.1461  0.0571  82  GLY A C   
621  O O   . GLY A 81  ? 0.8311 0.5780 0.7685 -0.0099 0.1342  0.0548  82  GLY A O   
622  N N   . THR A 82  ? 0.7184 0.4438 0.6850 -0.0378 0.1507  0.0448  83  THR A N   
623  C CA  . THR A 82  ? 0.7371 0.4989 0.7276 -0.0437 0.1393  0.0279  83  THR A CA  
624  C C   . THR A 82  ? 0.6752 0.4392 0.6716 -0.0390 0.1249  0.0163  83  THR A C   
625  O O   . THR A 82  ? 0.6530 0.4421 0.6523 -0.0323 0.1113  0.0095  83  THR A O   
626  C CB  . THR A 82  ? 0.8454 0.6188 0.8630 -0.0640 0.1488  0.0174  83  THR A CB  
627  O OG1 . THR A 82  ? 1.0818 0.8246 1.1053 -0.0764 0.1595  0.0157  83  THR A OG1 
628  C CG2 . THR A 82  ? 0.8130 0.5986 0.8299 -0.0687 0.1609  0.0247  83  THR A CG2 
629  N N   . GLU A 83  ? 0.6296 0.3661 0.6273 -0.0430 0.1288  0.0135  84  GLU A N   
630  C CA  . GLU A 83  ? 0.7202 0.4612 0.7272 -0.0419 0.1169  -0.0010 84  GLU A CA  
631  C C   . GLU A 83  ? 0.7054 0.4535 0.6964 -0.0236 0.1041  0.0020  84  GLU A C   
632  O O   . GLU A 83  ? 0.6609 0.4274 0.6591 -0.0216 0.0922  -0.0095 84  GLU A O   
633  C CB  . GLU A 83  ? 0.7097 0.4163 0.7199 -0.0497 0.1250  -0.0054 84  GLU A CB  
634  C CG  . GLU A 83  ? 0.8165 0.5189 0.8485 -0.0723 0.1375  -0.0134 84  GLU A CG  
635  C CD  . GLU A 83  ? 0.9316 0.6762 0.9904 -0.0830 0.1294  -0.0306 84  GLU A CD  
636  O OE1 . GLU A 83  ? 0.9105 0.6801 0.9710 -0.0740 0.1135  -0.0390 84  GLU A OE1 
637  O OE2 . GLU A 83  ? 0.9843 0.7377 1.0623 -0.1001 0.1397  -0.0355 84  GLU A OE2 
638  N N   . MET A 84  ? 0.6163 0.3527 0.5857 -0.0101 0.1063  0.0169  85  MET A N   
639  C CA  . MET A 84  ? 0.5073 0.2536 0.4642 0.0062  0.0948  0.0184  85  MET A CA  
640  C C   . MET A 84  ? 0.4932 0.2744 0.4559 0.0068  0.0838  0.0123  85  MET A C   
641  O O   . MET A 84  ? 0.5119 0.3047 0.4700 0.0156  0.0743  0.0092  85  MET A O   
642  C CB  . MET A 84  ? 0.5815 0.3138 0.5152 0.0209  0.0985  0.0347  85  MET A CB  
643  C CG  . MET A 84  ? 0.6849 0.4262 0.6111 0.0196  0.1041  0.0447  85  MET A CG  
644  S SD  . MET A 84  ? 0.7461 0.4725 0.6413 0.0394  0.1069  0.0632  85  MET A SD  
645  C CE  . MET A 84  ? 0.5701 0.3269 0.4632 0.0539  0.0894  0.0565  85  MET A CE  
646  N N   . TRP A 85  ? 0.4570 0.2544 0.4296 -0.0023 0.0857  0.0104  86  TRP A N   
647  C CA  . TRP A 85  ? 0.4730 0.2983 0.4497 -0.0012 0.0761  0.0049  86  TRP A CA  
648  C C   . TRP A 85  ? 0.4976 0.3372 0.4919 -0.0094 0.0700  -0.0090 86  TRP A C   
649  O O   . TRP A 85  ? 0.4821 0.3409 0.4778 -0.0073 0.0618  -0.0132 86  TRP A O   
650  C CB  . TRP A 85  ? 0.4435 0.2792 0.4173 -0.0022 0.0808  0.0112  86  TRP A CB  
651  C CG  . TRP A 85  ? 0.5545 0.3779 0.5090 0.0063  0.0869  0.0248  86  TRP A CG  
652  C CD1 . TRP A 85  ? 0.5145 0.3229 0.4629 0.0033  0.0999  0.0343  86  TRP A CD1 
653  C CD2 . TRP A 85  ? 0.5614 0.3880 0.4991 0.0195  0.0804  0.0301  86  TRP A CD2 
654  N NE1 . TRP A 85  ? 0.5426 0.3434 0.4685 0.0159  0.1010  0.0463  86  TRP A NE1 
655  C CE2 . TRP A 85  ? 0.5886 0.4025 0.5092 0.0260  0.0884  0.0429  86  TRP A CE2 
656  C CE3 . TRP A 85  ? 0.4679 0.3084 0.4036 0.0259  0.0692  0.0250  86  TRP A CE3 
657  C CZ2 . TRP A 85  ? 0.5225 0.3399 0.4248 0.0403  0.0835  0.0494  86  TRP A CZ2 
658  C CZ3 . TRP A 85  ? 0.5169 0.3618 0.4375 0.0377  0.0655  0.0306  86  TRP A CZ3 
659  C CH2 . TRP A 85  ? 0.5170 0.3518 0.4216 0.0455  0.0716  0.0421  86  TRP A CH2 
660  N N   . ASN A 86  ? 0.4163 0.2463 0.4230 -0.0182 0.0737  -0.0166 87  ASN A N   
661  C CA  . ASN A 86  ? 0.4978 0.3442 0.5215 -0.0255 0.0673  -0.0313 87  ASN A CA  
662  C C   . ASN A 86  ? 0.4856 0.3331 0.5043 -0.0197 0.0573  -0.0388 87  ASN A C   
663  O O   . ASN A 86  ? 0.4362 0.2680 0.4432 -0.0128 0.0580  -0.0348 87  ASN A O   
664  C CB  . ASN A 86  ? 0.5094 0.3479 0.5508 -0.0398 0.0761  -0.0385 87  ASN A CB  
665  C CG  . ASN A 86  ? 0.5996 0.4499 0.6525 -0.0482 0.0846  -0.0362 87  ASN A CG  
666  O OD1 . ASN A 86  ? 0.6361 0.5073 0.6886 -0.0433 0.0803  -0.0344 87  ASN A OD1 
667  N ND2 . ASN A 86  ? 0.5622 0.3988 0.6258 -0.0613 0.0977  -0.0368 87  ASN A ND2 
668  N N   . PRO A 87  ? 0.5035 0.3707 0.5297 -0.0208 0.0480  -0.0496 88  PRO A N   
669  C CA  . PRO A 87  ? 0.4947 0.3643 0.5130 -0.0148 0.0393  -0.0560 88  PRO A CA  
670  C C   . PRO A 87  ? 0.4884 0.3395 0.5080 -0.0169 0.0425  -0.0626 88  PRO A C   
671  O O   . PRO A 87  ? 0.4672 0.3101 0.5003 -0.0269 0.0475  -0.0701 88  PRO A O   
672  C CB  . PRO A 87  ? 0.4395 0.3317 0.4659 -0.0164 0.0300  -0.0667 88  PRO A CB  
673  C CG  . PRO A 87  ? 0.5251 0.4281 0.5679 -0.0237 0.0338  -0.0680 88  PRO A CG  
674  C CD  . PRO A 87  ? 0.5111 0.4009 0.5491 -0.0242 0.0443  -0.0545 88  PRO A CD  
675  N N   . ASN A 88  ? 0.4382 0.2824 0.4441 -0.0077 0.0404  -0.0604 89  ASN A N   
676  C CA  . ASN A 88  ? 0.5230 0.3500 0.5277 -0.0063 0.0422  -0.0679 89  ASN A CA  
677  C C   . ASN A 88  ? 0.5461 0.3869 0.5471 -0.0029 0.0333  -0.0800 89  ASN A C   
678  O O   . ASN A 88  ? 0.5622 0.3926 0.5577 0.0021  0.0336  -0.0861 89  ASN A O   
679  C CB  . ASN A 88  ? 0.5425 0.3518 0.5344 0.0042  0.0474  -0.0569 89  ASN A CB  
680  C CG  . ASN A 88  ? 0.5594 0.3856 0.5394 0.0144  0.0420  -0.0510 89  ASN A CG  
681  O OD1 . ASN A 88  ? 0.4983 0.3443 0.4777 0.0125  0.0367  -0.0505 89  ASN A OD1 
682  N ND2 . ASN A 88  ? 0.5873 0.4058 0.5581 0.0252  0.0437  -0.0470 89  ASN A ND2 
683  N N   . ARG A 89  ? 0.4773 0.3405 0.4787 -0.0039 0.0256  -0.0830 90  ARG A N   
684  C CA  . ARG A 89  ? 0.5328 0.4100 0.5292 -0.0013 0.0171  -0.0944 90  ARG A CA  
685  C C   . ARG A 89  ? 0.5237 0.4189 0.5309 -0.0069 0.0105  -0.1022 90  ARG A C   
686  O O   . ARG A 89  ? 0.5134 0.4130 0.5305 -0.0113 0.0127  -0.0970 90  ARG A O   
687  C CB  . ARG A 89  ? 0.5519 0.4386 0.5304 0.0077  0.0139  -0.0869 90  ARG A CB  
688  C CG  . ARG A 89  ? 0.5718 0.4492 0.5414 0.0147  0.0187  -0.0831 90  ARG A CG  
689  C CD  . ARG A 89  ? 0.5687 0.4414 0.5366 0.0171  0.0177  -0.0970 90  ARG A CD  
690  N NE  . ARG A 89  ? 0.6393 0.5080 0.5983 0.0263  0.0216  -0.0947 90  ARG A NE  
691  C CZ  . ARG A 89  ? 0.7089 0.5604 0.6705 0.0309  0.0276  -0.0906 90  ARG A CZ  
692  N NH1 . ARG A 89  ? 0.6291 0.4624 0.5997 0.0257  0.0318  -0.0868 90  ARG A NH1 
693  N NH2 . ARG A 89  ? 0.7927 0.6459 0.7472 0.0413  0.0299  -0.0901 90  ARG A NH2 
694  N N   . GLU A 90  ? 0.4833 0.3911 0.4882 -0.0055 0.0022  -0.1156 91  GLU A N   
695  C CA  . GLU A 90  ? 0.5202 0.4498 0.5339 -0.0076 -0.0064 -0.1239 91  GLU A CA  
696  C C   . GLU A 90  ? 0.4408 0.3804 0.4449 -0.0007 -0.0097 -0.1109 91  GLU A C   
697  O O   . GLU A 90  ? 0.3897 0.3230 0.3757 0.0058  -0.0083 -0.0993 91  GLU A O   
698  C CB  . GLU A 90  ? 0.5698 0.5124 0.5775 -0.0043 -0.0161 -0.1400 91  GLU A CB  
699  C CG  . GLU A 90  ? 0.7675 0.7168 0.7492 0.0076  -0.0218 -0.1337 91  GLU A CG  
700  C CD  . GLU A 90  ? 1.0416 1.0078 1.0152 0.0123  -0.0327 -0.1492 91  GLU A CD  
701  O OE1 . GLU A 90  ? 1.1757 1.1403 1.1561 0.0080  -0.0333 -0.1654 91  GLU A OE1 
702  O OE2 . GLU A 90  ? 1.1126 1.0924 1.0714 0.0209  -0.0407 -0.1454 91  GLU A OE2 
703  N N   . LEU A 91  ? 0.3472 0.3022 0.3648 -0.0028 -0.0134 -0.1139 92  LEU A N   
704  C CA  . LEU A 91  ? 0.3575 0.3210 0.3661 0.0052  -0.0177 -0.1040 92  LEU A CA  
705  C C   . LEU A 91  ? 0.4603 0.4347 0.4506 0.0158  -0.0289 -0.1072 92  LEU A C   
706  O O   . LEU A 91  ? 0.3754 0.3633 0.3688 0.0164  -0.0366 -0.1217 92  LEU A O   
707  C CB  . LEU A 91  ? 0.3703 0.3489 0.4000 0.0015  -0.0179 -0.1073 92  LEU A CB  
708  C CG  . LEU A 91  ? 0.4567 0.4260 0.5044 -0.0100 -0.0057 -0.1047 92  LEU A CG  
709  C CD1 . LEU A 91  ? 0.3304 0.3186 0.3971 -0.0124 -0.0052 -0.1073 92  LEU A CD1 
710  C CD2 . LEU A 91  ? 0.4364 0.3832 0.4694 -0.0083 0.0030  -0.0883 92  LEU A CD2 
711  N N   . SER A 92  ? 0.4425 0.4101 0.4123 0.0238  -0.0294 -0.0939 93  SER A N   
712  C CA  . SER A 92  ? 0.3981 0.3709 0.3454 0.0347  -0.0383 -0.0932 93  SER A CA  
713  C C   . SER A 92  ? 0.4371 0.3990 0.3678 0.0413  -0.0369 -0.0776 93  SER A C   
714  O O   . SER A 92  ? 0.4550 0.4029 0.3852 0.0366  -0.0282 -0.0675 93  SER A O   
715  C CB  . SER A 92  ? 0.3947 0.3615 0.3247 0.0354  -0.0370 -0.0952 93  SER A CB  
716  O OG  . SER A 92  ? 0.4240 0.3920 0.3270 0.0459  -0.0429 -0.0905 93  SER A OG  
717  N N   . GLU A 93  ? 0.4506 0.4180 0.3665 0.0530  -0.0460 -0.0763 94  GLU A N   
718  C CA  . GLU A 93  ? 0.5003 0.4505 0.3949 0.0595  -0.0440 -0.0613 94  GLU A CA  
719  C C   . GLU A 93  ? 0.5248 0.4580 0.3951 0.0570  -0.0371 -0.0519 94  GLU A C   
720  O O   . GLU A 93  ? 0.5483 0.4637 0.4062 0.0556  -0.0306 -0.0397 94  GLU A O   
721  C CB  . GLU A 93  ? 0.4679 0.4245 0.3498 0.0749  -0.0553 -0.0612 94  GLU A CB  
722  C CG  . GLU A 93  ? 0.4859 0.4585 0.3914 0.0787  -0.0601 -0.0674 94  GLU A CG  
723  C CD  . GLU A 93  ? 0.5411 0.5194 0.4325 0.0976  -0.0719 -0.0664 94  GLU A CD  
724  O OE1 . GLU A 93  ? 0.5194 0.4778 0.3951 0.1053  -0.0699 -0.0543 94  GLU A OE1 
725  O OE2 . GLU A 93  ? 0.5900 0.5925 0.4854 0.1055  -0.0835 -0.0784 94  GLU A OE2 
726  N N   . ASP A 94  ? 0.4748 0.4143 0.3391 0.0557  -0.0378 -0.0588 95  ASP A N   
727  C CA  . ASP A 94  ? 0.5263 0.4553 0.3717 0.0523  -0.0297 -0.0523 95  ASP A CA  
728  C C   . ASP A 94  ? 0.5182 0.4442 0.3820 0.0413  -0.0201 -0.0526 95  ASP A C   
729  O O   . ASP A 94  ? 0.4685 0.4013 0.3435 0.0377  -0.0189 -0.0621 95  ASP A O   
730  C CB  . ASP A 94  ? 0.4606 0.3999 0.2920 0.0573  -0.0346 -0.0612 95  ASP A CB  
731  C CG  . ASP A 94  ? 0.5435 0.4763 0.3579 0.0534  -0.0250 -0.0566 95  ASP A CG  
732  O OD1 . ASP A 94  ? 0.6139 0.5562 0.4197 0.0562  -0.0271 -0.0658 95  ASP A OD1 
733  O OD2 . ASP A 94  ? 0.5918 0.5124 0.4025 0.0473  -0.0152 -0.0453 95  ASP A OD2 
734  N N   . CYS A 95  ? 0.4419 0.3568 0.3075 0.0369  -0.0137 -0.0424 96  CYS A N   
735  C CA  . CYS A 95  ? 0.4602 0.3742 0.3432 0.0290  -0.0063 -0.0422 96  CYS A CA  
736  C C   . CYS A 95  ? 0.4320 0.3369 0.3065 0.0240  0.0019  -0.0322 96  CYS A C   
737  O O   . CYS A 95  ? 0.4290 0.3345 0.3166 0.0192  0.0068  -0.0312 96  CYS A O   
738  C CB  . CYS A 95  ? 0.4549 0.3711 0.3588 0.0275  -0.0080 -0.0443 96  CYS A CB  
739  S SG  . CYS A 95  ? 0.4909 0.3988 0.3890 0.0312  -0.0097 -0.0355 96  CYS A SG  
740  N N   . LEU A 96  ? 0.3767 0.2734 0.2294 0.0246  0.0041  -0.0250 97  LEU A N   
741  C CA  . LEU A 96  ? 0.3932 0.2816 0.2400 0.0172  0.0125  -0.0170 97  LEU A CA  
742  C C   . LEU A 96  ? 0.4564 0.3544 0.3016 0.0123  0.0198  -0.0190 97  LEU A C   
743  O O   . LEU A 96  ? 0.4439 0.3399 0.2709 0.0106  0.0245  -0.0155 97  LEU A O   
744  C CB  . LEU A 96  ? 0.4110 0.2815 0.2355 0.0188  0.0130  -0.0077 97  LEU A CB  
745  C CG  . LEU A 96  ? 0.5077 0.3688 0.3364 0.0243  0.0070  -0.0059 97  LEU A CG  
746  C CD1 . LEU A 96  ? 0.4387 0.2761 0.2446 0.0264  0.0088  0.0039  97  LEU A CD1 
747  C CD2 . LEU A 96  ? 0.4316 0.2978 0.2826 0.0191  0.0090  -0.0086 97  LEU A CD2 
748  N N   . TYR A 97  ? 0.4335 0.3423 0.2976 0.0107  0.0213  -0.0245 98  TYR A N   
749  C CA  . TYR A 97  ? 0.4117 0.3330 0.2789 0.0086  0.0275  -0.0281 98  TYR A CA  
750  C C   . TYR A 97  ? 0.4806 0.4081 0.3633 0.0049  0.0309  -0.0275 98  TYR A C   
751  O O   . TYR A 97  ? 0.4406 0.3634 0.3335 0.0057  0.0277  -0.0263 98  TYR A O   
