data_6CQZ
# 
_entry.id   6CQZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CQZ         
WWPDB D_1000233255 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 6CQW PDB . 
unspecified 6CQX PDB . 
unspecified 6CQY PDB . 
unspecified 6CQT PDB . 
unspecified 6CQU PDB . 
unspecified 6CQV PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6CQZ 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bester, S.M.' 1 ? 
'Guelta, M.A.' 2 ? 
'Pegan, S.D.'  3 ? 
'Height, J.J.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Chem. Res. Toxicol.' 
_citation.journal_id_ASTM           CRTOEC 
_citation.journal_id_CSD            2140 
_citation.journal_id_ISSN           1520-5010 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            31 
_citation.language                  ? 
_citation.page_first                1405 
_citation.page_last                 1417 
_citation.title                     
'Structural Insights of Stereospecific Inhibition of Human Acetylcholinesterase by VX and Subsequent Reactivation by HI-6.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.chemrestox.8b00294 
_citation.pdbx_database_id_PubMed   30462502 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bester, S.M.'     1 ?                   
primary 'Guelta, M.A.'     2 ?                   
primary 'Cheung, J.'       3 0000-0002-1014-0707 
primary 'Winemiller, M.D.' 4 0000-0001-7433-428X 
primary 'Bae, S.Y.'        5 ?                   
primary 'Myslinski, J.'    6 ?                   
primary 'Pegan, S.D.'      7 0000-0002-2958-5319 
primary 'Height, J.J.'     8 ?                   
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6CQZ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     104.601 
_cell.length_a_esd                 ? 
_cell.length_b                     104.601 
_cell.length_b_esd                 ? 
_cell.length_c                     323.752 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6CQZ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 59447.105 2    3.1.1.7 ? 'UNP residues 33-574' ? 
2 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2 
?       ? ?                     ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1    ?       ? ?                     ? 
4 non-polymer syn 'O-ETHYLMETHYLPHOSPHONIC ACID ESTER GROUP' 124.076   2    ?       ? ?                     ? 
5 water       nat water 18.015    1116 ?       ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   GLU n 
1 4   ASP n 
1 5   ALA n 
1 6   GLU n 
1 7   LEU n 
1 8   LEU n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  LEU n 
1 17  ARG n 
1 18  GLY n 
1 19  ILE n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  PRO n 
1 28  VAL n 
1 29  SER n 
1 30  ALA n 
1 31  PHE n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  PRO n 
1 36  PHE n 
1 37  ALA n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  MET n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  PRO n 
1 49  PRO n 
1 50  GLU n 
1 51  PRO n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  TRP n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  VAL n 
1 60  ASP n 
1 61  ALA n 
1 62  THR n 
1 63  THR n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  CYS n 
1 69  TYR n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  ASP n 
1 74  THR n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  PHE n 
1 80  GLU n 
1 81  GLY n 
1 82  THR n 
1 83  GLU n 
1 84  MET n 
1 85  TRP n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  SER n 
1 93  GLU n 
1 94  ASP n 
1 95  CYS n 
1 96  LEU n 
1 97  TYR n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 TYR n 
1 105 PRO n 
1 106 ARG n 
1 107 PRO n 
1 108 THR n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 VAL n 
1 114 LEU n 
1 115 VAL n 
1 116 TRP n 
1 117 ILE n 
1 118 TYR n 
1 119 GLY n 
1 120 GLY n 
1 121 GLY n 
1 122 PHE n 
1 123 TYR n 
1 124 SER n 
1 125 GLY n 
1 126 ALA n 
1 127 SER n 
1 128 SER n 
1 129 LEU n 
1 130 ASP n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 ARG n 
1 136 PHE n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 MET n 
1 149 ASN n 
1 150 TYR n 
1 151 ARG n 
1 152 VAL n 
1 153 GLY n 
1 154 ALA n 
1 155 PHE n 
1 156 GLY n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 PRO n 
1 162 GLY n 
1 163 SER n 
1 164 ARG n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 ASN n 
1 170 VAL n 
1 171 GLY n 
1 172 LEU n 
1 173 LEU n 
1 174 ASP n 
1 175 GLN n 
1 176 ARG n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 GLN n 
1 181 TRP n 
1 182 VAL n 
1 183 GLN n 
1 184 GLU n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 PHE n 
1 190 GLY n 
1 191 GLY n 
1 192 ASP n 
1 193 PRO n 
1 194 THR n 
1 195 SER n 
1 196 VAL n 
1 197 THR n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 GLU n 
1 202 SER n 
1 203 ALA n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 SER n 
1 208 VAL n 
1 209 GLY n 
1 210 MET n 
1 211 HIS n 
1 212 LEU n 
1 213 LEU n 
1 214 SER n 
1 215 PRO n 
1 216 PRO n 
1 217 SER n 
1 218 ARG n 
1 219 GLY n 
1 220 LEU n 
1 221 PHE n 
1 222 HIS n 
1 223 ARG n 
1 224 ALA n 
1 225 VAL n 
1 226 LEU n 
1 227 GLN n 
1 228 SER n 
1 229 GLY n 
1 230 ALA n 
1 231 PRO n 
1 232 ASN n 
1 233 GLY n 
1 234 PRO n 
1 235 TRP n 
1 236 ALA n 
1 237 THR n 
1 238 VAL n 
1 239 GLY n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 ALA n 
1 244 ARG n 
1 245 ARG n 
1 246 ARG n 
1 247 ALA n 
1 248 THR n 
1 249 GLN n 
1 250 LEU n 
1 251 ALA n 
1 252 HIS n 
1 253 LEU n 
1 254 VAL n 
1 255 GLY n 
1 256 CYS n 
1 257 PRO n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 GLY n 
1 263 GLY n 
1 264 ASN n 
1 265 ASP n 
1 266 THR n 
1 267 GLU n 
1 268 LEU n 
1 269 VAL n 
1 270 ALA n 
1 271 CYS n 
1 272 LEU n 
1 273 ARG n 
1 274 THR n 
1 275 ARG n 
1 276 PRO n 
1 277 ALA n 
1 278 GLN n 
1 279 VAL n 
1 280 LEU n 
1 281 VAL n 
1 282 ASN n 
1 283 HIS n 
1 284 GLU n 
1 285 TRP n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 PRO n 
1 290 GLN n 
1 291 GLU n 
1 292 SER n 
1 293 VAL n 
1 294 PHE n 
1 295 ARG n 
1 296 PHE n 
1 297 SER n 
1 298 PHE n 
1 299 VAL n 
1 300 PRO n 
1 301 VAL n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 ASP n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 ASP n 
1 310 THR n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 LEU n 
1 315 ILE n 
1 316 ASN n 
1 317 ALA n 
1 318 GLY n 
1 319 ASP n 
1 320 PHE n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 GLN n 
1 325 VAL n 
1 326 LEU n 
1 327 VAL n 
1 328 GLY n 
1 329 VAL n 
1 330 VAL n 
1 331 LYS n 
1 332 ASP n 
1 333 GLU n 
1 334 GLY n 
1 335 SER n 
1 336 TYR n 
1 337 PHE n 
1 338 LEU n 
1 339 VAL n 
1 340 TYR n 
1 341 GLY n 
1 342 ALA n 
1 343 PRO n 
1 344 GLY n 
1 345 PHE n 
1 346 SER n 
1 347 LYS n 
1 348 ASP n 
1 349 ASN n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ILE n 
1 354 SER n 
1 355 ARG n 
1 356 ALA n 
1 357 GLU n 
1 358 PHE n 
1 359 LEU n 
1 360 ALA n 
1 361 GLY n 
1 362 VAL n 
1 363 ARG n 
1 364 VAL n 
1 365 GLY n 
1 366 VAL n 
1 367 PRO n 
1 368 GLN n 
1 369 VAL n 
1 370 SER n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 VAL n 
1 378 VAL n 
1 379 LEU n 
1 380 HIS n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 TRP n 
1 385 LEU n 
1 386 HIS n 
1 387 PRO n 
1 388 GLU n 
1 389 ASP n 
1 390 PRO n 
1 391 ALA n 
1 392 ARG n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 SER n 
1 399 ASP n 
1 400 VAL n 
1 401 VAL n 
1 402 GLY n 
1 403 ASP n 
1 404 HIS n 
1 405 ASN n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 PRO n 
1 410 VAL n 
1 411 ALA n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 GLY n 
1 416 ARG n 
1 417 LEU n 
1 418 ALA n 
1 419 ALA n 
1 420 GLN n 
1 421 GLY n 
1 422 ALA n 
1 423 ARG n 
1 424 VAL n 
1 425 TYR n 
1 426 ALA n 
1 427 TYR n 
1 428 VAL n 
1 429 PHE n 
1 430 GLU n 
1 431 HIS n 
1 432 ARG n 
1 433 ALA n 
1 434 SER n 
1 435 THR n 
1 436 LEU n 
1 437 SER n 
1 438 TRP n 
1 439 PRO n 
1 440 LEU n 
1 441 TRP n 
1 442 MET n 
1 443 GLY n 
1 444 VAL n 
1 445 PRO n 
1 446 HIS n 
1 447 GLY n 
1 448 TYR n 
1 449 GLU n 
1 450 ILE n 
1 451 GLU n 
1 452 PHE n 
1 453 ILE n 
1 454 PHE n 
1 455 GLY n 
1 456 ILE n 
1 457 PRO n 
1 458 LEU n 
1 459 ASP n 
1 460 PRO n 
1 461 SER n 
1 462 ARG n 
1 463 ASN n 
1 464 TYR n 
1 465 THR n 
1 466 ALA n 
1 467 GLU n 
1 468 GLU n 
1 469 LYS n 
1 470 ILE n 
1 471 PHE n 
1 472 ALA n 
1 473 GLN n 
1 474 ARG n 
1 475 LEU n 
1 476 MET n 
1 477 ARG n 
1 478 TYR n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 ASP n 
1 488 PRO n 
1 489 ASN n 
1 490 GLU n 
1 491 PRO n 
1 492 ARG n 
1 493 ASP n 
1 494 PRO n 
1 495 LYS n 
1 496 ALA n 
1 497 PRO n 
1 498 GLN n 
1 499 TRP n 
1 500 PRO n 
1 501 PRO n 
1 502 TYR n 
1 503 THR n 
1 504 ALA n 
1 505 GLY n 
1 506 ALA n 
1 507 GLN n 
1 508 GLN n 
1 509 TYR n 
1 510 VAL n 
1 511 SER n 
1 512 LEU n 
1 513 ASP n 
1 514 LEU n 
1 515 ARG n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 VAL n 
1 520 ARG n 
1 521 ARG n 
1 522 GLY n 
1 523 LEU n 
1 524 ARG n 
1 525 ALA n 
1 526 GLN n 
1 527 ALA n 
1 528 CYS n 
1 529 ALA n 
1 530 PHE n 
1 531 TRP n 
1 532 ASN n 
1 533 ARG n 
1 534 PHE n 
1 535 LEU n 
1 536 PRO n 
1 537 LYS n 
1 538 LEU n 
1 539 LEU n 
1 540 SER n 
1 541 ALA n 
1 542 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   542 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           33 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6CQZ A 1 ? 542 ? P22303 33 ? 574 ? 2 543 
2 1 6CQZ B 1 ? 542 ? P22303 33 ? 574 ? 2 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                    ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                   ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                 ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                            ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE                                   ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                       ? 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                  ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                            ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                    ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                  ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                      ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                 ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                    ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                     ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                                 ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose   ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                              ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                    ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                     ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                  ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                 ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                   ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                     ? 'C5 H11 N O2'    117.146 
VX  non-polymer                   . 'O-ETHYLMETHYLPHOSPHONIC ACID ESTER GROUP' ? 'C3 H9 O3 P'     124.076 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CQZ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.30 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.40 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'12 to 18% PEG 3350, 0.2M potassium nitrate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-04-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6CQZ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.216 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       94149 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.1 
_reflns.pdbx_Rmerge_I_obs                0.102 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.048 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.216 
_reflns_shell.d_res_low                   2.26 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         5.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        91.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.314 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.1 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.165 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6CQZ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.216 
_refine.ls_d_res_low                             40.686 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     94144 
_refine.ls_number_reflns_R_free                  4688 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    91.34 
_refine.ls_percent_reflns_R_free                 4.98 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1672 
_refine.ls_R_factor_R_free                       0.1935 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1658 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4EY4 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 19.80 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.19 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8234 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         102 
_refine_hist.number_atoms_solvent             1119 
_refine_hist.number_atoms_total               9455 
_refine_hist.d_res_high                       2.216 
_refine_hist.d_res_low                        40.686 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003 ? 8645  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.722 ? 11827 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 2.587 ? 6898  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.047 ? 1276  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005 ? 1552  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.2158 2.2409  . . 63  1529 47.00  . . . 0.2493 . 0.2197 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2409 2.2673  . . 102 1670 52.00  . . . 0.2655 . 0.2077 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2673 2.2949  . . 93  1908 60.00  . . . 0.2441 . 0.2120 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2949 2.3240  . . 86  2120 64.00  . . . 0.2209 . 0.2098 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3240 2.3546  . . 154 2233 72.00  . . . 0.2118 . 0.2206 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3546 2.3868  . . 132 2528 78.00  . . . 0.2565 . 0.2222 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3868 2.4209  . . 138 2778 86.00  . . . 0.2647 . 0.2221 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4209 2.4570  . . 160 2932 92.00  . . . 0.2486 . 0.2118 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4570 2.4954  . . 152 3145 96.00  . . . 0.2686 . 0.2087 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4954 2.5363  . . 150 3141 97.00  . . . 0.2532 . 0.1999 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5363 2.5801  . . 140 3207 99.00  . . . 0.2463 . 0.1963 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5801 2.6270  . . 180 3216 99.00  . . . 0.2155 . 0.1965 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6270 2.6775  . . 144 3245 99.00  . . . 0.2110 . 0.1980 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6775 2.7321  . . 187 3185 100.00 . . . 0.2132 . 0.1879 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7321 2.7915  . . 180 3223 100.00 . . . 0.2239 . 0.1876 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7915 2.8565  . . 203 3210 100.00 . . . 0.2106 . 0.1807 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8565 2.9279  . . 166 3258 100.00 . . . 0.2270 . 0.1760 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9279 3.0070  . . 157 3245 100.00 . . . 0.1861 . 0.1655 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0070 3.0955  . . 186 3243 100.00 . . . 0.1806 . 0.1692 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0955 3.1953  . . 160 3265 100.00 . . . 0.2068 . 0.1650 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1953 3.3095  . . 165 3259 100.00 . . . 0.1827 . 0.1657 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3095 3.4419  . . 166 3264 100.00 . . . 0.1868 . 0.1546 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4419 3.5985  . . 169 3296 100.00 . . . 0.1680 . 0.1520 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5985 3.7881  . . 193 3255 100.00 . . . 0.1776 . 0.1415 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7881 4.0252  . . 183 3291 100.00 . . . 0.1606 . 0.1289 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0252 4.3357  . . 185 3277 100.00 . . . 0.1472 . 0.1282 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3357 4.7714  . . 158 3334 100.00 . . . 0.1468 . 0.1226 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7714 5.4604  . . 186 3314 100.00 . . . 0.1528 . 0.1439 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.4604 6.8742  . . 171 3382 100.00 . . . 0.2030 . 0.1773 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.8742 40.6929 . . 179 3503 98.00  . . . 0.2234 . 0.1806 . . . . . . . . . . 
# 
_struct.entry_id                     6CQZ 
_struct.title                        'Crystal Structure of Recombinant Human Acetylcholinesterase Inhibited by VX' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CQZ 
_struct_keywords.text            Hydrolase 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 4   ? GLU A 6   ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  AA2 MET A 41  ? ARG A 45  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  AA3 PHE A 79  ? MET A 84  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  AA4 LEU A 129 ? ASP A 133 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 134 ? ARG A 142 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  AA6 VAL A 152 ? LEU A 158 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  AA7 ASN A 169 ? VAL A 186 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  AA8 ALA A 187 ? PHE A 189 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  AA9 SER A 202 ? LEU A 213 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 AB1 SER A 214 ? GLY A 219 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 AB2 MET A 240 ? VAL A 254 ? MET A 241 VAL A 255 1 ? 15 
HELX_P HELX_P12 AB3 ASN A 264 ? THR A 274 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 AB4 PRO A 276 ? GLU A 284 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 AB5 TRP A 285 ? LEU A 288 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 AB6 THR A 310 ? ALA A 317 ? THR A 311 ALA A 318 1 ? 8  
HELX_P HELX_P16 AB7 GLY A 334 ? VAL A 339 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 AB8 SER A 354 ? VAL A 366 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 AB9 SER A 370 ? THR A 382 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 AC1 ASP A 389 ? VAL A 406 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 AC2 VAL A 406 ? GLN A 420 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 AC3 PRO A 439 ? GLY A 443 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 AC4 GLU A 449 ? PHE A 454 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 AC5 GLY A 455 ? ASP A 459 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 AC6 THR A 465 ? GLY A 486 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 AC7 ARG A 524 ? ARG A 533 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 AC8 PHE A 534 ? LEU A 539 ? PHE A 535 LEU A 540 1 ? 6  
HELX_P HELX_P27 AC9 ASP B 4   ? GLU B 6   ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 AD1 MET B 41  ? ARG B 45  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 AD2 PHE B 79  ? MET B 84  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 AD3 LEU B 129 ? ASP B 133 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 AD4 GLY B 134 ? ARG B 142 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 AD5 VAL B 152 ? LEU B 158 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 AD6 ASN B 169 ? VAL B 186 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 AD7 ALA B 187 ? PHE B 189 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 AD8 SER B 202 ? LEU B 213 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 AD9 SER B 214 ? GLY B 219 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 AE1 MET B 240 ? VAL B 254 ? MET B 241 VAL B 255 1 ? 15 
HELX_P HELX_P38 AE2 ASP B 265 ? THR B 274 ? ASP B 266 THR B 275 1 ? 10 
HELX_P HELX_P39 AE3 PRO B 276 ? HIS B 283 ? PRO B 277 HIS B 284 1 ? 8  
HELX_P HELX_P40 AE4 GLU B 284 ? LEU B 288 ? GLU B 285 LEU B 289 5 ? 5  
HELX_P HELX_P41 AE5 THR B 310 ? ALA B 317 ? THR B 311 ALA B 318 1 ? 8  
HELX_P HELX_P42 AE6 GLY B 334 ? VAL B 339 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 AE7 SER B 354 ? VAL B 366 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 AE8 SER B 370 ? THR B 382 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 AE9 ASP B 389 ? VAL B 406 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 AF1 VAL B 406 ? GLN B 420 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 AF2 PRO B 439 ? GLY B 443 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 AF3 GLU B 449 ? PHE B 454 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 AF4 GLY B 455 ? ASP B 459 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 AF5 THR B 465 ? GLY B 486 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 AF6 ARG B 524 ? ARG B 533 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 AF7 ARG B 533 ? ALA B 541 ? ARG B 534 ALA B 542 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 68  SG  ? ? ? 1_555 A CYS 95  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf2 disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 271 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf3 disulf ?    ? A CYS 408 SG  ? ? ? 1_555 A CYS 528 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf4 disulf ?    ? B CYS 68  SG  ? ? ? 1_555 B CYS 95  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf5 disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 271 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf6 disulf ?    ? B CYS 408 SG  ? ? ? 1_555 B CYS 528 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
covale1 covale one  ? A SER 202 OG  ? ? ? 1_555 F VX  .   P1 ? ? A SER 203 A VX  605 1_555 ? ? ? ? ? ? ? 1.404 ? ?               
covale2 covale one  ? A ASN 349 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.411 ? N-Glycosylation 
covale3 covale one  ? B ASN 349 ND2 ? ? ? 1_555 D NAG .   C1 ? ? B ASN 350 D NAG 1   1_555 ? ? ? ? ? ? ? 1.323 ? N-Glycosylation 
covale4 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale5 covale one  ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.199 ? ?               
covale6 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale7 covale one  ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? D NAG 1   D FUC 3   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 104 A . ? TYR 105 A PRO 105 A ? PRO 106 A 1 2.09  
2 CYS 256 A . ? CYS 257 A PRO 257 A ? PRO 258 A 1 -6.70 
3 TYR 104 B . ? TYR 105 B PRO 105 B ? PRO 106 B 1 0.98  
4 CYS 256 B . ? CYS 257 B PRO 257 B ? PRO 258 B 1 0.22  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
AA5 ? 3  ? 
AA6 ? 11 ? 
AA7 ? 2  ? 
AA8 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? parallel      
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA6 3  4  ? anti-parallel 
AA6 4  5  ? parallel      
AA6 5  6  ? parallel      
AA6 6  7  ? parallel      
AA6 7  8  ? parallel      
AA6 8  9  ? parallel      
AA6 9  10 ? parallel      
AA6 10 11 ? anti-parallel 
AA7 1  2  ? parallel      
AA8 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 8   ? THR A 10  ? LEU A 9   THR A 11  
AA1 2  ARG A 15  ? ARG A 17  ? ARG A 16  ARG A 18  
AA1 3  VAL A 58  ? ASP A 60  ? VAL A 59  ASP A 61  
AA2 1  ILE A 19  ? THR A 23  ? ILE A 20  THR A 24  
AA2 2  GLY A 26  ? PRO A 35  ? GLY A 27  PRO A 36  
AA2 3  TYR A 97  ? PRO A 103 ? TYR A 98  PRO A 104 
AA2 4  VAL A 144 ? MET A 148 ? VAL A 145 MET A 149 
AA2 5  THR A 111 ? ILE A 117 ? THR A 112 ILE A 118 
AA2 6  GLY A 191 ? GLU A 201 ? GLY A 192 GLU A 202 
AA2 7  ARG A 223 ? GLN A 227 ? ARG A 224 GLN A 228 
AA2 8  GLN A 324 ? VAL A 330 ? GLN A 325 VAL A 331 
AA2 9  ARG A 423 ? PHE A 429 ? ARG A 424 PHE A 430 
AA2 10 GLN A 508 ? LEU A 512 ? GLN A 509 LEU A 513 
AA2 11 GLU A 518 ? ARG A 521 ? GLU A 519 ARG A 522 
AA3 1  VAL A 67  ? CYS A 68  ? VAL A 68  CYS A 69  
AA3 2  LEU A 91  ? SER A 92  ? LEU A 92  SER A 93  
AA4 1  VAL A 238 ? GLY A 239 ? VAL A 239 GLY A 240 
AA4 2  VAL A 301 ? VAL A 302 ? VAL A 302 VAL A 303 
AA5 1  LEU B 8   ? VAL B 11  ? LEU B 9   VAL B 12  
AA5 2  GLY B 14  ? ARG B 17  ? GLY B 15  ARG B 18  
AA5 3  VAL B 58  ? ASP B 60  ? VAL B 59  ASP B 61  
AA6 1  ILE B 19  ? THR B 23  ? ILE B 20  THR B 24  
AA6 2  GLY B 26  ? PRO B 35  ? GLY B 27  PRO B 36  
AA6 3  TYR B 97  ? PRO B 103 ? TYR B 98  PRO B 104 
AA6 4  VAL B 144 ? MET B 148 ? VAL B 145 MET B 149 
AA6 5  THR B 111 ? ILE B 117 ? THR B 112 ILE B 118 
AA6 6  GLY B 191 ? GLU B 201 ? GLY B 192 GLU B 202 
AA6 7  ARG B 223 ? GLN B 227 ? ARG B 224 GLN B 228 
AA6 8  GLN B 324 ? VAL B 330 ? GLN B 325 VAL B 331 
AA6 9  ARG B 423 ? PHE B 429 ? ARG B 424 PHE B 430 
AA6 10 GLN B 508 ? LEU B 512 ? GLN B 509 LEU B 513 
AA6 11 GLU B 518 ? ARG B 521 ? GLU B 519 ARG B 522 
AA7 1  VAL B 67  ? CYS B 68  ? VAL B 68  CYS B 69  
AA7 2  LEU B 91  ? SER B 92  ? LEU B 92  SER B 93  
AA8 1  VAL B 238 ? GLY B 239 ? VAL B 239 GLY B 240 
AA8 2  VAL B 301 ? VAL B 302 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 9   ? N VAL A 10  O LEU A 16  ? O LEU A 17  
AA1 2  3  N ARG A 15  ? N ARG A 16  O VAL A 59  ? O VAL A 60  
AA2 1  2  N LEU A 21  ? N LEU A 22  O VAL A 28  ? O VAL A 29  
AA2 2  3  N ILE A 34  ? N ILE A 35  O LEU A 98  ? O LEU A 99  
AA2 3  4  N ASN A 99  ? N ASN A 100 O SER A 147 ? O SER A 148 
AA2 4  5  O VAL A 146 ? O VAL A 147 N TRP A 116 ? N TRP A 117 
AA2 5  6  N THR A 111 ? N THR A 112 O ASP A 192 ? O ASP A 193 
AA2 6  7  N GLY A 200 ? N GLY A 201 O GLN A 227 ? O GLN A 228 
AA2 7  8  N LEU A 226 ? N LEU A 227 O LEU A 326 ? O LEU A 327 
AA2 8  9  N VAL A 327 ? N VAL A 328 O TYR A 425 ? O TYR A 426 
AA2 9  10 N VAL A 428 ? N VAL A 429 O LEU A 512 ? O LEU A 513 
AA2 10 11 N TYR A 509 ? N TYR A 510 O ARG A 520 ? O ARG A 521 
AA3 1  2  N VAL A 67  ? N VAL A 68  O SER A 92  ? O SER A 93  
AA4 1  2  N VAL A 238 ? N VAL A 239 O VAL A 302 ? O VAL A 303 
AA5 1  2  N VAL B 9   ? N VAL B 10  O LEU B 16  ? O LEU B 17  
AA5 2  3  N ARG B 15  ? N ARG B 16  O VAL B 59  ? O VAL B 60  
AA6 1  2  N LEU B 21  ? N LEU B 22  O VAL B 28  ? O VAL B 29  
AA6 2  3  N ILE B 34  ? N ILE B 35  O LEU B 98  ? O LEU B 99  
AA6 3  4  N ASN B 99  ? N ASN B 100 O SER B 147 ? O SER B 148 
AA6 4  5  O VAL B 146 ? O VAL B 147 N LEU B 114 ? N LEU B 115 
AA6 5  6  N THR B 111 ? N THR B 112 O ASP B 192 ? O ASP B 193 
AA6 6  7  N LEU B 198 ? N LEU B 199 O ARG B 223 ? O ARG B 224 
AA6 7  8  N LEU B 226 ? N LEU B 227 O LEU B 326 ? O LEU B 327 
AA6 8  9  N VAL B 327 ? N VAL B 328 O TYR B 425 ? O TYR B 426 
AA6 9  10 N VAL B 428 ? N VAL B 429 O LEU B 512 ? O LEU B 513 
AA6 10 11 N TYR B 509 ? N TYR B 510 O ARG B 520 ? O ARG B 521 
AA7 1  2  N VAL B 67  ? N VAL B 68  O SER B 92  ? O SER B 93  
AA8 1  2  N VAL B 238 ? N VAL B 239 O VAL B 302 ? O VAL B 303 
# 
_atom_sites.entry_id                    6CQZ 
_atom_sites.fract_transf_matrix[1][1]   0.009560 
_atom_sites.fract_transf_matrix[1][2]   0.005520 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011039 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003089 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 2   ? 23.839  -40.434 379.614 1.00 105.54 ? 3    ARG A N   1 
ATOM   2    C CA  . ARG A 1 2   ? 25.120  -40.097 380.221 1.00 106.12 ? 3    ARG A CA  1 
ATOM   3    C C   . ARG A 1 2   ? 26.212  -39.958 379.142 1.00 98.00  ? 3    ARG A C   1 
ATOM   4    O O   . ARG A 1 2   ? 26.849  -38.911 379.034 1.00 101.84 ? 3    ARG A O   1 
ATOM   5    C CB  . ARG A 1 2   ? 25.494  -41.147 381.293 1.00 111.13 ? 3    ARG A CB  1 
ATOM   6    C CG  . ARG A 1 2   ? 26.149  -42.412 380.757 1.00 116.29 ? 3    ARG A CG  1 
ATOM   7    C CD  . ARG A 1 2   ? 26.224  -43.583 381.703 1.00 121.35 ? 3    ARG A CD  1 
ATOM   8    N NE  . ARG A 1 2   ? 26.408  -44.790 380.902 1.00 125.12 ? 3    ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 2   ? 27.465  -45.590 380.980 1.00 127.29 ? 3    ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 2   ? 28.435  -45.328 381.844 1.00 127.30 ? 3    ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 2   ? 27.554  -46.650 380.189 1.00 127.95 ? 3    ARG A NH2 1 
ATOM   12   N N   . GLU A 1 3   ? 26.389  -40.992 378.318 1.00 86.16  ? 4    GLU A N   1 
ATOM   13   C CA  . GLU A 1 3   ? 27.481  -41.068 377.360 1.00 74.88  ? 4    GLU A CA  1 
ATOM   14   C C   . GLU A 1 3   ? 27.033  -41.917 376.182 1.00 65.33  ? 4    GLU A C   1 
ATOM   15   O O   . GLU A 1 3   ? 26.289  -42.887 376.353 1.00 67.85  ? 4    GLU A O   1 
ATOM   16   C CB  . GLU A 1 3   ? 28.755  -41.677 377.970 1.00 74.52  ? 4    GLU A CB  1 
ATOM   17   C CG  . GLU A 1 3   ? 29.455  -40.832 379.030 1.00 76.64  ? 4    GLU A CG  1 
ATOM   18   C CD  . GLU A 1 3   ? 30.431  -39.827 378.441 1.00 75.65  ? 4    GLU A CD  1 
ATOM   19   O OE1 . GLU A 1 3   ? 30.134  -39.255 377.370 1.00 73.19  ? 4    GLU A OE1 1 
ATOM   20   O OE2 . GLU A 1 3   ? 31.501  -39.611 379.048 1.00 73.00  ? 4    GLU A OE2 1 
ATOM   21   N N   . ASP A 1 4   ? 27.495  -41.544 374.994 1.00 58.57  ? 5    ASP A N   1 
ATOM   22   C CA  . ASP A 1 4   ? 27.251  -42.294 373.771 1.00 52.36  ? 5    ASP A CA  1 
ATOM   23   C C   . ASP A 1 4   ? 28.494  -43.122 373.466 1.00 49.27  ? 5    ASP A C   1 
ATOM   24   O O   . ASP A 1 4   ? 29.568  -42.562 373.221 1.00 47.83  ? 5    ASP A O   1 
ATOM   25   C CB  . ASP A 1 4   ? 26.918  -41.345 372.619 1.00 50.35  ? 5    ASP A CB  1 
ATOM   26   C CG  . ASP A 1 4   ? 26.454  -42.069 371.364 1.00 56.42  ? 5    ASP A CG  1 
ATOM   27   O OD1 . ASP A 1 4   ? 25.843  -41.406 370.499 1.00 55.03  ? 5    ASP A OD1 1 
ATOM   28   O OD2 . ASP A 1 4   ? 26.696  -43.287 371.232 1.00 58.94  ? 5    ASP A OD2 1 
ATOM   29   N N   . ALA A 1 5   ? 28.348  -44.452 373.481 1.00 43.83  ? 6    ALA A N   1 
ATOM   30   C CA  . ALA A 1 5   ? 29.511  -45.322 373.317 1.00 45.87  ? 6    ALA A CA  1 
ATOM   31   C C   . ALA A 1 5   ? 30.171  -45.147 371.958 1.00 41.73  ? 6    ALA A C   1 
ATOM   32   O O   . ALA A 1 5   ? 31.375  -45.391 371.821 1.00 43.86  ? 6    ALA A O   1 
ATOM   33   C CB  . ALA A 1 5   ? 29.122  -46.787 373.510 1.00 47.50  ? 6    ALA A CB  1 
ATOM   34   N N   . GLU A 1 6   ? 29.408  -44.739 370.942 1.00 38.98  ? 7    GLU A N   1 
ATOM   35   C CA  . GLU A 1 6   ? 29.995  -44.562 369.618 1.00 38.46  ? 7    GLU A CA  1 
ATOM   36   C C   . GLU A 1 6   ? 30.987  -43.407 369.594 1.00 34.77  ? 7    GLU A C   1 
ATOM   37   O O   . GLU A 1 6   ? 31.906  -43.399 368.767 1.00 32.70  ? 7    GLU A O   1 
ATOM   38   C CB  . GLU A 1 6   ? 28.896  -44.342 368.578 1.00 43.79  ? 7    GLU A CB  1 
ATOM   39   C CG  . GLU A 1 6   ? 28.044  -45.572 368.301 1.00 56.97  ? 7    GLU A CG  1 
ATOM   40   C CD  . GLU A 1 6   ? 28.853  -46.743 367.774 1.00 65.14  ? 7    GLU A CD  1 
ATOM   41   O OE1 . GLU A 1 6   ? 29.753  -46.520 366.938 1.00 66.16  ? 7    GLU A OE1 1 
ATOM   42   O OE2 . GLU A 1 6   ? 28.586  -47.889 368.194 1.00 69.92  ? 7    GLU A OE2 1 
ATOM   43   N N   . LEU A 1 7   ? 30.829  -42.436 370.491 1.00 32.17  ? 8    LEU A N   1 
ATOM   44   C CA  . LEU A 1 7   ? 31.694  -41.266 370.541 1.00 36.58  ? 8    LEU A CA  1 
ATOM   45   C C   . LEU A 1 7   ? 32.815  -41.407 371.562 1.00 33.63  ? 8    LEU A C   1 
ATOM   46   O O   . LEU A 1 7   ? 33.480  -40.415 371.876 1.00 35.97  ? 8    LEU A O   1 
ATOM   47   C CB  . LEU A 1 7   ? 30.863  -40.017 370.838 1.00 36.12  ? 8    LEU A CB  1 
ATOM   48   C CG  . LEU A 1 7   ? 29.690  -39.818 369.878 1.00 33.36  ? 8    LEU A CG  1 
ATOM   49   C CD1 . LEU A 1 7   ? 28.869  -38.601 370.266 1.00 30.11  ? 8    LEU A CD1 1 
ATOM   50   C CD2 . LEU A 1 7   ? 30.195  -39.703 368.445 1.00 26.74  ? 8    LEU A CD2 1 
ATOM   51   N N   . LEU A 1 8   ? 33.039  -42.611 372.081 1.00 33.91  ? 9    LEU A N   1 
ATOM   52   C CA  . LEU A 1 8   ? 34.102  -42.880 373.042 1.00 36.76  ? 9    LEU A CA  1 
ATOM   53   C C   . LEU A 1 8   ? 35.053  -43.901 372.439 1.00 36.59  ? 9    LEU A C   1 
ATOM   54   O O   . LEU A 1 8   ? 34.629  -44.993 372.046 1.00 44.53  ? 9    LEU A O   1 
ATOM   55   C CB  . LEU A 1 8   ? 33.532  -43.394 374.365 1.00 33.99  ? 9    LEU A CB  1 
ATOM   56   C CG  . LEU A 1 8   ? 32.620  -42.428 375.118 1.00 39.40  ? 9    LEU A CG  1 
ATOM   57   C CD1 . LEU A 1 8   ? 32.084  -43.083 376.378 1.00 38.47  ? 9    LEU A CD1 1 
ATOM   58   C CD2 . LEU A 1 8   ? 33.363  -41.144 375.447 1.00 35.83  ? 9    LEU A CD2 1 
ATOM   59   N N   . VAL A 1 9   ? 36.333  -43.548 372.368 1.00 33.16  ? 10   VAL A N   1 
ATOM   60   C CA  . VAL A 1 9   ? 37.354  -44.407 371.781 1.00 35.55  ? 10   VAL A CA  1 
ATOM   61   C C   . VAL A 1 9   ? 38.579  -44.377 372.682 1.00 34.84  ? 10   VAL A C   1 
ATOM   62   O O   . VAL A 1 9   ? 38.912  -43.338 373.262 1.00 36.37  ? 10   VAL A O   1 
ATOM   63   C CB  . VAL A 1 9   ? 37.706  -43.964 370.342 1.00 35.74  ? 10   VAL A CB  1 
ATOM   64   C CG1 . VAL A 1 9   ? 38.968  -44.654 369.846 1.00 32.63  ? 10   VAL A CG1 1 
ATOM   65   C CG2 . VAL A 1 9   ? 36.549  -44.249 369.401 1.00 38.96  ? 10   VAL A CG2 1 
ATOM   66   N N   . THR A 1 10  ? 39.239  -45.524 372.816 1.00 30.17  ? 11   THR A N   1 
ATOM   67   C CA  . THR A 1 10  ? 40.506  -45.624 373.528 1.00 31.48  ? 11   THR A CA  1 
ATOM   68   C C   . THR A 1 10  ? 41.619  -45.876 372.520 1.00 32.85  ? 11   THR A C   1 
ATOM   69   O O   . THR A 1 10  ? 41.560  -46.842 371.751 1.00 35.83  ? 11   THR A O   1 
ATOM   70   C CB  . THR A 1 10  ? 40.470  -46.738 374.574 1.00 34.83  ? 11   THR A CB  1 
ATOM   71   O OG1 . THR A 1 10  ? 39.460  -46.450 375.548 1.00 34.70  ? 11   THR A OG1 1 
ATOM   72   C CG2 . THR A 1 10  ? 41.819  -46.851 375.269 1.00 38.42  ? 11   THR A CG2 1 
ATOM   73   N N   . VAL A 1 11  ? 42.619  -44.998 372.518 1.00 29.20  ? 12   VAL A N   1 
ATOM   74   C CA  . VAL A 1 11  ? 43.838  -45.197 371.743 1.00 29.44  ? 12   VAL A CA  1 
ATOM   75   C C   . VAL A 1 11  ? 44.982  -45.400 372.729 1.00 33.34  ? 12   VAL A C   1 
ATOM   76   O O   . VAL A 1 11  ? 44.752  -45.474 373.942 1.00 36.47  ? 12   VAL A O   1 
ATOM   77   C CB  . VAL A 1 11  ? 44.093  -44.015 370.790 1.00 33.02  ? 12   VAL A CB  1 
ATOM   78   C CG1 . VAL A 1 11  ? 42.922  -43.852 369.824 1.00 24.16  ? 12   VAL A CG1 1 
ATOM   79   C CG2 . VAL A 1 11  ? 44.312  -42.733 371.575 1.00 28.97  ? 12   VAL A CG2 1 
ATOM   80   N N   . ARG A 1 12  ? 46.203  -45.487 372.222 1.00 39.03  ? 13   ARG A N   1 
ATOM   81   C CA  . ARG A 1 12  ? 47.361  -45.752 373.066 1.00 44.15  ? 13   ARG A CA  1 
ATOM   82   C C   . ARG A 1 12  ? 47.617  -44.718 374.157 1.00 36.61  ? 13   ARG A C   1 
ATOM   83   O O   . ARG A 1 12  ? 48.017  -45.072 375.266 1.00 42.52  ? 13   ARG A O   1 
ATOM   84   C CB  . ARG A 1 12  ? 48.617  -45.913 372.204 1.00 49.61  ? 13   ARG A CB  1 
ATOM   85   C CG  . ARG A 1 12  ? 48.542  -47.057 371.206 1.00 60.11  ? 13   ARG A CG  1 
ATOM   86   C CD  . ARG A 1 12  ? 49.820  -47.160 370.387 1.00 75.73  ? 13   ARG A CD  1 
ATOM   87   N NE  . ARG A 1 12  ? 49.801  -48.254 369.415 1.00 86.76  ? 13   ARG A NE  1 
ATOM   88   C CZ  . ARG A 1 12  ? 49.250  -49.449 369.616 1.00 91.77  ? 13   ARG A CZ  1 
ATOM   89   N NH1 . ARG A 1 12  ? 48.672  -49.744 370.772 1.00 94.26  ? 13   ARG A NH1 1 
ATOM   90   N NH2 . ARG A 1 12  ? 49.293  -50.363 368.656 1.00 89.25  ? 13   ARG A NH2 1 
ATOM   91   N N   . GLY A 1 13  ? 47.403  -43.447 373.848 1.00 32.70  ? 14   GLY A N   1 
ATOM   92   C CA  . GLY A 1 13  ? 47.665  -42.403 374.819 1.00 32.12  ? 14   GLY A CA  1 
ATOM   93   C C   . GLY A 1 13  ? 46.609  -42.313 375.897 1.00 35.85  ? 14   GLY A C   1 
ATOM   94   O O   . GLY A 1 13  ? 46.893  -41.859 377.008 1.00 38.27  ? 14   GLY A O   1 
ATOM   95   N N   . GLY A 1 14  ? 45.394  -42.735 375.599 1.00 36.48  ? 15   GLY A N   1 
ATOM   96   C CA  . GLY A 1 14  ? 44.317  -42.655 376.559 1.00 29.92  ? 15   GLY A CA  1 
ATOM   97   C C   . GLY A 1 14  ? 42.978  -42.606 375.853 1.00 29.35  ? 15   GLY A C   1 
ATOM   98   O O   . GLY A 1 14  ? 42.854  -43.009 374.701 1.00 33.48  ? 15   GLY A O   1 
ATOM   99   N N   . ARG A 1 15  ? 41.987  -42.091 376.571 1.00 30.30  ? 16   ARG A N   1 
ATOM   100  C CA  . ARG A 1 15  ? 40.606  -42.098 376.116 1.00 29.51  ? 16   ARG A CA  1 
ATOM   101  C C   . ARG A 1 15  ? 40.246  -40.786 375.431 1.00 31.84  ? 16   ARG A C   1 
ATOM   102  O O   . ARG A 1 15  ? 40.736  -39.714 375.794 1.00 29.27  ? 16   ARG A O   1 
ATOM   103  C CB  . ARG A 1 15  ? 39.657  -42.355 377.286 1.00 29.87  ? 16   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 15  ? 39.715  -43.778 377.816 1.00 33.41  ? 16   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 15  ? 38.760  -43.967 378.979 1.00 38.48  ? 16   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 15  ? 39.257  -43.327 380.193 1.00 45.91  ? 16   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 15  ? 38.478  -42.882 381.173 1.00 50.99  ? 16   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 15  ? 37.161  -43.004 381.083 1.00 46.29  ? 16   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 15  ? 39.016  -42.311 382.243 1.00 51.81  ? 16   ARG A NH2 1 
ATOM   110  N N   . LEU A 1 16  ? 39.371  -40.889 374.431 1.00 27.52  ? 17   LEU A N   1 
ATOM   111  C CA  . LEU A 1 16  ? 38.917  -39.751 373.649 1.00 25.88  ? 17   LEU A CA  1 
ATOM   112  C C   . LEU A 1 16  ? 37.397  -39.702 373.641 1.00 29.76  ? 17   LEU A C   1 
ATOM   113  O O   . LEU A 1 16  ? 36.723  -40.725 373.796 1.00 32.74  ? 17   LEU A O   1 
ATOM   114  C CB  . LEU A 1 16  ? 39.419  -39.818 372.200 1.00 25.65  ? 17   LEU A CB  1 
ATOM   115  C CG  . LEU A 1 16  ? 40.925  -39.834 371.947 1.00 25.20  ? 17   LEU A CG  1 
ATOM   116  C CD1 . LEU A 1 16  ? 41.203  -40.141 370.484 1.00 25.11  ? 17   LEU A CD1 1 
ATOM   117  C CD2 . LEU A 1 16  ? 41.542  -38.506 372.344 1.00 26.84  ? 17   LEU A CD2 1 
ATOM   118  N N   . ARG A 1 17  ? 36.866  -38.497 373.448 1.00 30.60  ? 18   ARG A N   1 
ATOM   119  C CA  . ARG A 1 17  ? 35.437  -38.275 373.284 1.00 25.85  ? 18   ARG A CA  1 
ATOM   120  C C   . ARG A 1 17  ? 35.225  -37.432 372.035 1.00 29.68  ? 18   ARG A C   1 
ATOM   121  O O   . ARG A 1 17  ? 35.824  -36.361 371.900 1.00 28.59  ? 18   ARG A O   1 
ATOM   122  C CB  . ARG A 1 17  ? 34.837  -37.585 374.516 1.00 29.74  ? 18   ARG A CB  1 
ATOM   123  C CG  . ARG A 1 17  ? 33.344  -37.309 374.426 1.00 27.03  ? 18   ARG A CG  1 
ATOM   124  C CD  . ARG A 1 17  ? 32.857  -36.524 375.638 1.00 24.90  ? 18   ARG A CD  1 
ATOM   125  N NE  . ARG A 1 17  ? 32.973  -37.289 376.877 1.00 34.69  ? 18   ARG A NE  1 
ATOM   126  C CZ  . ARG A 1 17  ? 33.809  -36.992 377.868 1.00 38.16  ? 18   ARG A CZ  1 
ATOM   127  N NH1 . ARG A 1 17  ? 34.613  -35.941 377.770 1.00 35.70  ? 18   ARG A NH1 1 
ATOM   128  N NH2 . ARG A 1 17  ? 33.842  -37.746 378.958 1.00 34.54  ? 18   ARG A NH2 1 
ATOM   129  N N   . GLY A 1 18  ? 34.388  -37.922 371.120 1.00 27.57  ? 19   GLY A N   1 
ATOM   130  C CA  . GLY A 1 18  ? 34.113  -37.246 369.876 1.00 22.07  ? 19   GLY A CA  1 
ATOM   131  C C   . GLY A 1 18  ? 32.727  -36.630 369.833 1.00 27.22  ? 19   GLY A C   1 
ATOM   132  O O   . GLY A 1 18  ? 32.045  -36.480 370.849 1.00 25.62  ? 19   GLY A O   1 
ATOM   133  N N   . ILE A 1 19  ? 32.315  -36.264 368.617 1.00 23.01  ? 20   ILE A N   1 
ATOM   134  C CA  . ILE A 1 19  ? 31.002  -35.680 368.377 1.00 27.82  ? 20   ILE A CA  1 
ATOM   135  C C   . ILE A 1 19  ? 30.304  -36.445 367.262 1.00 29.61  ? 20   ILE A C   1 
ATOM   136  O O   . ILE A 1 19  ? 30.934  -37.104 366.432 1.00 29.09  ? 20   ILE A O   1 
ATOM   137  C CB  . ILE A 1 19  ? 31.069  -34.182 368.008 1.00 34.26  ? 20   ILE A CB  1 
ATOM   138  C CG1 . ILE A 1 19  ? 31.720  -33.999 366.634 1.00 39.71  ? 20   ILE A CG1 1 
ATOM   139  C CG2 . ILE A 1 19  ? 31.802  -33.398 369.070 1.00 32.47  ? 20   ILE A CG2 1 
ATOM   140  C CD1 . ILE A 1 19  ? 31.957  -32.556 366.256 1.00 42.77  ? 20   ILE A CD1 1 
ATOM   141  N N   . ARG A 1 20  ? 28.980  -36.339 367.254 1.00 31.81  ? 21   ARG A N   1 
ATOM   142  C CA  . ARG A 1 20  ? 28.149  -36.861 366.179 1.00 34.15  ? 21   ARG A CA  1 
ATOM   143  C C   . ARG A 1 20  ? 27.840  -35.720 365.218 1.00 35.09  ? 21   ARG A C   1 
ATOM   144  O O   . ARG A 1 20  ? 27.254  -34.708 365.618 1.00 34.35  ? 21   ARG A O   1 
ATOM   145  C CB  . ARG A 1 20  ? 26.864  -37.475 366.734 1.00 37.01  ? 21   ARG A CB  1 
ATOM   146  C CG  . ARG A 1 20  ? 25.845  -37.880 365.682 1.00 42.35  ? 21   ARG A CG  1 
ATOM   147  C CD  . ARG A 1 20  ? 24.534  -38.283 366.341 1.00 55.73  ? 21   ARG A CD  1 
ATOM   148  N NE  . ARG A 1 20  ? 23.374  -38.018 365.494 1.00 63.17  ? 21   ARG A NE  1 
ATOM   149  C CZ  . ARG A 1 20  ? 22.552  -38.959 365.040 1.00 66.08  ? 21   ARG A CZ  1 
ATOM   150  N NH1 . ARG A 1 20  ? 22.759  -40.231 365.352 1.00 71.86  ? 21   ARG A NH1 1 
ATOM   151  N NH2 . ARG A 1 20  ? 21.520  -38.628 364.276 1.00 63.05  ? 21   ARG A NH2 1 
ATOM   152  N N   . LEU A 1 21  ? 28.245  -35.879 363.964 1.00 31.72  ? 22   LEU A N   1 
ATOM   153  C CA  . LEU A 1 21  ? 28.079  -34.851 362.947 1.00 34.97  ? 22   LEU A CA  1 
ATOM   154  C C   . LEU A 1 21  ? 26.863  -35.158 362.088 1.00 33.79  ? 22   LEU A C   1 
ATOM   155  O O   . LEU A 1 21  ? 26.666  -36.303 361.669 1.00 33.43  ? 22   LEU A O   1 
ATOM   156  C CB  . LEU A 1 21  ? 29.321  -34.752 362.062 1.00 38.22  ? 22   LEU A CB  1 
ATOM   157  C CG  . LEU A 1 21  ? 30.510  -33.960 362.599 1.00 39.46  ? 22   LEU A CG  1 
ATOM   158  C CD1 . LEU A 1 21  ? 31.539  -33.779 361.500 1.00 37.31  ? 22   LEU A CD1 1 
ATOM   159  C CD2 . LEU A 1 21  ? 30.052  -32.617 363.137 1.00 36.16  ? 22   LEU A CD2 1 
ATOM   160  N N   . LYS A 1 22  ? 26.054  -34.137 361.828 1.00 38.29  ? 23   LYS A N   1 
ATOM   161  C CA  . LYS A 1 22  ? 24.983  -34.257 360.852 1.00 37.86  ? 23   LYS A CA  1 
ATOM   162  C C   . LYS A 1 22  ? 25.550  -34.044 359.455 1.00 38.41  ? 23   LYS A C   1 
ATOM   163  O O   . LYS A 1 22  ? 26.313  -33.102 359.221 1.00 46.67  ? 23   LYS A O   1 
ATOM   164  C CB  . LYS A 1 22  ? 23.876  -33.242 361.132 1.00 44.96  ? 23   LYS A CB  1 
ATOM   165  C CG  . LYS A 1 22  ? 23.137  -33.458 362.442 1.00 59.32  ? 23   LYS A CG  1 
ATOM   166  C CD  . LYS A 1 22  ? 22.123  -32.351 362.687 1.00 71.71  ? 23   LYS A CD  1 
ATOM   167  C CE  . LYS A 1 22  ? 21.355  -32.575 363.981 1.00 76.04  ? 23   LYS A CE  1 
ATOM   168  N NZ  . LYS A 1 22  ? 20.544  -33.823 363.941 1.00 79.48  ? 23   LYS A NZ  1 
ATOM   169  N N   . THR A 1 23  ? 25.200  -34.933 358.539 1.00 33.20  ? 24   THR A N   1 
ATOM   170  C CA  . THR A 1 23  ? 25.462  -34.768 357.120 1.00 42.22  ? 24   THR A CA  1 
ATOM   171  C C   . THR A 1 23  ? 24.142  -34.917 356.385 1.00 48.88  ? 24   THR A C   1 
ATOM   172  O O   . THR A 1 23  ? 23.182  -35.474 356.929 1.00 43.88  ? 24   THR A O   1 
ATOM   173  C CB  . THR A 1 23  ? 26.475  -35.797 356.591 1.00 34.00  ? 24   THR A CB  1 
ATOM   174  O OG1 . THR A 1 23  ? 25.816  -37.051 356.375 1.00 37.60  ? 24   THR A OG1 1 
ATOM   175  C CG2 . THR A 1 23  ? 27.623  -35.986 357.571 1.00 33.19  ? 24   THR A CG2 1 
ATOM   176  N N   . PRO A 1 24  ? 24.049  -34.402 355.156 1.00 56.06  ? 25   PRO A N   1 
ATOM   177  C CA  . PRO A 1 24  ? 22.827  -34.619 354.364 1.00 59.53  ? 25   PRO A CA  1 
ATOM   178  C C   . PRO A 1 24  ? 22.396  -36.072 354.289 1.00 56.77  ? 25   PRO A C   1 
ATOM   179  O O   . PRO A 1 24  ? 21.190  -36.353 354.270 1.00 67.70  ? 25   PRO A O   1 
ATOM   180  C CB  . PRO A 1 24  ? 23.219  -34.079 352.984 1.00 62.95  ? 25   PRO A CB  1 
ATOM   181  C CG  . PRO A 1 24  ? 24.194  -33.002 353.288 1.00 60.69  ? 25   PRO A CG  1 
ATOM   182  C CD  . PRO A 1 24  ? 24.967  -33.453 354.501 1.00 57.79  ? 25   PRO A CD  1 
ATOM   183  N N   . GLY A 1 25  ? 23.340  -37.007 354.267 1.00 49.72  ? 26   GLY A N   1 
ATOM   184  C CA  . GLY A 1 25  ? 23.037  -38.409 354.104 1.00 44.32  ? 26   GLY A CA  1 
ATOM   185  C C   . GLY A 1 25  ? 22.979  -39.245 355.363 1.00 46.11  ? 26   GLY A C   1 
ATOM   186  O O   . GLY A 1 25  ? 22.634  -40.427 355.284 1.00 57.74  ? 26   GLY A O   1 
ATOM   187  N N   . GLY A 1 26  ? 23.311  -38.682 356.521 1.00 38.82  ? 27   GLY A N   1 
ATOM   188  C CA  . GLY A 1 26  ? 23.278  -39.434 357.752 1.00 39.62  ? 27   GLY A CA  1 
ATOM   189  C C   . GLY A 1 26  ? 24.340  -38.996 358.739 1.00 40.47  ? 27   GLY A C   1 
ATOM   190  O O   . GLY A 1 26  ? 25.186  -38.147 358.446 1.00 40.06  ? 27   GLY A O   1 
ATOM   191  N N   . PRO A 1 27  ? 24.312  -39.576 359.936 1.00 37.97  ? 28   PRO A N   1 
ATOM   192  C CA  . PRO A 1 27  ? 25.277  -39.181 360.965 1.00 28.67  ? 28   PRO A CA  1 
ATOM   193  C C   . PRO A 1 27  ? 26.667  -39.725 360.680 1.00 32.54  ? 28   PRO A C   1 
ATOM   194  O O   . PRO A 1 27  ? 26.840  -40.772 360.050 1.00 29.92  ? 28   PRO A O   1 
ATOM   195  C CB  . PRO A 1 27  ? 24.696  -39.793 362.244 1.00 30.43  ? 28   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 27  ? 23.950  -40.991 361.758 1.00 34.14  ? 28   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 27  ? 23.366  -40.594 360.426 1.00 37.68  ? 28   PRO A CD  1 
ATOM   198  N N   . VAL A 1 28  ? 27.664  -38.986 361.156 1.00 31.94  ? 29   VAL A N   1 
ATOM   199  C CA  . VAL A 1 28  ? 29.067  -39.370 361.062 1.00 26.70  ? 29   VAL A CA  1 
ATOM   200  C C   . VAL A 1 28  ? 29.708  -39.088 362.414 1.00 29.21  ? 29   VAL A C   1 
ATOM   201  O O   . VAL A 1 28  ? 29.361  -38.107 363.080 1.00 27.61  ? 29   VAL A O   1 
ATOM   202  C CB  . VAL A 1 28  ? 29.787  -38.609 359.925 1.00 30.76  ? 29   VAL A CB  1 
ATOM   203  C CG1 . VAL A 1 28  ? 31.299  -38.767 360.022 1.00 33.33  ? 29   VAL A CG1 1 
ATOM   204  C CG2 . VAL A 1 28  ? 29.291  -39.085 358.567 1.00 29.20  ? 29   VAL A CG2 1 
ATOM   205  N N   . SER A 1 29  ? 30.617  -39.963 362.838 1.00 25.78  ? 30   SER A N   1 
ATOM   206  C CA  . SER A 1 29  ? 31.384  -39.735 364.055 1.00 29.53  ? 30   SER A CA  1 
ATOM   207  C C   . SER A 1 29  ? 32.670  -38.996 363.711 1.00 30.13  ? 30   SER A C   1 
ATOM   208  O O   . SER A 1 29  ? 33.384  -39.379 362.779 1.00 29.04  ? 30   SER A O   1 
ATOM   209  C CB  . SER A 1 29  ? 31.706  -41.052 364.761 1.00 27.50  ? 30   SER A CB  1 
ATOM   210  O OG  . SER A 1 29  ? 30.529  -41.765 365.087 1.00 38.76  ? 30   SER A OG  1 
ATOM   211  N N   . ALA A 1 30  ? 32.961  -37.939 364.464 1.00 23.35  ? 31   ALA A N   1 
ATOM   212  C CA  . ALA A 1 30  ? 34.140  -37.121 364.232 1.00 23.56  ? 31   ALA A CA  1 
ATOM   213  C C   . ALA A 1 30  ? 34.929  -36.976 365.523 1.00 25.43  ? 31   ALA A C   1 
ATOM   214  O O   . ALA A 1 30  ? 34.358  -36.724 366.588 1.00 27.38  ? 31   ALA A O   1 
ATOM   215  C CB  . ALA A 1 30  ? 33.765  -35.735 363.692 1.00 19.61  ? 31   ALA A CB  1 
ATOM   216  N N   . PHE A 1 31  ? 36.243  -37.140 365.418 1.00 24.48  ? 32   PHE A N   1 
ATOM   217  C CA  . PHE A 1 31  ? 37.171  -36.954 366.529 1.00 23.38  ? 32   PHE A CA  1 
ATOM   218  C C   . PHE A 1 31  ? 38.180  -35.908 366.066 1.00 21.97  ? 32   PHE A C   1 
ATOM   219  O O   . PHE A 1 31  ? 39.175  -36.229 365.412 1.00 26.12  ? 32   PHE A O   1 
ATOM   220  C CB  . PHE A 1 31  ? 37.832  -38.274 366.923 1.00 18.97  ? 32   PHE A CB  1 
ATOM   221  C CG  . PHE A 1 31  ? 36.860  -39.305 367.425 1.00 21.92  ? 32   PHE A CG  1 
ATOM   222  C CD1 . PHE A 1 31  ? 36.649  -39.476 368.783 1.00 21.36  ? 32   PHE A CD1 1 
ATOM   223  C CD2 . PHE A 1 31  ? 36.146  -40.094 366.537 1.00 26.55  ? 32   PHE A CD2 1 
ATOM   224  C CE1 . PHE A 1 31  ? 35.749  -40.419 369.246 1.00 29.47  ? 32   PHE A CE1 1 
ATOM   225  C CE2 . PHE A 1 31  ? 35.246  -41.039 366.994 1.00 31.61  ? 32   PHE A CE2 1 
ATOM   226  C CZ  . PHE A 1 31  ? 35.048  -41.201 368.350 1.00 25.84  ? 32   PHE A CZ  1 
ATOM   227  N N   . LEU A 1 32  ? 37.908  -34.652 366.401 1.00 20.90  ? 33   LEU A N   1 
ATOM   228  C CA  . LEU A 1 32  ? 38.661  -33.518 365.889 1.00 20.13  ? 33   LEU A CA  1 
ATOM   229  C C   . LEU A 1 32  ? 39.616  -32.989 366.950 1.00 21.75  ? 33   LEU A C   1 
ATOM   230  O O   . LEU A 1 32  ? 39.242  -32.828 368.113 1.00 22.83  ? 33   LEU A O   1 
ATOM   231  C CB  . LEU A 1 32  ? 37.708  -32.410 365.440 1.00 24.96  ? 33   LEU A CB  1 
ATOM   232  C CG  . LEU A 1 32  ? 36.546  -32.906 364.577 1.00 21.47  ? 33   LEU A CG  1 
ATOM   233  C CD1 . LEU A 1 32  ? 35.557  -31.789 364.284 1.00 20.80  ? 33   LEU A CD1 1 
ATOM   234  C CD2 . LEU A 1 32  ? 37.073  -33.514 363.285 1.00 19.62  ? 33   LEU A CD2 1 
ATOM   235  N N   . GLY A 1 33  ? 40.851  -32.716 366.541 1.00 19.62  ? 34   GLY A N   1 
ATOM   236  C CA  . GLY A 1 33  ? 41.836  -32.176 367.457 1.00 20.26  ? 34   GLY A CA  1 
ATOM   237  C C   . GLY A 1 33  ? 42.404  -33.196 368.422 1.00 21.70  ? 34   GLY A C   1 
ATOM   238  O O   . GLY A 1 33  ? 42.482  -32.942 369.627 1.00 21.67  ? 34   GLY A O   1 
ATOM   239  N N   . ILE A 1 34  ? 42.797  -34.357 367.907 1.00 18.78  ? 35   ILE A N   1 
ATOM   240  C CA  . ILE A 1 34  ? 43.478  -35.373 368.705 1.00 16.99  ? 35   ILE A CA  1 
ATOM   241  C C   . ILE A 1 34  ? 44.961  -35.030 368.759 1.00 23.39  ? 35   ILE A C   1 
ATOM   242  O O   . ILE A 1 34  ? 45.595  -34.888 367.704 1.00 22.01  ? 35   ILE A O   1 
ATOM   243  C CB  . ILE A 1 34  ? 43.270  -36.781 368.125 1.00 22.74  ? 35   ILE A CB  1 
ATOM   244  C CG1 . ILE A 1 34  ? 41.781  -37.086 367.953 1.00 25.15  ? 35   ILE A CG1 1 
ATOM   245  C CG2 . ILE A 1 34  ? 43.949  -37.826 369.001 1.00 23.14  ? 35   ILE A CG2 1 
ATOM   246  C CD1 . ILE A 1 34  ? 41.511  -38.361 367.178 1.00 25.68  ? 35   ILE A CD1 1 
ATOM   247  N N   . PRO A 1 35  ? 45.560  -34.892 369.941 1.00 24.91  ? 36   PRO A N   1 
ATOM   248  C CA  . PRO A 1 35  ? 47.003  -34.627 370.000 1.00 21.06  ? 36   PRO A CA  1 
ATOM   249  C C   . PRO A 1 35  ? 47.793  -35.871 369.625 1.00 24.93  ? 36   PRO A C   1 
ATOM   250  O O   . PRO A 1 35  ? 47.572  -36.951 370.178 1.00 25.41  ? 36   PRO A O   1 
ATOM   251  C CB  . PRO A 1 35  ? 47.234  -34.229 371.462 1.00 21.67  ? 36   PRO A CB  1 
ATOM   252  C CG  . PRO A 1 35  ? 46.139  -34.915 372.212 1.00 21.75  ? 36   PRO A CG  1 
ATOM   253  C CD  . PRO A 1 35  ? 44.953  -34.991 371.281 1.00 21.79  ? 36   PRO A CD  1 
ATOM   254  N N   . PHE A 1 36  ? 48.713  -35.722 368.670 1.00 22.92  ? 37   PHE A N   1 
ATOM   255  C CA  . PHE A 1 36  ? 49.609  -36.814 368.323 1.00 27.10  ? 37   PHE A CA  1 
ATOM   256  C C   . PHE A 1 36  ? 51.075  -36.514 368.597 1.00 22.63  ? 37   PHE A C   1 
ATOM   257  O O   . PHE A 1 36  ? 51.904  -37.422 368.474 1.00 26.63  ? 37   PHE A O   1 
ATOM   258  C CB  . PHE A 1 36  ? 49.431  -37.231 366.850 1.00 21.39  ? 37   PHE A CB  1 
ATOM   259  C CG  . PHE A 1 36  ? 49.881  -36.202 365.843 1.00 20.77  ? 37   PHE A CG  1 
ATOM   260  C CD1 . PHE A 1 36  ? 51.167  -36.237 365.323 1.00 21.83  ? 37   PHE A CD1 1 
ATOM   261  C CD2 . PHE A 1 36  ? 49.002  -35.239 365.372 1.00 16.85  ? 37   PHE A CD2 1 
ATOM   262  C CE1 . PHE A 1 36  ? 51.579  -35.309 364.381 1.00 18.59  ? 37   PHE A CE1 1 
ATOM   263  C CE2 . PHE A 1 36  ? 49.408  -34.308 364.428 1.00 20.74  ? 37   PHE A CE2 1 
ATOM   264  C CZ  . PHE A 1 36  ? 50.698  -34.344 363.932 1.00 21.52  ? 37   PHE A CZ  1 
ATOM   265  N N   . ALA A 1 37  ? 51.418  -35.288 368.982 1.00 20.11  ? 38   ALA A N   1 
ATOM   266  C CA  . ALA A 1 37  ? 52.780  -34.960 369.371 1.00 20.20  ? 38   ALA A CA  1 
ATOM   267  C C   . ALA A 1 37  ? 52.750  -34.040 370.581 1.00 26.03  ? 38   ALA A C   1 
ATOM   268  O O   . ALA A 1 37  ? 51.744  -33.386 370.866 1.00 26.18  ? 38   ALA A O   1 
ATOM   269  C CB  . ALA A 1 37  ? 53.559  -34.298 368.227 1.00 17.32  ? 38   ALA A CB  1 
ATOM   270  N N   . GLU A 1 38  ? 53.864  -34.012 371.303 1.00 27.56  ? 39   GLU A N   1 
ATOM   271  C CA  . GLU A 1 38  ? 54.044  -32.989 372.318 1.00 26.94  ? 39   GLU A CA  1 
ATOM   272  C C   . GLU A 1 38  ? 54.096  -31.623 371.640 1.00 27.17  ? 39   GLU A C   1 
ATOM   273  O O   . GLU A 1 38  ? 54.637  -31.501 370.534 1.00 29.81  ? 39   GLU A O   1 
ATOM   274  C CB  . GLU A 1 38  ? 55.326  -33.235 373.115 1.00 31.65  ? 39   GLU A CB  1 
ATOM   275  C CG  . GLU A 1 38  ? 55.250  -34.427 374.050 1.00 39.59  ? 39   GLU A CG  1 
ATOM   276  C CD  . GLU A 1 38  ? 54.239  -34.225 375.162 1.00 48.63  ? 39   GLU A CD  1 
ATOM   277  O OE1 . GLU A 1 38  ? 54.222  -33.126 375.757 1.00 50.23  ? 39   GLU A OE1 1 
ATOM   278  O OE2 . GLU A 1 38  ? 53.459  -35.161 375.436 1.00 48.45  ? 39   GLU A OE2 1 
ATOM   279  N N   . PRO A 1 39  ? 53.522  -30.589 372.248 1.00 28.71  ? 40   PRO A N   1 
ATOM   280  C CA  . PRO A 1 39  ? 53.528  -29.260 371.626 1.00 27.35  ? 40   PRO A CA  1 
ATOM   281  C C   . PRO A 1 39  ? 54.946  -28.782 371.372 1.00 31.71  ? 40   PRO A C   1 
ATOM   282  O O   . PRO A 1 39  ? 55.765  -28.710 372.300 1.00 31.08  ? 40   PRO A O   1 
ATOM   283  C CB  . PRO A 1 39  ? 52.818  -28.383 372.667 1.00 34.99  ? 40   PRO A CB  1 
ATOM   284  C CG  . PRO A 1 39  ? 51.926  -29.333 373.394 1.00 38.25  ? 40   PRO A CG  1 
ATOM   285  C CD  . PRO A 1 39  ? 52.700  -30.622 373.470 1.00 32.04  ? 40   PRO A CD  1 
ATOM   286  N N   . PRO A 1 40  ? 55.278  -28.454 370.122 1.00 33.03  ? 41   PRO A N   1 
ATOM   287  C CA  . PRO A 1 40  ? 56.645  -28.021 369.778 1.00 33.16  ? 41   PRO A CA  1 
ATOM   288  C C   . PRO A 1 40  ? 56.904  -26.560 370.138 1.00 35.12  ? 41   PRO A C   1 
ATOM   289  O O   . PRO A 1 40  ? 57.216  -25.723 369.287 1.00 36.20  ? 41   PRO A O   1 
ATOM   290  C CB  . PRO A 1 40  ? 56.693  -28.278 368.267 1.00 28.92  ? 41   PRO A CB  1 
ATOM   291  C CG  . PRO A 1 40  ? 55.292  -28.025 367.819 1.00 27.82  ? 41   PRO A CG  1 
ATOM   292  C CD  . PRO A 1 40  ? 54.405  -28.525 368.936 1.00 28.74  ? 41   PRO A CD  1 
ATOM   293  N N   . MET A 1 41  ? 56.779  -26.250 371.425 1.00 36.75  ? 42   MET A N   1 
ATOM   294  C CA  . MET A 1 41  ? 56.944  -24.902 371.946 1.00 41.00  ? 42   MET A CA  1 
ATOM   295  C C   . MET A 1 41  ? 58.329  -24.709 372.547 1.00 35.64  ? 42   MET A C   1 
ATOM   296  O O   . MET A 1 41  ? 59.022  -25.668 372.897 1.00 40.72  ? 42   MET A O   1 
ATOM   297  C CB  . MET A 1 41  ? 55.897  -24.595 373.019 1.00 52.77  ? 42   MET A CB  1 
ATOM   298  C CG  . MET A 1 41  ? 54.541  -25.210 372.783 1.00 58.83  ? 42   MET A CG  1 
ATOM   299  S SD  . MET A 1 41  ? 53.589  -24.227 371.620 1.00 71.42  ? 42   MET A SD  1 
ATOM   300  C CE  . MET A 1 41  ? 53.533  -22.662 372.488 1.00 68.79  ? 42   MET A CE  1 
ATOM   301  N N   . GLY A 1 42  ? 58.708  -23.438 372.684 1.00 37.00  ? 43   GLY A N   1 
ATOM   302  C CA  . GLY A 1 42  ? 59.893  -23.046 373.411 1.00 39.06  ? 43   GLY A CA  1 
ATOM   303  C C   . GLY A 1 42  ? 61.139  -23.770 372.954 1.00 39.83  ? 43   GLY A C   1 
ATOM   304  O O   . GLY A 1 42  ? 61.616  -23.587 371.830 1.00 32.52  ? 43   GLY A O   1 
ATOM   305  N N   . PRO A 1 43  ? 61.688  -24.624 373.823 1.00 41.18  ? 44   PRO A N   1 
ATOM   306  C CA  . PRO A 1 43  ? 62.900  -25.373 373.457 1.00 38.52  ? 44   PRO A CA  1 
ATOM   307  C C   . PRO A 1 43  ? 62.694  -26.387 372.343 1.00 36.67  ? 44   PRO A C   1 
ATOM   308  O O   . PRO A 1 43  ? 63.689  -26.860 371.780 1.00 36.28  ? 44   PRO A O   1 
ATOM   309  C CB  . PRO A 1 43  ? 63.293  -26.067 374.768 1.00 40.73  ? 44   PRO A CB  1 
ATOM   310  C CG  . PRO A 1 43  ? 62.023  -26.158 375.541 1.00 41.26  ? 44   PRO A CG  1 
ATOM   311  C CD  . PRO A 1 43  ? 61.248  -24.918 375.197 1.00 38.17  ? 44   PRO A CD  1 
ATOM   312  N N   . ARG A 1 44  ? 61.457  -26.738 371.999 1.00 32.94  ? 45   ARG A N   1 
ATOM   313  C CA  . ARG A 1 44  ? 61.215  -27.731 370.961 1.00 35.96  ? 45   ARG A CA  1 
ATOM   314  C C   . ARG A 1 44  ? 60.843  -27.122 369.617 1.00 29.71  ? 45   ARG A C   1 
ATOM   315  O O   . ARG A 1 44  ? 60.553  -27.869 368.677 1.00 27.79  ? 45   ARG A O   1 
ATOM   316  C CB  . ARG A 1 44  ? 60.140  -28.721 371.405 1.00 34.91  ? 45   ARG A CB  1 
ATOM   317  C CG  . ARG A 1 44  ? 60.495  -29.424 372.696 1.00 45.62  ? 45   ARG A CG  1 
ATOM   318  C CD  . ARG A 1 44  ? 59.281  -30.069 373.326 1.00 56.43  ? 45   ARG A CD  1 
ATOM   319  N NE  . ARG A 1 44  ? 59.538  -31.451 373.715 1.00 69.04  ? 45   ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 44  ? 58.925  -32.060 374.724 1.00 77.03  ? 45   ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 44  ? 58.018  -31.404 375.434 1.00 83.15  ? 45   ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 44  ? 59.211  -33.320 375.019 1.00 82.36  ? 45   ARG A NH2 1 
ATOM   323  N N   . ARG A 1 45  ? 60.853  -25.796 369.499 1.00 29.21  ? 46   ARG A N   1 
ATOM   324  C CA  . ARG A 1 45  ? 60.749  -25.172 368.188 1.00 31.33  ? 46   ARG A CA  1 
ATOM   325  C C   . ARG A 1 45  ? 61.924  -25.613 367.323 1.00 29.14  ? 46   ARG A C   1 
ATOM   326  O O   . ARG A 1 45  ? 63.066  -25.671 367.788 1.00 27.06  ? 46   ARG A O   1 
ATOM   327  C CB  . ARG A 1 45  ? 60.719  -23.646 368.329 1.00 24.49  ? 46   ARG A CB  1 
ATOM   328  C CG  . ARG A 1 45  ? 60.599  -22.888 367.011 1.00 23.99  ? 46   ARG A CG  1 
ATOM   329  C CD  . ARG A 1 45  ? 60.857  -21.395 367.193 1.00 25.92  ? 46   ARG A CD  1 
ATOM   330  N NE  . ARG A 1 45  ? 59.691  -20.677 367.700 1.00 25.46  ? 46   ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 45  ? 59.669  -19.371 367.950 1.00 30.91  ? 46   ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 45  ? 60.753  -18.636 367.742 1.00 30.27  ? 46   ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 45  ? 58.564  -18.799 368.410 1.00 24.58  ? 46   ARG A NH2 1 
ATOM   334  N N   . PHE A 1 46  ? 61.627  -25.957 366.069 1.00 22.51  ? 47   PHE A N   1 
ATOM   335  C CA  . PHE A 1 46  ? 62.548  -26.462 365.049 1.00 23.07  ? 47   PHE A CA  1 
ATOM   336  C C   . PHE A 1 46  ? 62.975  -27.909 365.275 1.00 25.35  ? 47   PHE A C   1 
ATOM   337  O O   . PHE A 1 46  ? 63.706  -28.456 364.440 1.00 28.88  ? 47   PHE A O   1 
ATOM   338  C CB  . PHE A 1 46  ? 63.823  -25.614 364.910 1.00 23.88  ? 47   PHE A CB  1 
ATOM   339  C CG  . PHE A 1 46  ? 63.567  -24.146 364.753 1.00 26.52  ? 47   PHE A CG  1 
ATOM   340  C CD1 . PHE A 1 46  ? 62.818  -23.667 363.692 1.00 26.25  ? 47   PHE A CD1 1 
ATOM   341  C CD2 . PHE A 1 46  ? 64.092  -23.241 365.660 1.00 25.82  ? 47   PHE A CD2 1 
ATOM   342  C CE1 . PHE A 1 46  ? 62.589  -22.312 363.545 1.00 22.35  ? 47   PHE A CE1 1 
ATOM   343  C CE2 . PHE A 1 46  ? 63.869  -21.887 365.518 1.00 23.52  ? 47   PHE A CE2 1 
ATOM   344  C CZ  . PHE A 1 46  ? 63.116  -21.421 364.459 1.00 23.65  ? 47   PHE A CZ  1 
ATOM   345  N N   . LEU A 1 47  ? 62.553  -28.550 366.362 1.00 22.81  ? 48   LEU A N   1 
ATOM   346  C CA  . LEU A 1 47  ? 62.985  -29.913 366.635 1.00 24.51  ? 48   LEU A CA  1 
ATOM   347  C C   . LEU A 1 47  ? 61.986  -30.923 366.087 1.00 27.41  ? 48   LEU A C   1 
ATOM   348  O O   . LEU A 1 47  ? 60.807  -30.607 365.894 1.00 24.82  ? 48   LEU A O   1 
ATOM   349  C CB  . LEU A 1 47  ? 63.163  -30.116 368.139 1.00 25.54  ? 48   LEU A CB  1 
ATOM   350  C CG  . LEU A 1 47  ? 64.336  -29.396 368.809 1.00 31.39  ? 48   LEU A CG  1 
ATOM   351  C CD1 . LEU A 1 47  ? 64.423  -29.790 370.274 1.00 30.66  ? 48   LEU A CD1 1 
ATOM   352  C CD2 . LEU A 1 47  ? 65.645  -29.695 368.090 1.00 33.34  ? 48   LEU A CD2 1 
ATOM   353  N N   . PRO A 1 48  ? 62.432  -32.149 365.814 1.00 29.28  ? 49   PRO A N   1 
ATOM   354  C CA  . PRO A 1 48  ? 61.503  -33.174 365.351 1.00 23.48  ? 49   PRO A CA  1 
ATOM   355  C C   . PRO A 1 48  ? 60.411  -33.408 366.377 1.00 28.07  ? 49   PRO A C   1 
ATOM   356  O O   . PRO A 1 48  ? 60.613  -33.187 367.586 1.00 30.07  ? 49   PRO A O   1 
ATOM   357  C CB  . PRO A 1 48  ? 62.397  -34.412 365.190 1.00 27.81  ? 49   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 48  ? 63.759  -33.859 364.963 1.00 34.61  ? 49   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 48  ? 63.824  -32.632 365.823 1.00 27.78  ? 49   PRO A CD  1 
ATOM   360  N N   . PRO A 1 49  ? 59.237  -33.855 365.939 1.00 29.39  ? 50   PRO A N   1 
ATOM   361  C CA  . PRO A 1 49  ? 58.129  -34.039 366.882 1.00 28.21  ? 50   PRO A CA  1 
ATOM   362  C C   . PRO A 1 49  ? 58.406  -35.169 367.859 1.00 27.06  ? 50   PRO A C   1 
ATOM   363  O O   . PRO A 1 49  ? 58.912  -36.230 367.489 1.00 30.60  ? 50   PRO A O   1 
ATOM   364  C CB  . PRO A 1 49  ? 56.944  -34.374 365.973 1.00 25.93  ? 50   PRO A CB  1 
ATOM   365  C CG  . PRO A 1 49  ? 57.583  -35.027 364.781 1.00 25.58  ? 50   PRO A CG  1 
ATOM   366  C CD  . PRO A 1 49  ? 58.869  -34.265 364.574 1.00 21.41  ? 50   PRO A CD  1 
ATOM   367  N N   . GLU A 1 50  ? 58.073  -34.924 369.121 1.00 27.13  ? 51   GLU A N   1 
ATOM   368  C CA  . GLU A 1 50  ? 58.067  -35.953 370.148 1.00 36.15  ? 51   GLU A CA  1 
ATOM   369  C C   . GLU A 1 50  ? 56.678  -36.570 370.247 1.00 35.61  ? 51   GLU A C   1 
ATOM   370  O O   . GLU A 1 50  ? 55.682  -35.842 370.233 1.00 30.89  ? 51   GLU A O   1 
ATOM   371  C CB  . GLU A 1 50  ? 58.453  -35.369 371.507 1.00 49.80  ? 51   GLU A CB  1 
ATOM   372  C CG  . GLU A 1 50  ? 59.943  -35.106 371.699 1.00 72.50  ? 51   GLU A CG  1 
ATOM   373  C CD  . GLU A 1 50  ? 60.834  -36.246 371.224 1.00 90.61  ? 51   GLU A CD  1 
ATOM   374  O OE1 . GLU A 1 50  ? 60.830  -37.315 371.869 1.00 95.71  ? 51   GLU A OE1 1 
ATOM   375  O OE2 . GLU A 1 50  ? 61.562  -36.061 370.222 1.00 93.73  ? 51   GLU A OE2 1 
ATOM   376  N N   . PRO A 1 51  ? 56.558  -37.895 370.339 1.00 35.21  ? 52   PRO A N   1 
ATOM   377  C CA  . PRO A 1 51  ? 55.225  -38.502 370.444 1.00 30.85  ? 52   PRO A CA  1 
ATOM   378  C C   . PRO A 1 51  ? 54.480  -38.014 371.680 1.00 30.88  ? 52   PRO A C   1 
ATOM   379  O O   . PRO A 1 51  ? 55.074  -37.725 372.721 1.00 33.22  ? 52   PRO A O   1 
ATOM   380  C CB  . PRO A 1 51  ? 55.521  -40.003 370.523 1.00 34.43  ? 52   PRO A CB  1 
ATOM   381  C CG  . PRO A 1 51  ? 56.875  -40.159 369.914 1.00 36.30  ? 52   PRO A CG  1 
ATOM   382  C CD  . PRO A 1 51  ? 57.625  -38.908 370.269 1.00 35.98  ? 52   PRO A CD  1 
ATOM   383  N N   . LYS A 1 52  ? 53.159  -37.916 371.546 1.00 30.01  ? 53   LYS A N   1 
ATOM   384  C CA  . LYS A 1 52  ? 52.325  -37.435 372.639 1.00 28.58  ? 53   LYS A CA  1 
ATOM   385  C C   . LYS A 1 52  ? 52.362  -38.419 373.802 1.00 31.46  ? 53   LYS A C   1 
ATOM   386  O O   . LYS A 1 52  ? 52.185  -39.627 373.615 1.00 32.66  ? 53   LYS A O   1 
ATOM   387  C CB  . LYS A 1 52  ? 50.888  -37.234 372.158 1.00 31.48  ? 53   LYS A CB  1 
ATOM   388  C CG  . LYS A 1 52  ? 49.911  -36.815 373.247 1.00 29.50  ? 53   LYS A CG  1 
ATOM   389  C CD  . LYS A 1 52  ? 50.205  -35.415 373.762 1.00 32.94  ? 53   LYS A CD  1 
ATOM   390  C CE  . LYS A 1 52  ? 49.116  -34.949 374.719 1.00 36.41  ? 53   LYS A CE  1 
ATOM   391  N NZ  . LYS A 1 52  ? 49.336  -33.553 375.194 1.00 35.36  ? 53   LYS A NZ  1 
ATOM   392  N N   . GLN A 1 53  ? 52.597  -37.903 375.004 1.00 32.71  ? 54   GLN A N   1 
ATOM   393  C CA  . GLN A 1 53  ? 52.657  -38.786 376.155 1.00 37.57  ? 54   GLN A CA  1 
ATOM   394  C C   . GLN A 1 53  ? 51.254  -39.168 376.616 1.00 37.71  ? 54   GLN A C   1 
ATOM   395  O O   . GLN A 1 53  ? 50.309  -38.389 376.465 1.00 37.02  ? 54   GLN A O   1 
ATOM   396  C CB  . GLN A 1 53  ? 53.412  -38.128 377.301 1.00 40.41  ? 54   GLN A CB  1 
ATOM   397  C CG  . GLN A 1 53  ? 54.900  -38.068 377.071 1.00 54.86  ? 54   GLN A CG  1 
ATOM   398  C CD  . GLN A 1 53  ? 55.525  -39.439 376.893 1.00 70.12  ? 54   GLN A CD  1 
ATOM   399  O OE1 . GLN A 1 53  ? 55.550  -40.250 377.818 1.00 76.93  ? 54   GLN A OE1 1 
ATOM   400  N NE2 . GLN A 1 53  ? 56.025  -39.708 375.691 1.00 72.64  ? 54   GLN A NE2 1 
ATOM   401  N N   . PRO A 1 54  ? 51.100  -40.363 377.184 1.00 38.28  ? 55   PRO A N   1 
ATOM   402  C CA  . PRO A 1 54  ? 49.770  -40.812 377.605 1.00 35.49  ? 55   PRO A CA  1 
ATOM   403  C C   . PRO A 1 54  ? 49.168  -39.887 378.651 1.00 37.61  ? 55   PRO A C   1 
ATOM   404  O O   . PRO A 1 54  ? 49.875  -39.214 379.405 1.00 34.32  ? 55   PRO A O   1 
ATOM   405  C CB  . PRO A 1 54  ? 50.029  -42.211 378.178 1.00 37.26  ? 55   PRO A CB  1 
ATOM   406  C CG  . PRO A 1 54  ? 51.322  -42.642 377.565 1.00 42.32  ? 55   PRO A CG  1 
ATOM   407  C CD  . PRO A 1 54  ? 52.128  -41.393 377.409 1.00 38.03  ? 55   PRO A CD  1 
ATOM   408  N N   . TRP A 1 55  ? 47.840  -39.863 378.684 1.00 38.07  ? 56   TRP A N   1 
ATOM   409  C CA  . TRP A 1 55  ? 47.087  -38.999 379.578 1.00 33.65  ? 56   TRP A CA  1 
ATOM   410  C C   . TRP A 1 55  ? 46.056  -39.821 380.334 1.00 34.97  ? 56   TRP A C   1 
ATOM   411  O O   . TRP A 1 55  ? 45.558  -40.834 379.836 1.00 31.17  ? 56   TRP A O   1 
ATOM   412  C CB  . TRP A 1 55  ? 46.382  -37.876 378.804 1.00 26.74  ? 56   TRP A CB  1 
ATOM   413  C CG  . TRP A 1 55  ? 45.384  -38.389 377.805 1.00 30.65  ? 56   TRP A CG  1 
ATOM   414  C CD1 . TRP A 1 55  ? 44.067  -38.671 378.031 1.00 31.07  ? 56   TRP A CD1 1 
ATOM   415  C CD2 . TRP A 1 55  ? 45.625  -38.687 376.423 1.00 30.48  ? 56   TRP A CD2 1 
ATOM   416  N NE1 . TRP A 1 55  ? 43.474  -39.125 376.877 1.00 29.10  ? 56   TRP A NE1 1 
ATOM   417  C CE2 . TRP A 1 55  ? 44.409  -39.143 375.875 1.00 25.62  ? 56   TRP A CE2 1 
ATOM   418  C CE3 . TRP A 1 55  ? 46.751  -38.612 375.597 1.00 33.93  ? 56   TRP A CE3 1 
ATOM   419  C CZ2 . TRP A 1 55  ? 44.287  -39.522 374.540 1.00 26.98  ? 56   TRP A CZ2 1 
ATOM   420  C CZ3 . TRP A 1 55  ? 46.628  -38.988 374.270 1.00 32.83  ? 56   TRP A CZ3 1 
ATOM   421  C CH2 . TRP A 1 55  ? 45.404  -39.437 373.755 1.00 28.99  ? 56   TRP A CH2 1 
ATOM   422  N N   . SER A 1 56  ? 45.741  -39.376 381.545 1.00 32.91  ? 57   SER A N   1 
ATOM   423  C CA  . SER A 1 56  ? 44.617  -39.926 382.284 1.00 37.75  ? 57   SER A CA  1 
ATOM   424  C C   . SER A 1 56  ? 43.363  -39.108 381.995 1.00 36.73  ? 57   SER A C   1 
ATOM   425  O O   . SER A 1 56  ? 43.430  -37.943 381.595 1.00 39.35  ? 57   SER A O   1 
ATOM   426  C CB  . SER A 1 56  ? 44.906  -39.948 383.786 1.00 42.25  ? 57   SER A CB  1 
ATOM   427  O OG  . SER A 1 56  ? 45.013  -38.635 384.305 1.00 45.08  ? 57   SER A OG  1 
ATOM   428  N N   . GLY A 1 57  ? 42.211  -39.735 382.195 1.00 36.79  ? 58   GLY A N   1 
ATOM   429  C CA  . GLY A 1 57  ? 40.953  -39.091 381.885 1.00 30.02  ? 58   GLY A CA  1 
ATOM   430  C C   . GLY A 1 57  ? 40.619  -39.169 380.407 1.00 34.19  ? 58   GLY A C   1 
ATOM   431  O O   . GLY A 1 57  ? 41.215  -39.925 379.634 1.00 32.69  ? 58   GLY A O   1 
ATOM   432  N N   . VAL A 1 58  ? 39.647  -38.350 380.009 1.00 28.77  ? 59   VAL A N   1 
ATOM   433  C CA  . VAL A 1 58  ? 39.108  -38.356 378.654 1.00 27.99  ? 59   VAL A CA  1 
ATOM   434  C C   . VAL A 1 58  ? 39.429  -37.027 377.986 1.00 27.37  ? 59   VAL A C   1 
ATOM   435  O O   . VAL A 1 58  ? 39.097  -35.962 378.518 1.00 28.94  ? 59   VAL A O   1 
ATOM   436  C CB  . VAL A 1 58  ? 37.589  -38.608 378.648 1.00 30.71  ? 59   VAL A CB  1 
ATOM   437  C CG1 . VAL A 1 58  ? 37.083  -38.742 377.220 1.00 26.81  ? 59   VAL A CG1 1 
ATOM   438  C CG2 . VAL A 1 58  ? 37.252  -39.848 379.462 1.00 27.47  ? 59   VAL A CG2 1 
ATOM   439  N N   . VAL A 1 59  ? 40.064  -37.094 376.819 1.00 25.34  ? 60   VAL A N   1 
ATOM   440  C CA  . VAL A 1 59  ? 40.360  -35.912 376.018 1.00 28.35  ? 60   VAL A CA  1 
ATOM   441  C C   . VAL A 1 59  ? 39.176  -35.630 375.104 1.00 26.07  ? 60   VAL A C   1 
ATOM   442  O O   . VAL A 1 59  ? 38.736  -36.508 374.350 1.00 29.96  ? 60   VAL A O   1 
ATOM   443  C CB  . VAL A 1 59  ? 41.649  -36.107 375.202 1.00 30.13  ? 60   VAL A CB  1 
ATOM   444  C CG1 . VAL A 1 59  ? 41.719  -35.095 374.065 1.00 27.27  ? 60   VAL A CG1 1 
ATOM   445  C CG2 . VAL A 1 59  ? 42.868  -35.984 376.101 1.00 25.32  ? 60   VAL A CG2 1 
ATOM   446  N N   . ASP A 1 60  ? 38.656  -34.407 375.170 1.00 23.87  ? 61   ASP A N   1 
ATOM   447  C CA  . ASP A 1 60  ? 37.564  -33.983 374.296 1.00 21.99  ? 61   ASP A CA  1 
ATOM   448  C C   . ASP A 1 60  ? 38.138  -33.677 372.920 1.00 26.15  ? 61   ASP A C   1 
ATOM   449  O O   . ASP A 1 60  ? 38.739  -32.622 372.704 1.00 20.65  ? 61   ASP A O   1 
ATOM   450  C CB  . ASP A 1 60  ? 36.848  -32.767 374.872 1.00 26.93  ? 61   ASP A CB  1 
ATOM   451  C CG  . ASP A 1 60  ? 35.953  -33.118 376.042 1.00 39.02  ? 61   ASP A CG  1 
ATOM   452  O OD1 . ASP A 1 60  ? 36.178  -32.576 377.145 1.00 44.72  ? 61   ASP A OD1 1 
ATOM   453  O OD2 . ASP A 1 60  ? 35.024  -33.931 375.859 1.00 39.31  ? 61   ASP A OD2 1 
ATOM   454  N N   . ALA A 1 61  ? 37.961  -34.606 371.985 1.00 23.67  ? 62   ALA A N   1 
ATOM   455  C CA  . ALA A 1 61  ? 38.323  -34.375 370.589 1.00 23.79  ? 62   ALA A CA  1 
ATOM   456  C C   . ALA A 1 61  ? 37.076  -33.944 369.818 1.00 28.00  ? 62   ALA A C   1 
ATOM   457  O O   . ALA A 1 61  ? 36.520  -34.674 368.996 1.00 22.74  ? 62   ALA A O   1 
ATOM   458  C CB  . ALA A 1 61  ? 38.960  -35.625 369.990 1.00 19.10  ? 62   ALA A CB  1 
ATOM   459  N N   . THR A 1 62  ? 36.644  -32.714 370.101 1.00 24.07  ? 63   THR A N   1 
ATOM   460  C CA  . THR A 1 62  ? 35.329  -32.245 369.687 1.00 23.79  ? 63   THR A CA  1 
ATOM   461  C C   . THR A 1 62  ? 35.346  -30.992 368.820 1.00 22.57  ? 63   THR A C   1 
ATOM   462  O O   . THR A 1 62  ? 34.270  -30.508 368.449 1.00 24.18  ? 63   THR A O   1 
ATOM   463  C CB  . THR A 1 62  ? 34.455  -31.992 370.924 1.00 30.64  ? 63   THR A CB  1 
ATOM   464  O OG1 . THR A 1 62  ? 35.078  -31.012 371.760 1.00 26.24  ? 63   THR A OG1 1 
ATOM   465  C CG2 . THR A 1 62  ? 34.269  -33.281 371.716 1.00 28.12  ? 63   THR A CG2 1 
ATOM   466  N N   . THR A 1 63  ? 36.517  -30.451 368.488 1.00 22.95  ? 64   THR A N   1 
ATOM   467  C CA  . THR A 1 63  ? 36.599  -29.314 367.579 1.00 20.48  ? 64   THR A CA  1 
ATOM   468  C C   . THR A 1 63  ? 38.014  -29.234 367.027 1.00 20.27  ? 64   THR A C   1 
ATOM   469  O O   . THR A 1 63  ? 38.959  -29.768 367.614 1.00 21.96  ? 64   THR A O   1 
ATOM   470  C CB  . THR A 1 63  ? 36.212  -27.997 368.268 1.00 30.22  ? 64   THR A CB  1 
ATOM   471  O OG1 . THR A 1 63  ? 35.913  -27.006 367.277 1.00 31.60  ? 64   THR A OG1 1 
ATOM   472  C CG2 . THR A 1 63  ? 37.348  -27.491 369.144 1.00 32.22  ? 64   THR A CG2 1 
ATOM   473  N N   . PHE A 1 64  ? 38.143  -28.568 365.881 1.00 18.31  ? 65   PHE A N   1 
ATOM   474  C CA  . PHE A 1 64  ? 39.451  -28.387 365.266 1.00 21.08  ? 65   PHE A CA  1 
ATOM   475  C C   . PHE A 1 64  ? 40.360  -27.573 366.179 1.00 22.25  ? 65   PHE A C   1 
ATOM   476  O O   . PHE A 1 64  ? 39.932  -26.597 366.801 1.00 19.53  ? 65   PHE A O   1 
ATOM   477  C CB  . PHE A 1 64  ? 39.317  -27.682 363.916 1.00 24.06  ? 65   PHE A CB  1 
ATOM   478  C CG  . PHE A 1 64  ? 38.755  -28.546 362.821 1.00 23.35  ? 65   PHE A CG  1 
ATOM   479  C CD1 . PHE A 1 64  ? 39.427  -29.681 362.396 1.00 19.72  ? 65   PHE A CD1 1 
ATOM   480  C CD2 . PHE A 1 64  ? 37.568  -28.203 362.195 1.00 22.73  ? 65   PHE A CD2 1 
ATOM   481  C CE1 . PHE A 1 64  ? 38.913  -30.468 361.380 1.00 26.46  ? 65   PHE A CE1 1 
ATOM   482  C CE2 . PHE A 1 64  ? 37.050  -28.984 361.179 1.00 23.29  ? 65   PHE A CE2 1 
ATOM   483  C CZ  . PHE A 1 64  ? 37.723  -30.118 360.771 1.00 25.12  ? 65   PHE A CZ  1 
ATOM   484  N N   . GLN A 1 65  ? 41.627  -27.975 366.248 1.00 23.36  ? 66   GLN A N   1 
ATOM   485  C CA  . GLN A 1 65  ? 42.605  -27.264 367.054 1.00 27.27  ? 66   GLN A CA  1 
ATOM   486  C C   . GLN A 1 65  ? 43.216  -26.107 366.266 1.00 25.32  ? 66   GLN A C   1 
ATOM   487  O O   . GLN A 1 65  ? 42.829  -25.808 365.133 1.00 25.31  ? 66   GLN A O   1 
ATOM   488  C CB  . GLN A 1 65  ? 43.698  -28.213 367.536 1.00 29.92  ? 66   GLN A CB  1 
ATOM   489  C CG  . GLN A 1 65  ? 43.600  -28.588 369.002 1.00 29.44  ? 66   GLN A CG  1 
ATOM   490  C CD  . GLN A 1 65  ? 43.992  -27.460 369.942 1.00 31.91  ? 66   GLN A CD  1 
ATOM   491  O OE1 . GLN A 1 65  ? 44.428  -26.392 369.510 1.00 34.38  ? 66   GLN A OE1 1 
ATOM   492  N NE2 . GLN A 1 65  ? 43.844  -27.698 371.241 1.00 25.52  ? 66   GLN A NE2 1 
ATOM   493  N N   . SER A 1 66  ? 44.212  -25.471 366.880 1.00 24.07  ? 67   SER A N   1 
ATOM   494  C CA  . SER A 1 66  ? 44.813  -24.265 366.330 1.00 23.08  ? 67   SER A CA  1 
ATOM   495  C C   . SER A 1 66  ? 45.504  -24.541 365.001 1.00 21.17  ? 67   SER A C   1 
ATOM   496  O O   . SER A 1 66  ? 45.938  -25.659 364.714 1.00 22.89  ? 67   SER A O   1 
ATOM   497  C CB  . SER A 1 66  ? 45.824  -23.687 367.319 1.00 16.23  ? 67   SER A CB  1 
ATOM   498  O OG  . SER A 1 66  ? 45.185  -23.200 368.484 1.00 20.82  ? 67   SER A OG  1 
ATOM   499  N N   . VAL A 1 67  ? 45.608  -23.496 364.191 1.00 18.83  ? 68   VAL A N   1 
ATOM   500  C CA  . VAL A 1 67  ? 46.363  -23.543 362.946 1.00 18.21  ? 68   VAL A CA  1 
ATOM   501  C C   . VAL A 1 67  ? 47.830  -23.273 363.252 1.00 24.26  ? 68   VAL A C   1 
ATOM   502  O O   . VAL A 1 67  ? 48.157  -22.375 364.038 1.00 22.57  ? 68   VAL A O   1 
ATOM   503  C CB  . VAL A 1 67  ? 45.796  -22.517 361.947 1.00 23.70  ? 68   VAL A CB  1 
ATOM   504  C CG1 . VAL A 1 67  ? 46.669  -22.420 360.718 1.00 21.21  ? 68   VAL A CG1 1 
ATOM   505  C CG2 . VAL A 1 67  ? 44.366  -22.876 361.568 1.00 25.36  ? 68   VAL A CG2 1 
ATOM   506  N N   . CYS A 1 68  ? 48.723  -24.062 362.654 1.00 17.22  ? 69   CYS A N   1 
ATOM   507  C CA  . CYS A 1 68  ? 50.149  -23.809 362.808 1.00 20.69  ? 69   CYS A CA  1 
ATOM   508  C C   . CYS A 1 68  ? 50.486  -22.415 362.295 1.00 24.27  ? 69   CYS A C   1 
ATOM   509  O O   . CYS A 1 68  ? 49.953  -21.970 361.273 1.00 24.98  ? 69   CYS A O   1 
ATOM   510  C CB  . CYS A 1 68  ? 50.967  -24.864 362.058 1.00 19.56  ? 69   CYS A CB  1 
ATOM   511  S SG  . CYS A 1 68  ? 50.801  -26.565 362.675 1.00 27.41  ? 69   CYS A SG  1 
ATOM   512  N N   . TYR A 1 69  ? 51.365  -21.719 363.019 1.00 19.70  ? 70   TYR A N   1 
ATOM   513  C CA  . TYR A 1 69  ? 51.689  -20.333 362.697 1.00 26.71  ? 70   TYR A CA  1 
ATOM   514  C C   . TYR A 1 69  ? 52.128  -20.196 361.249 1.00 22.14  ? 70   TYR A C   1 
ATOM   515  O O   . TYR A 1 69  ? 52.954  -20.971 360.757 1.00 18.68  ? 70   TYR A O   1 
ATOM   516  C CB  . TYR A 1 69  ? 52.781  -19.806 363.631 1.00 27.07  ? 70   TYR A CB  1 
ATOM   517  C CG  . TYR A 1 69  ? 52.260  -18.810 364.639 1.00 27.30  ? 70   TYR A CG  1 
ATOM   518  C CD1 . TYR A 1 69  ? 51.996  -19.190 365.947 1.00 32.37  ? 70   TYR A CD1 1 
ATOM   519  C CD2 . TYR A 1 69  ? 52.006  -17.493 364.275 1.00 32.61  ? 70   TYR A CD2 1 
ATOM   520  C CE1 . TYR A 1 69  ? 51.507  -18.285 366.868 1.00 36.65  ? 70   TYR A CE1 1 
ATOM   521  C CE2 . TYR A 1 69  ? 51.516  -16.580 365.190 1.00 31.44  ? 70   TYR A CE2 1 
ATOM   522  C CZ  . TYR A 1 69  ? 51.268  -16.984 366.485 1.00 44.32  ? 70   TYR A CZ  1 
ATOM   523  O OH  . TYR A 1 69  ? 50.780  -16.090 367.410 1.00 62.49  ? 70   TYR A OH  1 
ATOM   524  N N   . GLN A 1 70  ? 51.564  -19.203 360.564 1.00 20.12  ? 71   GLN A N   1 
ATOM   525  C CA  . GLN A 1 70  ? 51.793  -19.057 359.137 1.00 22.11  ? 71   GLN A CA  1 
ATOM   526  C C   . GLN A 1 70  ? 51.447  -17.642 358.706 1.00 22.78  ? 71   GLN A C   1 
ATOM   527  O O   . GLN A 1 70  ? 50.691  -16.931 359.374 1.00 25.56  ? 71   GLN A O   1 
ATOM   528  C CB  . GLN A 1 70  ? 50.970  -20.071 358.336 1.00 17.23  ? 71   GLN A CB  1 
ATOM   529  C CG  . GLN A 1 70  ? 49.478  -20.030 358.629 1.00 17.91  ? 71   GLN A CG  1 
ATOM   530  C CD  . GLN A 1 70  ? 48.737  -21.190 357.992 1.00 21.88  ? 71   GLN A CD  1 
ATOM   531  O OE1 . GLN A 1 70  ? 48.005  -21.017 357.019 1.00 19.59  ? 71   GLN A OE1 1 
ATOM   532  N NE2 . GLN A 1 70  ? 48.946  -22.387 358.527 1.00 18.06  ? 71   GLN A NE2 1 
ATOM   533  N N   . TYR A 1 71  ? 52.026  -17.249 357.577 1.00 29.05  ? 72   TYR A N   1 
ATOM   534  C CA  . TYR A 1 71  ? 51.645  -16.010 356.918 1.00 29.95  ? 72   TYR A CA  1 
ATOM   535  C C   . TYR A 1 71  ? 50.184  -16.076 356.489 1.00 28.30  ? 72   TYR A C   1 
ATOM   536  O O   . TYR A 1 71  ? 49.699  -17.117 356.037 1.00 35.33  ? 72   TYR A O   1 
ATOM   537  C CB  . TYR A 1 71  ? 52.554  -15.777 355.710 1.00 29.87  ? 72   TYR A CB  1 
ATOM   538  C CG  . TYR A 1 71  ? 52.147  -14.636 354.808 1.00 33.58  ? 72   TYR A CG  1 
ATOM   539  C CD1 . TYR A 1 71  ? 52.532  -13.333 355.090 1.00 34.69  ? 72   TYR A CD1 1 
ATOM   540  C CD2 . TYR A 1 71  ? 51.395  -14.866 353.662 1.00 31.60  ? 72   TYR A CD2 1 
ATOM   541  C CE1 . TYR A 1 71  ? 52.170  -12.287 354.262 1.00 39.26  ? 72   TYR A CE1 1 
ATOM   542  C CE2 . TYR A 1 71  ? 51.027  -13.827 352.831 1.00 42.30  ? 72   TYR A CE2 1 
ATOM   543  C CZ  . TYR A 1 71  ? 51.417  -12.540 353.135 1.00 43.26  ? 72   TYR A CZ  1 
ATOM   544  O OH  . TYR A 1 71  ? 51.054  -11.502 352.310 1.00 52.25  ? 72   TYR A OH  1 
ATOM   545  N N   . VAL A 1 72  ? 49.477  -14.960 356.642 1.00 26.33  ? 73   VAL A N   1 
ATOM   546  C CA  . VAL A 1 72  ? 48.066  -14.864 356.286 1.00 27.71  ? 73   VAL A CA  1 
ATOM   547  C C   . VAL A 1 72  ? 47.950  -13.987 355.046 1.00 36.12  ? 73   VAL A C   1 
ATOM   548  O O   . VAL A 1 72  ? 48.409  -12.838 355.043 1.00 37.14  ? 73   VAL A O   1 
ATOM   549  C CB  . VAL A 1 72  ? 47.222  -14.309 357.443 1.00 32.57  ? 73   VAL A CB  1 
ATOM   550  C CG1 . VAL A 1 72  ? 45.781  -14.107 356.999 1.00 28.62  ? 73   VAL A CG1 1 
ATOM   551  C CG2 . VAL A 1 72  ? 47.286  -15.249 358.638 1.00 31.82  ? 73   VAL A CG2 1 
ATOM   552  N N   . ASP A 1 73  ? 47.334  -14.531 353.999 1.00 33.75  ? 74   ASP A N   1 
ATOM   553  C CA  . ASP A 1 73  ? 47.220  -13.828 352.728 1.00 38.53  ? 74   ASP A CA  1 
ATOM   554  C C   . ASP A 1 73  ? 46.315  -12.607 352.864 1.00 40.01  ? 74   ASP A C   1 
ATOM   555  O O   . ASP A 1 73  ? 45.223  -12.690 353.434 1.00 43.35  ? 74   ASP A O   1 
ATOM   556  C CB  . ASP A 1 73  ? 46.676  -14.776 351.661 1.00 48.69  ? 74   ASP A CB  1 
ATOM   557  C CG  . ASP A 1 73  ? 46.589  -14.131 350.294 1.00 61.12  ? 74   ASP A CG  1 
ATOM   558  O OD1 . ASP A 1 73  ? 47.631  -13.669 349.785 1.00 67.26  ? 74   ASP A OD1 1 
ATOM   559  O OD2 . ASP A 1 73  ? 45.478  -14.088 349.727 1.00 69.69  ? 74   ASP A OD2 1 
ATOM   560  N N   . THR A 1 74  ? 46.773  -11.467 352.333 1.00 45.31  ? 75   THR A N   1 
ATOM   561  C CA  . THR A 1 74  ? 46.013  -10.222 352.389 1.00 51.92  ? 75   THR A CA  1 
ATOM   562  C C   . THR A 1 74  ? 45.936  -9.533  351.030 1.00 55.19  ? 75   THR A C   1 
ATOM   563  O O   . THR A 1 74  ? 45.667  -8.328  350.970 1.00 58.81  ? 75   THR A O   1 
ATOM   564  C CB  . THR A 1 74  ? 46.613  -9.260  353.420 1.00 55.38  ? 75   THR A CB  1 
ATOM   565  O OG1 . THR A 1 74  ? 47.999  -9.042  353.125 1.00 54.32  ? 75   THR A OG1 1 
ATOM   566  C CG2 . THR A 1 74  ? 46.477  -9.819  354.829 1.00 54.05  ? 75   THR A CG2 1 
ATOM   567  N N   . LEU A 1 75  ? 46.160  -10.268 349.937 1.00 54.50  ? 76   LEU A N   1 
ATOM   568  C CA  . LEU A 1 75  ? 46.200  -9.641  348.618 1.00 55.33  ? 76   LEU A CA  1 
ATOM   569  C C   . LEU A 1 75  ? 44.836  -9.093  348.215 1.00 55.71  ? 76   LEU A C   1 
ATOM   570  O O   . LEU A 1 75  ? 44.739  -7.971  347.705 1.00 58.96  ? 76   LEU A O   1 
ATOM   571  C CB  . LEU A 1 75  ? 46.706  -10.639 347.576 1.00 58.02  ? 76   LEU A CB  1 
ATOM   572  C CG  . LEU A 1 75  ? 46.711  -10.163 346.121 1.00 60.98  ? 76   LEU A CG  1 
ATOM   573  C CD1 . LEU A 1 75  ? 47.534  -8.892  345.962 1.00 57.19  ? 76   LEU A CD1 1 
ATOM   574  C CD2 . LEU A 1 75  ? 47.228  -11.257 345.199 1.00 62.26  ? 76   LEU A CD2 1 
ATOM   575  N N   . TYR A 1 76  ? 43.775  -9.869  348.425 1.00 52.00  ? 77   TYR A N   1 
ATOM   576  C CA  . TYR A 1 76  ? 42.411  -9.445  348.116 1.00 57.03  ? 77   TYR A CA  1 
ATOM   577  C C   . TYR A 1 76  ? 41.575  -9.617  349.377 1.00 58.45  ? 77   TYR A C   1 
ATOM   578  O O   . TYR A 1 76  ? 40.934  -10.659 349.575 1.00 52.24  ? 77   TYR A O   1 
ATOM   579  C CB  . TYR A 1 76  ? 41.837  -10.234 346.940 1.00 51.82  ? 77   TYR A CB  1 
ATOM   580  C CG  . TYR A 1 76  ? 42.593  -10.052 345.638 1.00 51.96  ? 77   TYR A CG  1 
ATOM   581  C CD1 . TYR A 1 76  ? 42.600  -8.828  344.979 1.00 53.98  ? 77   TYR A CD1 1 
ATOM   582  C CD2 . TYR A 1 76  ? 43.292  -11.107 345.065 1.00 55.60  ? 77   TYR A CD2 1 
ATOM   583  C CE1 . TYR A 1 76  ? 43.287  -8.660  343.787 1.00 59.92  ? 77   TYR A CE1 1 
ATOM   584  C CE2 . TYR A 1 76  ? 43.980  -10.949 343.874 1.00 58.52  ? 77   TYR A CE2 1 
ATOM   585  C CZ  . TYR A 1 76  ? 43.976  -9.724  343.241 1.00 60.73  ? 77   TYR A CZ  1 
ATOM   586  O OH  . TYR A 1 76  ? 44.661  -9.566  342.057 1.00 58.41  ? 77   TYR A OH  1 
ATOM   587  N N   . PRO A 1 77  ? 41.564  -8.616  350.258 1.00 62.98  ? 78   PRO A N   1 
ATOM   588  C CA  . PRO A 1 77  ? 40.867  -8.765  351.542 1.00 63.91  ? 78   PRO A CA  1 
ATOM   589  C C   . PRO A 1 77  ? 39.365  -8.924  351.361 1.00 59.78  ? 78   PRO A C   1 
ATOM   590  O O   . PRO A 1 77  ? 38.737  -8.229  350.558 1.00 61.49  ? 78   PRO A O   1 
ATOM   591  C CB  . PRO A 1 77  ? 41.208  -7.466  352.283 1.00 67.27  ? 78   PRO A CB  1 
ATOM   592  C CG  . PRO A 1 77  ? 42.440  -6.947  351.607 1.00 68.45  ? 78   PRO A CG  1 
ATOM   593  C CD  . PRO A 1 77  ? 42.301  -7.345  350.171 1.00 65.42  ? 78   PRO A CD  1 
ATOM   594  N N   . GLY A 1 78  ? 38.788  -9.848  352.129 1.00 59.47  ? 79   GLY A N   1 
ATOM   595  C CA  . GLY A 1 78  ? 37.379  -10.163 352.033 1.00 61.98  ? 79   GLY A CA  1 
ATOM   596  C C   . GLY A 1 78  ? 36.976  -10.950 350.809 1.00 59.71  ? 79   GLY A C   1 
ATOM   597  O O   . GLY A 1 78  ? 35.810  -11.351 350.709 1.00 62.62  ? 79   GLY A O   1 
ATOM   598  N N   . PHE A 1 79  ? 37.893  -11.187 349.875 1.00 53.93  ? 80   PHE A N   1 
ATOM   599  C CA  . PHE A 1 79  ? 37.583  -11.935 348.666 1.00 44.77  ? 80   PHE A CA  1 
ATOM   600  C C   . PHE A 1 79  ? 37.533  -13.425 348.977 1.00 42.15  ? 80   PHE A C   1 
ATOM   601  O O   . PHE A 1 79  ? 38.471  -13.979 349.559 1.00 43.07  ? 80   PHE A O   1 
ATOM   602  C CB  . PHE A 1 79  ? 38.623  -11.646 347.586 1.00 45.76  ? 80   PHE A CB  1 
ATOM   603  C CG  . PHE A 1 79  ? 38.407  -12.411 346.315 1.00 46.02  ? 80   PHE A CG  1 
ATOM   604  C CD1 . PHE A 1 79  ? 37.205  -12.323 345.635 1.00 42.00  ? 80   PHE A CD1 1 
ATOM   605  C CD2 . PHE A 1 79  ? 39.410  -13.213 345.797 1.00 42.55  ? 80   PHE A CD2 1 
ATOM   606  C CE1 . PHE A 1 79  ? 37.006  -13.024 344.462 1.00 40.36  ? 80   PHE A CE1 1 
ATOM   607  C CE2 . PHE A 1 79  ? 39.217  -13.916 344.624 1.00 40.30  ? 80   PHE A CE2 1 
ATOM   608  C CZ  . PHE A 1 79  ? 38.013  -13.823 343.956 1.00 39.99  ? 80   PHE A CZ  1 
ATOM   609  N N   . GLU A 1 80  ? 36.437  -14.072 348.575 1.00 46.04  ? 81   GLU A N   1 
ATOM   610  C CA  . GLU A 1 80  ? 36.230  -15.474 348.924 1.00 49.31  ? 81   GLU A CA  1 
ATOM   611  C C   . GLU A 1 80  ? 37.315  -16.367 348.333 1.00 43.71  ? 81   GLU A C   1 
ATOM   612  O O   . GLU A 1 80  ? 37.719  -17.355 348.955 1.00 36.95  ? 81   GLU A O   1 
ATOM   613  C CB  . GLU A 1 80  ? 34.848  -15.926 348.453 1.00 62.58  ? 81   GLU A CB  1 
ATOM   614  C CG  . GLU A 1 80  ? 34.267  -17.090 349.236 1.00 75.67  ? 81   GLU A CG  1 
ATOM   615  C CD  . GLU A 1 80  ? 34.608  -18.432 348.621 1.00 85.70  ? 81   GLU A CD  1 
ATOM   616  O OE1 . GLU A 1 80  ? 34.581  -18.538 347.377 1.00 91.17  ? 81   GLU A OE1 1 
ATOM   617  O OE2 . GLU A 1 80  ? 34.903  -19.379 349.380 1.00 85.58  ? 81   GLU A OE2 1 
ATOM   618  N N   . GLY A 1 81  ? 37.806  -16.031 347.137 1.00 41.84  ? 82   GLY A N   1 
ATOM   619  C CA  . GLY A 1 81  ? 38.773  -16.889 346.472 1.00 35.35  ? 82   GLY A CA  1 
ATOM   620  C C   . GLY A 1 81  ? 40.074  -17.047 347.234 1.00 38.41  ? 82   GLY A C   1 
ATOM   621  O O   . GLY A 1 81  ? 40.777  -18.047 347.071 1.00 39.89  ? 82   GLY A O   1 
ATOM   622  N N   . THR A 1 82  ? 40.416  -16.069 348.073 1.00 37.53  ? 83   THR A N   1 
ATOM   623  C CA  . THR A 1 82  ? 41.617  -16.146 348.893 1.00 37.72  ? 83   THR A CA  1 
ATOM   624  C C   . THR A 1 82  ? 41.339  -16.441 350.358 1.00 35.89  ? 83   THR A C   1 
ATOM   625  O O   . THR A 1 82  ? 42.168  -17.077 351.011 1.00 38.28  ? 83   THR A O   1 
ATOM   626  C CB  . THR A 1 82  ? 42.419  -14.842 348.800 1.00 38.09  ? 83   THR A CB  1 
ATOM   627  O OG1 . THR A 1 82  ? 41.602  -13.743 349.222 1.00 42.35  ? 83   THR A OG1 1 
ATOM   628  C CG2 . THR A 1 82  ? 42.889  -14.604 347.372 1.00 39.56  ? 83   THR A CG2 1 
ATOM   629  N N   . GLU A 1 83  ? 40.193  -16.005 350.888 1.00 33.64  ? 84   GLU A N   1 
ATOM   630  C CA  . GLU A 1 83  ? 39.912  -16.211 352.305 1.00 43.11  ? 84   GLU A CA  1 
ATOM   631  C C   . GLU A 1 83  ? 39.645  -17.676 352.628 1.00 40.38  ? 84   GLU A C   1 
ATOM   632  O O   . GLU A 1 83  ? 39.863  -18.104 353.767 1.00 39.69  ? 84   GLU A O   1 
ATOM   633  C CB  . GLU A 1 83  ? 38.723  -15.354 352.746 1.00 46.99  ? 84   GLU A CB  1 
ATOM   634  C CG  . GLU A 1 83  ? 38.930  -13.848 352.619 1.00 57.96  ? 84   GLU A CG  1 
ATOM   635  C CD  . GLU A 1 83  ? 39.954  -13.292 353.594 1.00 67.55  ? 84   GLU A CD  1 
ATOM   636  O OE1 . GLU A 1 83  ? 40.316  -12.104 353.454 1.00 70.33  ? 84   GLU A OE1 1 
ATOM   637  O OE2 . GLU A 1 83  ? 40.394  -14.032 354.500 1.00 68.42  ? 84   GLU A OE2 1 
ATOM   638  N N   . MET A 1 84  ? 39.177  -18.460 351.651 1.00 32.95  ? 85   MET A N   1 
ATOM   639  C CA  . MET A 1 84  ? 38.888  -19.867 351.909 1.00 27.21  ? 85   MET A CA  1 
ATOM   640  C C   . MET A 1 84  ? 40.145  -20.665 352.235 1.00 29.76  ? 85   MET A C   1 
ATOM   641  O O   . MET A 1 84  ? 40.036  -21.756 352.805 1.00 28.81  ? 85   MET A O   1 
ATOM   642  C CB  . MET A 1 84  ? 38.154  -20.493 350.713 1.00 30.97  ? 85   MET A CB  1 
ATOM   643  C CG  . MET A 1 84  ? 38.792  -20.200 349.356 1.00 39.09  ? 85   MET A CG  1 
ATOM   644  S SD  . MET A 1 84  ? 38.160  -21.083 347.898 1.00 42.08  ? 85   MET A SD  1 
ATOM   645  C CE  . MET A 1 84  ? 37.879  -22.753 348.482 1.00 36.52  ? 85   MET A CE  1 
ATOM   646  N N   . TRP A 1 85  ? 41.329  -20.158 351.881 1.00 23.60  ? 86   TRP A N   1 
ATOM   647  C CA  . TRP A 1 85  ? 42.592  -20.815 352.201 1.00 23.11  ? 86   TRP A CA  1 
ATOM   648  C C   . TRP A 1 85  ? 43.246  -20.266 353.462 1.00 26.19  ? 86   TRP A C   1 
ATOM   649  O O   . TRP A 1 85  ? 44.272  -20.805 353.892 1.00 22.40  ? 86   TRP A O   1 
ATOM   650  C CB  . TRP A 1 85  ? 43.578  -20.686 351.029 1.00 17.36  ? 86   TRP A CB  1 
ATOM   651  C CG  . TRP A 1 85  ? 42.984  -21.055 349.709 1.00 26.98  ? 86   TRP A CG  1 
ATOM   652  C CD1 . TRP A 1 85  ? 42.635  -20.205 348.700 1.00 30.67  ? 86   TRP A CD1 1 
ATOM   653  C CD2 . TRP A 1 85  ? 42.667  -22.374 349.249 1.00 28.92  ? 86   TRP A CD2 1 
ATOM   654  N NE1 . TRP A 1 85  ? 42.115  -20.912 347.643 1.00 30.82  ? 86   TRP A NE1 1 
ATOM   655  C CE2 . TRP A 1 85  ? 42.122  -22.246 347.956 1.00 28.95  ? 86   TRP A CE2 1 
ATOM   656  C CE3 . TRP A 1 85  ? 42.789  -23.652 349.807 1.00 25.05  ? 86   TRP A CE3 1 
ATOM   657  C CZ2 . TRP A 1 85  ? 41.699  -23.345 347.211 1.00 24.63  ? 86   TRP A CZ2 1 
ATOM   658  C CZ3 . TRP A 1 85  ? 42.362  -24.741 349.069 1.00 25.11  ? 86   TRP A CZ3 1 
ATOM   659  C CH2 . TRP A 1 85  ? 41.828  -24.581 347.784 1.00 27.34  ? 86   TRP A CH2 1 
ATOM   660  N N   . ASN A 1 86  ? 42.686  -19.219 354.055 1.00 23.95  ? 87   ASN A N   1 
ATOM   661  C CA  . ASN A 1 86  ? 43.274  -18.584 355.220 1.00 32.42  ? 87   ASN A CA  1 
ATOM   662  C C   . ASN A 1 86  ? 42.857  -19.310 356.497 1.00 28.91  ? 87   ASN A C   1 
ATOM   663  O O   . ASN A 1 86  ? 41.841  -20.009 356.519 1.00 24.49  ? 87   ASN A O   1 
ATOM   664  C CB  . ASN A 1 86  ? 42.856  -17.118 355.276 1.00 32.27  ? 87   ASN A CB  1 
ATOM   665  C CG  . ASN A 1 86  ? 43.730  -16.233 354.409 1.00 39.37  ? 87   ASN A CG  1 
ATOM   666  O OD1 . ASN A 1 86  ? 44.876  -16.574 354.112 1.00 38.41  ? 87   ASN A OD1 1 
ATOM   667  N ND2 . ASN A 1 86  ? 43.193  -15.091 353.998 1.00 35.54  ? 87   ASN A ND2 1 
ATOM   668  N N   . PRO A 1 87  ? 43.634  -19.169 357.572 1.00 32.14  ? 88   PRO A N   1 
ATOM   669  C CA  . PRO A 1 87  ? 43.308  -19.880 358.816 1.00 32.46  ? 88   PRO A CA  1 
ATOM   670  C C   . PRO A 1 87  ? 41.913  -19.537 359.319 1.00 28.37  ? 88   PRO A C   1 
ATOM   671  O O   . PRO A 1 87  ? 41.519  -18.370 359.371 1.00 31.59  ? 88   PRO A O   1 
ATOM   672  C CB  . PRO A 1 87  ? 44.392  -19.403 359.789 1.00 28.32  ? 88   PRO A CB  1 
ATOM   673  C CG  . PRO A 1 87  ? 45.535  -19.023 358.916 1.00 30.20  ? 88   PRO A CG  1 
ATOM   674  C CD  . PRO A 1 87  ? 44.924  -18.461 357.666 1.00 29.07  ? 88   PRO A CD  1 
ATOM   675  N N   . ASN A 1 88  ? 41.160  -20.577 359.674 1.00 24.97  ? 89   ASN A N   1 
ATOM   676  C CA  . ASN A 1 88  ? 39.857  -20.437 360.311 1.00 29.88  ? 89   ASN A CA  1 
ATOM   677  C C   . ASN A 1 88  ? 39.916  -20.787 361.791 1.00 29.21  ? 89   ASN A C   1 
ATOM   678  O O   . ASN A 1 88  ? 38.872  -20.953 362.429 1.00 33.31  ? 89   ASN A O   1 
ATOM   679  C CB  . ASN A 1 88  ? 38.821  -21.307 359.599 1.00 29.24  ? 89   ASN A CB  1 
ATOM   680  C CG  . ASN A 1 88  ? 39.173  -22.778 359.638 1.00 31.02  ? 89   ASN A CG  1 
ATOM   681  O OD1 . ASN A 1 88  ? 40.331  -23.147 359.842 1.00 27.69  ? 89   ASN A OD1 1 
ATOM   682  N ND2 . ASN A 1 88  ? 38.175  -23.629 359.437 1.00 30.14  ? 89   ASN A ND2 1 
ATOM   683  N N   . ARG A 1 89  ? 41.119  -20.936 362.333 1.00 28.78  ? 90   ARG A N   1 
ATOM   684  C CA  . ARG A 1 89  ? 41.355  -21.047 363.760 1.00 27.91  ? 90   ARG A CA  1 
ATOM   685  C C   . ARG A 1 89  ? 42.514  -20.127 364.113 1.00 30.21  ? 90   ARG A C   1 
ATOM   686  O O   . ARG A 1 89  ? 43.243  -19.651 363.240 1.00 22.67  ? 90   ARG A O   1 
ATOM   687  C CB  . ARG A 1 89  ? 41.673  -22.489 364.183 1.00 28.67  ? 90   ARG A CB  1 
ATOM   688  C CG  . ARG A 1 89  ? 40.500  -23.447 364.075 1.00 30.87  ? 90   ARG A CG  1 
ATOM   689  C CD  . ARG A 1 89  ? 39.519  -23.232 365.213 1.00 34.87  ? 90   ARG A CD  1 
ATOM   690  N NE  . ARG A 1 89  ? 38.526  -24.298 365.293 1.00 43.54  ? 90   ARG A NE  1 
ATOM   691  C CZ  . ARG A 1 89  ? 37.426  -24.349 364.549 1.00 45.13  ? 90   ARG A CZ  1 
ATOM   692  N NH1 . ARG A 1 89  ? 37.178  -23.395 363.662 1.00 37.31  ? 90   ARG A NH1 1 
ATOM   693  N NH2 . ARG A 1 89  ? 36.574  -25.356 364.690 1.00 49.84  ? 90   ARG A NH2 1 
ATOM   694  N N   . GLU A 1 90  ? 42.665  -19.874 365.407 1.00 27.09  ? 91   GLU A N   1 
ATOM   695  C CA  . GLU A 1 90  ? 43.785  -19.082 365.892 1.00 34.15  ? 91   GLU A CA  1 
ATOM   696  C C   . GLU A 1 90  ? 45.115  -19.697 365.460 1.00 23.40  ? 91   GLU A C   1 
ATOM   697  O O   . GLU A 1 90  ? 45.224  -20.904 365.224 1.00 28.52  ? 91   GLU A O   1 
ATOM   698  C CB  . GLU A 1 90  ? 43.740  -19.002 367.410 1.00 40.81  ? 91   GLU A CB  1 
ATOM   699  C CG  . GLU A 1 90  ? 44.377  -20.226 368.003 1.00 65.20  ? 91   GLU A CG  1 
ATOM   700  C CD  . GLU A 1 90  ? 44.461  -20.212 369.492 1.00 83.48  ? 91   GLU A CD  1 
ATOM   701  O OE1 . GLU A 1 90  ? 45.334  -20.929 370.022 1.00 88.10  ? 91   GLU A OE1 1 
ATOM   702  O OE2 . GLU A 1 90  ? 43.655  -19.509 370.135 1.00 91.05  ? 91   GLU A OE2 1 
ATOM   703  N N   . LEU A 1 91  ? 46.134  -18.849 365.364 1.00 20.94  ? 92   LEU A N   1 
ATOM   704  C CA  . LEU A 1 91  ? 47.485  -19.324 365.110 1.00 22.46  ? 92   LEU A CA  1 
ATOM   705  C C   . LEU A 1 91  ? 48.157  -19.708 366.421 1.00 25.60  ? 92   LEU A C   1 
ATOM   706  O O   . LEU A 1 91  ? 47.993  -19.032 367.441 1.00 25.66  ? 92   LEU A O   1 
ATOM   707  C CB  . LEU A 1 91  ? 48.309  -18.252 364.399 1.00 26.69  ? 92   LEU A CB  1 
ATOM   708  C CG  . LEU A 1 91  ? 47.781  -17.717 363.068 1.00 30.00  ? 92   LEU A CG  1 
ATOM   709  C CD1 . LEU A 1 91  ? 48.811  -16.796 362.435 1.00 24.49  ? 92   LEU A CD1 1 
ATOM   710  C CD2 . LEU A 1 91  ? 47.431  -18.860 362.128 1.00 28.99  ? 92   LEU A CD2 1 
ATOM   711  N N   . SER A 1 92  ? 48.916  -20.800 366.389 1.00 19.66  ? 93   SER A N   1 
ATOM   712  C CA  . SER A 1 92  ? 49.652  -21.252 367.560 1.00 21.65  ? 93   SER A CA  1 
ATOM   713  C C   . SER A 1 92  ? 50.749  -22.205 367.114 1.00 24.76  ? 93   SER A C   1 
ATOM   714  O O   . SER A 1 92  ? 50.607  -22.908 366.111 1.00 28.02  ? 93   SER A O   1 
ATOM   715  C CB  . SER A 1 92  ? 48.732  -21.941 368.575 1.00 20.92  ? 93   SER A CB  1 
ATOM   716  O OG  . SER A 1 92  ? 49.470  -22.450 369.673 1.00 24.99  ? 93   SER A OG  1 
ATOM   717  N N   . GLU A 1 93  ? 51.853  -22.209 367.864 1.00 20.83  ? 94   GLU A N   1 
ATOM   718  C CA  . GLU A 1 93  ? 52.848  -23.257 367.684 1.00 27.14  ? 94   GLU A CA  1 
ATOM   719  C C   . GLU A 1 93  ? 52.377  -24.577 368.276 1.00 27.02  ? 94   GLU A C   1 
ATOM   720  O O   . GLU A 1 93  ? 52.898  -25.634 367.907 1.00 27.90  ? 94   GLU A O   1 
ATOM   721  C CB  . GLU A 1 93  ? 54.181  -22.840 368.308 1.00 30.53  ? 94   GLU A CB  1 
ATOM   722  C CG  . GLU A 1 93  ? 54.858  -21.680 367.595 1.00 30.79  ? 94   GLU A CG  1 
ATOM   723  C CD  . GLU A 1 93  ? 56.253  -21.407 368.123 1.00 37.87  ? 94   GLU A CD  1 
ATOM   724  O OE1 . GLU A 1 93  ? 57.186  -22.154 367.756 1.00 35.89  ? 94   GLU A OE1 1 
ATOM   725  O OE2 . GLU A 1 93  ? 56.416  -20.448 368.906 1.00 38.65  ? 94   GLU A OE2 1 
ATOM   726  N N   . ASP A 1 94  ? 51.405  -24.530 369.185 1.00 23.30  ? 95   ASP A N   1 
ATOM   727  C CA  . ASP A 1 94  ? 50.732  -25.714 369.715 1.00 22.10  ? 95   ASP A CA  1 
ATOM   728  C C   . ASP A 1 94  ? 49.667  -26.108 368.700 1.00 23.43  ? 95   ASP A C   1 
ATOM   729  O O   . ASP A 1 94  ? 48.500  -25.728 368.806 1.00 21.73  ? 95   ASP A O   1 
ATOM   730  C CB  . ASP A 1 94  ? 50.136  -25.415 371.086 1.00 19.26  ? 95   ASP A CB  1 
ATOM   731  C CG  . ASP A 1 94  ? 49.460  -26.621 371.716 1.00 24.53  ? 95   ASP A CG  1 
ATOM   732  O OD1 . ASP A 1 94  ? 49.474  -27.714 371.113 1.00 26.96  ? 95   ASP A OD1 1 
ATOM   733  O OD2 . ASP A 1 94  ? 48.914  -26.470 372.829 1.00 30.80  ? 95   ASP A OD2 1 
ATOM   734  N N   . CYS A 1 95  ? 50.074  -26.885 367.692 1.00 24.76  ? 96   CYS A N   1 
ATOM   735  C CA  . CYS A 1 95  ? 49.203  -27.121 366.548 1.00 22.78  ? 96   CYS A CA  1 
ATOM   736  C C   . CYS A 1 95  ? 49.254  -28.543 366.008 1.00 21.27  ? 96   CYS A C   1 
ATOM   737  O O   . CYS A 1 95  ? 48.633  -28.812 364.973 1.00 19.21  ? 96   CYS A O   1 
ATOM   738  C CB  . CYS A 1 95  ? 49.552  -26.149 365.417 1.00 19.54  ? 96   CYS A CB  1 
ATOM   739  S SG  . CYS A 1 95  ? 51.184  -26.431 364.668 1.00 23.25  ? 96   CYS A SG  1 
ATOM   740  N N   . LEU A 1 96  ? 49.963  -29.467 366.655 1.00 17.38  ? 97   LEU A N   1 
ATOM   741  C CA  . LEU A 1 96  ? 50.137  -30.805 366.090 1.00 21.69  ? 97   LEU A CA  1 
ATOM   742  C C   . LEU A 1 96  ? 49.018  -31.707 366.597 1.00 22.08  ? 97   LEU A C   1 
ATOM   743  O O   . LEU A 1 96  ? 49.161  -32.474 367.554 1.00 21.15  ? 97   LEU A O   1 
ATOM   744  C CB  . LEU A 1 96  ? 51.525  -31.342 366.405 1.00 18.01  ? 97   LEU A CB  1 
ATOM   745  C CG  . LEU A 1 96  ? 52.596  -30.553 365.640 1.00 23.86  ? 97   LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 96  ? 53.977  -31.143 365.855 1.00 20.39  ? 97   LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 96  ? 52.265  -30.470 364.149 1.00 15.21  ? 97   LEU A CD2 1 
ATOM   748  N N   . TYR A 1 97  ? 47.874  -31.601 365.927 1.00 23.24  ? 98   TYR A N   1 
ATOM   749  C CA  . TYR A 1 97  ? 46.694  -32.401 366.203 1.00 17.45  ? 98   TYR A CA  1 
ATOM   750  C C   . TYR A 1 97  ? 46.169  -32.964 364.891 1.00 22.01  ? 98   TYR A C   1 
ATOM   751  O O   . TYR A 1 97  ? 46.411  -32.401 363.820 1.00 18.65  ? 98   TYR A O   1 
ATOM   752  C CB  . TYR A 1 97  ? 45.601  -31.572 366.903 1.00 15.05  ? 98   TYR A CB  1 
ATOM   753  C CG  . TYR A 1 97  ? 46.056  -30.926 368.194 1.00 20.59  ? 98   TYR A CG  1 
ATOM   754  C CD1 . TYR A 1 97  ? 46.804  -29.754 368.183 1.00 19.56  ? 98   TYR A CD1 1 
ATOM   755  C CD2 . TYR A 1 97  ? 45.741  -31.488 369.423 1.00 20.15  ? 98   TYR A CD2 1 
ATOM   756  C CE1 . TYR A 1 97  ? 47.226  -29.163 369.357 1.00 17.94  ? 98   TYR A CE1 1 
ATOM   757  C CE2 . TYR A 1 97  ? 46.160  -30.905 370.605 1.00 21.91  ? 98   TYR A CE2 1 
ATOM   758  C CZ  . TYR A 1 97  ? 46.902  -29.742 370.565 1.00 21.89  ? 98   TYR A CZ  1 
ATOM   759  O OH  . TYR A 1 97  ? 47.321  -29.156 371.737 1.00 28.02  ? 98   TYR A OH  1 
ATOM   760  N N   . LEU A 1 98  ? 45.461  -34.087 364.977 1.00 17.47  ? 99   LEU A N   1 
ATOM   761  C CA  . LEU A 1 98  ? 44.878  -34.721 363.804 1.00 20.29  ? 99   LEU A CA  1 
ATOM   762  C C   . LEU A 1 98  ? 43.396  -34.980 364.042 1.00 19.14  ? 99   LEU A C   1 
ATOM   763  O O   . LEU A 1 98  ? 42.893  -34.884 365.165 1.00 21.68  ? 99   LEU A O   1 
ATOM   764  C CB  . LEU A 1 98  ? 45.612  -36.023 363.437 1.00 22.78  ? 99   LEU A CB  1 
ATOM   765  C CG  . LEU A 1 98  ? 45.828  -37.131 364.473 1.00 26.05  ? 99   LEU A CG  1 
ATOM   766  C CD1 . LEU A 1 98  ? 44.585  -37.989 364.665 1.00 16.94  ? 99   LEU A CD1 1 
ATOM   767  C CD2 . LEU A 1 98  ? 47.011  -37.997 364.063 1.00 21.51  ? 99   LEU A CD2 1 
ATOM   768  N N   . ASN A 1 99  ? 42.697  -35.316 362.959 1.00 19.48  ? 100  ASN A N   1 
ATOM   769  C CA  . ASN A 1 99  ? 41.253  -35.497 362.971 1.00 19.15  ? 100  ASN A CA  1 
ATOM   770  C C   . ASN A 1 99  ? 40.900  -36.835 362.342 1.00 24.68  ? 100  ASN A C   1 
ATOM   771  O O   . ASN A 1 99  ? 41.536  -37.259 361.374 1.00 29.15  ? 100  ASN A O   1 
ATOM   772  C CB  . ASN A 1 99  ? 40.552  -34.368 362.210 1.00 16.18  ? 100  ASN A CB  1 
ATOM   773  C CG  . ASN A 1 99  ? 41.193  -33.018 362.456 1.00 22.51  ? 100  ASN A CG  1 
ATOM   774  O OD1 . ASN A 1 99  ? 41.081  -32.453 363.544 1.00 24.76  ? 100  ASN A OD1 1 
ATOM   775  N ND2 . ASN A 1 99  ? 41.880  -32.497 361.447 1.00 19.35  ? 100  ASN A ND2 1 
ATOM   776  N N   . VAL A 1 100 ? 39.882  -37.494 362.891 1.00 21.50  ? 101  VAL A N   1 
ATOM   777  C CA  . VAL A 1 100 ? 39.404  -38.772 362.374 1.00 22.68  ? 101  VAL A CA  1 
ATOM   778  C C   . VAL A 1 100 ? 37.896  -38.679 362.187 1.00 22.38  ? 101  VAL A C   1 
ATOM   779  O O   . VAL A 1 100 ? 37.168  -38.368 363.137 1.00 26.64  ? 101  VAL A O   1 
ATOM   780  C CB  . VAL A 1 100 ? 39.757  -39.947 363.302 1.00 20.33  ? 101  VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 100 ? 39.183  -41.244 362.749 1.00 17.86  ? 101  VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 100 ? 41.264  -40.061 363.474 1.00 21.38  ? 101  VAL A CG2 1 