752  C CB  . TYR A 97  ? 0.3155 0.2440 0.1881 0.0150  0.0243  -0.0379 98  TYR A CB  
753  C CG  . TYR A 97  ? 0.4559 0.3823 0.3135 0.0197  0.0191  -0.0410 98  TYR A CG  
754  C CD1 . TYR A 97  ? 0.4011 0.3226 0.2617 0.0235  0.0105  -0.0433 98  TYR A CD1 
755  C CD2 . TYR A 97  ? 0.5020 0.4340 0.3423 0.0210  0.0228  -0.0424 98  TYR A CD2 
756  C CE1 . TYR A 97  ? 0.3985 0.3219 0.2455 0.0293  0.0040  -0.0474 98  TYR A CE1 
757  C CE2 . TYR A 97  ? 0.4314 0.3628 0.2549 0.0270  0.0171  -0.0456 98  TYR A CE2 
758  C CZ  . TYR A 97  ? 0.4800 0.4075 0.3071 0.0316  0.0069  -0.0483 98  TYR A CZ  
759  O OH  . TYR A 97  ? 0.5306 0.4611 0.3414 0.0389  -0.0004 -0.0526 98  TYR A OH  
760  N N   . LEU A 98  ? 0.4229 0.3638 0.3071 0.0014  0.0375  -0.0289 99  LEU A N   
761  C CA  . LEU A 98  ? 0.4073 0.3596 0.3060 -0.0001 0.0395  -0.0299 99  LEU A CA  
762  C C   . LEU A 98  ? 0.4538 0.4233 0.3608 0.0059  0.0418  -0.0367 99  LEU A C   
763  O O   . LEU A 98  ? 0.4007 0.3739 0.3015 0.0093  0.0435  -0.0411 99  LEU A O   
764  C CB  . LEU A 98  ? 0.4508 0.4066 0.3470 -0.0109 0.0450  -0.0263 99  LEU A CB  
765  C CG  . LEU A 98  ? 0.4271 0.3892 0.3127 -0.0194 0.0535  -0.0256 99  LEU A CG  
766  C CD1 . LEU A 98  ? 0.4017 0.3917 0.2990 -0.0196 0.0589  -0.0326 99  LEU A CD1 
767  C CD2 . LEU A 98  ? 0.4073 0.3576 0.2861 -0.0315 0.0577  -0.0202 99  LEU A CD2 
768  N N   . ASN A 99  ? 0.3900 0.3707 0.3100 0.0089  0.0416  -0.0380 100 ASN A N   
769  C CA  . ASN A 99  ? 0.4031 0.3978 0.3322 0.0187  0.0422  -0.0440 100 ASN A CA  
770  C C   . ASN A 99  ? 0.3969 0.4170 0.3354 0.0168  0.0454  -0.0463 100 ASN A C   
771  O O   . ASN A 99  ? 0.3920 0.4147 0.3341 0.0112  0.0442  -0.0433 100 ASN A O   
772  C CB  . ASN A 99  ? 0.3616 0.3428 0.2967 0.0283  0.0373  -0.0432 100 ASN A CB  
773  C CG  . ASN A 99  ? 0.4836 0.4430 0.4139 0.0274  0.0340  -0.0423 100 ASN A CG  
774  O OD1 . ASN A 99  ? 0.4737 0.4297 0.3990 0.0290  0.0339  -0.0475 100 ASN A OD1 
775  N ND2 . ASN A 99  ? 0.4412 0.3884 0.3733 0.0250  0.0313  -0.0370 100 ASN A ND2 
776  N N   . VAL A 100 ? 0.3611 0.4022 0.3045 0.0220  0.0492  -0.0531 101 VAL A N   
777  C CA  . VAL A 100 ? 0.3223 0.3950 0.2782 0.0216  0.0519  -0.0579 101 VAL A CA  
778  C C   . VAL A 100 ? 0.4246 0.5102 0.3893 0.0396  0.0495  -0.0639 101 VAL A C   
779  O O   . VAL A 100 ? 0.4707 0.5536 0.4320 0.0472  0.0516  -0.0684 101 VAL A O   
780  C CB  . VAL A 100 ? 0.3810 0.4734 0.3358 0.0089  0.0612  -0.0614 101 VAL A CB  
781  C CG1 . VAL A 100 ? 0.2755 0.4063 0.2479 0.0075  0.0638  -0.0688 101 VAL A CG1 
782  C CG2 . VAL A 100 ? 0.2843 0.3574 0.2266 -0.0076 0.0643  -0.0541 101 VAL A CG2 
783  N N   . TRP A 101 ? 0.4359 0.5348 0.4103 0.0477  0.0450  -0.0642 102 TRP A N   
784  C CA  . TRP A 101 ? 0.3063 0.4213 0.2887 0.0669  0.0426  -0.0696 102 TRP A CA  
785  C C   . TRP A 101 ? 0.3576 0.5173 0.3551 0.0656  0.0442  -0.0776 102 TRP A C   
786  O O   . TRP A 101 ? 0.3608 0.5332 0.3634 0.0547  0.0428  -0.0769 102 TRP A O   
787  C CB  . TRP A 101 ? 0.3453 0.4408 0.3246 0.0806  0.0355  -0.0631 102 TRP A CB  
788  C CG  . TRP A 101 ? 0.3559 0.4108 0.3244 0.0838  0.0346  -0.0572 102 TRP A CG  
789  C CD1 . TRP A 101 ? 0.3762 0.4135 0.3415 0.0981  0.0346  -0.0591 102 TRP A CD1 
790  C CD2 . TRP A 101 ? 0.3055 0.3333 0.2664 0.0724  0.0338  -0.0496 102 TRP A CD2 
791  N NE1 . TRP A 101 ? 0.4232 0.4248 0.3807 0.0940  0.0343  -0.0537 102 TRP A NE1 
792  C CE2 . TRP A 101 ? 0.3178 0.3154 0.2732 0.0789  0.0336  -0.0479 102 TRP A CE2 
793  C CE3 . TRP A 101 ? 0.3231 0.3495 0.2820 0.0577  0.0334  -0.0452 102 TRP A CE3 
794  C CZ2 . TRP A 101 ? 0.3605 0.3316 0.3108 0.0704  0.0331  -0.0424 102 TRP A CZ2 
795  C CZ3 . TRP A 101 ? 0.2887 0.2873 0.2409 0.0518  0.0324  -0.0392 102 TRP A CZ3 
796  C CH2 . TRP A 101 ? 0.3365 0.3103 0.2856 0.0579  0.0323  -0.0381 102 TRP A CH2 
797  N N   . THR A 102 ? 0.3220 0.5072 0.3279 0.0766  0.0471  -0.0865 103 THR A N   
798  C CA  . THR A 102 ? 0.2936 0.5278 0.3174 0.0755  0.0491  -0.0964 103 THR A CA  
799  C C   . THR A 102 ? 0.3600 0.6153 0.3926 0.1013  0.0458  -0.1039 103 THR A C   
800  O O   . THR A 102 ? 0.3971 0.6275 0.4204 0.1158  0.0454  -0.1028 103 THR A O   
801  C CB  . THR A 102 ? 0.3735 0.6268 0.4006 0.0554  0.0607  -0.1015 103 THR A CB  
802  O OG1 . THR A 102 ? 0.4169 0.7175 0.4639 0.0474  0.0634  -0.1108 103 THR A OG1 
803  C CG2 . THR A 102 ? 0.3539 0.6090 0.3769 0.0640  0.0672  -0.1070 103 THR A CG2 
804  N N   . PRO A 103 ? 0.3177 0.6179 0.3679 0.1085  0.0426  -0.1122 104 PRO A N   
805  C CA  . PRO A 103 ? 0.3418 0.6654 0.4007 0.1361  0.0388  -0.1200 104 PRO A CA  
806  C C   . PRO A 103 ? 0.4351 0.7696 0.4968 0.1399  0.0479  -0.1288 104 PRO A C   
807  O O   . PRO A 103 ? 0.3742 0.7147 0.4357 0.1195  0.0581  -0.1314 104 PRO A O   
808  C CB  . PRO A 103 ? 0.2887 0.6680 0.3690 0.1371  0.0345  -0.1296 104 PRO A CB  
809  C CG  . PRO A 103 ? 0.2893 0.6550 0.3646 0.1190  0.0306  -0.1222 104 PRO A CG  
810  C CD  . PRO A 103 ? 0.3250 0.6499 0.3855 0.0960  0.0389  -0.1137 104 PRO A CD  
811  N N   . TYR A 104 ? 0.5283 0.8636 0.5904 0.1678  0.0443  -0.1334 105 TYR A N   
812  C CA  . TYR A 104 ? 0.5093 0.8534 0.5732 0.1755  0.0512  -0.1427 105 TYR A CA  
813  C C   . TYR A 104 ? 0.5573 0.9412 0.6375 0.1904  0.0457  -0.1505 105 TYR A C   
814  O O   . TYR A 104 ? 0.5851 0.9585 0.6617 0.2142  0.0354  -0.1474 105 TYR A O   
815  C CB  . TYR A 104 ? 0.5086 0.7998 0.5532 0.1902  0.0499  -0.1383 105 TYR A CB  
816  C CG  . TYR A 104 ? 0.5794 0.8675 0.6205 0.1911  0.0567  -0.1459 105 TYR A CG  
817  C CD1 . TYR A 104 ? 0.5648 0.8296 0.5922 0.1768  0.0643  -0.1462 105 TYR A CD1 
818  C CD2 . TYR A 104 ? 0.5868 0.8958 0.6367 0.2072  0.0547  -0.1533 105 TYR A CD2 
819  C CE1 . TYR A 104 ? 0.5352 0.7980 0.5577 0.1782  0.0700  -0.1535 105 TYR A CE1 
820  C CE2 . TYR A 104 ? 0.6249 0.9317 0.6711 0.2085  0.0611  -0.1609 105 TYR A CE2 
821  C CZ  . TYR A 104 ? 0.6259 0.9097 0.6582 0.1938  0.0688  -0.1610 105 TYR A CZ  
822  O OH  . TYR A 104 ? 0.6300 0.9124 0.6568 0.1957  0.0747  -0.1690 105 TYR A OH  
823  N N   . PRO A 105 ? 0.5585 0.9868 0.6548 0.1775  0.0523  -0.1603 106 PRO A N   
824  C CA  . PRO A 105 ? 0.5072 0.9457 0.6047 0.1493  0.0659  -0.1625 106 PRO A CA  
825  C C   . PRO A 105 ? 0.5002 0.9495 0.6030 0.1254  0.0684  -0.1593 106 PRO A C   
826  O O   . PRO A 105 ? 0.5011 0.9574 0.6098 0.1313  0.0589  -0.1575 106 PRO A O   
827  C CB  . PRO A 105 ? 0.4796 0.9634 0.5939 0.1477  0.0706  -0.1737 106 PRO A CB  
828  C CG  . PRO A 105 ? 0.4786 0.9922 0.6077 0.1656  0.0581  -0.1785 106 PRO A CG  
829  C CD  . PRO A 105 ? 0.5284 1.0006 0.6419 0.1902  0.0468  -0.1696 106 PRO A CD  
830  N N   . ARG A 106 ? 0.4923 0.9404 0.5907 0.0990  0.0812  -0.1581 107 ARG A N   
831  C CA  . ARG A 106 ? 0.4989 0.9507 0.5997 0.0735  0.0856  -0.1548 107 ARG A CA  
832  C C   . ARG A 106 ? 0.4991 0.9966 0.6245 0.0685  0.0802  -0.1628 107 ARG A C   
833  O O   . ARG A 106 ? 0.4953 1.0293 0.6367 0.0753  0.0786  -0.1722 107 ARG A O   
834  C CB  . ARG A 106 ? 0.5545 1.0001 0.6460 0.0463  0.1012  -0.1522 107 ARG A CB  
835  C CG  . ARG A 106 ? 0.6471 1.0340 0.7104 0.0370  0.1011  -0.1376 107 ARG A CG  
836  C CD  . ARG A 106 ? 0.6987 1.0807 0.7489 0.0164  0.1166  -0.1351 107 ARG A CD  
837  N NE  . ARG A 106 ? 0.7262 1.0827 0.7564 0.0285  0.1181  -0.1335 107 ARG A NE  
838  C CZ  . ARG A 106 ? 0.7741 1.1303 0.7900 0.0183  0.1311  -0.1332 107 ARG A CZ  
839  N NH1 . ARG A 106 ? 0.7357 1.1090 0.7546 -0.0052 0.1435  -0.1315 107 ARG A NH1 
840  N NH2 . ARG A 106 ? 0.8463 1.1807 0.8438 0.0310  0.1305  -0.1336 107 ARG A NH2 
841  N N   . PRO A 107 ? 0.5262 1.0220 0.6543 0.0571  0.0761  -0.1601 108 PRO A N   
842  C CA  . PRO A 107 ? 0.5361 1.0781 0.6879 0.0499  0.0709  -0.1704 108 PRO A CA  
843  C C   . PRO A 107 ? 0.6134 1.1880 0.7799 0.0266  0.0822  -0.1793 108 PRO A C   
844  O O   . PRO A 107 ? 0.5427 1.1000 0.6994 0.0062  0.0967  -0.1746 108 PRO A O   
845  C CB  . PRO A 107 ? 0.4405 0.9575 0.5846 0.0335  0.0672  -0.1631 108 PRO A CB  
846  C CG  . PRO A 107 ? 0.4231 0.8774 0.5387 0.0466  0.0608  -0.1467 108 PRO A CG  
847  C CD  . PRO A 107 ? 0.4517 0.8893 0.5564 0.0514  0.0700  -0.1444 108 PRO A CD  
848  N N   . THR A 108 ? 0.6968 1.3178 0.8848 0.0310  0.0756  -0.1919 109 THR A N   
849  C CA  . THR A 108 ? 0.7526 1.4073 0.9565 0.0074  0.0863  -0.2019 109 THR A CA  
850  C C   . THR A 108 ? 0.7237 1.3829 0.9352 -0.0241 0.0909  -0.2049 109 THR A C   
851  O O   . THR A 108 ? 0.8179 1.4719 1.0287 -0.0524 0.1061  -0.2043 109 THR A O   
852  C CB  . THR A 108 ? 0.7899 1.4936 1.0132 0.0249  0.0778  -0.2160 109 THR A CB  
853  O OG1 . THR A 108 ? 0.9139 1.6300 1.1413 0.0452  0.0599  -0.2192 109 THR A OG1 
854  C CG2 . THR A 108 ? 0.6847 1.3830 0.9010 0.0485  0.0790  -0.2143 109 THR A CG2 
855  N N   . SER A 109 ? 0.5840 1.2491 0.8003 -0.0192 0.0780  -0.2077 110 SER A N   
856  C CA  . SER A 109 ? 0.5610 1.2258 0.7828 -0.0454 0.0792  -0.2113 110 SER A CA  
857  C C   . SER A 109 ? 0.5595 1.1748 0.7614 -0.0520 0.0820  -0.1969 110 SER A C   
858  O O   . SER A 109 ? 0.5818 1.1728 0.7693 -0.0287 0.0762  -0.1870 110 SER A O   
859  C CB  . SER A 109 ? 0.6231 1.3240 0.8593 -0.0331 0.0621  -0.2237 110 SER A CB  
860  O OG  . SER A 109 ? 0.7234 1.4652 0.9721 -0.0129 0.0552  -0.2343 110 SER A OG  
861  N N   . PRO A 110 ? 0.5380 1.1345 0.7370 -0.0834 0.0915  -0.1955 111 PRO A N   
862  C CA  . PRO A 110 ? 0.4983 1.0423 0.6751 -0.0890 0.0915  -0.1815 111 PRO A CA  
863  C C   . PRO A 110 ? 0.4854 1.0199 0.6560 -0.0653 0.0715  -0.1789 111 PRO A C   
864  O O   . PRO A 110 ? 0.4209 0.9971 0.6107 -0.0611 0.0613  -0.1923 111 PRO A O   
865  C CB  . PRO A 110 ? 0.5212 1.0576 0.7020 -0.1260 0.1027  -0.1855 111 PRO A CB  
866  C CG  . PRO A 110 ? 0.5246 1.0864 0.7170 -0.1406 0.1135  -0.1938 111 PRO A CG  
867  C CD  . PRO A 110 ? 0.5279 1.1389 0.7381 -0.1144 0.1026  -0.2047 111 PRO A CD  
868  N N   . THR A 111 ? 0.4547 0.9353 0.5977 -0.0499 0.0661  -0.1617 112 THR A N   
869  C CA  . THR A 111 ? 0.4134 0.8798 0.5462 -0.0238 0.0496  -0.1559 112 THR A CA  
870  C C   . THR A 111 ? 0.4142 0.8286 0.5254 -0.0326 0.0462  -0.1442 112 THR A C   
871  O O   . THR A 111 ? 0.4168 0.7890 0.5114 -0.0468 0.0552  -0.1338 112 THR A O   
872  C CB  . THR A 111 ? 0.5587 1.0080 0.6796 0.0037  0.0470  -0.1469 112 THR A CB  
873  O OG1 . THR A 111 ? 0.6586 1.1602 0.8006 0.0178  0.0472  -0.1595 112 THR A OG1 
874  C CG2 . THR A 111 ? 0.5604 0.9796 0.6644 0.0274  0.0334  -0.1365 112 THR A CG2 
875  N N   . PRO A 112 ? 0.4424 0.8603 0.5523 -0.0233 0.0334  -0.1460 113 PRO A N   
876  C CA  . PRO A 112 ? 0.4257 0.7972 0.5157 -0.0305 0.0306  -0.1362 113 PRO A CA  
877  C C   . PRO A 112 ? 0.3883 0.7071 0.4542 -0.0187 0.0314  -0.1181 113 PRO A C   
878  O O   . PRO A 112 ? 0.3807 0.6973 0.4428 0.0025  0.0286  -0.1129 113 PRO A O   
879  C CB  . PRO A 112 ? 0.4787 0.8723 0.5716 -0.0161 0.0160  -0.1424 113 PRO A CB  
880  C CG  . PRO A 112 ? 0.5530 0.9917 0.6600 0.0076  0.0093  -0.1493 113 PRO A CG  
881  C CD  . PRO A 112 ? 0.4830 0.9509 0.6094 -0.0059 0.0210  -0.1583 113 PRO A CD  
882  N N   . VAL A 113 ? 0.2852 0.5614 0.3354 -0.0328 0.0351  -0.1097 114 VAL A N   
883  C CA  . VAL A 113 ? 0.3070 0.5355 0.3368 -0.0272 0.0373  -0.0946 114 VAL A CA  