ATOM   783  N N   . TRP A 1 101 ? 37.434  -38.939 360.967 1.00 23.32  ? 102  TRP A N   1 
ATOM   784  C CA  . TRP A 1 101 ? 36.021  -39.114 360.668 1.00 18.22  ? 102  TRP A CA  1 
ATOM   785  C C   . TRP A 1 101 ? 35.753  -40.588 360.402 1.00 22.27  ? 102  TRP A C   1 
ATOM   786  O O   . TRP A 1 101 ? 36.514  -41.245 359.684 1.00 24.23  ? 102  TRP A O   1 
ATOM   787  C CB  . TRP A 1 101 ? 35.595  -38.302 359.443 1.00 21.87  ? 102  TRP A CB  1 
ATOM   788  C CG  . TRP A 1 101 ? 35.561  -36.819 359.611 1.00 19.98  ? 102  TRP A CG  1 
ATOM   789  C CD1 . TRP A 1 101 ? 34.484  -36.057 359.959 1.00 17.23  ? 102  TRP A CD1 1 
ATOM   790  C CD2 . TRP A 1 101 ? 36.642  -35.907 359.387 1.00 20.52  ? 102  TRP A CD2 1 
ATOM   791  N NE1 . TRP A 1 101 ? 34.833  -34.728 359.985 1.00 17.33  ? 102  TRP A NE1 1 
ATOM   792  C CE2 . TRP A 1 101 ? 36.153  -34.610 359.638 1.00 15.95  ? 102  TRP A CE2 1 
ATOM   793  C CE3 . TRP A 1 101 ? 37.978  -36.064 359.014 1.00 16.24  ? 102  TRP A CE3 1 
ATOM   794  C CZ2 . TRP A 1 101 ? 36.955  -33.476 359.523 1.00 17.20  ? 102  TRP A CZ2 1 
ATOM   795  C CZ3 . TRP A 1 101 ? 38.772  -34.937 358.898 1.00 23.02  ? 102  TRP A CZ3 1 
ATOM   796  C CH2 . TRP A 1 101 ? 38.258  -33.661 359.152 1.00 16.89  ? 102  TRP A CH2 1 
ATOM   797  N N   . THR A 1 102 ? 34.669  -41.105 360.968 1.00 19.19  ? 103  THR A N   1 
ATOM   798  C CA  . THR A 1 102 ? 34.320  -42.507 360.804 1.00 23.84  ? 103  THR A CA  1 
ATOM   799  C C   . THR A 1 102 ? 32.806  -42.636 360.723 1.00 27.19  ? 103  THR A C   1 
ATOM   800  O O   . THR A 1 102 ? 32.080  -41.776 361.236 1.00 31.57  ? 103  THR A O   1 
ATOM   801  C CB  . THR A 1 102 ? 34.879  -43.358 361.961 1.00 32.10  ? 103  THR A CB  1 
ATOM   802  O OG1 . THR A 1 102 ? 34.863  -44.745 361.605 1.00 42.24  ? 103  THR A OG1 1 
ATOM   803  C CG2 . THR A 1 102 ? 34.074  -43.155 363.231 1.00 32.07  ? 103  THR A CG2 1 
ATOM   804  N N   . PRO A 1 103 ? 32.301  -43.672 360.048 1.00 26.69  ? 104  PRO A N   1 
ATOM   805  C CA  . PRO A 1 103 ? 30.847  -43.845 359.954 1.00 30.54  ? 104  PRO A CA  1 
ATOM   806  C C   . PRO A 1 103 ? 30.203  -44.029 361.321 1.00 33.62  ? 104  PRO A C   1 
ATOM   807  O O   . PRO A 1 103 ? 30.829  -44.499 362.274 1.00 32.94  ? 104  PRO A O   1 
ATOM   808  C CB  . PRO A 1 103 ? 30.694  -45.104 359.093 1.00 31.40  ? 104  PRO A CB  1 
ATOM   809  C CG  . PRO A 1 103 ? 31.939  -45.154 358.281 1.00 26.83  ? 104  PRO A CG  1 
ATOM   810  C CD  . PRO A 1 103 ? 33.024  -44.598 359.158 1.00 29.30  ? 104  PRO A CD  1 
ATOM   811  N N   . TYR A 1 104 ? 28.933  -43.640 361.404 1.00 36.46  ? 105  TYR A N   1 
ATOM   812  C CA  . TYR A 1 104 ? 28.115  -43.800 362.601 1.00 36.61  ? 105  TYR A CA  1 
ATOM   813  C C   . TYR A 1 104 ? 26.986  -44.769 362.278 1.00 39.93  ? 105  TYR A C   1 
ATOM   814  O O   . TYR A 1 104 ? 26.144  -44.460 361.417 1.00 43.15  ? 105  TYR A O   1 
ATOM   815  C CB  . TYR A 1 104 ? 27.556  -42.448 363.063 1.00 36.21  ? 105  TYR A CB  1 
ATOM   816  C CG  . TYR A 1 104 ? 26.912  -42.440 364.440 1.00 43.58  ? 105  TYR A CG  1 
ATOM   817  C CD1 . TYR A 1 104 ? 25.657  -43.000 364.650 1.00 43.27  ? 105  TYR A CD1 1 
ATOM   818  C CD2 . TYR A 1 104 ? 27.550  -41.846 365.523 1.00 42.15  ? 105  TYR A CD2 1 
ATOM   819  C CE1 . TYR A 1 104 ? 25.066  -42.984 365.902 1.00 39.39  ? 105  TYR A CE1 1 
ATOM   820  C CE2 . TYR A 1 104 ? 26.967  -41.824 366.777 1.00 40.83  ? 105  TYR A CE2 1 
ATOM   821  C CZ  . TYR A 1 104 ? 25.725  -42.395 366.961 1.00 44.12  ? 105  TYR A CZ  1 
ATOM   822  O OH  . TYR A 1 104 ? 25.142  -42.375 368.208 1.00 46.71  ? 105  TYR A OH  1 
ATOM   823  N N   . PRO A 1 105 ? 26.914  -45.946 362.922 1.00 44.50  ? 106  PRO A N   1 
ATOM   824  C CA  . PRO A 1 105 ? 27.824  -46.399 363.979 1.00 44.09  ? 106  PRO A CA  1 
ATOM   825  C C   . PRO A 1 105 ? 29.179  -46.877 363.457 1.00 39.36  ? 106  PRO A C   1 
ATOM   826  O O   . PRO A 1 105 ? 29.353  -47.039 362.248 1.00 36.73  ? 106  PRO A O   1 
ATOM   827  C CB  . PRO A 1 105 ? 27.053  -47.555 364.616 1.00 45.42  ? 106  PRO A CB  1 
ATOM   828  C CG  . PRO A 1 105 ? 26.273  -48.124 363.487 1.00 41.63  ? 106  PRO A CG  1 
ATOM   829  C CD  . PRO A 1 105 ? 25.865  -46.943 362.642 1.00 44.45  ? 106  PRO A CD  1 
ATOM   830  N N   . ARG A 1 106 ? 30.113  -47.090 364.380 1.00 42.97  ? 107  ARG A N   1 
ATOM   831  C CA  . ARG A 1 106 ? 31.464  -47.495 364.023 1.00 43.09  ? 107  ARG A CA  1 
ATOM   832  C C   . ARG A 1 106 ? 31.429  -48.759 363.165 1.00 43.20  ? 107  ARG A C   1 
ATOM   833  O O   . ARG A 1 106 ? 30.620  -49.659 363.421 1.00 52.38  ? 107  ARG A O   1 
ATOM   834  C CB  . ARG A 1 106 ? 32.284  -47.740 365.291 1.00 47.63  ? 107  ARG A CB  1 
ATOM   835  C CG  . ARG A 1 106 ? 33.788  -47.626 365.128 1.00 51.32  ? 107  ARG A CG  1 
ATOM   836  C CD  . ARG A 1 106 ? 34.468  -47.608 366.489 1.00 55.80  ? 107  ARG A CD  1 
ATOM   837  N NE  . ARG A 1 106 ? 33.898  -46.582 367.359 1.00 56.23  ? 107  ARG A NE  1 
ATOM   838  C CZ  . ARG A 1 106 ? 34.041  -46.552 368.681 1.00 56.19  ? 107  ARG A CZ  1 
ATOM   839  N NH1 . ARG A 1 106 ? 34.738  -47.496 369.298 1.00 54.81  ? 107  ARG A NH1 1 
ATOM   840  N NH2 . ARG A 1 106 ? 33.483  -45.577 369.386 1.00 56.20  ? 107  ARG A NH2 1 
ATOM   841  N N   . PRO A 1 107 ? 32.271  -48.854 362.136 1.00 48.11  ? 108  PRO A N   1 
ATOM   842  C CA  . PRO A 1 107 ? 32.270  -50.058 361.296 1.00 52.47  ? 108  PRO A CA  1 
ATOM   843  C C   . PRO A 1 107 ? 32.613  -51.302 362.103 1.00 59.37  ? 108  PRO A C   1 
ATOM   844  O O   . PRO A 1 107 ? 33.430  -51.265 363.025 1.00 60.88  ? 108  PRO A O   1 
ATOM   845  C CB  . PRO A 1 107 ? 33.341  -49.756 360.242 1.00 49.42  ? 108  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 107 ? 33.432  -48.267 360.207 1.00 43.93  ? 108  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 107 ? 33.179  -47.817 361.615 1.00 41.17  ? 108  PRO A CD  1 
ATOM   848  N N   . THR A 1 108 ? 31.969  -52.412 361.746 1.00 64.54  ? 109  THR A N   1 
ATOM   849  C CA  . THR A 1 108 ? 32.185  -53.679 362.432 1.00 75.79  ? 109  THR A CA  1 
ATOM   850  C C   . THR A 1 108 ? 33.363  -54.458 361.867 1.00 73.18  ? 109  THR A C   1 
ATOM   851  O O   . THR A 1 108 ? 33.992  -55.234 362.596 1.00 78.94  ? 109  THR A O   1 
ATOM   852  C CB  . THR A 1 108 ? 30.922  -54.542 362.357 1.00 84.80  ? 109  THR A CB  1 
ATOM   853  O OG1 . THR A 1 108 ? 30.916  -55.276 361.126 1.00 89.14  ? 109  THR A OG1 1 
ATOM   854  C CG2 . THR A 1 108 ? 29.679  -53.667 362.423 1.00 85.98  ? 109  THR A CG2 1 
ATOM   855  N N   . SER A 1 109 ? 33.671  -54.270 360.586 1.00 64.28  ? 110  SER A N   1 
ATOM   856  C CA  . SER A 1 109 ? 34.815  -54.877 359.933 1.00 62.08  ? 110  SER A CA  1 
ATOM   857  C C   . SER A 1 109 ? 35.798  -53.793 359.504 1.00 58.65  ? 110  SER A C   1 
ATOM   858  O O   . SER A 1 109 ? 35.399  -52.645 359.282 1.00 56.44  ? 110  SER A O   1 
ATOM   859  C CB  . SER A 1 109 ? 34.384  -55.697 358.710 1.00 67.59  ? 110  SER A CB  1 
ATOM   860  O OG  . SER A 1 109 ? 33.363  -55.034 357.987 1.00 72.18  ? 110  SER A OG  1 
ATOM   861  N N   . PRO A 1 110 ? 37.088  -54.120 359.399 1.00 57.07  ? 111  PRO A N   1 
ATOM   862  C CA  . PRO A 1 110 ? 38.081  -53.103 359.030 1.00 53.34  ? 111  PRO A CA  1 
ATOM   863  C C   . PRO A 1 110 ? 37.746  -52.417 357.712 1.00 50.06  ? 111  PRO A C   1 
ATOM   864  O O   . PRO A 1 110 ? 37.346  -53.056 356.736 1.00 45.87  ? 111  PRO A O   1 
ATOM   865  C CB  . PRO A 1 110 ? 39.383  -53.904 358.939 1.00 58.63  ? 111  PRO A CB  1 
ATOM   866  C CG  . PRO A 1 110 ? 39.182  -55.030 359.892 1.00 60.57  ? 111  PRO A CG  1 
ATOM   867  C CD  . PRO A 1 110 ? 37.723  -55.390 359.795 1.00 59.08  ? 111  PRO A CD  1 
ATOM   868  N N   . THR A 1 111 ? 37.927  -51.097 357.699 1.00 43.63  ? 112  THR A N   1 
ATOM   869  C CA  . THR A 1 111 ? 37.497  -50.183 356.657 1.00 42.78  ? 112  THR A CA  1 
ATOM   870  C C   . THR A 1 111 ? 38.689  -49.430 356.075 1.00 37.94  ? 112  THR A C   1 
ATOM   871  O O   . THR A 1 111 ? 39.570  -48.999 356.827 1.00 35.67  ? 112  THR A O   1 
ATOM   872  C CB  . THR A 1 111 ? 36.478  -49.181 357.234 1.00 45.49  ? 112  THR A CB  1 
ATOM   873  O OG1 . THR A 1 111 ? 35.309  -49.885 357.673 1.00 48.52  ? 112  THR A OG1 1 
ATOM   874  C CG2 . THR A 1 111 ? 36.080  -48.145 356.210 1.00 44.48  ? 112  THR A CG2 1 
ATOM   875  N N   . PRO A 1 112 ? 38.756  -49.266 354.750 1.00 35.31  ? 113  PRO A N   1 
ATOM   876  C CA  . PRO A 1 112 ? 39.876  -48.527 354.153 1.00 35.20  ? 113  PRO A CA  1 
ATOM   877  C C   . PRO A 1 112 ? 39.959  -47.098 354.672 1.00 27.64  ? 113  PRO A C   1 
ATOM   878  O O   . PRO A 1 112 ? 38.949  -46.463 354.983 1.00 26.47  ? 113  PRO A O   1 
ATOM   879  C CB  . PRO A 1 112 ? 39.562  -48.560 352.651 1.00 42.92  ? 113  PRO A CB  1 
ATOM   880  C CG  . PRO A 1 112 ? 38.093  -48.870 352.576 1.00 46.89  ? 113  PRO A CG  1 
ATOM   881  C CD  . PRO A 1 112 ? 37.856  -49.804 353.717 1.00 41.07  ? 113  PRO A CD  1 
ATOM   882  N N   . VAL A 1 113 ? 41.189  -46.594 354.754 1.00 25.63  ? 114  VAL A N   1 
ATOM   883  C CA  . VAL A 1 113 ? 41.484  -45.306 355.371 1.00 25.70  ? 114  VAL A CA  1 
ATOM   884  C C   . VAL A 1 113 ? 42.052  -44.364 354.319 1.00 28.08  ? 114  VAL A C   1 
ATOM   885  O O   . VAL A 1 113 ? 42.990  -44.723 353.597 1.00 30.62  ? 114  VAL A O   1 
ATOM   886  C CB  . VAL A 1 113 ? 42.471  -45.455 356.545 1.00 27.68  ? 114  VAL A CB  1 
ATOM   887  C CG1 . VAL A 1 113 ? 42.706  -44.109 357.217 1.00 21.53  ? 114  VAL A CG1 1 
ATOM   888  C CG2 . VAL A 1 113 ? 41.958  -46.480 357.545 1.00 24.63  ? 114  VAL A CG2 1 
ATOM   889  N N   . LEU A 1 114 ? 41.485  -43.162 354.239 1.00 27.46  ? 115  LEU A N   1 
ATOM   890  C CA  . LEU A 1 114 ? 42.048  -42.066 353.461 1.00 27.40  ? 115  LEU A CA  1 
ATOM   891  C C   . LEU A 1 114 ? 42.697  -41.072 354.415 1.00 25.29  ? 115  LEU A C   1 
ATOM   892  O O   . LEU A 1 114 ? 42.087  -40.679 355.414 1.00 26.39  ? 115  LEU A O   1 
ATOM   893  C CB  . LEU A 1 114 ? 40.972  -41.365 352.628 1.00 23.70  ? 115  LEU A CB  1 
ATOM   894  C CG  . LEU A 1 114 ? 40.498  -42.021 351.329 1.00 34.00  ? 115  LEU A CG  1 
ATOM   895  C CD1 . LEU A 1 114 ? 39.131  -41.481 350.933 1.00 34.95  ? 115  LEU A CD1 1 
ATOM   896  C CD2 . LEU A 1 114 ? 41.507  -41.788 350.215 1.00 37.33  ? 115  LEU A CD2 1 
ATOM   897  N N   . VAL A 1 115 ? 43.929  -40.671 354.112 1.00 23.60  ? 116  VAL A N   1 
ATOM   898  C CA  . VAL A 1 115 ? 44.679  -39.728 354.938 1.00 22.34  ? 116  VAL A CA  1 
ATOM   899  C C   . VAL A 1 115 ? 45.019  -38.513 354.085 1.00 24.08  ? 116  VAL A C   1 
ATOM   900  O O   . VAL A 1 115 ? 45.728  -38.634 353.079 1.00 28.49  ? 116  VAL A O   1 
ATOM   901  C CB  . VAL A 1 115 ? 45.950  -40.361 355.524 1.00 21.88  ? 116  VAL A CB  1 
ATOM   902  C CG1 . VAL A 1 115 ? 46.692  -39.351 356.385 1.00 21.72  ? 116  VAL A CG1 1 
ATOM   903  C CG2 . VAL A 1 115 ? 45.601  -41.602 356.333 1.00 19.74  ? 116  VAL A CG2 1 
ATOM   904  N N   . TRP A 1 116 ? 44.526  -37.346 354.495 1.00 19.74  ? 117  TRP A N   1 
ATOM   905  C CA  . TRP A 1 116 ? 44.680  -36.112 353.736 1.00 18.22  ? 117  TRP A CA  1 
ATOM   906  C C   . TRP A 1 116 ? 45.862  -35.302 354.251 1.00 19.07  ? 117  TRP A C   1 
ATOM   907  O O   . TRP A 1 116 ? 46.067  -35.179 355.462 1.00 14.70  ? 117  TRP A O   1 
ATOM   908  C CB  . TRP A 1 116 ? 43.406  -35.267 353.813 1.00 16.33  ? 117  TRP A CB  1 
ATOM   909  C CG  . TRP A 1 116 ? 43.520  -33.911 353.168 1.00 18.27  ? 117  TRP A CG  1 
ATOM   910  C CD1 . TRP A 1 116 ? 43.560  -32.702 353.801 1.00 18.40  ? 117  TRP A CD1 1 
ATOM   911  C CD2 . TRP A 1 116 ? 43.596  -33.630 351.766 1.00 16.96  ? 117  TRP A CD2 1 
ATOM   912  N NE1 . TRP A 1 116 ? 43.659  -31.687 352.878 1.00 17.88  ? 117  TRP A NE1 1 
ATOM   913  C CE2 . TRP A 1 116 ? 43.683  -32.232 351.622 1.00 17.55  ? 117  TRP A CE2 1 
ATOM   914  C CE3 . TRP A 1 116 ? 43.604  -34.426 350.619 1.00 16.72  ? 117  TRP A CE3 1 
ATOM   915  C CZ2 . TRP A 1 116 ? 43.772  -31.614 350.375 1.00 18.38  ? 117  TRP A CZ2 1 
ATOM   916  C CZ3 . TRP A 1 116 ? 43.688  -33.812 349.383 1.00 21.18  ? 117  TRP A CZ3 1 
ATOM   917  C CH2 . TRP A 1 116 ? 43.773  -32.421 349.271 1.00 17.75  ? 117  TRP A CH2 1 
ATOM   918  N N   . ILE A 1 117 ? 46.633  -34.746 353.320 1.00 19.16  ? 118  ILE A N   1 
ATOM   919  C CA  . ILE A 1 117 ? 47.731  -33.835 353.623 1.00 18.47  ? 118  ILE A CA  1 
ATOM   920  C C   . ILE A 1 117 ? 47.472  -32.555 352.843 1.00 22.26  ? 118  ILE A C   1 
ATOM   921  O O   . ILE A 1 117 ? 47.516  -32.557 351.606 1.00 19.08  ? 118  ILE A O   1 
ATOM   922  C CB  . ILE A 1 117 ? 49.098  -34.431 353.263 1.00 21.03  ? 118  ILE A CB  1 
ATOM   923  C CG1 . ILE A 1 117 ? 49.284  -35.795 353.929 1.00 21.65  ? 118  ILE A CG1 1 
ATOM   924  C CG2 . ILE A 1 117 ? 50.215  -33.477 353.659 1.00 17.93  ? 118  ILE A CG2 1 
ATOM   925  C CD1 . ILE A 1 117 ? 50.629  -36.432 353.645 1.00 21.85  ? 118  ILE A CD1 1 
ATOM   926  N N   . TYR A 1 118 ? 47.201  -31.464 353.552 1.00 21.07  ? 119  TYR A N   1 
ATOM   927  C CA  . TYR A 1 118 ? 46.875  -30.226 352.865 1.00 12.58  ? 119  TYR A CA  1 
ATOM   928  C C   . TYR A 1 118 ? 48.109  -29.637 352.191 1.00 17.38  ? 119  TYR A C   1 
ATOM   929  O O   . TYR A 1 118 ? 49.253  -29.930 352.548 1.00 16.94  ? 119  TYR A O   1 
ATOM   930  C CB  . TYR A 1 118 ? 46.264  -29.205 353.830 1.00 20.62  ? 119  TYR A CB  1 
ATOM   931  C CG  . TYR A 1 118 ? 47.091  -28.887 355.060 1.00 18.12  ? 119  TYR A CG  1 
ATOM   932  C CD1 . TYR A 1 118 ? 48.196  -28.045 354.989 1.00 20.36  ? 119  TYR A CD1 1 
ATOM   933  C CD2 . TYR A 1 118 ? 46.748  -29.409 356.300 1.00 13.23  ? 119  TYR A CD2 1 
ATOM   934  C CE1 . TYR A 1 118 ? 48.942  -27.746 356.115 1.00 15.60  ? 119  TYR A CE1 1 
ATOM   935  C CE2 . TYR A 1 118 ? 47.488  -29.116 357.431 1.00 16.61  ? 119  TYR A CE2 1 
ATOM   936  C CZ  . TYR A 1 118 ? 48.584  -28.286 357.333 1.00 17.75  ? 119  TYR A CZ  1 
ATOM   937  O OH  . TYR A 1 118 ? 49.321  -27.995 358.458 1.00 17.72  ? 119  TYR A OH  1 
ATOM   938  N N   . GLY A 1 119 ? 47.856  -28.794 351.189 1.00 14.66  ? 120  GLY A N   1 
ATOM   939  C CA  . GLY A 1 119 ? 48.892  -28.019 350.548 1.00 19.88  ? 120  GLY A CA  1 
ATOM   940  C C   . GLY A 1 119 ? 48.946  -26.597 351.076 1.00 19.02  ? 120  GLY A C   1 
ATOM   941  O O   . GLY A 1 119 ? 48.354  -26.252 352.100 1.00 19.99  ? 120  GLY A O   1 
ATOM   942  N N   . GLY A 1 120 ? 49.669  -25.757 350.344 1.00 24.90  ? 121  GLY A N   1 
ATOM   943  C CA  . GLY A 1 120 ? 49.870  -24.386 350.762 1.00 13.81  ? 121  GLY A CA  1 
ATOM   944  C C   . GLY A 1 120 ? 51.329  -23.986 350.720 1.00 22.76  ? 121  GLY A C   1 
ATOM   945  O O   . GLY A 1 120 ? 51.795  -23.216 351.565 1.00 23.30  ? 121  GLY A O   1 
ATOM   946  N N   . GLY A 1 121 ? 52.061  -24.526 349.746 1.00 17.48  ? 122  GLY A N   1 
ATOM   947  C CA  . GLY A 1 121 ? 53.439  -24.137 349.503 1.00 24.23  ? 122  GLY A CA  1 
ATOM   948  C C   . GLY A 1 121 ? 54.399  -24.385 350.643 1.00 21.51  ? 122  GLY A C   1 
ATOM   949  O O   . GLY A 1 121 ? 55.461  -23.760 350.689 1.00 22.57  ? 122  GLY A O   1 
ATOM   950  N N   . PHE A 1 122 ? 54.060  -25.286 351.565 1.00 18.06  ? 123  PHE A N   1 
ATOM   951  C CA  . PHE A 1 122 ? 54.826  -25.563 352.779 1.00 18.63  ? 123  PHE A CA  1 
ATOM   952  C C   . PHE A 1 122 ? 54.952  -24.348 353.694 1.00 18.50  ? 123  PHE A C   1 
ATOM   953  O O   . PHE A 1 122 ? 55.722  -24.386 354.660 1.00 20.12  ? 123  PHE A O   1 
ATOM   954  C CB  . PHE A 1 122 ? 56.228  -26.112 352.464 1.00 16.93  ? 123  PHE A CB  1 
ATOM   955  C CG  . PHE A 1 122 ? 56.227  -27.459 351.791 1.00 19.76  ? 123  PHE A CG  1 
ATOM   956  C CD1 . PHE A 1 122 ? 55.886  -28.603 352.495 1.00 19.39  ? 123  PHE A CD1 1 
ATOM   957  C CD2 . PHE A 1 122 ? 56.593  -27.583 350.460 1.00 18.74  ? 123  PHE A CD2 1 
ATOM   958  C CE1 . PHE A 1 122 ? 55.895  -29.843 351.880 1.00 17.86  ? 123  PHE A CE1 1 
ATOM   959  C CE2 . PHE A 1 122 ? 56.604  -28.820 349.839 1.00 18.20  ? 123  PHE A CE2 1 
ATOM   960  C CZ  . PHE A 1 122 ? 56.255  -29.951 350.551 1.00 19.16  ? 123  PHE A CZ  1 
ATOM   961  N N   . TYR A 1 123 ? 54.221  -23.266 353.420 1.00 15.26  ? 124  TYR A N   1 
ATOM   962  C CA  . TYR A 1 123 ? 54.230  -22.093 354.284 1.00 23.29  ? 124  TYR A CA  1 
ATOM   963  C C   . TYR A 1 123 ? 52.873  -21.794 354.902 1.00 22.21  ? 124  TYR A C   1 
ATOM   964  O O   . TYR A 1 123 ? 52.771  -20.862 355.709 1.00 21.74  ? 124  TYR A O   1 
ATOM   965  C CB  . TYR A 1 123 ? 54.723  -20.854 353.516 1.00 19.02  ? 124  TYR A CB  1 
ATOM   966  C CG  . TYR A 1 123 ? 53.726  -20.279 352.527 1.00 25.91  ? 124  TYR A CG  1 
ATOM   967  C CD1 . TYR A 1 123 ? 52.789  -19.327 352.919 1.00 23.49  ? 124  TYR A CD1 1 
ATOM   968  C CD2 . TYR A 1 123 ? 53.735  -20.674 351.195 1.00 25.14  ? 124  TYR A CD2 1 
ATOM   969  C CE1 . TYR A 1 123 ? 51.881  -18.801 352.019 1.00 24.65  ? 124  TYR A CE1 1 
ATOM   970  C CE2 . TYR A 1 123 ? 52.833  -20.150 350.287 1.00 25.11  ? 124  TYR A CE2 1 
ATOM   971  C CZ  . TYR A 1 123 ? 51.909  -19.215 350.704 1.00 28.28  ? 124  TYR A CZ  1 
ATOM   972  O OH  . TYR A 1 123 ? 51.009  -18.693 349.804 1.00 35.67  ? 124  TYR A OH  1 
ATOM   973  N N   . SER A 1 124 ? 51.833  -22.543 354.550 1.00 17.23  ? 125  SER A N   1 
ATOM   974  C CA  . SER A 1 124 ? 50.491  -22.263 355.043 1.00 20.43  ? 125  SER A CA  1 
ATOM   975  C C   . SER A 1 124 ? 49.648  -23.524 354.907 1.00 20.38  ? 125  SER A C   1 
ATOM   976  O O   . SER A 1 124 ? 50.117  -24.565 354.437 1.00 17.97  ? 125  SER A O   1 
ATOM   977  C CB  . SER A 1 124 ? 49.863  -21.088 354.291 1.00 22.14  ? 125  SER A CB  1 
ATOM   978  O OG  . SER A 1 124 ? 49.726  -21.387 352.913 1.00 22.56  ? 125  SER A OG  1 
ATOM   979  N N   . GLY A 1 125 ? 48.389  -23.415 355.319 1.00 17.75  ? 126  GLY A N   1 
ATOM   980  C CA  . GLY A 1 125 ? 47.474  -24.535 355.271 1.00 21.55  ? 126  GLY A CA  1 
ATOM   981  C C   . GLY A 1 125 ? 47.015  -24.971 356.645 1.00 21.06  ? 126  GLY A C   1 
ATOM   982  O O   . GLY A 1 125 ? 47.632  -24.623 357.657 1.00 17.87  ? 126  GLY A O   1 
ATOM   983  N N   . ALA A 1 126 ? 45.926  -25.734 356.689 1.00 21.63  ? 127  ALA A N   1 
ATOM   984  C CA  . ALA A 1 126 ? 45.384  -26.264 357.931 1.00 22.05  ? 127  ALA A CA  1 
ATOM   985  C C   . ALA A 1 126 ? 44.376  -27.347 357.588 1.00 25.58  ? 127  ALA A C   1 
ATOM   986  O O   . ALA A 1 126 ? 43.672  -27.244 356.581 1.00 18.69  ? 127  ALA A O   1 
ATOM   987  C CB  . ALA A 1 126 ? 44.716  -25.166 358.770 1.00 17.20  ? 127  ALA A CB  1 
ATOM   988  N N   . SER A 1 127 ? 44.316  -28.384 358.424 1.00 20.47  ? 128  SER A N   1 
ATOM   989  C CA  . SER A 1 127 ? 43.336  -29.443 358.227 1.00 19.15  ? 128  SER A CA  1 
ATOM   990  C C   . SER A 1 127 ? 41.924  -29.005 358.589 1.00 20.88  ? 128  SER A C   1 
ATOM   991  O O   . SER A 1 127 ? 40.978  -29.761 358.348 1.00 19.02  ? 128  SER A O   1 
ATOM   992  C CB  . SER A 1 127 ? 43.721  -30.676 359.047 1.00 17.19  ? 128  SER A CB  1 
ATOM   993  O OG  . SER A 1 127 ? 43.716  -30.389 360.435 1.00 17.86  ? 128  SER A OG  1 
ATOM   994  N N   . SER A 1 128 ? 41.762  -27.803 359.141 1.00 20.76  ? 129  SER A N   1 
ATOM   995  C CA  . SER A 1 128 ? 40.478  -27.327 359.635 1.00 20.67  ? 129  SER A CA  1 
ATOM   996  C C   . SER A 1 128 ? 39.687  -26.526 358.609 1.00 25.08  ? 129  SER A C   1 
ATOM   997  O O   . SER A 1 128 ? 38.531  -26.184 358.882 1.00 24.41  ? 129  SER A O   1 
ATOM   998  C CB  . SER A 1 128 ? 40.688  -26.467 360.884 1.00 20.78  ? 129  SER A CB  1 
ATOM   999  O OG  . SER A 1 128 ? 41.580  -25.397 360.623 1.00 20.78  ? 129  SER A OG  1 
ATOM   1000 N N   . LEU A 1 129 ? 40.269  -26.212 357.453 1.00 24.60  ? 130  LEU A N   1 
ATOM   1001 C CA  . LEU A 1 129 ? 39.560  -25.419 356.456 1.00 26.74  ? 130  LEU A CA  1 
ATOM   1002 C C   . LEU A 1 129 ? 38.297  -26.139 355.995 1.00 22.77  ? 130  LEU A C   1 
ATOM   1003 O O   . LEU A 1 129 ? 38.254  -27.369 355.902 1.00 25.48  ? 130  LEU A O   1 
ATOM   1004 C CB  . LEU A 1 129 ? 40.467  -25.122 355.260 1.00 23.31  ? 130  LEU A CB  1 
ATOM   1005 C CG  . LEU A 1 129 ? 41.831  -24.496 355.560 1.00 27.23  ? 130  LEU A CG  1 
ATOM   1006 C CD1 . LEU A 1 129 ? 42.579  -24.205 354.268 1.00 25.37  ? 130  LEU A CD1 1 
ATOM   1007 C CD2 . LEU A 1 129 ? 41.678  -23.231 356.391 1.00 23.56  ? 130  LEU A CD2 1 
ATOM   1008 N N   . ASP A 1 130 ? 37.258  -25.349 355.703 1.00 22.74  ? 131  ASP A N   1 
ATOM   1009 C CA  . ASP A 1 130 ? 35.950  -25.911 355.376 1.00 27.44  ? 131  ASP A CA  1 
ATOM   1010 C C   . ASP A 1 130 ? 36.009  -26.841 354.173 1.00 26.15  ? 131  ASP A C   1 
ATOM   1011 O O   . ASP A 1 130 ? 35.251  -27.815 354.103 1.00 25.45  ? 131  ASP A O   1 
ATOM   1012 C CB  . ASP A 1 130 ? 34.943  -24.792 355.108 1.00 26.18  ? 131  ASP A CB  1 
ATOM   1013 C CG  . ASP A 1 130 ? 34.671  -23.945 356.332 1.00 37.72  ? 131  ASP A CG  1 
ATOM   1014 O OD1 . ASP A 1 130 ? 34.953  -24.411 357.456 1.00 36.91  ? 131  ASP A OD1 1 
ATOM   1015 O OD2 . ASP A 1 130 ? 34.167  -22.814 356.169 1.00 44.18  ? 131  ASP A OD2 1 
ATOM   1016 N N   . VAL A 1 131 ? 36.895  -26.560 353.215 1.00 23.61  ? 132  VAL A N   1 
ATOM   1017 C CA  . VAL A 1 131 ? 36.955  -27.365 351.998 1.00 24.31  ? 132  VAL A CA  1 
ATOM   1018 C C   . VAL A 1 131 ? 37.625  -28.712 352.221 1.00 20.74  ? 132  VAL A C   1 
ATOM   1019 O O   . VAL A 1 131 ? 37.583  -29.568 351.329 1.00 22.81  ? 132  VAL A O   1 
ATOM   1020 C CB  . VAL A 1 131 ? 37.650  -26.544 350.894 1.00 28.03  ? 132  VAL A CB  1 
ATOM   1021 C CG1 . VAL A 1 131 ? 39.159  -26.633 351.017 1.00 25.24  ? 132  VAL A CG1 1 
ATOM   1022 C CG2 . VAL A 1 131 ? 37.180  -26.983 349.523 1.00 32.58  ? 132  VAL A CG2 1 
ATOM   1023 N N   . TYR A 1 132 ? 38.226  -28.933 353.391 1.00 18.29  ? 133  TYR A N   1 
ATOM   1024 C CA  . TYR A 1 132 ? 38.777  -30.230 353.765 1.00 21.08  ? 133  TYR A CA  1 
ATOM   1025 C C   . TYR A 1 132 ? 37.868  -30.995 354.721 1.00 25.93  ? 133  TYR A C   1 
ATOM   1026 O O   . TYR A 1 132 ? 38.318  -31.958 355.351 1.00 26.60  ? 133  TYR A O   1 
ATOM   1027 C CB  . TYR A 1 132 ? 40.162  -30.065 354.399 1.00 20.46  ? 133  TYR A CB  1 
ATOM   1028 C CG  . TYR A 1 132 ? 41.164  -29.285 353.574 1.00 20.31  ? 133  TYR A CG  1 
ATOM   1029 C CD1 . TYR A 1 132 ? 41.132  -29.311 352.185 1.00 19.28  ? 133  TYR A CD1 1 
ATOM   1030 C CD2 . TYR A 1 132 ? 42.149  -28.526 354.191 1.00 15.50  ? 133  TYR A CD2 1 
ATOM   1031 C CE1 . TYR A 1 132 ? 42.052  -28.596 351.435 1.00 20.53  ? 133  TYR A CE1 1 
ATOM   1032 C CE2 . TYR A 1 132 ? 43.070  -27.809 353.453 1.00 16.68  ? 133  TYR A CE2 1 
ATOM   1033 C CZ  . TYR A 1 132 ? 43.019  -27.848 352.077 1.00 19.35  ? 133  TYR A CZ  1 
ATOM   1034 O OH  . TYR A 1 132 ? 43.938  -27.134 351.342 1.00 18.78  ? 133  TYR A OH  1 
ATOM   1035 N N   . ASP A 1 133 ? 36.607  -30.578 354.854 1.00 24.77  ? 134  ASP A N   1 
ATOM   1036 C CA  . ASP A 1 133 ? 35.637  -31.239 355.720 1.00 23.80  ? 134  ASP A CA  1 
ATOM   1037 C C   . ASP A 1 133 ? 35.416  -32.679 355.272 1.00 26.31  ? 134  ASP A C   1 
ATOM   1038 O O   . ASP A 1 133 ? 34.846  -32.921 354.203 1.00 31.44  ? 134  ASP A O   1 
ATOM   1039 C CB  . ASP A 1 133 ? 34.316  -30.462 355.714 1.00 27.00  ? 134  ASP A CB  1 
ATOM   1040 C CG  . ASP A 1 133 ? 33.354  -30.908 356.805 1.00 29.77  ? 134  ASP A CG  1 
ATOM   1041 O OD1 . ASP A 1 133 ? 33.579  -31.970 357.423 1.00 28.66  ? 134  ASP A OD1 1 
ATOM   1042 O OD2 . ASP A 1 133 ? 32.361  -30.187 357.042 1.00 36.58  ? 134  ASP A OD2 1 
ATOM   1043 N N   . GLY A 1 134 ? 35.849  -33.640 356.083 1.00 21.84  ? 135  GLY A N   1 
ATOM   1044 C CA  . GLY A 1 134 ? 35.786  -35.032 355.688 1.00 23.33  ? 135  GLY A CA  1 
ATOM   1045 C C   . GLY A 1 134 ? 34.462  -35.734 355.891 1.00 26.27  ? 135  GLY A C   1 
ATOM   1046 O O   . GLY A 1 134 ? 34.369  -36.931 355.607 1.00 25.75  ? 135  GLY A O   1 
ATOM   1047 N N   . ARG A 1 135 ? 33.425  -35.031 356.354 1.00 23.60  ? 136  ARG A N   1 
ATOM   1048 C CA  . ARG A 1 135 ? 32.183  -35.709 356.718 1.00 24.89  ? 136  ARG A CA  1 
ATOM   1049 C C   . ARG A 1 135 ? 31.441  -36.250 355.500 1.00 27.08  ? 136  ARG A C   1 
ATOM   1050 O O   . ARG A 1 135 ? 30.783  -37.293 355.595 1.00 26.19  ? 136  ARG A O   1 
ATOM   1051 C CB  . ARG A 1 135 ? 31.278  -34.765 357.513 1.00 23.02  ? 136  ARG A CB  1 
ATOM   1052 C CG  . ARG A 1 135 ? 30.554  -33.722 356.676 1.00 31.98  ? 136  ARG A CG  1 
ATOM   1053 C CD  . ARG A 1 135 ? 29.626  -32.880 357.527 1.00 30.64  ? 136  ARG A CD  1 
ATOM   1054 N NE  . ARG A 1 135 ? 30.356  -31.852 358.261 1.00 32.39  ? 136  ARG A NE  1 
ATOM   1055 C CZ  . ARG A 1 135 ? 29.832  -31.116 359.234 1.00 37.03  ? 136  ARG A CZ  1 
ATOM   1056 N NH1 . ARG A 1 135 ? 28.568  -31.292 359.594 1.00 38.88  ? 136  ARG A NH1 1 
ATOM   1057 N NH2 . ARG A 1 135 ? 30.572  -30.203 359.847 1.00 37.49  ? 136  ARG A NH2 1 
ATOM   1058 N N   . PHE A 1 136 ? 31.536  -35.574 354.353 1.00 23.53  ? 137  PHE A N   1 
ATOM   1059 C CA  . PHE A 1 136 ? 30.774  -36.006 353.185 1.00 25.28  ? 137  PHE A CA  1 
ATOM   1060 C C   . PHE A 1 136 ? 31.388  -37.248 352.553 1.00 26.45  ? 137  PHE A C   1 
ATOM   1061 O O   . PHE A 1 136 ? 30.663  -38.157 352.129 1.00 33.42  ? 137  PHE A O   1 
ATOM   1062 C CB  . PHE A 1 136 ? 30.678  -34.868 352.170 1.00 22.02  ? 137  PHE A CB  1 
ATOM   1063 C CG  . PHE A 1 136 ? 30.193  -33.575 352.760 1.00 26.91  ? 137  PHE A CG  1 
ATOM   1064 C CD1 . PHE A 1 136 ? 31.087  -32.564 353.075 1.00 26.10  ? 137  PHE A CD1 1 
ATOM   1065 C CD2 . PHE A 1 136 ? 28.845  -33.372 353.007 1.00 30.39  ? 137  PHE A CD2 1 
ATOM   1066 C CE1 . PHE A 1 136 ? 30.644  -31.372 353.621 1.00 29.70  ? 137  PHE A CE1 1 
ATOM   1067 C CE2 . PHE A 1 136 ? 28.395  -32.184 353.553 1.00 32.68  ? 137  PHE A CE2 1 
ATOM   1068 C CZ  . PHE A 1 136 ? 29.296  -31.182 353.860 1.00 32.40  ? 137  PHE A CZ  1 
ATOM   1069 N N   . LEU A 1 137 ? 32.720  -37.307 352.483 1.00 21.86  ? 138  LEU A N   1 
ATOM   1070 C CA  . LEU A 1 137 ? 33.383  -38.498 351.961 1.00 26.95  ? 138  LEU A CA  1 
ATOM   1071 C C   . LEU A 1 137 ? 33.057  -39.725 352.801 1.00 29.86  ? 138  LEU A C   1 
ATOM   1072 O O   . LEU A 1 137 ? 32.786  -40.804 352.262 1.00 31.96  ? 138  LEU A O   1 
ATOM   1073 C CB  . LEU A 1 137 ? 34.895  -38.278 351.917 1.00 28.26  ? 138  LEU A CB  1 
ATOM   1074 C CG  . LEU A 1 137 ? 35.531  -38.062 350.546 1.00 30.94  ? 138  LEU A CG  1 
ATOM   1075 C CD1 . LEU A 1 137 ? 36.972  -37.604 350.700 1.00 30.83  ? 138  LEU A CD1 1 
ATOM   1076 C CD2 . LEU A 1 137 ? 35.452  -39.335 349.718 1.00 30.80  ? 138  LEU A CD2 1 
ATOM   1077 N N   . VAL A 1 138 ? 33.075  -39.574 354.126 1.00 27.55  ? 139  VAL A N   1 
ATOM   1078 C CA  . VAL A 1 138 ? 32.860  -40.712 355.013 1.00 25.80  ? 139  VAL A CA  1 
ATOM   1079 C C   . VAL A 1 138 ? 31.427  -41.217 354.904 1.00 26.95  ? 139  VAL A C   1 
ATOM   1080 O O   . VAL A 1 138 ? 31.183  -42.429 354.855 1.00 31.97  ? 139  VAL A O   1 
ATOM   1081 C CB  . VAL A 1 138 ? 33.223  -40.322 356.457 1.00 25.66  ? 139  VAL A CB  1 
ATOM   1082 C CG1 . VAL A 1 138 ? 32.755  -41.384 357.436 1.00 28.07  ? 139  VAL A CG1 1 
ATOM   1083 C CG2 . VAL A 1 138 ? 34.721  -40.107 356.569 1.00 24.10  ? 139  VAL A CG2 1 
ATOM   1084 N N   . GLN A 1 139 ? 30.459  -40.302 354.852 1.00 25.13  ? 140  GLN A N   1 
ATOM   1085 C CA  . GLN A 1 139 ? 29.065  -40.715 354.733 1.00 32.09  ? 140  GLN A CA  1 
ATOM   1086 C C   . GLN A 1 139 ? 28.788  -41.348 353.375 1.00 35.35  ? 140  GLN A C   1 
ATOM   1087 O O   . GLN A 1 139 ? 28.097  -42.370 353.290 1.00 37.89  ? 140  GLN A O   1 
ATOM   1088 C CB  . GLN A 1 139 ? 28.144  -39.517 354.965 1.00 34.02  ? 140  GLN A CB  1 
ATOM   1089 C CG  . GLN A 1 139 ? 26.743  -39.890 355.421 1.00 47.50  ? 140  GLN A CG  1 
ATOM   1090 C CD  . GLN A 1 139 ? 25.884  -40.421 354.292 1.00 58.98  ? 140  GLN A CD  1 
ATOM   1091 O OE1 . GLN A 1 139 ? 25.954  -39.936 353.162 1.00 64.94  ? 140  GLN A OE1 1 
ATOM   1092 N NE2 . GLN A 1 139 ? 25.069  -41.427 354.590 1.00 58.14  ? 140  GLN A NE2 1 
ATOM   1093 N N   . ALA A 1 140 ? 29.324  -40.761 352.303 1.00 33.76  ? 141  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 140 ? 28.992  -41.234 350.963 1.00 33.66  ? 141  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 140 ? 29.661  -42.567 350.652 1.00 36.94  ? 141  ALA A C   1 
ATOM   1096 O O   . ALA A 1 140 ? 29.055  -43.434 350.012 1.00 40.53  ? 141  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 140 ? 29.386  -40.185 349.924 1.00 31.35  ? 141  ALA A CB  1 
ATOM   1098 N N   . GLU A 1 141 ? 30.904  -42.756 351.093 1.00 34.13  ? 142  GLU A N   1 
ATOM   1099 C CA  . GLU A 1 141 ? 31.698  -43.891 350.648 1.00 36.70  ? 142  GLU A CA  1 
ATOM   1100 C C   . GLU A 1 141 ? 32.138  -44.828 351.765 1.00 36.85  ? 142  GLU A C   1 
ATOM   1101 O O   . GLU A 1 141 ? 32.859  -45.794 351.486 1.00 39.59  ? 142  GLU A O   1 
ATOM   1102 C CB  . GLU A 1 141 ? 32.926  -43.393 349.877 1.00 23.32  ? 142  GLU A CB  1 
ATOM   1103 C CG  . GLU A 1 141 ? 32.575  -42.745 348.545 1.00 30.82  ? 142  GLU A CG  1 
ATOM   1104 C CD  . GLU A 1 141 ? 31.981  -43.734 347.558 1.00 39.86  ? 142  GLU A CD  1 
ATOM   1105 O OE1 . GLU A 1 141 ? 31.037  -43.358 346.831 1.00 44.68  ? 142  GLU A OE1 1 
ATOM   1106 O OE2 . GLU A 1 141 ? 32.456  -44.889 347.511 1.00 41.02  ? 142  GLU A OE2 1 
ATOM   1107 N N   . ARG A 1 142 ? 31.729  -44.578 353.010 1.00 40.24  ? 143  ARG A N   1 
ATOM   1108 C CA  . ARG A 1 142 ? 31.961  -45.498 354.126 1.00 43.97  ? 143  ARG A CA  1 
ATOM   1109 C C   . ARG A 1 142 ? 33.440  -45.844 354.282 1.00 39.32  ? 143  ARG A C   1 
ATOM   1110 O O   . ARG A 1 142 ? 33.816  -47.006 354.441 1.00 52.10  ? 143  ARG A O   1 
ATOM   1111 C CB  . ARG A 1 142 ? 31.125  -46.769 353.975 1.00 51.53  ? 143  ARG A CB  1 
ATOM   1112 C CG  . ARG A 1 142 ? 29.638  -46.524 353.851 1.00 67.41  ? 143  ARG A CG  1 
ATOM   1113 C CD  . ARG A 1 142 ? 29.009  -46.246 355.205 1.00 81.64  ? 143  ARG A CD  1 
ATOM   1114 N NE  . ARG A 1 142 ? 27.552  -46.284 355.138 1.00 94.63  ? 143  ARG A NE  1 
ATOM   1115 C CZ  . ARG A 1 142 ? 26.770  -45.214 355.234 1.00 97.23  ? 143  ARG A CZ  1 
ATOM   1116 N NH1 . ARG A 1 142 ? 27.306  -44.012 355.405 1.00 93.90  ? 143  ARG A NH1 1 
ATOM   1117 N NH2 . ARG A 1 142 ? 25.453  -45.348 355.158 1.00 98.23  ? 143  ARG A NH2 1 
ATOM   1118 N N   . THR A 1 143 ? 34.283  -44.824 354.218 1.00 29.60  ? 144  THR A N   1 
ATOM   1119 C CA  . THR A 1 143 ? 35.685  -44.948 354.579 1.00 33.27  ? 144  THR A CA  1 
ATOM   1120 C C   . THR A 1 143 ? 35.927  -44.196 355.878 1.00 27.67  ? 144  THR A C   1 
ATOM   1121 O O   . THR A 1 143 ? 35.076  -43.443 356.357 1.00 27.71  ? 144  THR A O   1 
ATOM   1122 C CB  . THR A 1 143 ? 36.597  -44.407 353.470 1.00 37.81  ? 144  THR A CB  1 
ATOM   1123 O OG1 . THR A 1 143 ? 36.349  -43.008 353.284 1.00 38.42  ? 144  THR A OG1 1 
ATOM   1124 C CG2 . THR A 1 143 ? 36.343  -45.139 352.161 1.00 40.82  ? 144  THR A CG2 1 
ATOM   1125 N N   . VAL A 1 144 ? 37.096  -44.421 356.462 1.00 30.74  ? 145  VAL A N   1 
ATOM   1126 C CA  . VAL A 1 144 ? 37.588  -43.596 357.556 1.00 30.27  ? 145  VAL A CA  1 
ATOM   1127 C C   . VAL A 1 144 ? 38.539  -42.573 356.958 1.00 29.55  ? 145  VAL A C   1 
ATOM   1128 O O   . VAL A 1 144 ? 39.394  -42.918 356.132 1.00 28.95  ? 145  VAL A O   1 
ATOM   1129 C CB  . VAL A 1 144 ? 38.279  -44.442 358.639 1.00 26.26  ? 145  VAL A CB  1 
ATOM   1130 C CG1 . VAL A 1 144 ? 38.917  -43.544 359.688 1.00 23.13  ? 145  VAL A CG1 1 
ATOM   1131 C CG2 . VAL A 1 144 ? 37.280  -45.388 359.286 1.00 27.36  ? 145  VAL A CG2 1 
ATOM   1132 N N   . LEU A 1 145 ? 38.376  -41.311 357.342 1.00 26.04  ? 146  LEU A N   1 
ATOM   1133 C CA  . LEU A 1 145 ? 39.215  -40.235 356.837 1.00 18.64  ? 146  LEU A CA  1 
ATOM   1134 C C   . LEU A 1 145 ? 40.008  -39.635 357.985 1.00 21.47  ? 146  LEU A C   1 
ATOM   1135 O O   . LEU A 1 145 ? 39.456  -39.368 359.058 1.00 24.10  ? 146  LEU A O   1 
ATOM   1136 C CB  . LEU A 1 145 ? 38.388  -39.152 356.138 1.00 25.74  ? 146  LEU A CB  1 
ATOM   1137 C CG  . LEU A 1 145 ? 39.230  -38.164 355.321 1.00 38.52  ? 146  LEU A CG  1 
ATOM   1138 C CD1 . LEU A 1 145 ? 38.522  -37.787 354.037 1.00 39.49  ? 146  LEU A CD1 1 
ATOM   1139 C CD2 . LEU A 1 145 ? 39.569  -36.913 356.114 1.00 40.87  ? 146  LEU A CD2 1 
ATOM   1140 N N   . VAL A 1 146 ? 41.298  -39.425 357.751 1.00 22.37  ? 147  VAL A N   1 
ATOM   1141 C CA  . VAL A 1 146 ? 42.194  -38.809 358.716 1.00 19.37  ? 147  VAL A CA  1 
ATOM   1142 C C   . VAL A 1 146 ? 42.867  -37.620 358.046 1.00 22.82  ? 147  VAL A C   1 
ATOM   1143 O O   . VAL A 1 146 ? 43.236  -37.686 356.869 1.00 21.14  ? 147  VAL A O   1 
ATOM   1144 C CB  . VAL A 1 146 ? 43.246  -39.811 359.239 1.00 22.81  ? 147  VAL A CB  1 
ATOM   1145 C CG1 . VAL A 1 146 ? 44.114  -39.172 360.315 1.00 19.99  ? 147  VAL A CG1 1 
ATOM   1146 C CG2 . VAL A 1 146 ? 42.570  -41.067 359.770 1.00 22.77  ? 147  VAL A CG2 1 
ATOM   1147 N N   . SER A 1 147 ? 43.001  -36.525 358.787 1.00 21.98  ? 148  SER A N   1 
ATOM   1148 C CA  . SER A 1 147 ? 43.803  -35.393 358.355 1.00 20.89  ? 148  SER A CA  1 
ATOM   1149 C C   . SER A 1 147 ? 44.593  -34.896 359.553 1.00 17.95  ? 148  SER A C   1 
ATOM   1150 O O   . SER A 1 147 ? 44.153  -35.025 360.697 1.00 19.72  ? 148  SER A O   1 
ATOM   1151 C CB  . SER A 1 147 ? 42.949  -34.260 357.771 1.00 20.68  ? 148  SER A CB  1 
ATOM   1152 O OG  . SER A 1 147 ? 42.056  -33.737 358.740 1.00 25.57  ? 148  SER A OG  1 
ATOM   1153 N N   . MET A 1 148 ? 45.770  -34.341 359.286 1.00 20.88  ? 149  MET A N   1 
ATOM   1154 C CA  . MET A 1 148 ? 46.642  -33.872 360.349 1.00 18.51  ? 149  MET A CA  1 
ATOM   1155 C C   . MET A 1 148 ? 47.152  -32.477 360.028 1.00 22.96  ? 149  MET A C   1 
ATOM   1156 O O   . MET A 1 148 ? 47.224  -32.072 358.864 1.00 17.69  ? 149  MET A O   1 
ATOM   1157 C CB  . MET A 1 148 ? 47.832  -34.824 360.570 1.00 16.31  ? 149  MET A CB  1 
ATOM   1158 C CG  . MET A 1 148 ? 49.065  -34.513 359.730 1.00 20.86  ? 149  MET A CG  1 
ATOM   1159 S SD  . MET A 1 148 ? 48.816  -34.798 357.967 1.00 25.55  ? 149  MET A SD  1 
ATOM   1160 C CE  . MET A 1 148 ? 48.597  -36.575 357.940 1.00 23.84  ? 149  MET A CE  1 
ATOM   1161 N N   . ASN A 1 149 ? 47.496  -31.719 360.984 1.00 16.99  ? 150  ASN A N   1 
ATOM   1162 C CA  . ASN A 1 149 ? 48.327  -30.580 360.834 1.00 16.87  ? 150  ASN A CA  1 
ATOM   1163 C C   . ASN A 1 149 ? 49.785  -31.037 361.000 1.00 21.08  ? 150  ASN A C   1 
ATOM   1164 O O   . ASN A 1 149 ? 50.080  -31.883 361.772 1.00 16.22  ? 150  ASN A O   1 
ATOM   1165 C CB  . ASN A 1 149 ? 48.039  -29.506 361.843 1.00 18.79  ? 150  ASN A CB  1 
ATOM   1166 C CG  . ASN A 1 149 ? 46.735  -28.804 361.617 1.00 23.56  ? 150  ASN A CG  1 
ATOM   1167 O OD1 . ASN A 1 149 ? 46.214  -28.779 360.562 1.00 37.05  ? 150  ASN A OD1 1 
ATOM   1168 N ND2 . ASN A 1 149 ? 46.264  -28.189 362.618 1.00 22.51  ? 150  ASN A ND2 1 
ATOM   1169 N N   . TYR A 1 150 ? 50.516  -30.110 360.216 1.00 18.47  ? 151  TYR A N   1 
ATOM   1170 C CA  . TYR A 1 150 ? 51.965  -30.203 360.276 1.00 20.28  ? 151  TYR A CA  1 
ATOM   1171 C C   . TYR A 1 150 ? 52.534  -28.794 360.233 1.00 17.87  ? 151  TYR A C   1 
ATOM   1172 O O   . TYR A 1 150 ? 51.931  -27.884 359.660 1.00 18.55  ? 151  TYR A O   1 
ATOM   1173 C CB  . TYR A 1 150 ? 52.537  -31.062 359.134 1.00 16.27  ? 151  TYR A CB  1 
ATOM   1174 C CG  . TYR A 1 150 ? 52.238  -30.556 357.739 1.00 16.72  ? 151  TYR A CG  1 
ATOM   1175 C CD1 . TYR A 1 150 ? 51.076  -30.928 357.076 1.00 14.08  ? 151  TYR A CD1 1 
ATOM   1176 C CD2 . TYR A 1 150 ? 53.129  -29.718 357.080 1.00 17.89  ? 151  TYR A CD2 1 
ATOM   1177 C CE1 . TYR A 1 150 ? 50.805  -30.472 355.797 1.00 14.95  ? 151  TYR A CE1 1 
ATOM   1178 C CE2 . TYR A 1 150 ? 52.867  -29.256 355.804 1.00 15.56  ? 151  TYR A CE2 1 
ATOM   1179 C CZ  . TYR A 1 150 ? 51.705  -29.634 355.168 1.00 20.86  ? 151  TYR A CZ  1 
ATOM   1180 O OH  . TYR A 1 150 ? 51.445  -29.171 353.897 1.00 19.45  ? 151  TYR A OH  1 
ATOM   1181 N N   . ARG A 1 151 ? 53.693  -28.620 360.863 1.00 17.87  ? 152  ARG A N   1 
ATOM   1182 C CA  . ARG A 1 151 ? 54.316  -27.306 360.925 1.00 16.18  ? 152  ARG A CA  1 
ATOM   1183 C C   . ARG A 1 151 ? 54.725  -26.844 359.532 1.00 20.47  ? 152  ARG A C   1 
ATOM   1184 O O   . ARG A 1 151 ? 55.190  -27.635 358.708 1.00 17.63  ? 152  ARG A O   1 
ATOM   1185 C CB  . ARG A 1 151 ? 55.537  -27.340 361.840 1.00 14.57  ? 152  ARG A CB  1 
ATOM   1186 C CG  . ARG A 1 151 ? 55.212  -27.370 363.323 1.00 16.14  ? 152  ARG A CG  1 
ATOM   1187 C CD  . ARG A 1 151 ? 56.473  -27.640 364.126 1.00 17.88  ? 152  ARG A CD  1 
ATOM   1188 N NE  . ARG A 1 151 ? 56.825  -29.057 364.117 1.00 20.49  ? 152  ARG A NE  1 
ATOM   1189 C CZ  . ARG A 1 151 ? 57.888  -29.569 364.727 1.00 22.60  ? 152  ARG A CZ  1 
ATOM   1190 N NH1 . ARG A 1 151 ? 58.718  -28.776 365.392 1.00 20.36  ? 152  ARG A NH1 1 
ATOM   1191 N NH2 . ARG A 1 151 ? 58.128  -30.872 364.666 1.00 19.29  ? 152  ARG A NH2 1 
ATOM   1192 N N   . VAL A 1 152 ? 54.551  -25.549 359.275 1.00 17.17  ? 153  VAL A N   1 
ATOM   1193 C CA  . VAL A 1 152 ? 54.860  -24.954 357.984 1.00 19.71  ? 153  VAL A CA  1 
ATOM   1194 C C   . VAL A 1 152 ? 55.777  -23.757 358.203 1.00 24.47  ? 153  VAL A C   1 
ATOM   1195 O O   . VAL A 1 152 ? 56.052  -23.352 359.333 1.00 25.61  ? 153  VAL A O   1 
ATOM   1196 C CB  . VAL A 1 152 ? 53.591  -24.528 357.218 1.00 20.15  ? 153  VAL A CB  1 
ATOM   1197 C CG1 . VAL A 1 152 ? 52.734  -25.743 356.896 1.00 17.53  ? 153  VAL A CG1 1 
ATOM   1198 C CG2 . VAL A 1 152 ? 52.802  -23.511 358.027 1.00 16.37  ? 153  VAL A CG2 1 
ATOM   1199 N N   . GLY A 1 153 ? 56.247  -23.190 357.095 1.00 21.76  ? 154  GLY A N   1 
ATOM   1200 C CA  . GLY A 1 153 ? 57.148  -22.058 357.171 1.00 17.46  ? 154  GLY A CA  1 
ATOM   1201 C C   . GLY A 1 153 ? 58.441  -22.423 357.876 1.00 20.18  ? 154  GLY A C   1 
ATOM   1202 O O   . GLY A 1 153 ? 58.906  -23.568 357.839 1.00 22.96  ? 154  GLY A O   1 
ATOM   1203 N N   . ALA A 1 154 ? 59.031  -21.426 358.542 1.00 19.55  ? 155  ALA A N   1 
ATOM   1204 C CA  . ALA A 1 154 ? 60.279  -21.660 359.262 1.00 26.31  ? 155  ALA A CA  1 
ATOM   1205 C C   . ALA A 1 154 ? 60.100  -22.706 360.354 1.00 24.92  ? 155  ALA A C   1 
ATOM   1206 O O   . ALA A 1 154 ? 61.011  -23.497 360.621 1.00 25.82  ? 155  ALA A O   1 
ATOM   1207 C CB  . ALA A 1 154 ? 60.798  -20.351 359.858 1.00 18.52  ? 155  ALA A CB  1 
ATOM   1208 N N   . PHE A 1 155 ? 58.924  -22.735 360.986 1.00 23.44  ? 156  PHE A N   1 
ATOM   1209 C CA  . PHE A 1 155 ? 58.703  -23.659 362.093 1.00 23.14  ? 156  PHE A CA  1 
ATOM   1210 C C   . PHE A 1 155 ? 58.763  -25.111 361.640 1.00 23.04  ? 156  PHE A C   1 
ATOM   1211 O O   . PHE A 1 155 ? 59.099  -25.995 362.435 1.00 18.70  ? 156  PHE A O   1 
ATOM   1212 C CB  . PHE A 1 155 ? 57.360  -23.358 362.759 1.00 20.52  ? 156  PHE A CB  1 
ATOM   1213 C CG  . PHE A 1 155 ? 57.185  -21.914 363.124 1.00 23.25  ? 156  PHE A CG  1 
ATOM   1214 C CD1 . PHE A 1 155 ? 56.502  -21.049 362.286 1.00 24.67  ? 156  PHE A CD1 1 
ATOM   1215 C CD2 . PHE A 1 155 ? 57.732  -21.415 364.293 1.00 21.39  ? 156  PHE A CD2 1 
ATOM   1216 C CE1 . PHE A 1 155 ? 56.350  -19.716 362.621 1.00 28.22  ? 156  PHE A CE1 1 
ATOM   1217 C CE2 . PHE A 1 155 ? 57.586  -20.085 364.630 1.00 27.83  ? 156  PHE A CE2 1 
ATOM   1218 C CZ  . PHE A 1 155 ? 56.896  -19.234 363.792 1.00 28.48  ? 156  PHE A CZ  1 
ATOM   1219 N N   . GLY A 1 156 ? 58.457  -25.377 360.375 1.00 21.90  ? 157  GLY A N   1 
ATOM   1220 C CA  . GLY A 1 156 ? 58.459  -26.741 359.894 1.00 18.51  ? 157  GLY A CA  1 
ATOM   1221 C C   . GLY A 1 156 ? 59.631  -27.093 359.004 1.00 22.80  ? 157  GLY A C   1 
ATOM   1222 O O   . GLY A 1 156 ? 59.969  -28.273 358.868 1.00 22.74  ? 157  GLY A O   1 
ATOM   1223 N N   . PHE A 1 157 ? 60.273  -26.092 358.396 1.00 20.69  ? 158  PHE A N   1 
ATOM   1224 C CA  . PHE A 1 157 ? 61.231  -26.387 357.341 1.00 22.20  ? 158  PHE A CA  1 
ATOM   1225 C C   . PHE A 1 157 ? 62.467  -25.503 357.311 1.00 23.25  ? 158  PHE A C   1 
ATOM   1226 O O   . PHE A 1 157 ? 63.270  -25.646 356.383 1.00 19.30  ? 158  PHE A O   1 
ATOM   1227 C CB  . PHE A 1 157 ? 60.527  -26.327 355.980 1.00 17.10  ? 158  PHE A CB  1 
ATOM   1228 C CG  . PHE A 1 157 ? 59.495  -27.393 355.810 1.00 20.78  ? 158  PHE A CG  1 
ATOM   1229 C CD1 . PHE A 1 157 ? 58.148  -27.079 355.800 1.00 18.45  ? 158  PHE A CD1 1 
ATOM   1230 C CD2 . PHE A 1 157 ? 59.873  -28.720 355.705 1.00 16.66  ? 158  PHE A CD2 1 
ATOM   1231 C CE1 . PHE A 1 157 ? 57.196  -28.069 355.664 1.00 18.26  ? 158  PHE A CE1 1 
ATOM   1232 C CE2 . PHE A 1 157 ? 58.929  -29.712 355.567 1.00 20.52  ? 158  PHE A CE2 1 
ATOM   1233 C CZ  . PHE A 1 157 ? 57.588  -29.387 355.546 1.00 20.54  ? 158  PHE A CZ  1 
ATOM   1234 N N   . LEU A 1 158 ? 62.661  -24.606 358.274 1.00 20.48  ? 159  LEU A N   1 
ATOM   1235 C CA  . LEU A 1 158 ? 63.959  -23.960 358.382 1.00 26.23  ? 159  LEU A CA  1 
ATOM   1236 C C   . LEU A 1 158 ? 64.994  -25.008 358.743 1.00 26.61  ? 159  LEU A C   1 
ATOM   1237 O O   . LEU A 1 158 ? 64.829  -25.754 359.715 1.00 31.42  ? 159  LEU A O   1 
ATOM   1238 C CB  . LEU A 1 158 ? 63.945  -22.837 359.419 1.00 22.66  ? 159  LEU A CB  1 
ATOM   1239 C CG  . LEU A 1 158 ? 65.331  -22.228 359.686 1.00 29.47  ? 159  LEU A CG  1 
ATOM   1240 C CD1 . LEU A 1 158 ? 65.236  -20.719 359.844 1.00 29.60  ? 159  LEU A CD1 1 
ATOM   1241 C CD2 . LEU A 1 158 ? 66.014  -22.839 360.909 1.00 26.47  ? 159  LEU A CD2 1 
ATOM   1242 N N   . ALA A 1 159 ? 66.061  -25.078 357.956 1.00 26.84  ? 160  ALA A N   1 
ATOM   1243 C CA  . ALA A 1 159 ? 67.078  -26.100 358.127 1.00 27.70  ? 160  ALA A CA  1 
ATOM   1244 C C   . ALA A 1 159 ? 68.445  -25.449 358.234 1.00 26.45  ? 160  ALA A C   1 
ATOM   1245 O O   . ALA A 1 159 ? 68.828  -24.653 357.372 1.00 26.45  ? 160  ALA A O   1 
ATOM   1246 C CB  . ALA A 1 159 ? 67.061  -27.100 356.966 1.00 21.04  ? 160  ALA A CB  1 
ATOM   1247 N N   . LEU A 1 160 ? 69.164  -25.774 359.306 1.00 26.10  ? 161  LEU A N   1 
ATOM   1248 C CA  . LEU A 1 160 ? 70.609  -25.593 359.375 1.00 28.23  ? 161  LEU A CA  1 
ATOM   1249 C C   . LEU A 1 160 ? 71.199  -26.990 359.256 1.00 28.26  ? 161  LEU A C   1 
ATOM   1250 O O   . LEU A 1 160 ? 71.462  -27.648 360.274 1.00 30.73  ? 161  LEU A O   1 
ATOM   1251 C CB  . LEU A 1 160 ? 71.039  -24.914 360.677 1.00 32.49  ? 161  LEU A CB  1 
ATOM   1252 C CG  . LEU A 1 160 ? 70.635  -23.443 360.792 1.00 33.97  ? 161  LEU A CG  1 
ATOM   1253 C CD1 . LEU A 1 160 ? 70.900  -22.920 362.190 1.00 34.58  ? 161  LEU A CD1 1 
ATOM   1254 C CD2 . LEU A 1 160 ? 71.371  -22.604 359.757 1.00 29.66  ? 161  LEU A CD2 1 
ATOM   1255 N N   . PRO A 1 161 ? 71.400  -27.496 358.038 1.00 30.58  ? 162  PRO A N   1 
ATOM   1256 C CA  . PRO A 1 161 ? 71.704  -28.923 357.866 1.00 30.66  ? 162  PRO A CA  1 
ATOM   1257 C C   . PRO A 1 161 ? 72.960  -29.334 358.617 1.00 34.56  ? 162  PRO A C   1 
ATOM   1258 O O   . PRO A 1 161 ? 73.931  -28.580 358.705 1.00 35.80  ? 162  PRO A O   1 
ATOM   1259 C CB  . PRO A 1 161 ? 71.881  -29.066 356.350 1.00 31.13  ? 162  PRO A CB  1 
ATOM   1260 C CG  . PRO A 1 161 ? 71.146  -27.897 355.766 1.00 30.21  ? 162  PRO A CG  1 
ATOM   1261 C CD  . PRO A 1 161 ? 71.330  -26.784 356.752 1.00 29.32  ? 162  PRO A CD  1 
ATOM   1262 N N   . GLY A 1 162 ? 72.926  -30.546 359.167 1.00 35.48  ? 163  GLY A N   1 
ATOM   1263 C CA  . GLY A 1 162 ? 73.980  -31.053 360.010 1.00 36.54  ? 163  GLY A CA  1 
ATOM   1264 C C   . GLY A 1 162 ? 73.800  -30.738 361.481 1.00 42.10  ? 163  GLY A C   1 
ATOM   1265 O O   . GLY A 1 162 ? 74.270  -31.501 362.331 1.00 46.12  ? 163  GLY A O   1 
ATOM   1266 N N   . SER A 1 163 ? 73.128  -29.636 361.799 1.00 41.72  ? 164  SER A N   1 
ATOM   1267 C CA  . SER A 1 163 ? 72.866  -29.296 363.187 1.00 40.93  ? 164  SER A CA  1 
ATOM   1268 C C   . SER A 1 163 ? 71.794  -30.212 363.771 1.00 40.65  ? 164  SER A C   1 
ATOM   1269 O O   . SER A 1 163 ? 70.962  -30.781 363.059 1.00 42.99  ? 164  SER A O   1 
ATOM   1270 C CB  . SER A 1 163 ? 72.422  -27.838 363.311 1.00 38.42  ? 164  SER A CB  1 
ATOM   1271 O OG  . SER A 1 163 ? 71.069  -27.685 362.915 1.00 36.61  ? 164  SER A OG  1 
ATOM   1272 N N   . ARG A 1 164 ? 71.831  -30.351 365.094 1.00 39.76  ? 165  ARG A N   1 
ATOM   1273 C CA  . ARG A 1 164 ? 70.804  -31.072 365.831 1.00 45.55  ? 165  ARG A CA  1 
ATOM   1274 C C   . ARG A 1 164 ? 69.691  -30.163 366.331 1.00 36.74  ? 165  ARG A C   1 
ATOM   1275 O O   . ARG A 1 164 ? 68.616  -30.660 366.686 1.00 35.02  ? 165  ARG A O   1 
ATOM   1276 C CB  . ARG A 1 164 ? 71.439  -31.815 367.017 1.00 60.91  ? 165  ARG A CB  1 
ATOM   1277 C CG  . ARG A 1 164 ? 72.262  -30.923 367.936 1.00 77.95  ? 165  ARG A CG  1 
ATOM   1278 C CD  . ARG A 1 164 ? 73.121  -31.739 368.897 1.00 92.53  ? 165  ARG A CD  1 
ATOM   1279 N NE  . ARG A 1 164 ? 72.357  -32.782 369.575 1.00 98.38  ? 165  ARG A NE  1 
ATOM   1280 C CZ  . ARG A 1 164 ? 71.580  -32.575 370.633 1.00 99.83  ? 165  ARG A CZ  1 
ATOM   1281 N NH1 . ARG A 1 164 ? 71.467  -31.358 371.148 1.00 98.98  ? 165  ARG A NH1 1 
ATOM   1282 N NH2 . ARG A 1 164 ? 70.920  -33.586 371.182 1.00 101.37 ? 165  ARG A NH2 1 
ATOM   1283 N N   . GLU A 1 165 ? 69.916  -28.846 366.352 1.00 37.42  ? 166  GLU A N   1 
ATOM   1284 C CA  . GLU A 1 165 ? 68.927  -27.913 366.879 1.00 34.07  ? 166  GLU A CA  1 
ATOM   1285 C C   . GLU A 1 165 ? 67.900  -27.500 365.832 1.00 33.92  ? 166  GLU A C   1 
ATOM   1286 O O   . GLU A 1 165 ? 66.784  -27.107 366.190 1.00 36.78  ? 166  GLU A O   1 
ATOM   1287 C CB  . GLU A 1 165 ? 69.627  -26.676 367.443 1.00 41.60  ? 166  GLU A CB  1 
ATOM   1288 C CG  . GLU A 1 165 ? 70.397  -26.946 368.722 1.00 59.64  ? 166  GLU A CG  1 
ATOM   1289 C CD  . GLU A 1 165 ? 69.592  -27.764 369.712 1.00 69.21  ? 166  GLU A CD  1 
ATOM   1290 O OE1 . GLU A 1 165 ? 70.071  -28.841 370.127 1.00 72.20  ? 166  GLU A OE1 1 
ATOM   1291 O OE2 . GLU A 1 165 ? 68.476  -27.332 370.072 1.00 66.66  ? 166  GLU A OE2 1 
ATOM   1292 N N   . ALA A 1 166 ? 68.251  -27.571 364.547 1.00 28.53  ? 167  ALA A N   1 
ATOM   1293 C CA  . ALA A 1 166 ? 67.323  -27.248 363.461 1.00 31.66  ? 167  ALA A CA  1 
ATOM   1294 C C   . ALA A 1 166 ? 67.658  -28.117 362.257 1.00 30.73  ? 167  ALA A C   1 
ATOM   1295 O O   . ALA A 1 166 ? 68.171  -27.636 361.239 1.00 28.02  ? 167  ALA A O   1 
ATOM   1296 C CB  . ALA A 1 166 ? 67.389  -25.763 363.110 1.00 23.25  ? 167  ALA A CB  1 
ATOM   1297 N N   . PRO A 1 167 ? 67.366  -29.419 362.337 1.00 33.39  ? 168  PRO A N   1 
ATOM   1298 C CA  . PRO A 1 167 ? 67.809  -30.337 361.275 1.00 32.19  ? 168  PRO A CA  1 
ATOM   1299 C C   . PRO A 1 167 ? 67.027  -30.209 359.980 1.00 30.91  ? 168  PRO A C   1 
ATOM   1300 O O   . PRO A 1 167 ? 67.503  -30.690 358.944 1.00 31.38  ? 168  PRO A O   1 
ATOM   1301 C CB  . PRO A 1 167 ? 67.607  -31.719 361.907 1.00 37.72  ? 168  PRO A CB  1 
ATOM   1302 C CG  . PRO A 1 167 ? 66.464  -31.515 362.848 1.00 33.03  ? 168  PRO A CG  1 
ATOM   1303 C CD  . PRO A 1 167 ? 66.628  -30.121 363.402 1.00 26.08  ? 168  PRO A CD  1 
ATOM   1304 N N   . GLY A 1 168 ? 65.852  -29.592 359.999 1.00 31.22  ? 169  GLY A N   1 
ATOM   1305 C CA  . GLY A 1 168 ? 65.046  -29.451 358.806 1.00 33.34  ? 169  GLY A CA  1 
ATOM   1306 C C   . GLY A 1 168 ? 64.078  -30.607 358.612 1.00 31.61  ? 169  GLY A C   1 
ATOM   1307 O O   . GLY A 1 168 ? 64.189  -31.667 359.226 1.00 26.76  ? 169  GLY A O   1 
ATOM   1308 N N   . ASN A 1 169 ? 63.099  -30.373 357.737 1.00 26.38  ? 170  ASN A N   1 
ATOM   1309 C CA  . ASN A 1 169 ? 62.085  -31.358 357.357 1.00 23.67  ? 170  ASN A CA  1 
ATOM   1310 C C   . ASN A 1 169 ? 61.242  -31.834 358.532 1.00 22.84  ? 170  ASN A C   1 
ATOM   1311 O O   . ASN A 1 169 ? 60.600  -32.886 358.442 1.00 23.21  ? 170  ASN A O   1 
ATOM   1312 C CB  . ASN A 1 169 ? 62.704  -32.579 356.666 1.00 18.08  ? 170  ASN A CB  1 
ATOM   1313 C CG  . ASN A 1 169 ? 63.306  -32.245 355.329 1.00 24.12  ? 170  ASN A CG  1 
ATOM   1314 O OD1 . ASN A 1 169 ? 62.845  -31.341 354.645 1.00 25.15  ? 170  ASN A OD1 1 
ATOM   1315 N ND2 . ASN A 1 169 ? 64.319  -33.001 354.931 1.00 22.91  ? 170  ASN A ND2 1 
ATOM   1316 N N   . VAL A 1 170 ? 61.214  -31.097 359.644 1.00 18.27  ? 171  VAL A N   1 
ATOM   1317 C CA  . VAL A 1 170 ? 60.447  -31.578 360.785 1.00 18.70  ? 171  VAL A CA  1 
ATOM   1318 C C   . VAL A 1 170 ? 58.949  -31.509 360.514 1.00 23.03  ? 171  VAL A C   1 
ATOM   1319 O O   . VAL A 1 170 ? 58.181  -32.269 361.113 1.00 23.87  ? 171  VAL A O   1 
ATOM   1320 C CB  . VAL A 1 170 ? 60.826  -30.810 362.065 1.00 19.47  ? 171  VAL A CB  1 
ATOM   1321 C CG1 . VAL A 1 170 ? 62.299  -31.030 362.388 1.00 20.81  ? 171  VAL A CG1 1 
ATOM   1322 C CG2 . VAL A 1 170 ? 60.517  -29.330 361.925 1.00 19.41  ? 171  VAL A CG2 1 
ATOM   1323 N N   . GLY A 1 171 ? 58.512  -30.628 359.610 1.00 24.38  ? 172  GLY A N   1 
ATOM   1324 C CA  . GLY A 1 171 ? 57.129  -30.667 359.169 1.00 17.01  ? 172  GLY A CA  1 
ATOM   1325 C C   . GLY A 1 171 ? 56.778  -31.963 358.465 1.00 26.77  ? 172  GLY A C   1 
ATOM   1326 O O   . GLY A 1 171 ? 55.651  -32.453 358.581 1.00 20.85  ? 172  GLY A O   1 
ATOM   1327 N N   . LEU A 1 172 ? 57.732  -32.534 357.724 1.00 18.55  ? 173  LEU A N   1 
ATOM   1328 C CA  . LEU A 1 172 ? 57.524  -33.858 357.149 1.00 21.58  ? 173  LEU A CA  1 
ATOM   1329 C C   . LEU A 1 172 ? 57.497  -34.930 358.226 1.00 22.96  ? 173  LEU A C   1 
ATOM   1330 O O   . LEU A 1 172 ? 56.772  -35.923 358.096 1.00 21.02  ? 173  LEU A O   1 
ATOM   1331 C CB  . LEU A 1 172 ? 58.615  -34.170 356.126 1.00 17.30  ? 173  LEU A CB  1 
ATOM   1332 C CG  . LEU A 1 172 ? 58.501  -33.477 354.769 1.00 24.03  ? 173  LEU A CG  1 
ATOM   1333 C CD1 . LEU A 1 172 ? 59.728  -33.768 353.918 1.00 18.68  ? 173  LEU A CD1 1 
ATOM   1334 C CD2 . LEU A 1 172 ? 57.233  -33.915 354.057 1.00 24.20  ? 173  LEU A CD2 1 
ATOM   1335 N N   . LEU A 1 173 ? 58.276  -34.748 359.294 1.00 19.74  ? 174  LEU A N   1 
ATOM   1336 C CA  . LEU A 1 173 ? 58.270  -35.720 360.379 1.00 22.04  ? 174  LEU A CA  1 
ATOM   1337 C C   . LEU A 1 173 ? 56.976  -35.656 361.181 1.00 21.67  ? 174  LEU A C   1 
ATOM   1338 O O   . LEU A 1 173 ? 56.528  -36.684 361.704 1.00 27.86  ? 174  LEU A O   1 
ATOM   1339 C CB  . LEU A 1 173 ? 59.487  -35.505 361.277 1.00 22.46  ? 174  LEU A CB  1 
ATOM   1340 C CG  . LEU A 1 173 ? 60.824  -35.824 360.602 1.00 27.90  ? 174  LEU A CG  1 
ATOM   1341 C CD1 . LEU A 1 173 ? 61.998  -35.494 361.512 1.00 26.58  ? 174  LEU A CD1 1 
ATOM   1342 C CD2 . LEU A 1 173 ? 60.870  -37.285 360.169 1.00 26.03  ? 174  LEU A CD2 1 
ATOM   1343 N N   . ASP A 1 174 ? 56.358  -34.474 361.289 1.00 21.51  ? 175  ASP A N   1 
ATOM   1344 C CA  . ASP A 1 174 ? 55.027  -34.405 361.887 1.00 19.58  ? 175  ASP A CA  1 
ATOM   1345 C C   . ASP A 1 174 ? 54.028  -35.223 361.078 1.00 23.19  ? 175  ASP A C   1 
ATOM   1346 O O   . ASP A 1 174 ? 53.182  -35.922 361.646 1.00 22.92  ? 175  ASP A O   1 
ATOM   1347 C CB  . ASP A 1 174 ? 54.543  -32.956 362.007 1.00 18.48  ? 175  ASP A CB  1 
ATOM   1348 C CG  . ASP A 1 174 ? 55.567  -32.033 362.648 1.00 27.26  ? 175  ASP A CG  1 
ATOM   1349 O OD1 . ASP A 1 174 ? 55.699  -30.881 362.185 1.00 30.81  ? 175  ASP A OD1 1 
ATOM   1350 O OD2 . ASP A 1 174 ? 56.238  -32.452 363.611 1.00 26.24  ? 175  ASP A OD2 1 
ATOM   1351 N N   . GLN A 1 175 ? 54.109  -35.142 359.747 1.00 19.85  ? 176  GLN A N   1 
ATOM   1352 C CA  . GLN A 1 175 ? 53.268  -35.983 358.901 1.00 17.57  ? 176  GLN A CA  1 
ATOM   1353 C C   . GLN A 1 175 ? 53.548  -37.458 359.152 1.00 18.60  ? 176  GLN A C   1 
ATOM   1354 O O   . GLN A 1 175 ? 52.622  -38.269 359.268 1.00 22.85  ? 176  GLN A O   1 
ATOM   1355 C CB  . GLN A 1 175 ? 53.492  -35.647 357.426 1.00 21.85  ? 176  GLN A CB  1 
ATOM   1356 C CG  . GLN A 1 175 ? 53.210  -34.211 357.036 1.00 19.74  ? 176  GLN A CG  1 
ATOM   1357 C CD  . GLN A 1 175 ? 53.524  -33.952 355.576 1.00 22.08  ? 176  GLN A CD  1 
ATOM   1358 O OE1 . GLN A 1 175 ? 53.837  -34.878 354.825 1.00 20.36  ? 176  GLN A OE1 1 
ATOM   1359 N NE2 . GLN A 1 175 ? 53.447  -32.692 355.165 1.00 17.47  ? 176  GLN A NE2 1 
ATOM   1360 N N   . ARG A 1 176 ? 54.830  -37.825 359.235 1.00 20.03  ? 177  ARG A N   1 
ATOM   1361 C CA  . ARG A 1 176 ? 55.183  -39.223 359.455 1.00 25.13  ? 177  ARG A CA  1 
ATOM   1362 C C   . ARG A 1 176 ? 54.691  -39.713 360.811 1.00 27.40  ? 177  ARG A C   1 
ATOM   1363 O O   . ARG A 1 176 ? 54.194  -40.839 360.927 1.00 25.00  ? 177  ARG A O   1 
ATOM   1364 C CB  . ARG A 1 176 ? 56.692  -39.415 359.340 1.00 25.73  ? 177  ARG A CB  1 
ATOM   1365 C CG  . ARG A 1 176 ? 57.136  -40.824 359.686 1.00 30.41  ? 177  ARG A CG  1 
ATOM   1366 C CD  . ARG A 1 176 ? 58.631  -40.981 359.553 1.00 33.30  ? 177  ARG A CD  1 
ATOM   1367 N NE  . ARG A 1 176 ? 59.042  -41.067 358.157 1.00 35.89  ? 177  ARG A NE  1 
ATOM   1368 C CZ  . ARG A 1 176 ? 60.285  -40.863 357.736 1.00 35.84  ? 177  ARG A CZ  1 
ATOM   1369 N NH1 . ARG A 1 176 ? 61.240  -40.564 358.607 1.00 31.92  ? 177  ARG A NH1 1 
ATOM   1370 N NH2 . ARG A 1 176 ? 60.574  -40.961 356.445 1.00 29.17  ? 177  ARG A NH2 1 
ATOM   1371 N N   . LEU A 1 177 ? 54.830  -38.886 361.850 1.00 24.22  ? 178  LEU A N   1 
ATOM   1372 C CA  . LEU A 1 177 ? 54.328  -39.272 363.165 1.00 22.94  ? 178  LEU A CA  1 
ATOM   1373 C C   . LEU A 1 177 ? 52.823  -39.499 363.125 1.00 23.94  ? 178  LEU A C   1 
ATOM   1374 O O   . LEU A 1 177 ? 52.315  -40.454 363.725 1.00 28.95  ? 178  LEU A O   1 
ATOM   1375 C CB  . LEU A 1 177 ? 54.690  -38.208 364.202 1.00 21.67  ? 178  LEU A CB  1 
ATOM   1376 C CG  . LEU A 1 177 ? 54.301  -38.496 365.654 1.00 22.44  ? 178  LEU A CG  1 
ATOM   1377 C CD1 . LEU A 1 177 ? 54.817  -39.860 366.094 1.00 22.40  ? 178  LEU A CD1 1 
ATOM   1378 C CD2 . LEU A 1 177 ? 54.823  -37.405 366.575 1.00 21.49  ? 178  LEU A CD2 1 
ATOM   1379 N N   . ALA A 1 178 ? 52.094  -38.637 362.411 1.00 22.18  ? 179  ALA A N   1 
ATOM   1380 C CA  . ALA A 1 178 ? 50.662  -38.849 362.232 1.00 22.26  ? 179  ALA A CA  1 
ATOM   1381 C C   . ALA A 1 178 ? 50.389  -40.168 361.521 1.00 26.00  ? 179  ALA A C   1 
ATOM   1382 O O   . ALA A 1 178 ? 49.457  -40.896 361.883 1.00 25.86  ? 179  ALA A O   1 
ATOM   1383 C CB  . ALA A 1 178 ? 50.050  -37.683 361.456 1.00 18.65  ? 179  ALA A CB  1 
ATOM   1384 N N   . LEU A 1 179 ? 51.198  -40.496 360.510 1.00 25.67  ? 180  LEU A N   1 
ATOM   1385 C CA  . LEU A 1 179 ? 51.034  -41.765 359.809 1.00 25.26  ? 180  LEU A CA  1 
ATOM   1386 C C   . LEU A 1 179 ? 51.323  -42.945 360.728 1.00 31.58  ? 180  LEU A C   1 
ATOM   1387 O O   . LEU A 1 179 ? 50.648  -43.978 360.651 1.00 27.81  ? 180  LEU A O   1 
ATOM   1388 C CB  . LEU A 1 179 ? 51.940  -41.807 358.579 1.00 21.39  ? 180  LEU A CB  1 
ATOM   1389 C CG  . LEU A 1 179 ? 51.548  -40.877 357.433 1.00 24.21  ? 180  LEU A CG  1 
ATOM   1390 C CD1 . LEU A 1 179 ? 52.441  -41.103 356.221 1.00 24.99  ? 180  LEU A CD1 1 
ATOM   1391 C CD2 . LEU A 1 179 ? 50.086  -41.075 357.077 1.00 28.97  ? 180  LEU A CD2 1 
ATOM   1392 N N   . GLN A 1 180 ? 52.329  -42.814 361.597 1.00 29.92  ? 181  GLN A N   1 
ATOM   1393 C CA  . GLN A 1 180 ? 52.578  -43.851 362.592 1.00 30.51  ? 181  GLN A CA  1 
ATOM   1394 C C   . GLN A 1 180 ? 51.415  -43.956 363.569 1.00 28.97  ? 181  GLN A C   1 
ATOM   1395 O O   . GLN A 1 180 ? 51.036  -45.059 363.982 1.00 28.50  ? 181  GLN A O   1 
ATOM   1396 C CB  . GLN A 1 180 ? 53.885  -43.565 363.332 1.00 28.39  ? 181  GLN A CB  1 
ATOM   1397 C CG  . GLN A 1 180 ? 55.127  -43.728 362.470 1.00 36.39  ? 181  GLN A CG  1 
ATOM   1398 C CD  . GLN A 1 180 ? 56.361  -43.094 363.085 1.00 42.17  ? 181  GLN A CD  1 
ATOM   1399 O OE1 . GLN A 1 180 ? 56.266  -42.295 364.016 1.00 50.36  ? 181  GLN A OE1 1 
ATOM   1400 N NE2 . GLN A 1 180 ? 57.529  -43.449 362.562 1.00 42.00  ? 181  GLN A NE2 1 
ATOM   1401 N N   . TRP A 1 181 ? 50.834  -42.813 363.946 1.00 22.49  ? 182  TRP A N   1 
ATOM   1402 C CA  . TRP A 1 181 ? 49.654  -42.818 364.804 1.00 25.80  ? 182  TRP A CA  1 
ATOM   1403 C C   . TRP A 1 181 ? 48.513  -43.597 364.162 1.00 25.48  ? 182  TRP A C   1 
ATOM   1404 O O   . TRP A 1 181 ? 47.812  -44.359 364.839 1.00 23.12  ? 182  TRP A O   1 
ATOM   1405 C CB  . TRP A 1 181 ? 49.226  -41.379 365.097 1.00 24.35  ? 182  TRP A CB  1 
ATOM   1406 C CG  . TRP A 1 181 ? 48.165  -41.248 366.142 1.00 21.44  ? 182  TRP A CG  1 
ATOM   1407 C CD1 . TRP A 1 181 ? 48.351  -40.997 367.469 1.00 25.77  ? 182  TRP A CD1 1 
ATOM   1408 C CD2 . TRP A 1 181 ? 46.748  -41.347 365.947 1.00 20.57  ? 182  TRP A CD2 1 
ATOM   1409 N NE1 . TRP A 1 181 ? 47.140  -40.940 368.116 1.00 24.68  ? 182  TRP A NE1 1 
ATOM   1410 C CE2 . TRP A 1 181 ? 46.140  -41.152 367.204 1.00 24.93  ? 182  TRP A CE2 1 
ATOM   1411 C CE3 . TRP A 1 181 ? 45.935  -41.585 364.835 1.00 18.62  ? 182  TRP A CE3 1 
ATOM   1412 C CZ2 . TRP A 1 181 ? 44.758  -41.186 367.378 1.00 20.14  ? 182  TRP A CZ2 1 
ATOM   1413 C CZ3 . TRP A 1 181 ? 44.563  -41.620 365.010 1.00 22.00  ? 182  TRP A CZ3 1 
ATOM   1414 C CH2 . TRP A 1 181 ? 43.988  -41.422 366.272 1.00 19.29  ? 182  TRP A CH2 1 
ATOM   1415 N N   . VAL A 1 182 ? 48.318  -43.420 362.853 1.00 24.99  ? 183  VAL A N   1 
ATOM   1416 C CA  . VAL A 1 182 ? 47.252  -44.124 362.145 1.00 20.95  ? 183  VAL A CA  1 
ATOM   1417 C C   . VAL A 1 182 ? 47.472  -45.630 362.217 1.00 28.81  ? 183  VAL A C   1 
ATOM   1418 O O   . VAL A 1 182 ? 46.545  -46.399 362.494 1.00 26.65  ? 183  VAL A O   1 
ATOM   1419 C CB  . VAL A 1 182 ? 47.167  -43.634 360.688 1.00 24.43  ? 183  VAL A CB  1 
ATOM   1420 C CG1 . VAL A 1 182 ? 46.258  -44.537 359.866 1.00 24.25  ? 183  VAL A CG1 1 
ATOM   1421 C CG2 . VAL A 1 182 ? 46.685  -42.192 360.641 1.00 21.16  ? 183  VAL A CG2 1 
ATOM   1422 N N   . GLN A 1 183 ? 48.709  -46.072 361.975 1.00 26.85  ? 184  GLN A N   1 
ATOM   1423 C CA  . GLN A 1 183 ? 49.007  -47.500 362.023 1.00 26.71  ? 184  GLN A CA  1 
ATOM   1424 C C   . GLN A 1 183 ? 48.701  -48.087 363.394 1.00 30.83  ? 184  GLN A C   1 
ATOM   1425 O O   . GLN A 1 183 ? 48.177  -49.203 363.499 1.00 32.96  ? 184  GLN A O   1 
ATOM   1426 C CB  . GLN A 1 183 ? 50.470  -47.743 361.654 1.00 25.96  ? 184  GLN A CB  1 
ATOM   1427 C CG  . GLN A 1 183 ? 50.733  -47.719 360.163 1.00 29.93  ? 184  GLN A CG  1 
ATOM   1428 C CD  . GLN A 1 183 ? 50.001  -48.830 359.439 1.00 38.60  ? 184  GLN A CD  1 
ATOM   1429 O OE1 . GLN A 1 183 ? 50.011  -49.982 359.872 1.00 44.20  ? 184  GLN A OE1 1 
ATOM   1430 N NE2 . GLN A 1 183 ? 49.349  -48.486 358.335 1.00 36.56  ? 184  GLN A NE2 1 
ATOM   1431 N N   . GLU A 1 184 ? 49.005  -47.346 364.458 1.00 30.26  ? 185  GLU A N   1 
ATOM   1432 C CA  . GLU A 1 184 ? 48.838  -47.876 365.803 1.00 36.44  ? 185  GLU A CA  1 
ATOM   1433 C C   . GLU A 1 184 ? 47.415  -47.743 366.330 1.00 35.29  ? 185  GLU A C   1 
ATOM   1434 O O   . GLU A 1 184 ? 47.025  -48.521 367.207 1.00 32.79  ? 185  GLU A O   1 
ATOM   1435 C CB  . GLU A 1 184 ? 49.806  -47.178 366.764 1.00 42.53  ? 185  GLU A CB  1 
ATOM   1436 C CG  . GLU A 1 184 ? 51.236  -47.693 366.688 1.00 59.05  ? 185  GLU A CG  1 
ATOM   1437 C CD  . GLU A 1 184 ? 52.227  -46.779 367.384 1.00 72.67  ? 185  GLU A CD  1 
ATOM   1438 O OE1 . GLU A 1 184 ? 53.402  -46.743 366.960 1.00 75.11  ? 185  GLU A OE1 1 
ATOM   1439 O OE2 . GLU A 1 184 ? 51.832  -46.097 368.354 1.00 75.50  ? 185  GLU A OE2 1 
ATOM   1440 N N   . ASN A 1 185 ? 46.624  -46.796 365.816 1.00 30.95  ? 186  ASN A N   1 
ATOM   1441 C CA  . ASN A 1 185 ? 45.373  -46.436 366.470 1.00 28.99  ? 186  ASN A CA  1 
ATOM   1442 C C   . ASN A 1 185 ? 44.130  -46.452 365.590 1.00 29.42  ? 186  ASN A C   1 
ATOM   1443 O O   . ASN A 1 185 ? 43.025  -46.383 366.139 1.00 29.06  ? 186  ASN A O   1 
ATOM   1444 C CB  . ASN A 1 185 ? 45.487  -45.040 367.101 1.00 27.83  ? 186  ASN A CB  1 
ATOM   1445 C CG  . ASN A 1 185 ? 46.541  -44.976 368.184 1.00 26.77  ? 186  ASN A CG  1 
ATOM   1446 O OD1 . ASN A 1 185 ? 46.420  -45.625 369.221 1.00 34.40  ? 186  ASN A OD1 1 
ATOM   1447 N ND2 . ASN A 1 185 ? 47.582  -44.187 367.950 1.00 29.20  ? 186  ASN A ND2 1 
ATOM   1448 N N   . VAL A 1 186 ? 44.254  -46.531 364.263 1.00 30.11  ? 187  VAL A N   1 
ATOM   1449 C CA  . VAL A 1 186 ? 43.067  -46.361 363.431 1.00 27.37  ? 187  VAL A CA  1 
ATOM   1450 C C   . VAL A 1 186 ? 42.103  -47.535 363.565 1.00 32.46  ? 187  VAL A C   1 
ATOM   1451 O O   . VAL A 1 186 ? 40.904  -47.375 363.307 1.00 29.24  ? 187  VAL A O   1 
ATOM   1452 C CB  . VAL A 1 186 ? 43.454  -46.131 361.956 1.00 27.78  ? 187  VAL A CB  1 
ATOM   1453 C CG1 . VAL A 1 186 ? 43.781  -47.446 361.262 1.00 24.91  ? 187  VAL A CG1 1 
ATOM   1454 C CG2 . VAL A 1 186 ? 42.343  -45.389 361.226 1.00 26.04  ? 187  VAL A CG2 1 
ATOM   1455 N N   . ALA A 1 187 ? 42.585  -48.707 363.990 1.00 31.13  ? 188  ALA A N   1 
ATOM   1456 C CA  . ALA A 1 187 ? 41.692  -49.849 364.162 1.00 30.59  ? 188  ALA A CA  1 
ATOM   1457 C C   . ALA A 1 187 ? 40.652  -49.598 365.247 1.00 32.37  ? 188  ALA A C   1 
ATOM   1458 O O   . ALA A 1 187 ? 39.556  -50.167 365.195 1.00 38.41  ? 188  ALA A O   1 
ATOM   1459 C CB  . ALA A 1 187 ? 42.498  -51.110 364.478 1.00 32.41  ? 188  ALA A CB  1 
ATOM   1460 N N   . ALA A 1 188 ? 40.968  -48.753 366.234 1.00 28.37  ? 189  ALA A N   1 
ATOM   1461 C CA  . ALA A 1 188 ? 39.991  -48.433 367.272 1.00 30.13  ? 189  ALA A CA  1 
ATOM   1462 C C   . ALA A 1 188 ? 38.800  -47.664 366.728 1.00 30.03  ? 189  ALA A C   1 
ATOM   1463 O O   . ALA A 1 188 ? 37.737  -47.664 367.358 1.00 33.18  ? 189  ALA A O   1 
ATOM   1464 C CB  . ALA A 1 188 ? 40.632  -47.617 368.389 1.00 24.34  ? 189  ALA A CB  1 
ATOM   1465 N N   . PHE A 1 189 ? 38.959  -46.993 365.594 1.00 28.31  ? 190  PHE A N   1 
ATOM   1466 C CA  . PHE A 1 189 ? 37.867  -46.287 364.945 1.00 32.12  ? 190  PHE A CA  1 
ATOM   1467 C C   . PHE A 1 189 ? 37.200  -47.127 363.868 1.00 33.42  ? 190  PHE A C   1 
ATOM   1468 O O   . PHE A 1 189 ? 36.299  -46.634 363.183 1.00 36.39  ? 190  PHE A O   1 
ATOM   1469 C CB  . PHE A 1 189 ? 38.374  -44.972 364.343 1.00 27.00  ? 190  PHE A CB  1 
ATOM   1470 C CG  . PHE A 1 189 ? 39.026  -44.054 365.343 1.00 28.92  ? 190  PHE A CG  1 
ATOM   1471 C CD1 . PHE A 1 189 ? 40.372  -44.183 365.652 1.00 25.82  ? 190  PHE A CD1 1 
ATOM   1472 C CD2 . PHE A 1 189 ? 38.294  -43.058 365.968 1.00 27.30  ? 190  PHE A CD2 1 
ATOM   1473 C CE1 . PHE A 1 189 ? 40.973  -43.340 366.569 1.00 23.20  ? 190  PHE A CE1 1 
ATOM   1474 C CE2 . PHE A 1 189 ? 38.889  -42.211 366.885 1.00 24.20  ? 190  PHE A CE2 1 
ATOM   1475 C CZ  . PHE A 1 189 ? 40.230  -42.352 367.185 1.00 19.78  ? 190  PHE A CZ  1 
ATOM   1476 N N   . GLY A 1 190 ? 37.616  -48.382 363.709 1.00 28.77  ? 191  GLY A N   1 
ATOM   1477 C CA  . GLY A 1 190 ? 37.115  -49.234 362.654 1.00 30.31  ? 191  GLY A CA  1 
ATOM   1478 C C   . GLY A 1 190 ? 37.922  -49.203 361.376 1.00 30.97  ? 191  GLY A C   1 
ATOM   1479 O O   . GLY A 1 190 ? 37.523  -49.845 360.396 1.00 34.44  ? 191  GLY A O   1 
ATOM   1480 N N   . GLY A 1 191 ? 39.041  -48.481 361.351 1.00 31.75  ? 192  GLY A N   1 
ATOM   1481 C CA  . GLY A 1 191 ? 39.840  -48.399 360.145 1.00 30.69  ? 192  GLY A CA  1 
ATOM   1482 C C   . GLY A 1 191 ? 40.790  -49.573 360.001 1.00 35.21  ? 192  GLY A C   1 
ATOM   1483 O O   . GLY A 1 191 ? 41.207  -50.197 360.976 1.00 35.26  ? 192  GLY A O   1 
ATOM   1484 N N   . ASP A 1 192 ? 41.135  -49.876 358.749 1.00 33.35  ? 193  ASP A N   1 
ATOM   1485 C CA  . ASP A 1 192 ? 42.026  -50.985 358.450 1.00 30.92  ? 193  ASP A CA  1 
ATOM   1486 C C   . ASP A 1 192 ? 43.437  -50.457 358.246 1.00 35.53  ? 193  ASP A C   1 
ATOM   1487 O O   . ASP A 1 192 ? 43.709  -49.836 357.208 1.00 34.20  ? 193  ASP A O   1 
ATOM   1488 C CB  . ASP A 1 192 ? 41.555  -51.736 357.206 1.00 31.56  ? 193  ASP A CB  1 
ATOM   1489 C CG  . ASP A 1 192 ? 42.406  -52.958 356.901 1.00 41.99  ? 193  ASP A CG  1 
ATOM   1490 O OD1 . ASP A 1 192 ? 43.273  -53.311 357.731 1.00 49.48  ? 193  ASP A OD1 1 
ATOM   1491 O OD2 . ASP A 1 192 ? 42.204  -53.572 355.834 1.00 50.21  ? 193  ASP A OD2 1 
ATOM   1492 N N   . PRO A 1 193 ? 44.364  -50.687 359.180 1.00 37.24  ? 194  PRO A N   1 
ATOM   1493 C CA  . PRO A 1 193 ? 45.743  -50.214 358.983 1.00 36.33  ? 194  PRO A CA  1 
ATOM   1494 C C   . PRO A 1 193 ? 46.468  -50.885 357.826 1.00 39.18  ? 194  PRO A C   1 
ATOM   1495 O O   . PRO A 1 193 ? 47.538  -50.401 357.435 1.00 41.51  ? 194  PRO A O   1 
ATOM   1496 C CB  . PRO A 1 193 ? 46.417  -50.538 360.324 1.00 35.38  ? 194  PRO A CB  1 
ATOM   1497 C CG  . PRO A 1 193 ? 45.606  -51.657 360.892 1.00 33.12  ? 194  PRO A CG  1 
ATOM   1498 C CD  . PRO A 1 193 ? 44.193  -51.375 360.471 1.00 40.53  ? 194  PRO A CD  1 
ATOM   1499 N N   . THR A 1 194 ? 45.934  -51.971 357.269 1.00 34.41  ? 195  THR A N   1 
ATOM   1500 C CA  . THR A 1 194 ? 46.529  -52.610 356.103 1.00 38.25  ? 195  THR A CA  1 
ATOM   1501 C C   . THR A 1 194 ? 45.985  -52.061 354.789 1.00 39.34  ? 195  THR A C   1 
ATOM   1502 O O   . THR A 1 194 ? 46.282  -52.620 353.728 1.00 46.72  ? 195  THR A O   1 
ATOM   1503 C CB  . THR A 1 194 ? 46.320  -54.128 356.153 1.00 37.74  ? 195  THR A CB  1 
ATOM   1504 O OG1 . THR A 1 194 ? 44.963  -54.442 355.815 1.00 42.33  ? 195  THR A OG1 1 
ATOM   1505 C CG2 . THR A 1 194 ? 46.636  -54.669 357.541 1.00 37.52  ? 195  THR A CG2 1 
ATOM   1506 N N   . SER A 1 195 ? 45.207  -50.969 354.832 1.00 37.82  ? 196  SER A N   1 
ATOM   1507 C CA  . SER A 1 195 ? 44.657  -50.356 353.619 1.00 39.53  ? 196  SER A CA  1 
ATOM   1508 C C   . SER A 1 195 ? 44.565  -48.844 353.861 1.00 34.48  ? 196  SER A C   1 
ATOM   1509 O O   . SER A 1 195 ? 43.504  -48.288 354.154 1.00 32.38  ? 196  SER A O   1 
ATOM   1510 C CB  . SER A 1 195 ? 43.299  -50.949 353.246 1.00 37.08  ? 196  SER A CB  1 
ATOM   1511 O OG  . SER A 1 195 ? 42.782  -50.345 352.074 1.00 43.43  ? 196  SER A OG  1 
ATOM   1512 N N   . VAL A 1 196 ? 45.706  -48.172 353.725 1.00 29.25  ? 197  VAL A N   1 
ATOM   1513 C CA  . VAL A 1 196 ? 45.824  -46.737 353.962 1.00 25.30  ? 197  VAL A CA  1 
ATOM   1514 C C   . VAL A 1 196 ? 46.235  -46.065 352.661 1.00 26.47  ? 197  VAL A C   1 
ATOM   1515 O O   . VAL A 1 196 ? 47.244  -46.441 352.054 1.00 27.97  ? 197  VAL A O   1 
ATOM   1516 C CB  . VAL A 1 196 ? 46.841  -46.427 355.076 1.00 27.40  ? 197  VAL A CB  1 
ATOM   1517 C CG1 . VAL A 1 196 ? 47.025  -44.924 355.223 1.00 24.63  ? 197  VAL A CG1 1 
ATOM   1518 C CG2 . VAL A 1 196 ? 46.397  -47.051 356.389 1.00 22.60  ? 197  VAL A CG2 1 
ATOM   1519 N N   . THR A 1 197 ? 45.461  -45.066 352.242 1.00 27.80  ? 198  THR A N   1 
ATOM   1520 C CA  . THR A 1 197 ? 45.730  -44.321 351.018 1.00 23.66  ? 198  THR A CA  1 
ATOM   1521 C C   . THR A 1 197 ? 45.968  -42.860 351.364 1.00 24.09  ? 198  THR A C   1 
ATOM   1522 O O   . THR A 1 197 ? 45.064  -42.181 351.865 1.00 28.78  ? 198  THR A O   1 
ATOM   1523 C CB  . THR A 1 197 ? 44.573  -44.450 350.024 1.00 24.51  ? 198  THR A CB  1 
ATOM   1524 O OG1 . THR A 1 197 ? 44.407  -45.824 349.656 1.00 28.46  ? 198  THR A OG1 1 
ATOM   1525 C CG2 . THR A 1 197 ? 44.854  -43.626 348.775 1.00 19.75  ? 198  THR A CG2 1 
ATOM   1526 N N   . LEU A 1 198 ? 47.181  -42.381 351.103 1.00 22.20  ? 199  LEU A N   1 
ATOM   1527 C CA  . LEU A 1 198 ? 47.481  -40.965 351.243 1.00 23.52  ? 199  LEU A CA  1 
ATOM   1528 C C   . LEU A 1 198 ? 46.942  -40.199 350.048 1.00 23.77  ? 199  LEU A C   1 
ATOM   1529 O O   . LEU A 1 198 ? 47.049  -40.652 348.905 1.00 27.56  ? 199  LEU A O   1 
ATOM   1530 C CB  . LEU A 1 198 ? 48.988  -40.728 351.340 1.00 30.95  ? 199  LEU A CB  1 
ATOM   1531 C CG  . LEU A 1 198 ? 49.823  -41.517 352.340 1.00 33.04  ? 199  LEU A CG  1 
ATOM   1532 C CD1 . LEU A 1 198 ? 51.215  -40.909 352.432 1.00 25.98  ? 199  LEU A CD1 1 
ATOM   1533 C CD2 . LEU A 1 198 ? 49.145  -41.523 353.691 1.00 27.93  ? 199  LEU A CD2 1 
ATOM   1534 N N   . PHE A 1 199 ? 46.368  -39.031 350.309 1.00 19.44  ? 200  PHE A N   1 
ATOM   1535 C CA  . PHE A 1 199 ? 46.098  -38.097 349.230 1.00 17.74  ? 200  PHE A CA  1 
ATOM   1536 C C   . PHE A 1 199 ? 46.331  -36.681 349.727 1.00 15.52  ? 200  PHE A C   1 
ATOM   1537 O O   . PHE A 1 199 ? 46.128  -36.369 350.902 1.00 18.29  ? 200  PHE A O   1 
ATOM   1538 C CB  . PHE A 1 199 ? 44.689  -38.290 348.619 1.00 20.62  ? 200  PHE A CB  1 
ATOM   1539 C CG  . PHE A 1 199 ? 43.539  -37.836 349.476 1.00 20.71  ? 200  PHE A CG  1 
ATOM   1540 C CD1 . PHE A 1 199 ? 42.566  -37.008 348.936 1.00 24.70  ? 200  PHE A CD1 1 
ATOM   1541 C CD2 . PHE A 1 199 ? 43.388  -38.276 350.781 1.00 24.09  ? 200  PHE A CD2 1 
ATOM   1542 C CE1 . PHE A 1 199 ? 41.480  -36.600 349.688 1.00 29.25  ? 200  PHE A CE1 1 
ATOM   1543 C CE2 . PHE A 1 199 ? 42.304  -37.866 351.542 1.00 25.91  ? 200  PHE A CE2 1 
ATOM   1544 C CZ  . PHE A 1 199 ? 41.351  -37.025 350.993 1.00 30.02  ? 200  PHE A CZ  1 
ATOM   1545 N N   . GLY A 1 200 ? 46.823  -35.847 348.818 1.00 19.36  ? 201  GLY A N   1 
ATOM   1546 C CA  . GLY A 1 200 ? 47.176  -34.477 349.131 1.00 17.95  ? 201  GLY A CA  1 
ATOM   1547 C C   . GLY A 1 200 ? 47.172  -33.664 347.860 1.00 21.34  ? 201  GLY A C   1 
ATOM   1548 O O   . GLY A 1 200 ? 47.114  -34.198 346.750 1.00 19.23  ? 201  GLY A O   1 
ATOM   1549 N N   . GLU A 1 201 ? 47.238  -32.352 348.038 1.00 16.06  ? 202  GLU A N   1 
ATOM   1550 C CA  . GLU A 1 201 ? 47.132  -31.421 346.930 1.00 16.85  ? 202  GLU A CA  1 
ATOM   1551 C C   . GLU A 1 201 ? 48.243  -30.386 347.032 1.00 18.83  ? 202  GLU A C   1 
ATOM   1552 O O   . GLU A 1 201 ? 48.564  -29.918 348.127 1.00 18.42  ? 202  GLU A O   1 
ATOM   1553 C CB  . GLU A 1 201 ? 45.755  -30.756 346.925 1.00 19.24  ? 202  GLU A CB  1 
ATOM   1554 C CG  . GLU A 1 201 ? 45.436  -29.969 345.677 1.00 18.05  ? 202  GLU A CG  1 
ATOM   1555 C CD  . GLU A 1 201 ? 45.942  -28.548 345.757 1.00 29.97  ? 202  GLU A CD  1 
ATOM   1556 O OE1 . GLU A 1 201 ? 46.074  -27.903 344.697 1.00 28.40  ? 202  GLU A OE1 1 
ATOM   1557 O OE2 . GLU A 1 201 ? 46.217  -28.084 346.885 1.00 25.27  ? 202  GLU A OE2 1 
ATOM   1558 N N   . SER A 1 202 ? 48.830  -30.046 345.883 1.00 20.07  ? 203  SER A N   1 
ATOM   1559 C CA  . SER A 1 202 ? 49.907  -29.055 345.780 1.00 20.88  ? 203  SER A CA  1 
ATOM   1560 C C   . SER A 1 202 ? 51.052  -29.503 346.680 1.00 23.52  ? 203  SER A C   1 
ATOM   1561 O O   . SER A 1 202 ? 51.591  -30.602 346.459 1.00 16.88  ? 203  SER A O   1 
ATOM   1562 C CB  . SER A 1 202 ? 49.336  -27.669 346.078 1.00 23.37  ? 203  SER A CB  1 
ATOM   1563 O OG  . SER A 1 202 ? 50.207  -26.646 345.625 1.00 30.46  ? 203  SER A OG  1 
ATOM   1564 N N   . ALA A 1 203 ? 51.457  -28.716 347.681 1.00 14.05  ? 204  ALA A N   1 
ATOM   1565 C CA  . ALA A 1 203 ? 52.512  -29.152 348.589 1.00 19.23  ? 204  ALA A CA  1 
ATOM   1566 C C   . ALA A 1 203 ? 52.113  -30.411 349.347 1.00 19.01  ? 204  ALA A C   1 
ATOM   1567 O O   . ALA A 1 203 ? 52.981  -31.183 349.771 1.00 19.53  ? 204  ALA A O   1 
ATOM   1568 C CB  . ALA A 1 203 ? 52.862  -28.030 349.567 1.00 16.39  ? 204  ALA A CB  1 
ATOM   1569 N N   . GLY A 1 204 ? 50.811  -30.633 349.533 1.00 22.95  ? 205  GLY A N   1 
ATOM   1570 C CA  . GLY A 1 204 ? 50.364  -31.893 350.101 1.00 15.60  ? 205  GLY A CA  1 
ATOM   1571 C C   . GLY A 1 204 ? 50.653  -33.066 349.185 1.00 20.90  ? 205  GLY A C   1 
ATOM   1572 O O   . GLY A 1 204 ? 51.005  -34.155 349.648 1.00 19.45  ? 205  GLY A O   1 
ATOM   1573 N N   . ALA A 1 205 ? 50.512  -32.861 347.873 1.00 14.20  ? 206  ALA A N   1 
ATOM   1574 C CA  . ALA A 1 205 ? 50.863  -33.909 346.921 1.00 21.91  ? 206  ALA A CA  1 
ATOM   1575 C C   . ALA A 1 205 ? 52.370  -34.121 346.871 1.00 23.82  ? 206  ALA A C   1 
ATOM   1576 O O   . ALA A 1 205 ? 52.840  -35.262 346.785 1.00 23.56  ? 206  ALA A O   1 
ATOM   1577 C CB  . ALA A 1 205 ? 50.320  -33.564 345.535 1.00 15.35  ? 206  ALA A CB  1 
ATOM   1578 N N   . ALA A 1 206 ? 53.144  -33.032 346.918 1.00 18.63  ? 207  ALA A N   1 
ATOM   1579 C CA  . ALA A 1 206 ? 54.593  -33.162 347.016 1.00 19.81  ? 207  ALA A CA  1 
ATOM   1580 C C   . ALA A 1 206 ? 54.989  -33.912 348.280 1.00 25.00  ? 207  ALA A C   1 
ATOM   1581 O O   . ALA A 1 206 ? 55.917  -34.730 348.262 1.00 22.85  ? 207  ALA A O   1 
ATOM   1582 C CB  . ALA A 1 206 ? 55.248  -31.781 346.982 1.00 15.26  ? 207  ALA A CB  1 
ATOM   1583 N N   . SER A 1 207 ? 54.290  -33.651 349.388 1.00 19.69  ? 208  SER A N   1 
ATOM   1584 C CA  . SER A 1 207 ? 54.546  -34.385 350.623 1.00 20.00  ? 208  SER A CA  1 
ATOM   1585 C C   . SER A 1 207 ? 54.272  -35.872 350.440 1.00 24.10  ? 208  SER A C   1 
ATOM   1586 O O   . SER A 1 207 ? 55.084  -36.718 350.834 1.00 17.20  ? 208  SER A O   1 
ATOM   1587 C CB  . SER A 1 207 ? 53.692  -33.818 351.758 1.00 16.58  ? 208  SER A CB  1 
ATOM   1588 O OG  . SER A 1 207 ? 54.061  -32.485 352.061 1.00 20.81  ? 208  SER A OG  1 
ATOM   1589 N N   . VAL A 1 208 ? 53.123  -36.209 349.843 1.00 18.36  ? 209  VAL A N   1 
ATOM   1590 C CA  . VAL A 1 208 ? 52.784  -37.608 349.591 1.00 25.15  ? 209  VAL A CA  1 
ATOM   1591 C C   . VAL A 1 208 ? 53.886  -38.288 348.791 1.00 26.50  ? 209  VAL A C   1 
ATOM   1592 O O   . VAL A 1 208 ? 54.301  -39.412 349.102 1.00 27.62  ? 209  VAL A O   1 
ATOM   1593 C CB  . VAL A 1 208 ? 51.425  -37.709 348.873 1.00 23.60  ? 209  VAL A CB  1 
ATOM   1594 C CG1 . VAL A 1 208 ? 51.211  -39.115 348.335 1.00 16.53  ? 209  VAL A CG1 1 
ATOM   1595 C CG2 . VAL A 1 208 ? 50.294  -37.318 349.811 1.00 21.48  ? 209  VAL A CG2 1 
ATOM   1596 N N   . GLY A 1 209 ? 54.385  -37.611 347.754 1.00 24.90  ? 210  GLY A N   1 
ATOM   1597 C CA  . GLY A 1 209 ? 55.448  -38.190 346.950 1.00 22.61  ? 210  GLY A CA  1 
ATOM   1598 C C   . GLY A 1 209 ? 56.720  -38.426 347.741 1.00 19.73  ? 210  GLY A C   1 
ATOM   1599 O O   . GLY A 1 209 ? 57.414  -39.423 347.535 1.00 26.65  ? 210  GLY A O   1 
ATOM   1600 N N   . MET A 1 210 ? 57.039  -37.517 348.664 1.00 20.75  ? 211  MET A N   1 
ATOM   1601 C CA  . MET A 1 210 ? 58.245  -37.686 349.467 1.00 27.14  ? 211  MET A CA  1 
ATOM   1602 C C   . MET A 1 210 ? 58.113  -38.849 350.441 1.00 26.84  ? 211  MET A C   1 
ATOM   1603 O O   . MET A 1 210 ? 59.111  -39.509 350.751 1.00 26.90  ? 211  MET A O   1 
ATOM   1604 C CB  . MET A 1 210 ? 58.568  -36.388 350.205 1.00 22.98  ? 211  MET A CB  1 
ATOM   1605 C CG  . MET A 1 210 ? 59.005  -35.275 349.269 1.00 31.68  ? 211  MET A CG  1 
ATOM   1606 S SD  . MET A 1 210 ? 59.210  -33.678 350.069 1.00 38.03  ? 211  MET A SD  1 
ATOM   1607 C CE  . MET A 1 210 ? 59.112  -32.589 348.652 1.00 28.66  ? 211  MET A CE  1 
ATOM   1608 N N   . HIS A 1 211 ? 56.900  -39.123 350.926 1.00 21.74  ? 212  HIS A N   1 
ATOM   1609 C CA  . HIS A 1 211 ? 56.695  -40.318 351.736 1.00 22.00  ? 212  HIS A CA  1 
ATOM   1610 C C   . HIS A 1 211 ? 56.873  -41.584 350.908 1.00 26.59  ? 212  HIS A C   1 
ATOM   1611 O O   . HIS A 1 211 ? 57.363  -42.595 351.423 1.00 27.91  ? 212  HIS A O   1 
ATOM   1612 C CB  . HIS A 1 211 ? 55.313  -40.284 352.387 1.00 23.11  ? 212  HIS A CB  1 
ATOM   1613 C CG  . HIS A 1 211 ? 55.173  -39.234 353.444 1.00 25.72  ? 212  HIS A CG  1 
ATOM   1614 N ND1 . HIS A 1 211 ? 55.882  -39.270 354.625 1.00 26.48  ? 212  HIS A ND1 1 
ATOM   1615 C CD2 . HIS A 1 211 ? 54.411  -38.116 353.496 1.00 22.71  ? 212  HIS A CD2 1 
ATOM   1616 C CE1 . HIS A 1 211 ? 55.562  -38.220 355.361 1.00 25.77  ? 212  HIS A CE1 1 
ATOM   1617 N NE2 . HIS A 1 211 ? 54.671  -37.504 354.699 1.00 26.82  ? 212  HIS A NE2 1 
ATOM   1618 N N   . LEU A 1 212 ? 56.492  -41.544 349.628 1.00 28.65  ? 213  LEU A N   1 
ATOM   1619 C CA  . LEU A 1 212 ? 56.757  -42.671 348.740 1.00 27.21  ? 213  LEU A CA  1 
ATOM   1620 C C   . LEU A 1 212 ? 58.253  -42.921 348.600 1.00 30.11  ? 213  LEU A C   1 
ATOM   1621 O O   . LEU A 1 212 ? 58.696  -44.073 348.534 1.00 34.89  ? 213  LEU A O   1 
ATOM   1622 C CB  . LEU A 1 212 ? 56.137  -42.417 347.365 1.00 28.50  ? 213  LEU A CB  1 
ATOM   1623 C CG  . LEU A 1 212 ? 54.644  -42.686 347.187 1.00 39.09  ? 213  LEU A CG  1 
ATOM   1624 C CD1 . LEU A 1 212 ? 54.167  -42.157 345.844 1.00 35.41  ? 213  LEU A CD1 1 
ATOM   1625 C CD2 . LEU A 1 212 ? 54.359  -44.172 347.314 1.00 43.27  ? 213  LEU A CD2 1 
ATOM   1626 N N   . LEU A 1 213 ? 59.045  -41.853 348.558 1.00 27.93  ? 214  LEU A N   1 
ATOM   1627 C CA  . LEU A 1 213 ? 60.472  -41.940 348.288 1.00 28.91  ? 214  LEU A CA  1 
ATOM   1628 C C   . LEU A 1 213 ? 61.317  -42.044 349.552 1.00 30.02  ? 214  LEU A C   1 
ATOM   1629 O O   . LEU A 1 213 ? 62.548  -42.081 349.453 1.00 36.28  ? 214  LEU A O   1 
ATOM   1630 C CB  . LEU A 1 213 ? 60.916  -40.725 347.466 1.00 25.94  ? 214  LEU A CB  1 
ATOM   1631 C CG  . LEU A 1 213 ? 60.174  -40.514 346.143 1.00 25.01  ? 214  LEU A CG  1 
ATOM   1632 C CD1 . LEU A 1 213 ? 60.542  -39.176 345.521 1.00 22.86  ? 214  LEU A CD1 1 
ATOM   1633 C CD2 . LEU A 1 213 ? 60.458  -41.654 345.175 1.00 26.24  ? 214  LEU A CD2 1 
ATOM   1634 N N   . SER A 1 214 ? 60.696  -42.090 350.724 1.00 26.39  ? 215  SER A N   1 
ATOM   1635 C CA  . SER A 1 214 ? 61.416  -42.207 351.992 1.00 27.73  ? 215  SER A CA  1 
ATOM   1636 C C   . SER A 1 214 ? 61.069  -43.537 352.644 1.00 29.45  ? 215  SER A C   1 
ATOM   1637 O O   . SER A 1 214 ? 59.920  -43.720 353.090 1.00 31.74  ? 215  SER A O   1 
ATOM   1638 C CB  . SER A 1 214 ? 61.068  -41.044 352.921 1.00 30.21  ? 215  SER A CB  1 
ATOM   1639 O OG  . SER A 1 214 ? 61.830  -41.095 354.114 1.00 34.28  ? 215  SER A OG  1 
ATOM   1640 N N   . PRO A 1 215 ? 62.009  -44.476 352.730 1.00 32.60  ? 216  PRO A N   1 
ATOM   1641 C CA  . PRO A 1 215 ? 61.685  -45.846 353.180 1.00 33.86  ? 216  PRO A CA  1 
ATOM   1642 C C   . PRO A 1 215 ? 60.987  -45.887 354.532 1.00 37.12  ? 216  PRO A C   1 
ATOM   1643 O O   . PRO A 1 215 ? 60.048  -46.680 354.701 1.00 37.91  ? 216  PRO A O   1 
ATOM   1644 C CB  . PRO A 1 215 ? 63.058  -46.535 353.230 1.00 38.69  ? 216  PRO A CB  1 
ATOM   1645 C CG  . PRO A 1 215 ? 63.878  -45.794 352.227 1.00 38.74  ? 216  PRO A CG  1 
ATOM   1646 C CD  . PRO A 1 215 ? 63.400  -44.363 352.252 1.00 39.25  ? 216  PRO A CD  1 
ATOM   1647 N N   . PRO A 1 216 ? 61.398  -45.085 355.529 1.00 36.04  ? 217  PRO A N   1 
ATOM   1648 C CA  . PRO A 1 216 ? 60.677  -45.144 356.815 1.00 35.32  ? 217  PRO A CA  1 
ATOM   1649 C C   . PRO A 1 216 ? 59.206  -44.774 356.717 1.00 36.36  ? 217  PRO A C   1 
ATOM   1650 O O   . PRO A 1 216 ? 58.406  -45.244 357.536 1.00 40.05  ? 217  PRO A O   1 
ATOM   1651 C CB  . PRO A 1 216 ? 61.449  -44.156 357.700 1.00 33.44  ? 217  PRO A CB  1 
ATOM   1652 C CG  . PRO A 1 216 ? 62.801  -44.118 357.122 1.00 34.55  ? 217  PRO A CG  1 
ATOM   1653 C CD  . PRO A 1 216 ? 62.601  -44.236 355.646 1.00 33.10  ? 217  PRO A CD  1 
ATOM   1654 N N   . SER A 1 217 ? 58.819  -43.947 355.746 1.00 30.10  ? 218  SER A N   1 
ATOM   1655 C CA  . SER A 1 217 ? 57.413  -43.609 355.563 1.00 33.07  ? 218  SER A CA  1 
ATOM   1656 C C   . SER A 1 217 ? 56.673  -44.621 354.700 1.00 36.42  ? 218  SER A C   1 
ATOM   1657 O O   . SER A 1 217 ? 55.467  -44.818 354.886 1.00 33.20  ? 218  SER A O   1 
ATOM   1658 C CB  . SER A 1 217 ? 57.277  -42.221 354.930 1.00 30.82  ? 218  SER A CB  1 
ATOM   1659 O OG  . SER A 1 217 ? 57.873  -41.222 355.739 1.00 34.74  ? 218  SER A OG  1 
ATOM   1660 N N   . ARG A 1 218 ? 57.380  -45.275 353.773 1.00 43.23  ? 219  ARG A N   1 
ATOM   1661 C CA  . ARG A 1 218 ? 56.727  -46.101 352.762 1.00 47.18  ? 219  ARG A CA  1 
ATOM   1662 C C   . ARG A 1 218 ? 55.985  -47.285 353.373 1.00 41.30  ? 219  ARG A C   1 
ATOM   1663 O O   . ARG A 1 218 ? 54.973  -47.732 352.821 1.00 39.22  ? 219  ARG A O   1 
ATOM   1664 C CB  . ARG A 1 218 ? 57.768  -46.578 351.746 1.00 47.38  ? 219  ARG A CB  1 
ATOM   1665 C CG  . ARG A 1 218 ? 57.232  -47.476 350.645 1.00 51.05  ? 219  ARG A CG  1 
ATOM   1666 C CD  . ARG A 1 218 ? 56.235  -46.759 349.750 1.00 52.39  ? 219  ARG A CD  1 
ATOM   1667 N NE  . ARG A 1 218 ? 55.699  -47.661 348.736 1.00 56.57  ? 219  ARG A NE  1 
ATOM   1668 C CZ  . ARG A 1 218 ? 54.559  -48.334 348.861 1.00 55.34  ? 219  ARG A CZ  1 
ATOM   1669 N NH1 . ARG A 1 218 ? 53.827  -48.203 349.959 1.00 49.77  ? 219  ARG A NH1 1 
ATOM   1670 N NH2 . ARG A 1 218 ? 54.150  -49.137 347.888 1.00 56.53  ? 219  ARG A NH2 1 
ATOM   1671 N N   . GLY A 1 219 ? 56.457  -47.800 354.503 1.00 36.60  ? 220  GLY A N   1 
ATOM   1672 C CA  . GLY A 1 219 ? 55.759  -48.895 355.143 1.00 31.45  ? 220  GLY A CA  1 
ATOM   1673 C C   . GLY A 1 219 ? 54.501  -48.522 355.893 1.00 37.71  ? 220  GLY A C   1 
ATOM   1674 O O   . GLY A 1 219 ? 53.849  -49.402 356.461 1.00 42.07  ? 220  GLY A O   1 
ATOM   1675 N N   . LEU A 1 220 ? 54.130  -47.243 355.907 1.00 27.54  ? 221  LEU A N   1 
ATOM   1676 C CA  . LEU A 1 220 ? 52.984  -46.769 356.672 1.00 28.50  ? 221  LEU A CA  1 
ATOM   1677 C C   . LEU A 1 220 ? 51.731  -46.583 355.827 1.00 34.70  ? 221  LEU A C   1 
ATOM   1678 O O   . LEU A 1 220 ? 50.694  -46.183 356.363 1.00 31.91  ? 221  LEU A O   1 
ATOM   1679 C CB  . LEU A 1 220 ? 53.332  -45.451 357.372 1.00 25.51  ? 221  LEU A CB  1 
ATOM   1680 C CG  . LEU A 1 220 ? 54.607  -45.476 358.217 1.00 29.94  ? 221  LEU A CG  1 
ATOM   1681 C CD1 . LEU A 1 220 ? 54.914  -44.096 358.777 1.00 27.61  ? 221  LEU A CD1 1 
ATOM   1682 C CD2 . LEU A 1 220 ? 54.486  -46.502 359.334 1.00 26.40  ? 221  LEU A CD2 1 
ATOM   1683 N N   . PHE A 1 221 ? 51.799  -46.859 354.528 1.00 30.03  ? 222  PHE A N   1 
ATOM   1684 C CA  . PHE A 1 221 ? 50.642  -46.716 353.655 1.00 28.07  ? 222  PHE A CA  1 
ATOM   1685 C C   . PHE A 1 221 ? 50.848  -47.611 352.443 1.00 29.76  ? 222  PHE A C   1 
ATOM   1686 O O   . PHE A 1 221 ? 51.913  -48.205 352.259 1.00 33.04  ? 222  PHE A O   1 
ATOM   1687 C CB  . PHE A 1 221 ? 50.421  -45.254 353.248 1.00 27.86  ? 222  PHE A CB  1 
ATOM   1688 C CG  . PHE A 1 221 ? 51.535  -44.674 352.423 1.00 25.09  ? 222  PHE A CG  1 
ATOM   1689 C CD1 . PHE A 1 221 ? 52.733  -44.304 353.012 1.00 24.40  ? 222  PHE A CD1 1 
ATOM   1690 C CD2 . PHE A 1 221 ? 51.380  -44.489 351.060 1.00 27.19  ? 222  PHE A CD2 1 
ATOM   1691 C CE1 . PHE A 1 221 ? 53.758  -43.768 352.256 1.00 21.60  ? 222  PHE A CE1 1 
ATOM   1692 C CE2 . PHE A 1 221 ? 52.400  -43.951 350.299 1.00 29.80  ? 222  PHE A CE2 1 
ATOM   1693 C CZ  . PHE A 1 221 ? 53.591  -43.590 350.898 1.00 26.93  ? 222  PHE A CZ  1 
ATOM   1694 N N   . HIS A 1 222 ? 49.812  -47.700 351.611 1.00 26.96  ? 223  HIS A N   1 
ATOM   1695 C CA  . HIS A 1 222 ? 49.805  -48.658 350.513 1.00 28.27  ? 223  HIS A CA  1 
ATOM   1696 C C   . HIS A 1 222 ? 49.472  -48.064 349.155 1.00 28.29  ? 223  HIS A C   1 
ATOM   1697 O O   . HIS A 1 222 ? 49.865  -48.655 348.141 1.00 36.05  ? 223  HIS A O   1 
ATOM   1698 C CB  . HIS A 1 222 ? 48.824  -49.796 350.822 1.00 35.05  ? 223  HIS A CB  1 
ATOM   1699 C CG  . HIS A 1 222 ? 48.897  -50.266 352.240 1.00 41.53  ? 223  HIS A CG  1 
ATOM   1700 N ND1 . HIS A 1 222 ? 48.222  -49.640 353.265 1.00 35.70  ? 223  HIS A ND1 1 
ATOM   1701 C CD2 . HIS A 1 222 ? 49.596  -51.276 352.810 1.00 39.60  ? 223  HIS A CD2 1 
ATOM   1702 C CE1 . HIS A 1 222 ? 48.492  -50.252 354.404 1.00 38.23  ? 223  HIS A CE1 1 
ATOM   1703 N NE2 . HIS A 1 222 ? 49.319  -51.251 354.155 1.00 42.72  ? 223  HIS A NE2 1 
ATOM   1704 N N   . ARG A 1 223 ? 48.773  -46.933 349.089 1.00 31.48  ? 224  ARG A N   1 
ATOM   1705 C CA  . ARG A 1 223 ? 48.470  -46.272 347.828 1.00 31.19  ? 224  ARG A CA  1 
ATOM   1706 C C   . ARG A 1 223 ? 48.538  -44.768 348.018 1.00 25.13  ? 224  ARG A C   1 
ATOM   1707 O O   . ARG A 1 223 ? 48.474  -44.257 349.139 1.00 24.17  ? 224  ARG A O   1 
ATOM   1708 C CB  . ARG A 1 223 ? 47.097  -46.679 347.289 1.00 33.00  ? 224  ARG A CB  1 
ATOM   1709 C CG  . ARG A 1 223 ? 47.049  -48.118 346.857 1.00 41.84  ? 224  ARG A CG  1 
ATOM   1710 C CD  . ARG A 1 223 ? 45.681  -48.509 346.381 1.00 44.27  ? 224  ARG A CD  1 
ATOM   1711 N NE  . ARG A 1 223 ? 44.792  -48.960 347.454 1.00 46.69  ? 224  ARG A NE  1 
ATOM   1712 C CZ  . ARG A 1 223 ? 45.065  -49.884 348.377 1.00 58.64  ? 224  ARG A CZ  1 
ATOM   1713 N NH1 . ARG A 1 223 ? 46.228  -50.529 348.411 1.00 63.90  ? 224  ARG A NH1 1 
ATOM   1714 N NH2 . ARG A 1 223 ? 44.142  -50.175 349.282 1.00 58.15  ? 224  ARG A NH2 1 
ATOM   1715 N N   . ALA A 1 224 ? 48.658  -44.058 346.901 1.00 23.79  ? 225  ALA A N   1 
ATOM   1716 C CA  . ALA A 1 224 ? 48.910  -42.629 346.938 1.00 25.05  ? 225  ALA A CA  1 
ATOM   1717 C C   . ALA A 1 224 ? 48.092  -41.923 345.869 1.00 28.19  ? 225  ALA A C   1 
ATOM   1718 O O   . ALA A 1 224 ? 47.864  -42.455 344.779 1.00 25.76  ? 225  ALA A O   1 
ATOM   1719 C CB  . ALA A 1 224 ? 50.400  -42.321 346.743 1.00 24.92  ? 225  ALA A CB  1 
ATOM   1720 N N   . VAL A 1 225 ? 47.647  -40.716 346.206 1.00 20.43  ? 226  VAL A N   1 
ATOM   1721 C CA  . VAL A 1 225 ? 46.973  -39.817 345.280 1.00 19.11  ? 226  VAL A CA  1 
ATOM   1722 C C   . VAL A 1 225 ? 47.690  -38.476 345.335 1.00 23.96  ? 226  VAL A C   1 
ATOM   1723 O O   . VAL A 1 225 ? 47.855  -37.902 346.417 1.00 21.77  ? 226  VAL A O   1 
ATOM   1724 C CB  . VAL A 1 225 ? 45.480  -39.647 345.621 1.00 24.87  ? 226  VAL A CB  1 
ATOM   1725 C CG1 . VAL A 1 225 ? 44.764  -38.857 344.533 1.00 20.23  ? 226  VAL A CG1 1 
ATOM   1726 C CG2 . VAL A 1 225 ? 44.817  -41.000 345.852 1.00 19.65  ? 226  VAL A CG2 1 
ATOM   1727 N N   . LEU A 1 226 ? 48.125  -37.985 344.178 1.00 21.43  ? 227  LEU A N   1 
ATOM   1728 C CA  . LEU A 1 226 ? 48.857  -36.726 344.078 1.00 23.71  ? 227  LEU A CA  1 
ATOM   1729 C C   . LEU A 1 226 ? 48.075  -35.788 343.169 1.00 24.33  ? 227  LEU A C   1 
ATOM   1730 O O   . LEU A 1 226 ? 47.997  -36.013 341.956 1.00 24.96  ? 227  LEU A O   1 
ATOM   1731 C CB  . LEU A 1 226 ? 50.275  -36.949 343.550 1.00 22.30  ? 227  LEU A CB  1 
ATOM   1732 C CG  . LEU A 1 226 ? 51.256  -37.680 344.471 1.00 26.18  ? 227  LEU A CG  1 
ATOM   1733 C CD1 . LEU A 1 226 ? 51.094  -39.188 344.365 1.00 29.03  ? 227  LEU A CD1 1 
ATOM   1734 C CD2 . LEU A 1 226 ? 52.687  -37.272 344.160 1.00 27.59  ? 227  LEU A CD2 1 
ATOM   1735 N N   . GLN A 1 227 ? 47.502  -34.740 343.752 1.00 26.33  ? 228  GLN A N   1 
ATOM   1736 C CA  . GLN A 1 227 ? 46.675  -33.784 343.028 1.00 24.61  ? 228  GLN A CA  1 
ATOM   1737 C C   . GLN A 1 227 ? 47.452  -32.486 342.848 1.00 21.61  ? 228  GLN A C   1 
ATOM   1738 O O   . GLN A 1 227 ? 47.785  -31.819 343.833 1.00 27.42  ? 228  GLN A O   1 
ATOM   1739 C CB  . GLN A 1 227 ? 45.363  -33.529 343.772 1.00 20.80  ? 228  GLN A CB  1 
ATOM   1740 C CG  . GLN A 1 227 ? 44.578  -34.795 344.092 1.00 29.58  ? 228  GLN A CG  1 
ATOM   1741 C CD  . GLN A 1 227 ? 43.413  -34.548 345.036 1.00 37.10  ? 228  GLN A CD  1 
ATOM   1742 O OE1 . GLN A 1 227 ? 42.928  -35.468 345.694 1.00 34.63  ? 228  GLN A OE1 1 
ATOM   1743 N NE2 . GLN A 1 227 ? 42.957  -33.301 345.103 1.00 28.23  ? 228  GLN A NE2 1 
ATOM   1744 N N   . SER A 1 228 ? 47.745  -32.141 341.592 1.00 21.81  ? 229  SER A N   1 
ATOM   1745 C CA  . SER A 1 228 ? 48.363  -30.859 341.243 1.00 20.58  ? 229  SER A CA  1 
ATOM   1746 C C   . SER A 1 228 ? 49.665  -30.627 342.006 1.00 23.05  ? 229  SER A C   1 
ATOM   1747 O O   . SER A 1 228 ? 49.922  -29.531 342.509 1.00 20.90  ? 229  SER A O   1 
ATOM   1748 C CB  . SER A 1 228 ? 47.392  -29.701 341.477 1.00 22.95  ? 229  SER A CB  1 
ATOM   1749 O OG  . SER A 1 228 ? 46.227  -29.842 340.685 1.00 25.14  ? 229  SER A OG  1 
ATOM   1750 N N   . GLY A 1 229 ? 50.495  -31.661 342.093 1.00 21.24  ? 230  GLY A N   1 
ATOM   1751 C CA  . GLY A 1 229 ? 51.748  -31.547 342.811 1.00 21.57  ? 230  GLY A CA  1 
ATOM   1752 C C   . GLY A 1 229 ? 52.593  -32.799 342.728 1.00 24.65  ? 230  GLY A C   1 
ATOM   1753 O O   . GLY A 1 229 ? 52.070  -33.900 342.534 1.00 25.42  ? 230  GLY A O   1 
ATOM   1754 N N   . ALA A 1 230 ? 53.905  -32.642 342.876 1.00 18.30  ? 231  ALA A N   1 
ATOM   1755 C CA  . ALA A 1 230 ? 54.842  -33.750 342.775 1.00 20.86  ? 231  ALA A CA  1 
ATOM   1756 C C   . ALA A 1 230 ? 56.083  -33.405 343.578 1.00 21.91  ? 231  ALA A C   1 
ATOM   1757 O O   . ALA A 1 230 ? 56.435  -32.225 343.692 1.00 25.88  ? 231  ALA A O   1 
ATOM   1758 C CB  . ALA A 1 230 ? 55.217  -34.040 341.314 1.00 18.71  ? 231  ALA A CB  1 
ATOM   1759 N N   . PRO A 1 231 ? 56.765  -34.402 344.148 1.00 28.63  ? 232  PRO A N   1 
ATOM   1760 C CA  . PRO A 1 231 ? 57.980  -34.105 344.922 1.00 25.04  ? 232  PRO A CA  1 
ATOM   1761 C C   . PRO A 1 231 ? 59.122  -33.562 344.082 1.00 28.54  ? 232  PRO A C   1 
ATOM   1762 O O   . PRO A 1 231 ? 60.029  -32.933 344.640 1.00 27.83  ? 232  PRO A O   1 
ATOM   1763 C CB  . PRO A 1 231 ? 58.339  -35.461 345.543 1.00 23.94  ? 232  PRO A CB  1 
ATOM   1764 C CG  . PRO A 1 231 ? 57.743  -36.462 344.605 1.00 29.79  ? 232  PRO A CG  1 
ATOM   1765 C CD  . PRO A 1 231 ? 56.452  -35.841 344.149 1.00 30.37  ? 232  PRO A CD  1 
ATOM   1766 N N   . ASN A 1 232 ? 59.108  -33.774 342.767 1.00 26.34  ? 233  ASN A N   1 
ATOM   1767 C CA  . ASN A 1 232 ? 60.179  -33.315 341.894 1.00 27.42  ? 233  ASN A CA  1 
ATOM   1768 C C   . ASN A 1 232 ? 59.936  -31.918 341.334 1.00 27.42  ? 233  ASN A C   1 
ATOM   1769 O O   . ASN A 1 232 ? 60.687  -31.477 340.458 1.00 27.23  ? 233  ASN A O   1 
ATOM   1770 C CB  . ASN A 1 232 ? 60.389  -34.306 340.745 1.00 21.30  ? 233  ASN A CB  1 
ATOM   1771 C CG  . ASN A 1 232 ? 59.085  -34.850 340.197 1.00 28.69  ? 233  ASN A CG  1 
ATOM   1772 O OD1 . ASN A 1 232 ? 58.221  -35.297 340.951 1.00 26.26  ? 233  ASN A OD1 1 
ATOM   1773 N ND2 . ASN A 1 232 ? 58.938  -34.822 338.877 1.00 22.04  ? 233  ASN A ND2 1 
ATOM   1774 N N   . GLY A 1 233 ? 58.911  -31.217 341.813 1.00 31.32  ? 234  GLY A N   1 
ATOM   1775 C CA  . GLY A 1 233 ? 58.678  -29.850 341.414 1.00 41.26  ? 234  GLY A CA  1 
ATOM   1776 C C   . GLY A 1 233 ? 59.863  -28.965 341.745 1.00 44.31  ? 234  GLY A C   1 
ATOM   1777 O O   . GLY A 1 233 ? 60.582  -29.191 342.723 1.00 44.61  ? 234  GLY A O   1 
ATOM   1778 N N   . PRO A 1 234 ? 60.098  -27.938 340.922 1.00 30.94  ? 235  PRO A N   1 
ATOM   1779 C CA  . PRO A 1 234 ? 61.230  -27.031 341.176 1.00 22.41  ? 235  PRO A CA  1 
ATOM   1780 C C   . PRO A 1 234 ? 61.067  -26.186 342.429 1.00 23.36  ? 235  PRO A C   1 
ATOM   1781 O O   . PRO A 1 234 ? 62.036  -25.545 342.855 1.00 26.37  ? 235  PRO A O   1 
ATOM   1782 C CB  . PRO A 1 234 ? 61.263  -26.153 339.919 1.00 23.28  ? 235  PRO A CB  1 
ATOM   1783 C CG  . PRO A 1 234 ? 59.856  -26.178 339.413 1.00 28.37  ? 235  PRO A CG  1 
ATOM   1784 C CD  . PRO A 1 234 ? 59.313  -27.539 339.741 1.00 22.87  ? 235  PRO A CD  1 
ATOM   1785 N N   . TRP A 1 235 ? 59.878  -26.168 343.025 1.00 21.35  ? 236  TRP A N   1 
ATOM   1786 C CA  . TRP A 1 235 ? 59.585  -25.404 344.228 1.00 23.30  ? 236  TRP A CA  1 
ATOM   1787 C C   . TRP A 1 235 ? 59.561  -26.263 345.484 1.00 20.87  ? 236  TRP A C   1 
ATOM   1788 O O   . TRP A 1 235 ? 59.581  -25.714 346.592 1.00 19.79  ? 236  TRP A O   1 
ATOM   1789 C CB  . TRP A 1 235 ? 58.225  -24.718 344.078 1.00 17.73  ? 236  TRP A CB  1 
ATOM   1790 C CG  . TRP A 1 235 ? 57.176  -25.696 343.646 1.00 22.16  ? 236  TRP A CG  1 
ATOM   1791 C CD1 . TRP A 1 235 ? 56.817  -25.998 342.364 1.00 21.42  ? 236  TRP A CD1 1 
ATOM   1792 C CD2 . TRP A 1 235 ? 56.381  -26.535 344.493 1.00 16.59  ? 236  TRP A CD2 1 
ATOM   1793 N NE1 . TRP A 1 235 ? 55.837  -26.960 342.361 1.00 21.57  ? 236  TRP A NE1 1 
ATOM   1794 C CE2 . TRP A 1 235 ? 55.551  -27.307 343.655 1.00 20.69  ? 236  TRP A CE2 1 
ATOM   1795 C CE3 . TRP A 1 235 ? 56.281  -26.700 345.879 1.00 21.08  ? 236  TRP A CE3 1 
ATOM   1796 C CZ2 . TRP A 1 235 ? 54.635  -28.230 344.157 1.00 21.01  ? 236  TRP A CZ2 1 
ATOM   1797 C CZ3 . TRP A 1 235 ? 55.374  -27.619 346.374 1.00 21.78  ? 236  TRP A CZ3 1 
ATOM   1798 C CH2 . TRP A 1 235 ? 54.562  -28.372 345.515 1.00 22.98  ? 236  TRP A CH2 1 
ATOM   1799 N N   . ALA A 1 236 ? 59.515  -27.587 345.339 1.00 20.52  ? 237  ALA A N   1 
ATOM   1800 C CA  . ALA A 1 236 ? 59.181  -28.478 346.442 1.00 20.99  ? 237  ALA A CA  1 
ATOM   1801 C C   . ALA A 1 236 ? 60.366  -28.837 347.325 1.00 20.65  ? 237  ALA A C   1 
ATOM   1802 O O   . ALA A 1 236 ? 60.159  -29.205 348.487 1.00 25.10  ? 237  ALA A O   1 
ATOM   1803 C CB  . ALA A 1 236 ? 58.547  -29.764 345.903 1.00 17.98  ? 237  ALA A CB  1 
ATOM   1804 N N   . THR A 1 237 ? 61.590  -28.760 346.813 1.00 18.88  ? 238  THR A N   1 
ATOM   1805 C CA  . THR A 1 237 ? 62.772  -29.056 347.606 1.00 22.74  ? 238  THR A CA  1 
ATOM   1806 C C   . THR A 1 237 ? 63.813  -27.967 347.406 1.00 25.46  ? 238  THR A C   1 
ATOM   1807 O O   . THR A 1 237 ? 63.745  -27.164 346.471 1.00 25.71  ? 238  THR A O   1 
ATOM   1808 C CB  . THR A 1 237 ? 63.388  -30.417 347.251 1.00 23.46  ? 238  THR A CB  1 
ATOM   1809 O OG1 . THR A 1 237 ? 63.684  -30.460 345.850 1.00 24.65  ? 238  THR A OG1 1 
ATOM   1810 C CG2 . THR A 1 237 ? 62.442  -31.550 347.611 1.00 26.10  ? 238  THR A CG2 1 
ATOM   1811 N N   . VAL A 1 238 ? 64.794  -27.967 348.301 1.00 22.32  ? 239  VAL A N   1 
ATOM   1812 C CA  . VAL A 1 238 ? 65.882  -27.003 348.281 1.00 24.28  ? 239  VAL A CA  1 
ATOM   1813 C C   . VAL A 1 238 ? 67.160  -27.733 348.670 1.00 30.94  ? 239  VAL A C   1 
ATOM   1814 O O   . VAL A 1 238 ? 67.128  -28.751 349.368 1.00 23.94  ? 239  VAL A O   1 
ATOM   1815 C CB  . VAL A 1 238 ? 65.586  -25.810 349.222 1.00 29.00  ? 239  VAL A CB  1 
ATOM   1816 C CG1 . VAL A 1 238 ? 65.961  -26.139 350.659 1.00 24.90  ? 239  VAL A CG1 1 
ATOM   1817 C CG2 . VAL A 1 238 ? 66.285  -24.557 348.740 1.00 32.24  ? 239  VAL A CG2 1 
ATOM   1818 N N   . GLY A 1 239 ? 68.292  -27.226 348.181 1.00 33.06  ? 240  GLY A N   1 
ATOM   1819 C CA  . GLY A 1 239 ? 69.567  -27.821 348.515 1.00 30.59  ? 240  GLY A CA  1 
ATOM   1820 C C   . GLY A 1 239 ? 70.041  -27.435 349.903 1.00 29.49  ? 240  GLY A C   1 
ATOM   1821 O O   . GLY A 1 239 ? 69.569  -26.468 350.500 1.00 31.64  ? 240  GLY A O   1 
ATOM   1822 N N   . MET A 1 240 ? 70.997  -28.214 350.417 1.00 28.73  ? 241  MET A N   1 
ATOM   1823 C CA  . MET A 1 240 ? 71.497  -27.979 351.770 1.00 31.65  ? 241  MET A CA  1 
ATOM   1824 C C   . MET A 1 240 ? 72.106  -26.589 351.905 1.00 28.52  ? 241  MET A C   1 
ATOM   1825 O O   . MET A 1 240 ? 71.874  -25.896 352.903 1.00 25.68  ? 241  MET A O   1 
ATOM   1826 C CB  . MET A 1 240 ? 72.524  -29.046 352.149 1.00 32.22  ? 241  MET A CB  1 
ATOM   1827 C CG  . MET A 1 240 ? 71.922  -30.385 352.538 1.00 38.58  ? 241  MET A CG  1 
ATOM   1828 S SD  . MET A 1 240 ? 73.166  -31.682 352.694 1.00 42.61  ? 241  MET A SD  1 
ATOM   1829 C CE  . MET A 1 240 ? 73.849  -31.310 354.307 1.00 51.16  ? 241  MET A CE  1 
ATOM   1830 N N   . GLY A 1 241 ? 72.889  -26.164 350.913 1.00 28.08  ? 242  GLY A N   1 
ATOM   1831 C CA  . GLY A 1 241 ? 73.515  -24.855 350.990 1.00 31.42  ? 242  GLY A CA  1 
ATOM   1832 C C   . GLY A 1 241 ? 72.512  -23.719 350.938 1.00 30.83  ? 242  GLY A C   1 
ATOM   1833 O O   . GLY A 1 241 ? 72.608  -22.760 351.709 1.00 30.00  ? 242  GLY A O   1 
ATOM   1834 N N   . GLU A 1 242 ? 71.537  -23.809 350.031 1.00 29.47  ? 243  GLU A N   1 
ATOM   1835 C CA  . GLU A 1 242 ? 70.532  -22.756 349.924 1.00 28.14  ? 243  GLU A CA  1 
ATOM   1836 C C   . GLU A 1 242 ? 69.630  -22.724 351.152 1.00 27.15  ? 243  GLU A C   1 
ATOM   1837 O O   . GLU A 1 242 ? 69.200  -21.648 351.583 1.00 27.13  ? 243  GLU A O   1 
ATOM   1838 C CB  . GLU A 1 242 ? 69.713  -22.946 348.646 1.00 28.70  ? 243  GLU A CB  1 
ATOM   1839 C CG  . GLU A 1 242 ? 68.590  -21.934 348.440 1.00 34.15  ? 243  GLU A CG  1 
ATOM   1840 C CD  . GLU A 1 242 ? 69.071  -20.500 348.304 1.00 37.95  ? 243  GLU A CD  1 
ATOM   1841 O OE1 . GLU A 1 242 ? 70.282  -20.278 348.089 1.00 40.58  ? 243  GLU A OE1 1 
ATOM   1842 O OE2 . GLU A 1 242 ? 68.223  -19.588 348.406 1.00 37.28  ? 243  GLU A OE2 1 
ATOM   1843 N N   . ALA A 1 243 ? 69.337  -23.891 351.732 1.00 28.70  ? 244  ALA A N   1 
ATOM   1844 C CA  . ALA A 1 243 ? 68.559  -23.922 352.966 1.00 30.96  ? 244  ALA A CA  1 
ATOM   1845 C C   . ALA A 1 243 ? 69.295  -23.215 354.096 1.00 31.52  ? 244  ALA A C   1 
ATOM   1846 O O   . ALA A 1 243 ? 68.696  -22.435 354.846 1.00 26.70  ? 244  ALA A O   1 
ATOM   1847 C CB  . ALA A 1 243 ? 68.242  -25.366 353.355 1.00 24.28  ? 244  ALA A CB  1 
ATOM   1848 N N   . ARG A 1 244 ? 70.599  -23.472 354.229 1.00 28.22  ? 245  ARG A N   1 
ATOM   1849 C CA  . ARG A 1 244 ? 71.379  -22.816 355.272 1.00 33.26  ? 245  ARG A CA  1 
ATOM   1850 C C   . ARG A 1 244 ? 71.448  -21.311 355.045 1.00 32.93  ? 245  ARG A C   1 
ATOM   1851 O O   . ARG A 1 244 ? 71.381  -20.529 356.001 1.00 38.05  ? 245  ARG A O   1 
ATOM   1852 C CB  . ARG A 1 244 ? 72.784  -23.417 355.334 1.00 27.15  ? 245  ARG A CB  1 
ATOM   1853 C CG  . ARG A 1 244 ? 73.754  -22.645 356.216 1.00 32.95  ? 245  ARG A CG  1 
ATOM   1854 C CD  . ARG A 1 244 ? 74.984  -23.474 356.547 1.00 34.30  ? 245  ARG A CD  1 
ATOM   1855 N NE  . ARG A 1 244 ? 74.649  -24.670 357.314 1.00 32.11  ? 245  ARG A NE  1 
ATOM   1856 C CZ  . ARG A 1 244 ? 74.587  -24.714 358.641 1.00 33.43  ? 245  ARG A CZ  1 
ATOM   1857 N NH1 . ARG A 1 244 ? 74.837  -23.626 359.357 1.00 30.56  ? 245  ARG A NH1 1 
ATOM   1858 N NH2 . ARG A 1 244 ? 74.276  -25.848 359.254 1.00 29.61  ? 245  ARG A NH2 1 
ATOM   1859 N N   . ARG A 1 245 ? 71.571  -20.883 353.786 1.00 30.94  ? 246  ARG A N   1 
ATOM   1860 C CA  . ARG A 1 245 ? 71.659  -19.453 353.506 1.00 30.80  ? 246  ARG A CA  1 
ATOM   1861 C C   . ARG A 1 245 ? 70.361  -18.736 353.860 1.00 30.92  ? 246  ARG A C   1 
ATOM   1862 O O   . ARG A 1 245 ? 70.390  -17.644 354.439 1.00 30.02  ? 246  ARG A O   1 
ATOM   1863 C CB  . ARG A 1 245 ? 72.014  -19.215 352.039 1.00 28.38  ? 246  ARG A CB  1 
ATOM   1864 C CG  . ARG A 1 245 ? 72.260  -17.748 351.715 1.00 33.78  ? 246  ARG A CG  1 
ATOM   1865 C CD  . ARG A 1 245 ? 72.162  -17.459 350.226 1.00 38.18  ? 246  ARG A CD  1 
ATOM   1866 N NE  . ARG A 1 245 ? 70.850  -17.794 349.678 1.00 39.81  ? 246  ARG A NE  1 
ATOM   1867 C CZ  . ARG A 1 245 ? 69.771  -17.026 349.788 1.00 42.42  ? 246  ARG A CZ  1 
ATOM   1868 N NH1 . ARG A 1 245 ? 69.835  -15.870 350.437 1.00 41.11  ? 246  ARG A NH1 1 
ATOM   1869 N NH2 . ARG A 1 245 ? 68.622  -17.415 349.252 1.00 37.80  ? 246  ARG A NH2 1 
ATOM   1870 N N   . ARG A 1 246 ? 69.214  -19.332 353.524 1.00 25.92  ? 247  ARG A N   1 
ATOM   1871 C CA  . ARG A 1 246 ? 67.938  -18.709 353.865 1.00 26.51  ? 247  ARG A CA  1 