884  C C   . VAL A 113 ? 0.3567 0.5564 0.3726 -0.0194 0.0293  -0.0870 114 VAL A C   
885  O O   . VAL A 113 ? 0.3578 0.5556 0.3732 -0.0304 0.0275  -0.0912 114 VAL A O   
886  C CB  . VAL A 113 ? 0.3534 0.5565 0.3752 -0.0483 0.0491  -0.0905 114 VAL A CB  
887  C CG1 . VAL A 113 ? 0.3114 0.4711 0.3134 -0.0406 0.0495  -0.0767 114 VAL A CG1 
888  C CG2 . VAL A 113 ? 0.2795 0.5136 0.3145 -0.0583 0.0593  -0.0983 114 VAL A CG2 
889  N N   . LEU A 114 ? 0.3770 0.5543 0.3817 -0.0013 0.0256  -0.0767 115 LEU A N   
890  C CA  . LEU A 114 ? 0.3241 0.4701 0.3143 0.0049  0.0210  -0.0676 115 LEU A CA  
891  C C   . LEU A 114 ? 0.4175 0.5241 0.3955 0.0001  0.0262  -0.0578 115 LEU A C   
892  O O   . LEU A 114 ? 0.4422 0.5423 0.4189 0.0057  0.0291  -0.0547 115 LEU A O   
893  C CB  . LEU A 114 ? 0.3525 0.5020 0.3389 0.0284  0.0137  -0.0631 115 LEU A CB  
894  C CG  . LEU A 114 ? 0.3770 0.5594 0.3687 0.0373  0.0055  -0.0704 115 LEU A CG  
895  C CD1 . LEU A 114 ? 0.3613 0.5510 0.3496 0.0632  -0.0001 -0.0660 115 LEU A CD1 
896  C CD2 . LEU A 114 ? 0.4296 0.5973 0.4107 0.0328  0.0022  -0.0684 115 LEU A CD2 
897  N N   . VAL A 115 ? 0.3622 0.4442 0.3312 -0.0092 0.0268  -0.0543 116 VAL A N   
898  C CA  . VAL A 115 ? 0.3992 0.4471 0.3571 -0.0129 0.0302  -0.0461 116 VAL A CA  
899  C C   . VAL A 115 ? 0.4444 0.4711 0.3942 -0.0040 0.0261  -0.0393 116 VAL A C   
900  O O   . VAL A 115 ? 0.4516 0.4764 0.3987 -0.0068 0.0238  -0.0409 116 VAL A O   
901  C CB  . VAL A 115 ? 0.3842 0.4193 0.3376 -0.0309 0.0358  -0.0474 116 VAL A CB  
902  C CG1 . VAL A 115 ? 0.3749 0.3772 0.3154 -0.0307 0.0377  -0.0387 116 VAL A CG1 
903  C CG2 . VAL A 115 ? 0.3043 0.3617 0.2660 -0.0421 0.0423  -0.0539 116 VAL A CG2 
904  N N   . TRP A 116 ? 0.4323 0.4435 0.3784 0.0054  0.0260  -0.0328 117 TRP A N   
905  C CA  . TRP A 116 ? 0.3648 0.3581 0.3053 0.0132  0.0240  -0.0264 117 TRP A CA  
906  C C   . TRP A 116 ? 0.3975 0.3670 0.3324 0.0068  0.0257  -0.0229 117 TRP A C   
907  O O   . TRP A 116 ? 0.4065 0.3680 0.3401 0.0033  0.0276  -0.0225 117 TRP A O   
908  C CB  . TRP A 116 ? 0.3406 0.3298 0.2817 0.0261  0.0237  -0.0224 117 TRP A CB  
909  C CG  . TRP A 116 ? 0.3930 0.3618 0.3290 0.0313  0.0242  -0.0154 117 TRP A CG  
910  C CD1 . TRP A 116 ? 0.3978 0.3472 0.3337 0.0307  0.0265  -0.0123 117 TRP A CD1 
911  C CD2 . TRP A 116 ? 0.3740 0.3420 0.3045 0.0370  0.0232  -0.0113 117 TRP A CD2 
912  N NE1 . TRP A 116 ? 0.4224 0.3594 0.3552 0.0342  0.0281  -0.0066 117 TRP A NE1 
913  C CE2 . TRP A 116 ? 0.4051 0.3520 0.3329 0.0386  0.0265  -0.0050 117 TRP A CE2 
914  C CE3 . TRP A 116 ? 0.3630 0.3479 0.2903 0.0407  0.0199  -0.0132 117 TRP A CE3 
915  C CZ2 . TRP A 116 ? 0.3826 0.3232 0.3034 0.0434  0.0283  0.0009  117 TRP A CZ2 
916  C CZ3 . TRP A 116 ? 0.3553 0.3339 0.2736 0.0473  0.0201  -0.0075 117 TRP A CZ3 
917  C CH2 . TRP A 116 ? 0.3693 0.3250 0.2837 0.0485  0.0251  0.0002  117 TRP A CH2 
918  N N   . ILE A 117 ? 0.3548 0.3149 0.2859 0.0071  0.0247  -0.0208 118 ILE A N   
919  C CA  . ILE A 117 ? 0.3934 0.3341 0.3207 0.0043  0.0255  -0.0181 118 ILE A CA  
920  C C   . ILE A 117 ? 0.4085 0.3426 0.3364 0.0118  0.0258  -0.0136 118 ILE A C   
921  O O   . ILE A 117 ? 0.3877 0.3258 0.3128 0.0151  0.0257  -0.0127 118 ILE A O   
922  C CB  . ILE A 117 ? 0.3552 0.2899 0.2776 -0.0031 0.0254  -0.0211 118 ILE A CB  
923  C CG1 . ILE A 117 ? 0.3983 0.3389 0.3202 -0.0132 0.0271  -0.0255 118 ILE A CG1 
924  C CG2 . ILE A 117 ? 0.3653 0.2810 0.2837 -0.0029 0.0255  -0.0185 118 ILE A CG2 
925  C CD1 . ILE A 117 ? 0.3901 0.3187 0.3059 -0.0222 0.0283  -0.0289 118 ILE A CD1 
926  N N   . TYR A 118 ? 0.3542 0.2787 0.2852 0.0138  0.0269  -0.0113 119 TYR A N   
927  C CA  . TYR A 118 ? 0.3330 0.2509 0.2662 0.0184  0.0294  -0.0072 119 TYR A CA  
928  C C   . TYR A 118 ? 0.3365 0.2500 0.2691 0.0166  0.0304  -0.0069 119 TYR A C   
929  O O   . TYR A 118 ? 0.3633 0.2743 0.2945 0.0131  0.0284  -0.0099 119 TYR A O   
930  C CB  . TYR A 118 ? 0.3338 0.2437 0.2730 0.0187  0.0305  -0.0073 119 TYR A CB  
931  C CG  . TYR A 118 ? 0.3879 0.2946 0.3293 0.0143  0.0280  -0.0113 119 TYR A CG  
932  C CD1 . TYR A 118 ? 0.3838 0.2874 0.3283 0.0127  0.0275  -0.0121 119 TYR A CD1 
933  C CD2 . TYR A 118 ? 0.3565 0.2651 0.2962 0.0133  0.0261  -0.0144 119 TYR A CD2 
934  C CE1 . TYR A 118 ? 0.4446 0.3467 0.3894 0.0117  0.0238  -0.0156 119 TYR A CE1 
935  C CE2 . TYR A 118 ? 0.4165 0.3221 0.3544 0.0112  0.0232  -0.0172 119 TYR A CE2 
936  C CZ  . TYR A 118 ? 0.4247 0.3269 0.3648 0.0111  0.0214  -0.0176 119 TYR A CZ  
937  O OH  . TYR A 118 ? 0.4256 0.3262 0.3622 0.0118  0.0172  -0.0203 119 TYR A OH  
938  N N   . GLY A 119 ? 0.3355 0.2470 0.2681 0.0200  0.0344  -0.0028 120 GLY A N   
939  C CA  . GLY A 119 ? 0.3567 0.2666 0.2907 0.0191  0.0370  -0.0030 120 GLY A CA  
940  C C   . GLY A 119 ? 0.4250 0.3305 0.3698 0.0168  0.0401  -0.0032 120 GLY A C   
941  O O   . GLY A 119 ? 0.4552 0.3573 0.4059 0.0150  0.0390  -0.0046 120 GLY A O   
942  N N   . GLY A 120 ? 0.4353 0.3432 0.3837 0.0164  0.0442  -0.0033 121 GLY A N   
943  C CA  . GLY A 120 ? 0.3380 0.2474 0.3001 0.0129  0.0472  -0.0059 121 GLY A CA  
944  C C   . GLY A 120 ? 0.4402 0.3577 0.4076 0.0141  0.0459  -0.0111 121 GLY A C   
945  O O   . GLY A 120 ? 0.4427 0.3659 0.4221 0.0129  0.0434  -0.0166 121 GLY A O   
946  N N   . GLY A 121 ? 0.4136 0.3329 0.3721 0.0177  0.0468  -0.0107 122 GLY A N   
947  C CA  . GLY A 121 ? 0.3725 0.2984 0.3347 0.0211  0.0465  -0.0160 122 GLY A CA  
948  C C   . GLY A 121 ? 0.4221 0.3458 0.3861 0.0243  0.0382  -0.0213 122 GLY A C   
949  O O   . GLY A 121 ? 0.3954 0.3261 0.3663 0.0289  0.0373  -0.0263 122 GLY A O   
950  N N   . PHE A 122 ? 0.3559 0.2704 0.3127 0.0229  0.0325  -0.0201 123 PHE A N   
951  C CA  . PHE A 122 ? 0.3904 0.2990 0.3440 0.0260  0.0252  -0.0227 123 PHE A CA  
952  C C   . PHE A 122 ? 0.4176 0.3362 0.3845 0.0279  0.0221  -0.0267 123 PHE A C   
953  O O   . PHE A 122 ? 0.4055 0.3213 0.3687 0.0334  0.0154  -0.0289 123 PHE A O   
954  C CB  . PHE A 122 ? 0.3791 0.2795 0.3236 0.0319  0.0230  -0.0251 123 PHE A CB  
955  C CG  . PHE A 122 ? 0.4296 0.3196 0.3607 0.0285  0.0244  -0.0240 123 PHE A CG  
956  C CD1 . PHE A 122 ? 0.3146 0.1947 0.2365 0.0234  0.0223  -0.0217 123 PHE A CD1 
957  C CD2 . PHE A 122 ? 0.4278 0.3203 0.3562 0.0300  0.0281  -0.0264 123 PHE A CD2 
958  C CE1 . PHE A 122 ? 0.4024 0.2769 0.3152 0.0185  0.0235  -0.0229 123 PHE A CE1 
959  C CE2 . PHE A 122 ? 0.3820 0.2679 0.2993 0.0264  0.0284  -0.0279 123 PHE A CE2 
960  C CZ  . PHE A 122 ? 0.3845 0.2621 0.2953 0.0201  0.0259  -0.0266 123 PHE A CZ  
961  N N   . TYR A 123 ? 0.3237 0.2535 0.3054 0.0234  0.0269  -0.0281 124 TYR A N   
962  C CA  . TYR A 123 ? 0.3992 0.3415 0.3963 0.0228  0.0238  -0.0344 124 TYR A CA  
963  C C   . TYR A 123 ? 0.4091 0.3494 0.4114 0.0152  0.0252  -0.0345 124 TYR A C   
964  O O   . TYR A 123 ? 0.4194 0.3705 0.4351 0.0131  0.0224  -0.0417 124 TYR A O   
965  C CB  . TYR A 123 ? 0.3760 0.3362 0.3909 0.0225  0.0290  -0.0394 124 TYR A CB  
966  C CG  . TYR A 123 ? 0.4170 0.3780 0.4391 0.0132  0.0405  -0.0360 124 TYR A CG  
967  C CD1 . TYR A 123 ? 0.3287 0.2938 0.3654 0.0042  0.0442  -0.0390 124 TYR A CD1 
968  C CD2 . TYR A 123 ? 0.4349 0.3907 0.4475 0.0137  0.0481  -0.0298 124 TYR A CD2 
969  C CE1 . TYR A 123 ? 0.4251 0.3850 0.4652 -0.0043 0.0562  -0.0341 124 TYR A CE1 
970  C CE2 . TYR A 123 ? 0.4688 0.4225 0.4836 0.0068  0.0592  -0.0246 124 TYR A CE2 
971  C CZ  . TYR A 123 ? 0.5001 0.4539 0.5280 -0.0023 0.0638  -0.0258 124 TYR A CZ  
972  O OH  . TYR A 123 ? 0.6155 0.5616 0.6427 -0.0091 0.0762  -0.0190 124 TYR A OH  
973  N N   . SER A 124 ? 0.3486 0.2766 0.3412 0.0119  0.0291  -0.0281 125 SER A N   
974  C CA  . SER A 124 ? 0.3817 0.3049 0.3783 0.0064  0.0314  -0.0283 125 SER A CA  
975  C C   . SER A 124 ? 0.3887 0.3002 0.3703 0.0079  0.0317  -0.0219 125 SER A C   
976  O O   . SER A 124 ? 0.3891 0.2983 0.3593 0.0110  0.0304  -0.0183 125 SER A O   
977  C CB  . SER A 124 ? 0.3666 0.2907 0.3757 -0.0002 0.0411  -0.0277 125 SER A CB  
978  O OG  . SER A 124 ? 0.3608 0.2801 0.3611 0.0014  0.0479  -0.0196 125 SER A OG  
979  N N   . GLY A 125 ? 0.3342 0.2392 0.3171 0.0055  0.0336  -0.0219 126 GLY A N   
980  C CA  . GLY A 125 ? 0.2918 0.1896 0.2635 0.0082  0.0339  -0.0174 126 GLY A CA  
981  C C   . GLY A 125 ? 0.3832 0.2814 0.3517 0.0090  0.0284  -0.0221 126 GLY A C   
982  O O   . GLY A 125 ? 0.3351 0.2382 0.3056 0.0086  0.0233  -0.0277 126 GLY A O   
983  N N   . ALA A 126 ? 0.4020 0.2963 0.3643 0.0115  0.0296  -0.0199 127 ALA A N   
984  C CA  . ALA A 126 ? 0.4642 0.3602 0.4224 0.0128  0.0262  -0.0244 127 ALA A CA  
985  C C   . ALA A 126 ? 0.4761 0.3727 0.4284 0.0172  0.0283  -0.0212 127 ALA A C   
986  O O   . ALA A 126 ? 0.4373 0.3295 0.3897 0.0205  0.0319  -0.0164 127 ALA A O   
987  C CB  . ALA A 126 ? 0.4095 0.3014 0.3756 0.0110  0.0257  -0.0321 127 ALA A CB  
988  N N   . SER A 127 ? 0.3735 0.2771 0.3200 0.0181  0.0263  -0.0239 128 SER A N   
989  C CA  . SER A 127 ? 0.4242 0.3344 0.3679 0.0227  0.0280  -0.0226 128 SER A CA  
990  C C   . SER A 127 ? 0.4242 0.3282 0.3708 0.0289  0.0297  -0.0258 128 SER A C   
991  O O   . SER A 127 ? 0.3876 0.2977 0.3328 0.0358  0.0308  -0.0253 128 SER A O   
992  C CB  . SER A 127 ? 0.3265 0.2489 0.2644 0.0201  0.0272  -0.0247 128 SER A CB  
993  O OG  . SER A 127 ? 0.3759 0.2967 0.3101 0.0185  0.0259  -0.0294 128 SER A OG  
994  N N   . SER A 128 ? 0.3668 0.2594 0.3177 0.0269  0.0298  -0.0303 129 SER A N   
995  C CA  . SER A 128 ? 0.3838 0.2664 0.3367 0.0318  0.0317  -0.0354 129 SER A CA  
996  C C   . SER A 128 ? 0.4383 0.3023 0.3939 0.0347  0.0365  -0.0305 129 SER A C   
997  O O   . SER A 128 ? 0.4214 0.2712 0.3774 0.0394  0.0389  -0.0341 129 SER A O   
998  C CB  . SER A 128 ? 0.3299 0.2099 0.2858 0.0271  0.0292  -0.0454 129 SER A CB  
999  O OG  . SER A 128 ? 0.4085 0.2855 0.3715 0.0196  0.0282  -0.0459 129 SER A OG  
1000 N N   . LEU A 129 ? 0.4065 0.2681 0.3622 0.0322  0.0386  -0.0224 130 LEU A N   
1001 C CA  . LEU A 129 ? 0.5111 0.3528 0.4662 0.0344  0.0449  -0.0158 130 LEU A CA  
1002 C C   . LEU A 129 ? 0.4962 0.3312 0.4427 0.0480  0.0462  -0.0114 130 LEU A C   
1003 O O   . LEU A 129 ? 0.4749 0.3280 0.4171 0.0551  0.0422  -0.0105 130 LEU A O   
1004 C CB  . LEU A 129 ? 0.4488 0.2928 0.4029 0.0306  0.0475  -0.0076 130 LEU A CB  
1005 C CG  . LEU A 129 ? 0.5336 0.3878 0.4961 0.0202  0.0456  -0.0118 130 LEU A CG  
1006 C CD1 . LEU A 129 ? 0.4343 0.2912 0.3948 0.0186  0.0491  -0.0043 130 LEU A CD1 
1007 C CD2 . LEU A 129 ? 0.4770 0.3231 0.4514 0.0118  0.0474  -0.0202 130 LEU A CD2 
1008 N N   . ASP A 130 ? 0.4927 0.3016 0.4371 0.0516  0.0519  -0.0091 131 ASP A N   
1009 C CA  . ASP A 130 ? 0.5360 0.3343 0.4708 0.0677  0.0529  -0.0048 131 ASP A CA  
1010 C C   . ASP A 130 ? 0.4863 0.2989 0.4117 0.0779  0.0506  0.0050  131 ASP A C   
1011 O O   . ASP A 130 ? 0.5410 0.3660 0.4622 0.0917  0.0466  0.0045  131 ASP A O   
1012 C CB  . ASP A 130 ? 0.5551 0.3156 0.4860 0.0691  0.0612  -0.0007 131 ASP A CB  
1013 C CG  . ASP A 130 ? 0.7266 0.4728 0.6668 0.0612  0.0627  -0.0136 131 ASP A CG  
1014 O OD1 . ASP A 130 ? 0.7020 0.4676 0.6478 0.0604  0.0565  -0.0250 131 ASP A OD1 
1015 O OD2 . ASP A 130 ? 0.8380 0.5535 0.7792 0.0552  0.0706  -0.0128 131 ASP A OD2 
1016 N N   . VAL A 131 ? 0.4500 0.2641 0.3728 0.0718  0.0527  0.0126  132 VAL A N   
1017 C CA  . VAL A 131 ? 0.5579 0.3845 0.4699 0.0816  0.0505  0.0210  132 VAL A CA  
1018 C C   . VAL A 131 ? 0.4964 0.3577 0.4129 0.0812  0.0423  0.0146  132 VAL A C   
1019 O O   . VAL A 131 ? 0.5116 0.3888 0.4211 0.0897  0.0388  0.0181  132 VAL A O   
1020 C CB  . VAL A 131 ? 0.5602 0.3765 0.4670 0.0746  0.0567  0.0300  132 VAL A CB  
1021 C CG1 . VAL A 131 ? 0.5167 0.3514 0.4338 0.0602  0.0545  0.0242  132 VAL A CG1 
1022 C CG2 . VAL A 131 ? 0.6449 0.4632 0.5349 0.0881  0.0565  0.0408  132 VAL A CG2 
1023 N N   . TYR A 132 ? 0.4456 0.3189 0.3726 0.0715  0.0396  0.0048  133 TYR A N   
1024 C CA  . TYR A 132 ? 0.4232 0.3255 0.3541 0.0689  0.0341  -0.0012 133 TYR A CA  
1025 C C   . TYR A 132 ? 0.4626 0.3775 0.3973 0.0758  0.0320  -0.0086 133 TYR A C   
1026 O O   . TYR A 132 ? 0.4661 0.4038 0.4056 0.0705  0.0295  -0.0148 133 TYR A O   
1027 C CB  . TYR A 132 ? 0.3828 0.2894 0.3193 0.0538  0.0335  -0.0054 133 TYR A CB  
1028 C CG  . TYR A 132 ? 0.4407 0.3391 0.3757 0.0471  0.0356  -0.0004 133 TYR A CG  
1029 C CD1 . TYR A 132 ? 0.3834 0.2778 0.3239 0.0366  0.0359  -0.0036 133 TYR A CD1 
1030 C CD2 . TYR A 132 ? 0.4404 0.3371 0.3677 0.0528  0.0372  0.0071  133 TYR A CD2 
1031 C CE1 . TYR A 132 ? 0.3102 0.2004 0.2512 0.0317  0.0382  -0.0004 133 TYR A CE1 
1032 C CE2 . TYR A 132 ? 0.4599 0.3511 0.3858 0.0470  0.0403  0.0109  133 TYR A CE2 
1033 C CZ  . TYR A 132 ? 0.4482 0.3368 0.3822 0.0363  0.0410  0.0067  133 TYR A CZ  
1034 O OH  . TYR A 132 ? 0.3953 0.2818 0.3298 0.0316  0.0443  0.0091  133 TYR A OH  
1035 N N   . ASP A 133 ? 0.5249 0.4243 0.4572 0.0872  0.0339  -0.0082 134 ASP A N   
1036 C CA  . ASP A 133 ? 0.5563 0.4678 0.4923 0.0960  0.0325  -0.0162 134 ASP A CA  
1037 C C   . ASP A 133 ? 0.5225 0.4673 0.4606 0.1043  0.0281  -0.0181 134 ASP A C   
1038 O O   . ASP A 133 ? 0.5338 0.4813 0.4661 0.1174  0.0258  -0.0123 134 ASP A O   
1039 C CB  . ASP A 133 ? 0.6016 0.4854 0.5324 0.1092  0.0356  -0.0146 134 ASP A CB  
1040 C CG  . ASP A 133 ? 0.6167 0.5088 0.5516 0.1181  0.0351  -0.0250 134 ASP A CG  
1041 O OD1 . ASP A 133 ? 0.5729 0.4970 0.5144 0.1162  0.0327  -0.0321 134 ASP A OD1 
1042 O OD2 . ASP A 133 ? 0.6705 0.5358 0.6017 0.1267  0.0380  -0.0263 134 ASP A OD2 
1043 N N   . GLY A 134 ? 0.4547 0.4260 0.4009 0.0968  0.0273  -0.0267 135 GLY A N   
1044 C CA  . GLY A 134 ? 0.4044 0.4124 0.3569 0.1001  0.0241  -0.0313 135 GLY A CA  
1045 C C   . GLY A 134 ? 0.3993 0.4255 0.3561 0.1184  0.0225  -0.0369 135 GLY A C   
1046 O O   . GLY A 134 ? 0.4400 0.5018 0.4046 0.1222  0.0193  -0.0420 135 GLY A O   
1047 N N   . ARG A 135 ? 0.3919 0.3958 0.3446 0.1305  0.0245  -0.0371 136 ARG A N   
1048 C CA  . ARG A 135 ? 0.4596 0.4815 0.4172 0.1487  0.0236  -0.0444 136 ARG A CA  
1049 C C   . ARG A 135 ? 0.4916 0.5290 0.4471 0.1690  0.0176  -0.0407 136 ARG A C   
1050 O O   . ARG A 135 ? 0.4855 0.5595 0.4507 0.1805  0.0146  -0.0490 136 ARG A O   
1051 C CB  . ARG A 135 ? 0.4707 0.4596 0.4227 0.1572  0.0273  -0.0464 136 ARG A CB  
1052 C CG  . ARG A 135 ? 0.6091 0.5596 0.5486 0.1725  0.0272  -0.0364 136 ARG A CG  
1053 C CD  . ARG A 135 ? 0.5756 0.4922 0.5108 0.1794  0.0315  -0.0407 136 ARG A CD  
1054 N NE  . ARG A 135 ? 0.6235 0.5175 0.5591 0.1589  0.0355  -0.0426 136 ARG A NE  
1055 C CZ  . ARG A 135 ? 0.7434 0.6172 0.6789 0.1575  0.0388  -0.0515 136 ARG A CZ  
1056 N NH1 . ARG A 135 ? 0.7677 0.6379 0.7021 0.1757  0.0395  -0.0591 136 ARG A NH1 
1057 N NH2 . ARG A 135 ? 0.7012 0.5600 0.6380 0.1390  0.0408  -0.0541 136 ARG A NH2 
1058 N N   . PHE A 136 ? 0.4906 0.5032 0.4332 0.1741  0.0159  -0.0286 137 PHE A N   
1059 C CA  . PHE A 136 ? 0.5220 0.5461 0.4578 0.1965  0.0097  -0.0237 137 PHE A CA  
1060 C C   . PHE A 136 ? 0.3653 0.4366 0.3106 0.1917  0.0033  -0.0293 137 PHE A C   
1061 O O   . PHE A 136 ? 0.4466 0.5528 0.3976 0.2089  -0.0031 -0.0350 137 PHE A O   
1062 C CB  . PHE A 136 ? 0.4315 0.4127 0.3472 0.2029  0.0114  -0.0080 137 PHE A CB  
1063 C CG  . PHE A 136 ? 0.4828 0.4152 0.3910 0.2021  0.0190  -0.0036 137 PHE A CG  
1064 C CD1 . PHE A 136 ? 0.5104 0.4159 0.4177 0.1807  0.0250  -0.0001 137 PHE A CD1 
1065 C CD2 . PHE A 136 ? 0.5566 0.4712 0.4600 0.2228  0.0199  -0.0049 137 PHE A CD2 
1066 C CE1 . PHE A 136 ? 0.5357 0.3997 0.4389 0.1778  0.0319  0.0013  137 PHE A CE1 
1067 C CE2 . PHE A 136 ? 0.5914 0.4594 0.4888 0.2201  0.0273  -0.0030 137 PHE A CE2 
1068 C CZ  . PHE A 136 ? 0.6029 0.4468 0.5010 0.1965  0.0333  -0.0003 137 PHE A CZ  
1069 N N   . LEU A 137 ? 0.4133 0.4873 0.3613 0.1686  0.0048  -0.0290 138 LEU A N   
1070 C CA  . LEU A 137 ? 0.4350 0.5508 0.3929 0.1600  -0.0002 -0.0365 138 LEU A CA  
1071 C C   . LEU A 137 ? 0.4511 0.6107 0.4289 0.1576  -0.0003 -0.0512 138 LEU A C   
1072 O O   . LEU A 137 ? 0.4501 0.6524 0.4381 0.1649  -0.0066 -0.0594 138 LEU A O   
1073 C CB  . LEU A 137 ? 0.4274 0.5307 0.3842 0.1348  0.0032  -0.0344 138 LEU A CB  
1074 C CG  . LEU A 137 ? 0.5533 0.6779 0.5107 0.1264  -0.0015 -0.0368 138 LEU A CG  
1075 C CD1 . LEU A 137 ? 0.5333 0.6723 0.4819 0.1483  -0.0097 -0.0339 138 LEU A CD1 
1076 C CD2 . LEU A 137 ? 0.5663 0.6589 0.5141 0.1108  0.0025  -0.0292 138 LEU A CD2 
1077 N N   . VAL A 138 ? 0.3997 0.5519 0.3836 0.1474  0.0068  -0.0556 139 VAL A N   
1078 C CA  . VAL A 138 ? 0.3714 0.5650 0.3735 0.1422  0.0094  -0.0692 139 VAL A CA  
1079 C C   . VAL A 138 ? 0.4137 0.6329 0.4224 0.1688  0.0052  -0.0754 139 VAL A C   
1080 O O   . VAL A 138 ? 0.3828 0.6519 0.4087 0.1713  0.0026  -0.0871 139 VAL A O   
1081 C CB  . VAL A 138 ? 0.4215 0.5979 0.4236 0.1259  0.0185  -0.0709 139 VAL A CB  
1082 C CG1 . VAL A 138 ? 0.3504 0.5641 0.3675 0.1270  0.0230  -0.0837 139 VAL A CG1 
1083 C CG2 . VAL A 138 ? 0.3709 0.5358 0.3702 0.0998  0.0218  -0.0676 139 VAL A CG2 
1084 N N   . GLN A 139 ? 0.3971 0.5829 0.3928 0.1894  0.0045  -0.0683 140 GLN A N   
1085 C CA  . GLN A 139 ? 0.4046 0.6093 0.4036 0.2188  -0.0001 -0.0731 140 GLN A CA  
1086 C C   . GLN A 139 ? 0.4677 0.7027 0.4672 0.2353  -0.0107 -0.0726 140 GLN A C   
1087 O O   . GLN A 139 ? 0.4227 0.7068 0.4377 0.2490  -0.0157 -0.0842 140 GLN A O   
1088 C CB  . GLN A 139 ? 0.3891 0.5426 0.3709 0.2366  0.0022  -0.0646 140 GLN A CB  
1089 C CG  . GLN A 139 ? 0.5512 0.7194 0.5384 0.2635  0.0011  -0.0732 140 GLN A CG  
1090 C CD  . GLN A 139 ? 0.7458 0.9375 0.7307 0.2884  -0.0094 -0.0715 140 GLN A CD  
1091 O OE1 . GLN A 139 ? 0.8517 1.0215 0.8196 0.2976  -0.0145 -0.0588 140 GLN A OE1 
1092 N NE2 . GLN A 139 ? 0.7330 0.9670 0.7323 0.2958  -0.0127 -0.0833 140 GLN A NE2 
1093 N N   . ALA A 140 ? 0.4061 0.6153 0.3887 0.2350  -0.0144 -0.0601 141 ALA A N   
1094 C CA  . ALA A 140 ? 0.4731 0.7069 0.4505 0.2550  -0.0253 -0.0584 141 ALA A CA  
1095 C C   . ALA A 140 ? 0.4825 0.7761 0.4807 0.2415  -0.0306 -0.0728 141 ALA A C   
1096 O O   . ALA A 140 ? 0.4554 0.7935 0.4615 0.2603  -0.0403 -0.0808 141 ALA A O   
1097 C CB  . ALA A 140 ? 0.3977 0.5879 0.3493 0.2576  -0.0264 -0.0411 141 ALA A CB  
1098 N N   . GLU A 141 ? 0.4654 0.7608 0.4725 0.2093  -0.0245 -0.0769 142 GLU A N   
1099 C CA  . GLU A 141 ? 0.4441 0.7866 0.4679 0.1930  -0.0285 -0.0895 142 GLU A CA  
1100 C C   . GLU A 141 ? 0.4644 0.8400 0.5130 0.1698  -0.0207 -0.1041 142 GLU A C   
1101 O O   . GLU A 141 ? 0.4644 0.8779 0.5287 0.1527  -0.0222 -0.1159 142 GLU A O   
1102 C CB  . GLU A 141 ? 0.4009 0.7174 0.4113 0.1750  -0.0285 -0.0819 142 GLU A CB  
1103 C CG  . GLU A 141 ? 0.4114 0.7064 0.3979 0.1963  -0.0361 -0.0691 142 GLU A CG  
1104 C CD  . GLU A 141 ? 0.5132 0.8569 0.5037 0.2180  -0.0492 -0.0775 142 GLU A CD  
1105 O OE1 . GLU A 141 ? 0.5102 0.9062 0.5235 0.2068  -0.0530 -0.0950 142 GLU A OE1 
1106 O OE2 . GLU A 141 ? 0.6091 0.9389 0.5794 0.2464  -0.0556 -0.0667 142 GLU A OE2 
1107 N N   . ARG A 142 ? 0.4489 0.8105 0.5003 0.1681  -0.0118 -0.1041 143 ARG A N   
1108 C CA  . ARG A 142 ? 0.4382 0.8301 0.5100 0.1480  -0.0025 -0.1166 143 ARG A CA  
1109 C C   . ARG A 142 ? 0.4532 0.8404 0.5277 0.1141  0.0034  -0.1177 143 ARG A C   
1110 O O   . ARG A 142 ? 0.5932 1.0222 0.6871 0.0972  0.0056  -0.1307 143 ARG A O   
1111 C CB  . ARG A 142 ? 0.4703 0.9285 0.5671 0.1595  -0.0065 -0.1336 143 ARG A CB  
1112 C CG  . ARG A 142 ? 0.6700 1.1343 0.7645 0.1957  -0.0123 -0.1335 143 ARG A CG  
1113 C CD  . ARG A 142 ? 0.8654 1.3115 0.9589 0.1981  -0.0020 -0.1337 143 ARG A CD  
1114 N NE  . ARG A 142 ? 0.9982 1.4480 1.0886 0.2260  -0.0082 -0.1351 143 ARG A NE  
1115 C CZ  . ARG A 142 ? 1.0275 1.4302 1.0988 0.2450  -0.0079 -0.1253 143 ARG A CZ  
1116 N NH1 . ARG A 142 ? 1.0240 1.3771 1.0799 0.2404  -0.0019 -0.1149 143 ARG A NH1 
1117 N NH2 . ARG A 142 ? 1.0310 1.4353 1.0982 0.2678  -0.0134 -0.1267 143 ARG A NH2 
1118 N N   . THR A 143 ? 0.3970 0.7325 0.4520 0.1045  0.0061  -0.1045 144 THR A N   
1119 C CA  . THR A 143 ? 0.3686 0.6882 0.4218 0.0750  0.0129  -0.1034 144 THR A CA  
1120 C C   . THR A 143 ? 0.3865 0.6737 0.4313 0.0656  0.0231  -0.0974 144 THR A C   
1121 O O   . THR A 143 ? 0.4329 0.7068 0.4724 0.0813  0.0241  -0.0943 144 THR A O   
1122 C CB  . THR A 143 ? 0.4179 0.7061 0.4551 0.0721  0.0075  -0.0940 144 THR A CB  
1123 O OG1 . THR A 143 ? 0.5232 0.7757 0.5429 0.0924  0.0040  -0.0812 144 THR A OG1 
1124 C CG2 . THR A 143 ? 0.4447 0.7690 0.4902 0.0740  -0.0016 -0.1029 144 THR A CG2 
1125 N N   . VAL A 144 ? 0.3743 0.6477 0.4163 0.0406  0.0304  -0.0961 145 VAL A N   
1126 C CA  . VAL A 144 ? 0.3190 0.5533 0.3466 0.0322  0.0376  -0.0876 145 VAL A CA  
1127 C C   . VAL A 144 ? 0.2994 0.4922 0.3109 0.0294  0.0336  -0.0765 145 VAL A C   
1128 O O   . VAL A 144 ? 0.3343 0.5286 0.3463 0.0194  0.0310  -0.0772 145 VAL A O   
1129 C CB  . VAL A 144 ? 0.3356 0.5793 0.3673 0.0085  0.0490  -0.0919 145 VAL A CB  
1130 C CG1 . VAL A 144 ? 0.2597 0.4633 0.2731 0.0025  0.0548  -0.0826 145 VAL A CG1 
1131 C CG2 . VAL A 144 ? 0.2576 0.5477 0.3074 0.0104  0.0545  -0.1040 145 VAL A CG2 
1132 N N   . LEU A 145 ? 0.3276 0.4852 0.3260 0.0382  0.0332  -0.0677 146 LEU A N   
1133 C CA  . LEU A 145 ? 0.3403 0.4611 0.3254 0.0351  0.0306  -0.0580 146 LEU A CA  
1134 C C   . LEU A 145 ? 0.4220 0.5154 0.3973 0.0242  0.0362  -0.0536 146 LEU A C   
1135 O O   . LEU A 145 ? 0.4632 0.5526 0.4364 0.0289  0.0393  -0.0547 146 LEU A O   
1136 C CB  . LEU A 145 ? 0.4005 0.5031 0.3788 0.0541  0.0250  -0.0513 146 LEU A CB  
1137 C CG  . LEU A 145 ? 0.6108 0.6913 0.5799 0.0506  0.0219  -0.0437 146 LEU A CG  
1138 C CD1 . LEU A 145 ? 0.6172 0.6875 0.5797 0.0687  0.0174  -0.0373 146 LEU A CD1 
1139 C CD2 . LEU A 145 ? 0.6378 0.6857 0.5984 0.0398  0.0252  -0.0378 146 LEU A CD2 
1140 N N   . VAL A 146 ? 0.3845 0.4599 0.3529 0.0111  0.0369  -0.0494 147 VAL A N   
1141 C CA  . VAL A 146 ? 0.3546 0.4031 0.3115 0.0026  0.0403  -0.0443 147 VAL A CA  
1142 C C   . VAL A 146 ? 0.4563 0.4777 0.4060 0.0057  0.0357  -0.0374 147 VAL A C   
1143 O O   . VAL A 146 ? 0.4390 0.4612 0.3900 0.0057  0.0324  -0.0364 147 VAL A O   
1144 C CB  . VAL A 146 ? 0.3864 0.4370 0.3405 -0.0156 0.0465  -0.0456 147 VAL A CB  
1145 C CG1 . VAL A 146 ? 0.2747 0.2980 0.2135 -0.0208 0.0496  -0.0394 147 VAL A CG1 
1146 C CG2 . VAL A 146 ? 0.3269 0.4105 0.2918 -0.0210 0.0524  -0.0537 147 VAL A CG2 
1147 N N   . SER A 147 ? 0.4771 0.4771 0.4197 0.0085  0.0355  -0.0338 148 SER A N   