ATOM   1872 C C   . ARG A 1 246 ? 67.710  -18.707 355.371 1.00 29.66  ? 247  ARG A C   1 
ATOM   1873 O O   . ARG A 1 246 ? 67.211  -17.722 355.926 1.00 30.29  ? 247  ARG A O   1 
ATOM   1874 C CB  . ARG A 1 246 ? 66.793  -19.422 353.148 1.00 27.50  ? 247  ARG A CB  1 
ATOM   1875 C CG  . ARG A 1 246 ? 66.903  -19.391 351.634 1.00 27.60  ? 247  ARG A CG  1 
ATOM   1876 C CD  . ARG A 1 246 ? 65.814  -20.222 350.975 1.00 21.38  ? 247  ARG A CD  1 
ATOM   1877 N NE  . ARG A 1 246 ? 65.957  -20.236 349.522 1.00 25.91  ? 247  ARG A NE  1 
ATOM   1878 C CZ  . ARG A 1 246 ? 65.058  -20.741 348.684 1.00 25.82  ? 247  ARG A CZ  1 
ATOM   1879 N NH1 . ARG A 1 246 ? 63.940  -21.279 349.151 1.00 25.56  ? 247  ARG A NH1 1 
ATOM   1880 N NH2 . ARG A 1 246 ? 65.279  -20.711 347.377 1.00 26.61  ? 247  ARG A NH2 1 
ATOM   1881 N N   . ALA A 1 247 ? 68.065  -19.803 356.045 1.00 28.08  ? 248  ALA A N   1 
ATOM   1882 C CA  . ALA A 1 247 ? 67.966  -19.847 357.500 1.00 23.56  ? 248  ALA A CA  1 
ATOM   1883 C C   . ALA A 1 247 ? 68.842  -18.776 358.135 1.00 32.14  ? 248  ALA A C   1 
ATOM   1884 O O   . ALA A 1 247 ? 68.415  -18.065 359.052 1.00 30.43  ? 248  ALA A O   1 
ATOM   1885 C CB  . ALA A 1 247 ? 68.359  -21.234 358.006 1.00 23.49  ? 248  ALA A CB  1 
ATOM   1886 N N   . THR A 1 248 ? 70.077  -18.643 357.646 1.00 32.69  ? 249  THR A N   1 
ATOM   1887 C CA  . THR A 1 248 ? 71.002  -17.657 358.191 1.00 35.37  ? 249  THR A CA  1 
ATOM   1888 C C   . THR A 1 248 ? 70.522  -16.235 357.920 1.00 35.18  ? 249  THR A C   1 
ATOM   1889 O O   . THR A 1 248 ? 70.653  -15.356 358.781 1.00 36.18  ? 249  THR A O   1 
ATOM   1890 C CB  . THR A 1 248 ? 72.397  -17.882 357.606 1.00 35.90  ? 249  THR A CB  1 
ATOM   1891 O OG1 . THR A 1 248 ? 72.876  -19.174 358.000 1.00 39.95  ? 249  THR A OG1 1 
ATOM   1892 C CG2 . THR A 1 248 ? 73.369  -16.816 358.082 1.00 30.81  ? 249  THR A CG2 1 
ATOM   1893 N N   . GLN A 1 249 ? 69.958  -15.989 356.735 1.00 29.52  ? 250  GLN A N   1 
ATOM   1894 C CA  . GLN A 1 249 ? 69.459  -14.652 356.430 1.00 30.13  ? 250  GLN A CA  1 
ATOM   1895 C C   . GLN A 1 249 ? 68.243  -14.309 357.280 1.00 30.47  ? 250  GLN A C   1 
ATOM   1896 O O   . GLN A 1 249 ? 68.107  -13.170 357.745 1.00 35.33  ? 250  GLN A O   1 
ATOM   1897 C CB  . GLN A 1 249 ? 69.124  -14.528 354.945 1.00 31.24  ? 250  GLN A CB  1 
ATOM   1898 C CG  . GLN A 1 249 ? 68.178  -13.375 354.640 1.00 45.22  ? 250  GLN A CG  1 
ATOM   1899 C CD  . GLN A 1 249 ? 68.484  -12.689 353.327 1.00 63.73  ? 250  GLN A CD  1 
ATOM   1900 O OE1 . GLN A 1 249 ? 68.203  -13.222 352.254 1.00 65.72  ? 250  GLN A OE1 1 
ATOM   1901 N NE2 . GLN A 1 249 ? 69.064  -11.496 353.405 1.00 67.60  ? 250  GLN A NE2 1 
ATOM   1902 N N   . LEU A 1 250 ? 67.344  -15.274 357.489 1.00 25.63  ? 251  LEU A N   1 
ATOM   1903 C CA  . LEU A 1 250 ? 66.210  -15.040 358.377 1.00 28.13  ? 251  LEU A CA  1 
ATOM   1904 C C   . LEU A 1 250 ? 66.685  -14.648 359.769 1.00 37.88  ? 251  LEU A C   1 
ATOM   1905 O O   . LEU A 1 250 ? 66.175  -13.693 360.368 1.00 41.99  ? 251  LEU A O   1 
ATOM   1906 C CB  . LEU A 1 250 ? 65.326  -16.283 358.449 1.00 25.17  ? 251  LEU A CB  1 
ATOM   1907 C CG  . LEU A 1 250 ? 64.198  -16.140 359.471 1.00 31.38  ? 251  LEU A CG  1 
ATOM   1908 C CD1 . LEU A 1 250 ? 63.180  -15.109 358.996 1.00 28.14  ? 251  LEU A CD1 1 
ATOM   1909 C CD2 . LEU A 1 250 ? 63.542  -17.481 359.756 1.00 23.96  ? 251  LEU A CD2 1 
ATOM   1910 N N   . ALA A 1 251 ? 67.669  -15.380 360.298 1.00 31.27  ? 252  ALA A N   1 
ATOM   1911 C CA  . ALA A 1 251 ? 68.253  -15.032 361.588 1.00 36.87  ? 252  ALA A CA  1 
ATOM   1912 C C   . ALA A 1 251 ? 68.790  -13.609 361.580 1.00 35.75  ? 252  ALA A C   1 
ATOM   1913 O O   . ALA A 1 251 ? 68.515  -12.821 362.492 1.00 33.87  ? 252  ALA A O   1 
ATOM   1914 C CB  . ALA A 1 251 ? 69.372  -16.010 361.933 1.00 37.14  ? 252  ALA A CB  1 
ATOM   1915 N N   . HIS A 1 252 ? 69.572  -13.269 360.555 1.00 30.62  ? 253  HIS A N   1 
ATOM   1916 C CA  . HIS A 1 252 ? 70.150  -11.933 360.475 1.00 39.95  ? 253  HIS A CA  1 
ATOM   1917 C C   . HIS A 1 252 ? 69.066  -10.865 360.419 1.00 39.83  ? 253  HIS A C   1 
ATOM   1918 O O   . HIS A 1 252 ? 69.219  -9.783  360.999 1.00 42.63  ? 253  HIS A O   1 
ATOM   1919 C CB  . HIS A 1 252 ? 71.065  -11.838 359.255 1.00 45.23  ? 253  HIS A CB  1 
ATOM   1920 C CG  . HIS A 1 252 ? 71.642  -10.475 359.040 1.00 61.77  ? 253  HIS A CG  1 
ATOM   1921 N ND1 . HIS A 1 252 ? 71.015  -9.513  358.279 1.00 65.93  ? 253  HIS A ND1 1 
ATOM   1922 C CD2 . HIS A 1 252 ? 72.787  -9.912  359.492 1.00 65.52  ? 253  HIS A CD2 1 
ATOM   1923 C CE1 . HIS A 1 252 ? 71.749  -8.415  358.269 1.00 67.50  ? 253  HIS A CE1 1 
ATOM   1924 N NE2 . HIS A 1 252 ? 72.830  -8.631  358.998 1.00 66.99  ? 253  HIS A NE2 1 
ATOM   1925 N N   . LEU A 1 253 ? 67.954  -11.156 359.741 1.00 37.13  ? 254  LEU A N   1 
ATOM   1926 C CA  . LEU A 1 253 ? 66.891  -10.171 359.591 1.00 40.44  ? 254  LEU A CA  1 
ATOM   1927 C C   . LEU A 1 253 ? 66.139  -9.914  360.891 1.00 45.95  ? 254  LEU A C   1 
ATOM   1928 O O   . LEU A 1 253 ? 65.501  -8.863  361.021 1.00 49.93  ? 254  LEU A O   1 
ATOM   1929 C CB  . LEU A 1 253 ? 65.911  -10.616 358.506 1.00 31.47  ? 254  LEU A CB  1 
ATOM   1930 C CG  . LEU A 1 253 ? 66.363  -10.398 357.061 1.00 39.95  ? 254  LEU A CG  1 
ATOM   1931 C CD1 . LEU A 1 253 ? 65.410  -11.085 356.097 1.00 37.65  ? 254  LEU A CD1 1 
ATOM   1932 C CD2 . LEU A 1 253 ? 66.472  -8.914  356.748 1.00 40.90  ? 254  LEU A CD2 1 
ATOM   1933 N N   . VAL A 1 254 ? 66.193  -10.837 361.849 1.00 37.29  ? 255  VAL A N   1 
ATOM   1934 C CA  . VAL A 1 254 ? 65.502  -10.678 363.123 1.00 37.57  ? 255  VAL A CA  1 
ATOM   1935 C C   . VAL A 1 254 ? 66.476  -10.450 364.272 1.00 41.40  ? 255  VAL A C   1 
ATOM   1936 O O   . VAL A 1 254 ? 66.062  -10.440 365.436 1.00 46.70  ? 255  VAL A O   1 
ATOM   1937 C CB  . VAL A 1 254 ? 64.577  -11.872 363.413 1.00 32.68  ? 255  VAL A CB  1 
ATOM   1938 C CG1 . VAL A 1 254 ? 63.517  -11.996 362.328 1.00 28.07  ? 255  VAL A CG1 1 
ATOM   1939 C CG2 . VAL A 1 254 ? 65.382  -13.156 363.534 1.00 29.88  ? 255  VAL A CG2 1 
ATOM   1940 N N   . GLY A 1 255 ? 67.758  -10.271 363.979 1.00 42.62  ? 256  GLY A N   1 
ATOM   1941 C CA  . GLY A 1 255 ? 68.734  -9.913  364.987 1.00 40.32  ? 256  GLY A CA  1 
ATOM   1942 C C   . GLY A 1 255 ? 69.562  -11.045 365.557 1.00 43.86  ? 256  GLY A C   1 
ATOM   1943 O O   . GLY A 1 255 ? 70.068  -10.905 366.676 1.00 53.26  ? 256  GLY A O   1 
ATOM   1944 N N   . CYS A 1 256 ? 69.727  -12.148 364.830 1.00 41.66  ? 257  CYS A N   1 
ATOM   1945 C CA  . CYS A 1 256 ? 70.473  -13.296 365.315 1.00 47.14  ? 257  CYS A CA  1 
ATOM   1946 C C   . CYS A 1 256 ? 71.604  -13.637 364.352 1.00 59.28  ? 257  CYS A C   1 
ATOM   1947 O O   . CYS A 1 256 ? 71.369  -13.738 363.139 1.00 61.11  ? 257  CYS A O   1 
ATOM   1948 C CB  . CYS A 1 256 ? 69.556  -14.520 365.488 1.00 49.52  ? 257  CYS A CB  1 
ATOM   1949 S SG  . CYS A 1 256 ? 68.266  -14.359 366.750 1.00 53.32  ? 257  CYS A SG  1 
ATOM   1950 N N   . PRO A 1 257 ? 72.843  -13.804 364.838 1.00 73.63  ? 258  PRO A N   1 
ATOM   1951 C CA  . PRO A 1 257 ? 73.172  -13.530 366.236 1.00 78.85  ? 258  PRO A CA  1 
ATOM   1952 C C   . PRO A 1 257 ? 73.485  -12.051 366.409 1.00 80.02  ? 258  PRO A C   1 
ATOM   1953 O O   . PRO A 1 257 ? 73.675  -11.363 365.406 1.00 78.49  ? 258  PRO A O   1 
ATOM   1954 C CB  . PRO A 1 257 ? 74.404  -14.399 366.476 1.00 78.75  ? 258  PRO A CB  1 
ATOM   1955 C CG  . PRO A 1 257 ? 75.089  -14.410 365.153 1.00 76.92  ? 258  PRO A CG  1 
ATOM   1956 C CD  . PRO A 1 257 ? 74.019  -14.277 364.086 1.00 73.77  ? 258  PRO A CD  1 
ATOM   1957 N N   . PRO A 1 258 ? 73.515  -11.557 367.653 1.00 83.40  ? 259  PRO A N   1 
ATOM   1958 C CA  . PRO A 1 258 ? 73.882  -10.150 367.845 1.00 83.70  ? 259  PRO A CA  1 
ATOM   1959 C C   . PRO A 1 258 ? 75.334  -9.874  367.465 1.00 84.60  ? 259  PRO A C   1 
ATOM   1960 O O   . PRO A 1 258 ? 75.573  -9.191  366.469 1.00 83.59  ? 259  PRO A O   1 
ATOM   1961 C CB  . PRO A 1 258 ? 73.656  -9.925  369.344 1.00 85.07  ? 259  PRO A CB  1 
ATOM   1962 C CG  . PRO A 1 258 ? 72.728  -11.016 369.767 1.00 85.76  ? 259  PRO A CG  1 
ATOM   1963 C CD  . PRO A 1 258 ? 73.061  -12.189 368.903 1.00 84.56  ? 259  PRO A CD  1 
ATOM   1964 N N   . GLY A 1 262 ? 75.969  -15.829 361.190 1.00 56.97  ? 263  GLY A N   1 
ATOM   1965 C CA  . GLY A 1 262 ? 76.169  -17.257 361.206 1.00 62.61  ? 263  GLY A CA  1 
ATOM   1966 C C   . GLY A 1 262 ? 76.720  -17.796 362.502 1.00 74.41  ? 263  GLY A C   1 
ATOM   1967 O O   . GLY A 1 262 ? 76.144  -17.558 363.517 1.00 77.31  ? 263  GLY A O   1 
ATOM   1968 N N   . GLY A 1 263 ? 77.845  -18.504 362.470 1.00 81.24  ? 264  GLY A N   1 
ATOM   1969 C CA  . GLY A 1 263 ? 78.462  -19.049 363.675 1.00 83.60  ? 264  GLY A CA  1 
ATOM   1970 C C   . GLY A 1 263 ? 77.968  -20.383 364.203 1.00 77.68  ? 264  GLY A C   1 
ATOM   1971 O O   . GLY A 1 263 ? 77.490  -21.172 363.448 1.00 80.76  ? 264  GLY A O   1 
ATOM   1972 N N   . ASN A 1 264 ? 78.145  -20.629 365.496 1.00 69.60  ? 265  ASN A N   1 
ATOM   1973 C CA  . ASN A 1 264 ? 77.718  -21.838 366.178 1.00 61.76  ? 265  ASN A CA  1 
ATOM   1974 C C   . ASN A 1 264 ? 76.253  -22.016 365.878 1.00 47.74  ? 265  ASN A C   1 
ATOM   1975 O O   . ASN A 1 264 ? 75.463  -21.112 366.097 1.00 46.80  ? 265  ASN A O   1 
ATOM   1976 C CB  . ASN A 1 264 ? 77.919  -21.656 367.683 1.00 70.57  ? 265  ASN A CB  1 
ATOM   1977 C CG  . ASN A 1 264 ? 77.753  -22.931 368.471 1.00 86.23  ? 265  ASN A CG  1 
ATOM   1978 O OD1 . ASN A 1 264 ? 76.814  -23.661 368.280 1.00 79.24  ? 265  ASN A OD1 1 
ATOM   1979 N ND2 . ASN A 1 264 ? 78.685  -23.197 369.391 1.00 110.38 ? 265  ASN A ND2 1 
ATOM   1980 N N   . ASP A 1 265 ? 75.886  -23.174 365.378 1.00 34.84  ? 266  ASP A N   1 
ATOM   1981 C CA  . ASP A 1 265 ? 74.485  -23.396 365.033 1.00 35.94  ? 266  ASP A CA  1 
ATOM   1982 C C   . ASP A 1 265 ? 73.613  -23.436 366.283 1.00 37.60  ? 266  ASP A C   1 
ATOM   1983 O O   . ASP A 1 265 ? 72.443  -23.038 366.238 1.00 36.08  ? 266  ASP A O   1 
ATOM   1984 C CB  . ASP A 1 265 ? 74.325  -24.684 364.222 1.00 39.39  ? 266  ASP A CB  1 
ATOM   1985 C CG  . ASP A 1 265 ? 74.454  -24.451 362.723 1.00 44.25  ? 266  ASP A CG  1 
ATOM   1986 O OD1 . ASP A 1 265 ? 74.438  -23.278 362.293 1.00 43.85  ? 266  ASP A OD1 1 
ATOM   1987 O OD2 . ASP A 1 265 ? 74.564  -25.444 361.972 1.00 38.95  ? 266  ASP A OD2 1 
ATOM   1988 N N   . THR A 1 266 ? 74.174  -23.889 367.407 1.00 36.53  ? 267  THR A N   1 
ATOM   1989 C CA  . THR A 1 266 ? 73.422  -23.950 368.656 1.00 35.13  ? 267  THR A CA  1 
ATOM   1990 C C   . THR A 1 266 ? 73.086  -22.553 369.167 1.00 40.16  ? 267  THR A C   1 
ATOM   1991 O O   . THR A 1 266 ? 71.929  -22.264 369.495 1.00 45.39  ? 267  THR A O   1 
ATOM   1992 C CB  . THR A 1 266 ? 74.219  -24.729 369.702 1.00 40.86  ? 267  THR A CB  1 
ATOM   1993 O OG1 . THR A 1 266 ? 74.491  -26.047 369.212 1.00 46.90  ? 267  THR A OG1 1 
ATOM   1994 C CG2 . THR A 1 266 ? 73.444  -24.826 371.004 1.00 41.73  ? 267  THR A CG2 1 
ATOM   1995 N N   . GLU A 1 267 ? 74.071  -21.677 369.187 1.00 40.74  ? 268  GLU A N   1 
ATOM   1996 C CA  . GLU A 1 267 ? 73.833  -20.319 369.624 1.00 47.69  ? 268  GLU A CA  1 
ATOM   1997 C C   . GLU A 1 267 ? 72.829  -19.651 368.687 1.00 40.99  ? 268  GLU A C   1 
ATOM   1998 O O   . GLU A 1 267 ? 72.051  -18.795 369.108 1.00 35.27  ? 268  GLU A O   1 
ATOM   1999 C CB  . GLU A 1 267 ? 75.141  -19.527 369.655 1.00 56.30  ? 268  GLU A CB  1 
ATOM   2000 C CG  . GLU A 1 267 ? 74.988  -18.087 370.119 1.00 75.69  ? 268  GLU A CG  1 
ATOM   2001 C CD  . GLU A 1 267 ? 74.275  -17.217 369.102 1.00 96.38  ? 268  GLU A CD  1 
ATOM   2002 O OE1 . GLU A 1 267 ? 74.327  -17.543 367.897 1.00 102.96 ? 268  GLU A OE1 1 
ATOM   2003 O OE2 . GLU A 1 267 ? 73.667  -16.204 369.506 1.00 102.57 ? 268  GLU A OE2 1 
ATOM   2004 N N   . LEU A 1 268 ? 72.868  -20.027 367.410 1.00 38.98  ? 269  LEU A N   1 
ATOM   2005 C CA  . LEU A 1 268 ? 72.025  -19.395 366.406 1.00 36.52  ? 269  LEU A CA  1 
ATOM   2006 C C   . LEU A 1 268 ? 70.559  -19.779 366.586 1.00 36.82  ? 269  LEU A C   1 
ATOM   2007 O O   . LEU A 1 268 ? 69.680  -18.909 366.646 1.00 33.48  ? 269  LEU A O   1 
ATOM   2008 C CB  . LEU A 1 268 ? 72.523  -19.787 365.020 1.00 43.72  ? 269  LEU A CB  1 
ATOM   2009 C CG  . LEU A 1 268 ? 71.931  -18.956 363.897 1.00 45.52  ? 269  LEU A CG  1 
ATOM   2010 C CD1 . LEU A 1 268 ? 72.273  -17.487 364.083 1.00 48.44  ? 269  LEU A CD1 1 
ATOM   2011 C CD2 . LEU A 1 268 ? 72.363  -19.484 362.539 1.00 43.72  ? 269  LEU A CD2 1 
ATOM   2012 N N   . VAL A 1 269 ? 70.276  -21.081 366.663 1.00 31.46  ? 270  VAL A N   1 
ATOM   2013 C CA  . VAL A 1 269 ? 68.901  -21.537 366.846 1.00 35.19  ? 270  VAL A CA  1 
ATOM   2014 C C   . VAL A 1 269 ? 68.357  -21.062 368.188 1.00 38.76  ? 270  VAL A C   1 
ATOM   2015 O O   . VAL A 1 269 ? 67.181  -20.691 368.302 1.00 35.00  ? 270  VAL A O   1 
ATOM   2016 C CB  . VAL A 1 269 ? 68.827  -23.070 366.714 1.00 36.96  ? 270  VAL A CB  1 
ATOM   2017 C CG1 . VAL A 1 269 ? 67.414  -23.559 366.959 1.00 34.76  ? 270  VAL A CG1 1 
ATOM   2018 C CG2 . VAL A 1 269 ? 69.308  -23.505 365.343 1.00 36.25  ? 270  VAL A CG2 1 
ATOM   2019 N N   . ALA A 1 270 ? 69.204  -21.058 369.221 1.00 34.69  ? 271  ALA A N   1 
ATOM   2020 C CA  . ALA A 1 270 ? 68.766  -20.600 370.536 1.00 42.19  ? 271  ALA A CA  1 
ATOM   2021 C C   . ALA A 1 270 ? 68.305  -19.149 370.490 1.00 41.49  ? 271  ALA A C   1 
ATOM   2022 O O   . ALA A 1 270 ? 67.300  -18.789 371.114 1.00 41.80  ? 271  ALA A O   1 
ATOM   2023 C CB  . ALA A 1 270 ? 69.889  -20.777 371.557 1.00 32.42  ? 271  ALA A CB  1 
ATOM   2024 N N   . CYS A 1 271 ? 69.028  -18.300 369.753 1.00 33.56  ? 272  CYS A N   1 
ATOM   2025 C CA  . CYS A 1 271 ? 68.585  -16.922 369.564 1.00 36.50  ? 272  CYS A CA  1 
ATOM   2026 C C   . CYS A 1 271 ? 67.269  -16.873 368.799 1.00 36.53  ? 272  CYS A C   1 
ATOM   2027 O O   . CYS A 1 271 ? 66.373  -16.090 369.137 1.00 37.50  ? 272  CYS A O   1 
ATOM   2028 C CB  . CYS A 1 271 ? 69.662  -16.120 368.833 1.00 48.89  ? 272  CYS A CB  1 
ATOM   2029 S SG  . CYS A 1 271 ? 69.254  -14.377 368.530 1.00 60.16  ? 272  CYS A SG  1 
ATOM   2030 N N   . LEU A 1 272 ? 67.135  -17.704 367.760 1.00 31.61  ? 273  LEU A N   1 
ATOM   2031 C CA  . LEU A 1 272 ? 65.889  -17.752 367.000 1.00 31.84  ? 273  LEU A CA  1 
ATOM   2032 C C   . LEU A 1 272 ? 64.713  -18.166 367.870 1.00 33.41  ? 273  LEU A C   1 
ATOM   2033 O O   . LEU A 1 272 ? 63.584  -17.720 367.639 1.00 26.58  ? 273  LEU A O   1 
ATOM   2034 C CB  . LEU A 1 272 ? 66.009  -18.725 365.830 1.00 29.93  ? 273  LEU A CB  1 
ATOM   2035 C CG  . LEU A 1 272 ? 66.545  -18.272 364.476 1.00 35.36  ? 273  LEU A CG  1 
ATOM   2036 C CD1 . LEU A 1 272 ? 66.337  -19.406 363.484 1.00 38.46  ? 273  LEU A CD1 1 
ATOM   2037 C CD2 . LEU A 1 272 ? 65.876  -16.998 363.991 1.00 36.80  ? 273  LEU A CD2 1 
ATOM   2038 N N   . ARG A 1 273 ? 64.951  -19.028 368.859 1.00 32.33  ? 274  ARG A N   1 
ATOM   2039 C CA  . ARG A 1 273 ? 63.858  -19.537 369.676 1.00 31.15  ? 274  ARG A CA  1 
ATOM   2040 C C   . ARG A 1 273 ? 63.319  -18.490 370.640 1.00 32.75  ? 274  ARG A C   1 
ATOM   2041 O O   . ARG A 1 273 ? 62.205  -18.651 371.150 1.00 32.35  ? 274  ARG A O   1 
ATOM   2042 C CB  . ARG A 1 273 ? 64.315  -20.780 370.437 1.00 28.71  ? 274  ARG A CB  1 
ATOM   2043 C CG  . ARG A 1 273 ? 64.182  -22.053 369.625 1.00 33.26  ? 274  ARG A CG  1 
ATOM   2044 C CD  . ARG A 1 273 ? 64.391  -23.286 370.477 1.00 37.46  ? 274  ARG A CD  1 
ATOM   2045 N NE  . ARG A 1 273 ? 64.878  -24.410 369.687 1.00 45.75  ? 274  ARG A NE  1 
ATOM   2046 C CZ  . ARG A 1 273 ? 66.091  -24.936 369.810 1.00 49.50  ? 274  ARG A CZ  1 
ATOM   2047 N NH1 . ARG A 1 273 ? 66.943  -24.437 370.695 1.00 50.02  ? 274  ARG A NH1 1 
ATOM   2048 N NH2 . ARG A 1 273 ? 66.451  -25.960 369.049 1.00 50.33  ? 274  ARG A NH2 1 
ATOM   2049 N N   . THR A 1 274 ? 64.077  -17.424 370.898 1.00 32.14  ? 275  THR A N   1 
ATOM   2050 C CA  . THR A 1 274 ? 63.595  -16.337 371.739 1.00 36.71  ? 275  THR A CA  1 
ATOM   2051 C C   . THR A 1 274 ? 62.730  -15.339 370.981 1.00 41.04  ? 275  THR A C   1 
ATOM   2052 O O   . THR A 1 274 ? 62.185  -14.422 371.604 1.00 39.16  ? 275  THR A O   1 
ATOM   2053 C CB  . THR A 1 274 ? 64.772  -15.595 372.378 1.00 37.49  ? 275  THR A CB  1 
ATOM   2054 O OG1 . THR A 1 274 ? 65.430  -14.794 371.388 1.00 32.96  ? 275  THR A OG1 1 
ATOM   2055 C CG2 . THR A 1 274 ? 65.767  -16.580 372.972 1.00 37.00  ? 275  THR A CG2 1 
ATOM   2056 N N   . ARG A 1 275 ? 62.593  -15.487 369.666 1.00 37.47  ? 276  ARG A N   1 
ATOM   2057 C CA  . ARG A 1 275 ? 61.788  -14.470 369.002 1.00 33.80  ? 276  ARG A CA  1 
ATOM   2058 C C   . ARG A 1 275 ? 60.333  -14.919 368.903 1.00 32.12  ? 276  ARG A C   1 
ATOM   2059 O O   . ARG A 1 275 ? 60.063  -16.105 368.688 1.00 35.26  ? 276  ARG A O   1 
ATOM   2060 C CB  . ARG A 1 275 ? 62.326  -14.177 367.604 1.00 30.70  ? 276  ARG A CB  1 
ATOM   2061 C CG  . ARG A 1 275 ? 63.783  -13.742 367.578 1.00 38.00  ? 276  ARG A CG  1 
ATOM   2062 C CD  . ARG A 1 275 ? 63.930  -12.282 367.977 1.00 43.27  ? 276  ARG A CD  1 
ATOM   2063 N NE  . ARG A 1 275 ? 65.275  -11.782 367.711 1.00 52.68  ? 276  ARG A NE  1 
ATOM   2064 C CZ  . ARG A 1 275 ? 66.283  -11.850 368.574 1.00 62.85  ? 276  ARG A CZ  1 
ATOM   2065 N NH1 . ARG A 1 275 ? 66.102  -12.399 369.768 1.00 65.17  ? 276  ARG A NH1 1 
ATOM   2066 N NH2 . ARG A 1 275 ? 67.474  -11.369 368.244 1.00 70.14  ? 276  ARG A NH2 1 
ATOM   2067 N N   . PRO A 1 276 ? 59.397  -13.984 369.067 1.00 27.25  ? 277  PRO A N   1 
ATOM   2068 C CA  . PRO A 1 276 ? 57.979  -14.327 368.912 1.00 27.74  ? 277  PRO A CA  1 
ATOM   2069 C C   . PRO A 1 276 ? 57.715  -14.933 367.543 1.00 30.16  ? 277  PRO A C   1 
ATOM   2070 O O   . PRO A 1 276 ? 58.347  -14.565 366.550 1.00 32.47  ? 277  PRO A O   1 
ATOM   2071 C CB  . PRO A 1 276 ? 57.267  -12.980 369.081 1.00 27.56  ? 277  PRO A CB  1 
ATOM   2072 C CG  . PRO A 1 276 ? 58.233  -12.133 369.852 1.00 33.23  ? 277  PRO A CG  1 
ATOM   2073 C CD  . PRO A 1 276 ? 59.594  -12.563 369.399 1.00 32.28  ? 277  PRO A CD  1 
ATOM   2074 N N   . ALA A 1 277 ? 56.777  -15.883 367.505 1.00 28.92  ? 278  ALA A N   1 
ATOM   2075 C CA  . ALA A 1 277 ? 56.470  -16.581 366.260 1.00 29.82  ? 278  ALA A CA  1 
ATOM   2076 C C   . ALA A 1 277 ? 56.105  -15.606 365.149 1.00 29.02  ? 278  ALA A C   1 
ATOM   2077 O O   . ALA A 1 277 ? 56.554  -15.757 364.006 1.00 28.08  ? 278  ALA A O   1 
ATOM   2078 C CB  . ALA A 1 277 ? 55.335  -17.581 366.488 1.00 23.38  ? 278  ALA A CB  1 
ATOM   2079 N N   . GLN A 1 278 ? 55.304  -14.587 365.470 1.00 28.99  ? 279  GLN A N   1 
ATOM   2080 C CA  . GLN A 1 278 ? 54.876  -13.632 364.454 1.00 28.08  ? 279  GLN A CA  1 
ATOM   2081 C C   . GLN A 1 278 ? 56.052  -12.860 363.867 1.00 33.59  ? 279  GLN A C   1 
ATOM   2082 O O   . GLN A 1 278 ? 56.016  -12.483 362.690 1.00 33.28  ? 279  GLN A O   1 
ATOM   2083 C CB  . GLN A 1 278 ? 53.846  -12.666 365.043 1.00 26.52  ? 279  GLN A CB  1 
ATOM   2084 C CG  . GLN A 1 278 ? 53.154  -11.794 364.008 1.00 36.76  ? 279  GLN A CG  1 
ATOM   2085 C CD  . GLN A 1 278 ? 52.461  -12.608 362.931 1.00 43.54  ? 279  GLN A CD  1 
ATOM   2086 O OE1 . GLN A 1 278 ? 51.686  -13.519 363.225 1.00 44.33  ? 279  GLN A OE1 1 
ATOM   2087 N NE2 . GLN A 1 278 ? 52.743  -12.286 361.673 1.00 35.71  ? 279  GLN A NE2 1 
ATOM   2088 N N   . VAL A 1 279 ? 57.099  -12.620 364.660 1.00 31.86  ? 280  VAL A N   1 
ATOM   2089 C CA  . VAL A 1 279 ? 58.259  -11.891 364.152 1.00 28.93  ? 280  VAL A CA  1 
ATOM   2090 C C   . VAL A 1 279 ? 58.941  -12.680 363.042 1.00 33.56  ? 280  VAL A C   1 
ATOM   2091 O O   . VAL A 1 279 ? 59.360  -12.114 362.024 1.00 34.90  ? 280  VAL A O   1 
ATOM   2092 C CB  . VAL A 1 279 ? 59.234  -11.562 365.298 1.00 32.05  ? 280  VAL A CB  1 
ATOM   2093 C CG1 . VAL A 1 279 ? 60.548  -11.030 364.746 1.00 30.96  ? 280  VAL A CG1 1 
ATOM   2094 C CG2 . VAL A 1 279 ? 58.610  -10.552 366.248 1.00 31.21  ? 280  VAL A CG2 1 
ATOM   2095 N N   . LEU A 1 280 ? 59.055  -13.999 363.210 1.00 28.71  ? 281  LEU A N   1 
ATOM   2096 C CA  . LEU A 1 280 ? 59.648  -14.814 362.155 1.00 33.11  ? 281  LEU A CA  1 
ATOM   2097 C C   . LEU A 1 280 ? 58.754  -14.851 360.920 1.00 31.40  ? 281  LEU A C   1 
ATOM   2098 O O   . LEU A 1 280 ? 59.249  -14.761 359.790 1.00 31.22  ? 281  LEU A O   1 
ATOM   2099 C CB  . LEU A 1 280 ? 59.924  -16.229 362.667 1.00 32.08  ? 281  LEU A CB  1 
ATOM   2100 C CG  . LEU A 1 280 ? 60.742  -16.353 363.955 1.00 34.79  ? 281  LEU A CG  1 
ATOM   2101 C CD1 . LEU A 1 280 ? 60.883  -17.813 364.361 1.00 31.40  ? 281  LEU A CD1 1 
ATOM   2102 C CD2 . LEU A 1 280 ? 62.108  -15.697 363.804 1.00 26.61  ? 281  LEU A CD2 1 
ATOM   2103 N N   . VAL A 1 281 ? 57.438  -14.970 361.115 1.00 31.02  ? 282  VAL A N   1 
ATOM   2104 C CA  . VAL A 1 281 ? 56.512  -14.980 359.984 1.00 30.33  ? 282  VAL A CA  1 
ATOM   2105 C C   . VAL A 1 281 ? 56.629  -13.690 359.182 1.00 32.68  ? 282  VAL A C   1 
ATOM   2106 O O   . VAL A 1 281 ? 56.608  -13.706 357.945 1.00 33.10  ? 282  VAL A O   1 
ATOM   2107 C CB  . VAL A 1 281 ? 55.070  -15.212 360.479 1.00 28.01  ? 282  VAL A CB  1 
ATOM   2108 C CG1 . VAL A 1 281 ? 54.068  -14.880 359.386 1.00 22.70  ? 282  VAL A CG1 1 
ATOM   2109 C CG2 . VAL A 1 281 ? 54.893  -16.650 360.942 1.00 23.78  ? 282  VAL A CG2 1 
ATOM   2110 N N   . ASN A 1 282 ? 56.777  -12.555 359.870 1.00 30.30  ? 283  ASN A N   1 
ATOM   2111 C CA  . ASN A 1 282 ? 56.795  -11.262 359.195 1.00 33.34  ? 283  ASN A CA  1 
ATOM   2112 C C   . ASN A 1 282 ? 58.003  -11.076 358.285 1.00 37.65  ? 283  ASN A C   1 
ATOM   2113 O O   . ASN A 1 282 ? 57.957  -10.226 357.390 1.00 41.14  ? 283  ASN A O   1 
ATOM   2114 C CB  . ASN A 1 282 ? 56.754  -10.128 360.223 1.00 33.92  ? 283  ASN A CB  1 
ATOM   2115 C CG  . ASN A 1 282 ? 55.407  -10.007 360.908 1.00 42.57  ? 283  ASN A CG  1 
ATOM   2116 O OD1 . ASN A 1 282 ? 54.388  -10.465 360.388 1.00 40.44  ? 283  ASN A OD1 1 
ATOM   2117 N ND2 . ASN A 1 282 ? 55.393  -9.382  362.079 1.00 44.75  ? 283  ASN A ND2 1 
ATOM   2118 N N   . HIS A 1 283 ? 59.078  -11.838 358.485 1.00 34.45  ? 284  HIS A N   1 
ATOM   2119 C CA  . HIS A 1 283 ? 60.301  -11.666 357.709 1.00 35.38  ? 284  HIS A CA  1 
ATOM   2120 C C   . HIS A 1 283 ? 60.561  -12.810 356.742 1.00 33.89  ? 284  HIS A C   1 
ATOM   2121 O O   . HIS A 1 283 ? 61.609  -12.822 356.086 1.00 37.85  ? 284  HIS A O   1 
ATOM   2122 C CB  . HIS A 1 283 ? 61.506  -11.510 358.636 1.00 35.41  ? 284  HIS A CB  1 
ATOM   2123 C CG  . HIS A 1 283 ? 61.523  -10.221 359.393 1.00 39.76  ? 284  HIS A CG  1 
ATOM   2124 N ND1 . HIS A 1 283 ? 60.950  -10.082 360.639 1.00 41.60  ? 284  HIS A ND1 1 
ATOM   2125 C CD2 . HIS A 1 283 ? 62.049  -9.013  359.083 1.00 41.25  ? 284  HIS A CD2 1 
ATOM   2126 C CE1 . HIS A 1 283 ? 61.121  -8.843  361.063 1.00 43.37  ? 284  HIS A CE1 1 
ATOM   2127 N NE2 . HIS A 1 283 ? 61.785  -8.174  360.138 1.00 44.65  ? 284  HIS A NE2 1 
ATOM   2128 N N   . GLU A 1 284 ? 59.673  -13.758 356.688 1.00 34.12  ? 285  GLU A N   1 
ATOM   2129 C CA  . GLU A 1 284 ? 59.882  -14.915 355.916 1.00 40.40  ? 285  GLU A CA  1 
ATOM   2130 C C   . GLU A 1 284 ? 60.102  -14.763 354.428 1.00 37.57  ? 285  GLU A C   1 
ATOM   2131 O O   . GLU A 1 284 ? 60.951  -15.386 353.904 1.00 41.56  ? 285  GLU A O   1 
ATOM   2132 C CB  . GLU A 1 284 ? 58.723  -15.849 356.173 1.00 45.24  ? 285  GLU A CB  1 
ATOM   2133 C CG  . GLU A 1 284 ? 58.694  -17.067 355.297 1.00 60.71  ? 285  GLU A CG  1 
ATOM   2134 C CD  . GLU A 1 284 ? 57.415  -17.845 355.352 1.00 63.87  ? 285  GLU A CD  1 
ATOM   2135 O OE1 . GLU A 1 284 ? 56.923  -18.201 354.310 1.00 71.86  ? 285  GLU A OE1 1 
ATOM   2136 O OE2 . GLU A 1 284 ? 56.934  -18.151 356.403 1.00 51.77  ? 285  GLU A OE2 1 
ATOM   2137 N N   . TRP A 1 285 ? 59.346  -13.935 353.774 1.00 35.29  ? 286  TRP A N   1 
ATOM   2138 C CA  . TRP A 1 285 ? 59.443  -13.801 352.324 1.00 44.99  ? 286  TRP A CA  1 
ATOM   2139 C C   . TRP A 1 285 ? 60.693  -13.052 351.894 1.00 41.96  ? 286  TRP A C   1 
ATOM   2140 O O   . TRP A 1 285 ? 61.057  -13.113 350.715 1.00 47.15  ? 286  TRP A O   1 
ATOM   2141 C CB  . TRP A 1 285 ? 58.197  -13.107 351.765 1.00 49.58  ? 286  TRP A CB  1 
ATOM   2142 C CG  . TRP A 1 285 ? 56.940  -13.906 351.954 1.00 58.15  ? 286  TRP A CG  1 
ATOM   2143 C CD1 . TRP A 1 285 ? 56.022  -13.762 352.954 1.00 59.28  ? 286  TRP A CD1 1 
ATOM   2144 C CD2 . TRP A 1 285 ? 56.463  -14.975 351.124 1.00 62.46  ? 286  TRP A CD2 1 
ATOM   2145 N NE1 . TRP A 1 285 ? 55.005  -14.672 352.799 1.00 54.39  ? 286  TRP A NE1 1 
ATOM   2146 C CE2 . TRP A 1 285 ? 55.251  -15.429 351.683 1.00 55.73  ? 286  TRP A CE2 1 
ATOM   2147 C CE3 . TRP A 1 285 ? 56.942  -15.592 349.963 1.00 63.97  ? 286  TRP A CE3 1 
ATOM   2148 C CZ2 . TRP A 1 285 ? 54.512  -16.469 351.123 1.00 53.84  ? 286  TRP A CZ2 1 
ATOM   2149 C CZ3 . TRP A 1 285 ? 56.205  -16.625 349.408 1.00 61.05  ? 286  TRP A CZ3 1 
ATOM   2150 C CH2 . TRP A 1 285 ? 55.004  -17.053 349.988 1.00 56.76  ? 286  TRP A CH2 1 
ATOM   2151 N N   . HIS A 1 286 ? 61.369  -12.378 352.821 1.00 36.52  ? 287  HIS A N   1 
ATOM   2152 C CA  . HIS A 1 286 ? 62.552  -11.599 352.495 1.00 41.30  ? 287  HIS A CA  1 
ATOM   2153 C C   . HIS A 1 286 ? 63.787  -12.454 352.244 1.00 42.55  ? 287  HIS A C   1 
ATOM   2154 O O   . HIS A 1 286 ? 64.761  -11.947 351.677 1.00 44.99  ? 287  HIS A O   1 
ATOM   2155 C CB  . HIS A 1 286 ? 62.825  -10.597 353.618 1.00 50.55  ? 287  HIS A CB  1 
ATOM   2156 C CG  . HIS A 1 286 ? 61.679  -9.671  353.886 1.00 66.92  ? 287  HIS A CG  1 
ATOM   2157 N ND1 . HIS A 1 286 ? 60.851  -9.205  352.888 1.00 71.95  ? 287  HIS A ND1 1 
ATOM   2158 C CD2 . HIS A 1 286 ? 61.222  -9.125  355.038 1.00 72.37  ? 287  HIS A CD2 1 
ATOM   2159 C CE1 . HIS A 1 286 ? 59.934  -8.412  353.412 1.00 72.44  ? 287  HIS A CE1 1 
ATOM   2160 N NE2 . HIS A 1 286 ? 60.137  -8.346  354.715 1.00 73.32  ? 287  HIS A NE2 1 
ATOM   2161 N N   . VAL A 1 287 ? 63.778  -13.734 352.633 1.00 31.41  ? 288  VAL A N   1 
ATOM   2162 C CA  . VAL A 1 287 ? 64.955  -14.577 352.423 1.00 38.24  ? 288  VAL A CA  1 
ATOM   2163 C C   . VAL A 1 287 ? 65.016  -15.181 351.030 1.00 43.19  ? 288  VAL A C   1 
ATOM   2164 O O   . VAL A 1 287 ? 66.038  -15.783 350.676 1.00 44.85  ? 288  VAL A O   1 
ATOM   2165 C CB  . VAL A 1 287 ? 65.031  -15.714 353.460 1.00 33.75  ? 288  VAL A CB  1 
ATOM   2166 C CG1 . VAL A 1 287 ? 64.842  -15.167 354.867 1.00 38.80  ? 288  VAL A CG1 1 
ATOM   2167 C CG2 . VAL A 1 287 ? 64.003  -16.789 353.154 1.00 27.88  ? 288  VAL A CG2 1 
ATOM   2168 N N   . LEU A 1 288 ? 63.963  -15.040 350.230 1.00 37.10  ? 289  LEU A N   1 
ATOM   2169 C CA  . LEU A 1 288 ? 63.990  -15.575 348.877 1.00 37.85  ? 289  LEU A CA  1 
ATOM   2170 C C   . LEU A 1 288 ? 64.998  -14.800 348.030 1.00 42.66  ? 289  LEU A C   1 
ATOM   2171 O O   . LEU A 1 288 ? 65.053  -13.568 348.099 1.00 46.27  ? 289  LEU A O   1 
ATOM   2172 C CB  . LEU A 1 288 ? 62.604  -15.508 348.238 1.00 32.20  ? 289  LEU A CB  1 
ATOM   2173 C CG  . LEU A 1 288 ? 61.709  -16.723 348.492 1.00 39.32  ? 289  LEU A CG  1 
ATOM   2174 C CD1 . LEU A 1 288 ? 60.384  -16.586 347.757 1.00 40.44  ? 289  LEU A CD1 1 
ATOM   2175 C CD2 . LEU A 1 288 ? 62.423  -18.007 348.092 1.00 34.46  ? 289  LEU A CD2 1 
ATOM   2176 N N   . PRO A 1 289 ? 65.810  -15.491 347.225 1.00 46.10  ? 290  PRO A N   1 
ATOM   2177 C CA  . PRO A 1 289 ? 66.898  -14.799 346.516 1.00 51.93  ? 290  PRO A CA  1 
ATOM   2178 C C   . PRO A 1 289 ? 66.437  -13.831 345.435 1.00 60.55  ? 290  PRO A C   1 
ATOM   2179 O O   . PRO A 1 289 ? 67.219  -12.944 345.070 1.00 60.13  ? 290  PRO A O   1 
ATOM   2180 C CB  . PRO A 1 289 ? 67.722  -15.949 345.916 1.00 46.58  ? 290  PRO A CB  1 
ATOM   2181 C CG  . PRO A 1 289 ? 66.818  -17.134 345.924 1.00 47.84  ? 290  PRO A CG  1 
ATOM   2182 C CD  . PRO A 1 289 ? 65.889  -16.955 347.083 1.00 47.22  ? 290  PRO A CD  1 
ATOM   2183 N N   . GLN A 1 290 ? 65.256  -14.067 344.863 1.00 68.58  ? 291  GLN A N   1 
ATOM   2184 C CA  . GLN A 1 290 ? 64.764  -13.269 343.737 1.00 79.30  ? 291  GLN A CA  1 
ATOM   2185 C C   . GLN A 1 290 ? 63.252  -13.045 343.649 1.00 73.09  ? 291  GLN A C   1 
ATOM   2186 O O   . GLN A 1 290 ? 62.462  -13.682 344.345 1.00 70.98  ? 291  GLN A O   1 
ATOM   2187 C CB  . GLN A 1 290 ? 65.271  -13.859 342.416 1.00 90.31  ? 291  GLN A CB  1 
ATOM   2188 C CG  . GLN A 1 290 ? 66.786  -13.886 342.289 1.00 102.64 ? 291  GLN A CG  1 
ATOM   2189 C CD  . GLN A 1 290 ? 67.413  -12.505 342.363 1.00 113.10 ? 291  GLN A CD  1 
ATOM   2190 O OE1 . GLN A 1 290 ? 68.632  -12.371 342.469 1.00 120.16 ? 291  GLN A OE1 1 
ATOM   2191 N NE2 . GLN A 1 290 ? 66.581  -11.469 342.309 1.00 109.78 ? 291  GLN A NE2 1 
ATOM   2192 N N   . GLU A 1 291 ? 62.882  -12.112 342.775 1.00 67.87  ? 292  GLU A N   1 
ATOM   2193 C CA  . GLU A 1 291 ? 61.498  -11.699 342.543 1.00 69.77  ? 292  GLU A CA  1 
ATOM   2194 C C   . GLU A 1 291 ? 60.771  -12.799 341.775 1.00 67.39  ? 292  GLU A C   1 
ATOM   2195 O O   . GLU A 1 291 ? 60.927  -12.924 340.558 1.00 73.41  ? 292  GLU A O   1 
ATOM   2196 C CB  . GLU A 1 291 ? 61.509  -10.386 341.767 1.00 76.46  ? 292  GLU A CB  1 
ATOM   2197 C CG  . GLU A 1 291 ? 60.185  -9.692  341.545 1.00 82.16  ? 292  GLU A CG  1 
ATOM   2198 C CD  . GLU A 1 291 ? 60.202  -8.856  340.273 1.00 88.29  ? 292  GLU A CD  1 
ATOM   2199 O OE1 . GLU A 1 291 ? 59.133  -8.353  339.870 1.00 89.15  ? 292  GLU A OE1 1 
ATOM   2200 O OE2 . GLU A 1 291 ? 61.288  -8.716  339.668 1.00 90.76  ? 292  GLU A OE2 1 
ATOM   2201 N N   . SER A 1 292 ? 59.970  -13.610 342.472 1.00 58.82  ? 293  SER A N   1 
ATOM   2202 C CA  . SER A 1 292 ? 59.398  -14.807 341.864 1.00 53.99  ? 293  SER A CA  1 
ATOM   2203 C C   . SER A 1 292 ? 57.932  -14.987 342.223 1.00 49.89  ? 293  SER A C   1 
ATOM   2204 O O   . SER A 1 292 ? 57.412  -14.390 343.169 1.00 54.82  ? 293  SER A O   1 
ATOM   2205 C CB  . SER A 1 292 ? 60.132  -16.082 342.293 1.00 56.37  ? 293  SER A CB  1 
ATOM   2206 O OG  . SER A 1 292 ? 60.106  -16.235 343.703 1.00 59.08  ? 293  SER A OG  1 
ATOM   2207 N N   . VAL A 1 293 ? 57.280  -15.848 341.441 1.00 44.41  ? 294  VAL A N   1 
ATOM   2208 C CA  . VAL A 1 293 ? 56.027  -16.493 341.805 1.00 46.03  ? 294  VAL A CA  1 
ATOM   2209 C C   . VAL A 1 293 ? 56.288  -17.992 341.869 1.00 44.79  ? 294  VAL A C   1 
ATOM   2210 O O   . VAL A 1 293 ? 57.216  -18.504 341.233 1.00 39.52  ? 294  VAL A O   1 
ATOM   2211 C CB  . VAL A 1 293 ? 54.881  -16.177 340.816 1.00 49.65  ? 294  VAL A CB  1 
ATOM   2212 C CG1 . VAL A 1 293 ? 54.704  -14.676 340.665 1.00 53.20  ? 294  VAL A CG1 1 
ATOM   2213 C CG2 . VAL A 1 293 ? 55.137  -16.834 339.465 1.00 48.59  ? 294  VAL A CG2 1 
ATOM   2214 N N   . PHE A 1 294 ? 55.471  -18.692 342.658 1.00 43.63  ? 295  PHE A N   1 
ATOM   2215 C CA  . PHE A 1 294 ? 55.568  -20.145 342.814 1.00 39.65  ? 295  PHE A CA  1 
ATOM   2216 C C   . PHE A 1 294 ? 56.906  -20.569 343.420 1.00 40.34  ? 295  PHE A C   1 
ATOM   2217 O O   . PHE A 1 294 ? 57.438  -21.633 343.096 1.00 41.75  ? 295  PHE A O   1 
ATOM   2218 C CB  . PHE A 1 294 ? 55.332  -20.864 341.481 1.00 39.88  ? 295  PHE A CB  1 
ATOM   2219 C CG  . PHE A 1 294 ? 54.493  -22.105 341.597 1.00 36.84  ? 295  PHE A CG  1 
ATOM   2220 C CD1 . PHE A 1 294 ? 53.453  -22.336 340.713 1.00 34.17  ? 295  PHE A CD1 1 
ATOM   2221 C CD2 . PHE A 1 294 ? 54.749  -23.045 342.581 1.00 38.11  ? 295  PHE A CD2 1 
ATOM   2222 C CE1 . PHE A 1 294 ? 52.682  -23.478 340.811 1.00 33.98  ? 295  PHE A CE1 1 
ATOM   2223 C CE2 . PHE A 1 294 ? 53.980  -24.188 342.684 1.00 39.39  ? 295  PHE A CE2 1 
ATOM   2224 C CZ  . PHE A 1 294 ? 52.944  -24.404 341.799 1.00 38.22  ? 295  PHE A CZ  1 
ATOM   2225 N N   . ARG A 1 295 ? 57.466  -19.740 344.298 1.00 32.91  ? 296  ARG A N   1 
ATOM   2226 C CA  . ARG A 1 295 ? 58.644  -20.099 345.074 1.00 31.01  ? 296  ARG A CA  1 
ATOM   2227 C C   . ARG A 1 295 ? 58.384  -19.774 346.536 1.00 34.31  ? 296  ARG A C   1 
ATOM   2228 O O   . ARG A 1 295 ? 57.761  -18.756 346.854 1.00 32.24  ? 296  ARG A O   1 
ATOM   2229 C CB  . ARG A 1 295 ? 59.900  -19.370 344.586 1.00 28.86  ? 296  ARG A CB  1 
ATOM   2230 C CG  . ARG A 1 295 ? 60.443  -19.882 343.260 1.00 34.34  ? 296  ARG A CG  1 
ATOM   2231 C CD  . ARG A 1 295 ? 60.697  -21.384 343.284 1.00 34.51  ? 296  ARG A CD  1 
ATOM   2232 N NE  . ARG A 1 295 ? 61.342  -21.834 342.053 1.00 39.48  ? 296  ARG A NE  1 
ATOM   2233 C CZ  . ARG A 1 295 ? 60.688  -22.236 340.967 1.00 41.50  ? 296  ARG A CZ  1 
ATOM   2234 N NH1 . ARG A 1 295 ? 59.362  -22.253 340.956 1.00 32.08  ? 296  ARG A NH1 1 
ATOM   2235 N NH2 . ARG A 1 295 ? 61.362  -22.623 339.892 1.00 40.90  ? 296  ARG A NH2 1 
ATOM   2236 N N   . PHE A 1 296 ? 58.862  -20.642 347.421 1.00 27.18  ? 297  PHE A N   1 
ATOM   2237 C CA  . PHE A 1 296 ? 58.546  -20.564 348.838 1.00 24.68  ? 297  PHE A CA  1 
ATOM   2238 C C   . PHE A 1 296 ? 59.824  -20.699 349.654 1.00 28.53  ? 297  PHE A C   1 
ATOM   2239 O O   . PHE A 1 296 ? 60.727  -21.459 349.291 1.00 30.88  ? 297  PHE A O   1 
ATOM   2240 C CB  . PHE A 1 296 ? 57.522  -21.640 349.206 1.00 21.00  ? 297  PHE A CB  1 
ATOM   2241 C CG  . PHE A 1 296 ? 56.442  -21.812 348.170 1.00 21.45  ? 297  PHE A CG  1 
ATOM   2242 C CD1 . PHE A 1 296 ? 55.465  -20.842 348.005 1.00 22.08  ? 297  PHE A CD1 1 
ATOM   2243 C CD2 . PHE A 1 296 ? 56.421  -22.923 347.343 1.00 18.77  ? 297  PHE A CD2 1 
ATOM   2244 C CE1 . PHE A 1 296 ? 54.477  -20.985 347.047 1.00 26.19  ? 297  PHE A CE1 1 
ATOM   2245 C CE2 . PHE A 1 296 ? 55.434  -23.073 346.381 1.00 23.98  ? 297  PHE A CE2 1 
ATOM   2246 C CZ  . PHE A 1 296 ? 54.461  -22.102 346.234 1.00 26.26  ? 297  PHE A CZ  1 
ATOM   2247 N N   . SER A 1 297 ? 59.890  -19.950 350.757 1.00 25.52  ? 298  SER A N   1 
ATOM   2248 C CA  . SER A 1 297 ? 61.150  -19.775 351.474 1.00 29.23  ? 298  SER A CA  1 
ATOM   2249 C C   . SER A 1 297 ? 61.630  -21.078 352.100 1.00 27.51  ? 298  SER A C   1 
ATOM   2250 O O   . SER A 1 297 ? 62.765  -21.510 351.866 1.00 26.13  ? 298  SER A O   1 
ATOM   2251 C CB  . SER A 1 297 ? 60.992  -18.698 352.548 1.00 28.10  ? 298  SER A CB  1 
ATOM   2252 O OG  . SER A 1 297 ? 60.910  -17.408 351.969 1.00 31.24  ? 298  SER A OG  1 
ATOM   2253 N N   . PHE A 1 298 ? 60.786  -21.713 352.906 1.00 19.35  ? 299  PHE A N   1 
ATOM   2254 C CA  . PHE A 1 298 ? 61.194  -22.854 353.714 1.00 26.20  ? 299  PHE A CA  1 
ATOM   2255 C C   . PHE A 1 298 ? 60.420  -24.081 353.258 1.00 22.99  ? 299  PHE A C   1 
ATOM   2256 O O   . PHE A 1 298 ? 59.210  -24.188 353.491 1.00 19.46  ? 299  PHE A O   1 
ATOM   2257 C CB  . PHE A 1 298 ? 60.991  -22.551 355.196 1.00 22.63  ? 299  PHE A CB  1 
ATOM   2258 C CG  . PHE A 1 298 ? 61.879  -21.449 355.689 1.00 24.21  ? 299  PHE A CG  1 
ATOM   2259 C CD1 . PHE A 1 298 ? 63.216  -21.692 355.949 1.00 22.01  ? 299  PHE A CD1 1 
ATOM   2260 C CD2 . PHE A 1 298 ? 61.394  -20.161 355.846 1.00 18.43  ? 299  PHE A CD2 1 
ATOM   2261 C CE1 . PHE A 1 298 ? 64.049  -20.684 356.385 1.00 23.09  ? 299  PHE A CE1 1 
ATOM   2262 C CE2 . PHE A 1 298 ? 62.224  -19.144 356.282 1.00 25.18  ? 299  PHE A CE2 1 
ATOM   2263 C CZ  . PHE A 1 298 ? 63.554  -19.407 356.551 1.00 27.92  ? 299  PHE A CZ  1 
ATOM   2264 N N   . VAL A 1 299 ? 61.125  -24.992 352.596 1.00 21.41  ? 300  VAL A N   1 
ATOM   2265 C CA  . VAL A 1 299 ? 60.545  -26.175 351.970 1.00 18.78  ? 300  VAL A CA  1 
ATOM   2266 C C   . VAL A 1 299 ? 61.425  -27.365 352.336 1.00 22.63  ? 300  VAL A C   1 
ATOM   2267 O O   . VAL A 1 299 ? 62.496  -27.170 352.931 1.00 20.61  ? 300  VAL A O   1 
ATOM   2268 C CB  . VAL A 1 299 ? 60.436  -25.997 350.446 1.00 21.82  ? 300  VAL A CB  1 
ATOM   2269 C CG1 . VAL A 1 299 ? 59.526  -24.826 350.102 1.00 16.15  ? 300  VAL A CG1 1 
ATOM   2270 C CG2 . VAL A 1 299 ? 61.818  -25.817 349.836 1.00 17.64  ? 300  VAL A CG2 1 
ATOM   2271 N N   . PRO A 1 300 ? 61.020  -28.599 352.027 1.00 21.93  ? 301  PRO A N   1 
ATOM   2272 C CA  . PRO A 1 300 ? 61.873  -29.751 352.339 1.00 21.11  ? 301  PRO A CA  1 
ATOM   2273 C C   . PRO A 1 300 ? 63.294  -29.616 351.802 1.00 27.97  ? 301  PRO A C   1 
ATOM   2274 O O   . PRO A 1 300 ? 63.529  -29.122 350.703 1.00 24.05  ? 301  PRO A O   1 
ATOM   2275 C CB  . PRO A 1 300 ? 61.128  -30.915 351.683 1.00 20.36  ? 301  PRO A CB  1 
ATOM   2276 C CG  . PRO A 1 300 ? 59.706  -30.529 351.837 1.00 16.79  ? 301  PRO A CG  1 
ATOM   2277 C CD  . PRO A 1 300 ? 59.663  -29.032 351.643 1.00 15.61  ? 301  PRO A CD  1 
ATOM   2278 N N   . VAL A 1 301 ? 64.239  -30.073 352.618 1.00 22.51  ? 302  VAL A N   1 
ATOM   2279 C CA  . VAL A 1 301 ? 65.666  -30.042 352.318 1.00 23.78  ? 302  VAL A CA  1 
ATOM   2280 C C   . VAL A 1 301 ? 66.076  -31.426 351.820 1.00 24.11  ? 302  VAL A C   1 
ATOM   2281 O O   . VAL A 1 301 ? 65.616  -32.447 352.345 1.00 24.05  ? 302  VAL A O   1 
ATOM   2282 C CB  . VAL A 1 301 ? 66.468  -29.611 353.568 1.00 33.20  ? 302  VAL A CB  1 
ATOM   2283 C CG1 . VAL A 1 301 ? 66.417  -30.678 354.648 1.00 38.26  ? 302  VAL A CG1 1 
ATOM   2284 C CG2 . VAL A 1 301 ? 67.904  -29.277 353.208 1.00 28.70  ? 302  VAL A CG2 1 
ATOM   2285 N N   . VAL A 1 302 ? 66.891  -31.464 350.767 1.00 25.21  ? 303  VAL A N   1 
ATOM   2286 C CA  . VAL A 1 302 ? 67.503  -32.715 350.318 1.00 27.60  ? 303  VAL A CA  1 
ATOM   2287 C C   . VAL A 1 302 ? 68.855  -32.805 351.018 1.00 36.08  ? 303  VAL A C   1 
ATOM   2288 O O   . VAL A 1 302 ? 69.838  -32.196 350.589 1.00 37.98  ? 303  VAL A O   1 
ATOM   2289 C CB  . VAL A 1 302 ? 67.642  -32.793 348.798 1.00 30.54  ? 303  VAL A CB  1 
ATOM   2290 C CG1 . VAL A 1 302 ? 68.276  -34.117 348.409 1.00 29.55  ? 303  VAL A CG1 1 
ATOM   2291 C CG2 . VAL A 1 302 ? 66.288  -32.642 348.125 1.00 26.63  ? 303  VAL A CG2 1 
ATOM   2292 N N   . ASP A 1 303 ? 68.908  -33.575 352.104 1.00 38.81  ? 304  ASP A N   1 
ATOM   2293 C CA  . ASP A 1 303 ? 70.075  -33.591 352.975 1.00 40.90  ? 304  ASP A CA  1 
ATOM   2294 C C   . ASP A 1 303 ? 70.586  -34.994 353.279 1.00 41.29  ? 304  ASP A C   1 
ATOM   2295 O O   . ASP A 1 303 ? 71.469  -35.143 354.131 1.00 43.71  ? 304  ASP A O   1 
ATOM   2296 C CB  . ASP A 1 303 ? 69.766  -32.861 354.287 1.00 42.76  ? 304  ASP A CB  1 
ATOM   2297 C CG  . ASP A 1 303 ? 68.823  -33.642 355.185 1.00 45.07  ? 304  ASP A CG  1 
ATOM   2298 O OD1 . ASP A 1 303 ? 68.047  -34.477 354.669 1.00 45.30  ? 304  ASP A OD1 1 
ATOM   2299 O OD2 . ASP A 1 303 ? 68.861  -33.424 356.413 1.00 50.96  ? 304  ASP A OD2 1 
ATOM   2300 N N   . GLY A 1 304 ? 70.057  -36.025 352.623 1.00 39.50  ? 305  GLY A N   1 
ATOM   2301 C CA  . GLY A 1 304 ? 70.503  -37.382 352.837 1.00 41.02  ? 305  GLY A CA  1 
ATOM   2302 C C   . GLY A 1 304 ? 69.734  -38.159 353.887 1.00 47.00  ? 305  GLY A C   1 
ATOM   2303 O O   . GLY A 1 304 ? 69.838  -39.390 353.922 1.00 53.56  ? 305  GLY A O   1 
ATOM   2304 N N   . ASP A 1 305 ? 68.936  -37.522 354.720 1.00 39.81  ? 306  ASP A N   1 
ATOM   2305 C CA  . ASP A 1 305 ? 68.220  -38.263 355.733 1.00 35.65  ? 306  ASP A CA  1 
ATOM   2306 C C   . ASP A 1 305 ? 66.806  -38.599 355.319 1.00 36.80  ? 306  ASP A C   1 
ATOM   2307 O O   . ASP A 1 305 ? 66.561  -39.685 354.891 1.00 39.60  ? 306  ASP A O   1 
ATOM   2308 C CB  . ASP A 1 305 ? 68.236  -37.444 356.997 1.00 41.85  ? 306  ASP A CB  1 
ATOM   2309 C CG  . ASP A 1 305 ? 67.747  -38.178 358.177 1.00 51.71  ? 306  ASP A CG  1 
ATOM   2310 O OD1 . ASP A 1 305 ? 67.473  -39.343 358.096 1.00 54.28  ? 306  ASP A OD1 1 
ATOM   2311 O OD2 . ASP A 1 305 ? 67.633  -37.571 359.222 1.00 56.48  ? 306  ASP A OD2 1 
ATOM   2312 N N   . PHE A 1 306 ? 65.876  -37.671 355.387 1.00 31.69  ? 307  PHE A N   1 
ATOM   2313 C CA  . PHE A 1 306 ? 64.532  -37.997 354.918 1.00 29.92  ? 307  PHE A CA  1 
ATOM   2314 C C   . PHE A 1 306 ? 64.552  -38.410 353.452 1.00 31.49  ? 307  PHE A C   1 
ATOM   2315 O O   . PHE A 1 306 ? 63.900  -39.387 353.064 1.00 27.51  ? 307  PHE A O   1 
ATOM   2316 C CB  . PHE A 1 306 ? 63.590  -36.809 355.127 1.00 29.03  ? 307  PHE A CB  1 
ATOM   2317 C CG  . PHE A 1 306 ? 62.132  -37.181 355.102 1.00 28.81  ? 307  PHE A CG  1 
ATOM   2318 C CD1 . PHE A 1 306 ? 61.487  -37.441 353.902 1.00 29.60  ? 307  PHE A CD1 1 
ATOM   2319 C CD2 . PHE A 1 306 ? 61.409  -37.276 356.277 1.00 27.75  ? 307  PHE A CD2 1 
ATOM   2320 C CE1 . PHE A 1 306 ? 60.150  -37.787 353.877 1.00 26.43  ? 307  PHE A CE1 1 
ATOM   2321 C CE2 . PHE A 1 306 ? 60.071  -37.621 356.258 1.00 30.30  ? 307  PHE A CE2 1 
ATOM   2322 C CZ  . PHE A 1 306 ? 59.441  -37.877 355.056 1.00 26.53  ? 307  PHE A CZ  1 
ATOM   2323 N N   . LEU A 1 307 ? 65.296  -37.681 352.627 1.00 30.05  ? 308  LEU A N   1 
ATOM   2324 C CA  . LEU A 1 307 ? 65.489  -38.013 351.220 1.00 34.19  ? 308  LEU A CA  1 
ATOM   2325 C C   . LEU A 1 307 ? 66.972  -38.282 351.009 1.00 35.59  ? 308  LEU A C   1 
ATOM   2326 O O   . LEU A 1 307 ? 67.793  -37.364 351.115 1.00 34.62  ? 308  LEU A O   1 
ATOM   2327 C CB  . LEU A 1 307 ? 64.998  -36.883 350.317 1.00 30.59  ? 308  LEU A CB  1 
ATOM   2328 C CG  . LEU A 1 307 ? 63.567  -36.407 350.565 1.00 39.35  ? 308  LEU A CG  1 
ATOM   2329 C CD1 . LEU A 1 307 ? 63.323  -35.063 349.895 1.00 38.20  ? 308  LEU A CD1 1 
ATOM   2330 C CD2 . LEU A 1 307 ? 62.568  -37.445 350.076 1.00 41.52  ? 308  LEU A CD2 1 
ATOM   2331 N N   . SER A 1 308 ? 67.318  -39.539 350.721 1.00 35.31  ? 309  SER A N   1 
ATOM   2332 C CA  . SER A 1 308 ? 68.718  -39.890 350.512 1.00 41.77  ? 309  SER A CA  1 
ATOM   2333 C C   . SER A 1 308 ? 69.285  -39.270 349.241 1.00 45.51  ? 309  SER A C   1 
ATOM   2334 O O   . SER A 1 308 ? 70.509  -39.154 349.115 1.00 54.12  ? 309  SER A O   1 
ATOM   2335 C CB  . SER A 1 308 ? 68.881  -41.411 350.480 1.00 44.98  ? 309  SER A CB  1 
ATOM   2336 O OG  . SER A 1 308 ? 68.063  -41.997 349.483 1.00 48.94  ? 309  SER A OG  1 
ATOM   2337 N N   . ASP A 1 309 ? 68.428  -38.873 348.304 1.00 44.15  ? 310  ASP A N   1 
ATOM   2338 C CA  . ASP A 1 309 ? 68.839  -38.123 347.127 1.00 40.94  ? 310  ASP A CA  1 
ATOM   2339 C C   . ASP A 1 309 ? 67.673  -37.233 346.711 1.00 37.87  ? 310  ASP A C   1 
ATOM   2340 O O   . ASP A 1 309 ? 66.633  -37.191 347.374 1.00 42.56  ? 310  ASP A O   1 
ATOM   2341 C CB  . ASP A 1 309 ? 69.279  -39.060 345.993 1.00 44.13  ? 310  ASP A CB  1 
ATOM   2342 C CG  . ASP A 1 309 ? 70.093  -38.347 344.921 1.00 49.69  ? 310  ASP A CG  1 
ATOM   2343 O OD1 . ASP A 1 309 ? 70.888  -39.017 344.230 1.00 54.96  ? 310  ASP A OD1 1 
ATOM   2344 O OD2 . ASP A 1 309 ? 69.934  -37.118 344.763 1.00 58.08  ? 310  ASP A OD2 1 
ATOM   2345 N N   . THR A 1 310 ? 67.860  -36.510 345.609 1.00 34.81  ? 311  THR A N   1 
ATOM   2346 C CA  . THR A 1 310 ? 66.797  -35.679 345.072 1.00 36.27  ? 311  THR A CA  1 
ATOM   2347 C C   . THR A 1 310 ? 65.592  -36.546 344.708 1.00 37.22  ? 311  THR A C   1 
ATOM   2348 O O   . THR A 1 310 ? 65.744  -37.727 344.382 1.00 35.63  ? 311  THR A O   1 
ATOM   2349 C CB  . THR A 1 310 ? 67.275  -34.923 343.834 1.00 39.51  ? 311  THR A CB  1 
ATOM   2350 O OG1 . THR A 1 310 ? 67.549  -35.856 342.780 1.00 45.57  ? 311  THR A OG1 1 
ATOM   2351 C CG2 . THR A 1 310 ? 68.537  -34.134 344.144 1.00 38.60  ? 311  THR A CG2 1 
ATOM   2352 N N   . PRO A 1 311 ? 64.381  -35.991 344.778 1.00 34.82  ? 312  PRO A N   1 
ATOM   2353 C CA  . PRO A 1 311 ? 63.214  -36.740 344.288 1.00 30.79  ? 312  PRO A CA  1 
ATOM   2354 C C   . PRO A 1 311 ? 63.376  -37.216 342.855 1.00 32.46  ? 312  PRO A C   1 
ATOM   2355 O O   . PRO A 1 311 ? 62.994  -38.349 342.544 1.00 36.91  ? 312  PRO A O   1 
ATOM   2356 C CB  . PRO A 1 311 ? 62.071  -35.729 344.440 1.00 28.16  ? 312  PRO A CB  1 
ATOM   2357 C CG  . PRO A 1 311 ? 62.497  -34.875 345.590 1.00 31.13  ? 312  PRO A CG  1 
ATOM   2358 C CD  . PRO A 1 311 ? 63.992  -34.740 345.453 1.00 34.35  ? 312  PRO A CD  1 
ATOM   2359 N N   . GLU A 1 312 ? 63.957  -36.390 341.980 1.00 36.83  ? 313  GLU A N   1 
ATOM   2360 C CA  . GLU A 1 312 ? 64.220  -36.814 340.607 1.00 48.63  ? 313  GLU A CA  1 
ATOM   2361 C C   . GLU A 1 312 ? 65.032  -38.104 340.571 1.00 46.57  ? 313  GLU A C   1 
ATOM   2362 O O   . GLU A 1 312 ? 64.660  -39.068 339.893 1.00 47.50  ? 313  GLU A O   1 
ATOM   2363 C CB  . GLU A 1 312 ? 64.953  -35.707 339.846 1.00 61.89  ? 313  GLU A CB  1 
ATOM   2364 C CG  . GLU A 1 312 ? 64.047  -34.759 339.077 1.00 75.52  ? 313  GLU A CG  1 
ATOM   2365 C CD  . GLU A 1 312 ? 63.687  -33.521 339.873 1.00 86.52  ? 313  GLU A CD  1 
ATOM   2366 O OE1 . GLU A 1 312 ? 63.171  -32.556 339.270 1.00 89.07  ? 313  GLU A OE1 1 
ATOM   2367 O OE2 . GLU A 1 312 ? 63.919  -33.512 341.102 1.00 87.99  ? 313  GLU A OE2 1 
ATOM   2368 N N   . ALA A 1 313 ? 66.145  -38.138 341.307 1.00 40.89  ? 314  ALA A N   1 
ATOM   2369 C CA  . ALA A 1 313 ? 67.006  -39.317 341.302 1.00 37.59  ? 314  ALA A CA  1 
ATOM   2370 C C   . ALA A 1 313 ? 66.290  -40.529 341.885 1.00 41.83  ? 314  ALA A C   1 
ATOM   2371 O O   . ALA A 1 313 ? 66.323  -41.621 341.306 1.00 45.92  ? 314  ALA A O   1 
ATOM   2372 C CB  . ALA A 1 313 ? 68.292  -39.028 342.075 1.00 32.73  ? 314  ALA A CB  1 
ATOM   2373 N N   . LEU A 1 314 ? 65.639  -40.355 343.038 1.00 39.60  ? 315  LEU A N   1 
ATOM   2374 C CA  . LEU A 1 314 ? 64.928  -41.465 343.664 1.00 36.72  ? 315  LEU A CA  1 
ATOM   2375 C C   . LEU A 1 314 ? 63.819  -41.995 342.767 1.00 41.12  ? 315  LEU A C   1 
ATOM   2376 O O   . LEU A 1 314 ? 63.536  -43.199 342.770 1.00 41.62  ? 315  LEU A O   1 
ATOM   2377 C CB  . LEU A 1 314 ? 64.356  -41.022 345.010 1.00 31.24  ? 315  LEU A CB  1 
ATOM   2378 C CG  . LEU A 1 314 ? 65.394  -40.507 346.006 1.00 34.49  ? 315  LEU A CG  1 
ATOM   2379 C CD1 . LEU A 1 314 ? 64.725  -39.885 347.222 1.00 31.13  ? 315  LEU A CD1 1 
ATOM   2380 C CD2 . LEU A 1 314 ? 66.330  -41.632 346.415 1.00 38.84  ? 315  LEU A CD2 1 
ATOM   2381 N N   . ILE A 1 315 ? 63.192  -41.113 341.991 1.00 40.64  ? 316  ILE A N   1 
ATOM   2382 C CA  . ILE A 1 315 ? 62.126  -41.525 341.086 1.00 40.07  ? 316  ILE A CA  1 
ATOM   2383 C C   . ILE A 1 315 ? 62.684  -42.390 339.962 1.00 43.38  ? 316  ILE A C   1 
ATOM   2384 O O   . ILE A 1 315 ? 62.173  -43.481 339.682 1.00 43.84  ? 316  ILE A O   1 
ATOM   2385 C CB  . ILE A 1 315 ? 61.401  -40.282 340.539 1.00 37.22  ? 316  ILE A CB  1 
ATOM   2386 C CG1 . ILE A 1 315 ? 60.438  -39.732 341.593 1.00 39.65  ? 316  ILE A CG1 1 
ATOM   2387 C CG2 . ILE A 1 315 ? 60.694  -40.595 339.231 1.00 37.69  ? 316  ILE A CG2 1 
ATOM   2388 C CD1 . ILE A 1 315 ? 60.086  -38.267 341.399 1.00 41.43  ? 316  ILE A CD1 1 
ATOM   2389 N N   . ASN A 1 316 ? 63.751  -41.920 339.311 1.00 47.71  ? 317  ASN A N   1 
ATOM   2390 C CA  . ASN A 1 316 ? 64.305  -42.638 338.167 1.00 45.19  ? 317  ASN A CA  1 
ATOM   2391 C C   . ASN A 1 316 ? 64.914  -43.975 338.570 1.00 45.87  ? 317  ASN A C   1 
ATOM   2392 O O   . ASN A 1 316 ? 64.989  -44.891 337.744 1.00 54.93  ? 317  ASN A O   1 
ATOM   2393 C CB  . ASN A 1 316 ? 65.353  -41.772 337.468 1.00 45.54  ? 317  ASN A CB  1 
ATOM   2394 C CG  . ASN A 1 316 ? 64.780  -40.470 336.944 1.00 57.43  ? 317  ASN A CG  1 
ATOM   2395 O OD1 . ASN A 1 316 ? 63.585  -40.373 336.663 1.00 61.66  ? 317  ASN A OD1 1 
ATOM   2396 N ND2 . ASN A 1 316 ? 65.631  -39.459 336.812 1.00 63.92  ? 317  ASN A ND2 1 
ATOM   2397 N N   . ALA A 1 317 ? 65.346  -44.112 339.823 1.00 45.70  ? 318  ALA A N   1 
ATOM   2398 C CA  . ALA A 1 317 ? 66.054  -45.301 340.279 1.00 49.22  ? 318  ALA A CA  1 
ATOM   2399 C C   . ALA A 1 317 ? 65.218  -46.176 341.205 1.00 56.52  ? 318  ALA A C   1 
ATOM   2400 O O   . ALA A 1 317 ? 65.770  -47.062 341.865 1.00 62.88  ? 318  ALA A O   1 
ATOM   2401 C CB  . ALA A 1 317 ? 67.354  -44.899 340.978 1.00 56.09  ? 318  ALA A CB  1 
ATOM   2402 N N   . GLY A 1 318 ? 63.909  -45.962 341.265 1.00 55.52  ? 319  GLY A N   1 
ATOM   2403 C CA  . GLY A 1 318 ? 63.055  -46.668 342.199 1.00 52.84  ? 319  GLY A CA  1 
ATOM   2404 C C   . GLY A 1 318 ? 62.370  -47.881 341.596 1.00 52.39  ? 319  GLY A C   1 
ATOM   2405 O O   . GLY A 1 318 ? 62.057  -47.914 340.408 1.00 51.08  ? 319  GLY A O   1 
ATOM   2406 N N   . ASP A 1 319 ? 62.148  -48.887 342.440 1.00 51.73  ? 320  ASP A N   1 
ATOM   2407 C CA  . ASP A 1 319 ? 61.347  -50.057 342.097 1.00 56.02  ? 320  ASP A CA  1 
ATOM   2408 C C   . ASP A 1 319 ? 59.962  -49.854 342.701 1.00 51.54  ? 320  ASP A C   1 
ATOM   2409 O O   . ASP A 1 319 ? 59.809  -49.844 343.927 1.00 56.36  ? 320  ASP A O   1 
ATOM   2410 C CB  . ASP A 1 319 ? 61.995  -51.339 342.615 1.00 64.16  ? 320  ASP A CB  1 
ATOM   2411 C CG  . ASP A 1 319 ? 61.232  -52.588 342.209 1.00 71.39  ? 320  ASP A CG  1 
ATOM   2412 O OD1 . ASP A 1 319 ? 60.339  -52.491 341.342 1.00 72.73  ? 320  ASP A OD1 1 
ATOM   2413 O OD2 . ASP A 1 319 ? 61.528  -53.670 342.759 1.00 79.33  ? 320  ASP A OD2 1 
ATOM   2414 N N   . PHE A 1 320 ? 58.956  -49.693 341.844 1.00 45.98  ? 321  PHE A N   1 
ATOM   2415 C CA  . PHE A 1 320 ? 57.615  -49.329 342.286 1.00 47.59  ? 321  PHE A CA  1 
ATOM   2416 C C   . PHE A 1 320 ? 56.596  -50.425 341.990 1.00 47.83  ? 321  PHE A C   1 
ATOM   2417 O O   . PHE A 1 320 ? 55.423  -50.139 341.741 1.00 49.67  ? 321  PHE A O   1 
ATOM   2418 C CB  . PHE A 1 320 ? 57.189  -48.005 341.654 1.00 41.62  ? 321  PHE A CB  1 
ATOM   2419 C CG  . PHE A 1 320 ? 58.115  -46.864 341.966 1.00 39.52  ? 321  PHE A CG  1 
ATOM   2420 C CD1 . PHE A 1 320 ? 58.048  -46.216 343.189 1.00 41.70  ? 321  PHE A CD1 1 
ATOM   2421 C CD2 . PHE A 1 320 ? 59.061  -46.448 341.044 1.00 35.23  ? 321  PHE A CD2 1 
ATOM   2422 C CE1 . PHE A 1 320 ? 58.902  -45.168 343.483 1.00 39.21  ? 321  PHE A CE1 1 
ATOM   2423 C CE2 . PHE A 1 320 ? 59.918  -45.402 341.332 1.00 39.25  ? 321  PHE A CE2 1 
ATOM   2424 C CZ  . PHE A 1 320 ? 59.838  -44.761 342.553 1.00 40.80  ? 321  PHE A CZ  1 
ATOM   2425 N N   . HIS A 1 321 ? 57.025  -51.684 342.021 1.00 50.13  ? 322  HIS A N   1 
ATOM   2426 C CA  . HIS A 1 321 ? 56.084  -52.789 341.903 1.00 49.54  ? 322  HIS A CA  1 
ATOM   2427 C C   . HIS A 1 321 ? 55.288  -52.938 343.194 1.00 50.95  ? 322  HIS A C   1 
ATOM   2428 O O   . HIS A 1 321 ? 55.826  -52.794 344.296 1.00 54.94  ? 322  HIS A O   1 
ATOM   2429 C CB  . HIS A 1 321 ? 56.818  -54.090 341.583 1.00 54.21  ? 322  HIS A CB  1 
ATOM   2430 C CG  . HIS A 1 321 ? 57.282  -54.190 340.163 1.00 57.32  ? 322  HIS A CG  1 
ATOM   2431 N ND1 . HIS A 1 321 ? 58.552  -53.829 339.768 1.00 57.91  ? 322  HIS A ND1 1 
ATOM   2432 C CD2 . HIS A 1 321 ? 56.645  -54.609 339.044 1.00 57.22  ? 322  HIS A CD2 1 
ATOM   2433 C CE1 . HIS A 1 321 ? 58.677  -54.023 338.467 1.00 57.77  ? 322  HIS A CE1 1 
ATOM   2434 N NE2 . HIS A 1 321 ? 57.534  -54.495 338.004 1.00 59.58  ? 322  HIS A NE2 1 
ATOM   2435 N N   . GLY A 1 322 ? 53.998  -53.228 343.052 1.00 48.89  ? 323  GLY A N   1 
ATOM   2436 C CA  . GLY A 1 322 ? 53.106  -53.318 344.189 1.00 48.53  ? 323  GLY A CA  1 
ATOM   2437 C C   . GLY A 1 322 ? 52.490  -52.008 344.622 1.00 49.52  ? 323  GLY A C   1 
ATOM   2438 O O   . GLY A 1 322 ? 51.897  -51.949 345.706 1.00 51.42  ? 323  GLY A O   1 
ATOM   2439 N N   . LEU A 1 323 ? 52.604  -50.959 343.811 1.00 46.65  ? 324  LEU A N   1 
ATOM   2440 C CA  . LEU A 1 323 ? 52.130  -49.628 344.161 1.00 44.59  ? 324  LEU A CA  1 
ATOM   2441 C C   . LEU A 1 323 ? 51.124  -49.151 343.125 1.00 40.10  ? 324  LEU A C   1 
ATOM   2442 O O   . LEU A 1 323 ? 51.372  -49.251 341.918 1.00 40.16  ? 324  LEU A O   1 
ATOM   2443 C CB  . LEU A 1 323 ? 53.299  -48.644 344.256 1.00 41.71  ? 324  LEU A CB  1 
ATOM   2444 C CG  . LEU A 1 323 ? 52.944  -47.168 344.440 1.00 36.37  ? 324  LEU A CG  1 
ATOM   2445 C CD1 . LEU A 1 323 ? 52.361  -46.918 345.823 1.00 33.16  ? 324  LEU A CD1 1 
ATOM   2446 C CD2 . LEU A 1 323 ? 54.163  -46.292 344.198 1.00 33.17  ? 324  LEU A CD2 1 
ATOM   2447 N N   . GLN A 1 324 ? 49.993  -48.641 343.600 1.00 34.69  ? 325  GLN A N   1 
ATOM   2448 C CA  . GLN A 1 324 ? 48.997  -47.988 342.763 1.00 33.12  ? 325  GLN A CA  1 
ATOM   2449 C C   . GLN A 1 324 ? 48.960  -46.510 343.127 1.00 29.51  ? 325  GLN A C   1 
ATOM   2450 O O   . GLN A 1 324 ? 48.929  -46.162 344.312 1.00 27.55  ? 325  GLN A O   1 
ATOM   2451 C CB  . GLN A 1 324 ? 47.614  -48.619 342.948 1.00 37.69  ? 325  GLN A CB  1 
ATOM   2452 C CG  . GLN A 1 324 ? 47.572  -50.127 342.736 1.00 42.66  ? 325  GLN A CG  1 
ATOM   2453 C CD  . GLN A 1 324 ? 47.930  -50.911 343.986 1.00 48.37  ? 325  GLN A CD  1 
ATOM   2454 O OE1 . GLN A 1 324 ? 47.285  -50.776 345.024 1.00 45.11  ? 325  GLN A OE1 1 
ATOM   2455 N NE2 . GLN A 1 324 ? 48.962  -51.739 343.888 1.00 56.24  ? 325  GLN A NE2 1 
ATOM   2456 N N   . VAL A 1 325 ? 48.987  -45.645 342.116 1.00 28.82  ? 326  VAL A N   1 
ATOM   2457 C CA  . VAL A 1 325 ? 48.984  -44.202 342.329 1.00 28.45  ? 326  VAL A CA  1 
ATOM   2458 C C   . VAL A 1 325 ? 47.978  -43.570 341.378 1.00 29.04  ? 326  VAL A C   1 
ATOM   2459 O O   . VAL A 1 325 ? 47.796  -44.030 340.246 1.00 27.15  ? 326  VAL A O   1 
ATOM   2460 C CB  . VAL A 1 325 ? 50.390  -43.585 342.139 1.00 29.98  ? 326  VAL A CB  1 
ATOM   2461 C CG1 . VAL A 1 325 ? 50.362  -42.086 342.328 1.00 32.94  ? 326  VAL A CG1 1 
ATOM   2462 C CG2 . VAL A 1 325 ? 51.385  -44.211 343.095 1.00 37.96  ? 326  VAL A CG2 1 
ATOM   2463 N N   . LEU A 1 326 ? 47.314  -42.520 341.854 1.00 27.29  ? 327  LEU A N   1 
ATOM   2464 C CA  . LEU A 1 326 ? 46.376  -41.726 341.072 1.00 24.93  ? 327  LEU A CA  1 
ATOM   2465 C C   . LEU A 1 326 ? 46.869  -40.286 341.081 1.00 25.57  ? 327  LEU A C   1 
ATOM   2466 O O   . LEU A 1 326 ? 47.062  -39.704 342.153 1.00 26.69  ? 327  LEU A O   1 
ATOM   2467 C CB  . LEU A 1 326 ? 44.967  -41.834 341.658 1.00 27.47  ? 327  LEU A CB  1 
ATOM   2468 C CG  . LEU A 1 326 ? 43.884  -40.875 341.172 1.00 32.70  ? 327  LEU A CG  1 
ATOM   2469 C CD1 . LEU A 1 326 ? 43.542  -41.172 339.731 1.00 39.44  ? 327  LEU A CD1 1 
ATOM   2470 C CD2 . LEU A 1 326 ? 42.650  -40.989 342.054 1.00 37.90  ? 327  LEU A CD2 1 
ATOM   2471 N N   . VAL A 1 327 ? 47.103  -39.720 339.896 1.00 23.95  ? 328  VAL A N   1 
ATOM   2472 C CA  . VAL A 1 327 ? 47.648  -38.373 339.782 1.00 25.26  ? 328  VAL A CA  1 
ATOM   2473 C C   . VAL A 1 327 ? 46.811  -37.570 338.798 1.00 22.39  ? 328  VAL A C   1 
ATOM   2474 O O   . VAL A 1 327 ? 46.095  -38.118 337.959 1.00 24.25  ? 328  VAL A O   1 
ATOM   2475 C CB  . VAL A 1 327 ? 49.129  -38.366 339.343 1.00 27.55  ? 328  VAL A CB  1 
ATOM   2476 C CG1 . VAL A 1 327 ? 49.943  -39.314 340.194 1.00 24.79  ? 328  VAL A CG1 1 
ATOM   2477 C CG2 . VAL A 1 327 ? 49.254  -38.725 337.869 1.00 26.80  ? 328  VAL A CG2 1 
ATOM   2478 N N   . GLY A 1 328 ? 46.917  -36.252 338.907 1.00 21.55  ? 329  GLY A N   1 
ATOM   2479 C CA  . GLY A 1 328 ? 46.206  -35.394 337.981 1.00 24.02  ? 329  GLY A CA  1 
ATOM   2480 C C   . GLY A 1 328 ? 46.486  -33.937 338.259 1.00 19.96  ? 329  GLY A C   1 
ATOM   2481 O O   . GLY A 1 328 ? 47.177  -33.578 339.219 1.00 24.61  ? 329  GLY A O   1 
ATOM   2482 N N   . VAL A 1 329 ? 45.940  -33.096 337.381 1.00 19.11  ? 330  VAL A N   1 
ATOM   2483 C CA  . VAL A 1 329 ? 46.089  -31.648 337.440 1.00 21.38  ? 330  VAL A CA  1 
ATOM   2484 C C   . VAL A 1 329 ? 44.755  -31.020 337.058 1.00 23.35  ? 330  VAL A C   1 
ATOM   2485 O O   . VAL A 1 329 ? 43.860  -31.681 336.529 1.00 23.88  ? 330  VAL A O   1 
ATOM   2486 C CB  . VAL A 1 329 ? 47.206  -31.132 336.502 1.00 22.70  ? 330  VAL A CB  1 
ATOM   2487 C CG1 . VAL A 1 329 ? 48.514  -31.880 336.735 1.00 20.24  ? 330  VAL A CG1 1 
ATOM   2488 C CG2 . VAL A 1 329 ? 46.771  -31.258 335.050 1.00 21.02  ? 330  VAL A CG2 1 
ATOM   2489 N N   . VAL A 1 330 ? 44.626  -29.722 337.333 1.00 19.89  ? 331  VAL A N   1 
ATOM   2490 C CA  . VAL A 1 330 ? 43.469  -28.971 336.857 1.00 22.91  ? 331  VAL A CA  1 
ATOM   2491 C C   . VAL A 1 330 ? 43.809  -28.411 335.483 1.00 31.08  ? 331  VAL A C   1 
ATOM   2492 O O   . VAL A 1 330 ? 44.959  -28.493 335.035 1.00 26.59  ? 331  VAL A O   1 
ATOM   2493 C CB  . VAL A 1 330 ? 43.059  -27.856 337.837 1.00 24.68  ? 331  VAL A CB  1 
ATOM   2494 C CG1 . VAL A 1 330 ? 42.685  -28.449 339.191 1.00 20.70  ? 331  VAL A CG1 1 
ATOM   2495 C CG2 . VAL A 1 330 ? 44.169  -26.829 337.978 1.00 19.11  ? 331  VAL A CG2 1 
ATOM   2496 N N   . LYS A 1 331 ? 42.816  -27.833 334.804 1.00 28.34  ? 332  LYS A N   1 
ATOM   2497 C CA  . LYS A 1 331 ? 43.010  -27.452 333.409 1.00 28.98  ? 332  LYS A CA  1 
ATOM   2498 C C   . LYS A 1 331 ? 43.906  -26.228 333.262 1.00 31.52  ? 332  LYS A C   1 
ATOM   2499 O O   . LYS A 1 331 ? 44.599  -26.091 332.248 1.00 31.38  ? 332  LYS A O   1 
ATOM   2500 C CB  . LYS A 1 331 ? 41.660  -27.201 332.739 1.00 29.53  ? 332  LYS A CB  1 
ATOM   2501 C CG  . LYS A 1 331 ? 41.752  -27.038 331.230 1.00 36.51  ? 332  LYS A CG  1 
ATOM   2502 C CD  . LYS A 1 331 ? 40.435  -27.354 330.548 1.00 53.13  ? 332  LYS A CD  1 
ATOM   2503 C CE  . LYS A 1 331 ? 39.586  -26.107 330.396 1.00 62.58  ? 332  LYS A CE  1 
ATOM   2504 N NZ  . LYS A 1 331 ? 40.092  -25.232 329.301 1.00 65.61  ? 332  LYS A NZ  1 
ATOM   2505 N N   . ASP A 1 332 ? 43.915  -25.330 334.251 1.00 34.30  ? 333  ASP A N   1 
ATOM   2506 C CA  . ASP A 1 332 ? 44.673  -24.076 334.170 1.00 33.57  ? 333  ASP A CA  1 
ATOM   2507 C C   . ASP A 1 332 ? 45.476  -23.912 335.460 1.00 32.32  ? 333  ASP A C   1 
ATOM   2508 O O   . ASP A 1 332 ? 45.109  -23.138 336.346 1.00 33.70  ? 333  ASP A O   1 
ATOM   2509 C CB  . ASP A 1 332 ? 43.735  -22.899 333.917 1.00 36.29  ? 333  ASP A CB  1 
ATOM   2510 C CG  . ASP A 1 332 ? 42.901  -23.082 332.661 1.00 44.50  ? 333  ASP A CG  1 
ATOM   2511 O OD1 . ASP A 1 332 ? 43.426  -22.834 331.555 1.00 47.33  ? 333  ASP A OD1 1 
ATOM   2512 O OD2 . ASP A 1 332 ? 41.723  -23.481 332.778 1.00 47.73  ? 333  ASP A OD2 1 
ATOM   2513 N N   . GLU A 1 333 ? 46.593  -24.639 335.547 1.00 28.53  ? 334  GLU A N   1 
ATOM   2514 C CA  . GLU A 1 333 ? 47.372  -24.671 336.781 1.00 25.31  ? 334  GLU A CA  1 
ATOM   2515 C C   . GLU A 1 333 ? 48.067  -23.345 337.064 1.00 29.49  ? 334  GLU A C   1 
ATOM   2516 O O   . GLU A 1 333 ? 48.232  -22.973 338.231 1.00 28.33  ? 334  GLU A O   1 
ATOM   2517 C CB  . GLU A 1 333 ? 48.409  -25.794 336.717 1.00 22.02  ? 334  GLU A CB  1 
ATOM   2518 C CG  . GLU A 1 333 ? 47.831  -27.191 336.838 1.00 27.30  ? 334  GLU A CG  1 
ATOM   2519 C CD  . GLU A 1 333 ? 47.528  -27.574 338.273 1.00 35.66  ? 334  GLU A CD  1 
ATOM   2520 O OE1 . GLU A 1 333 ? 47.825  -26.772 339.185 1.00 36.12  ? 334  GLU A OE1 1 
ATOM   2521 O OE2 . GLU A 1 333 ? 46.990  -28.678 338.492 1.00 35.95  ? 334  GLU A OE2 1 
ATOM   2522 N N   . GLY A 1 334 ? 48.480  -22.621 336.028 1.00 26.42  ? 335  GLY A N   1 
ATOM   2523 C CA  . GLY A 1 334 ? 49.352  -21.479 336.222 1.00 23.10  ? 335  GLY A CA  1 
ATOM   2524 C C   . GLY A 1 334 ? 48.687  -20.152 336.529 1.00 29.96  ? 335  GLY A C   1 
ATOM   2525 O O   . GLY A 1 334 ? 49.332  -19.256 337.083 1.00 33.70  ? 335  GLY A O   1 
ATOM   2526 N N   . SER A 1 335 ? 47.401  -20.012 336.193 1.00 32.47  ? 336  SER A N   1 
ATOM   2527 C CA  . SER A 1 335 ? 46.762  -18.697 336.227 1.00 35.11  ? 336  SER A CA  1 
ATOM   2528 C C   . SER A 1 335 ? 46.708  -18.124 337.640 1.00 37.73  ? 336  SER A C   1 
ATOM   2529 O O   . SER A 1 335 ? 46.956  -16.928 337.839 1.00 38.02  ? 336  SER A O   1 
ATOM   2530 C CB  . SER A 1 335 ? 45.356  -18.784 335.631 1.00 36.96  ? 336  SER A CB  1 
ATOM   2531 O OG  . SER A 1 335 ? 44.542  -19.680 336.367 1.00 39.97  ? 336  SER A OG  1 
ATOM   2532 N N   . TYR A 1 336 ? 46.383  -18.960 338.631 1.00 36.02  ? 337  TYR A N   1 
ATOM   2533 C CA  . TYR A 1 336 ? 46.242  -18.488 340.008 1.00 39.07  ? 337  TYR A CA  1 
ATOM   2534 C C   . TYR A 1 336 ? 47.506  -17.790 340.496 1.00 39.94  ? 337  TYR A C   1 
ATOM   2535 O O   . TYR A 1 336 ? 47.433  -16.770 341.191 1.00 41.30  ? 337  TYR A O   1 
ATOM   2536 C CB  . TYR A 1 336 ? 45.887  -19.669 340.915 1.00 45.28  ? 337  TYR A CB  1 
ATOM   2537 C CG  . TYR A 1 336 ? 45.899  -19.395 342.406 1.00 53.46  ? 337  TYR A CG  1 
ATOM   2538 C CD1 . TYR A 1 336 ? 44.778  -18.886 343.049 1.00 62.27  ? 337  TYR A CD1 1 
ATOM   2539 C CD2 . TYR A 1 336 ? 47.020  -19.685 343.177 1.00 60.92  ? 337  TYR A CD2 1 
ATOM   2540 C CE1 . TYR A 1 336 ? 44.779  -18.651 344.413 1.00 68.90  ? 337  TYR A CE1 1 
ATOM   2541 C CE2 . TYR A 1 336 ? 47.030  -19.453 344.542 1.00 68.86  ? 337  TYR A CE2 1 
ATOM   2542 C CZ  . TYR A 1 336 ? 45.907  -18.936 345.154 1.00 74.42  ? 337  TYR A CZ  1 
ATOM   2543 O OH  . TYR A 1 336 ? 45.911  -18.704 346.512 1.00 79.37  ? 337  TYR A OH  1 
ATOM   2544 N N   . PHE A 1 337 ? 48.672  -18.315 340.130 1.00 34.61  ? 338  PHE A N   1 
ATOM   2545 C CA  . PHE A 1 337 ? 49.935  -17.800 340.640 1.00 36.20  ? 338  PHE A CA  1 
ATOM   2546 C C   . PHE A 1 337 ? 50.384  -16.518 339.951 1.00 40.88  ? 338  PHE A C   1 
ATOM   2547 O O   . PHE A 1 337 ? 51.271  -15.835 340.474 1.00 40.32  ? 338  PHE A O   1 
ATOM   2548 C CB  . PHE A 1 337 ? 51.012  -18.878 340.507 1.00 34.73  ? 338  PHE A CB  1 
ATOM   2549 C CG  . PHE A 1 337 ? 50.641  -20.172 341.169 1.00 39.45  ? 338  PHE A CG  1 
ATOM   2550 C CD1 . PHE A 1 337 ? 49.945  -21.150 340.475 1.00 31.90  ? 338  PHE A CD1 1 
ATOM   2551 C CD2 . PHE A 1 337 ? 50.962  -20.399 342.497 1.00 39.60  ? 338  PHE A CD2 1 
ATOM   2552 C CE1 . PHE A 1 337 ? 49.586  -22.334 341.091 1.00 35.67  ? 338  PHE A CE1 1 
ATOM   2553 C CE2 . PHE A 1 337 ? 50.610  -21.582 343.118 1.00 41.14  ? 338  PHE A CE2 1 
ATOM   2554 C CZ  . PHE A 1 337 ? 49.920  -22.551 342.415 1.00 40.16  ? 338  PHE A CZ  1 
ATOM   2555 N N   . LEU A 1 338 ? 49.783  -16.162 338.813 1.00 37.25  ? 339  LEU A N   1 
ATOM   2556 C CA  . LEU A 1 338 ? 50.263  -15.013 338.054 1.00 38.05  ? 339  LEU A CA  1 
ATOM   2557 C C   . LEU A 1 338 ? 49.871  -13.690 338.698 1.00 42.61  ? 339  LEU A C   1 
ATOM   2558 O O   . LEU A 1 338 ? 50.615  -12.710 338.590 1.00 43.01  ? 339  LEU A O   1 
ATOM   2559 C CB  . LEU A 1 338 ? 49.748  -15.088 336.620 1.00 38.36  ? 339  LEU A CB  1 
ATOM   2560 C CG  . LEU A 1 338 ? 50.367  -16.254 335.851 1.00 39.01  ? 339  LEU A CG  1 
ATOM   2561 C CD1 . LEU A 1 338 ? 49.852  -16.307 334.428 1.00 40.56  ? 339  LEU A CD1 1 
ATOM   2562 C CD2 . LEU A 1 338 ? 51.884  -16.144 335.878 1.00 38.15  ? 339  LEU A CD2 1 
ATOM   2563 N N   . VAL A 1 339 ? 48.721  -13.630 339.378 1.00 43.08  ? 340  VAL A N   1 
ATOM   2564 C CA  . VAL A 1 339 ? 48.316  -12.379 340.018 1.00 51.65  ? 340  VAL A CA  1 
ATOM   2565 C C   . VAL A 1 339 ? 49.100  -12.090 341.286 1.00 56.80  ? 340  VAL A C   1 
ATOM   2566 O O   . VAL A 1 339 ? 48.853  -11.062 341.931 1.00 62.67  ? 340  VAL A O   1 
ATOM   2567 C CB  . VAL A 1 339 ? 46.804  -12.383 340.323 1.00 52.73  ? 340  VAL A CB  1 
ATOM   2568 C CG1 . VAL A 1 339 ? 46.015  -12.576 339.038 1.00 54.77  ? 340  VAL A CG1 1 
ATOM   2569 C CG2 . VAL A 1 339 ? 46.461  -13.457 341.343 1.00 54.27  ? 340  VAL A CG2 1 
ATOM   2570 N N   . TYR A 1 340 ? 50.048  -12.950 341.657 1.00 56.31  ? 341  TYR A N   1 
ATOM   2571 C CA  . TYR A 1 340 ? 50.891  -12.762 342.838 1.00 60.43  ? 341  TYR A CA  1 
ATOM   2572 C C   . TYR A 1 340 ? 52.296  -12.296 342.475 1.00 63.34  ? 341  TYR A C   1 
ATOM   2573 O O   . TYR A 1 340 ? 53.279  -12.756 343.064 1.00 66.58  ? 341  TYR A O   1 
ATOM   2574 C CB  . TYR A 1 340 ? 50.956  -14.051 343.653 1.00 59.69  ? 341  TYR A CB  1 
ATOM   2575 C CG  . TYR A 1 340 ? 49.711  -14.335 344.458 1.00 62.56  ? 341  TYR A CG  1 
ATOM   2576 C CD1 . TYR A 1 340 ? 49.646  -14.017 345.808 1.00 65.62  ? 341  TYR A CD1 1 
ATOM   2577 C CD2 . TYR A 1 340 ? 48.600  -14.925 343.869 1.00 62.92  ? 341  TYR A CD2 1 
ATOM   2578 C CE1 . TYR A 1 340 ? 48.509  -14.275 346.548 1.00 69.33  ? 341  TYR A CE1 1 
ATOM   2579 C CE2 . TYR A 1 340 ? 47.457  -15.187 344.602 1.00 67.39  ? 341  TYR A CE2 1 
ATOM   2580 C CZ  . TYR A 1 340 ? 47.418  -14.860 345.941 1.00 69.41  ? 341  TYR A CZ  1 
ATOM   2581 O OH  . TYR A 1 340 ? 46.284  -15.117 346.676 1.00 69.98  ? 341  TYR A OH  1 
ATOM   2582 N N   . GLY A 1 341 ? 52.430  -11.393 341.507 1.00 61.71  ? 342  GLY A N   1 
ATOM   2583 C CA  . GLY A 1 341 ? 53.735  -10.835 341.214 1.00 66.01  ? 342  GLY A CA  1 
ATOM   2584 C C   . GLY A 1 341 ? 54.082  -10.673 339.748 1.00 64.36  ? 342  GLY A C   1 
ATOM   2585 O O   . GLY A 1 341 ? 54.976  -9.890  339.411 1.00 74.33  ? 342  GLY A O   1 
ATOM   2586 N N   . ALA A 1 342 ? 53.405  -11.401 338.869 1.00 54.22  ? 343  ALA A N   1 
ATOM   2587 C CA  . ALA A 1 342 ? 53.711  -11.305 337.446 1.00 50.07  ? 343  ALA A CA  1 
ATOM   2588 C C   . ALA A 1 342 ? 53.271  -9.945  336.914 1.00 50.16  ? 343  ALA A C   1 
ATOM   2589 O O   . ALA A 1 342 ? 52.145  -9.513  337.188 1.00 46.00  ? 343  ALA A O   1 
ATOM   2590 C CB  . ALA A 1 342 ? 53.034  -12.428 336.664 1.00 41.83  ? 343  ALA A CB  1 
ATOM   2591 N N   . PRO A 1 343 ? 54.123  -9.242  336.170 1.00 47.89  ? 344  PRO A N   1 
ATOM   2592 C CA  . PRO A 1 343 ? 53.763  -7.896  335.701 1.00 50.75  ? 344  PRO A CA  1 
ATOM   2593 C C   . PRO A 1 343 ? 52.561  -7.919  334.766 1.00 50.43  ? 344  PRO A C   1 
ATOM   2594 O O   . PRO A 1 343 ? 52.506  -8.698  333.811 1.00 46.13  ? 344  PRO A O   1 
ATOM   2595 C CB  . PRO A 1 343 ? 55.032  -7.417  334.981 1.00 43.18  ? 344  PRO A CB  1 
ATOM   2596 C CG  . PRO A 1 343 ? 55.856  -8.649  334.751 1.00 44.15  ? 344  PRO A CG  1 
ATOM   2597 C CD  . PRO A 1 343 ? 55.519  -9.587  335.860 1.00 45.40  ? 344  PRO A CD  1 
ATOM   2598 N N   . GLY A 1 344 ? 51.592  -7.050  335.054 1.00 52.07  ? 345  GLY A N   1 
ATOM   2599 C CA  . GLY A 1 344 ? 50.425  -6.877  334.218 1.00 55.15  ? 345  GLY A CA  1 
ATOM   2600 C C   . GLY A 1 344 ? 49.227  -7.727  334.579 1.00 54.71  ? 345  GLY A C   1 
ATOM   2601 O O   . GLY A 1 344 ? 48.217  -7.674  333.865 1.00 60.31  ? 345  GLY A O   1 
ATOM   2602 N N   . PHE A 1 345 ? 49.294  -8.498  335.660 1.00 47.04  ? 346  PHE A N   1 
ATOM   2603 C CA  . PHE A 1 345 ? 48.243  -9.441  336.011 1.00 48.81  ? 346  PHE A CA  1 
ATOM   2604 C C   . PHE A 1 345 ? 47.428  -8.936  337.192 1.00 50.27  ? 346  PHE A C   1 
ATOM   2605 O O   . PHE A 1 345 ? 47.969  -8.338  338.128 1.00 53.12  ? 346  PHE A O   1 
ATOM   2606 C CB  . PHE A 1 345 ? 48.828  -10.818 336.337 1.00 42.73  ? 346  PHE A CB  1 
ATOM   2607 C CG  . PHE A 1 345 ? 49.141  -11.638 335.123 1.00 41.85  ? 346  PHE A CG  1 
ATOM   2608 C CD1 . PHE A 1 345 ? 48.213  -12.532 334.617 1.00 36.45  ? 346  PHE A CD1 1 
ATOM   2609 C CD2 . PHE A 1 345 ? 50.358  -11.505 334.479 1.00 41.49  ? 346  PHE A CD2 1 
ATOM   2610 C CE1 . PHE A 1 345 ? 48.495  -13.282 333.493 1.00 34.45  ? 346  PHE A CE1 1 
ATOM   2611 C CE2 . PHE A 1 345 ? 50.648  -12.253 333.356 1.00 43.88  ? 346  PHE A CE2 1 
ATOM   2612 C CZ  . PHE A 1 345 ? 49.716  -13.144 332.863 1.00 40.98  ? 346  PHE A CZ  1 
ATOM   2613 N N   . SER A 1 346 ? 46.123  -9.184  337.135 1.00 47.72  ? 347  SER A N   1 
ATOM   2614 C CA  . SER A 1 346 ? 45.214  -8.893  338.232 1.00 48.28  ? 347  SER A CA  1 
ATOM   2615 C C   . SER A 1 346 ? 43.966  -9.740  338.048 1.00 45.72  ? 347  SER A C   1 
ATOM   2616 O O   . SER A 1 346 ? 43.594  -10.081 336.923 1.00 46.31  ? 347  SER A O   1 
ATOM   2617 C CB  . SER A 1 346 ? 44.843  -7.407  338.293 1.00 49.90  ? 347  SER A CB  1 
ATOM   2618 O OG  . SER A 1 346 ? 43.765  -7.187  339.188 1.00 49.83  ? 347  SER A OG  1 
ATOM   2619 N N   . LYS A 1 347 ? 43.331  -10.085 339.168 1.00 41.15  ? 348  LYS A N   1 
ATOM   2620 C CA  . LYS A 1 347 ? 42.041  -10.757 339.090 1.00 43.18  ? 348  LYS A CA  1 
ATOM   2621 C C   . LYS A 1 347 ? 40.933  -9.805  338.663 1.00 45.08  ? 348  LYS A C   1 
ATOM   2622 O O   . LYS A 1 347 ? 39.867  -10.262 338.240 1.00 47.29  ? 348  LYS A O   1 
ATOM   2623 C CB  . LYS A 1 347 ? 41.689  -11.393 340.436 1.00 40.92  ? 348  LYS A CB  1 
ATOM   2624 C CG  . LYS A 1 347 ? 41.049  -10.434 341.429 1.00 38.57  ? 348  LYS A CG  1 
ATOM   2625 C CD  . LYS A 1 347 ? 40.535  -11.168 342.658 1.00 46.88  ? 348  LYS A CD  1 
ATOM   2626 C CE  . LYS A 1 347 ? 39.704  -10.252 343.545 1.00 48.91  ? 348  LYS A CE  1 
ATOM   2627 N NZ  . LYS A 1 347 ? 38.455  -9.797  342.873 1.00 49.61  ? 348  LYS A NZ  1 
ATOM   2628 N N   . ASP A 1 348 ? 41.168  -8.497  338.747 1.00 46.06  ? 349  ASP A N   1 
ATOM   2629 C CA  . ASP A 1 348 ? 40.130  -7.501  338.528 1.00 51.76  ? 349  ASP A CA  1 
ATOM   2630 C C   . ASP A 1 348 ? 40.130  -6.918  337.121 1.00 55.76  ? 349  ASP A C   1 
ATOM   2631 O O   . ASP A 1 348 ? 39.299  -6.053  336.829 1.00 64.38  ? 349  ASP A O   1 
ATOM   2632 C CB  . ASP A 1 348 ? 40.261  -6.377  339.560 1.00 57.38  ? 349  ASP A CB  1 
ATOM   2633 C CG  . ASP A 1 348 ? 39.910  -6.835  340.963 1.00 61.07  ? 349  ASP A CG  1 
ATOM   2634 O OD1 . ASP A 1 348 ? 38.899  -7.552  341.120 1.00 59.32  ? 349  ASP A OD1 1 
ATOM   2635 O OD2 . ASP A 1 348 ? 40.647  -6.483  341.908 1.00 63.82  ? 349  ASP A OD2 1 
ATOM   2636 N N   . ASN A 1 349 ? 41.034  -7.353  336.246 1.00 52.85  ? 350  ASN A N   1 
ATOM   2637 C CA  . ASN A 1 349 ? 40.928  -7.033  334.826 1.00 51.44  ? 350  ASN A CA  1 
ATOM   2638 C C   . ASN A 1 349 ? 41.307  -8.277  334.029 1.00 51.05  ? 350  ASN A C   1 
ATOM   2639 O O   . ASN A 1 349 ? 41.456  -9.373  334.580 1.00 56.34  ? 350  ASN A O   1 
ATOM   2640 C CB  . ASN A 1 349 ? 41.758  -5.791  334.454 1.00 43.79  ? 350  ASN A CB  1 
ATOM   2641 C CG  . ASN A 1 349 ? 43.260  -5.962  334.680 1.00 50.61  ? 350  ASN A CG  1 
ATOM   2642 O OD1 . ASN A 1 349 ? 43.806  -7.064  334.613 1.00 50.55  ? 350  ASN A OD1 1 
ATOM   2643 N ND2 . ASN A 1 349 ? 43.935  -4.842  334.934 1.00 64.12  ? 350  ASN A ND2 1 
ATOM   2644 N N   . GLU A 1 350 ? 41.460  -8.106  332.718 1.00 47.62  ? 351  GLU A N   1 
ATOM   2645 C CA  . GLU A 1 350 ? 41.705  -9.235  331.832 1.00 46.49  ? 351  GLU A CA  1 
ATOM   2646 C C   . GLU A 1 350 ? 43.167  -9.655  331.783 1.00 42.43  ? 351  GLU A C   1 
ATOM   2647 O O   . GLU A 1 350 ? 43.465  -10.705 331.205 1.00 42.61  ? 351  GLU A O   1 
ATOM   2648 C CB  . GLU A 1 350 ? 41.212  -8.906  330.422 1.00 51.87  ? 351  GLU A CB  1 
ATOM   2649 C CG  . GLU A 1 350 ? 39.697  -8.871  330.300 1.00 62.54  ? 351  GLU A CG  1 
ATOM   2650 C CD  . GLU A 1 350 ? 39.035  -10.084 330.929 1.00 77.83  ? 351  GLU A CD  1 
ATOM   2651 O OE1 . GLU A 1 350 ? 38.618  -9.999  332.104 1.00 82.91  ? 351  GLU A OE1 1 
ATOM   2652 O OE2 . GLU A 1 350 ? 38.934  -11.125 330.246 1.00 82.89  ? 351  GLU A OE2 1 
ATOM   2653 N N   . SER A 1 351 ? 44.071  -8.871  332.374 1.00 37.42  ? 352  SER A N   1 
ATOM   2654 C CA  . SER A 1 351 ? 45.498  -9.196  332.408 1.00 35.84  ? 352  SER A CA  1 
ATOM   2655 C C   . SER A 1 351 ? 46.038  -9.471  331.006 1.00 42.98  ? 352  SER A C   1 
ATOM   2656 O O   . SER A 1 351 ? 46.807  -10.408 330.782 1.00 39.59  ? 352  SER A O   1 
ATOM   2657 C CB  . SER A 1 351 ? 45.768  -10.378 333.341 1.00 33.85  ? 352  SER A CB  1 
ATOM   2658 O OG  . SER A 1 351 ? 45.291  -10.114 334.650 1.00 35.37  ? 352  SER A OG  1 
ATOM   2659 N N   . LEU A 1 352 ? 45.617  -8.647  330.049 1.00 43.20  ? 353  LEU A N   1 
ATOM   2660 C CA  . LEU A 1 352 ? 46.088  -8.743  328.669 1.00 41.58  ? 353  LEU A CA  1 
ATOM   2661 C C   . LEU A 1 352 ? 47.445  -8.057  328.597 1.00 44.19  ? 353  LEU A C   1 
ATOM   2662 O O   . LEU A 1 352 ? 47.550  -6.843  328.412 1.00 51.51  ? 353  LEU A O   1 
ATOM   2663 C CB  . LEU A 1 352 ? 45.077  -8.123  327.712 1.00 37.86  ? 353  LEU A CB  1 
ATOM   2664 C CG  . LEU A 1 352 ? 43.719  -8.829  327.693 1.00 39.24  ? 353  LEU A CG  1 
ATOM   2665 C CD1 . LEU A 1 352 ? 42.677  -8.008  326.945 1.00 42.80  ? 353  LEU A CD1 1 
ATOM   2666 C CD2 . LEU A 1 352 ? 43.849  -10.217 327.085 1.00 32.42  ? 353  LEU A CD2 1 
ATOM   2667 N N   . ILE A 1 353 ? 48.499  -8.852  328.745 1.00 39.14  ? 354  ILE A N   1 
ATOM   2668 C CA  . ILE A 1 353 ? 49.846  -8.333  328.923 1.00 37.33  ? 354  ILE A CA  1 
ATOM   2669 C C   . ILE A 1 353 ? 50.497  -8.084  327.569 1.00 37.61  ? 354  ILE A C   1 
ATOM   2670 O O   . ILE A 1 353 ? 50.074  -8.605  326.534 1.00 33.26  ? 354  ILE A O   1 
ATOM   2671 C CB  . ILE A 1 353 ? 50.703  -9.291  329.771 1.00 37.49  ? 354  ILE A CB  1 
ATOM   2672 C CG1 . ILE A 1 353 ? 50.741  -10.675 329.118 1.00 34.26  ? 354  ILE A CG1 1 
ATOM   2673 C CG2 . ILE A 1 353 ? 50.164  -9.371  331.191 1.00 31.04  ? 354  ILE A CG2 1 
ATOM   2674 C CD1 . ILE A 1 353 ? 51.727  -11.627 329.752 1.00 29.31  ? 354  ILE A CD1 1 
ATOM   2675 N N   . SER A 1 354 ? 51.554  -7.280  327.586 1.00 37.43  ? 355  SER A N   1 
ATOM   2676 C CA  . SER A 1 354 ? 52.337  -6.984  326.399 1.00 33.93  ? 355  SER A CA  1 
ATOM   2677 C C   . SER A 1 354 ? 53.469  -7.996  326.239 1.00 35.21  ? 355  SER A C   1 
ATOM   2678 O O   . SER A 1 354 ? 53.742  -8.814  327.122 1.00 34.34  ? 355  SER A O   1 
ATOM   2679 C CB  . SER A 1 354 ? 52.904  -5.567  326.473 1.00 42.65  ? 355  SER A CB  1 
ATOM   2680 O OG  . SER A 1 354 ? 53.842  -5.453  327.529 1.00 41.40  ? 355  SER A OG  1 
ATOM   2681 N N   . ARG A 1 355 ? 54.132  -7.929  325.082 1.00 33.61  ? 356  ARG A N   1 
ATOM   2682 C CA  . ARG A 1 355 ? 55.296  -8.774  324.842 1.00 33.73  ? 356  ARG A CA  1 
ATOM   2683 C C   . ARG A 1 355 ? 56.380  -8.525  325.881 1.00 39.50  ? 356  ARG A C   1 
ATOM   2684 O O   . ARG A 1 355 ? 56.980  -9.471  326.405 1.00 39.58  ? 356  ARG A O   1 
ATOM   2685 C CB  . ARG A 1 355 ? 55.837  -8.525  323.434 1.00 34.93  ? 356  ARG A CB  1 
ATOM   2686 C CG  . ARG A 1 355 ? 57.068  -9.338  323.093 1.00 35.58  ? 356  ARG A CG  1 
ATOM   2687 C CD  . ARG A 1 355 ? 56.694  -10.778 322.814 1.00 38.71  ? 356  ARG A CD  1 
ATOM   2688 N NE  . ARG A 1 355 ? 57.856  -11.597 322.487 1.00 42.33  ? 356  ARG A NE  1 
ATOM   2689 C CZ  . ARG A 1 355 ? 57.798  -12.902 322.248 1.00 32.81  ? 356  ARG A CZ  1 
ATOM   2690 N NH1 . ARG A 1 355 ? 56.634  -13.533 322.299 1.00 32.54  ? 356  ARG A NH1 1 
ATOM   2691 N NH2 . ARG A 1 355 ? 58.902  -13.576 321.960 1.00 27.86  ? 356  ARG A NH2 1 
ATOM   2692 N N   . ALA A 1 356 ? 56.642  -7.253  326.195 1.00 40.77  ? 357  ALA A N   1 
ATOM   2693 C CA  . ALA A 1 356 ? 57.648  -6.928  327.200 1.00 39.54  ? 357  ALA A CA  1 
ATOM   2694 C C   . ALA A 1 356 ? 57.261  -7.479  328.566 1.00 38.23  ? 357  ALA A C   1 
ATOM   2695 O O   . ALA A 1 356 ? 58.114  -7.989  329.302 1.00 42.93  ? 357  ALA A O   1 
ATOM   2696 C CB  . ALA A 1 356 ? 57.850  -5.414  327.266 1.00 37.73  ? 357  ALA A CB  1 
ATOM   2697 N N   . GLU A 1 357 ? 55.978  -7.386  328.924 1.00 35.92  ? 358  GLU A N   1 
ATOM   2698 C CA  . GLU A 1 357 ? 55.527  -7.953  330.190 1.00 37.49  ? 358  GLU A CA  1 
ATOM   2699 C C   . GLU A 1 357 ? 55.607  -9.474  330.179 1.00 38.00  ? 358  GLU A C   1 
ATOM   2700 O O   . GLU A 1 357 ? 55.852  -10.087 331.225 1.00 32.81  ? 358  GLU A O   1 
ATOM   2701 C CB  . GLU A 1 357 ? 54.100  -7.493  330.495 1.00 40.15  ? 358  GLU A CB  1 
ATOM   2702 C CG  . GLU A 1 357 ? 53.973  -5.996  330.752 1.00 51.58  ? 358  GLU A CG  1 
ATOM   2703 C CD  . GLU A 1 357 ? 52.533  -5.549  330.935 1.00 55.48  ? 358  GLU A CD  1 
ATOM   2704 O OE1 . GLU A 1 357 ? 51.673  -5.959  330.127 1.00 55.19  ? 358  GLU A OE1 1 
ATOM   2705 O OE2 . GLU A 1 357 ? 52.262  -4.785  331.885 1.00 60.92  ? 358  GLU A OE2 1 
ATOM   2706 N N   . PHE A 1 358 ? 55.411  -10.097 329.015 1.00 39.37  ? 359  PHE A N   1 
ATOM   2707 C CA  . PHE A 1 358 ? 55.544  -11.547 328.914 1.00 34.46  ? 359  PHE A CA  1 
ATOM   2708 C C   . PHE A 1 358 ? 56.990  -11.978 329.125 1.00 32.23  ? 359  PHE A C   1 
ATOM   2709 O O   . PHE A 1 358 ? 57.263  -12.937 329.857 1.00 28.76  ? 359  PHE A O   1 
ATOM   2710 C CB  . PHE A 1 358 ? 55.025  -12.025 327.557 1.00 30.11  ? 359  PHE A CB  1 
ATOM   2711 C CG  . PHE A 1 358 ? 55.397  -13.443 327.226 1.00 31.29  ? 359  PHE A CG  1 
ATOM   2712 C CD1 . PHE A 1 358 ? 54.694  -14.504 327.774 1.00 26.71  ? 359  PHE A CD1 1 
ATOM   2713 C CD2 . PHE A 1 358 ? 56.442  -13.716 326.357 1.00 30.78  ? 359  PHE A CD2 1 
ATOM   2714 C CE1 . PHE A 1 358 ? 55.032  -15.811 327.467 1.00 31.21  ? 359  PHE A CE1 1 
ATOM   2715 C CE2 . PHE A 1 358 ? 56.784  -15.020 326.048 1.00 24.04  ? 359  PHE A CE2 1 
ATOM   2716 C CZ  . PHE A 1 358 ? 56.078  -16.068 326.603 1.00 22.58  ? 359  PHE A CZ  1 
ATOM   2717 N N   . LEU A 1 359 ? 57.933  -11.276 328.490 1.00 29.71  ? 360  LEU A N   1 
ATOM   2718 C CA  . LEU A 1 359 ? 59.344  -11.608 328.660 1.00 32.63  ? 360  LEU A CA  1 
ATOM   2719 C C   . LEU A 1 359 ? 59.792  -11.391 330.099 1.00 37.32  ? 360  LEU A C   1 
ATOM   2720 O O   . LEU A 1 359 ? 60.580  -12.177 330.638 1.00 40.29  ? 360  LEU A O   1 
ATOM   2721 C CB  . LEU A 1 359 ? 60.197  -10.778 327.702 1.00 32.70  ? 360  LEU A CB  1 
ATOM   2722 C CG  . LEU A 1 359 ? 59.901  -10.964 326.213 1.00 32.63  ? 360  LEU A CG  1 
ATOM   2723 C CD1 . LEU A 1 359 ? 60.628  -9.919  325.382 1.00 36.16  ? 360  LEU A CD1 1 
ATOM   2724 C CD2 . LEU A 1 359 ? 60.282  -12.360 325.769 1.00 32.96  ? 360  LEU A CD2 1 
ATOM   2725 N N   . ALA A 1 360 ? 59.300  -10.328 330.738 1.00 40.17  ? 361  ALA A N   1 
ATOM   2726 C CA  . ALA A 1 360 ? 59.631  -10.093 332.139 1.00 34.30  ? 361  ALA A CA  1 
ATOM   2727 C C   . ALA A 1 360 ? 58.989  -11.140 333.039 1.00 37.16  ? 361  ALA A C   1 
ATOM   2728 O O   . ALA A 1 360 ? 59.582  -11.552 334.043 1.00 42.09  ? 361  ALA A O   1 
ATOM   2729 C CB  . ALA A 1 360 ? 59.197  -8.687  332.553 1.00 36.92  ? 361  ALA A CB  1 
ATOM   2730 N N   . GLY A 1 361 ? 57.780  -11.587 332.694 1.00 34.45  ? 362  GLY A N   1 
ATOM   2731 C CA  . GLY A 1 361 ? 57.115  -12.598 333.497 1.00 28.17  ? 362  GLY A CA  1 
ATOM   2732 C C   . GLY A 1 361 ? 57.790  -13.952 333.434 1.00 32.06  ? 362  GLY A C   1 
ATOM   2733 O O   . GLY A 1 361 ? 57.694  -14.740 334.379 1.00 33.42  ? 362  GLY A O   1 
ATOM   2734 N N   . VAL A 1 362 ? 58.479  -14.243 332.327 1.00 31.23  ? 363  VAL A N   1 
ATOM   2735 C CA  . VAL A 1 362 ? 59.178  -15.519 332.199 1.00 34.16  ? 363  VAL A CA  1 
ATOM   2736 C C   . VAL A 1 362 ? 60.270  -15.637 333.257 1.00 33.86  ? 363  VAL A C   1 
ATOM   2737 O O   . VAL A 1 362 ? 60.455  -16.701 333.861 1.00 33.04  ? 363  VAL A O   1 
ATOM   2738 C CB  . VAL A 1 362 ? 59.741  -15.676 330.773 1.00 34.62  ? 363  VAL A CB  1 
ATOM   2739 C CG1 . VAL A 1 362 ? 60.735  -16.826 330.709 1.00 30.00  ? 363  VAL A CG1 1 
ATOM   2740 C CG2 . VAL A 1 362 ? 58.609  -15.894 329.777 1.00 30.12  ? 363  VAL A CG2 1 
ATOM   2741 N N   . ARG A 1 363 ? 61.000  -14.545 333.510 1.00 33.32  ? 364  ARG A N   1 
ATOM   2742 C CA  . ARG A 1 363 ? 62.050  -14.578 334.525 1.00 37.34  ? 364  ARG A CA  1 
ATOM   2743 C C   . ARG A 1 363 ? 61.473  -14.710 335.929 1.00 35.41  ? 364  ARG A C   1 
ATOM   2744 O O   . ARG A 1 363 ? 62.118  -15.289 336.810 1.00 43.53  ? 364  ARG A O   1 
ATOM   2745 C CB  . ARG A 1 363 ? 62.922  -13.324 334.440 1.00 40.59  ? 364  ARG A CB  1 
ATOM   2746 C CG  . ARG A 1 363 ? 63.568  -13.079 333.086 1.00 47.91  ? 364  ARG A CG  1 
ATOM   2747 C CD  . ARG A 1 363 ? 64.180  -14.344 332.505 1.00 53.52  ? 364  ARG A CD  1 
ATOM   2748 N NE  . ARG A 1 363 ? 65.332  -14.832 333.262 1.00 56.18  ? 364  ARG A NE  1 
ATOM   2749 C CZ  . ARG A 1 363 ? 66.597  -14.538 332.976 1.00 56.90  ? 364  ARG A CZ  1 
ATOM   2750 N NH1 . ARG A 1 363 ? 66.883  -13.747 331.951 1.00 50.06  ? 364  ARG A NH1 1 
ATOM   2751 N NH2 . ARG A 1 363 ? 67.579  -15.034 333.717 1.00 62.45  ? 364  ARG A NH2 1 
ATOM   2752 N N   . VAL A 1 364 ? 60.276  -14.173 336.160 1.00 38.22  ? 365  VAL A N   1 
ATOM   2753 C CA  . VAL A 1 364 ? 59.637  -14.315 337.464 1.00 38.23  ? 365  VAL A CA  1 
ATOM   2754 C C   . VAL A 1 364 ? 59.067  -15.718 337.631 1.00 40.87  ? 365  VAL A C   1 
ATOM   2755 O O   . VAL A 1 364 ? 59.160  -16.315 338.709 1.00 43.21  ? 365  VAL A O   1 
ATOM   2756 C CB  . VAL A 1 364 ? 58.557  -13.231 337.640 1.00 38.35  ? 365  VAL A CB  1 
ATOM   2757 C CG1 . VAL A 1 364 ? 57.705  -13.512 338.868 1.00 40.98  ? 365  VAL A CG1 1 
ATOM   2758 C CG2 . VAL A 1 364 ? 59.200  -11.855 337.735 1.00 39.56  ? 365  VAL A CG2 1 
ATOM   2759 N N   . GLY A 1 365 ? 58.480  -16.270 336.565 1.00 36.41  ? 366  GLY A N   1 
ATOM   2760 C CA  . GLY A 1 365 ? 57.922  -17.610 336.624 1.00 34.24  ? 366  GLY A CA  1 
ATOM   2761 C C   . GLY A 1 365 ? 58.938  -18.723 336.496 1.00 33.85  ? 366  GLY A C   1 
ATOM   2762 O O   . GLY A 1 365 ? 58.640  -19.862 336.868 1.00 41.03  ? 366  GLY A O   1 
ATOM   2763 N N   . VAL A 1 366 ? 60.117  -18.428 335.960 1.00 34.69  ? 367  VAL A N   1 
ATOM   2764 C CA  . VAL A 1 366 ? 61.206  -19.400 335.894 1.00 31.76  ? 367  VAL A CA  1 
ATOM   2765 C C   . VAL A 1 366 ? 62.433  -18.743 336.511 1.00 34.03  ? 367  VAL A C   1 
ATOM   2766 O O   . VAL A 1 366 ? 63.380  -18.387 335.793 1.00 34.62  ? 367  VAL A O   1 
ATOM   2767 C CB  . VAL A 1 366 ? 61.475  -19.864 334.454 1.00 33.13  ? 367  VAL A CB  1 
ATOM   2768 C CG1 . VAL A 1 366 ? 62.306  -21.138 334.457 1.00 31.03  ? 367  VAL A CG1 1 
ATOM   2769 C CG2 . VAL A 1 366 ? 60.167  -20.083 333.713 1.00 28.85  ? 367  VAL A CG2 1 
ATOM   2770 N N   . PRO A 1 367 ? 62.456  -18.551 337.825 1.00 33.80  ? 368  PRO A N   1 
ATOM   2771 C CA  . PRO A 1 367 ? 63.564  -17.826 338.443 1.00 32.09  ? 368  PRO A CA  1 
ATOM   2772 C C   . PRO A 1 367 ? 64.827  -18.662 338.465 1.00 30.47  ? 368  PRO A C   1 
ATOM   2773 O O   . PRO A 1 367 ? 64.786  -19.894 338.532 1.00 42.76  ? 368  PRO A O   1 
ATOM   2774 C CB  . PRO A 1 367 ? 63.055  -17.566 339.863 1.00 31.04  ? 368  PRO A CB  1 
ATOM   2775 C CG  . PRO A 1 367 ? 62.157  -18.720 340.137 1.00 33.72  ? 368  PRO A CG  1 
ATOM   2776 C CD  . PRO A 1 367 ? 61.489  -19.043 338.826 1.00 29.15  ? 368  PRO A CD  1 
ATOM   2777 N N   . GLN A 1 368 ? 65.918  -17.979 338.571 1.00 45.84  ? 369  GLN A N   1 
ATOM   2778 C CA  . GLN A 1 368 ? 67.200  -18.599 338.692 1.00 61.88  ? 369  GLN A CA  1 
ATOM   2779 C C   . GLN A 1 368 ? 67.711  -19.492 337.547 1.00 62.56  ? 369  GLN A C   1 
ATOM   2780 O O   . GLN A 1 368 ? 68.372  -20.450 337.811 1.00 64.26  ? 369  GLN A O   1 
ATOM   2781 C CB  . GLN A 1 368 ? 67.205  -19.395 339.992 1.00 72.18  ? 369  GLN A CB  1 
ATOM   2782 C CG  . GLN A 1 368 ? 66.668  -18.680 341.203 1.00 78.67  ? 369  GLN A CG  1 
ATOM   2783 C CD  . GLN A 1 368 ? 67.730  -17.935 341.934 1.00 82.31  ? 369  GLN A CD  1 
ATOM   2784 O OE1 . GLN A 1 368 ? 67.995  -16.802 341.636 1.00 84.95  ? 369  GLN A OE1 1 
ATOM   2785 N NE2 . GLN A 1 368 ? 68.342  -18.575 342.902 1.00 83.22  ? 369  GLN A NE2 1 
ATOM   2786 N N   . VAL A 1 369 ? 67.405  -19.185 336.297 1.00 53.70  ? 370  VAL A N   1 
ATOM   2787 C CA  . VAL A 1 369 ? 67.938  -19.938 335.169 1.00 44.63  ? 370  VAL A CA  1 
ATOM   2788 C C   . VAL A 1 369 ? 68.774  -18.972 334.347 1.00 45.08  ? 370  VAL A C   1 
ATOM   2789 O O   . VAL A 1 369 ? 68.585  -17.753 334.393 1.00 44.15  ? 370  VAL A O   1 
ATOM   2790 C CB  . VAL A 1 369 ? 66.838  -20.607 334.314 1.00 42.31  ? 370  VAL A CB  1 
ATOM   2791 C CG1 . VAL A 1 369 ? 66.172  -21.736 335.102 1.00 35.95  ? 370  VAL A CG1 1 
ATOM   2792 C CG2 . VAL A 1 369 ? 65.806  -19.586 333.847 1.00 42.86  ? 370  VAL A CG2 1 
ATOM   2793 N N   . SER A 1 370 ? 69.736  -19.527 333.620 1.00 42.26  ? 371  SER A N   1 
ATOM   2794 C CA  . SER A 1 370 ? 70.584  -18.689 332.794 1.00 39.59  ? 371  SER A CA  1 
ATOM   2795 C C   . SER A 1 370 ? 69.734  -17.944 331.771 1.00 37.80  ? 371  SER A C   1 
ATOM   2796 O O   . SER A 1 370 ? 68.585  -18.303 331.496 1.00 36.28  ? 371  SER A O   1 
ATOM   2797 C CB  . SER A 1 370 ? 71.654  -19.528 332.095 1.00 44.66  ? 371  SER A CB  1 
ATOM   2798 O OG  . SER A 1 370 ? 71.077  -20.614 331.391 1.00 43.78  ? 371  SER A OG  1 
ATOM   2799 N N   . ASP A 1 371 ? 70.304  -16.866 331.230 1.00 39.11  ? 372  ASP A N   1 
ATOM   2800 C CA  . ASP A 1 371 ? 69.629  -16.151 330.153 1.00 43.41  ? 372  ASP A CA  1 
ATOM   2801 C C   . ASP A 1 371 ? 69.312  -17.091 328.999 1.00 40.06  ? 372  ASP A C   1 
ATOM   2802 O O   . ASP A 1 371 ? 68.263  -16.970 328.357 1.00 34.93  ? 372  ASP A O   1 
ATOM   2803 C CB  . ASP A 1 371 ? 70.490  -14.984 329.671 1.00 47.92  ? 372  ASP A CB  1 
ATOM   2804 C CG  . ASP A 1 371 ? 70.857  -14.027 330.787 1.00 56.81  ? 372  ASP A CG  1 
ATOM   2805 O OD1 . ASP A 1 371 ? 70.134  -13.987 331.805 1.00 57.11  ? 372  ASP A OD1 1 
ATOM   2806 O OD2 . ASP A 1 371 ? 71.870  -13.310 330.642 1.00 65.55  ? 372  ASP A OD2 1 
ATOM   2807 N N   . LEU A 1 372 ? 70.208  -18.045 328.733 1.00 38.76  ? 373  LEU A N   1 
ATOM   2808 C CA  . LEU A 1 372 ? 69.975  -19.017 327.671 1.00 36.49  ? 373  LEU A CA  1 
ATOM   2809 C C   . LEU A 1 372 ? 68.745  -19.868 327.958 1.00 38.68  ? 373  LEU A C   1 
ATOM   2810 O O   . LEU A 1 372 ? 67.919  -20.099 327.067 1.00 32.72  ? 373  LEU A O   1 
ATOM   2811 C CB  . LEU A 1 372 ? 71.208  -19.901 327.498 1.00 32.73  ? 373  LEU A CB  1 
ATOM   2812 C CG  . LEU A 1 372 ? 71.189  -20.857 326.308 1.00 37.37  ? 373  LEU A CG  1 
ATOM   2813 C CD1 . LEU A 1 372 ? 71.091  -20.080 325.004 1.00 33.27  ? 373  LEU A CD1 1 
ATOM   2814 C CD2 . LEU A 1 372 ? 72.426  -21.737 326.324 1.00 42.67  ? 373  LEU A CD2 1 
ATOM   2815 N N   . ALA A 1 373 ? 68.609  -20.349 329.197 1.00 32.51  ? 374  ALA A N   1 
ATOM   2816 C CA  . ALA A 1 373 ? 67.434  -21.135 329.553 1.00 31.84  ? 374  ALA A CA  1 
ATOM   2817 C C   . ALA A 1 373 ? 66.161  -20.314 329.402 1.00 26.23  ? 374  ALA A C   1 
ATOM   2818 O O   . ALA A 1 373 ? 65.148  -20.812 328.899 1.00 25.70  ? 374  ALA A O   1 
ATOM   2819 C CB  . ALA A 1 373 ? 67.568  -21.667 330.979 1.00 29.02  ? 374  ALA A CB  1 
ATOM   2820 N N   . ALA A 1 374 ? 66.197  -19.048 329.825 1.00 31.27  ? 375  ALA A N   1 
ATOM   2821 C CA  . ALA A 1 374 ? 65.049  -18.169 329.632 1.00 28.94  ? 375  ALA A CA  1 
ATOM   2822 C C   . ALA A 1 374 ? 64.728  -18.001 328.153 1.00 30.35  ? 375  ALA A C   1 
ATOM   2823 O O   . ALA A 1 374 ? 63.554  -17.942 327.767 1.00 31.87  ? 375  ALA A O   1 
ATOM   2824 C CB  . ALA A 1 374 ? 65.316  -16.811 330.278 1.00 29.31  ? 375  ALA A CB  1 
ATOM   2825 N N   . GLU A 1 375 ? 65.759  -17.929 327.310 1.00 24.30  ? 376  GLU A N   1 
ATOM   2826 C CA  . GLU A 1 375 ? 65.531  -17.789 325.876 1.00 30.81  ? 376  GLU A CA  1 
ATOM   2827 C C   . GLU A 1 375 ? 64.900  -19.047 325.291 1.00 31.73  ? 376  GLU A C   1 
ATOM   2828 O O   . GLU A 1 375 ? 64.081  -18.965 324.368 1.00 28.04  ? 376  GLU A O   1 
ATOM   2829 C CB  . GLU A 1 375 ? 66.843  -17.462 325.168 1.00 43.30  ? 376  GLU A CB  1 
ATOM   2830 C CG  . GLU A 1 375 ? 66.703  -16.413 324.084 1.00 64.60  ? 376  GLU A CG  1 
ATOM   2831 C CD  . GLU A 1 375 ? 66.437  -15.029 324.638 1.00 75.69  ? 376  GLU A CD  1 
ATOM   2832 O OE1 . GLU A 1 375 ? 67.286  -14.516 325.396 1.00 80.72  ? 376  GLU A OE1 1 
ATOM   2833 O OE2 . GLU A 1 375 ? 65.377  -14.454 324.313 1.00 79.19  ? 376  GLU A OE2 1 
ATOM   2834 N N   . ALA A 1 376 ? 65.273  -20.220 325.810 1.00 25.64  ? 377  ALA A N   1 
ATOM   2835 C CA  . ALA A 1 376 ? 64.631  -21.456 325.373 1.00 26.85  ? 377  ALA A CA  1 
ATOM   2836 C C   . ALA A 1 376 ? 63.156  -21.462 325.741 1.00 26.65  ? 377  ALA A C   1 
ATOM   2837 O O   . ALA A 1 376 ? 62.312  -21.904 324.953 1.00 24.52  ? 377  ALA A O   1 
ATOM   2838 C CB  . ALA A 1 376 ? 65.341  -22.664 325.983 1.00 21.83  ? 377  ALA A CB  1 
ATOM   2839 N N   . VAL A 1 377 ? 62.829  -20.974 326.939 1.00 23.65  ? 378  VAL A N   1 
ATOM   2840 C CA  . VAL A 1 377 ? 61.433  -20.869 327.355 1.00 23.38  ? 378  VAL A CA  1 
ATOM   2841 C C   . VAL A 1 377 ? 60.652  -20.003 326.374 1.00 26.97  ? 378  VAL A C   1 
ATOM   2842 O O   . VAL A 1 377 ? 59.579  -20.390 325.895 1.00 24.20  ? 378  VAL A O   1 
ATOM   2843 C CB  . VAL A 1 377 ? 61.342  -20.313 328.787 1.00 23.83  ? 378  VAL A CB  1 
ATOM   2844 C CG1 . VAL A 1 377 ? 59.887  -20.095 329.176 1.00 20.50  ? 378  VAL A CG1 1 
ATOM   2845 C CG2 . VAL A 1 377 ? 62.028  -21.254 329.764 1.00 20.54  ? 378  VAL A CG2 1 
ATOM   2846 N N   . VAL A 1 378 ? 61.183  -18.820 326.057 1.00 27.43  ? 379  VAL A N   1 
ATOM   2847 C CA  . VAL A 1 378 ? 60.449  -17.888 325.206 1.00 26.95  ? 379  VAL A CA  1 
ATOM   2848 C C   . VAL A 1 378 ? 60.309  -18.448 323.795 1.00 25.34  ? 379  VAL A C   1 
ATOM   2849 O O   . VAL A 1 378 ? 59.258  -18.306 323.161 1.00 32.49  ? 379  VAL A O   1 
ATOM   2850 C CB  . VAL A 1 378 ? 61.129  -16.509 325.217 1.00 29.53  ? 379  VAL A CB  1 
ATOM   2851 C CG1 . VAL A 1 378 ? 60.630  -15.651 324.062 1.00 27.49  ? 379  VAL A CG1 1 
ATOM   2852 C CG2 . VAL A 1 378 ? 60.875  -15.818 326.543 1.00 31.01  ? 379  VAL A CG2 1 
ATOM   2853 N N   . LEU A 1 379 ? 61.354  -19.108 323.291 1.00 29.33  ? 380  LEU A N   1 
ATOM   2854 C CA  . LEU A 1 379 ? 61.256  -19.749 321.982 1.00 31.45  ? 380  LEU A CA  1 
ATOM   2855 C C   . LEU A 1 379 ? 60.116  -20.759 321.944 1.00 35.71  ? 380  LEU A C   1 
ATOM   2856 O O   . LEU A 1 379 ? 59.370  -20.834 320.961 1.00 33.60  ? 380  LEU A O   1 
ATOM   2857 C CB  . LEU A 1 379 ? 62.575  -20.443 321.623 1.00 32.61  ? 380  LEU A CB  1 
ATOM   2858 C CG  . LEU A 1 379 ? 62.433  -21.557 320.576 1.00 33.44  ? 380  LEU A CG  1 
ATOM   2859 C CD1 . LEU A 1 379 ? 62.306  -20.977 319.171 1.00 31.98  ? 380  LEU A CD1 1 
ATOM   2860 C CD2 . LEU A 1 379 ? 63.571  -22.567 320.641 1.00 30.06  ? 380  LEU A CD2 1 
ATOM   2861 N N   . HIS A 1 380 ? 60.028  -21.564 322.949 1.00 34.13  ? 381  HIS A N   1 
ATOM   2862 C CA  . HIS A 1 380 ? 59.019  -22.554 323.031 1.00 32.77  ? 381  HIS A CA  1 
ATOM   2863 C C   . HIS A 1 380 ? 57.569  -22.112 323.201 1.00 29.46  ? 381  HIS A C   1 
ATOM   2864 O O   . HIS A 1 380 ? 56.703  -22.702 322.673 1.00 29.16  ? 381  HIS A O   1 
ATOM   2865 C CB  . HIS A 1 380 ? 59.391  -23.465 324.151 1.00 37.88  ? 381  HIS A CB  1 
ATOM   2866 C CG  . HIS A 1 380 ? 59.415  -24.880 323.759 1.00 44.00  ? 381  HIS A CG  1 
ATOM   2867 N ND1 . HIS A 1 380 ? 58.435  -25.765 324.135 1.00 48.31  ? 381  HIS A ND1 1 
ATOM   2868 C CD2 . HIS A 1 380 ? 60.280  -25.566 322.991 1.00 45.63  ? 381  HIS A CD2 1 
ATOM   2869 C CE1 . HIS A 1 380 ? 58.709  -26.949 323.637 1.00 50.18  ? 381  HIS A CE1 1 
ATOM   2870 N NE2 . HIS A 1 380 ? 59.822  -26.853 322.937 1.00 47.56  ? 381  HIS A NE2 1 
ATOM   2871 N N   . TYR A 1 381 ? 57.338  -21.079 323.977 1.00 25.38  ? 382  TYR A N   1 
ATOM   2872 C CA  . TYR A 1 381 ? 55.990  -20.639 324.309 1.00 25.06  ? 382  TYR A CA  1 
ATOM   2873 C C   . TYR A 1 381 ? 55.534  -19.426 323.512 1.00 27.31  ? 382  TYR A C   1 
ATOM   2874 O O   . TYR A 1 381 ? 54.459  -18.883 323.792 1.00 31.45  ? 382  TYR A O   1 
ATOM   2875 C CB  . TYR A 1 381 ? 55.891  -20.360 325.807 1.00 22.93  ? 382  TYR A CB  1 
ATOM   2876 C CG  . TYR A 1 381 ? 55.842  -21.629 326.617 1.00 20.46  ? 382  TYR A CG  1 
ATOM   2877 C CD1 . TYR A 1 381 ? 54.629  -22.173 327.017 1.00 20.31  ? 382  TYR A CD1 1 
ATOM   2878 C CD2 . TYR A 1 381 ? 57.008  -22.301 326.959 1.00 20.17  ? 382  TYR A CD2 1 
ATOM   2879 C CE1 . TYR A 1 381 ? 54.578  -23.341 327.747 1.00 19.86  ? 382  TYR A CE1 1 
ATOM   2880 C CE2 . TYR A 1 381 ? 56.968  -23.472 327.690 1.00 21.75  ? 382  TYR A CE2 1 
ATOM   2881 C CZ  . TYR A 1 381 ? 55.749  -23.987 328.081 1.00 25.73  ? 382  TYR A CZ  1 
ATOM   2882 O OH  . TYR A 1 381 ? 55.701  -25.152 328.810 1.00 22.73  ? 382  TYR A OH  1 
ATOM   2883 N N   . THR A 1 382 ? 56.308  -18.993 322.525 1.00 25.85  ? 383  THR A N   1 
ATOM   2884 C CA  . THR A 1 382 ? 55.900  -17.918 321.634 1.00 24.93  ? 383  THR A CA  1 
ATOM   2885 C C   . THR A 1 382 ? 55.326  -18.516 320.358 1.00 28.17  ? 383  THR A C   1 
ATOM   2886 O O   . THR A 1 382 ? 55.918  -19.431 319.773 1.00 28.87  ? 383  THR A O   1 
ATOM   2887 C CB  . THR A 1 382 ? 57.074  -16.994 321.302 1.00 25.31  ? 383  THR A CB  1 
ATOM   2888 O OG1 . THR A 1 382 ? 57.391  -16.189 322.444 1.00 28.05  ? 383  THR A OG1 1 
ATOM   2889 C CG2 . THR A 1 382 ? 56.728  -16.084 320.131 1.00 24.60  ? 383  THR A CG2 1 
ATOM   2890 N N   . ASP A 1 383 ? 54.164  -18.019 319.945 1.00 26.08  ? 384  ASP A N   1 
ATOM   2891 C CA  . ASP A 1 383 ? 53.622  -18.298 318.621 1.00 27.36  ? 384  ASP A CA  1 
ATOM   2892 C C   . ASP A 1 383 ? 54.215  -17.265 317.672 1.00 25.92  ? 384  ASP A C   1 
ATOM   2893 O O   . ASP A 1 383 ? 53.843  -16.089 317.713 1.00 27.48  ? 384  ASP A O   1 
ATOM   2894 C CB  . ASP A 1 383 ? 52.096  -18.243 318.634 1.00 27.20  ? 384  ASP A CB  1 
ATOM   2895 C CG  . ASP A 1 383 ? 51.476  -18.602 317.288 1.00 31.97  ? 384  ASP A CG  1 
ATOM   2896 O OD1 . ASP A 1 383 ? 52.200  -18.668 316.271 1.00 34.64  ? 384  ASP A OD1 1 
ATOM   2897 O OD2 . ASP A 1 383 ? 50.248  -18.820 317.250 1.00 32.61  ? 384  ASP A OD2 1 
ATOM   2898 N N   . TRP A 1 384 ? 55.138  -17.699 316.820 1.00 30.95  ? 385  TRP A N   1 
ATOM   2899 C CA  . TRP A 1 384 ? 55.884  -16.768 315.986 1.00 26.97  ? 385  TRP A CA  1 
ATOM   2900 C C   . TRP A 1 384 ? 55.082  -16.247 314.801 1.00 31.86  ? 385  TRP A C   1 
ATOM   2901 O O   . TRP A 1 384 ? 55.596  -15.417 314.043 1.00 31.84  ? 385  TRP A O   1 
ATOM   2902 C CB  . TRP A 1 384 ? 57.185  -17.432 315.535 1.00 26.30  ? 385  TRP A CB  1 
ATOM   2903 C CG  . TRP A 1 384 ? 58.061  -17.699 316.718 1.00 25.40  ? 385  TRP A CG  1 
ATOM   2904 C CD1 . TRP A 1 384 ? 58.201  -18.879 317.389 1.00 24.69  ? 385  TRP A CD1 1 
ATOM   2905 C CD2 . TRP A 1 384 ? 58.870  -16.744 317.412 1.00 25.27  ? 385  TRP A CD2 1 
ATOM   2906 N NE1 . TRP A 1 384 ? 59.071  -18.723 318.443 1.00 24.12  ? 385  TRP A NE1 1 
ATOM   2907 C CE2 . TRP A 1 384 ? 59.495  -17.421 318.478 1.00 25.03  ? 385  TRP A CE2 1 
ATOM   2908 C CE3 . TRP A 1 384 ? 59.138  -15.384 317.226 1.00 25.87  ? 385  TRP A CE3 1 
ATOM   2909 C CZ2 . TRP A 1 384 ? 60.371  -16.784 319.355 1.00 26.54  ? 385  TRP A CZ2 1 
ATOM   2910 C CZ3 . TRP A 1 384 ? 60.007  -14.754 318.097 1.00 25.68  ? 385  TRP A CZ3 1 
ATOM   2911 C CH2 . TRP A 1 384 ? 60.613  -15.453 319.148 1.00 27.63  ? 385  TRP A CH2 1 
ATOM   2912 N N   . LEU A 1 385 ? 53.838  -16.695 314.633 1.00 30.69  ? 386  LEU A N   1 
ATOM   2913 C CA  . LEU A 1 385 ? 52.899  -16.027 313.743 1.00 34.26  ? 386  LEU A CA  1 
ATOM   2914 C C   . LEU A 1 385 ? 52.088  -14.954 314.455 1.00 34.22  ? 386  LEU A C   1 
ATOM   2915 O O   . LEU A 1 385 ? 51.498  -14.096 313.788 1.00 32.97  ? 386  LEU A O   1 
ATOM   2916 C CB  . LEU A 1 385 ? 51.947  -17.044 313.108 1.00 35.24  ? 386  LEU A CB  1 
ATOM   2917 C CG  . LEU A 1 385 ? 52.559  -17.964 312.051 1.00 42.98  ? 386  LEU A CG  1 
ATOM   2918 C CD1 . LEU A 1 385 ? 51.473  -18.719 311.299 1.00 44.96  ? 386  LEU A CD1 1 
ATOM   2919 C CD2 . LEU A 1 385 ? 53.424  -17.163 311.091 1.00 44.96  ? 386  LEU A CD2 1 
ATOM   2920 N N   . HIS A 1 386 ? 52.044  -14.987 315.788 1.00 28.85  ? 387  HIS A N   1 
ATOM   2921 C CA  . HIS A 1 386 ? 51.352  -13.975 316.590 1.00 33.26  ? 387  HIS A CA  1 
ATOM   2922 C C   . HIS A 1 386 ? 52.190  -13.662 317.824 1.00 30.83  ? 387  HIS A C   1 
ATOM   2923 O O   . HIS A 1 386 ? 51.759  -13.881 318.960 1.00 27.77  ? 387  HIS A O   1 
ATOM   2924 C CB  . HIS A 1 386 ? 49.957  -14.458 316.985 1.00 32.85  ? 387  HIS A CB  1 
ATOM   2925 C CG  . HIS A 1 386 ? 49.134  -14.949 315.836 1.00 38.73  ? 387  HIS A CG  1 
ATOM   2926 N ND1 . HIS A 1 386 ? 48.361  -14.111 315.062 1.00 38.87  ? 387  HIS A ND1 1 
ATOM   2927 C CD2 . HIS A 1 386 ? 48.963  -16.193 315.329 1.00 36.21  ? 387  HIS A CD2 1 
ATOM   2928 C CE1 . HIS A 1 386 ? 47.748  -14.817 314.129 1.00 41.21  ? 387  HIS A CE1 1 
ATOM   2929 N NE2 . HIS A 1 386 ? 48.097  -16.084 314.269 1.00 40.09  ? 387  HIS A NE2 1 
ATOM   2930 N N   . PRO A 1 387 ? 53.407  -13.142 317.635 1.00 33.25  ? 388  PRO A N   1 
ATOM   2931 C CA  . PRO A 1 387 ? 54.337  -13.040 318.772 1.00 28.50  ? 388  PRO A CA  1 
ATOM   2932 C C   . PRO A 1 387 ? 53.924  -12.031 319.830 1.00 35.29  ? 388  PRO A C   1 
ATOM   2933 O O   . PRO A 1 387 ? 54.438  -12.104 320.953 1.00 33.77  ? 388  PRO A O   1 
ATOM   2934 C CB  . PRO A 1 387 ? 55.659  -12.636 318.106 1.00 28.24  ? 388  PRO A CB  1 
ATOM   2935 C CG  . PRO A 1 387 ? 55.240  -11.909 316.876 1.00 32.06  ? 388  PRO A CG  1 
ATOM   2936 C CD  . PRO A 1 387 ? 53.994  -12.603 316.395 1.00 29.00  ? 388  PRO A CD  1 
ATOM   2937 N N   . GLU A 1 388 ? 53.017  -11.098 319.525 1.00 31.64  ? 389  GLU A N   1 
ATOM   2938 C CA  . GLU A 1 388 ? 52.701  -10.026 320.464 1.00 37.01  ? 389  GLU A CA  1 
ATOM   2939 C C   . GLU A 1 388 ? 51.205  -9.886  320.727 1.00 36.59  ? 389  GLU A C   1 
ATOM   2940 O O   . GLU A 1 388 ? 50.767  -8.834  321.203 1.00 45.60  ? 389  GLU A O   1 
ATOM   2941 C CB  . GLU A 1 388 ? 53.274  -8.693  319.968 1.00 42.92  ? 389  GLU A CB  1 
ATOM   2942 C CG  . GLU A 1 388 ? 54.641  -8.818  319.310 1.00 52.44  ? 389  GLU A CG  1 
ATOM   2943 C CD  . GLU A 1 388 ? 55.478  -7.560  319.432 1.00 67.86  ? 389  GLU A CD  1 
ATOM   2944 O OE1 . GLU A 1 388 ? 55.174  -6.719  320.304 1.00 75.30  ? 389  GLU A OE1 1 
ATOM   2945 O OE2 . GLU A 1 388 ? 56.449  -7.419  318.660 1.00 75.87  ? 389  GLU A OE2 1 
ATOM   2946 N N   . ASP A 1 389 ? 50.408  -10.914 320.446 1.00 30.13  ? 390  ASP A N   1 
ATOM   2947 C CA  . ASP A 1 389 ? 48.976  -10.830 320.710 1.00 32.25  ? 390  ASP A CA  1 
ATOM   2948 C C   . ASP A 1 389 ? 48.725  -10.976 322.206 1.00 34.90  ? 390  ASP A C   1 
ATOM   2949 O O   . ASP A 1 389 ? 49.043  -12.026 322.776 1.00 34.02  ? 390  ASP A O   1 
ATOM   2950 C CB  . ASP A 1 389 ? 48.209  -11.894 319.937 1.00 40.71  ? 390  ASP A CB  1 
ATOM   2951 C CG  . ASP A 1 389 ? 46.778  -12.058 320.428 1.00 49.61  ? 390  ASP A CG  1 
ATOM   2952 O OD1 . ASP A 1 389 ? 46.150  -11.044 320.802 1.00 57.42  ? 390  ASP A OD1 1 
ATOM   2953 O OD2 . ASP A 1 389 ? 46.274  -13.199 320.426 1.00 54.14  ? 390  ASP A OD2 1 
ATOM   2954 N N   . PRO A 1 390 ? 48.146  -9.969  322.867 1.00 36.97  ? 391  PRO A N   1 
ATOM   2955 C CA  . PRO A 1 390 ? 48.078  -9.992  324.340 1.00 35.23  ? 391  PRO A CA  1 
ATOM   2956 C C   . PRO A 1 390 ? 47.358  -11.196 324.924 1.00 32.34  ? 391  PRO A C   1 
ATOM   2957 O O   . PRO A 1 390 ? 47.805  -11.733 325.945 1.00 34.54  ? 391  PRO A O   1 
ATOM   2958 C CB  . PRO A 1 390 ? 47.345  -8.682  324.666 1.00 38.04  ? 391  PRO A CB  1 
ATOM   2959 C CG  . PRO A 1 390 ? 47.643  -7.791  323.504 1.00 38.91  ? 391  PRO A CG  1 
ATOM   2960 C CD  . PRO A 1 390 ? 47.667  -8.693  322.308 1.00 33.78  ? 391  PRO A CD  1 
ATOM   2961 N N   . ALA A 1 391 ? 46.251  -11.634 324.320 1.00 35.31  ? 392  ALA A N   1 