1148 C CA  . SER A 147 ? 0.4390 0.4160 0.3764 0.0086  0.0326  -0.0283 148 SER A CA  
1149 C C   . SER A 147 ? 0.4513 0.4127 0.3798 0.0035  0.0336  -0.0268 148 SER A C   
1150 O O   . SER A 147 ? 0.4384 0.4034 0.3637 0.0039  0.0359  -0.0293 148 SER A O   
1151 C CB  . SER A 147 ? 0.3896 0.3576 0.3298 0.0199  0.0300  -0.0261 148 SER A CB  
1152 O OG  . SER A 147 ? 0.4280 0.3918 0.3686 0.0256  0.0308  -0.0287 148 SER A OG  
1153 N N   . MET A 148 ? 0.4351 0.3806 0.3585 0.0002  0.0317  -0.0230 149 MET A N   
1154 C CA  . MET A 148 ? 0.4209 0.3525 0.3344 -0.0019 0.0311  -0.0212 149 MET A CA  
1155 C C   . MET A 148 ? 0.4908 0.4101 0.4062 0.0027  0.0266  -0.0198 149 MET A C   
1156 O O   . MET A 148 ? 0.4418 0.3597 0.3635 0.0045  0.0256  -0.0185 149 MET A O   
1157 C CB  . MET A 148 ? 0.3687 0.2930 0.2716 -0.0110 0.0341  -0.0184 149 MET A CB  
1158 C CG  . MET A 148 ? 0.3953 0.3054 0.2958 -0.0122 0.0317  -0.0155 149 MET A CG  
1159 S SD  . MET A 148 ? 0.4639 0.3851 0.3763 -0.0118 0.0307  -0.0180 149 MET A SD  
1160 C CE  . MET A 148 ? 0.3986 0.3334 0.3120 -0.0231 0.0357  -0.0220 149 MET A CE  
1161 N N   . ASN A 149 ? 0.3870 0.2998 0.2969 0.0049  0.0241  -0.0208 150 ASN A N   
1162 C CA  . ASN A 149 ? 0.3927 0.2974 0.3048 0.0080  0.0196  -0.0207 150 ASN A CA  
1163 C C   . ASN A 149 ? 0.4560 0.3505 0.3574 0.0065  0.0185  -0.0165 150 ASN A C   
1164 O O   . ASN A 149 ? 0.4175 0.3067 0.3055 0.0033  0.0208  -0.0137 150 ASN A O   
1165 C CB  . ASN A 149 ? 0.3584 0.2641 0.2697 0.0117  0.0158  -0.0257 150 ASN A CB  
1166 C CG  . ASN A 149 ? 0.4480 0.3565 0.3731 0.0136  0.0158  -0.0309 150 ASN A CG  
1167 O OD1 . ASN A 149 ? 0.5712 0.4808 0.4990 0.0153  0.0125  -0.0373 150 ASN A OD1 
1168 N ND2 . ASN A 149 ? 0.3866 0.2954 0.3192 0.0134  0.0195  -0.0286 150 ASN A ND2 
1169 N N   . TYR A 150 ? 0.4378 0.3282 0.3444 0.0089  0.0160  -0.0161 151 TYR A N   
1170 C CA  . TYR A 150 ? 0.3856 0.2639 0.2823 0.0107  0.0142  -0.0130 151 TYR A CA  
1171 C C   . TYR A 150 ? 0.3679 0.2487 0.2723 0.0177  0.0088  -0.0159 151 TYR A C   
1172 O O   . TYR A 150 ? 0.3934 0.2840 0.3131 0.0177  0.0090  -0.0195 151 TYR A O   
1173 C CB  . TYR A 150 ? 0.4073 0.2798 0.3027 0.0061  0.0177  -0.0111 151 TYR A CB  
1174 C CG  . TYR A 150 ? 0.3515 0.2318 0.2599 0.0071  0.0184  -0.0131 151 TYR A CG  
1175 C CD1 . TYR A 150 ? 0.3707 0.2619 0.2864 0.0046  0.0212  -0.0138 151 TYR A CD1 
1176 C CD2 . TYR A 150 ? 0.3802 0.2575 0.2920 0.0118  0.0166  -0.0139 151 TYR A CD2 
1177 C CE1 . TYR A 150 ? 0.3181 0.2144 0.2413 0.0066  0.0224  -0.0139 151 TYR A CE1 
1178 C CE2 . TYR A 150 ? 0.3673 0.2519 0.2886 0.0125  0.0187  -0.0150 151 TYR A CE2 
1179 C CZ  . TYR A 150 ? 0.3861 0.2789 0.3116 0.0098  0.0218  -0.0143 151 TYR A CZ  
1180 O OH  . TYR A 150 ? 0.4141 0.3122 0.3449 0.0116  0.0245  -0.0138 151 TYR A OH  
1181 N N   . ARG A 151 ? 0.3847 0.2569 0.2782 0.0238  0.0045  -0.0144 152 ARG A N   
1182 C CA  . ARG A 151 ? 0.4422 0.3223 0.3446 0.0319  -0.0017 -0.0187 152 ARG A CA  
1183 C C   . ARG A 151 ? 0.4103 0.2942 0.3260 0.0322  0.0005  -0.0204 152 ARG A C   
1184 O O   . ARG A 151 ? 0.4174 0.2908 0.3271 0.0305  0.0040  -0.0172 152 ARG A O   
1185 C CB  . ARG A 151 ? 0.3692 0.2388 0.2541 0.0417  -0.0076 -0.0160 152 ARG A CB  
1186 C CG  . ARG A 151 ? 0.3376 0.2090 0.2097 0.0446  -0.0115 -0.0161 152 ARG A CG  
1187 C CD  . ARG A 151 ? 0.4550 0.3112 0.3035 0.0558  -0.0165 -0.0104 152 ARG A CD  
1188 N NE  . ARG A 151 ? 0.4736 0.3044 0.3009 0.0508  -0.0092 -0.0006 152 ARG A NE  
1189 C CZ  . ARG A 151 ? 0.5280 0.3355 0.3308 0.0586  -0.0102 0.0073  152 ARG A CZ  
1190 N NH1 . ARG A 151 ? 0.4923 0.3007 0.2876 0.0749  -0.0198 0.0069  152 ARG A NH1 
1191 N NH2 . ARG A 151 ? 0.5399 0.3230 0.3255 0.0504  -0.0014 0.0155  152 ARG A NH2 
1192 N N   . VAL A 152 ? 0.3645 0.2642 0.2983 0.0333  -0.0008 -0.0262 153 VAL A N   
1193 C CA  . VAL A 152 ? 0.4764 0.3826 0.4231 0.0332  0.0028  -0.0279 153 VAL A CA  
1194 C C   . VAL A 152 ? 0.4920 0.4114 0.4493 0.0414  -0.0025 -0.0340 153 VAL A C   
1195 O O   . VAL A 152 ? 0.4224 0.3469 0.3772 0.0475  -0.0100 -0.0373 153 VAL A O   
1196 C CB  . VAL A 152 ? 0.4710 0.3846 0.4311 0.0251  0.0094  -0.0285 153 VAL A CB  
1197 C CG1 . VAL A 152 ? 0.3520 0.2560 0.3023 0.0202  0.0140  -0.0228 153 VAL A CG1 
1198 C CG2 . VAL A 152 ? 0.2585 0.1813 0.2295 0.0222  0.0075  -0.0340 153 VAL A CG2 
1199 N N   . GLY A 153 ? 0.4257 0.3534 0.3946 0.0426  0.0012  -0.0363 154 GLY A N   
1200 C CA  . GLY A 153 ? 0.3273 0.2730 0.3100 0.0507  -0.0031 -0.0437 154 GLY A CA  
1201 C C   . GLY A 153 ? 0.3975 0.3346 0.3652 0.0649  -0.0118 -0.0430 154 GLY A C   
1202 O O   . GLY A 153 ? 0.4226 0.3358 0.3695 0.0675  -0.0114 -0.0361 154 GLY A O   
1203 N N   . ALA A 154 ? 0.3582 0.3149 0.3364 0.0743  -0.0197 -0.0505 155 ALA A N   
1204 C CA  . ALA A 154 ? 0.4626 0.4109 0.4248 0.0914  -0.0289 -0.0492 155 ALA A CA  
1205 C C   . ALA A 154 ? 0.5057 0.4290 0.4403 0.0923  -0.0320 -0.0405 155 ALA A C   
1206 O O   . ALA A 154 ? 0.5119 0.4104 0.4236 0.1016  -0.0339 -0.0335 155 ALA A O   
1207 C CB  . ALA A 154 ? 0.3939 0.3735 0.3734 0.1023  -0.0384 -0.0601 155 ALA A CB  
1208 N N   . PHE A 155 ? 0.4082 0.3360 0.3439 0.0823  -0.0316 -0.0409 156 PHE A N   
1209 C CA  . PHE A 155 ? 0.4525 0.3614 0.3630 0.0829  -0.0336 -0.0337 156 PHE A CA  
1210 C C   . PHE A 155 ? 0.4439 0.3234 0.3358 0.0759  -0.0253 -0.0234 156 PHE A C   
1211 O O   . PHE A 155 ? 0.4953 0.3540 0.3625 0.0785  -0.0258 -0.0158 156 PHE A O   
1212 C CB  . PHE A 155 ? 0.3555 0.2781 0.2735 0.0737  -0.0340 -0.0386 156 PHE A CB  
1213 C CG  . PHE A 155 ? 0.4379 0.3911 0.3788 0.0761  -0.0409 -0.0515 156 PHE A CG  
1214 C CD1 . PHE A 155 ? 0.4229 0.3883 0.3568 0.0884  -0.0527 -0.0568 156 PHE A CD1 
1215 C CD2 . PHE A 155 ? 0.4442 0.4143 0.4130 0.0659  -0.0354 -0.0588 156 PHE A CD2 
1216 C CE1 . PHE A 155 ? 0.4437 0.4414 0.4014 0.0896  -0.0597 -0.0713 156 PHE A CE1 
1217 C CE2 . PHE A 155 ? 0.4872 0.4864 0.4796 0.0654  -0.0404 -0.0722 156 PHE A CE2 
1218 C CZ  . PHE A 155 ? 0.5129 0.5277 0.5014 0.0769  -0.0531 -0.0796 156 PHE A CZ  
1219 N N   . GLY A 156 ? 0.4613 0.3396 0.3640 0.0671  -0.0176 -0.0235 157 GLY A N   
1220 C CA  . GLY A 156 ? 0.4780 0.3332 0.3663 0.0595  -0.0105 -0.0166 157 GLY A CA  
1221 C C   . GLY A 156 ? 0.4500 0.2900 0.3330 0.0646  -0.0086 -0.0158 157 GLY A C   
1222 O O   . GLY A 156 ? 0.4760 0.2923 0.3431 0.0599  -0.0042 -0.0109 157 GLY A O   
1223 N N   . PHE A 157 ? 0.3991 0.2531 0.2961 0.0736  -0.0113 -0.0218 158 PHE A N   
1224 C CA  . PHE A 157 ? 0.5181 0.3595 0.4118 0.0779  -0.0083 -0.0229 158 PHE A CA  
1225 C C   . PHE A 157 ? 0.5222 0.3696 0.4198 0.0957  -0.0143 -0.0277 158 PHE A C   
1226 O O   . PHE A 157 ? 0.5241 0.3637 0.4209 0.1010  -0.0117 -0.0306 158 PHE A O   
1227 C CB  . PHE A 157 ? 0.3837 0.2378 0.2922 0.0674  -0.0008 -0.0264 158 PHE A CB  
1228 C CG  . PHE A 157 ? 0.3835 0.2332 0.2881 0.0527  0.0042  -0.0225 158 PHE A CG  
1229 C CD1 . PHE A 157 ? 0.3912 0.2196 0.2810 0.0463  0.0079  -0.0199 158 PHE A CD1 
1230 C CD2 . PHE A 157 ? 0.3851 0.2522 0.3017 0.0454  0.0055  -0.0226 158 PHE A CD2 
1231 C CE1 . PHE A 157 ? 0.4602 0.2902 0.3490 0.0337  0.0119  -0.0179 158 PHE A CE1 
1232 C CE2 . PHE A 157 ? 0.4122 0.2772 0.3257 0.0347  0.0095  -0.0195 158 PHE A CE2 
1233 C CZ  . PHE A 157 ? 0.4240 0.2731 0.3244 0.0292  0.0124  -0.0174 158 PHE A CZ  
1234 N N   . LEU A 158 ? 0.4271 0.2899 0.3289 0.1063  -0.0227 -0.0299 159 LEU A N   
1235 C CA  . LEU A 158 ? 0.4800 0.3465 0.3815 0.1266  -0.0299 -0.0339 159 LEU A CA  
1236 C C   . LEU A 158 ? 0.5557 0.3806 0.4265 0.1363  -0.0307 -0.0257 159 LEU A C   
1237 O O   . LEU A 158 ? 0.5717 0.3724 0.4202 0.1322  -0.0305 -0.0167 159 LEU A O   
1238 C CB  . LEU A 158 ? 0.4588 0.3518 0.3692 0.1367  -0.0405 -0.0386 159 LEU A CB  
1239 C CG  . LEU A 158 ? 0.5260 0.4293 0.4377 0.1609  -0.0501 -0.0439 159 LEU A CG  
1240 C CD1 . LEU A 158 ? 0.4830 0.4335 0.4235 0.1644  -0.0573 -0.0562 159 LEU A CD1 
1241 C CD2 . LEU A 158 ? 0.4724 0.3438 0.3501 0.1775  -0.0577 -0.0344 159 LEU A CD2 
1242 N N   . ALA A 159 ? 0.5854 0.4000 0.4542 0.1485  -0.0304 -0.0290 160 ALA A N   
1243 C CA  . ALA A 159 ? 0.5808 0.3497 0.4203 0.1560  -0.0291 -0.0220 160 ALA A CA  
1244 C C   . ALA A 159 ? 0.6423 0.4076 0.4773 0.1827  -0.0368 -0.0255 160 ALA A C   
1245 O O   . ALA A 159 ? 0.6094 0.4000 0.4655 0.1904  -0.0371 -0.0359 160 ALA A O   
1246 C CB  . ALA A 159 ? 0.5581 0.3071 0.3950 0.1413  -0.0188 -0.0233 160 ALA A CB  
1247 N N   . LEU A 160 ? 0.6216 0.3566 0.4285 0.1976  -0.0425 -0.0165 161 LEU A N   
1248 C CA  . LEU A 160 ? 0.6943 0.4120 0.4884 0.2224  -0.0480 -0.0169 161 LEU A CA  
1249 C C   . LEU A 160 ? 0.7541 0.4212 0.5212 0.2124  -0.0391 -0.0079 161 LEU A C   
1250 O O   . LEU A 160 ? 0.7987 0.4366 0.5385 0.2134  -0.0393 0.0040  161 LEU A O   
1251 C CB  . LEU A 160 ? 0.7058 0.4368 0.4911 0.2421  -0.0605 -0.0133 161 LEU A CB  
1252 C CG  . LEU A 160 ? 0.6739 0.4618 0.4915 0.2523  -0.0703 -0.0259 161 LEU A CG  
1253 C CD1 . LEU A 160 ? 0.7520 0.5533 0.5581 0.2676  -0.0831 -0.0226 161 LEU A CD1 
1254 C CD2 . LEU A 160 ? 0.6885 0.5045 0.5311 0.2629  -0.0708 -0.0387 161 LEU A CD2 
1255 N N   . PRO A 161 ? 0.6889 0.3464 0.4634 0.2019  -0.0307 -0.0141 162 PRO A N   
1256 C CA  . PRO A 161 ? 0.7246 0.3379 0.4783 0.1867  -0.0212 -0.0081 162 PRO A CA  
1257 C C   . PRO A 161 ? 0.8545 0.4336 0.5817 0.1988  -0.0230 0.0010  162 PRO A C   
1258 O O   . PRO A 161 ? 0.9002 0.4865 0.6276 0.2207  -0.0301 -0.0015 162 PRO A O   
1259 C CB  . PRO A 161 ? 0.7514 0.3699 0.5209 0.1812  -0.0155 -0.0202 162 PRO A CB  
1260 C CG  . PRO A 161 ? 0.7093 0.3736 0.5066 0.1839  -0.0181 -0.0300 162 PRO A CG  
1261 C CD  . PRO A 161 ? 0.7149 0.4042 0.5174 0.2025  -0.0288 -0.0280 162 PRO A CD  
1262 N N   . GLY A 162 ? 0.8993 0.4420 0.6037 0.1841  -0.0157 0.0115  163 GLY A N   
1263 C CA  . GLY A 162 ? 0.9357 0.4419 0.6112 0.1930  -0.0152 0.0224  163 GLY A CA  
1264 C C   . GLY A 162 ? 1.0015 0.5114 0.6597 0.2037  -0.0216 0.0332  163 GLY A C   
1265 O O   . GLY A 162 ? 1.0487 0.5245 0.6788 0.2034  -0.0176 0.0450  163 GLY A O   
1266 N N   . SER A 163 ? 0.9727 0.5237 0.6471 0.2129  -0.0311 0.0290  164 SER A N   
1267 C CA  . SER A 163 ? 0.9647 0.5239 0.6236 0.2247  -0.0388 0.0370  164 SER A CA  
1268 C C   . SER A 163 ? 0.9488 0.4941 0.5934 0.2044  -0.0311 0.0467  164 SER A C   
1269 O O   . SER A 163 ? 0.9121 0.4572 0.5679 0.1822  -0.0226 0.0444  164 SER A O   
1270 C CB  . SER A 163 ? 0.9872 0.5982 0.6711 0.2394  -0.0518 0.0270  164 SER A CB  
1271 O OG  . SER A 163 ? 0.9347 0.5683 0.6370 0.2233  -0.0499 0.0231  164 SER A OG  
1272 N N   . ARG A 164 ? 0.9503 0.4861 0.5695 0.2130  -0.0340 0.0572  165 ARG A N   
1273 C CA  . ARG A 164 ? 0.9447 0.4714 0.5487 0.1966  -0.0270 0.0666  165 ARG A CA  
1274 C C   . ARG A 164 ? 0.8404 0.4076 0.4590 0.1977  -0.0354 0.0620  165 ARG A C   
1275 O O   . ARG A 164 ? 0.7444 0.3128 0.3634 0.1787  -0.0285 0.0648  165 ARG A O   
1276 C CB  . ARG A 164 ? 1.2011 0.6971 0.7688 0.2052  -0.0247 0.0802  165 ARG A CB  
1277 C CG  . ARG A 164 ? 1.4783 0.9984 1.0355 0.2272  -0.0379 0.0820  165 ARG A CG  
1278 C CD  . ARG A 164 ? 1.6883 1.1753 1.2071 0.2365  -0.0347 0.0961  165 ARG A CD  
1279 N NE  . ARG A 164 ? 1.7783 1.2352 1.2781 0.2134  -0.0188 0.1075  165 ARG A NE  
1280 C CZ  . ARG A 164 ? 1.7984 1.2696 1.3035 0.1945  -0.0133 0.1083  165 ARG A CZ  
1281 N NH1 . ARG A 164 ? 1.8018 1.3146 1.3289 0.1956  -0.0225 0.0990  165 ARG A NH1 
1282 N NH2 . ARG A 164 ? 1.7841 1.2280 1.2725 0.1741  0.0022  0.1180  165 ARG A NH2 
1283 N N   . GLU A 165 ? 0.8140 0.4165 0.4468 0.2190  -0.0501 0.0537  166 GLU A N   
1284 C CA  . GLU A 165 ? 0.8509 0.4930 0.4972 0.2214  -0.0595 0.0482  166 GLU A CA  
1285 C C   . GLU A 165 ? 0.7975 0.4695 0.4811 0.2057  -0.0575 0.0362  166 GLU A C   
1286 O O   . GLU A 165 ? 0.7724 0.4807 0.4739 0.1952  -0.0598 0.0298  166 GLU A O   
1287 C CB  . GLU A 165 ? 0.9681 0.6431 0.6191 0.2477  -0.0759 0.0413  166 GLU A CB  
1288 C CG  . GLU A 165 ? 1.1933 0.8485 0.8087 0.2613  -0.0782 0.0520  166 GLU A CG  
1289 C CD  . GLU A 165 ? 1.3609 1.0043 0.9527 0.2488  -0.0722 0.0623  166 GLU A CD  
1290 O OE1 . GLU A 165 ? 1.3629 1.0353 0.9680 0.2410  -0.0760 0.0568  166 GLU A OE1 
1291 O OE2 . GLU A 165 ? 1.4706 1.0762 1.0308 0.2466  -0.0632 0.0757  166 GLU A OE2 
1292 N N   . ALA A 166 ? 0.7102 0.3746 0.4100 0.1992  -0.0511 0.0307  167 ALA A N   
1293 C CA  . ALA A 166 ? 0.7052 0.4042 0.4434 0.1802  -0.0465 0.0182  167 ALA A CA  
1294 C C   . ALA A 166 ? 0.7384 0.4100 0.4775 0.1693  -0.0358 0.0176  167 ALA A C   
1295 O O   . ALA A 166 ? 0.6398 0.3213 0.3958 0.1766  -0.0370 0.0086  167 ALA A O   
1296 C CB  . ALA A 166 ? 0.6201 0.3668 0.3900 0.1929  -0.0568 0.0043  167 ALA A CB  
1297 N N   . PRO A 167 ? 0.7924 0.4315 0.5141 0.1510  -0.0248 0.0257  168 PRO A N   
1298 C CA  . PRO A 167 ? 0.7198 0.3298 0.4393 0.1407  -0.0153 0.0240  168 PRO A CA  
1299 C C   . PRO A 167 ? 0.7586 0.3998 0.5102 0.1247  -0.0112 0.0120  168 PRO A C   
1300 O O   . PRO A 167 ? 0.7913 0.4163 0.5446 0.1196  -0.0056 0.0070  168 PRO A O   
1301 C CB  . PRO A 167 ? 0.7487 0.3209 0.4420 0.1239  -0.0048 0.0354  168 PRO A CB  
1302 C CG  . PRO A 167 ? 0.7219 0.3227 0.4192 0.1161  -0.0063 0.0385  168 PRO A CG  
1303 C CD  . PRO A 167 ? 0.7221 0.3528 0.4266 0.1382  -0.0202 0.0353  168 PRO A CD  
1304 N N   . GLY A 168 ? 0.6576 0.3408 0.4327 0.1172  -0.0135 0.0072  169 GLY A N   
1305 C CA  . GLY A 168 ? 0.5784 0.2885 0.3801 0.1034  -0.0091 -0.0019 169 GLY A CA  
1306 C C   . GLY A 168 ? 0.6604 0.3654 0.4610 0.0804  -0.0003 0.0004  169 GLY A C   
1307 O O   . GLY A 168 ? 0.6839 0.3603 0.4638 0.0726  0.0047  0.0078  169 GLY A O   
1308 N N   . ASN A 169 ? 0.5580 0.2926 0.3814 0.0698  0.0020  -0.0062 170 ASN A N   
1309 C CA  . ASN A 169 ? 0.5324 0.2708 0.3596 0.0504  0.0090  -0.0063 170 ASN A CA  
1310 C C   . ASN A 169 ? 0.5795 0.3190 0.3992 0.0422  0.0104  0.0002  170 ASN A C   
1311 O O   . ASN A 169 ? 0.5799 0.3177 0.3986 0.0269  0.0168  0.0008  170 ASN A O   
1312 C CB  . ASN A 169 ? 0.5830 0.2942 0.3994 0.0415  0.0153  -0.0082 170 ASN A CB  
1313 C CG  . ASN A 169 ? 0.6827 0.3959 0.5069 0.0483  0.0147  -0.0168 170 ASN A CG  
1314 O OD1 . ASN A 169 ? 0.6988 0.3831 0.5103 0.0507  0.0168  -0.0192 170 ASN A OD1 
1315 N ND2 . ASN A 169 ? 0.5271 0.2728 0.3711 0.0517  0.0126  -0.0217 170 ASN A ND2 
1316 N N   . VAL A 170 ? 0.4926 0.2389 0.3082 0.0523  0.0045  0.0038  171 VAL A N   
1317 C CA  . VAL A 170 ? 0.5549 0.3013 0.3604 0.0453  0.0066  0.0095  171 VAL A CA  
1318 C C   . VAL A 170 ? 0.5415 0.3164 0.3666 0.0334  0.0092  0.0049  171 VAL A C   
1319 O O   . VAL A 170 ? 0.4713 0.2464 0.2910 0.0228  0.0144  0.0077  171 VAL A O   
1320 C CB  . VAL A 170 ? 0.5625 0.3102 0.3562 0.0602  -0.0014 0.0133  171 VAL A CB  
1321 C CG1 . VAL A 170 ? 0.5680 0.2839 0.3383 0.0749  -0.0042 0.0195  171 VAL A CG1 
1322 C CG2 . VAL A 170 ? 0.5268 0.3089 0.3440 0.0678  -0.0094 0.0049  171 VAL A CG2 
1323 N N   . GLY A 171 ? 0.5124 0.3106 0.3595 0.0351  0.0067  -0.0019 172 GLY A N   
1324 C CA  . GLY A 171 ? 0.3983 0.2178 0.2614 0.0253  0.0098  -0.0052 172 GLY A CA  
1325 C C   . GLY A 171 ? 0.5219 0.3366 0.3836 0.0128  0.0167  -0.0053 172 GLY A C   
1326 O O   . GLY A 171 ? 0.5302 0.3577 0.3973 0.0049  0.0197  -0.0059 172 GLY A O   
1327 N N   . LEU A 172 ? 0.4335 0.2312 0.2886 0.0114  0.0188  -0.0062 173 LEU A N   
1328 C CA  . LEU A 172 ? 0.4612 0.2555 0.3152 -0.0019 0.0247  -0.0084 173 LEU A CA  
1329 C C   . LEU A 172 ? 0.4949 0.2744 0.3344 -0.0111 0.0299  -0.0035 173 LEU A C   
1330 O O   . LEU A 172 ? 0.5053 0.2952 0.3493 -0.0235 0.0350  -0.0058 173 LEU A O   
1331 C CB  . LEU A 172 ? 0.4538 0.2329 0.3045 -0.0015 0.0256  -0.0129 173 LEU A CB  
1332 C CG  . LEU A 172 ? 0.5166 0.3132 0.3811 0.0033  0.0235  -0.0192 173 LEU A CG  
1333 C CD1 . LEU A 172 ? 0.5007 0.2783 0.3581 0.0058  0.0243  -0.0242 173 LEU A CD1 
1334 C CD2 . LEU A 172 ? 0.4730 0.2929 0.3485 -0.0054 0.0254  -0.0226 173 LEU A CD2 
1335 N N   . LEU A 173 ? 0.4524 0.2090 0.2738 -0.0045 0.0292  0.0033  174 LEU A N   
1336 C CA  . LEU A 173 ? 0.5728 0.3146 0.3772 -0.0128 0.0356  0.0098  174 LEU A CA  
1337 C C   . LEU A 173 ? 0.5630 0.3299 0.3738 -0.0149 0.0359  0.0103  174 LEU A C   
1338 O O   . LEU A 173 ? 0.6133 0.3809 0.4187 -0.0265 0.0435  0.0122  174 LEU A O   
1339 C CB  . LEU A 173 ? 0.4992 0.2086 0.2786 -0.0022 0.0343  0.0186  174 LEU A CB  
1340 C CG  . LEU A 173 ? 0.7130 0.3897 0.4819 -0.0013 0.0363  0.0184  174 LEU A CG  
1341 C CD1 . LEU A 173 ? 0.7028 0.3460 0.4451 0.0137  0.0337  0.0280  174 LEU A CD1 
1342 C CD2 . LEU A 173 ? 0.5762 0.2387 0.3430 -0.0219 0.0470  0.0160  174 LEU A CD2 
1343 N N   . ASP A 174 ? 0.5273 0.3149 0.3502 -0.0046 0.0285  0.0075  175 ASP A N   
1344 C CA  . ASP A 174 ? 0.4991 0.3102 0.3304 -0.0065 0.0288  0.0055  175 ASP A CA  
1345 C C   . ASP A 174 ? 0.5331 0.3616 0.3785 -0.0183 0.0342  0.0007  175 ASP A C   
1346 O O   . ASP A 174 ? 0.5072 0.3451 0.3512 -0.0255 0.0396  0.0007  175 ASP A O   
1347 C CB  . ASP A 174 ? 0.4118 0.2400 0.2567 0.0043  0.0207  0.0013  175 ASP A CB  
1348 C CG  . ASP A 174 ? 0.5298 0.3496 0.3636 0.0169  0.0137  0.0037  175 ASP A CG  
1349 O OD1 . ASP A 174 ? 0.5450 0.3783 0.3924 0.0246  0.0072  -0.0012 175 ASP A OD1 
1350 O OD2 . ASP A 174 ? 0.5309 0.3315 0.3422 0.0195  0.0147  0.0104  175 ASP A OD2 
1351 N N   . GLN A 175 ? 0.4921 0.3273 0.3507 -0.0191 0.0327  -0.0040 176 GLN A N   
1352 C CA  . GLN A 175 ? 0.4522 0.3061 0.3234 -0.0279 0.0361  -0.0094 176 GLN A CA  
1353 C C   . GLN A 175 ? 0.4773 0.3247 0.3415 -0.0422 0.0439  -0.0098 176 GLN A C   
1354 O O   . GLN A 175 ? 0.4845 0.3515 0.3559 -0.0497 0.0482  -0.0128 176 GLN A O   
1355 C CB  . GLN A 175 ? 0.4412 0.3000 0.3222 -0.0252 0.0329  -0.0137 176 GLN A CB  
1356 C CG  . GLN A 175 ? 0.3986 0.2646 0.2879 -0.0137 0.0276  -0.0134 176 GLN A CG  
1357 C CD  . GLN A 175 ? 0.4518 0.3195 0.3464 -0.0111 0.0262  -0.0166 176 GLN A CD  
1358 O OE1 . GLN A 175 ? 0.4591 0.3260 0.3523 -0.0174 0.0280  -0.0204 176 GLN A OE1 
1359 N NE2 . GLN A 175 ? 0.3838 0.2552 0.2848 -0.0026 0.0236  -0.0159 176 GLN A NE2 
1360 N N   . ARG A 176 ? 0.4400 0.2599 0.2907 -0.0464 0.0466  -0.0072 177 ARG A N   
1361 C CA  . ARG A 176 ? 0.4710 0.2803 0.3148 -0.0628 0.0558  -0.0077 177 ARG A CA  
1362 C C   . ARG A 176 ? 0.5372 0.3483 0.3716 -0.0679 0.0627  -0.0022 177 ARG A C   
1363 O O   . ARG A 176 ? 0.4676 0.2916 0.3074 -0.0824 0.0709  -0.0057 177 ARG A O   
1364 C CB  . ARG A 176 ? 0.5188 0.2901 0.3460 -0.0645 0.0579  -0.0047 177 ARG A CB  
1365 C CG  . ARG A 176 ? 0.5785 0.3306 0.3956 -0.0834 0.0695  -0.0042 177 ARG A CG  
1366 C CD  . ARG A 176 ? 0.6272 0.3357 0.4262 -0.0835 0.0715  -0.0012 177 ARG A CD  
1367 N NE  . ARG A 176 ? 0.7159 0.4269 0.5267 -0.0844 0.0674  -0.0121 177 ARG A NE  
1368 C CZ  . ARG A 176 ? 0.7707 0.4484 0.5698 -0.0798 0.0665  -0.0127 177 ARG A CZ  
1369 N NH1 . ARG A 176 ? 0.7449 0.3829 0.5198 -0.0728 0.0689  -0.0018 177 ARG A NH1 
1370 N NH2 . ARG A 176 ? 0.7281 0.4118 0.5380 -0.0806 0.0629  -0.0242 177 ARG A NH2 
1371 N N   . LEU A 177 ? 0.5552 0.3562 0.3759 -0.0561 0.0596  0.0054  178 LEU A N   
1372 C CA  . LEU A 177 ? 0.5382 0.3423 0.3474 -0.0594 0.0660  0.0104  178 LEU A CA  
1373 C C   . LEU A 177 ? 0.5635 0.4053 0.3920 -0.0622 0.0671  0.0031  178 LEU A C   
1374 O O   . LEU A 177 ? 0.5082 0.3610 0.3360 -0.0733 0.0766  0.0024  178 LEU A O   
1375 C CB  . LEU A 177 ? 0.4936 0.2847 0.2850 -0.0438 0.0599  0.0177  178 LEU A CB  
1376 C CG  . LEU A 177 ? 0.5605 0.3533 0.3349 -0.0445 0.0658  0.0232  178 LEU A CG  
1377 C CD1 . LEU A 177 ? 0.5193 0.2930 0.2772 -0.0608 0.0801  0.0295  178 LEU A CD1 
1378 C CD2 . LEU A 177 ? 0.5277 0.3073 0.2821 -0.0276 0.0579  0.0295  178 LEU A CD2 
1379 N N   . ALA A 178 ? 0.4270 0.2884 0.2728 -0.0520 0.0584  -0.0025 179 ALA A N   
1380 C CA  . ALA A 178 ? 0.4384 0.3324 0.3018 -0.0519 0.0587  -0.0094 179 ALA A CA  
1381 C C   . ALA A 178 ? 0.5126 0.4242 0.3888 -0.0657 0.0649  -0.0159 179 ALA A C   
1382 O O   . ALA A 178 ? 0.4832 0.4181 0.3667 -0.0713 0.0708  -0.0200 179 ALA A O   
1383 C CB  . ALA A 178 ? 0.3962 0.3008 0.2732 -0.0389 0.0493  -0.0127 179 ALA A CB  
1384 N N   . LEU A 179 ? 0.4436 0.3466 0.3233 -0.0712 0.0634  -0.0185 180 LEU A N   
1385 C CA  . LEU A 179 ? 0.4838 0.4044 0.3761 -0.0857 0.0684  -0.0269 180 LEU A CA  
1386 C C   . LEU A 179 ? 0.5450 0.4599 0.4293 -0.1030 0.0812  -0.0254 180 LEU A C   
1387 O O   . LEU A 179 ? 0.5212 0.4647 0.4200 -0.1143 0.0873  -0.0333 180 LEU A O   
1388 C CB  . LEU A 179 ? 0.4739 0.3816 0.3677 -0.0884 0.0645  -0.0307 180 LEU A CB  
1389 C CG  . LEU A 179 ? 0.4815 0.3995 0.3840 -0.0734 0.0540  -0.0329 180 LEU A CG  
1390 C CD1 . LEU A 179 ? 0.4887 0.3986 0.3924 -0.0770 0.0511  -0.0387 180 LEU A CD1 
1391 C CD2 . LEU A 179 ? 0.5218 0.4767 0.4408 -0.0677 0.0511  -0.0382 180 LEU A CD2 
1392 N N   . GLN A 180 ? 0.5248 0.4036 0.3859 -0.1050 0.0860  -0.0153 181 GLN A N   
1393 C CA  . GLN A 180 ? 0.5657 0.4347 0.4146 -0.1210 0.1001  -0.0112 181 GLN A CA  
1394 C C   . GLN A 180 ? 0.5282 0.4251 0.3803 -0.1189 0.1047  -0.0114 181 GLN A C   
1395 O O   . GLN A 180 ? 0.5509 0.4637 0.4075 -0.1345 0.1169  -0.0146 181 GLN A O   
1396 C CB  . GLN A 180 ? 0.6415 0.4625 0.4601 -0.1192 0.1032  0.0018  181 GLN A CB  
1397 C CG  . GLN A 180 ? 0.8228 0.6121 0.6362 -0.1258 0.1032  0.0010  181 GLN A CG  
1398 C CD  . GLN A 180 ? 0.8936 0.6355 0.6771 -0.1158 0.1022  0.0140  181 GLN A CD  
1399 O OE1 . GLN A 180 ? 0.9904 0.7268 0.7584 -0.1016 0.0988  0.0229  181 GLN A OE1 
1400 N NE2 . GLN A 180 ? 0.8290 0.5369 0.6039 -0.1220 0.1047  0.0141  181 GLN A NE2 
1401 N N   . TRP A 181 ? 0.4429 0.3471 0.2937 -0.1003 0.0957  -0.0094 182 TRP A N   
1402 C CA  . TRP A 181 ? 0.5283 0.4588 0.3823 -0.0961 0.0991  -0.0116 182 TRP A CA  
1403 C C   . TRP A 181 ? 0.4913 0.4645 0.3729 -0.1009 0.1007  -0.0240 182 TRP A C   
1404 O O   . TRP A 181 ? 0.4721 0.4694 0.3585 -0.1075 0.1102  -0.0277 182 TRP A O   
1405 C CB  . TRP A 181 ? 0.4882 0.4161 0.3376 -0.0757 0.0879  -0.0095 182 TRP A CB  
1406 C CG  . TRP A 181 ? 0.4885 0.4364 0.3366 -0.0693 0.0905  -0.0121 182 TRP A CG  
1407 C CD1 . TRP A 181 ? 0.4868 0.4231 0.3121 -0.0656 0.0942  -0.0059 182 TRP A CD1 
1408 C CD2 . TRP A 181 ? 0.4869 0.4696 0.3558 -0.0635 0.0891  -0.0220 182 TRP A CD2 
1409 N NE1 . TRP A 181 ? 0.5102 0.4725 0.3415 -0.0592 0.0956  -0.0127 182 TRP A NE1 
1410 C CE2 . TRP A 181 ? 0.5356 0.5255 0.3939 -0.0574 0.0927  -0.0225 182 TRP A CE2 