ATOM   2962 C CA  . ALA A 1 391 ? 45.523  -12.774 324.870 1.00 32.51  ? 392  ALA A CA  1 
ATOM   2963 C C   . ALA A 1 391 ? 46.351  -14.051 324.790 1.00 29.36  ? 392  ALA A C   1 
ATOM   2964 O O   . ALA A 1 391 ? 46.377  -14.841 325.741 1.00 30.74  ? 392  ALA A O   1 
ATOM   2965 C CB  . ALA A 1 391 ? 44.189  -12.951 324.146 1.00 34.20  ? 392  ALA A CB  1 
ATOM   2966 N N   . ARG A 1 392 ? 47.035  -14.269 323.663 1.00 29.87  ? 393  ARG A N   1 
ATOM   2967 C CA  . ARG A 1 392 ? 47.904  -15.435 323.540 1.00 31.37  ? 393  ARG A CA  1 
ATOM   2968 C C   . ARG A 1 392 ? 49.071  -15.359 324.516 1.00 28.57  ? 393  ARG A C   1 
ATOM   2969 O O   . ARG A 1 392 ? 49.486  -16.380 325.076 1.00 27.07  ? 393  ARG A O   1 
ATOM   2970 C CB  . ARG A 1 392 ? 48.417  -15.561 322.105 1.00 30.86  ? 393  ARG A CB  1 
ATOM   2971 C CG  . ARG A 1 392 ? 47.402  -16.101 321.109 1.00 32.00  ? 393  ARG A CG  1 
ATOM   2972 C CD  . ARG A 1 392 ? 48.003  -16.160 319.711 1.00 37.50  ? 393  ARG A CD  1 
ATOM   2973 N NE  . ARG A 1 392 ? 47.148  -16.864 318.759 1.00 42.19  ? 393  ARG A NE  1 
ATOM   2974 C CZ  . ARG A 1 392 ? 46.335  -16.261 317.898 1.00 46.70  ? 393  ARG A CZ  1 
ATOM   2975 N NH1 . ARG A 1 392 ? 46.262  -14.937 317.867 1.00 51.58  ? 393  ARG A NH1 1 
ATOM   2976 N NH2 . ARG A 1 392 ? 45.596  -16.980 317.065 1.00 49.35  ? 393  ARG A NH2 1 
ATOM   2977 N N   . LEU A 1 393 ? 49.613  -14.157 324.731 1.00 25.97  ? 394  LEU A N   1 
ATOM   2978 C CA  . LEU A 1 393 ? 50.722  -13.997 325.667 1.00 27.81  ? 394  LEU A CA  1 
ATOM   2979 C C   . LEU A 1 393 ? 50.295  -14.305 327.097 1.00 30.36  ? 394  LEU A C   1 
ATOM   2980 O O   . LEU A 1 393 ? 51.053  -14.919 327.858 1.00 25.89  ? 394  LEU A O   1 
ATOM   2981 C CB  . LEU A 1 393 ? 51.285  -12.579 325.572 1.00 26.14  ? 394  LEU A CB  1 
ATOM   2982 C CG  . LEU A 1 393 ? 52.039  -12.221 324.291 1.00 30.70  ? 394  LEU A CG  1 
ATOM   2983 C CD1 . LEU A 1 393 ? 52.239  -10.717 324.198 1.00 28.61  ? 394  LEU A CD1 1 
ATOM   2984 C CD2 . LEU A 1 393 ? 53.374  -12.947 324.233 1.00 25.62  ? 394  LEU A CD2 1 
ATOM   2985 N N   . ARG A 1 394 ? 49.095  -13.870 327.486 1.00 33.34  ? 395  ARG A N   1 
ATOM   2986 C CA  . ARG A 1 394 ? 48.597  -14.158 328.826 1.00 28.04  ? 395  ARG A CA  1 
ATOM   2987 C C   . ARG A 1 394 ? 48.445  -15.656 329.029 1.00 33.00  ? 395  ARG A C   1 
ATOM   2988 O O   . ARG A 1 394 ? 48.833  -16.200 330.070 1.00 27.74  ? 395  ARG A O   1 
ATOM   2989 C CB  . ARG A 1 394 ? 47.259  -13.452 329.041 1.00 29.95  ? 395  ARG A CB  1 
ATOM   2990 C CG  . ARG A 1 394 ? 46.623  -13.705 330.393 1.00 32.40  ? 395  ARG A CG  1 
ATOM   2991 C CD  . ARG A 1 394 ? 45.175  -13.246 330.405 1.00 35.97  ? 395  ARG A CD  1 
ATOM   2992 N NE  . ARG A 1 394 ? 44.344  -14.038 329.504 1.00 42.38  ? 395  ARG A NE  1 
ATOM   2993 C CZ  . ARG A 1 394 ? 43.173  -13.638 329.020 1.00 43.82  ? 395  ARG A CZ  1 
ATOM   2994 N NH1 . ARG A 1 394 ? 42.689  -12.447 329.346 1.00 44.67  ? 395  ARG A NH1 1 
ATOM   2995 N NH2 . ARG A 1 394 ? 42.487  -14.428 328.206 1.00 45.82  ? 395  ARG A NH2 1 
ATOM   2996 N N   . GLU A 1 395 ? 47.886  -16.337 328.024 1.00 31.05  ? 396  GLU A N   1 
ATOM   2997 C CA  . GLU A 1 395 ? 47.669  -17.776 328.102 1.00 31.53  ? 396  GLU A CA  1 
ATOM   2998 C C   . GLU A 1 395 ? 48.998  -18.516 328.080 1.00 28.89  ? 396  GLU A C   1 
ATOM   2999 O O   . GLU A 1 395 ? 49.164  -19.516 328.784 1.00 21.86  ? 396  GLU A O   1 
ATOM   3000 C CB  . GLU A 1 395 ? 46.763  -18.223 326.944 1.00 40.90  ? 396  GLU A CB  1 
ATOM   3001 C CG  . GLU A 1 395 ? 46.142  -19.568 327.072 1.00 58.67  ? 396  GLU A CG  1 
ATOM   3002 C CD  . GLU A 1 395 ? 45.577  -20.089 325.785 1.00 79.68  ? 396  GLU A CD  1 
ATOM   3003 O OE1 . GLU A 1 395 ? 45.045  -21.225 325.817 1.00 87.29  ? 396  GLU A OE1 1 
ATOM   3004 O OE2 . GLU A 1 395 ? 45.715  -19.377 324.746 1.00 82.90  ? 396  GLU A OE2 1 
ATOM   3005 N N   . ALA A 1 396 ? 49.970  -18.016 327.306 1.00 32.04  ? 397  ALA A N   1 
ATOM   3006 C CA  . ALA A 1 396 ? 51.277  -18.663 327.222 1.00 23.82  ? 397  ALA A CA  1 
ATOM   3007 C C   . ALA A 1 396 ? 52.037  -18.565 328.541 1.00 23.89  ? 397  ALA A C   1 
ATOM   3008 O O   . ALA A 1 396 ? 52.658  -19.542 328.978 1.00 27.49  ? 397  ALA A O   1 
ATOM   3009 C CB  . ALA A 1 396 ? 52.093  -18.045 326.087 1.00 22.48  ? 397  ALA A CB  1 
ATOM   3010 N N   . LEU A 1 397 ? 52.008  -17.396 329.186 1.00 24.93  ? 398  LEU A N   1 
ATOM   3011 C CA  . LEU A 1 397 ? 52.678  -17.259 330.475 1.00 24.94  ? 398  LEU A CA  1 
ATOM   3012 C C   . LEU A 1 397 ? 52.039  -18.160 331.523 1.00 27.41  ? 398  LEU A C   1 
ATOM   3013 O O   . LEU A 1 397 ? 52.735  -18.719 332.379 1.00 28.09  ? 398  LEU A O   1 
ATOM   3014 C CB  . LEU A 1 397 ? 52.657  -15.804 330.940 1.00 22.41  ? 398  LEU A CB  1 
ATOM   3015 C CG  . LEU A 1 397 ? 53.549  -15.533 332.155 1.00 28.43  ? 398  LEU A CG  1 
ATOM   3016 C CD1 . LEU A 1 397 ? 54.967  -16.024 331.896 1.00 24.34  ? 398  LEU A CD1 1 
ATOM   3017 C CD2 . LEU A 1 397 ? 53.550  -14.061 332.521 1.00 30.01  ? 398  LEU A CD2 1 
ATOM   3018 N N   . SER A 1 398 ? 50.715  -18.315 331.470 1.00 25.89  ? 399  SER A N   1 
ATOM   3019 C CA  . SER A 1 398 ? 50.045  -19.235 332.382 1.00 26.00  ? 399  SER A CA  1 
ATOM   3020 C C   . SER A 1 398 ? 50.510  -20.666 332.152 1.00 26.07  ? 399  SER A C   1 
ATOM   3021 O O   . SER A 1 398 ? 50.694  -21.430 333.107 1.00 29.51  ? 399  SER A O   1 
ATOM   3022 C CB  . SER A 1 398 ? 48.529  -19.127 332.218 1.00 23.64  ? 399  SER A CB  1 
ATOM   3023 O OG  . SER A 1 398 ? 47.858  -20.032 333.078 1.00 31.77  ? 399  SER A OG  1 
ATOM   3024 N N   . ASP A 1 399 ? 50.714  -21.044 330.888 1.00 24.76  ? 400  ASP A N   1 
ATOM   3025 C CA  . ASP A 1 399 ? 51.212  -22.382 330.589 1.00 22.81  ? 400  ASP A CA  1 
ATOM   3026 C C   . ASP A 1 399 ? 52.645  -22.558 331.077 1.00 23.02  ? 400  ASP A C   1 
ATOM   3027 O O   . ASP A 1 399 ? 52.996  -23.620 331.601 1.00 19.52  ? 400  ASP A O   1 
ATOM   3028 C CB  . ASP A 1 399 ? 51.116  -22.657 329.089 1.00 30.32  ? 400  ASP A CB  1 
ATOM   3029 C CG  . ASP A 1 399 ? 49.689  -22.887 328.629 1.00 42.27  ? 400  ASP A CG  1 
ATOM   3030 O OD1 . ASP A 1 399 ? 48.847  -23.275 329.467 1.00 45.67  ? 400  ASP A OD1 1 
ATOM   3031 O OD2 . ASP A 1 399 ? 49.409  -22.679 327.430 1.00 47.30  ? 400  ASP A OD2 1 
ATOM   3032 N N   . VAL A 1 400 ? 53.481  -21.526 330.922 1.00 19.63  ? 401  VAL A N   1 
ATOM   3033 C CA  . VAL A 1 400 ? 54.863  -21.597 331.398 1.00 21.43  ? 401  VAL A CA  1 
ATOM   3034 C C   . VAL A 1 400 ? 54.898  -21.961 332.877 1.00 24.12  ? 401  VAL A C   1 
ATOM   3035 O O   . VAL A 1 400 ? 55.546  -22.933 333.285 1.00 24.21  ? 401  VAL A O   1 
ATOM   3036 C CB  . VAL A 1 400 ? 55.592  -20.265 331.139 1.00 25.03  ? 401  VAL A CB  1 
ATOM   3037 C CG1 . VAL A 1 400 ? 56.914  -20.232 331.891 1.00 19.85  ? 401  VAL A CG1 1 
ATOM   3038 C CG2 . VAL A 1 400 ? 55.815  -20.054 329.652 1.00 23.15  ? 401  VAL A CG2 1 
ATOM   3039 N N   . VAL A 1 401 ? 54.190  -21.186 333.698 1.00 25.05  ? 402  VAL A N   1 
ATOM   3040 C CA  . VAL A 1 401 ? 54.210  -21.406 335.140 1.00 24.41  ? 402  VAL A CA  1 
ATOM   3041 C C   . VAL A 1 401 ? 53.568  -22.743 335.491 1.00 23.27  ? 402  VAL A C   1 
ATOM   3042 O O   . VAL A 1 401 ? 54.079  -23.489 336.334 1.00 26.03  ? 402  VAL A O   1 
ATOM   3043 C CB  . VAL A 1 401 ? 53.519  -20.233 335.859 1.00 24.60  ? 402  VAL A CB  1 
ATOM   3044 C CG1 . VAL A 1 401 ? 53.407  -20.508 337.351 1.00 24.32  ? 402  VAL A CG1 1 
ATOM   3045 C CG2 . VAL A 1 401 ? 54.278  -18.940 335.603 1.00 25.53  ? 402  VAL A CG2 1 
ATOM   3046 N N   . GLY A 1 402 ? 52.447  -23.072 334.845 1.00 22.96  ? 403  GLY A N   1 
ATOM   3047 C CA  . GLY A 1 402 ? 51.775  -24.327 335.143 1.00 19.41  ? 403  GLY A CA  1 
ATOM   3048 C C   . GLY A 1 402 ? 52.570  -25.544 334.709 1.00 20.57  ? 403  GLY A C   1 
ATOM   3049 O O   . GLY A 1 402 ? 52.675  -26.524 335.453 1.00 24.05  ? 403  GLY A O   1 
ATOM   3050 N N   . ASP A 1 403 ? 53.140  -25.502 333.501 1.00 18.29  ? 404  ASP A N   1 
ATOM   3051 C CA  . ASP A 1 403 ? 53.929  -26.629 333.010 1.00 20.02  ? 404  ASP A CA  1 
ATOM   3052 C C   . ASP A 1 403 ? 55.160  -26.857 333.876 1.00 20.81  ? 404  ASP A C   1 
ATOM   3053 O O   . ASP A 1 403 ? 55.421  -27.979 334.324 1.00 21.74  ? 404  ASP A O   1 
ATOM   3054 C CB  . ASP A 1 403 ? 54.348  -26.399 331.557 1.00 24.95  ? 404  ASP A CB  1 
ATOM   3055 C CG  . ASP A 1 403 ? 53.176  -26.423 330.607 1.00 35.60  ? 404  ASP A CG  1 
ATOM   3056 O OD1 . ASP A 1 403 ? 53.139  -25.598 329.668 1.00 37.30  ? 404  ASP A OD1 1 
ATOM   3057 O OD2 . ASP A 1 403 ? 52.282  -27.262 330.818 1.00 38.21  ? 404  ASP A OD2 1 
ATOM   3058 N N   . HIS A 1 404 ? 55.940  -25.811 334.068 1.00 20.61  ? 405  HIS A N   1 
ATOM   3059 C CA  . HIS A 1 404 ? 57.178  -25.909 334.821 1.00 20.80  ? 405  HIS A CA  1 
ATOM   3060 C C   . HIS A 1 404 ? 57.038  -26.306 336.284 1.00 21.98  ? 405  HIS A C   1 
ATOM   3061 O O   . HIS A 1 404 ? 57.923  -26.954 336.842 1.00 26.41  ? 405  HIS A O   1 
ATOM   3062 C CB  . HIS A 1 404 ? 57.960  -24.595 334.720 1.00 20.19  ? 405  HIS A CB  1 
ATOM   3063 C CG  . HIS A 1 404 ? 59.251  -24.600 335.477 1.00 25.35  ? 405  HIS A CG  1 
ATOM   3064 N ND1 . HIS A 1 404 ? 60.443  -25.002 334.914 1.00 27.75  ? 405  HIS A ND1 1 
ATOM   3065 C CD2 . HIS A 1 404 ? 59.537  -24.251 336.754 1.00 24.55  ? 405  HIS A CD2 1 
ATOM   3066 C CE1 . HIS A 1 404 ? 61.407  -24.902 335.811 1.00 28.94  ? 405  HIS A CE1 1 
ATOM   3067 N NE2 . HIS A 1 404 ? 60.885  -24.448 336.936 1.00 28.84  ? 405  HIS A NE2 1 
ATOM   3068 N N   . ASN A 1 405 ? 55.951  -25.885 336.916 1.00 20.99  ? 406  ASN A N   1 
ATOM   3069 C CA  . ASN A 1 405 ? 55.798  -26.100 338.349 1.00 21.08  ? 406  ASN A CA  1 
ATOM   3070 C C   . ASN A 1 405 ? 54.904  -27.282 338.698 1.00 21.45  ? 406  ASN A C   1 
ATOM   3071 O O   . ASN A 1 405 ? 55.103  -27.903 339.748 1.00 24.95  ? 406  ASN A O   1 
ATOM   3072 C CB  . ASN A 1 405 ? 55.246  -24.834 339.010 1.00 21.18  ? 406  ASN A CB  1 
ATOM   3073 C CG  . ASN A 1 405 ? 56.292  -23.743 339.148 1.00 22.60  ? 406  ASN A CG  1 
ATOM   3074 O OD1 . ASN A 1 405 ? 57.277  -23.898 339.869 1.00 26.92  ? 406  ASN A OD1 1 
ATOM   3075 N ND2 . ASN A 1 405 ? 56.085  -22.633 338.449 1.00 19.14  ? 406  ASN A ND2 1 
ATOM   3076 N N   . VAL A 1 406 ? 53.924  -27.614 337.856 1.00 19.31  ? 407  VAL A N   1 
ATOM   3077 C CA  . VAL A 1 406 ? 52.946  -28.635 338.219 1.00 19.41  ? 407  VAL A CA  1 
ATOM   3078 C C   . VAL A 1 406 ? 52.860  -29.734 337.167 1.00 23.43  ? 407  VAL A C   1 
ATOM   3079 O O   . VAL A 1 406 ? 53.156  -30.900 337.451 1.00 25.20  ? 407  VAL A O   1 
ATOM   3080 C CB  . VAL A 1 406 ? 51.556  -28.012 338.451 1.00 23.38  ? 407  VAL A CB  1 
ATOM   3081 C CG1 . VAL A 1 406 ? 50.573  -29.084 338.890 1.00 22.04  ? 407  VAL A CG1 1 
ATOM   3082 C CG2 . VAL A 1 406 ? 51.629  -26.897 339.484 1.00 19.14  ? 407  VAL A CG2 1 
ATOM   3083 N N   . VAL A 1 407 ? 52.454  -29.371 335.948 1.00 21.25  ? 408  VAL A N   1 
ATOM   3084 C CA  . VAL A 1 407 ? 52.030  -30.372 334.969 1.00 20.98  ? 408  VAL A CA  1 
ATOM   3085 C C   . VAL A 1 407 ? 53.183  -31.296 334.596 1.00 18.89  ? 408  VAL A C   1 
ATOM   3086 O O   . VAL A 1 407 ? 53.034  -32.523 334.565 1.00 25.22  ? 408  VAL A O   1 
ATOM   3087 C CB  . VAL A 1 407 ? 51.436  -29.689 333.724 1.00 28.08  ? 408  VAL A CB  1 
ATOM   3088 C CG1 . VAL A 1 407 ? 50.963  -30.735 332.725 1.00 23.25  ? 408  VAL A CG1 1 
ATOM   3089 C CG2 . VAL A 1 407 ? 50.294  -28.771 334.121 1.00 27.27  ? 408  VAL A CG2 1 
ATOM   3090 N N   . CYS A 1 408 ? 54.342  -30.727 334.299 1.00 21.97  ? 409  CYS A N   1 
ATOM   3091 C CA  . CYS A 1 408 ? 55.442  -31.550 333.811 1.00 22.01  ? 409  CYS A CA  1 
ATOM   3092 C C   . CYS A 1 408 ? 56.119  -32.348 334.925 1.00 23.83  ? 409  CYS A C   1 
ATOM   3093 O O   . CYS A 1 408 ? 56.513  -33.497 334.685 1.00 27.76  ? 409  CYS A O   1 
ATOM   3094 C CB  . CYS A 1 408 ? 56.448  -30.680 333.057 1.00 26.71  ? 409  CYS A CB  1 
ATOM   3095 S SG  . CYS A 1 408 ? 55.733  -29.984 331.542 1.00 28.44  ? 409  CYS A SG  1 
ATOM   3096 N N   . PRO A 1 409 ? 56.288  -31.808 336.142 1.00 22.14  ? 410  PRO A N   1 
ATOM   3097 C CA  . PRO A 1 409 ? 56.709  -32.690 337.246 1.00 19.84  ? 410  PRO A CA  1 
ATOM   3098 C C   . PRO A 1 409 ? 55.736  -33.830 337.490 1.00 20.76  ? 410  PRO A C   1 
ATOM   3099 O O   . PRO A 1 409 ? 56.161  -34.970 337.717 1.00 22.39  ? 410  PRO A O   1 
ATOM   3100 C CB  . PRO A 1 409 ? 56.786  -31.735 338.445 1.00 18.26  ? 410  PRO A CB  1 
ATOM   3101 C CG  . PRO A 1 409 ? 57.089  -30.418 337.837 1.00 21.22  ? 410  PRO A CG  1 
ATOM   3102 C CD  . PRO A 1 409 ? 56.300  -30.393 336.558 1.00 18.51  ? 410  PRO A CD  1 
ATOM   3103 N N   . VAL A 1 410 ? 54.431  -33.546 337.443 1.00 18.83  ? 411  VAL A N   1 
ATOM   3104 C CA  . VAL A 1 410 ? 53.422  -34.596 337.569 1.00 19.29  ? 411  VAL A CA  1 
ATOM   3105 C C   . VAL A 1 410 ? 53.585  -35.625 336.456 1.00 27.89  ? 411  VAL A C   1 
ATOM   3106 O O   . VAL A 1 410 ? 53.572  -36.838 336.698 1.00 27.13  ? 411  VAL A O   1 
ATOM   3107 C CB  . VAL A 1 410 ? 52.009  -33.982 337.563 1.00 24.43  ? 411  VAL A CB  1 
ATOM   3108 C CG1 . VAL A 1 410 ? 50.964  -35.048 337.272 1.00 21.81  ? 411  VAL A CG1 1 
ATOM   3109 C CG2 . VAL A 1 410 ? 51.719  -33.298 338.891 1.00 17.77  ? 411  VAL A CG2 1 
ATOM   3110 N N   . ALA A 1 411 ? 53.745  -35.150 335.217 1.00 24.46  ? 412  ALA A N   1 
ATOM   3111 C CA  . ALA A 1 411 ? 53.856  -36.061 334.081 1.00 26.58  ? 412  ALA A CA  1 
ATOM   3112 C C   . ALA A 1 411 ? 55.110  -36.919 334.177 1.00 27.39  ? 412  ALA A C   1 
ATOM   3113 O O   . ALA A 1 411 ? 55.073  -38.120 333.882 1.00 26.80  ? 412  ALA A O   1 
ATOM   3114 C CB  . ALA A 1 411 ? 53.846  -35.271 332.773 1.00 24.74  ? 412  ALA A CB  1 
ATOM   3115 N N   . GLN A 1 412 ? 56.234  -36.322 334.583 1.00 25.68  ? 413  GLN A N   1 
ATOM   3116 C CA  . GLN A 1 412 ? 57.455  -37.103 334.757 1.00 24.39  ? 413  GLN A CA  1 
ATOM   3117 C C   . GLN A 1 412 ? 57.286  -38.143 335.855 1.00 27.66  ? 413  GLN A C   1 
ATOM   3118 O O   . GLN A 1 412 ? 57.716  -39.293 335.703 1.00 30.18  ? 413  GLN A O   1 
ATOM   3119 C CB  . GLN A 1 412 ? 58.633  -36.186 335.075 1.00 27.04  ? 413  GLN A CB  1 
ATOM   3120 C CG  . GLN A 1 412 ? 59.893  -36.943 335.446 1.00 40.54  ? 413  GLN A CG  1 
ATOM   3121 C CD  . GLN A 1 412 ? 61.150  -36.157 335.161 1.00 58.65  ? 413  GLN A CD  1 
ATOM   3122 O OE1 . GLN A 1 412 ? 61.374  -35.092 335.735 1.00 62.63  ? 413  GLN A OE1 1 
ATOM   3123 N NE2 . GLN A 1 412 ? 61.979  -36.675 334.261 1.00 70.13  ? 413  GLN A NE2 1 
ATOM   3124 N N   . LEU A 1 413 ? 56.612  -37.758 336.935 1.00 24.36  ? 414  LEU A N   1 
ATOM   3125 C CA  . LEU A 1 413 ? 56.350  -38.673 338.041 1.00 25.57  ? 414  LEU A CA  1 
ATOM   3126 C C   . LEU A 1 413 ? 55.474  -39.849 337.593 1.00 23.77  ? 414  LEU A C   1 
ATOM   3127 O O   . LEU A 1 413 ? 55.718  -40.992 337.980 1.00 22.62  ? 414  LEU A O   1 
ATOM   3128 C CB  . LEU A 1 413 ? 55.688  -37.932 339.204 1.00 26.91  ? 414  LEU A CB  1 
ATOM   3129 C CG  . LEU A 1 413 ? 55.447  -38.730 340.488 1.00 35.08  ? 414  LEU A CG  1 
ATOM   3130 C CD1 . LEU A 1 413 ? 54.985  -37.814 341.611 1.00 33.13  ? 414  LEU A CD1 1 
ATOM   3131 C CD2 . LEU A 1 413 ? 54.443  -39.849 340.256 1.00 43.72  ? 414  LEU A CD2 1 
ATOM   3132 N N   . ALA A 1 414 ? 54.458  -39.567 336.778 1.00 26.01  ? 415  ALA A N   1 
ATOM   3133 C CA  . ALA A 1 414 ? 53.568  -40.609 336.278 1.00 26.55  ? 415  ALA A CA  1 
ATOM   3134 C C   . ALA A 1 414 ? 54.283  -41.538 335.305 1.00 29.21  ? 415  ALA A C   1 
ATOM   3135 O O   . ALA A 1 414 ? 54.138  -42.764 335.387 1.00 31.08  ? 415  ALA A O   1 
ATOM   3136 C CB  . ALA A 1 414 ? 52.348  -39.973 335.611 1.00 20.95  ? 415  ALA A CB  1 
ATOM   3137 N N   . GLY A 1 415 ? 55.061  -40.976 334.379 1.00 30.77  ? 416  GLY A N   1 
ATOM   3138 C CA  . GLY A 1 415 ? 55.723  -41.804 333.384 1.00 31.77  ? 416  GLY A CA  1 
ATOM   3139 C C   . GLY A 1 415 ? 56.763  -42.732 333.981 1.00 32.02  ? 416  GLY A C   1 
ATOM   3140 O O   . GLY A 1 415 ? 56.829  -43.913 333.626 1.00 32.97  ? 416  GLY A O   1 
ATOM   3141 N N   . ARG A 1 416 ? 57.587  -42.218 334.897 1.00 27.84  ? 417  ARG A N   1 
ATOM   3142 C CA  . ARG A 1 416 ? 58.645  -43.041 335.476 1.00 28.13  ? 417  ARG A CA  1 
ATOM   3143 C C   . ARG A 1 416 ? 58.075  -44.118 336.391 1.00 32.57  ? 417  ARG A C   1 
ATOM   3144 O O   . ARG A 1 416 ? 58.553  -45.259 336.383 1.00 36.32  ? 417  ARG A O   1 
ATOM   3145 C CB  . ARG A 1 416 ? 59.640  -42.160 336.228 1.00 29.33  ? 417  ARG A CB  1 
ATOM   3146 C CG  . ARG A 1 416 ? 60.391  -41.185 335.337 1.00 39.91  ? 417  ARG A CG  1 
ATOM   3147 C CD  . ARG A 1 416 ? 61.061  -41.912 334.182 1.00 47.37  ? 417  ARG A CD  1 
ATOM   3148 N NE  . ARG A 1 416 ? 62.015  -42.913 334.649 1.00 55.86  ? 417  ARG A NE  1 
ATOM   3149 C CZ  . ARG A 1 416 ? 63.329  -42.833 334.467 1.00 58.05  ? 417  ARG A CZ  1 
ATOM   3150 N NH1 . ARG A 1 416 ? 63.848  -41.797 333.823 1.00 56.05  ? 417  ARG A NH1 1 
ATOM   3151 N NH2 . ARG A 1 416 ? 64.124  -43.790 334.927 1.00 57.44  ? 417  ARG A NH2 1 
ATOM   3152 N N   . LEU A 1 417 ? 57.057  -43.778 337.188 1.00 31.45  ? 418  LEU A N   1 
ATOM   3153 C CA  . LEU A 1 417 ? 56.421  -44.783 338.037 1.00 26.95  ? 418  LEU A CA  1 
ATOM   3154 C C   . LEU A 1 417 ? 55.793  -45.890 337.200 1.00 30.97  ? 418  LEU A C   1 
ATOM   3155 O O   . LEU A 1 417 ? 55.945  -47.077 337.512 1.00 33.76  ? 418  LEU A O   1 
ATOM   3156 C CB  . LEU A 1 417 ? 55.362  -44.136 338.932 1.00 28.91  ? 418  LEU A CB  1 
ATOM   3157 C CG  . LEU A 1 417 ? 55.780  -43.164 340.040 1.00 36.37  ? 418  LEU A CG  1 
ATOM   3158 C CD1 . LEU A 1 417 ? 54.700  -43.084 341.109 1.00 30.60  ? 418  LEU A CD1 1 
ATOM   3159 C CD2 . LEU A 1 417 ? 57.107  -43.553 340.652 1.00 37.94  ? 418  LEU A CD2 1 
ATOM   3160 N N   . ALA A 1 418 ? 55.086  -45.520 336.129 1.00 33.11  ? 419  ALA A N   1 
ATOM   3161 C CA  . ALA A 1 418 ? 54.433  -46.519 335.289 1.00 35.03  ? 419  ALA A CA  1 
ATOM   3162 C C   . ALA A 1 418 ? 55.452  -47.431 334.620 1.00 32.60  ? 419  ALA A C   1 
ATOM   3163 O O   . ALA A 1 418 ? 55.249  -48.649 334.540 1.00 38.00  ? 419  ALA A O   1 
ATOM   3164 C CB  . ALA A 1 418 ? 53.560  -45.833 334.239 1.00 35.51  ? 419  ALA A CB  1 
ATOM   3165 N N   . ALA A 1 419 ? 56.559  -46.862 334.138 1.00 31.64  ? 420  ALA A N   1 
ATOM   3166 C CA  . ALA A 1 419 ? 57.574  -47.658 333.461 1.00 31.62  ? 420  ALA A CA  1 
ATOM   3167 C C   . ALA A 1 419 ? 58.335  -48.568 334.413 1.00 36.97  ? 420  ALA A C   1 
ATOM   3168 O O   . ALA A 1 419 ? 58.959  -49.533 333.960 1.00 44.84  ? 420  ALA A O   1 
ATOM   3169 C CB  . ALA A 1 419 ? 58.555  -46.743 332.726 1.00 28.54  ? 420  ALA A CB  1 
ATOM   3170 N N   . GLN A 1 420 ? 58.293  -48.296 335.717 1.00 40.87  ? 421  GLN A N   1 
ATOM   3171 C CA  . GLN A 1 420 ? 59.099  -49.028 336.686 1.00 39.35  ? 421  GLN A CA  1 
ATOM   3172 C C   . GLN A 1 420 ? 58.241  -49.829 337.662 1.00 39.06  ? 421  GLN A C   1 
ATOM   3173 O O   . GLN A 1 420 ? 58.638  -50.054 338.807 1.00 40.78  ? 421  GLN A O   1 
ATOM   3174 C CB  . GLN A 1 420 ? 60.030  -48.072 337.431 1.00 41.88  ? 421  GLN A CB  1 
ATOM   3175 C CG  . GLN A 1 420 ? 61.066  -47.428 336.519 1.00 47.55  ? 421  GLN A CG  1 
ATOM   3176 C CD  . GLN A 1 420 ? 61.653  -46.158 337.096 1.00 47.30  ? 421  GLN A CD  1 
ATOM   3177 O OE1 . GLN A 1 420 ? 62.027  -45.245 336.360 1.00 52.68  ? 421  GLN A OE1 1 
ATOM   3178 N NE2 . GLN A 1 420 ? 61.744  -46.095 338.418 1.00 48.38  ? 421  GLN A NE2 1 
ATOM   3179 N N   . GLY A 1 421 ? 57.063  -50.270 337.221 1.00 41.32  ? 422  GLY A N   1 
ATOM   3180 C CA  . GLY A 1 421 ? 56.294  -51.270 337.935 1.00 40.09  ? 422  GLY A CA  1 
ATOM   3181 C C   . GLY A 1 421 ? 55.014  -50.786 338.582 1.00 41.09  ? 422  GLY A C   1 
ATOM   3182 O O   . GLY A 1 421 ? 54.235  -51.621 339.057 1.00 42.40  ? 422  GLY A O   1 
ATOM   3183 N N   . ALA A 1 422 ? 54.764  -49.482 338.621 1.00 38.83  ? 423  ALA A N   1 
ATOM   3184 C CA  . ALA A 1 422 ? 53.570  -48.991 339.291 1.00 38.60  ? 423  ALA A CA  1 
ATOM   3185 C C   . ALA A 1 422 ? 52.369  -49.005 338.350 1.00 34.01  ? 423  ALA A C   1 
ATOM   3186 O O   . ALA A 1 422 ? 52.500  -48.970 337.124 1.00 36.07  ? 423  ALA A O   1 
ATOM   3187 C CB  . ALA A 1 422 ? 53.794  -47.576 339.827 1.00 40.52  ? 423  ALA A CB  1 
ATOM   3188 N N   . ARG A 1 423 ? 51.183  -49.067 338.949 1.00 33.97  ? 424  ARG A N   1 
ATOM   3189 C CA  . ARG A 1 423 ? 49.924  -48.908 338.233 1.00 35.65  ? 424  ARG A CA  1 
ATOM   3190 C C   . ARG A 1 423 ? 49.449  -47.472 338.427 1.00 34.75  ? 424  ARG A C   1 
ATOM   3191 O O   . ARG A 1 423 ? 49.154  -47.063 339.556 1.00 31.27  ? 424  ARG A O   1 
ATOM   3192 C CB  . ARG A 1 423 ? 48.882  -49.906 338.735 1.00 41.68  ? 424  ARG A CB  1 
ATOM   3193 C CG  . ARG A 1 423 ? 47.456  -49.566 338.347 1.00 51.98  ? 424  ARG A CG  1 
ATOM   3194 C CD  . ARG A 1 423 ? 47.235  -49.744 336.856 1.00 62.44  ? 424  ARG A CD  1 
ATOM   3195 N NE  . ARG A 1 423 ? 47.635  -51.069 336.394 1.00 73.72  ? 424  ARG A NE  1 
ATOM   3196 C CZ  . ARG A 1 423 ? 46.845  -52.138 336.415 1.00 79.16  ? 424  ARG A CZ  1 
ATOM   3197 N NH1 . ARG A 1 423 ? 45.606  -52.039 336.876 1.00 77.30  ? 424  ARG A NH1 1 
ATOM   3198 N NH2 . ARG A 1 423 ? 47.294  -53.305 335.974 1.00 83.92  ? 424  ARG A NH2 1 
ATOM   3199 N N   . VAL A 1 424 ? 49.393  -46.708 337.335 1.00 31.02  ? 425  VAL A N   1 
ATOM   3200 C CA  . VAL A 1 424 ? 49.161  -45.268 337.380 1.00 29.66  ? 425  VAL A CA  1 
ATOM   3201 C C   . VAL A 1 424 ? 47.834  -44.945 336.708 1.00 32.05  ? 425  VAL A C   1 
ATOM   3202 O O   . VAL A 1 424 ? 47.535  -45.462 335.626 1.00 32.67  ? 425  VAL A O   1 
ATOM   3203 C CB  . VAL A 1 424 ? 50.296  -44.480 336.688 1.00 32.53  ? 425  VAL A CB  1 
ATOM   3204 C CG1 . VAL A 1 424 ? 50.071  -42.980 336.836 1.00 22.40  ? 425  VAL A CG1 1 
ATOM   3205 C CG2 . VAL A 1 424 ? 51.664  -44.886 337.212 1.00 23.83  ? 425  VAL A CG2 1 
ATOM   3206 N N   . TYR A 1 425 ? 47.052  -44.071 337.338 1.00 25.66  ? 426  TYR A N   1 
ATOM   3207 C CA  . TYR A 1 425 ? 45.878  -43.468 336.722 1.00 24.36  ? 426  TYR A CA  1 
ATOM   3208 C C   . TYR A 1 425 ? 46.031  -41.954 336.745 1.00 29.68  ? 426  TYR A C   1 
ATOM   3209 O O   . TYR A 1 425 ? 46.444  -41.379 337.757 1.00 29.91  ? 426  TYR A O   1 
ATOM   3210 C CB  . TYR A 1 425 ? 44.591  -43.881 337.439 1.00 25.16  ? 426  TYR A CB  1 
ATOM   3211 C CG  . TYR A 1 425 ? 44.311  -45.362 337.363 1.00 26.67  ? 426  TYR A CG  1 
ATOM   3212 C CD1 . TYR A 1 425 ? 43.543  -45.892 336.334 1.00 31.20  ? 426  TYR A CD1 1 
ATOM   3213 C CD2 . TYR A 1 425 ? 44.820  -46.231 338.317 1.00 26.26  ? 426  TYR A CD2 1 
ATOM   3214 C CE1 . TYR A 1 425 ? 43.288  -47.249 336.261 1.00 33.07  ? 426  TYR A CE1 1 
ATOM   3215 C CE2 . TYR A 1 425 ? 44.570  -47.586 338.253 1.00 30.42  ? 426  TYR A CE2 1 
ATOM   3216 C CZ  . TYR A 1 425 ? 43.805  -48.090 337.223 1.00 35.57  ? 426  TYR A CZ  1 
ATOM   3217 O OH  . TYR A 1 425 ? 43.557  -49.441 337.158 1.00 39.13  ? 426  TYR A OH  1 
ATOM   3218 N N   . ALA A 1 426 ? 45.703  -41.311 335.625 1.00 23.32  ? 427  ALA A N   1 
ATOM   3219 C CA  . ALA A 1 426 ? 45.909  -39.879 335.466 1.00 23.07  ? 427  ALA A CA  1 
ATOM   3220 C C   . ALA A 1 426 ? 44.620  -39.203 335.025 1.00 24.61  ? 427  ALA A C   1 
ATOM   3221 O O   . ALA A 1 426 ? 43.815  -39.781 334.289 1.00 28.37  ? 427  ALA A O   1 
ATOM   3222 C CB  . ALA A 1 426 ? 47.025  -39.581 334.456 1.00 21.38  ? 427  ALA A CB  1 
ATOM   3223 N N   . TYR A 1 427 ? 44.436  -37.964 335.477 1.00 20.86  ? 428  TYR A N   1 
ATOM   3224 C CA  . TYR A 1 427 ? 43.249  -37.189 335.149 1.00 22.97  ? 428  TYR A CA  1 
ATOM   3225 C C   . TYR A 1 427 ? 43.639  -35.745 334.870 1.00 28.30  ? 428  TYR A C   1 
ATOM   3226 O O   . TYR A 1 427 ? 44.715  -35.282 335.252 1.00 19.95  ? 428  TYR A O   1 
ATOM   3227 C CB  . TYR A 1 427 ? 42.205  -37.235 336.281 1.00 22.14  ? 428  TYR A CB  1 
ATOM   3228 C CG  . TYR A 1 427 ? 42.619  -36.500 337.543 1.00 20.22  ? 428  TYR A CG  1 
ATOM   3229 C CD1 . TYR A 1 427 ? 42.435  -35.125 337.668 1.00 24.26  ? 428  TYR A CD1 1 
ATOM   3230 C CD2 . TYR A 1 427 ? 43.186  -37.182 338.612 1.00 19.92  ? 428  TYR A CD2 1 
ATOM   3231 C CE1 . TYR A 1 427 ? 42.816  -34.452 338.813 1.00 22.50  ? 428  TYR A CE1 1 
ATOM   3232 C CE2 . TYR A 1 427 ? 43.565  -36.517 339.766 1.00 25.86  ? 428  TYR A CE2 1 
ATOM   3233 C CZ  . TYR A 1 427 ? 43.379  -35.152 339.858 1.00 25.35  ? 428  TYR A CZ  1 
ATOM   3234 O OH  . TYR A 1 427 ? 43.756  -34.483 340.998 1.00 27.26  ? 428  TYR A OH  1 
ATOM   3235 N N   . VAL A 1 428 ? 42.737  -35.034 334.199 1.00 23.70  ? 429  VAL A N   1 
ATOM   3236 C CA  . VAL A 1 428 ? 42.766  -33.578 334.131 1.00 24.19  ? 429  VAL A CA  1 
ATOM   3237 C C   . VAL A 1 428 ? 41.386  -33.082 334.536 1.00 25.04  ? 429  VAL A C   1 
ATOM   3238 O O   . VAL A 1 428 ? 40.379  -33.482 333.939 1.00 21.88  ? 429  VAL A O   1 
ATOM   3239 C CB  . VAL A 1 428 ? 43.148  -33.054 332.737 1.00 31.20  ? 429  VAL A CB  1 
ATOM   3240 C CG1 . VAL A 1 428 ? 43.030  -31.537 332.698 1.00 20.86  ? 429  VAL A CG1 1 
ATOM   3241 C CG2 . VAL A 1 428 ? 44.564  -33.475 332.386 1.00 29.82  ? 429  VAL A CG2 1 
ATOM   3242 N N   . PHE A 1 429 ? 41.337  -32.234 335.557 1.00 22.62  ? 430  PHE A N   1 
ATOM   3243 C CA  . PHE A 1 429 ? 40.082  -31.707 336.076 1.00 21.35  ? 430  PHE A CA  1 
ATOM   3244 C C   . PHE A 1 429 ? 39.701  -30.463 335.282 1.00 25.23  ? 430  PHE A C   1 
ATOM   3245 O O   . PHE A 1 429 ? 40.419  -29.458 335.313 1.00 24.37  ? 430  PHE A O   1 
ATOM   3246 C CB  . PHE A 1 429 ? 40.216  -31.389 337.563 1.00 20.47  ? 430  PHE A CB  1 
ATOM   3247 C CG  . PHE A 1 429 ? 38.936  -30.958 338.207 1.00 24.88  ? 430  PHE A CG  1 
ATOM   3248 C CD1 . PHE A 1 429 ? 38.033  -31.896 338.677 1.00 23.33  ? 430  PHE A CD1 1 
ATOM   3249 C CD2 . PHE A 1 429 ? 38.634  -29.614 338.345 1.00 24.38  ? 430  PHE A CD2 1 
ATOM   3250 C CE1 . PHE A 1 429 ? 36.852  -31.502 339.272 1.00 27.06  ? 430  PHE A CE1 1 
ATOM   3251 C CE2 . PHE A 1 429 ? 37.456  -29.213 338.940 1.00 26.39  ? 430  PHE A CE2 1 
ATOM   3252 C CZ  . PHE A 1 429 ? 36.562  -30.158 339.403 1.00 24.67  ? 430  PHE A CZ  1 
ATOM   3253 N N   . GLU A 1 430 ? 38.567  -30.526 334.580 1.00 23.00  ? 431  GLU A N   1 
ATOM   3254 C CA  . GLU A 1 430 ? 38.207  -29.501 333.608 1.00 29.49  ? 431  GLU A CA  1 
ATOM   3255 C C   . GLU A 1 430 ? 36.875  -28.819 333.892 1.00 29.98  ? 431  GLU A C   1 
ATOM   3256 O O   . GLU A 1 430 ? 36.359  -28.119 333.012 1.00 33.06  ? 431  GLU A O   1 
ATOM   3257 C CB  . GLU A 1 430 ? 38.168  -30.095 332.197 1.00 26.33  ? 431  GLU A CB  1 
ATOM   3258 C CG  . GLU A 1 430 ? 39.470  -30.701 331.723 1.00 35.84  ? 431  GLU A CG  1 
ATOM   3259 C CD  . GLU A 1 430 ? 39.467  -30.951 330.229 1.00 43.67  ? 431  GLU A CD  1 
ATOM   3260 O OE1 . GLU A 1 430 ? 40.515  -30.741 329.586 1.00 51.11  ? 431  GLU A OE1 1 
ATOM   3261 O OE2 . GLU A 1 430 ? 38.408  -31.349 329.697 1.00 50.61  ? 431  GLU A OE2 1 
ATOM   3262 N N   . HIS A 1 431 ? 36.295  -28.995 335.073 1.00 28.73  ? 432  HIS A N   1 
ATOM   3263 C CA  . HIS A 1 431 ? 35.038  -28.335 335.399 1.00 30.92  ? 432  HIS A CA  1 
ATOM   3264 C C   . HIS A 1 431 ? 35.311  -27.052 336.169 1.00 32.71  ? 432  HIS A C   1 
ATOM   3265 O O   . HIS A 1 431 ? 36.009  -27.067 337.188 1.00 31.33  ? 432  HIS A O   1 
ATOM   3266 C CB  . HIS A 1 431 ? 34.110  -29.233 336.215 1.00 27.49  ? 432  HIS A CB  1 
ATOM   3267 C CG  . HIS A 1 431 ? 32.864  -28.537 336.666 1.00 31.44  ? 432  HIS A CG  1 
ATOM   3268 N ND1 . HIS A 1 431 ? 31.894  -28.106 335.785 1.00 32.47  ? 432  HIS A ND1 1 
ATOM   3269 C CD2 . HIS A 1 431 ? 32.441  -28.170 337.899 1.00 32.69  ? 432  HIS A CD2 1 
ATOM   3270 C CE1 . HIS A 1 431 ? 30.922  -27.516 336.458 1.00 31.98  ? 432  HIS A CE1 1 
ATOM   3271 N NE2 . HIS A 1 431 ? 31.229  -27.542 337.742 1.00 33.74  ? 432  HIS A NE2 1 
ATOM   3272 N N   . ARG A 1 432 ? 34.755  -25.950 335.681 1.00 33.86  ? 433  ARG A N   1 
ATOM   3273 C CA  . ARG A 1 432 ? 34.821  -24.675 336.379 1.00 36.03  ? 433  ARG A CA  1 
ATOM   3274 C C   . ARG A 1 432 ? 33.565  -24.527 337.230 1.00 40.26  ? 433  ARG A C   1 
ATOM   3275 O O   . ARG A 1 432 ? 32.450  -24.487 336.698 1.00 41.35  ? 433  ARG A O   1 
ATOM   3276 C CB  . ARG A 1 432 ? 34.954  -23.523 335.387 1.00 36.62  ? 433  ARG A CB  1 
ATOM   3277 C CG  . ARG A 1 432 ? 34.559  -22.181 335.957 1.00 41.00  ? 433  ARG A CG  1 
ATOM   3278 C CD  . ARG A 1 432 ? 35.412  -21.069 335.391 1.00 39.66  ? 433  ARG A CD  1 
ATOM   3279 N NE  . ARG A 1 432 ? 35.005  -19.775 335.922 1.00 43.34  ? 433  ARG A NE  1 
ATOM   3280 C CZ  . ARG A 1 432 ? 35.846  -18.795 336.232 1.00 43.58  ? 433  ARG A CZ  1 
ATOM   3281 N NH1 . ARG A 1 432 ? 37.151  -18.960 336.064 1.00 37.61  ? 433  ARG A NH1 1 
ATOM   3282 N NH2 . ARG A 1 432 ? 35.381  -17.651 336.715 1.00 44.74  ? 433  ARG A NH2 1 
ATOM   3283 N N   . ALA A 1 433 ? 33.750  -24.457 338.547 1.00 38.83  ? 434  ALA A N   1 
ATOM   3284 C CA  . ALA A 1 433 ? 32.621  -24.450 339.467 1.00 36.35  ? 434  ALA A CA  1 
ATOM   3285 C C   . ALA A 1 433 ? 31.727  -23.239 339.228 1.00 36.47  ? 434  ALA A C   1 
ATOM   3286 O O   . ALA A 1 433 ? 32.205  -22.131 338.970 1.00 39.86  ? 434  ALA A O   1 
ATOM   3287 C CB  . ALA A 1 433 ? 33.118  -24.458 340.913 1.00 29.34  ? 434  ALA A CB  1 
ATOM   3288 N N   . SER A 1 434 ? 30.414  -23.464 339.315 1.00 33.71  ? 435  SER A N   1 
ATOM   3289 C CA  . SER A 1 434 ? 29.455  -22.377 339.165 1.00 39.22  ? 435  SER A CA  1 
ATOM   3290 C C   . SER A 1 434 ? 29.618  -21.314 340.242 1.00 42.67  ? 435  SER A C   1 
ATOM   3291 O O   . SER A 1 434 ? 29.202  -20.169 340.038 1.00 46.01  ? 435  SER A O   1 
ATOM   3292 C CB  . SER A 1 434 ? 28.028  -22.928 339.200 1.00 41.05  ? 435  SER A CB  1 
ATOM   3293 O OG  . SER A 1 434 ? 27.702  -23.404 340.495 1.00 39.74  ? 435  SER A OG  1 
ATOM   3294 N N   . THR A 1 435 ? 30.218  -21.667 341.376 1.00 40.87  ? 436  THR A N   1 
ATOM   3295 C CA  . THR A 1 435 ? 30.373  -20.762 342.506 1.00 41.45  ? 436  THR A CA  1 
ATOM   3296 C C   . THR A 1 435 ? 31.720  -20.052 342.524 1.00 39.96  ? 436  THR A C   1 
ATOM   3297 O O   . THR A 1 435 ? 31.976  -19.271 343.446 1.00 43.86  ? 436  THR A O   1 
ATOM   3298 C CB  . THR A 1 435 ? 30.196  -21.533 343.817 1.00 41.48  ? 436  THR A CB  1 
ATOM   3299 O OG1 . THR A 1 435 ? 31.107  -22.639 343.844 1.00 42.56  ? 436  THR A OG1 1 
ATOM   3300 C CG2 . THR A 1 435 ? 28.774  -22.057 343.940 1.00 42.07  ? 436  THR A CG2 1 
ATOM   3301 N N   . LEU A 1 436 ? 32.580  -20.298 341.538 1.00 37.50  ? 437  LEU A N   1 
ATOM   3302 C CA  . LEU A 1 436 ? 33.935  -19.764 341.573 1.00 42.98  ? 437  LEU A CA  1 
ATOM   3303 C C   . LEU A 1 436 ? 33.922  -18.244 341.460 1.00 46.72  ? 437  LEU A C   1 
ATOM   3304 O O   . LEU A 1 436 ? 33.246  -17.678 340.595 1.00 45.76  ? 437  LEU A O   1 
ATOM   3305 C CB  . LEU A 1 436 ? 34.773  -20.374 340.452 1.00 40.18  ? 437  LEU A CB  1 
ATOM   3306 C CG  . LEU A 1 436 ? 36.275  -20.113 340.566 1.00 50.28  ? 437  LEU A CG  1 
ATOM   3307 C CD1 . LEU A 1 436 ? 36.942  -21.241 341.314 1.00 51.04  ? 437  LEU A CD1 1 
ATOM   3308 C CD2 . LEU A 1 436 ? 36.899  -19.957 339.199 1.00 57.40  ? 437  LEU A CD2 1 
ATOM   3309 N N   . SER A 1 437 ? 34.681  -17.584 342.336 1.00 45.15  ? 438  SER A N   1 
ATOM   3310 C CA  . SER A 1 437 ? 34.713  -16.130 342.410 1.00 50.62  ? 438  SER A CA  1 
ATOM   3311 C C   . SER A 1 437 ? 35.845  -15.507 341.602 1.00 48.37  ? 438  SER A C   1 
ATOM   3312 O O   . SER A 1 437 ? 35.828  -14.291 341.382 1.00 49.46  ? 438  SER A O   1 
ATOM   3313 C CB  . SER A 1 437 ? 34.825  -15.681 343.872 1.00 56.79  ? 438  SER A CB  1 
ATOM   3314 O OG  . SER A 1 437 ? 35.804  -16.437 344.564 1.00 64.94  ? 438  SER A OG  1 
ATOM   3315 N N   . TRP A 1 438 ? 36.821  -16.298 341.161 1.00 42.24  ? 439  TRP A N   1 
ATOM   3316 C CA  . TRP A 1 438 ? 37.905  -15.779 340.345 1.00 40.84  ? 439  TRP A CA  1 
ATOM   3317 C C   . TRP A 1 438 ? 37.386  -15.387 338.962 1.00 41.04  ? 439  TRP A C   1 
ATOM   3318 O O   . TRP A 1 438 ? 36.341  -15.872 338.521 1.00 43.10  ? 439  TRP A O   1 
ATOM   3319 C CB  . TRP A 1 438 ? 39.017  -16.819 340.226 1.00 33.97  ? 439  TRP A CB  1 
ATOM   3320 C CG  . TRP A 1 438 ? 39.727  -17.081 341.517 1.00 34.91  ? 439  TRP A CG  1 
ATOM   3321 C CD1 . TRP A 1 438 ? 39.530  -18.135 342.360 1.00 37.30  ? 439  TRP A CD1 1 
ATOM   3322 C CD2 . TRP A 1 438 ? 40.745  -16.271 342.118 1.00 38.74  ? 439  TRP A CD2 1 
ATOM   3323 N NE1 . TRP A 1 438 ? 40.364  -18.034 343.447 1.00 38.28  ? 439  TRP A NE1 1 
ATOM   3324 C CE2 . TRP A 1 438 ? 41.120  -16.899 343.323 1.00 43.51  ? 439  TRP A CE2 1 
ATOM   3325 C CE3 . TRP A 1 438 ? 41.377  -15.077 341.754 1.00 36.16  ? 439  TRP A CE3 1 
ATOM   3326 C CZ2 . TRP A 1 438 ? 42.098  -16.373 344.166 1.00 41.46  ? 439  TRP A CZ2 1 
ATOM   3327 C CZ3 . TRP A 1 438 ? 42.347  -14.557 342.592 1.00 40.21  ? 439  TRP A CZ3 1 
ATOM   3328 C CH2 . TRP A 1 438 ? 42.698  -15.205 343.784 1.00 44.27  ? 439  TRP A CH2 1 
ATOM   3329 N N   . PRO A 1 439 ? 38.095  -14.503 338.259 1.00 43.56  ? 440  PRO A N   1 
ATOM   3330 C CA  . PRO A 1 439 ? 37.631  -14.077 336.935 1.00 44.21  ? 440  PRO A CA  1 
ATOM   3331 C C   . PRO A 1 439 ? 37.636  -15.221 335.932 1.00 43.07  ? 440  PRO A C   1 
ATOM   3332 O O   . PRO A 1 439 ? 38.247  -16.272 336.136 1.00 39.72  ? 440  PRO A O   1 
ATOM   3333 C CB  . PRO A 1 439 ? 38.635  -12.988 336.538 1.00 46.09  ? 440  PRO A CB  1 
ATOM   3334 C CG  . PRO A 1 439 ? 39.852  -13.294 337.340 1.00 50.25  ? 440  PRO A CG  1 
ATOM   3335 C CD  . PRO A 1 439 ? 39.331  -13.804 338.651 1.00 46.52  ? 440  PRO A CD  1 
ATOM   3336 N N   . LEU A 1 440 ? 36.941  -14.985 334.817 1.00 44.84  ? 441  LEU A N   1 
ATOM   3337 C CA  . LEU A 1 440 ? 36.722  -16.038 333.831 1.00 48.51  ? 441  LEU A CA  1 
ATOM   3338 C C   . LEU A 1 440 ? 38.008  -16.446 333.123 1.00 46.39  ? 441  LEU A C   1 
ATOM   3339 O O   . LEU A 1 440 ? 38.170  -17.621 332.776 1.00 45.55  ? 441  LEU A O   1 
ATOM   3340 C CB  . LEU A 1 440 ? 35.678  -15.585 332.810 1.00 55.75  ? 441  LEU A CB  1 
ATOM   3341 C CG  . LEU A 1 440 ? 34.953  -16.676 332.020 1.00 60.65  ? 441  LEU A CG  1 
ATOM   3342 C CD1 . LEU A 1 440 ? 34.140  -17.566 332.946 1.00 58.32  ? 441  LEU A CD1 1 
ATOM   3343 C CD2 . LEU A 1 440 ? 34.064  -16.056 330.953 1.00 66.14  ? 441  LEU A CD2 1 
ATOM   3344 N N   . TRP A 1 441 ? 38.931  -15.505 332.897 1.00 43.10  ? 442  TRP A N   1 
ATOM   3345 C CA  . TRP A 1 441 ? 40.126  -15.832 332.125 1.00 41.84  ? 442  TRP A CA  1 
ATOM   3346 C C   . TRP A 1 441 ? 41.020  -16.842 332.834 1.00 40.22  ? 442  TRP A C   1 
ATOM   3347 O O   . TRP A 1 441 ? 41.816  -17.514 332.171 1.00 37.28  ? 442  TRP A O   1 
ATOM   3348 C CB  . TRP A 1 441 ? 40.922  -14.564 331.790 1.00 42.84  ? 442  TRP A CB  1 
ATOM   3349 C CG  . TRP A 1 441 ? 41.497  -13.825 332.969 1.00 42.64  ? 442  TRP A CG  1 
ATOM   3350 C CD1 . TRP A 1 441 ? 40.950  -12.748 333.606 1.00 47.71  ? 442  TRP A CD1 1 
ATOM   3351 C CD2 . TRP A 1 441 ? 42.741  -14.092 333.632 1.00 39.80  ? 442  TRP A CD2 1 
ATOM   3352 N NE1 . TRP A 1 441 ? 41.770  -12.335 334.629 1.00 44.56  ? 442  TRP A NE1 1 
ATOM   3353 C CE2 . TRP A 1 441 ? 42.875  -13.144 334.667 1.00 42.27  ? 442  TRP A CE2 1 
ATOM   3354 C CE3 . TRP A 1 441 ? 43.751  -15.043 333.455 1.00 38.24  ? 442  TRP A CE3 1 
ATOM   3355 C CZ2 . TRP A 1 441 ? 43.976  -13.121 335.520 1.00 41.84  ? 442  TRP A CZ2 1 
ATOM   3356 C CZ3 . TRP A 1 441 ? 44.843  -15.019 334.305 1.00 37.85  ? 442  TRP A CZ3 1 
ATOM   3357 C CH2 . TRP A 1 441 ? 44.947  -14.063 335.324 1.00 38.92  ? 442  TRP A CH2 1 
ATOM   3358 N N   . MET A 1 442 ? 40.898  -16.978 334.156 1.00 39.98  ? 443  MET A N   1 
ATOM   3359 C CA  . MET A 1 442 ? 41.712  -17.940 334.888 1.00 36.43  ? 443  MET A CA  1 
ATOM   3360 C C   . MET A 1 442 ? 41.274  -19.383 334.658 1.00 35.21  ? 443  MET A C   1 
ATOM   3361 O O   . MET A 1 442 ? 42.002  -20.300 335.054 1.00 36.81  ? 443  MET A O   1 
ATOM   3362 C CB  . MET A 1 442 ? 41.691  -17.608 336.383 1.00 35.86  ? 443  MET A CB  1 
ATOM   3363 C CG  . MET A 1 442 ? 42.350  -16.272 336.715 1.00 36.83  ? 443  MET A CG  1 
ATOM   3364 S SD  . MET A 1 442 ? 42.513  -15.903 338.476 1.00 39.96  ? 443  MET A SD  1 
ATOM   3365 C CE  . MET A 1 442 ? 42.816  -17.530 339.158 1.00 44.14  ? 443  MET A CE  1 
ATOM   3366 N N   . GLY A 1 443 ? 40.121  -19.604 334.032 1.00 36.68  ? 444  GLY A N   1 
ATOM   3367 C CA  . GLY A 1 443 ? 39.709  -20.961 333.698 1.00 33.04  ? 444  GLY A CA  1 
ATOM   3368 C C   . GLY A 1 443 ? 39.396  -21.772 334.940 1.00 33.76  ? 444  GLY A C   1 
ATOM   3369 O O   . GLY A 1 443 ? 38.650  -21.336 335.824 1.00 31.36  ? 444  GLY A O   1 
ATOM   3370 N N   . VAL A 1 444 ? 39.960  -22.974 335.005 1.00 30.61  ? 445  VAL A N   1 
ATOM   3371 C CA  . VAL A 1 444 ? 39.838  -23.842 336.174 1.00 29.41  ? 445  VAL A CA  1 
ATOM   3372 C C   . VAL A 1 444 ? 41.131  -23.722 336.973 1.00 32.32  ? 445  VAL A C   1 
ATOM   3373 O O   . VAL A 1 444 ? 42.115  -24.411 336.667 1.00 25.19  ? 445  VAL A O   1 
ATOM   3374 C CB  . VAL A 1 444 ? 39.555  -25.297 335.768 1.00 32.26  ? 445  VAL A CB  1 
ATOM   3375 C CG1 . VAL A 1 444 ? 39.375  -26.171 337.002 1.00 28.22  ? 445  VAL A CG1 1 
ATOM   3376 C CG2 . VAL A 1 444 ? 38.325  -25.366 334.875 1.00 35.08  ? 445  VAL A CG2 1 
ATOM   3377 N N   . PRO A 1 445 ? 41.178  -22.871 337.992 1.00 31.80  ? 446  PRO A N   1 
ATOM   3378 C CA  . PRO A 1 445 ? 42.451  -22.553 338.641 1.00 29.76  ? 446  PRO A CA  1 
ATOM   3379 C C   . PRO A 1 445 ? 42.915  -23.664 339.574 1.00 30.17  ? 446  PRO A C   1 
ATOM   3380 O O   . PRO A 1 445 ? 42.173  -24.579 339.934 1.00 27.35  ? 446  PRO A O   1 
ATOM   3381 C CB  . PRO A 1 445 ? 42.146  -21.268 339.427 1.00 29.16  ? 446  PRO A CB  1 
ATOM   3382 C CG  . PRO A 1 445 ? 40.753  -20.850 339.011 1.00 34.96  ? 446  PRO A CG  1 
ATOM   3383 C CD  . PRO A 1 445 ? 40.068  -22.097 338.565 1.00 30.33  ? 446  PRO A CD  1 
ATOM   3384 N N   . HIS A 1 446 ? 44.183  -23.551 339.961 1.00 28.71  ? 447  HIS A N   1 
ATOM   3385 C CA  . HIS A 1 446 ? 44.792  -24.482 340.899 1.00 26.21  ? 447  HIS A CA  1 
ATOM   3386 C C   . HIS A 1 446 ? 43.998  -24.541 342.199 1.00 26.30  ? 447  HIS A C   1 
ATOM   3387 O O   . HIS A 1 446 ? 43.584  -23.513 342.743 1.00 24.93  ? 447  HIS A O   1 
ATOM   3388 C CB  . HIS A 1 446 ? 46.235  -24.049 341.173 1.00 28.45  ? 447  HIS A CB  1 
ATOM   3389 C CG  . HIS A 1 446 ? 46.965  -24.924 342.142 1.00 32.50  ? 447  HIS A CG  1 
ATOM   3390 N ND1 . HIS A 1 446 ? 47.785  -25.956 341.741 1.00 34.56  ? 447  HIS A ND1 1 
ATOM   3391 C CD2 . HIS A 1 446 ? 47.015  -24.906 343.495 1.00 33.36  ? 447  HIS A CD2 1 
ATOM   3392 C CE1 . HIS A 1 446 ? 48.301  -26.544 342.806 1.00 35.04  ? 447  HIS A CE1 1 
ATOM   3393 N NE2 . HIS A 1 446 ? 47.849  -25.926 343.882 1.00 37.15  ? 447  HIS A NE2 1 
ATOM   3394 N N   . GLY A 1 447 ? 43.768  -25.761 342.686 1.00 23.19  ? 448  GLY A N   1 
ATOM   3395 C CA  . GLY A 1 447 ? 43.148  -25.978 343.974 1.00 22.24  ? 448  GLY A CA  1 
ATOM   3396 C C   . GLY A 1 447 ? 41.643  -26.144 343.968 1.00 28.93  ? 448  GLY A C   1 
ATOM   3397 O O   . GLY A 1 447 ? 41.068  -26.444 345.022 1.00 27.18  ? 448  GLY A O   1 
ATOM   3398 N N   . TYR A 1 448 ? 40.978  -25.977 342.826 1.00 27.68  ? 449  TYR A N   1 
ATOM   3399 C CA  . TYR A 1 448 ? 39.522  -25.928 342.810 1.00 28.29  ? 449  TYR A CA  1 
ATOM   3400 C C   . TYR A 1 448 ? 38.885  -27.224 342.327 1.00 26.81  ? 449  TYR A C   1 
ATOM   3401 O O   . TYR A 1 448 ? 37.701  -27.236 341.975 1.00 29.53  ? 449  TYR A O   1 
ATOM   3402 C CB  . TYR A 1 448 ? 39.057  -24.727 341.993 1.00 22.95  ? 449  TYR A CB  1 
ATOM   3403 C CG  . TYR A 1 448 ? 39.275  -23.467 342.786 1.00 29.54  ? 449  TYR A CG  1 
ATOM   3404 C CD1 . TYR A 1 448 ? 38.367  -23.080 343.762 1.00 30.04  ? 449  TYR A CD1 1 
ATOM   3405 C CD2 . TYR A 1 448 ? 40.421  -22.703 342.615 1.00 27.55  ? 449  TYR A CD2 1 
ATOM   3406 C CE1 . TYR A 1 448 ? 38.569  -21.943 344.513 1.00 34.03  ? 449  TYR A CE1 1 
ATOM   3407 C CE2 . TYR A 1 448 ? 40.635  -21.563 343.364 1.00 30.78  ? 449  TYR A CE2 1 
ATOM   3408 C CZ  . TYR A 1 448 ? 39.705  -21.188 344.313 1.00 38.40  ? 449  TYR A CZ  1 
ATOM   3409 O OH  . TYR A 1 448 ? 39.910  -20.055 345.064 1.00 45.70  ? 449  TYR A OH  1 
ATOM   3410 N N   . GLU A 1 449 ? 39.642  -28.317 342.324 1.00 21.91  ? 450  GLU A N   1 
ATOM   3411 C CA  . GLU A 1 449 ? 39.051  -29.645 342.277 1.00 23.98  ? 450  GLU A CA  1 
ATOM   3412 C C   . GLU A 1 449 ? 38.810  -30.213 343.667 1.00 27.79  ? 450  GLU A C   1 
ATOM   3413 O O   . GLU A 1 449 ? 37.999  -31.136 343.813 1.00 22.28  ? 450  GLU A O   1 
ATOM   3414 C CB  . GLU A 1 449 ? 39.951  -30.600 341.485 1.00 24.58  ? 450  GLU A CB  1 
ATOM   3415 C CG  . GLU A 1 449 ? 40.994  -31.334 342.322 1.00 32.17  ? 450  GLU A CG  1 
ATOM   3416 C CD  . GLU A 1 449 ? 42.152  -30.448 342.760 1.00 32.82  ? 450  GLU A CD  1 
ATOM   3417 O OE1 . GLU A 1 449 ? 42.076  -29.213 342.589 1.00 31.77  ? 450  GLU A OE1 1 
ATOM   3418 O OE2 . GLU A 1 449 ? 43.148  -30.996 343.278 1.00 35.68  ? 450  GLU A OE2 1 
ATOM   3419 N N   . ILE A 1 450 ? 39.477  -29.661 344.687 1.00 27.24  ? 451  ILE A N   1 
ATOM   3420 C CA  . ILE A 1 450 ? 39.431  -30.235 346.032 1.00 27.62  ? 451  ILE A CA  1 
ATOM   3421 C C   . ILE A 1 450 ? 37.998  -30.286 346.548 1.00 26.58  ? 451  ILE A C   1 
ATOM   3422 O O   . ILE A 1 450 ? 37.559  -31.298 347.106 1.00 26.01  ? 451  ILE A O   1 
ATOM   3423 C CB  . ILE A 1 450 ? 40.335  -29.438 346.989 1.00 26.58  ? 451  ILE A CB  1 
ATOM   3424 C CG1 . ILE A 1 450 ? 41.790  -29.459 346.519 1.00 22.62  ? 451  ILE A CG1 1 
ATOM   3425 C CG2 . ILE A 1 450 ? 40.233  -29.990 348.402 1.00 24.11  ? 451  ILE A CG2 1 
ATOM   3426 C CD1 . ILE A 1 450 ? 42.687  -28.565 347.348 1.00 20.98  ? 451  ILE A CD1 1 
ATOM   3427 N N   . GLU A 1 451 ? 37.251  -29.190 346.374 1.00 20.75  ? 452  GLU A N   1 
ATOM   3428 C CA  . GLU A 1 451 ? 35.897  -29.123 346.917 1.00 27.35  ? 452  GLU A CA  1 
ATOM   3429 C C   . GLU A 1 451 ? 35.008  -30.224 346.359 1.00 26.86  ? 452  GLU A C   1 
ATOM   3430 O O   . GLU A 1 451 ? 34.117  -30.717 347.061 1.00 27.12  ? 452  GLU A O   1 
ATOM   3431 C CB  . GLU A 1 451 ? 35.279  -27.751 346.638 1.00 24.89  ? 452  GLU A CB  1 
ATOM   3432 C CG  . GLU A 1 451 ? 35.449  -27.251 345.213 1.00 29.96  ? 452  GLU A CG  1 
ATOM   3433 C CD  . GLU A 1 451 ? 35.263  -25.747 345.101 1.00 40.72  ? 452  GLU A CD  1 
ATOM   3434 O OE1 . GLU A 1 451 ? 34.254  -25.314 344.507 1.00 42.84  ? 452  GLU A OE1 1 
ATOM   3435 O OE2 . GLU A 1 451 ? 36.123  -24.999 345.613 1.00 43.00  ? 452  GLU A OE2 1 
ATOM   3436 N N   . PHE A 1 452 ? 35.234  -30.630 345.110 1.00 21.71  ? 453  PHE A N   1 
ATOM   3437 C CA  . PHE A 1 452 ? 34.441  -31.711 344.540 1.00 24.15  ? 453  PHE A CA  1 
ATOM   3438 C C   . PHE A 1 452 ? 34.889  -33.069 345.066 1.00 28.90  ? 453  PHE A C   1 
ATOM   3439 O O   . PHE A 1 452 ? 34.056  -33.956 345.281 1.00 32.18  ? 453  PHE A O   1 
ATOM   3440 C CB  . PHE A 1 452 ? 34.515  -31.662 343.014 1.00 22.39  ? 453  PHE A CB  1 
ATOM   3441 C CG  . PHE A 1 452 ? 33.736  -30.527 342.415 1.00 28.25  ? 453  PHE A CG  1 
ATOM   3442 C CD1 . PHE A 1 452 ? 34.337  -29.301 342.183 1.00 24.17  ? 453  PHE A CD1 1 
ATOM   3443 C CD2 . PHE A 1 452 ? 32.394  -30.679 342.108 1.00 24.26  ? 453  PHE A CD2 1 
ATOM   3444 C CE1 . PHE A 1 452 ? 33.618  -28.252 341.642 1.00 30.69  ? 453  PHE A CE1 1 
ATOM   3445 C CE2 . PHE A 1 452 ? 31.669  -29.635 341.567 1.00 30.20  ? 453  PHE A CE2 1 
ATOM   3446 C CZ  . PHE A 1 452 ? 32.282  -28.420 341.334 1.00 25.38  ? 453  PHE A CZ  1 
ATOM   3447 N N   . ILE A 1 453 ? 36.194  -33.244 345.291 1.00 25.92  ? 454  ILE A N   1 
ATOM   3448 C CA  . ILE A 1 453 ? 36.695  -34.500 345.844 1.00 27.67  ? 454  ILE A CA  1 
ATOM   3449 C C   . ILE A 1 453 ? 36.127  -34.734 347.238 1.00 27.80  ? 454  ILE A C   1 
ATOM   3450 O O   . ILE A 1 453 ? 35.756  -35.859 347.593 1.00 29.00  ? 454  ILE A O   1 
ATOM   3451 C CB  . ILE A 1 453 ? 38.235  -34.506 345.858 1.00 30.31  ? 454  ILE A CB  1 
ATOM   3452 C CG1 . ILE A 1 453 ? 38.790  -34.260 344.453 1.00 30.19  ? 454  ILE A CG1 1 
ATOM   3453 C CG2 . ILE A 1 453 ? 38.758  -35.820 346.425 1.00 23.22  ? 454  ILE A CG2 1 
ATOM   3454 C CD1 . ILE A 1 453 ? 38.283  -35.232 343.415 1.00 33.65  ? 454  ILE A CD1 1 
ATOM   3455 N N   . PHE A 1 454 ? 36.054  -33.683 348.051 1.00 20.71  ? 455  PHE A N   1 
ATOM   3456 C CA  . PHE A 1 454 ? 35.549  -33.815 349.411 1.00 20.91  ? 455  PHE A CA  1 
ATOM   3457 C C   . PHE A 1 454 ? 34.030  -33.744 349.494 1.00 24.28  ? 455  PHE A C   1 
ATOM   3458 O O   . PHE A 1 454 ? 33.483  -33.841 350.598 1.00 28.59  ? 455  PHE A O   1 
ATOM   3459 C CB  . PHE A 1 454 ? 36.172  -32.742 350.310 1.00 23.02  ? 455  PHE A CB  1 
ATOM   3460 C CG  . PHE A 1 454 ? 37.538  -33.104 350.828 1.00 23.62  ? 455  PHE A CG  1 
ATOM   3461 C CD1 . PHE A 1 454 ? 38.666  -32.895 350.053 1.00 24.31  ? 455  PHE A CD1 1 
ATOM   3462 C CD2 . PHE A 1 454 ? 37.691  -33.655 352.090 1.00 24.15  ? 455  PHE A CD2 1 
ATOM   3463 C CE1 . PHE A 1 454 ? 39.924  -33.227 350.527 1.00 25.62  ? 455  PHE A CE1 1 
ATOM   3464 C CE2 . PHE A 1 454 ? 38.946  -33.990 352.570 1.00 25.86  ? 455  PHE A CE2 1 
ATOM   3465 C CZ  . PHE A 1 454 ? 40.063  -33.775 351.787 1.00 23.34  ? 455  PHE A CZ  1 
ATOM   3466 N N   . GLY A 1 455 ? 33.337  -33.582 348.368 1.00 22.22  ? 456  GLY A N   1 
ATOM   3467 C CA  . GLY A 1 455 ? 31.887  -33.589 348.378 1.00 23.96  ? 456  GLY A CA  1 
ATOM   3468 C C   . GLY A 1 455 ? 31.240  -32.346 348.942 1.00 29.77  ? 456  GLY A C   1 
ATOM   3469 O O   . GLY A 1 455 ? 30.062  -32.385 349.307 1.00 29.97  ? 456  GLY A O   1 
ATOM   3470 N N   . ILE A 1 456 ? 31.975  -31.240 349.013 1.00 24.54  ? 457  ILE A N   1 
ATOM   3471 C CA  . ILE A 1 456 ? 31.475  -29.966 349.531 1.00 23.99  ? 457  ILE A CA  1 
ATOM   3472 C C   . ILE A 1 456 ? 30.192  -29.502 348.840 1.00 30.62  ? 457  ILE A C   1 
ATOM   3473 O O   . ILE A 1 456 ? 29.339  -28.902 349.511 1.00 27.53  ? 457  ILE A O   1 
ATOM   3474 C CB  . ILE A 1 456 ? 32.566  -28.884 349.442 1.00 26.93  ? 457  ILE A CB  1 
ATOM   3475 C CG1 . ILE A 1 456 ? 33.839  -29.359 350.145 1.00 25.60  ? 457  ILE A CG1 1 
ATOM   3476 C CG2 . ILE A 1 456 ? 32.091  -27.579 350.067 1.00 24.62  ? 457  ILE A CG2 1 
ATOM   3477 C CD1 . ILE A 1 456 ? 33.620  -29.784 351.584 1.00 22.68  ? 457  ILE A CD1 1 
ATOM   3478 N N   . PRO A 1 457 ? 29.987  -29.728 347.533 1.00 25.34  ? 458  PRO A N   1 
ATOM   3479 C CA  . PRO A 1 457 ? 28.707  -29.315 346.926 1.00 30.11  ? 458  PRO A CA  1 
ATOM   3480 C C   . PRO A 1 457 ? 27.472  -29.916 347.583 1.00 32.71  ? 458  PRO A C   1 
ATOM   3481 O O   . PRO A 1 457 ? 26.369  -29.398 347.370 1.00 34.76  ? 458  PRO A O   1 
ATOM   3482 C CB  . PRO A 1 457 ? 28.842  -29.779 345.470 1.00 26.63  ? 458  PRO A CB  1 
ATOM   3483 C CG  . PRO A 1 457 ? 30.291  -29.723 345.209 1.00 30.66  ? 458  PRO A CG  1 
ATOM   3484 C CD  . PRO A 1 457 ? 30.956  -30.131 346.492 1.00 24.60  ? 458  PRO A CD  1 
ATOM   3485 N N   . LEU A 1 458 ? 27.613  -30.983 348.370 1.00 32.85  ? 459  LEU A N   1 
ATOM   3486 C CA  . LEU A 1 458 ? 26.470  -31.568 349.059 1.00 33.80  ? 459  LEU A CA  1 
ATOM   3487 C C   . LEU A 1 458 ? 26.071  -30.802 350.314 1.00 38.85  ? 459  LEU A C   1 
ATOM   3488 O O   . LEU A 1 458 ? 25.027  -31.111 350.899 1.00 40.63  ? 459  LEU A O   1 
ATOM   3489 C CB  . LEU A 1 458 ? 26.760  -33.025 349.424 1.00 28.65  ? 459  LEU A CB  1 
ATOM   3490 C CG  . LEU A 1 458 ? 27.138  -33.944 348.262 1.00 32.34  ? 459  LEU A CG  1 
ATOM   3491 C CD1 . LEU A 1 458 ? 27.425  -35.348 348.766 1.00 29.83  ? 459  LEU A CD1 1 
ATOM   3492 C CD2 . LEU A 1 458 ? 26.034  -33.962 347.216 1.00 36.13  ? 459  LEU A CD2 1 
ATOM   3493 N N   . ASP A 1 459 ? 26.864  -29.829 350.742 1.00 34.43  ? 460  ASP A N   1 
ATOM   3494 C CA  . ASP A 1 459 ? 26.515  -29.018 351.901 1.00 40.04  ? 460  ASP A CA  1 
ATOM   3495 C C   . ASP A 1 459 ? 25.242  -28.231 351.602 1.00 43.44  ? 460  ASP A C   1 
ATOM   3496 O O   . ASP A 1 459 ? 25.207  -27.476 350.618 1.00 38.50  ? 460  ASP A O   1 
ATOM   3497 C CB  . ASP A 1 459 ? 27.674  -28.083 352.251 1.00 43.28  ? 460  ASP A CB  1 
ATOM   3498 C CG  . ASP A 1 459 ? 27.474  -27.345 353.569 1.00 48.27  ? 460  ASP A CG  1 
ATOM   3499 O OD1 . ASP A 1 459 ? 26.319  -27.120 353.986 1.00 52.84  ? 460  ASP A OD1 1 
ATOM   3500 O OD2 . ASP A 1 459 ? 28.492  -26.973 354.191 1.00 53.81  ? 460  ASP A OD2 1 
ATOM   3501 N N   . PRO A 1 460 ? 24.183  -28.384 352.405 1.00 46.64  ? 461  PRO A N   1 
ATOM   3502 C CA  . PRO A 1 460 ? 22.923  -27.679 352.102 1.00 48.20  ? 461  PRO A CA  1 
ATOM   3503 C C   . PRO A 1 460 ? 23.061  -26.169 352.039 1.00 53.12  ? 461  PRO A C   1 
ATOM   3504 O O   . PRO A 1 460 ? 22.397  -25.527 351.215 1.00 59.97  ? 461  PRO A O   1 
ATOM   3505 C CB  . PRO A 1 460 ? 21.991  -28.113 353.245 1.00 55.11  ? 461  PRO A CB  1 
ATOM   3506 C CG  . PRO A 1 460 ? 22.869  -28.784 354.265 1.00 58.08  ? 461  PRO A CG  1 
ATOM   3507 C CD  . PRO A 1 460 ? 24.044  -29.324 353.528 1.00 50.54  ? 461  PRO A CD  1 
ATOM   3508 N N   . SER A 1 461 ? 23.907  -25.577 352.883 1.00 50.63  ? 462  SER A N   1 
ATOM   3509 C CA  . SER A 1 461 ? 24.062  -24.127 352.883 1.00 52.59  ? 462  SER A CA  1 
ATOM   3510 C C   . SER A 1 461 ? 24.787  -23.603 351.650 1.00 51.53  ? 462  SER A C   1 
ATOM   3511 O O   . SER A 1 461 ? 24.935  -22.383 351.518 1.00 53.82  ? 462  SER A O   1 
ATOM   3512 C CB  . SER A 1 461 ? 24.796  -23.676 354.148 1.00 57.25  ? 462  SER A CB  1 
ATOM   3513 O OG  . SER A 1 461 ? 26.102  -24.219 354.205 1.00 63.83  ? 462  SER A OG  1 
ATOM   3514 N N   . ARG A 1 462 ? 25.242  -24.475 350.755 1.00 52.09  ? 463  ARG A N   1 
ATOM   3515 C CA  . ARG A 1 462 ? 25.814  -24.044 349.489 1.00 53.89  ? 463  ARG A CA  1 
ATOM   3516 C C   . ARG A 1 462 ? 24.736  -23.929 348.426 1.00 51.38  ? 463  ARG A C   1 
ATOM   3517 O O   . ARG A 1 462 ? 23.635  -24.470 348.552 1.00 57.39  ? 463  ARG A O   1 
ATOM   3518 C CB  . ARG A 1 462 ? 26.880  -25.014 348.991 1.00 55.15  ? 463  ARG A CB  1 
ATOM   3519 C CG  . ARG A 1 462 ? 27.790  -25.525 350.044 1.00 58.84  ? 463  ARG A CG  1 
ATOM   3520 C CD  . ARG A 1 462 ? 28.878  -24.536 350.326 1.00 58.17  ? 463  ARG A CD  1 
ATOM   3521 N NE  . ARG A 1 462 ? 29.671  -24.960 351.468 1.00 62.26  ? 463  ARG A NE  1 
ATOM   3522 C CZ  . ARG A 1 462 ? 30.805  -24.382 351.837 1.00 63.35  ? 463  ARG A CZ  1 
ATOM   3523 N NH1 . ARG A 1 462 ? 31.277  -23.353 351.148 1.00 64.32  ? 463  ARG A NH1 1 
ATOM   3524 N NH2 . ARG A 1 462 ? 31.466  -24.833 352.892 1.00 63.48  ? 463  ARG A NH2 1 
ATOM   3525 N N   . ASN A 1 463 ? 25.084  -23.231 347.350 1.00 45.17  ? 464  ASN A N   1 
ATOM   3526 C CA  . ASN A 1 463 ? 24.195  -23.125 346.207 1.00 46.44  ? 464  ASN A CA  1 
ATOM   3527 C C   . ASN A 1 463 ? 24.908  -23.609 344.950 1.00 40.02  ? 464  ASN A C   1 
ATOM   3528 O O   . ASN A 1 463 ? 24.949  -22.905 343.936 1.00 43.13  ? 464  ASN A O   1 
ATOM   3529 C CB  . ASN A 1 463 ? 23.691  -21.688 346.063 1.00 55.38  ? 464  ASN A CB  1 
ATOM   3530 C CG  . ASN A 1 463 ? 23.087  -21.154 347.355 1.00 66.29  ? 464  ASN A CG  1 
ATOM   3531 O OD1 . ASN A 1 463 ? 22.530  -21.910 348.152 1.00 68.67  ? 464  ASN A OD1 1 
ATOM   3532 N ND2 . ASN A 1 463 ? 23.197  -19.848 347.566 1.00 73.73  ? 464  ASN A ND2 1 
ATOM   3533 N N   . TYR A 1 464 ? 25.494  -24.803 345.025 1.00 32.89  ? 465  TYR A N   1 
ATOM   3534 C CA  . TYR A 1 464 ? 25.945  -25.499 343.831 1.00 31.46  ? 465  TYR A CA  1 
ATOM   3535 C C   . TYR A 1 464 ? 24.742  -26.043 343.065 1.00 34.27  ? 465  TYR A C   1 
ATOM   3536 O O   . TYR A 1 464 ? 23.651  -26.220 343.614 1.00 35.71  ? 465  TYR A O   1 
ATOM   3537 C CB  . TYR A 1 464 ? 26.880  -26.657 344.187 1.00 31.82  ? 465  TYR A CB  1 
ATOM   3538 C CG  . TYR A 1 464 ? 28.265  -26.262 344.651 1.00 34.85  ? 465  TYR A CG  1 
ATOM   3539 C CD1 . TYR A 1 464 ? 28.501  -25.907 345.973 1.00 31.55  ? 465  TYR A CD1 1 
ATOM   3540 C CD2 . TYR A 1 464 ? 29.342  -26.270 343.773 1.00 34.84  ? 465  TYR A CD2 1 
ATOM   3541 C CE1 . TYR A 1 464 ? 29.766  -25.557 346.405 1.00 34.09  ? 465  TYR A CE1 1 
ATOM   3542 C CE2 . TYR A 1 464 ? 30.612  -25.920 344.195 1.00 36.11  ? 465  TYR A CE2 1 
ATOM   3543 C CZ  . TYR A 1 464 ? 30.818  -25.564 345.513 1.00 39.85  ? 465  TYR A CZ  1 
ATOM   3544 O OH  . TYR A 1 464 ? 32.078  -25.216 345.941 1.00 40.56  ? 465  TYR A OH  1 
ATOM   3545 N N   . THR A 1 465 ? 24.952  -26.320 341.783 1.00 32.80  ? 466  THR A N   1 
ATOM   3546 C CA  . THR A 1 465 ? 23.883  -26.888 340.979 1.00 36.30  ? 466  THR A CA  1 
ATOM   3547 C C   . THR A 1 465 ? 23.703  -28.370 341.298 1.00 38.24  ? 466  THR A C   1 
ATOM   3548 O O   . THR A 1 465 ? 24.576  -29.020 341.879 1.00 36.55  ? 466  THR A O   1 
ATOM   3549 C CB  . THR A 1 465 ? 24.167  -26.714 339.487 1.00 34.70  ? 466  THR A CB  1 
ATOM   3550 O OG1 . THR A 1 465 ? 25.223  -27.600 339.095 1.00 36.41  ? 466  THR A OG1 1 
ATOM   3551 C CG2 . THR A 1 465 ? 24.573  -25.280 339.187 1.00 41.89  ? 466  THR A CG2 1 
ATOM   3552 N N   . ALA A 1 466 ? 22.542  -28.900 340.907 1.00 35.09  ? 467  ALA A N   1 
ATOM   3553 C CA  . ALA A 1 466 ? 22.285  -30.326 341.086 1.00 42.52  ? 467  ALA A CA  1 
ATOM   3554 C C   . ALA A 1 466 ? 23.237  -31.163 340.243 1.00 39.28  ? 467  ALA A C   1 
ATOM   3555 O O   . ALA A 1 466 ? 23.654  -32.251 340.659 1.00 42.21  ? 467  ALA A O   1 
ATOM   3556 C CB  . ALA A 1 466 ? 20.831  -30.645 340.736 1.00 39.43  ? 467  ALA A CB  1 
ATOM   3557 N N   . GLU A 1 467 ? 23.588  -30.672 339.051 1.00 36.04  ? 468  GLU A N   1 
ATOM   3558 C CA  . GLU A 1 467 ? 24.573  -31.356 338.220 1.00 36.37  ? 468  GLU A CA  1 
ATOM   3559 C C   . GLU A 1 467 ? 25.911  -31.473 338.934 1.00 37.25  ? 468  GLU A C   1 
ATOM   3560 O O   . GLU A 1 467 ? 26.576  -32.513 338.862 1.00 38.63  ? 468  GLU A O   1 
ATOM   3561 C CB  . GLU A 1 467 ? 24.754  -30.609 336.900 1.00 46.08  ? 468  GLU A CB  1 
ATOM   3562 C CG  . GLU A 1 467 ? 23.870  -31.076 335.765 1.00 63.14  ? 468  GLU A CG  1 
ATOM   3563 C CD  . GLU A 1 467 ? 24.211  -30.377 334.465 1.00 79.58  ? 468  GLU A CD  1 
ATOM   3564 O OE1 . GLU A 1 467 ? 24.482  -29.158 334.502 1.00 83.08  ? 468  GLU A OE1 1 
ATOM   3565 O OE2 . GLU A 1 467 ? 24.215  -31.044 333.409 1.00 86.20  ? 468  GLU A OE2 1 
ATOM   3566 N N   . GLU A 1 468 ? 26.328  -30.408 339.622 1.00 34.35  ? 469  GLU A N   1 
ATOM   3567 C CA  . GLU A 1 468 ? 27.616  -30.428 340.303 1.00 34.16  ? 469  GLU A CA  1 
ATOM   3568 C C   . GLU A 1 468 ? 27.613  -31.387 341.485 1.00 35.01  ? 469  GLU A C   1 
ATOM   3569 O O   . GLU A 1 468 ? 28.654  -31.970 341.809 1.00 27.41  ? 469  GLU A O   1 
ATOM   3570 C CB  . GLU A 1 468 ? 27.988  -29.014 340.748 1.00 35.42  ? 469  GLU A CB  1 
ATOM   3571 C CG  . GLU A 1 468 ? 28.362  -28.104 339.590 1.00 36.93  ? 469  GLU A CG  1 
ATOM   3572 C CD  . GLU A 1 468 ? 28.547  -26.661 340.008 1.00 37.90  ? 469  GLU A CD  1 
ATOM   3573 O OE1 . GLU A 1 468 ? 27.737  -26.164 340.819 1.00 43.95  ? 469  GLU A OE1 1 
ATOM   3574 O OE2 . GLU A 1 468 ? 29.503  -26.022 339.523 1.00 43.31  ? 469  GLU A OE2 1 
ATOM   3575 N N   . LYS A 1 469 ? 26.462  -31.572 342.134 1.00 29.51  ? 470  LYS A N   1 
ATOM   3576 C CA  . LYS A 1 469 ? 26.390  -32.536 343.226 1.00 33.60  ? 470  LYS A CA  1 
ATOM   3577 C C   . LYS A 1 469 ? 26.502  -33.965 342.708 1.00 29.04  ? 470  LYS A C   1 
ATOM   3578 O O   . LYS A 1 469 ? 27.117  -34.816 343.358 1.00 34.35  ? 470  LYS A O   1 
ATOM   3579 C CB  . LYS A 1 469 ? 25.101  -32.333 344.022 1.00 30.16  ? 470  LYS A CB  1 
ATOM   3580 C CG  . LYS A 1 469 ? 24.891  -30.886 344.436 1.00 34.85  ? 470  LYS A CG  1 
ATOM   3581 C CD  . LYS A 1 469 ? 23.661  -30.695 345.303 1.00 32.49  ? 470  LYS A CD  1 
ATOM   3582 C CE  . LYS A 1 469 ? 23.179  -29.255 345.220 1.00 36.05  ? 470  LYS A CE  1 
ATOM   3583 N NZ  . LYS A 1 469 ? 22.376  -28.849 346.402 1.00 35.79  ? 470  LYS A NZ  1 
ATOM   3584 N N   . ILE A 1 470 ? 25.927  -34.244 341.535 1.00 33.68  ? 471  ILE A N   1 
ATOM   3585 C CA  . ILE A 1 470 ? 26.154  -35.535 340.890 1.00 35.55  ? 471  ILE A CA  1 
ATOM   3586 C C   . ILE A 1 470 ? 27.633  -35.705 340.568 1.00 33.64  ? 471  ILE A C   1 
ATOM   3587 O O   . ILE A 1 470 ? 28.235  -36.749 340.845 1.00 37.33  ? 471  ILE A O   1 
ATOM   3588 C CB  . ILE A 1 470 ? 25.288  -35.668 339.625 1.00 37.23  ? 471  ILE A CB  1 
ATOM   3589 C CG1 . ILE A 1 470 ? 23.804  -35.572 339.974 1.00 40.42  ? 471  ILE A CG1 1 
ATOM   3590 C CG2 . ILE A 1 470 ? 25.590  -36.978 338.909 1.00 33.36  ? 471  ILE A CG2 1 
ATOM   3591 C CD1 . ILE A 1 470 ? 23.314  -36.691 340.863 1.00 46.79  ? 471  ILE A CD1 1 
ATOM   3592 N N   . PHE A 1 471 ? 28.236  -34.671 339.977 1.00 32.86  ? 472  PHE A N   1 
ATOM   3593 C CA  . PHE A 1 471 ? 29.657  -34.705 339.644 1.00 29.77  ? 472  PHE A CA  1 
ATOM   3594 C C   . PHE A 1 471 ? 30.506  -35.000 340.874 1.00 26.05  ? 472  PHE A C   1 
ATOM   3595 O O   . PHE A 1 471 ? 31.388  -35.865 340.842 1.00 31.29  ? 472  PHE A O   1 
ATOM   3596 C CB  . PHE A 1 471 ? 30.062  -33.373 339.009 1.00 31.72  ? 472  PHE A CB  1 
ATOM   3597 C CG  . PHE A 1 471 ? 31.488  -33.325 338.544 1.00 30.59  ? 472  PHE A CG  1 
ATOM   3598 C CD1 . PHE A 1 471 ? 32.045  -34.389 337.857 1.00 30.29  ? 472  PHE A CD1 1 
ATOM   3599 C CD2 . PHE A 1 471 ? 32.269  -32.206 338.786 1.00 31.84  ? 472  PHE A CD2 1 
ATOM   3600 C CE1 . PHE A 1 471 ? 33.358  -34.342 337.426 1.00 27.79  ? 472  PHE A CE1 1 
ATOM   3601 C CE2 . PHE A 1 471 ? 33.581  -32.153 338.356 1.00 30.09  ? 472  PHE A CE2 1 
ATOM   3602 C CZ  . PHE A 1 471 ? 34.126  -33.222 337.675 1.00 26.43  ? 472  PHE A CZ  1 
ATOM   3603 N N   . ALA A 1 472 ? 30.242  -34.291 341.975 1.00 25.84  ? 473  ALA A N   1 
ATOM   3604 C CA  . ALA A 1 472 ? 30.992  -34.520 343.206 1.00 26.05  ? 473  ALA A CA  1 
ATOM   3605 C C   . ALA A 1 472 ? 30.873  -35.967 343.667 1.00 27.69  ? 473  ALA A C   1 
ATOM   3606 O O   . ALA A 1 472 ? 31.863  -36.576 344.090 1.00 27.29  ? 473  ALA A O   1 
ATOM   3607 C CB  . ALA A 1 472 ? 30.507  -33.569 344.300 1.00 24.92  ? 473  ALA A CB  1 
ATOM   3608 N N   . GLN A 1 473 ? 29.670  -36.538 343.583 1.00 28.25  ? 474  GLN A N   1 
ATOM   3609 C CA  . GLN A 1 473 ? 29.478  -37.918 344.011 1.00 27.13  ? 474  GLN A CA  1 
ATOM   3610 C C   . GLN A 1 473 ? 30.187  -38.899 343.085 1.00 29.39  ? 474  GLN A C   1 
ATOM   3611 O O   . GLN A 1 473 ? 30.627  -39.964 343.534 1.00 28.40  ? 474  GLN A O   1 
ATOM   3612 C CB  . GLN A 1 473 ? 27.983  -38.224 344.103 1.00 30.46  ? 474  GLN A CB  1 
ATOM   3613 C CG  . GLN A 1 473 ? 27.280  -37.403 345.178 1.00 37.26  ? 474  GLN A CG  1 
ATOM   3614 C CD  . GLN A 1 473 ? 25.775  -37.600 345.198 1.00 41.40  ? 474  GLN A CD  1 
ATOM   3615 O OE1 . GLN A 1 473 ? 25.157  -37.878 344.171 1.00 45.39  ? 474  GLN A OE1 1 
ATOM   3616 N NE2 . GLN A 1 473 ? 25.177  -37.445 346.374 1.00 45.13  ? 474  GLN A NE2 1 
ATOM   3617 N N   . ARG A 1 474 ? 30.316  -38.557 341.800 1.00 26.42  ? 475  ARG A N   1 
ATOM   3618 C CA  . ARG A 1 474 ? 31.116  -39.372 340.890 1.00 34.13  ? 475  ARG A CA  1 
ATOM   3619 C C   . ARG A 1 474 ? 32.579  -39.384 341.311 1.00 27.99  ? 475  ARG A C   1 
ATOM   3620 O O   . ARG A 1 474 ? 33.220  -40.441 341.351 1.00 32.16  ? 475  ARG A O   1 
ATOM   3621 C CB  . ARG A 1 474 ? 30.989  -38.848 339.460 1.00 32.36  ? 475  ARG A CB  1 
ATOM   3622 C CG  . ARG A 1 474 ? 29.783  -39.345 338.693 1.00 40.19  ? 475  ARG A CG  1 
ATOM   3623 C CD  . ARG A 1 474 ? 29.830  -38.829 337.264 1.00 41.65  ? 475  ARG A CD  1 
ATOM   3624 N NE  . ARG A 1 474 ? 31.122  -39.096 336.637 1.00 35.44  ? 475  ARG A NE  1 
ATOM   3625 C CZ  . ARG A 1 474 ? 31.709  -38.289 335.759 1.00 38.47  ? 475  ARG A CZ  1 
ATOM   3626 N NH1 . ARG A 1 474 ? 31.123  -37.156 335.399 1.00 38.16  ? 475  ARG A NH1 1 
ATOM   3627 N NH2 . ARG A 1 474 ? 32.887  -38.615 335.242 1.00 30.98  ? 475  ARG A NH2 1 
ATOM   3628 N N   . LEU A 1 475 ? 33.127  -38.207 341.624 1.00 26.90  ? 476  LEU A N   1 
ATOM   3629 C CA  . LEU A 1 475 ? 34.543  -38.112 341.964 1.00 27.47  ? 476  LEU A CA  1 
ATOM   3630 C C   . LEU A 1 475 ? 34.842  -38.787 343.296 1.00 31.23  ? 476  LEU A C   1 
ATOM   3631 O O   . LEU A 1 475 ? 35.859  -39.479 343.430 1.00 31.56  ? 476  LEU A O   1 
ATOM   3632 C CB  . LEU A 1 475 ? 34.978  -36.647 341.992 1.00 26.04  ? 476  LEU A CB  1 
ATOM   3633 C CG  . LEU A 1 475 ? 34.854  -35.884 340.672 1.00 29.66  ? 476  LEU A CG  1 
ATOM   3634 C CD1 . LEU A 1 475 ? 35.490  -34.509 340.790 1.00 35.90  ? 476  LEU A CD1 1 
ATOM   3635 C CD2 . LEU A 1 475 ? 35.482  -36.673 339.534 1.00 36.02  ? 476  LEU A CD2 1 
ATOM   3636 N N   . MET A 1 476 ? 33.977  -38.590 344.295 1.00 23.00  ? 477  MET A N   1 
ATOM   3637 C CA  . MET A 1 476 ? 34.145  -39.294 345.562 1.00 29.54  ? 477  MET A CA  1 
ATOM   3638 C C   . MET A 1 476 ? 34.170  -40.801 345.345 1.00 31.47  ? 477  MET A C   1 
ATOM   3639 O O   . MET A 1 476 ? 34.941  -41.519 345.992 1.00 27.63  ? 477  MET A O   1 
ATOM   3640 C CB  . MET A 1 476 ? 33.027  -38.907 346.531 1.00 28.21  ? 477  MET A CB  1 
ATOM   3641 C CG  . MET A 1 476 ? 33.124  -37.482 347.056 1.00 28.84  ? 477  MET A CG  1 
ATOM   3642 S SD  . MET A 1 476 ? 32.096  -37.178 348.509 1.00 34.78  ? 477  MET A SD  1 
ATOM   3643 C CE  . MET A 1 476 ? 30.459  -37.237 347.785 1.00 30.98  ? 477  MET A CE  1 
ATOM   3644 N N   . ARG A 1 477 ? 33.343  -41.291 344.418 1.00 28.31  ? 478  ARG A N   1 
ATOM   3645 C CA  . ARG A 1 477 ? 33.321  -42.715 344.102 1.00 31.54  ? 478  ARG A CA  1 
ATOM   3646 C C   . ARG A 1 477 ? 34.636  -43.161 343.473 1.00 32.76  ? 478  ARG A C   1 
ATOM   3647 O O   . ARG A 1 477 ? 35.195  -44.198 343.852 1.00 28.69  ? 478  ARG A O   1 
ATOM   3648 C CB  . ARG A 1 477 ? 32.142  -43.016 343.176 1.00 33.43  ? 478  ARG A CB  1 
ATOM   3649 C CG  . ARG A 1 477 ? 32.078  -44.448 342.685 1.00 36.94  ? 478  ARG A CG  1 
ATOM   3650 C CD  . ARG A 1 477 ? 31.982  -45.419 343.847 1.00 45.53  ? 478  ARG A CD  1 
ATOM   3651 N NE  . ARG A 1 477 ? 30.823  -45.159 344.692 1.00 47.05  ? 478  ARG A NE  1 
ATOM   3652 C CZ  . ARG A 1 477 ? 29.623  -45.695 344.497 1.00 53.70  ? 478  ARG A CZ  1 
ATOM   3653 N NH1 . ARG A 1 477 ? 29.422  -46.521 343.479 1.00 51.36  ? 478  ARG A NH1 1 
ATOM   3654 N NH2 . ARG A 1 477 ? 28.624  -45.404 345.318 1.00 56.56  ? 478  ARG A NH2 1 
ATOM   3655 N N   . TYR A 1 478 ? 35.141  -42.394 342.500 1.00 27.08  ? 479  TYR A N   1 
ATOM   3656 C CA  . TYR A 1 478 ? 36.437  -42.696 341.895 1.00 25.19  ? 479  TYR A CA  1 
ATOM   3657 C C   . TYR A 1 478 ? 37.530  -42.781 342.951 1.00 24.57  ? 479  TYR A C   1 
ATOM   3658 O O   . TYR A 1 478 ? 38.320  -43.732 342.978 1.00 27.21  ? 479  TYR A O   1 
ATOM   3659 C CB  . TYR A 1 478 ? 36.808  -41.625 340.866 1.00 25.48  ? 479  TYR A CB  1 
ATOM   3660 C CG  . TYR A 1 478 ? 36.008  -41.623 339.583 1.00 27.32  ? 479  TYR A CG  1 
ATOM   3661 C CD1 . TYR A 1 478 ? 35.651  -42.807 338.950 1.00 29.07  ? 479  TYR A CD1 1 
ATOM   3662 C CD2 . TYR A 1 478 ? 35.633  -40.425 338.990 1.00 28.66  ? 479  TYR A CD2 1 
ATOM   3663 C CE1 . TYR A 1 478 ? 34.928  -42.794 337.769 1.00 34.20  ? 479  TYR A CE1 1 
ATOM   3664 C CE2 . TYR A 1 478 ? 34.913  -40.402 337.814 1.00 33.05  ? 479  TYR A CE2 1 
ATOM   3665 C CZ  . TYR A 1 478 ? 34.562  -41.586 337.207 1.00 38.04  ? 479  TYR A CZ  1 
ATOM   3666 O OH  . TYR A 1 478 ? 33.843  -41.557 336.035 1.00 42.36  ? 479  TYR A OH  1 
ATOM   3667 N N   . TRP A 1 479 ? 37.596  -41.774 343.826 1.00 25.66  ? 480  TRP A N   1 
ATOM   3668 C CA  . TRP A 1 479 ? 38.653  -41.720 344.829 1.00 29.87  ? 480  TRP A CA  1 
ATOM   3669 C C   . TRP A 1 479 ? 38.541  -42.876 345.817 1.00 29.35  ? 480  TRP A C   1 
ATOM   3670 O O   . TRP A 1 479 ? 39.549  -43.493 346.179 1.00 25.25  ? 480  TRP A O   1 
ATOM   3671 C CB  . TRP A 1 479 ? 38.600  -40.377 345.562 1.00 21.01  ? 480  TRP A CB  1 
ATOM   3672 C CG  . TRP A 1 479 ? 39.607  -39.353 345.094 1.00 21.89  ? 480  TRP A CG  1 
ATOM   3673 C CD1 . TRP A 1 479 ? 40.559  -38.737 345.857 1.00 21.96  ? 480  TRP A CD1 1 
ATOM   3674 C CD2 . TRP A 1 479 ? 39.746  -38.811 343.770 1.00 20.37  ? 480  TRP A CD2 1 
ATOM   3675 N NE1 . TRP A 1 479 ? 41.286  -37.857 345.092 1.00 25.93  ? 480  TRP A NE1 1 
ATOM   3676 C CE2 . TRP A 1 479 ? 40.808  -37.882 343.809 1.00 19.72  ? 480  TRP A CE2 1 
ATOM   3677 C CE3 . TRP A 1 479 ? 39.082  -39.024 342.557 1.00 20.96  ? 480  TRP A CE3 1 
ATOM   3678 C CZ2 . TRP A 1 479 ? 41.221  -37.170 342.683 1.00 20.65  ? 480  TRP A CZ2 1 
ATOM   3679 C CZ3 . TRP A 1 479 ? 39.493  -38.313 341.439 1.00 25.56  ? 480  TRP A CZ3 1 
ATOM   3680 C CH2 . TRP A 1 479 ? 40.553  -37.398 341.511 1.00 22.58  ? 480  TRP A CH2 1 
ATOM   3681 N N   . ALA A 1 480 ? 37.320  -43.190 346.259 1.00 24.78  ? 481  ALA A N   1 
ATOM   3682 C CA  . ALA A 1 480 ? 37.146  -44.250 347.246 1.00 28.72  ? 481  ALA A CA  1 
ATOM   3683 C C   . ALA A 1 480 ? 37.337  -45.628 346.625 1.00 32.62  ? 481  ALA A C   1 
ATOM   3684 O O   . ALA A 1 480 ? 37.859  -46.539 347.278 1.00 33.64  ? 481  ALA A O   1 
ATOM   3685 C CB  . ALA A 1 480 ? 35.772  -44.144 347.900 1.00 26.38  ? 481  ALA A CB  1 
ATOM   3686 N N   . ASN A 1 481 ? 36.907  -45.808 345.373 1.00 29.28  ? 482  ASN A N   1 
ATOM   3687 C CA  . ASN A 1 481 ? 37.191  -47.064 344.686 1.00 33.40  ? 482  ASN A CA  1 
ATOM   3688 C C   . ASN A 1 481 ? 38.691  -47.276 344.545 1.00 32.88  ? 482  ASN A C   1 
ATOM   3689 O O   . ASN A 1 481 ? 39.180  -48.405 344.666 1.00 38.03  ? 482  ASN A O   1 
ATOM   3690 C CB  . ASN A 1 481 ? 36.520  -47.095 343.313 1.00 31.00  ? 482  ASN A CB  1 
ATOM   3691 C CG  . ASN A 1 481 ? 35.044  -47.417 343.391 1.00 31.14  ? 482  ASN A CG  1 
ATOM   3692 O OD1 . ASN A 1 481 ? 34.584  -48.064 344.332 1.00 34.86  ? 482  ASN A OD1 1 
ATOM   3693 N ND2 . ASN A 1 481 ? 34.296  -46.995 342.380 1.00 31.31  ? 482  ASN A ND2 1 
ATOM   3694 N N   . PHE A 1 482 ? 39.439  -46.200 344.295 1.00 29.29  ? 483  PHE A N   1 
ATOM   3695 C CA  . PHE A 1 482 ? 40.891  -46.317 344.267 1.00 30.30  ? 483  PHE A CA  1 
ATOM   3696 C C   . PHE A 1 482 ? 41.437  -46.685 345.639 1.00 34.19  ? 483  PHE A C   1 
ATOM   3697 O O   . PHE A 1 482 ? 42.325  -47.536 345.755 1.00 33.43  ? 483  PHE A O   1 
ATOM   3698 C CB  . PHE A 1 482 ? 41.526  -45.017 343.777 1.00 25.13  ? 483  PHE A CB  1 
ATOM   3699 C CG  . PHE A 1 482 ? 43.025  -45.053 343.776 1.00 27.02  ? 483  PHE A CG  1 
ATOM   3700 C CD1 . PHE A 1 482 ? 43.710  -45.719 342.775 1.00 26.36  ? 483  PHE A CD1 1 
ATOM   3701 C CD2 . PHE A 1 482 ? 43.749  -44.446 344.790 1.00 23.71  ? 483  PHE A CD2 1 
ATOM   3702 C CE1 . PHE A 1 482 ? 45.089  -45.767 342.775 1.00 23.76  ? 483  PHE A CE1 1 
ATOM   3703 C CE2 . PHE A 1 482 ? 45.129  -44.491 344.795 1.00 26.38  ? 483  PHE A CE2 1 
ATOM   3704 C CZ  . PHE A 1 482 ? 45.799  -45.152 343.786 1.00 24.47  ? 483  PHE A CZ  1 
ATOM   3705 N N   . ALA A 1 483 ? 40.919  -46.050 346.693 1.00 28.40  ? 484  ALA A N   1 
ATOM   3706 C CA  . ALA A 1 483 ? 41.386  -46.359 348.040 1.00 30.14  ? 484  ALA A CA  1 
ATOM   3707 C C   . ALA A 1 483 ? 41.124  -47.818 348.394 1.00 32.58  ? 484  ALA A C   1 
ATOM   3708 O O   . ALA A 1 483 ? 41.977  -48.482 348.994 1.00 35.48  ? 484  ALA A O   1 
ATOM   3709 C CB  . ALA A 1 483 ? 40.717  -45.431 349.054 1.00 27.25  ? 484  ALA A CB  1 
ATOM   3710 N N   . ARG A 1 484 ? 39.955  -48.339 348.014 1.00 29.81  ? 485  ARG A N   1 
ATOM   3711 C CA  . ARG A 1 484 ? 39.612  -49.715 348.357 1.00 36.05  ? 485  ARG A CA  1 
ATOM   3712 C C   . ARG A 1 484 ? 40.411  -50.712 347.526 1.00 39.13  ? 485  ARG A C   1 
ATOM   3713 O O   . ARG A 1 484 ? 40.961  -51.682 348.062 1.00 36.03  ? 485  ARG A O   1 
ATOM   3714 C CB  . ARG A 1 484 ? 38.111  -49.947 348.165 1.00 29.75  ? 485  ARG A CB  1 
ATOM   3715 C CG  . ARG A 1 484 ? 37.224  -49.187 349.135 1.00 28.71  ? 485  ARG A CG  1 
ATOM   3716 C CD  . ARG A 1 484 ? 35.758  -49.541 348.933 1.00 31.11  ? 485  ARG A CD  1 
ATOM   3717 N NE  . ARG A 1 484 ? 35.160  -48.789 347.834 1.00 35.77  ? 485  ARG A NE  1 
ATOM   3718 C CZ  . ARG A 1 484 ? 34.452  -47.674 347.989 1.00 36.59  ? 485  ARG A CZ  1 
ATOM   3719 N NH1 . ARG A 1 484 ? 34.248  -47.178 349.202 1.00 29.98  ? 485  ARG A NH1 1 
ATOM   3720 N NH2 . ARG A 1 484 ? 33.947  -47.056 346.930 1.00 37.01  ? 485  ARG A NH2 1 
ATOM   3721 N N   . THR A 1 485 ? 40.490  -50.491 346.211 1.00 37.72  ? 486  THR A N   1 
ATOM   3722 C CA  . THR A 1 485 ? 40.991  -51.498 345.288 1.00 33.98  ? 486  THR A CA  1 
ATOM   3723 C C   . THR A 1 485 ? 42.227  -51.089 344.500 1.00 39.35  ? 486  THR A C   1 
ATOM   3724 O O   . THR A 1 485 ? 42.783  -51.933 343.788 1.00 38.62  ? 486  THR A O   1 
ATOM   3725 C CB  . THR A 1 485 ? 39.896  -51.890 344.282 1.00 36.44  ? 486  THR A CB  1 
ATOM   3726 O OG1 . THR A 1 485 ? 39.776  -50.865 343.287 1.00 38.92  ? 486  THR A OG1 1 
ATOM   3727 C CG2 . THR A 1 485 ? 38.558  -52.066 344.982 1.00 34.78  ? 486  THR A CG2 1 
ATOM   3728 N N   . GLY A 1 486 ? 42.674  -49.840 344.592 1.00 40.65  ? 487  GLY A N   1 
ATOM   3729 C CA  . GLY A 1 486 ? 43.737  -49.399 343.711 1.00 33.85  ? 487  GLY A CA  1 
ATOM   3730 C C   . GLY A 1 486 ? 43.318  -49.197 342.276 1.00 35.34  ? 487  GLY A C   1 
ATOM   3731 O O   . GLY A 1 486 ? 44.180  -49.077 341.401 1.00 31.97  ? 487  GLY A O   1 
ATOM   3732 N N   . ASP A 1 487 ? 42.016  -49.158 342.012 1.00 36.54  ? 488  ASP A N   1 
ATOM   3733 C CA  . ASP A 1 487 ? 41.451  -49.010 340.680 1.00 31.77  ? 488  ASP A CA  1 
ATOM   3734 C C   . ASP A 1 487 ? 40.195  -48.155 340.792 1.00 32.98  ? 488  ASP A C   1 
ATOM   3735 O O   . ASP A 1 487 ? 39.227  -48.556 341.450 1.00 37.88  ? 488  ASP A O   1 
ATOM   3736 C CB  . ASP A 1 487 ? 41.142  -50.383 340.076 1.00 38.82  ? 488  ASP A CB  1 
ATOM   3737 C CG  . ASP A 1 487 ? 40.705  -50.311 338.620 1.00 43.32  ? 488  ASP A CG  1 
ATOM   3738 O OD1 . ASP A 1 487 ? 40.233  -49.247 338.170 1.00 39.44  ? 488  ASP A OD1 1 
ATOM   3739 O OD2 . ASP A 1 487 ? 40.834  -51.337 337.919 1.00 50.39  ? 488  ASP A OD2 1 
ATOM   3740 N N   . PRO A 1 488 ? 40.170  -46.973 340.169 1.00 33.80  ? 489  PRO A N   1 
ATOM   3741 C CA  . PRO A 1 488 ? 39.002  -46.089 340.311 1.00 34.81  ? 489  PRO A CA  1 
ATOM   3742 C C   . PRO A 1 488 ? 37.762  -46.577 339.579 1.00 34.44  ? 489  PRO A C   1 
ATOM   3743 O O   . PRO A 1 488 ? 36.679  -46.020 339.803 1.00 31.21  ? 489  PRO A O   1 
ATOM   3744 C CB  . PRO A 1 488 ? 39.498  -44.759 339.729 1.00 32.03  ? 489  PRO A CB  1 
ATOM   3745 C CG  . PRO A 1 488 ? 40.560  -45.156 338.756 1.00 33.05  ? 489  PRO A CG  1 
ATOM   3746 C CD  . PRO A 1 488 ? 41.225  -46.377 339.330 1.00 32.51  ? 489  PRO A CD  1 
ATOM   3747 N N   . ASN A 1 489 ? 37.878  -47.592 338.727 1.00 36.05  ? 490  ASN A N   1 
ATOM   3748 C CA  . ASN A 1 489 ? 36.758  -48.065 337.929 1.00 44.06  ? 490  ASN A CA  1 
ATOM   3749 C C   . ASN A 1 489 ? 35.871  -49.017 338.723 1.00 50.84  ? 490  ASN A C   1 
ATOM   3750 O O   . ASN A 1 489 ? 36.285  -49.610 339.724 1.00 47.95  ? 490  ASN A O   1 
ATOM   3751 C CB  . ASN A 1 489 ? 37.248  -48.801 336.681 1.00 38.88  ? 490  ASN A CB  1 
ATOM   3752 C CG  . ASN A 1 489 ? 37.956  -47.896 335.703 1.00 37.51  ? 490  ASN A CG  1 
ATOM   3753 O OD1 . ASN A 1 489 ? 37.324  -47.126 334.981 1.00 42.60  ? 490  ASN A OD1 1 
ATOM   3754 N ND2 . ASN A 1 489 ? 39.279  -47.997 335.660 1.00 32.19  ? 490  ASN A ND2 1 
ATOM   3755 N N   . GLU A 1 490 ? 34.631  -49.149 338.254 1.00 69.58  ? 491  GLU A N   1 
ATOM   3756 C CA  . GLU A 1 490 ? 33.816  -50.341 338.482 1.00 85.00  ? 491  GLU A CA  1 
ATOM   3757 C C   . GLU A 1 490 ? 32.533  -50.286 337.659 1.00 91.47  ? 491  GLU A C   1 
ATOM   3758 O O   . GLU A 1 490 ? 32.236  -51.211 336.902 1.00 95.63  ? 491  GLU A O   1 
ATOM   3759 C CB  . GLU A 1 490 ? 33.472  -50.535 339.958 1.00 87.78  ? 491  GLU A CB  1 
ATOM   3760 C CG  . GLU A 1 490 ? 33.218  -51.998 340.299 1.00 89.69  ? 491  GLU A CG  1 
ATOM   3761 C CD  . GLU A 1 490 ? 34.224  -52.934 339.636 1.00 96.44  ? 491  GLU A CD  1 
ATOM   3762 O OE1 . GLU A 1 490 ? 33.950  -53.420 338.515 1.00 99.00  ? 491  GLU A OE1 1 
ATOM   3763 O OE2 . GLU A 1 490 ? 35.291  -53.183 340.235 1.00 97.24  ? 491  GLU A OE2 1 
ATOM   3764 N N   . PRO A 1 497 ? 31.857  -46.059 330.850 1.00 74.29  ? 498  PRO A N   1 
ATOM   3765 C CA  . PRO A 1 497 ? 33.151  -45.687 330.275 1.00 72.14  ? 498  PRO A CA  1 
ATOM   3766 C C   . PRO A 1 497 ? 34.297  -45.932 331.250 1.00 63.70  ? 498  PRO A C   1 
ATOM   3767 O O   . PRO A 1 497 ? 34.248  -45.468 332.389 1.00 59.14  ? 498  PRO A O   1 
ATOM   3768 C CB  . PRO A 1 497 ? 32.989  -44.190 329.980 1.00 71.20  ? 498  PRO A CB  1 
ATOM   3769 C CG  . PRO A 1 497 ? 31.734  -43.748 330.737 1.00 73.33  ? 498  PRO A CG  1 
ATOM   3770 C CD  . PRO A 1 497 ? 31.224  -44.918 331.526 1.00 73.60  ? 498  PRO A CD  1 
ATOM   3771 N N   . GLN A 1 498 ? 35.321  -46.648 330.803 1.00 57.69  ? 499  GLN A N   1 
ATOM   3772 C CA  . GLN A 1 498 ? 36.381  -47.079 331.697 1.00 52.14  ? 499  GLN A CA  1 
ATOM   3773 C C   . GLN A 1 498 ? 37.541  -46.088 331.707 1.00 52.61  ? 499  GLN A C   1 
ATOM   3774 O O   . GLN A 1 498 ? 37.743  -45.309 330.772 1.00 46.70  ? 499  GLN A O   1 
ATOM   3775 C CB  . GLN A 1 498 ? 36.876  -48.471 331.305 1.00 56.28  ? 499  GLN A CB  1 
ATOM   3776 C CG  . GLN A 1 498 ? 35.841  -49.564 331.522 1.00 63.32  ? 499  GLN A CG  1 
ATOM   3777 C CD  . GLN A 1 498 ? 35.390  -49.661 332.968 1.00 67.07  ? 499  GLN A CD  1 
ATOM   3778 O OE1 . GLN A 1 498 ? 36.123  -50.149 333.827 1.00 72.21  ? 499  GLN A OE1 1 
ATOM   3779 N NE2 . GLN A 1 498 ? 34.178  -49.194 333.242 1.00 65.68  ? 499  GLN A NE2 1 
ATOM   3780 N N   . TRP A 1 499 ? 38.302  -46.132 332.798 1.00 45.25  ? 500  TRP A N   1 
ATOM   3781 C CA  . TRP A 1 499 ? 39.458  -45.272 333.028 1.00 33.55  ? 500  TRP A CA  1 
ATOM   3782 C C   . TRP A 1 499 ? 40.722  -46.097 332.826 1.00 35.09  ? 500  TRP A C   1 
ATOM   3783 O O   . TRP A 1 499 ? 41.102  -46.876 333.714 1.00 34.17  ? 500  TRP A O   1 
ATOM   3784 C CB  . TRP A 1 499 ? 39.403  -44.696 334.447 1.00 34.66  ? 500  TRP A CB  1 
ATOM   3785 C CG  . TRP A 1 499 ? 40.440  -43.664 334.797 1.00 33.90  ? 500  TRP A CG  1 
ATOM   3786 C CD1 . TRP A 1 499 ? 41.657  -43.471 334.205 1.00 34.26  ? 500  TRP A CD1 1 
ATOM   3787 C CD2 . TRP A 1 499 ? 40.346  -42.690 335.843 1.00 32.25  ? 500  TRP A CD2 1 
ATOM   3788 N NE1 . TRP A 1 499 ? 42.321  -42.434 334.817 1.00 30.30  ? 500  TRP A NE1 1 
ATOM   3789 C CE2 . TRP A 1 499 ? 41.538  -41.940 335.826 1.00 31.42  ? 500  TRP A CE2 1 
ATOM   3790 C CE3 . TRP A 1 499 ? 39.366  -42.379 336.792 1.00 26.74  ? 500  TRP A CE3 1 
ATOM   3791 C CZ2 . TRP A 1 499 ? 41.774  -40.895 336.717 1.00 31.66  ? 500  TRP A CZ2 1 
ATOM   3792 C CZ3 . TRP A 1 499 ? 39.604  -41.344 337.677 1.00 28.32  ? 500  TRP A CZ3 1 
ATOM   3793 C CH2 . TRP A 1 499 ? 40.797  -40.615 337.634 1.00 27.47  ? 500  TRP A CH2 1 
ATOM   3794 N N   . PRO A 1 500 ? 41.405  -45.972 331.692 1.00 35.48  ? 501  PRO A N   1 
ATOM   3795 C CA  . PRO A 1 500 ? 42.572  -46.817 331.433 1.00 37.75  ? 501  PRO A CA  1 
ATOM   3796 C C   . PRO A 1 500 ? 43.767  -46.354 332.244 1.00 36.29  ? 501  PRO A C   1 
ATOM   3797 O O   . PRO A 1 500 ? 43.883  -45.164 332.574 1.00 32.26  ? 501  PRO A O   1 
ATOM   3798 C CB  . PRO A 1 500 ? 42.814  -46.630 329.930 1.00 33.05  ? 501  PRO A CB  1 
ATOM   3799 C CG  . PRO A 1 500 ? 42.319  -45.254 329.654 1.00 30.28  ? 501  PRO A CG  1 
ATOM   3800 C CD  . PRO A 1 500 ? 41.164  -45.011 330.601 1.00 35.25  ? 501  PRO A CD  1 
ATOM   3801 N N   . PRO A 1 501 ? 44.671  -47.264 332.596 1.00 36.80  ? 502  PRO A N   1 
ATOM   3802 C CA  . PRO A 1 501 ? 45.888  -46.854 333.300 1.00 30.95  ? 502  PRO A CA  1 
ATOM   3803 C C   . PRO A 1 501 ? 46.776  -45.981 332.427 1.00 35.59  ? 502  PRO A C   1 
ATOM   3804 O O   . PRO A 1 501 ? 46.782  -46.084 331.198 1.00 33.27  ? 502  PRO A O   1 
ATOM   3805 C CB  . PRO A 1 501 ? 46.576  -48.184 333.630 1.00 33.74  ? 502  PRO A CB  1 
ATOM   3806 C CG  . PRO A 1 501 ? 45.486  -49.202 333.585 1.00 36.47  ? 502  PRO A CG  1 
ATOM   3807 C CD  . PRO A 1 501 ? 44.542  -48.729 332.520 1.00 33.49  ? 502  PRO A CD  1 
ATOM   3808 N N   . TYR A 1 502 ? 47.527  -45.105 333.087 1.00 32.89  ? 503  TYR A N   1 
ATOM   3809 C CA  . TYR A 1 502 ? 48.527  -44.292 332.412 1.00 29.95  ? 503  TYR A CA  1 
ATOM   3810 C C   . TYR A 1 502 ? 49.810  -45.093 332.231 1.00 34.02  ? 503  TYR A C   1 
ATOM   3811 O O   . TYR A 1 502 ? 50.260  -45.785 333.149 1.00 34.67  ? 503  TYR A O   1 
ATOM   3812 C CB  . TYR A 1 502 ? 48.808  -43.020 333.217 1.00 26.60  ? 503  TYR A CB  1 
ATOM   3813 C CG  . TYR A 1 502 ? 49.770  -42.054 332.559 1.00 27.16  ? 503  TYR A CG  1 
ATOM   3814 C CD1 . TYR A 1 502 ? 51.144  -42.188 332.722 1.00 27.10  ? 503  TYR A CD1 1 
ATOM   3815 C CD2 . TYR A 1 502 ? 49.304  -40.996 331.790 1.00 28.94  ? 503  TYR A CD2 1 
ATOM   3816 C CE1 . TYR A 1 502 ? 52.025  -41.306 332.125 1.00 28.61  ? 503  TYR A CE1 1 
ATOM   3817 C CE2 . TYR A 1 502 ? 50.178  -40.106 331.194 1.00 33.50  ? 503  TYR A CE2 1 
ATOM   3818 C CZ  . TYR A 1 502 ? 51.537  -40.267 331.364 1.00 32.35  ? 503  TYR A CZ  1 
ATOM   3819 O OH  . TYR A 1 502 ? 52.410  -39.384 330.770 1.00 29.70  ? 503  TYR A OH  1 
ATOM   3820 N N   . THR A 1 503 ? 50.393  -45.009 331.036 1.00 33.03  ? 504  THR A N   1 
ATOM   3821 C CA  . THR A 1 503 ? 51.672  -45.646 330.752 1.00 35.12  ? 504  THR A CA  1 
ATOM   3822 C C   . THR A 1 503 ? 52.543  -44.687 329.954 1.00 36.50  ? 504  THR A C   1 
ATOM   3823 O O   . THR A 1 503 ? 52.050  -43.764 329.301 1.00 33.57  ? 504  THR A O   1 
ATOM   3824 C CB  . THR A 1 503 ? 51.511  -46.969 329.984 1.00 36.30  ? 504  THR A CB  1 
ATOM   3825 O OG1 . THR A 1 503 ? 50.917  -46.715 328.706 1.00 39.69  ? 504  THR A OG1 1 
ATOM   3826 C CG2 . THR A 1 503 ? 50.647  -47.955 330.764 1.00 35.77  ? 504  THR A CG2 1 
ATOM   3827 N N   . ALA A 1 504 ? 53.857  -44.925 330.007 1.00 39.06  ? 505  ALA A N   1 
ATOM   3828 C CA  . ALA A 1 504 ? 54.808  -44.004 329.390 1.00 40.20  ? 505  ALA A CA  1 
ATOM   3829 C C   . ALA A 1 504 ? 54.618  -43.907 327.881 1.00 40.41  ? 505  ALA A C   1 
ATOM   3830 O O   . ALA A 1 504 ? 54.921  -42.867 327.286 1.00 41.86  ? 505  ALA A O   1 
ATOM   3831 C CB  . ALA A 1 504 ? 56.239  -44.432 329.716 1.00 38.08  ? 505  ALA A CB  1 
ATOM   3832 N N   . GLY A 1 505 ? 54.123  -44.967 327.248 1.00 38.88  ? 506  GLY A N   1 
ATOM   3833 C CA  . GLY A 1 505 ? 53.914  -44.954 325.814 1.00 31.53  ? 506  GLY A CA  1 
ATOM   3834 C C   . GLY A 1 505 ? 52.614  -44.299 325.394 1.00 37.82  ? 506  GLY A C   1 
ATOM   3835 O O   . GLY A 1 505 ? 52.621  -43.257 324.733 1.00 42.51  ? 506  GLY A O   1 
ATOM   3836 N N   . ALA A 1 506 ? 51.485  -44.903 325.778 1.00 37.02  ? 507  ALA A N   1 
ATOM   3837 C CA  . ALA A 1 506 ? 50.187  -44.378 325.369 1.00 32.93  ? 507  ALA A CA  1 
ATOM   3838 C C   . ALA A 1 506 ? 49.858  -43.062 326.066 1.00 31.50  ? 507  ALA A C   1 
ATOM   3839 O O   . ALA A 1 506 ? 49.205  -42.197 325.471 1.00 33.87  ? 507  ALA A O   1 
ATOM   3840 C CB  . ALA A 1 506 ? 49.094  -45.411 325.640 1.00 35.44  ? 507  ALA A CB  1 
ATOM   3841 N N   . GLN A 1 507 ? 50.292  -42.900 327.319 1.00 28.32  ? 508  GLN A N   1 
ATOM   3842 C CA  . GLN A 1 507 ? 50.108  -41.658 328.075 1.00 25.60  ? 508  GLN A CA  1 
ATOM   3843 C C   . GLN A 1 507 ? 48.637  -41.260 328.159 1.00 32.87  ? 508  GLN A C   1 
ATOM   3844 O O   . GLN A 1 507 ? 48.276  -40.094 327.978 1.00 30.29  ? 508  GLN A O   1 
ATOM   3845 C CB  . GLN A 1 507 ? 50.954  -40.526 327.487 1.00 25.61  ? 508  GLN A CB  1 
ATOM   3846 C CG  . GLN A 1 507 ? 52.440  -40.844 327.446 1.00 34.09  ? 508  GLN A CG  1 
ATOM   3847 C CD  . GLN A 1 507 ? 53.219  -39.919 326.533 1.00 39.88  ? 508  GLN A CD  1 
ATOM   3848 O OE1 . GLN A 1 507 ? 53.694  -40.329 325.474 1.00 44.64  ? 508  GLN A OE1 1 
ATOM   3849 N NE2 . GLN A 1 507 ? 53.361  -38.664 326.943 1.00 32.47  ? 508  GLN A NE2 1 
ATOM   3850 N N   . GLN A 1 508 ? 47.781  -42.233 328.457 1.00 25.83  ? 509  GLN A N   1 
ATOM   3851 C CA  . GLN A 1 508 ? 46.345  -42.004 328.487 1.00 32.45  ? 509  GLN A CA  1 
ATOM   3852 C C   . GLN A 1 508 ? 45.901  -41.437 329.830 1.00 28.84  ? 509  GLN A C   1 
ATOM   3853 O O   . GLN A 1 508 ? 46.337  -41.892 330.891 1.00 25.60  ? 509  GLN A O   1 
ATOM   3854 C CB  . GLN A 1 508 ? 45.591  -43.302 328.209 1.00 29.78  ? 509  GLN A CB  1 
ATOM   3855 C CG  . GLN A 1 508 ? 45.769  -43.840 326.805 1.00 37.86  ? 509  GLN A CG  1 
ATOM   3856 C CD  . GLN A 1 508 ? 45.144  -45.208 326.637 1.00 36.67  ? 509  GLN A CD  1 
ATOM   3857 O OE1 . GLN A 1 508 ? 44.123  -45.358 325.967 1.00 42.44  ? 509  GLN A OE1 1 
ATOM   3858 N NE2 . GLN A 1 508 ? 45.753  -46.216 327.251 1.00 38.09  ? 509  GLN A NE2 1 
ATOM   3859 N N   . TYR A 1 509 ? 45.017  -40.444 329.771 1.00 30.07  ? 510  TYR A N   1 
ATOM   3860 C CA  . TYR A 1 509 ? 44.385  -39.871 330.949 1.00 26.86  ? 510  TYR A CA  1 
ATOM   3861 C C   . TYR A 1 509 ? 42.926  -39.592 330.616 1.00 31.71  ? 510  TYR A C   1 
ATOM   3862 O O   . TYR A 1 509 ? 42.517  -39.628 329.452 1.00 31.87  ? 510  TYR A O   1 
ATOM   3863 C CB  . TYR A 1 509 ? 45.094  -38.589 331.407 1.00 25.20  ? 510  TYR A CB  1 
ATOM   3864 C CG  . TYR A 1 509 ? 44.950  -37.437 330.437 1.00 27.00  ? 510  TYR A CG  1 
ATOM   3865 C CD1 . TYR A 1 509 ? 45.849  -37.267 329.392 1.00 29.24  ? 510  TYR A CD1 1 
ATOM   3866 C CD2 . TYR A 1 509 ? 43.914  -36.521 330.565 1.00 32.75  ? 510  TYR A CD2 1 
ATOM   3867 C CE1 . TYR A 1 509 ? 45.718  -36.215 328.502 1.00 29.03  ? 510  TYR A CE1 1 
ATOM   3868 C CE2 . TYR A 1 509 ? 43.773  -35.471 329.679 1.00 30.99  ? 510  TYR A CE2 1 
ATOM   3869 C CZ  . TYR A 1 509 ? 44.679  -35.320 328.653 1.00 37.03  ? 510  TYR A CZ  1 
ATOM   3870 O OH  . TYR A 1 509 ? 44.541  -34.271 327.773 1.00 38.78  ? 510  TYR A OH  1 
ATOM   3871 N N   . VAL A 1 510 ? 42.135  -39.304 331.646 1.00 24.07  ? 511  VAL A N   1 
ATOM   3872 C CA  . VAL A 1 510 ? 40.725  -38.991 331.458 1.00 28.05  ? 511  VAL A CA  1 
ATOM   3873 C C   . VAL A 1 510 ? 40.470  -37.555 331.890 1.00 30.67  ? 511  VAL A C   1 
ATOM   3874 O O   . VAL A 1 510 ? 41.142  -37.018 332.777 1.00 24.90  ? 511  VAL A O   1 
ATOM   3875 C CB  . VAL A 1 510 ? 39.798  -39.960 332.227 1.00 26.81  ? 511  VAL A CB  1 
ATOM   3876 C CG1 . VAL A 1 510 ? 40.056  -41.397 331.801 1.00 29.31  ? 511  VAL A CG1 1 
ATOM   3877 C CG2 . VAL A 1 510 ? 39.972  -39.795 333.728 1.00 24.22  ? 511  VAL A CG2 1 
ATOM   3878 N N   . SER A 1 511 ? 39.494  -36.929 331.243 1.00 33.17  ? 512  SER A N   1 
ATOM   3879 C CA  . SER A 1 511 ? 39.029  -35.610 331.640 1.00 31.24  ? 512  SER A CA  1 
ATOM   3880 C C   . SER A 1 511 ? 37.880  -35.767 332.626 1.00 33.80  ? 512  SER A C   1 
ATOM   3881 O O   . SER A 1 511 ? 36.974  -36.578 332.409 1.00 31.54  ? 512  SER A O   1 
ATOM   3882 C CB  . SER A 1 511 ? 38.582  -34.798 330.425 1.00 34.65  ? 512  SER A CB  1 
ATOM   3883 O OG  . SER A 1 511 ? 37.547  -35.460 329.720 1.00 46.68  ? 512  SER A OG  1 
ATOM   3884 N N   . LEU A 1 512 ? 37.930  -35.004 333.713 1.00 26.19  ? 513  LEU A N   1 
ATOM   3885 C CA  . LEU A 1 512 ? 36.892  -35.013 334.736 1.00 25.78  ? 513  LEU A CA  1 
ATOM   3886 C C   . LEU A 1 512 ? 36.087  -33.726 334.604 1.00 31.49  ? 513  LEU A C   1 
ATOM   3887 O O   . LEU A 1 512 ? 36.600  -32.635 334.879 1.00 29.08  ? 513  LEU A O   1 
ATOM   3888 C CB  . LEU A 1 512 ? 37.499  -35.145 336.132 1.00 25.62  ? 513  LEU A CB  1 
ATOM   3889 C CG  . LEU A 1 512 ? 38.347  -36.391 336.405 1.00 26.01  ? 513  LEU A CG  1 
ATOM   3890 C CD1 . LEU A 1 512 ? 38.988  -36.315 337.782 1.00 21.89  ? 513  LEU A CD1 1 
ATOM   3891 C CD2 . LEU A 1 512 ? 37.512  -37.655 336.270 1.00 27.81  ? 513  LEU A CD2 1 
ATOM   3892 N N   . ASP A 1 513 ? 34.838  -33.853 334.166 1.00 30.54  ? 514  ASP A N   1 
ATOM   3893 C CA  . ASP A 1 513 ? 33.912  -32.729 334.094 1.00 31.05  ? 514  ASP A CA  1 
ATOM   3894 C C   . ASP A 1 513 ? 32.493  -33.287 334.163 1.00 34.71  ? 514  ASP A C   1 
ATOM   3895 O O   . ASP A 1 513 ? 32.290  -34.469 334.463 1.00 33.20  ? 514  ASP A O   1 
ATOM   3896 C CB  . ASP A 1 513 ? 34.161  -31.882 332.839 1.00 38.60  ? 514  ASP A CB  1 
ATOM   3897 C CG  . ASP A 1 513 ? 34.101  -32.690 331.550 1.00 51.02  ? 514  ASP A CG  1 
ATOM   3898 O OD1 . ASP A 1 513 ? 33.582  -33.826 331.559 1.00 56.98  ? 514  ASP A OD1 1 
ATOM   3899 O OD2 . ASP A 1 513 ? 34.577  -32.178 330.515 1.00 58.58  ? 514  ASP A OD2 1 
ATOM   3900 N N   . LEU A 1 514 ? 31.504  -32.435 333.880 1.00 28.32  ? 515  LEU A N   1 
ATOM   3901 C CA  . LEU A 1 514 ? 30.114  -32.870 333.967 1.00 42.03  ? 515  LEU A CA  1 
ATOM   3902 C C   . LEU A 1 514 ? 29.788  -33.939 332.929 1.00 41.74  ? 515  LEU A C   1 
ATOM   3903 O O   . LEU A 1 514 ? 28.871  -34.741 333.136 1.00 48.04  ? 515  LEU A O   1 
ATOM   3904 C CB  . LEU A 1 514 ? 29.176  -31.672 333.814 1.00 37.37  ? 515  LEU A CB  1 
ATOM   3905 C CG  . LEU A 1 514 ? 29.281  -30.584 334.888 1.00 41.66  ? 515  LEU A CG  1 
ATOM   3906 C CD1 . LEU A 1 514 ? 28.222  -29.512 334.681 1.00 41.76  ? 515  LEU A CD1 1 
ATOM   3907 C CD2 . LEU A 1 514 ? 29.169  -31.186 336.279 1.00 39.44  ? 515  LEU A CD2 1 
ATOM   3908 N N   . ARG A 1 515 ? 30.521  -33.968 331.821 1.00 37.80  ? 516  ARG A N   1 
ATOM   3909 C CA  . ARG A 1 515 ? 30.329  -34.975 330.791 1.00 41.69  ? 516  ARG A CA  1 
ATOM   3910 C C   . ARG A 1 515 ? 30.941  -36.306 331.223 1.00 41.59  ? 516  ARG A C   1 
ATOM   3911 O O   . ARG A 1 515 ? 31.740  -36.355 332.161 1.00 41.27  ? 516  ARG A O   1 
ATOM   3912 C CB  . ARG A 1 515 ? 30.955  -34.504 329.481 1.00 39.30  ? 516  ARG A CB  1 
ATOM   3913 C CG  . ARG A 1 515 ? 30.545  -33.102 329.063 1.00 50.42  ? 516  ARG A CG  1 
ATOM   3914 C CD  . ARG A 1 515 ? 31.427  -32.577 327.939 1.00 63.73  ? 516  ARG A CD  1 
ATOM   3915 N NE  . ARG A 1 515 ? 32.848  -32.791 328.204 1.00 71.11  ? 516  ARG A NE  1 
ATOM   3916 C CZ  . ARG A 1 515 ? 33.633  -33.582 327.479 1.00 73.52  ? 516  ARG A CZ  1 
ATOM   3917 N NH1 . ARG A 1 515 ? 33.138  -34.238 326.438 1.00 78.57  ? 516  ARG A NH1 1 
ATOM   3918 N NH2 . ARG A 1 515 ? 34.914  -33.717 327.795 1.00 65.51  ? 516  ARG A NH2 1 
ATOM   3919 N N   . PRO A 1 516 ? 30.570  -37.407 330.564 1.00 45.71  ? 517  PRO A N   1 
ATOM   3920 C CA  . PRO A 1 516 ? 31.200  -38.694 330.880 1.00 45.90  ? 517  PRO A CA  1 
ATOM   3921 C C   . PRO A 1 516 ? 32.692  -38.678 330.578 1.00 42.11  ? 517  PRO A C   1 
ATOM   3922 O O   . PRO A 1 516 ? 33.204  -37.804 329.875 1.00 41.17  ? 517  PRO A O   1 
ATOM   3923 C CB  . PRO A 1 516 ? 30.461  -39.689 329.976 1.00 50.75  ? 517  PRO A CB  1 
ATOM   3924 C CG  . PRO A 1 516 ? 29.165  -39.032 329.666 1.00 48.08  ? 517  PRO A CG  1 
ATOM   3925 C CD  . PRO A 1 516 ? 29.450  -37.562 329.619 1.00 44.33  ? 517  PRO A CD  1 
ATOM   3926 N N   . LEU A 1 517 ? 33.387  -39.676 331.128 1.00 38.96  ? 518  LEU A N   1 
ATOM   3927 C CA  . LEU A 1 517 ? 34.830  -39.787 330.955 1.00 38.68  ? 518  LEU A CA  1 
ATOM   3928 C C   . LEU A 1 517 ? 35.206  -39.777 329.480 1.00 40.28  ? 518  LEU A C   1 
ATOM   3929 O O   . LEU A 1 517 ? 34.573  -40.438 328.653 1.00 35.03  ? 518  LEU A O   1 
ATOM   3930 C CB  . LEU A 1 517 ? 35.349  -41.072 331.606 1.00 40.67  ? 518  LEU A CB  1 
ATOM   3931 C CG  . LEU A 1 517 ? 35.423  -41.148 333.130 1.00 45.88  ? 518  LEU A CG  1 
ATOM   3932 C CD1 . LEU A 1 517 ? 36.201  -42.385 333.553 1.00 49.90  ? 518  LEU A CD1 1 
ATOM   3933 C CD2 . LEU A 1 517 ? 36.056  -39.892 333.703 1.00 45.94  ? 518  LEU A CD2 1 
ATOM   3934 N N   . GLU A 1 518 ? 36.245  -39.011 329.156 1.00 39.92  ? 519  GLU A N   1 
ATOM   3935 C CA  . GLU A 1 518 ? 36.811  -38.969 327.814 1.00 39.51  ? 519  GLU A CA  1 
ATOM   3936 C C   . GLU A 1 518 ? 38.302  -39.237 327.929 1.00 37.94  ? 519  GLU A C   1 
ATOM   3937 O O   . GLU A 1 518 ? 39.002  -38.550 328.680 1.00 33.99  ? 519  GLU A O   1 
ATOM   3938 C CB  . GLU A 1 518 ? 36.547  -37.618 327.142 1.00 45.61  ? 519  GLU A CB  1 
ATOM   3939 C CG  . GLU A 1 518 ? 37.248  -37.434 325.806 1.00 64.58  ? 519  GLU A CG  1 
ATOM   3940 C CD  . GLU A 1 518 ? 37.130  -36.017 325.279 1.00 77.86  ? 519  GLU A CD  1 
ATOM   3941 O OE1 . GLU A 1 518 ? 36.403  -35.211 325.897 1.00 81.47  ? 519  GLU A OE1 1 
ATOM   3942 O OE2 . GLU A 1 518 ? 37.764  -35.708 324.247 1.00 80.60  ? 519  GLU A OE2 1 
ATOM   3943 N N   . VAL A 1 519 ? 38.783  -40.240 327.202 1.00 34.16  ? 520  VAL A N   1 
ATOM   3944 C CA  . VAL A 1 519 ? 40.186  -40.632 327.252 1.00 34.32  ? 520  VAL A CA  1 
ATOM   3945 C C   . VAL A 1 519 ? 40.967  -39.798 326.247 1.00 39.40  ? 520  VAL A C   1 
ATOM   3946 O O   . VAL A 1 519 ? 40.548  -39.644 325.093 1.00 44.89  ? 520  VAL A O   1 
ATOM   3947 C CB  . VAL A 1 519 ? 40.349  -42.134 326.966 1.00 37.54  ? 520  VAL A CB  1 
ATOM   3948 C CG1 . VAL A 1 519 ? 41.819  -42.528 327.012 1.00 33.64  ? 520  VAL A CG1 1 
ATOM   3949 C CG2 . VAL A 1 519 ? 39.539  -42.955 327.957 1.00 33.68  ? 520  VAL A CG2 1 
ATOM   3950 N N   . ARG A 1 520 ? 42.097  -39.249 326.687 1.00 29.90  ? 521  ARG A N   1 
ATOM   3951 C CA  . ARG A 1 520 ? 43.004  -38.506 325.825 1.00 31.22  ? 521  ARG A CA  1 
ATOM   3952 C C   . ARG A 1 520 ? 44.424  -39.004 326.040 1.00 33.28  ? 521  ARG A C   1 
ATOM   3953 O O   . ARG A 1 520 ? 44.700  -39.797 326.943 1.00 30.92  ? 521  ARG A O   1 
ATOM   3954 C CB  . ARG A 1 520 ? 42.939  -36.998 326.088 1.00 32.01  ? 521  ARG A CB  1 
ATOM   3955 C CG  . ARG A 1 520 ? 41.566  -36.499 326.446 1.00 42.24  ? 521  ARG A CG  1 
ATOM   3956 C CD  . ARG A 1 520 ? 41.364  -35.083 325.968 1.00 45.49  ? 521  ARG A CD  1 
ATOM   3957 N NE  . ARG A 1 520 ? 39.978  -34.674 326.144 1.00 48.74  ? 521  ARG A NE  1 
ATOM   3958 C CZ  . ARG A 1 520 ? 39.585  -33.731 326.990 1.00 53.75  ? 521  ARG A CZ  1 
ATOM   3959 N NH1 . ARG A 1 520 ? 40.477  -33.098 327.739 1.00 54.05  ? 521  ARG A NH1 1 
ATOM   3960 N NH2 . ARG A 1 520 ? 38.300  -33.424 327.090 1.00 63.46  ? 521  ARG A NH2 1 
ATOM   3961 N N   . ARG A 1 521 ? 45.333  -38.512 325.204 1.00 29.54  ? 522  ARG A N   1 
ATOM   3962 C CA  . ARG A 1 521 ? 46.732  -38.907 325.240 1.00 35.13  ? 522  ARG A CA  1 
ATOM   3963 C C   . ARG A 1 521 ? 47.615  -37.693 325.481 1.00 34.79  ? 522  ARG A C   1 
ATOM   3964 O O   . ARG A 1 521 ? 47.388  -36.622 324.908 1.00 33.16  ? 522  ARG A O   1 
ATOM   3965 C CB  . ARG A 1 521 ? 47.150  -39.589 323.936 1.00 36.79  ? 522  ARG A CB  1 
ATOM   3966 C CG  . ARG A 1 521 ? 46.507  -40.939 323.703 1.00 39.44  ? 522  ARG A CG  1 
ATOM   3967 C CD  . ARG A 1 521 ? 47.250  -41.706 322.624 1.00 40.24  ? 522  ARG A CD  1 
ATOM   3968 N NE  . ARG A 1 521 ? 48.664  -41.869 322.951 1.00 40.44  ? 522  ARG A NE  1 
ATOM   3969 C CZ  . ARG A 1 521 ? 49.662  -41.576 322.123 1.00 45.63  ? 522  ARG A CZ  1 
ATOM   3970 N NH1 . ARG A 1 521 ? 49.405  -41.103 320.911 1.00 43.34  ? 522  ARG A NH1 1 
ATOM   3971 N NH2 . ARG A 1 521 ? 50.919  -41.757 322.506 1.00 44.93  ? 522  ARG A NH2 1 
ATOM   3972 N N   . GLY A 1 522 ? 48.622  -37.869 326.330 1.00 29.78  ? 523  GLY A N   1 
ATOM   3973 C CA  . GLY A 1 522 ? 49.642  -36.858 326.510 1.00 27.30  ? 523  GLY A CA  1 
ATOM   3974 C C   . GLY A 1 522 ? 49.294  -35.770 327.500 1.00 27.41  ? 523  GLY A C   1 
ATOM   3975 O O   . GLY A 1 522 ? 48.386  -34.966 327.267 1.00 38.45  ? 523  GLY A O   1 
ATOM   3976 N N   . LEU A 1 523 ? 50.017  -35.738 328.619 1.00 26.14  ? 524  LEU A N   1 
ATOM   3977 C CA  . LEU A 1 523 ? 49.922  -34.638 329.576 1.00 30.62  ? 524  LEU A CA  1 
ATOM   3978 C C   . LEU A 1 523 ? 50.866  -33.538 329.104 1.00 32.48  ? 524  LEU A C   1 
ATOM   3979 O O   . LEU A 1 523 ? 51.986  -33.378 329.594 1.00 31.73  ? 524  LEU A O   1 
ATOM   3980 C CB  . LEU A 1 523 ? 50.258  -35.114 330.983 1.00 30.28  ? 524  LEU A CB  1 
ATOM   3981 C CG  . LEU A 1 523 ? 49.286  -36.126 331.591 1.00 31.96  ? 524  LEU A CG  1 
ATOM   3982 C CD1 . LEU A 1 523 ? 49.880  -36.754 332.840 1.00 27.07  ? 524  LEU A CD1 1 
ATOM   3983 C CD2 . LEU A 1 523 ? 47.954  -35.462 331.902 1.00 32.72  ? 524  LEU A CD2 1 
ATOM   3984 N N   . ARG A 1 524 ? 50.389  -32.773 328.120 1.00 34.37  ? 525  ARG A N   1 
ATOM   3985 C CA  . ARG A 1 524 ? 51.188  -31.747 327.451 1.00 34.91  ? 525  ARG A CA  1 
ATOM   3986 C C   . ARG A 1 524 ? 52.560  -32.297 327.073 1.00 31.76  ? 525  ARG A C   1 
ATOM   3987 O O   . ARG A 1 524 ? 53.605  -31.755 327.444 1.00 27.22  ? 525  ARG A O   1 
ATOM   3988 C CB  . ARG A 1 524 ? 51.296  -30.494 328.317 1.00 38.84  ? 525  ARG A CB  1 
ATOM   3989 C CG  . ARG A 1 524 ? 49.998  -29.711 328.349 1.00 42.47  ? 525  ARG A CG  1 
ATOM   3990 C CD  . ARG A 1 524 ? 50.138  -28.402 329.082 1.00 45.68  ? 525  ARG A CD  1 
ATOM   3991 N NE  . ARG A 1 524 ? 51.062  -27.482 328.425 1.00 57.91  ? 525  ARG A NE  1 
ATOM   3992 C CZ  . ARG A 1 524 ? 50.751  -26.738 327.369 1.00 58.31  ? 525  ARG A CZ  1 
ATOM   3993 N NH1 . ARG A 1 524 ? 49.534  -26.802 326.845 1.00 65.03  ? 525  ARG A NH1 1 
ATOM   3994 N NH2 . ARG A 1 524 ? 51.655  -25.926 326.837 1.00 44.87  ? 525  ARG A NH2 1 
ATOM   3995 N N   . ALA A 1 525 ? 52.536  -33.403 326.324 1.00 30.33  ? 526  ALA A N   1 
ATOM   3996 C CA  . ALA A 1 525 ? 53.754  -34.151 326.031 1.00 21.79  ? 526  ALA A CA  1 
ATOM   3997 C C   . ALA A 1 525 ? 54.792  -33.286 325.330 1.00 27.98  ? 526  ALA A C   1 
ATOM   3998 O O   . ALA A 1 525 ? 55.988  -33.373 325.632 1.00 23.11  ? 526  ALA A O   1 
ATOM   3999 C CB  . ALA A 1 525 ? 53.420  -35.376 325.180 1.00 23.51  ? 526  ALA A CB  1 
ATOM   4000 N N   . GLN A 1 526 ? 54.355  -32.443 324.392 1.00 30.06  ? 527  GLN A N   1 
ATOM   4001 C CA  . GLN A 1 526 ? 55.295  -31.605 323.658 1.00 33.07  ? 527  GLN A CA  1 
ATOM   4002 C C   . GLN A 1 526 ? 56.008  -30.633 324.590 1.00 31.38  ? 527  GLN A C   1 
ATOM   4003 O O   . GLN A 1 526 ? 57.235  -30.495 324.543 1.00 28.39  ? 527  GLN A O   1 
ATOM   4004 C CB  . GLN A 1 526 ? 54.567  -30.853 322.543 1.00 37.51  ? 527  GLN A CB  1 
ATOM   4005 C CG  . GLN A 1 526 ? 53.809  -31.751 321.576 1.00 40.79  ? 527  GLN A CG  1 
ATOM   4006 C CD  . GLN A 1 526 ? 54.675  -32.852 320.984 1.00 43.58  ? 527  GLN A CD  1 
ATOM   4007 O OE1 . GLN A 1 526 ? 55.876  -32.674 320.775 1.00 34.02  ? 527  GLN A OE1 1 
ATOM   4008 N NE2 . GLN A 1 526 ? 54.063  -33.999 320.711 1.00 49.09  ? 527  GLN A NE2 1 
ATOM   4009 N N   . ALA A 1 527 ? 55.252  -29.957 325.458 1.00 27.32  ? 528  ALA A N   1 
ATOM   4010 C CA  . ALA A 1 527 ? 55.860  -28.996 326.371 1.00 26.12  ? 528  ALA A CA  1 
ATOM   4011 C C   . ALA A 1 527 ? 56.711  -29.691 327.424 1.00 27.66  ? 528  ALA A C   1 
ATOM   4012 O O   . ALA A 1 527 ? 57.825  -29.247 327.724 1.00 33.48  ? 528  ALA A O   1 
ATOM   4013 C CB  . ALA A 1 527 ? 54.780  -28.143 327.034 1.00 28.83  ? 528  ALA A CB  1 
ATOM   4014 N N   . CYS A 1 528 ? 56.209  -30.787 327.993 1.00 23.39  ? 529  CYS A N   1 
ATOM   4015 C CA  . CYS A 1 528 ? 56.924  -31.444 329.079 1.00 22.84  ? 529  CYS A CA  1 
ATOM   4016 C C   . CYS A 1 528 ? 58.190  -32.144 328.606 1.00 28.72  ? 529  CYS A C   1 
ATOM   4017 O O   . CYS A 1 528 ? 59.079  -32.398 329.423 1.00 28.20  ? 529  CYS A O   1 
ATOM   4018 C CB  . CYS A 1 528 ? 55.993  -32.419 329.792 1.00 28.24  ? 529  CYS A CB  1 
ATOM   4019 S SG  . CYS A 1 528 ? 54.718  -31.546 330.723 1.00 32.51  ? 529  CYS A SG  1 
ATOM   4020 N N   . ALA A 1 529 ? 58.300  -32.450 327.311 1.00 24.61  ? 530  ALA A N   1 
ATOM   4021 C CA  . ALA A 1 529 ? 59.576  -32.918 326.784 1.00 23.37  ? 530  ALA A CA  1 
ATOM   4022 C C   . ALA A 1 529 ? 60.644  -31.840 326.918 1.00 28.16  ? 530  ALA A C   1 
ATOM   4023 O O   . ALA A 1 529 ? 61.810  -32.140 327.195 1.00 26.13  ? 530  ALA A O   1 
ATOM   4024 C CB  . ALA A 1 529 ? 59.422  -33.349 325.326 1.00 22.08  ? 530  ALA A CB  1 
ATOM   4025 N N   . PHE A 1 530 ? 60.261  -30.575 326.732 1.00 24.18  ? 531  PHE A N   1 
ATOM   4026 C CA  . PHE A 1 530 ? 61.202  -29.480 326.945 1.00 24.00  ? 531  PHE A CA  1 
ATOM   4027 C C   . PHE A 1 530 ? 61.630  -29.406 328.405 1.00 22.90  ? 531  PHE A C   1 
ATOM   4028 O O   . PHE A 1 530 ? 62.825  -29.334 328.713 1.00 22.87  ? 531  PHE A O   1 
ATOM   4029 C CB  . PHE A 1 530 ? 60.582  -28.155 326.500 1.00 22.43  ? 531  PHE A CB  1 
ATOM   4030 C CG  . PHE A 1 530 ? 61.337  -26.945 326.977 1.00 25.07  ? 531  PHE A CG  1 
ATOM   4031 C CD1 . PHE A 1 530 ? 62.529  -26.576 326.375 1.00 26.40  ? 531  PHE A CD1 1 
ATOM   4032 C CD2 . PHE A 1 530 ? 60.860  -26.182 328.031 1.00 27.32  ? 531  PHE A CD2 1 
ATOM   4033 C CE1 . PHE A 1 530 ? 63.231  -25.467 326.813 1.00 25.84  ? 531  PHE A CE1 1 
ATOM   4034 C CE2 . PHE A 1 530 ? 61.557  -25.071 328.474 1.00 29.42  ? 531  PHE A CE2 1 
ATOM   4035 C CZ  . PHE A 1 530 ? 62.745  -24.714 327.863 1.00 27.49  ? 531  PHE A CZ  1 
ATOM   4036 N N   . TRP A 1 531 ? 60.661  -29.432 329.323 1.00 21.67  ? 532  TRP A N   1 
ATOM   4037 C CA  . TRP A 1 531 ? 60.981  -29.259 330.736 1.00 26.06  ? 532  TRP A CA  1 
ATOM   4038 C C   . TRP A 1 531 ? 61.673  -30.489 331.313 1.00 27.01  ? 532  TRP A C   1 
ATOM   4039 O O   . TRP A 1 531 ? 62.589  -30.361 332.133 1.00 30.58  ? 532  TRP A O   1 
ATOM   4040 C CB  . TRP A 1 531 ? 59.711  -28.938 331.526 1.00 21.73  ? 532  TRP A CB  1 
ATOM   4041 C CG  . TRP A 1 531 ? 59.078  -27.625 331.158 1.00 22.88  ? 532  TRP A CG  1 
ATOM   4042 C CD1 . TRP A 1 531 ? 57.947  -27.438 330.416 1.00 22.75  ? 532  TRP A CD1 1 
ATOM   4043 C CD2 . TRP A 1 531 ? 59.540  -26.316 331.518 1.00 24.06  ? 532  TRP A CD2 1 
ATOM   4044 N NE1 . TRP A 1 531 ? 57.678  -26.096 330.291 1.00 24.96  ? 532  TRP A NE1 1 
ATOM   4045 C CE2 . TRP A 1 531 ? 58.641  -25.386 330.959 1.00 22.55  ? 532  TRP A CE2 1 
ATOM   4046 C CE3 . TRP A 1 531 ? 60.627  -25.841 332.258 1.00 19.27  ? 532  TRP A CE3 1 
ATOM   4047 C CZ2 . TRP A 1 531 ? 58.795  -24.010 331.116 1.00 21.97  ? 532  TRP A CZ2 1 
ATOM   4048 C CZ3 . TRP A 1 531 ? 60.778  -24.473 332.412 1.00 25.55  ? 532  TRP A CZ3 1 
ATOM   4049 C CH2 . TRP A 1 531 ? 59.867  -23.575 331.844 1.00 21.70  ? 532  TRP A CH2 1 
ATOM   4050 N N   . ASN A 1 532 ? 61.261  -31.688 330.896 1.00 24.49  ? 533  ASN A N   1 
ATOM   4051 C CA  . ASN A 1 532 ? 61.748  -32.906 331.537 1.00 27.63  ? 533  ASN A CA  1 
ATOM   4052 C C   . ASN A 1 532 ? 62.937  -33.541 330.828 1.00 31.06  ? 533  ASN A C   1 
ATOM   4053 O O   . ASN A 1 532 ? 63.711  -34.260 331.471 1.00 31.50  ? 533  ASN A O   1 
ATOM   4054 C CB  . ASN A 1 532 ? 60.623  -33.940 331.643 1.00 24.35  ? 533  ASN A CB  1 
ATOM   4055 C CG  . ASN A 1 532 ? 59.474  -33.463 332.510 1.00 26.90  ? 533  ASN A CG  1 
ATOM   4056 O OD1 . ASN A 1 532 ? 59.662  -32.654 333.418 1.00 29.97  ? 533  ASN A OD1 1 
ATOM   4057 N ND2 . ASN A 1 532 ? 58.276  -33.967 332.235 1.00 23.33  ? 533  ASN A ND2 1 
ATOM   4058 N N   . ARG A 1 533 ? 63.109  -33.309 329.529 1.00 28.89  ? 534  ARG A N   1 
ATOM   4059 C CA  . ARG A 1 533 ? 64.176  -33.959 328.778 1.00 32.31  ? 534  ARG A CA  1 
ATOM   4060 C C   . ARG A 1 533 ? 65.282  -33.007 328.349 1.00 32.84  ? 534  ARG A C   1 
ATOM   4061 O O   . ARG A 1 533 ? 66.463  -33.323 328.520 1.00 40.36  ? 534  ARG A O   1 
ATOM   4062 C CB  . ARG A 1 533 ? 63.599  -34.674 327.547 1.00 33.58  ? 534  ARG A CB  1 
ATOM   4063 C CG  . ARG A 1 533 ? 62.577  -35.743 327.891 1.00 29.21  ? 534  ARG A CG  1 
ATOM   4064 C CD  . ARG A 1 533 ? 61.799  -36.194 326.668 1.00 33.96  ? 534  ARG A CD  1 
ATOM   4065 N NE  . ARG A 1 533 ? 60.752  -37.147 327.025 1.00 38.66  ? 534  ARG A NE  1 
ATOM   4066 C CZ  . ARG A 1 533 ? 60.948  -38.455 327.157 1.00 43.33  ? 534  ARG A CZ  1 
ATOM   4067 N NH1 . ARG A 1 533 ? 62.154  -38.970 326.959 1.00 39.00  ? 534  ARG A NH1 1 
ATOM   4068 N NH2 . ARG A 1 533 ? 59.938  -39.247 327.489 1.00 44.27  ? 534  ARG A NH2 1 
ATOM   4069 N N   . PHE A 1 534 ? 64.942  -31.842 327.798 1.00 29.13  ? 535  PHE A N   1 
ATOM   4070 C CA  . PHE A 1 534 ? 65.983  -30.981 327.248 1.00 28.96  ? 535  PHE A CA  1 
ATOM   4071 C C   . PHE A 1 534 ? 66.546  -29.995 328.265 1.00 32.03  ? 535  PHE A C   1 
ATOM   4072 O O   . PHE A 1 534 ? 67.768  -29.898 328.417 1.00 35.44  ? 535  PHE A O   1 
ATOM   4073 C CB  . PHE A 1 534 ? 65.470  -30.204 326.036 1.00 22.87  ? 535  PHE A CB  1 
ATOM   4074 C CG  . PHE A 1 534 ? 66.470  -29.222 325.506 1.00 24.45  ? 535  PHE A CG  1 
ATOM   4075 C CD1 . PHE A 1 534 ? 67.620  -29.667 324.875 1.00 25.20  ? 535  PHE A CD1 1 
ATOM   4076 C CD2 . PHE A 1 534 ? 66.286  -27.860 325.673 1.00 25.52  ? 535  PHE A CD2 1 
ATOM   4077 C CE1 . PHE A 1 534 ? 68.557  -28.773 324.398 1.00 30.07  ? 535  PHE A CE1 1 
ATOM   4078 C CE2 . PHE A 1 534 ? 67.221  -26.959 325.198 1.00 29.13  ? 535  PHE A CE2 1 
ATOM   4079 C CZ  . PHE A 1 534 ? 68.358  -27.416 324.559 1.00 28.21  ? 535  PHE A CZ  1 
ATOM   4080 N N   . LEU A 1 535 ? 65.679  -29.241 328.938 1.00 30.06  ? 536  LEU A N   1 
ATOM   4081 C CA  . LEU A 1 535 ? 66.150  -28.184 329.831 1.00 34.47  ? 536  LEU A CA  1 
ATOM   4082 C C   . LEU A 1 535 ? 67.143  -28.661 330.887 1.00 36.66  ? 536  LEU A C   1 
ATOM   4083 O O   . LEU A 1 535 ? 68.093  -27.912 331.174 1.00 31.99  ? 536  LEU A O   1 
ATOM   4084 C CB  . LEU A 1 535 ? 64.953  -27.487 330.493 1.00 37.17  ? 536  LEU A CB  1 
ATOM   4085 C CG  . LEU A 1 535 ? 65.337  -26.239 331.292 1.00 40.64  ? 536  LEU A CG  1 
ATOM   4086 C CD1 . LEU A 1 535 ? 66.082  -25.253 330.402 1.00 41.44  ? 536  LEU A CD1 1 
ATOM   4087 C CD2 . LEU A 1 535 ? 64.117  -25.584 331.908 1.00 38.52  ? 536  LEU A CD2 1 
ATOM   4088 N N   . PRO A 1 536 ? 67.004  -29.847 331.497 1.00 31.57  ? 537  PRO A N   1 
ATOM   4089 C CA  . PRO A 1 536 ? 68.081  -30.316 332.388 1.00 35.61  ? 537  PRO A CA  1 
ATOM   4090 C C   . PRO A 1 536 ? 69.427  -30.435 331.693 1.00 44.14  ? 537  PRO A C   1 
ATOM   4091 O O   . PRO A 1 536 ? 70.460  -30.129 332.302 1.00 45.27  ? 537  PRO A O   1 
ATOM   4092 C CB  . PRO A 1 536 ? 67.566  -31.677 332.874 1.00 32.02  ? 537  PRO A CB  1 
ATOM   4093 C CG  . PRO A 1 536 ? 66.091  -31.579 332.770 1.00 33.37  ? 537  PRO A CG  1 
ATOM   4094 C CD  . PRO A 1 536 ? 65.816  -30.718 331.574 1.00 30.79  ? 537  PRO A CD  1 
ATOM   4095 N N   . LYS A 1 537 ? 69.447  -30.873 330.431 1.00 43.10  ? 538  LYS A N   1 
ATOM   4096 C CA  . LYS A 1 537 ? 70.706  -30.948 329.696 1.00 39.20  ? 538  LYS A CA  1 
ATOM   4097 C C   . LYS A 1 537 ? 71.304  -29.564 329.482 1.00 40.81  ? 538  LYS A C   1 
ATOM   4098 O O   . LYS A 1 537 ? 72.529  -29.399 329.505 1.00 48.69  ? 538  LYS A O   1 
ATOM   4099 C CB  . LYS A 1 537 ? 70.496  -31.645 328.351 1.00 41.36  ? 538  LYS A CB  1 
ATOM   4100 C CG  . LYS A 1 537 ? 70.130  -33.115 328.443 1.00 42.23  ? 538  LYS A CG  1 
ATOM   4101 C CD  . LYS A 1 537 ? 69.937  -33.700 327.052 1.00 49.41  ? 538  LYS A CD  1 
ATOM   4102 C CE  . LYS A 1 537 ? 69.787  -35.211 327.092 1.00 53.38  ? 538  LYS A CE  1 
ATOM   4103 N NZ  . LYS A 1 537 ? 68.608  -35.635 327.896 1.00 56.46  ? 538  LYS A NZ  1 
ATOM   4104 N N   . LEU A 1 538 ? 70.453  -28.558 329.266 1.00 44.41  ? 539  LEU A N   1 
ATOM   4105 C CA  . LEU A 1 538 ? 70.945  -27.197 329.082 1.00 45.12  ? 539  LEU A CA  1 
ATOM   4106 C C   . LEU A 1 538 ? 71.518  -26.641 330.379 1.00 45.66  ? 539  LEU A C   1 
ATOM   4107 O O   . LEU A 1 538 ? 72.531  -25.931 330.362 1.00 45.98  ? 539  LEU A O   1 
ATOM   4108 C CB  . LEU A 1 538 ? 69.819  -26.302 328.559 1.00 42.49  ? 539  LEU A CB  1 
ATOM   4109 C CG  . LEU A 1 538 ? 70.177  -24.902 328.052 1.00 44.57  ? 539  LEU A CG  1 
ATOM   4110 C CD1 . LEU A 1 538 ? 69.228  -24.492 326.939 1.00 44.93  ? 539  LEU A CD1 1 
ATOM   4111 C CD2 . LEU A 1 538 ? 70.143  -23.876 329.177 1.00 44.17  ? 539  LEU A CD2 1 
ATOM   4112 N N   . LEU A 1 539 ? 70.886  -26.949 331.511 1.00 49.07  ? 540  LEU A N   1 
ATOM   4113 C CA  . LEU A 1 539 ? 71.353  -26.452 332.799 1.00 58.10  ? 540  LEU A CA  1 
ATOM   4114 C C   . LEU A 1 539 ? 72.615  -27.156 333.285 1.00 65.10  ? 540  LEU A C   1 
ATOM   4115 O O   . LEU A 1 539 ? 73.143  -26.779 334.337 1.00 74.14  ? 540  LEU A O   1 
ATOM   4116 C CB  . LEU A 1 539 ? 70.241  -26.587 333.842 1.00 57.00  ? 540  LEU A CB  1 
ATOM   4117 C CG  . LEU A 1 539 ? 69.019  -25.688 333.630 1.00 52.83  ? 540  LEU A CG  1 
ATOM   4118 C CD1 . LEU A 1 539 ? 67.969  -25.925 334.707 1.00 43.49  ? 540  LEU A CD1 1 
ATOM   4119 C CD2 . LEU A 1 539 ? 69.424  -24.221 333.585 1.00 50.13  ? 540  LEU A CD2 1 
ATOM   4120 N N   . SER A 1 540 ? 73.108  -28.156 332.556 1.00 65.81  ? 541  SER A N   1 
ATOM   4121 C CA  . SER A 1 540 ? 74.350  -28.837 332.891 1.00 70.21  ? 541  SER A CA  1 
ATOM   4122 C C   . SER A 1 540 ? 75.538  -28.333 332.082 1.00 78.50  ? 541  SER A C   1 
ATOM   4123 O O   . SER A 1 540 ? 76.656  -28.819 332.280 1.00 85.42  ? 541  SER A O   1 
ATOM   4124 C CB  . SER A 1 540 ? 74.196  -30.349 332.691 1.00 69.09  ? 541  SER A CB  1 
ATOM   4125 O OG  . SER A 1 540 ? 73.197  -30.878 333.546 1.00 71.19  ? 541  SER A OG  1 
ATOM   4126 N N   . ALA A 1 541 ? 75.326  -27.379 331.180 1.00 77.22  ? 542  ALA A N   1 
ATOM   4127 C CA  . ALA A 1 541 ? 76.410  -26.810 330.387 1.00 78.63  ? 542  ALA A CA  1 
ATOM   4128 C C   . ALA A 1 541 ? 76.045  -25.411 329.900 1.00 75.84  ? 542  ALA A C   1 
ATOM   4129 O O   . ALA A 1 541 ? 75.684  -24.542 330.694 1.00 74.87  ? 542  ALA A O   1 
ATOM   4130 C CB  . ALA A 1 541 ? 76.741  -27.713 329.209 1.00 77.62  ? 542  ALA A CB  1 
ATOM   4131 N N   . GLU B 1 3   ? 105.911 -34.282 393.071 1.00 87.59  ? 4    GLU B N   1 
ATOM   4132 C CA  . GLU B 1 3   ? 105.949 -34.368 391.616 1.00 85.64  ? 4    GLU B CA  1 
ATOM   4133 C C   . GLU B 1 3   ? 107.313 -34.835 391.113 1.00 75.16  ? 4    GLU B C   1 
ATOM   4134 O O   . GLU B 1 3   ? 108.322 -34.721 391.810 1.00 76.10  ? 4    GLU B O   1 
ATOM   4135 C CB  . GLU B 1 3   ? 105.592 -33.018 390.989 1.00 91.76  ? 4    GLU B CB  1 
ATOM   4136 C CG  . GLU B 1 3   ? 104.216 -32.983 390.337 1.00 95.73  ? 4    GLU B CG  1 
ATOM   4137 C CD  . GLU B 1 3   ? 103.958 -31.694 389.582 1.00 95.14  ? 4    GLU B CD  1 
ATOM   4138 O OE1 . GLU B 1 3   ? 103.714 -30.658 390.235 1.00 95.49  ? 4    GLU B OE1 1 
ATOM   4139 O OE2 . GLU B 1 3   ? 104.005 -31.715 388.334 1.00 92.63  ? 4    GLU B OE2 1 
ATOM   4140 N N   . ASP B 1 4   ? 107.323 -35.357 389.889 1.00 63.02  ? 5    ASP B N   1 
ATOM   4141 C CA  . ASP B 1 4   ? 108.510 -35.923 389.261 1.00 55.29  ? 5    ASP B CA  1 
ATOM   4142 C C   . ASP B 1 4   ? 109.162 -34.856 388.388 1.00 56.33  ? 5    ASP B C   1 
ATOM   4143 O O   . ASP B 1 4   ? 108.533 -34.346 387.455 1.00 59.11  ? 5    ASP B O   1 
ATOM   4144 C CB  . ASP B 1 4   ? 108.126 -37.153 388.435 1.00 52.83  ? 5    ASP B CB  1 
ATOM   4145 C CG  . ASP B 1 4   ? 109.325 -37.901 387.876 1.00 55.36  ? 5    ASP B CG  1 
ATOM   4146 O OD1 . ASP B 1 4   ? 109.128 -39.042 387.409 1.00 53.77  ? 5    ASP B OD1 1 
ATOM   4147 O OD2 . ASP B 1 4   ? 110.454 -37.367 387.894 1.00 56.10  ? 5    ASP B OD2 1 
ATOM   4148 N N   . ALA B 1 5   ? 110.423 -34.529 388.687 1.00 52.20  ? 6    ALA B N   1 
ATOM   4149 C CA  . ALA B 1 5   ? 111.112 -33.475 387.949 1.00 48.85  ? 6    ALA B CA  1 
ATOM   4150 C C   . ALA B 1 5   ? 111.305 -33.839 386.483 1.00 49.38  ? 6    ALA B C   1 
ATOM   4151 O O   . ALA B 1 5   ? 111.356 -32.951 385.625 1.00 51.13  ? 6    ALA B O   1 
ATOM   4152 C CB  . ALA B 1 5   ? 112.462 -33.171 388.600 1.00 48.28  ? 6    ALA B CB  1 
ATOM   4153 N N   . GLU B 1 6   ? 111.411 -35.136 386.177 1.00 45.16  ? 7    GLU B N   1 
ATOM   4154 C CA  . GLU B 1 6   ? 111.594 -35.567 384.795 1.00 42.05  ? 7    GLU B CA  1 
ATOM   4155 C C   . GLU B 1 6   ? 110.434 -35.140 383.907 1.00 37.08  ? 7    GLU B C   1 
ATOM   4156 O O   . GLU B 1 6   ? 110.604 -34.993 382.691 1.00 40.25  ? 7    GLU B O   1 
ATOM   4157 C CB  . GLU B 1 6   ? 111.754 -37.086 384.736 1.00 42.92  ? 7    GLU B CB  1 
ATOM   4158 C CG  . GLU B 1 6   ? 112.968 -37.615 385.468 1.00 48.19  ? 7    GLU B CG  1 
ATOM   4159 C CD  . GLU B 1 6   ? 114.265 -37.128 384.861 1.00 55.03  ? 7    GLU B CD  1 
ATOM   4160 O OE1 . GLU B 1 6   ? 115.257 -36.995 385.607 1.00 60.02  ? 7    GLU B OE1 1 
ATOM   4161 O OE2 . GLU B 1 6   ? 114.295 -36.882 383.636 1.00 53.71  ? 7    GLU B OE2 1 
ATOM   4162 N N   . LEU B 1 7   ? 109.255 -34.939 384.489 1.00 33.52  ? 8    LEU B N   1 
ATOM   4163 C CA  . LEU B 1 7   ? 108.044 -34.655 383.735 1.00 30.80  ? 8    LEU B CA  1 
ATOM   4164 C C   . LEU B 1 7   ? 107.706 -33.172 383.694 1.00 32.38  ? 8    LEU B C   1 
ATOM   4165 O O   . LEU B 1 7   ? 106.621 -32.809 383.231 1.00 30.82  ? 8    LEU B O   1 
ATOM   4166 C CB  . LEU B 1 7   ? 106.874 -35.445 384.317 1.00 30.81  ? 8    LEU B CB  1 
ATOM   4167 C CG  . LEU B 1 7   ? 107.129 -36.948 384.431 1.00 30.23  ? 8    LEU B CG  1 
ATOM   4168 C CD1 . LEU B 1 7   ? 105.926 -37.650 385.034 1.00 37.33  ? 8    LEU B CD1 1 
ATOM   4169 C CD2 . LEU B 1 7   ? 107.473 -37.534 383.069 1.00 29.57  ? 8    LEU B CD2 1 
ATOM   4170 N N   . LEU B 1 8   ? 108.598 -32.310 384.169 1.00 31.11  ? 9    LEU B N   1 
ATOM   4171 C CA  . LEU B 1 8   ? 108.406 -30.868 384.108 1.00 33.38  ? 9    LEU B CA  1 
ATOM   4172 C C   . LEU B 1 8   ? 109.475 -30.279 383.203 1.00 33.81  ? 9    LEU B C   1 
ATOM   4173 O O   . LEU B 1 8   ? 110.672 -30.468 383.445 1.00 36.52  ? 9    LEU B O   1 
ATOM   4174 C CB  . LEU B 1 8   ? 108.461 -30.240 385.501 1.00 33.09  ? 9    LEU B CB  1 
ATOM   4175 C CG  . LEU B 1 8   ? 107.417 -30.770 386.485 1.00 39.99  ? 9    LEU B CG  1 
ATOM   4176 C CD1 . LEU B 1 8   ? 107.891 -30.588 387.917 1.00 42.36  ? 9    LEU B CD1 1 
ATOM   4177 C CD2 . LEU B 1 8   ? 106.072 -30.092 386.265 1.00 40.43  ? 9    LEU B CD2 1 
ATOM   4178 N N   . VAL B 1 9   ? 109.042 -29.584 382.156 1.00 33.28  ? 10   VAL B N   1 
ATOM   4179 C CA  . VAL B 1 9   ? 109.936 -28.981 381.179 1.00 32.58  ? 10   VAL B CA  1 
ATOM   4180 C C   . VAL B 1 9   ? 109.497 -27.544 380.952 1.00 31.20  ? 10   VAL B C   1 
ATOM   4181 O O   . VAL B 1 9   ? 108.299 -27.241 380.955 1.00 30.77  ? 10   VAL B O   1 
ATOM   4182 C CB  . VAL B 1 9   ? 109.943 -29.765 379.847 1.00 34.01  ? 10   VAL B CB  1 
ATOM   4183 C CG1 . VAL B 1 9   ? 110.887 -29.120 378.842 1.00 31.86  ? 10   VAL B CG1 1 
ATOM   4184 C CG2 . VAL B 1 9   ? 110.338 -31.212 380.084 1.00 38.21  ? 10   VAL B CG2 1 
ATOM   4185 N N   . THR B 1 10  ? 110.469 -26.657 380.774 1.00 26.91  ? 11   THR B N   1 
ATOM   4186 C CA  . THR B 1 10  ? 110.220 -25.273 380.399 1.00 27.60  ? 11   THR B CA  1 
ATOM   4187 C C   . THR B 1 10  ? 110.618 -25.097 378.941 1.00 28.05  ? 11   THR B C   1 
ATOM   4188 O O   . THR B 1 10  ? 111.781 -25.311 378.582 1.00 34.19  ? 11   THR B O   1 
ATOM   4189 C CB  . THR B 1 10  ? 111.003 -24.310 381.293 1.00 30.49  ? 11   THR B CB  1 
ATOM   4190 O OG1 . THR B 1 10  ? 110.625 -24.510 382.660 1.00 36.07  ? 11   THR B OG1 1 
ATOM   4191 C CG2 . THR B 1 10  ? 110.719 -22.868 380.901 1.00 30.39  ? 11   THR B CG2 1 
ATOM   4192 N N   . VAL B 1 11  ? 109.651 -24.738 378.100 1.00 26.32  ? 12   VAL B N   1 
ATOM   4193 C CA  . VAL B 1 11  ? 109.945 -24.352 376.726 1.00 26.68  ? 12   VAL B CA  1 
ATOM   4194 C C   . VAL B 1 11  ? 109.866 -22.834 376.659 1.00 28.18  ? 12   VAL B C   1 
ATOM   4195 O O   . VAL B 1 11  ? 109.665 -22.171 377.683 1.00 28.57  ? 12   VAL B O   1 
ATOM   4196 C CB  . VAL B 1 11  ? 108.989 -25.019 375.720 1.00 22.08  ? 12   VAL B CB  1 
ATOM   4197 C CG1 . VAL B 1 11  ? 109.320 -26.499 375.581 1.00 25.41  ? 12   VAL B CG1 1 
ATOM   4198 C CG2 . VAL B 1 11  ? 107.541 -24.826 376.142 1.00 21.70  ? 12   VAL B CG2 1 
ATOM   4199 N N   . ARG B 1 12  ? 110.024 -22.271 375.460 1.00 26.09  ? 13   ARG B N   1 
ATOM   4200 C CA  . ARG B 1 12  ? 110.067 -20.817 375.339 1.00 30.16  ? 13   ARG B CA  1 
ATOM   4201 C C   . ARG B 1 12  ? 108.747 -20.174 375.742 1.00 34.45  ? 13   ARG B C   1 
ATOM   4202 O O   . ARG B 1 12  ? 108.740 -19.061 376.279 1.00 39.05  ? 13   ARG B O   1 
ATOM   4203 C CB  . ARG B 1 12  ? 110.445 -20.424 373.912 1.00 31.09  ? 13   ARG B CB  1 
ATOM   4204 C CG  . ARG B 1 12  ? 111.902 -20.693 373.600 1.00 40.48  ? 13   ARG B CG  1 
ATOM   4205 C CD  . ARG B 1 12  ? 112.394 -19.912 372.400 1.00 47.67  ? 13   ARG B CD  1 
ATOM   4206 N NE  . ARG B 1 12  ? 113.540 -20.578 371.791 1.00 61.02  ? 13   ARG B NE  1 
ATOM   4207 C CZ  . ARG B 1 12  ? 114.405 -19.992 370.971 1.00 67.55  ? 13   ARG B CZ  1 
ATOM   4208 N NH1 . ARG B 1 12  ? 114.260 -18.713 370.653 1.00 67.72  ? 13   ARG B NH1 1 
ATOM   4209 N NH2 . ARG B 1 12  ? 115.417 -20.687 370.471 1.00 70.44  ? 13   ARG B NH2 1 
ATOM   4210 N N   . GLY B 1 13  ? 107.625 -20.859 375.508 1.00 32.46  ? 14   GLY B N   1 
ATOM   4211 C CA  . GLY B 1 13  ? 106.332 -20.293 375.846 1.00 31.19  ? 14   GLY B CA  1 
ATOM   4212 C C   . GLY B 1 13  ? 105.955 -20.390 377.308 1.00 28.81  ? 14   GLY B C   1 
ATOM   4213 O O   . GLY B 1 13  ? 105.073 -19.653 377.757 1.00 33.50  ? 14   GLY B O   1 
ATOM   4214 N N   . GLY B 1 14  ? 106.594 -21.275 378.058 1.00 24.76  ? 15   GLY B N   1 
ATOM   4215 C CA  . GLY B 1 14  ? 106.262 -21.459 379.454 1.00 26.99  ? 15   GLY B CA  1 
ATOM   4216 C C   . GLY B 1 14  ? 106.483 -22.901 379.870 1.00 31.51  ? 15   GLY B C   1 
ATOM   4217 O O   . GLY B 1 14  ? 107.161 -23.661 379.186 1.00 27.13  ? 15   GLY B O   1 
ATOM   4218 N N   . ARG B 1 15  ? 105.878 -23.256 380.999 1.00 29.21  ? 16   ARG B N   1 
ATOM   4219 C CA  . ARG B 1 15  ? 106.141 -24.528 381.655 1.00 29.40  ? 16   ARG B CA  1 
ATOM   4220 C C   . ARG B 1 15  ? 105.145 -25.598 381.224 1.00 32.11  ? 16   ARG B C   1 
ATOM   4221 O O   . ARG B 1 15  ? 103.974 -25.317 380.951 1.00 29.57  ? 16   ARG B O   1 
ATOM   4222 C CB  . ARG B 1 15  ? 106.097 -24.356 383.174 1.00 33.61  ? 16   ARG B CB  1 
ATOM   4223 C CG  . ARG B 1 15  ? 107.209 -23.474 383.721 1.00 37.28  ? 16   ARG B CG  1 
ATOM   4224 C CD  . ARG B 1 15  ? 107.157 -23.381 385.237 1.00 42.06  ? 16   ARG B CD  1 
ATOM   4225 N NE  . ARG B 1 15  ? 105.993 -22.633 385.703 1.00 48.79  ? 16   ARG B NE  1 
ATOM   4226 C CZ  . ARG B 1 15  ? 105.426 -22.800 386.893 1.00 57.50  ? 16   ARG B CZ  1 
ATOM   4227 N NH1 . ARG B 1 15  ? 105.915 -23.693 387.743 1.00 57.79  ? 16   ARG B NH1 1 
ATOM   4228 N NH2 . ARG B 1 15  ? 104.370 -22.074 387.235 1.00 58.75  ? 16   ARG B NH2 1 
ATOM   4229 N N   . LEU B 1 16  ? 105.627 -26.840 381.174 1.00 25.45  ? 17   LEU B N   1 
ATOM   4230 C CA  . LEU B 1 16  ? 104.825 -27.989 380.784 1.00 27.95  ? 17   LEU B CA  1 
ATOM   4231 C C   . LEU B 1 16  ? 104.960 -29.092 381.822 1.00 28.94  ? 17   LEU B C   1 
ATOM   4232 O O   . LEU B 1 16  ? 105.986 -29.211 382.497 1.00 31.57  ? 17   LEU B O   1 
ATOM   4233 C CB  . LEU B 1 16  ? 105.250 -28.550 379.416 1.00 25.36  ? 17   LEU B CB  1 
ATOM   4234 C CG  . LEU B 1 16  ? 105.444 -27.606 378.232 1.00 32.41  ? 17   LEU B CG  1 
ATOM   4235 C CD1 . LEU B 1 16  ? 106.271 -28.291 377.153 1.00 25.02  ? 17   LEU B CD1 1 
ATOM   4236 C CD2 . LEU B 1 16  ? 104.100 -27.171 377.680 1.00 34.71  ? 17   LEU B CD2 1 
ATOM   4237 N N   A ARG B 1 17  ? 103.912 -29.904 381.937 0.43 29.43  ? 18   ARG B N   1 
ATOM   4238 N N   B ARG B 1 17  ? 103.910 -29.900 381.944 0.57 29.10  ? 18   ARG B N   1 
ATOM   4239 C CA  A ARG B 1 17  ? 103.920 -31.098 382.773 0.43 31.94  ? 18   ARG B CA  1 
ATOM   4240 C CA  B ARG B 1 17  ? 103.929 -31.099 382.772 0.57 31.88  ? 18   ARG B CA  1 
ATOM   4241 C C   A ARG B 1 17  ? 103.544 -32.291 381.908 0.43 30.21  ? 18   ARG B C   1 
ATOM   4242 C C   B ARG B 1 17  ? 103.550 -32.287 381.903 0.57 30.35  ? 18   ARG B C   1 
ATOM   4243 O O   A ARG B 1 17  ? 102.473 -32.301 381.292 0.43 29.94  ? 18   ARG B O   1 
ATOM   4244 O O   B ARG B 1 17  ? 102.482 -32.289 381.280 0.57 30.09  ? 18   ARG B O   1 
ATOM   4245 C CB  A ARG B 1 17  ? 102.955 -30.963 383.952 0.43 36.99  ? 18   ARG B CB  1 
ATOM   4246 C CB  B ARG B 1 17  ? 102.976 -30.979 383.962 0.57 36.83  ? 18   ARG B CB  1 
ATOM   4247 C CG  A ARG B 1 17  ? 102.786 -32.247 384.749 0.43 42.72  ? 18   ARG B CG  1 
ATOM   4248 C CG  B ARG B 1 17  ? 103.031 -32.178 384.898 0.57 43.11  ? 18   ARG B CG  1 
ATOM   4249 C CD  A ARG B 1 17  ? 101.847 -32.060 385.929 0.43 48.84  ? 18   ARG B CD  1 
ATOM   4250 C CD  B ARG B 1 17  ? 101.807 -32.251 385.794 0.57 48.36  ? 18   ARG B CD  1 
ATOM   4251 N NE  A ARG B 1 17  ? 102.325 -31.035 386.852 0.43 53.96  ? 18   ARG B NE  1 
ATOM   4252 N NE  B ARG B 1 17  ? 101.621 -31.026 386.565 0.57 54.67  ? 18   ARG B NE  1 
ATOM   4253 C CZ  A ARG B 1 17  ? 101.724 -29.866 387.045 0.43 55.18  ? 18   ARG B CZ  1 
ATOM   4254 C CZ  B ARG B 1 17  ? 100.653 -30.144 386.339 0.57 55.72  ? 18   ARG B CZ  1 
ATOM   4255 N NH1 A ARG B 1 17  ? 100.616 -29.571 386.378 0.43 55.69  ? 18   ARG B NH1 1 
ATOM   4256 N NH1 B ARG B 1 17  ? 99.780  -30.351 385.362 0.57 51.46  ? 18   ARG B NH1 1 
ATOM   4257 N NH2 A ARG B 1 17  ? 102.229 -28.991 387.905 0.43 51.32  ? 18   ARG B NH2 1 
ATOM   4258 N NH2 B ARG B 1 17  ? 100.559 -29.055 387.090 0.57 55.44  ? 18   ARG B NH2 1 
ATOM   4259 N N   . GLY B 1 18  ? 104.422 -33.289 381.860 1.00 26.70  ? 19   GLY B N   1 
ATOM   4260 C CA  . GLY B 1 18  ? 104.212 -34.474 381.064 1.00 22.55  ? 19   GLY B CA  1 
ATOM   4261 C C   . GLY B 1 18  ? 103.689 -35.638 381.877 1.00 25.93  ? 19   GLY B C   1 
ATOM   4262 O O   . GLY B 1 18  ? 103.191 -35.483 382.998 1.00 31.84  ? 19   GLY B O   1 
ATOM   4263 N N   . ILE B 1 19  ? 103.809 -36.831 381.299 1.00 23.05  ? 20   ILE B N   1 
ATOM   4264 C CA  . ILE B 1 19  ? 103.323 -38.055 381.917 1.00 26.18  ? 20   ILE B CA  1 
ATOM   4265 C C   . ILE B 1 19  ? 104.307 -39.176 381.611 1.00 27.94  ? 20   ILE B C   1 
ATOM   4266 O O   . ILE B 1 19  ? 104.920 -39.218 380.540 1.00 29.86  ? 20   ILE B O   1 
ATOM   4267 C CB  . ILE B 1 19  ? 101.897 -38.408 381.428 1.00 30.34  ? 20   ILE B CB  1 
ATOM   4268 C CG1 . ILE B 1 19  ? 101.375 -39.673 382.113 1.00 35.40  ? 20   ILE B CG1 1 
ATOM   4269 C CG2 . ILE B 1 19  ? 101.868 -38.558 379.911 1.00 28.22  ? 20   ILE B CG2 1 
ATOM   4270 C CD1 . ILE B 1 19  ? 99.931  -39.992 381.784 1.00 35.41  ? 20   ILE B CD1 1 
ATOM   4271 N N   . ARG B 1 20  ? 104.475 -40.073 382.577 1.00 28.01  ? 21   ARG B N   1 
ATOM   4272 C CA  . ARG B 1 20  ? 105.316 -41.250 382.417 1.00 28.62  ? 21   ARG B CA  1 
ATOM   4273 C C   . ARG B 1 20  ? 104.466 -42.400 381.890 1.00 26.51  ? 21   ARG B C   1 
ATOM   4274 O O   . ARG B 1 20  ? 103.385 -42.672 382.423 1.00 30.93  ? 21   ARG B O   1 
ATOM   4275 C CB  . ARG B 1 20  ? 105.961 -41.620 383.754 1.00 32.72  ? 21   ARG B CB  1 
ATOM   4276 C CG  . ARG B 1 20  ? 107.044 -42.680 383.676 1.00 37.95  ? 21   ARG B CG  1 
ATOM   4277 C CD  . ARG B 1 20  ? 107.775 -42.825 385.010 1.00 45.16  ? 21   ARG B CD  1 
ATOM   4278 N NE  . ARG B 1 20  ? 106.912 -42.567 386.162 1.00 51.26  ? 21   ARG B NE  1 
ATOM   4279 C CZ  . ARG B 1 20  ? 106.046 -43.442 386.664 1.00 54.06  ? 21   ARG B CZ  1 
ATOM   4280 N NH1 . ARG B 1 20  ? 105.916 -44.643 386.117 1.00 50.22  ? 21   ARG B NH1 1 
ATOM   4281 N NH2 . ARG B 1 20  ? 105.306 -43.114 387.716 1.00 50.72  ? 21   ARG B NH2 1 
ATOM   4282 N N   . LEU B 1 21  ? 104.940 -43.061 380.837 1.00 24.65  ? 22   LEU B N   1 
ATOM   4283 C CA  . LEU B 1 21  ? 104.217 -44.181 380.254 1.00 27.09  ? 22   LEU B CA  1 
ATOM   4284 C C   . LEU B 1 21  ? 105.055 -45.450 380.323 1.00 31.82  ? 22   LEU B C   1 
ATOM   4285 O O   . LEU B 1 21  ? 106.287 -45.410 380.381 1.00 38.92  ? 22   LEU B O   1 
ATOM   4286 C CB  . LEU B 1 21  ? 103.822 -43.912 378.796 1.00 29.09  ? 22   LEU B CB  1 
ATOM   4287 C CG  . LEU B 1 21  ? 103.198 -42.577 378.393 1.00 29.73  ? 22   LEU B CG  1 
ATOM   4288 C CD1 . LEU B 1 21  ? 103.202 -42.437 376.879 1.00 28.10  ? 22   LEU B CD1 1 
ATOM   4289 C CD2 . LEU B 1 21  ? 101.785 -42.483 378.928 1.00 28.10  ? 22   LEU B CD2 1 
ATOM   4290 N N   . LYS B 1 22  ? 104.361 -46.583 380.302 1.00 33.95  ? 23   LYS B N   1 
ATOM   4291 C CA  . LYS B 1 22  ? 104.985 -47.895 380.372 1.00 30.79  ? 23   LYS B CA  1 
ATOM   4292 C C   . LYS B 1 22  ? 105.112 -48.502 378.982 1.00 29.09  ? 23   LYS B C   1 
ATOM   4293 O O   . LYS B 1 22  ? 104.208 -48.376 378.150 1.00 30.75  ? 23   LYS B O   1 
ATOM   4294 C CB  . LYS B 1 22  ? 104.173 -48.841 381.259 1.00 30.35  ? 23   LYS B CB  1 
ATOM   4295 C CG  . LYS B 1 22  ? 103.919 -48.348 382.673 1.00 41.08  ? 23   LYS B CG  1 
ATOM   4296 C CD  . LYS B 1 22  ? 103.164 -49.394 383.492 1.00 43.86  ? 23   LYS B CD  1 
ATOM   4297 C CE  . LYS B 1 22  ? 102.330 -50.311 382.602 1.00 53.14  ? 23   LYS B CE  1 
ATOM   4298 N NZ  . LYS B 1 22  ? 101.384 -51.159 383.379 1.00 61.07  ? 23   LYS B NZ  1 
ATOM   4299 N N   . THR B 1 23  ? 106.240 -49.152 378.738 1.00 23.90  ? 24   THR B N   1 
ATOM   4300 C CA  . THR B 1 23  ? 106.461 -50.033 377.604 1.00 29.88  ? 24   THR B CA  1 
ATOM   4301 C C   . THR B 1 23  ? 107.013 -51.338 378.153 1.00 30.96  ? 24   THR B C   1 
ATOM   4302 O O   . THR B 1 23  ? 107.478 -51.385 379.297 1.00 28.24  ? 24   THR B O   1 
ATOM   4303 C CB  . THR B 1 23  ? 107.439 -49.431 376.580 1.00 24.50  ? 24   THR B CB  1 
ATOM   4304 O OG1 . THR B 1 23  ? 108.787 -49.672 376.999 1.00 30.13  ? 24   THR B OG1 1 
ATOM   4305 C CG2 . THR B 1 23  ? 107.214 -47.934 376.420 1.00 28.56  ? 24   THR B CG2 1 
ATOM   4306 N N   . PRO B 1 24  ? 106.962 -52.426 377.377 1.00 29.47  ? 25   PRO B N   1 
ATOM   4307 C CA  . PRO B 1 24  ? 107.524 -53.692 377.875 1.00 29.70  ? 25   PRO B CA  1 
ATOM   4308 C C   . PRO B 1 24  ? 109.013 -53.621 378.158 1.00 31.88  ? 25   PRO B C   1 
ATOM   4309 O O   . PRO B 1 24  ? 109.527 -54.462 378.906 1.00 38.19  ? 25   PRO B O   1 
ATOM   4310 C CB  . PRO B 1 24  ? 107.215 -54.684 376.745 1.00 29.92  ? 25   PRO B CB  1 
ATOM   4311 C CG  . PRO B 1 24  ? 106.067 -54.073 376.021 1.00 31.63  ? 25   PRO B CG  1 
ATOM   4312 C CD  . PRO B 1 24  ? 106.332 -52.604 376.057 1.00 25.81  ? 25   PRO B CD  1 
ATOM   4313 N N   . GLY B 1 25  ? 109.719 -52.648 377.590 1.00 28.35  ? 26   GLY B N   1 
ATOM   4314 C CA  . GLY B 1 25  ? 111.131 -52.456 377.836 1.00 29.27  ? 26   GLY B CA  1 
ATOM   4315 C C   . GLY B 1 25  ? 111.473 -51.385 378.848 1.00 28.16  ? 26   GLY B C   1 
ATOM   4316 O O   . GLY B 1 25  ? 112.660 -51.095 379.039 1.00 32.39  ? 26   GLY B O   1 
ATOM   4317 N N   . GLY B 1 26  ? 110.482 -50.786 379.504 1.00 26.88  ? 27   GLY B N   1 
ATOM   4318 C CA  . GLY B 1 26  ? 110.739 -49.762 380.488 1.00 31.60  ? 27   GLY B CA  1 
ATOM   4319 C C   . GLY B 1 26  ? 109.961 -48.488 380.231 1.00 31.85  ? 27   GLY B C   1 
ATOM   4320 O O   . GLY B 1 26  ? 109.203 -48.374 379.262 1.00 28.73  ? 27   GLY B O   1 
ATOM   4321 N N   . PRO B 1 27  ? 110.146 -47.496 381.096 1.00 30.35  ? 28   PRO B N   1 
ATOM   4322 C CA  . PRO B 1 27  ? 109.340 -46.276 381.016 1.00 21.81  ? 28   PRO B CA  1 
ATOM   4323 C C   . PRO B 1 27  ? 109.856 -45.299 379.968 1.00 25.25  ? 28   PRO B C   1 
ATOM   4324 O O   . PRO B 1 27  ? 110.991 -45.377 379.496 1.00 24.19  ? 28   PRO B O   1 
ATOM   4325 C CB  . PRO B 1 27  ? 109.474 -45.683 382.421 1.00 28.30  ? 28   PRO B CB  1 
ATOM   4326 C CG  . PRO B 1 27  ? 110.836 -46.108 382.849 1.00 28.69  ? 28   PRO B CG  1 
ATOM   4327 C CD  . PRO B 1 27  ? 111.055 -47.481 382.256 1.00 24.61  ? 28   PRO B CD  1 
ATOM   4328 N N   . VAL B 1 28  ? 108.980 -44.356 379.623 1.00 20.21  ? 29   VAL B N   1 
ATOM   4329 C CA  . VAL B 1 28  ? 109.272 -43.300 378.661 1.00 24.78  ? 29   VAL B CA  1 
ATOM   4330 C C   . VAL B 1 28  ? 108.529 -42.051 379.119 1.00 29.99  ? 29   VAL B C   1 
ATOM   4331 O O   . VAL B 1 28  ? 107.462 -42.136 379.732 1.00 25.53  ? 29   VAL B O   1 
ATOM   4332 C CB  . VAL B 1 28  ? 108.868 -43.729 377.225 1.00 30.12  ? 29   VAL B CB  1 
ATOM   4333 C CG1 . VAL B 1 28  ? 108.691 -42.534 376.298 1.00 38.41  ? 29   VAL B CG1 1 
ATOM   4334 C CG2 . VAL B 1 28  ? 109.877 -44.707 376.639 1.00 27.20  ? 29   VAL B CG2 1 
ATOM   4335 N N   . SER B 1 29  ? 109.116 -40.883 378.853 1.00 25.52  ? 30   SER B N   1 
ATOM   4336 C CA  . SER B 1 29  ? 108.471 -39.611 379.151 1.00 24.58  ? 30   SER B CA  1 
ATOM   4337 C C   . SER B 1 29  ? 107.715 -39.119 377.924 1.00 28.79  ? 30   SER B C   1 
ATOM   4338 O O   . SER B 1 29  ? 108.252 -39.126 376.812 1.00 25.30  ? 30   SER B O   1 
ATOM   4339 C CB  . SER B 1 29  ? 109.498 -38.566 379.588 1.00 26.27  ? 30   SER B CB  1 
ATOM   4340 O OG  . SER B 1 29  ? 110.457 -39.122 380.468 1.00 35.05  ? 30   SER B OG  1 
ATOM   4341 N N   . ALA B 1 30  ? 106.472 -38.687 378.129 1.00 25.93  ? 31   ALA B N   1 
ATOM   4342 C CA  . ALA B 1 30  ? 105.639 -38.179 377.050 1.00 25.66  ? 31   ALA B CA  1 
ATOM   4343 C C   . ALA B 1 30  ? 105.074 -36.821 377.428 1.00 25.00  ? 31   ALA B C   1 
ATOM   4344 O O   . ALA B 1 30  ? 104.691 -36.593 378.579 1.00 23.85  ? 31   ALA B O   1 
ATOM   4345 C CB  . ALA B 1 30  ? 104.492 -39.137 376.720 1.00 20.80  ? 31   ALA B CB  1 
ATOM   4346 N N   . PHE B 1 31  ? 105.030 -35.921 376.450 1.00 21.75  ? 32   PHE B N   1 
ATOM   4347 C CA  . PHE B 1 31  ? 104.457 -34.589 376.621 1.00 19.71  ? 32   PHE B CA  1 
ATOM   4348 C C   . PHE B 1 31  ? 103.498 -34.391 375.451 1.00 19.43  ? 32   PHE B C   1 
ATOM   4349 O O   . PHE B 1 31  ? 103.921 -34.101 374.328 1.00 18.92  ? 32   PHE B O   1 
ATOM   4350 C CB  . PHE B 1 31  ? 105.541 -33.513 376.686 1.00 20.05  ? 32   PHE B CB  1 
ATOM   4351 C CG  . PHE B 1 31  ? 106.650 -33.828 377.664 1.00 23.31  ? 32   PHE B CG  1 
ATOM   4352 C CD1 . PHE B 1 31  ? 107.625 -34.766 377.355 1.00 23.08  ? 32   PHE B CD1 1 
ATOM   4353 C CD2 . PHE B 1 31  ? 106.703 -33.202 378.899 1.00 23.91  ? 32   PHE B CD2 1 
ATOM   4354 C CE1 . PHE B 1 31  ? 108.633 -35.066 378.251 1.00 26.23  ? 32   PHE B CE1 1 
ATOM   4355 C CE2 . PHE B 1 31  ? 107.711 -33.500 379.802 1.00 24.71  ? 32   PHE B CE2 1 
ATOM   4356 C CZ  . PHE B 1 31  ? 108.678 -34.431 379.475 1.00 24.48  ? 32   PHE B CZ  1 
ATOM   4357 N N   . LEU B 1 32  ? 102.209 -34.573 375.722 1.00 20.69  ? 33   LEU B N   1 
ATOM   4358 C CA  . LEU B 1 32  ? 101.175 -34.649 374.703 1.00 19.32  ? 33   LEU B CA  1 
ATOM   4359 C C   . LEU B 1 32  ? 100.346 -33.372 374.704 1.00 22.03  ? 33   LEU B C   1 
ATOM   4360 O O   . LEU B 1 32  ? 100.029 -32.830 375.763 1.00 22.60  ? 33   LEU B O   1 
ATOM   4361 C CB  . LEU B 1 32  ? 100.262 -35.852 374.957 1.00 20.46  ? 33   LEU B CB  1 
ATOM   4362 C CG  . LEU B 1 32  ? 100.975 -37.172 375.256 1.00 25.07  ? 33   LEU B CG  1 
ATOM   4363 C CD1 . LEU B 1 32  ? 99.982  -38.306 375.476 1.00 22.22  ? 33   LEU B CD1 1 
ATOM   4364 C CD2 . LEU B 1 32  ? 101.932 -37.514 374.127 1.00 24.40  ? 33   LEU B CD2 1 
ATOM   4365 N N   . GLY B 1 33  ? 99.985  -32.906 373.515 1.00 21.19  ? 34   GLY B N   1 
ATOM   4366 C CA  . GLY B 1 33  ? 99.139  -31.729 373.418 1.00 19.26  ? 34   GLY B CA  1 
ATOM   4367 C C   . GLY B 1 33  ? 99.829  -30.428 373.770 1.00 20.59  ? 34   GLY B C   1 
ATOM   4368 O O   . GLY B 1 33  ? 99.232  -29.578 374.442 1.00 24.19  ? 34   GLY B O   1 
ATOM   4369 N N   . ILE B 1 34  ? 101.075 -30.256 373.340 1.00 23.95  ? 35   ILE B N   1 
ATOM   4370 C CA  . ILE B 1 34  ? 101.793 -28.996 373.515 1.00 19.96  ? 35   ILE B CA  1 
ATOM   4371 C C   . ILE B 1 34  ? 101.304 -28.013 372.458 1.00 21.83  ? 35   ILE B C   1 
ATOM   4372 O O   . ILE B 1 34  ? 101.432 -28.290 371.258 1.00 20.83  ? 35   ILE B O   1 
ATOM   4373 C CB  . ILE B 1 34  ? 103.313 -29.196 373.407 1.00 23.61  ? 35   ILE B CB  1 
ATOM   4374 C CG1 . ILE B 1 34  ? 103.779 -30.311 374.345 1.00 22.58  ? 35   ILE B CG1 1 
ATOM   4375 C CG2 . ILE B 1 34  ? 104.044 -27.890 373.695 1.00 17.73  ? 35   ILE B CG2 1 
ATOM   4376 C CD1 . ILE B 1 34  ? 105.271 -30.561 374.294 1.00 19.04  ? 35   ILE B CD1 1 
ATOM   4377 N N   . PRO B 1 35  ? 100.744 -26.867 372.842 1.00 23.96  ? 36   PRO B N   1 
ATOM   4378 C CA  . PRO B 1 35  ? 100.323 -25.887 371.831 1.00 20.30  ? 36   PRO B CA  1 
ATOM   4379 C C   . PRO B 1 35  ? 101.533 -25.224 371.190 1.00 23.42  ? 36   PRO B C   1 
ATOM   4380 O O   . PRO B 1 35  ? 102.410 -24.702 371.882 1.00 22.45  ? 36   PRO B O   1 
ATOM   4381 C CB  . PRO B 1 35  ? 99.486  -24.886 372.635 1.00 21.62  ? 36   PRO B CB  1 
ATOM   4382 C CG  . PRO B 1 35  ? 100.057 -24.961 374.015 1.00 24.05  ? 36   PRO B CG  1 
ATOM   4383 C CD  . PRO B 1 35  ? 100.475 -26.400 374.214 1.00 23.42  ? 36   PRO B CD  1 
ATOM   4384 N N   . PHE B 1 36  ? 101.588 -25.262 369.858 1.00 19.70  ? 37   PHE B N   1 
ATOM   4385 C CA  . PHE B 1 36  ? 102.649 -24.578 369.135 1.00 22.53  ? 37   PHE B CA  1 
ATOM   4386 C C   . PHE B 1 36  ? 102.146 -23.433 368.269 1.00 22.98  ? 37   PHE B C   1 
ATOM   4387 O O   . PHE B 1 36  ? 102.967 -22.699 367.709 1.00 24.90  ? 37   PHE B O   1 
ATOM   4388 C CB  . PHE B 1 36  ? 103.458 -25.569 368.276 1.00 15.46  ? 37   PHE B CB  1 
ATOM   4389 C CG  . PHE B 1 36  ? 102.705 -26.150 367.105 1.00 21.56  ? 37   PHE B CG  1 
ATOM   4390 C CD1 . PHE B 1 36  ? 102.791 -25.567 365.849 1.00 17.65  ? 37   PHE B CD1 1 
ATOM   4391 C CD2 . PHE B 1 36  ? 101.957 -27.309 367.247 1.00 21.42  ? 37   PHE B CD2 1 
ATOM   4392 C CE1 . PHE B 1 36  ? 102.118 -26.107 364.766 1.00 19.99  ? 37   PHE B CE1 1 
ATOM   4393 C CE2 . PHE B 1 36  ? 101.283 -27.856 366.167 1.00 20.82  ? 37   PHE B CE2 1 
ATOM   4394 C CZ  . PHE B 1 36  ? 101.364 -27.254 364.925 1.00 20.04  ? 37   PHE B CZ  1 
ATOM   4395 N N   . ALA B 1 37  ? 100.833 -23.245 368.162 1.00 19.85  ? 38   ALA B N   1 
ATOM   4396 C CA  . ALA B 1 37  ? 100.276 -22.134 367.409 1.00 19.48  ? 38   ALA B CA  1 
ATOM   4397 C C   . ALA B 1 37  ? 99.055  -21.592 368.133 1.00 27.65  ? 38   ALA B C   1 
ATOM   4398 O O   . ALA B 1 37  ? 98.407  -22.301 368.908 1.00 25.54  ? 38   ALA B O   1 
ATOM   4399 C CB  . ALA B 1 37  ? 99.890  -22.548 365.984 1.00 16.07  ? 38   ALA B CB  1 
ATOM   4400 N N   . GLU B 1 38  ? 98.756  -20.323 367.880 1.00 27.35  ? 39   GLU B N   1 
ATOM   4401 C CA  . GLU B 1 38  ? 97.484  -19.776 368.320 1.00 26.21  ? 39   GLU B CA  1 
ATOM   4402 C C   . GLU B 1 38  ? 96.354  -20.509 367.601 1.00 25.46  ? 39   GLU B C   1 
ATOM   4403 O O   . GLU B 1 38  ? 96.508  -20.892 366.435 1.00 20.78  ? 39   GLU B O   1 
ATOM   4404 C CB  . GLU B 1 38  ? 97.412  -18.275 368.038 1.00 30.07  ? 39   GLU B CB  1 
ATOM   4405 C CG  . GLU B 1 38  ? 98.300  -17.437 368.945 1.00 36.04  ? 39   GLU B CG  1 
ATOM   4406 C CD  . GLU B 1 38  ? 97.858  -17.489 370.395 1.00 41.71  ? 39   GLU B CD  1 
ATOM   4407 O OE1 . GLU B 1 38  ? 96.676  -17.191 370.668 1.00 48.06  ? 39   GLU B OE1 1 
ATOM   4408 O OE2 . GLU B 1 38  ? 98.689  -17.834 371.260 1.00 42.03  ? 39   GLU B OE2 1 
ATOM   4409 N N   . PRO B 1 39  ? 95.227  -20.748 368.265 1.00 25.34  ? 40   PRO B N   1 
ATOM   4410 C CA  . PRO B 1 39  ? 94.138  -21.507 367.639 1.00 26.43  ? 40   PRO B CA  1 
ATOM   4411 C C   . PRO B 1 39  ? 93.634  -20.814 366.387 1.00 32.51  ? 40   PRO B C   1 
ATOM   4412 O O   . PRO B 1 39  ? 93.225  -19.644 366.432 1.00 33.72  ? 40   PRO B O   1 
ATOM   4413 C CB  . PRO B 1 39  ? 93.061  -21.544 368.733 1.00 22.80  ? 40   PRO B CB  1 
ATOM   4414 C CG  . PRO B 1 39  ? 93.815  -21.363 370.010 1.00 24.84  ? 40   PRO B CG  1 
ATOM   4415 C CD  . PRO B 1 39  ? 94.950  -20.439 369.678 1.00 25.53  ? 40   PRO B CD  1 
ATOM   4416 N N   . PRO B 1 40  ? 93.649  -21.505 365.241 1.00 26.42  ? 41   PRO B N   1 
ATOM   4417 C CA  . PRO B 1 40  ? 93.233  -20.890 363.966 1.00 30.27  ? 41   PRO B CA  1 
ATOM   4418 C C   . PRO B 1 40  ? 91.715  -20.830 363.819 1.00 30.43  ? 41   PRO B C   1 
ATOM   4419 O O   . PRO B 1 40  ? 91.121  -21.446 362.930 1.00 31.76  ? 41   PRO B O   1 
ATOM   4420 C CB  . PRO B 1 40  ? 93.892  -21.814 362.935 1.00 26.04  ? 41   PRO B CB  1 
ATOM   4421 C CG  . PRO B 1 40  ? 93.859  -23.157 363.590 1.00 25.25  ? 41   PRO B CG  1 
ATOM   4422 C CD  . PRO B 1 40  ? 94.061  -22.910 365.069 1.00 20.19  ? 41   PRO B CD  1 
ATOM   4423 N N   . MET B 1 41  ? 91.077  -20.064 364.698 1.00 34.42  ? 42   MET B N   1 
ATOM   4424 C CA  . MET B 1 41  ? 89.628  -19.996 364.794 1.00 37.35  ? 42   MET B CA  1 
ATOM   4425 C C   . MET B 1 41  ? 89.110  -18.650 364.307 1.00 37.41  ? 42   MET B C   1 
ATOM   4426 O O   . MET B 1 41  ? 89.853  -17.670 364.205 1.00 39.51  ? 42   MET B O   1 
ATOM   4427 C CB  . MET B 1 41  ? 89.164  -20.214 366.237 1.00 44.98  ? 42   MET B CB  1 
ATOM   4428 C CG  . MET B 1 41  ? 90.003  -21.193 367.021 1.00 51.51  ? 42   MET B CG  1 
ATOM   4429 S SD  . MET B 1 41  ? 89.271  -22.834 367.037 1.00 65.36  ? 42   MET B SD  1 
ATOM   4430 C CE  . MET B 1 41  ? 87.859  -22.552 368.100 1.00 60.16  ? 42   MET B CE  1 
ATOM   4431 N N   . GLY B 1 42  ? 87.806  -18.618 364.030 1.00 38.72  ? 43   GLY B N   1 
ATOM   4432 C CA  . GLY B 1 42  ? 87.119  -17.405 363.658 1.00 36.46  ? 43   GLY B CA  1 
ATOM   4433 C C   . GLY B 1 42  ? 87.765  -16.700 362.486 1.00 35.31  ? 43   GLY B C   1 
ATOM   4434 O O   . GLY B 1 42  ? 87.845  -17.232 361.374 1.00 34.38  ? 43   GLY B O   1 
ATOM   4435 N N   . PRO B 1 43  ? 88.252  -15.477 362.718 1.00 34.36  ? 44   PRO B N   1 
ATOM   4436 C CA  . PRO B 1 43  ? 88.937  -14.742 361.644 1.00 33.41  ? 44   PRO B CA  1 
ATOM   4437 C C   . PRO B 1 43  ? 90.257  -15.365 361.224 1.00 32.74  ? 44   PRO B C   1 
ATOM   4438 O O   . PRO B 1 43  ? 90.790  -14.984 360.173 1.00 30.50  ? 44   PRO B O   1 
ATOM   4439 C CB  . PRO B 1 43  ? 89.148  -13.349 362.252 1.00 30.88  ? 44   PRO B CB  1 
ATOM   4440 C CG  . PRO B 1 43  ? 89.158  -13.580 363.727 1.00 32.99  ? 44   PRO B CG  1 
ATOM   4441 C CD  . PRO B 1 43  ? 88.198  -14.710 363.975 1.00 33.70  ? 44   PRO B CD  1 
ATOM   4442 N N   . ARG B 1 44  ? 90.794  -16.309 361.996 1.00 31.19  ? 45   ARG B N   1 
ATOM   4443 C CA  . ARG B 1 44  ? 92.071  -16.936 361.683 1.00 32.31  ? 45   ARG B CA  1 
ATOM   4444 C C   . ARG B 1 44  ? 91.941  -18.169 360.800 1.00 32.00  ? 45   ARG B C   1 
ATOM   4445 O O   . ARG B 1 44  ? 92.967  -18.728 360.396 1.00 30.56  ? 45   ARG B O   1 
ATOM   4446 C CB  . ARG B 1 44  ? 92.803  -17.322 362.971 1.00 34.59  ? 45   ARG B CB  1 
ATOM   4447 C CG  . ARG B 1 44  ? 93.053  -16.169 363.924 1.00 50.86  ? 45   ARG B CG  1 
ATOM   4448 C CD  . ARG B 1 44  ? 94.517  -16.120 364.312 1.00 61.04  ? 45   ARG B CD  1 
ATOM   4449 N NE  . ARG B 1 44  ? 94.739  -15.613 365.661 1.00 72.73  ? 45   ARG B NE  1 
ATOM   4450 C CZ  . ARG B 1 44  ? 95.894  -15.103 366.075 1.00 76.34  ? 45   ARG B CZ  1 
ATOM   4451 N NH1 . ARG B 1 44  ? 96.915  -15.034 365.239 1.00 73.34  ? 45   ARG B NH1 1 
ATOM   4452 N NH2 . ARG B 1 44  ? 96.029  -14.661 367.317 1.00 78.55  ? 45   ARG B NH2 1 
ATOM   4453 N N   . ARG B 1 45  ? 90.724  -18.615 360.500 1.00 30.03  ? 46   ARG B N   1 
ATOM   4454 C CA  . ARG B 1 45  ? 90.557  -19.767 359.627 1.00 26.82  ? 46   ARG B CA  1 
ATOM   4455 C C   . ARG B 1 45  ? 91.012  -19.420 358.215 1.00 23.83  ? 46   ARG B C   1 
ATOM   4456 O O   . ARG B 1 45  ? 90.728  -18.330 357.706 1.00 29.29  ? 46   ARG B O   1 
ATOM   4457 C CB  . ARG B 1 45  ? 89.100  -20.229 359.624 1.00 24.94  ? 46   ARG B CB  1 
ATOM   4458 C CG  . ARG B 1 45  ? 88.764  -21.216 358.520 1.00 25.54  ? 46   ARG B CG  1 
ATOM   4459 C CD  . ARG B 1 45  ? 87.269  -21.453 358.421 1.00 29.31  ? 46   ARG B CD  1 
ATOM   4460 N NE  . ARG B 1 45  ? 86.712  -22.049 359.631 1.00 24.47  ? 46   ARG B NE  1 
ATOM   4461 C CZ  . ARG B 1 45  ? 85.409  -22.180 359.860 1.00 28.97  ? 46   ARG B CZ  1 
ATOM   4462 N NH1 . ARG B 1 45  ? 84.532  -21.752 358.963 1.00 32.65  ? 46   ARG B NH1 1 
ATOM   4463 N NH2 . ARG B 1 45  ? 84.979  -22.735 360.985 1.00 25.82  ? 46   ARG B NH2 1 
ATOM   4464 N N   . PHE B 1 46  ? 91.737  -20.351 357.593 1.00 18.88  ? 47   PHE B N   1 
ATOM   4465 C CA  . PHE B 1 46  ? 92.366  -20.269 356.271 1.00 24.73  ? 47   PHE B CA  1 
ATOM   4466 C C   . PHE B 1 46  ? 93.641  -19.431 356.292 1.00 25.11  ? 47   PHE B C   1 
ATOM   4467 O O   . PHE B 1 46  ? 94.293  -19.313 355.247 1.00 26.13  ? 47   PHE B O   1 
ATOM   4468 C CB  . PHE B 1 46  ? 91.436  -19.709 355.180 1.00 18.49  ? 47   PHE B CB  1 
ATOM   4469 C CG  . PHE B 1 46  ? 90.103  -20.394 355.106 1.00 21.07  ? 47   PHE B CG  1 
ATOM   4470 C CD1 . PHE B 1 46  ? 90.025  -21.769 354.965 1.00 18.85  ? 47   PHE B CD1 1 
ATOM   4471 C CD2 . PHE B 1 46  ? 88.929  -19.663 355.176 1.00 20.93  ? 47   PHE B CD2 1 
ATOM   4472 C CE1 . PHE B 1 46  ? 88.801  -22.403 354.894 1.00 20.42  ? 47   PHE B CE1 1 
ATOM   4473 C CE2 . PHE B 1 46  ? 87.701  -20.292 355.107 1.00 23.83  ? 47   PHE B CE2 1 
ATOM   4474 C CZ  . PHE B 1 46  ? 87.637  -21.663 354.965 1.00 22.84  ? 47   PHE B CZ  1 
ATOM   4475 N N   . LEU B 1 47  ? 94.022  -18.854 357.425 1.00 24.42  ? 48   LEU B N   1 
ATOM   4476 C CA  . LEU B 1 47  ? 95.209  -18.018 357.489 1.00 26.87  ? 48   LEU B CA  1 
ATOM   4477 C C   . LEU B 1 47  ? 96.418  -18.829 357.933 1.00 22.33  ? 48   LEU B C   1 
ATOM   4478 O O   . LEU B 1 47  ? 96.278  -19.874 358.576 1.00 19.96  ? 48   LEU B O   1 
ATOM   4479 C CB  . LEU B 1 47  ? 94.979  -16.855 358.451 1.00 24.90  ? 48   LEU B CB  1 
ATOM   4480 C CG  . LEU B 1 47  ? 94.076  -15.729 357.947 1.00 31.78  ? 48   LEU B CG  1 
ATOM   4481 C CD1 . LEU B 1 47  ? 94.020  -14.600 358.963 1.00 30.56  ? 48   LEU B CD1 1 
ATOM   4482 C CD2 . LEU B 1 47  ? 94.553  -15.217 356.597 1.00 28.44  ? 48   LEU B CD2 1 
ATOM   4483 N N   . PRO B 1 48  ? 97.624  -18.378 357.589 1.00 24.09  ? 49   PRO B N   1 
ATOM   4484 C CA  . PRO B 1 48  ? 98.818  -19.057 358.077 1.00 19.83  ? 49   PRO B CA  1 
ATOM   4485 C C   . PRO B 1 48  ? 98.849  -19.058 359.592 1.00 23.90  ? 49   PRO B C   1 
ATOM   4486 O O   . PRO B 1 48  ? 98.307  -18.145 360.243 1.00 27.79  ? 49   PRO B O   1 
ATOM   4487 C CB  . PRO B 1 48  ? 99.964  -18.220 357.491 1.00 21.59  ? 49   PRO B CB  1 
ATOM   4488 C CG  . PRO B 1 48  ? 99.379  -17.598 356.273 1.00 25.02  ? 49   PRO B CG  1 
ATOM   4489 C CD  . PRO B 1 48  ? 97.953  -17.303 356.636 1.00 26.88  ? 49   PRO B CD  1 
ATOM   4490 N N   . PRO B 1 49  ? 99.472  -20.065 360.198 1.00 26.37  ? 50   PRO B N   1 
ATOM   4491 C CA  . PRO B 1 49  ? 99.482  -20.144 361.661 1.00 24.18  ? 50   PRO B CA  1 
ATOM   4492 C C   . PRO B 1 49  ? 100.315 -19.035 362.277 1.00 26.69  ? 50   PRO B C   1 
ATOM   4493 O O   . PRO B 1 49  ? 101.300 -18.565 361.702 1.00 27.43  ? 50   PRO B O   1 
ATOM   4494 C CB  . PRO B 1 49  ? 100.104 -21.517 361.933 1.00 19.31  ? 50   PRO B CB  1 
ATOM   4495 C CG  . PRO B 1 49  ? 100.993 -21.745 360.753 1.00 22.22  ? 50   PRO B CG  1 
ATOM   4496 C CD  . PRO B 1 49  ? 100.246 -21.157 359.582 1.00 20.50  ? 50   PRO B CD  1 
ATOM   4497 N N   . GLU B 1 50  ? 99.902  -18.614 363.465 1.00 25.05  ? 51   GLU B N   1 
ATOM   4498 C CA  . GLU B 1 50  ? 100.699 -17.676 364.231 1.00 33.61  ? 51   GLU B CA  1 
ATOM   4499 C C   . GLU B 1 50  ? 101.305 -18.376 365.439 1.00 26.70  ? 51   GLU B C   1 
ATOM   4500 O O   . GLU B 1 50  ? 100.665 -19.254 366.027 1.00 28.11  ? 51   GLU B O   1 
ATOM   4501 C CB  . GLU B 1 50  ? 99.863  -16.481 364.699 1.00 43.68  ? 51   GLU B CB  1 
ATOM   4502 C CG  . GLU B 1 50  ? 99.438  -15.550 363.575 1.00 62.44  ? 51   GLU B CG  1 
ATOM   4503 C CD  . GLU B 1 50  ? 100.604 -15.033 362.761 1.00 78.44  ? 51   GLU B CD  1 
ATOM   4504 O OE1 . GLU B 1 50  ? 101.276 -14.085 363.220 1.00 82.71  ? 51   GLU B OE1 1 
ATOM   4505 O OE2 . GLU B 1 50  ? 100.842 -15.568 361.658 1.00 81.43  ? 51   GLU B OE2 1 
ATOM   4506 N N   . PRO B 1 51  ? 102.533 -18.022 365.819 1.00 29.68  ? 52   PRO B N   1 
ATOM   4507 C CA  . PRO B 1 51  ? 103.173 -18.691 366.957 1.00 28.12  ? 52   PRO B CA  1 
ATOM   4508 C C   . PRO B 1 51  ? 102.346 -18.548 368.226 1.00 27.37  ? 52   PRO B C   1 
ATOM   4509 O O   . PRO B 1 51  ? 101.725 -17.512 368.473 1.00 27.01  ? 52   PRO B O   1 
ATOM   4510 C CB  . PRO B 1 51  ? 104.520 -17.970 367.079 1.00 31.09  ? 52   PRO B CB  1 
ATOM   4511 C CG  . PRO B 1 51  ? 104.768 -17.400 365.720 1.00 31.36  ? 52   PRO B CG  1 
ATOM   4512 C CD  . PRO B 1 51  ? 103.418 -17.028 365.189 1.00 29.49  ? 52   PRO B CD  1 
ATOM   4513 N N   . LYS B 1 52  ? 102.335 -19.612 369.025 1.00 23.80  ? 53   LYS B N   1 
ATOM   4514 C CA  . LYS B 1 52  ? 101.625 -19.584 370.295 1.00 26.19  ? 53   LYS B CA  1 
ATOM   4515 C C   . LYS B 1 52  ? 102.222 -18.522 371.207 1.00 27.95  ? 53   LYS B C   1 
ATOM   4516 O O   . LYS B 1 52  ? 103.440 -18.462 371.398 1.00 33.05  ? 53   LYS B O   1 
ATOM   4517 C CB  . LYS B 1 52  ? 101.692 -20.956 370.968 1.00 26.94  ? 53   LYS B CB  1 
ATOM   4518 C CG  . LYS B 1 52  ? 101.086 -21.000 372.363 1.00 25.24  ? 53   LYS B CG  1 
ATOM   4519 C CD  . LYS B 1 52  ? 99.572  -20.887 372.309 1.00 23.65  ? 53   LYS B CD  1 
ATOM   4520 C CE  . LYS B 1 52  ? 98.948  -21.086 373.681 1.00 30.18  ? 53   LYS B CE  1 
ATOM   4521 N NZ  . LYS B 1 52  ? 97.461  -21.003 373.625 1.00 34.98  ? 53   LYS B NZ  1 
ATOM   4522 N N   . GLN B 1 53  ? 101.362 -17.671 371.756 1.00 30.04  ? 54   GLN B N   1 
ATOM   4523 C CA  A GLN B 1 53  ? 101.821 -16.654 372.685 0.55 34.84  ? 54   GLN B CA  1 
ATOM   4524 C CA  B GLN B 1 53  ? 101.822 -16.655 372.684 0.45 34.91  ? 54   GLN B CA  1 
ATOM   4525 C C   . GLN B 1 53  ? 102.198 -17.297 374.019 1.00 33.60  ? 54   GLN B C   1 
ATOM   4526 O O   . GLN B 1 53  ? 101.617 -18.312 374.415 1.00 32.07  ? 54   GLN B O   1 
ATOM   4527 C CB  A GLN B 1 53  ? 100.742 -15.597 372.901 0.55 39.09  ? 54   GLN B CB  1 
ATOM   4528 C CB  B GLN B 1 53  ? 100.743 -15.594 372.891 0.45 39.07  ? 54   GLN B CB  1 
ATOM   4529 C CG  A GLN B 1 53  ? 100.629 -14.585 371.771 0.55 42.32  ? 54   GLN B CG  1 
ATOM   4530 C CG  B GLN B 1 53  ? 100.616 -14.614 371.731 0.45 42.33  ? 54   GLN B CG  1 
ATOM   4531 C CD  A GLN B 1 53  ? 101.910 -13.800 371.557 0.55 46.43  ? 54   GLN B CD  1 
ATOM   4532 C CD  B GLN B 1 53  ? 99.186  -14.163 371.492 0.45 46.91  ? 54   GLN B CD  1 
ATOM   4533 O OE1 A GLN B 1 53  ? 102.569 -13.936 370.526 0.55 45.65  ? 54   GLN B OE1 1 
ATOM   4534 O OE1 B GLN B 1 53  ? 98.384  -14.082 372.422 0.45 49.33  ? 54   GLN B OE1 1 
ATOM   4535 N NE2 A GLN B 1 53  ? 102.267 -12.972 372.532 0.55 48.42  ? 54   GLN B NE2 1 
ATOM   4536 N NE2 B GLN B 1 53  ? 98.861  -13.868 370.238 0.45 49.45  ? 54   GLN B NE2 1 
ATOM   4537 N N   . PRO B 1 54  ? 103.178 -16.732 374.726 1.00 32.65  ? 55   PRO B N   1 
ATOM   4538 C CA  . PRO B 1 54  ? 103.587 -17.314 376.009 1.00 30.20  ? 55   PRO B CA  1 
ATOM   4539 C C   . PRO B 1 54  ? 102.435 -17.368 377.001 1.00 33.64  ? 55   PRO B C   1 
ATOM   4540 O O   . PRO B 1 54  ? 101.506 -16.559 376.961 1.00 35.97  ? 55   PRO B O   1 
ATOM   4541 C CB  . PRO B 1 54  ? 104.694 -16.371 376.491 1.00 27.87  ? 55   PRO B CB  1 
ATOM   4542 C CG  . PRO B 1 54  ? 105.237 -15.769 375.243 1.00 34.06  ? 55   PRO B CG  1 
ATOM   4543 C CD  . PRO B 1 54  ? 104.067 -15.634 374.309 1.00 32.43  ? 55   PRO B CD  1 
ATOM   4544 N N   . TRP B 1 55  ? 102.508 -18.346 377.899 1.00 30.62  ? 56   TRP B N   1 
ATOM   4545 C CA  . TRP B 1 55  ? 101.483 -18.574 378.903 1.00 30.27  ? 56   TRP B CA  1 
ATOM   4546 C C   . TRP B 1 55  ? 102.114 -18.575 380.286 1.00 36.67  ? 56   TRP B C   1 
ATOM   4547 O O   . TRP B 1 55  ? 103.298 -18.885 380.446 1.00 34.04  ? 56   TRP B O   1 
ATOM   4548 C CB  . TRP B 1 55  ? 100.759 -19.907 378.670 1.00 29.80  ? 56   TRP B CB  1 
ATOM   4549 C CG  . TRP B 1 55  ? 101.680 -21.089 378.736 1.00 31.24  ? 56   TRP B CG  1 
ATOM   4550 C CD1 . TRP B 1 55  ? 102.070 -21.765 379.857 1.00 32.35  ? 56   TRP B CD1 1 
ATOM   4551 C CD2 . TRP B 1 55  ? 102.339 -21.726 377.635 1.00 29.54  ? 56   TRP B CD2 1 
ATOM   4552 N NE1 . TRP B 1 55  ? 102.928 -22.784 379.521 1.00 29.26  ? 56   TRP B NE1 1 
ATOM   4553 C CE2 . TRP B 1 55  ? 103.109 -22.782 378.163 1.00 31.48  ? 56   TRP B CE2 1 
ATOM   4554 C CE3 . TRP B 1 55  ? 102.352 -21.506 376.254 1.00 25.97  ? 56   TRP B CE3 1 
ATOM   4555 C CZ2 . TRP B 1 55  ? 103.881 -23.618 377.359 1.00 26.63  ? 56   TRP B CZ2 1 
ATOM   4556 C CZ3 . TRP B 1 55  ? 103.120 -22.337 375.457 1.00 28.83  ? 56   TRP B CZ3 1 
ATOM   4557 C CH2 . TRP B 1 55  ? 103.874 -23.380 376.012 1.00 25.38  ? 56   TRP B CH2 1 
ATOM   4558 N N   . SER B 1 56  ? 101.313 -18.223 381.284 1.00 39.05  ? 57   SER B N   1 
ATOM   4559 C CA  . SER B 1 56  ? 101.696 -18.382 382.677 1.00 42.05  ? 57   SER B CA  1 
ATOM   4560 C C   . SER B 1 56  ? 101.098 -19.673 383.223 1.00 39.84  ? 57   SER B C   1 
ATOM   4561 O O   . SER B 1 56  ? 100.152 -20.233 382.663 1.00 44.25  ? 57   SER B O   1 
ATOM   4562 C CB  . SER B 1 56  ? 101.240 -17.185 383.516 1.00 45.85  ? 57   SER B CB  1 
ATOM   4563 O OG  . SER B 1 56  ? 99.868  -16.907 383.309 1.00 52.54  ? 57   SER B OG  1 
ATOM   4564 N N   . GLY B 1 57  ? 101.668 -20.147 384.321 1.00 39.89  ? 58   GLY B N   1 
ATOM   4565 C CA  . GLY B 1 57  ? 101.255 -21.418 384.869 1.00 39.83  ? 58   GLY B CA  1 
ATOM   4566 C C   . GLY B 1 57  ? 101.865 -22.583 384.112 1.00 41.60  ? 58   GLY B C   1 
ATOM   4567 O O   . GLY B 1 57  ? 102.804 -22.440 383.323 1.00 38.84  ? 58   GLY B O   1 
ATOM   4568 N N   . VAL B 1 58  ? 101.302 -23.762 384.357 1.00 38.72  ? 59   VAL B N   1 
ATOM   4569 C CA  . VAL B 1 58  ? 101.822 -25.013 383.818 1.00 36.35  ? 59   VAL B CA  1 
ATOM   4570 C C   . VAL B 1 58  ? 100.774 -25.597 382.884 1.00 33.20  ? 59   VAL B C   1 
ATOM   4571 O O   . VAL B 1 58  ? 99.681  -25.977 383.325 1.00 38.74  ? 59   VAL B O   1 
ATOM   4572 C CB  . VAL B 1 58  ? 102.182 -26.008 384.929 1.00 37.42  ? 59   VAL B CB  1 
ATOM   4573 C CG1 . VAL B 1 58  ? 102.742 -27.288 384.331 1.00 30.82  ? 59   VAL B CG1 1 
ATOM   4574 C CG2 . VAL B 1 58  ? 103.175 -25.383 385.896 1.00 38.55  ? 59   VAL B CG2 1 
ATOM   4575 N N   . VAL B 1 59  ? 101.102 -25.672 381.594 1.00 26.54  ? 60   VAL B N   1 
ATOM   4576 C CA  . VAL B 1 59  ? 100.234 -26.351 380.641 1.00 30.68  ? 60   VAL B CA  1 
ATOM   4577 C C   . VAL B 1 59  ? 100.258 -27.846 380.925 1.00 31.93  ? 60   VAL B C   1 
ATOM   4578 O O   . VAL B 1 59  ? 101.327 -28.445 381.107 1.00 31.64  ? 60   VAL B O   1 
ATOM   4579 C CB  . VAL B 1 59  ? 100.668 -26.046 379.198 1.00 32.66  ? 60   VAL B CB  1 
ATOM   4580 C CG1 . VAL B 1 59  ? 100.102 -27.084 378.237 1.00 32.41  ? 60   VAL B CG1 1 
ATOM   4581 C CG2 . VAL B 1 59  ? 100.218 -24.652 378.796 1.00 31.60  ? 60   VAL B CG2 1 
ATOM   4582 N N   . ASP B 1 60  ? 99.076  -28.452 380.982 1.00 34.32  ? 61   ASP B N   1 
ATOM   4583 C CA  . ASP B 1 60  ? 98.948  -29.888 381.205 1.00 36.89  ? 61   ASP B CA  1 
ATOM   4584 C C   . ASP B 1 60  ? 99.209  -30.610 379.889 1.00 31.78  ? 61   ASP B C   1 
ATOM   4585 O O   . ASP B 1 60  ? 98.406  -30.524 378.954 1.00 34.70  ? 61   ASP B O   1 
ATOM   4586 C CB  . ASP B 1 60  ? 97.562  -30.212 381.757 1.00 51.13  ? 61   ASP B CB  1 
ATOM   4587 C CG  . ASP B 1 60  ? 97.288  -31.703 381.828 1.00 68.56  ? 61   ASP B CG  1 
ATOM   4588 O OD1 . ASP B 1 60  ? 96.101  -32.082 381.912 1.00 75.68  ? 61   ASP B OD1 1 
ATOM   4589 O OD2 . ASP B 1 60  ? 98.249  -32.498 381.814 1.00 75.57  ? 61   ASP B OD2 1 
ATOM   4590 N N   . ALA B 1 61  ? 100.331 -31.324 379.813 1.00 24.35  ? 62   ALA B N   1 
ATOM   4591 C CA  . ALA B 1 61  ? 100.674 -32.063 378.606 1.00 23.27  ? 62   ALA B CA  1 
ATOM   4592 C C   . ALA B 1 61  ? 100.657 -33.565 378.861 1.00 24.62  ? 62   ALA B C   1 
ATOM   4593 O O   . ALA B 1 61  ? 101.620 -34.266 378.533 1.00 26.76  ? 62   ALA B O   1 
ATOM   4594 C CB  . ALA B 1 61  ? 102.044 -31.626 378.081 1.00 24.27  ? 62   ALA B CB  1 
ATOM   4595 N N   . THR B 1 62  ? 99.566  -34.071 379.434 1.00 25.38  ? 63   THR B N   1 
ATOM   4596 C CA  . THR B 1 62  ? 99.458  -35.477 379.800 1.00 29.74  ? 63   THR B CA  1 
ATOM   4597 C C   . THR B 1 62  ? 98.503  -36.265 378.915 1.00 31.94  ? 63   THR B C   1 
ATOM   4598 O O   . THR B 1 62  ? 98.368  -37.478 379.106 1.00 27.75  ? 63   THR B O   1 
ATOM   4599 C CB  . THR B 1 62  ? 99.012  -35.615 381.261 1.00 31.66  ? 63   THR B CB  1 
ATOM   4600 O OG1 . THR B 1 62  ? 97.763  -34.938 381.447 1.00 28.91  ? 63   THR B OG1 1 
ATOM   4601 C CG2 . THR B 1 62  ? 100.056 -35.027 382.198 1.00 30.21  ? 63   THR B CG2 1 
ATOM   4602 N N   . THR B 1 63  ? 97.836  -35.622 377.961 1.00 30.60  ? 64   THR B N   1 
ATOM   4603 C CA  . THR B 1 63  ? 96.876  -36.323 377.123 1.00 26.52  ? 64   THR B CA  1 
ATOM   4604 C C   . THR B 1 63  ? 96.837  -35.670 375.749 1.00 25.98  ? 64   THR B C   1 
ATOM   4605 O O   . THR B 1 63  ? 97.136  -34.481 375.601 1.00 29.40  ? 64   THR B O   1 
ATOM   4606 C CB  . THR B 1 63  ? 95.480  -36.336 377.766 1.00 34.39  ? 64   THR B CB  1 
ATOM   4607 O OG1 . THR B 1 63  ? 94.623  -37.234 377.049 1.00 51.63  ? 64   THR B OG1 1 
ATOM   4608 C CG2 . THR B 1 63  ? 94.867  -34.941 377.774 1.00 23.36  ? 64   THR B CG2 1 
ATOM   4609 N N   . PHE B 1 64  ? 96.489  -36.470 374.742 1.00 22.57  ? 65   PHE B N   1 
ATOM   4610 C CA  . PHE B 1 64  ? 96.368  -35.956 373.385 1.00 24.92  ? 65   PHE B CA  1 
ATOM   4611 C C   . PHE B 1 64  ? 95.282  -34.894 373.319 1.00 26.92  ? 65   PHE B C   1 
ATOM   4612 O O   . PHE B 1 64  ? 94.265  -34.967 374.016 1.00 27.58  ? 65   PHE B O   1 
ATOM   4613 C CB  . PHE B 1 64  ? 96.035  -37.085 372.409 1.00 23.11  ? 65   PHE B CB  1 
ATOM   4614 C CG  . PHE B 1 64  ? 97.194  -37.980 372.093 1.00 24.31  ? 65   PHE B CG  1 
ATOM   4615 C CD1 . PHE B 1 64  ? 98.310  -37.490 371.436 1.00 16.95  ? 65   PHE B CD1 1 
ATOM   4616 C CD2 . PHE B 1 64  ? 97.158  -39.321 372.438 1.00 24.34  ? 65   PHE B CD2 1 
ATOM   4617 C CE1 . PHE B 1 64  ? 99.374  -38.320 371.139 1.00 23.81  ? 65   PHE B CE1 1 
ATOM   4618 C CE2 . PHE B 1 64  ? 98.218  -40.155 372.144 1.00 23.67  ? 65   PHE B CE2 1 
ATOM   4619 C CZ  . PHE B 1 64  ? 99.327  -39.655 371.493 1.00 21.63  ? 65   PHE B CZ  1 
ATOM   4620 N N   . GLN B 1 65  ? 95.493  -33.896 372.469 1.00 26.43  ? 66   GLN B N   1 
ATOM   4621 C CA  . GLN B 1 65  ? 94.480  -32.875 372.294 1.00 27.96  ? 66   GLN B CA  1 
ATOM   4622 C C   . GLN B 1 65  ? 93.671  -33.146 371.024 1.00 25.86  ? 66   GLN B C   1 
ATOM   4623 O O   . GLN B 1 65  ? 93.851  -34.157 370.338 1.00 23.80  ? 66   GLN B O   1 
ATOM   4624 C CB  . GLN B 1 65  ? 95.107  -31.483 372.293 1.00 26.15  ? 66   GLN B CB  1 
ATOM   4625 C CG  . GLN B 1 65  ? 95.033  -30.818 373.668 1.00 34.86  ? 66   GLN B CG  1 
ATOM   4626 C CD  . GLN B 1 65  ? 93.938  -29.770 373.764 1.00 41.24  ? 66   GLN B CD  1 
ATOM   4627 O OE1 . GLN B 1 65  ? 92.999  -29.759 372.967 1.00 46.34  ? 66   GLN B OE1 1 
ATOM   4628 N NE2 . GLN B 1 65  ? 94.050  -28.886 374.750 1.00 45.43  ? 66   GLN B NE2 1 
ATOM   4629 N N   . SER B 1 66  ? 92.770  -32.217 370.716 1.00 23.29  ? 67   SER B N   1 
ATOM   4630 C CA  . SER B 1 66  ? 91.725  -32.452 369.728 1.00 21.49  ? 67   SER B CA  1 
ATOM   4631 C C   . SER B 1 66  ? 92.303  -32.725 368.344 1.00 24.68  ? 67   SER B C   1 
ATOM   4632 O O   . SER B 1 66  ? 93.419  -32.315 368.012 1.00 24.14  ? 67   SER B O   1 
ATOM   4633 C CB  . SER B 1 66  ? 90.787  -31.248 369.671 1.00 23.60  ? 67   SER B CB  1 
ATOM   4634 O OG  . SER B 1 66  ? 90.438  -30.825 370.978 1.00 33.44  ? 67   SER B OG  1 
ATOM   4635 N N   . VAL B 1 67  ? 91.522  -33.434 367.541 1.00 24.95  ? 68   VAL B N   1 
ATOM   4636 C CA  . VAL B 1 67  ? 91.849  -33.752 366.156 1.00 18.64  ? 68   VAL B CA  1 
ATOM   4637 C C   . VAL B 1 67  ? 91.317  -32.638 365.265 1.00 19.92  ? 68   VAL B C   1 
ATOM   4638 O O   . VAL B 1 67  ? 90.195  -32.158 365.468 1.00 19.10  ? 68   VAL B O   1 
ATOM   4639 C CB  . VAL B 1 67  ? 91.247  -35.117 365.767 1.00 18.77  ? 68   VAL B CB  1 
ATOM   4640 C CG1 . VAL B 1 67  ? 91.425  -35.388 364.285 1.00 21.08  ? 68   VAL B CG1 1 
ATOM   4641 C CG2 . VAL B 1 67  ? 91.860  -36.231 366.604 1.00 18.53  ? 68   VAL B CG2 1 
ATOM   4642 N N   . CYS B 1 68  ? 92.117  -32.207 364.285 1.00 18.56  ? 69   CYS B N   1 
ATOM   4643 C CA  . CYS B 1 68  ? 91.635  -31.196 363.351 1.00 21.02  ? 69   CYS B CA  1 
ATOM   4644 C C   . CYS B 1 68  ? 90.418  -31.708 362.596 1.00 23.30  ? 69   CYS B C   1 
ATOM   4645 O O   . CYS B 1 68  ? 90.301  -32.899 362.296 1.00 27.70  ? 69   CYS B O   1 
ATOM   4646 C CB  . CYS B 1 68  ? 92.723  -30.782 362.350 1.00 21.46  ? 69   CYS B CB  1 
ATOM   4647 S SG  . CYS B 1 68  ? 94.146  -29.855 363.012 1.00 27.68  ? 69   CYS B SG  1 
ATOM   4648 N N   . TYR B 1 69  ? 89.526  -30.776 362.265 1.00 20.25  ? 70   TYR B N   1 
ATOM   4649 C CA  . TYR B 1 69  ? 88.256  -31.110 361.635 1.00 23.55  ? 70   TYR B CA  1 
ATOM   4650 C C   . TYR B 1 69  ? 88.468  -31.863 360.331 1.00 22.03  ? 70   TYR B C   1 
ATOM   4651 O O   . TYR B 1 69  ? 89.216  -31.419 359.456 1.00 19.23  ? 70   TYR B O   1 
ATOM   4652 C CB  . TYR B 1 69  ? 87.457  -29.837 361.378 1.00 27.39  ? 70   TYR B CB  1 
ATOM   4653 C CG  . TYR B 1 69  ? 86.290  -29.686 362.308 1.00 29.24  ? 70   TYR B CG  1 
ATOM   4654 C CD1 . TYR B 1 69  ? 85.088  -30.325 362.046 1.00 30.72  ? 70   TYR B CD1 1 
ATOM   4655 C CD2 . TYR B 1 69  ? 86.393  -28.922 363.461 1.00 33.13  ? 70   TYR B CD2 1 
ATOM   4656 C CE1 . TYR B 1 69  ? 84.015  -30.199 362.899 1.00 35.88  ? 70   TYR B CE1 1 
ATOM   4657 C CE2 . TYR B 1 69  ? 85.325  -28.790 364.321 1.00 32.40  ? 70   TYR B CE2 1 
ATOM   4658 C CZ  . TYR B 1 69  ? 84.139  -29.430 364.035 1.00 38.55  ? 70   TYR B CZ  1 
ATOM   4659 O OH  . TYR B 1 69  ? 83.072  -29.300 364.891 1.00 53.15  ? 70   TYR B OH  1 
ATOM   4660 N N   . GLN B 1 70  ? 87.793  -33.003 360.196 1.00 19.93  ? 71   GLN B N   1 
ATOM   4661 C CA  . GLN B 1 70  ? 88.000  -33.842 359.027 1.00 20.87  ? 71   GLN B CA  1 
ATOM   4662 C C   . GLN B 1 70  ? 86.808  -34.762 358.828 1.00 25.58  ? 71   GLN B C   1 
ATOM   4663 O O   . GLN B 1 70  ? 86.040  -35.035 359.756 1.00 24.80  ? 71   GLN B O   1 
ATOM   4664 C CB  . GLN B 1 70  ? 89.282  -34.669 359.156 1.00 17.53  ? 71   GLN B CB  1 
ATOM   4665 C CG  . GLN B 1 70  ? 89.321  -35.548 360.393 1.00 19.52  ? 71   GLN B CG  1 
ATOM   4666 C CD  . GLN B 1 70  ? 90.694  -36.139 360.631 1.00 26.42  ? 71   GLN B CD  1 
ATOM   4667 O OE1 . GLN B 1 70  ? 90.917  -37.330 360.415 1.00 17.66  ? 71   GLN B OE1 1 
ATOM   4668 N NE2 . GLN B 1 70  ? 91.629  -35.302 361.064 1.00 15.26  ? 71   GLN B NE2 1 
ATOM   4669 N N   . TYR B 1 71  ? 86.675  -35.232 357.592 1.00 25.15  ? 72   TYR B N   1 
ATOM   4670 C CA  . TYR B 1 71  ? 85.718  -36.277 357.265 1.00 23.46  ? 72   TYR B CA  1 
ATOM   4671 C C   . TYR B 1 71  ? 86.018  -37.539 358.064 1.00 25.21  ? 72   TYR B C   1 
ATOM   4672 O O   . TYR B 1 71  ? 87.180  -37.889 358.291 1.00 33.99  ? 72   TYR B O   1 
ATOM   4673 C CB  . TYR B 1 71  ? 85.778  -36.569 355.765 1.00 28.83  ? 72   TYR B CB  1 
ATOM   4674 C CG  . TYR B 1 71  ? 84.884  -37.690 355.295 1.00 34.54  ? 72   TYR B CG  1 
ATOM   4675 C CD1 . TYR B 1 71  ? 83.518  -37.498 355.143 1.00 40.05  ? 72   TYR B CD1 1 
ATOM   4676 C CD2 . TYR B 1 71  ? 85.409  -38.941 354.992 1.00 35.02  ? 72   TYR B CD2 1 
ATOM   4677 C CE1 . TYR B 1 71  ? 82.697  -38.520 354.708 1.00 41.06  ? 72   TYR B CE1 1 
ATOM   4678 C CE2 . TYR B 1 71  ? 84.596  -39.970 354.557 1.00 34.86  ? 72   TYR B CE2 1 
ATOM   4679 C CZ  . TYR B 1 71  ? 83.241  -39.754 354.417 1.00 39.10  ? 72   TYR B CZ  1 
ATOM   4680 O OH  . TYR B 1 71  ? 82.425  -40.774 353.985 1.00 51.63  ? 72   TYR B OH  1 
ATOM   4681 N N   . VAL B 1 72  ? 84.962  -38.222 358.498 1.00 25.57  ? 73   VAL B N   1 
ATOM   4682 C CA  . VAL B 1 72  ? 85.074  -39.490 359.210 1.00 25.67  ? 73   VAL B CA  1 
ATOM   4683 C C   . VAL B 1 72  ? 84.539  -40.583 358.296 1.00 29.21  ? 73   VAL B C   1 
ATOM   4684 O O   . VAL B 1 72  ? 83.384  -40.525 357.856 1.00 32.32  ? 73   VAL B O   1 
ATOM   4685 C CB  . VAL B 1 72  ? 84.317  -39.464 360.546 1.00 31.74  ? 73   VAL B CB  1 
ATOM   4686 C CG1 . VAL B 1 72  ? 84.374  -40.831 361.214 1.00 26.10  ? 73   VAL B CG1 1 
ATOM   4687 C CG2 . VAL B 1 72  ? 84.894  -38.395 361.461 1.00 29.98  ? 73   VAL B CG2 1 
ATOM   4688 N N   . ASP B 1 73  ? 85.376  -41.577 358.010 1.00 32.29  ? 74   ASP B N   1 
ATOM   4689 C CA  . ASP B 1 73  ? 84.996  -42.642 357.091 1.00 33.02  ? 74   ASP B CA  1 
ATOM   4690 C C   . ASP B 1 73  ? 83.907  -43.515 357.703 1.00 36.25  ? 74   ASP B C   1 
ATOM   4691 O O   . ASP B 1 73  ? 84.000  -43.920 358.866 1.00 41.02  ? 74   ASP B O   1 
ATOM   4692 C CB  . ASP B 1 73  ? 86.216  -43.488 356.731 1.00 39.53  ? 74   ASP B CB  1 
ATOM   4693 C CG  . ASP B 1 73  ? 85.871  -44.650 355.822 1.00 48.80  ? 74   ASP B CG  1 
ATOM   4694 O OD1 . ASP B 1 73  ? 85.503  -44.405 354.655 1.00 56.79  ? 74   ASP B OD1 1 
ATOM   4695 O OD2 . ASP B 1 73  ? 85.968  -45.809 356.275 1.00 56.95  ? 74   ASP B OD2 1 
ATOM   4696 N N   . THR B 1 74  ? 82.870  -43.806 356.911 1.00 37.85  ? 75   THR B N   1 
ATOM   4697 C CA  . THR B 1 74  ? 81.750  -44.629 357.355 1.00 48.42  ? 75   THR B CA  1 
ATOM   4698 C C   . THR B 1 74  ? 81.485  -45.792 356.404 1.00 49.88  ? 75   THR B C   1 
ATOM   4699 O O   . THR B 1 74  ? 80.376  -46.335 356.396 1.00 47.39  ? 75   THR B O   1 
ATOM   4700 C CB  . THR B 1 74  ? 80.480  -43.787 357.506 1.00 50.04  ? 75   THR B CB  1 
ATOM   4701 O OG1 . THR B 1 74  ? 80.304  -42.972 356.341 1.00 52.28  ? 75   THR B OG1 1 
ATOM   4702 C CG2 . THR B 1 74  ? 80.571  -42.895 358.734 1.00 50.52  ? 75   THR B CG2 1 
ATOM   4703 N N   . LEU B 1 75  ? 82.480  -46.185 355.604 1.00 51.09  ? 76   LEU B N   1 
ATOM   4704 C CA  . LEU B 1 75  ? 82.262  -47.224 354.601 1.00 51.04  ? 76   LEU B CA  1 
ATOM   4705 C C   . LEU B 1 75  ? 81.931  -48.561 355.253 1.00 52.12  ? 76   LEU B C   1 
ATOM   4706 O O   . LEU B 1 75  ? 80.961  -49.227 354.872 1.00 51.95  ? 76   LEU B O   1 
ATOM   4707 C CB  . LEU B 1 75  ? 83.493  -47.352 353.704 1.00 49.87  ? 76   LEU B CB  1 
ATOM   4708 C CG  . LEU B 1 75  ? 83.382  -48.401 352.597 1.00 50.86  ? 76   LEU B CG  1 
ATOM   4709 C CD1 . LEU B 1 75  ? 82.139  -48.156 351.756 1.00 48.76  ? 76   LEU B CD1 1 
ATOM   4710 C CD2 . LEU B 1 75  ? 84.628  -48.407 351.728 1.00 48.70  ? 76   LEU B CD2 1 
ATOM   4711 N N   . TYR B 1 76  ? 82.731  -48.974 356.233 1.00 46.62  ? 77   TYR B N   1 
ATOM   4712 C CA  . TYR B 1 76  ? 82.523  -50.224 356.962 1.00 45.49  ? 77   TYR B CA  1 
ATOM   4713 C C   . TYR B 1 76  ? 82.460  -49.900 358.449 1.00 45.96  ? 77   TYR B C   1 
ATOM   4714 O O   . TYR B 1 76  ? 83.457  -50.041 359.169 1.00 46.94  ? 77   TYR B O   1 
ATOM   4715 C CB  . TYR B 1 76  ? 83.632  -51.234 356.661 1.00 40.88  ? 77   TYR B CB  1 
ATOM   4716 C CG  . TYR B 1 76  ? 83.770  -51.610 355.200 1.00 44.78  ? 77   TYR B CG  1 
ATOM   4717 C CD1 . TYR B 1 76  ? 82.781  -52.338 354.552 1.00 44.20  ? 77   TYR B CD1 1 
ATOM   4718 C CD2 . TYR B 1 76  ? 84.899  -51.249 354.475 1.00 46.42  ? 77   TYR B CD2 1 
ATOM   4719 C CE1 . TYR B 1 76  ? 82.908  -52.690 353.219 1.00 48.48  ? 77   TYR B CE1 1 
ATOM   4720 C CE2 . TYR B 1 76  ? 85.035  -51.597 353.142 1.00 45.27  ? 77   TYR B CE2 1 
ATOM   4721 C CZ  . TYR B 1 76  ? 84.037  -52.316 352.519 1.00 51.45  ? 77   TYR B CZ  1 
ATOM   4722 O OH  . TYR B 1 76  ? 84.167  -52.663 351.193 1.00 52.23  ? 77   TYR B OH  1 
ATOM   4723 N N   . PRO B 1 77  ? 81.302  -49.458 358.940 1.00 49.47  ? 78   PRO B N   1 
ATOM   4724 C CA  . PRO B 1 77  ? 81.203  -49.037 360.346 1.00 48.11  ? 78   PRO B CA  1 
ATOM   4725 C C   . PRO B 1 77  ? 81.571  -50.160 361.308 1.00 47.72  ? 78   PRO B C   1 
ATOM   4726 O O   . PRO B 1 77  ? 81.088  -51.289 361.189 1.00 50.90  ? 78   PRO B O   1 
ATOM   4727 C CB  . PRO B 1 77  ? 79.732  -48.632 360.488 1.00 49.52  ? 78   PRO B CB  1 
ATOM   4728 C CG  . PRO B 1 77  ? 79.317  -48.252 359.105 1.00 52.53  ? 78   PRO B CG  1 
ATOM   4729 C CD  . PRO B 1 77  ? 80.059  -49.193 358.197 1.00 52.21  ? 78   PRO B CD  1 
ATOM   4730 N N   . GLY B 1 78  ? 82.434  -49.834 362.271 1.00 45.24  ? 79   GLY B N   1 
ATOM   4731 C CA  . GLY B 1 78  ? 82.904  -50.791 363.249 1.00 43.39  ? 79   GLY B CA  1 
ATOM   4732 C C   . GLY B 1 78  ? 84.039  -51.677 362.789 1.00 46.04  ? 79   GLY B C   1 
ATOM   4733 O O   . GLY B 1 78  ? 84.571  -52.445 363.602 1.00 47.94  ? 79   GLY B O   1 
ATOM   4734 N N   . PHE B 1 79  ? 84.432  -51.598 361.520 1.00 41.17  ? 80   PHE B N   1 
ATOM   4735 C CA  . PHE B 1 79  ? 85.478  -52.456 360.983 1.00 34.31  ? 80   PHE B CA  1 
ATOM   4736 C C   . PHE B 1 79  ? 86.849  -51.914 361.366 1.00 34.90  ? 80   PHE B C   1 
ATOM   4737 O O   . PHE B 1 79  ? 87.144  -50.734 361.153 1.00 35.81  ? 80   PHE B O   1 
ATOM   4738 C CB  . PHE B 1 79  ? 85.340  -52.556 359.464 1.00 32.00  ? 80   PHE B CB  1 
ATOM   4739 C CG  . PHE B 1 79  ? 86.461  -53.292 358.790 1.00 36.83  ? 80   PHE B CG  1 
ATOM   4740 C CD1 . PHE B 1 79  ? 86.792  -54.583 359.167 1.00 36.65  ? 80   PHE B CD1 1 
ATOM   4741 C CD2 . PHE B 1 79  ? 87.171  -52.697 357.759 1.00 38.75  ? 80   PHE B CD2 1 
ATOM   4742 C CE1 . PHE B 1 79  ? 87.819  -55.262 358.536 1.00 36.17  ? 80   PHE B CE1 1 
ATOM   4743 C CE2 . PHE B 1 79  ? 88.197  -53.370 357.125 1.00 39.29  ? 80   PHE B CE2 1 
ATOM   4744 C CZ  . PHE B 1 79  ? 88.523  -54.654 357.514 1.00 38.14  ? 80   PHE B CZ  1 
ATOM   4745 N N   . GLU B 1 80  ? 87.689  -52.788 361.926 1.00 34.63  ? 81   GLU B N   1 
ATOM   4746 C CA  . GLU B 1 80  ? 88.982  -52.360 362.449 1.00 37.81  ? 81   GLU B CA  1 
ATOM   4747 C C   . GLU B 1 80  ? 89.874  -51.769 361.361 1.00 39.39  ? 81   GLU B C   1 
ATOM   4748 O O   . GLU B 1 80  ? 90.644  -50.840 361.631 1.00 34.02  ? 81   GLU B O   1 
ATOM   4749 C CB  . GLU B 1 80  ? 89.669  -53.546 363.131 1.00 48.54  ? 81   GLU B CB  1 
ATOM   4750 C CG  . GLU B 1 80  ? 91.107  -53.310 363.559 1.00 65.75  ? 81   GLU B CG  1 
ATOM   4751 C CD  . GLU B 1 80  ? 91.235  -52.440 364.798 1.00 82.18  ? 81   GLU B CD  1 
ATOM   4752 O OE1 . GLU B 1 80  ? 92.375  -52.257 365.274 1.00 86.63  ? 81   GLU B OE1 1 
ATOM   4753 O OE2 . GLU B 1 80  ? 90.205  -51.941 365.299 1.00 88.66  ? 81   GLU B OE2 1 
ATOM   4754 N N   . GLY B 1 81  ? 89.774  -52.277 360.130 1.00 32.70  ? 82   GLY B N   1 
ATOM   4755 C CA  . GLY B 1 81  ? 90.643  -51.801 359.066 1.00 31.96  ? 82   GLY B CA  1 
ATOM   4756 C C   . GLY B 1 81  ? 90.444  -50.338 358.723 1.00 32.73  ? 82   GLY B C   1 
ATOM   4757 O O   . GLY B 1 81  ? 91.377  -49.673 358.264 1.00 33.98  ? 82   GLY B O   1 
ATOM   4758 N N   . THR B 1 82  ? 89.237  -49.817 358.932 1.00 27.90  ? 83   THR B N   1 
ATOM   4759 C CA  . THR B 1 82  ? 88.966  -48.406 358.687 1.00 30.34  ? 83   THR B CA  1 
ATOM   4760 C C   . THR B 1 82  ? 88.953  -47.568 359.956 1.00 33.23  ? 83   THR B C   1 
ATOM   4761 O O   . THR B 1 82  ? 89.358  -46.402 359.917 1.00 35.03  ? 83   THR B O   1 
ATOM   4762 C CB  . THR B 1 82  ? 87.625  -48.234 357.963 1.00 32.03  ? 83   THR B CB  1 
ATOM   4763 O OG1 . THR B 1 82  ? 86.582  -48.851 358.728 1.00 37.49  ? 83   THR B OG1 1 
ATOM   4764 C CG2 . THR B 1 82  ? 87.677  -48.866 356.579 1.00 32.56  ? 83   THR B CG2 1 
ATOM   4765 N N   . GLU B 1 83  ? 88.509  -48.135 361.082 1.00 29.16  ? 84   GLU B N   1 
ATOM   4766 C CA  . GLU B 1 83  ? 88.387  -47.351 362.307 1.00 30.36  ? 84   GLU B CA  1 
ATOM   4767 C C   . GLU B 1 83  ? 89.746  -46.976 362.884 1.00 27.66  ? 84   GLU B C   1 
ATOM   4768 O O   . GLU B 1 83  ? 89.858  -45.960 363.581 1.00 25.29  ? 84   GLU B O   1 
ATOM   4769 C CB  . GLU B 1 83  ? 87.568  -48.114 363.349 1.00 37.96  ? 84   GLU B CB  1 
ATOM   4770 C CG  . GLU B 1 83  ? 86.134  -48.429 362.932 1.00 46.32  ? 84   GLU B CG  1 
ATOM   4771 C CD  . GLU B 1 83  ? 85.240  -47.204 362.874 1.00 53.49  ? 84   GLU B CD  1 
ATOM   4772 O OE1 . GLU B 1 83  ? 84.089  -47.336 362.407 1.00 54.42  ? 84   GLU B OE1 1 
ATOM   4773 O OE2 . GLU B 1 83  ? 85.681  -46.113 363.296 1.00 53.58  ? 84   GLU B OE2 1 
ATOM   4774 N N   . MET B 1 84  ? 90.786  -47.772 362.613 1.00 25.99  ? 85   MET B N   1 
ATOM   4775 C CA  . MET B 1 84  ? 92.112  -47.460 363.136 1.00 22.65  ? 85   MET B CA  1 
ATOM   4776 C C   . MET B 1 84  ? 92.654  -46.148 362.582 1.00 29.09  ? 85   MET B C   1 
ATOM   4777 O O   . MET B 1 84  ? 93.601  -45.592 363.149 1.00 29.20  ? 85   MET B O   1 
ATOM   4778 C CB  . MET B 1 84  ? 93.088  -48.603 362.834 1.00 24.67  ? 85   MET B CB  1 
ATOM   4779 C CG  . MET B 1 84  ? 93.271  -48.899 361.350 1.00 27.49  ? 85   MET B CG  1 
ATOM   4780 S SD  . MET B 1 84  ? 94.305  -50.338 360.981 1.00 38.97  ? 85   MET B SD  1 
ATOM   4781 C CE  . MET B 1 84  ? 95.855  -49.932 361.782 1.00 34.44  ? 85   MET B CE  1 
ATOM   4782 N N   . TRP B 1 85  ? 92.071  -45.637 361.496 1.00 25.61  ? 86   TRP B N   1 
ATOM   4783 C CA  . TRP B 1 85  ? 92.482  -44.373 360.899 1.00 23.84  ? 86   TRP B CA  1 
ATOM   4784 C C   . TRP B 1 85  ? 91.547  -43.218 361.232 1.00 26.71  ? 86   TRP B C   1 
ATOM   4785 O O   . TRP B 1 85  ? 91.863  -42.072 360.897 1.00 25.31  ? 86   TRP B O   1 
ATOM   4786 C CB  . TRP B 1 85  ? 92.578  -44.515 359.375 1.00 17.57  ? 86   TRP B CB  1 
ATOM   4787 C CG  . TRP B 1 85  ? 93.372  -45.703 358.949 1.00 24.15  ? 86   TRP B CG  1 
ATOM   4788 C CD1 . TRP B 1 85  ? 92.893  -46.857 358.401 1.00 24.01  ? 86   TRP B CD1 1 
ATOM   4789 C CD2 . TRP B 1 85  ? 94.791  -45.860 359.041 1.00 20.02  ? 86   TRP B CD2 1 
ATOM   4790 N NE1 . TRP B 1 85  ? 93.927  -47.724 358.147 1.00 24.35  ? 86   TRP B NE1 1 
ATOM   4791 C CE2 . TRP B 1 85  ? 95.104  -47.135 358.530 1.00 25.51  ? 86   TRP B CE2 1 
ATOM   4792 C CE3 . TRP B 1 85  ? 95.830  -45.044 359.503 1.00 20.62  ? 86   TRP B CE3 1 
ATOM   4793 C CZ2 . TRP B 1 85  ? 96.410  -47.616 358.470 1.00 25.05  ? 86   TRP B CZ2 1 
ATOM   4794 C CZ3 . TRP B 1 85  ? 97.126  -45.524 359.446 1.00 20.58  ? 86   TRP B CZ3 1 
ATOM   4795 C CH2 . TRP B 1 85  ? 97.405  -46.798 358.932 1.00 22.57  ? 86   TRP B CH2 1 
ATOM   4796 N N   . ASN B 1 86  ? 90.415  -43.487 361.873 1.00 26.20  ? 87   ASN B N   1 
ATOM   4797 C CA  . ASN B 1 86  ? 89.443  -42.452 362.174 1.00 28.42  ? 87   ASN B CA  1 
ATOM   4798 C C   . ASN B 1 86  ? 89.849  -41.673 363.422 1.00 24.60  ? 87   ASN B C   1 
ATOM   4799 O O   . ASN B 1 86  ? 90.595  -42.178 364.265 1.00 24.18  ? 87   ASN B O   1 
ATOM   4800 C CB  . ASN B 1 86  ? 88.062  -43.074 362.362 1.00 19.70  ? 87   ASN B CB  1 
ATOM   4801 C CG  . ASN B 1 86  ? 87.333  -43.275 361.048 1.00 36.91  ? 87   ASN B CG  1 
ATOM   4802 O OD1 . ASN B 1 86  ? 87.647  -42.632 360.045 1.00 30.96  ? 87   ASN B OD1 1 
ATOM   4803 N ND2 . ASN B 1 86  ? 86.351  -44.169 361.047 1.00 32.83  ? 87   ASN B ND2 1 
ATOM   4804 N N   . PRO B 1 87  ? 89.378  -40.433 363.556 1.00 23.12  ? 88   PRO B N   1 
ATOM   4805 C CA  . PRO B 1 87  ? 89.722  -39.632 364.738 1.00 26.30  ? 88   PRO B CA  1 
ATOM   4806 C C   . PRO B 1 87  ? 89.351  -40.342 366.032 1.00 30.57  ? 88   PRO B C   1 
ATOM   4807 O O   . PRO B 1 87  ? 88.245  -40.868 366.179 1.00 29.54  ? 88   PRO B O   1 
ATOM   4808 C CB  . PRO B 1 87  ? 88.902  -38.352 364.546 1.00 28.49  ? 88   PRO B CB  1 
ATOM   4809 C CG  . PRO B 1 87  ? 88.675  -38.262 363.078 1.00 26.96  ? 88   PRO B CG  1 
ATOM   4810 C CD  . PRO B 1 87  ? 88.573  -39.671 362.583 1.00 23.04  ? 88   PRO B CD  1 
ATOM   4811 N N   . ASN B 1 88  ? 90.293  -40.362 366.974 1.00 27.32  ? 89   ASN B N   1 
ATOM   4812 C CA  . ASN B 1 88  ? 90.071  -40.950 368.289 1.00 28.78  ? 89   ASN B CA  1 
ATOM   4813 C C   . ASN B 1 88  ? 90.011  -39.898 369.390 1.00 27.85  ? 89   ASN B C   1 
ATOM   4814 O O   . ASN B 1 88  ? 90.059  -40.246 370.574 1.00 34.65  ? 89   ASN B O   1 
ATOM   4815 C CB  . ASN B 1 88  ? 91.151  -41.991 368.598 1.00 29.50  ? 89   ASN B CB  1 
ATOM   4816 C CG  . ASN B 1 88  ? 92.543  -41.394 368.653 1.00 30.79  ? 89   ASN B CG  1 
ATOM   4817 O OD1 . ASN B 1 88  ? 92.779  -40.285 368.173 1.00 28.84  ? 89   ASN B OD1 1 
ATOM   4818 N ND2 . ASN B 1 88  ? 93.478  -42.133 369.239 1.00 34.37  ? 89   ASN B ND2 1 
ATOM   4819 N N   . ARG B 1 89  ? 89.925  -38.623 369.023 1.00 26.66  ? 90   ARG B N   1 
ATOM   4820 C CA  . ARG B 1 89  ? 89.612  -37.533 369.933 1.00 22.17  ? 90   ARG B CA  1 
ATOM   4821 C C   . ARG B 1 89  ? 88.562  -36.659 369.264 1.00 28.71  ? 90   ARG B C   1 
ATOM   4822 O O   . ARG B 1 89  ? 88.312  -36.770 368.060 1.00 28.66  ? 90   ARG B O   1 
ATOM   4823 C CB  . ARG B 1 89  ? 90.859  -36.710 370.292 1.00 25.42  ? 90   ARG B CB  1 
ATOM   4824 C CG  . ARG B 1 89  ? 91.922  -37.471 371.075 1.00 26.66  ? 90   ARG B CG  1 
ATOM   4825 C CD  . ARG B 1 89  ? 91.421  -37.888 372.451 1.00 34.97  ? 90   ARG B CD  1 
ATOM   4826 N NE  . ARG B 1 89  ? 92.484  -38.479 373.260 1.00 36.40  ? 90   ARG B NE  1 
ATOM   4827 C CZ  . ARG B 1 89  ? 92.865  -39.750 373.184 1.00 37.94  ? 90   ARG B CZ  1 
ATOM   4828 N NH1 . ARG B 1 89  ? 92.268  -40.573 372.333 1.00 37.36  ? 90   ARG B NH1 1 
ATOM   4829 N NH2 . ARG B 1 89  ? 93.843  -40.200 373.958 1.00 40.73  ? 90   ARG B NH2 1 
ATOM   4830 N N   . GLU B 1 90  ? 87.932  -35.789 370.047 1.00 26.90  ? 91   GLU B N   1 
ATOM   4831 C CA  . GLU B 1 90  ? 86.911  -34.915 369.487 1.00 28.57  ? 91   GLU B CA  1 
ATOM   4832 C C   . GLU B 1 90  ? 87.525  -33.959 368.472 1.00 29.22  ? 91   GLU B C   1 
ATOM   4833 O O   . GLU B 1 90  ? 88.681  -33.536 368.600 1.00 25.73  ? 91   GLU B O   1 
ATOM   4834 C CB  . GLU B 1 90  ? 86.206  -34.132 370.593 1.00 33.98  ? 91   GLU B CB  1 
ATOM   4835 C CG  . GLU B 1 90  ? 84.700  -34.039 370.410 1.00 64.75  ? 91   GLU B CG  1 
ATOM   4836 C CD  . GLU B 1 90  ? 84.079  -35.374 370.038 1.00 80.61  ? 91   GLU B CD  1 
ATOM   4837 O OE1 . GLU B 1 90  ? 83.627  -35.521 368.884 1.00 81.90  ? 91   GLU B OE1 1 
ATOM   4838 O OE2 . GLU B 1 90  ? 84.043  -36.276 370.901 1.00 81.67  ? 91   GLU B OE2 1 
ATOM   4839 N N   . LEU B 1 91  ? 86.750  -33.630 367.442 1.00 21.57  ? 92   LEU B N   1 
ATOM   4840 C CA  . LEU B 1 91  ? 87.222  -32.723 366.409 1.00 25.15  ? 92   LEU B CA  1 
ATOM   4841 C C   . LEU B 1 91  ? 87.087  -31.277 366.851 1.00 25.24  ? 92   LEU B C   1 
ATOM   4842 O O   . LEU B 1 91  ? 86.129  -30.901 367.536 1.00 24.18  ? 92   LEU B O   1 
ATOM   4843 C CB  . LEU B 1 91  ? 86.473  -32.936 365.096 1.00 27.98  ? 92   LEU B CB  1 
ATOM   4844 C CG  . LEU B 1 91  ? 86.164  -34.366 364.665 1.00 28.63  ? 92   LEU B CG  1 
ATOM   4845 C CD1 . LEU B 1 91  ? 85.132  -34.346 363.554 1.00 23.99  ? 92   LEU B CD1 1 
ATOM   4846 C CD2 . LEU B 1 91  ? 87.434  -35.062 364.218 1.00 26.71  ? 92   LEU B CD2 1 
ATOM   4847 N N   . SER B 1 92  ? 88.055  -30.459 366.452 1.00 22.65  ? 93   SER B N   1 
ATOM   4848 C CA  . SER B 1 92  ? 88.055  -29.043 366.771 1.00 21.07  ? 93   SER B CA  1 
ATOM   4849 C C   . SER B 1 92  ? 88.966  -28.336 365.784 1.00 21.98  ? 93   SER B C   1 
ATOM   4850 O O   . SER B 1 92  ? 89.914  -28.929 365.262 1.00 24.31  ? 93   SER B O   1 
ATOM   4851 C CB  . SER B 1 92  ? 88.520  -28.787 368.210 1.00 19.04  ? 93   SER B CB  1 
ATOM   4852 O OG  . SER B 1 92  ? 88.671  -27.402 368.461 1.00 29.17  ? 93   SER B OG  1 
ATOM   4853 N N   . GLU B 1 93  ? 88.654  -27.069 365.517 1.00 24.40  ? 94   GLU B N   1 
ATOM   4854 C CA  . GLU B 1 93  ? 89.580  -26.237 364.762 1.00 27.87  ? 94   GLU B CA  1 
ATOM   4855 C C   . GLU B 1 93  ? 90.773  -25.818 365.606 1.00 25.63  ? 94   GLU B C   1 
ATOM   4856 O O   . GLU B 1 93  ? 91.837  -25.522 365.054 1.00 31.38  ? 94   GLU B O   1 
ATOM   4857 C CB  . GLU B 1 93  ? 88.865  -25.003 364.217 1.00 22.00  ? 94   GLU B CB  1 
ATOM   4858 C CG  . GLU B 1 93  ? 88.043  -25.267 362.973 1.00 26.26  ? 94   GLU B CG  1 
ATOM   4859 C CD  . GLU B 1 93  ? 87.327  -24.027 362.489 1.00 28.89  ? 94   GLU B CD  1 
ATOM   4860 O OE1 . GLU B 1 93  ? 87.831  -23.385 361.544 1.00 20.91  ? 94   GLU B OE1 1 
ATOM   4861 O OE2 . GLU B 1 93  ? 86.266  -23.690 363.056 1.00 24.97  ? 94   GLU B OE2 1 
ATOM   4862 N N   . ASP B 1 94  ? 90.614  -25.779 366.928 1.00 24.67  ? 95   ASP B N   1 
ATOM   4863 C CA  . ASP B 1 94  ? 91.722  -25.549 367.853 1.00 24.61  ? 95   ASP B CA  1 
ATOM   4864 C C   . ASP B 1 94  ? 92.442  -26.884 367.991 1.00 21.04  ? 95   ASP B C   1 
ATOM   4865 O O   . ASP B 1 94  ? 92.197  -27.675 368.906 1.00 18.40  ? 95   ASP B O   1 
ATOM   4866 C CB  . ASP B 1 94  ? 91.200  -25.016 369.184 1.00 23.09  ? 95   ASP B CB  1 
ATOM   4867 C CG  . ASP B 1 94  ? 92.289  -24.835 370.239 1.00 31.60  ? 95   ASP B CG  1 
ATOM   4868 O OD1 . ASP B 1 94  ? 93.421  -25.330 370.062 1.00 31.83  ? 95   ASP B OD1 1 
ATOM   4869 O OD2 . ASP B 1 94  ? 92.009  -24.165 371.256 1.00 35.27  ? 95   ASP B OD2 1 
ATOM   4870 N N   . CYS B 1 95  ? 93.337  -27.153 367.043 1.00 23.50  ? 96   CYS B N   1 
ATOM   4871 C CA  . CYS B 1 95  ? 93.949  -28.471 366.987 1.00 22.04  ? 96   CYS B CA  1 
ATOM   4872 C C   . CYS B 1 95  ? 95.456  -28.428 366.784 1.00 19.27  ? 96   CYS B C   1 
ATOM   4873 O O   . CYS B 1 95  ? 96.065  -29.488 366.603 1.00 19.39  ? 96   CYS B O   1 
ATOM   4874 C CB  . CYS B 1 95  ? 93.347  -29.308 365.849 1.00 23.53  ? 96   CYS B CB  1 
ATOM   4875 S SG  . CYS B 1 95  ? 93.304  -28.482 364.242 1.00 23.40  ? 96   CYS B SG  1 
ATOM   4876 N N   . LEU B 1 96  ? 96.070  -27.246 366.769 1.00 15.41  ? 97   LEU B N   1 
ATOM   4877 C CA  . LEU B 1 96  ? 97.489  -27.110 366.443 1.00 21.37  ? 97   LEU B CA  1 
ATOM   4878 C C   . LEU B 1 96  ? 98.314  -27.401 367.694 1.00 21.93  ? 97   LEU B C   1 
ATOM   4879 O O   . LEU B 1 96  ? 98.799  -26.509 368.395 1.00 19.16  ? 97   LEU B O   1 
ATOM   4880 C CB  . LEU B 1 96  ? 97.772  -25.728 365.868 1.00 18.98  ? 97   LEU B CB  1 
ATOM   4881 C CG  . LEU B 1 96  ? 97.086  -25.513 364.513 1.00 24.71  ? 97   LEU B CG  1 
ATOM   4882 C CD1 . LEU B 1 96  ? 97.606  -24.270 363.806 1.00 23.37  ? 97   LEU B CD1 1 
ATOM   4883 C CD2 . LEU B 1 96  ? 97.253  -26.742 363.627 1.00 16.81  ? 97   LEU B CD2 1 
ATOM   4884 N N   . TYR B 1 97  ? 98.468  -28.693 367.971 1.00 22.03  ? 98   TYR B N   1 
ATOM   4885 C CA  . TYR B 1 97  ? 99.263  -29.184 369.085 1.00 22.28  ? 98   TYR B CA  1 
ATOM   4886 C C   . TYR B 1 97  ? 100.233 -30.235 368.569 1.00 18.28  ? 98   TYR B C   1 
ATOM   4887 O O   . TYR B 1 97  ? 100.020 -30.841 367.516 1.00 18.09  ? 98   TYR B O   1 
ATOM   4888 C CB  . TYR B 1 97  ? 98.379  -29.772 370.196 1.00 17.81  ? 98   TYR B CB  1 
ATOM   4889 C CG  . TYR B 1 97  ? 97.373  -28.787 370.739 1.00 20.77  ? 98   TYR B CG  1 
ATOM   4890 C CD1 . TYR B 1 97  ? 97.626  -28.079 371.905 1.00 21.54  ? 98   TYR B CD1 1 
ATOM   4891 C CD2 . TYR B 1 97  ? 96.173  -28.556 370.079 1.00 20.37  ? 98   TYR B CD2 1 
ATOM   4892 C CE1 . TYR B 1 97  ? 96.714  -27.170 372.400 1.00 23.59  ? 98   TYR B CE1 1 
ATOM   4893 C CE2 . TYR B 1 97  ? 95.257  -27.652 370.565 1.00 23.77  ? 98   TYR B CE2 1 
ATOM   4894 C CZ  . TYR B 1 97  ? 95.531  -26.960 371.726 1.00 26.09  ? 98   TYR B CZ  1 
ATOM   4895 O OH  . TYR B 1 97  ? 94.617  -26.055 372.214 1.00 21.20  ? 98   TYR B OH  1 
ATOM   4896 N N   . LEU B 1 98  ? 101.311 -30.442 369.319 1.00 18.07  ? 99   LEU B N   1 
ATOM   4897 C CA  . LEU B 1 98  ? 102.309 -31.442 368.976 1.00 19.00  ? 99   LEU B CA  1 
ATOM   4898 C C   . LEU B 1 98  ? 102.668 -32.251 370.217 1.00 17.89  ? 99   LEU B C   1 
ATOM   4899 O O   . LEU B 1 98  ? 102.313 -31.896 371.344 1.00 19.38  ? 99   LEU B O   1 
ATOM   4900 C CB  . LEU B 1 98  ? 103.559 -30.800 368.346 1.00 18.36  ? 99   LEU B CB  1 
ATOM   4901 C CG  . LEU B 1 98  ? 104.308 -29.666 369.052 1.00 19.94  ? 99   LEU B CG  1 
ATOM   4902 C CD1 . LEU B 1 98  ? 105.219 -30.187 370.154 1.00 14.97  ? 99   LEU B CD1 1 
ATOM   4903 C CD2 . LEU B 1 98  ? 105.111 -28.864 368.038 1.00 14.42  ? 99   LEU B CD2 1 
ATOM   4904 N N   . ASN B 1 99  ? 103.385 -33.351 369.997 1.00 15.31  ? 100  ASN B N   1 
ATOM   4905 C CA  . ASN B 1 99  ? 103.694 -34.311 371.048 1.00 16.77  ? 100  ASN B CA  1 
ATOM   4906 C C   . ASN B 1 99  ? 105.171 -34.674 371.007 1.00 17.96  ? 100  ASN B C   1 
ATOM   4907 O O   . ASN B 1 99  ? 105.764 -34.771 369.930 1.00 21.19  ? 100  ASN B O   1 
ATOM   4908 C CB  . ASN B 1 99  ? 102.843 -35.576 370.896 1.00 16.08  ? 100  ASN B CB  1 
ATOM   4909 C CG  . ASN B 1 99  ? 101.420 -35.271 370.474 1.00 18.90  ? 100  ASN B CG  1 
ATOM   4910 O OD1 . ASN B 1 99  ? 100.617 -34.773 371.266 1.00 18.79  ? 100  ASN B OD1 1 
ATOM   4911 N ND2 . ASN B 1 99  ? 101.101 -35.561 369.218 1.00 14.43  ? 100  ASN B ND2 1 
ATOM   4912 N N   . VAL B 1 100 ? 105.757 -34.879 372.186 1.00 16.34  ? 101  VAL B N   1 
ATOM   4913 C CA  . VAL B 1 100 ? 107.168 -35.229 372.320 1.00 20.62  ? 101  VAL B CA  1 
ATOM   4914 C C   . VAL B 1 100 ? 107.280 -36.454 373.219 1.00 24.48  ? 101  VAL B C   1 
ATOM   4915 O O   . VAL B 1 100 ? 106.786 -36.443 374.354 1.00 26.99  ? 101  VAL B O   1 
ATOM   4916 C CB  . VAL B 1 100 ? 108.004 -34.070 372.892 1.00 20.85  ? 101  VAL B CB  1 
ATOM   4917 C CG1 . VAL B 1 100 ? 109.480 -34.438 372.909 1.00 16.33  ? 101  VAL B CG1 1 
ATOM   4918 C CG2 . VAL B 1 100 ? 107.779 -32.795 372.092 1.00 15.74  ? 101  VAL B CG2 1 
ATOM   4919 N N   . TRP B 1 101 ? 107.920 -37.506 372.712 1.00 21.20  ? 102  TRP B N   1 
ATOM   4920 C CA  . TRP B 1 101 ? 108.326 -38.661 373.502 1.00 17.65  ? 102  TRP B CA  1 
ATOM   4921 C C   . TRP B 1 101 ? 109.844 -38.651 373.644 1.00 19.32  ? 102  TRP B C   1 
ATOM   4922 O O   . TRP B 1 101 ? 110.561 -38.412 372.667 1.00 22.20  ? 102  TRP B O   1 
ATOM   4923 C CB  . TRP B 1 101 ? 107.899 -39.983 372.848 1.00 17.33  ? 102  TRP B CB  1 
ATOM   4924 C CG  . TRP B 1 101 ? 106.426 -40.304 372.832 1.00 20.51  ? 102  TRP B CG  1 
ATOM   4925 C CD1 . TRP B 1 101 ? 105.729 -41.014 373.769 1.00 28.56  ? 102  TRP B CD1 1 
ATOM   4926 C CD2 . TRP B 1 101 ? 105.488 -39.983 371.796 1.00 15.94  ? 102  TRP B CD2 1 
ATOM   4927 N NE1 . TRP B 1 101 ? 104.412 -41.131 373.393 1.00 20.35  ? 102  TRP B NE1 1 
ATOM   4928 C CE2 . TRP B 1 101 ? 104.238 -40.507 372.186 1.00 18.27  ? 102  TRP B CE2 1 
ATOM   4929 C CE3 . TRP B 1 101 ? 105.580 -39.291 370.586 1.00 20.32  ? 102  TRP B CE3 1 
ATOM   4930 C CZ2 . TRP B 1 101 ? 103.091 -40.359 371.408 1.00 19.79  ? 102  TRP B CZ2 1 
ATOM   4931 C CZ3 . TRP B 1 101 ? 104.440 -39.147 369.814 1.00 26.25  ? 102  TRP B CZ3 1 
ATOM   4932 C CH2 . TRP B 1 101 ? 103.213 -39.678 370.228 1.00 21.67  ? 102  TRP B CH2 1 
ATOM   4933 N N   . THR B 1 102 ? 110.332 -38.904 374.853 1.00 20.23  ? 103  THR B N   1 
ATOM   4934 C CA  . THR B 1 102 ? 111.758 -39.004 375.132 1.00 24.43  ? 103  THR B CA  1 
ATOM   4935 C C   . THR B 1 102 ? 111.984 -40.167 376.083 1.00 25.30  ? 103  THR B C   1 
ATOM   4936 O O   . THR B 1 102 ? 111.045 -40.627 376.741 1.00 25.20  ? 103  THR B O   1 
ATOM   4937 C CB  . THR B 1 102 ? 112.327 -37.722 375.761 1.00 28.44  ? 103  THR B CB  1 
ATOM   4938 O OG1 . THR B 1 102 ? 111.793 -37.557 377.080 1.00 37.79  ? 103  THR B OG1 1 
ATOM   4939 C CG2 . THR B 1 102 ? 111.999 -36.497 374.921 1.00 34.05  ? 103  THR B CG2 1 
ATOM   4940 N N   . PRO B 1 103 ? 113.214 -40.680 376.165 1.00 22.10  ? 104  PRO B N   1 
ATOM   4941 C CA  . PRO B 1 103 ? 113.513 -41.696 377.179 1.00 25.59  ? 104  PRO B CA  1 
ATOM   4942 C C   . PRO B 1 103 ? 113.275 -41.171 378.588 1.00 26.93  ? 104  PRO B C   1 
ATOM   4943 O O   . PRO B 1 103 ? 113.275 -39.965 378.843 1.00 35.12  ? 104  PRO B O   1 
ATOM   4944 C CB  . PRO B 1 103 ? 114.996 -42.006 376.944 1.00 23.88  ? 104  PRO B CB  1 
ATOM   4945 C CG  . PRO B 1 103 ? 115.195 -41.726 375.496 1.00 23.42  ? 104  PRO B CG  1 
ATOM   4946 C CD  . PRO B 1 103 ? 114.323 -40.530 375.204 1.00 22.20  ? 104  PRO B CD  1 
ATOM   4947 N N   . TYR B 1 104 ? 113.055 -42.108 379.511 1.00 29.12  ? 105  TYR B N   1 
ATOM   4948 C CA  . TYR B 1 104 ? 112.941 -41.799 380.930 1.00 28.66  ? 105  TYR B CA  1 
ATOM   4949 C C   . TYR B 1 104 ? 114.103 -42.448 381.667 1.00 36.30  ? 105  TYR B C   1 
ATOM   4950 O O   . TYR B 1 104 ? 114.266 -43.674 381.584 1.00 33.09  ? 105  TYR B O   1 
ATOM   4951 C CB  . TYR B 1 104 ? 111.607 -42.286 381.499 1.00 30.21  ? 105  TYR B CB  1 
ATOM   4952 C CG  . TYR B 1 104 ? 111.332 -41.828 382.919 1.00 30.72  ? 105  TYR B CG  1 
ATOM   4953 C CD1 . TYR B 1 104 ? 111.901 -42.483 384.006 1.00 28.28  ? 105  TYR B CD1 1 
ATOM   4954 C CD2 . TYR B 1 104 ? 110.501 -40.743 383.173 1.00 32.07  ? 105  TYR B CD2 1 
ATOM   4955 C CE1 . TYR B 1 104 ? 111.655 -42.069 385.301 1.00 28.80  ? 105  TYR B CE1 1 
ATOM   4956 C CE2 . TYR B 1 104 ? 110.247 -40.322 384.468 1.00 29.82  ? 105  TYR B CE2 1 
ATOM   4957 C CZ  . TYR B 1 104 ? 110.828 -40.991 385.527 1.00 33.39  ? 105  TYR B CZ  1 
ATOM   4958 O OH  . TYR B 1 104 ? 110.585 -40.583 386.818 1.00 36.05  ? 105  TYR B OH  1 
ATOM   4959 N N   . PRO B 1 105 ? 114.940 -41.686 382.390 1.00 36.55  ? 106  PRO B N   1 
ATOM   4960 C CA  . PRO B 1 105 ? 114.826 -40.235 382.560 1.00 37.83  ? 106  PRO B CA  1 
ATOM   4961 C C   . PRO B 1 105 ? 115.221 -39.491 381.292 1.00 35.54  ? 106  PRO B C   1 
ATOM   4962 O O   . PRO B 1 105 ? 115.873 -40.090 380.436 1.00 32.21  ? 106  PRO B O   1 
ATOM   4963 C CB  . PRO B 1 105 ? 115.803 -39.946 383.698 1.00 35.25  ? 106  PRO B CB  1 
ATOM   4964 C CG  . PRO B 1 105 ? 116.868 -40.966 383.516 1.00 34.35  ? 106  PRO B CG  1 
ATOM   4965 C CD  . PRO B 1 105 ? 116.176 -42.209 383.001 1.00 35.24  ? 106  PRO B CD  1 
ATOM   4966 N N   . ARG B 1 106 ? 114.819 -38.231 381.175 1.00 40.58  ? 107  ARG B N   1 
ATOM   4967 C CA  . ARG B 1 106 ? 115.084 -37.473 379.961 1.00 43.04  ? 107  ARG B CA  1 
ATOM   4968 C C   . ARG B 1 106 ? 116.577 -37.503 379.642 1.00 39.14  ? 107  ARG B C   1 
ATOM   4969 O O   . ARG B 1 106 ? 117.407 -37.461 380.560 1.00 45.34  ? 107  ARG B O   1 
ATOM   4970 C CB  . ARG B 1 106 ? 114.604 -36.028 380.118 1.00 41.48  ? 107  ARG B CB  1 
ATOM   4971 C CG  . ARG B 1 106 ? 113.134 -35.901 380.481 1.00 43.94  ? 107  ARG B CG  1 
ATOM   4972 C CD  . ARG B 1 106 ? 112.546 -34.604 379.950 1.00 44.96  ? 107  ARG B CD  1 
ATOM   4973 N NE  . ARG B 1 106 ? 113.473 -33.485 380.097 1.00 49.03  ? 107  ARG B NE  1 
ATOM   4974 C CZ  . ARG B 1 106 ? 113.449 -32.624 381.109 1.00 52.38  ? 107  ARG B CZ  1 
ATOM   4975 N NH1 . ARG B 1 106 ? 112.545 -32.753 382.071 1.00 51.50  ? 107  ARG B NH1 1 
ATOM   4976 N NH2 . ARG B 1 106 ? 114.330 -31.634 381.162 1.00 58.05  ? 107  ARG B NH2 1 
ATOM   4977 N N   . PRO B 1 107 ? 116.955 -37.598 378.368 1.00 37.82  ? 108  PRO B N   1 
ATOM   4978 C CA  . PRO B 1 107 ? 118.380 -37.638 378.031 1.00 40.94  ? 108  PRO B CA  1 
ATOM   4979 C C   . PRO B 1 107 ? 119.078 -36.361 378.464 1.00 44.66  ? 108  PRO B C   1 
ATOM   4980 O O   . PRO B 1 107 ? 118.505 -35.269 378.437 1.00 46.57  ? 108  PRO B O   1 
ATOM   4981 C CB  . PRO B 1 107 ? 118.387 -37.786 376.504 1.00 35.61  ? 108  PRO B CB  1 
ATOM   4982 C CG  . PRO B 1 107 ? 117.013 -38.240 376.140 1.00 35.81  ? 108  PRO B CG  1 
ATOM   4983 C CD  . PRO B 1 107 ? 116.097 -37.672 377.175 1.00 32.79  ? 108  PRO B CD  1 
ATOM   4984 N N   . THR B 1 108 ? 120.330 -36.512 378.886 1.00 48.32  ? 109  THR B N   1 
ATOM   4985 C CA  . THR B 1 108 ? 121.155 -35.372 379.249 1.00 55.71  ? 109  THR B CA  1 
ATOM   4986 C C   . THR B 1 108 ? 122.158 -35.007 378.164 1.00 57.24  ? 109  THR B C   1 
ATOM   4987 O O   . THR B 1 108 ? 122.753 -33.927 378.233 1.00 60.29  ? 109  THR B O   1 
ATOM   4988 C CB  . THR B 1 108 ? 121.885 -35.644 380.569 1.00 50.39  ? 109  THR B CB  1 
ATOM   4989 O OG1 . THR B 1 108 ? 122.555 -36.909 380.501 1.00 54.56  ? 109  THR B OG1 1 
ATOM   4990 C CG2 . THR B 1 108 ? 120.899 -35.656 381.730 1.00 44.27  ? 109  THR B CG2 1 
ATOM   4991 N N   . SER B 1 109 ? 122.358 -35.882 377.166 1.00 54.47  ? 110  SER B N   1 
ATOM   4992 C CA  . SER B 1 109 ? 123.125 -35.618 375.960 1.00 51.65  ? 110  SER B CA  1 
ATOM   4993 C C   . SER B 1 109 ? 122.189 -35.475 374.767 1.00 46.61  ? 110  SER B C   1 
ATOM   4994 O O   . SER B 1 109 ? 121.157 -36.154 374.710 1.00 37.36  ? 110  SER B O   1 
ATOM   4995 C CB  . SER B 1 109 ? 124.133 -36.738 375.671 1.00 53.69  ? 110  SER B CB  1 
ATOM   4996 O OG  . SER B 1 109 ? 124.709 -37.240 376.862 1.00 74.20  ? 110  SER B OG  1 
ATOM   4997 N N   . PRO B 1 110 ? 122.513 -34.601 373.816 1.00 47.48  ? 111  PRO B N   1 
ATOM   4998 C CA  . PRO B 1 110 ? 121.656 -34.431 372.636 1.00 44.32  ? 111  PRO B CA  1 
ATOM   4999 C C   . PRO B 1 110 ? 121.400 -35.750 371.923 1.00 45.77  ? 111  PRO B C   1 
ATOM   5000 O O   . PRO B 1 110 ? 122.326 -36.477 371.556 1.00 46.91  ? 111  PRO B O   1 
ATOM   5001 C CB  . PRO B 1 110 ? 122.450 -33.453 371.758 1.00 41.44  ? 111  PRO B CB  1 
ATOM   5002 C CG  . PRO B 1 110 ? 123.815 -33.357 372.379 1.00 50.53  ? 111  PRO B CG  1 
ATOM   5003 C CD  . PRO B 1 110 ? 123.620 -33.636 373.827 1.00 46.35  ? 111  PRO B CD  1 
ATOM   5004 N N   . THR B 1 111 ? 120.125 -36.053 371.736 1.00 38.56  ? 112  THR B N   1 
ATOM   5005 C CA  . THR B 1 111 ? 119.566 -37.270 371.185 1.00 38.14  ? 112  THR B CA  1 
ATOM   5006 C C   . THR B 1 111 ? 118.953 -36.999 369.814 1.00 35.68  ? 112  THR B C   1 
ATOM   5007 O O   . THR B 1 111 ? 118.271 -35.983 369.638 1.00 28.33  ? 112  THR B O   1 
ATOM   5008 C CB  . THR B 1 111 ? 118.493 -37.821 372.134 1.00 40.64  ? 112  THR B CB  1 
ATOM   5009 O OG1 . THR B 1 111 ? 119.085 -38.101 373.409 1.00 42.65  ? 112  THR B OG1 1 
ATOM   5010 C CG2 . THR B 1 111 ? 117.879 -39.083 371.592 1.00 36.80  ? 112  THR B CG2 1 
ATOM   5011 N N   . PRO B 1 112 ? 119.193 -37.863 368.824 1.00 40.71  ? 113  PRO B N   1 
ATOM   5012 C CA  . PRO B 1 112 ? 118.600 -37.642 367.498 1.00 32.21  ? 113  PRO B CA  1 
ATOM   5013 C C   . PRO B 1 112 ? 117.082 -37.570 367.568 1.00 24.30  ? 113  PRO B C   1 
ATOM   5014 O O   . PRO B 1 112 ? 116.442 -38.230 368.390 1.00 24.77  ? 113  PRO B O   1 
ATOM   5015 C CB  . PRO B 1 112 ? 119.070 -38.857 366.687 1.00 36.60  ? 113  PRO B CB  1 
ATOM   5016 C CG  . PRO B 1 112 ? 119.509 -39.866 367.708 1.00 40.14  ? 113  PRO B CG  1 
ATOM   5017 C CD  . PRO B 1 112 ? 120.052 -39.058 368.845 1.00 42.71  ? 113  PRO B CD  1 
ATOM   5018 N N   . VAL B 1 113 ? 116.509 -36.748 366.693 1.00 23.11  ? 114  VAL B N   1 
ATOM   5019 C CA  . VAL B 1 113 ? 115.088 -36.426 366.716 1.00 19.24  ? 114  VAL B CA  1 
ATOM   5020 C C   . VAL B 1 113 ? 114.429 -36.987 365.465 1.00 21.66  ? 114  VAL B C   1 
ATOM   5021 O O   . VAL B 1 113 ? 114.927 -36.794 364.349 1.00 21.76  ? 114  VAL B O   1 
ATOM   5022 C CB  . VAL B 1 113 ? 114.858 -34.907 366.814 1.00 22.35  ? 114  VAL B CB  1 
ATOM   5023 C CG1 . VAL B 1 113 ? 113.370 -34.597 366.882 1.00 17.88  ? 114  VAL B CG1 1 
ATOM   5024 C CG2 . VAL B 1 113 ? 115.586 -34.336 368.022 1.00 18.90  ? 114  VAL B CG2 1 
ATOM   5025 N N   . LEU B 1 114 ? 113.310 -37.680 365.655 1.00 19.28  ? 115  LEU B N   1 
ATOM   5026 C CA  . LEU B 1 114 ? 112.435 -38.101 364.571 1.00 18.47  ? 115  LEU B CA  1 
ATOM   5027 C C   . LEU B 1 114 ? 111.167 -37.261 364.623 1.00 19.54  ? 115  LEU B C   1 
ATOM   5028 O O   . LEU B 1 114 ? 110.580 -37.089 365.696 1.00 19.71  ? 115  LEU B O   1 
ATOM   5029 C CB  . LEU B 1 114 ? 112.092 -39.588 364.689 1.00 21.81  ? 115  LEU B CB  1 
ATOM   5030 C CG  . LEU B 1 114 ? 113.139 -40.580 364.184 1.00 32.37  ? 115  LEU B CG  1 
ATOM   5031 C CD1 . LEU B 1 114 ? 112.917 -41.953 364.792 1.00 33.33  ? 115  LEU B CD1 1 
ATOM   5032 C CD2 . LEU B 1 114 ? 113.103 -40.655 362.666 1.00 37.74  ? 115  LEU B CD2 1 
ATOM   5033 N N   . VAL B 1 115 ? 110.750 -36.733 363.475 1.00 16.48  ? 116  VAL B N   1 
ATOM   5034 C CA  . VAL B 1 115 ? 109.534 -35.931 363.381 1.00 18.34  ? 116  VAL B CA  1 
ATOM   5035 C C   . VAL B 1 115 ? 108.583 -36.624 362.415 1.00 14.74  ? 116  VAL B C   1 
ATOM   5036 O O   . VAL B 1 115 ? 108.900 -36.784 361.229 1.00 17.66  ? 116  VAL B O   1 
ATOM   5037 C CB  . VAL B 1 115 ? 109.820 -34.488 362.941 1.00 18.42  ? 116  VAL B CB  1 
ATOM   5038 C CG1 . VAL B 1 115 ? 108.514 -33.767 362.653 1.00 15.52  ? 116  VAL B CG1 1 
ATOM   5039 C CG2 . VAL B 1 115 ? 110.601 -33.757 364.017 1.00 18.62  ? 116  VAL B CG2 1 
ATOM   5040 N N   . TRP B 1 116 ? 107.424 -37.036 362.924 1.00 16.37  ? 117  TRP B N   1 
ATOM   5041 C CA  . TRP B 1 116 ? 106.440 -37.791 362.159 1.00 14.84  ? 117  TRP B CA  1 
ATOM   5042 C C   . TRP B 1 116 ? 105.364 -36.857 361.622 1.00 21.13  ? 117  TRP B C   1 
ATOM   5043 O O   . TRP B 1 116 ? 104.824 -36.031 362.365 1.00 14.14  ? 117  TRP B O   1 
ATOM   5044 C CB  . TRP B 1 116 ? 105.803 -38.880 363.024 1.00 15.43  ? 117  TRP B CB  1 
ATOM   5045 C CG  . TRP B 1 116 ? 104.654 -39.576 362.367 1.00 19.54  ? 117  TRP B CG  1 
ATOM   5046 C CD1 . TRP B 1 116 ? 103.330 -39.436 362.664 1.00 16.02  ? 117  TRP B CD1 1 
ATOM   5047 C CD2 . TRP B 1 116 ? 104.726 -40.525 361.297 1.00 14.84  ? 117  TRP B CD2 1 
ATOM   5048 N NE1 . TRP B 1 116 ? 102.573 -40.239 361.845 1.00 17.95  ? 117  TRP B NE1 1 
ATOM   5049 C CE2 . TRP B 1 116 ? 103.408 -40.918 360.997 1.00 15.76  ? 117  TRP B CE2 1 
ATOM   5050 C CE3 . TRP B 1 116 ? 105.778 -41.078 360.564 1.00 13.50  ? 117  TRP B CE3 1 
ATOM   5051 C CZ2 . TRP B 1 116 ? 103.115 -41.843 359.996 1.00 14.74  ? 117  TRP B CZ2 1 
ATOM   5052 C CZ3 . TRP B 1 116 ? 105.488 -41.996 359.573 1.00 18.68  ? 117  TRP B CZ3 1 
ATOM   5053 C CH2 . TRP B 1 116 ? 104.167 -42.369 359.296 1.00 19.02  ? 117  TRP B CH2 1 
ATOM   5054 N N   . ILE B 1 117 ? 105.056 -36.997 360.335 1.00 15.70  ? 118  ILE B N   1 
ATOM   5055 C CA  . ILE B 1 117 ? 103.978 -36.264 359.678 1.00 15.33  ? 118  ILE B CA  1 
ATOM   5056 C C   . ILE B 1 117 ? 102.987 -37.298 359.163 1.00 14.73  ? 118  ILE B C   1 
ATOM   5057 O O   . ILE B 1 117 ? 103.317 -38.086 358.268 1.00 16.75  ? 118  ILE B O   1 
ATOM   5058 C CB  . ILE B 1 117 ? 104.493 -35.380 358.534 1.00 18.81  ? 118  ILE B CB  1 
ATOM   5059 C CG1 . ILE B 1 117 ? 105.611 -34.456 359.024 1.00 16.15  ? 118  ILE B CG1 1 
ATOM   5060 C CG2 . ILE B 1 117 ? 103.349 -34.585 357.919 1.00 15.25  ? 118  ILE B CG2 1 
ATOM   5061 C CD1 . ILE B 1 117 ? 106.132 -33.512 357.954 1.00 15.37  ? 118  ILE B CD1 1 
ATOM   5062 N N   . TYR B 1 118 ? 101.777 -37.301 359.716 1.00 14.65  ? 119  TYR B N   1 
ATOM   5063 C CA  . TYR B 1 118 ? 100.810 -38.327 359.351 1.00 19.73  ? 119  TYR B CA  1 
ATOM   5064 C C   . TYR B 1 118 ? 100.260 -38.095 357.948 1.00 18.62  ? 119  TYR B C   1 
ATOM   5065 O O   . TYR B 1 118 ? 100.247 -36.974 357.434 1.00 12.32  ? 119  TYR B O   1 
ATOM   5066 C CB  . TYR B 1 118 ? 99.656  -38.382 360.360 1.00 18.69  ? 119  TYR B CB  1 
ATOM   5067 C CG  . TYR B 1 118 ? 98.900  -37.083 360.583 1.00 20.96  ? 119  TYR B CG  1 
ATOM   5068 C CD1 . TYR B 1 118 ? 98.009  -36.591 359.633 1.00 18.52  ? 119  TYR B CD1 1 
ATOM   5069 C CD2 . TYR B 1 118 ? 99.053  -36.368 361.763 1.00 17.26  ? 119  TYR B CD2 1 
ATOM   5070 C CE1 . TYR B 1 118 ? 97.311  -35.414 359.846 1.00 14.18  ? 119  TYR B CE1 1 
ATOM   5071 C CE2 . TYR B 1 118 ? 98.360  -35.191 361.985 1.00 14.90  ? 119  TYR B CE2 1 
ATOM   5072 C CZ  . TYR B 1 118 ? 97.493  -34.718 361.023 1.00 18.89  ? 119  TYR B CZ  1 
ATOM   5073 O OH  . TYR B 1 118 ? 96.806  -33.546 361.246 1.00 19.01  ? 119  TYR B OH  1 
ATOM   5074 N N   . GLY B 1 119 ? 99.802  -39.182 357.331 1.00 16.99  ? 120  GLY B N   1 
ATOM   5075 C CA  . GLY B 1 119 ? 99.099  -39.117 356.069 1.00 18.45  ? 120  GLY B CA  1 
ATOM   5076 C C   . GLY B 1 119 ? 97.597  -39.047 356.263 1.00 22.81  ? 120  GLY B C   1 
ATOM   5077 O O   . GLY B 1 119 ? 97.086  -38.842 357.366 1.00 26.00  ? 120  GLY B O   1 
ATOM   5078 N N   . GLY B 1 120 ? 96.881  -39.229 355.158 1.00 20.00  ? 121  GLY B N   1 
ATOM   5079 C CA  . GLY B 1 120 ? 95.435  -39.133 355.172 1.00 13.96  ? 121  GLY B CA  1 
ATOM   5080 C C   . GLY B 1 120 ? 94.891  -38.293 354.034 1.00 17.28  ? 121  GLY B C   1 
ATOM   5081 O O   . GLY B 1 120 ? 93.854  -37.637 354.176 1.00 18.52  ? 121  GLY B O   1 
ATOM   5082 N N   . GLY B 1 121 ? 95.599  -38.294 352.905 1.00 18.21  ? 122  GLY B N   1 
ATOM   5083 C CA  . GLY B 1 121 ? 95.139  -37.614 351.707 1.00 17.03  ? 122  GLY B CA  1 
ATOM   5084 C C   . GLY B 1 121 ? 95.004  -36.113 351.822 1.00 17.67  ? 122  GLY B C   1 
ATOM   5085 O O   . GLY B 1 121 ? 94.323  -35.500 350.995 1.00 18.66  ? 122  GLY B O   1 
ATOM   5086 N N   . PHE B 1 122 ? 95.641  -35.500 352.819 1.00 14.33  ? 123  PHE B N   1 
ATOM   5087 C CA  . PHE B 1 122 ? 95.513  -34.081 353.146 1.00 15.73  ? 123  PHE B CA  1 
ATOM   5088 C C   . PHE B 1 122 ? 94.100  -33.698 353.575 1.00 20.31  ? 123  PHE B C   1 
ATOM   5089 O O   . PHE B 1 122 ? 93.802  -32.506 353.713 1.00 20.61  ? 123  PHE B O   1 
ATOM   5090 C CB  . PHE B 1 122 ? 95.959  -33.177 351.983 1.00 17.50  ? 123  PHE B CB  1 
ATOM   5091 C CG  . PHE B 1 122 ? 97.433  -33.243 351.682 1.00 15.99  ? 123  PHE B CG  1 
ATOM   5092 C CD1 . PHE B 1 122 ? 98.363  -32.726 352.571 1.00 19.71  ? 123  PHE B CD1 1 
ATOM   5093 C CD2 . PHE B 1 122 ? 97.885  -33.806 350.500 1.00 16.05  ? 123  PHE B CD2 1 
ATOM   5094 C CE1 . PHE B 1 122 ? 99.719  -32.781 352.289 1.00 19.63  ? 123  PHE B CE1 1 
ATOM   5095 C CE2 . PHE B 1 122 ? 99.238  -33.863 350.212 1.00 18.01  ? 123  PHE B CE2 1 
ATOM   5096 C CZ  . PHE B 1 122 ? 100.156 -33.348 351.108 1.00 15.03  ? 123  PHE B CZ  1 
ATOM   5097 N N   . TYR B 1 123 ? 93.216  -34.676 353.788 1.00 14.32  ? 124  TYR B N   1 
ATOM   5098 C CA  . TYR B 1 123 ? 91.865  -34.414 354.264 1.00 19.98  ? 124  TYR B CA  1 
ATOM   5099 C C   . TYR B 1 123 ? 91.575  -35.043 355.618 1.00 22.35  ? 124  TYR B C   1 
ATOM   5100 O O   . TYR B 1 123 ? 90.490  -34.816 356.166 1.00 21.48  ? 124  TYR B O   1 
ATOM   5101 C CB  . TYR B 1 123 ? 90.825  -34.907 353.244 1.00 15.53  ? 124  TYR B CB  1 
ATOM   5102 C CG  . TYR B 1 123 ? 90.639  -36.413 353.198 1.00 29.62  ? 124  TYR B CG  1 
ATOM   5103 C CD1 . TYR B 1 123 ? 89.744  -37.056 354.049 1.00 25.26  ? 124  TYR B CD1 1 
ATOM   5104 C CD2 . TYR B 1 123 ? 91.348  -37.190 352.290 1.00 26.17  ? 124  TYR B CD2 1 
ATOM   5105 C CE1 . TYR B 1 123 ? 89.576  -38.428 354.009 1.00 22.90  ? 124  TYR B CE1 1 
ATOM   5106 C CE2 . TYR B 1 123 ? 91.183  -38.563 352.241 1.00 23.79  ? 124  TYR B CE2 1 
ATOM   5107 C CZ  . TYR B 1 123 ? 90.296  -39.175 353.101 1.00 32.50  ? 124  TYR B CZ  1 
ATOM   5108 O OH  . TYR B 1 123 ? 90.130  -40.541 353.053 1.00 36.61  ? 124  TYR B OH  1 
ATOM   5109 N N   . SER B 1 124 ? 92.495  -35.830 356.167 1.00 19.39  ? 125  SER B N   1 
ATOM   5110 C CA  . SER B 1 124 ? 92.240  -36.554 357.405 1.00 20.56  ? 125  SER B CA  1 
ATOM   5111 C C   . SER B 1 124 ? 93.573  -36.870 358.070 1.00 19.14  ? 125  SER B C   1 
ATOM   5112 O O   . SER B 1 124 ? 94.645  -36.573 357.535 1.00 19.15  ? 125  SER B O   1 
ATOM   5113 C CB  . SER B 1 124 ? 91.433  -37.828 357.138 1.00 19.83  ? 125  SER B CB  1 
ATOM   5114 O OG  . SER B 1 124 ? 92.172  -38.741 356.345 1.00 22.98  ? 125  SER B OG  1 
ATOM   5115 N N   . GLY B 1 125 ? 93.495  -37.483 359.248 1.00 19.30  ? 126  GLY B N   1 
ATOM   5116 C CA  . GLY B 1 125 ? 94.683  -37.862 359.983 1.00 17.99  ? 126  GLY B CA  1 
ATOM   5117 C C   . GLY B 1 125 ? 94.802  -37.164 361.322 1.00 20.92  ? 126  GLY B C   1 
ATOM   5118 O O   . GLY B 1 125 ? 94.208  -36.103 361.534 1.00 19.37  ? 126  GLY B O   1 
ATOM   5119 N N   . ALA B 1 126 ? 95.575  -37.752 362.231 1.00 14.60  ? 127  ALA B N   1 
ATOM   5120 C CA  . ALA B 1 126 ? 95.771  -37.191 363.559 1.00 19.56  ? 127  ALA B CA  1 
ATOM   5121 C C   . ALA B 1 126 ? 97.024  -37.806 364.161 1.00 22.16  ? 127  ALA B C   1 
ATOM   5122 O O   . ALA B 1 126 ? 97.332  -38.975 363.918 1.00 17.63  ? 127  ALA B O   1 
ATOM   5123 C CB  . ALA B 1 126 ? 94.561  -37.449 364.464 1.00 14.89  ? 127  ALA B CB  1 
ATOM   5124 N N   . SER B 1 127 ? 97.748  -37.005 364.945 1.00 16.51  ? 128  SER B N   1 
ATOM   5125 C CA  . SER B 1 127 ? 98.937  -37.510 365.618 1.00 18.83  ? 128  SER B CA  1 
ATOM   5126 C C   . SER B 1 127 ? 98.608  -38.396 366.812 1.00 23.39  ? 128  SER B C   1 
ATOM   5127 O O   . SER B 1 127 ? 99.523  -38.995 367.387 1.00 20.30  ? 128  SER B O   1 
ATOM   5128 C CB  . SER B 1 127 ? 99.828  -36.351 366.076 1.00 20.44  ? 128  SER B CB  1 
ATOM   5129 O OG  . SER B 1 127 ? 99.157  -35.529 367.017 1.00 22.48  ? 128  SER B OG  1 
ATOM   5130 N N   . SER B 1 128 ? 97.335  -38.505 367.185 1.00 19.76  ? 129  SER B N   1 
ATOM   5131 C CA  . SER B 1 128 ? 96.923  -39.241 368.372 1.00 19.80  ? 129  SER B CA  1 
ATOM   5132 C C   . SER B 1 128 ? 96.510  -40.679 368.082 1.00 22.38  ? 129  SER B C   1 
ATOM   5133 O O   . SER B 1 128 ? 96.168  -41.405 369.022 1.00 19.68  ? 129  SER B O   1 
ATOM   5134 C CB  . SER B 1 128 ? 95.764  -38.515 369.060 1.00 20.74  ? 129  SER B CB  1 
ATOM   5135 O OG  . SER B 1 128 ? 94.706  -38.269 368.150 1.00 20.88  ? 129  SER B OG  1 
ATOM   5136 N N   . LEU B 1 129 ? 96.520  -41.108 366.821 1.00 23.66  ? 130  LEU B N   1 
ATOM   5137 C CA  . LEU B 1 129 ? 96.093  -42.464 366.502 1.00 23.33  ? 130  LEU B CA  1 
ATOM   5138 C C   . LEU B 1 129 ? 97.016  -43.488 367.151 1.00 26.53  ? 130  LEU B C   1 
ATOM   5139 O O   . LEU B 1 129 ? 98.225  -43.268 367.279 1.00 21.27  ? 130  LEU B O   1 
ATOM   5140 C CB  . LEU B 1 129 ? 96.046  -42.675 364.988 1.00 24.18  ? 130  LEU B CB  1 
ATOM   5141 C CG  . LEU B 1 129 ? 95.294  -41.622 364.170 1.00 25.63  ? 130  LEU B CG  1 