1411 C CE3 . TRP A 181 ? 0.4805 0.4883 0.3740 -0.0612 0.0847  -0.0307 182 TRP A CE3 
1412 C CZ2 . TRP A 181 ? 0.5161 0.5361 0.3891 -0.0493 0.0926  -0.0320 182 TRP A CZ2 
1413 C CZ3 . TRP A 181 ? 0.4516 0.4887 0.3587 -0.0521 0.0842  -0.0387 182 TRP A CZ3 
1414 C CH2 . TRP A 181 ? 0.4635 0.5057 0.3610 -0.0463 0.0884  -0.0396 182 TRP A CH2 
1415 N N   . VAL A 182 ? 0.4841 0.4690 0.3836 -0.0967 0.0916  -0.0306 183 VAL A N   
1416 C CA  . VAL A 182 ? 0.3642 0.3908 0.2890 -0.0980 0.0908  -0.0425 183 VAL A CA  
1417 C C   . VAL A 182 ? 0.4870 0.5299 0.4204 -0.1204 0.1030  -0.0489 183 VAL A C   
1418 O O   . VAL A 182 ? 0.5128 0.5926 0.4614 -0.1243 0.1091  -0.0568 183 VAL A O   
1419 C CB  . VAL A 182 ? 0.4098 0.4407 0.3462 -0.0885 0.0785  -0.0467 183 VAL A CB  
1420 C CG1 . VAL A 182 ? 0.3075 0.3818 0.2680 -0.0893 0.0766  -0.0591 183 VAL A CG1 
1421 C CG2 . VAL A 182 ? 0.3777 0.3969 0.3085 -0.0681 0.0688  -0.0412 183 VAL A CG2 
1422 N N   . GLN A 183 ? 0.4470 0.4627 0.3718 -0.1357 0.1075  -0.0465 184 GLN A N   
1423 C CA  . GLN A 183 ? 0.4864 0.5123 0.4188 -0.1606 0.1210  -0.0528 184 GLN A CA  
1424 C C   . GLN A 183 ? 0.6020 0.6338 0.5260 -0.1695 0.1360  -0.0484 184 GLN A C   
1425 O O   . GLN A 183 ? 0.6124 0.6780 0.5537 -0.1851 0.1465  -0.0578 184 GLN A O   
1426 C CB  . GLN A 183 ? 0.4858 0.4693 0.4040 -0.1744 0.1244  -0.0488 184 GLN A CB  
1427 C CG  . GLN A 183 ? 0.5445 0.5327 0.4764 -0.1731 0.1135  -0.0586 184 GLN A CG  
1428 C CD  . GLN A 183 ? 0.5524 0.5925 0.5147 -0.1817 0.1126  -0.0760 184 GLN A CD  
1429 O OE1 . GLN A 183 ? 0.5916 0.6468 0.5646 -0.2043 0.1245  -0.0841 184 GLN A OE1 
1430 N NE2 . GLN A 183 ? 0.5414 0.6101 0.5175 -0.1635 0.0988  -0.0820 184 GLN A NE2 
1431 N N   . GLU A 184 ? 0.5501 0.5521 0.4476 -0.1597 0.1373  -0.0350 185 GLU A N   
1432 C CA  . GLU A 184 ? 0.6114 0.6144 0.4951 -0.1685 0.1528  -0.0294 185 GLU A CA  
1433 C C   . GLU A 184 ? 0.5156 0.5603 0.4115 -0.1563 0.1522  -0.0359 185 GLU A C   
1434 O O   . GLU A 184 ? 0.5069 0.5683 0.4004 -0.1664 0.1668  -0.0364 185 GLU A O   
1435 C CB  . GLU A 184 ? 0.7343 0.6875 0.5806 -0.1626 0.1546  -0.0124 185 GLU A CB  
1436 C CG  . GLU A 184 ? 0.9926 0.9009 0.8211 -0.1784 0.1621  -0.0043 185 GLU A CG  
1437 C CD  . GLU A 184 ? 1.1727 1.0320 0.9627 -0.1676 0.1614  0.0130  185 GLU A CD  
1438 O OE1 . GLU A 184 ? 1.2231 1.0865 0.9977 -0.1548 0.1609  0.0189  185 GLU A OE1 
1439 O OE2 . GLU A 184 ? 1.2356 1.0531 1.0104 -0.1708 0.1610  0.0198  185 GLU A OE2 
1440 N N   . ASN A 185 ? 0.4626 0.5235 0.3712 -0.1353 0.1369  -0.0411 186 ASN A N   
1441 C CA  . ASN A 185 ? 0.4274 0.5150 0.3404 -0.1198 0.1354  -0.0452 186 ASN A CA  
1442 C C   . ASN A 185 ? 0.4704 0.5992 0.4127 -0.1076 0.1263  -0.0583 186 ASN A C   
1443 O O   . ASN A 185 ? 0.4757 0.6315 0.4248 -0.0970 0.1279  -0.0641 186 ASN A O   
1444 C CB  . ASN A 185 ? 0.4873 0.5447 0.3778 -0.1013 0.1263  -0.0362 186 ASN A CB  
1445 C CG  . ASN A 185 ? 0.5119 0.5342 0.3700 -0.1079 0.1348  -0.0233 186 ASN A CG  
1446 O OD1 . ASN A 185 ? 0.5441 0.5302 0.3843 -0.1021 0.1276  -0.0141 186 ASN A OD1 
1447 N ND2 . ASN A 185 ? 0.4497 0.4834 0.2994 -0.1191 0.1506  -0.0223 186 ASN A ND2 
1448 N N   . VAL A 186 ? 0.3821 0.5162 0.3400 -0.1070 0.1168  -0.0632 187 VAL A N   
1449 C CA  . VAL A 186 ? 0.3364 0.5032 0.3159 -0.0901 0.1060  -0.0727 187 VAL A CA  
1450 C C   . VAL A 186 ? 0.3891 0.6079 0.3920 -0.0944 0.1134  -0.0858 187 VAL A C   
1451 O O   . VAL A 186 ? 0.3968 0.6437 0.4131 -0.0760 0.1069  -0.0930 187 VAL A O   
1452 C CB  . VAL A 186 ? 0.3564 0.5174 0.3438 -0.0875 0.0943  -0.0744 187 VAL A CB  
1453 C CG1 . VAL A 186 ? 0.3096 0.4994 0.3162 -0.1055 0.0984  -0.0853 187 VAL A CG1 
1454 C CG2 . VAL A 186 ? 0.3052 0.4784 0.3009 -0.0632 0.0813  -0.0769 187 VAL A CG2 
1455 N N   . ALA A 187 ? 0.3329 0.5648 0.3408 -0.1182 0.1275  -0.0894 188 ALA A N   
1456 C CA  . ALA A 187 ? 0.4060 0.6929 0.4392 -0.1242 0.1359  -0.1034 188 ALA A CA  
1457 C C   . ALA A 187 ? 0.4647 0.7676 0.4940 -0.1109 0.1415  -0.1042 188 ALA A C   
1458 O O   . ALA A 187 ? 0.4765 0.8283 0.5287 -0.1038 0.1430  -0.1170 188 ALA A O   
1459 C CB  . ALA A 187 ? 0.3539 0.6477 0.3924 -0.1560 0.1524  -0.1067 188 ALA A CB  
1460 N N   . ALA A 188 ? 0.4840 0.7483 0.4847 -0.1061 0.1442  -0.0919 189 ALA A N   
1461 C CA  . ALA A 188 ? 0.4773 0.7544 0.4718 -0.0922 0.1486  -0.0939 189 ALA A CA  
1462 C C   . ALA A 188 ? 0.4719 0.7628 0.4780 -0.0642 0.1341  -0.1007 189 ALA A C   
1463 O O   . ALA A 188 ? 0.5120 0.8275 0.5227 -0.0514 0.1374  -0.1081 189 ALA A O   
1464 C CB  . ALA A 188 ? 0.3903 0.6227 0.3499 -0.0922 0.1525  -0.0802 189 ALA A CB  
1465 N N   . PHE A 189 ? 0.3852 0.6591 0.3943 -0.0542 0.1191  -0.0981 190 PHE A N   
1466 C CA  . PHE A 189 ? 0.3749 0.6576 0.3936 -0.0284 0.1060  -0.1030 190 PHE A CA  
1467 C C   . PHE A 189 ? 0.4128 0.7394 0.4593 -0.0237 0.1008  -0.1143 190 PHE A C   
1468 O O   . PHE A 189 ? 0.4636 0.7967 0.5168 -0.0009 0.0896  -0.1172 190 PHE A O   
1469 C CB  . PHE A 189 ? 0.3956 0.6329 0.3991 -0.0189 0.0936  -0.0925 190 PHE A CB  
1470 C CG  . PHE A 189 ? 0.4330 0.6298 0.4108 -0.0220 0.0960  -0.0825 190 PHE A CG  
1471 C CD1 . PHE A 189 ? 0.4394 0.6114 0.4024 -0.0405 0.1013  -0.0737 190 PHE A CD1 
1472 C CD2 . PHE A 189 ? 0.4148 0.5979 0.3827 -0.0055 0.0925  -0.0828 190 PHE A CD2 
1473 C CE1 . PHE A 189 ? 0.4061 0.5434 0.3444 -0.0406 0.1020  -0.0647 190 PHE A CE1 
1474 C CE2 . PHE A 189 ? 0.3635 0.5137 0.3085 -0.0076 0.0932  -0.0756 190 PHE A CE2 
1475 C CZ  . PHE A 189 ? 0.3890 0.5178 0.3190 -0.0242 0.0974  -0.0662 190 PHE A CZ  
1476 N N   . GLY A 190 ? 0.4030 0.7591 0.4650 -0.0443 0.1084  -0.1209 191 GLY A N   
1477 C CA  . GLY A 190 ? 0.3951 0.7967 0.4844 -0.0411 0.1020  -0.1335 191 GLY A CA  
1478 C C   . GLY A 190 ? 0.3973 0.7848 0.4873 -0.0478 0.0922  -0.1311 191 GLY A C   
1479 O O   . GLY A 190 ? 0.4232 0.8486 0.5340 -0.0436 0.0847  -0.1420 191 GLY A O   
1480 N N   . GLY A 191 ? 0.3808 0.7173 0.4486 -0.0568 0.0916  -0.1182 192 GLY A N   
1481 C CA  . GLY A 191 ? 0.3566 0.6783 0.4235 -0.0629 0.0832  -0.1166 192 GLY A CA  
1482 C C   . GLY A 191 ? 0.4231 0.7577 0.5002 -0.0920 0.0922  -0.1237 192 GLY A C   
1483 O O   . GLY A 191 ? 0.4553 0.7932 0.5322 -0.1112 0.1073  -0.1244 192 GLY A O   
1484 N N   . ASP A 192 ? 0.4002 0.7411 0.4853 -0.0955 0.0834  -0.1294 193 ASP A N   
1485 C CA  . ASP A 192 ? 0.3989 0.7504 0.4951 -0.1234 0.0903  -0.1387 193 ASP A CA  
1486 C C   . ASP A 192 ? 0.4452 0.7401 0.5185 -0.1349 0.0910  -0.1277 193 ASP A C   
1487 O O   . ASP A 192 ? 0.4754 0.7548 0.5426 -0.1245 0.0787  -0.1258 193 ASP A O   
1488 C CB  . ASP A 192 ? 0.4064 0.8068 0.5276 -0.1198 0.0794  -0.1556 193 ASP A CB  
1489 C CG  . ASP A 192 ? 0.4680 0.8887 0.6064 -0.1509 0.0872  -0.1700 193 ASP A CG  
1490 O OD1 . ASP A 192 ? 0.5072 0.8913 0.6335 -0.1751 0.1000  -0.1642 193 ASP A OD1 
1491 O OD2 . ASP A 192 ? 0.5011 0.9751 0.6655 -0.1508 0.0804  -0.1878 193 ASP A OD2 
1492 N N   . PRO A 193 ? 0.4610 0.7238 0.5200 -0.1551 0.1052  -0.1202 194 PRO A N   
1493 C CA  . PRO A 193 ? 0.4481 0.6567 0.4851 -0.1640 0.1053  -0.1104 194 PRO A CA  
1494 C C   . PRO A 193 ? 0.4518 0.6659 0.4999 -0.1785 0.1015  -0.1222 194 PRO A C   
1495 O O   . PRO A 193 ? 0.4435 0.6160 0.4751 -0.1799 0.0979  -0.1162 194 PRO A O   
1496 C CB  . PRO A 193 ? 0.4637 0.6434 0.4841 -0.1826 0.1230  -0.1010 194 PRO A CB  
1497 C CG  . PRO A 193 ? 0.4177 0.6455 0.4588 -0.1937 0.1346  -0.1114 194 PRO A CG  
1498 C CD  . PRO A 193 ? 0.4361 0.7092 0.4958 -0.1690 0.1223  -0.1194 194 PRO A CD  
1499 N N   . THR A 194 ? 0.3924 0.6584 0.4686 -0.1884 0.1016  -0.1404 195 THR A N   
1500 C CA  . THR A 194 ? 0.4461 0.7231 0.5344 -0.2007 0.0958  -0.1549 195 THR A CA  
1501 C C   . THR A 194 ? 0.4677 0.7694 0.5623 -0.1760 0.0763  -0.1607 195 THR A C   
1502 O O   . THR A 194 ? 0.4924 0.8141 0.5989 -0.1830 0.0695  -0.1755 195 THR A O   
1503 C CB  . THR A 194 ? 0.4303 0.7522 0.5468 -0.2278 0.1063  -0.1740 195 THR A CB  
1504 O OG1 . THR A 194 ? 0.4512 0.8396 0.5947 -0.2140 0.0982  -0.1875 195 THR A OG1 
1505 C CG2 . THR A 194 ? 0.4558 0.7604 0.5659 -0.2494 0.1277  -0.1665 195 THR A CG2 
1506 N N   . SER A 195 ? 0.4569 0.7554 0.5420 -0.1473 0.0676  -0.1494 196 SER A N   
1507 C CA  . SER A 195 ? 0.3970 0.7077 0.4809 -0.1223 0.0506  -0.1504 196 SER A CA  
1508 C C   . SER A 195 ? 0.3855 0.6535 0.4454 -0.1009 0.0467  -0.1310 196 SER A C   
1509 O O   . SER A 195 ? 0.3579 0.6355 0.4176 -0.0809 0.0435  -0.1252 196 SER A O   
1510 C CB  . SER A 195 ? 0.4455 0.8180 0.5526 -0.1079 0.0429  -0.1630 196 SER A CB  
1511 O OG  . SER A 195 ? 0.5304 0.9115 0.6327 -0.0850 0.0270  -0.1634 196 SER A OG  
1512 N N   . VAL A 196 ? 0.2902 0.5115 0.3308 -0.1051 0.0468  -0.1222 197 VAL A N   
1513 C CA  . VAL A 196 ? 0.4077 0.5878 0.4272 -0.0893 0.0444  -0.1053 197 VAL A CA  
1514 C C   . VAL A 196 ? 0.4095 0.5755 0.4197 -0.0790 0.0343  -0.1040 197 VAL A C   
1515 O O   . VAL A 196 ? 0.4142 0.5679 0.4214 -0.0919 0.0346  -0.1097 197 VAL A O   
1516 C CB  . VAL A 196 ? 0.3845 0.5215 0.3882 -0.1025 0.0551  -0.0949 197 VAL A CB  
1517 C CG1 . VAL A 196 ? 0.3300 0.4277 0.3142 -0.0872 0.0506  -0.0806 197 VAL A CG1 
1518 C CG2 . VAL A 196 ? 0.3634 0.5130 0.3717 -0.1091 0.0656  -0.0938 197 VAL A CG2 
1519 N N   . THR A 197 ? 0.4228 0.5888 0.4272 -0.0561 0.0265  -0.0965 198 THR A N   
1520 C CA  . THR A 197 ? 0.3867 0.5408 0.3803 -0.0442 0.0182  -0.0935 198 THR A CA  
1521 C C   . THR A 197 ? 0.4330 0.5463 0.4101 -0.0349 0.0197  -0.0780 198 THR A C   
1522 O O   . THR A 197 ? 0.4356 0.5460 0.4112 -0.0221 0.0197  -0.0701 198 THR A O   
1523 C CB  . THR A 197 ? 0.3569 0.5459 0.3562 -0.0250 0.0084  -0.0976 198 THR A CB  
1524 O OG1 . THR A 197 ? 0.3773 0.6103 0.3945 -0.0335 0.0057  -0.1144 198 THR A OG1 
1525 C CG2 . THR A 197 ? 0.3268 0.5024 0.3115 -0.0127 0.0014  -0.0931 198 THR A CG2 
1526 N N   . LEU A 198 ? 0.4071 0.4900 0.3731 -0.0413 0.0210  -0.0749 199 LEU A N   
1527 C CA  . LEU A 198 ? 0.4075 0.4581 0.3605 -0.0316 0.0212  -0.0624 199 LEU A CA  
1528 C C   . LEU A 198 ? 0.4896 0.5453 0.4375 -0.0145 0.0147  -0.0589 199 LEU A C   
1529 O O   . LEU A 198 ? 0.4828 0.5554 0.4307 -0.0126 0.0098  -0.0660 199 LEU A O   
1530 C CB  . LEU A 198 ? 0.4147 0.4336 0.3578 -0.0416 0.0244  -0.0612 199 LEU A CB  
1531 C CG  . LEU A 198 ? 0.4920 0.4941 0.4332 -0.0584 0.0318  -0.0622 199 LEU A CG  
1532 C CD1 . LEU A 198 ? 0.4777 0.4440 0.4058 -0.0605 0.0330  -0.0584 199 LEU A CD1 
1533 C CD2 . LEU A 198 ? 0.5090 0.5093 0.4504 -0.0566 0.0359  -0.0549 199 LEU A CD2 
1534 N N   . PHE A 199 ? 0.4027 0.4431 0.3453 -0.0026 0.0153  -0.0481 200 PHE A N   
1535 C CA  . PHE A 199 ? 0.4039 0.4395 0.3380 0.0111  0.0121  -0.0421 200 PHE A CA  
1536 C C   . PHE A 199 ? 0.4485 0.4554 0.3770 0.0145  0.0160  -0.0317 200 PHE A C   
1537 O O   . PHE A 199 ? 0.4388 0.4359 0.3707 0.0118  0.0190  -0.0289 200 PHE A O   
1538 C CB  . PHE A 199 ? 0.3404 0.3999 0.2758 0.0262  0.0073  -0.0419 200 PHE A CB  
1539 C CG  . PHE A 199 ? 0.3669 0.4221 0.3046 0.0364  0.0090  -0.0351 200 PHE A CG  
1540 C CD1 . PHE A 199 ? 0.4123 0.4632 0.3418 0.0537  0.0073  -0.0270 200 PHE A CD1 
1541 C CD2 . PHE A 199 ? 0.3790 0.4345 0.3252 0.0295  0.0126  -0.0372 200 PHE A CD2 
1542 C CE1 . PHE A 199 ? 0.4688 0.5125 0.3996 0.0637  0.0090  -0.0218 200 PHE A CE1 
1543 C CE2 . PHE A 199 ? 0.4559 0.5080 0.4037 0.0400  0.0138  -0.0330 200 PHE A CE2 
1544 C CZ  . PHE A 199 ? 0.4625 0.5076 0.4031 0.0570  0.0119  -0.0258 200 PHE A CZ  
1545 N N   . GLY A 200 ? 0.3746 0.3702 0.2948 0.0196  0.0162  -0.0274 201 GLY A N   
1546 C CA  . GLY A 200 ? 0.3435 0.3161 0.2609 0.0212  0.0202  -0.0196 201 GLY A CA  
1547 C C   . GLY A 200 ? 0.4449 0.4137 0.3536 0.0291  0.0213  -0.0148 201 GLY A C   
1548 O O   . GLY A 200 ? 0.4425 0.4246 0.3447 0.0332  0.0184  -0.0178 201 GLY A O   
1549 N N   . GLU A 201 ? 0.4147 0.3669 0.3233 0.0307  0.0260  -0.0079 202 GLU A N   
1550 C CA  . GLU A 201 ? 0.3982 0.3456 0.2985 0.0375  0.0299  -0.0015 202 GLU A CA  
1551 C C   . GLU A 201 ? 0.4960 0.4312 0.3996 0.0325  0.0345  -0.0011 202 GLU A C   
1552 O O   . GLU A 201 ? 0.4107 0.3377 0.3234 0.0273  0.0351  -0.0019 202 GLU A O   
1553 C CB  . GLU A 201 ? 0.4034 0.3442 0.3008 0.0461  0.0328  0.0076  202 GLU A CB  
1554 C CG  . GLU A 201 ? 0.4024 0.3373 0.2871 0.0539  0.0380  0.0163  202 GLU A CG  
1555 C CD  . GLU A 201 ? 0.5518 0.4697 0.4410 0.0487  0.0467  0.0214  202 GLU A CD  
1556 O OE1 . GLU A 201 ? 0.5251 0.4373 0.4045 0.0521  0.0536  0.0286  202 GLU A OE1 
1557 O OE2 . GLU A 201 ? 0.4997 0.4118 0.4023 0.0410  0.0468  0.0177  202 GLU A OE2 
1558 N N   . SER A 202 ? 0.4541 0.3909 0.3500 0.0351  0.0374  -0.0006 203 SER A N   
1559 C CA  . SER A 202 ? 0.4645 0.3949 0.3642 0.0322  0.0422  -0.0016 203 SER A CA  
1560 C C   . SER A 202 ? 0.4413 0.3679 0.3480 0.0261  0.0379  -0.0094 203 SER A C   
1561 O O   . SER A 202 ? 0.4240 0.3538 0.3260 0.0240  0.0337  -0.0162 203 SER A O   
1562 C CB  . SER A 202 ? 0.4752 0.3971 0.3811 0.0320  0.0495  0.0061  203 SER A CB  
1563 O OG  . SER A 202 ? 0.5542 0.4760 0.4656 0.0298  0.0551  0.0046  203 SER A OG  
1564 N N   . ALA A 203 ? 0.4471 0.3666 0.3639 0.0232  0.0388  -0.0092 204 ALA A N   
1565 C CA  . ALA A 203 ? 0.3930 0.3062 0.3120 0.0199  0.0345  -0.0149 204 ALA A CA  
1566 C C   . ALA A 203 ? 0.4142 0.3265 0.3306 0.0154  0.0301  -0.0166 204 ALA A C   
1567 O O   . ALA A 203 ? 0.3897 0.2950 0.3025 0.0116  0.0277  -0.0211 204 ALA A O   
1568 C CB  . ALA A 203 ? 0.4053 0.3144 0.3345 0.0198  0.0349  -0.0144 204 ALA A CB  
1569 N N   . GLY A 204 ? 0.4121 0.3305 0.3300 0.0159  0.0299  -0.0132 205 GLY A N   
1570 C CA  . GLY A 204 ? 0.3875 0.3108 0.3045 0.0117  0.0269  -0.0160 205 GLY A CA  
1571 C C   . GLY A 204 ? 0.4738 0.4063 0.3854 0.0095  0.0249  -0.0219 205 GLY A C   
1572 O O   . GLY A 204 ? 0.4067 0.3396 0.3181 0.0020  0.0235  -0.0273 205 GLY A O   
1573 N N   . ALA A 205 ? 0.3812 0.3214 0.2877 0.0155  0.0253  -0.0214 206 ALA A N   
1574 C CA  . ALA A 205 ? 0.4219 0.3729 0.3227 0.0139  0.0224  -0.0293 206 ALA A CA  
1575 C C   . ALA A 205 ? 0.4662 0.4047 0.3643 0.0079  0.0227  -0.0363 206 ALA A C   
1576 O O   . ALA A 205 ? 0.4049 0.3454 0.3021 0.0002  0.0206  -0.0451 206 ALA A O   
1577 C CB  . ALA A 205 ? 0.3995 0.3610 0.2918 0.0237  0.0227  -0.0265 206 ALA A CB  
1578 N N   . ALA A 206 ? 0.3835 0.3089 0.2812 0.0112  0.0257  -0.0334 207 ALA A N   
1579 C CA  . ALA A 206 ? 0.4169 0.3273 0.3113 0.0084  0.0259  -0.0396 207 ALA A CA  
1580 C C   . ALA A 206 ? 0.4737 0.3704 0.3692 0.0001  0.0248  -0.0406 207 ALA A C   
1581 O O   . ALA A 206 ? 0.4612 0.3461 0.3515 -0.0061 0.0246  -0.0475 207 ALA A O   
1582 C CB  . ALA A 206 ? 0.3564 0.2598 0.2525 0.0155  0.0289  -0.0365 207 ALA A CB  
1583 N N   . SER A 207 ? 0.3214 0.2179 0.2220 -0.0006 0.0250  -0.0339 208 SER A N   
1584 C CA  . SER A 207 ? 0.3628 0.2477 0.2617 -0.0083 0.0252  -0.0336 208 SER A CA  
1585 C C   . SER A 207 ? 0.4160 0.3093 0.3148 -0.0187 0.0254  -0.0401 208 SER A C   
1586 O O   . SER A 207 ? 0.4197 0.2982 0.3135 -0.0278 0.0273  -0.0441 208 SER A O   
1587 C CB  . SER A 207 ? 0.3875 0.2753 0.2911 -0.0063 0.0252  -0.0267 208 SER A CB  
1588 O OG  . SER A 207 ? 0.3959 0.2782 0.3019 0.0014  0.0246  -0.0228 208 SER A OG  
1589 N N   . VAL A 208 ? 0.3386 0.2560 0.2433 -0.0174 0.0238  -0.0416 209 VAL A N   
1590 C CA  . VAL A 208 ? 0.3581 0.2914 0.2663 -0.0268 0.0230  -0.0501 209 VAL A CA  
1591 C C   . VAL A 208 ? 0.4748 0.3996 0.3779 -0.0339 0.0229  -0.0602 209 VAL A C   
1592 O O   . VAL A 208 ? 0.5157 0.4346 0.4195 -0.0473 0.0253  -0.0669 209 VAL A O   
1593 C CB  . VAL A 208 ? 0.3875 0.3498 0.3010 -0.0193 0.0194  -0.0509 209 VAL A CB  
1594 C CG1 . VAL A 208 ? 0.3812 0.3656 0.2996 -0.0277 0.0169  -0.0630 209 VAL A CG1 
1595 C CG2 . VAL A 208 ? 0.3960 0.3650 0.3151 -0.0144 0.0201  -0.0433 209 VAL A CG2 
1596 N N   . GLY A 209 ? 0.4150 0.3376 0.3125 -0.0255 0.0212  -0.0620 210 GLY A N   
1597 C CA  . GLY A 209 ? 0.5035 0.4173 0.3952 -0.0307 0.0209  -0.0733 210 GLY A CA  
1598 C C   . GLY A 209 ? 0.5114 0.3918 0.3972 -0.0378 0.0248  -0.0739 210 GLY A C   
1599 O O   . GLY A 209 ? 0.5005 0.3700 0.3836 -0.0493 0.0262  -0.0841 210 GLY A O   
1600 N N   . MET A 210 ? 0.4870 0.3496 0.3699 -0.0309 0.0264  -0.0633 211 MET A N   
1601 C CA  . MET A 210 ? 0.5724 0.4013 0.4463 -0.0344 0.0295  -0.0619 211 MET A CA  
1602 C C   . MET A 210 ? 0.5313 0.3518 0.4045 -0.0499 0.0336  -0.0619 211 MET A C   
1603 O O   . MET A 210 ? 0.5948 0.3866 0.4587 -0.0582 0.0375  -0.0650 211 MET A O   
1604 C CB  . MET A 210 ? 0.5147 0.3323 0.3862 -0.0217 0.0288  -0.0513 211 MET A CB  
1605 C CG  . MET A 210 ? 0.5254 0.3445 0.3966 -0.0086 0.0271  -0.0536 211 MET A CG  
1606 S SD  . MET A 210 ? 0.6348 0.4537 0.5100 0.0053  0.0257  -0.0438 211 MET A SD  
1607 C CE  . MET A 210 ? 0.5404 0.3803 0.4224 0.0153  0.0262  -0.0472 211 MET A CE  
1608 N N   . HIS A 211 ? 0.4197 0.2636 0.3019 -0.0541 0.0338  -0.0587 212 HIS A N   
1609 C CA  . HIS A 211 ? 0.4679 0.3096 0.3512 -0.0701 0.0392  -0.0601 212 HIS A CA  
1610 C C   . HIS A 211 ? 0.5619 0.4120 0.4504 -0.0851 0.0405  -0.0747 212 HIS A C   
1611 O O   . HIS A 211 ? 0.6448 0.4786 0.5305 -0.1015 0.0472  -0.0782 212 HIS A O   
1612 C CB  . HIS A 211 ? 0.4932 0.3619 0.3862 -0.0692 0.0391  -0.0549 212 HIS A CB  
1613 C CG  . HIS A 211 ? 0.4975 0.3556 0.3849 -0.0586 0.0388  -0.0426 212 HIS A CG  
1614 N ND1 . HIS A 211 ? 0.5515 0.3823 0.4263 -0.0615 0.0432  -0.0353 212 HIS A ND1 
1615 C CD2 . HIS A 211 ? 0.4671 0.3381 0.3592 -0.0455 0.0347  -0.0370 212 HIS A CD2 
1616 C CE1 . HIS A 211 ? 0.5329 0.3640 0.4057 -0.0499 0.0405  -0.0270 212 HIS A CE1 
1617 N NE2 . HIS A 211 ? 0.5093 0.3641 0.3937 -0.0412 0.0357  -0.0285 212 HIS A NE2 
1618 N N   . LEU A 212 ? 0.5031 0.3782 0.3982 -0.0802 0.0346  -0.0838 213 LEU A N   
1619 C CA  . LEU A 212 ? 0.5173 0.4023 0.4171 -0.0932 0.0341  -0.1005 213 LEU A CA  
1620 C C   . LEU A 212 ? 0.5468 0.3919 0.4346 -0.1004 0.0381  -0.1062 213 LEU A C   
1621 O O   . LEU A 212 ? 0.6444 0.4824 0.5344 -0.1188 0.0423  -0.1179 213 LEU A O   
1622 C CB  . LEU A 212 ? 0.6118 0.5287 0.5157 -0.0823 0.0259  -0.1080 213 LEU A CB  
1623 C CG  . LEU A 212 ? 0.6275 0.5871 0.5436 -0.0777 0.0213  -0.1079 213 LEU A CG  
1624 C CD1 . LEU A 212 ? 0.5605 0.5412 0.4729 -0.0617 0.0139  -0.1098 213 LEU A CD1 
1625 C CD2 . LEU A 212 ? 0.7160 0.6994 0.6455 -0.0957 0.0223  -0.1218 213 LEU A CD2 
1626 N N   . LEU A 213 ? 0.5283 0.3473 0.4041 -0.0860 0.0372  -0.0989 214 LEU A N   
1627 C CA  . LEU A 213 ? 0.6096 0.3906 0.4728 -0.0873 0.0397  -0.1049 214 LEU A CA  
1628 C C   . LEU A 213 ? 0.6669 0.4043 0.5171 -0.0908 0.0466  -0.0944 214 LEU A C   
1629 O O   . LEU A 213 ? 0.7863 0.4857 0.6233 -0.0891 0.0490  -0.0972 214 LEU A O   
1630 C CB  . LEU A 213 ? 0.5642 0.3453 0.4220 -0.0677 0.0347  -0.1049 214 LEU A CB  
1631 C CG  . LEU A 213 ? 0.5747 0.3965 0.4403 -0.0609 0.0286  -0.1117 214 LEU A CG  
1632 C CD1 . LEU A 213 ? 0.6040 0.4275 0.4647 -0.0413 0.0264  -0.1064 214 LEU A CD1 
1633 C CD2 . LEU A 213 ? 0.5112 0.3419 0.3778 -0.0722 0.0269  -0.1315 214 LEU A CD2 
1634 N N   . SER A 214 ? 0.5920 0.3329 0.4436 -0.0944 0.0499  -0.0826 215 SER A N   
1635 C CA  . SER A 214 ? 0.6041 0.3051 0.4399 -0.0970 0.0567  -0.0710 215 SER A CA  
1636 C C   . SER A 214 ? 0.6252 0.3266 0.4643 -0.1204 0.0657  -0.0730 215 SER A C   
1637 O O   . SER A 214 ? 0.6457 0.3797 0.4965 -0.1243 0.0660  -0.0698 215 SER A O   
1638 C CB  . SER A 214 ? 0.6312 0.3363 0.4634 -0.0801 0.0534  -0.0553 215 SER A CB  
1639 O OG  . SER A 214 ? 0.7165 0.3806 0.5289 -0.0764 0.0576  -0.0440 215 SER A OG  
1640 N N   . PRO A 215 ? 0.5647 0.2311 0.3946 -0.1369 0.0738  -0.0788 216 PRO A N   
1641 C CA  . PRO A 215 ? 0.6895 0.3605 0.5262 -0.1633 0.0842  -0.0836 216 PRO A CA  
1642 C C   . PRO A 215 ? 0.7383 0.4155 0.5719 -0.1653 0.0902  -0.0685 216 PRO A C   
1643 O O   . PRO A 215 ? 0.7075 0.4200 0.5577 -0.1798 0.0941  -0.0735 216 PRO A O   
1644 C CB  . PRO A 215 ? 0.6296 0.2617 0.4558 -0.1696 0.0903  -0.0839 216 PRO A CB  
1645 C CG  . PRO A 215 ? 0.6290 0.2508 0.4522 -0.1540 0.0814  -0.0920 216 PRO A CG  
1646 C CD  . PRO A 215 ? 0.7212 0.3495 0.5387 -0.1320 0.0736  -0.0841 216 PRO A CD  
1647 N N   . PRO A 216 ? 0.7357 0.3830 0.5488 -0.1506 0.0909  -0.0510 217 PRO A N   
1648 C CA  . PRO A 216 ? 0.7862 0.4426 0.5953 -0.1527 0.0966  -0.0382 217 PRO A CA  
1649 C C   . PRO A 216 ? 0.7031 0.4149 0.5335 -0.1457 0.0895  -0.0405 217 PRO A C   
1650 O O   . PRO A 216 ? 0.7188 0.4496 0.5534 -0.1540 0.0956  -0.0368 217 PRO A O   
1651 C CB  . PRO A 216 ? 0.7835 0.4008 0.5660 -0.1332 0.0948  -0.0212 217 PRO A CB  
1652 C CG  . PRO A 216 ? 0.8096 0.3903 0.5814 -0.1276 0.0932  -0.0243 217 PRO A CG  
1653 C CD  . PRO A 216 ? 0.8019 0.4062 0.5935 -0.1319 0.0873  -0.0427 217 PRO A CD  
1654 N N   . SER A 217 ? 0.6405 0.3772 0.4831 -0.1306 0.0776  -0.0462 218 SER A N   
1655 C CA  . SER A 217 ? 0.6533 0.4384 0.5148 -0.1238 0.0714  -0.0486 218 SER A CA  
1656 C C   . SER A 217 ? 0.6601 0.4822 0.5427 -0.1386 0.0720  -0.0640 218 SER A C   
1657 O O   . SER A 217 ? 0.5625 0.4213 0.4592 -0.1404 0.0721  -0.0656 218 SER A O   
1658 C CB  . SER A 217 ? 0.6006 0.3953 0.4648 -0.1019 0.0600  -0.0470 218 SER A CB  
1659 O OG  . SER A 217 ? 0.6849 0.4566 0.5347 -0.0871 0.0580  -0.0345 218 SER A OG  
1660 N N   . ARG A 218 ? 0.7470 0.5608 0.6318 -0.1484 0.0719  -0.0765 219 ARG A N   
1661 C CA  . ARG A 218 ? 0.7687 0.6222 0.6741 -0.1588 0.0689  -0.0938 219 ARG A CA  
1662 C C   . ARG A 218 ? 0.6848 0.5630 0.6042 -0.1793 0.0777  -0.0994 219 ARG A C   
1663 O O   . ARG A 218 ? 0.7026 0.6279 0.6426 -0.1822 0.0733  -0.1114 219 ARG A O   
1664 C CB  . ARG A 218 ? 0.8415 0.6752 0.7434 -0.1665 0.0679  -0.1072 219 ARG A CB  
1665 C CG  . ARG A 218 ? 0.8900 0.7649 0.8114 -0.1762 0.0629  -0.1277 219 ARG A CG  
1666 C CD  . ARG A 218 ? 0.8832 0.8028 0.8148 -0.1566 0.0509  -0.1282 219 ARG A CD  
1667 N NE  . ARG A 218 ? 0.9129 0.8753 0.8618 -0.1646 0.0453  -0.1478 219 ARG A NE  
1668 C CZ  . ARG A 218 ? 0.8787 0.8856 0.8469 -0.1713 0.0450  -0.1544 219 ARG A CZ  
1669 N NH1 . ARG A 218 ? 0.8179 0.8306 0.7897 -0.1713 0.0508  -0.1429 219 ARG A NH1 
1670 N NH2 . ARG A 218 ? 0.8407 0.8885 0.8244 -0.1769 0.0383  -0.1737 219 ARG A NH2 
1671 N N   . GLY A 219 ? 0.6420 0.4917 0.5503 -0.1924 0.0902  -0.0907 220 GLY A N   
1672 C CA  . GLY A 219 ? 0.6044 0.4802 0.5264 -0.2120 0.1005  -0.0953 220 GLY A CA  
1673 C C   . GLY A 219 ? 0.6100 0.5221 0.5405 -0.2007 0.0988  -0.0885 220 GLY A C   
1674 O O   . GLY A 219 ? 0.6260 0.5681