ATOM   5142 C CD1 . LEU B 1 129 ? 95.439  -41.906 362.687 1.00 23.45  ? 130  LEU B CD1 1 
ATOM   5143 C CD2 . LEU B 1 129 ? 93.827  -41.576 364.567 1.00 27.63  ? 130  LEU B CD2 1 
ATOM   5144 N N   . ASP B 1 130 ? 96.429  -44.615 367.568 1.00 21.91  ? 131  ASP B N   1 
ATOM   5145 C CA  . ASP B 1 130 ? 97.180  -45.638 368.291 1.00 26.45  ? 131  ASP B CA  1 
ATOM   5146 C C   . ASP B 1 130 ? 98.388  -46.115 367.496 1.00 25.63  ? 131  ASP B C   1 
ATOM   5147 O O   . ASP B 1 130 ? 99.443  -46.408 368.071 1.00 27.38  ? 131  ASP B O   1 
ATOM   5148 C CB  . ASP B 1 130 ? 96.270  -46.821 368.621 1.00 30.95  ? 131  ASP B CB  1 
ATOM   5149 C CG  . ASP B 1 130 ? 95.187  -46.466 369.619 1.00 36.55  ? 131  ASP B CG  1 
ATOM   5150 O OD1 . ASP B 1 130 ? 95.272  -45.381 370.233 1.00 39.43  ? 131  ASP B OD1 1 
ATOM   5151 O OD2 . ASP B 1 130 ? 94.248  -47.272 369.787 1.00 44.59  ? 131  ASP B OD2 1 
ATOM   5152 N N   . VAL B 1 131 ? 98.257  -46.197 366.171 1.00 20.68  ? 132  VAL B N   1 
ATOM   5153 C CA  . VAL B 1 131 ? 99.333  -46.729 365.344 1.00 24.13  ? 132  VAL B CA  1 
ATOM   5154 C C   . VAL B 1 131 ? 100.525 -45.786 365.252 1.00 22.14  ? 132  VAL B C   1 
ATOM   5155 O O   . VAL B 1 131 ? 101.604 -46.207 364.818 1.00 22.50  ? 132  VAL B O   1 
ATOM   5156 C CB  . VAL B 1 131 ? 98.760  -47.091 363.955 1.00 26.39  ? 132  VAL B CB  1 
ATOM   5157 C CG1 . VAL B 1 131 ? 98.393  -45.839 363.172 1.00 21.52  ? 132  VAL B CG1 1 
ATOM   5158 C CG2 . VAL B 1 131 ? 99.718  -47.982 363.173 1.00 34.83  ? 132  VAL B CG2 1 
ATOM   5159 N N   . TYR B 1 132 ? 100.378 -44.528 365.678 1.00 17.87  ? 133  TYR B N   1 
ATOM   5160 C CA  . TYR B 1 132 ? 101.482 -43.575 365.699 1.00 19.40  ? 133  TYR B CA  1 
ATOM   5161 C C   . TYR B 1 132 ? 102.067 -43.380 367.098 1.00 25.18  ? 133  TYR B C   1 
ATOM   5162 O O   . TYR B 1 132 ? 102.753 -42.380 367.338 1.00 21.17  ? 133  TYR B O   1 
ATOM   5163 C CB  . TYR B 1 132 ? 101.041 -42.220 365.140 1.00 15.25  ? 133  TYR B CB  1 
ATOM   5164 C CG  . TYR B 1 132 ? 100.403 -42.253 363.767 1.00 19.92  ? 133  TYR B CG  1 
ATOM   5165 C CD1 . TYR B 1 132 ? 100.795 -43.180 362.808 1.00 17.88  ? 133  TYR B CD1 1 
ATOM   5166 C CD2 . TYR B 1 132 ? 99.416  -41.337 363.427 1.00 13.99  ? 133  TYR B CD2 1 
ATOM   5167 C CE1 . TYR B 1 132 ? 100.209 -43.198 361.552 1.00 19.86  ? 133  TYR B CE1 1 
ATOM   5168 C CE2 . TYR B 1 132 ? 98.828  -41.347 362.179 1.00 13.89  ? 133  TYR B CE2 1 
ATOM   5169 C CZ  . TYR B 1 132 ? 99.225  -42.278 361.246 1.00 16.76  ? 133  TYR B CZ  1 
ATOM   5170 O OH  . TYR B 1 132 ? 98.635  -42.287 360.003 1.00 17.38  ? 133  TYR B OH  1 
ATOM   5171 N N   . ASP B 1 133 ? 101.809 -44.305 368.022 1.00 28.09  ? 134  ASP B N   1 
ATOM   5172 C CA  . ASP B 1 133 ? 102.322 -44.187 369.385 1.00 21.06  ? 134  ASP B CA  1 
ATOM   5173 C C   . ASP B 1 133 ? 103.844 -44.275 369.379 1.00 19.70  ? 134  ASP B C   1 
ATOM   5174 O O   . ASP B 1 133 ? 104.411 -45.312 369.021 1.00 24.22  ? 134  ASP B O   1 
ATOM   5175 C CB  . ASP B 1 133 ? 101.724 -45.283 370.266 1.00 24.56  ? 134  ASP B CB  1 
ATOM   5176 C CG  . ASP B 1 133 ? 101.942 -45.034 371.752 1.00 34.00  ? 134  ASP B CG  1 
ATOM   5177 O OD1 . ASP B 1 133 ? 102.829 -44.232 372.114 1.00 37.33  ? 134  ASP B OD1 1 
ATOM   5178 O OD2 . ASP B 1 133 ? 101.221 -45.651 372.564 1.00 43.83  ? 134  ASP B OD2 1 
ATOM   5179 N N   . GLY B 1 134 ? 104.507 -43.197 369.793 1.00 17.65  ? 135  GLY B N   1 
ATOM   5180 C CA  . GLY B 1 134 ? 105.953 -43.139 369.733 1.00 19.79  ? 135  GLY B CA  1 
ATOM   5181 C C   . GLY B 1 134 ? 106.704 -43.810 370.860 1.00 26.37  ? 135  GLY B C   1 
ATOM   5182 O O   . GLY B 1 134 ? 107.938 -43.795 370.852 1.00 25.04  ? 135  GLY B O   1 
ATOM   5183 N N   . ARG B 1 135 ? 106.004 -44.422 371.820 1.00 21.67  ? 136  ARG B N   1 
ATOM   5184 C CA  . ARG B 1 135 ? 106.660 -44.903 373.033 1.00 23.65  ? 136  ARG B CA  1 
ATOM   5185 C C   . ARG B 1 135 ? 107.639 -46.040 372.758 1.00 24.01  ? 136  ARG B C   1 
ATOM   5186 O O   . ARG B 1 135 ? 108.670 -46.141 373.433 1.00 23.65  ? 136  ARG B O   1 
ATOM   5187 C CB  . ARG B 1 135 ? 105.611 -45.346 374.055 1.00 19.52  ? 136  ARG B CB  1 
ATOM   5188 C CG  . ARG B 1 135 ? 104.959 -46.690 373.774 1.00 23.36  ? 136  ARG B CG  1 
ATOM   5189 C CD  . ARG B 1 135 ? 103.973 -47.062 374.867 1.00 26.23  ? 136  ARG B CD  1 
ATOM   5190 N NE  . ARG B 1 135 ? 102.773 -46.233 374.820 1.00 27.90  ? 136  ARG B NE  1 
ATOM   5191 C CZ  . ARG B 1 135 ? 101.929 -46.080 375.835 1.00 34.19  ? 136  ARG B CZ  1 
ATOM   5192 N NH1 . ARG B 1 135 ? 102.152 -46.702 376.986 1.00 32.25  ? 136  ARG B NH1 1 
ATOM   5193 N NH2 . ARG B 1 135 ? 100.861 -45.306 375.699 1.00 24.36  ? 136  ARG B NH2 1 
ATOM   5194 N N   . PHE B 1 136 ? 107.343 -46.897 371.779 1.00 19.69  ? 137  PHE B N   1 
ATOM   5195 C CA  . PHE B 1 136 ? 108.184 -48.064 371.527 1.00 22.20  ? 137  PHE B CA  1 
ATOM   5196 C C   . PHE B 1 136 ? 109.470 -47.684 370.809 1.00 24.58  ? 137  PHE B C   1 
ATOM   5197 O O   . PHE B 1 136 ? 110.550 -48.173 371.166 1.00 25.03  ? 137  PHE B O   1 
ATOM   5198 C CB  . PHE B 1 136 ? 107.410 -49.097 370.708 1.00 26.39  ? 137  PHE B CB  1 
ATOM   5199 C CG  . PHE B 1 136 ? 106.113 -49.516 371.333 1.00 23.44  ? 137  PHE B CG  1 
ATOM   5200 C CD1 . PHE B 1 136 ? 104.905 -49.128 370.777 1.00 28.35  ? 137  PHE B CD1 1 
ATOM   5201 C CD2 . PHE B 1 136 ? 106.099 -50.304 372.472 1.00 27.62  ? 137  PHE B CD2 1 
ATOM   5202 C CE1 . PHE B 1 136 ? 103.708 -49.514 371.347 1.00 28.89  ? 137  PHE B CE1 1 
ATOM   5203 C CE2 . PHE B 1 136 ? 104.905 -50.694 373.047 1.00 26.19  ? 137  PHE B CE2 1 
ATOM   5204 C CZ  . PHE B 1 136 ? 103.708 -50.298 372.483 1.00 24.70  ? 137  PHE B CZ  1 
ATOM   5205 N N   . LEU B 1 137 ? 109.382 -46.804 369.844 1.00 23.08  ? 138  LEU B N   1 
ATOM   5206 C CA  . LEU B 1 137 ? 110.553 -46.368 369.162 1.00 25.39  ? 138  LEU B CA  1 
ATOM   5207 C C   . LEU B 1 137 ? 111.505 -45.665 370.102 1.00 22.99  ? 138  LEU B C   1 
ATOM   5208 O O   . LEU B 1 137 ? 112.645 -45.869 370.023 1.00 25.74  ? 138  LEU B O   1 
ATOM   5209 C CB  . LEU B 1 137 ? 110.243 -45.383 368.063 1.00 21.34  ? 138  LEU B CB  1 
ATOM   5210 C CG  . LEU B 1 137 ? 110.313 -45.831 366.645 1.00 32.93  ? 138  LEU B CG  1 
ATOM   5211 C CD1 . LEU B 1 137 ? 109.867 -44.715 365.752 1.00 48.60  ? 138  LEU B CD1 1 
ATOM   5212 C CD2 . LEU B 1 137 ? 111.619 -46.446 366.212 1.00 26.36  ? 138  LEU B CD2 1 
ATOM   5213 N N   . VAL B 1 138 ? 110.981 -44.850 370.979 1.00 21.56  ? 139  VAL B N   1 
ATOM   5214 C CA  . VAL B 1 138 ? 111.820 -44.049 371.858 1.00 23.58  ? 139  VAL B CA  1 
ATOM   5215 C C   . VAL B 1 138 ? 112.552 -44.932 372.860 1.00 24.79  ? 139  VAL B C   1 
ATOM   5216 O O   . VAL B 1 138 ? 113.752 -44.754 373.102 1.00 24.18  ? 139  VAL B O   1 
ATOM   5217 C CB  . VAL B 1 138 ? 110.960 -42.979 372.548 1.00 26.16  ? 139  VAL B CB  1 
ATOM   5218 C CG1 . VAL B 1 138 ? 111.677 -42.423 373.739 1.00 26.43  ? 139  VAL B CG1 1 
ATOM   5219 C CG2 . VAL B 1 138 ? 110.612 -41.876 371.557 1.00 21.12  ? 139  VAL B CG2 1 
ATOM   5220 N N   . GLN B 1 139 ? 111.854 -45.903 373.451 1.00 25.30  ? 140  GLN B N   1 
ATOM   5221 C CA  . GLN B 1 139 ? 112.504 -46.795 374.406 1.00 27.98  ? 140  GLN B CA  1 
ATOM   5222 C C   . GLN B 1 139 ? 113.513 -47.700 373.711 1.00 26.75  ? 140  GLN B C   1 
ATOM   5223 O O   . GLN B 1 139 ? 114.639 -47.875 374.191 1.00 23.97  ? 140  GLN B O   1 
ATOM   5224 C CB  . GLN B 1 139 ? 111.462 -47.631 375.151 1.00 25.19  ? 140  GLN B CB  1 
ATOM   5225 C CG  . GLN B 1 139 ? 112.013 -48.368 376.369 1.00 25.88  ? 140  GLN B CG  1 
ATOM   5226 C CD  . GLN B 1 139 ? 112.810 -49.609 375.999 1.00 26.21  ? 140  GLN B CD  1 
ATOM   5227 O OE1 . GLN B 1 139 ? 112.428 -50.364 375.105 1.00 28.38  ? 140  GLN B OE1 1 
ATOM   5228 N NE2 . GLN B 1 139 ? 113.937 -49.810 376.673 1.00 25.60  ? 140  GLN B NE2 1 
ATOM   5229 N N   . ALA B 1 140 ? 113.123 -48.294 372.582 1.00 24.95  ? 141  ALA B N   1 
ATOM   5230 C CA  . ALA B 1 140 ? 113.976 -49.291 371.944 1.00 28.91  ? 141  ALA B CA  1 
ATOM   5231 C C   . ALA B 1 140 ? 115.225 -48.661 371.342 1.00 30.73  ? 141  ALA B C   1 
ATOM   5232 O O   . ALA B 1 140 ? 116.325 -49.210 371.469 1.00 28.41  ? 141  ALA B O   1 
ATOM   5233 C CB  . ALA B 1 140 ? 113.193 -50.047 370.872 1.00 22.60  ? 141  ALA B CB  1 
ATOM   5234 N N   . GLU B 1 141 ? 115.082 -47.511 370.687 1.00 24.78  ? 142  GLU B N   1 
ATOM   5235 C CA  . GLU B 1 141 ? 116.165 -46.947 369.896 1.00 22.56  ? 142  GLU B CA  1 
ATOM   5236 C C   . GLU B 1 141 ? 116.708 -45.635 370.443 1.00 25.64  ? 142  GLU B C   1 
ATOM   5237 O O   . GLU B 1 141 ? 117.595 -45.045 369.817 1.00 26.83  ? 142  GLU B O   1 
ATOM   5238 C CB  . GLU B 1 141 ? 115.707 -46.764 368.446 1.00 20.77  ? 142  GLU B CB  1 
ATOM   5239 C CG  . GLU B 1 141 ? 115.513 -48.083 367.709 1.00 20.97  ? 142  GLU B CG  1 
ATOM   5240 C CD  . GLU B 1 141 ? 116.788 -48.909 367.644 1.00 28.88  ? 142  GLU B CD  1 
ATOM   5241 O OE1 . GLU B 1 141 ? 117.887 -48.315 367.602 1.00 29.62  ? 142  GLU B OE1 1 
ATOM   5242 O OE2 . GLU B 1 141 ? 116.692 -50.156 367.640 1.00 31.28  ? 142  GLU B OE2 1 
ATOM   5243 N N   . ARG B 1 142 ? 116.211 -45.169 371.589 1.00 25.57  ? 143  ARG B N   1 
ATOM   5244 C CA  . ARG B 1 142 ? 116.780 -44.022 372.296 1.00 28.98  ? 143  ARG B CA  1 
ATOM   5245 C C   . ARG B 1 142 ? 116.830 -42.784 371.400 1.00 29.37  ? 143  ARG B C   1 
ATOM   5246 O O   . ARG B 1 142 ? 117.881 -42.181 371.176 1.00 27.65  ? 143  ARG B O   1 
ATOM   5247 C CB  . ARG B 1 142 ? 118.170 -44.356 372.844 1.00 26.61  ? 143  ARG B CB  1 
ATOM   5248 C CG  . ARG B 1 142 ? 118.273 -45.730 373.467 1.00 36.97  ? 143  ARG B CG  1 
ATOM   5249 C CD  . ARG B 1 142 ? 117.966 -45.656 374.942 1.00 38.62  ? 143  ARG B CD  1 
ATOM   5250 N NE  . ARG B 1 142 ? 118.741 -44.607 375.594 1.00 48.33  ? 143  ARG B NE  1 
ATOM   5251 C CZ  . ARG B 1 142 ? 118.524 -44.181 376.833 1.00 47.91  ? 143  ARG B CZ  1 
ATOM   5252 N NH1 . ARG B 1 142 ? 117.549 -44.713 377.557 1.00 34.46  ? 143  ARG B NH1 1 
ATOM   5253 N NH2 . ARG B 1 142 ? 119.280 -43.220 377.347 1.00 50.17  ? 143  ARG B NH2 1 
ATOM   5254 N N   . THR B 1 143 ? 115.667 -42.426 370.874 1.00 25.27  ? 144  THR B N   1 
ATOM   5255 C CA  . THR B 1 143 ? 115.505 -41.207 370.106 1.00 25.56  ? 144  THR B CA  1 
ATOM   5256 C C   . THR B 1 143 ? 114.444 -40.341 370.767 1.00 25.61  ? 144  THR B C   1 
ATOM   5257 O O   . THR B 1 143 ? 113.682 -40.799 371.623 1.00 33.20  ? 144  THR B O   1 
ATOM   5258 C CB  . THR B 1 143 ? 115.111 -41.502 368.652 1.00 37.45  ? 144  THR B CB  1 
ATOM   5259 O OG1 . THR B 1 143 ? 113.973 -42.373 368.630 1.00 39.61  ? 144  THR B OG1 1 
ATOM   5260 C CG2 . THR B 1 143 ? 116.264 -42.166 367.913 1.00 41.45  ? 144  THR B CG2 1 
ATOM   5261 N N   . VAL B 1 144 ? 114.421 -39.074 370.385 1.00 23.22  ? 145  VAL B N   1 
ATOM   5262 C CA  . VAL B 1 144 ? 113.297 -38.200 370.687 1.00 23.01  ? 145  VAL B CA  1 
ATOM   5263 C C   . VAL B 1 144 ? 112.362 -38.235 369.490 1.00 24.28  ? 145  VAL B C   1 
ATOM   5264 O O   . VAL B 1 144 ? 112.805 -38.093 368.344 1.00 25.99  ? 145  VAL B O   1 
ATOM   5265 C CB  . VAL B 1 144 ? 113.768 -36.766 370.983 1.00 17.38  ? 145  VAL B CB  1 
ATOM   5266 C CG1 . VAL B 1 144 ? 112.574 -35.831 371.109 1.00 19.06  ? 145  VAL B CG1 1 
ATOM   5267 C CG2 . VAL B 1 144 ? 114.611 -36.734 372.248 1.00 19.65  ? 145  VAL B CG2 1 
ATOM   5268 N N   . LEU B 1 145 ? 111.076 -38.455 369.739 1.00 18.47  ? 146  LEU B N   1 
ATOM   5269 C CA  . LEU B 1 145 ? 110.092 -38.505 368.669 1.00 19.91  ? 146  LEU B CA  1 
ATOM   5270 C C   . LEU B 1 145 ? 109.089 -37.377 368.841 1.00 23.76  ? 146  LEU B C   1 
ATOM   5271 O O   . LEU B 1 145 ? 108.509 -37.211 369.919 1.00 22.08  ? 146  LEU B O   1 
ATOM   5272 C CB  . LEU B 1 145 ? 109.368 -39.851 368.619 1.00 21.31  ? 146  LEU B CB  1 
ATOM   5273 C CG  . LEU B 1 145 ? 108.598 -39.984 367.302 1.00 28.38  ? 146  LEU B CG  1 
ATOM   5274 C CD1 . LEU B 1 145 ? 108.763 -41.350 366.687 1.00 34.33  ? 146  LEU B CD1 1 
ATOM   5275 C CD2 . LEU B 1 145 ? 107.120 -39.662 367.462 1.00 30.04  ? 146  LEU B CD2 1 
ATOM   5276 N N   . VAL B 1 146 ? 108.881 -36.619 367.769 1.00 21.11  ? 147  VAL B N   1 
ATOM   5277 C CA  . VAL B 1 146 ? 107.933 -35.515 367.742 1.00 17.48  ? 147  VAL B CA  1 
ATOM   5278 C C   . VAL B 1 146 ? 106.881 -35.805 366.682 1.00 20.01  ? 147  VAL B C   1 
ATOM   5279 O O   . VAL B 1 146 ? 107.200 -36.280 365.587 1.00 16.90  ? 147  VAL B O   1 
ATOM   5280 C CB  . VAL B 1 146 ? 108.631 -34.168 367.461 1.00 18.19  ? 147  VAL B CB  1 
ATOM   5281 C CG1 . VAL B 1 146 ? 107.622 -33.029 367.484 1.00 13.84  ? 147  VAL B CG1 1 
ATOM   5282 C CG2 . VAL B 1 146 ? 109.741 -33.925 368.471 1.00 17.57  ? 147  VAL B CG2 1 
ATOM   5283 N N   . SER B 1 147 ? 105.624 -35.531 367.021 1.00 14.21  ? 148  SER B N   1 
ATOM   5284 C CA  . SER B 1 147 ? 104.514 -35.588 366.084 1.00 16.73  ? 148  SER B CA  1 
ATOM   5285 C C   . SER B 1 147 ? 103.681 -34.327 366.257 1.00 16.06  ? 148  SER B C   1 
ATOM   5286 O O   . SER B 1 147 ? 103.560 -33.800 367.363 1.00 19.40  ? 148  SER B O   1 
ATOM   5287 C CB  . SER B 1 147 ? 103.637 -36.824 366.314 1.00 13.29  ? 148  SER B CB  1 
ATOM   5288 O OG  . SER B 1 147 ? 102.807 -36.650 367.450 1.00 25.45  ? 148  SER B OG  1 
ATOM   5289 N N   . MET B 1 148 ? 103.113 -33.841 365.158 1.00 12.89  ? 149  MET B N   1 
ATOM   5290 C CA  . MET B 1 148 ? 102.277 -32.653 365.206 1.00 26.24  ? 149  MET B CA  1 
ATOM   5291 C C   . MET B 1 148 ? 100.988 -32.891 364.439 1.00 22.07  ? 149  MET B C   1 
ATOM   5292 O O   . MET B 1 148 ? 100.932 -33.701 363.508 1.00 18.04  ? 149  MET B O   1 
ATOM   5293 C CB  . MET B 1 148 ? 102.993 -31.417 364.632 1.00 12.94  ? 149  MET B CB  1 
ATOM   5294 C CG  . MET B 1 148 ? 102.763 -31.179 363.144 1.00 12.66  ? 149  MET B CG  1 
ATOM   5295 S SD  . MET B 1 148 ? 103.570 -32.410 362.105 1.00 22.07  ? 149  MET B SD  1 
ATOM   5296 C CE  . MET B 1 148 ? 105.288 -32.027 362.430 1.00 19.05  ? 149  MET B CE  1 
ATOM   5297 N N   . ASN B 1 149 ? 99.943  -32.188 364.855 1.00 15.78  ? 150  ASN B N   1 
ATOM   5298 C CA  . ASN B 1 149 ? 98.732  -32.088 364.062 1.00 20.64  ? 150  ASN B CA  1 
ATOM   5299 C C   . ASN B 1 149 ? 98.828  -30.871 363.158 1.00 20.56  ? 150  ASN B C   1 
ATOM   5300 O O   . ASN B 1 149 ? 99.398  -29.841 363.536 1.00 21.93  ? 150  ASN B O   1 
ATOM   5301 C CB  . ASN B 1 149 ? 97.492  -32.002 364.953 1.00 19.09  ? 150  ASN B CB  1 
ATOM   5302 C CG  . ASN B 1 149 ? 97.081  -33.353 365.504 1.00 21.90  ? 150  ASN B CG  1 
ATOM   5303 O OD1 . ASN B 1 149 ? 97.689  -34.371 365.184 1.00 26.88  ? 150  ASN B OD1 1 
ATOM   5304 N ND2 . ASN B 1 149 ? 96.036  -33.372 366.320 1.00 26.94  ? 150  ASN B ND2 1 
ATOM   5305 N N   . TYR B 1 150 ? 98.301  -31.006 361.948 1.00 21.00  ? 151  TYR B N   1 
ATOM   5306 C CA  . TYR B 1 150 ? 98.264  -29.920 360.985 1.00 13.04  ? 151  TYR B CA  1 
ATOM   5307 C C   . TYR B 1 150 ? 96.889  -29.907 360.340 1.00 19.84  ? 151  TYR B C   1 
ATOM   5308 O O   . TYR B 1 150 ? 96.240  -30.949 360.212 1.00 18.63  ? 151  TYR B O   1 
ATOM   5309 C CB  . TYR B 1 150 ? 99.370  -30.061 359.925 1.00 14.96  ? 151  TYR B CB  1 
ATOM   5310 C CG  . TYR B 1 150 ? 99.275  -31.310 359.076 1.00 15.75  ? 151  TYR B CG  1 
ATOM   5311 C CD1 . TYR B 1 150 ? 99.895  -32.491 359.469 1.00 16.09  ? 151  TYR B CD1 1 
ATOM   5312 C CD2 . TYR B 1 150 ? 98.578  -31.305 357.873 1.00 13.74  ? 151  TYR B CD2 1 
ATOM   5313 C CE1 . TYR B 1 150 ? 99.817  -33.632 358.692 1.00 14.03  ? 151  TYR B CE1 1 
ATOM   5314 C CE2 . TYR B 1 150 ? 98.491  -32.443 357.091 1.00 12.50  ? 151  TYR B CE2 1 
ATOM   5315 C CZ  . TYR B 1 150 ? 99.110  -33.603 357.506 1.00 15.94  ? 151  TYR B CZ  1 
ATOM   5316 O OH  . TYR B 1 150 ? 99.024  -34.734 356.727 1.00 14.97  ? 151  TYR B OH  1 
ATOM   5317 N N   . ARG B 1 151 ? 96.442  -28.718 359.950 1.00 15.45  ? 152  ARG B N   1 
ATOM   5318 C CA  . ARG B 1 151 ? 95.100  -28.574 359.404 1.00 19.17  ? 152  ARG B CA  1 
ATOM   5319 C C   . ARG B 1 151 ? 94.971  -29.333 358.090 1.00 20.53  ? 152  ARG B C   1 
ATOM   5320 O O   . ARG B 1 151 ? 95.862  -29.292 357.237 1.00 15.20  ? 152  ARG B O   1 
ATOM   5321 C CB  . ARG B 1 151 ? 94.765  -27.098 359.199 1.00 19.12  ? 152  ARG B CB  1 
ATOM   5322 C CG  . ARG B 1 151 ? 94.426  -26.363 360.484 1.00 18.82  ? 152  ARG B CG  1 
ATOM   5323 C CD  . ARG B 1 151 ? 94.332  -24.867 360.247 1.00 19.36  ? 152  ARG B CD  1 
ATOM   5324 N NE  . ARG B 1 151 ? 95.649  -24.247 360.130 1.00 20.37  ? 152  ARG B NE  1 
ATOM   5325 C CZ  . ARG B 1 151 ? 95.846  -22.968 359.828 1.00 20.54  ? 152  ARG B CZ  1 
ATOM   5326 N NH1 . ARG B 1 151 ? 94.809  -22.170 359.608 1.00 16.84  ? 152  ARG B NH1 1 
ATOM   5327 N NH2 . ARG B 1 151 ? 97.079  -22.486 359.744 1.00 17.08  ? 152  ARG B NH2 1 
ATOM   5328 N N   . VAL B 1 152 ? 93.852  -30.038 357.935 1.00 14.08  ? 153  VAL B N   1 
ATOM   5329 C CA  . VAL B 1 152 ? 93.576  -30.828 356.745 1.00 15.64  ? 153  VAL B CA  1 
ATOM   5330 C C   . VAL B 1 152 ? 92.289  -30.317 356.107 1.00 21.14  ? 153  VAL B C   1 
ATOM   5331 O O   . VAL B 1 152 ? 91.573  -29.490 356.672 1.00 19.75  ? 153  VAL B O   1 
ATOM   5332 C CB  . VAL B 1 152 ? 93.471  -32.334 357.055 1.00 16.57  ? 153  VAL B CB  1 
ATOM   5333 C CG1 . VAL B 1 152 ? 94.825  -32.888 357.471 1.00 18.18  ? 153  VAL B CG1 1 
ATOM   5334 C CG2 . VAL B 1 152 ? 92.430  -32.578 358.138 1.00 14.96  ? 153  VAL B CG2 1 
ATOM   5335 N N   . GLY B 1 153 ? 92.003  -30.831 354.912 1.00 23.92  ? 154  GLY B N   1 
ATOM   5336 C CA  . GLY B 1 153 ? 90.804  -30.430 354.203 1.00 19.26  ? 154  GLY B CA  1 
ATOM   5337 C C   . GLY B 1 153 ? 90.847  -28.965 353.801 1.00 22.64  ? 154  GLY B C   1 
ATOM   5338 O O   . GLY B 1 153 ? 91.912  -28.371 353.610 1.00 19.07  ? 154  GLY B O   1 
ATOM   5339 N N   . ALA B 1 154 ? 89.655  -28.374 353.676 1.00 19.81  ? 155  ALA B N   1 
ATOM   5340 C CA  . ALA B 1 154 ? 89.565  -26.959 353.331 1.00 22.19  ? 155  ALA B CA  1 
ATOM   5341 C C   . ALA B 1 154 ? 90.253  -26.085 354.371 1.00 20.00  ? 155  ALA B C   1 
ATOM   5342 O O   . ALA B 1 154 ? 90.828  -25.047 354.027 1.00 18.35  ? 155  ALA B O   1 
ATOM   5343 C CB  . ALA B 1 154 ? 88.101  -26.546 353.175 1.00 18.53  ? 155  ALA B CB  1 
ATOM   5344 N N   . PHE B 1 155 ? 90.213  -26.491 355.641 1.00 16.37  ? 156  PHE B N   1 
ATOM   5345 C CA  . PHE B 1 155 ? 90.849  -25.705 356.692 1.00 16.24  ? 156  PHE B CA  1 
ATOM   5346 C C   . PHE B 1 155 ? 92.349  -25.582 356.473 1.00 21.00  ? 156  PHE B C   1 
ATOM   5347 O O   . PHE B 1 155 ? 92.949  -24.568 356.845 1.00 22.63  ? 156  PHE B O   1 
ATOM   5348 C CB  . PHE B 1 155 ? 90.557  -26.331 358.055 1.00 16.23  ? 156  PHE B CB  1 
ATOM   5349 C CG  . PHE B 1 155 ? 89.109  -26.649 358.264 1.00 21.72  ? 156  PHE B CG  1 
ATOM   5350 C CD1 . PHE B 1 155 ? 88.612  -27.909 357.973 1.00 23.13  ? 156  PHE B CD1 1 
ATOM   5351 C CD2 . PHE B 1 155 ? 88.237  -25.680 358.728 1.00 20.38  ? 156  PHE B CD2 1 
ATOM   5352 C CE1 . PHE B 1 155 ? 87.276  -28.199 358.155 1.00 25.04  ? 156  PHE B CE1 1 
ATOM   5353 C CE2 . PHE B 1 155 ? 86.901  -25.964 358.913 1.00 25.35  ? 156  PHE B CE2 1 
ATOM   5354 C CZ  . PHE B 1 155 ? 86.420  -27.226 358.625 1.00 22.29  ? 156  PHE B CZ  1 
ATOM   5355 N N   . GLY B 1 156 ? 92.966  -26.587 355.862 1.00 20.70  ? 157  GLY B N   1 
ATOM   5356 C CA  . GLY B 1 156 ? 94.398  -26.560 355.657 1.00 14.81  ? 157  GLY B CA  1 
ATOM   5357 C C   . GLY B 1 156 ? 94.827  -26.177 354.257 1.00 21.27  ? 157  GLY B C   1 
ATOM   5358 O O   . GLY B 1 156 ? 95.939  -25.672 354.070 1.00 18.30  ? 157  GLY B O   1 
ATOM   5359 N N   . PHE B 1 157 ? 93.972  -26.405 353.255 1.00 21.09  ? 158  PHE B N   1 
ATOM   5360 C CA  . PHE B 1 157 ? 94.437  -26.277 351.880 1.00 20.95  ? 158  PHE B CA  1 
ATOM   5361 C C   . PHE B 1 157 ? 93.433  -25.636 350.928 1.00 24.67  ? 158  PHE B C   1 
ATOM   5362 O O   . PHE B 1 157 ? 93.630  -25.716 349.708 1.00 24.44  ? 158  PHE B O   1 
ATOM   5363 C CB  . PHE B 1 157 ? 94.861  -27.653 351.358 1.00 19.35  ? 158  PHE B CB  1 
ATOM   5364 C CG  . PHE B 1 157 ? 95.981  -28.261 352.146 1.00 21.62  ? 158  PHE B CG  1 
ATOM   5365 C CD1 . PHE B 1 157 ? 95.722  -29.171 353.159 1.00 20.04  ? 158  PHE B CD1 1 
ATOM   5366 C CD2 . PHE B 1 157 ? 97.291  -27.881 351.912 1.00 16.15  ? 158  PHE B CD2 1 
ATOM   5367 C CE1 . PHE B 1 157 ? 96.752  -29.712 353.902 1.00 19.48  ? 158  PHE B CE1 1 
ATOM   5368 C CE2 . PHE B 1 157 ? 98.325  -28.418 352.649 1.00 15.92  ? 158  PHE B CE2 1 
ATOM   5369 C CZ  . PHE B 1 157 ? 98.056  -29.336 353.646 1.00 20.51  ? 158  PHE B CZ  1 
ATOM   5370 N N   . LEU B 1 158 ? 92.379  -24.996 351.428 1.00 24.12  ? 159  LEU B N   1 
ATOM   5371 C CA  . LEU B 1 158 ? 91.553  -24.167 350.562 1.00 27.84  ? 159  LEU B CA  1 
ATOM   5372 C C   . LEU B 1 158 ? 92.360  -22.959 350.111 1.00 28.77  ? 159  LEU B C   1 
ATOM   5373 O O   . LEU B 1 158 ? 92.984  -22.276 350.929 1.00 24.72  ? 159  LEU B O   1 
ATOM   5374 C CB  . LEU B 1 158 ? 90.283  -23.718 351.283 1.00 24.93  ? 159  LEU B CB  1 
ATOM   5375 C CG  . LEU B 1 158 ? 89.302  -22.900 350.439 1.00 24.86  ? 159  LEU B CG  1 
ATOM   5376 C CD1 . LEU B 1 158 ? 87.880  -23.386 350.656 1.00 23.84  ? 159  LEU B CD1 1 
ATOM   5377 C CD2 . LEU B 1 158 ? 89.412  -21.414 350.750 1.00 24.79  ? 159  LEU B CD2 1 
ATOM   5378 N N   . ALA B 1 159 ? 92.352  -22.694 348.808 1.00 23.29  ? 160  ALA B N   1 
ATOM   5379 C CA  . ALA B 1 159 ? 93.176  -21.631 348.254 1.00 26.00  ? 160  ALA B CA  1 
ATOM   5380 C C   . ALA B 1 159 ? 92.382  -20.821 347.244 1.00 28.72  ? 160  ALA B C   1 
ATOM   5381 O O   . ALA B 1 159 ? 91.819  -21.378 346.297 1.00 25.81  ? 160  ALA B O   1 
ATOM   5382 C CB  . ALA B 1 159 ? 94.437  -22.198 347.591 1.00 17.74  ? 160  ALA B CB  1 
ATOM   5383 N N   . LEU B 1 160 ? 92.325  -19.509 347.467 1.00 32.17  ? 161  LEU B N   1 
ATOM   5384 C CA  . LEU B 1 160 ? 91.987  -18.536 346.435 1.00 32.12  ? 161  LEU B CA  1 
ATOM   5385 C C   . LEU B 1 160 ? 93.301  -17.866 346.063 1.00 36.35  ? 161  LEU B C   1 
ATOM   5386 O O   . LEU B 1 160 ? 93.684  -16.857 346.673 1.00 34.84  ? 161  LEU B O   1 
ATOM   5387 C CB  . LEU B 1 160 ? 90.962  -17.513 346.928 1.00 28.89  ? 161  LEU B CB  1 
ATOM   5388 C CG  . LEU B 1 160 ? 89.550  -18.060 347.151 1.00 34.41  ? 161  LEU B CG  1 
ATOM   5389 C CD1 . LEU B 1 160 ? 88.656  -17.005 347.778 1.00 39.74  ? 161  LEU B CD1 1 
ATOM   5390 C CD2 . LEU B 1 160 ? 88.953  -18.563 345.844 1.00 31.95  ? 161  LEU B CD2 1 
ATOM   5391 N N   . PRO B 1 161 ? 94.041  -18.403 345.093 1.00 37.18  ? 162  PRO B N   1 
ATOM   5392 C CA  . PRO B 1 161 ? 95.429  -17.969 344.890 1.00 37.38  ? 162  PRO B CA  1 
ATOM   5393 C C   . PRO B 1 161 ? 95.523  -16.488 344.556 1.00 34.38  ? 162  PRO B C   1 
ATOM   5394 O O   . PRO B 1 161 ? 94.761  -15.963 343.742 1.00 33.17  ? 162  PRO B O   1 
ATOM   5395 C CB  . PRO B 1 161 ? 95.904  -18.844 343.725 1.00 38.38  ? 162  PRO B CB  1 
ATOM   5396 C CG  . PRO B 1 161 ? 94.988  -20.029 343.738 1.00 34.87  ? 162  PRO B CG  1 
ATOM   5397 C CD  . PRO B 1 161 ? 93.661  -19.486 344.171 1.00 36.52  ? 162  PRO B CD  1 
ATOM   5398 N N   . GLY B 1 162 ? 96.476  -15.817 345.202 1.00 42.18  ? 163  GLY B N   1 
ATOM   5399 C CA  . GLY B 1 162 ? 96.622  -14.385 345.104 1.00 47.72  ? 163  GLY B CA  1 
ATOM   5400 C C   . GLY B 1 162 ? 95.938  -13.605 346.205 1.00 48.60  ? 163  GLY B C   1 
ATOM   5401 O O   . GLY B 1 162 ? 96.256  -12.427 346.401 1.00 45.69  ? 163  GLY B O   1 
ATOM   5402 N N   . SER B 1 163 ? 95.012  -14.227 346.929 1.00 46.67  ? 164  SER B N   1 
ATOM   5403 C CA  . SER B 1 163 ? 94.317  -13.574 348.025 1.00 46.01  ? 164  SER B CA  1 
ATOM   5404 C C   . SER B 1 163 ? 95.126  -13.688 349.308 1.00 45.23  ? 164  SER B C   1 
ATOM   5405 O O   . SER B 1 163 ? 95.883  -14.642 349.509 1.00 45.56  ? 164  SER B O   1 
ATOM   5406 C CB  . SER B 1 163 ? 92.934  -14.192 348.239 1.00 48.44  ? 164  SER B CB  1 
ATOM   5407 O OG  . SER B 1 163 ? 93.030  -15.400 348.975 1.00 48.64  ? 164  SER B OG  1 
ATOM   5408 N N   . ARG B 1 164 ? 94.958  -12.700 350.180 1.00 42.47  ? 165  ARG B N   1 
ATOM   5409 C CA  . ARG B 1 164 ? 95.568  -12.747 351.498 1.00 52.52  ? 165  ARG B CA  1 
ATOM   5410 C C   . ARG B 1 164 ? 94.650  -13.358 352.546 1.00 49.19  ? 165  ARG B C   1 
ATOM   5411 O O   . ARG B 1 164 ? 95.100  -13.614 353.668 1.00 54.36  ? 165  ARG B O   1 
ATOM   5412 C CB  . ARG B 1 164 ? 95.996  -11.342 351.928 1.00 66.24  ? 165  ARG B CB  1 
ATOM   5413 C CG  . ARG B 1 164 ? 97.266  -10.860 351.243 1.00 80.72  ? 165  ARG B CG  1 
ATOM   5414 C CD  . ARG B 1 164 ? 98.178  -10.139 352.220 1.00 92.81  ? 165  ARG B CD  1 
ATOM   5415 N NE  . ARG B 1 164 ? 97.416  -9.306  353.144 1.00 103.24 ? 165  ARG B NE  1 
ATOM   5416 C CZ  . ARG B 1 164 ? 97.569  -9.320  354.464 1.00 104.21 ? 165  ARG B CZ  1 
ATOM   5417 N NH1 . ARG B 1 164 ? 98.461  -10.128 355.022 1.00 101.30 ? 165  ARG B NH1 1 
ATOM   5418 N NH2 . ARG B 1 164 ? 96.828  -8.529  355.227 1.00 105.63 ? 165  ARG B NH2 1 
ATOM   5419 N N   . GLU B 1 165 ? 93.385  -13.608 352.207 1.00 42.65  ? 166  GLU B N   1 
ATOM   5420 C CA  A GLU B 1 165 ? 92.423  -14.212 353.122 0.52 41.28  ? 166  GLU B CA  1 
ATOM   5421 C CA  B GLU B 1 165 ? 92.475  -14.217 353.165 0.48 41.14  ? 166  GLU B CA  1 
ATOM   5422 C C   . GLU B 1 165 ? 92.397  -15.731 353.032 1.00 35.62  ? 166  GLU B C   1 
ATOM   5423 O O   . GLU B 1 165 ? 92.016  -16.399 354.000 1.00 36.32  ? 166  GLU B O   1 
ATOM   5424 C CB  A GLU B 1 165 ? 91.017  -13.670 352.841 0.52 41.67  ? 166  GLU B CB  1 
ATOM   5425 C CB  B GLU B 1 165 ? 91.078  -13.604 353.034 0.48 41.93  ? 166  GLU B CB  1 
ATOM   5426 C CG  A GLU B 1 165 ? 90.846  -12.184 353.113 0.52 41.94  ? 166  GLU B CG  1 
ATOM   5427 C CG  B GLU B 1 165 ? 90.990  -12.177 353.568 0.48 42.22  ? 166  GLU B CG  1 
ATOM   5428 C CD  A GLU B 1 165 ? 90.965  -11.339 351.858 0.52 44.29  ? 166  GLU B CD  1 
ATOM   5429 C CD  B GLU B 1 165 ? 91.669  -12.011 354.918 0.48 41.95  ? 166  GLU B CD  1 
ATOM   5430 O OE1 A GLU B 1 165 ? 90.750  -10.112 351.944 0.52 45.52  ? 166  GLU B OE1 1 
ATOM   5431 O OE1 B GLU B 1 165 ? 91.217  -12.641 355.898 0.48 34.22  ? 166  GLU B OE1 1 
ATOM   5432 O OE2 A GLU B 1 165 ? 91.275  -11.901 350.786 0.52 41.96  ? 166  GLU B OE2 1 
ATOM   5433 O OE2 B GLU B 1 165 ? 92.659  -11.252 355.000 0.48 43.51  ? 166  GLU B OE2 1 
ATOM   5434 N N   . ALA B 1 166 ? 92.769  -16.289 351.880 1.00 31.56  ? 167  ALA B N   1 
ATOM   5435 C CA  . ALA B 1 166 ? 92.830  -17.739 351.682 1.00 32.28  ? 167  ALA B CA  1 
ATOM   5436 C C   . ALA B 1 166 ? 94.024  -18.059 350.792 1.00 29.02  ? 167  ALA B C   1 
ATOM   5437 O O   . ALA B 1 166 ? 93.872  -18.488 349.643 1.00 27.43  ? 167  ALA B O   1 
ATOM   5438 C CB  . ALA B 1 166 ? 91.526  -18.267 351.077 1.00 34.21  ? 167  ALA B CB  1 
ATOM   5439 N N   . PRO B 1 167 ? 95.244  -17.869 351.307 1.00 28.87  ? 168  PRO B N   1 
ATOM   5440 C CA  . PRO B 1 167 ? 96.427  -18.009 350.442 1.00 30.33  ? 168  PRO B CA  1 
ATOM   5441 C C   . PRO B 1 167 ? 96.728  -19.443 350.043 1.00 35.06  ? 168  PRO B C   1 
ATOM   5442 O O   . PRO B 1 167 ? 97.329  -19.662 348.984 1.00 33.50  ? 168  PRO B O   1 
ATOM   5443 C CB  . PRO B 1 167 ? 97.554  -17.416 351.296 1.00 30.97  ? 168  PRO B CB  1 
ATOM   5444 C CG  . PRO B 1 167 ? 97.099  -17.626 352.703 1.00 28.26  ? 168  PRO B CG  1 
ATOM   5445 C CD  . PRO B 1 167 ? 95.602  -17.493 352.686 1.00 24.68  ? 168  PRO B CD  1 
ATOM   5446 N N   . GLY B 1 168 ? 96.340  -20.420 350.852 1.00 33.38  ? 169  GLY B N   1 
ATOM   5447 C CA  . GLY B 1 168 ? 96.619  -21.809 350.558 1.00 30.71  ? 169  GLY B CA  1 
ATOM   5448 C C   . GLY B 1 168 ? 97.875  -22.306 351.258 1.00 27.26  ? 169  GLY B C   1 
ATOM   5449 O O   . GLY B 1 168 ? 98.714  -21.534 351.730 1.00 25.92  ? 169  GLY B O   1 
ATOM   5450 N N   . ASN B 1 169 ? 97.987  -23.634 351.335 1.00 21.47  ? 170  ASN B N   1 
ATOM   5451 C CA  . ASN B 1 169 ? 99.147  -24.338 351.878 1.00 18.70  ? 170  ASN B CA  1 
ATOM   5452 C C   . ASN B 1 169 ? 99.356  -24.096 353.369 1.00 20.24  ? 170  ASN B C   1 
ATOM   5453 O O   . ASN B 1 169 ? 100.437 -24.384 353.892 1.00 20.52  ? 170  ASN B O   1 
ATOM   5454 C CB  . ASN B 1 169 ? 100.430 -23.973 351.118 1.00 14.97  ? 170  ASN B CB  1 
ATOM   5455 C CG  . ASN B 1 169 ? 100.373 -24.366 349.657 1.00 24.26  ? 170  ASN B CG  1 
ATOM   5456 O OD1 . ASN B 1 169 ? 99.769  -25.375 349.301 1.00 21.23  ? 170  ASN B OD1 1 
ATOM   5457 N ND2 . ASN B 1 169 ? 100.999 -23.566 348.802 1.00 21.81  ? 170  ASN B ND2 1 
ATOM   5458 N N   . VAL B 1 170 ? 98.348  -23.583 354.081 1.00 22.03  ? 171  VAL B N   1 
ATOM   5459 C CA  . VAL B 1 170 ? 98.562  -23.240 355.485 1.00 18.33  ? 171  VAL B CA  1 
ATOM   5460 C C   . VAL B 1 170 ? 98.763  -24.492 356.330 1.00 17.74  ? 171  VAL B C   1 
ATOM   5461 O O   . VAL B 1 170 ? 99.455  -24.449 357.356 1.00 18.62  ? 171  VAL B O   1 
ATOM   5462 C CB  . VAL B 1 170 ? 97.406  -22.369 356.018 1.00 19.92  ? 171  VAL B CB  1 
ATOM   5463 C CG1 . VAL B 1 170 ? 97.315  -21.072 355.226 1.00 20.03  ? 171  VAL B CG1 1 
ATOM   5464 C CG2 . VAL B 1 170 ? 96.086  -23.121 355.979 1.00 16.53  ? 171  VAL B CG2 1 
ATOM   5465 N N   . GLY B 1 171 ? 98.181  -25.623 355.923 1.00 16.54  ? 172  GLY B N   1 
ATOM   5466 C CA  . GLY B 1 171 ? 98.482  -26.875 356.597 1.00 13.47  ? 172  GLY B CA  1 
ATOM   5467 C C   . GLY B 1 171 ? 99.954  -27.231 356.514 1.00 20.40  ? 172  GLY B C   1 
ATOM   5468 O O   . GLY B 1 171 ? 100.534 -27.748 357.472 1.00 19.64  ? 172  GLY B O   1 
ATOM   5469 N N   . LEU B 1 172 ? 100.578 -26.956 355.366 1.00 18.76  ? 173  LEU B N   1 
ATOM   5470 C CA  . LEU B 1 172 ? 102.022 -27.125 355.249 1.00 18.58  ? 173  LEU B CA  1 
ATOM   5471 C C   . LEU B 1 172 ? 102.761 -26.148 356.153 1.00 13.39  ? 173  LEU B C   1 
ATOM   5472 O O   . LEU B 1 172 ? 103.796 -26.491 356.736 1.00 19.39  ? 173  LEU B O   1 
ATOM   5473 C CB  . LEU B 1 172 ? 102.456 -26.941 353.796 1.00 18.90  ? 173  LEU B CB  1 
ATOM   5474 C CG  . LEU B 1 172 ? 102.197 -28.120 352.858 1.00 22.96  ? 173  LEU B CG  1 
ATOM   5475 C CD1 . LEU B 1 172 ? 102.513 -27.738 351.422 1.00 13.54  ? 173  LEU B CD1 1 
ATOM   5476 C CD2 . LEU B 1 172 ? 103.016 -29.326 353.289 1.00 18.49  ? 173  LEU B CD2 1 
ATOM   5477 N N   . LEU B 1 173 ? 102.244 -24.924 356.280 1.00 13.83  ? 174  LEU B N   1 
ATOM   5478 C CA  . LEU B 1 173 ? 102.857 -23.957 357.183 1.00 15.17  ? 174  LEU B CA  1 
ATOM   5479 C C   . LEU B 1 173 ? 102.674 -24.359 358.641 1.00 17.83  ? 174  LEU B C   1 
ATOM   5480 O O   . LEU B 1 173 ? 103.530 -24.048 359.477 1.00 20.45  ? 174  LEU B O   1 
ATOM   5481 C CB  . LEU B 1 173 ? 102.283 -22.562 356.931 1.00 17.98  ? 174  LEU B CB  1 
ATOM   5482 C CG  . LEU B 1 173 ? 102.559 -21.975 355.545 1.00 23.77  ? 174  LEU B CG  1 
ATOM   5483 C CD1 . LEU B 1 173 ? 101.914 -20.605 355.396 1.00 20.50  ? 174  LEU B CD1 1 
ATOM   5484 C CD2 . LEU B 1 173 ? 104.057 -21.894 355.286 1.00 20.51  ? 174  LEU B CD2 1 
ATOM   5485 N N   . ASP B 1 174 ? 101.570 -25.040 358.966 1.00 18.25  ? 175  ASP B N   1 
ATOM   5486 C CA  . ASP B 1 174 ? 101.435 -25.634 360.293 1.00 18.72  ? 175  ASP B CA  1 
ATOM   5487 C C   . ASP B 1 174 ? 102.589 -26.589 360.570 1.00 20.99  ? 175  ASP B C   1 
ATOM   5488 O O   . ASP B 1 174 ? 103.207 -26.545 361.639 1.00 20.42  ? 175  ASP B O   1 
ATOM   5489 C CB  . ASP B 1 174 ? 100.098 -26.370 360.420 1.00 15.23  ? 175  ASP B CB  1 
ATOM   5490 C CG  . ASP B 1 174 ? 98.900  -25.443 360.330 1.00 21.35  ? 175  ASP B CG  1 
ATOM   5491 O OD1 . ASP B 1 174 ? 99.073  -24.218 360.484 1.00 19.43  ? 175  ASP B OD1 1 
ATOM   5492 O OD2 . ASP B 1 174 ? 97.776  -25.948 360.115 1.00 23.88  ? 175  ASP B OD2 1 
ATOM   5493 N N   . GLN B 1 175 ? 102.894 -27.459 359.602 1.00 18.44  ? 176  GLN B N   1 
ATOM   5494 C CA  . GLN B 1 175 ? 104.011 -28.385 359.753 1.00 17.16  ? 176  GLN B CA  1 
ATOM   5495 C C   . GLN B 1 175 ? 105.328 -27.640 359.930 1.00 18.86  ? 176  GLN B C   1 
ATOM   5496 O O   . GLN B 1 175 ? 106.141 -27.998 360.791 1.00 17.27  ? 176  GLN B O   1 
ATOM   5497 C CB  . GLN B 1 175 ? 104.090 -29.318 358.544 1.00 17.41  ? 176  GLN B CB  1 
ATOM   5498 C CG  . GLN B 1 175 ? 102.853 -30.171 358.306 1.00 13.81  ? 176  GLN B CG  1 
ATOM   5499 C CD  . GLN B 1 175 ? 102.945 -30.970 357.018 1.00 21.85  ? 176  GLN B CD  1 
ATOM   5500 O OE1 . GLN B 1 175 ? 103.978 -30.967 356.347 1.00 18.48  ? 176  GLN B OE1 1 
ATOM   5501 N NE2 . GLN B 1 175 ? 101.864 -31.659 356.666 1.00 14.18  ? 176  GLN B NE2 1 
ATOM   5502 N N   . ARG B 1 176 ? 105.558 -26.599 359.126 1.00 13.40  ? 177  ARG B N   1 
ATOM   5503 C CA  . ARG B 1 176 ? 106.814 -25.862 359.224 1.00 18.44  ? 177  ARG B CA  1 
ATOM   5504 C C   . ARG B 1 176 ? 106.936 -25.149 360.564 1.00 19.29  ? 177  ARG B C   1 
ATOM   5505 O O   . ARG B 1 176 ? 108.029 -25.083 361.139 1.00 17.99  ? 177  ARG B O   1 
ATOM   5506 C CB  . ARG B 1 176 ? 106.934 -24.861 358.076 1.00 14.24  ? 177  ARG B CB  1 
ATOM   5507 C CG  . ARG B 1 176 ? 108.161 -23.970 358.183 1.00 17.41  ? 177  ARG B CG  1 
ATOM   5508 C CD  . ARG B 1 176 ? 108.239 -22.993 357.031 1.00 20.35  ? 177  ARG B CD  1 
ATOM   5509 N NE  . ARG B 1 176 ? 108.525 -23.669 355.771 1.00 25.24  ? 177  ARG B NE  1 
ATOM   5510 C CZ  . ARG B 1 176 ? 108.299 -23.138 354.575 1.00 28.07  ? 177  ARG B CZ  1 
ATOM   5511 N NH1 . ARG B 1 176 ? 107.783 -21.920 354.479 1.00 23.69  ? 177  ARG B NH1 1 
ATOM   5512 N NH2 . ARG B 1 176 ? 108.589 -23.821 353.476 1.00 26.46  ? 177  ARG B NH2 1 
ATOM   5513 N N   . LEU B 1 177 ? 105.827 -24.609 361.077 1.00 19.27  ? 178  LEU B N   1 
ATOM   5514 C CA  . LEU B 1 177 ? 105.859 -23.973 362.390 1.00 18.02  ? 178  LEU B CA  1 
ATOM   5515 C C   . LEU B 1 177 ? 106.254 -24.971 363.470 1.00 16.95  ? 178  LEU B C   1 
ATOM   5516 O O   . LEU B 1 177 ? 107.045 -24.649 364.365 1.00 21.42  ? 178  LEU B O   1 
ATOM   5517 C CB  . LEU B 1 177 ? 104.501 -23.347 362.705 1.00 17.52  ? 178  LEU B CB  1 
ATOM   5518 C CG  . LEU B 1 177 ? 104.396 -22.611 364.042 1.00 21.82  ? 178  LEU B CG  1 
ATOM   5519 C CD1 . LEU B 1 177 ? 105.503 -21.574 364.173 1.00 19.83  ? 178  LEU B CD1 1 
ATOM   5520 C CD2 . LEU B 1 177 ? 103.030 -21.964 364.192 1.00 21.18  ? 178  LEU B CD2 1 
ATOM   5521 N N   . ALA B 1 178 ? 105.719 -26.193 363.399 1.00 17.40  ? 179  ALA B N   1 
ATOM   5522 C CA  . ALA B 1 178 ? 106.127 -27.233 364.338 1.00 18.03  ? 179  ALA B CA  1 
ATOM   5523 C C   . ALA B 1 178 ? 107.607 -27.560 364.185 1.00 21.51  ? 179  ALA B C   1 
ATOM   5524 O O   . ALA B 1 178 ? 108.299 -27.822 365.176 1.00 18.16  ? 179  ALA B O   1 
ATOM   5525 C CB  . ALA B 1 178 ? 105.275 -28.486 364.139 1.00 16.62  ? 179  ALA B CB  1 
ATOM   5526 N N   . LEU B 1 179 ? 108.111 -27.546 362.948 1.00 18.51  ? 180  LEU B N   1 
ATOM   5527 C CA  . LEU B 1 179 ? 109.533 -27.790 362.728 1.00 20.98  ? 180  LEU B CA  1 
ATOM   5528 C C   . LEU B 1 179 ? 110.382 -26.664 363.305 1.00 22.48  ? 180  LEU B C   1 
ATOM   5529 O O   . LEU B 1 179 ? 111.467 -26.911 363.843 1.00 20.86  ? 180  LEU B O   1 
ATOM   5530 C CB  . LEU B 1 179 ? 109.813 -27.969 361.237 1.00 19.70  ? 180  LEU B CB  1 
ATOM   5531 C CG  . LEU B 1 179 ? 109.299 -29.281 360.642 1.00 22.21  ? 180  LEU B CG  1 
ATOM   5532 C CD1 . LEU B 1 179 ? 109.711 -29.417 359.184 1.00 18.74  ? 180  LEU B CD1 1 
ATOM   5533 C CD2 . LEU B 1 179 ? 109.803 -30.457 361.462 1.00 23.66  ? 180  LEU B CD2 1 
ATOM   5534 N N   . GLN B 1 180 ? 109.907 -25.420 363.198 1.00 16.92  ? 181  GLN B N   1 
ATOM   5535 C CA  . GLN B 1 180 ? 110.600 -24.315 363.851 1.00 21.53  ? 181  GLN B CA  1 
ATOM   5536 C C   . GLN B 1 180 ? 110.535 -24.452 365.367 1.00 24.19  ? 181  GLN B C   1 
ATOM   5537 O O   . GLN B 1 180 ? 111.520 -24.179 366.064 1.00 21.17  ? 181  GLN B O   1 
ATOM   5538 C CB  . GLN B 1 180 ? 110.004 -22.982 363.404 1.00 20.47  ? 181  GLN B CB  1 
ATOM   5539 C CG  . GLN B 1 180 ? 110.225 -22.676 361.933 1.00 28.07  ? 181  GLN B CG  1 
ATOM   5540 C CD  . GLN B 1 180 ? 109.386 -21.514 361.443 1.00 36.01  ? 181  GLN B CD  1 
ATOM   5541 O OE1 . GLN B 1 180 ? 108.445 -21.085 362.113 1.00 41.65  ? 181  GLN B OE1 1 
ATOM   5542 N NE2 . GLN B 1 180 ? 109.724 -20.995 360.268 1.00 32.25  ? 181  GLN B NE2 1 
ATOM   5543 N N   . TRP B 1 181 ? 109.382 -24.876 365.890 1.00 19.84  ? 182  TRP B N   1 
ATOM   5544 C CA  . TRP B 1 181 ? 109.267 -25.157 367.318 1.00 22.30  ? 182  TRP B CA  1 
ATOM   5545 C C   . TRP B 1 181 ? 110.277 -26.213 367.747 1.00 22.44  ? 182  TRP B C   1 
ATOM   5546 O O   . TRP B 1 181 ? 110.873 -26.112 368.826 1.00 24.31  ? 182  TRP B O   1 
ATOM   5547 C CB  . TRP B 1 181 ? 107.840 -25.605 367.640 1.00 15.65  ? 182  TRP B CB  1 
ATOM   5548 C CG  . TRP B 1 181 ? 107.526 -25.706 369.104 1.00 16.06  ? 182  TRP B CG  1 
ATOM   5549 C CD1 . TRP B 1 181 ? 106.879 -24.778 369.867 1.00 23.27  ? 182  TRP B CD1 1 
ATOM   5550 C CD2 . TRP B 1 181 ? 107.824 -26.805 369.976 1.00 17.80  ? 182  TRP B CD2 1 
ATOM   5551 N NE1 . TRP B 1 181 ? 106.763 -25.226 371.161 1.00 22.44  ? 182  TRP B NE1 1 
ATOM   5552 C CE2 . TRP B 1 181 ? 107.335 -26.467 371.254 1.00 18.63  ? 182  TRP B CE2 1 
ATOM   5553 C CE3 . TRP B 1 181 ? 108.458 -28.038 369.800 1.00 17.28  ? 182  TRP B CE3 1 
ATOM   5554 C CZ2 . TRP B 1 181 ? 107.465 -27.317 372.350 1.00 19.78  ? 182  TRP B CZ2 1 
ATOM   5555 C CZ3 . TRP B 1 181 ? 108.585 -28.880 370.890 1.00 20.93  ? 182  TRP B CZ3 1 
ATOM   5556 C CH2 . TRP B 1 181 ? 108.090 -28.517 372.148 1.00 17.31  ? 182  TRP B CH2 1 
ATOM   5557 N N   . VAL B 1 182 ? 110.483 -27.231 366.907 1.00 22.58  ? 183  VAL B N   1 
ATOM   5558 C CA  . VAL B 1 182 ? 111.474 -28.264 367.200 1.00 20.23  ? 183  VAL B CA  1 
ATOM   5559 C C   . VAL B 1 182 ? 112.860 -27.647 367.337 1.00 22.99  ? 183  VAL B C   1 
ATOM   5560 O O   . VAL B 1 182 ? 113.597 -27.933 368.287 1.00 21.06  ? 183  VAL B O   1 
ATOM   5561 C CB  . VAL B 1 182 ? 111.446 -29.354 366.112 1.00 17.45  ? 183  VAL B CB  1 
ATOM   5562 C CG1 . VAL B 1 182 ? 112.693 -30.221 366.186 1.00 17.69  ? 183  VAL B CG1 1 
ATOM   5563 C CG2 . VAL B 1 182 ? 110.194 -30.205 366.249 1.00 15.59  ? 183  VAL B CG2 1 
ATOM   5564 N N   . GLN B 1 183 ? 113.230 -26.779 366.391 1.00 16.49  ? 184  GLN B N   1 
ATOM   5565 C CA  . GLN B 1 183 ? 114.545 -26.146 366.440 1.00 29.97  ? 184  GLN B CA  1 
ATOM   5566 C C   . GLN B 1 183 ? 114.733 -25.351 367.725 1.00 23.39  ? 184  GLN B C   1 
ATOM   5567 O O   . GLN B 1 183 ? 115.815 -25.370 368.323 1.00 23.18  ? 184  GLN B O   1 
ATOM   5568 C CB  . GLN B 1 183 ? 114.738 -25.241 365.222 1.00 21.26  ? 184  GLN B CB  1 
ATOM   5569 C CG  . GLN B 1 183 ? 115.029 -25.989 363.935 1.00 21.56  ? 184  GLN B CG  1 
ATOM   5570 C CD  . GLN B 1 183 ? 116.289 -26.826 364.028 1.00 25.88  ? 184  GLN B CD  1 
ATOM   5571 O OE1 . GLN B 1 183 ? 117.384 -26.302 364.234 1.00 31.16  ? 184  GLN B OE1 1 
ATOM   5572 N NE2 . GLN B 1 183 ? 116.139 -28.138 363.884 1.00 19.51  ? 184  GLN B NE2 1 
ATOM   5573 N N   . GLU B 1 184 ? 113.687 -24.661 368.176 1.00 23.27  ? 185  GLU B N   1 
ATOM   5574 C CA  . GLU B 1 184 ? 113.825 -23.756 369.308 1.00 23.84  ? 185  GLU B CA  1 
ATOM   5575 C C   . GLU B 1 184 ? 113.671 -24.442 370.661 1.00 26.08  ? 185  GLU B C   1 
ATOM   5576 O O   . GLU B 1 184 ? 114.193 -23.928 371.655 1.00 35.67  ? 185  GLU B O   1 
ATOM   5577 C CB  . GLU B 1 184 ? 112.809 -22.615 369.189 1.00 29.79  ? 185  GLU B CB  1 
ATOM   5578 C CG  . GLU B 1 184 ? 113.054 -21.701 367.994 1.00 45.55  ? 185  GLU B CG  1 
ATOM   5579 C CD  . GLU B 1 184 ? 112.016 -20.600 367.867 1.00 58.03  ? 185  GLU B CD  1 
ATOM   5580 O OE1 . GLU B 1 184 ? 111.909 -20.009 366.771 1.00 60.47  ? 185  GLU B OE1 1 
ATOM   5581 O OE2 . GLU B 1 184 ? 111.309 -20.326 368.859 1.00 62.53  ? 185  GLU B OE2 1 
ATOM   5582 N N   . ASN B 1 185 ? 112.989 -25.590 370.734 1.00 24.81  ? 186  ASN B N   1 
ATOM   5583 C CA  . ASN B 1 185 ? 112.619 -26.148 372.029 1.00 23.89  ? 186  ASN B CA  1 
ATOM   5584 C C   . ASN B 1 185 ? 113.002 -27.603 372.267 1.00 24.05  ? 186  ASN B C   1 
ATOM   5585 O O   . ASN B 1 185 ? 112.890 -28.056 373.411 1.00 23.90  ? 186  ASN B O   1 
ATOM   5586 C CB  . ASN B 1 185 ? 111.104 -26.019 372.252 1.00 24.38  ? 186  ASN B CB  1 
ATOM   5587 C CG  . ASN B 1 185 ? 110.630 -24.584 372.211 1.00 25.26  ? 186  ASN B CG  1 
ATOM   5588 O OD1 . ASN B 1 185 ? 110.830 -23.826 373.158 1.00 28.52  ? 186  ASN B OD1 1 
ATOM   5589 N ND2 . ASN B 1 185 ? 109.989 -24.203 371.112 1.00 22.61  ? 186  ASN B ND2 1 
ATOM   5590 N N   . VAL B 1 186 ? 113.442 -28.352 371.252 1.00 19.41  ? 187  VAL B N   1 
ATOM   5591 C CA  . VAL B 1 186 ? 113.594 -29.791 371.454 1.00 22.04  ? 187  VAL B CA  1 
ATOM   5592 C C   . VAL B 1 186 ? 114.753 -30.102 372.397 1.00 21.80  ? 187  VAL B C   1 
ATOM   5593 O O   . VAL B 1 186 ? 114.748 -31.141 373.069 1.00 25.65  ? 187  VAL B O   1 
ATOM   5594 C CB  . VAL B 1 186 ? 113.745 -30.522 370.105 1.00 22.43  ? 187  VAL B CB  1 
ATOM   5595 C CG1 . VAL B 1 186 ? 115.168 -30.412 369.574 1.00 17.28  ? 187  VAL B CG1 1 
ATOM   5596 C CG2 . VAL B 1 186 ? 113.326 -31.980 370.245 1.00 20.83  ? 187  VAL B CG2 1 
ATOM   5597 N N   . ALA B 1 187 ? 115.747 -29.213 372.486 1.00 23.13  ? 188  ALA B N   1 
ATOM   5598 C CA  . ALA B 1 187 ? 116.868 -29.456 373.390 1.00 23.16  ? 188  ALA B CA  1 
ATOM   5599 C C   . ALA B 1 187 ? 116.424 -29.455 374.846 1.00 25.64  ? 188  ALA B C   1 
ATOM   5600 O O   . ALA B 1 187 ? 117.042 -30.124 375.683 1.00 29.45  ? 188  ALA B O   1 
ATOM   5601 C CB  . ALA B 1 187 ? 117.965 -28.414 373.169 1.00 23.78  ? 188  ALA B CB  1 
ATOM   5602 N N   . ALA B 1 188 ? 115.358 -28.719 375.168 1.00 27.17  ? 189  ALA B N   1 
ATOM   5603 C CA  . ALA B 1 188 ? 114.807 -28.756 376.518 1.00 26.56  ? 189  ALA B CA  1 
ATOM   5604 C C   . ALA B 1 188 ? 114.324 -30.149 376.897 1.00 29.63  ? 189  ALA B C   1 
ATOM   5605 O O   . ALA B 1 188 ? 114.181 -30.442 378.089 1.00 27.47  ? 189  ALA B O   1 
ATOM   5606 C CB  . ALA B 1 188 ? 113.662 -27.750 376.648 1.00 23.39  ? 189  ALA B CB  1 
ATOM   5607 N N   . PHE B 1 189 ? 114.074 -31.009 375.911 1.00 21.25  ? 190  PHE B N   1 
ATOM   5608 C CA  . PHE B 1 189 ? 113.665 -32.388 376.134 1.00 29.71  ? 190  PHE B CA  1 
ATOM   5609 C C   . PHE B 1 189 ? 114.814 -33.376 375.987 1.00 32.32  ? 190  PHE B C   1 
ATOM   5610 O O   . PHE B 1 189 ? 114.602 -34.581 376.155 1.00 29.29  ? 190  PHE B O   1 
ATOM   5611 C CB  . PHE B 1 189 ? 112.544 -32.769 375.160 1.00 22.38  ? 190  PHE B CB  1 
ATOM   5612 C CG  . PHE B 1 189 ? 111.312 -31.921 375.286 1.00 25.42  ? 190  PHE B CG  1 
ATOM   5613 C CD1 . PHE B 1 189 ? 111.194 -30.733 374.582 1.00 20.62  ? 190  PHE B CD1 1 
ATOM   5614 C CD2 . PHE B 1 189 ? 110.264 -32.319 376.100 1.00 18.45  ? 190  PHE B CD2 1 
ATOM   5615 C CE1 . PHE B 1 189 ? 110.059 -29.953 374.695 1.00 20.60  ? 190  PHE B CE1 1 
ATOM   5616 C CE2 . PHE B 1 189 ? 109.126 -31.544 376.217 1.00 25.65  ? 190  PHE B CE2 1 
ATOM   5617 C CZ  . PHE B 1 189 ? 109.022 -30.360 375.512 1.00 21.65  ? 190  PHE B CZ  1 
ATOM   5618 N N   . GLY B 1 190 ? 116.018 -32.902 375.676 1.00 27.59  ? 191  GLY B N   1 
ATOM   5619 C CA  . GLY B 1 190 ? 117.147 -33.769 375.419 1.00 26.38  ? 191  GLY B CA  1 
ATOM   5620 C C   . GLY B 1 190 ? 117.403 -34.063 373.958 1.00 29.26  ? 191  GLY B C   1 
ATOM   5621 O O   . GLY B 1 190 ? 118.378 -34.758 373.646 1.00 28.48  ? 191  GLY B O   1 
ATOM   5622 N N   . GLY B 1 191 ? 116.562 -33.557 373.054 1.00 24.32  ? 192  GLY B N   1 
ATOM   5623 C CA  . GLY B 1 191 ? 116.765 -33.793 371.643 1.00 27.57  ? 192  GLY B CA  1 
ATOM   5624 C C   . GLY B 1 191 ? 117.813 -32.879 371.037 1.00 28.93  ? 192  GLY B C   1 
ATOM   5625 O O   . GLY B 1 191 ? 118.101 -31.791 371.535 1.00 36.13  ? 192  GLY B O   1 
ATOM   5626 N N   . ASP B 1 192 ? 118.388 -33.345 369.928 1.00 26.58  ? 193  ASP B N   1 
ATOM   5627 C CA  . ASP B 1 192 ? 119.443 -32.625 369.233 1.00 25.73  ? 193  ASP B CA  1 
ATOM   5628 C C   . ASP B 1 192 ? 118.851 -31.917 368.026 1.00 26.78  ? 193  ASP B C   1 
ATOM   5629 O O   . ASP B 1 192 ? 118.550 -32.579 367.021 1.00 28.28  ? 193  ASP B O   1 
ATOM   5630 C CB  . ASP B 1 192 ? 120.545 -33.592 368.799 1.00 30.01  ? 193  ASP B CB  1 
ATOM   5631 C CG  . ASP B 1 192 ? 121.691 -32.904 368.072 1.00 33.71  ? 193  ASP B CG  1 
ATOM   5632 O OD1 . ASP B 1 192 ? 121.691 -31.660 367.953 1.00 35.43  ? 193  ASP B OD1 1 
ATOM   5633 O OD2 . ASP B 1 192 ? 122.607 -33.623 367.617 1.00 39.15  ? 193  ASP B OD2 1 
ATOM   5634 N N   . PRO B 1 193 ? 118.681 -30.591 368.057 1.00 27.26  ? 194  PRO B N   1 
ATOM   5635 C CA  . PRO B 1 193 ? 118.095 -29.896 366.899 1.00 21.70  ? 194  PRO B CA  1 
ATOM   5636 C C   . PRO B 1 193 ? 118.958 -29.951 365.649 1.00 28.23  ? 194  PRO B C   1 
ATOM   5637 O O   . PRO B 1 193 ? 118.461 -29.618 364.566 1.00 25.34  ? 194  PRO B O   1 
ATOM   5638 C CB  . PRO B 1 193 ? 117.937 -28.455 367.399 1.00 27.36  ? 194  PRO B CB  1 
ATOM   5639 C CG  . PRO B 1 193 ? 118.993 -28.313 368.445 1.00 23.44  ? 194  PRO B CG  1 
ATOM   5640 C CD  . PRO B 1 193 ? 119.064 -29.653 369.127 1.00 22.41  ? 194  PRO B CD  1 
ATOM   5641 N N   . THR B 1 194 ? 120.222 -30.356 365.759 1.00 24.66  ? 195  THR B N   1 
ATOM   5642 C CA  . THR B 1 194 ? 121.101 -30.491 364.605 1.00 30.72  ? 195  THR B CA  1 
ATOM   5643 C C   . THR B 1 194 ? 121.028 -31.869 363.961 1.00 32.41  ? 195  THR B C   1 
ATOM   5644 O O   . THR B 1 194 ? 121.767 -32.128 363.005 1.00 36.96  ? 195  THR B O   1 
ATOM   5645 C CB  . THR B 1 194 ? 122.552 -30.190 364.999 1.00 33.23  ? 195  THR B CB  1 
ATOM   5646 O OG1 . THR B 1 194 ? 123.052 -31.240 365.836 1.00 35.09  ? 195  THR B OG1 1 
ATOM   5647 C CG2 . THR B 1 194 ? 122.643 -28.865 365.744 1.00 32.38  ? 195  THR B CG2 1 
ATOM   5648 N N   . SER B 1 195 ? 120.157 -32.763 364.456 1.00 27.12  ? 196  SER B N   1 
ATOM   5649 C CA  . SER B 1 195 ? 119.975 -34.097 363.873 1.00 29.51  ? 196  SER B CA  1 
ATOM   5650 C C   . SER B 1 195 ? 118.471 -34.390 363.867 1.00 29.83  ? 196  SER B C   1 
ATOM   5651 O O   . SER B 1 195 ? 117.950 -35.135 364.700 1.00 26.48  ? 196  SER B O   1 
ATOM   5652 C CB  . SER B 1 195 ? 120.765 -35.161 364.633 1.00 33.23  ? 196  SER B CB  1 
ATOM   5653 O OG  . SER B 1 195 ? 120.572 -36.442 364.057 1.00 36.22  ? 196  SER B OG  1 
ATOM   5654 N N   . VAL B 1 196 ? 117.776 -33.786 362.905 1.00 24.23  ? 197  VAL B N   1 
ATOM   5655 C CA  . VAL B 1 196 ? 116.331 -33.916 362.755 1.00 17.58  ? 197  VAL B CA  1 
ATOM   5656 C C   . VAL B 1 196 ? 116.067 -34.742 361.503 1.00 23.25  ? 197  VAL B C   1 
ATOM   5657 O O   . VAL B 1 196 ? 116.531 -34.391 360.413 1.00 21.30  ? 197  VAL B O   1 
ATOM   5658 C CB  . VAL B 1 196 ? 115.649 -32.543 362.656 1.00 23.14  ? 197  VAL B CB  1 
ATOM   5659 C CG1 . VAL B 1 196 ? 114.170 -32.704 362.332 1.00 18.91  ? 197  VAL B CG1 1 
ATOM   5660 C CG2 . VAL B 1 196 ? 115.846 -31.757 363.941 1.00 21.38  ? 197  VAL B CG2 1 
ATOM   5661 N N   . THR B 1 197 ? 115.326 -35.835 361.658 1.00 21.35  ? 198  THR B N   1 
ATOM   5662 C CA  . THR B 1 197 ? 114.918 -36.673 360.534 1.00 16.79  ? 198  THR B CA  1 
ATOM   5663 C C   . THR B 1 197 ? 113.403 -36.612 360.393 1.00 22.30  ? 198  THR B C   1 
ATOM   5664 O O   . THR B 1 197 ? 112.672 -36.987 361.318 1.00 22.51  ? 198  THR B O   1 
ATOM   5665 C CB  . THR B 1 197 ? 115.378 -38.121 360.715 1.00 21.10  ? 198  THR B CB  1 
ATOM   5666 O OG1 . THR B 1 197 ? 116.797 -38.154 360.914 1.00 22.64  ? 198  THR B OG1 1 
ATOM   5667 C CG2 . THR B 1 197 ? 115.026 -38.946 359.488 1.00 18.15  ? 198  THR B CG2 1 
ATOM   5668 N N   . LEU B 1 198 ? 112.939 -36.131 359.244 1.00 19.77  ? 199  LEU B N   1 
ATOM   5669 C CA  . LEU B 1 198 ? 111.519 -36.141 358.928 1.00 20.71  ? 199  LEU B CA  1 
ATOM   5670 C C   . LEU B 1 198 ? 111.120 -37.498 358.369 1.00 24.14  ? 199  LEU B C   1 
ATOM   5671 O O   . LEU B 1 198 ? 111.812 -38.058 357.514 1.00 28.62  ? 199  LEU B O   1 
ATOM   5672 C CB  . LEU B 1 198 ? 111.188 -35.060 357.898 1.00 21.63  ? 199  LEU B CB  1 
ATOM   5673 C CG  . LEU B 1 198 ? 111.116 -33.589 358.296 1.00 27.19  ? 199  LEU B CG  1 
ATOM   5674 C CD1 . LEU B 1 198 ? 110.681 -32.758 357.098 1.00 21.62  ? 199  LEU B CD1 1 
ATOM   5675 C CD2 . LEU B 1 198 ? 110.155 -33.400 359.445 1.00 37.73  ? 199  LEU B CD2 1 
ATOM   5676 N N   . PHE B 1 199 ? 109.997 -38.029 358.844 1.00 15.25  ? 200  PHE B N   1 
ATOM   5677 C CA  . PHE B 1 199 ? 109.414 -39.183 358.179 1.00 17.89  ? 200  PHE B CA  1 
ATOM   5678 C C   . PHE B 1 199 ? 107.897 -39.090 358.219 1.00 17.78  ? 200  PHE B C   1 
ATOM   5679 O O   . PHE B 1 199 ? 107.308 -38.526 359.143 1.00 21.99  ? 200  PHE B O   1 
ATOM   5680 C CB  . PHE B 1 199 ? 109.937 -40.524 358.750 1.00 17.94  ? 200  PHE B CB  1 
ATOM   5681 C CG  . PHE B 1 199 ? 109.446 -40.886 360.129 1.00 20.00  ? 200  PHE B CG  1 
ATOM   5682 C CD1 . PHE B 1 199 ? 108.918 -42.149 360.360 1.00 23.59  ? 200  PHE B CD1 1 
ATOM   5683 C CD2 . PHE B 1 199 ? 109.578 -40.018 361.199 1.00 21.63  ? 200  PHE B CD2 1 
ATOM   5684 C CE1 . PHE B 1 199 ? 108.493 -42.525 361.620 1.00 28.53  ? 200  PHE B CE1 1 
ATOM   5685 C CE2 . PHE B 1 199 ? 109.150 -40.389 362.466 1.00 16.14  ? 200  PHE B CE2 1 
ATOM   5686 C CZ  . PHE B 1 199 ? 108.606 -41.643 362.674 1.00 24.63  ? 200  PHE B CZ  1 
ATOM   5687 N N   . GLY B 1 200 ? 107.283 -39.613 357.164 1.00 17.61  ? 201  GLY B N   1 
ATOM   5688 C CA  . GLY B 1 200 ? 105.846 -39.562 356.992 1.00 14.20  ? 201  GLY B CA  1 
ATOM   5689 C C   . GLY B 1 200 ? 105.432 -40.593 355.971 1.00 15.79  ? 201  GLY B C   1 
ATOM   5690 O O   . GLY B 1 200 ? 106.258 -41.145 355.239 1.00 20.08  ? 201  GLY B O   1 
ATOM   5691 N N   . GLU B 1 201 ? 104.131 -40.852 355.931 1.00 17.17  ? 202  GLU B N   1 
ATOM   5692 C CA  . GLU B 1 201 ? 103.575 -41.865 355.052 1.00 17.84  ? 202  GLU B CA  1 
ATOM   5693 C C   . GLU B 1 201 ? 102.423 -41.271 354.258 1.00 19.96  ? 202  GLU B C   1 
ATOM   5694 O O   . GLU B 1 201 ? 101.639 -40.477 354.788 1.00 20.99  ? 202  GLU B O   1 
ATOM   5695 C CB  . GLU B 1 201 ? 103.117 -43.091 355.860 1.00 17.45  ? 202  GLU B CB  1 
ATOM   5696 C CG  . GLU B 1 201 ? 102.571 -44.239 355.029 1.00 21.45  ? 202  GLU B CG  1 
ATOM   5697 C CD  . GLU B 1 201 ? 101.095 -44.090 354.736 1.00 31.64  ? 202  GLU B CD  1 
ATOM   5698 O OE1 . GLU B 1 201 ? 100.455 -43.207 355.345 1.00 25.83  ? 202  GLU B OE1 1 
ATOM   5699 O OE2 . GLU B 1 201 ? 100.576 -44.851 353.895 1.00 31.40  ? 202  GLU B OE2 1 
ATOM   5700 N N   . SER B 1 202 ? 102.332 -41.655 352.982 1.00 21.33  ? 203  SER B N   1 
ATOM   5701 C CA  . SER B 1 202 ? 101.274 -41.217 352.063 1.00 27.07  ? 203  SER B CA  1 
ATOM   5702 C C   . SER B 1 202 ? 101.326 -39.697 351.972 1.00 17.67  ? 203  SER B C   1 
ATOM   5703 O O   . SER B 1 202 ? 102.366 -39.162 351.548 1.00 20.11  ? 203  SER B O   1 
ATOM   5704 C CB  . SER B 1 202 ? 99.939  -41.810 352.515 1.00 58.54  ? 203  SER B CB  1 
ATOM   5705 O OG  . SER B 1 202 ? 98.968  -41.719 351.489 1.00 91.46  ? 203  SER B OG  1 
ATOM   5706 N N   . ALA B 1 203 ? 100.268 -38.969 352.341 1.00 13.00  ? 204  ALA B N   1 
ATOM   5707 C CA  . ALA B 1 203 ? 100.313 -37.512 352.281 1.00 19.59  ? 204  ALA B CA  1 
ATOM   5708 C C   . ALA B 1 203 ? 101.367 -36.948 353.222 1.00 17.84  ? 204  ALA B C   1 
ATOM   5709 O O   . ALA B 1 203 ? 101.882 -35.848 352.991 1.00 17.80  ? 204  ALA B O   1 
ATOM   5710 C CB  . ALA B 1 203 ? 98.938  -36.928 352.607 1.00 12.89  ? 204  ALA B CB  1 
ATOM   5711 N N   . GLY B 1 204 ? 101.696 -37.680 354.288 1.00 17.59  ? 205  GLY B N   1 
ATOM   5712 C CA  . GLY B 1 204 ? 102.807 -37.274 355.132 1.00 13.19  ? 205  GLY B CA  1 
ATOM   5713 C C   . GLY B 1 204 ? 104.135 -37.360 354.407 1.00 17.47  ? 205  GLY B C   1 
ATOM   5714 O O   . GLY B 1 204 ? 104.993 -36.485 354.556 1.00 18.29  ? 205  GLY B O   1 
ATOM   5715 N N   . ALA B 1 205 ? 104.323 -38.414 353.606 1.00 15.09  ? 206  ALA B N   1 
ATOM   5716 C CA  . ALA B 1 205 ? 105.519 -38.509 352.777 1.00 16.72  ? 206  ALA B CA  1 
ATOM   5717 C C   . ALA B 1 205 ? 105.539 -37.415 351.718 1.00 20.70  ? 206  ALA B C   1 
ATOM   5718 O O   . ALA B 1 205 ? 106.588 -36.814 351.457 1.00 14.96  ? 206  ALA B O   1 
ATOM   5719 C CB  . ALA B 1 205 ? 105.600 -39.890 352.126 1.00 13.09  ? 206  ALA B CB  1 
ATOM   5720 N N   . ALA B 1 206 ? 104.388 -37.143 351.095 1.00 14.17  ? 207  ALA B N   1 
ATOM   5721 C CA  . ALA B 1 206 ? 104.302 -36.026 350.160 1.00 12.87  ? 207  ALA B CA  1 
ATOM   5722 C C   . ALA B 1 206 ? 104.656 -34.714 350.847 1.00 18.15  ? 207  ALA B C   1 
ATOM   5723 O O   . ALA B 1 206 ? 105.328 -33.858 350.260 1.00 20.13  ? 207  ALA B O   1 
ATOM   5724 C CB  . ALA B 1 206 ? 102.902 -35.956 349.550 1.00 13.02  ? 207  ALA B CB  1 
ATOM   5725 N N   . SER B 1 207 ? 104.217 -34.545 352.097 1.00 14.45  ? 208  SER B N   1 
ATOM   5726 C CA  . SER B 1 207 ? 104.583 -33.360 352.866 1.00 12.35  ? 208  SER B CA  1 
ATOM   5727 C C   . SER B 1 207 ? 106.090 -33.287 353.075 1.00 16.94  ? 208  SER B C   1 
ATOM   5728 O O   . SER B 1 207 ? 106.704 -32.229 352.895 1.00 19.56  ? 208  SER B O   1 
ATOM   5729 C CB  . SER B 1 207 ? 103.858 -33.368 354.212 1.00 12.14  ? 208  SER B CB  1 
ATOM   5730 O OG  . SER B 1 207 ? 102.465 -33.166 354.047 1.00 15.41  ? 208  SER B OG  1 
ATOM   5731 N N   . VAL B 1 208 ? 106.701 -34.411 353.464 1.00 15.40  ? 209  VAL B N   1 
ATOM   5732 C CA  . VAL B 1 208 ? 108.147 -34.453 353.675 1.00 19.55  ? 209  VAL B CA  1 
ATOM   5733 C C   . VAL B 1 208 ? 108.877 -34.005 352.416 1.00 20.72  ? 209  VAL B C   1 
ATOM   5734 O O   . VAL B 1 208 ? 109.817 -33.202 352.469 1.00 20.38  ? 209  VAL B O   1 
ATOM   5735 C CB  . VAL B 1 208 ? 108.584 -35.865 354.106 1.00 18.26  ? 209  VAL B CB  1 
ATOM   5736 C CG1 . VAL B 1 208 ? 110.093 -36.007 354.011 1.00 18.95  ? 209  VAL B CG1 1 
ATOM   5737 C CG2 . VAL B 1 208 ? 108.105 -36.163 355.517 1.00 13.90  ? 209  VAL B CG2 1 
ATOM   5738 N N   . GLY B 1 209 ? 108.443 -34.511 351.260 1.00 16.82  ? 210  GLY B N   1 
ATOM   5739 C CA  . GLY B 1 209 ? 109.068 -34.115 350.011 1.00 16.15  ? 210  GLY B CA  1 
ATOM   5740 C C   . GLY B 1 209 ? 108.912 -32.635 349.720 1.00 17.65  ? 210  GLY B C   1 
ATOM   5741 O O   . GLY B 1 209 ? 109.819 -32.001 349.176 1.00 20.83  ? 210  GLY B O   1 
ATOM   5742 N N   . MET B 1 210 ? 107.764 -32.060 350.083 1.00 16.78  ? 211  MET B N   1 
ATOM   5743 C CA  . MET B 1 210 ? 107.551 -30.641 349.818 1.00 18.45  ? 211  MET B CA  1 
ATOM   5744 C C   . MET B 1 210 ? 108.411 -29.765 350.721 1.00 21.27  ? 211  MET B C   1 
ATOM   5745 O O   . MET B 1 210 ? 108.815 -28.670 350.314 1.00 20.57  ? 211  MET B O   1 
ATOM   5746 C CB  . MET B 1 210 ? 106.070 -30.300 349.963 1.00 21.37  ? 211  MET B CB  1 
ATOM   5747 C CG  . MET B 1 210 ? 105.234 -30.849 348.815 1.00 25.07  ? 211  MET B CG  1 
ATOM   5748 S SD  . MET B 1 210 ? 103.460 -30.662 349.033 1.00 34.02  ? 211  MET B SD  1 
ATOM   5749 C CE  . MET B 1 210 ? 102.855 -31.984 347.986 1.00 27.02  ? 211  MET B CE  1 
ATOM   5750 N N   . HIS B 1 211 ? 108.710 -30.225 351.938 1.00 18.28  ? 212  HIS B N   1 
ATOM   5751 C CA  . HIS B 1 211 ? 109.679 -29.512 352.762 1.00 21.48  ? 212  HIS B CA  1 
ATOM   5752 C C   . HIS B 1 211 ? 111.087 -29.639 352.194 1.00 20.00  ? 212  HIS B C   1 
ATOM   5753 O O   . HIS B 1 211 ? 111.895 -28.714 352.331 1.00 15.65  ? 212  HIS B O   1 
ATOM   5754 C CB  . HIS B 1 211 ? 109.626 -30.023 354.202 1.00 16.06  ? 212  HIS B CB  1 
ATOM   5755 C CG  . HIS B 1 211 ? 108.359 -29.668 354.917 1.00 19.38  ? 212  HIS B CG  1 
ATOM   5756 N ND1 . HIS B 1 211 ? 107.987 -28.365 355.168 1.00 17.35  ? 212  HIS B ND1 1 
ATOM   5757 C CD2 . HIS B 1 211 ? 107.374 -30.445 355.426 1.00 19.11  ? 212  HIS B CD2 1 
ATOM   5758 C CE1 . HIS B 1 211 ? 106.829 -28.355 355.804 1.00 18.98  ? 212  HIS B CE1 1 
ATOM   5759 N NE2 . HIS B 1 211 ? 106.436 -29.604 355.973 1.00 19.97  ? 212  HIS B NE2 1 
ATOM   5760 N N   . LEU B 1 212 ? 111.393 -30.767 351.547 1.00 19.96  ? 213  LEU B N   1 
ATOM   5761 C CA  . LEU B 1 212 ? 112.667 -30.901 350.849 1.00 22.89  ? 213  LEU B CA  1 
ATOM   5762 C C   . LEU B 1 212 ? 112.786 -29.899 349.709 1.00 29.73  ? 213  LEU B C   1 
ATOM   5763 O O   . LEU B 1 212 ? 113.892 -29.447 349.391 1.00 34.26  ? 213  LEU B O   1 
ATOM   5764 C CB  . LEU B 1 212 ? 112.825 -32.323 350.308 1.00 25.01  ? 213  LEU B CB  1 
ATOM   5765 C CG  . LEU B 1 212 ? 113.316 -33.407 351.268 1.00 34.69  ? 213  LEU B CG  1 
ATOM   5766 C CD1 . LEU B 1 212 ? 113.270 -34.772 350.596 1.00 30.52  ? 213  LEU B CD1 1 
ATOM   5767 C CD2 . LEU B 1 212 ? 114.720 -33.089 351.748 1.00 36.34  ? 213  LEU B CD2 1 
ATOM   5768 N N   . LEU B 1 213 ? 111.664 -29.539 349.089 1.00 23.25  ? 214  LEU B N   1 
ATOM   5769 C CA  . LEU B 1 213 ? 111.650 -28.689 347.907 1.00 22.61  ? 214  LEU B CA  1 
ATOM   5770 C C   . LEU B 1 213 ? 111.369 -27.227 348.223 1.00 23.77  ? 214  LEU B C   1 
ATOM   5771 O O   . LEU B 1 213 ? 111.275 -26.415 347.298 1.00 26.59  ? 214  LEU B O   1 
ATOM   5772 C CB  . LEU B 1 213 ? 110.609 -29.210 346.911 1.00 23.36  ? 214  LEU B CB  1 
ATOM   5773 C CG  . LEU B 1 213 ? 110.819 -30.657 346.460 1.00 24.36  ? 214  LEU B CG  1 
ATOM   5774 C CD1 . LEU B 1 213 ? 109.774 -31.069 345.435 1.00 18.73  ? 214  LEU B CD1 1 
ATOM   5775 C CD2 . LEU B 1 213 ? 112.224 -30.839 345.904 1.00 24.39  ? 214  LEU B CD2 1 
ATOM   5776 N N   . SER B 1 214 ? 111.227 -26.874 349.495 1.00 22.86  ? 215  SER B N   1 
ATOM   5777 C CA  . SER B 1 214 ? 110.939 -25.498 349.899 1.00 24.53  ? 215  SER B CA  1 
ATOM   5778 C C   . SER B 1 214 ? 112.081 -24.983 350.764 1.00 27.60  ? 215  SER B C   1 
ATOM   5779 O O   . SER B 1 214 ? 112.278 -25.486 351.886 1.00 26.47  ? 215  SER B O   1 
ATOM   5780 C CB  . SER B 1 214 ? 109.611 -25.422 350.653 1.00 22.82  ? 215  SER B CB  1 
ATOM   5781 O OG  . SER B 1 214 ? 109.147 -24.087 350.741 1.00 22.34  ? 215  SER B OG  1 
ATOM   5782 N N   . PRO B 1 215 ? 112.848 -24.001 350.296 1.00 27.97  ? 216  PRO B N   1 
ATOM   5783 C CA  . PRO B 1 215 ? 114.060 -23.569 351.018 1.00 28.23  ? 216  PRO B CA  1 
ATOM   5784 C C   . PRO B 1 215 ? 113.788 -23.142 352.453 1.00 29.04  ? 216  PRO B C   1 
ATOM   5785 O O   . PRO B 1 215 ? 114.592 -23.466 353.340 1.00 29.78  ? 216  PRO B O   1 
ATOM   5786 C CB  . PRO B 1 215 ? 114.573 -22.399 350.164 1.00 28.22  ? 216  PRO B CB  1 
ATOM   5787 C CG  . PRO B 1 215 ? 114.124 -22.755 348.783 1.00 31.31  ? 216  PRO B CG  1 
ATOM   5788 C CD  . PRO B 1 215 ? 112.766 -23.397 348.953 1.00 30.80  ? 216  PRO B CD  1 
ATOM   5789 N N   . PRO B 1 216 ? 112.700 -22.412 352.749 1.00 27.71  ? 217  PRO B N   1 
ATOM   5790 C CA  . PRO B 1 216 ? 112.451 -22.058 354.160 1.00 29.64  ? 217  PRO B CA  1 
ATOM   5791 C C   . PRO B 1 216 ? 112.268 -23.257 355.079 1.00 34.19  ? 217  PRO B C   1 
ATOM   5792 O O   . PRO B 1 216 ? 112.465 -23.117 356.293 1.00 37.50  ? 217  PRO B O   1 
ATOM   5793 C CB  . PRO B 1 216 ? 111.178 -21.202 354.094 1.00 25.23  ? 217  PRO B CB  1 
ATOM   5794 C CG  . PRO B 1 216 ? 111.183 -20.637 352.736 1.00 25.55  ? 217  PRO B CG  1 
ATOM   5795 C CD  . PRO B 1 216 ? 111.746 -21.715 351.863 1.00 24.80  ? 217  PRO B CD  1 
ATOM   5796 N N   . SER B 1 217 ? 111.900 -24.425 354.551 1.00 26.15  ? 218  SER B N   1 
ATOM   5797 C CA  . SER B 1 217 ? 111.802 -25.629 355.368 1.00 27.41  ? 218  SER B CA  1 
ATOM   5798 C C   . SER B 1 217 ? 113.104 -26.413 355.422 1.00 30.31  ? 218  SER B C   1 
ATOM   5799 O O   . SER B 1 217 ? 113.347 -27.127 356.402 1.00 28.66  ? 218  SER B O   1 
ATOM   5800 C CB  . SER B 1 217 ? 110.698 -26.550 354.840 1.00 20.85  ? 218  SER B CB  1 
ATOM   5801 O OG  . SER B 1 217 ? 109.417 -25.966 354.983 1.00 23.53  ? 218  SER B OG  1 
ATOM   5802 N N   . ARG B 1 218 ? 113.945 -26.288 354.392 1.00 35.01  ? 219  ARG B N   1 
ATOM   5803 C CA  . ARG B 1 218 ? 115.103 -27.167 354.256 1.00 40.92  ? 219  ARG B CA  1 
ATOM   5804 C C   . ARG B 1 218 ? 116.086 -27.003 355.409 1.00 34.98  ? 219  ARG B C   1 
ATOM   5805 O O   . ARG B 1 218 ? 116.760 -27.968 355.789 1.00 34.69  ? 219  ARG B O   1 
ATOM   5806 C CB  . ARG B 1 218 ? 115.792 -26.905 352.917 1.00 47.02  ? 219  ARG B CB  1 
ATOM   5807 C CG  . ARG B 1 218 ? 116.870 -27.910 352.556 1.00 51.82  ? 219  ARG B CG  1 
ATOM   5808 C CD  . ARG B 1 218 ? 116.323 -29.326 352.497 1.00 50.26  ? 219  ARG B CD  1 
ATOM   5809 N NE  . ARG B 1 218 ? 117.397 -30.302 352.336 1.00 55.43  ? 219  ARG B NE  1 
ATOM   5810 C CZ  . ARG B 1 218 ? 118.026 -30.894 353.346 1.00 55.07  ? 219  ARG B CZ  1 
ATOM   5811 N NH1 . ARG B 1 218 ? 117.685 -30.615 354.596 1.00 48.25  ? 219  ARG B NH1 1 
ATOM   5812 N NH2 . ARG B 1 218 ? 118.996 -31.767 353.107 1.00 52.25  ? 219  ARG B NH2 1 
ATOM   5813 N N   . GLY B 1 219 ? 116.179 -25.808 355.982 1.00 29.06  ? 220  GLY B N   1 
ATOM   5814 C CA  . GLY B 1 219 ? 117.072 -25.591 357.100 1.00 19.79  ? 220  GLY B CA  1 
ATOM   5815 C C   . GLY B 1 219 ? 116.594 -26.103 358.439 1.00 28.00  ? 220  GLY B C   1 
ATOM   5816 O O   . GLY B 1 219 ? 117.290 -25.916 359.440 1.00 33.20  ? 220  GLY B O   1 
ATOM   5817 N N   . LEU B 1 220 ? 115.432 -26.753 358.499 1.00 25.94  ? 221  LEU B N   1 
ATOM   5818 C CA  . LEU B 1 220 ? 114.855 -27.190 359.764 1.00 24.70  ? 221  LEU B CA  1 
ATOM   5819 C C   . LEU B 1 220 ? 114.954 -28.696 359.979 1.00 26.24  ? 221  LEU B C   1 
ATOM   5820 O O   . LEU B 1 220 ? 114.445 -29.201 360.986 1.00 31.69  ? 221  LEU B O   1 
ATOM   5821 C CB  . LEU B 1 220 ? 113.397 -26.734 359.860 1.00 19.08  ? 221  LEU B CB  1 
ATOM   5822 C CG  . LEU B 1 220 ? 113.171 -25.253 359.544 1.00 23.02  ? 221  LEU B CG  1 
ATOM   5823 C CD1 . LEU B 1 220 ? 111.693 -24.955 359.342 1.00 22.61  ? 221  LEU B CD1 1 
ATOM   5824 C CD2 . LEU B 1 220 ? 113.760 -24.374 360.638 1.00 16.76  ? 221  LEU B CD2 1 
ATOM   5825 N N   . PHE B 1 221 ? 115.602 -29.421 359.072 1.00 19.22  ? 222  PHE B N   1 
ATOM   5826 C CA  . PHE B 1 221 ? 115.813 -30.854 359.238 1.00 20.66  ? 222  PHE B CA  1 
ATOM   5827 C C   . PHE B 1 221 ? 116.990 -31.267 358.366 1.00 22.38  ? 222  PHE B C   1 
ATOM   5828 O O   . PHE B 1 221 ? 117.524 -30.469 357.591 1.00 23.30  ? 222  PHE B O   1 
ATOM   5829 C CB  . PHE B 1 221 ? 114.551 -31.656 358.899 1.00 15.83  ? 222  PHE B CB  1 
ATOM   5830 C CG  . PHE B 1 221 ? 114.130 -31.550 357.466 1.00 20.02  ? 222  PHE B CG  1 
ATOM   5831 C CD1 . PHE B 1 221 ? 113.484 -30.416 357.001 1.00 21.92  ? 222  PHE B CD1 1 
ATOM   5832 C CD2 . PHE B 1 221 ? 114.371 -32.588 356.583 1.00 23.16  ? 222  PHE B CD2 1 
ATOM   5833 C CE1 . PHE B 1 221 ? 113.095 -30.316 355.681 1.00 24.46  ? 222  PHE B CE1 1 
ATOM   5834 C CE2 . PHE B 1 221 ? 113.982 -32.497 355.262 1.00 23.30  ? 222  PHE B CE2 1 
ATOM   5835 C CZ  . PHE B 1 221 ? 113.343 -31.359 354.810 1.00 25.35  ? 222  PHE B CZ  1 
ATOM   5836 N N   . HIS B 1 222 ? 117.387 -32.532 358.495 1.00 22.12  ? 223  HIS B N   1 
ATOM   5837 C CA  . HIS B 1 222 ? 118.651 -32.965 357.911 1.00 26.43  ? 223  HIS B CA  1 
ATOM   5838 C C   . HIS B 1 222 ? 118.513 -34.235 357.079 1.00 26.34  ? 223  HIS B C   1 
ATOM   5839 O O   . HIS B 1 222 ? 119.286 -34.448 356.140 1.00 33.17  ? 223  HIS B O   1 
ATOM   5840 C CB  . HIS B 1 222 ? 119.681 -33.152 359.027 1.00 31.29  ? 223  HIS B CB  1 
ATOM   5841 C CG  . HIS B 1 222 ? 119.782 -31.970 359.940 1.00 39.92  ? 223  HIS B CG  1 
ATOM   5842 N ND1 . HIS B 1 222 ? 118.922 -31.772 360.999 1.00 34.86  ? 223  HIS B ND1 1 
ATOM   5843 C CD2 . HIS B 1 222 ? 120.621 -30.907 359.934 1.00 36.27  ? 223  HIS B CD2 1 
ATOM   5844 C CE1 . HIS B 1 222 ? 119.235 -30.645 361.613 1.00 35.33  ? 223  HIS B CE1 1 
ATOM   5845 N NE2 . HIS B 1 222 ? 120.264 -30.102 360.988 1.00 37.40  ? 223  HIS B NE2 1 
ATOM   5846 N N   . ARG B 1 223 ? 117.540 -35.081 357.407 1.00 23.15  ? 224  ARG B N   1 
ATOM   5847 C CA  . ARG B 1 223 ? 117.303 -36.311 356.664 1.00 20.68  ? 224  ARG B CA  1 
ATOM   5848 C C   . ARG B 1 223 ? 115.803 -36.503 356.500 1.00 19.89  ? 224  ARG B C   1 
ATOM   5849 O O   . ARG B 1 223 ? 114.999 -35.873 357.191 1.00 20.73  ? 224  ARG B O   1 
ATOM   5850 C CB  . ARG B 1 223 ? 117.935 -37.522 357.363 1.00 26.30  ? 224  ARG B CB  1 
ATOM   5851 C CG  . ARG B 1 223 ? 119.449 -37.579 357.237 1.00 32.45  ? 224  ARG B CG  1 
ATOM   5852 C CD  . ARG B 1 223 ? 120.051 -38.626 358.162 1.00 43.77  ? 224  ARG B CD  1 
ATOM   5853 N NE  . ARG B 1 223 ? 119.988 -38.225 359.565 1.00 54.84  ? 224  ARG B NE  1 
ATOM   5854 C CZ  . ARG B 1 223 ? 120.801 -37.338 360.130 1.00 62.01  ? 224  ARG B CZ  1 
ATOM   5855 N NH1 . ARG B 1 223 ? 121.749 -36.749 359.414 1.00 62.09  ? 224  ARG B NH1 1 
ATOM   5856 N NH2 . ARG B 1 223 ? 120.666 -37.037 361.415 1.00 64.17  ? 224  ARG B NH2 1 
ATOM   5857 N N   . ALA B 1 224 ? 115.426 -37.382 355.573 1.00 17.17  ? 225  ALA B N   1 
ATOM   5858 C CA  . ALA B 1 224 ? 114.023 -37.552 355.225 1.00 18.67  ? 225  ALA B CA  1 
ATOM   5859 C C   . ALA B 1 224 ? 113.712 -39.009 354.925 1.00 23.33  ? 225  ALA B C   1 
ATOM   5860 O O   . ALA B 1 224 ? 114.529 -39.723 354.337 1.00 21.10  ? 225  ALA B O   1 
ATOM   5861 C CB  . ALA B 1 224 ? 113.644 -36.684 354.019 1.00 16.22  ? 225  ALA B CB  1 
ATOM   5862 N N   . VAL B 1 225 ? 112.521 -39.441 355.335 1.00 18.71  ? 226  VAL B N   1 
ATOM   5863 C CA  . VAL B 1 225 ? 111.992 -40.761 355.013 1.00 17.45  ? 226  VAL B CA  1 
ATOM   5864 C C   . VAL B 1 225 ? 110.605 -40.566 354.420 1.00 19.02  ? 226  VAL B C   1 
ATOM   5865 O O   . VAL B 1 225 ? 109.742 -39.936 355.043 1.00 17.20  ? 226  VAL B O   1 
ATOM   5866 C CB  . VAL B 1 225 ? 111.926 -41.683 356.243 1.00 19.97  ? 226  VAL B CB  1 
ATOM   5867 C CG1 . VAL B 1 225 ? 111.508 -43.092 355.838 1.00 17.10  ? 226  VAL B CG1 1 
ATOM   5868 C CG2 . VAL B 1 225 ? 113.256 -41.696 356.982 1.00 15.02  ? 226  VAL B CG2 1 
ATOM   5869 N N   . LEU B 1 226 ? 110.390 -41.097 353.220 1.00 13.71  ? 227  LEU B N   1 
ATOM   5870 C CA  . LEU B 1 226 ? 109.111 -40.980 352.528 1.00 24.94  ? 227  LEU B CA  1 
ATOM   5871 C C   . LEU B 1 226 ? 108.569 -42.382 352.293 1.00 19.62  ? 227  LEU B C   1 
ATOM   5872 O O   . LEU B 1 226 ? 109.098 -43.130 351.464 1.00 24.90  ? 227  LEU B O   1 
ATOM   5873 C CB  . LEU B 1 226 ? 109.255 -40.204 351.217 1.00 20.38  ? 227  LEU B CB  1 
ATOM   5874 C CG  . LEU B 1 226 ? 109.692 -38.735 351.320 1.00 25.17  ? 227  LEU B CG  1 
ATOM   5875 C CD1 . LEU B 1 226 ? 111.195 -38.587 351.528 1.00 15.97  ? 227  LEU B CD1 1 
ATOM   5876 C CD2 . LEU B 1 226 ? 109.243 -37.947 350.099 1.00 18.32  ? 227  LEU B CD2 1 
ATOM   5877 N N   . GLN B 1 227 ? 107.520 -42.735 353.029 1.00 18.14  ? 228  GLN B N   1 
ATOM   5878 C CA  . GLN B 1 227 ? 106.913 -44.057 352.966 1.00 14.63  ? 228  GLN B CA  1 
ATOM   5879 C C   . GLN B 1 227 ? 105.629 -43.974 352.148 1.00 14.04  ? 228  GLN B C   1 
ATOM   5880 O O   . GLN B 1 227 ? 104.698 -43.256 352.525 1.00 19.22  ? 228  GLN B O   1 
ATOM   5881 C CB  . GLN B 1 227 ? 106.629 -44.583 354.375 1.00 14.40  ? 228  GLN B CB  1 
ATOM   5882 C CG  . GLN B 1 227 ? 107.840 -44.527 355.307 1.00 18.71  ? 228  GLN B CG  1 
ATOM   5883 C CD  . GLN B 1 227 ? 107.492 -44.766 356.769 1.00 26.14  ? 228  GLN B CD  1 
ATOM   5884 O OE1 . GLN B 1 227 ? 108.254 -44.400 357.665 1.00 24.16  ? 228  GLN B OE1 1 
ATOM   5885 N NE2 . GLN B 1 227 ? 106.340 -45.380 357.015 1.00 21.86  ? 228  GLN B NE2 1 
ATOM   5886 N N   . SER B 1 228 ? 105.592 -44.692 351.025 1.00 17.13  ? 229  SER B N   1 
ATOM   5887 C CA  . SER B 1 228 ? 104.386 -44.835 350.206 1.00 16.55  ? 229  SER B CA  1 
ATOM   5888 C C   . SER B 1 228 ? 103.792 -43.479 349.828 1.00 21.97  ? 229  SER B C   1 
ATOM   5889 O O   . SER B 1 228 ? 102.583 -43.252 349.920 1.00 23.79  ? 229  SER B O   1 
ATOM   5890 C CB  . SER B 1 228 ? 103.345 -45.699 350.919 1.00 18.33  ? 229  SER B CB  1 
ATOM   5891 O OG  . SER B 1 228 ? 103.833 -47.009 351.148 1.00 24.90  ? 229  SER B OG  1 
ATOM   5892 N N   . GLY B 1 229 ? 104.657 -42.567 349.396 1.00 18.86  ? 230  GLY B N   1 
ATOM   5893 C CA  . GLY B 1 229 ? 104.206 -41.246 349.008 1.00 17.88  ? 230  GLY B CA  1 
ATOM   5894 C C   . GLY B 1 229 ? 105.323 -40.370 348.485 1.00 20.07  ? 230  GLY B C   1 
ATOM   5895 O O   . GLY B 1 229 ? 106.492 -40.575 348.824 1.00 23.73  ? 230  GLY B O   1 
ATOM   5896 N N   . ALA B 1 230 ? 104.976 -39.389 347.656 1.00 17.22  ? 231  ALA B N   1 
ATOM   5897 C CA  . ALA B 1 230 ? 105.964 -38.500 347.061 1.00 21.05  ? 231  ALA B CA  1 
ATOM   5898 C C   . ALA B 1 230 ? 105.277 -37.195 346.698 1.00 18.84  ? 231  ALA B C   1 
ATOM   5899 O O   . ALA B 1 230 ? 104.082 -37.198 346.381 1.00 18.44  ? 231  ALA B O   1 
ATOM   5900 C CB  . ALA B 1 230 ? 106.606 -39.138 345.821 1.00 20.89  ? 231  ALA B CB  1 
ATOM   5901 N N   . PRO B 1 231 ? 105.992 -36.067 346.738 1.00 18.36  ? 232  PRO B N   1 
ATOM   5902 C CA  . PRO B 1 231 ? 105.353 -34.787 346.394 1.00 21.08  ? 232  PRO B CA  1 
ATOM   5903 C C   . PRO B 1 231 ? 104.958 -34.681 344.933 1.00 22.73  ? 232  PRO B C   1 
ATOM   5904 O O   . PRO B 1 231 ? 104.124 -33.829 344.596 1.00 23.12  ? 232  PRO B O   1 
ATOM   5905 C CB  . PRO B 1 231 ? 106.426 -33.752 346.759 1.00 17.77  ? 232  PRO B CB  1 
ATOM   5906 C CG  . PRO B 1 231 ? 107.715 -34.498 346.610 1.00 16.23  ? 232  PRO B CG  1 
ATOM   5907 C CD  . PRO B 1 231 ? 107.413 -35.895 347.089 1.00 18.39  ? 232  PRO B CD  1 
ATOM   5908 N N   . ASN B 1 232 ? 105.517 -35.516 344.061 1.00 20.86  ? 233  ASN B N   1 
ATOM   5909 C CA  . ASN B 1 232 ? 105.229 -35.479 342.634 1.00 20.58  ? 233  ASN B CA  1 
ATOM   5910 C C   . ASN B 1 232 ? 104.094 -36.413 342.229 1.00 23.36  ? 233  ASN B C   1 
ATOM   5911 O O   . ASN B 1 232 ? 103.865 -36.601 341.030 1.00 24.84  ? 233  ASN B O   1 
ATOM   5912 C CB  . ASN B 1 232 ? 106.490 -35.823 341.837 1.00 19.13  ? 233  ASN B CB  1 
ATOM   5913 C CG  . ASN B 1 232 ? 107.240 -37.000 342.419 1.00 20.06  ? 233  ASN B CG  1 
ATOM   5914 O OD1 . ASN B 1 232 ? 107.531 -37.033 343.613 1.00 25.73  ? 233  ASN B OD1 1 
ATOM   5915 N ND2 . ASN B 1 232 ? 107.556 -37.977 341.577 1.00 20.24  ? 233  ASN B ND2 1 
ATOM   5916 N N   . GLY B 1 233 ? 103.387 -37.003 343.188 1.00 34.92  ? 234  GLY B N   1 
ATOM   5917 C CA  . GLY B 1 233 ? 102.235 -37.816 342.882 1.00 45.26  ? 234  GLY B CA  1 
ATOM   5918 C C   . GLY B 1 233 ? 101.156 -37.003 342.195 1.00 43.84  ? 234  GLY B C   1 
ATOM   5919 O O   . GLY B 1 233 ? 101.023 -35.796 342.418 1.00 44.44  ? 234  GLY B O   1 
ATOM   5920 N N   . PRO B 1 234 ? 100.361 -37.650 341.336 1.00 32.19  ? 235  PRO B N   1 
ATOM   5921 C CA  . PRO B 1 234 ? 99.300  -36.922 340.618 1.00 26.90  ? 235  PRO B CA  1 
ATOM   5922 C C   . PRO B 1 234 ? 98.196  -36.398 341.521 1.00 26.55  ? 235  PRO B C   1 
ATOM   5923 O O   . PRO B 1 234 ? 97.353  -35.622 341.054 1.00 28.99  ? 235  PRO B O   1 
ATOM   5924 C CB  . PRO B 1 234 ? 98.760  -37.973 339.641 1.00 22.91  ? 235  PRO B CB  1 
ATOM   5925 C CG  . PRO B 1 234 ? 99.043  -39.277 340.316 1.00 20.60  ? 235  PRO B CG  1 
ATOM   5926 C CD  . PRO B 1 234 ? 100.366 -39.086 341.005 1.00 23.57  ? 235  PRO B CD  1 
ATOM   5927 N N   . TRP B 1 235 ? 98.179  -36.792 342.792 1.00 24.30  ? 236  TRP B N   1 
ATOM   5928 C CA  . TRP B 1 235 ? 97.154  -36.394 343.743 1.00 22.78  ? 236  TRP B CA  1 
ATOM   5929 C C   . TRP B 1 235 ? 97.638  -35.362 344.750 1.00 19.93  ? 236  TRP B C   1 
ATOM   5930 O O   . TRP B 1 235 ? 96.810  -34.782 345.462 1.00 21.31  ? 236  TRP B O   1 
ATOM   5931 C CB  . TRP B 1 235 ? 96.659  -37.627 344.509 1.00 20.18  ? 236  TRP B CB  1 
ATOM   5932 C CG  . TRP B 1 235 ? 97.809  -38.419 345.045 1.00 22.73  ? 236  TRP B CG  1 
ATOM   5933 C CD1 . TRP B 1 235 ? 98.458  -39.446 344.423 1.00 20.47  ? 236  TRP B CD1 1 
ATOM   5934 C CD2 . TRP B 1 235 ? 98.478  -38.221 346.297 1.00 15.78  ? 236  TRP B CD2 1 
ATOM   5935 N NE1 . TRP B 1 235 ? 99.477  -39.912 345.217 1.00 17.72  ? 236  TRP B NE1 1 
ATOM   5936 C CE2 . TRP B 1 235 ? 99.511  -39.177 346.373 1.00 18.92  ? 236  TRP B CE2 1 
ATOM   5937 C CE3 . TRP B 1 235 ? 98.297  -37.338 347.366 1.00 16.02  ? 236  TRP B CE3 1 
ATOM   5938 C CZ2 . TRP B 1 235 ? 100.360 -39.272 347.474 1.00 17.56  ? 236  TRP B CZ2 1 
ATOM   5939 C CZ3 . TRP B 1 235 ? 99.142  -37.432 348.457 1.00 14.59  ? 236  TRP B CZ3 1 
ATOM   5940 C CH2 . TRP B 1 235 ? 100.160 -38.393 348.503 1.00 21.01  ? 236  TRP B CH2 1 
ATOM   5941 N N   . ALA B 1 236 ? 98.947  -35.124 344.833 1.00 20.12  ? 237  ALA B N   1 
ATOM   5942 C CA  . ALA B 1 236 ? 99.526  -34.382 345.943 1.00 22.91  ? 237  ALA B CA  1 
ATOM   5943 C C   . ALA B 1 236 ? 99.478  -32.873 345.767 1.00 19.09  ? 237  ALA B C   1 
ATOM   5944 O O   . ALA B 1 236 ? 99.541  -32.151 346.768 1.00 21.20  ? 237  ALA B O   1 
ATOM   5945 C CB  . ALA B 1 236 ? 100.980 -34.814 346.164 1.00 15.98  ? 237  ALA B CB  1 
ATOM   5946 N N   . THR B 1 237 ? 99.386  -32.373 344.538 1.00 15.71  ? 238  THR B N   1 
ATOM   5947 C CA  . THR B 1 237 ? 99.327  -30.938 344.306 1.00 24.79  ? 238  THR B CA  1 
ATOM   5948 C C   . THR B 1 237 ? 98.222  -30.611 343.315 1.00 21.69  ? 238  THR B C   1 
ATOM   5949 O O   . THR B 1 237 ? 97.720  -31.475 342.592 1.00 22.67  ? 238  THR B O   1 
ATOM   5950 C CB  . THR B 1 237 ? 100.658 -30.371 343.787 1.00 21.14  ? 238  THR B CB  1 
ATOM   5951 O OG1 . THR B 1 237 ? 101.008 -31.008 342.553 1.00 23.77  ? 238  THR B OG1 1 
ATOM   5952 C CG2 . THR B 1 237 ? 101.769 -30.578 344.803 1.00 21.57  ? 238  THR B CG2 1 
ATOM   5953 N N   . VAL B 1 238 ? 97.857  -29.332 343.295 1.00 18.66  ? 239  VAL B N   1 
ATOM   5954 C CA  . VAL B 1 238 ? 96.834  -28.808 342.403 1.00 24.27  ? 239  VAL B CA  1 
ATOM   5955 C C   . VAL B 1 238 ? 97.334  -27.483 341.845 1.00 25.57  ? 239  VAL B C   1 
ATOM   5956 O O   . VAL B 1 238 ? 98.103  -26.766 342.493 1.00 26.13  ? 239  VAL B O   1 
ATOM   5957 C CB  . VAL B 1 238 ? 95.479  -28.643 343.136 1.00 27.94  ? 239  VAL B CB  1 
ATOM   5958 C CG1 . VAL B 1 238 ? 95.576  -27.582 344.225 1.00 22.86  ? 239  VAL B CG1 1 
ATOM   5959 C CG2 . VAL B 1 238 ? 94.372  -28.316 342.161 1.00 32.06  ? 239  VAL B CG2 1 
ATOM   5960 N N   . GLY B 1 239 ? 96.919  -27.173 340.616 1.00 29.04  ? 240  GLY B N   1 
ATOM   5961 C CA  . GLY B 1 239 ? 97.233  -25.889 340.031 1.00 25.18  ? 240  GLY B CA  1 
ATOM   5962 C C   . GLY B 1 239 ? 96.358  -24.781 340.587 1.00 30.15  ? 240  GLY B C   1 
ATOM   5963 O O   . GLY B 1 239 ? 95.333  -25.021 341.226 1.00 30.95  ? 240  GLY B O   1 
ATOM   5964 N N   . MET B 1 240 ? 96.781  -23.540 340.329 1.00 28.36  ? 241  MET B N   1 
ATOM   5965 C CA  . MET B 1 240 ? 96.065  -22.387 340.868 1.00 31.25  ? 241  MET B CA  1 
ATOM   5966 C C   . MET B 1 240 ? 94.646  -22.303 340.320 1.00 33.54  ? 241  MET B C   1 
ATOM   5967 O O   . MET B 1 240 ? 93.700  -22.028 341.068 1.00 30.54  ? 241  MET B O   1 
ATOM   5968 C CB  . MET B 1 240 ? 96.829  -21.100 340.559 1.00 34.28  ? 241  MET B CB  1 
ATOM   5969 C CG  . MET B 1 240 ? 98.075  -20.897 341.400 1.00 40.84  ? 241  MET B CG  1 
ATOM   5970 S SD  . MET B 1 240 ? 99.157  -19.628 340.716 1.00 47.91  ? 241  MET B SD  1 
ATOM   5971 C CE  . MET B 1 240 ? 98.516  -18.161 341.510 1.00 48.76  ? 241  MET B CE  1 
ATOM   5972 N N   . GLY B 1 241 ? 94.478  -22.532 339.016 1.00 29.33  ? 242  GLY B N   1 
ATOM   5973 C CA  . GLY B 1 241 ? 93.153  -22.438 338.425 1.00 28.34  ? 242  GLY B CA  1 
ATOM   5974 C C   . GLY B 1 241 ? 92.183  -23.449 339.004 1.00 32.34  ? 242  GLY B C   1 
ATOM   5975 O O   . GLY B 1 241 ? 91.045  -23.114 339.346 1.00 29.42  ? 242  GLY B O   1 
ATOM   5976 N N   . GLU B 1 242 ? 92.622  -24.703 339.130 1.00 28.10  ? 243  GLU B N   1 
ATOM   5977 C CA  . GLU B 1 242 ? 91.749  -25.733 339.682 1.00 33.21  ? 243  GLU B CA  1 
ATOM   5978 C C   . GLU B 1 242 ? 91.497  -25.506 341.169 1.00 34.11  ? 243  GLU B C   1 
ATOM   5979 O O   . GLU B 1 242 ? 90.396  -25.773 341.664 1.00 33.37  ? 243  GLU B O   1 
ATOM   5980 C CB  . GLU B 1 242 ? 92.348  -27.117 339.432 1.00 31.11  ? 243  GLU B CB  1 
ATOM   5981 C CG  . GLU B 1 242 ? 91.567  -28.273 340.049 1.00 36.77  ? 243  GLU B CG  1 
ATOM   5982 C CD  . GLU B 1 242 ? 90.224  -28.518 339.386 1.00 38.33  ? 243  GLU B CD  1 
ATOM   5983 O OE1 . GLU B 1 242 ? 89.924  -27.868 338.362 1.00 45.76  ? 243  GLU B OE1 1 
ATOM   5984 O OE2 . GLU B 1 242 ? 89.465  -29.371 339.892 1.00 40.74  ? 243  GLU B OE2 1 
ATOM   5985 N N   . ALA B 1 243 ? 92.502  -25.007 341.894 1.00 29.63  ? 244  ALA B N   1 
ATOM   5986 C CA  . ALA B 1 243 ? 92.303  -24.694 343.306 1.00 31.14  ? 244  ALA B CA  1 
ATOM   5987 C C   . ALA B 1 243 ? 91.244  -23.614 343.484 1.00 29.10  ? 244  ALA B C   1 
ATOM   5988 O O   . ALA B 1 243 ? 90.381  -23.718 344.363 1.00 27.46  ? 244  ALA B O   1 
ATOM   5989 C CB  . ALA B 1 243 ? 93.624  -24.261 343.942 1.00 26.23  ? 244  ALA B CB  1 
ATOM   5990 N N   . ARG B 1 244 ? 91.291  -22.571 342.651 1.00 25.26  ? 245  ARG B N   1 
ATOM   5991 C CA  . ARG B 1 244 ? 90.286  -21.516 342.732 1.00 26.44  ? 245  ARG B CA  1 
ATOM   5992 C C   . ARG B 1 244 ? 88.900  -22.047 342.392 1.00 28.80  ? 245  ARG B C   1 
ATOM   5993 O O   . ARG B 1 244 ? 87.911  -21.674 343.033 1.00 27.51  ? 245  ARG B O   1 
ATOM   5994 C CB  . ARG B 1 244 ? 90.663  -20.359 341.806 1.00 28.25  ? 245  ARG B CB  1 
ATOM   5995 C CG  . ARG B 1 244 ? 89.584  -19.296 341.668 1.00 36.04  ? 245  ARG B CG  1 
ATOM   5996 C CD  . ARG B 1 244 ? 90.108  -18.072 340.938 1.00 41.01  ? 245  ARG B CD  1 
ATOM   5997 N NE  . ARG B 1 244 ? 91.095  -17.350 341.737 1.00 42.65  ? 245  ARG B NE  1 
ATOM   5998 C CZ  . ARG B 1 244 ? 90.791  -16.421 342.637 1.00 39.44  ? 245  ARG B CZ  1 
ATOM   5999 N NH1 . ARG B 1 244 ? 89.524  -16.095 342.855 1.00 37.39  ? 245  ARG B NH1 1 
ATOM   6000 N NH2 . ARG B 1 244 ? 91.755  -15.817 343.320 1.00 38.80  ? 245  ARG B NH2 1 
ATOM   6001 N N   . ARG B 1 245 ? 88.805  -22.926 341.389 1.00 28.18  ? 246  ARG B N   1 
ATOM   6002 C CA  . ARG B 1 245 ? 87.506  -23.493 341.040 1.00 29.04  ? 246  ARG B CA  1 
ATOM   6003 C C   . ARG B 1 245 ? 86.946  -24.331 342.180 1.00 30.34  ? 246  ARG B C   1 
ATOM   6004 O O   . ARG B 1 245 ? 85.750  -24.253 342.488 1.00 34.30  ? 246  ARG B O   1 
ATOM   6005 C CB  . ARG B 1 245 ? 87.605  -24.339 339.770 1.00 24.59  ? 246  ARG B CB  1 
ATOM   6006 C CG  . ARG B 1 245 ? 86.239  -24.807 339.278 1.00 34.95  ? 246  ARG B CG  1 
ATOM   6007 C CD  . ARG B 1 245 ? 86.314  -26.020 338.363 1.00 34.05  ? 246  ARG B CD  1 
ATOM   6008 N NE  . ARG B 1 245 ? 86.857  -27.204 339.025 1.00 37.22  ? 246  ARG B NE  1 
ATOM   6009 C CZ  . ARG B 1 245 ? 86.168  -27.987 339.851 1.00 42.00  ? 246  ARG B CZ  1 
ATOM   6010 N NH1 . ARG B 1 245 ? 84.901  -27.713 340.133 1.00 47.01  ? 246  ARG B NH1 1 
ATOM   6011 N NH2 . ARG B 1 245 ? 86.749  -29.045 340.400 1.00 38.39  ? 246  ARG B NH2 1 
ATOM   6012 N N   . ARG B 1 246 ? 87.792  -25.140 342.819 1.00 26.83  ? 247  ARG B N   1 
ATOM   6013 C CA  . ARG B 1 246 ? 87.319  -25.980 343.914 1.00 27.86  ? 247  ARG B CA  1 
ATOM   6014 C C   . ARG B 1 246 ? 86.881  -25.141 345.106 1.00 27.94  ? 247  ARG B C   1 
ATOM   6015 O O   . ARG B 1 246 ? 85.856  -25.432 345.733 1.00 30.70  ? 247  ARG B O   1 
ATOM   6016 C CB  . ARG B 1 246 ? 88.407  -26.972 344.318 1.00 25.65  ? 247  ARG B CB  1 
ATOM   6017 C CG  . ARG B 1 246 ? 88.652  -28.040 343.273 1.00 29.41  ? 247  ARG B CG  1 
ATOM   6018 C CD  . ARG B 1 246 ? 89.676  -29.056 343.729 1.00 28.16  ? 247  ARG B CD  1 
ATOM   6019 N NE  . ARG B 1 246 ? 90.094  -29.909 342.623 1.00 27.05  ? 247  ARG B NE  1 
ATOM   6020 C CZ  . ARG B 1 246 ? 90.935  -30.930 342.740 1.00 29.66  ? 247  ARG B CZ  1 
ATOM   6021 N NH1 . ARG B 1 246 ? 91.455  -31.233 343.922 1.00 23.38  ? 247  ARG B NH1 1 
ATOM   6022 N NH2 . ARG B 1 246 ? 91.257  -31.648 341.673 1.00 24.81  ? 247  ARG B NH2 1 
ATOM   6023 N N   . ALA B 1 247 ? 87.641  -24.092 345.431 1.00 27.06  ? 248  ALA B N   1 
ATOM   6024 C CA  . ALA B 1 247 ? 87.252  -23.212 346.527 1.00 28.95  ? 248  ALA B CA  1 
ATOM   6025 C C   . ALA B 1 247 ? 85.946  -22.492 346.217 1.00 33.26  ? 248  ALA B C   1 
ATOM   6026 O O   . ALA B 1 247 ? 85.084  -22.347 347.092 1.00 32.57  ? 248  ALA B O   1 
ATOM   6027 C CB  . ALA B 1 247 ? 88.366  -22.207 346.815 1.00 20.47  ? 248  ALA B CB  1 
ATOM   6028 N N   . THR B 1 248 ? 85.780  -22.038 344.972 1.00 30.57  ? 249  THR B N   1 
ATOM   6029 C CA  . THR B 1 248 ? 84.546  -21.359 344.589 1.00 29.73  ? 249  THR B CA  1 
ATOM   6030 C C   . THR B 1 248 ? 83.363  -22.320 344.597 1.00 34.82  ? 249  THR B C   1 
ATOM   6031 O O   . THR B 1 248 ? 82.253  -21.944 344.995 1.00 30.83  ? 249  THR B O   1 
ATOM   6032 C CB  . THR B 1 248 ? 84.713  -20.714 343.212 1.00 34.54  ? 249  THR B CB  1 
ATOM   6033 O OG1 . THR B 1 248 ? 85.778  -19.756 343.260 1.00 39.24  ? 249  THR B OG1 1 
ATOM   6034 C CG2 . THR B 1 248 ? 83.431  -20.014 342.785 1.00 33.98  ? 249  THR B CG2 1 
ATOM   6035 N N   . GLN B 1 249 ? 83.582  -23.566 344.171 1.00 23.97  ? 250  GLN B N   1 
ATOM   6036 C CA  . GLN B 1 249 ? 82.507  -24.553 344.193 1.00 28.94  ? 250  GLN B CA  1 
ATOM   6037 C C   . GLN B 1 249 ? 82.085  -24.879 345.621 1.00 31.30  ? 250  GLN B C   1 
ATOM   6038 O O   . GLN B 1 249 ? 80.893  -25.067 345.893 1.00 31.44  ? 250  GLN B O   1 
ATOM   6039 C CB  . GLN B 1 249 ? 82.944  -25.819 343.453 1.00 34.86  ? 250  GLN B CB  1 
ATOM   6040 C CG  . GLN B 1 249 ? 81.997  -27.005 343.595 1.00 41.76  ? 250  GLN B CG  1 
ATOM   6041 C CD  . GLN B 1 249 ? 80.752  -26.881 342.735 1.00 56.34  ? 250  GLN B CD  1 
ATOM   6042 O OE1 . GLN B 1 249 ? 80.526  -25.859 342.087 1.00 65.70  ? 250  GLN B OE1 1 
ATOM   6043 N NE2 . GLN B 1 249 ? 79.938  -27.931 342.722 1.00 59.61  ? 250  GLN B NE2 1 
ATOM   6044 N N   . LEU B 1 250 ? 83.044  -24.942 346.549 1.00 24.54  ? 251  LEU B N   1 
ATOM   6045 C CA  . LEU B 1 250 ? 82.700  -25.189 347.946 1.00 32.47  ? 251  LEU B CA  1 
ATOM   6046 C C   . LEU B 1 250 ? 81.833  -24.069 348.506 1.00 29.54  ? 251  LEU B C   1 
ATOM   6047 O O   . LEU B 1 250 ? 80.855  -24.328 349.217 1.00 35.43  ? 251  LEU B O   1 
ATOM   6048 C CB  . LEU B 1 250 ? 83.966  -25.350 348.788 1.00 27.11  ? 251  LEU B CB  1 
ATOM   6049 C CG  . LEU B 1 250 ? 83.710  -25.634 350.271 1.00 30.52  ? 251  LEU B CG  1 
ATOM   6050 C CD1 . LEU B 1 250 ? 83.079  -27.008 350.453 1.00 26.64  ? 251  LEU B CD1 1 
ATOM   6051 C CD2 . LEU B 1 250 ? 84.986  -25.513 351.087 1.00 25.80  ? 251  LEU B CD2 1 
ATOM   6052 N N   . ALA B 1 251 ? 82.178  -22.816 348.197 1.00 27.86  ? 252  ALA B N   1 
ATOM   6053 C CA  . ALA B 1 251 ? 81.387  -21.686 348.674 1.00 33.14  ? 252  ALA B CA  1 
ATOM   6054 C C   . ALA B 1 251 ? 79.944  -21.789 348.197 1.00 32.41  ? 252  ALA B C   1 
ATOM   6055 O O   . ALA B 1 251 ? 79.004  -21.604 348.979 1.00 32.65  ? 252  ALA B O   1 
ATOM   6056 C CB  . ALA B 1 251 ? 82.017  -20.373 348.210 1.00 25.39  ? 252  ALA B CB  1 
ATOM   6057 N N   . HIS B 1 252 ? 79.750  -22.098 346.912 1.00 31.44  ? 253  HIS B N   1 
ATOM   6058 C CA  . HIS B 1 252 ? 78.399  -22.221 346.375 1.00 35.72  ? 253  HIS B CA  1 
ATOM   6059 C C   . HIS B 1 252 ? 77.631  -23.348 347.055 1.00 33.32  ? 253  HIS B C   1 
ATOM   6060 O O   . HIS B 1 252 ? 76.432  -23.216 347.326 1.00 37.77  ? 253  HIS B O   1 
ATOM   6061 C CB  . HIS B 1 252 ? 78.454  -22.446 344.864 1.00 41.26  ? 253  HIS B CB  1 
ATOM   6062 C CG  . HIS B 1 252 ? 77.143  -22.851 344.265 1.00 57.97  ? 253  HIS B CG  1 
ATOM   6063 N ND1 . HIS B 1 252 ? 76.779  -24.169 344.092 1.00 61.24  ? 253  HIS B ND1 1 
ATOM   6064 C CD2 . HIS B 1 252 ? 76.108  -22.112 343.801 1.00 61.14  ? 253  HIS B CD2 1 
ATOM   6065 C CE1 . HIS B 1 252 ? 75.578  -24.225 343.546 1.00 61.03  ? 253  HIS B CE1 1 
ATOM   6066 N NE2 . HIS B 1 252 ? 75.148  -22.990 343.359 1.00 63.55  ? 253  HIS B NE2 1 
ATOM   6067 N N   . LEU B 1 253 ? 78.306  -24.462 347.346 1.00 33.22  ? 254  LEU B N   1 
ATOM   6068 C CA  . LEU B 1 253 ? 77.629  -25.608 347.940 1.00 33.65  ? 254  LEU B CA  1 
ATOM   6069 C C   . LEU B 1 253 ? 77.174  -25.349 349.371 1.00 31.34  ? 254  LEU B C   1 
ATOM   6070 O O   . LEU B 1 253 ? 76.273  -26.044 349.851 1.00 33.74  ? 254  LEU B O   1 
ATOM   6071 C CB  . LEU B 1 253 ? 78.539  -26.838 347.905 1.00 31.07  ? 254  LEU B CB  1 
ATOM   6072 C CG  . LEU B 1 253 ? 78.806  -27.470 346.537 1.00 31.90  ? 254  LEU B CG  1 
ATOM   6073 C CD1 . LEU B 1 253 ? 79.820  -28.598 346.661 1.00 29.82  ? 254  LEU B CD1 1 
ATOM   6074 C CD2 . LEU B 1 253 ? 77.513  -27.971 345.907 1.00 28.54  ? 254  LEU B CD2 1 
ATOM   6075 N N   . VAL B 1 254 ? 77.767  -24.379 350.062 1.00 29.57  ? 255  VAL B N   1 
ATOM   6076 C CA  . VAL B 1 254 ? 77.409  -24.088 351.444 1.00 27.03  ? 255  VAL B CA  1 
ATOM   6077 C C   . VAL B 1 254 ? 76.647  -22.766 351.557 1.00 28.18  ? 255  VAL B C   1 
ATOM   6078 O O   . VAL B 1 254 ? 76.499  -22.230 352.653 1.00 30.66  ? 255  VAL B O   1 
ATOM   6079 C CB  . VAL B 1 254 ? 78.646  -24.103 352.359 1.00 26.23  ? 255  VAL B CB  1 
ATOM   6080 C CG1 . VAL B 1 254 ? 79.322  -25.467 352.316 1.00 25.30  ? 255  VAL B CG1 1 
ATOM   6081 C CG2 . VAL B 1 254 ? 79.619  -23.004 351.965 1.00 25.18  ? 255  VAL B CG2 1 
ATOM   6082 N N   . GLY B 1 255 ? 76.157  -22.237 350.440 1.00 33.96  ? 256  GLY B N   1 
ATOM   6083 C CA  . GLY B 1 255 ? 75.327  -21.049 350.463 1.00 35.45  ? 256  GLY B CA  1 
ATOM   6084 C C   . GLY B 1 255 ? 76.060  -19.731 350.377 1.00 35.59  ? 256  GLY B C   1 
ATOM   6085 O O   . GLY B 1 255 ? 75.492  -18.700 350.753 1.00 38.67  ? 256  GLY B O   1 
ATOM   6086 N N   . CYS B 1 256 ? 77.298  -19.723 349.886 1.00 36.44  ? 257  CYS B N   1 
ATOM   6087 C CA  . CYS B 1 256 ? 78.077  -18.501 349.815 1.00 46.07  ? 257  CYS B CA  1 
ATOM   6088 C C   . CYS B 1 256 ? 78.364  -18.126 348.366 1.00 62.58  ? 257  CYS B C   1 
ATOM   6089 O O   . CYS B 1 256 ? 78.554  -19.009 347.523 1.00 67.48  ? 257  CYS B O   1 
ATOM   6090 C CB  . CYS B 1 256 ? 79.406  -18.652 350.574 1.00 44.34  ? 257  CYS B CB  1 
ATOM   6091 S SG  . CYS B 1 256 ? 79.239  -18.757 352.373 1.00 50.63  ? 257  CYS B SG  1 
ATOM   6092 N N   . PRO B 1 257 ? 78.373  -16.850 348.070 1.00 80.90  ? 258  PRO B N   1 
ATOM   6093 C CA  . PRO B 1 257 ? 78.127  -15.818 349.067 1.00 87.83  ? 258  PRO B CA  1 
ATOM   6094 C C   . PRO B 1 257 ? 76.770  -15.197 348.806 1.00 95.05  ? 258  PRO B C   1 
ATOM   6095 O O   . PRO B 1 257 ? 76.604  -14.011 349.041 1.00 99.09  ? 258  PRO B O   1 
ATOM   6096 C CB  . PRO B 1 257 ? 79.169  -14.789 348.732 1.00 86.32  ? 258  PRO B CB  1 
ATOM   6097 C CG  . PRO B 1 257 ? 79.239  -14.887 347.262 1.00 88.49  ? 258  PRO B CG  1 
ATOM   6098 C CD  . PRO B 1 257 ? 79.154  -16.336 346.946 1.00 86.18  ? 258  PRO B CD  1 
ATOM   6099 N N   . ASN B 1 264 ? 84.540  -11.330 344.358 1.00 59.53  ? 265  ASN B N   1 
ATOM   6100 C CA  . ASN B 1 264 ? 85.369  -10.767 345.417 1.00 57.96  ? 265  ASN B CA  1 
ATOM   6101 C C   . ASN B 1 264 ? 85.820  -11.858 346.382 1.00 53.46  ? 265  ASN B C   1 
ATOM   6102 O O   . ASN B 1 264 ? 85.001  -12.471 347.067 1.00 54.71  ? 265  ASN B O   1 
ATOM   6103 C CB  . ASN B 1 264 ? 84.608  -9.673  346.170 1.00 67.92  ? 265  ASN B CB  1 
ATOM   6104 C CG  . ASN B 1 264 ? 85.529  -8.664  346.829 1.00 76.02  ? 265  ASN B CG  1 
ATOM   6105 O OD1 . ASN B 1 264 ? 86.629  -9.001  347.266 1.00 81.81  ? 265  ASN B OD1 1 
ATOM   6106 N ND2 . ASN B 1 264 ? 85.080  -7.416  346.905 1.00 77.53  ? 265  ASN B ND2 1 
ATOM   6107 N N   . ASP B 1 265 ? 87.133  -12.096 346.429 1.00 48.86  ? 266  ASP B N   1 
ATOM   6108 C CA  . ASP B 1 265 ? 87.663  -13.136 347.305 1.00 46.70  ? 266  ASP B CA  1 
ATOM   6109 C C   . ASP B 1 265 ? 87.429  -12.795 348.771 1.00 42.37  ? 266  ASP B C   1 
ATOM   6110 O O   . ASP B 1 265 ? 87.180  -13.686 349.590 1.00 37.96  ? 266  ASP B O   1 
ATOM   6111 C CB  . ASP B 1 265 ? 89.152  -13.346 347.031 1.00 48.10  ? 266  ASP B CB  1 
ATOM   6112 C CG  . ASP B 1 265 ? 89.408  -14.022 345.698 1.00 54.92  ? 266  ASP B CG  1 
ATOM   6113 O OD1 . ASP B 1 265 ? 88.455  -14.590 345.125 1.00 56.33  ? 266  ASP B OD1 1 
ATOM   6114 O OD2 . ASP B 1 265 ? 90.564  -13.988 345.225 1.00 58.32  ? 266  ASP B OD2 1 
ATOM   6115 N N   . THR B 1 266 ? 87.500  -11.508 349.120 1.00 40.52  ? 267  THR B N   1 
ATOM   6116 C CA  . THR B 1 266 ? 87.271  -11.099 350.503 1.00 42.45  ? 267  THR B CA  1 
ATOM   6117 C C   . THR B 1 266 ? 85.865  -11.473 350.959 1.00 42.85  ? 267  THR B C   1 
ATOM   6118 O O   . THR B 1 266 ? 85.682  -12.044 352.041 1.00 45.56  ? 267  THR B O   1 
ATOM   6119 C CB  . THR B 1 266 ? 87.504  -9.595  350.651 1.00 47.16  ? 267  THR B CB  1 
ATOM   6120 O OG1 . THR B 1 266 ? 88.828  -9.269  350.210 1.00 49.29  ? 267  THR B OG1 1 
ATOM   6121 C CG2 . THR B 1 266 ? 87.340  -9.171  352.103 1.00 39.42  ? 267  THR B CG2 1 
ATOM   6122 N N   . GLU B 1 267 ? 84.856  -11.162 350.141 1.00 39.97  ? 268  GLU B N   1 
ATOM   6123 C CA  . GLU B 1 267 ? 83.484  -11.516 350.492 1.00 44.45  ? 268  GLU B CA  1 
ATOM   6124 C C   . GLU B 1 267 ? 83.300  -13.028 350.540 1.00 38.23  ? 268  GLU B C   1 
ATOM   6125 O O   . GLU B 1 267 ? 82.592  -13.548 351.410 1.00 38.86  ? 268  GLU B O   1 
ATOM   6126 C CB  . GLU B 1 267 ? 82.507  -10.892 349.494 1.00 52.54  ? 268  GLU B CB  1 
ATOM   6127 C CG  . GLU B 1 267 ? 82.570  -9.375  349.412 1.00 72.49  ? 268  GLU B CG  1 
ATOM   6128 C CD  . GLU B 1 267 ? 81.801  -8.823  348.225 1.00 92.30  ? 268  GLU B CD  1 
ATOM   6129 O OE1 . GLU B 1 267 ? 81.313  -7.677  348.311 1.00 99.81  ? 268  GLU B OE1 1 
ATOM   6130 O OE2 . GLU B 1 267 ? 81.678  -9.536  347.207 1.00 98.14  ? 268  GLU B OE2 1 
ATOM   6131 N N   . LEU B 1 268 ? 83.934  -13.747 349.612 1.00 34.84  ? 269  LEU B N   1 
ATOM   6132 C CA  . LEU B 1 268 ? 83.815  -15.202 349.573 1.00 37.03  ? 269  LEU B CA  1 
ATOM   6133 C C   . LEU B 1 268 ? 84.348  -15.833 350.854 1.00 34.63  ? 269  LEU B C   1 
ATOM   6134 O O   . LEU B 1 268 ? 83.684  -16.674 351.470 1.00 31.08  ? 269  LEU B O   1 
ATOM   6135 C CB  . LEU B 1 268 ? 84.557  -15.743 348.348 1.00 41.78  ? 269  LEU B CB  1 
ATOM   6136 C CG  . LEU B 1 268 ? 84.261  -17.150 347.821 1.00 44.48  ? 269  LEU B CG  1 
ATOM   6137 C CD1 . LEU B 1 268 ? 84.607  -17.229 346.343 1.00 40.17  ? 269  LEU B CD1 1 
ATOM   6138 C CD2 . LEU B 1 268 ? 85.040  -18.202 348.592 1.00 48.26  ? 269  LEU B CD2 1 
ATOM   6139 N N   . VAL B 1 269 ? 85.552  -15.435 351.272 1.00 31.71  ? 270  VAL B N   1 
ATOM   6140 C CA  . VAL B 1 269 ? 86.160  -16.039 352.453 1.00 31.06  ? 270  VAL B CA  1 
ATOM   6141 C C   . VAL B 1 269 ? 85.412  -15.626 353.714 1.00 35.70  ? 270  VAL B C   1 
ATOM   6142 O O   . VAL B 1 269 ? 85.238  -16.430 354.638 1.00 38.61  ? 270  VAL B O   1 
ATOM   6143 C CB  . VAL B 1 269 ? 87.653  -15.674 352.534 1.00 29.64  ? 270  VAL B CB  1 
ATOM   6144 C CG1 . VAL B 1 269 ? 88.302  -16.362 353.719 1.00 27.97  ? 270  VAL B CG1 1 
ATOM   6145 C CG2 . VAL B 1 269 ? 88.362  -16.066 351.254 1.00 27.00  ? 270  VAL B CG2 1 
ATOM   6146 N N   . ALA B 1 270 ? 84.958  -14.371 353.774 1.00 30.94  ? 271  ALA B N   1 
ATOM   6147 C CA  . ALA B 1 270 ? 84.214  -13.911 354.942 1.00 31.42  ? 271  ALA B CA  1 
ATOM   6148 C C   . ALA B 1 270 ? 82.959  -14.746 355.157 1.00 35.20  ? 271  ALA B C   1 
ATOM   6149 O O   . ALA B 1 270 ? 82.648  -15.126 356.291 1.00 36.18  ? 271  ALA B O   1 
ATOM   6150 C CB  . ALA B 1 270 ? 83.859  -12.432 354.794 1.00 31.12  ? 271  ALA B CB  1 
ATOM   6151 N N   . CYS B 1 271 ? 82.232  -15.052 354.079 1.00 30.39  ? 272  CYS B N   1 
ATOM   6152 C CA  . CYS B 1 271 ? 81.060  -15.912 354.199 1.00 34.79  ? 272  CYS B CA  1 
ATOM   6153 C C   . CYS B 1 271 ? 81.454  -17.325 354.610 1.00 37.31  ? 272  CYS B C   1 
ATOM   6154 O O   . CYS B 1 271 ? 80.789  -17.940 355.452 1.00 33.54  ? 272  CYS B O   1 
ATOM   6155 C CB  . CYS B 1 271 ? 80.283  -15.936 352.882 1.00 43.80  ? 272  CYS B CB  1 
ATOM   6156 S SG  . CYS B 1 271 ? 78.729  -16.872 352.945 1.00 51.73  ? 272  CYS B SG  1 
ATOM   6157 N N   . LEU B 1 272 ? 82.532  -17.855 354.025 1.00 31.54  ? 273  LEU B N   1 
ATOM   6158 C CA  . LEU B 1 272 ? 83.008  -19.181 354.406 1.00 28.10  ? 273  LEU B CA  1 
ATOM   6159 C C   . LEU B 1 272 ? 83.341  -19.256 355.889 1.00 26.30  ? 273  LEU B C   1 
ATOM   6160 O O   . LEU B 1 272 ? 83.148  -20.303 356.516 1.00 29.10  ? 273  LEU B O   1 
ATOM   6161 C CB  . LEU B 1 272 ? 84.233  -19.561 353.574 1.00 28.73  ? 273  LEU B CB  1 
ATOM   6162 C CG  . LEU B 1 272 ? 83.971  -20.105 352.170 1.00 35.27  ? 273  LEU B CG  1 
ATOM   6163 C CD1 . LEU B 1 272 ? 85.284  -20.383 351.455 1.00 24.15  ? 273  LEU B CD1 1 
ATOM   6164 C CD2 . LEU B 1 272 ? 83.117  -21.361 352.237 1.00 30.90  ? 273  LEU B CD2 1 
ATOM   6165 N N   . ARG B 1 273 ? 83.834  -18.160 356.468 1.00 26.97  ? 274  ARG B N   1 
ATOM   6166 C CA  . ARG B 1 273 ? 84.208  -18.157 357.875 1.00 29.87  ? 274  ARG B CA  1 
ATOM   6167 C C   . ARG B 1 273 ? 82.997  -18.104 358.801 1.00 33.64  ? 274  ARG B C   1 
ATOM   6168 O O   . ARG B 1 273 ? 83.132  -18.397 359.993 1.00 33.01  ? 274  ARG B O   1 
ATOM   6169 C CB  . ARG B 1 273 ? 85.150  -16.984 358.158 1.00 26.50  ? 274  ARG B CB  1 
ATOM   6170 C CG  . ARG B 1 273 ? 86.566  -17.215 357.641 1.00 32.23  ? 274  ARG B CG  1 
ATOM   6171 C CD  . ARG B 1 273 ? 87.545  -16.170 358.153 1.00 30.93  ? 274  ARG B CD  1 
ATOM   6172 N NE  . ARG B 1 273 ? 88.838  -16.264 357.479 1.00 47.23  ? 274  ARG B NE  1 
ATOM   6173 C CZ  . ARG B 1 273 ? 89.392  -15.278 356.780 1.00 50.85  ? 274  ARG B CZ  1 
ATOM   6174 N NH1 . ARG B 1 273 ? 88.763  -14.117 356.660 1.00 52.64  ? 274  ARG B NH1 1 
ATOM   6175 N NH2 . ARG B 1 273 ? 90.572  -15.454 356.200 1.00 48.30  ? 274  ARG B NH2 1 
ATOM   6176 N N   . THR B 1 274 ? 81.824  -17.745 358.277 1.00 25.62  ? 275  THR B N   1 
ATOM   6177 C CA  . THR B 1 274 ? 80.575  -17.800 359.031 1.00 30.77  ? 275  THR B CA  1 
ATOM   6178 C C   . THR B 1 274 ? 80.054  -19.215 359.214 1.00 31.76  ? 275  THR B C   1 
ATOM   6179 O O   . THR B 1 274 ? 79.183  -19.431 360.066 1.00 35.14  ? 275  THR B O   1 
ATOM   6180 C CB  . THR B 1 274 ? 79.484  -16.989 358.323 1.00 33.04  ? 275  THR B CB  1 
ATOM   6181 O OG1 . THR B 1 274 ? 78.955  -17.754 357.235 1.00 39.42  ? 275  THR B OG1 1 
ATOM   6182 C CG2 . THR B 1 274 ? 80.033  -15.681 357.795 1.00 34.27  ? 275  THR B CG2 1 
ATOM   6183 N N   . ARG B 1 275 ? 80.536  -20.162 358.428 1.00 27.44  ? 276  ARG B N   1 
ATOM   6184 C CA  . ARG B 1 275 ? 79.954  -21.494 358.394 1.00 31.26  ? 276  ARG B CA  1 
ATOM   6185 C C   . ARG B 1 275 ? 80.575  -22.381 359.471 1.00 28.94  ? 276  ARG B C   1 
ATOM   6186 O O   . ARG B 1 275 ? 81.788  -22.333 359.693 1.00 27.37  ? 276  ARG B O   1 
ATOM   6187 C CB  . ARG B 1 275 ? 80.159  -22.128 357.019 1.00 30.82  ? 276  ARG B CB  1 
ATOM   6188 C CG  . ARG B 1 275 ? 79.431  -21.407 355.894 1.00 27.37  ? 276  ARG B CG  1 
ATOM   6189 C CD  . ARG B 1 275 ? 77.943  -21.352 356.174 1.00 27.81  ? 276  ARG B CD  1 
ATOM   6190 N NE  . ARG B 1 275 ? 77.162  -20.978 354.999 1.00 36.37  ? 276  ARG B NE  1 
ATOM   6191 C CZ  . ARG B 1 275 ? 76.554  -19.806 354.851 1.00 40.06  ? 276  ARG B CZ  1 
ATOM   6192 N NH1 . ARG B 1 275 ? 76.641  -18.888 355.803 1.00 34.66  ? 276  ARG B NH1 1 
ATOM   6193 N NH2 . ARG B 1 275 ? 75.859  -19.552 353.750 1.00 39.94  ? 276  ARG B NH2 1 
ATOM   6194 N N   . PRO B 1 276 ? 79.765  -23.189 360.157 1.00 28.35  ? 277  PRO B N   1 
ATOM   6195 C CA  . PRO B 1 276 ? 80.326  -24.197 361.061 1.00 24.87  ? 277  PRO B CA  1 
ATOM   6196 C C   . PRO B 1 276 ? 81.297  -25.105 360.323 1.00 29.62  ? 277  PRO B C   1 
ATOM   6197 O O   . PRO B 1 276 ? 81.136  -25.390 359.135 1.00 27.46  ? 277  PRO B O   1 
ATOM   6198 C CB  . PRO B 1 276 ? 79.094  -24.970 361.544 1.00 26.12  ? 277  PRO B CB  1 
ATOM   6199 C CG  . PRO B 1 276 ? 77.967  -24.004 361.405 1.00 26.47  ? 277  PRO B CG  1 
ATOM   6200 C CD  . PRO B 1 276 ? 78.293  -23.141 360.217 1.00 26.33  ? 277  PRO B CD  1 
ATOM   6201 N N   . ALA B 1 277 ? 82.323  -25.553 361.050 1.00 22.62  ? 278  ALA B N   1 
ATOM   6202 C CA  . ALA B 1 277 ? 83.375  -26.356 360.437 1.00 28.58  ? 278  ALA B CA  1 
ATOM   6203 C C   . ALA B 1 277 ? 82.820  -27.637 359.825 1.00 27.63  ? 278  ALA B C   1 
ATOM   6204 O O   . ALA B 1 277 ? 83.271  -28.067 358.756 1.00 30.32  ? 278  ALA B O   1 
ATOM   6205 C CB  . ALA B 1 277 ? 84.453  -26.678 361.471 1.00 24.92  ? 278  ALA B CB  1 
ATOM   6206 N N   . GLN B 1 278 ? 81.835  -28.258 360.480 1.00 24.59  ? 279  GLN B N   1 
ATOM   6207 C CA  . GLN B 1 278 ? 81.312  -29.523 359.975 1.00 30.81  ? 279  GLN B CA  1 
ATOM   6208 C C   . GLN B 1 278 ? 80.582  -29.340 358.648 1.00 27.17  ? 279  GLN B C   1 
ATOM   6209 O O   . GLN B 1 278 ? 80.524  -30.273 357.841 1.00 24.56  ? 279  GLN B O   1 
ATOM   6210 C CB  . GLN B 1 278 ? 80.391  -30.173 361.010 1.00 26.17  ? 279  GLN B CB  1 
ATOM   6211 C CG  . GLN B 1 278 ? 79.874  -31.549 360.599 1.00 36.50  ? 279  GLN B CG  1 
ATOM   6212 C CD  . GLN B 1 278 ? 80.993  -32.566 360.421 1.00 46.65  ? 279  GLN B CD  1 
ATOM   6213 O OE1 . GLN B 1 278 ? 81.945  -32.606 361.201 1.00 41.95  ? 279  GLN B OE1 1 
ATOM   6214 N NE2 . GLN B 1 278 ? 80.885  -33.387 359.381 1.00 47.43  ? 279  GLN B NE2 1 
ATOM   6215 N N   . VAL B 1 279 ? 80.031  -28.150 358.400 1.00 25.58  ? 280  VAL B N   1 
ATOM   6216 C CA  . VAL B 1 279 ? 79.347  -27.909 357.131 1.00 25.46  ? 280  VAL B CA  1 
ATOM   6217 C C   . VAL B 1 279 ? 80.341  -27.930 355.976 1.00 28.39  ? 280  VAL B C   1 
ATOM   6218 O O   . VAL B 1 279 ? 80.059  -28.487 354.909 1.00 30.15  ? 280  VAL B O   1 
ATOM   6219 C CB  . VAL B 1 279 ? 78.562  -26.586 357.184 1.00 32.25  ? 280  VAL B CB  1 
ATOM   6220 C CG1 . VAL B 1 279 ? 77.883  -26.324 355.848 1.00 27.17  ? 280  VAL B CG1 1 
ATOM   6221 C CG2 . VAL B 1 279 ? 77.534  -26.629 358.302 1.00 32.56  ? 280  VAL B CG2 1 
ATOM   6222 N N   . LEU B 1 280 ? 81.517  -27.325 356.166 1.00 26.93  ? 281  LEU B N   1 
ATOM   6223 C CA  . LEU B 1 280 ? 82.556  -27.404 355.143 1.00 29.26  ? 281  LEU B CA  1 
ATOM   6224 C C   . LEU B 1 280 ? 82.973  -28.848 354.904 1.00 32.11  ? 281  LEU B C   1 
ATOM   6225 O O   . LEU B 1 280 ? 83.154  -29.271 353.756 1.00 35.41  ? 281  LEU B O   1 
ATOM   6226 C CB  . LEU B 1 280 ? 83.765  -26.560 355.549 1.00 22.06  ? 281  LEU B CB  1 
ATOM   6227 C CG  . LEU B 1 280 ? 83.553  -25.064 355.793 1.00 29.70  ? 281  LEU B CG  1 
ATOM   6228 C CD1 . LEU B 1 280 ? 84.866  -24.311 355.647 1.00 29.05  ? 281  LEU B CD1 1 
ATOM   6229 C CD2 . LEU B 1 280 ? 82.502  -24.491 354.852 1.00 23.47  ? 281  LEU B CD2 1 
ATOM   6230 N N   . VAL B 1 281 ? 83.119  -29.622 355.982 1.00 30.09  ? 282  VAL B N   1 
ATOM   6231 C CA  . VAL B 1 281 ? 83.499  -31.026 355.859 1.00 27.71  ? 282  VAL B CA  1 
ATOM   6232 C C   . VAL B 1 281 ? 82.446  -31.803 355.078 1.00 30.66  ? 282  VAL B C   1 
ATOM   6233 O O   . VAL B 1 281 ? 82.773  -32.658 354.246 1.00 32.12  ? 282  VAL B O   1 
ATOM   6234 C CB  . VAL B 1 281 ? 83.731  -31.632 357.257 1.00 26.45  ? 282  VAL B CB  1 
ATOM   6235 C CG1 . VAL B 1 281 ? 83.875  -33.142 357.174 1.00 24.22  ? 282  VAL B CG1 1 
ATOM   6236 C CG2 . VAL B 1 281 ? 84.958  -31.009 357.906 1.00 23.44  ? 282  VAL B CG2 1 
ATOM   6237 N N   . ASN B 1 282 ? 81.166  -31.506 355.317 1.00 24.79  ? 283  ASN B N   1 
ATOM   6238 C CA  . ASN B 1 282 ? 80.092  -32.288 354.714 1.00 30.01  ? 283  ASN B CA  1 
ATOM   6239 C C   . ASN B 1 282 ? 80.018  -32.132 353.200 1.00 32.15  ? 283  ASN B C   1 
ATOM   6240 O O   . ASN B 1 282 ? 79.462  -33.009 352.530 1.00 38.03  ? 283  ASN B O   1 
ATOM   6241 C CB  . ASN B 1 282 ? 78.747  -31.905 355.337 1.00 36.58  ? 283  ASN B CB  1 
ATOM   6242 C CG  . ASN B 1 282 ? 78.600  -32.410 356.760 1.00 43.05  ? 283  ASN B CG  1 
ATOM   6243 O OD1 . ASN B 1 282 ? 79.357  -33.273 357.207 1.00 39.96  ? 283  ASN B OD1 1 
ATOM   6244 N ND2 . ASN B 1 282 ? 77.616  -31.879 357.478 1.00 43.12  ? 283  ASN B ND2 1 
ATOM   6245 N N   . HIS B 1 283 ? 80.559  -31.050 352.643 1.00 29.08  ? 284  HIS B N   1 
ATOM   6246 C CA  . HIS B 1 283 ? 80.494  -30.801 351.208 1.00 33.64  ? 284  HIS B CA  1 
ATOM   6247 C C   . HIS B 1 283 ? 81.843  -30.968 350.520 1.00 37.70  ? 284  HIS B C   1 
ATOM   6248 O O   . HIS B 1 283 ? 81.962  -30.667 349.328 1.00 36.08  ? 284  HIS B O   1 
ATOM   6249 C CB  . HIS B 1 283 ? 79.942  -29.398 350.946 1.00 28.18  ? 284  HIS B CB  1 
ATOM   6250 C CG  . HIS B 1 283 ? 78.512  -29.231 351.351 1.00 37.51  ? 284  HIS B CG  1 
ATOM   6251 N ND1 . HIS B 1 283 ? 77.461  -29.516 350.506 1.00 38.36  ? 284  HIS B ND1 1 
ATOM   6252 C CD2 . HIS B 1 283 ? 77.957  -28.821 352.516 1.00 36.10  ? 284  HIS B CD2 1 
ATOM   6253 C CE1 . HIS B 1 283 ? 76.321  -29.282 351.130 1.00 40.55  ? 284  HIS B CE1 1 
ATOM   6254 N NE2 . HIS B 1 283 ? 76.594  -28.860 352.352 1.00 42.38  ? 284  HIS B NE2 1 
ATOM   6255 N N   . GLU B 1 284 ? 82.851  -31.467 351.238 1.00 35.19  ? 285  GLU B N   1 
ATOM   6256 C CA  . GLU B 1 284 ? 84.218  -31.452 350.727 1.00 39.60  ? 285  GLU B CA  1 
ATOM   6257 C C   . GLU B 1 284 ? 84.377  -32.347 349.503 1.00 38.46  ? 285  GLU B C   1 
ATOM   6258 O O   . GLU B 1 284 ? 84.949  -31.929 348.490 1.00 31.76  ? 285  GLU B O   1 
ATOM   6259 C CB  . GLU B 1 284 ? 85.183  -31.883 351.828 1.00 40.56  ? 285  GLU B CB  1 
ATOM   6260 C CG  . GLU B 1 284 ? 86.562  -32.231 351.322 1.00 57.07  ? 285  GLU B CG  1 
ATOM   6261 C CD  . GLU B 1 284 ? 87.491  -32.645 352.436 1.00 63.64  ? 285  GLU B CD  1 
ATOM   6262 O OE1 . GLU B 1 284 ? 87.625  -31.882 353.415 1.00 68.11  ? 285  GLU B OE1 1 
ATOM   6263 O OE2 . GLU B 1 284 ? 88.081  -33.739 352.335 1.00 70.51  ? 285  GLU B OE2 1 
ATOM   6264 N N   . TRP B 1 285 ? 83.888  -33.587 349.580 1.00 33.30  ? 286  TRP B N   1 
ATOM   6265 C CA  . TRP B 1 285 ? 84.113  -34.539 348.498 1.00 38.68  ? 286  TRP B CA  1 
ATOM   6266 C C   . TRP B 1 285 ? 83.406  -34.141 347.206 1.00 43.64  ? 286  TRP B C   1 
ATOM   6267 O O   . TRP B 1 285 ? 83.748  -34.670 346.143 1.00 48.19  ? 286  TRP B O   1 
ATOM   6268 C CB  . TRP B 1 285 ? 83.655  -35.941 348.917 1.00 42.93  ? 286  TRP B CB  1 
ATOM   6269 C CG  . TRP B 1 285 ? 84.504  -36.604 349.977 1.00 57.37  ? 286  TRP B CG  1 
ATOM   6270 C CD1 . TRP B 1 285 ? 84.184  -36.770 351.295 1.00 57.45  ? 286  TRP B CD1 1 
ATOM   6271 C CD2 . TRP B 1 285 ? 85.795  -37.208 349.801 1.00 62.07  ? 286  TRP B CD2 1 
ATOM   6272 N NE1 . TRP B 1 285 ? 85.197  -37.428 351.950 1.00 54.34  ? 286  TRP B NE1 1 
ATOM   6273 C CE2 . TRP B 1 285 ? 86.197  -37.708 351.057 1.00 58.71  ? 286  TRP B CE2 1 
ATOM   6274 C CE3 . TRP B 1 285 ? 86.652  -37.368 348.707 1.00 60.81  ? 286  TRP B CE3 1 
ATOM   6275 C CZ2 . TRP B 1 285 ? 87.416  -38.357 351.248 1.00 55.83  ? 286  TRP B CZ2 1 
ATOM   6276 C CZ3 . TRP B 1 285 ? 87.863  -38.013 348.899 1.00 58.48  ? 286  TRP B CZ3 1 
ATOM   6277 C CH2 . TRP B 1 285 ? 88.233  -38.499 350.160 1.00 56.94  ? 286  TRP B CH2 1 
ATOM   6278 N N   . HIS B 1 286 ? 82.446  -33.220 347.266 1.00 41.59  ? 287  HIS B N   1 
ATOM   6279 C CA  . HIS B 1 286 ? 81.598  -32.913 346.122 1.00 43.70  ? 287  HIS B CA  1 
ATOM   6280 C C   . HIS B 1 286 ? 82.155  -31.816 345.221 1.00 41.03  ? 287  HIS B C   1 
ATOM   6281 O O   . HIS B 1 286 ? 81.500  -31.458 344.237 1.00 44.45  ? 287  HIS B O   1 
ATOM   6282 C CB  . HIS B 1 286 ? 80.196  -32.528 346.601 1.00 53.55  ? 287  HIS B CB  1 
ATOM   6283 C CG  . HIS B 1 286 ? 79.507  -33.613 347.368 1.00 73.61  ? 287  HIS B CG  1 
ATOM   6284 N ND1 . HIS B 1 286 ? 78.840  -33.382 348.552 1.00 79.76  ? 287  HIS B ND1 1 
ATOM   6285 C CD2 . HIS B 1 286 ? 79.391  -34.940 347.124 1.00 79.22  ? 287  HIS B CD2 1 
ATOM   6286 C CE1 . HIS B 1 286 ? 78.339  -34.518 349.002 1.00 81.87  ? 287  HIS B CE1 1 
ATOM   6287 N NE2 . HIS B 1 286 ? 78.659  -35.479 348.154 1.00 80.18  ? 287  HIS B NE2 1 
ATOM   6288 N N   . VAL B 1 287 ? 83.339  -31.273 345.521 1.00 37.15  ? 288  VAL B N   1 
ATOM   6289 C CA  . VAL B 1 287 ? 83.963  -30.313 344.613 1.00 37.33  ? 288  VAL B CA  1 
ATOM   6290 C C   . VAL B 1 287 ? 84.902  -30.979 343.619 1.00 38.38  ? 288  VAL B C   1 
ATOM   6291 O O   . VAL B 1 287 ? 85.402  -30.303 342.706 1.00 42.04  ? 288  VAL B O   1 
ATOM   6292 C CB  . VAL B 1 287 ? 84.740  -29.219 345.374 1.00 38.36  ? 288  VAL B CB  1 
ATOM   6293 C CG1 . VAL B 1 287 ? 83.850  -28.552 346.411 1.00 40.73  ? 288  VAL B CG1 1 
ATOM   6294 C CG2 . VAL B 1 287 ? 85.979  -29.801 346.019 1.00 30.24  ? 288  VAL B CG2 1 
ATOM   6295 N N   . LEU B 1 288 ? 85.160  -32.276 343.764 1.00 36.82  ? 289  LEU B N   1 
ATOM   6296 C CA  . LEU B 1 288 ? 86.033  -32.967 342.828 1.00 38.70  ? 289  LEU B CA  1 
ATOM   6297 C C   . LEU B 1 288 ? 85.407  -32.965 341.435 1.00 41.51  ? 289  LEU B C   1 
ATOM   6298 O O   . LEU B 1 288 ? 84.189  -33.138 341.300 1.00 45.13  ? 289  LEU B O   1 
ATOM   6299 C CB  . LEU B 1 288 ? 86.291  -34.403 343.289 1.00 40.64  ? 289  LEU B CB  1 
ATOM   6300 C CG  . LEU B 1 288 ? 87.379  -34.597 344.348 1.00 37.37  ? 289  LEU B CG  1 
ATOM   6301 C CD1 . LEU B 1 288 ? 87.483  -36.060 344.754 1.00 35.71  ? 289  LEU B CD1 1 
ATOM   6302 C CD2 . LEU B 1 288 ? 88.718  -34.081 343.846 1.00 29.83  ? 289  LEU B CD2 1 
ATOM   6303 N N   . PRO B 1 289 ? 86.204  -32.775 340.380 1.00 47.29  ? 290  PRO B N   1 
ATOM   6304 C CA  . PRO B 1 289 ? 85.620  -32.637 339.037 1.00 49.51  ? 290  PRO B CA  1 
ATOM   6305 C C   . PRO B 1 289 ? 85.033  -33.922 338.483 1.00 51.35  ? 290  PRO B C   1 
ATOM   6306 O O   . PRO B 1 289 ? 84.146  -33.850 337.624 1.00 58.33  ? 290  PRO B O   1 
ATOM   6307 C CB  . PRO B 1 289 ? 86.805  -32.159 338.189 1.00 46.27  ? 290  PRO B CB  1 
ATOM   6308 C CG  . PRO B 1 289 ? 88.004  -32.701 338.894 1.00 44.18  ? 290  PRO B CG  1 
ATOM   6309 C CD  . PRO B 1 289 ? 87.673  -32.668 340.362 1.00 47.03  ? 290  PRO B CD  1 
ATOM   6310 N N   . GLN B 1 290 ? 85.518  -35.081 338.899 1.00 52.65  ? 291  GLN B N   1 
ATOM   6311 C CA  . GLN B 1 290 ? 85.049  -36.372 338.381 1.00 63.56  ? 291  GLN B CA  1 
ATOM   6312 C C   . GLN B 1 290 ? 85.012  -37.476 339.381 1.00 63.41  ? 291  GLN B C   1 
ATOM   6313 O O   . GLN B 1 290 ? 85.620  -37.369 340.394 1.00 59.39  ? 291  GLN B O   1 
ATOM   6314 C CB  . GLN B 1 290 ? 86.003  -36.883 337.309 1.00 73.52  ? 291  GLN B CB  1 
ATOM   6315 C CG  . GLN B 1 290 ? 85.589  -36.651 335.875 1.00 86.09  ? 291  GLN B CG  1 
ATOM   6316 C CD  . GLN B 1 290 ? 84.424  -37.527 335.441 1.00 97.31  ? 291  GLN B CD  1 
ATOM   6317 O OE1 . GLN B 1 290 ? 83.344  -37.485 336.032 1.00 101.95 ? 291  GLN B OE1 1 
ATOM   6318 N NE2 . GLN B 1 290 ? 84.626  -38.305 334.384 1.00 98.34  ? 291  GLN B NE2 1 
ATOM   6319 N N   . GLU B 1 291 ? 84.308  -38.557 339.087 1.00 63.95  ? 292  GLU B N   1 
ATOM   6320 C CA  . GLU B 1 291 ? 84.306  -39.695 339.991 1.00 67.87  ? 292  GLU B CA  1 
ATOM   6321 C C   . GLU B 1 291 ? 85.736  -40.203 339.941 1.00 61.82  ? 292  GLU B C   1 
ATOM   6322 O O   . GLU B 1 291 ? 86.354  -40.168 338.908 1.00 61.48  ? 292  GLU B O   1 
ATOM   6323 C CB  . GLU B 1 291 ? 83.332  -40.763 339.563 1.00 83.75  ? 292  GLU B CB  1 
ATOM   6324 C CG  . GLU B 1 291 ? 81.883  -40.410 339.853 1.00 100.28 ? 292  GLU B CG  1 
ATOM   6325 C CD  . GLU B 1 291 ? 81.681  -39.900 341.270 1.00 111.40 ? 292  GLU B CD  1 
ATOM   6326 O OE1 . GLU B 1 291 ? 82.475  -40.280 342.146 1.00 114.69 ? 292  GLU B OE1 1 
ATOM   6327 O OE2 . GLU B 1 291 ? 80.733  -39.125 341.504 1.00 113.93 ? 292  GLU B OE2 1 
ATOM   6328 N N   . SER B 1 292 ? 86.267  -40.659 341.060 1.00 53.37  ? 293  SER B N   1 
ATOM   6329 C CA  . SER B 1 292 ? 87.666  -41.055 341.129 1.00 49.44  ? 293  SER B CA  1 
ATOM   6330 C C   . SER B 1 292 ? 87.941  -41.774 342.438 1.00 51.60  ? 293  SER B C   1 
ATOM   6331 O O   . SER B 1 292 ? 87.211  -41.623 343.422 1.00 56.20  ? 293  SER B O   1 
ATOM   6332 C CB  . SER B 1 292 ? 88.598  -39.843 341.000 1.00 43.33  ? 293  SER B CB  1 
ATOM   6333 O OG  . SER B 1 292 ? 88.247  -38.833 341.933 1.00 43.93  ? 293  SER B OG  1 
ATOM   6334 N N   . VAL B 1 293 ? 89.006  -42.568 342.424 1.00 47.00  ? 294  VAL B N   1 
ATOM   6335 C CA  . VAL B 1 293 ? 89.679  -43.013 343.633 1.00 44.16  ? 294  VAL B CA  1 
ATOM   6336 C C   . VAL B 1 293 ? 91.043  -42.334 343.667 1.00 44.71  ? 294  VAL B C   1 
ATOM   6337 O O   . VAL B 1 293 ? 91.587  -41.926 342.635 1.00 39.15  ? 294  VAL B O   1 
ATOM   6338 C CB  . VAL B 1 293 ? 89.819  -44.549 343.707 1.00 37.66  ? 294  VAL B CB  1 
ATOM   6339 C CG1 . VAL B 1 293 ? 88.450  -45.214 343.700 1.00 38.56  ? 294  VAL B CG1 1 
ATOM   6340 C CG2 . VAL B 1 293 ? 90.677  -45.064 342.559 1.00 34.46  ? 294  VAL B CG2 1 
ATOM   6341 N N   . PHE B 1 294 ? 91.589  -42.191 344.879 1.00 40.87  ? 295  PHE B N   1 
ATOM   6342 C CA  . PHE B 1 294 ? 92.918  -41.602 345.095 1.00 40.15  ? 295  PHE B CA  1 
ATOM   6343 C C   . PHE B 1 294 ? 92.999  -40.172 344.571 1.00 40.76  ? 295  PHE B C   1 
ATOM   6344 O O   . PHE B 1 294 ? 94.001  -39.772 343.974 1.00 33.29  ? 295  PHE B O   1 
ATOM   6345 C CB  . PHE B 1 294 ? 94.018  -42.451 344.457 1.00 36.33  ? 295  PHE B CB  1 
ATOM   6346 C CG  . PHE B 1 294 ? 95.262  -42.603 345.300 1.00 36.40  ? 295  PHE B CG  1 
ATOM   6347 C CD1 . PHE B 1 294 ? 95.794  -43.860 345.566 1.00 33.15  ? 295  PHE B CD1 1 
ATOM   6348 C CD2 . PHE B 1 294 ? 95.921  -41.499 345.788 1.00 29.44  ? 295  PHE B CD2 1 
ATOM   6349 C CE1 . PHE B 1 294 ? 96.937  -44.010 346.316 1.00 29.68  ? 295  PHE B CE1 1 
ATOM   6350 C CE2 . PHE B 1 294 ? 97.063  -41.647 346.539 1.00 28.62  ? 295  PHE B CE2 1 
ATOM   6351 C CZ  . PHE B 1 294 ? 97.568  -42.906 346.804 1.00 31.34  ? 295  PHE B CZ  1 
ATOM   6352 N N   . ARG B 1 295 ? 91.935  -39.400 344.772 1.00 34.83  ? 296  ARG B N   1 
ATOM   6353 C CA  . ARG B 1 295 ? 91.976  -37.965 344.531 1.00 32.76  ? 296  ARG B CA  1 
ATOM   6354 C C   . ARG B 1 295 ? 91.259  -37.256 345.666 1.00 33.31  ? 296  ARG B C   1 
ATOM   6355 O O   . ARG B 1 295 ? 90.242  -37.742 346.172 1.00 33.92  ? 296  ARG B O   1 
ATOM   6356 C CB  . ARG B 1 295 ? 91.350  -37.576 343.186 1.00 30.99  ? 296  ARG B CB  1 
ATOM   6357 C CG  . ARG B 1 295 ? 92.123  -38.071 341.977 1.00 35.99  ? 296  ARG B CG  1 
ATOM   6358 C CD  . ARG B 1 295 ? 93.281  -37.138 341.615 1.00 36.17  ? 296  ARG B CD  1 
ATOM   6359 N NE  . ARG B 1 295 ? 94.018  -37.612 340.444 1.00 42.11  ? 296  ARG B NE  1 
ATOM   6360 C CZ  . ARG B 1 295 ? 94.718  -38.743 340.394 1.00 40.76  ? 296  ARG B CZ  1 
ATOM   6361 N NH1 . ARG B 1 295 ? 94.812  -39.530 341.459 1.00 31.68  ? 296  ARG B NH1 1 
ATOM   6362 N NH2 . ARG B 1 295 ? 95.342  -39.085 339.274 1.00 38.51  ? 296  ARG B NH2 1 
ATOM   6363 N N   . PHE B 1 296 ? 91.795  -36.103 346.054 1.00 28.84  ? 297  PHE B N   1 
ATOM   6364 C CA  . PHE B 1 296 ? 91.359  -35.386 347.239 1.00 27.55  ? 297  PHE B CA  1 
ATOM   6365 C C   . PHE B 1 296 ? 91.181  -33.911 346.907 1.00 30.35  ? 297  PHE B C   1 
ATOM   6366 O O   . PHE B 1 296 ? 91.924  -33.342 346.103 1.00 28.11  ? 297  PHE B O   1 
ATOM   6367 C CB  . PHE B 1 296 ? 92.366  -35.585 348.376 1.00 26.51  ? 297  PHE B CB  1 
ATOM   6368 C CG  . PHE B 1 296 ? 92.943  -36.972 348.418 1.00 21.30  ? 297  PHE B CG  1 
ATOM   6369 C CD1 . PHE B 1 296 ? 92.178  -38.039 348.859 1.00 22.38  ? 297  PHE B CD1 1 
ATOM   6370 C CD2 . PHE B 1 296 ? 94.233  -37.215 347.978 1.00 21.44  ? 297  PHE B CD2 1 
ATOM   6371 C CE1 . PHE B 1 296 ? 92.697  -39.321 348.884 1.00 23.11  ? 297  PHE B CE1 1 
ATOM   6372 C CE2 . PHE B 1 296 ? 94.759  -38.496 348.000 1.00 22.46  ? 297  PHE B CE2 1 
ATOM   6373 C CZ  . PHE B 1 296 ? 93.989  -39.550 348.453 1.00 23.53  ? 297  PHE B CZ  1 
ATOM   6374 N N   . SER B 1 297 ? 90.189  -33.296 347.553 1.00 25.00  ? 298  SER B N   1 
ATOM   6375 C CA  . SER B 1 297 ? 89.698  -31.996 347.106 1.00 27.83  ? 298  SER B CA  1 
ATOM   6376 C C   . SER B 1 297 ? 90.702  -30.882 347.378 1.00 28.27  ? 298  SER B C   1 
ATOM   6377 O O   . SER B 1 297 ? 91.007  -30.079 346.489 1.00 24.91  ? 298  SER B O   1 
ATOM   6378 C CB  . SER B 1 297 ? 88.361  -31.690 347.779 1.00 31.14  ? 298  SER B CB  1 
ATOM   6379 O OG  . SER B 1 297 ? 87.408  -32.697 347.488 1.00 32.59  ? 298  SER B OG  1 
ATOM   6380 N N   . PHE B 1 298 ? 91.220  -30.804 348.600 1.00 20.40  ? 299  PHE B N   1 
ATOM   6381 C CA  . PHE B 1 298 ? 92.040  -29.672 349.016 1.00 22.28  ? 299  PHE B CA  1 
ATOM   6382 C C   . PHE B 1 298 ? 93.433  -30.168 349.376 1.00 23.26  ? 299  PHE B C   1 
ATOM   6383 O O   . PHE B 1 298 ? 93.631  -30.784 350.429 1.00 21.75  ? 299  PHE B O   1 
ATOM   6384 C CB  . PHE B 1 298 ? 91.367  -28.925 350.162 1.00 19.43  ? 299  PHE B CB  1 
ATOM   6385 C CG  . PHE B 1 298 ? 90.083  -28.272 349.750 1.00 24.71  ? 299  PHE B CG  1 
ATOM   6386 C CD1 . PHE B 1 298 ? 90.100  -27.076 349.052 1.00 23.77  ? 299  PHE B CD1 1 
ATOM   6387 C CD2 . PHE B 1 298 ? 88.865  -28.879 350.003 1.00 26.25  ? 299  PHE B CD2 1 
ATOM   6388 C CE1 . PHE B 1 298 ? 88.925  -26.478 348.644 1.00 21.70  ? 299  PHE B CE1 1 
ATOM   6389 C CE2 . PHE B 1 298 ? 87.684  -28.286 349.596 1.00 25.18  ? 299  PHE B CE2 1 
ATOM   6390 C CZ  . PHE B 1 298 ? 87.715  -27.083 348.916 1.00 26.98  ? 299  PHE B CZ  1 
ATOM   6391 N N   . VAL B 1 299 ? 94.384  -29.898 348.487 1.00 19.10  ? 300  VAL B N   1 
ATOM   6392 C CA  . VAL B 1 299 ? 95.759  -30.382 348.579 1.00 18.64  ? 300  VAL B CA  1 
ATOM   6393 C C   . VAL B 1 299 ? 96.687  -29.185 348.395 1.00 19.70  ? 300  VAL B C   1 
ATOM   6394 O O   . VAL B 1 299 ? 96.207  -28.085 348.081 1.00 18.92  ? 300  VAL B O   1 
ATOM   6395 C CB  . VAL B 1 299 ? 96.025  -31.480 347.533 1.00 21.41  ? 300  VAL B CB  1 
ATOM   6396 C CG1 . VAL B 1 299 ? 94.944  -32.550 347.587 1.00 19.64  ? 300  VAL B CG1 1 
ATOM   6397 C CG2 . VAL B 1 299 ? 96.109  -30.873 346.141 1.00 20.02  ? 300  VAL B CG2 1 
ATOM   6398 N N   . PRO B 1 300 ? 97.998  -29.331 348.605 1.00 19.33  ? 301  PRO B N   1 
ATOM   6399 C CA  . PRO B 1 300 ? 98.914  -28.214 348.348 1.00 18.29  ? 301  PRO B CA  1 
ATOM   6400 C C   . PRO B 1 300 ? 98.757  -27.645 346.944 1.00 20.32  ? 301  PRO B C   1 
ATOM   6401 O O   . PRO B 1 300 ? 98.569  -28.376 345.970 1.00 22.24  ? 301  PRO B O   1 
ATOM   6402 C CB  . PRO B 1 300 ? 100.293 -28.848 348.547 1.00 18.01  ? 301  PRO B CB  1 
ATOM   6403 C CG  . PRO B 1 300 ? 100.050 -29.866 349.603 1.00 20.91  ? 301  PRO B CG  1 
ATOM   6404 C CD  . PRO B 1 300 ? 98.679  -30.430 349.316 1.00 21.31  ? 301  PRO B CD  1 
ATOM   6405 N N   . VAL B 1 301 ? 98.832  -26.320 346.849 1.00 20.83  ? 302  VAL B N   1 
ATOM   6406 C CA  . VAL B 1 301 ? 98.695  -25.605 345.586 1.00 20.59  ? 302  VAL B CA  1 
ATOM   6407 C C   . VAL B 1 301 ? 100.068 -25.103 345.159 1.00 25.10  ? 302  VAL B C   1 
ATOM   6408 O O   . VAL B 1 301 ? 100.863 -24.647 345.990 1.00 23.98  ? 302  VAL B O   1 
ATOM   6409 C CB  . VAL B 1 301 ? 97.681  -24.446 345.699 1.00 23.08  ? 302  VAL B CB  1 
ATOM   6410 C CG1 . VAL B 1 301 ? 98.140  -23.408 346.718 1.00 24.17  ? 302  VAL B CG1 1 
ATOM   6411 C CG2 . VAL B 1 301 ? 97.441  -23.802 344.340 1.00 25.27  ? 302  VAL B CG2 1 
ATOM   6412 N N   . VAL B 1 302 ? 100.357 -25.216 343.864 1.00 23.84  ? 303  VAL B N   1 
ATOM   6413 C CA  . VAL B 1 302 ? 101.604 -24.713 343.296 1.00 26.07  ? 303  VAL B CA  1 
ATOM   6414 C C   . VAL B 1 302 ? 101.332 -23.287 342.830 1.00 29.12  ? 303  VAL B C   1 
ATOM   6415 O O   . VAL B 1 302 ? 100.788 -23.065 341.747 1.00 36.39  ? 303  VAL B O   1 
ATOM   6416 C CB  . VAL B 1 302 ? 102.113 -25.600 342.160 1.00 28.70  ? 303  VAL B CB  1 
ATOM   6417 C CG1 . VAL B 1 302 ? 103.398 -25.030 341.578 1.00 24.44  ? 303  VAL B CG1 1 
ATOM   6418 C CG2 . VAL B 1 302 ? 102.337 -27.020 342.658 1.00 27.90  ? 303  VAL B CG2 1 
ATOM   6419 N N   . ASP B 1 303 ? 101.710 -22.312 343.659 1.00 30.06  ? 304  ASP B N   1 
ATOM   6420 C CA  . ASP B 1 303 ? 101.423 -20.910 343.385 1.00 36.15  ? 304  ASP B CA  1 
ATOM   6421 C C   . ASP B 1 303 ? 102.669 -20.031 343.403 1.00 36.69  ? 304  ASP B C   1 
ATOM   6422 O O   . ASP B 1 303 ? 102.542 -18.803 343.468 1.00 38.90  ? 304  ASP B O   1 
ATOM   6423 C CB  . ASP B 1 303 ? 100.395 -20.372 344.388 1.00 40.83  ? 304  ASP B CB  1 
ATOM   6424 C CG  . ASP B 1 303 ? 100.930 -20.326 345.808 1.00 46.13  ? 304  ASP B CG  1 
ATOM   6425 O OD1 . ASP B 1 303 ? 101.941 -21.004 346.094 1.00 44.32  ? 304  ASP B OD1 1 
ATOM   6426 O OD2 . ASP B 1 303 ? 100.334 -19.615 346.644 1.00 51.06  ? 304  ASP B OD2 1 
ATOM   6427 N N   . GLY B 1 304 ? 103.864 -20.619 343.354 1.00 31.21  ? 305  GLY B N   1 
ATOM   6428 C CA  . GLY B 1 304 ? 105.093 -19.856 343.338 1.00 35.83  ? 305  GLY B CA  1 
ATOM   6429 C C   . GLY B 1 304 ? 105.626 -19.454 344.696 1.00 37.40  ? 305  GLY B C   1 
ATOM   6430 O O   . GLY B 1 304 ? 106.742 -18.923 344.771 1.00 35.25  ? 305  GLY B O   1 
ATOM   6431 N N   . ASP B 1 305 ? 104.907 -19.696 345.770 1.00 31.68  ? 306  ASP B N   1 
ATOM   6432 C CA  . ASP B 1 305 ? 105.368 -19.307 347.076 1.00 34.18  ? 306  ASP B CA  1 
ATOM   6433 C C   . ASP B 1 305 ? 105.978 -20.479 347.838 1.00 34.35  ? 306  ASP B C   1 
ATOM   6434 O O   . ASP B 1 305 ? 107.163 -20.673 347.785 1.00 32.87  ? 306  ASP B O   1 
ATOM   6435 C CB  . ASP B 1 305 ? 104.181 -18.764 347.827 1.00 40.05  ? 306  ASP B CB  1 
ATOM   6436 C CG  . ASP B 1 305 ? 104.553 -18.070 349.073 1.00 49.41  ? 306  ASP B CG  1 
ATOM   6437 O OD1 . ASP B 1 305 ? 105.697 -18.118 349.480 1.00 52.82  ? 306  ASP B OD1 1 
ATOM   6438 O OD2 . ASP B 1 305 ? 103.684 -17.457 349.664 1.00 53.02  ? 306  ASP B OD2 1 
ATOM   6439 N N   . PHE B 1 306 ? 105.184 -21.278 348.518 1.00 32.83  ? 307  PHE B N   1 
ATOM   6440 C CA  . PHE B 1 306 ? 105.759 -22.442 349.190 1.00 25.09  ? 307  PHE B CA  1 
ATOM   6441 C C   . PHE B 1 306 ? 106.518 -23.317 348.202 1.00 29.98  ? 307  PHE B C   1 
ATOM   6442 O O   . PHE B 1 306 ? 107.632 -23.771 348.490 1.00 28.47  ? 307  PHE B O   1 
ATOM   6443 C CB  . PHE B 1 306 ? 104.664 -23.249 349.891 1.00 20.49  ? 307  PHE B CB  1 
ATOM   6444 C CG  . PHE B 1 306 ? 105.189 -24.214 350.922 1.00 24.17  ? 307  PHE B CG  1 
ATOM   6445 C CD1 . PHE B 1 306 ? 105.782 -25.409 350.541 1.00 19.28  ? 307  PHE B CD1 1 
ATOM   6446 C CD2 . PHE B 1 306 ? 105.088 -23.926 352.273 1.00 20.82  ? 307  PHE B CD2 1 
ATOM   6447 C CE1 . PHE B 1 306 ? 106.267 -26.294 351.487 1.00 20.22  ? 307  PHE B CE1 1 
ATOM   6448 C CE2 . PHE B 1 306 ? 105.569 -24.808 353.224 1.00 20.07  ? 307  PHE B CE2 1 
ATOM   6449 C CZ  . PHE B 1 306 ? 106.160 -25.993 352.830 1.00 18.66  ? 307  PHE B CZ  1 
ATOM   6450 N N   . LEU B 1 307 ? 105.932 -23.561 347.035 1.00 31.60  ? 308  LEU B N   1 
ATOM   6451 C CA  . LEU B 1 307 ? 106.595 -24.251 345.937 1.00 30.88  ? 308  LEU B CA  1 
ATOM   6452 C C   . LEU B 1 307 ? 106.745 -23.266 344.785 1.00 32.41  ? 308  LEU B C   1 
ATOM   6453 O O   . LEU B 1 307 ? 105.744 -22.762 344.265 1.00 34.81  ? 308  LEU B O   1 
ATOM   6454 C CB  . LEU B 1 307 ? 105.798 -25.479 345.497 1.00 34.19  ? 308  LEU B CB  1 
ATOM   6455 C CG  . LEU B 1 307 ? 105.556 -26.556 346.555 1.00 37.18  ? 308  LEU B CG  1 
ATOM   6456 C CD1 . LEU B 1 307 ? 104.526 -27.563 346.066 1.00 37.15  ? 308  LEU B CD1 1 
ATOM   6457 C CD2 . LEU B 1 307 ? 106.859 -27.249 346.919 1.00 30.05  ? 308  LEU B CD2 1 
ATOM   6458 N N   . SER B 1 308 ? 107.990 -22.987 344.397 1.00 33.00  ? 309  SER B N   1 
ATOM   6459 C CA  . SER B 1 308 ? 108.243 -22.047 343.311 1.00 36.62  ? 309  SER B CA  1 
ATOM   6460 C C   . SER B 1 308 ? 107.948 -22.642 341.940 1.00 37.40  ? 309  SER B C   1 
ATOM   6461 O O   . SER B 1 308 ? 107.841 -21.894 340.963 1.00 44.35  ? 309  SER B O   1 
ATOM   6462 C CB  . SER B 1 308 ? 109.692 -21.557 343.363 1.00 37.30  ? 309  SER B CB  1 
ATOM   6463 O OG  . SER B 1 308 ? 110.599 -22.644 343.329 1.00 47.30  ? 309  SER B OG  1 
ATOM   6464 N N   . ASP B 1 309 ? 107.822 -23.963 341.851 1.00 33.17  ? 310  ASP B N   1 
ATOM   6465 C CA  . ASP B 1 309 ? 107.440 -24.645 340.624 1.00 32.50  ? 310  ASP B CA  1 
ATOM   6466 C C   . ASP B 1 309 ? 106.774 -25.956 341.020 1.00 31.73  ? 310  ASP B C   1 
ATOM   6467 O O   . ASP B 1 309 ? 106.609 -26.252 342.207 1.00 28.99  ? 310  ASP B O   1 
ATOM   6468 C CB  . ASP B 1 309 ? 108.654 -24.866 339.713 1.00 39.47  ? 310  ASP B CB  1 
ATOM   6469 C CG  . ASP B 1 309 ? 108.284 -24.891 338.239 1.00 51.85  ? 310  ASP B CG  1 
ATOM   6470 O OD1 . ASP B 1 309 ? 107.132 -25.252 337.918 1.00 53.13  ? 310  ASP B OD1 1 
ATOM   6471 O OD2 . ASP B 1 309 ? 109.148 -24.549 337.403 1.00 54.97  ? 310  ASP B OD2 1 
ATOM   6472 N N   . THR B 1 310 ? 106.379 -26.742 340.022 1.00 28.76  ? 311  THR B N   1 
ATOM   6473 C CA  . THR B 1 310 ? 105.829 -28.054 340.315 1.00 30.96  ? 311  THR B CA  1 
ATOM   6474 C C   . THR B 1 310 ? 106.891 -28.908 341.005 1.00 31.20  ? 311  THR B C   1 
ATOM   6475 O O   . THR B 1 310 ? 108.089 -28.743 340.753 1.00 32.49  ? 311  THR B O   1 
ATOM   6476 C CB  . THR B 1 310 ? 105.353 -28.751 339.041 1.00 31.82  ? 311  THR B CB  1 
ATOM   6477 O OG1 . THR B 1 310 ? 106.486 -29.149 338.258 1.00 35.48  ? 311  THR B OG1 1 
ATOM   6478 C CG2 . THR B 1 310 ? 104.471 -27.824 338.221 1.00 28.50  ? 311  THR B CG2 1 
ATOM   6479 N N   . PRO B 1 311 ? 106.482 -29.812 341.898 1.00 31.80  ? 312  PRO B N   1 
ATOM   6480 C CA  . PRO B 1 311 ? 107.466 -30.717 342.509 1.00 29.55  ? 312  PRO B CA  1 
ATOM   6481 C C   . PRO B 1 311 ? 108.325 -31.464 341.495 1.00 31.77  ? 312  PRO B C   1 
ATOM   6482 O O   . PRO B 1 311 ? 109.524 -31.617 341.744 1.00 35.04  ? 312  PRO B O   1 
ATOM   6483 C CB  . PRO B 1 311 ? 106.589 -31.662 343.343 1.00 31.38  ? 312  PRO B CB  1 
ATOM   6484 C CG  . PRO B 1 311 ? 105.391 -30.839 343.685 1.00 32.44  ? 312  PRO B CG  1 
ATOM   6485 C CD  . PRO B 1 311 ? 105.135 -29.995 342.465 1.00 31.24  ? 312  PRO B CD  1 
ATOM   6486 N N   . GLU B 1 312 ? 107.769 -31.916 340.359 1.00 33.06  ? 313  GLU B N   1 
ATOM   6487 C CA  . GLU B 1 312 ? 108.595 -32.571 339.337 1.00 36.59  ? 313  GLU B CA  1 
ATOM   6488 C C   . GLU B 1 312 ? 109.659 -31.628 338.804 1.00 34.41  ? 313  GLU B C   1 
ATOM   6489 O O   . GLU B 1 312 ? 110.815 -32.023 338.626 1.00 35.63  ? 313  GLU B O   1 
ATOM   6490 C CB  . GLU B 1 312 ? 107.747 -33.083 338.167 1.00 51.00  ? 313  GLU B CB  1 
ATOM   6491 C CG  . GLU B 1 312 ? 107.075 -34.397 338.392 1.00 70.14  ? 313  GLU B CG  1 
ATOM   6492 C CD  . GLU B 1 312 ? 105.703 -34.160 339.058 1.00 86.30  ? 313  GLU B CD  1 
ATOM   6493 O OE1 . GLU B 1 312 ? 104.791 -34.968 338.831 1.00 89.32  ? 313  GLU B OE1 1 
ATOM   6494 O OE2 . GLU B 1 312 ? 105.589 -33.200 339.820 1.00 87.55  ? 313  GLU B OE2 1 
ATOM   6495 N N   . ALA B 1 313 ? 109.279 -30.383 338.502 1.00 32.92  ? 314  ALA B N   1 
ATOM   6496 C CA  . ALA B 1 313 ? 110.262 -29.441 337.976 1.00 33.18  ? 314  ALA B CA  1 
ATOM   6497 C C   . ALA B 1 313 ? 111.364 -29.177 338.993 1.00 37.77  ? 314  ALA B C   1 
ATOM   6498 O O   . ALA B 1 313 ? 112.546 -29.100 338.635 1.00 38.98  ? 314  ALA B O   1 
ATOM   6499 C CB  . ALA B 1 313 ? 109.588 -28.132 337.562 1.00 29.68  ? 314  ALA B CB  1 
ATOM   6500 N N   . LEU B 1 314 ? 110.999 -29.050 340.271 1.00 35.59  ? 315  LEU B N   1 
ATOM   6501 C CA  . LEU B 1 314 ? 112.001 -28.799 341.300 1.00 30.68  ? 315  LEU B CA  1 
ATOM   6502 C C   . LEU B 1 314 ? 112.884 -30.017 341.536 1.00 29.93  ? 315  LEU B C   1 
ATOM   6503 O O   . LEU B 1 314 ? 114.067 -29.868 341.861 1.00 31.01  ? 315  LEU B O   1 
ATOM   6504 C CB  . LEU B 1 314 ? 111.319 -28.371 342.599 1.00 29.05  ? 315  LEU B CB  1 
ATOM   6505 C CG  . LEU B 1 314 ? 110.670 -26.987 342.541 1.00 31.67  ? 315  LEU B CG  1 
ATOM   6506 C CD1 . LEU B 1 314 ? 109.689 -26.793 343.686 1.00 23.79  ? 315  LEU B CD1 1 
ATOM   6507 C CD2 . LEU B 1 314 ? 111.735 -25.900 342.547 1.00 33.27  ? 315  LEU B CD2 1 
ATOM   6508 N N   . ILE B 1 315 ? 112.337 -31.223 341.373 1.00 29.90  ? 316  ILE B N   1 
ATOM   6509 C CA  . ILE B 1 315 ? 113.141 -32.427 341.552 1.00 35.56  ? 316  ILE B CA  1 
ATOM   6510 C C   . ILE B 1 315 ? 114.174 -32.553 340.435 1.00 42.10  ? 316  ILE B C   1 
ATOM   6511 O O   . ILE B 1 315 ? 115.324 -32.940 340.676 1.00 46.28  ? 316  ILE B O   1 
ATOM   6512 C CB  . ILE B 1 315 ? 112.231 -33.668 341.635 1.00 32.15  ? 316  ILE B CB  1 
ATOM   6513 C CG1 . ILE B 1 315 ? 111.454 -33.680 342.952 1.00 33.92  ? 316  ILE B CG1 1 
ATOM   6514 C CG2 . ILE B 1 315 ? 113.042 -34.938 341.532 1.00 33.94  ? 316  ILE B CG2 1 
ATOM   6515 C CD1 . ILE B 1 315 ? 110.233 -34.581 342.928 1.00 34.40  ? 316  ILE B CD1 1 
ATOM   6516 N N   . ASN B 1 316 ? 113.791 -32.204 339.203 1.00 41.85  ? 317  ASN B N   1 
ATOM   6517 C CA  . ASN B 1 316 ? 114.693 -32.380 338.067 1.00 39.62  ? 317  ASN B CA  1 
ATOM   6518 C C   . ASN B 1 316 ? 115.813 -31.346 338.054 1.00 41.80  ? 317  ASN B C   1 
ATOM   6519 O O   . ASN B 1 316 ? 116.881 -31.602 337.488 1.00 54.66  ? 317  ASN B O   1 
ATOM   6520 C CB  . ASN B 1 316 ? 113.912 -32.311 336.754 1.00 37.10  ? 317  ASN B CB  1 
ATOM   6521 C CG  . ASN B 1 316 ? 112.924 -33.448 336.603 1.00 47.39  ? 317  ASN B CG  1 
ATOM   6522 O OD1 . ASN B 1 316 ? 113.057 -34.492 337.241 1.00 50.72  ? 317  ASN B OD1 1 
ATOM   6523 N ND2 . ASN B 1 316 ? 111.924 -33.252 335.751 1.00 52.30  ? 317  ASN B ND2 1 
ATOM   6524 N N   . ALA B 1 317 ? 115.591 -30.180 338.653 1.00 36.19  ? 318  ALA B N   1 
ATOM   6525 C CA  . ALA B 1 317 ? 116.566 -29.099 338.631 1.00 36.15  ? 318  ALA B CA  1 
ATOM   6526 C C   . ALA B 1 317 ? 117.362 -28.984 339.922 1.00 40.81  ? 318  ALA B C   1 
ATOM   6527 O O   . ALA B 1 317 ? 118.182 -28.069 340.049 1.00 49.83  ? 318  ALA B O   1 
ATOM   6528 C CB  . ALA B 1 317 ? 115.867 -27.767 338.341 1.00 38.91  ? 318  ALA B CB  1 
ATOM   6529 N N   . GLY B 1 318 ? 117.154 -29.889 340.874 1.00 39.00  ? 319  GLY B N   1 
ATOM   6530 C CA  . GLY B 1 318 ? 117.719 -29.732 342.201 1.00 37.12  ? 319  GLY B CA  1 
ATOM   6531 C C   . GLY B 1 318 ? 119.104 -30.342 342.338 1.00 36.97  ? 319  GLY B C   1 
ATOM   6532 O O   . GLY B 1 318 ? 119.412 -31.372 341.741 1.00 36.38  ? 319  GLY B O   1 
ATOM   6533 N N   . ASP B 1 319 ? 119.939 -29.675 343.130 1.00 37.84  ? 320  ASP B N   1 
ATOM   6534 C CA  . ASP B 1 319 ? 121.202 -30.231 343.600 1.00 38.04  ? 320  ASP B CA  1 
ATOM   6535 C C   . ASP B 1 319 ? 120.929 -30.884 344.948 1.00 35.65  ? 320  ASP B C   1 
ATOM   6536 O O   . ASP B 1 319 ? 120.578 -30.201 345.915 1.00 34.69  ? 320  ASP B O   1 
ATOM   6537 C CB  . ASP B 1 319 ? 122.267 -29.142 343.713 1.00 42.17  ? 320  ASP B CB  1 
ATOM   6538 C CG  . ASP B 1 319 ? 123.632 -29.684 344.117 1.00 48.41  ? 320  ASP B CG  1 
ATOM   6539 O OD1 . ASP B 1 319 ? 123.744 -30.887 344.441 1.00 43.13  ? 320  ASP B OD1 1 
ATOM   6540 O OD2 . ASP B 1 319 ? 124.603 -28.896 344.113 1.00 48.40  ? 320  ASP B OD2 1 
ATOM   6541 N N   . PHE B 1 320 ? 121.084 -32.206 345.016 1.00 30.22  ? 321  PHE B N   1 
ATOM   6542 C CA  . PHE B 1 320 ? 120.748 -32.946 346.225 1.00 31.14  ? 321  PHE B CA  1 
ATOM   6543 C C   . PHE B 1 320 ? 121.962 -33.621 346.853 1.00 32.73  ? 321  PHE B C   1 
ATOM   6544 O O   . PHE B 1 320 ? 121.804 -34.536 347.665 1.00 29.18  ? 321  PHE B O   1 
ATOM   6545 C CB  . PHE B 1 320 ? 119.646 -33.963 345.927 1.00 31.63  ? 321  PHE B CB  1 
ATOM   6546 C CG  . PHE B 1 320 ? 118.352 -33.328 345.511 1.00 32.10  ? 321  PHE B CG  1 
ATOM   6547 C CD1 . PHE B 1 320 ? 117.516 -32.751 346.453 1.00 28.45  ? 321  PHE B CD1 1 
ATOM   6548 C CD2 . PHE B 1 320 ? 117.986 -33.278 344.176 1.00 30.42  ? 321  PHE B CD2 1 
ATOM   6549 C CE1 . PHE B 1 320 ? 116.329 -32.153 346.074 1.00 31.61  ? 321  PHE B CE1 1 
ATOM   6550 C CE2 . PHE B 1 320 ? 116.799 -32.682 343.791 1.00 31.18  ? 321  PHE B CE2 1 
ATOM   6551 C CZ  . PHE B 1 320 ? 115.970 -32.119 344.741 1.00 30.69  ? 321  PHE B CZ  1 
ATOM   6552 N N   . HIS B 1 321 ? 123.169 -33.181 346.504 1.00 30.11  ? 322  HIS B N   1 
ATOM   6553 C CA  . HIS B 1 321 ? 124.355 -33.639 347.216 1.00 31.64  ? 322  HIS B CA  1 
ATOM   6554 C C   . HIS B 1 321 ? 124.249 -33.265 348.688 1.00 30.34  ? 322  HIS B C   1 
ATOM   6555 O O   . HIS B 1 321 ? 123.873 -32.140 349.030 1.00 34.76  ? 322  HIS B O   1 
ATOM   6556 C CB  . HIS B 1 321 ? 125.617 -33.030 346.606 1.00 33.64  ? 322  HIS B CB  1 
ATOM   6557 C CG  . HIS B 1 321 ? 126.010 -33.636 345.296 1.00 32.05  ? 322  HIS B CG  1 
ATOM   6558 N ND1 . HIS B 1 321 ? 125.565 -33.147 344.087 1.00 35.62  ? 322  HIS B ND1 1 
ATOM   6559 C CD2 . HIS B 1 321 ? 126.805 -34.693 345.005 1.00 34.15  ? 322  HIS B CD2 1 
ATOM   6560 C CE1 . HIS B 1 321 ? 126.070 -33.875 343.107 1.00 38.75  ? 322  HIS B CE1 1 
ATOM   6561 N NE2 . HIS B 1 321 ? 126.825 -34.820 343.637 1.00 39.74  ? 322  HIS B NE2 1 
ATOM   6562 N N   . GLY B 1 322 ? 124.575 -34.214 349.560 1.00 26.91  ? 323  GLY B N   1 
ATOM   6563 C CA  . GLY B 1 322 ? 124.461 -34.006 350.986 1.00 31.07  ? 323  GLY B CA  1 
ATOM   6564 C C   . GLY B 1 322 ? 123.131 -34.406 351.584 1.00 34.08  ? 323  GLY B C   1 
ATOM   6565 O O   . GLY B 1 322 ? 122.928 -34.205 352.788 1.00 37.02  ? 323  GLY B O   1 
ATOM   6566 N N   . LEU B 1 323 ? 122.221 -34.956 350.789 1.00 30.03  ? 324  LEU B N   1 
ATOM   6567 C CA  . LEU B 1 323 ? 120.930 -35.425 351.271 1.00 28.47  ? 324  LEU B CA  1 
ATOM   6568 C C   . LEU B 1 323 ? 120.938 -36.946 351.322 1.00 26.27  ? 324  LEU B C   1 
ATOM   6569 O O   . LEU B 1 323 ? 121.420 -37.600 350.394 1.00 25.15  ? 324  LEU B O   1 
ATOM   6570 C CB  . LEU B 1 323 ? 119.793 -34.926 350.374 1.00 31.60  ? 324  LEU B CB  1 
ATOM   6571 C CG  . LEU B 1 323 ? 118.374 -35.352 350.758 1.00 32.63  ? 324  LEU B CG  1 
ATOM   6572 C CD1 . LEU B 1 323 ? 118.003 -34.811 352.129 1.00 26.42  ? 324  LEU B CD1 1 
ATOM   6573 C CD2 . LEU B 1 323 ? 117.367 -34.897 349.709 1.00 31.83  ? 324  LEU B CD2 1 
ATOM   6574 N N   . GLN B 1 324 ? 120.436 -37.502 352.417 1.00 18.43  ? 325  GLN B N   1 
ATOM   6575 C CA  . GLN B 1 324 ? 120.137 -38.923 352.511 1.00 23.73  ? 325  GLN B CA  1 
ATOM   6576 C C   . GLN B 1 324 ? 118.633 -39.080 352.666 1.00 22.43  ? 325  GLN B C   1 
ATOM   6577 O O   . GLN B 1 324 ? 118.019 -38.392 353.488 1.00 22.53  ? 325  GLN B O   1 
ATOM   6578 C CB  . GLN B 1 324 ? 120.862 -39.578 353.689 1.00 27.63  ? 325  GLN B CB  1 
ATOM   6579 C CG  . GLN B 1 324 ? 122.377 -39.522 353.614 1.00 30.17  ? 325  GLN B CG  1 
ATOM   6580 C CD  . GLN B 1 324 ? 122.946 -38.305 354.311 1.00 40.90  ? 325  GLN B CD  1 
ATOM   6581 O OE1 . GLN B 1 324 ? 122.574 -37.993 355.442 1.00 46.67  ? 325  GLN B OE1 1 
ATOM   6582 N NE2 . GLN B 1 324 ? 123.857 -37.612 353.639 1.00 49.40  ? 325  GLN B NE2 1 
ATOM   6583 N N   . VAL B 1 325 ? 118.038 -39.960 351.866 1.00 18.87  ? 326  VAL B N   1 
ATOM   6584 C CA  . VAL B 1 325 ? 116.611 -40.232 351.967 1.00 25.98  ? 326  VAL B CA  1 
ATOM   6585 C C   . VAL B 1 325 ? 116.384 -41.735 351.999 1.00 23.08  ? 326  VAL B C   1 
ATOM   6586 O O   . VAL B 1 325 ? 117.128 -42.516 351.397 1.00 21.59  ? 326  VAL B O   1 
ATOM   6587 C CB  . VAL B 1 325 ? 115.791 -39.590 350.823 1.00 26.33  ? 326  VAL B CB  1 
ATOM   6588 C CG1 . VAL B 1 325 ? 115.896 -38.076 350.870 1.00 33.46  ? 326  VAL B CG1 1 
ATOM   6589 C CG2 . VAL B 1 325 ? 116.232 -40.123 349.479 1.00 34.94  ? 326  VAL B CG2 1 
ATOM   6590 N N   . LEU B 1 326 ? 115.345 -42.129 352.727 1.00 20.71  ? 327  LEU B N   1 
ATOM   6591 C CA  . LEU B 1 326 ? 114.860 -43.500 352.778 1.00 21.23  ? 327  LEU B CA  1 
ATOM   6592 C C   . LEU B 1 326 ? 113.448 -43.499 352.209 1.00 22.23  ? 327  LEU B C   1 
ATOM   6593 O O   . LEU B 1 326 ? 112.581 -42.775 352.707 1.00 22.21  ? 327  LEU B O   1 
ATOM   6594 C CB  . LEU B 1 326 ? 114.880 -44.026 354.216 1.00 25.97  ? 327  LEU B CB  1 
ATOM   6595 C CG  . LEU B 1 326 ? 114.359 -45.432 354.513 1.00 28.53  ? 327  LEU B CG  1 
ATOM   6596 C CD1 . LEU B 1 326 ? 115.175 -46.461 353.764 1.00 31.69  ? 327  LEU B CD1 1 
ATOM   6597 C CD2 . LEU B 1 326 ? 114.398 -45.701 356.010 1.00 32.67  ? 327  LEU B CD2 1 
ATOM   6598 N N   . VAL B 1 327 ? 113.225 -44.276 351.149 1.00 18.70  ? 328  VAL B N   1 
ATOM   6599 C CA  . VAL B 1 327 ? 111.934 -44.304 350.473 1.00 16.28  ? 328  VAL B CA  1 
ATOM   6600 C C   . VAL B 1 327 ? 111.498 -45.750 350.295 1.00 18.84  ? 328  VAL B C   1 
ATOM   6601 O O   . VAL B 1 327 ? 112.314 -46.672 350.274 1.00 21.72  ? 328  VAL B O   1 
ATOM   6602 C CB  . VAL B 1 327 ? 111.966 -43.582 349.106 1.00 20.39  ? 328  VAL B CB  1 
ATOM   6603 C CG1 . VAL B 1 327 ? 112.524 -42.173 349.253 1.00 18.96  ? 328  VAL B CG1 1 
ATOM   6604 C CG2 . VAL B 1 327 ? 112.777 -44.380 348.094 1.00 17.24  ? 328  VAL B CG2 1 
ATOM   6605 N N   . GLY B 1 328 ? 110.191 -45.945 350.166 1.00 15.63  ? 329  GLY B N   1 
ATOM   6606 C CA  . GLY B 1 328 ? 109.693 -47.292 349.965 1.00 20.28  ? 329  GLY B CA  1 
ATOM   6607 C C   . GLY B 1 328 ? 108.191 -47.321 349.795 1.00 22.25  ? 329  GLY B C   1 
ATOM   6608 O O   . GLY B 1 328 ? 107.499 -46.306 349.929 1.00 17.59  ? 329  GLY B O   1 
ATOM   6609 N N   . VAL B 1 329 ? 107.701 -48.526 349.490 1.00 18.22  ? 330  VAL B N   1 
ATOM   6610 C CA  . VAL B 1 329 ? 106.294 -48.785 349.218 1.00 16.71  ? 330  VAL B CA  1 
ATOM   6611 C C   . VAL B 1 329 ? 105.925 -50.126 349.839 1.00 20.52  ? 330  VAL B C   1 
ATOM   6612 O O   . VAL B 1 329 ? 106.790 -50.928 350.197 1.00 22.36  ? 330  VAL B O   1 
ATOM   6613 C CB  . VAL B 1 329 ? 105.987 -48.809 347.702 1.00 17.55  ? 330  VAL B CB  1 
ATOM   6614 C CG1 . VAL B 1 329 ? 106.359 -47.485 347.046 1.00 19.28  ? 330  VAL B CG1 1 
ATOM   6615 C CG2 . VAL B 1 329 ? 106.730 -49.961 347.036 1.00 15.00  ? 330  VAL B CG2 1 
ATOM   6616 N N   . VAL B 1 330 ? 104.620 -50.369 349.961 1.00 21.95  ? 331  VAL B N   1 
ATOM   6617 C CA  . VAL B 1 330 ? 104.146 -51.684 350.380 1.00 23.82  ? 331  VAL B CA  1 
ATOM   6618 C C   . VAL B 1 330 ? 103.916 -52.529 349.134 1.00 22.66  ? 331  VAL B C   1 
ATOM   6619 O O   . VAL B 1 330 ? 103.896 -52.010 348.012 1.00 24.38  ? 331  VAL B O   1 
ATOM   6620 C CB  . VAL B 1 330 ? 102.872 -51.595 351.242 1.00 25.60  ? 331  VAL B CB  1 
ATOM   6621 C CG1 . VAL B 1 330 ? 103.132 -50.772 352.498 1.00 20.00  ? 331  VAL B CG1 1 
ATOM   6622 C CG2 . VAL B 1 330 ? 101.717 -51.019 350.443 1.00 23.25  ? 331  VAL B CG2 1 
ATOM   6623 N N   . LYS B 1 331 ? 103.734 -53.837 349.327 1.00 25.94  ? 332  LYS B N   1 
ATOM   6624 C CA  . LYS B 1 331 ? 103.684 -54.766 348.202 1.00 27.84  ? 332  LYS B CA  1 
ATOM   6625 C C   . LYS B 1 331 ? 102.475 -54.525 347.305 1.00 25.99  ? 332  LYS B C   1 
ATOM   6626 O O   . LYS B 1 331 ? 102.558 -54.742 346.091 1.00 29.51  ? 332  LYS B O   1 
ATOM   6627 C CB  . LYS B 1 331 ? 103.689 -56.204 348.728 1.00 29.18  ? 332  LYS B CB  1 
ATOM   6628 C CG  . LYS B 1 331 ? 103.839 -57.295 347.674 1.00 34.32  ? 332  LYS B CG  1 
ATOM   6629 C CD  . LYS B 1 331 ? 104.242 -58.608 348.342 1.00 43.60  ? 332  LYS B CD  1 
ATOM   6630 C CE  . LYS B 1 331 ? 103.778 -59.829 347.562 1.00 52.48  ? 332  LYS B CE  1 
ATOM   6631 N NZ  . LYS B 1 331 ? 104.218 -59.817 346.143 1.00 58.20  ? 332  LYS B NZ  1 
ATOM   6632 N N   . ASP B 1 332 ? 101.349 -54.072 347.869 1.00 23.95  ? 333  ASP B N   1 
ATOM   6633 C CA  . ASP B 1 332 ? 100.101 -53.892 347.117 1.00 30.96  ? 333  ASP B CA  1 
ATOM   6634 C C   . ASP B 1 332 ? 99.525  -52.511 347.435 1.00 27.57  ? 333  ASP B C   1 
ATOM   6635 O O   . ASP B 1 332 ? 98.559  -52.384 348.190 1.00 29.51  ? 333  ASP B O   1 
ATOM   6636 C CB  . ASP B 1 332 ? 99.115  -55.011 347.439 1.00 29.61  ? 333  ASP B CB  1 
ATOM   6637 C CG  . ASP B 1 332 ? 99.722  -56.389 347.257 1.00 32.39  ? 333  ASP B CG  1 
ATOM   6638 O OD1 . ASP B 1 332 ? 99.770  -56.870 346.106 1.00 35.94  ? 333  ASP B OD1 1 
ATOM   6639 O OD2 . ASP B 1 332 ? 100.157 -56.987 348.264 1.00 34.21  ? 333  ASP B OD2 1 
ATOM   6640 N N   . GLU B 1 333 ? 100.112 -51.478 346.825 1.00 25.14  ? 334  GLU B N   1 
ATOM   6641 C CA  . GLU B 1 333 ? 99.734  -50.105 347.145 1.00 26.34  ? 334  GLU B CA  1 
ATOM   6642 C C   . GLU B 1 333 ? 98.297  -49.789 346.745 1.00 24.38  ? 334  GLU B C   1 
ATOM   6643 O O   . GLU B 1 333 ? 97.635  -48.983 347.408 1.00 30.20  ? 334  GLU B O   1 
ATOM   6644 C CB  . GLU B 1 333 ? 100.689 -49.127 346.458 1.00 23.04  ? 334  GLU B CB  1 
ATOM   6645 C CG  . GLU B 1 333 ? 102.057 -49.023 347.107 1.00 28.20  ? 334  GLU B CG  1 
ATOM   6646 C CD  . GLU B 1 333 ? 102.021 -48.277 348.428 1.00 38.72  ? 334  GLU B CD  1 
ATOM   6647 O OE1 . GLU B 1 333 ? 100.999 -47.618 348.718 1.00 39.03  ? 334  GLU B OE1 1 
ATOM   6648 O OE2 . GLU B 1 333 ? 103.020 -48.346 349.174 1.00 38.91  ? 334  GLU B OE2 1 
ATOM   6649 N N   . GLY B 1 334 ? 97.797  -50.405 345.679 1.00 24.77  ? 335  GLY B N   1 
ATOM   6650 C CA  . GLY B 1 334 ? 96.531  -49.986 345.108 1.00 22.20  ? 335  GLY B CA  1 
ATOM   6651 C C   . GLY B 1 334 ? 95.283  -50.670 345.631 1.00 27.53  ? 335  GLY B C   1 
ATOM   6652 O O   . GLY B 1 334 ? 94.185  -50.116 345.515 1.00 25.58  ? 335  GLY B O   1 
ATOM   6653 N N   . SER B 1 335 ? 95.435  -51.862 346.215 1.00 27.16  ? 336  SER B N   1 
ATOM   6654 C CA  . SER B 1 335 ? 94.273  -52.689 346.540 1.00 33.95  ? 336  SER B CA  1 
ATOM   6655 C C   . SER B 1 335 ? 93.311  -51.973 347.482 1.00 32.80  ? 336  SER B C   1 
ATOM   6656 O O   . SER B 1 335 ? 92.090  -52.034 347.298 1.00 36.53  ? 336  SER B O   1 
ATOM   6657 C CB  . SER B 1 335 ? 94.730  -54.012 347.154 1.00 35.27  ? 336  SER B CB  1 
ATOM   6658 O OG  . SER B 1 335 ? 95.357  -53.803 348.408 1.00 34.13  ? 336  SER B OG  1 
ATOM   6659 N N   . TYR B 1 336 ? 93.769  -51.317 348.513 1.00 33.25  ? 337  TYR B N   1 
ATOM   6660 C CA  . TYR B 1 336 ? 92.901  -50.654 349.462 1.00 38.86  ? 337  TYR B CA  1 
ATOM   6661 C C   . TYR B 1 336 ? 92.063  -49.556 348.885 1.00 39.38  ? 337  TYR B C   1 
ATOM   6662 O O   . TYR B 1 336 ? 90.950  -49.385 349.237 1.00 37.04  ? 337  TYR B O   1 
ATOM   6663 C CB  . TYR B 1 336 ? 93.699  -50.178 350.703 1.00 50.53  ? 337  TYR B CB  1 
ATOM   6664 C CG  . TYR B 1 336 ? 93.206  -48.970 351.483 1.00 56.01  ? 337  TYR B CG  1 
ATOM   6665 C CD1 . TYR B 1 336 ? 93.449  -47.711 351.036 1.00 56.94  ? 337  TYR B CD1 1 
ATOM   6666 C CD2 . TYR B 1 336 ? 92.559  -49.103 352.697 1.00 65.27  ? 337  TYR B CD2 1 
ATOM   6667 C CE1 . TYR B 1 336 ? 93.042  -46.620 351.720 1.00 64.20  ? 337  TYR B CE1 1 
ATOM   6668 C CE2 . TYR B 1 336 ? 92.153  -47.999 353.418 1.00 73.43  ? 337  TYR B CE2 1 
ATOM   6669 C CZ  . TYR B 1 336 ? 92.397  -46.750 352.904 1.00 76.28  ? 337  TYR B CZ  1 
ATOM   6670 O OH  . TYR B 1 336 ? 92.012  -45.588 353.552 1.00 83.01  ? 337  TYR B OH  1 
ATOM   6671 N N   . PHE B 1 337 ? 92.607  -48.806 347.977 1.00 34.01  ? 338  PHE B N   1 
ATOM   6672 C CA  . PHE B 1 337 ? 91.838  -47.696 347.429 1.00 36.27  ? 338  PHE B CA  1 
ATOM   6673 C C   . PHE B 1 337 ? 90.719  -48.143 346.495 1.00 36.98  ? 338  PHE B C   1 
ATOM   6674 O O   . PHE B 1 337 ? 89.831  -47.338 346.197 1.00 34.47  ? 338  PHE B O   1 
ATOM   6675 C CB  . PHE B 1 337 ? 92.774  -46.732 346.696 1.00 34.39  ? 338  PHE B CB  1 
ATOM   6676 C CG  . PHE B 1 337 ? 93.802  -46.101 347.589 1.00 37.58  ? 338  PHE B CG  1 
ATOM   6677 C CD1 . PHE B 1 337 ? 95.015  -46.727 347.822 1.00 36.09  ? 338  PHE B CD1 1 
ATOM   6678 C CD2 . PHE B 1 337 ? 93.549  -44.888 348.208 1.00 34.27  ? 338  PHE B CD2 1 
ATOM   6679 C CE1 . PHE B 1 337 ? 95.959  -46.153 348.653 1.00 36.89  ? 338  PHE B CE1 1 
ATOM   6680 C CE2 . PHE B 1 337 ? 94.489  -44.308 349.038 1.00 38.10  ? 338  PHE B CE2 1 
ATOM   6681 C CZ  . PHE B 1 337 ? 95.696  -44.941 349.262 1.00 33.54  ? 338  PHE B CZ  1 
ATOM   6682 N N   . LEU B 1 338 ? 90.727  -49.400 346.046 1.00 30.70  ? 339  LEU B N   1 
ATOM   6683 C CA  . LEU B 1 338 ? 89.760  -49.831 345.041 1.00 35.35  ? 339  LEU B CA  1 
ATOM   6684 C C   . LEU B 1 338 ? 88.357  -49.991 345.616 1.00 37.41  ? 339  LEU B C   1 
ATOM   6685 O O   . LEU B 1 338 ? 87.373  -49.872 344.878 1.00 38.84  ? 339  LEU B O   1 
ATOM   6686 C CB  . LEU B 1 338 ? 90.223  -51.137 344.400 1.00 32.96  ? 339  LEU B CB  1 
ATOM   6687 C CG  . LEU B 1 338 ? 91.473  -50.996 343.531 1.00 36.09  ? 339  LEU B CG  1 
ATOM   6688 C CD1 . LEU B 1 338 ? 91.982  -52.354 343.084 1.00 34.90  ? 339  LEU B CD1 1 
ATOM   6689 C CD2 . LEU B 1 338 ? 91.185  -50.103 342.333 1.00 36.98  ? 339  LEU B CD2 1 
ATOM   6690 N N   . VAL B 1 339 ? 88.233  -50.250 346.916 1.00 40.78  ? 340  VAL B N   1 
ATOM   6691 C CA  . VAL B 1 339 ? 86.921  -50.488 347.512 1.00 50.92  ? 340  VAL B CA  1 
ATOM   6692 C C   . VAL B 1 339 ? 86.236  -49.167 347.837 1.00 51.40  ? 340  VAL B C   1 
ATOM   6693 O O   . VAL B 1 339 ? 85.225  -49.141 348.546 1.00 60.04  ? 340  VAL B O   1 
ATOM   6694 C CB  . VAL B 1 339 ? 87.031  -51.371 348.767 1.00 48.87  ? 340  VAL B CB  1 
ATOM   6695 C CG1 . VAL B 1 339 ? 87.590  -52.731 348.400 1.00 49.41  ? 340  VAL B CG1 1 
ATOM   6696 C CG2 . VAL B 1 339 ? 87.893  -50.692 349.822 1.00 45.65  ? 340  VAL B CG2 1 
ATOM   6697 N N   . TYR B 1 340 ? 86.770  -48.065 347.312 1.00 51.02  ? 341  TYR B N   1 
ATOM   6698 C CA  . TYR B 1 340 ? 86.218  -46.737 347.550 1.00 52.72  ? 341  TYR B CA  1 
ATOM   6699 C C   . TYR B 1 340 ? 85.732  -46.083 346.260 1.00 57.56  ? 341  TYR B C   1 
ATOM   6700 O O   . TYR B 1 340 ? 85.671  -44.856 346.168 1.00 61.53  ? 341  TYR B O   1 
ATOM   6701 C CB  . TYR B 1 340 ? 87.244  -45.842 348.244 1.00 50.25  ? 341  TYR B CB  1 
ATOM   6702 C CG  . TYR B 1 340 ? 87.376  -46.089 349.730 1.00 47.61  ? 341  TYR B CG  1 
ATOM   6703 C CD1 . TYR B 1 340 ? 86.588  -45.397 350.641 1.00 43.93  ? 341  TYR B CD1 1 
ATOM   6704 C CD2 . TYR B 1 340 ? 88.290  -47.011 350.221 1.00 49.64  ? 341  TYR B CD2 1 
ATOM   6705 C CE1 . TYR B 1 340 ? 86.707  -45.617 352.001 1.00 46.73  ? 341  TYR B CE1 1 
ATOM   6706 C CE2 . TYR B 1 340 ? 88.415  -47.240 351.579 1.00 53.70  ? 341  TYR B CE2 1 
ATOM   6707 C CZ  . TYR B 1 340 ? 87.621  -46.541 352.464 1.00 53.92  ? 341  TYR B CZ  1 
ATOM   6708 O OH  . TYR B 1 340 ? 87.742  -46.766 353.816 1.00 55.87  ? 341  TYR B OH  1 
ATOM   6709 N N   . GLY B 1 341 ? 85.386  -46.882 345.253 1.00 55.61  ? 342  GLY B N   1 
ATOM   6710 C CA  . GLY B 1 341 ? 84.861  -46.312 344.027 1.00 52.27  ? 342  GLY B CA  1 
ATOM   6711 C C   . GLY B 1 341 ? 85.024  -47.154 342.778 1.00 48.48  ? 342  GLY B C   1 
ATOM   6712 O O   . GLY B 1 341 ? 84.369  -46.890 341.766 1.00 48.75  ? 342  GLY B O   1 
ATOM   6713 N N   . ALA B 1 342 ? 85.891  -48.159 342.821 1.00 45.51  ? 343  ALA B N   1 
ATOM   6714 C CA  . ALA B 1 342 ? 86.079  -49.007 341.649 1.00 44.37  ? 343  ALA B CA  1 
ATOM   6715 C C   . ALA B 1 342 ? 84.919  -49.989 341.529 1.00 45.40  ? 343  ALA B C   1 
ATOM   6716 O O   . ALA B 1 342 ? 84.607  -50.691 342.497 1.00 45.18  ? 343  ALA B O   1 
ATOM   6717 C CB  . ALA B 1 342 ? 87.402  -49.763 341.727 1.00 38.17  ? 343  ALA B CB  1 
ATOM   6718 N N   . PRO B 1 343 ? 84.258  -50.060 340.374 1.00 43.79  ? 344  PRO B N   1 
ATOM   6719 C CA  . PRO B 1 343 ? 83.099  -50.955 340.237 1.00 46.70  ? 344  PRO B CA  1 
ATOM   6720 C C   . PRO B 1 343 ? 83.504  -52.418 340.351 1.00 48.73  ? 344  PRO B C   1 
ATOM   6721 O O   . PRO B 1 343 ? 84.465  -52.864 339.719 1.00 48.61  ? 344  PRO B O   1 
ATOM   6722 C CB  . PRO B 1 343 ? 82.557  -50.625 338.840 1.00 44.88  ? 344  PRO B CB  1 
ATOM   6723 C CG  . PRO B 1 343 ? 83.710  -49.996 338.119 1.00 42.99  ? 344  PRO B CG  1 
ATOM   6724 C CD  . PRO B 1 343 ? 84.483  -49.253 339.164 1.00 36.89  ? 344  PRO B CD  1 
ATOM   6725 N N   . GLY B 1 344 ? 82.761  -53.161 341.169 1.00 49.30  ? 345  GLY B N   1 
ATOM   6726 C CA  . GLY B 1 344 ? 82.976  -54.581 341.344 1.00 48.67  ? 345  GLY B CA  1 
ATOM   6727 C C   . GLY B 1 344 ? 83.805  -54.974 342.547 1.00 49.67  ? 345  GLY B C   1 
ATOM   6728 O O   . GLY B 1 344 ? 83.953  -56.175 342.806 1.00 53.57  ? 345  GLY B O   1 
ATOM   6729 N N   . PHE B 1 345 ? 84.341  -54.013 343.293 1.00 44.21  ? 346  PHE B N   1 
ATOM   6730 C CA  . PHE B 1 345 ? 85.241  -54.305 344.398 1.00 39.89  ? 346  PHE B CA  1 
ATOM   6731 C C   . PHE B 1 345 ? 84.534  -54.168 345.740 1.00 46.15  ? 346  PHE B C   1 
ATOM   6732 O O   . PHE B 1 345 ? 83.636  -53.340 345.916 1.00 43.69  ? 346  PHE B O   1 
ATOM   6733 C CB  . PHE B 1 345 ? 86.464  -53.387 344.366 1.00 31.92  ? 346  PHE B CB  1 
ATOM   6734 C CG  . PHE B 1 345 ? 87.483  -53.775 343.337 1.00 39.30  ? 346  PHE B CG  1 
ATOM   6735 C CD1 . PHE B 1 345 ? 87.316  -53.417 342.010 1.00 36.55  ? 346  PHE B CD1 1 
ATOM   6736 C CD2 . PHE B 1 345 ? 88.604  -54.507 343.693 1.00 40.33  ? 346  PHE B CD2 1 
ATOM   6737 C CE1 . PHE B 1 345 ? 88.251  -53.773 341.060 1.00 37.39  ? 346  PHE B CE1 1 
ATOM   6738 C CE2 . PHE B 1 345 ? 89.540  -54.870 342.745 1.00 35.00  ? 346  PHE B CE2 1 
ATOM   6739 C CZ  . PHE B 1 345 ? 89.363  -54.503 341.427 1.00 35.81  ? 346  PHE B CZ  1 
ATOM   6740 N N   . SER B 1 346 ? 84.962  -54.996 346.687 1.00 50.65  ? 347  SER B N   1 
ATOM   6741 C CA  . SER B 1 346 ? 84.473  -54.989 348.057 1.00 47.86  ? 347  SER B CA  1 
ATOM   6742 C C   . SER B 1 346 ? 85.426  -55.819 348.902 1.00 43.55  ? 347  SER B C   1 
ATOM   6743 O O   . SER B 1 346 ? 86.040  -56.769 348.408 1.00 44.01  ? 347  SER B O   1 
ATOM   6744 C CB  . SER B 1 346 ? 83.046  -55.543 348.152 1.00 46.21  ? 347  SER B CB  1 
ATOM   6745 O OG  . SER B 1 346 ? 82.675  -55.811 349.496 1.00 53.53  ? 347  SER B OG  1 
ATOM   6746 N N   . LYS B 1 347 ? 85.554  -55.442 350.174 1.00 40.96  ? 348  LYS B N   1 
ATOM   6747 C CA  . LYS B 1 347 ? 86.388  -56.206 351.094 1.00 39.33  ? 348  LYS B CA  1 
ATOM   6748 C C   . LYS B 1 347 ? 85.745  -57.522 351.480 1.00 36.13  ? 348  LYS B C   1 
ATOM   6749 O O   . LYS B 1 347 ? 86.425  -58.413 352.004 1.00 41.73  ? 348  LYS B O   1 
ATOM   6750 C CB  . LYS B 1 347 ? 86.656  -55.403 352.360 1.00 34.38  ? 348  LYS B CB  1 
ATOM   6751 C CG  . LYS B 1 347 ? 85.503  -55.419 353.356 1.00 33.70  ? 348  LYS B CG  1 
ATOM   6752 C CD  . LYS B 1 347 ? 85.874  -54.723 354.653 1.00 34.67  ? 348  LYS B CD  1 
ATOM   6753 C CE  . LYS B 1 347 ? 84.889  -55.065 355.762 1.00 37.11  ? 348  LYS B CE  1 
ATOM   6754 N NZ  . LYS B 1 347 ? 85.071  -56.455 356.264 1.00 40.74  ? 348  LYS B NZ  1 
ATOM   6755 N N   . ASP B 1 348 ? 84.450  -57.659 351.222 1.00 33.86  ? 349  ASP B N   1 
ATOM   6756 C CA  . ASP B 1 348 ? 83.709  -58.851 351.587 1.00 42.41  ? 349  ASP B CA  1 
ATOM   6757 C C   . ASP B 1 348 ? 83.506  -59.884 350.451 1.00 49.10  ? 349  ASP B C   1 
ATOM   6758 O O   . ASP B 1 348 ? 82.887  -60.927 350.715 1.00 54.19  ? 349  ASP B O   1 
ATOM   6759 C CB  . ASP B 1 348 ? 82.348  -58.442 352.171 1.00 39.63  ? 349  ASP B CB  1 
ATOM   6760 C CG  . ASP B 1 348 ? 82.472  -57.582 353.456 1.00 50.29  ? 349  ASP B CG  1 
ATOM   6761 O OD1 . ASP B 1 348 ? 83.266  -57.942 354.340 1.00 49.98  ? 349  ASP B OD1 1 
ATOM   6762 O OD2 . ASP B 1 348 ? 81.779  -56.531 353.549 1.00 52.33  ? 349  ASP B OD2 1 
ATOM   6763 N N   . ASN B 1 349 ? 84.121  -59.718 349.306 1.00 53.94  ? 350  ASN B N   1 
ATOM   6764 C CA  . ASN B 1 349 ? 84.082  -60.715 348.248 1.00 56.11  ? 350  ASN B CA  1 
ATOM   6765 C C   . ASN B 1 349 ? 85.473  -60.711 347.590 1.00 56.36  ? 350  ASN B C   1 
ATOM   6766 O O   . ASN B 1 349 ? 86.272  -59.907 347.958 1.00 59.11  ? 350  ASN B O   1 
ATOM   6767 C CB  . ASN B 1 349 ? 82.868  -60.575 347.335 1.00 53.84  ? 350  ASN B CB  1 
ATOM   6768 C CG  . ASN B 1 349 ? 82.927  -59.382 346.468 1.00 67.89  ? 350  ASN B CG  1 
ATOM   6769 O OD1 . ASN B 1 349 ? 84.005  -58.941 346.143 1.00 89.30  ? 350  ASN B OD1 1 
ATOM   6770 N ND2 . ASN B 1 349 ? 81.784  -58.857 346.063 1.00 79.62  ? 350  ASN B ND2 1 
ATOM   6771 N N   . GLU B 1 350 ? 85.766  -61.645 346.702 1.00 50.04  ? 351  GLU B N   1 
ATOM   6772 C CA  . GLU B 1 350 ? 87.021  -61.817 346.015 1.00 46.61  ? 351  GLU B CA  1 
ATOM   6773 C C   . GLU B 1 350 ? 87.255  -60.694 345.039 1.00 41.08  ? 351  GLU B C   1 
ATOM   6774 O O   . GLU B 1 350 ? 88.375  -60.568 344.547 1.00 41.86  ? 351  GLU B O   1 
ATOM   6775 C CB  . GLU B 1 350 ? 87.019  -63.174 345.316 1.00 55.91  ? 351  GLU B CB  1 
ATOM   6776 C CG  . GLU B 1 350 ? 87.257  -64.366 346.242 1.00 66.17  ? 351  GLU B CG  1 
ATOM   6777 C CD  . GLU B 1 350 ? 88.588  -64.278 346.980 1.00 74.23  ? 351  GLU B CD  1 
ATOM   6778 O OE1 . GLU B 1 350 ? 88.615  -63.671 348.072 1.00 74.26  ? 351  GLU B OE1 1 
ATOM   6779 O OE2 . GLU B 1 350 ? 89.602  -64.813 346.481 1.00 77.96  ? 351  GLU B OE2 1 
ATOM   6780 N N   . SER B 1 351 ? 86.234  -59.873 344.771 1.00 40.70  ? 352  SER B N   1 
ATOM   6781 C CA  . SER B 1 351 ? 86.365  -58.737 343.861 1.00 29.90  ? 352  SER B CA  1 
ATOM   6782 C C   . SER B 1 351 ? 86.879  -59.189 342.496 1.00 42.27  ? 352  SER B C   1 
ATOM   6783 O O   . SER B 1 351 ? 87.742  -58.548 341.890 1.00 39.89  ? 352  SER B O   1 
ATOM   6784 C CB  . SER B 1 351 ? 87.269  -57.655 344.456 1.00 32.07  ? 352  SER B CB  1 
ATOM   6785 O OG  . SER B 1 351 ? 86.683  -57.083 345.613 1.00 31.24  ? 352  SER B OG  1 
ATOM   6786 N N   . LEU B 1 352 ? 86.353  -60.313 342.014 1.00 38.58  ? 353  LEU B N   1 
ATOM   6787 C CA  . LEU B 1 352 ? 86.709  -60.850 340.702 1.00 38.04  ? 353  LEU B CA  1 
ATOM   6788 C C   . LEU B 1 352 ? 85.890  -60.110 339.655 1.00 43.95  ? 353  LEU B C   1 
ATOM   6789 O O   . LEU B 1 352 ? 84.765  -60.488 339.325 1.00 54.10  ? 353  LEU B O   1 
ATOM   6790 C CB  . LEU B 1 352 ? 86.466  -62.353 340.654 1.00 34.65  ? 353  LEU B CB  1 
ATOM   6791 C CG  . LEU B 1 352 ? 87.282  -63.153 341.668 1.00 36.15  ? 353  LEU B CG  1 
ATOM   6792 C CD1 . LEU B 1 352 ? 86.794  -64.589 341.751 1.00 41.40  ? 353  LEU B CD1 1 
ATOM   6793 C CD2 . LEU B 1 352 ? 88.753  -63.106 341.301 1.00 33.58  ? 353  LEU B CD2 1 
ATOM   6794 N N   . ILE B 1 353 ? 86.471  -59.038 339.121 1.00 38.29  ? 354  ILE B N   1 
ATOM   6795 C CA  . ILE B 1 353 ? 85.761  -58.130 338.229 1.00 39.73  ? 354  ILE B CA  1 
ATOM   6796 C C   . ILE B 1 353 ? 85.784  -58.649 336.799 1.00 44.75  ? 354  ILE B C   1 
ATOM   6797 O O   . ILE B 1 353 ? 86.571  -59.539 336.455 1.00 44.54  ? 354  ILE B O   1 
ATOM   6798 C CB  . ILE B 1 353 ? 86.358  -56.715 338.299 1.00 34.76  ? 354  ILE B CB  1 
ATOM   6799 C CG1 . ILE B 1 353 ? 87.845  -56.754 337.932 1.00 29.93  ? 354  ILE B CG1 1 
ATOM   6800 C CG2 . ILE B 1 353 ? 86.149  -56.128 339.683 1.00 32.36  ? 354  ILE B CG2 1 
ATOM   6801 C CD1 . ILE B 1 353 ? 88.491  -55.392 337.830 1.00 33.16  ? 354  ILE B CD1 1 
ATOM   6802 N N   . SER B 1 354 ? 84.917  -58.092 335.961 1.00 43.54  ? 355  SER B N   1 
ATOM   6803 C CA  . SER B 1 354 ? 84.883  -58.398 334.543 1.00 41.72  ? 355  SER B CA  1 
ATOM   6804 C C   . SER B 1 354 ? 85.740  -57.399 333.772 1.00 39.78  ? 355  SER B C   1 
ATOM   6805 O O   . SER B 1 354 ? 86.192  -56.384 334.311 1.00 30.19  ? 355  SER B O   1 
ATOM   6806 C CB  . SER B 1 354 ? 83.445  -58.379 334.028 1.00 42.62  ? 355  SER B CB  1 
ATOM   6807 O OG  . SER B 1 354 ? 82.948  -57.053 333.982 1.00 45.68  ? 355  SER B OG  1 
ATOM   6808 N N   . ARG B 1 355 ? 85.945  -57.695 332.492 1.00 39.01  ? 356  ARG B N   1 
ATOM   6809 C CA  . ARG B 1 355 ? 86.723  -56.829 331.620 1.00 41.27  ? 356  ARG B CA  1 
ATOM   6810 C C   . ARG B 1 355 ? 86.068  -55.455 331.576 1.00 42.17  ? 356  ARG B C   1 
ATOM   6811 O O   . ARG B 1 355 ? 86.742  -54.433 331.705 1.00 39.18  ? 356  ARG B O   1 
ATOM   6812 C CB  . ARG B 1 355 ? 86.810  -57.419 330.212 1.00 41.97  ? 356  ARG B CB  1 
ATOM   6813 C CG  . ARG B 1 355 ? 87.569  -56.552 329.221 1.00 45.58  ? 356  ARG B CG  1 
ATOM   6814 C CD  . ARG B 1 355 ? 88.776  -57.285 328.658 1.00 44.54  ? 356  ARG B CD  1 
ATOM   6815 N NE  . ARG B 1 355 ? 89.602  -56.418 327.823 1.00 46.44  ? 356  ARG B NE  1 
ATOM   6816 C CZ  . ARG B 1 355 ? 90.803  -55.969 328.172 1.00 42.88  ? 356  ARG B CZ  1 
ATOM   6817 N NH1 . ARG B 1 355 ? 91.324  -56.303 329.344 1.00 38.22  ? 356  ARG B NH1 1 
ATOM   6818 N NH2 . ARG B 1 355 ? 91.484  -55.184 327.348 1.00 37.50  ? 356  ARG B NH2 1 
ATOM   6819 N N   . ALA B 1 356 ? 84.750  -55.436 331.398 1.00 42.57  ? 357  ALA B N   1 
ATOM   6820 C CA  . ALA B 1 356 ? 84.016  -54.174 331.356 1.00 40.62  ? 357  ALA B CA  1 
ATOM   6821 C C   . ALA B 1 356 ? 84.233  -53.371 332.632 1.00 39.56  ? 357  ALA B C   1 
ATOM   6822 O O   . ALA B 1 356 ? 84.412  -52.150 332.582 1.00 42.07  ? 357  ALA B O   1 
ATOM   6823 C CB  . ALA B 1 356 ? 82.527  -54.440 331.130 1.00 38.30  ? 357  ALA B CB  1 
ATOM   6824 N N   . GLU B 1 357 ? 84.230  -54.044 333.786 1.00 36.27  ? 358  GLU B N   1 
ATOM   6825 C CA  . GLU B 1 357 ? 84.487  -53.349 335.044 1.00 39.38  ? 358  GLU B CA  1 
ATOM   6826 C C   . GLU B 1 357 ? 85.937  -52.886 335.130 1.00 40.50  ? 358  GLU B C   1 
ATOM   6827 O O   . GLU B 1 357 ? 86.220  -51.814 335.678 1.00 34.34  ? 358  GLU B O   1 
ATOM   6828 C CB  . GLU B 1 357 ? 84.132  -54.252 336.225 1.00 42.56  ? 358  GLU B CB  1 
ATOM   6829 C CG  . GLU B 1 357 ? 82.641  -54.542 336.349 1.00 49.30  ? 358  GLU B CG  1 
ATOM   6830 C CD  . GLU B 1 357 ? 82.316  -55.531 337.454 1.00 54.73  ? 358  GLU B CD  1 
ATOM   6831 O OE1 . GLU B 1 357 ? 83.000  -56.572 337.546 1.00 53.49  ? 358  GLU B OE1 1 
ATOM   6832 O OE2 . GLU B 1 357 ? 81.371  -55.270 338.228 1.00 59.29  ? 358  GLU B OE2 1 
ATOM   6833 N N   . PHE B 1 358 ? 86.867  -53.682 334.596 1.00 38.45  ? 359  PHE B N   1 
ATOM   6834 C CA  . PHE B 1 358 ? 88.265  -53.264 334.541 1.00 38.04  ? 359  PHE B CA  1 
ATOM   6835 C C   . PHE B 1 358 ? 88.419  -51.988 333.722 1.00 36.22  ? 359  PHE B C   1 
ATOM   6836 O O   . PHE B 1 358 ? 89.064  -51.028 334.160 1.00 34.42  ? 359  PHE B O   1 
ATOM   6837 C CB  . PHE B 1 358 ? 89.123  -54.388 333.957 1.00 36.40  ? 359  PHE B CB  1 
ATOM   6838 C CG  . PHE B 1 358 ? 90.545  -53.985 333.674 1.00 32.50  ? 359  PHE B CG  1 
ATOM   6839 C CD1 . PHE B 1 358 ? 91.469  -53.888 334.701 1.00 25.51  ? 359  PHE B CD1 1 
ATOM   6840 C CD2 . PHE B 1 358 ? 90.958  -53.709 332.380 1.00 29.69  ? 359  PHE B CD2 1 
ATOM   6841 C CE1 . PHE B 1 358 ? 92.777  -53.520 334.444 1.00 29.26  ? 359  PHE B CE1 1 
ATOM   6842 C CE2 . PHE B 1 358 ? 92.265  -53.340 332.117 1.00 30.98  ? 359  PHE B CE2 1 
ATOM   6843 C CZ  . PHE B 1 358 ? 93.175  -53.245 333.151 1.00 26.69  ? 359  PHE B CZ  1 
ATOM   6844 N N   . LEU B 1 359 ? 87.827  -51.963 332.524 1.00 34.61  ? 360  LEU B N   1 
ATOM   6845 C CA  . LEU B 1 359 ? 87.883  -50.766 331.691 1.00 35.66  ? 360  LEU B CA  1 
ATOM   6846 C C   . LEU B 1 359 ? 87.230  -49.581 332.389 1.00 40.81  ? 360  LEU B C   1 
ATOM   6847 O O   . LEU B 1 359 ? 87.713  -48.447 332.288 1.00 45.87  ? 360  LEU B O   1 
ATOM   6848 C CB  . LEU B 1 359 ? 87.209  -51.031 330.345 1.00 33.26  ? 360  LEU B CB  1 
ATOM   6849 C CG  . LEU B 1 359 ? 87.817  -52.132 329.476 1.00 39.58  ? 360  LEU B CG  1 
ATOM   6850 C CD1 . LEU B 1 359 ? 87.061  -52.256 328.161 1.00 38.60  ? 360  LEU B CD1 1 
ATOM   6851 C CD2 . LEU B 1 359 ? 89.291  -51.866 329.227 1.00 34.09  ? 360  LEU B CD2 1 
ATOM   6852 N N   . ALA B 1 360 ? 86.128  -49.824 333.102 1.00 39.26  ? 361  ALA B N   1 
ATOM   6853 C CA  . ALA B 1 360 ? 85.498  -48.755 333.869 1.00 38.31  ? 361  ALA B CA  1 
ATOM   6854 C C   . ALA B 1 360 ? 86.386  -48.313 335.024 1.00 38.13  ? 361  ALA B C   1 
ATOM   6855 O O   . ALA B 1 360 ? 86.502  -47.113 335.301 1.00 39.84  ? 361  ALA B O   1 
ATOM   6856 C CB  . ALA B 1 360 ? 84.133  -49.211 334.382 1.00 42.56  ? 361  ALA B CB  1 
ATOM   6857 N N   . GLY B 1 361 ? 87.025  -49.266 335.705 1.00 32.37  ? 362  GLY B N   1 
ATOM   6858 C CA  . GLY B 1 361 ? 87.911  -48.914 336.800 1.00 29.03  ? 362  GLY B CA  1 
ATOM   6859 C C   . GLY B 1 361 ? 89.095  -48.074 336.365 1.00 31.64  ? 362  GLY B C   1 
ATOM   6860 O O   . GLY B 1 361 ? 89.619  -47.280 337.150 1.00 27.31  ? 362  GLY B O   1 
ATOM   6861 N N   . VAL B 1 362 ? 89.528  -48.229 335.113 1.00 32.88  ? 363  VAL B N   1 
ATOM   6862 C CA  . VAL B 1 362 ? 90.668  -47.459 334.625 1.00 30.29  ? 363  VAL B CA  1 
ATOM   6863 C C   . VAL B 1 362 ? 90.323  -45.976 334.552 1.00 35.34  ? 363  VAL B C   1 
ATOM   6864 O O   . VAL B 1 362 ? 91.158  -45.116 334.859 1.00 37.82  ? 363  VAL B O   1 
ATOM   6865 C CB  . VAL B 1 362 ? 91.139  -48.009 333.266 1.00 32.20  ? 363  VAL B CB  1 
ATOM   6866 C CG1 . VAL B 1 362 ? 92.101  -47.040 332.592 1.00 26.36  ? 363  VAL B CG1 1 
ATOM   6867 C CG2 . VAL B 1 362 ? 91.797  -49.369 333.448 1.00 29.57  ? 363  VAL B CG2 1 
ATOM   6868 N N   . ARG B 1 363 ? 89.087  -45.649 334.165 1.00 34.07  ? 364  ARG B N   1 
ATOM   6869 C CA  . ARG B 1 363 ? 88.704  -44.243 334.070 1.00 37.02  ? 364  ARG B CA  1 
ATOM   6870 C C   . ARG B 1 363 ? 88.620  -43.593 335.447 1.00 32.78  ? 364  ARG B C   1 
ATOM   6871 O O   . ARG B 1 363 ? 88.962  -42.416 335.602 1.00 42.56  ? 364  ARG B O   1 
ATOM   6872 C CB  . ARG B 1 363 ? 87.376  -44.095 333.325 1.00 40.30  ? 364  ARG B CB  1 
ATOM   6873 C CG  . ARG B 1 363 ? 87.384  -44.634 331.901 1.00 45.04  ? 364  ARG B CG  1 
ATOM   6874 C CD  . ARG B 1 363 ? 88.687  -44.320 331.169 1.00 49.70  ? 364  ARG B CD  1 
ATOM   6875 N NE  . ARG B 1 363 ? 88.909  -42.889 330.969 1.00 50.44  ? 364  ARG B NE  1 
ATOM   6876 C CZ  . ARG B 1 363 ? 88.643  -42.242 329.838 1.00 53.46  ? 364  ARG B CZ  1 
ATOM   6877 N NH1 . ARG B 1 363 ? 88.135  -42.896 328.803 1.00 46.68  ? 364  ARG B NH1 1 
ATOM   6878 N NH2 . ARG B 1 363 ? 88.883  -40.941 329.743 1.00 56.35  ? 364  ARG B NH2 1 
ATOM   6879 N N   . VAL B 1 364 ? 88.172  -44.338 336.460 1.00 30.94  ? 365  VAL B N   1 
ATOM   6880 C CA  . VAL B 1 364 ? 88.108  -43.758 337.798 1.00 36.55  ? 365  VAL B CA  1 
ATOM   6881 C C   . VAL B 1 364 ? 89.476  -43.795 338.475 1.00 38.09  ? 365  VAL B C   1 
ATOM   6882 O O   . VAL B 1 364 ? 89.794  -42.913 339.283 1.00 39.56  ? 365  VAL B O   1 
ATOM   6883 C CB  . VAL B 1 364 ? 87.034  -44.457 338.653 1.00 46.55  ? 365  VAL B CB  1 
ATOM   6884 C CG1 . VAL B 1 364 ? 85.686  -44.422 337.947 1.00 47.95  ? 365  VAL B CG1 1 
ATOM   6885 C CG2 . VAL B 1 364 ? 87.433  -45.888 338.980 1.00 49.88  ? 365  VAL B CG2 1 
ATOM   6886 N N   . GLY B 1 365 ? 90.308  -44.791 338.157 1.00 36.05  ? 366  GLY B N   1 
ATOM   6887 C CA  . GLY B 1 365 ? 91.638  -44.860 338.736 1.00 29.92  ? 366  GLY B CA  1 
ATOM   6888 C C   . GLY B 1 365 ? 92.641  -43.919 338.108 1.00 31.93  ? 366  GLY B C   1 
ATOM   6889 O O   . GLY B 1 365 ? 93.617  -43.542 338.765 1.00 35.23  ? 366  GLY B O   1 
ATOM   6890 N N   . VAL B 1 366 ? 92.428  -43.538 336.852 1.00 33.77  ? 367  VAL B N   1 
ATOM   6891 C CA  . VAL B 1 366 ? 93.277  -42.565 336.171 1.00 34.81  ? 367  VAL B CA  1 
ATOM   6892 C C   . VAL B 1 366 ? 92.385  -41.429 335.682 1.00 26.78  ? 367  VAL B C   1 
ATOM   6893 O O   . VAL B 1 366 ? 92.143  -41.305 334.473 1.00 28.24  ? 367  VAL B O   1 
ATOM   6894 C CB  . VAL B 1 366 ? 94.056  -43.211 335.013 1.00 37.54  ? 367  VAL B CB  1 
ATOM   6895 C CG1 . VAL B 1 366 ? 95.133  -42.265 334.498 1.00 38.04  ? 367  VAL B CG1 1 
ATOM   6896 C CG2 . VAL B 1 366 ? 94.672  -44.530 335.454 1.00 27.59  ? 367  VAL B CG2 1 
ATOM   6897 N N   . PRO B 1 367 ? 91.875  -40.586 336.573 1.00 27.54  ? 368  PRO B N   1 
ATOM   6898 C CA  . PRO B 1 367 ? 90.909  -39.567 336.159 1.00 29.63  ? 368  PRO B CA  1 
ATOM   6899 C C   . PRO B 1 367 ? 91.577  -38.400 335.446 1.00 36.34  ? 368  PRO B C   1 
ATOM   6900 O O   . PRO B 1 367 ? 92.768  -38.126 335.612 1.00 39.27  ? 368  PRO B O   1 
ATOM   6901 C CB  . PRO B 1 367 ? 90.290  -39.116 337.487 1.00 25.29  ? 368  PRO B CB  1 
ATOM   6902 C CG  . PRO B 1 367 ? 91.389  -39.305 338.474 1.00 28.68  ? 368  PRO B CG  1 
ATOM   6903 C CD  . PRO B 1 367 ? 92.168  -40.515 338.016 1.00 28.15  ? 368  PRO B CD  1 
ATOM   6904 N N   . GLN B 1 368 ? 90.770  -37.718 334.629 1.00 38.68  ? 369  GLN B N   1 
ATOM   6905 C CA  . GLN B 1 368 ? 91.162  -36.474 333.961 1.00 54.44  ? 369  GLN B CA  1 
ATOM   6906 C C   . GLN B 1 368 ? 92.265  -36.698 332.927 1.00 55.59  ? 369  GLN B C   1 
ATOM   6907 O O   . GLN B 1 368 ? 93.162  -35.869 332.773 1.00 59.00  ? 369  GLN B O   1 
ATOM   6908 C CB  . GLN B 1 368 ? 91.588  -35.407 334.973 1.00 61.20  ? 369  GLN B CB  1 
ATOM   6909 C CG  . GLN B 1 368 ? 90.558  -35.122 336.045 1.00 63.45  ? 369  GLN B CG  1 
ATOM   6910 C CD  . GLN B 1 368 ? 89.448  -34.216 335.557 1.00 68.23  ? 369  GLN B CD  1 
ATOM   6911 O OE1 . GLN B 1 368 ? 88.399  -34.683 335.114 1.00 67.60  ? 369  GLN B OE1 1 
ATOM   6912 N NE2 . GLN B 1 368 ? 89.676  -32.910 335.635 1.00 67.27  ? 369  GLN B NE2 1 
ATOM   6913 N N   . VAL B 1 369 ? 92.205  -37.819 332.213 1.00 50.18  ? 370  VAL B N   1 
ATOM   6914 C CA  . VAL B 1 369 ? 93.108  -38.064 331.099 1.00 42.76  ? 370  VAL B CA  1 
ATOM   6915 C C   . VAL B 1 369 ? 92.274  -38.333 329.854 1.00 42.21  ? 370  VAL B C   1 
ATOM   6916 O O   . VAL B 1 369 ? 91.119  -38.761 329.927 1.00 43.39  ? 370  VAL B O   1 
ATOM   6917 C CB  . VAL B 1 369 ? 94.087  -39.228 331.366 1.00 36.44  ? 370  VAL B CB  1 
ATOM   6918 C CG1 . VAL B 1 369 ? 94.947  -38.932 332.587 1.00 33.05  ? 370  VAL B CG1 1 
ATOM   6919 C CG2 . VAL B 1 369 ? 93.334  -40.539 331.530 1.00 34.96  ? 370  VAL B CG2 1 
ATOM   6920 N N   . SER B 1 370 ? 92.877  -38.065 328.699 1.00 41.21  ? 371  SER B N   1 
ATOM   6921 C CA  . SER B 1 370 ? 92.190  -38.270 327.434 1.00 41.85  ? 371  SER B CA  1 
ATOM   6922 C C   . SER B 1 370 ? 91.898  -39.752 327.219 1.00 40.11  ? 371  SER B C   1 
ATOM   6923 O O   . SER B 1 370 ? 92.459  -40.630 327.882 1.00 33.30  ? 371  SER B O   1 
ATOM   6924 C CB  . SER B 1 370 ? 93.029  -37.730 326.276 1.00 42.93  ? 371  SER B CB  1 
ATOM   6925 O OG  . SER B 1 370 ? 94.342  -38.263 326.306 1.00 46.22  ? 371  SER B OG  1 
ATOM   6926 N N   . ASP B 1 371 ? 90.991  -40.024 326.278 1.00 40.47  ? 372  ASP B N   1 
ATOM   6927 C CA  . ASP B 1 371 ? 90.691  -41.406 325.920 1.00 44.87  ? 372  ASP B CA  1 
ATOM   6928 C C   . ASP B 1 371 ? 91.940  -42.126 325.432 1.00 41.62  ? 372  ASP B C   1 
ATOM   6929 O O   . ASP B 1 371 ? 92.146  -43.307 325.739 1.00 39.34  ? 372  ASP B O   1 
ATOM   6930 C CB  . ASP B 1 371 ? 89.599  -41.449 324.852 1.00 52.19  ? 372  ASP B CB  1 
ATOM   6931 C CG  . ASP B 1 371 ? 88.254  -40.989 325.375 1.00 61.00  ? 372  ASP B CG  1 
ATOM   6932 O OD1 . ASP B 1 371 ? 88.045  -41.042 326.604 1.00 62.90  ? 372  ASP B OD1 1 
ATOM   6933 O OD2 . ASP B 1 371 ? 87.407  -40.576 324.555 1.00 66.81  ? 372  ASP B OD2 1 
ATOM   6934 N N   . LEU B 1 372 ? 92.788  -41.426 324.675 1.00 39.53  ? 373  LEU B N   1 
ATOM   6935 C CA  . LEU B 1 372 ? 94.020  -42.032 324.182 1.00 37.75  ? 373  LEU B CA  1 
ATOM   6936 C C   . LEU B 1 372 ? 94.922  -42.463 325.331 1.00 36.54  ? 373  LEU B C   1 
ATOM   6937 O O   . LEU B 1 372 ? 95.502  -43.554 325.299 1.00 33.13  ? 373  LEU B O   1 
ATOM   6938 C CB  . LEU B 1 372 ? 94.750  -41.054 323.263 1.00 38.37  ? 373  LEU B CB  1 
ATOM   6939 C CG  . LEU B 1 372 ? 96.012  -41.594 322.593 1.00 41.42  ? 373  LEU B CG  1 
ATOM   6940 C CD1 . LEU B 1 372 ? 95.678  -42.809 321.743 1.00 38.34  ? 373  LEU B CD1 1 
ATOM   6941 C CD2 . LEU B 1 372 ? 96.672  -40.513 321.755 1.00 44.50  ? 373  LEU B CD2 1 
ATOM   6942 N N   . ALA B 1 373 ? 95.051  -41.619 326.358 1.00 35.39  ? 374  ALA B N   1 
ATOM   6943 C CA  . ALA B 1 373 ? 95.858  -41.986 327.517 1.00 32.44  ? 374  ALA B CA  1 
ATOM   6944 C C   . ALA B 1 373 ? 95.274  -43.198 328.232 1.00 29.19  ? 374  ALA B C   1 
ATOM   6945 O O   . ALA B 1 373 ? 96.014  -44.092 328.658 1.00 29.26  ? 374  ALA B O   1 
ATOM   6946 C CB  . ALA B 1 373 ? 95.973  -40.800 328.475 1.00 29.21  ? 374  ALA B CB  1 
ATOM   6947 N N   . ALA B 1 374 ? 93.946  -43.247 328.368 1.00 27.05  ? 375  ALA B N   1 
ATOM   6948 C CA  . ALA B 1 374 ? 93.310  -44.403 328.991 1.00 29.11  ? 375  ALA B CA  1 
ATOM   6949 C C   . ALA B 1 374 ? 93.545  -45.667 328.173 1.00 31.58  ? 375  ALA B C   1 
ATOM   6950 O O   . ALA B 1 374 ? 93.766  -46.746 328.735 1.00 32.10  ? 375  ALA B O   1 
ATOM   6951 C CB  . ALA B 1 374 ? 91.814  -44.148 329.169 1.00 28.80  ? 375  ALA B CB  1 
ATOM   6952 N N   . GLU B 1 375 ? 93.504  -45.551 326.842 1.00 30.39  ? 376  GLU B N   1 
ATOM   6953 C CA  . GLU B 1 375 ? 93.796  -46.699 325.989 1.00 33.06  ? 376  GLU B CA  1 
ATOM   6954 C C   . GLU B 1 375 ? 95.225  -47.185 326.192 1.00 30.94  ? 376  GLU B C   1 
ATOM   6955 O O   . GLU B 1 375 ? 95.486  -48.394 326.181 1.00 27.54  ? 376  GLU B O   1 
ATOM   6956 C CB  . GLU B 1 375 ? 93.564  -46.340 324.521 1.00 42.74  ? 376  GLU B CB  1 
ATOM   6957 C CG  . GLU B 1 375 ? 92.104  -46.211 324.116 1.00 59.55  ? 376  GLU B CG  1 
ATOM   6958 C CD  . GLU B 1 375 ? 91.309  -47.478 324.364 1.00 77.26  ? 376  GLU B CD  1 
ATOM   6959 O OE1 . GLU B 1 375 ? 90.141  -47.370 324.792 1.00 85.37  ? 376  GLU B OE1 1 
ATOM   6960 O OE2 . GLU B 1 375 ? 91.849  -48.581 324.131 1.00 83.01  ? 376  GLU B OE2 1 
ATOM   6961 N N   . ALA B 1 376 ? 96.166  -46.254 326.372 1.00 28.37  ? 377  ALA B N   1 
ATOM   6962 C CA  . ALA B 1 376 ? 97.551  -46.641 326.618 1.00 25.93  ? 377  ALA B CA  1 
ATOM   6963 C C   . ALA B 1 376 ? 97.681  -47.408 327.927 1.00 24.40  ? 377  ALA B C   1 
ATOM   6964 O O   . ALA B 1 376 ? 98.471  -48.355 328.024 1.00 26.14  ? 377  ALA B O   1 
ATOM   6965 C CB  . ALA B 1 376 ? 98.449  -45.404 326.625 1.00 25.48  ? 377  ALA B CB  1 
ATOM   6966 N N   . VAL B 1 377 ? 96.912  -47.014 328.944 1.00 24.87  ? 378  VAL B N   1 
ATOM   6967 C CA  . VAL B 1 377 ? 96.914  -47.745 330.209 1.00 20.34  ? 378  VAL B CA  1 
ATOM   6968 C C   . VAL B 1 377 ? 96.382  -49.157 330.003 1.00 22.41  ? 378  VAL B C   1 
ATOM   6969 O O   . VAL B 1 377 ? 96.976  -50.139 330.465 1.00 22.28  ? 378  VAL B O   1 
ATOM   6970 C CB  . VAL B 1 377 ? 96.094  -46.988 331.269 1.00 25.00  ? 378  VAL B CB  1 
ATOM   6971 C CG1 . VAL B 1 377 ? 96.032  -47.788 332.562 1.00 19.78  ? 378  VAL B CG1 1 
ATOM   6972 C CG2 . VAL B 1 377 ? 96.682  -45.608 331.514 1.00 22.82  ? 378  VAL B CG2 1 
ATOM   6973 N N   . VAL B 1 378 ? 95.252  -49.275 329.301 1.00 25.30  ? 379  VAL B N   1 
ATOM   6974 C CA  . VAL B 1 378 ? 94.643  -50.582 329.070 1.00 25.90  ? 379  VAL B CA  1 
ATOM   6975 C C   . VAL B 1 378 ? 95.588  -51.483 328.287 1.00 27.78  ? 379  VAL B C   1 
ATOM   6976 O O   . VAL B 1 378 ? 95.725  -52.675 328.588 1.00 32.26  ? 379  VAL B O   1 
ATOM   6977 C CB  . VAL B 1 378 ? 93.290  -50.415 328.354 1.00 31.22  ? 379  VAL B CB  1 
ATOM   6978 C CG1 . VAL B 1 378 ? 92.765  -51.760 327.887 1.00 28.35  ? 379  VAL B CG1 1 
ATOM   6979 C CG2 . VAL B 1 378 ? 92.286  -49.735 329.274 1.00 28.55  ? 379  VAL B CG2 1 
ATOM   6980 N N   . LEU B 1 379 ? 96.257  -50.929 327.273 1.00 25.11  ? 380  LEU B N   1 
ATOM   6981 C CA  . LEU B 1 379 ? 97.235  -51.706 326.517 1.00 27.94  ? 380  LEU B CA  1 
ATOM   6982 C C   . LEU B 1 379 ? 98.338  -52.238 327.422 1.00 29.18  ? 380  LEU B C   1 
ATOM   6983 O O   . LEU B 1 379 ? 98.768  -53.389 327.283 1.00 30.45  ? 380  LEU B O   1 
ATOM   6984 C CB  . LEU B 1 379 ? 97.839  -50.845 325.406 1.00 33.36  ? 380  LEU B CB  1 
ATOM   6985 C CG  . LEU B 1 379 ? 99.172  -51.338 324.832 1.00 35.75  ? 380  LEU B CG  1 
ATOM   6986 C CD1 . LEU B 1 379 ? 98.932  -52.403 323.775 1.00 33.62  ? 380  LEU B CD1 1 
ATOM   6987 C CD2 . LEU B 1 379 ? 100.003 -50.191 324.274 1.00 36.27  ? 380  LEU B CD2 1 
ATOM   6988 N N   A HIS B 1 380 ? 98.807  -51.425 328.365 0.55 28.83  ? 381  HIS B N   1 
ATOM   6989 N N   B HIS B 1 380 ? 98.786  -51.408 328.366 0.45 29.23  ? 381  HIS B N   1 
ATOM   6990 C CA  A HIS B 1 380 ? 99.972  -51.834 329.141 0.55 30.77  ? 381  HIS B CA  1 
ATOM   6991 C CA  B HIS B 1 380 ? 99.943  -51.730 329.192 0.45 30.99  ? 381  HIS B CA  1 
ATOM   6992 C C   A HIS B 1 380 ? 99.622  -52.795 330.268 0.55 30.68  ? 381  HIS B C   1 
ATOM   6993 C C   B HIS B 1 380 ? 99.611  -52.783 330.242 0.45 30.44  ? 381  HIS B C   1 
ATOM   6994 O O   A HIS B 1 380 ? 100.469 -53.604 330.665 0.55 29.82  ? 381  HIS B O   1 
ATOM   6995 O O   B HIS B 1 380 ? 100.447 -53.637 330.559 0.45 29.50  ? 381  HIS B O   1 
ATOM   6996 C CB  A HIS B 1 380 ? 100.686 -50.605 329.698 0.55 32.45  ? 381  HIS B CB  1 
ATOM   6997 C CB  B HIS B 1 380 ? 100.454 -50.451 329.858 0.45 32.63  ? 381  HIS B CB  1 
ATOM   6998 C CG  A HIS B 1 380 ? 101.623 -49.970 328.721 0.55 35.14  ? 381  HIS B CG  1 
ATOM   6999 C CG  B HIS B 1 380 ? 101.880 -50.521 330.302 0.45 32.95  ? 381  HIS B CG  1 
ATOM   7000 N ND1 A HIS B 1 380 ? 101.223 -48.993 327.836 0.55 35.38  ? 381  HIS B ND1 1 
ATOM   7001 N ND1 B HIS B 1 380 ? 102.908 -50.878 329.457 0.45 36.45  ? 381  HIS B ND1 1 
ATOM   7002 C CD2 A HIS B 1 380 ? 102.936 -50.188 328.476 0.55 35.79  ? 381  HIS B CD2 1 
ATOM   7003 C CD2 B HIS B 1 380 ? 102.452 -50.266 331.503 0.45 34.76  ? 381  HIS B CD2 1 
ATOM   7004 C CE1 A HIS B 1 380 ? 102.253 -48.626 327.096 0.55 35.13  ? 381  HIS B CE1 1 
ATOM   7005 C CE1 B HIS B 1 380 ? 104.050 -50.846 330.118 0.45 34.96  ? 381  HIS B CE1 1 
ATOM   7006 N NE2 A HIS B 1 380 ? 103.305 -49.336 327.463 0.55 38.64  ? 381  HIS B NE2 1 
ATOM   7007 N NE2 B HIS B 1 380 ? 103.801 -50.478 331.362 0.45 34.74  ? 381  HIS B NE2 1 
ATOM   7008 N N   . TYR B 1 381 ? 98.400  -52.738 330.793 1.00 25.20  ? 382  TYR B N   1 
ATOM   7009 C CA  . TYR B 1 381 ? 98.021  -53.571 331.925 1.00 25.09  ? 382  TYR B CA  1 
ATOM   7010 C C   . TYR B 1 381 ? 97.115  -54.732 331.541 1.00 26.25  ? 382  TYR B C   1 
ATOM   7011 O O   . TYR B 1 381 ? 96.568  -55.397 332.427 1.00 31.11  ? 382  TYR B O   1 
ATOM   7012 C CB  . TYR B 1 381 ? 97.369  -52.708 333.004 1.00 20.06  ? 382  TYR B CB  1 
ATOM   7013 C CG  . TYR B 1 381 ? 98.383  -51.876 333.751 1.00 24.75  ? 382  TYR B CG  1 
ATOM   7014 C CD1 . TYR B 1 381 ? 98.915  -52.313 334.956 1.00 24.49  ? 382  TYR B CD1 1 
ATOM   7015 C CD2 . TYR B 1 381 ? 98.829  -50.664 333.239 1.00 24.29  ? 382  TYR B CD2 1 
ATOM   7016 C CE1 . TYR B 1 381 ? 99.850  -51.561 335.639 1.00 25.75  ? 382  TYR B CE1 1 
ATOM   7017 C CE2 . TYR B 1 381 ? 99.766  -49.905 333.914 1.00 27.26  ? 382  TYR B CE2 1 
ATOM   7018 C CZ  . TYR B 1 381 ? 100.272 -50.359 335.114 1.00 28.99  ? 382  TYR B CZ  1 
ATOM   7019 O OH  . TYR B 1 381 ? 101.206 -49.609 335.793 1.00 22.45  ? 382  TYR B OH  1 
ATOM   7020 N N   . THR B 1 382 ? 96.956  -55.003 330.251 1.00 27.47  ? 383  THR B N   1 
ATOM   7021 C CA  . THR B 1 382 ? 96.238  -56.178 329.781 1.00 27.33  ? 383  THR B CA  1 
ATOM   7022 C C   . THR B 1 382 ? 97.239  -57.268 329.426 1.00 30.18  ? 383  THR B C   1 
ATOM   7023 O O   . THR B 1 382 ? 98.227  -57.006 328.732 1.00 27.00  ? 383  THR B O   1 
ATOM   7024 C CB  . THR B 1 382 ? 95.375  -55.852 328.559 1.00 26.58  ? 383  THR B CB  1 
ATOM   7025 O OG1 . THR B 1 382 ? 94.324  -54.953 328.933 1.00 30.43  ? 383  THR B OG1 1 
ATOM   7026 C CG2 . THR B 1 382 ? 94.767  -57.123 327.979 1.00 24.92  ? 383  THR B CG2 1 
ATOM   7027 N N   . ASP B 1 383 ? 96.995  -58.480 329.920 1.00 29.42  ? 384  ASP B N   1 
ATOM   7028 C CA  . ASP B 1 383 ? 97.658  -59.672 329.405 1.00 29.92  ? 384  ASP B CA  1 
ATOM   7029 C C   . ASP B 1 383 ? 96.847  -60.135 328.203 1.00 31.14  ? 384  ASP B C   1 
ATOM   7030 O O   . ASP B 1 383 ? 95.747  -60.672 328.359 1.00 28.51  ? 384  ASP B O   1 
ATOM   7031 C CB  . ASP B 1 383 ? 97.752  -60.760 330.472 1.00 35.64  ? 384  ASP B CB  1 
ATOM   7032 C CG  . ASP B 1 383 ? 98.568  -61.968 330.017 1.00 39.51  ? 384  ASP B CG  1 
ATOM   7033 O OD1 . ASP B 1 383 ? 98.742  -62.168 328.796 1.00 41.28  ? 384  ASP B OD1 1 
ATOM   7034 O OD2 . ASP B 1 383 ? 99.039  -62.724 330.892 1.00 39.24  ? 384  ASP B OD2 1 
ATOM   7035 N N   . TRP B 1 384 ? 97.380  -59.922 327.005 1.00 27.43  ? 385  TRP B N   1 
ATOM   7036 C CA  . TRP B 1 384 ? 96.604  -60.179 325.801 1.00 28.53  ? 385  TRP B CA  1 
ATOM   7037 C C   . TRP B 1 384 ? 96.499  -61.659 325.464 1.00 33.41  ? 385  TRP B C   1 
ATOM   7038 O O   . TRP B 1 384 ? 95.842  -62.008 324.477 1.00 32.23  ? 385  TRP B O   1 
ATOM   7039 C CB  . TRP B 1 384 ? 97.192  -59.381 324.637 1.00 26.73  ? 385  TRP B CB  1 
ATOM   7040 C CG  . TRP B 1 384 ? 97.023  -57.914 324.875 1.00 25.72  ? 385  TRP B CG  1 
ATOM   7041 C CD1 . TRP B 1 384 ? 97.949  -57.050 325.384 1.00 24.72  ? 385  TRP B CD1 1 
ATOM   7042 C CD2 . TRP B 1 384 ? 95.829  -57.149 324.673 1.00 25.75  ? 385  TRP B CD2 1 
ATOM   7043 N NE1 . TRP B 1 384 ? 97.414  -55.789 325.485 1.00 25.94  ? 385  TRP B NE1 1 
ATOM   7044 C CE2 . TRP B 1 384 ? 96.113  -55.823 325.055 1.00 25.90  ? 385  TRP B CE2 1 
ATOM   7045 C CE3 . TRP B 1 384 ? 94.551  -57.455 324.194 1.00 26.64  ? 385  TRP B CE3 1 
ATOM   7046 C CZ2 . TRP B 1 384 ? 95.166  -54.805 324.974 1.00 24.66  ? 385  TRP B CZ2 1 
ATOM   7047 C CZ3 . TRP B 1 384 ? 93.613  -56.442 324.112 1.00 26.53  ? 385  TRP B CZ3 1 
ATOM   7048 C CH2 . TRP B 1 384 ? 93.925  -55.133 324.501 1.00 25.56  ? 385  TRP B CH2 1 
ATOM   7049 N N   . LEU B 1 385 ? 97.114  -62.532 326.261 1.00 32.63  ? 386  LEU B N   1 
ATOM   7050 C CA  . LEU B 1 385 ? 96.808  -63.955 326.214 1.00 33.82  ? 386  LEU B CA  1 
ATOM   7051 C C   . LEU B 1 385 ? 95.689  -64.338 327.174 1.00 37.16  ? 386  LEU B C   1 
ATOM   7052 O O   . LEU B 1 385 ? 95.057  -65.383 326.983 1.00 36.04  ? 386  LEU B O   1 
ATOM   7053 C CB  . LEU B 1 385 ? 98.060  -64.781 326.530 1.00 32.44  ? 386  LEU B CB  1 
ATOM   7054 C CG  . LEU B 1 385 ? 99.134  -64.818 325.441 1.00 35.58  ? 386  LEU B CG  1 
ATOM   7055 C CD1 . LEU B 1 385 ? 100.377 -65.547 325.928 1.00 38.13  ? 386  LEU B CD1 1 
ATOM   7056 C CD2 . LEU B 1 385 ? 98.585  -65.467 324.182 1.00 36.93  ? 386  LEU B CD2 1 
ATOM   7057 N N   . HIS B 1 386 ? 95.430  -63.515 328.193 1.00 33.86  ? 387  HIS B N   1 
ATOM   7058 C CA  . HIS B 1 386 ? 94.328  -63.737 329.134 1.00 37.76  ? 387  HIS B CA  1 
ATOM   7059 C C   . HIS B 1 386 ? 93.589  -62.426 329.370 1.00 31.13  ? 387  HIS B C   1 
ATOM   7060 O O   . HIS B 1 386 ? 93.540  -61.915 330.492 1.00 32.00  ? 387  HIS B O   1 
ATOM   7061 C CB  . HIS B 1 386 ? 94.846  -64.301 330.457 1.00 34.31  ? 387  HIS B CB  1 
ATOM   7062 C CG  . HIS B 1 386 ? 95.623  -65.571 330.319 1.00 39.17  ? 387  HIS B CG  1 
ATOM   7063 N ND1 . HIS B 1 386 ? 97.000  -65.599 330.270 1.00 40.64  ? 387  HIS B ND1 1 
ATOM   7064 C CD2 . HIS B 1 386 ? 95.218  -66.860 330.240 1.00 38.20  ? 387  HIS B CD2 1 
ATOM   7065 C CE1 . HIS B 1 386 ? 97.409  -66.850 330.159 1.00 38.78  ? 387  HIS B CE1 1 
ATOM   7066 N NE2 . HIS B 1 386 ? 96.347  -67.635 330.138 1.00 41.98  ? 387  HIS B NE2 1 
ATOM   7067 N N   . PRO B 1 387 ? 92.985  -61.851 328.324 1.00 32.99  ? 388  PRO B N   1 
ATOM   7068 C CA  . PRO B 1 387 ? 92.418  -60.501 328.468 1.00 30.63  ? 388  PRO B CA  1 
ATOM   7069 C C   . PRO B 1 387 ? 91.201  -60.427 329.377 1.00 38.03  ? 388  PRO B C   1 
ATOM   7070 O O   . PRO B 1 387 ? 90.861  -59.326 329.829 1.00 34.22  ? 388  PRO B O   1 
ATOM   7071 C CB  . PRO B 1 387 ? 92.058  -60.116 327.028 1.00 28.62  ? 388  PRO B CB  1 
ATOM   7072 C CG  . PRO B 1 387 ? 91.811  -61.418 326.353 1.00 29.99  ? 388  PRO B CG  1 
ATOM   7073 C CD  . PRO B 1 387 ? 92.765  -62.401 326.974 1.00 30.07  ? 388  PRO B CD  1 
ATOM   7074 N N   . GLU B 1 388 ? 90.541  -61.548 329.672 1.00 40.49  ? 389  GLU B N   1 
ATOM   7075 C CA  . GLU B 1 388 ? 89.270  -61.524 330.389 1.00 42.49  ? 389  GLU B CA  1 
ATOM   7076 C C   . GLU B 1 388 ? 89.314  -62.252 331.729 1.00 40.38  ? 389  GLU B C   1 
ATOM   7077 O O   . GLU B 1 388 ? 88.268  -62.392 332.375 1.00 42.35  ? 389  GLU B O   1 
ATOM   7078 C CB  . GLU B 1 388 ? 88.164  -62.120 329.513 1.00 49.75  ? 389  GLU B CB  1 
ATOM   7079 C CG  . GLU B 1 388 ? 88.140  -61.579 328.090 1.00 61.70  ? 389  GLU B CG  1 
ATOM   7080 C CD  . GLU B 1 388 ? 86.865  -60.824 327.773 1.00 73.73  ? 389  GLU B CD  1 
ATOM   7081 O OE1 . GLU B 1 388 ? 85.877  -60.981 328.522 1.00 78.52  ? 389  GLU B OE1 1 
ATOM   7082 O OE2 . GLU B 1 388 ? 86.849  -60.074 326.774 1.00 76.49  ? 389  GLU B OE2 1 
ATOM   7083 N N   . ASP B 1 389 ? 90.480  -62.710 332.167 1.00 38.61  ? 390  ASP B N   1 
ATOM   7084 C CA  . ASP B 1 389 ? 90.576  -63.479 333.407 1.00 40.14  ? 390  ASP B CA  1 
ATOM   7085 C C   . ASP B 1 389 ? 90.234  -62.603 334.607 1.00 38.26  ? 390  ASP B C   1 
ATOM   7086 O O   . ASP B 1 389 ? 90.895  -61.579 334.821 1.00 37.71  ? 390  ASP B O   1 
ATOM   7087 C CB  . ASP B 1 389 ? 91.977  -64.064 333.556 1.00 42.45  ? 390  ASP B CB  1 
ATOM   7088 C CG  . ASP B 1 389 ? 92.131  -64.905 334.811 1.00 52.48  ? 390  ASP B CG  1 
ATOM   7089 O OD1 . ASP B 1 389 ? 91.116  -65.430 335.313 1.00 61.06  ? 390  ASP B OD1 1 
ATOM   7090 O OD2 . ASP B 1 389 ? 93.273  -65.044 335.297 1.00 59.18  ? 390  ASP B OD2 1 
ATOM   7091 N N   . PRO B 1 390 ? 89.224  -62.960 335.408 1.00 37.63  ? 391  PRO B N   1 
ATOM   7092 C CA  . PRO B 1 390 ? 88.839  -62.087 336.534 1.00 37.13  ? 391  PRO B CA  1 
ATOM   7093 C C   . PRO B 1 390 ? 89.960  -61.819 337.526 1.00 38.18  ? 391  PRO B C   1 
ATOM   7094 O O   . PRO B 1 390 ? 90.192  -60.659 337.891 1.00 35.02  ? 391  PRO B O   1 
ATOM   7095 C CB  . PRO B 1 390 ? 87.676  -62.855 337.177 1.00 35.68  ? 391  PRO B CB  1 
ATOM   7096 C CG  . PRO B 1 390 ? 87.100  -63.661 336.062 1.00 37.30  ? 391  PRO B CG  1 
ATOM   7097 C CD  . PRO B 1 390 ? 88.272  -64.069 335.216 1.00 38.69  ? 391  PRO B CD  1 
ATOM   7098 N N   . ALA B 1 391 ? 90.662  -62.860 337.982 1.00 37.57  ? 392  ALA B N   1 
ATOM   7099 C CA  . ALA B 1 391 ? 91.706  -62.657 338.982 1.00 34.88  ? 392  ALA B CA  1 
ATOM   7100 C C   . ALA B 1 391 ? 92.844  -61.799 338.445 1.00 36.80  ? 392  ALA B C   1 
ATOM   7101 O O   . ALA B 1 391 ? 93.417  -60.995 339.188 1.00 38.51  ? 392  ALA B O   1 
ATOM   7102 C CB  . ALA B 1 391 ? 92.240  -64.004 339.470 1.00 35.03  ? 392  ALA B CB  1 
ATOM   7103 N N   . ARG B 1 392 ? 93.181  -61.946 337.162 1.00 40.77  ? 393  ARG B N   1 
ATOM   7104 C CA  . ARG B 1 392 ? 94.248  -61.135 336.583 1.00 34.36  ? 393  ARG B CA  1 
ATOM   7105 C C   . ARG B 1 392 ? 93.828  -59.679 336.425 1.00 27.91  ? 393  ARG B C   1 
ATOM   7106 O O   . ARG B 1 392 ? 94.660  -58.777 336.581 1.00 28.53  ? 393  ARG B O   1 
ATOM   7107 C CB  . ARG B 1 392 ? 94.669  -61.707 335.230 1.00 34.82  ? 393  ARG B CB  1 
ATOM   7108 C CG  . ARG B 1 392 ? 95.672  -62.846 335.294 1.00 39.61  ? 393  ARG B CG  1 
ATOM   7109 C CD  . ARG B 1 392 ? 96.026  -63.297 333.884 1.00 40.09  ? 393  ARG B CD  1 
ATOM   7110 N NE  . ARG B 1 392 ? 96.987  -64.396 333.855 1.00 41.94  ? 393  ARG B NE  1 
ATOM   7111 C CZ  . ARG B 1 392 ? 96.655  -65.674 333.707 1.00 46.95  ? 393  ARG B CZ  1 
ATOM   7112 N NH1 . ARG B 1 392 ? 95.381  -66.019 333.581 1.00 49.20  ? 393  ARG B NH1 1 
ATOM   7113 N NH2 . ARG B 1 392 ? 97.596  -66.608 333.685 1.00 51.28  ? 393  ARG B NH2 1 
ATOM   7114 N N   . LEU B 1 393 ? 92.555  -59.430 336.108 1.00 30.99  ? 394  LEU B N   1 
ATOM   7115 C CA  . LEU B 1 393 ? 92.090  -58.055 335.954 1.00 30.20  ? 394  LEU B CA  1 
ATOM   7116 C C   . LEU B 1 393 ? 92.013  -57.346 337.299 1.00 30.71  ? 394  LEU B C   1 
ATOM   7117 O O   . LEU B 1 393 ? 92.280  -56.142 337.388 1.00 30.17  ? 394  LEU B O   1 
ATOM   7118 C CB  . LEU B 1 393 ? 90.731  -58.032 335.256 1.00 30.31  ? 394  LEU B CB  1 
ATOM   7119 C CG  . LEU B 1 393 ? 90.722  -58.464 333.789 1.00 32.30  ? 394  LEU B CG  1 
ATOM   7120 C CD1 . LEU B 1 393 ? 89.303  -58.767 333.341 1.00 31.08  ? 394  LEU B CD1 1 
ATOM   7121 C CD2 . LEU B 1 393 ? 91.354  -57.399 332.907 1.00 27.74  ? 394  LEU B CD2 1 
ATOM   7122 N N   . ARG B 1 394 ? 91.646  -58.075 338.355 1.00 29.80  ? 395  ARG B N   1 
ATOM   7123 C CA  . ARG B 1 394 ? 91.663  -57.493 339.693 1.00 29.12  ? 395  ARG B CA  1 
ATOM   7124 C C   . ARG B 1 394 ? 93.064  -57.015 340.059 1.00 27.61  ? 395  ARG B C   1 
ATOM   7125 O O   . ARG B 1 394 ? 93.242  -55.892 340.543 1.00 28.64  ? 395  ARG B O   1 
ATOM   7126 C CB  . ARG B 1 394 ? 91.143  -58.508 340.713 1.00 31.50  ? 395  ARG B CB  1 
ATOM   7127 C CG  . ARG B 1 394 ? 91.029  -57.960 342.127 1.00 35.30  ? 395  ARG B CG  1 
ATOM   7128 C CD  . ARG B 1 394 ? 90.743  -59.057 343.136 1.00 35.51  ? 395  ARG B CD  1 
ATOM   7129 N NE  . ARG B 1 394 ? 91.788  -60.074 343.156 1.00 40.06  ? 395  ARG B NE  1 
ATOM   7130 C CZ  . ARG B 1 394 ? 91.579  -61.351 343.456 1.00 49.86  ? 395  ARG B CZ  1 
ATOM   7131 N NH1 . ARG B 1 394 ? 90.362  -61.771 343.770 1.00 46.52  ? 395  ARG B NH1 1 
ATOM   7132 N NH2 . ARG B 1 394 ? 92.585  -62.209 343.449 1.00 65.65  ? 395  ARG B NH2 1 
ATOM   7133 N N   . GLU B 1 395 ? 94.079  -57.848 339.808 1.00 30.59  ? 396  GLU B N   1 
ATOM   7134 C CA  . GLU B 1 395 ? 95.454  -57.438 340.085 1.00 34.15  ? 396  GLU B CA  1 
ATOM   7135 C C   . GLU B 1 395 ? 95.881  -56.291 339.193 1.00 30.07  ? 396  GLU B C   1 
ATOM   7136 O O   . GLU B 1 395 ? 96.569  -55.367 339.642 1.00 27.66  ? 396  GLU B O   1 
ATOM   7137 C CB  . GLU B 1 395 ? 96.419  -58.596 339.877 1.00 37.11  ? 396  GLU B CB  1 
ATOM   7138 C CG  . GLU B 1 395 ? 96.786  -59.235 341.148 1.00 61.84  ? 396  GLU B CG  1 
ATOM   7139 C CD  . GLU B 1 395 ? 95.641  -60.061 341.632 1.00 80.79  ? 396  GLU B CD  1 
ATOM   7140 O OE1 . GLU B 1 395 ? 94.948  -59.623 342.570 1.00 88.72  ? 396  GLU B OE1 1 
ATOM   7141 O OE2 . GLU B 1 395 ? 95.409  -61.125 341.036 1.00 87.44  ? 396  GLU B OE2 1 
ATOM   7142 N N   . ALA B 1 396 ? 95.528  -56.364 337.910 1.00 26.60  ? 397  ALA B N   1 
ATOM   7143 C CA  . ALA B 1 396 ? 95.969  -55.346 336.970 1.00 28.17  ? 397  ALA B CA  1 
ATOM   7144 C C   . ALA B 1 396 ? 95.460  -53.973 337.381 1.00 20.46  ? 397  ALA B C   1 
ATOM   7145 O O   . ALA B 1 396 ? 96.220  -52.999 337.386 1.00 25.28  ? 397  ALA B O   1 
ATOM   7146 C CB  . ALA B 1 396 ? 95.508  -55.703 335.558 1.00 21.71  ? 397  ALA B CB  1 
ATOM   7147 N N   . LEU B 1 397 ? 94.185  -53.884 337.764 1.00 21.02  ? 398  LEU B N   1 
ATOM   7148 C CA  . LEU B 1 397 ? 93.641  -52.602 338.199 1.00 30.45  ? 398  LEU B CA  1 
ATOM   7149 C C   . LEU B 1 397 ? 94.271  -52.152 339.512 1.00 29.95  ? 398  LEU B C   1 
ATOM   7150 O O   . LEU B 1 397 ? 94.503  -50.954 339.716 1.00 27.06  ? 398  LEU B O   1 
ATOM   7151 C CB  . LEU B 1 397 ? 92.123  -52.690 338.331 1.00 26.07  ? 398  LEU B CB  1 
ATOM   7152 C CG  . LEU B 1 397 ? 91.460  -51.326 338.522 1.00 30.18  ? 398  LEU B CG  1 
ATOM   7153 C CD1 . LEU B 1 397 ? 91.662  -50.473 337.278 1.00 29.33  ? 398  LEU B CD1 1 
ATOM   7154 C CD2 . LEU B 1 397 ? 89.984  -51.479 338.839 1.00 31.78  ? 398  LEU B CD2 1 
ATOM   7155 N N   . SER B 1 398 ? 94.550  -53.094 340.416 1.00 28.49  ? 399  SER B N   1 
ATOM   7156 C CA  . SER B 1 398 ? 95.294  -52.754 341.624 1.00 23.93  ? 399  SER B CA  1 
ATOM   7157 C C   . SER B 1 398 ? 96.670  -52.203 341.275 1.00 28.52  ? 399  SER B C   1 
ATOM   7158 O O   . SER B 1 398 ? 97.132  -51.230 341.882 1.00 28.02  ? 399  SER B O   1 
ATOM   7159 C CB  . SER B 1 398 ? 95.416  -53.980 342.530 1.00 25.77  ? 399  SER B CB  1 
ATOM   7160 O OG  . SER B 1 398 ? 96.159  -53.684 343.700 1.00 35.44  ? 399  SER B OG  1 
ATOM   7161 N N   . ASP B 1 399 ? 97.333  -52.804 340.283 1.00 22.82  ? 400  ASP B N   1 
ATOM   7162 C CA  . ASP B 1 399 ? 98.626  -52.294 339.840 1.00 25.16  ? 400  ASP B CA  1 
ATOM   7163 C C   . ASP B 1 399 ? 98.497  -50.921 339.188 1.00 26.07  ? 400  ASP B C   1 
ATOM   7164 O O   . ASP B 1 399 ? 99.354  -50.056 339.393 1.00 25.33  ? 400  ASP B O   1 
ATOM   7165 C CB  . ASP B 1 399 ? 99.282  -53.278 338.871 1.00 33.44  ? 400  ASP B CB  1 
ATOM   7166 C CG  . ASP B 1 399 ? 99.771  -54.539 339.555 1.00 41.99  ? 400  ASP B CG  1 
ATOM   7167 O OD1 . ASP B 1 399 ? 100.003 -54.505 340.781 1.00 45.70  ? 400  ASP B OD1 1 
ATOM   7168 O OD2 . ASP B 1 399 ? 99.933  -55.564 338.859 1.00 46.33  ? 400  ASP B OD2 1 
ATOM   7169 N N   . VAL B 1 400 ? 97.453  -50.712 338.379 1.00 21.25  ? 401  VAL B N   1 
ATOM   7170 C CA  . VAL B 1 400 ? 97.276  -49.431 337.695 1.00 20.60  ? 401  VAL B CA  1 
ATOM   7171 C C   . VAL B 1 400 ? 97.258  -48.305 338.706 1.00 23.90  ? 401  VAL B C   1 
ATOM   7172 O O   . VAL B 1 400 ? 97.978  -47.304 338.584 1.00 20.39  ? 401  VAL B O   1 
ATOM   7173 C CB  . VAL B 1 400 ? 95.972  -49.437 336.879 1.00 24.47  ? 401  VAL B CB  1 
ATOM   7174 C CG1 . VAL B 1 400 ? 95.632  -48.032 336.407 1.00 20.90  ? 401  VAL B CG1 1 
ATOM   7175 C CG2 . VAL B 1 400 ? 96.074  -50.382 335.718 1.00 20.93  ? 401  VAL B CG2 1 
ATOM   7176 N N   . VAL B 1 401 ? 96.431  -48.482 339.733 1.00 22.46  ? 402  VAL B N   1 
ATOM   7177 C CA  . VAL B 1 401 ? 96.189  -47.471 340.747 1.00 21.23  ? 402  VAL B CA  1 
ATOM   7178 C C   . VAL B 1 401 ? 97.393  -47.309 341.656 1.00 26.63  ? 402  VAL B C   1 
ATOM   7179 O O   . VAL B 1 401 ? 97.755  -46.185 342.018 1.00 20.47  ? 402  VAL B O   1 
ATOM   7180 C CB  . VAL B 1 401 ? 94.902  -47.838 341.507 1.00 29.15  ? 402  VAL B CB  1 
ATOM   7181 C CG1 . VAL B 1 401 ? 94.824  -47.178 342.846 1.00 31.11  ? 402  VAL B CG1 1 
ATOM   7182 C CG2 . VAL B 1 401 ? 93.693  -47.491 340.645 1.00 43.83  ? 402  VAL B CG2 1 
ATOM   7183 N N   . GLY B 1 402 ? 98.046  -48.415 342.024 1.00 24.30  ? 403  GLY B N   1 
ATOM   7184 C CA  . GLY B 1 402 ? 99.224  -48.316 342.870 1.00 22.95  ? 403  GLY B CA  1 
ATOM   7185 C C   . GLY B 1 402 ? 100.422 -47.726 342.149 1.00 24.72  ? 403  GLY B C   1 
ATOM   7186 O O   . GLY B 1 402 ? 101.168 -46.925 342.720 1.00 24.12  ? 403  GLY B O   1 
ATOM   7187 N N   . ASP B 1 403 ? 100.623 -48.108 340.885 1.00 18.34  ? 404  ASP B N   1 
ATOM   7188 C CA  . ASP B 1 403 ? 101.743 -47.571 340.118 1.00 21.05  ? 404  ASP B CA  1 
ATOM   7189 C C   . ASP B 1 403 ? 101.557 -46.084 339.842 1.00 19.29  ? 404  ASP B C   1 
ATOM   7190 O O   . ASP B 1 403 ? 102.478 -45.284 340.040 1.00 19.40  ? 404  ASP B O   1 
ATOM   7191 C CB  . ASP B 1 403 ? 101.903 -48.335 338.801 1.00 22.00  ? 404  ASP B CB  1 
ATOM   7192 C CG  . ASP B 1 403 ? 102.232 -49.803 339.006 1.00 24.50  ? 404  ASP B CG  1 
ATOM   7193 O OD1 . ASP B 1 403 ? 102.516 -50.201 340.155 1.00 24.25  ? 404  ASP B OD1 1 
ATOM   7194 O OD2 . ASP B 1 403 ? 102.197 -50.560 338.012 1.00 22.60  ? 404  ASP B OD2 1 
ATOM   7195 N N   . HIS B 1 404 ? 100.365 -45.700 339.378 1.00 18.07  ? 405  HIS B N   1 
ATOM   7196 C CA  . HIS B 1 404 ? 100.110 -44.313 339.003 1.00 20.37  ? 405  HIS B CA  1 
ATOM   7197 C C   . HIS B 1 404 ? 100.265 -43.373 340.193 1.00 20.60  ? 405  HIS B C   1 
ATOM   7198 O O   . HIS B 1 404 ? 100.859 -42.295 340.069 1.00 19.97  ? 405  HIS B O   1 
ATOM   7199 C CB  . HIS B 1 404 ? 98.708  -44.199 338.398 1.00 18.73  ? 405  HIS B CB  1 
ATOM   7200 C CG  . HIS B 1 404 ? 98.305  -42.804 338.033 1.00 23.05  ? 405  HIS B CG  1 
ATOM   7201 N ND1 . HIS B 1 404 ? 99.152  -41.923 337.394 1.00 21.58  ? 405  HIS B ND1 1 
ATOM   7202 C CD2 . HIS B 1 404 ? 97.135  -42.143 338.203 1.00 22.89  ? 405  HIS B CD2 1 
ATOM   7203 C CE1 . HIS B 1 404 ? 98.523  -40.778 337.194 1.00 19.64  ? 405  HIS B CE1 1 
ATOM   7204 N NE2 . HIS B 1 404 ? 97.298  -40.885 337.676 1.00 23.75  ? 405  HIS B NE2 1 
ATOM   7205 N N   . ASN B 1 405 ? 99.758  -43.769 341.358 1.00 19.44  ? 406  ASN B N   1 
ATOM   7206 C CA  . ASN B 1 405 ? 99.659  -42.859 342.490 1.00 19.43  ? 406  ASN B CA  1 
ATOM   7207 C C   . ASN B 1 405 ? 100.809 -42.967 343.482 1.00 17.90  ? 406  ASN B C   1 
ATOM   7208 O O   . ASN B 1 405 ? 101.126 -41.973 344.142 1.00 22.68  ? 406  ASN B O   1 
ATOM   7209 C CB  . ASN B 1 405 ? 98.337  -43.085 343.232 1.00 16.67  ? 406  ASN B CB  1 
ATOM   7210 C CG  . ASN B 1 405 ? 97.129  -42.694 342.402 1.00 21.53  ? 406  ASN B CG  1 
ATOM   7211 O OD1 . ASN B 1 405 ? 96.836  -41.510 342.233 1.00 25.31  ? 406  ASN B OD1 1 
ATOM   7212 N ND2 . ASN B 1 405 ? 96.421  -43.689 341.879 1.00 17.27  ? 406  ASN B ND2 1 
ATOM   7213 N N   . VAL B 1 406 ? 101.445 -44.131 343.616 1.00 18.21  ? 407  VAL B N   1 
ATOM   7214 C CA  . VAL B 1 406 ? 102.449 -44.303 344.662 1.00 20.57  ? 407  VAL B CA  1 
ATOM   7215 C C   . VAL B 1 406 ? 103.790 -44.756 344.095 1.00 24.25  ? 407  VAL B C   1 
ATOM   7216 O O   . VAL B 1 406 ? 104.788 -44.035 344.195 1.00 21.13  ? 407  VAL B O   1 
ATOM   7217 C CB  . VAL B 1 406 ? 101.965 -45.291 345.739 1.00 22.94  ? 407  VAL B CB  1 
ATOM   7218 C CG1 . VAL B 1 406 ? 103.048 -45.487 346.787 1.00 21.09  ? 407  VAL B CG1 1 
ATOM   7219 C CG2 . VAL B 1 406 ? 100.681 -44.794 346.384 1.00 22.92  ? 407  VAL B CG2 1 
ATOM   7220 N N   . VAL B 1 407 ? 103.820 -45.953 343.500 1.00 19.68  ? 408  VAL B N   1 
ATOM   7221 C CA  . VAL B 1 407 ? 105.091 -46.616 343.200 1.00 16.67  ? 408  VAL B CA  1 
ATOM   7222 C C   . VAL B 1 407 ? 105.921 -45.794 342.220 1.00 20.07  ? 408  VAL B C   1 
ATOM   7223 O O   . VAL B 1 407 ? 107.100 -45.509 342.467 1.00 21.29  ? 408  VAL B O   1 
ATOM   7224 C CB  . VAL B 1 407 ? 104.844 -48.038 342.667 1.00 21.49  ? 408  VAL B CB  1 
ATOM   7225 C CG1 . VAL B 1 407 ? 106.167 -48.709 342.327 1.00 18.21  ? 408  VAL B CG1 1 
ATOM   7226 C CG2 . VAL B 1 407 ? 104.067 -48.858 343.681 1.00 20.41  ? 408  VAL B CG2 1 
ATOM   7227 N N   . CYS B 1 408 ? 105.333 -45.419 341.086 1.00 14.55  ? 409  CYS B N   1 
ATOM   7228 C CA  . CYS B 1 408 ? 106.103 -44.693 340.081 1.00 18.19  ? 409  CYS B CA  1 
ATOM   7229 C C   . CYS B 1 408 ? 106.449 -43.256 340.463 1.00 21.96  ? 409  CYS B C   1 
ATOM   7230 O O   . CYS B 1 408 ? 107.543 -42.797 340.111 1.00 20.38  ? 409  CYS B O   1 
ATOM   7231 C CB  . CYS B 1 408 ? 105.392 -44.745 338.723 1.00 16.54  ? 409  CYS B CB  1 
ATOM   7232 S SG  . CYS B 1 408 ? 105.037 -46.444 338.210 1.00 26.49  ? 409  CYS B SG  1 
ATOM   7233 N N   . PRO B 1 409 ? 105.579 -42.505 341.148 1.00 23.88  ? 410  PRO B N   1 
ATOM   7234 C CA  . PRO B 1 409 ? 106.066 -41.248 341.739 1.00 24.89  ? 410  PRO B CA  1 
ATOM   7235 C C   . PRO B 1 409 ? 107.226 -41.465 342.696 1.00 24.31  ? 410  PRO B C   1 
ATOM   7236 O O   . PRO B 1 409 ? 108.182 -40.679 342.697 1.00 18.49  ? 410  PRO B O   1 
ATOM   7237 C CB  . PRO B 1 409 ? 104.825 -40.696 342.447 1.00 19.81  ? 410  PRO B CB  1 
ATOM   7238 C CG  . PRO B 1 409 ? 103.692 -41.230 341.652 1.00 19.29  ? 410  PRO B CG  1 
ATOM   7239 C CD  . PRO B 1 409 ? 104.111 -42.616 341.246 1.00 17.06  ? 410  PRO B CD  1 
ATOM   7240 N N   . VAL B 1 410 ? 107.171 -42.526 343.505 1.00 18.78  ? 411  VAL B N   1 
ATOM   7241 C CA  . VAL B 1 410 ? 108.265 -42.824 344.424 1.00 19.40  ? 411  VAL B CA  1 
ATOM   7242 C C   . VAL B 1 410 ? 109.526 -43.201 343.654 1.00 26.21  ? 411  VAL B C   1 
ATOM   7243 O O   . VAL B 1 410 ? 110.631 -42.758 343.990 1.00 24.46  ? 411  VAL B O   1 
ATOM   7244 C CB  . VAL B 1 410 ? 107.845 -43.932 345.408 1.00 19.17  ? 411  VAL B CB  1 
ATOM   7245 C CG1 . VAL B 1 410 ? 109.063 -44.547 346.083 1.00 18.81  ? 411  VAL B CG1 1 
ATOM   7246 C CG2 . VAL B 1 410 ? 106.884 -43.378 346.451 1.00 16.87  ? 411  VAL B CG2 1 
ATOM   7247 N N   . ALA B 1 411 ? 109.383 -44.015 342.604 1.00 22.41  ? 412  ALA B N   1 
ATOM   7248 C CA  . ALA B 1 411 ? 110.547 -44.435 341.830 1.00 22.88  ? 412  ALA B CA  1 
ATOM   7249 C C   . ALA B 1 411 ? 111.173 -43.262 341.087 1.00 18.40  ? 412  ALA B C   1 
ATOM   7250 O O   . ALA B 1 411 ? 112.401 -43.190 340.951 1.00 22.78  ? 412  ALA B O   1 
ATOM   7251 C CB  . ALA B 1 411 ? 110.157 -45.543 340.851 1.00 22.33  ? 412  ALA B CB  1 
ATOM   7252 N N   . GLN B 1 412 ? 110.349 -42.338 340.593 1.00 18.69  ? 413  GLN B N   1 
ATOM   7253 C CA  . GLN B 1 412 ? 110.879 -41.160 339.914 1.00 19.58  ? 413  GLN B CA  1 
ATOM   7254 C C   . GLN B 1 412 ? 111.658 -40.278 340.880 1.00 23.83  ? 413  GLN B C   1 
ATOM   7255 O O   . GLN B 1 412 ? 112.752 -39.799 340.557 1.00 20.77  ? 413  GLN B O   1 
ATOM   7256 C CB  . GLN B 1 412 ? 109.743 -40.369 339.270 1.00 20.74  ? 413  GLN B CB  1 
ATOM   7257 C CG  . GLN B 1 412 ? 110.208 -39.148 338.503 1.00 30.19  ? 413  GLN B CG  1 
ATOM   7258 C CD  . GLN B 1 412 ? 109.133 -38.603 337.590 1.00 49.41  ? 413  GLN B CD  1 
ATOM   7259 O OE1 . GLN B 1 412 ? 108.028 -38.291 338.033 1.00 56.63  ? 413  GLN B OE1 1 
ATOM   7260 N NE2 . GLN B 1 412 ? 109.446 -38.499 336.305 1.00 55.76  ? 413  GLN B NE2 1 
ATOM   7261 N N   . LEU B 1 413 ? 111.112 -40.100 342.079 1.00 21.94  ? 414  LEU B N   1 
ATOM   7262 C CA  . LEU B 1 413 ? 111.768 -39.306 343.110 1.00 21.08  ? 414  LEU B CA  1 
ATOM   7263 C C   . LEU B 1 413 ? 113.100 -39.935 343.525 1.00 21.12  ? 414  LEU B C   1 
ATOM   7264 O O   . LEU B 1 413 ? 114.088 -39.229 343.728 1.00 23.00  ? 414  LEU B O   1 
ATOM   7265 C CB  . LEU B 1 413 ? 110.854 -39.151 344.328 1.00 17.53  ? 414  LEU B CB  1 
ATOM   7266 C CG  . LEU B 1 413 ? 111.354 -38.249 345.459 1.00 30.24  ? 414  LEU B CG  1 
ATOM   7267 C CD1 . LEU B 1 413 ? 110.260 -38.026 346.492 1.00 34.53  ? 414  LEU B CD1 1 
ATOM   7268 C CD2 . LEU B 1 413 ? 112.601 -38.828 346.109 1.00 45.52  ? 414  LEU B CD2 1 
ATOM   7269 N N   . ALA B 1 414 ? 113.125 -41.261 343.648 1.00 17.83  ? 415  ALA B N   1 
ATOM   7270 C CA  . ALA B 1 414 ? 114.343 -41.966 344.035 1.00 20.19  ? 415  ALA B CA  1 
ATOM   7271 C C   . ALA B 1 414 ? 115.408 -41.859 342.951 1.00 20.18  ? 415  ALA B C   1 
ATOM   7272 O O   . ALA B 1 414 ? 116.574 -41.563 343.236 1.00 24.60  ? 415  ALA B O   1 
ATOM   7273 C CB  . ALA B 1 414 ? 114.026 -43.431 344.338 1.00 16.26  ? 415  ALA B CB  1 
ATOM   7274 N N   . GLY B 1 415 ? 115.019 -42.084 341.695 1.00 22.96  ? 416  GLY B N   1 
ATOM   7275 C CA  . GLY B 1 415 ? 115.990 -42.052 340.615 1.00 18.33  ? 416  GLY B CA  1 
ATOM   7276 C C   . GLY B 1 415 ? 116.569 -40.671 340.379 1.00 23.02  ? 416  GLY B C   1 
ATOM   7277 O O   . GLY B 1 415 ? 117.776 -40.523 340.167 1.00 28.21  ? 416  GLY B O   1 
ATOM   7278 N N   . ARG B 1 416 ? 115.722 -39.640 340.414 1.00 22.73  ? 417  ARG B N   1 
ATOM   7279 C CA  . ARG B 1 416 ? 116.207 -38.287 340.164 1.00 22.80  ? 417  ARG B CA  1 
ATOM   7280 C C   . ARG B 1 416 ? 117.095 -37.795 341.299 1.00 26.26  ? 417  ARG B C   1 
ATOM   7281 O O   . ARG B 1 416 ? 118.148 -37.194 341.052 1.00 30.01  ? 417  ARG B O   1 
ATOM   7282 C CB  . ARG B 1 416 ? 115.031 -37.336 339.954 1.00 25.60  ? 417  ARG B CB  1 
ATOM   7283 C CG  . ARG B 1 416 ? 114.349 -37.480 338.604 1.00 34.19  ? 417  ARG B CG  1 
ATOM   7284 C CD  . ARG B 1 416 ? 115.372 -37.653 337.493 1.00 40.83  ? 417  ARG B CD  1 
ATOM   7285 N NE  . ARG B 1 416 ? 114.951 -37.010 336.253 1.00 56.78  ? 417  ARG B NE  1 
ATOM   7286 C CZ  . ARG B 1 416 ? 115.415 -35.842 335.822 1.00 60.80  ? 417  ARG B CZ  1 
ATOM   7287 N NH1 . ARG B 1 416 ? 116.319 -35.181 336.533 1.00 55.57  ? 417  ARG B NH1 1 
ATOM   7288 N NH2 . ARG B 1 416 ? 114.974 -35.333 334.680 1.00 65.21  ? 417  ARG B NH2 1 
ATOM   7289 N N   . LEU B 1 417 ? 116.689 -38.034 342.547 1.00 22.79  ? 418  LEU B N   1 
ATOM   7290 C CA  . LEU B 1 417 ? 117.517 -37.625 343.675 1.00 27.85  ? 418  LEU B CA  1 
ATOM   7291 C C   . LEU B 1 417 ? 118.870 -38.327 343.637 1.00 27.52  ? 418  LEU B C   1 
ATOM   7292 O O   . LEU B 1 417 ? 119.915 -37.697 343.838 1.00 30.95  ? 418  LEU B O   1 
ATOM   7293 C CB  . LEU B 1 417 ? 116.796 -37.905 344.997 1.00 25.11  ? 418  LEU B CB  1 
ATOM   7294 C CG  . LEU B 1 417 ? 115.506 -37.142 345.322 1.00 33.27  ? 418  LEU B CG  1 
ATOM   7295 C CD1 . LEU B 1 417 ? 115.019 -37.481 346.721 1.00 33.42  ? 418  LEU B CD1 1 
ATOM   7296 C CD2 . LEU B 1 417 ? 115.690 -35.651 345.182 1.00 37.48  ? 418  LEU B CD2 1 
ATOM   7297 N N   . ALA B 1 418 ? 118.868 -39.642 343.390 1.00 25.01  ? 419  ALA B N   1 
ATOM   7298 C CA  . ALA B 1 418 ? 120.117 -40.402 343.383 1.00 24.37  ? 419  ALA B CA  1 
ATOM   7299 C C   . ALA B 1 418 ? 121.049 -39.930 342.277 1.00 27.83  ? 419  ALA B C   1 
ATOM   7300 O O   . ALA B 1 418 ? 122.263 -39.813 342.485 1.00 34.00  ? 419  ALA B O   1 
ATOM   7301 C CB  . ALA B 1 418 ? 119.826 -41.896 343.240 1.00 19.10  ? 419  ALA B CB  1 
ATOM   7302 N N   . ALA B 1 419 ? 120.500 -39.650 341.096 1.00 26.31  ? 420  ALA B N   1 
ATOM   7303 C CA  . ALA B 1 419 ? 121.310 -39.174 339.984 1.00 32.87  ? 420  ALA B CA  1 
ATOM   7304 C C   . ALA B 1 419 ? 121.825 -37.760 340.194 1.00 38.30  ? 420  ALA B C   1 
ATOM   7305 O O   . ALA B 1 419 ? 122.718 -37.330 339.456 1.00 43.13  ? 420  ALA B O   1 
ATOM   7306 C CB  . ALA B 1 419 ? 120.507 -39.242 338.684 1.00 24.76  ? 420  ALA B CB  1 
ATOM   7307 N N   . GLN B 1 420 ? 121.298 -37.033 341.176 1.00 38.83  ? 421  GLN B N   1 
ATOM   7308 C CA  . GLN B 1 420 ? 121.654 -35.637 341.379 1.00 32.84  ? 421  GLN B CA  1 
ATOM   7309 C C   . GLN B 1 420 ? 122.255 -35.396 342.760 1.00 31.10  ? 421  GLN B C   1 
ATOM   7310 O O   . GLN B 1 420 ? 122.151 -34.297 343.308 1.00 31.27  ? 421  GLN B O   1 
ATOM   7311 C CB  . GLN B 1 420 ? 120.442 -34.743 341.132 1.00 30.84  ? 421  GLN B CB  1 
ATOM   7312 C CG  . GLN B 1 420 ? 120.019 -34.751 339.669 1.00 42.10  ? 421  GLN B CG  1 
ATOM   7313 C CD  . GLN B 1 420 ? 118.566 -34.387 339.464 1.00 44.61  ? 421  GLN B CD  1 
ATOM   7314 O OE1 . GLN B 1 420 ? 117.892 -34.946 338.599 1.00 45.35  ? 421  GLN B OE1 1 
ATOM   7315 N NE2 . GLN B 1 420 ? 118.075 -33.439 340.253 1.00 43.38  ? 421  GLN B NE2 1 
ATOM   7316 N N   . GLY B 1 421 ? 122.887 -36.420 343.334 1.00 27.12  ? 422  GLY B N   1 
ATOM   7317 C CA  . GLY B 1 421 ? 123.820 -36.230 344.426 1.00 29.53  ? 422  GLY B CA  1 
ATOM   7318 C C   . GLY B 1 421 ? 123.410 -36.784 345.772 1.00 28.85  ? 422  GLY B C   1 
ATOM   7319 O O   . GLY B 1 421 ? 124.249 -36.810 346.681 1.00 33.26  ? 422  GLY B O   1 
ATOM   7320 N N   . ALA B 1 422 ? 122.173 -37.219 345.954 1.00 24.83  ? 423  ALA B N   1 
ATOM   7321 C CA  . ALA B 1 422 ? 121.770 -37.704 347.264 1.00 31.75  ? 423  ALA B CA  1 
ATOM   7322 C C   . ALA B 1 422 ? 121.900 -39.224 347.331 1.00 25.78  ? 423  ALA B C   1 
ATOM   7323 O O   . ALA B 1 422 ? 121.917 -39.916 346.310 1.00 24.88  ? 423  ALA B O   1 
ATOM   7324 C CB  . ALA B 1 422 ? 120.343 -37.254 347.593 1.00 33.73  ? 423  ALA B CB  1 
ATOM   7325 N N   . ARG B 1 423 ? 122.019 -39.737 348.553 1.00 25.64  ? 424  ARG B N   1 
ATOM   7326 C CA  . ARG B 1 423 ? 122.100 -41.174 348.787 1.00 28.08  ? 424  ARG B CA  1 
ATOM   7327 C C   . ARG B 1 423 ? 120.714 -41.691 349.158 1.00 23.89  ? 424  ARG B C   1 
ATOM   7328 O O   . ARG B 1 423 ? 120.146 -41.280 350.175 1.00 24.48  ? 424  ARG B O   1 
ATOM   7329 C CB  . ARG B 1 423 ? 123.115 -41.505 349.883 1.00 25.48  ? 424  ARG B CB  1 
ATOM   7330 C CG  . ARG B 1 423 ? 123.725 -42.891 349.719 1.00 37.88  ? 424  ARG B CG  1 
ATOM   7331 C CD  . ARG B 1 423 ? 124.498 -43.356 350.942 1.00 48.67  ? 424  ARG B CD  1 
ATOM   7332 N NE  . ARG B 1 423 ? 125.378 -42.329 351.486 1.00 60.95  ? 424  ARG B NE  1 
ATOM   7333 C CZ  . ARG B 1 423 ? 125.485 -42.050 352.780 1.00 55.37  ? 424  ARG B CZ  1 
ATOM   7334 N NH1 . ARG B 1 423 ? 124.766 -42.718 353.670 1.00 45.98  ? 424  ARG B NH1 1 
ATOM   7335 N NH2 . ARG B 1 423 ? 126.316 -41.104 353.184 1.00 61.26  ? 424  ARG B NH2 1 
ATOM   7336 N N   . VAL B 1 424 ? 120.175 -42.587 348.330 1.00 26.58  ? 425  VAL B N   1 
ATOM   7337 C CA  . VAL B 1 424 ? 118.832 -43.133 348.503 1.00 23.39  ? 425  VAL B CA  1 
ATOM   7338 C C   . VAL B 1 424 ? 118.931 -44.578 348.959 1.00 22.84  ? 425  VAL B C   1 
ATOM   7339 O O   . VAL B 1 424 ? 119.743 -45.351 348.440 1.00 26.79  ? 425  VAL B O   1 
ATOM   7340 C CB  . VAL B 1 424 ? 117.999 -43.065 347.207 1.00 23.85  ? 425  VAL B CB  1 
ATOM   7341 C CG1 . VAL B 1 424 ? 116.621 -43.666 347.425 1.00 22.74  ? 425  VAL B CG1 1 
ATOM   7342 C CG2 . VAL B 1 424 ? 117.831 -41.672 346.766 1.00 24.72  ? 425  VAL B CG2 1 
ATOM   7343 N N   . TYR B 1 425 ? 118.081 -44.945 349.911 1.00 20.45  ? 426  TYR B N   1 
ATOM   7344 C CA  . TYR B 1 425 ? 117.811 -46.336 350.240 1.00 22.85  ? 426  TYR B CA  1 
ATOM   7345 C C   . TYR B 1 425 ? 116.337 -46.605 349.982 1.00 24.53  ? 426  TYR B C   1 
ATOM   7346 O O   . TYR B 1 425 ? 115.475 -45.841 350.429 1.00 26.54  ? 426  TYR B O   1 
ATOM   7347 C CB  . TYR B 1 425 ? 118.180 -46.642 351.690 1.00 20.96  ? 426  TYR B CB  1 
ATOM   7348 C CG  . TYR B 1 425 ? 119.640 -46.401 351.988 1.00 19.90  ? 426  TYR B CG  1 
ATOM   7349 C CD1 . TYR B 1 425 ? 120.570 -47.423 351.862 1.00 21.95  ? 426  TYR B CD1 1 
ATOM   7350 C CD2 . TYR B 1 425 ? 120.090 -45.148 352.385 1.00 21.09  ? 426  TYR B CD2 1 
ATOM   7351 C CE1 . TYR B 1 425 ? 121.907 -47.207 352.129 1.00 19.92  ? 426  TYR B CE1 1 
ATOM   7352 C CE2 . TYR B 1 425 ? 121.425 -44.922 352.654 1.00 17.83  ? 426  TYR B CE2 1 
ATOM   7353 C CZ  . TYR B 1 425 ? 122.329 -45.956 352.524 1.00 23.30  ? 426  TYR B CZ  1 
ATOM   7354 O OH  . TYR B 1 425 ? 123.660 -45.739 352.792 1.00 26.87  ? 426  TYR B OH  1 
ATOM   7355 N N   . ALA B 1 426 ? 116.051 -47.676 349.246 1.00 18.02  ? 427  ALA B N   1 
ATOM   7356 C CA  . ALA B 1 426 ? 114.695 -48.009 348.842 1.00 20.46  ? 427  ALA B CA  1 
ATOM   7357 C C   . ALA B 1 426 ? 114.314 -49.388 349.364 1.00 24.78  ? 427  ALA B C   1 
ATOM   7358 O O   . ALA B 1 426 ? 115.152 -50.289 349.458 1.00 21.05  ? 427  ALA B O   1 
ATOM   7359 C CB  . ALA B 1 426 ? 114.543 -47.966 347.317 1.00 16.03  ? 427  ALA B CB  1 
ATOM   7360 N N   . TYR B 1 427 ? 113.035 -49.544 349.700 1.00 17.94  ? 428  TYR B N   1 
ATOM   7361 C CA  . TYR B 1 427 ? 112.526 -50.798 350.234 1.00 17.98  ? 428  TYR B CA  1 
ATOM   7362 C C   . TYR B 1 427 ? 111.161 -51.096 349.632 1.00 21.64  ? 428  TYR B C   1 
ATOM   7363 O O   . TYR B 1 427 ? 110.473 -50.208 349.123 1.00 21.51  ? 428  TYR B O   1 
ATOM   7364 C CB  . TYR B 1 427 ? 112.415 -50.763 351.770 1.00 18.21  ? 428  TYR B CB  1 
ATOM   7365 C CG  . TYR B 1 427 ? 111.362 -49.804 352.298 1.00 19.75  ? 428  TYR B CG  1 
ATOM   7366 C CD1 . TYR B 1 427 ? 110.025 -50.182 352.387 1.00 14.83  ? 428  TYR B CD1 1 
ATOM   7367 C CD2 . TYR B 1 427 ? 111.708 -48.526 352.717 1.00 15.73  ? 428  TYR B CD2 1 
ATOM   7368 C CE1 . TYR B 1 427 ? 109.065 -49.312 352.861 1.00 17.62  ? 428  TYR B CE1 1 
ATOM   7369 C CE2 . TYR B 1 427 ? 110.752 -47.648 353.200 1.00 16.47  ? 428  TYR B CE2 1 
ATOM   7370 C CZ  . TYR B 1 427 ? 109.433 -48.048 353.268 1.00 20.10  ? 428  TYR B CZ  1 
ATOM   7371 O OH  . TYR B 1 427 ? 108.477 -47.183 353.741 1.00 22.44  ? 428  TYR B OH  1 
ATOM   7372 N N   . VAL B 1 428 ? 110.772 -52.365 349.709 1.00 24.48  ? 429  VAL B N   1 
ATOM   7373 C CA  . VAL B 1 428 ? 109.394 -52.785 349.491 1.00 22.65  ? 429  VAL B CA  1 
ATOM   7374 C C   . VAL B 1 428 ? 108.986 -53.626 350.691 1.00 23.76  ? 429  VAL B C   1 
ATOM   7375 O O   . VAL B 1 428 ? 109.653 -54.616 351.014 1.00 22.30  ? 429  VAL B O   1 
ATOM   7376 C CB  . VAL B 1 428 ? 109.210 -53.572 348.184 1.00 25.53  ? 429  VAL B CB  1 
ATOM   7377 C CG1 . VAL B 1 428 ? 107.769 -54.042 348.055 1.00 23.49  ? 429  VAL B CG1 1 
ATOM   7378 C CG2 . VAL B 1 428 ? 109.581 -52.705 346.995 1.00 28.61  ? 429  VAL B CG2 1 
ATOM   7379 N N   . PHE B 1 429 ? 107.910 -53.222 351.358 1.00 21.66  ? 430  PHE B N   1 
ATOM   7380 C CA  . PHE B 1 429 ? 107.423 -53.908 352.547 1.00 20.76  ? 430  PHE B CA  1 
ATOM   7381 C C   . PHE B 1 429 ? 106.490 -55.033 352.116 1.00 23.87  ? 430  PHE B C   1 
ATOM   7382 O O   . PHE B 1 429 ? 105.440 -54.778 351.515 1.00 24.57  ? 430  PHE B O   1 
ATOM   7383 C CB  . PHE B 1 429 ? 106.711 -52.921 353.470 1.00 21.57  ? 430  PHE B CB  1 
ATOM   7384 C CG  . PHE B 1 429 ? 106.278 -53.516 354.775 1.00 26.40  ? 430  PHE B CG  1 
ATOM   7385 C CD1 . PHE B 1 429 ? 107.153 -53.578 355.846 1.00 27.88  ? 430  PHE B CD1 1 
ATOM   7386 C CD2 . PHE B 1 429 ? 104.991 -53.999 354.936 1.00 21.34  ? 430  PHE B CD2 1 
ATOM   7387 C CE1 . PHE B 1 429 ? 106.755 -54.121 357.052 1.00 28.17  ? 430  PHE B CE1 1 
ATOM   7388 C CE2 . PHE B 1 429 ? 104.587 -54.542 356.139 1.00 28.19  ? 430  PHE B CE2 1 
ATOM   7389 C CZ  . PHE B 1 429 ? 105.470 -54.604 357.199 1.00 22.93  ? 430  PHE B CZ  1 
ATOM   7390 N N   . GLU B 1 430 ? 106.866 -56.275 352.428 1.00 22.56  ? 431  GLU B N   1 
ATOM   7391 C CA  . GLU B 1 430 ? 106.200 -57.439 351.852 1.00 28.03  ? 431  GLU B CA  1 
ATOM   7392 C C   . GLU B 1 430 ? 105.635 -58.399 352.891 1.00 28.90  ? 431  GLU B C   1 
ATOM   7393 O O   . GLU B 1 430 ? 105.301 -59.537 352.544 1.00 34.71  ? 431  GLU B O   1 
ATOM   7394 C CB  . GLU B 1 430 ? 107.158 -58.197 350.932 1.00 25.59  ? 431  GLU B CB  1 
ATOM   7395 C CG  . GLU B 1 430 ? 107.692 -57.384 349.775 1.00 35.24  ? 431  GLU B CG  1 
ATOM   7396 C CD  . GLU B 1 430 ? 108.213 -58.260 348.657 1.00 46.66  ? 431  GLU B CD  1 
ATOM   7397 O OE1 . GLU B 1 430 ? 107.675 -58.172 347.534 1.00 56.00  ? 431  GLU B OE1 1 
ATOM   7398 O OE2 . GLU B 1 430 ? 109.156 -59.041 348.903 1.00 51.95  ? 431  GLU B OE2 1 
ATOM   7399 N N   . HIS B 1 431 ? 105.512 -57.997 354.152 1.00 30.53  ? 432  HIS B N   1 
ATOM   7400 C CA  . HIS B 1 431 ? 104.929 -58.880 355.152 1.00 27.63  ? 432  HIS B CA  1 
ATOM   7401 C C   . HIS B 1 431 ? 103.499 -58.469 355.459 1.00 27.41  ? 432  HIS B C   1 
ATOM   7402 O O   . HIS B 1 431 ? 103.236 -57.310 355.807 1.00 30.51  ? 432  HIS B O   1 
ATOM   7403 C CB  . HIS B 1 431 ? 105.727 -58.920 356.453 1.00 25.83  ? 432  HIS B CB  1 
ATOM   7404 C CG  . HIS B 1 431 ? 104.950 -59.516 357.586 1.00 37.70  ? 432  HIS B CG  1 
ATOM   7405 N ND1 . HIS B 1 431 ? 104.863 -60.877 357.789 1.00 38.13  ? 432  HIS B ND1 1 
ATOM   7406 C CD2 . HIS B 1 431 ? 104.191 -58.943 358.550 1.00 35.60  ? 432  HIS B CD2 1 
ATOM   7407 C CE1 . HIS B 1 431 ? 104.092 -61.116 358.834 1.00 40.14  ? 432  HIS B CE1 1 
ATOM   7408 N NE2 . HIS B 1 431 ? 103.673 -59.960 359.316 1.00 37.93  ? 432  HIS B NE2 1 
ATOM   7409 N N   . ARG B 1 432 ? 102.583 -59.425 355.352 1.00 28.31  ? 433  ARG B N   1 
ATOM   7410 C CA  . ARG B 1 432 ? 101.193 -59.231 355.731 1.00 31.23  ? 433  ARG B CA  1 
ATOM   7411 C C   . ARG B 1 432 ? 101.030 -59.604 357.200 1.00 32.20  ? 433  ARG B C   1 
ATOM   7412 O O   . ARG B 1 432 ? 101.294 -60.749 357.585 1.00 36.08  ? 433  ARG B O   1 
ATOM   7413 C CB  . ARG B 1 432 ? 100.284 -60.076 354.843 1.00 36.91  ? 433  ARG B CB  1 
ATOM   7414 C CG  . ARG B 1 432 ? 98.812  -59.892 355.115 1.00 42.85  ? 433  ARG B CG  1 
ATOM   7415 C CD  . ARG B 1 432 ? 97.979  -60.857 354.300 1.00 39.14  ? 433  ARG B CD  1 
ATOM   7416 N NE  . ARG B 1 432 ? 96.628  -60.953 354.837 1.00 44.48  ? 433  ARG B NE  1 
ATOM   7417 C CZ  . ARG B 1 432 ? 95.582  -60.300 354.344 1.00 44.79  ? 433  ARG B CZ  1 
ATOM   7418 N NH1 . ARG B 1 432 ? 95.727  -59.504 353.293 1.00 36.87  ? 433  ARG B NH1 1 
ATOM   7419 N NH2 . ARG B 1 432 ? 94.389  -60.443 354.904 1.00 47.16  ? 433  ARG B NH2 1 
ATOM   7420 N N   . ALA B 1 433 ? 100.610 -58.639 358.017 1.00 27.98  ? 434  ALA B N   1 
ATOM   7421 C CA  . ALA B 1 433 ? 100.490 -58.872 359.449 1.00 35.54  ? 434  ALA B CA  1 
ATOM   7422 C C   . ALA B 1 433 ? 99.479  -59.975 359.737 1.00 37.22  ? 434  ALA B C   1 
ATOM   7423 O O   . ALA B 1 433 ? 98.430  -60.064 359.093 1.00 37.09  ? 434  ALA B O   1 
ATOM   7424 C CB  . ALA B 1 433 ? 100.079 -57.584 360.166 1.00 28.69  ? 434  ALA B CB  1 
ATOM   7425 N N   . SER B 1 434 ? 99.806  -60.826 360.714 1.00 36.07  ? 435  SER B N   1 
ATOM   7426 C CA  . SER B 1 434 ? 98.881  -61.873 361.130 1.00 36.07  ? 435  SER B CA  1 
ATOM   7427 C C   . SER B 1 434 ? 97.578  -61.301 361.668 1.00 38.74  ? 435  SER B C   1 
ATOM   7428 O O   . SER B 1 434 ? 96.556  -61.996 361.662 1.00 38.89  ? 435  SER B O   1 
ATOM   7429 C CB  . SER B 1 434 ? 99.534  -62.761 362.191 1.00 41.00  ? 435  SER B CB  1 
ATOM   7430 O OG  . SER B 1 434 ? 99.825  -62.017 363.361 1.00 46.63  ? 435  SER B OG  1 
ATOM   7431 N N   . THR B 1 435 ? 97.592  -60.052 362.125 1.00 41.02  ? 436  THR B N   1 
ATOM   7432 C CA  . THR B 1 435 ? 96.425  -59.397 362.695 1.00 42.27  ? 436  THR B CA  1 
ATOM   7433 C C   . THR B 1 435 ? 95.598  -58.643 361.661 1.00 36.85  ? 436  THR B C   1 
ATOM   7434 O O   . THR B 1 435 ? 94.577  -58.049 362.024 1.00 42.20  ? 436  THR B O   1 
ATOM   7435 C CB  . THR B 1 435 ? 96.860  -58.427 363.798 1.00 40.91  ? 436  THR B CB  1 
ATOM   7436 O OG1 . THR B 1 435 ? 97.709  -57.417 363.236 1.00 39.90  ? 436  THR B OG1 1 
ATOM   7437 C CG2 . THR B 1 435 ? 97.624  -59.168 364.883 1.00 38.58  ? 436  THR B CG2 1 
ATOM   7438 N N   . LEU B 1 436 ? 96.008  -58.653 360.394 1.00 31.50  ? 437  LEU B N   1 
ATOM   7439 C CA  . LEU B 1 436 ? 95.343  -57.847 359.378 1.00 31.19  ? 437  LEU B CA  1 
ATOM   7440 C C   . LEU B 1 436 ? 93.901  -58.299 359.180 1.00 39.07  ? 437  LEU B C   1 
ATOM   7441 O O   . LEU B 1 436 ? 93.624  -59.491 359.017 1.00 37.41  ? 437  LEU B O   1 
ATOM   7442 C CB  . LEU B 1 436 ? 96.113  -57.931 358.060 1.00 35.00  ? 437  LEU B CB  1 
ATOM   7443 C CG  . LEU B 1 436 ? 95.692  -56.946 356.969 1.00 44.17  ? 437  LEU B CG  1 
ATOM   7444 C CD1 . LEU B 1 436 ? 95.947  -55.518 357.416 1.00 38.62  ? 437  LEU B CD1 1 
ATOM   7445 C CD2 . LEU B 1 436 ? 96.432  -57.237 355.679 1.00 46.98  ? 437  LEU B CD2 1 
ATOM   7446 N N   . SER B 1 437 ? 92.980  -57.333 359.191 1.00 37.47  ? 438  SER B N   1 
ATOM   7447 C CA  . SER B 1 437 ? 91.557  -57.623 359.076 1.00 40.02  ? 438  SER B CA  1 
ATOM   7448 C C   . SER B 1 437 ? 91.032  -57.517 357.651 1.00 38.52  ? 438  SER B C   1 
ATOM   7449 O O   . SER B 1 437 ? 89.927  -58.000 357.378 1.00 43.19  ? 438  SER B O   1 
ATOM   7450 C CB  . SER B 1 437 ? 90.753  -56.683 359.980 1.00 47.41  ? 438  SER B CB  1 
ATOM   7451 O OG  . SER B 1 437 ? 91.095  -55.328 359.741 1.00 52.18  ? 438  SER B OG  1 
ATOM   7452 N N   . TRP B 1 438 ? 91.783  -56.896 356.744 1.00 39.27  ? 439  TRP B N   1 
ATOM   7453 C CA  . TRP B 1 438 ? 91.374  -56.827 355.352 1.00 37.85  ? 439  TRP B CA  1 
ATOM   7454 C C   . TRP B 1 438 ? 91.461  -58.211 354.710 1.00 37.26  ? 439  TRP B C   1 
ATOM   7455 O O   . TRP B 1 438 ? 92.224  -59.067 355.162 1.00 39.11  ? 439  TRP B O   1 
ATOM   7456 C CB  . TRP B 1 438 ? 92.249  -55.834 354.589 1.00 33.87  ? 439  TRP B CB  1 
ATOM   7457 C CG  . TRP B 1 438 ? 92.065  -54.411 355.014 1.00 31.79  ? 439  TRP B CG  1 
ATOM   7458 C CD1 . TRP B 1 438 ? 92.880  -53.691 355.837 1.00 35.64  ? 439  TRP B CD1 1 
ATOM   7459 C CD2 . TRP B 1 438 ? 90.999  -53.529 354.634 1.00 31.56  ? 439  TRP B CD2 1 
ATOM   7460 N NE1 . TRP B 1 438 ? 92.389  -52.418 355.996 1.00 30.29  ? 439  TRP B NE1 1 
ATOM   7461 C CE2 . TRP B 1 438 ? 91.235  -52.293 355.267 1.00 34.52  ? 439  TRP B CE2 1 
ATOM   7462 C CE3 . TRP B 1 438 ? 89.868  -53.666 353.823 1.00 30.93  ? 439  TRP B CE3 1 
ATOM   7463 C CZ2 . TRP B 1 438 ? 90.384  -51.200 355.114 1.00 32.69  ? 439  TRP B CZ2 1 
ATOM   7464 C CZ3 . TRP B 1 438 ? 89.023  -52.579 353.671 1.00 32.20  ? 439  TRP B CZ3 1 
ATOM   7465 C CH2 . TRP B 1 438 ? 89.286  -51.363 354.314 1.00 36.29  ? 439  TRP B CH2 1 
ATOM   7466 N N   . PRO B 1 439 ? 90.683  -58.456 353.654 1.00 38.09  ? 440  PRO B N   1 
ATOM   7467 C CA  . PRO B 1 439 ? 90.717  -59.771 353.006 1.00 35.02  ? 440  PRO B CA  1 
ATOM   7468 C C   . PRO B 1 439 ? 92.090  -60.076 352.427 1.00 40.23  ? 440  PRO B C   1 
ATOM   7469 O O   . PRO B 1 439 ? 92.904  -59.184 352.172 1.00 41.25  ? 440  PRO B O   1 
ATOM   7470 C CB  . PRO B 1 439 ? 89.660  -59.653 351.902 1.00 37.77  ? 440  PRO B CB  1 
ATOM   7471 C CG  . PRO B 1 439 ? 89.558  -58.187 351.642 1.00 35.76  ? 440  PRO B CG  1 
ATOM   7472 C CD  . PRO B 1 439 ? 89.729  -57.551 352.989 1.00 37.78  ? 440  PRO B CD  1 
ATOM   7473 N N   . LEU B 1 440 ? 92.339  -61.370 352.214 1.00 41.55  ? 441  LEU B N   1 
ATOM   7474 C CA  . LEU B 1 440 ? 93.662  -61.805 351.779 1.00 43.62  ? 441  LEU B CA  1 
ATOM   7475 C C   . LEU B 1 440 ? 93.985  -61.331 350.367 1.00 40.35  ? 441  LEU B C   1 
ATOM   7476 O O   . LEU B 1 440 ? 95.162  -61.146 350.037 1.00 40.03  ? 441  LEU B O   1 
ATOM   7477 C CB  . LEU B 1 440 ? 93.770  -63.328 351.871 1.00 53.84  ? 441  LEU B CB  1 
ATOM   7478 C CG  . LEU B 1 440 ? 95.169  -63.934 351.728 1.00 66.09  ? 441  LEU B CG  1 
ATOM   7479 C CD1 . LEU B 1 440 ? 96.009  -63.663 352.968 1.00 69.89  ? 441  LEU B CD1 1 
ATOM   7480 C CD2 . LEU B 1 440 ? 95.077  -65.428 351.467 1.00 70.19  ? 441  LEU B CD2 1 
ATOM   7481 N N   . TRP B 1 441 ? 92.969  -61.116 349.524 1.00 37.46  ? 442  TRP B N   1 
ATOM   7482 C CA  . TRP B 1 441 ? 93.244  -60.699 348.152 1.00 39.70  ? 442  TRP B CA  1 
ATOM   7483 C C   . TRP B 1 441 ? 93.858  -59.306 348.081 1.00 34.06  ? 442  TRP B C   1 
ATOM   7484 O O   . TRP B 1 441 ? 94.423  -58.947 347.042 1.00 34.10  ? 442  TRP B O   1 
ATOM   7485 C CB  . TRP B 1 441 ? 91.972  -60.767 347.293 1.00 41.30  ? 442  TRP B CB  1 
ATOM   7486 C CG  . TRP B 1 441 ? 90.911  -59.732 347.586 1.00 39.00  ? 442  TRP B CG  1 
ATOM   7487 C CD1 . TRP B 1 441 ? 89.775  -59.911 348.322 1.00 40.72  ? 442  TRP B CD1 1 
ATOM   7488 C CD2 . TRP B 1 441 ? 90.873  -58.374 347.118 1.00 34.41  ? 442  TRP B CD2 1 
ATOM   7489 N NE1 . TRP B 1 441 ? 89.042  -58.749 348.355 1.00 37.63  ? 442  TRP B NE1 1 
ATOM   7490 C CE2 . TRP B 1 441 ? 89.694  -57.791 347.625 1.00 37.12  ? 442  TRP B CE2 1 
ATOM   7491 C CE3 . TRP B 1 441 ? 91.725  -57.593 346.329 1.00 34.79  ? 442  TRP B CE3 1 
ATOM   7492 C CZ2 . TRP B 1 441 ? 89.346  -56.465 347.370 1.00 37.79  ? 442  TRP B CZ2 1 
ATOM   7493 C CZ3 . TRP B 1 441 ? 91.378  -56.277 346.078 1.00 32.68  ? 442  TRP B CZ3 1 
ATOM   7494 C CH2 . TRP B 1 441 ? 90.199  -55.727 346.596 1.00 40.11  ? 442  TRP B CH2 1 
ATOM   7495 N N   . MET B 1 442 ? 93.773  -58.520 349.155 1.00 33.05  ? 443  MET B N   1 
ATOM   7496 C CA  . MET B 1 442 ? 94.412  -57.211 349.183 1.00 31.66  ? 443  MET B CA  1 
ATOM   7497 C C   . MET B 1 442 ? 95.908  -57.285 349.460 1.00 29.16  ? 443  MET B C   1 
ATOM   7498 O O   . MET B 1 442 ? 96.595  -56.268 349.315 1.00 31.24  ? 443  MET B O   1 
ATOM   7499 C CB  . MET B 1 442 ? 93.742  -56.318 350.230 1.00 30.77  ? 443  MET B CB  1 
ATOM   7500 C CG  . MET B 1 442 ? 92.334  -55.878 349.869 1.00 38.65  ? 443  MET B CG  1 
ATOM   7501 S SD  . MET B 1 442 ? 91.749  -54.569 350.959 1.00 44.46  ? 443  MET B SD  1 
ATOM   7502 C CE  . MET B 1 442 ? 90.114  -54.281 350.299 1.00 43.87  ? 443  MET B CE  1 
ATOM   7503 N N   . GLY B 1 443 ? 96.422  -58.446 349.857 1.00 33.14  ? 444  GLY B N   1 
ATOM   7504 C CA  . GLY B 1 443 ? 97.858  -58.589 350.061 1.00 34.59  ? 444  GLY B CA  1 
ATOM   7505 C C   . GLY B 1 443 ? 98.344  -57.744 351.223 1.00 34.87  ? 444  GLY B C   1 
ATOM   7506 O O   . GLY B 1 443 ? 97.767  -57.757 352.316 1.00 35.14  ? 444  GLY B O   1 
ATOM   7507 N N   . VAL B 1 444 ? 99.431  -57.011 350.990 1.00 29.01  ? 445  VAL B N   1 
ATOM   7508 C CA  . VAL B 1 444 ? 99.968  -56.053 351.953 1.00 27.48  ? 445  VAL B CA  1 
ATOM   7509 C C   . VAL B 1 444 ? 99.456  -54.670 351.568 1.00 24.25  ? 445  VAL B C   1 
ATOM   7510 O O   . VAL B 1 444 ? 100.057 -54.008 350.710 1.00 23.80  ? 445  VAL B O   1 
ATOM   7511 C CB  . VAL B 1 444 ? 101.505 -56.085 351.984 1.00 29.73  ? 445  VAL B CB  1 
ATOM   7512 C CG1 . VAL B 1 444 ? 102.034 -55.220 353.119 1.00 31.48  ? 445  VAL B CG1 1 
ATOM   7513 C CG2 . VAL B 1 444 ? 102.007 -57.515 352.112 1.00 32.60  ? 445  VAL B CG2 1 
ATOM   7514 N N   . PRO B 1 445 ? 98.368  -54.195 352.162 1.00 26.51  ? 446  PRO B N   1 
ATOM   7515 C CA  . PRO B 1 445 ? 97.738  -52.964 351.682 1.00 27.83  ? 446  PRO B CA  1 
ATOM   7516 C C   . PRO B 1 445 ? 98.478  -51.719 352.152 1.00 31.55  ? 446  PRO B C   1 
ATOM   7517 O O   . PRO B 1 445 ? 99.350  -51.756 353.023 1.00 24.41  ? 446  PRO B O   1 
ATOM   7518 C CB  . PRO B 1 445 ? 96.324  -53.022 352.281 1.00 21.21  ? 446  PRO B CB  1 
ATOM   7519 C CG  . PRO B 1 445 ? 96.217  -54.373 352.963 1.00 23.25  ? 446  PRO B CG  1 
ATOM   7520 C CD  . PRO B 1 445 ? 97.617  -54.783 353.278 1.00 25.32  ? 446  PRO B CD  1 
ATOM   7521 N N   . HIS B 1 446 ? 98.094  -50.601 351.543 1.00 28.64  ? 447  HIS B N   1 
ATOM   7522 C CA  . HIS B 1 446 ? 98.671  -49.302 351.856 1.00 23.43  ? 447  HIS B CA  1 
ATOM   7523 C C   . HIS B 1 446 ? 98.534  -48.984 353.340 1.00 24.82  ? 447  HIS B C   1 
ATOM   7524 O O   . HIS B 1 446 ? 97.455  -49.128 353.923 1.00 23.93  ? 447  HIS B O   1 
ATOM   7525 C CB  . HIS B 1 446 ? 97.975  -48.235 351.011 1.00 28.65  ? 447  HIS B CB  1 
ATOM   7526 C CG  . HIS B 1 446 ? 98.386  -46.833 351.328 1.00 36.60  ? 447  HIS B CG  1 
ATOM   7527 N ND1 . HIS B 1 446 ? 99.436  -46.205 350.694 1.00 34.67  ? 447  HIS B ND1 1 
ATOM   7528 C CD2 . HIS B 1 446 ? 97.876  -45.929 352.197 1.00 34.43  ? 447  HIS B CD2 1 
ATOM   7529 C CE1 . HIS B 1 446 ? 99.558  -44.976 351.162 1.00 35.00  ? 447  HIS B CE1 1 
ATOM   7530 N NE2 . HIS B 1 446 ? 98.626  -44.785 352.078 1.00 38.14  ? 447  HIS B NE2 1 
ATOM   7531 N N   . GLY B 1 447 ? 99.642  -48.567 353.956 1.00 21.04  ? 448  GLY B N   1 
ATOM   7532 C CA  . GLY B 1 447 ? 99.635  -48.079 355.317 1.00 19.25  ? 448  GLY B CA  1 
ATOM   7533 C C   . GLY B 1 447 ? 99.941  -49.100 356.392 1.00 26.00  ? 448  GLY B C   1 
ATOM   7534 O O   . GLY B 1 447 ? 100.082 -48.718 357.561 1.00 25.91  ? 448  GLY B O   1 
ATOM   7535 N N   . TYR B 1 448 ? 100.062 -50.382 356.050 1.00 20.62  ? 449  TYR B N   1 
ATOM   7536 C CA  . TYR B 1 448 ? 100.185 -51.417 357.066 1.00 26.38  ? 449  TYR B CA  1 
ATOM   7537 C C   . TYR B 1 448 ? 101.629 -51.814 357.334 1.00 23.05  ? 449  TYR B C   1 
ATOM   7538 O O   . TYR B 1 448 ? 101.880 -52.858 357.947 1.00 30.78  ? 449  TYR B O   1 
ATOM   7539 C CB  . TYR B 1 448 ? 99.315  -52.613 356.686 1.00 18.20  ? 449  TYR B CB  1 
ATOM   7540 C CG  . TYR B 1 448 ? 97.883  -52.255 356.963 1.00 24.49  ? 449  TYR B CG  1 
ATOM   7541 C CD1 . TYR B 1 448 ? 97.357  -52.385 358.239 1.00 23.75  ? 449  TYR B CD1 1 
ATOM   7542 C CD2 . TYR B 1 448 ? 97.085  -51.691 355.977 1.00 18.75  ? 449  TYR B CD2 1 
ATOM   7543 C CE1 . TYR B 1 448 ? 96.060  -52.021 358.515 1.00 23.48  ? 449  TYR B CE1 1 
ATOM   7544 C CE2 . TYR B 1 448 ? 95.783  -51.321 356.243 1.00 21.67  ? 449  TYR B CE2 1 
ATOM   7545 C CZ  . TYR B 1 448 ? 95.276  -51.489 357.514 1.00 23.84  ? 449  TYR B CZ  1 
ATOM   7546 O OH  . TYR B 1 448 ? 93.981  -51.122 357.791 1.00 30.51  ? 449  TYR B OH  1 
ATOM   7547 N N   . GLU B 1 449 ? 102.579 -50.984 356.913 1.00 19.90  ? 450  GLU B N   1 
ATOM   7548 C CA  . GLU B 1 449 ? 103.937 -51.056 357.426 1.00 23.12  ? 450  GLU B CA  1 
ATOM   7549 C C   . GLU B 1 449 ? 104.151 -50.146 358.628 1.00 24.43  ? 450  GLU B C   1 
ATOM   7550 O O   . GLU B 1 449 ? 105.108 -50.355 359.382 1.00 22.38  ? 450  GLU B O   1 
ATOM   7551 C CB  . GLU B 1 449 ? 104.940 -50.689 356.325 1.00 23.67  ? 450  GLU B CB  1 
ATOM   7552 C CG  . GLU B 1 449 ? 105.294 -49.203 356.247 1.00 32.23  ? 450  GLU B CG  1 
ATOM   7553 C CD  . GLU B 1 449 ? 104.212 -48.350 355.597 1.00 38.50  ? 450  GLU B CD  1 
ATOM   7554 O OE1 . GLU B 1 449 ? 103.052 -48.804 355.496 1.00 35.44  ? 450  GLU B OE1 1 
ATOM   7555 O OE2 . GLU B 1 449 ? 104.529 -47.215 355.182 1.00 39.29  ? 450  GLU B OE2 1 
ATOM   7556 N N   . ILE B 1 450 ? 103.266 -49.162 358.831 1.00 18.92  ? 451  ILE B N   1 
ATOM   7557 C CA  . ILE B 1 450 ? 103.475 -48.149 359.865 1.00 21.86  ? 451  ILE B CA  1 
ATOM   7558 C C   . ILE B 1 450 ? 103.542 -48.791 361.245 1.00 21.77  ? 451  ILE B C   1 
ATOM   7559 O O   . ILE B 1 450 ? 104.413 -48.462 362.060 1.00 22.11  ? 451  ILE B O   1 
ATOM   7560 C CB  . ILE B 1 450 ? 102.366 -47.082 359.807 1.00 21.79  ? 451  ILE B CB  1 
ATOM   7561 C CG1 . ILE B 1 450 ? 102.334 -46.398 358.439 1.00 17.79  ? 451  ILE B CG1 1 
ATOM   7562 C CG2 . ILE B 1 450 ? 102.555 -46.053 360.913 1.00 16.01  ? 451  ILE B CG2 1 
ATOM   7563 C CD1 . ILE B 1 450 ? 101.150 -45.469 358.262 1.00 17.58  ? 451  ILE B CD1 1 
ATOM   7564 N N   . GLU B 1 451 ? 102.616 -49.711 361.530 1.00 17.87  ? 452  GLU B N   1 
ATOM   7565 C CA  . GLU B 1 451 ? 102.562 -50.325 362.853 1.00 23.18  ? 452  GLU B CA  1 
ATOM   7566 C C   . GLU B 1 451 ? 103.857 -51.049 363.191 1.00 23.41  ? 452  GLU B C   1 
ATOM   7567 O O   . GLU B 1 451 ? 104.231 -51.134 364.366 1.00 24.26  ? 452  GLU B O   1 
ATOM   7568 C CB  . GLU B 1 451 ? 101.375 -51.286 362.942 1.00 22.19  ? 452  GLU B CB  1 
ATOM   7569 C CG  . GLU B 1 451 ? 101.335 -52.337 361.844 1.00 31.34  ? 452  GLU B CG  1 
ATOM   7570 C CD  . GLU B 1 451 ? 99.977  -53.006 361.730 1.00 42.50  ? 452  GLU B CD  1 
ATOM   7571 O OE1 . GLU B 1 451 ? 99.875  -54.208 362.053 1.00 44.77  ? 452  GLU B OE1 1 
ATOM   7572 O OE2 . GLU B 1 451 ? 99.010  -52.328 361.319 1.00 37.55  ? 452  GLU B OE2 1 
ATOM   7573 N N   . PHE B 1 452 ? 104.560 -51.563 362.183 1.00 21.79  ? 453  PHE B N   1 
ATOM   7574 C CA  . PHE B 1 452 ? 105.829 -52.229 362.447 1.00 24.03  ? 453  PHE B CA  1 
ATOM   7575 C C   . PHE B 1 452 ? 106.952 -51.221 362.658 1.00 28.56  ? 453  PHE B C   1 
ATOM   7576 O O   . PHE B 1 452 ? 107.827 -51.435 363.505 1.00 22.38  ? 453  PHE B O   1 
ATOM   7577 C CB  . PHE B 1 452 ? 106.158 -53.191 361.308 1.00 19.07  ? 453  PHE B CB  1 
ATOM   7578 C CG  . PHE B 1 452 ? 105.351 -54.455 361.344 1.00 27.46  ? 453  PHE B CG  1 
ATOM   7579 C CD1 . PHE B 1 452 ? 104.107 -54.518 360.738 1.00 23.53  ? 453  PHE B CD1 1 
ATOM   7580 C CD2 . PHE B 1 452 ? 105.825 -55.574 362.007 1.00 27.18  ? 453  PHE B CD2 1 
ATOM   7581 C CE1 . PHE B 1 452 ? 103.357 -55.679 360.780 1.00 25.58  ? 453  PHE B CE1 1 
ATOM   7582 C CE2 . PHE B 1 452 ? 105.082 -56.737 362.054 1.00 28.72  ? 453  PHE B CE2 1 
ATOM   7583 C CZ  . PHE B 1 452 ? 103.846 -56.790 361.440 1.00 26.53  ? 453  PHE B CZ  1 
ATOM   7584 N N   . ILE B 1 453 ? 106.936 -50.116 361.909 1.00 17.64  ? 454  ILE B N   1 
ATOM   7585 C CA  . ILE B 1 453 ? 107.932 -49.066 362.110 1.00 20.63  ? 454  ILE B CA  1 
ATOM   7586 C C   . ILE B 1 453 ? 107.817 -48.480 363.512 1.00 20.21  ? 454  ILE B C   1 
ATOM   7587 O O   . ILE B 1 453 ? 108.828 -48.176 364.157 1.00 22.84  ? 454  ILE B O   1 
ATOM   7588 C CB  . ILE B 1 453 ? 107.788 -47.976 361.031 1.00 22.23  ? 454  ILE B CB  1 
ATOM   7589 C CG1 . ILE B 1 453 ? 107.860 -48.590 359.631 1.00 24.22  ? 454  ILE B CG1 1 
ATOM   7590 C CG2 . ILE B 1 453 ? 108.855 -46.904 361.207 1.00 24.98  ? 454  ILE B CG2 1 
ATOM   7591 C CD1 . ILE B 1 453 ? 109.161 -49.305 359.346 1.00 30.07  ? 454  ILE B CD1 1 
ATOM   7592 N N   . PHE B 1 454 ? 106.589 -48.313 364.007 1.00 21.58  ? 455  PHE B N   1 
ATOM   7593 C CA  . PHE B 1 454 ? 106.375 -47.741 365.332 1.00 18.18  ? 455  PHE B CA  1 
ATOM   7594 C C   . PHE B 1 454 ? 106.496 -48.771 366.450 1.00 24.99  ? 455  PHE B C   1 
ATOM   7595 O O   . PHE B 1 454 ? 106.384 -48.401 367.624 1.00 25.60  ? 455  PHE B O   1 
ATOM   7596 C CB  . PHE B 1 454 ? 105.011 -47.029 365.389 1.00 18.90  ? 455  PHE B CB  1 
ATOM   7597 C CG  . PHE B 1 454 ? 105.064 -45.587 364.929 1.00 24.32  ? 455  PHE B CG  1 
ATOM   7598 C CD1 . PHE B 1 454 ? 105.082 -44.539 365.847 1.00 23.93  ? 455  PHE B CD1 1 
ATOM   7599 C CD2 . PHE B 1 454 ? 105.153 -45.283 363.577 1.00 21.34  ? 455  PHE B CD2 1 
ATOM   7600 C CE1 . PHE B 1 454 ? 105.171 -43.217 365.416 1.00 26.77  ? 455  PHE B CE1 1 
ATOM   7601 C CE2 . PHE B 1 454 ? 105.236 -43.966 363.144 1.00 22.57  ? 455  PHE B CE2 1 
ATOM   7602 C CZ  . PHE B 1 454 ? 105.243 -42.933 364.064 1.00 21.42  ? 455  PHE B CZ  1 
ATOM   7603 N N   . GLY B 1 455 ? 106.753 -50.038 366.125 1.00 24.34  ? 456  GLY B N   1 
ATOM   7604 C CA  . GLY B 1 455 ? 106.953 -51.045 367.149 1.00 21.10  ? 456  GLY B CA  1 
ATOM   7605 C C   . GLY B 1 455 ? 105.694 -51.505 367.845 1.00 25.55  ? 456  GLY B C   1 
ATOM   7606 O O   . GLY B 1 455 ? 105.776 -52.105 368.919 1.00 25.79  ? 456  GLY B O   1 
ATOM   7607 N N   . ILE B 1 456 ? 104.530 -51.243 367.258 1.00 21.55  ? 457  ILE B N   1 
ATOM   7608 C CA  . ILE B 1 456 ? 103.234 -51.628 367.817 1.00 22.68  ? 457  ILE B CA  1 
ATOM   7609 C C   . ILE B 1 456 ? 103.166 -53.120 368.149 1.00 26.68  ? 457  ILE B C   1 
ATOM   7610 O O   . ILE B 1 456 ? 102.555 -53.477 369.167 1.00 28.42  ? 457  ILE B O   1 
ATOM   7611 C CB  . ILE B 1 456 ? 102.094 -51.222 366.867 1.00 30.52  ? 457  ILE B CB  1 
ATOM   7612 C CG1 . ILE B 1 456 ? 102.173 -49.725 366.557 1.00 25.02  ? 457  ILE B CG1 1 
ATOM   7613 C CG2 . ILE B 1 456 ? 100.741 -51.558 367.470 1.00 28.90  ? 457  ILE B CG2 1 
ATOM   7614 C CD1 . ILE B 1 456 ? 102.244 -48.846 367.791 1.00 24.45  ? 457  ILE B CD1 1 
ATOM   7615 N N   . PRO B 1 457 ? 103.751 -54.029 367.353 1.00 24.93  ? 458  PRO B N   1 
ATOM   7616 C CA  . PRO B 1 457 ? 103.733 -55.448 367.752 1.00 28.11  ? 458  PRO B CA  1 
ATOM   7617 C C   . PRO B 1 457 ? 104.316 -55.726 369.129 1.00 28.04  ? 458  PRO B C   1 
ATOM   7618 O O   . PRO B 1 457 ? 104.008 -56.776 369.707 1.00 33.86  ? 458  PRO B O   1 
ATOM   7619 C CB  . PRO B 1 457 ? 104.553 -56.128 366.649 1.00 27.72  ? 458  PRO B CB  1 
ATOM   7620 C CG  . PRO B 1 457 ? 104.281 -55.303 365.458 1.00 26.30  ? 458  PRO B CG  1 
ATOM   7621 C CD  . PRO B 1 457 ? 104.231 -53.886 365.963 1.00 24.95  ? 458  PRO B CD  1 
ATOM   7622 N N   . LEU B 1 458 ? 105.136 -54.829 369.679 1.00 29.45  ? 459  LEU B N   1 
ATOM   7623 C CA  . LEU B 1 458 ? 105.686 -55.046 371.012 1.00 27.86  ? 459  LEU B CA  1 
ATOM   7624 C C   . LEU B 1 458 ? 104.655 -54.858 372.119 1.00 29.00  ? 459  LEU B C   1 
ATOM   7625 O O   . LEU B 1 458 ? 104.913 -55.274 373.253 1.00 34.07  ? 459  LEU B O   1 
ATOM   7626 C CB  . LEU B 1 458 ? 106.876 -54.113 371.246 1.00 31.44  ? 459  LEU B CB  1 
ATOM   7627 C CG  . LEU B 1 458 ? 108.065 -54.321 370.306 1.00 40.96  ? 459  LEU B CG  1 
ATOM   7628 C CD1 . LEU B 1 458 ? 109.224 -53.416 370.689 1.00 41.04  ? 459  LEU B CD1 1 
ATOM   7629 C CD2 . LEU B 1 458 ? 108.498 -55.779 370.307 1.00 42.71  ? 459  LEU B CD2 1 
ATOM   7630 N N   . ASP B 1 459 ? 103.511 -54.249 371.824 1.00 32.57  ? 460  ASP B N   1 
ATOM   7631 C CA  . ASP B 1 459 ? 102.447 -54.081 372.806 1.00 34.49  ? 460  ASP B CA  1 
ATOM   7632 C C   . ASP B 1 459 ? 101.916 -55.447 373.229 1.00 42.10  ? 460  ASP B C   1 
ATOM   7633 O O   . ASP B 1 459 ? 101.360 -56.173 372.389 1.00 36.52  ? 460  ASP B O   1 
ATOM   7634 C CB  . ASP B 1 459 ? 101.323 -53.226 372.215 1.00 37.62  ? 460  ASP B CB  1 
ATOM   7635 C CG  . ASP B 1 459 ? 100.278 -52.816 373.246 1.00 43.27  ? 460  ASP B CG  1 
ATOM   7636 O OD1 . ASP B 1 459 ? 100.209 -53.430 374.332 1.00 45.17  ? 460  ASP B OD1 1 
ATOM   7637 O OD2 . ASP B 1 459 ? 99.515  -51.870 372.963 1.00 46.54  ? 460  ASP B OD2 1 
ATOM   7638 N N   . PRO B 1 460 ? 102.054 -55.834 374.500 1.00 44.69  ? 461  PRO B N   1 
ATOM   7639 C CA  . PRO B 1 460 ? 101.617 -57.181 374.904 1.00 52.55  ? 461  PRO B CA  1 
ATOM   7640 C C   . PRO B 1 460 ? 100.123 -57.409 374.757 1.00 53.08  ? 461  PRO B C   1 
ATOM   7641 O O   . PRO B 1 460 ? 99.698  -58.556 374.574 1.00 60.56  ? 461  PRO B O   1 
ATOM   7642 C CB  . PRO B 1 460 ? 102.059 -57.267 376.373 1.00 53.90  ? 461  PRO B CB  1 
ATOM   7643 C CG  . PRO B 1 460 ? 103.116 -56.214 376.519 1.00 54.96  ? 461  PRO B CG  1 
ATOM   7644 C CD  . PRO B 1 460 ? 102.678 -55.105 375.615 1.00 47.65  ? 461  PRO B CD  1 
ATOM   7645 N N   . SER B 1 461 ? 99.311  -56.353 374.823 1.00 45.56  ? 462  SER B N   1 
ATOM   7646 C CA  . SER B 1 461 ? 97.867  -56.507 374.695 1.00 45.63  ? 462  SER B CA  1 
ATOM   7647 C C   . SER B 1 461 ? 97.419  -56.773 373.263 1.00 49.97  ? 462  SER B C   1 
ATOM   7648 O O   . SER B 1 461 ? 96.209  -56.852 373.021 1.00 53.87  ? 462  SER B O   1 
ATOM   7649 C CB  . SER B 1 461 ? 97.158  -55.265 375.238 1.00 46.74  ? 462  SER B CB  1 
ATOM   7650 O OG  . SER B 1 461 ? 97.128  -54.229 374.271 1.00 54.08  ? 462  SER B OG  1 
ATOM   7651 N N   . ARG B 1 462 ? 98.344  -56.910 372.318 1.00 46.11  ? 463  ARG B N   1 
ATOM   7652 C CA  . ARG B 1 462 ? 98.025  -57.223 370.934 1.00 42.60  ? 463  ARG B CA  1 
ATOM   7653 C C   . ARG B 1 462 ? 98.539  -58.618 370.589 1.00 43.28  ? 463  ARG B C   1 
ATOM   7654 O O   . ARG B 1 462 ? 99.305  -59.227 371.341 1.00 47.15  ? 463  ARG B O   1 
ATOM   7655 C CB  . ARG B 1 462 ? 98.605  -56.158 369.995 1.00 39.83  ? 463  ARG B CB  1 
ATOM   7656 C CG  . ARG B 1 462 ? 98.036  -54.767 370.264 1.00 43.54  ? 463  ARG B CG  1 
ATOM   7657 C CD  . ARG B 1 462 ? 98.417  -53.766 369.188 1.00 47.96  ? 463  ARG B CD  1 
ATOM   7658 N NE  . ARG B 1 462 ? 97.363  -52.777 368.969 1.00 53.33  ? 463  ARG B NE  1 
ATOM   7659 C CZ  . ARG B 1 462 ? 97.309  -51.594 369.573 1.00 59.06  ? 463  ARG B CZ  1 
ATOM   7660 N NH1 . ARG B 1 462 ? 98.249  -51.247 370.441 1.00 64.01  ? 463  ARG B NH1 1 
ATOM   7661 N NH2 . ARG B 1 462 ? 96.313  -50.758 369.311 1.00 59.10  ? 463  ARG B NH2 1 
ATOM   7662 N N   . ASN B 1 463 ? 98.104  -59.127 369.435 1.00 43.80  ? 464  ASN B N   1 
ATOM   7663 C CA  . ASN B 1 463 ? 98.221  -60.545 369.113 1.00 48.86  ? 464  ASN B CA  1 
ATOM   7664 C C   . ASN B 1 463 ? 99.352  -60.860 368.140 1.00 42.53  ? 464  ASN B C   1 
ATOM   7665 O O   . ASN B 1 463 ? 99.346  -61.935 367.531 1.00 49.56  ? 464  ASN B O   1 
ATOM   7666 C CB  . ASN B 1 463 ? 96.902  -61.067 368.540 1.00 60.34  ? 464  ASN B CB  1 
ATOM   7667 C CG  . ASN B 1 463 ? 95.728  -60.831 369.463 1.00 74.01  ? 464  ASN B CG  1 
ATOM   7668 O OD1 . ASN B 1 463 ? 94.711  -60.267 369.059 1.00 84.28  ? 464  ASN B OD1 1 
ATOM   7669 N ND2 . ASN B 1 463 ? 95.861  -61.263 370.711 1.00 74.28  ? 464  ASN B ND2 1 
ATOM   7670 N N   . TYR B 1 464 ? 100.318 -59.962 367.975 1.00 38.24  ? 465  TYR B N   1 
ATOM   7671 C CA  . TYR B 1 464 ? 101.398 -60.229 367.036 1.00 36.39  ? 465  TYR B CA  1 
ATOM   7672 C C   . TYR B 1 464 ? 102.253 -61.397 367.518 1.00 36.68  ? 465  TYR B C   1 
ATOM   7673 O O   . TYR B 1 464 ? 102.423 -61.621 368.719 1.00 35.74  ? 465  TYR B O   1 
ATOM   7674 C CB  . TYR B 1 464 ? 102.262 -58.985 366.841 1.00 27.72  ? 465  TYR B CB  1 
ATOM   7675 C CG  . TYR B 1 464 ? 101.538 -57.840 366.171 1.00 27.25  ? 465  TYR B CG  1 
ATOM   7676 C CD1 . TYR B 1 464 ? 100.783 -56.943 366.915 1.00 24.85  ? 465  TYR B CD1 1 
ATOM   7677 C CD2 . TYR B 1 464 ? 101.607 -57.656 364.796 1.00 25.59  ? 465  TYR B CD2 1 
ATOM   7678 C CE1 . TYR B 1 464 ? 100.123 -55.892 366.312 1.00 31.63  ? 465  TYR B CE1 1 
ATOM   7679 C CE2 . TYR B 1 464 ? 100.947 -56.608 364.182 1.00 34.87  ? 465  TYR B CE2 1 
ATOM   7680 C CZ  . TYR B 1 464 ? 100.206 -55.729 364.946 1.00 36.54  ? 465  TYR B CZ  1 
ATOM   7681 O OH  . TYR B 1 464 ? 99.546  -54.683 364.345 1.00 34.77  ? 465  TYR B OH  1 
ATOM   7682 N N   . THR B 1 465 ? 102.786 -62.151 366.560 1.00 36.94  ? 466  THR B N   1 
ATOM   7683 C CA  . THR B 1 465 ? 103.585 -63.324 366.872 1.00 39.28  ? 466  THR B CA  1 
ATOM   7684 C C   . THR B 1 465 ? 104.975 -62.918 367.358 1.00 40.70  ? 466  THR B C   1 
ATOM   7685 O O   . THR B 1 465 ? 105.382 -61.756 367.273 1.00 41.88  ? 466  THR B O   1 
ATOM   7686 C CB  . THR B 1 465 ? 103.703 -64.237 365.652 1.00 40.38  ? 466  THR B CB  1 
ATOM   7687 O OG1 . THR B 1 465 ? 104.675 -63.701 364.747 1.00 41.85  ? 466  THR B OG1 1 
ATOM   7688 C CG2 . THR B 1 465 ? 102.363 -64.350 364.941 1.00 39.77  ? 466  THR B CG2 1 
ATOM   7689 N N   . ALA B 1 466 ? 105.710 -63.907 367.873 1.00 38.98  ? 467  ALA B N   1 
ATOM   7690 C CA  . ALA B 1 466 ? 107.069 -63.654 368.341 1.00 39.05  ? 467  ALA B CA  1 
ATOM   7691 C C   . ALA B 1 466 ? 107.978 -63.232 367.194 1.00 36.91  ? 467  ALA B C   1 
ATOM   7692 O O   . ALA B 1 466 ? 108.837 -62.358 367.362 1.00 35.62  ? 467  ALA B O   1 
ATOM   7693 C CB  . ALA B 1 466 ? 107.622 -64.895 369.041 1.00 36.91  ? 467  ALA B CB  1 
ATOM   7694 N N   . GLU B 1 467 ? 107.805 -63.844 366.018 1.00 34.66  ? 468  GLU B N   1 
ATOM   7695 C CA  . GLU B 1 467 ? 108.596 -63.452 364.855 1.00 37.83  ? 468  GLU B CA  1 
ATOM   7696 C C   . GLU B 1 467 ? 108.282 -62.025 364.427 1.00 36.33  ? 468  GLU B C   1 
ATOM   7697 O O   . GLU B 1 467 ? 109.177 -61.289 363.996 1.00 34.83  ? 468  GLU B O   1 
ATOM   7698 C CB  . GLU B 1 467 ? 108.344 -64.412 363.692 1.00 48.34  ? 468  GLU B CB  1 
ATOM   7699 C CG  . GLU B 1 467 ? 108.855 -65.824 363.900 1.00 65.93  ? 468  GLU B CG  1 
ATOM   7700 C CD  . GLU B 1 467 ? 108.750 -66.660 362.638 1.00 86.50  ? 468  GLU B CD  1 
ATOM   7701 O OE1 . GLU B 1 467 ? 109.799 -67.104 362.126 1.00 94.06  ? 468  GLU B OE1 1 
ATOM   7702 O OE2 . GLU B 1 467 ? 107.618 -66.862 362.150 1.00 92.24  ? 468  GLU B OE2 1 
ATOM   7703 N N   . GLU B 1 468 ? 107.014 -61.620 364.529 1.00 35.03  ? 469  GLU B N   1 
ATOM   7704 C CA  . GLU B 1 468 ? 106.635 -60.275 364.114 1.00 32.09  ? 469  GLU B CA  1 
ATOM   7705 C C   . GLU B 1 468 ? 107.215 -59.217 365.045 1.00 34.02  ? 469  GLU B C   1 
ATOM   7706 O O   . GLU B 1 468 ? 107.524 -58.106 364.600 1.00 32.24  ? 469  GLU B O   1 
ATOM   7707 C CB  . GLU B 1 468 ? 105.112 -60.161 364.037 1.00 28.72  ? 469  GLU B CB  1 
ATOM   7708 C CG  . GLU B 1 468 ? 104.523 -60.770 362.768 1.00 30.03  ? 469  GLU B CG  1 
ATOM   7709 C CD  . GLU B 1 468 ? 103.004 -60.807 362.770 1.00 37.26  ? 469  GLU B CD  1 
ATOM   7710 O OE1 . GLU B 1 468 ? 102.412 -61.097 363.831 1.00 37.28  ? 469  GLU B OE1 1 
ATOM   7711 O OE2 . GLU B 1 468 ? 102.403 -60.551 361.704 1.00 37.41  ? 469  GLU B OE2 1 
ATOM   7712 N N   . LYS B 1 469 ? 107.380 -59.543 366.330 1.00 30.98  ? 470  LYS B N   1 
ATOM   7713 C CA  . LYS B 1 469 ? 108.018 -58.608 367.251 1.00 32.48  ? 470  LYS B CA  1 
ATOM   7714 C C   . LYS B 1 469 ? 109.496 -58.438 366.928 1.00 29.44  ? 470  LYS B C   1 
ATOM   7715 O O   . LYS B 1 469 ? 110.020 -57.318 366.967 1.00 28.13  ? 470  LYS B O   1 
ATOM   7716 C CB  . LYS B 1 469 ? 107.836 -59.082 368.692 1.00 34.35  ? 470  LYS B CB  1 
ATOM   7717 C CG  . LYS B 1 469 ? 106.440 -58.862 369.236 1.00 38.97  ? 470  LYS B CG  1 
ATOM   7718 C CD  . LYS B 1 469 ? 106.037 -59.978 370.179 1.00 45.82  ? 470  LYS B CD  1 
ATOM   7719 C CE  . LYS B 1 469 ? 105.073 -59.474 371.235 1.00 45.82  ? 470  LYS B CE  1 
ATOM   7720 N NZ  . LYS B 1 469 ? 104.205 -60.564 371.753 1.00 54.15  ? 470  LYS B NZ  1 
ATOM   7721 N N   . ILE B 1 470 ? 110.186 -59.539 366.620 1.00 29.17  ? 471  ILE B N   1 
ATOM   7722 C CA  . ILE B 1 470 ? 111.576 -59.452 366.179 1.00 31.04  ? 471  ILE B CA  1 
ATOM   7723 C C   . ILE B 1 470 ? 111.671 -58.636 364.897 1.00 28.62  ? 471  ILE B C   1 
ATOM   7724 O O   . ILE B 1 470 ? 112.572 -57.802 364.735 1.00 31.32  ? 471  ILE B O   1 
ATOM   7725 C CB  . ILE B 1 470 ? 112.164 -60.864 365.998 1.00 30.08  ? 471  ILE B CB  1 
ATOM   7726 C CG1 . ILE B 1 470 ? 112.309 -61.564 367.350 1.00 33.27  ? 471  ILE B CG1 1 
ATOM   7727 C CG2 . ILE B 1 470 ? 113.501 -60.806 365.275 1.00 26.20  ? 471  ILE B CG2 1 
ATOM   7728 C CD1 . ILE B 1 470 ? 112.574 -63.052 367.236 1.00 39.35  ? 471  ILE B CD1 1 
ATOM   7729 N N   . PHE B 1 471 ? 110.736 -58.861 363.972 1.00 23.14  ? 472  PHE B N   1 
ATOM   7730 C CA  . PHE B 1 471 ? 110.699 -58.105 362.724 1.00 26.07  ? 472  PHE B CA  1 
ATOM   7731 C C   . PHE B 1 471 ? 110.516 -56.615 362.991 1.00 30.56  ? 472  PHE B C   1 
ATOM   7732 O O   . PHE B 1 471 ? 111.212 -55.776 362.406 1.00 24.65  ? 472  PHE B O   1 
ATOM   7733 C CB  . PHE B 1 471 ? 109.575 -58.653 361.841 1.00 21.77  ? 472  PHE B CB  1 
ATOM   7734 C CG  . PHE B 1 471 ? 109.418 -57.947 360.524 1.00 22.31  ? 472  PHE B CG  1 
ATOM   7735 C CD1 . PHE B 1 471 ? 110.509 -57.711 359.704 1.00 28.94  ? 472  PHE B CD1 1 
ATOM   7736 C CD2 . PHE B 1 471 ? 108.163 -57.547 360.093 1.00 28.27  ? 472  PHE B CD2 1 
ATOM   7737 C CE1 . PHE B 1 471 ? 110.351 -57.070 358.486 1.00 28.08  ? 472  PHE B CE1 1 
ATOM   7738 C CE2 . PHE B 1 471 ? 107.999 -56.908 358.878 1.00 26.54  ? 472  PHE B CE2 1 
ATOM   7739 C CZ  . PHE B 1 471 ? 109.094 -56.669 358.073 1.00 25.82  ? 472  PHE B CZ  1 
ATOM   7740 N N   . ALA B 1 472 ? 109.584 -56.268 363.884 1.00 25.46  ? 473  ALA B N   1 
ATOM   7741 C CA  . ALA B 1 472 ? 109.378 -54.867 364.235 1.00 27.45  ? 473  ALA B CA  1 
ATOM   7742 C C   . ALA B 1 472 ? 110.639 -54.255 364.831 1.00 30.62  ? 473  ALA B C   1 
ATOM   7743 O O   . ALA B 1 472 ? 110.986 -53.108 364.528 1.00 24.60  ? 473  ALA B O   1 
ATOM   7744 C CB  . ALA B 1 472 ? 108.207 -54.735 365.208 1.00 24.43  ? 473  ALA B CB  1 
ATOM   7745 N N   . GLN B 1 473 ? 111.342 -55.009 365.681 1.00 27.64  ? 474  GLN B N   1 
ATOM   7746 C CA  . GLN B 1 473 ? 112.589 -54.508 366.249 1.00 26.42  ? 474  GLN B CA  1 
ATOM   7747 C C   . GLN B 1 473 ? 113.653 -54.317 365.175 1.00 25.44  ? 474  GLN B C   1 
ATOM   7748 O O   . GLN B 1 473 ? 114.483 -53.406 365.281 1.00 25.79  ? 474  GLN B O   1 
ATOM   7749 C CB  . GLN B 1 473 ? 113.082 -55.455 367.345 1.00 27.17  ? 474  GLN B CB  1 
ATOM   7750 C CG  . GLN B 1 473 ? 112.199 -55.462 368.589 1.00 29.73  ? 474  GLN B CG  1 
ATOM   7751 C CD  . GLN B 1 473 ? 112.612 -56.512 369.605 1.00 35.29  ? 474  GLN B CD  1 
ATOM   7752 O OE1 . GLN B 1 473 ? 112.913 -57.652 369.251 1.00 37.73  ? 474  GLN B OE1 1 
ATOM   7753 N NE2 . GLN B 1 473 ? 112.623 -56.131 370.878 1.00 28.27  ? 474  GLN B NE2 1 
ATOM   7754 N N   . ARG B 1 474 ? 113.640 -55.155 364.135 1.00 24.81  ? 475  ARG B N   1 
ATOM   7755 C CA  . ARG B 1 474 ? 114.548 -54.963 363.007 1.00 26.88  ? 475  ARG B CA  1 
ATOM   7756 C C   . ARG B 1 474 ? 114.255 -53.654 362.284 1.00 23.74  ? 475  ARG B C   1 
ATOM   7757 O O   . ARG B 1 474 ? 115.171 -52.891 361.957 1.00 24.61  ? 475  ARG B O   1 
ATOM   7758 C CB  . ARG B 1 474 ? 114.435 -56.133 362.027 1.00 28.31  ? 475  ARG B CB  1 
ATOM   7759 C CG  . ARG B 1 474 ? 115.150 -57.404 362.436 1.00 34.97  ? 475  ARG B CG  1 
ATOM   7760 C CD  . ARG B 1 474 ? 115.028 -58.449 361.332 1.00 38.70  ? 475  ARG B CD  1 
ATOM   7761 N NE  . ARG B 1 474 ? 115.474 -57.928 360.041 1.00 31.37  ? 475  ARG B NE  1 
ATOM   7762 C CZ  . ARG B 1 474 ? 114.910 -58.225 358.874 1.00 32.82  ? 475  ARG B CZ  1 
ATOM   7763 N NH1 . ARG B 1 474 ? 113.866 -59.043 358.826 1.00 30.13  ? 475  ARG B NH1 1 
ATOM   7764 N NH2 . ARG B 1 474 ? 115.387 -57.701 357.752 1.00 24.72  ? 475  ARG B NH2 1 
ATOM   7765 N N   . LEU B 1 475 ? 112.975 -53.388 362.011 1.00 21.84  ? 476  LEU B N   1 
ATOM   7766 C CA  . LEU B 1 475 ? 112.608 -52.194 361.256 1.00 23.69  ? 476  LEU B CA  1 
ATOM   7767 C C   . LEU B 1 475 ? 112.879 -50.927 362.057 1.00 27.23  ? 476  LEU B C   1 
ATOM   7768 O O   . LEU B 1 475 ? 113.305 -49.911 361.495 1.00 20.38  ? 476  LEU B O   1 
ATOM   7769 C CB  . LEU B 1 475 ? 111.137 -52.266 360.846 1.00 22.33  ? 476  LEU B CB  1 
ATOM   7770 C CG  . LEU B 1 475 ? 110.743 -53.389 359.884 1.00 32.20  ? 476  LEU B CG  1 
ATOM   7771 C CD1 . LEU B 1 475 ? 109.315 -53.197 359.404 1.00 36.12  ? 476  LEU B CD1 1 
ATOM   7772 C CD2 . LEU B 1 475 ? 111.703 -53.457 358.704 1.00 31.34  ? 476  LEU B CD2 1 
ATOM   7773 N N   . MET B 1 476 ? 112.629 -50.965 363.368 1.00 23.27  ? 477  MET B N   1 
ATOM   7774 C CA  . MET B 1 476 ? 112.949 -49.817 364.210 1.00 18.63  ? 477  MET B CA  1 
ATOM   7775 C C   . MET B 1 476 ? 114.443 -49.525 364.187 1.00 21.43  ? 477  MET B C   1 
ATOM   7776 O O   . MET B 1 476 ? 114.856 -48.359 364.208 1.00 22.40  ? 477  MET B O   1 
ATOM   7777 C CB  . MET B 1 476 ? 112.475 -50.064 365.642 1.00 18.44  ? 477  MET B CB  1 
ATOM   7778 C CG  . MET B 1 476 ? 110.965 -50.068 365.814 1.00 26.82  ? 477  MET B CG  1 
ATOM   7779 S SD  . MET B 1 476 ? 110.477 -49.963 367.547 1.00 31.16  ? 477  MET B SD  1 
ATOM   7780 C CE  . MET B 1 476 ? 111.132 -51.509 368.173 1.00 35.76  ? 477  MET B CE  1 
ATOM   7781 N N   . ARG B 1 477 ? 115.269 -50.573 364.136 1.00 19.55  ? 478  ARG B N   1 
ATOM   7782 C CA  . ARG B 1 477 ? 116.714 -50.379 364.097 1.00 24.34  ? 478  ARG B CA  1 
ATOM   7783 C C   . ARG B 1 477 ? 117.154 -49.755 362.778 1.00 25.09  ? 478  ARG B C   1 
ATOM   7784 O O   . ARG B 1 477 ? 117.980 -48.835 362.769 1.00 24.55  ? 478  ARG B O   1 
ATOM   7785 C CB  . ARG B 1 477 ? 117.427 -51.712 364.331 1.00 25.74  ? 478  ARG B CB  1 
ATOM   7786 C CG  . ARG B 1 477 ? 118.943 -51.647 364.213 1.00 26.50  ? 478  ARG B CG  1 
ATOM   7787 C CD  . ARG B 1 477 ? 119.560 -50.772 365.296 1.00 31.36  ? 478  ARG B CD  1 
ATOM   7788 N NE  . ARG B 1 477 ? 119.134 -51.163 366.638 1.00 34.67  ? 478  ARG B NE  1 
ATOM   7789 C CZ  . ARG B 1 477 ? 119.775 -52.042 367.402 1.00 39.51  ? 478  ARG B CZ  1 
ATOM   7790 N NH1 . ARG B 1 477 ? 120.879 -52.630 366.961 1.00 38.35  ? 478  ARG B NH1 1 
ATOM   7791 N NH2 . ARG B 1 477 ? 119.312 -52.332 368.610 1.00 37.44  ? 478  ARG B NH2 1 
ATOM   7792 N N   . TYR B 1 478 ? 116.617 -50.241 361.654 1.00 21.98  ? 479  TYR B N   1 
ATOM   7793 C CA  . TYR B 1 478 ? 116.930 -49.638 360.360 1.00 19.52  ? 479  TYR B CA  1 
ATOM   7794 C C   . TYR B 1 478 ? 116.557 -48.161 360.342 1.00 19.11  ? 479  TYR B C   1 
ATOM   7795 O O   . TYR B 1 478 ? 117.370 -47.307 359.969 1.00 24.67  ? 479  TYR B O   1 
ATOM   7796 C CB  . TYR B 1 478 ? 116.198 -50.371 359.232 1.00 18.93  ? 479  TYR B CB  1 
ATOM   7797 C CG  . TYR B 1 478 ? 116.657 -51.786 358.952 1.00 27.59  ? 479  TYR B CG  1 
ATOM   7798 C CD1 . TYR B 1 478 ? 118.005 -52.098 358.834 1.00 24.64  ? 479  TYR B CD1 1 
ATOM   7799 C CD2 . TYR B 1 478 ? 115.731 -52.805 358.768 1.00 29.19  ? 479  TYR B CD2 1 
ATOM   7800 C CE1 . TYR B 1 478 ? 118.417 -53.393 358.564 1.00 27.35  ? 479  TYR B CE1 1 
ATOM   7801 C CE2 . TYR B 1 478 ? 116.132 -54.099 358.498 1.00 30.53  ? 479  TYR B CE2 1 
ATOM   7802 C CZ  . TYR B 1 478 ? 117.475 -54.388 358.397 1.00 33.49  ? 479  TYR B CZ  1 
ATOM   7803 O OH  . TYR B 1 478 ? 117.872 -55.678 358.127 1.00 42.74  ? 479  TYR B OH  1 
ATOM   7804 N N   . TRP B 1 479 ? 115.323 -47.844 360.744 1.00 20.37  ? 480  TRP B N   1 
ATOM   7805 C CA  . TRP B 1 479 ? 114.861 -46.460 360.715 1.00 23.05  ? 480  TRP B CA  1 
ATOM   7806 C C   . TRP B 1 479 ? 115.698 -45.577 361.633 1.00 24.61  ? 480  TRP B C   1 
ATOM   7807 O O   . TRP B 1 479 ? 116.030 -44.439 361.280 1.00 24.10  ? 480  TRP B O   1 
ATOM   7808 C CB  . TRP B 1 479 ? 113.383 -46.393 361.105 1.00 17.21  ? 480  TRP B CB  1 
ATOM   7809 C CG  . TRP B 1 479 ? 112.438 -46.256 359.942 1.00 21.55  ? 480  TRP B CG  1 
ATOM   7810 C CD1 . TRP B 1 479 ? 111.583 -45.219 359.701 1.00 18.17  ? 480  TRP B CD1 1 
ATOM   7811 C CD2 . TRP B 1 479 ? 112.240 -47.193 358.874 1.00 20.53  ? 480  TRP B CD2 1 
ATOM   7812 N NE1 . TRP B 1 479 ? 110.873 -45.447 358.547 1.00 21.33  ? 480  TRP B NE1 1 
ATOM   7813 C CE2 . TRP B 1 479 ? 111.256 -46.652 358.021 1.00 19.69  ? 480  TRP B CE2 1 
ATOM   7814 C CE3 . TRP B 1 479 ? 112.801 -48.434 358.555 1.00 23.57  ? 480  TRP B CE3 1 
ATOM   7815 C CZ2 . TRP B 1 479 ? 110.823 -47.309 356.869 1.00 22.59  ? 480  TRP B CZ2 1 
ATOM   7816 C CZ3 . TRP B 1 479 ? 112.368 -49.085 357.411 1.00 23.29  ? 480  TRP B CZ3 1 
ATOM   7817 C CH2 . TRP B 1 479 ? 111.389 -48.520 356.582 1.00 21.55  ? 480  TRP B CH2 1 
ATOM   7818 N N   . ALA B 1 480 ? 116.056 -46.086 362.815 1.00 21.15  ? 481  ALA B N   1 
ATOM   7819 C CA  . ALA B 1 480 ? 116.853 -45.292 363.744 1.00 21.38  ? 481  ALA B CA  1 
ATOM   7820 C C   . ALA B 1 480 ? 118.303 -45.189 363.286 1.00 25.07  ? 481  ALA B C   1 
ATOM   7821 O O   . ALA B 1 480 ? 118.942 -44.147 363.471 1.00 21.74  ? 481  ALA B O   1 
ATOM   7822 C CB  . ALA B 1 480 ? 116.775 -45.885 365.149 1.00 16.19  ? 481  ALA B CB  1 
ATOM   7823 N N   . ASN B 1 481 ? 118.844 -46.264 362.703 1.00 23.16  ? 482  ASN B N   1 
ATOM   7824 C CA  . ASN B 1 481 ? 120.173 -46.186 362.101 1.00 25.78  ? 482  ASN B CA  1 
ATOM   7825 C C   . ASN B 1 481 ? 120.228 -45.075 361.063 1.00 24.26  ? 482  ASN B C   1 
ATOM   7826 O O   . ASN B 1 481 ? 121.170 -44.275 361.038 1.00 21.79  ? 482  ASN B O   1 
ATOM   7827 C CB  . ASN B 1 481 ? 120.550 -47.524 361.463 1.00 22.30  ? 482  ASN B CB  1 
ATOM   7828 C CG  . ASN B 1 481 ? 121.064 -48.535 362.470 1.00 28.13  ? 482  ASN B CG  1 
ATOM   7829 O OD1 . ASN B 1 481 ? 121.289 -48.212 363.636 1.00 23.28  ? 482  ASN B OD1 1 
ATOM   7830 N ND2 . ASN B 1 481 ? 121.262 -49.768 362.017 1.00 24.58  ? 482  ASN B ND2 1 
ATOM   7831 N N   . PHE B 1 482 ? 119.211 -45.008 360.199 1.00 17.77  ? 483  PHE B N   1 
ATOM   7832 C CA  . PHE B 1 482 ? 119.157 -43.956 359.191 1.00 23.10  ? 483  PHE B CA  1 
ATOM   7833 C C   . PHE B 1 482 ? 119.104 -42.576 359.833 1.00 21.20  ? 483  PHE B C   1 
ATOM   7834 O O   . PHE B 1 482 ? 119.803 -41.654 359.398 1.00 23.70  ? 483  PHE B O   1 
ATOM   7835 C CB  . PHE B 1 482 ? 117.948 -44.166 358.280 1.00 17.23  ? 483  PHE B CB  1 
ATOM   7836 C CG  . PHE B 1 482 ? 117.859 -43.172 357.162 1.00 18.75  ? 483  PHE B CG  1 
ATOM   7837 C CD1 . PHE B 1 482 ? 118.620 -43.331 356.019 1.00 22.15  ? 483  PHE B CD1 1 
ATOM   7838 C CD2 . PHE B 1 482 ? 117.022 -42.071 357.258 1.00 17.38  ? 483  PHE B CD2 1 
ATOM   7839 C CE1 . PHE B 1 482 ? 118.546 -42.418 354.989 1.00 23.89  ? 483  PHE B CE1 1 
ATOM   7840 C CE2 . PHE B 1 482 ? 116.945 -41.153 356.231 1.00 19.79  ? 483  PHE B CE2 1 
ATOM   7841 C CZ  . PHE B 1 482 ? 117.709 -41.327 355.096 1.00 17.51  ? 483  PHE B CZ  1 
ATOM   7842 N N   . ALA B 1 483 ? 118.278 -42.413 360.869 1.00 22.36  ? 484  ALA B N   1 
ATOM   7843 C CA  . ALA B 1 483 ? 118.171 -41.116 361.527 1.00 27.33  ? 484  ALA B CA  1 
ATOM   7844 C C   . ALA B 1 483 ? 119.482 -40.709 362.186 1.00 27.75  ? 484  ALA B C   1 
ATOM   7845 O O   . ALA B 1 483 ? 119.810 -39.518 362.230 1.00 26.14  ? 484  ALA B O   1 
ATOM   7846 C CB  . ALA B 1 483 ? 117.043 -41.141 362.559 1.00 24.39  ? 484  ALA B CB  1 
ATOM   7847 N N   . ARG B 1 484 ? 120.246 -41.676 362.696 1.00 28.98  ? 485  ARG B N   1 
ATOM   7848 C CA  . ARG B 1 484 ? 121.492 -41.347 363.378 1.00 26.29  ? 485  ARG B CA  1 
ATOM   7849 C C   . ARG B 1 484 ? 122.618 -41.048 362.394 1.00 26.48  ? 485  ARG B C   1 
ATOM   7850 O O   . ARG B 1 484 ? 123.424 -40.141 362.632 1.00 31.27  ? 485  ARG B O   1 
ATOM   7851 C CB  . ARG B 1 484 ? 121.900 -42.488 364.312 1.00 20.11  ? 485  ARG B CB  1 
ATOM   7852 C CG  . ARG B 1 484 ? 121.082 -42.578 365.592 1.00 20.92  ? 485  ARG B CG  1 
ATOM   7853 C CD  . ARG B 1 484 ? 121.657 -43.621 366.543 1.00 23.67  ? 485  ARG B CD  1 
ATOM   7854 N NE  . ARG B 1 484 ? 121.368 -44.984 366.107 1.00 26.45  ? 485  ARG B NE  1 
ATOM   7855 C CZ  . ARG B 1 484 ? 120.326 -45.698 366.523 1.00 29.98  ? 485  ARG B CZ  1 
ATOM   7856 N NH1 . ARG B 1 484 ? 119.468 -45.178 367.390 1.00 22.98  ? 485  ARG B NH1 1 
ATOM   7857 N NH2 . ARG B 1 484 ? 120.141 -46.931 366.071 1.00 21.38  ? 485  ARG B NH2 1 
ATOM   7858 N N   . THR B 1 485 ? 122.694 -41.795 361.287 1.00 25.70  ? 486  THR B N   1 
ATOM   7859 C CA  . THR B 1 485 ? 123.850 -41.737 360.399 1.00 26.82  ? 486  THR B CA  1 
ATOM   7860 C C   . THR B 1 485 ? 123.526 -41.535 358.926 1.00 25.66  ? 486  THR B C   1 
ATOM   7861 O O   . THR B 1 485 ? 124.460 -41.367 358.135 1.00 25.17  ? 486  THR B O   1 
ATOM   7862 C CB  . THR B 1 485 ? 124.684 -43.024 360.517 1.00 24.66  ? 486  THR B CB  1 
ATOM   7863 O OG1 . THR B 1 485 ? 123.967 -44.110 359.915 1.00 28.92  ? 486  THR B OG1 1 
ATOM   7864 C CG2 . THR B 1 485 ? 124.978 -43.358 361.973 1.00 21.30  ? 486  THR B CG2 1 
ATOM   7865 N N   . GLY B 1 486 ? 122.258 -41.558 358.524 1.00 20.84  ? 487  GLY B N   1 
ATOM   7866 C CA  . GLY B 1 486 ? 121.952 -41.545 357.107 1.00 20.46  ? 487  GLY B CA  1 
ATOM   7867 C C   . GLY B 1 486 ? 122.198 -42.863 356.411 1.00 21.72  ? 487  GLY B C   1 
ATOM   7868 O O   . GLY B 1 486 ? 122.311 -42.894 355.183 1.00 23.94  ? 487  GLY B O   1 
ATOM   7869 N N   . ASP B 1 487 ? 122.280 -43.958 357.166 1.00 27.10  ? 488  ASP B N   1 
ATOM   7870 C CA  . ASP B 1 487 ? 122.571 -45.289 356.649 1.00 25.88  ? 488  ASP B CA  1 
ATOM   7871 C C   . ASP B 1 487 ? 121.860 -46.319 357.520 1.00 26.59  ? 488  ASP B C   1 
ATOM   7872 O O   . ASP B 1 487 ? 122.137 -46.408 358.723 1.00 31.09  ? 488  ASP B O   1 
ATOM   7873 C CB  . ASP B 1 487 ? 124.084 -45.533 356.632 1.00 32.53  ? 488  ASP B CB  1 
ATOM   7874 C CG  . ASP B 1 487 ? 124.476 -46.813 355.905 1.00 34.87  ? 488  ASP B CG  1 
ATOM   7875 O OD1 . ASP B 1 487 ? 123.619 -47.701 355.714 1.00 32.16  ? 488  ASP B OD1 1 
ATOM   7876 O OD2 . ASP B 1 487 ? 125.661 -46.932 355.526 1.00 33.90  ? 488  ASP B OD2 1 
ATOM   7877 N N   . PRO B 1 488 ? 120.943 -47.114 356.961 1.00 26.18  ? 489  PRO B N   1 
ATOM   7878 C CA  . PRO B 1 488 ? 120.194 -48.064 357.799 1.00 22.52  ? 489  PRO B CA  1 
ATOM   7879 C C   . PRO B 1 488 ? 121.008 -49.266 358.253 1.00 25.50  ? 489  PRO B C   1 
ATOM   7880 O O   . PRO B 1 488 ? 120.597 -49.938 359.207 1.00 30.62  ? 489  PRO B O   1 
ATOM   7881 C CB  . PRO B 1 488 ? 119.032 -48.491 356.894 1.00 20.57  ? 489  PRO B CB  1 
ATOM   7882 C CG  . PRO B 1 488 ? 119.556 -48.317 355.508 1.00 24.38  ? 489  PRO B CG  1 
ATOM   7883 C CD  . PRO B 1 488 ? 120.502 -47.143 355.554 1.00 24.99  ? 489  PRO B CD  1 
ATOM   7884 N N   . ASN B 1 489 ? 122.141 -49.553 357.617 1.00 25.28  ? 490  ASN B N   1 
ATOM   7885 C CA  . ASN B 1 489 ? 122.900 -50.757 357.922 1.00 30.52  ? 490  ASN B CA  1 
ATOM   7886 C C   . ASN B 1 489 ? 123.609 -50.637 359.272 1.00 37.45  ? 490  ASN B C   1 
ATOM   7887 O O   . ASN B 1 489 ? 123.726 -49.557 359.858 1.00 36.09  ? 490  ASN B O   1 
ATOM   7888 C CB  . ASN B 1 489 ? 123.934 -51.034 356.831 1.00 28.57  ? 490  ASN B CB  1 
ATOM   7889 C CG  . ASN B 1 489 ? 123.304 -51.288 355.480 1.00 32.84  ? 490  ASN B CG  1 
ATOM   7890 O OD1 . ASN B 1 489 ? 122.816 -52.384 355.207 1.00 34.91  ? 490  ASN B OD1 1 
ATOM   7891 N ND2 . ASN B 1 489 ? 123.321 -50.276 354.620 1.00 20.72  ? 490  ASN B ND2 1 
ATOM   7892 N N   . GLU B 1 490 ? 124.094 -51.778 359.756 1.00 54.70  ? 491  GLU B N   1 
ATOM   7893 C CA  . GLU B 1 490 ? 124.952 -51.825 360.935 1.00 68.46  ? 491  GLU B CA  1 
ATOM   7894 C C   . GLU B 1 490 ? 125.741 -53.130 360.969 1.00 70.77  ? 491  GLU B C   1 
ATOM   7895 O O   . GLU B 1 490 ? 126.913 -53.169 360.595 1.00 75.82  ? 491  GLU B O   1 
ATOM   7896 C CB  . GLU B 1 490 ? 124.135 -51.675 362.218 1.00 77.53  ? 491  GLU B CB  1 
ATOM   7897 C CG  . GLU B 1 490 ? 123.151 -52.801 362.469 1.00 77.94  ? 491  GLU B CG  1 
ATOM   7898 C CD  . GLU B 1 490 ? 122.447 -52.664 363.803 1.00 74.20  ? 491  GLU B CD  1 
ATOM   7899 O OE1 . GLU B 1 490 ? 122.728 -51.684 364.526 1.00 74.23  ? 491  GLU B OE1 1 
ATOM   7900 O OE2 . GLU B 1 490 ? 121.614 -53.535 364.130 1.00 75.56  ? 491  GLU B OE2 1 
ATOM   7901 N N   . PRO B 1 497 ? 124.168 -59.319 355.352 1.00 71.52  ? 498  PRO B N   1 
ATOM   7902 C CA  . PRO B 1 497 ? 123.157 -58.932 354.368 1.00 67.81  ? 498  PRO B CA  1 
ATOM   7903 C C   . PRO B 1 497 ? 122.985 -57.419 354.319 1.00 57.80  ? 498  PRO B C   1 
ATOM   7904 O O   . PRO B 1 497 ? 122.182 -56.867 355.071 1.00 58.43  ? 498  PRO B O   1 
ATOM   7905 C CB  . PRO B 1 497 ? 121.893 -59.615 354.893 1.00 68.68  ? 498  PRO B CB  1 
ATOM   7906 C CG  . PRO B 1 497 ? 122.136 -59.780 356.404 1.00 68.54  ? 498  PRO B CG  1 
ATOM   7907 C CD  . PRO B 1 497 ? 123.579 -59.421 356.696 1.00 68.48  ? 498  PRO B CD  1 
ATOM   7908 N N   . GLN B 1 498 ? 123.732 -56.758 353.442 1.00 47.60  ? 499  GLN B N   1 
ATOM   7909 C CA  . GLN B 1 498 ? 123.794 -55.305 353.435 1.00 41.09  ? 499  GLN B CA  1 
ATOM   7910 C C   . GLN B 1 498 ? 122.729 -54.707 352.526 1.00 39.70  ? 499  GLN B C   1 
ATOM   7911 O O   . GLN B 1 498 ? 122.406 -55.258 351.470 1.00 40.71  ? 499  GLN B O   1 
ATOM   7912 C CB  . GLN B 1 498 ? 125.181 -54.829 353.004 1.00 41.98  ? 499  GLN B CB  1 
ATOM   7913 C CG  . GLN B 1 498 ? 126.266 -55.104 354.034 1.00 46.78  ? 499  GLN B CG  1 
ATOM   7914 C CD  . GLN B 1 498 ? 125.985 -54.435 355.368 1.00 51.84  ? 499  GLN B CD  1 
ATOM   7915 O OE1 . GLN B 1 498 ? 126.114 -53.218 355.505 1.00 46.50  ? 499  GLN B OE1 1 
ATOM   7916 N NE2 . GLN B 1 498 ? 125.597 -55.231 356.359 1.00 54.81  ? 499  GLN B NE2 1 
ATOM   7917 N N   . TRP B 1 499 ? 122.187 -53.569 352.960 1.00 31.83  ? 500  TRP B N   1 
ATOM   7918 C CA  . TRP B 1 499 ? 121.192 -52.823 352.204 1.00 24.13  ? 500  TRP B CA  1 
ATOM   7919 C C   . TRP B 1 499 ? 121.924 -51.833 351.307 1.00 26.10  ? 500  TRP B C   1 
ATOM   7920 O O   . TRP B 1 499 ? 122.465 -50.840 351.816 1.00 28.81  ? 500  TRP B O   1 
ATOM   7921 C CB  . TRP B 1 499 ? 120.255 -52.100 353.165 1.00 22.18  ? 500  TRP B CB  1 
ATOM   7922 C CG  . TRP B 1 499 ? 119.085 -51.363 352.574 1.00 24.03  ? 500  TRP B CG  1 
ATOM   7923 C CD1 . TRP B 1 499 ? 118.936 -50.924 351.288 1.00 26.37  ? 500  TRP B CD1 1 
ATOM   7924 C CD2 . TRP B 1 499 ? 117.899 -50.966 353.272 1.00 20.26  ? 500  TRP B CD2 1 
ATOM   7925 N NE1 . TRP B 1 499 ? 117.727 -50.283 351.145 1.00 20.86  ? 500  TRP B NE1 1 
ATOM   7926 C CE2 . TRP B 1 499 ? 117.074 -50.295 352.350 1.00 21.70  ? 500  TRP B CE2 1 
ATOM   7927 C CE3 . TRP B 1 499 ? 117.456 -51.118 354.590 1.00 23.00  ? 500  TRP B CE3 1 
ATOM   7928 C CZ2 . TRP B 1 499 ? 115.828 -49.779 352.702 1.00 21.03  ? 500  TRP B CZ2 1 
ATOM   7929 C CZ3 . TRP B 1 499 ? 116.221 -50.602 354.939 1.00 22.58  ? 500  TRP B CZ3 1 
ATOM   7930 C CH2 . TRP B 1 499 ? 115.421 -49.942 353.998 1.00 21.48  ? 500  TRP B CH2 1 
ATOM   7931 N N   . PRO B 1 500 ? 121.985 -52.054 349.997 1.00 27.01  ? 501  PRO B N   1 
ATOM   7932 C CA  . PRO B 1 500 ? 122.750 -51.158 349.128 1.00 29.73  ? 501  PRO B CA  1 
ATOM   7933 C C   . PRO B 1 500 ? 121.935 -49.938 348.745 1.00 29.01  ? 501  PRO B C   1 
ATOM   7934 O O   . PRO B 1 500 ? 120.695 -49.986 348.727 1.00 29.77  ? 501  PRO B O   1 
ATOM   7935 C CB  . PRO B 1 500 ? 123.051 -52.034 347.906 1.00 30.88  ? 501  PRO B CB  1 
ATOM   7936 C CG  . PRO B 1 500 ? 121.866 -52.936 347.822 1.00 31.49  ? 501  PRO B CG  1 
ATOM   7937 C CD  . PRO B 1 500 ? 121.403 -53.182 349.246 1.00 28.10  ? 501  PRO B CD  1 
ATOM   7938 N N   . PRO B 1 501 ? 122.592 -48.821 348.440 1.00 30.40  ? 502  PRO B N   1 
ATOM   7939 C CA  . PRO B 1 501 ? 121.855 -47.628 348.011 1.00 24.40  ? 502  PRO B CA  1 
ATOM   7940 C C   . PRO B 1 501 ? 121.179 -47.826 346.663 1.00 25.28  ? 502  PRO B C   1 
ATOM   7941 O O   . PRO B 1 501 ? 121.637 -48.592 345.812 1.00 23.42  ? 502  PRO B O   1 
ATOM   7942 C CB  . PRO B 1 501 ? 122.941 -46.548 347.928 1.00 24.44  ? 502  PRO B CB  1 
ATOM   7943 C CG  . PRO B 1 501 ? 124.045 -47.043 348.800 1.00 27.27  ? 502  PRO B CG  1 
ATOM   7944 C CD  . PRO B 1 501 ? 124.018 -48.537 348.673 1.00 24.82  ? 502  PRO B CD  1 
ATOM   7945 N N   . TYR B 1 502 ? 120.070 -47.113 346.482 1.00 22.44  ? 503  TYR B N   1 
ATOM   7946 C CA  . TYR B 1 502 ? 119.351 -47.111 345.216 1.00 22.32  ? 503  TYR B CA  1 
ATOM   7947 C C   . TYR B 1 502 ? 120.015 -46.136 344.250 1.00 24.12  ? 503  TYR B C   1 
ATOM   7948 O O   . TYR B 1 502 ? 120.337 -45.003 344.623 1.00 26.87  ? 503  TYR B O   1 
ATOM   7949 C CB  . TYR B 1 502 ? 117.887 -46.730 345.443 1.00 21.61  ? 503  TYR B CB  1 
ATOM   7950 C CG  . TYR B 1 502 ? 117.022 -46.732 344.200 1.00 25.71  ? 503  TYR B CG  1 
ATOM   7951 C CD1 . TYR B 1 502 ? 116.962 -45.620 343.367 1.00 24.32  ? 503  TYR B CD1 1 
ATOM   7952 C CD2 . TYR B 1 502 ? 116.251 -47.839 343.869 1.00 25.44  ? 503  TYR B CD2 1 
ATOM   7953 C CE1 . TYR B 1 502 ? 116.170 -45.616 342.234 1.00 25.95  ? 503  TYR B CE1 1 
ATOM   7954 C CE2 . TYR B 1 502 ? 115.454 -47.843 342.739 1.00 25.74  ? 503  TYR B CE2 1 
ATOM   7955 C CZ  . TYR B 1 502 ? 115.419 -46.730 341.926 1.00 24.59  ? 503  TYR B CZ  1 
ATOM   7956 O OH  . TYR B 1 502 ? 114.628 -46.731 340.800 1.00 29.22  ? 503  TYR B OH  1 
ATOM   7957 N N   . THR B 1 503 ? 120.224 -46.579 343.013 1.00 20.90  ? 504  THR B N   1 
ATOM   7958 C CA  . THR B 1 503 ? 120.805 -45.754 341.963 1.00 28.03  ? 504  THR B CA  1 
ATOM   7959 C C   . THR B 1 503 ? 119.940 -45.864 340.714 1.00 27.80  ? 504  THR B C   1 
ATOM   7960 O O   . THR B 1 503 ? 119.226 -46.850 340.521 1.00 27.48  ? 504  THR B O   1 
ATOM   7961 C CB  . THR B 1 503 ? 122.251 -46.174 341.648 1.00 32.33  ? 504  THR B CB  1 
ATOM   7962 O OG1 . THR B 1 503 ? 122.279 -47.556 341.271 1.00 35.54  ? 504  THR B OG1 1 
ATOM   7963 C CG2 . THR B 1 503 ? 123.145 -45.970 342.866 1.00 30.85  ? 504  THR B CG2 1 
ATOM   7964 N N   . ALA B 1 504 ? 120.003 -44.838 339.859 1.00 33.29  ? 505  ALA B N   1 
ATOM   7965 C CA  . ALA B 1 504 ? 119.142 -44.826 338.677 1.00 37.88  ? 505  ALA B CA  1 
ATOM   7966 C C   . ALA B 1 504 ? 119.452 -45.982 337.737 1.00 33.87  ? 505  ALA B C   1 
ATOM   7967 O O   . ALA B 1 504 ? 118.561 -46.457 337.024 1.00 34.12  ? 505  ALA B O   1 
ATOM   7968 C CB  . ALA B 1 504 ? 119.269 -43.499 337.928 1.00 34.99  ? 505  ALA B CB  1 
ATOM   7969 N N   . GLY B 1 505 ? 120.698 -46.449 337.719 1.00 34.59  ? 506  GLY B N   1 
ATOM   7970 C CA  . GLY B 1 505 ? 121.077 -47.554 336.862 1.00 31.95  ? 506  GLY B CA  1 
ATOM   7971 C C   . GLY B 1 505 ? 120.789 -48.913 337.466 1.00 33.11  ? 506  GLY B C   1 
ATOM   7972 O O   . GLY B 1 505 ? 120.019 -49.699 336.905 1.00 39.02  ? 506  GLY B O   1 
ATOM   7973 N N   . ALA B 1 506 ? 121.402 -49.203 338.617 1.00 33.48  ? 507  ALA B N   1 
ATOM   7974 C CA  . ALA B 1 506 ? 121.226 -50.513 339.236 1.00 27.40  ? 507  ALA B CA  1 
ATOM   7975 C C   . ALA B 1 506 ? 119.832 -50.677 339.832 1.00 26.21  ? 507  ALA B C   1 
ATOM   7976 O O   . ALA B 1 506 ? 119.305 -51.795 339.860 1.00 27.05  ? 507  ALA B O   1 
ATOM   7977 C CB  . ALA B 1 506 ? 122.294 -50.737 340.305 1.00 30.74  ? 507  ALA B CB  1 
ATOM   7978 N N   . GLN B 1 507 ? 119.233 -49.586 340.319 1.00 22.16  ? 508  GLN B N   1 
ATOM   7979 C CA  . GLN B 1 507 ? 117.848 -49.580 340.805 1.00 25.87  ? 508  GLN B CA  1 
ATOM   7980 C C   . GLN B 1 507 ? 117.623 -50.619 341.901 1.00 27.09  ? 508  GLN B C   1 
ATOM   7981 O O   . GLN B 1 507 ? 116.604 -51.312 341.924 1.00 29.28  ? 508  GLN B O   1 
ATOM   7982 C CB  . GLN B 1 507 ? 116.861 -49.786 339.655 1.00 26.54  ? 508  GLN B CB  1 
ATOM   7983 C CG  . GLN B 1 507 ? 116.959 -48.741 338.559 1.00 27.95  ? 508  GLN B CG  1 
ATOM   7984 C CD  . GLN B 1 507 ? 116.180 -49.127 337.317 1.00 32.03  ? 508  GLN B CD  1 
ATOM   7985 O OE1 . GLN B 1 507 ? 114.958 -49.269 337.356 1.00 30.33  ? 508  GLN B OE1 1 
ATOM   7986 N NE2 . GLN B 1 507 ? 116.886 -49.302 336.205 1.00 25.44  ? 508  GLN B NE2 1 
ATOM   7987 N N   . GLN B 1 508 ? 118.571 -50.720 342.826 1.00 24.05  ? 509  GLN B N   1 
ATOM   7988 C CA  . GLN B 1 508 ? 118.525 -51.748 343.855 1.00 23.25  ? 509  GLN B CA  1 
ATOM   7989 C C   . GLN B 1 508 ? 117.689 -51.303 345.047 1.00 22.64  ? 509  GLN B C   1 
ATOM   7990 O O   . GLN B 1 508 ? 117.754 -50.148 345.478 1.00 24.43  ? 509  GLN B O   1 
ATOM   7991 C CB  . GLN B 1 508 ? 119.935 -52.110 344.320 1.00 20.51  ? 509  GLN B CB  1 
ATOM   7992 C CG  . GLN B 1 508 ? 120.696 -52.986 343.345 1.00 25.81  ? 509  GLN B CG  1 
ATOM   7993 C CD  . GLN B 1 508 ? 122.142 -53.174 343.747 1.00 32.34  ? 509  GLN B CD  1 
ATOM   7994 O OE1 . GLN B 1 508 ? 122.596 -54.296 343.969 1.00 38.55  ? 509  GLN B OE1 1 
ATOM   7995 N NE2 . GLN B 1 508 ? 122.875 -52.071 343.851 1.00 31.39  ? 509  GLN B NE2 1 
ATOM   7996 N N   . TYR B 1 509 ? 116.902 -52.240 345.572 1.00 23.12  ? 510  TYR B N   1 
ATOM   7997 C CA  . TYR B 1 509 ? 116.125 -52.053 346.787 1.00 24.47  ? 510  TYR B CA  1 
ATOM   7998 C C   . TYR B 1 509 ? 116.099 -53.378 347.534 1.00 24.86  ? 510  TYR B C   1 
ATOM   7999 O O   . TYR B 1 509 ? 116.541 -54.409 347.021 1.00 28.38  ? 510  TYR B O   1 
ATOM   8000 C CB  . TYR B 1 509 ? 114.698 -51.578 346.482 1.00 24.94  ? 510  TYR B CB  1 
ATOM   8001 C CG  . TYR B 1 509 ? 113.876 -52.617 345.759 1.00 24.88  ? 510  TYR B CG  1 
ATOM   8002 C CD1 . TYR B 1 509 ? 113.957 -52.756 344.380 1.00 25.46  ? 510  TYR B CD1 1 
ATOM   8003 C CD2 . TYR B 1 509 ? 113.032 -53.472 346.455 1.00 27.12  ? 510  TYR B CD2 1 
ATOM   8004 C CE1 . TYR B 1 509 ? 113.216 -53.710 343.714 1.00 27.15  ? 510  TYR B CE1 1 
ATOM   8005 C CE2 . TYR B 1 509 ? 112.290 -54.431 345.798 1.00 28.46  ? 510  TYR B CE2 1 
ATOM   8006 C CZ  . TYR B 1 509 ? 112.383 -54.543 344.428 1.00 29.87  ? 510  TYR B CZ  1 
ATOM   8007 O OH  . TYR B 1 509 ? 111.642 -55.495 343.769 1.00 35.47  ? 510  TYR B OH  1 
ATOM   8008 N N   . VAL B 1 510 ? 115.564 -53.356 348.751 1.00 20.56  ? 511  VAL B N   1 
ATOM   8009 C CA  . VAL B 1 510 ? 115.465 -54.566 349.555 1.00 25.32  ? 511  VAL B CA  1 
ATOM   8010 C C   . VAL B 1 510 ? 114.002 -54.857 349.853 1.00 27.55  ? 511  VAL B C   1 
ATOM   8011 O O   . VAL B 1 510 ? 113.162 -53.953 349.920 1.00 25.55  ? 511  VAL B O   1 
ATOM   8012 C CB  . VAL B 1 510 ? 116.270 -54.472 350.871 1.00 27.64  ? 511  VAL B CB  1 
ATOM   8013 C CG1 . VAL B 1 510 ? 117.753 -54.315 350.579 1.00 27.12  ? 511  VAL B CG1 1 
ATOM   8014 C CG2 . VAL B 1 510 ? 115.752 -53.333 351.734 1.00 19.82  ? 511  VAL B CG2 1 
ATOM   8015 N N   . SER B 1 511 ? 113.705 -56.141 350.024 1.00 25.82  ? 512  SER B N   1 
ATOM   8016 C CA  . SER B 1 511 ? 112.405 -56.583 350.502 1.00 23.39  ? 512  SER B CA  1 
ATOM   8017 C C   . SER B 1 511 ? 112.460 -56.719 352.016 1.00 26.23  ? 512  SER B C   1 
ATOM   8018 O O   . SER B 1 511 ? 113.388 -57.329 352.557 1.00 29.56  ? 512  SER B O   1 
ATOM   8019 C CB  . SER B 1 511 ? 112.017 -57.916 349.865 1.00 26.72  ? 512  SER B CB  1 
ATOM   8020 O OG  . SER B 1 511 ? 112.913 -58.941 350.257 1.00 37.88  ? 512  SER B OG  1 
ATOM   8021 N N   . LEU B 1 512 ? 111.474 -56.146 352.697 1.00 27.01  ? 513  LEU B N   1 
ATOM   8022 C CA  . LEU B 1 512 ? 111.386 -56.206 354.151 1.00 25.74  ? 513  LEU B CA  1 
ATOM   8023 C C   . LEU B 1 512 ? 110.258 -57.158 354.524 1.00 27.74  ? 513  LEU B C   1 
ATOM   8024 O O   . LEU B 1 512 ? 109.082 -56.866 354.277 1.00 28.87  ? 513  LEU B O   1 
ATOM   8025 C CB  . LEU B 1 512 ? 111.162 -54.817 354.745 1.00 19.95  ? 513  LEU B CB  1 
ATOM   8026 C CG  . LEU B 1 512 ? 112.242 -53.772 354.453 1.00 23.79  ? 513  LEU B CG  1 
ATOM   8027 C CD1 . LEU B 1 512 ? 111.832 -52.409 354.983 1.00 21.07  ? 513  LEU B CD1 1 
ATOM   8028 C CD2 . LEU B 1 512 ? 113.564 -54.192 355.059 1.00 19.55  ? 513  LEU B CD2 1 
ATOM   8029 N N   . ASP B 1 513 ? 110.620 -58.300 355.100 1.00 26.34  ? 514  ASP B N   1 
ATOM   8030 C CA  . ASP B 1 513 ? 109.659 -59.251 355.644 1.00 32.49  ? 514  ASP B CA  1 
ATOM   8031 C C   . ASP B 1 513 ? 110.379 -60.079 356.708 1.00 33.03  ? 514  ASP B C   1 
ATOM   8032 O O   . ASP B 1 513 ? 111.456 -59.694 357.179 1.00 35.30  ? 514  ASP B O   1 
ATOM   8033 C CB  . ASP B 1 513 ? 109.036 -60.102 354.523 1.00 36.43  ? 514  ASP B CB  1 
ATOM   8034 C CG  . ASP B 1 513 ? 110.073 -60.786 353.649 1.00 45.67  ? 514  ASP B CG  1 
ATOM   8035 O OD1 . ASP B 1 513 ? 111.226 -60.961 354.094 1.00 49.50  ? 514  ASP B OD1 1 
ATOM   8036 O OD2 . ASP B 1 513 ? 109.729 -61.155 352.507 1.00 54.36  ? 514  ASP B OD2 1 
ATOM   8037 N N   . LEU B 1 514 ? 109.793 -61.219 357.080 1.00 33.04  ? 515  LEU B N   1 
ATOM   8038 C CA  . LEU B 1 514 ? 110.368 -62.025 358.152 1.00 35.42  ? 515  LEU B CA  1 
ATOM   8039 C C   . LEU B 1 514 ? 111.686 -62.667 357.739 1.00 39.06  ? 515  LEU B C   1 
ATOM   8040 O O   . LEU B 1 514 ? 112.520 -62.975 358.599 1.00 49.22  ? 515  LEU B O   1 
ATOM   8041 C CB  . LEU B 1 514 ? 109.368 -63.090 358.597 1.00 37.27  ? 515  LEU B CB  1 
ATOM   8042 C CG  . LEU B 1 514 ? 108.004 -62.547 359.026 1.00 39.89  ? 515  LEU B CG  1 
ATOM   8043 C CD1 . LEU B 1 514 ? 107.099 -63.670 359.508 1.00 38.54  ? 515  LEU B CD1 1 
ATOM   8044 C CD2 . LEU B 1 514 ? 108.171 -61.492 360.105 1.00 35.15  ? 515  LEU B CD2 1 
ATOM   8045 N N   . ARG B 1 515 ? 111.895 -62.875 356.445 1.00 35.05  ? 516  ARG B N   1 
ATOM   8046 C CA  . ARG B 1 515 ? 113.150 -63.411 355.950 1.00 36.24  ? 516  ARG B CA  1 
ATOM   8047 C C   . ARG B 1 515 ? 114.233 -62.337 355.981 1.00 37.96  ? 516  ARG B C   1 
ATOM   8048 O O   . ARG B 1 515 ? 113.931 -61.142 356.033 1.00 34.99  ? 516  ARG B O   1 
ATOM   8049 C CB  . ARG B 1 515 ? 112.970 -63.934 354.528 1.00 39.26  ? 516  ARG B CB  1 
ATOM   8050 C CG  . ARG B 1 515 ? 111.851 -64.949 354.366 1.00 51.39  ? 516  ARG B CG  1 
ATOM   8051 C CD  . ARG B 1 515 ? 111.363 -64.996 352.925 1.00 65.28  ? 516  ARG B CD  1 
ATOM   8052 N NE  . ARG B 1 515 ? 112.453 -64.833 351.965 1.00 78.04  ? 516  ARG B NE  1 
ATOM   8053 C CZ  . ARG B 1 515 ? 112.616 -63.764 351.191 1.00 80.23  ? 516  ARG B CZ  1 
ATOM   8054 N NH1 . ARG B 1 515 ? 111.761 -62.754 351.262 1.00 77.80  ? 516  ARG B NH1 1 
ATOM   8055 N NH2 . ARG B 1 515 ? 113.638 -63.704 350.348 1.00 80.24  ? 516  ARG B NH2 1 
ATOM   8056 N N   . PRO B 1 516 ? 115.507 -62.732 355.954 1.00 41.98  ? 517  PRO B N   1 
ATOM   8057 C CA  . PRO B 1 516 ? 116.583 -61.736 355.883 1.00 37.86  ? 517  PRO B CA  1 
ATOM   8058 C C   . PRO B 1 516 ? 116.458 -60.882 354.631 1.00 39.75  ? 517  PRO B C   1 
ATOM   8059 O O   . PRO B 1 516 ? 115.722 -61.196 353.693 1.00 39.92  ? 517  PRO B O   1 
ATOM   8060 C CB  . PRO B 1 516 ? 117.860 -62.584 355.859 1.00 39.77  ? 517  PRO B CB  1 
ATOM   8061 C CG  . PRO B 1 516 ? 117.459 -63.885 356.467 1.00 42.51  ? 517  PRO B CG  1 
ATOM   8062 C CD  . PRO B 1 516 ? 116.040 -64.103 356.036 1.00 39.53  ? 517  PRO B CD  1 
ATOM   8063 N N   . LEU B 1 517 ? 117.197 -59.773 354.631 1.00 34.08  ? 518  LEU B N   1 
ATOM   8064 C CA  . LEU B 1 517 ? 117.164 -58.851 353.504 1.00 32.32  ? 518  LEU B CA  1 
ATOM   8065 C C   . LEU B 1 517 ? 117.504 -59.566 352.204 1.00 34.09  ? 518  LEU B C   1 
ATOM   8066 O O   . LEU B 1 517 ? 118.448 -60.358 352.137 1.00 36.89  ? 518  LEU B O   1 
ATOM   8067 C CB  . LEU B 1 517 ? 118.144 -57.699 353.723 1.00 36.98  ? 518  LEU B CB  1 
ATOM   8068 C CG  . LEU B 1 517 ? 117.756 -56.622 354.731 1.00 39.07  ? 518  LEU B CG  1 
ATOM   8069 C CD1 . LEU B 1 517 ? 118.746 -55.471 354.677 1.00 40.61  ? 518  LEU B CD1 1 
ATOM   8070 C CD2 . LEU B 1 517 ? 116.358 -56.139 354.437 1.00 38.47  ? 518  LEU B CD2 1 
ATOM   8071 N N   . GLU B 1 518 ? 116.718 -59.287 351.169 1.00 33.21  ? 519  GLU B N   1 
ATOM   8072 C CA  . GLU B 1 518 ? 116.994 -59.755 349.819 1.00 33.97  ? 519  GLU B CA  1 
ATOM   8073 C C   . GLU B 1 518 ? 117.048 -58.547 348.897 1.00 27.41  ? 519  GLU B C   1 
ATOM   8074 O O   . GLU B 1 518 ? 116.142 -57.707 348.914 1.00 28.32  ? 519  GLU B O   1 
ATOM   8075 C CB  . GLU B 1 518 ? 115.933 -60.753 349.346 1.00 37.40  ? 519  GLU B CB  1 
ATOM   8076 C CG  . GLU B 1 518 ? 115.915 -60.970 347.842 1.00 61.10  ? 519  GLU B CG  1 
ATOM   8077 C CD  . GLU B 1 518 ? 114.789 -61.882 347.398 1.00 76.38  ? 519  GLU B CD  1 
ATOM   8078 O OE1 . GLU B 1 518 ? 114.413 -61.829 346.208 1.00 79.66  ? 519  GLU B OE1 1 
ATOM   8079 O OE2 . GLU B 1 518 ? 114.283 -62.655 348.238 1.00 81.54  ? 519  GLU B OE2 1 
ATOM   8080 N N   . VAL B 1 519 ? 118.113 -58.455 348.109 1.00 29.90  ? 520  VAL B N   1 
ATOM   8081 C CA  . VAL B 1 519 ? 118.323 -57.330 347.206 1.00 26.85  ? 520  VAL B CA  1 
ATOM   8082 C C   . VAL B 1 519 ? 117.687 -57.651 345.861 1.00 26.13  ? 520  VAL B C   1 
ATOM   8083 O O   . VAL B 1 519 ? 117.881 -58.745 345.316 1.00 33.74  ? 520  VAL B O   1 
ATOM   8084 C CB  . VAL B 1 519 ? 119.821 -57.024 347.049 1.00 28.54  ? 520  VAL B CB  1 
ATOM   8085 C CG1 . VAL B 1 519 ? 120.036 -55.908 346.036 1.00 28.64  ? 520  VAL B CG1 1 
ATOM   8086 C CG2 . VAL B 1 519 ? 120.430 -56.659 348.394 1.00 28.22  ? 520  VAL B CG2 1 
ATOM   8087 N N   . ARG B 1 520 ? 116.923 -56.701 345.327 1.00 33.94  ? 521  ARG B N   1 
ATOM   8088 C CA  . ARG B 1 520 ? 116.280 -56.837 344.029 1.00 33.10  ? 521  ARG B CA  1 
ATOM   8089 C C   . ARG B 1 520 ? 116.495 -55.560 343.228 1.00 31.37  ? 521  ARG B C   1 
ATOM   8090 O O   . ARG B 1 520 ? 116.920 -54.531 343.760 1.00 29.32  ? 521  ARG B O   1 
ATOM   8091 C CB  . ARG B 1 520 ? 114.784 -57.146 344.179 1.00 31.01  ? 521  ARG B CB  1 
ATOM   8092 C CG  . ARG B 1 520 ? 114.509 -58.371 345.036 1.00 35.68  ? 521  ARG B CG  1 
ATOM   8093 C CD  . ARG B 1 520 ? 113.034 -58.705 345.095 1.00 38.39  ? 521  ARG B CD  1 
ATOM   8094 N NE  . ARG B 1 520 ? 112.748 -59.686 346.137 1.00 43.89  ? 521  ARG B NE  1 
ATOM   8095 C CZ  . ARG B 1 520 ? 111.560 -59.843 346.709 1.00 44.08  ? 521  ARG B CZ  1 
ATOM   8096 N NH1 . ARG B 1 520 ? 110.539 -59.081 346.342 1.00 41.78  ? 521  ARG B NH1 1 
ATOM   8097 N NH2 . ARG B 1 520 ? 111.392 -60.761 347.650 1.00 47.65  ? 521  ARG B NH2 1 
ATOM   8098 N N   . ARG B 1 521 ? 116.203 -55.633 341.931 1.00 30.61  ? 522  ARG B N   1 
ATOM   8099 C CA  . ARG B 1 521 ? 116.414 -54.524 341.012 1.00 28.38  ? 522  ARG B CA  1 
ATOM   8100 C C   . ARG B 1 521 ? 115.091 -54.073 340.410 1.00 30.17  ? 522  ARG B C   1 
ATOM   8101 O O   . ARG B 1 521 ? 114.261 -54.900 340.018 1.00 33.34  ? 522  ARG B O   1 
ATOM   8102 C CB  . ARG B 1 521 ? 117.378 -54.905 339.882 1.00 27.10  ? 522  ARG B CB  1 
ATOM   8103 C CG  . ARG B 1 521 ? 118.794 -55.219 340.327 1.00 33.31  ? 522  ARG B CG  1 
ATOM   8104 C CD  . ARG B 1 521 ? 119.739 -55.286 339.132 1.00 36.79  ? 522  ARG B CD  1 
ATOM   8105 N NE  . ARG B 1 521 ? 119.800 -54.021 338.403 1.00 42.71  ? 522  ARG B NE  1 
ATOM   8106 C CZ  . ARG B 1 521 ? 119.542 -53.889 337.105 1.00 48.30  ? 522  ARG B CZ  1 
ATOM   8107 N NH1 . ARG B 1 521 ? 119.202 -54.947 336.381 1.00 52.04  ? 522  ARG B NH1 1 
ATOM   8108 N NH2 . ARG B 1 521 ? 119.624 -52.697 336.528 1.00 41.05  ? 522  ARG B NH2 1 
ATOM   8109 N N   . GLY B 1 522 ? 114.906 -52.758 340.333 1.00 28.64  ? 523  GLY B N   1 
ATOM   8110 C CA  . GLY B 1 522 ? 113.773 -52.190 339.632 1.00 31.91  ? 523  GLY B CA  1 
ATOM   8111 C C   . GLY B 1 522 ? 112.504 -52.068 340.448 1.00 29.58  ? 523  GLY B C   1 
ATOM   8112 O O   . GLY B 1 522 ? 111.900 -53.074 340.829 1.00 26.72  ? 523  GLY B O   1 
ATOM   8113 N N   . LEU B 1 523 ? 112.091 -50.829 340.722 1.00 29.33  ? 524  LEU B N   1 
ATOM   8114 C CA  . LEU B 1 523 ? 110.791 -50.557 341.333 1.00 28.50  ? 524  LEU B CA  1 
ATOM   8115 C C   . LEU B 1 523 ? 109.757 -50.508 340.212 1.00 31.23  ? 524  LEU B C   1 
ATOM   8116 O O   . LEU B 1 523 ? 109.301 -49.444 339.785 1.00 31.61  ? 524  LEU B O   1 
ATOM   8117 C CB  . LEU B 1 523 ? 110.818 -49.257 342.127 1.00 24.31  ? 524  LEU B CB  1 
ATOM   8118 C CG  . LEU B 1 523 ? 111.717 -49.181 343.362 1.00 29.43  ? 524  LEU B CG  1 
ATOM   8119 C CD1 . LEU B 1 523 ? 111.832 -47.740 343.836 1.00 27.93  ? 524  LEU B CD1 1 
ATOM   8120 C CD2 . LEU B 1 523 ? 111.184 -50.072 344.471 1.00 30.10  ? 524  LEU B CD2 1 
ATOM   8121 N N   . ARG B 1 524 ? 109.395 -51.694 339.726 1.00 29.06  ? 525  ARG B N   1 
ATOM   8122 C CA  . ARG B 1 524 ? 108.478 -51.855 338.600 1.00 31.69  ? 525  ARG B CA  1 
ATOM   8123 C C   . ARG B 1 524 ? 108.914 -50.978 337.427 1.00 28.21  ? 525  ARG B C   1 
ATOM   8124 O O   . ARG B 1 524 ? 108.190 -50.100 336.955 1.00 23.66  ? 525  ARG B O   1 
ATOM   8125 C CB  . ARG B 1 524 ? 107.041 -51.559 339.030 1.00 32.36  ? 525  ARG B CB  1 
ATOM   8126 C CG  . ARG B 1 524 ? 106.544 -52.552 340.060 1.00 36.69  ? 525  ARG B CG  1 
ATOM   8127 C CD  . ARG B 1 524 ? 105.050 -52.492 340.256 1.00 37.84  ? 525  ARG B CD  1 
ATOM   8128 N NE  . ARG B 1 524 ? 104.294 -52.418 339.011 1.00 56.60  ? 525  ARG B NE  1 
ATOM   8129 C CZ  . ARG B 1 524 ? 103.805 -53.474 338.368 1.00 54.49  ? 525  ARG B CZ  1 
ATOM   8130 N NH1 . ARG B 1 524 ? 104.009 -54.696 338.842 1.00 60.01  ? 525  ARG B NH1 1 
ATOM   8131 N NH2 . ARG B 1 524 ? 103.119 -53.309 337.246 1.00 40.96  ? 525  ARG B NH2 1 
ATOM   8132 N N   . ALA B 1 525 ? 110.142 -51.242 336.971 1.00 25.28  ? 526  ALA B N   1 
ATOM   8133 C CA  . ALA B 1 525 ? 110.788 -50.374 335.993 1.00 23.79  ? 526  ALA B CA  1 
ATOM   8134 C C   . ALA B 1 525 ? 109.999 -50.303 334.692 1.00 22.95  ? 526  ALA B C   1 
ATOM   8135 O O   . ALA B 1 525 ? 109.871 -49.227 334.095 1.00 28.65  ? 526  ALA B O   1 
ATOM   8136 C CB  . ALA B 1 525 ? 112.214 -50.858 335.732 1.00 18.59  ? 526  ALA B CB  1 
ATOM   8137 N N   . GLN B 1 526 ? 109.464 -51.437 334.234 1.00 28.72  ? 527  GLN B N   1 
ATOM   8138 C CA  . GLN B 1 526 ? 108.723 -51.443 332.976 1.00 26.86  ? 527  GLN B CA  1 
ATOM   8139 C C   . GLN B 1 526 ? 107.441 -50.630 333.089 1.00 29.04  ? 527  GLN B C   1 
ATOM   8140 O O   . GLN B 1 526 ? 107.127 -49.820 332.209 1.00 33.70  ? 527  GLN B O   1 
ATOM   8141 C CB  . GLN B 1 526 ? 108.413 -52.878 332.549 1.00 26.89  ? 527  GLN B CB  1 
ATOM   8142 C CG  . GLN B 1 526 ? 109.636 -53.771 332.434 1.00 35.56  ? 527  GLN B CG  1 
ATOM   8143 C CD  . GLN B 1 526 ? 110.673 -53.222 331.473 1.00 38.38  ? 527  GLN B CD  1 
ATOM   8144 O OE1 . GLN B 1 526 ? 110.337 -52.640 330.442 1.00 41.27  ? 527  GLN B OE1 1 
ATOM   8145 N NE2 . GLN B 1 526 ? 111.944 -53.409 331.807 1.00 45.41  ? 527  GLN B NE2 1 
ATOM   8146 N N   . ALA B 1 527 ? 106.685 -50.831 334.170 1.00 28.97  ? 528  ALA B N   1 
ATOM   8147 C CA  . ALA B 1 527 ? 105.446 -50.081 334.344 1.00 27.01  ? 528  ALA B CA  1 
ATOM   8148 C C   . ALA B 1 527 ? 105.721 -48.601 334.568 1.00 26.76  ? 528  ALA B C   1 
ATOM   8149 O O   . ALA B 1 527 ? 105.000 -47.743 334.044 1.00 32.78  ? 528  ALA B O   1 
ATOM   8150 C CB  . ALA B 1 527 ? 104.641 -50.655 335.509 1.00 31.36  ? 528  ALA B CB  1 
ATOM   8151 N N   . CYS B 1 528 ? 106.758 -48.277 335.339 1.00 20.67  ? 529  CYS B N   1 
ATOM   8152 C CA  . CYS B 1 528 ? 106.993 -46.881 335.670 1.00 24.51  ? 529  CYS B CA  1 
ATOM   8153 C C   . CYS B 1 528 ? 107.695 -46.125 334.550 1.00 27.08  ? 529  CYS B C   1 
ATOM   8154 O O   . CYS B 1 528 ? 107.648 -44.891 334.539 1.00 22.31  ? 529  CYS B O   1 
ATOM   8155 C CB  . CYS B 1 528 ? 107.777 -46.790 336.981 1.00 27.67  ? 529  CYS B CB  1 
ATOM   8156 S SG  . CYS B 1 528 ? 106.833 -47.358 338.433 1.00 27.22  ? 529  CYS B SG  1 
ATOM   8157 N N   . ALA B 1 529 ? 108.328 -46.827 333.606 1.00 23.20  ? 530  ALA B N   1 
ATOM   8158 C CA  . ALA B 1 529 ? 108.776 -46.158 332.390 1.00 24.12  ? 530  ALA B CA  1 
ATOM   8159 C C   . ALA B 1 529 ? 107.593 -45.575 331.628 1.00 24.69  ? 530  ALA B C   1 
ATOM   8160 O O   . ALA B 1 529 ? 107.694 -44.490 331.046 1.00 23.65  ? 530  ALA B O   1 
ATOM   8161 C CB  . ALA B 1 529 ? 109.560 -47.125 331.502 1.00 19.48  ? 530  ALA B CB  1 
ATOM   8162 N N   . PHE B 1 530 ? 106.459 -46.278 331.628 1.00 21.23  ? 531  PHE B N   1 
ATOM   8163 C CA  . PHE B 1 530 ? 105.270 -45.763 330.958 1.00 23.85  ? 531  PHE B CA  1 
ATOM   8164 C C   . PHE B 1 530 ? 104.734 -44.524 331.668 1.00 23.38  ? 531  PHE B C   1 
ATOM   8165 O O   . PHE B 1 530 ? 104.467 -43.499 331.030 1.00 25.54  ? 531  PHE B O   1 
ATOM   8166 C CB  . PHE B 1 530 ? 104.201 -46.855 330.880 1.00 23.49  ? 531  PHE B CB  1 
ATOM   8167 C CG  . PHE B 1 530 ? 102.800 -46.328 330.724 1.00 27.06  ? 531  PHE B CG  1 
ATOM   8168 C CD1 . PHE B 1 530 ? 101.930 -46.303 331.802 1.00 26.50  ? 531  PHE B CD1 1 
ATOM   8169 C CD2 . PHE B 1 530 ? 102.355 -45.858 329.499 1.00 30.52  ? 531  PHE B CD2 1 
ATOM   8170 C CE1 . PHE B 1 530 ? 100.643 -45.819 331.661 1.00 28.33  ? 531  PHE B CE1 1 
ATOM   8171 C CE2 . PHE B 1 530 ? 101.068 -45.373 329.352 1.00 33.58  ? 531  PHE B CE2 1 
ATOM   8172 C CZ  . PHE B 1 530 ? 100.211 -45.354 330.435 1.00 32.31  ? 531  PHE B CZ  1 
ATOM   8173 N N   . TRP B 1 531 ? 104.471 -44.603 332.966 1.00 17.02  ? 532  TRP B N   1 
ATOM   8174 C CA  . TRP B 1 531 ? 103.925 -43.421 333.629 1.00 19.79  ? 532  TRP B CA  1 
ATOM   8175 C C   . TRP B 1 531 ? 104.902 -42.245 333.664 1.00 20.07  ? 532  TRP B C   1 
ATOM   8176 O O   . TRP B 1 531 ? 104.545 -41.106 333.361 1.00 26.60  ? 532  TRP B O   1 
ATOM   8177 C CB  . TRP B 1 531 ? 103.475 -43.767 335.051 1.00 20.53  ? 532  TRP B CB  1 
ATOM   8178 C CG  . TRP B 1 531 ? 102.429 -44.839 335.105 1.00 21.51  ? 532  TRP B CG  1 
ATOM   8179 C CD1 . TRP B 1 531 ? 102.638 -46.182 335.221 1.00 19.99  ? 532  TRP B CD1 1 
ATOM   8180 C CD2 . TRP B 1 531 ? 101.010 -44.656 335.044 1.00 16.68  ? 532  TRP B CD2 1 
ATOM   8181 N NE1 . TRP B 1 531 ? 101.436 -46.848 335.236 1.00 20.26  ? 532  TRP B NE1 1 
ATOM   8182 C CE2 . TRP B 1 531 ? 100.421 -45.934 335.129 1.00 20.88  ? 532  TRP B CE2 1 
ATOM   8183 C CE3 . TRP B 1 531 ? 100.179 -43.538 334.926 1.00 19.75  ? 532  TRP B CE3 1 
ATOM   8184 C CZ2 . TRP B 1 531 ? 99.041  -46.123 335.100 1.00 22.11  ? 532  TRP B CZ2 1 
ATOM   8185 C CZ3 . TRP B 1 531 ? 98.809  -43.728 334.897 1.00 21.18  ? 532  TRP B CZ3 1 
ATOM   8186 C CH2 . TRP B 1 531 ? 98.254  -45.010 334.983 1.00 18.31  ? 532  TRP B CH2 1 
ATOM   8187 N N   . ASN B 1 532 ? 106.138 -42.549 334.040 1.00 18.64  ? 533  ASN B N   1 
ATOM   8188 C CA  . ASN B 1 532 ? 107.225 -41.575 334.148 1.00 25.25  ? 533  ASN B CA  1 
ATOM   8189 C C   . ASN B 1 532 ? 107.831 -40.933 332.893 1.00 27.98  ? 533  ASN B C   1 
ATOM   8190 O O   . ASN B 1 532 ? 108.177 -39.752 332.896 1.00 33.52  ? 533  ASN B O   1 
ATOM   8191 C CB  . ASN B 1 532 ? 108.355 -42.158 335.006 1.00 16.60  ? 533  ASN B CB  1 
ATOM   8192 C CG  . ASN B 1 532 ? 107.901 -42.502 336.411 1.00 23.00  ? 533  ASN B CG  1 
ATOM   8193 O OD1 . ASN B 1 532 ? 106.737 -42.311 336.764 1.00 25.33  ? 533  ASN B OD1 1 
ATOM   8194 N ND2 . ASN B 1 532 ? 108.820 -43.013 337.222 1.00 16.36  ? 533  ASN B ND2 1 
ATOM   8195 N N   . ARG B 1 533 ? 107.985 -41.728 331.839 1.00 25.51  ? 534  ARG B N   1 
ATOM   8196 C CA  . ARG B 1 533 ? 108.663 -41.295 330.623 1.00 27.92  ? 534  ARG B CA  1 
ATOM   8197 C C   . ARG B 1 533 ? 107.721 -41.086 329.448 1.00 31.92  ? 534  ARG B C   1 
ATOM   8198 O O   . ARG B 1 533 ? 107.817 -40.066 328.758 1.00 34.88  ? 534  ARG B O   1 
ATOM   8199 C CB  . ARG B 1 533 ? 109.753 -42.305 330.237 1.00 26.60  ? 534  ARG B CB  1 
ATOM   8200 C CG  . ARG B 1 533 ? 110.781 -42.531 331.325 1.00 29.47  ? 534  ARG B CG  1 
ATOM   8201 C CD  . ARG B 1 533 ? 111.726 -43.665 330.978 1.00 30.14  ? 534  ARG B CD  1 
ATOM   8202 N NE  . ARG B 1 533 ? 112.616 -43.965 332.095 1.00 38.33  ? 534  ARG B NE  1 
ATOM   8203 C CZ  . ARG B 1 533 ? 113.781 -43.361 332.299 1.00 44.95  ? 534  ARG B CZ  1 
ATOM   8204 N NH1 . ARG B 1 533 ? 114.200 -42.425 331.458 1.00 40.16  ? 534  ARG B NH1 1 
ATOM   8205 N NH2 . ARG B 1 533 ? 114.527 -43.692 333.344 1.00 47.27  ? 534  ARG B NH2 1 
ATOM   8206 N N   . PHE B 1 534 ? 106.809 -42.022 329.191 1.00 29.68  ? 535  PHE B N   1 
ATOM   8207 C CA  . PHE B 1 534 ? 105.980 -41.919 327.994 1.00 27.13  ? 535  PHE B CA  1 
ATOM   8208 C C   . PHE B 1 534 ? 104.736 -41.062 328.209 1.00 28.58  ? 535  PHE B C   1 
ATOM   8209 O O   . PHE B 1 534 ? 104.507 -40.101 327.468 1.00 27.82  ? 535  PHE B O   1 
ATOM   8210 C CB  . PHE B 1 534 ? 105.557 -43.300 327.495 1.00 22.08  ? 535  PHE B CB  1 
ATOM   8211 C CG  . PHE B 1 534 ? 104.755 -43.238 326.235 1.00 28.47  ? 535  PHE B CG  1 
ATOM   8212 C CD1 . PHE B 1 534 ? 105.357 -42.857 325.050 1.00 26.31  ? 535  PHE B CD1 1 
ATOM   8213 C CD2 . PHE B 1 534 ? 103.396 -43.502 326.239 1.00 29.05  ? 535  PHE B CD2 1 
ATOM   8214 C CE1 . PHE B 1 534 ? 104.628 -42.767 323.887 1.00 30.35  ? 535  PHE B CE1 1 
ATOM   8215 C CE2 . PHE B 1 534 ? 102.660 -43.416 325.072 1.00 27.16  ? 535  PHE B CE2 1 
ATOM   8216 C CZ  . PHE B 1 534 ? 103.279 -43.050 323.894 1.00 26.90  ? 535  PHE B CZ  1 
ATOM   8217 N N   . LEU B 1 535 ? 103.917 -41.417 329.199 1.00 27.79  ? 536  LEU B N   1 
ATOM   8218 C CA  . LEU B 1 535 ? 102.620 -40.763 329.353 1.00 31.39  ? 536  LEU B CA  1 
ATOM   8219 C C   . LEU B 1 535 ? 102.698 -39.243 329.470 1.00 34.98  ? 536  LEU B C   1 
ATOM   8220 O O   . LEU B 1 535 ? 101.789 -38.573 328.949 1.00 37.31  ? 536  LEU B O   1 
ATOM   8221 C CB  . LEU B 1 535 ? 101.876 -41.361 330.554 1.00 30.24  ? 536  LEU B CB  1 
ATOM   8222 C CG  . LEU B 1 535 ? 100.414 -40.917 330.653 1.00 40.87  ? 536  LEU B CG  1 
ATOM   8223 C CD1 . LEU B 1 535 ? 99.684  -41.198 329.346 1.00 41.89  ? 536  LEU B CD1 1 
ATOM   8224 C CD2 . LEU B 1 535 ? 99.712  -41.596 331.813 1.00 39.51  ? 536  LEU B CD2 1 
ATOM   8225 N N   . PRO B 1 536 ? 103.703 -38.638 330.119 1.00 36.69  ? 537  PRO B N   1 
ATOM   8226 C CA  . PRO B 1 536 ? 103.800 -37.169 330.054 1.00 35.32  ? 537  PRO B CA  1 
ATOM   8227 C C   . PRO B 1 536 ? 103.911 -36.637 328.635 1.00 38.93  ? 537  PRO B C   1 
ATOM   8228 O O   . PRO B 1 536 ? 103.254 -35.643 328.299 1.00 37.48  ? 537  PRO B O   1 
ATOM   8229 C CB  . PRO B 1 536 ? 105.059 -36.868 330.878 1.00 35.95  ? 537  PRO B CB  1 
ATOM   8230 C CG  . PRO B 1 536 ? 105.144 -37.993 331.836 1.00 34.60  ? 537  PRO B CG  1 
ATOM   8231 C CD  . PRO B 1 536 ? 104.679 -39.197 331.073 1.00 37.08  ? 537  PRO B CD  1 
ATOM   8232 N N   . LYS B 1 537 ? 104.725 -37.275 327.789 1.00 41.53  ? 538  LYS B N   1 
ATOM   8233 C CA  . LYS B 1 537 ? 104.822 -36.856 326.393 1.00 34.32  ? 538  LYS B CA  1 
ATOM   8234 C C   . LYS B 1 537 ? 103.483 -37.000 325.684 1.00 37.30  ? 538  LYS B C   1 
ATOM   8235 O O   . LYS B 1 537 ? 103.096 -36.138 324.886 1.00 41.39  ? 538  LYS B O   1 
ATOM   8236 C CB  . LYS B 1 537 ? 105.887 -37.679 325.670 1.00 33.79  ? 538  LYS B CB  1 
ATOM   8237 C CG  . LYS B 1 537 ? 107.283 -37.570 326.250 1.00 35.71  ? 538  LYS B CG  1 
ATOM   8238 C CD  . LYS B 1 537 ? 108.271 -38.313 325.370 1.00 41.13  ? 538  LYS B CD  1 
ATOM   8239 C CE  . LYS B 1 537 ? 109.708 -38.051 325.784 1.00 49.99  ? 538  LYS B CE  1 
ATOM   8240 N NZ  . LYS B 1 537 ? 110.022 -38.650 327.110 1.00 53.45  ? 538  LYS B NZ  1 
ATOM   8241 N N   . LEU B 1 538 ? 102.771 -38.095 325.957 1.00 45.98  ? 539  LEU B N   1 
ATOM   8242 C CA  . LEU B 1 538 ? 101.451 -38.310 325.373 1.00 42.23  ? 539  LEU B CA  1 
ATOM   8243 C C   . LEU B 1 538 ? 100.501 -37.177 325.741 1.00 48.44  ? 539  LEU B C   1 
ATOM   8244 O O   . LEU B 1 538 ? 99.781  -36.649 324.886 1.00 54.04  ? 539  LEU B O   1 
ATOM   8245 C CB  . LEU B 1 538 ? 100.905 -39.662 325.843 1.00 33.96  ? 539  LEU B CB  1 
ATOM   8246 C CG  . LEU B 1 538 ? 99.682  -40.330 325.205 1.00 34.70  ? 539  LEU B CG  1 
ATOM   8247 C CD1 . LEU B 1 538 ? 98.373  -39.690 325.654 1.00 38.28  ? 539  LEU B CD1 1 
ATOM   8248 C CD2 . LEU B 1 538 ? 99.791  -40.335 323.688 1.00 41.51  ? 539  LEU B CD2 1 
ATOM   8249 N N   . LEU B 1 539 ? 100.492 -36.785 327.017 1.00 55.62  ? 540  LEU B N   1 
ATOM   8250 C CA  . LEU B 1 539 ? 99.560  -35.759 327.470 1.00 61.86  ? 540  LEU B CA  1 
ATOM   8251 C C   . LEU B 1 539 ? 99.919  -34.382 326.923 1.00 69.62  ? 540  LEU B C   1 
ATOM   8252 O O   . LEU B 1 539 ? 99.036  -33.535 326.755 1.00 75.64  ? 540  LEU B O   1 
ATOM   8253 C CB  . LEU B 1 539 ? 99.510  -35.740 328.998 1.00 55.67  ? 540  LEU B CB  1 
ATOM   8254 C CG  . LEU B 1 539 ? 98.920  -37.006 329.625 1.00 55.15  ? 540  LEU B CG  1 
ATOM   8255 C CD1 . LEU B 1 539 ? 98.869  -36.906 331.142 1.00 54.16  ? 540  LEU B CD1 1 
ATOM   8256 C CD2 . LEU B 1 539 ? 97.536  -37.286 329.060 1.00 51.17  ? 540  LEU B CD2 1 
ATOM   8257 N N   . SER B 1 540 ? 101.201 -34.145 326.629 1.00 69.21  ? 541  SER B N   1 
ATOM   8258 C CA  . SER B 1 540 ? 101.608 -32.848 326.097 1.00 69.59  ? 541  SER B CA  1 
ATOM   8259 C C   . SER B 1 540 ? 101.119 -32.641 324.669 1.00 72.45  ? 541  SER B C   1 
ATOM   8260 O O   . SER B 1 540 ? 100.950 -31.496 324.234 1.00 76.75  ? 541  SER B O   1 
ATOM   8261 C CB  . SER B 1 540 ? 103.129 -32.709 326.157 1.00 71.88  ? 541  SER B CB  1 
ATOM   8262 O OG  . SER B 1 540 ? 103.553 -32.269 327.436 1.00 77.97  ? 541  SER B OG  1 
ATOM   8263 N N   . ALA B 1 541 ? 100.889 -33.721 323.930 1.00 72.82  ? 542  ALA B N   1 
ATOM   8264 C CA  . ALA B 1 541 ? 100.447 -33.619 322.543 1.00 75.79  ? 542  ALA B CA  1 
ATOM   8265 C C   . ALA B 1 541 ? 98.956  -33.309 322.461 1.00 81.59  ? 542  ALA B C   1 
ATOM   8266 O O   . ALA B 1 541 ? 98.120  -34.110 322.880 1.00 83.47  ? 542  ALA B O   1 
ATOM   8267 C CB  . ALA B 1 541 ? 100.765 -34.901 321.791 1.00 69.43  ? 542  ALA B CB  1 
HETATM 8268 C C1  . NAG C 2 .   ? 45.243  -4.334  335.081 1.00 47.03  ? 1    NAG C C1  1 
HETATM 8269 C C2  . NAG C 2 .   ? 45.950  -3.160  334.411 1.00 64.16  ? 1    NAG C C2  1 
HETATM 8270 C C3  . NAG C 2 .   ? 47.430  -3.129  334.761 1.00 66.74  ? 1    NAG C C3  1 
HETATM 8271 C C4  . NAG C 2 .   ? 47.605  -3.196  336.270 1.00 71.32  ? 1    NAG C C4  1 
HETATM 8272 C C5  . NAG C 2 .   ? 46.872  -4.409  336.827 1.00 66.44  ? 1    NAG C C5  1 
HETATM 8273 C C6  . NAG C 2 .   ? 47.019  -4.484  338.342 1.00 76.03  ? 1    NAG C C6  1 
HETATM 8274 C C7  . NAG C 2 .   ? 44.674  -2.804  332.377 1.00 80.28  ? 1    NAG C C7  1 
HETATM 8275 C C8  . NAG C 2 .   ? 44.044  -1.584  332.982 1.00 78.63  ? 1    NAG C C8  1 
HETATM 8276 N N2  . NAG C 2 .   ? 45.783  -3.234  332.972 1.00 72.59  ? 1    NAG C N2  1 
HETATM 8277 O O3  . NAG C 2 .   ? 48.018  -1.923  334.262 1.00 67.61  ? 1    NAG C O3  1 
HETATM 8278 O O4  . NAG C 2 .   ? 48.998  -3.289  336.588 1.00 83.25  ? 1    NAG C O4  1 
HETATM 8279 O O5  . NAG C 2 .   ? 45.486  -4.346  336.489 1.00 52.99  ? 1    NAG C O5  1 
HETATM 8280 O O6  . NAG C 2 .   ? 46.327  -3.384  338.944 1.00 83.74  ? 1    NAG C O6  1 
HETATM 8281 O O7  . NAG C 2 .   ? 44.199  -3.365  331.404 1.00 84.72  ? 1    NAG C O7  1 
HETATM 8282 C C1  . NAG C 2 .   ? 49.336  -2.227  337.498 1.00 95.80  ? 2    NAG C C1  1 
HETATM 8283 C C2  . NAG C 2 .   ? 50.706  -2.517  338.138 1.00 99.10  ? 2    NAG C C2  1 
HETATM 8284 C C3  . NAG C 2 .   ? 51.134  -1.365  339.056 1.00 105.15 ? 2    NAG C C3  1 
HETATM 8285 C C4  . NAG C 2 .   ? 51.022  -0.024  338.344 1.00 106.80 ? 2    NAG C C4  1 
HETATM 8286 C C5  . NAG C 2 .   ? 49.623  0.137   337.759 1.00 105.41 ? 2    NAG C C5  1 
HETATM 8287 C C6  . NAG C 2 .   ? 49.441  1.422   336.983 1.00 105.56 ? 2    NAG C C6  1 
HETATM 8288 C C7  . NAG C 2 .   ? 50.911  -4.955  338.328 1.00 92.44  ? 2    NAG C C7  1 
HETATM 8289 C C8  . NAG C 2 .   ? 50.824  -6.141  339.238 1.00 92.72  ? 2    NAG C C8  1 
HETATM 8290 N N2  . NAG C 2 .   ? 50.671  -3.763  338.886 1.00 97.19  ? 2    NAG C N2  1 
HETATM 8291 O O3  . NAG C 2 .   ? 52.477  -1.590  339.479 1.00 106.03 ? 2    NAG C O3  1 
HETATM 8292 O O4  . NAG C 2 .   ? 51.285  1.038   339.256 1.00 107.95 ? 2    NAG C O4  1 
HETATM 8293 O O5  . NAG C 2 .   ? 49.365  -0.945  336.853 1.00 102.81 ? 2    NAG C O5  1 
HETATM 8294 O O6  . NAG C 2 .   ? 50.220  1.408   335.794 1.00 106.68 ? 2    NAG C O6  1 
HETATM 8295 O O7  . NAG C 2 .   ? 51.188  -5.068  337.138 1.00 89.13  ? 2    NAG C O7  1 
HETATM 8296 C C1  . FUC C 2 .   ? 45.974  -3.042  340.038 1.00 87.88  ? 3    FUC C C1  1 
HETATM 8297 C C2  . FUC C 2 .   ? 45.856  -1.528  340.337 1.00 91.73  ? 3    FUC C C2  1 
HETATM 8298 C C3  . FUC C 2 .   ? 45.034  -0.812  339.249 1.00 96.33  ? 3    FUC C C3  1 
HETATM 8299 C C4  . FUC C 2 .   ? 43.685  -1.511  339.047 1.00 94.72  ? 3    FUC C C4  1 
HETATM 8300 C C5  . FUC C 2 .   ? 43.926  -2.992  338.752 1.00 88.46  ? 3    FUC C C5  1 
HETATM 8301 C C6  . FUC C 2 .   ? 42.654  -3.807  338.627 1.00 87.28  ? 3    FUC C C6  1 
HETATM 8302 O O2  . FUC C 2 .   ? 47.133  -0.914  340.482 1.00 89.42  ? 3    FUC C O2  1 
HETATM 8303 O O3  . FUC C 2 .   ? 44.769  0.533   339.632 1.00 100.51 ? 3    FUC C O3  1 
HETATM 8304 O O4  . FUC C 2 .   ? 42.900  -1.381  340.220 1.00 96.89  ? 3    FUC C O4  1 
HETATM 8305 O O5  . FUC C 2 .   ? 44.712  -3.616  339.796 1.00 86.50  ? 3    FUC C O5  1 
HETATM 8306 C C1  . NAG D 2 .   ? 81.198  -58.221 345.062 1.00 65.33  ? 1    NAG D C1  1 
HETATM 8307 C C2  . NAG D 2 .   ? 80.499  -58.579 343.754 1.00 69.06  ? 1    NAG D C2  1 
HETATM 8308 C C3  . NAG D 2 .   ? 80.253  -57.343 342.900 1.00 66.59  ? 1    NAG D C3  1 
HETATM 8309 C C4  . NAG D 2 .   ? 79.545  -56.280 343.724 1.00 69.10  ? 1    NAG D C4  1 
HETATM 8310 C C5  . NAG D 2 .   ? 80.334  -55.994 344.994 1.00 67.97  ? 1    NAG D C5  1 
HETATM 8311 C C6  . NAG D 2 .   ? 79.631  -54.942 345.844 1.00 73.57  ? 1    NAG D C6  1 
HETATM 8312 C C7  . NAG D 2 .   ? 81.248  -60.841 343.298 1.00 80.67  ? 1    NAG D C7  1 
HETATM 8313 C C8  . NAG D 2 .   ? 79.891  -61.389 343.627 1.00 77.64  ? 1    NAG D C8  1 
HETATM 8314 N N2  . NAG D 2 .   ? 81.292  -59.543 343.015 1.00 76.36  ? 1    NAG D N2  1 
HETATM 8315 O O3  . NAG D 2 .   ? 79.447  -57.693 341.770 1.00 66.81  ? 1    NAG D O3  1 
HETATM 8316 O O4  . NAG D 2 .   ? 79.421  -55.079 342.954 1.00 78.10  ? 1    NAG D O4  1 
HETATM 8317 O O5  . NAG D 2 .   ? 80.492  -57.191 345.757 1.00 67.06  ? 1    NAG D O5  1 
HETATM 8318 O O6  . NAG D 2 .   ? 78.395  -55.473 346.336 1.00 83.85  ? 1    NAG D O6  1 
HETATM 8319 O O7  . NAG D 2 .   ? 82.247  -61.542 343.292 1.00 85.79  ? 1    NAG D O7  1 
HETATM 8320 C C1  . NAG D 2 .   ? 78.066  -54.606 343.053 1.00 91.94  ? 2    NAG D C1  1 
HETATM 8321 C C2  . NAG D 2 .   ? 77.965  -53.219 342.426 1.00 98.68  ? 2    NAG D C2  1 
HETATM 8322 C C3  . NAG D 2 .   ? 76.534  -52.700 342.451 1.00 102.61 ? 2    NAG D C3  1 
HETATM 8323 C C4  . NAG D 2 .   ? 75.599  -53.737 341.847 1.00 105.14 ? 2    NAG D C4  1 
HETATM 8324 C C5  . NAG D 2 .   ? 75.775  -55.072 342.557 1.00 101.48 ? 2    NAG D C5  1 
HETATM 8325 C C6  . NAG D 2 .   ? 74.858  -56.132 341.957 1.00 100.67 ? 2    NAG D C6  1 
HETATM 8326 C C7  . NAG D 2 .   ? 80.140  -52.233 342.853 1.00 99.99  ? 2    NAG D C7  1 
HETATM 8327 C C8  . NAG D 2 .   ? 80.980  -51.517 343.869 1.00 98.88  ? 2    NAG D C8  1 
HETATM 8328 N N2  . NAG D 2 .   ? 78.839  -52.294 343.121 1.00 99.96  ? 2    NAG D N2  1 
HETATM 8329 O O3  . NAG D 2 .   ? 76.450  -51.484 341.701 1.00 102.47 ? 2    NAG D O3  1 
HETATM 8330 O O4  . NAG D 2 .   ? 74.244  -53.296 341.982 1.00 106.66 ? 2    NAG D O4  1 
HETATM 8331 O O5  . NAG D 2 .   ? 77.131  -55.509 342.458 1.00 96.86  ? 2    NAG D O5  1 
HETATM 8332 O O6  . NAG D 2 .   ? 74.929  -57.326 342.744 1.00 100.11 ? 2    NAG D O6  1 
HETATM 8333 O O7  . NAG D 2 .   ? 80.620  -52.726 341.845 1.00 101.32 ? 2    NAG D O7  1 
HETATM 8334 C C1  . FUC D 2 .   ? 78.237  -55.077 347.710 1.00 85.82  ? 3    FUC D C1  1 
HETATM 8335 C C2  . FUC D 2 .   ? 76.765  -55.176 348.101 1.00 87.26  ? 3    FUC D C2  1 
HETATM 8336 C C3  . FUC D 2 .   ? 76.319  -56.626 348.223 1.00 88.47  ? 3    FUC D C3  1 
HETATM 8337 C C4  . FUC D 2 .   ? 77.269  -57.381 349.140 1.00 85.15  ? 3    FUC D C4  1 
HETATM 8338 C C5  . FUC D 2 .   ? 78.701  -57.226 348.647 1.00 82.98  ? 3    FUC D C5  1 
HETATM 8339 C C6  . FUC D 2 .   ? 79.673  -57.964 349.560 1.00 80.68  ? 3    FUC D C6  1 
HETATM 8340 O O2  . FUC D 2 .   ? 75.963  -54.511 347.119 1.00 85.01  ? 3    FUC D O2  1 
HETATM 8341 O O3  . FUC D 2 .   ? 74.992  -56.678 348.757 1.00 91.61  ? 3    FUC D O3  1 
HETATM 8342 O O4  . FUC D 2 .   ? 77.161  -56.866 350.471 1.00 85.23  ? 3    FUC D O4  1 
HETATM 8343 O O5  . FUC D 2 .   ? 79.057  -55.844 348.594 1.00 84.87  ? 3    FUC D O5  1 
HETATM 8344 C C1  . NAG E 3 .   ? 78.386  -23.507 370.353 1.00 83.56  ? 604  NAG A C1  1 
HETATM 8345 C C2  . NAG E 3 .   ? 79.674  -24.327 370.341 1.00 95.73  ? 604  NAG A C2  1 
HETATM 8346 C C3  . NAG E 3 .   ? 79.494  -25.661 371.054 1.00 98.98  ? 604  NAG A C3  1 
HETATM 8347 C C4  . NAG E 3 .   ? 78.883  -25.438 372.429 1.00 97.98  ? 604  NAG A C4  1 
HETATM 8348 C C5  . NAG E 3 .   ? 77.599  -24.630 372.307 1.00 95.52  ? 604  NAG A C5  1 
HETATM 8349 C C6  . NAG E 3 .   ? 76.978  -24.385 373.677 1.00 97.67  ? 604  NAG A C6  1 
HETATM 8350 C C7  . NAG E 3 .   ? 81.020  -25.448 368.650 1.00 103.27 ? 604  NAG A C7  1 
HETATM 8351 C C8  . NAG E 3 .   ? 80.490  -26.711 368.039 1.00 102.45 ? 604  NAG A C8  1 
HETATM 8352 N N2  . NAG E 3 .   ? 80.107  -24.536 368.971 1.00 102.50 ? 604  NAG A N2  1 
HETATM 8353 O O3  . NAG E 3 .   ? 80.764  -26.306 371.201 1.00 101.27 ? 604  NAG A O3  1 
HETATM 8354 O O4  . NAG E 3 .   ? 78.598  -26.702 373.037 1.00 96.79  ? 604  NAG A O4  1 
HETATM 8355 O O5  . NAG E 3 .   ? 77.867  -23.376 371.677 1.00 88.75  ? 604  NAG A O5  1 
HETATM 8356 O O6  . NAG E 3 .   ? 75.700  -23.759 373.518 1.00 97.76  ? 604  NAG A O6  1 
HETATM 8357 O O7  . NAG E 3 .   ? 82.212  -25.268 368.839 1.00 102.10 ? 604  NAG A O7  1 
HETATM 8358 P P1  . VX  F 4 .   ? 50.885  -25.638 346.328 1.00 30.23  ? 605  VX  A P1  1 
HETATM 8359 O O1  . VX  F 4 .   ? 50.999  -25.795 347.826 1.00 20.64  ? 605  VX  A O1  1 
HETATM 8360 O O2  . VX  F 4 .   ? 49.999  -24.297 345.980 1.00 34.54  ? 605  VX  A O2  1 
HETATM 8361 C C1  . VX  F 4 .   ? 52.584  -25.438 345.600 1.00 28.64  ? 605  VX  A C1  1 
HETATM 8362 C C2  . VX  F 4 .   ? 49.390  -23.602 347.028 1.00 45.70  ? 605  VX  A C2  1 
HETATM 8363 C C3  . VX  F 4 .   ? 48.327  -22.670 346.451 1.00 59.92  ? 605  VX  A C3  1 
HETATM 8364 P P1  . VX  G 4 .   ? 97.797  -41.011 351.492 1.00 115.82 ? 601  VX  B P1  1 
HETATM 8365 O O1  . VX  G 4 .   ? 97.416  -39.963 352.510 1.00 136.11 ? 601  VX  B O1  1 
HETATM 8366 O O2  . VX  G 4 .   ? 96.985  -42.409 351.814 1.00 93.35  ? 601  VX  B O2  1 
HETATM 8367 C C1  . VX  G 4 .   ? 97.350  -40.412 349.788 1.00 146.98 ? 601  VX  B C1  1 
HETATM 8368 C C2  . VX  G 4 .   ? 95.937  -42.374 352.741 1.00 90.06  ? 601  VX  B C2  1 
HETATM 8369 C C3  . VX  G 4 .   ? 94.743  -41.643 352.131 1.00 88.81  ? 601  VX  B C3  1 
HETATM 8370 O O   . HOH H 5 .   ? 63.580  -21.726 338.490 1.00 40.38  ? 701  HOH A O   1 
HETATM 8371 O O   . HOH H 5 .   ? 38.062  -51.185 334.065 1.00 67.94  ? 702  HOH A O   1 
HETATM 8372 O O   . HOH H 5 .   ? 46.930  -25.988 347.263 1.00 58.00  ? 703  HOH A O   1 
HETATM 8373 O O   . HOH H 5 .   ? 63.633  -13.092 323.781 1.00 60.52  ? 704  HOH A O   1 
HETATM 8374 O O   . HOH H 5 .   ? 39.894  -11.568 328.208 1.00 64.12  ? 705  HOH A O   1 
HETATM 8375 O O   . HOH H 5 .   ? 28.198  -47.834 360.415 1.00 56.39  ? 706  HOH A O   1 
HETATM 8376 O O   . HOH H 5 .   ? 57.534  -20.366 338.841 1.00 50.92  ? 707  HOH A O   1 
HETATM 8377 O O   . HOH H 5 .   ? 34.661  -32.456 378.896 1.00 33.67  ? 708  HOH A O   1 
HETATM 8378 O O   . HOH H 5 .   ? 21.518  -25.364 348.885 1.00 38.27  ? 709  HOH A O   1 
HETATM 8379 O O   . HOH H 5 .   ? 44.025  -13.787 320.439 1.00 53.55  ? 710  HOH A O   1 
HETATM 8380 O O   . HOH H 5 .   ? 57.604  -31.487 319.706 1.00 40.03  ? 711  HOH A O   1 
HETATM 8381 O O   . HOH H 5 .   ? 57.556  -18.230 352.014 1.00 42.96  ? 712  HOH A O   1 
HETATM 8382 O O   . HOH H 5 .   ? 75.886  -18.039 365.849 1.00 51.40  ? 713  HOH A O   1 
HETATM 8383 O O   . HOH H 5 .   ? 49.356  -12.026 350.049 1.00 56.29  ? 714  HOH A O   1 
HETATM 8384 O O   . HOH H 5 .   ? 67.912  -12.968 349.879 1.00 45.10  ? 715  HOH A O   1 
HETATM 8385 O O   . HOH H 5 .   ? 33.021  -44.613 366.265 1.00 48.26  ? 716  HOH A O   1 
HETATM 8386 O O   . HOH H 5 .   ? 52.464  -49.821 334.832 1.00 54.75  ? 717  HOH A O   1 
HETATM 8387 O O   . HOH H 5 .   ? 40.792  -31.805 371.655 1.00 42.98  ? 718  HOH A O   1 
HETATM 8388 O O   . HOH H 5 .   ? 66.358  -35.233 353.062 1.00 34.28  ? 719  HOH A O   1 
HETATM 8389 O O   . HOH H 5 .   ? 40.436  -29.457 327.496 1.00 63.57  ? 720  HOH A O   1 
HETATM 8390 O O   . HOH H 5 .   ? 66.148  -41.544 353.341 1.00 67.48  ? 721  HOH A O   1 
HETATM 8391 O O   . HOH H 5 .   ? 52.345  -37.481 328.840 1.00 24.28  ? 722  HOH A O   1 
HETATM 8392 O O   . HOH H 5 .   ? 54.833  -39.592 331.114 1.00 39.06  ? 723  HOH A O   1 
HETATM 8393 O O   . HOH H 5 .   ? 35.747  -26.113 359.044 1.00 33.31  ? 724  HOH A O   1 
HETATM 8394 O O   . HOH H 5 .   ? 62.757  -34.284 369.005 1.00 59.51  ? 725  HOH A O   1 
HETATM 8395 O O   . HOH H 5 .   ? 52.946  -52.853 340.856 1.00 56.92  ? 726  HOH A O   1 
HETATM 8396 O O   . HOH H 5 .   ? 62.776  -39.016 334.120 1.00 73.30  ? 727  HOH A O   1 
HETATM 8397 O O   . HOH H 5 .   ? 29.662  -39.444 374.933 1.00 41.07  ? 728  HOH A O   1 
HETATM 8398 O O   . HOH H 5 .   ? 64.151  -25.298 354.065 1.00 24.16  ? 729  HOH A O   1 
HETATM 8399 O O   . HOH H 5 .   ? 67.508  -22.933 372.617 1.00 56.81  ? 730  HOH A O   1 
HETATM 8400 O O   . HOH H 5 .   ? 20.786  -41.773 365.428 1.00 55.96  ? 731  HOH A O   1 
HETATM 8401 O O   . HOH H 5 .   ? 31.014  -52.374 359.412 1.00 63.75  ? 732  HOH A O   1 
HETATM 8402 O O   . HOH H 5 .   ? 75.441  -20.979 361.987 1.00 45.24  ? 733  HOH A O   1 
HETATM 8403 O O   . HOH H 5 .   ? 23.675  -44.699 361.895 1.00 53.93  ? 734  HOH A O   1 
HETATM 8404 O O   . HOH H 5 .   ? 22.969  -44.889 355.406 1.00 48.05  ? 735  HOH A O   1 
HETATM 8405 O O   . HOH H 5 .   ? 44.464  -5.852  330.961 1.00 50.39  ? 736  HOH A O   1 
HETATM 8406 O O   . HOH H 5 .   ? 39.422  -20.182 355.746 1.00 39.14  ? 737  HOH A O   1 
HETATM 8407 O O   . HOH H 5 .   ? 61.772  -37.539 368.156 1.00 70.99  ? 738  HOH A O   1 
HETATM 8408 O O   . HOH H 5 .   ? 61.953  -31.021 344.065 1.00 25.25  ? 739  HOH A O   1 
HETATM 8409 O O   . HOH H 5 .   ? 32.685  -43.456 334.779 1.00 41.67  ? 740  HOH A O   1 
HETATM 8410 O O   . HOH H 5 .   ? 72.804  -22.420 330.852 1.00 62.12  ? 741  HOH A O   1 
HETATM 8411 O O   . HOH H 5 .   ? 42.936  -41.804 379.428 1.00 28.96  ? 742  HOH A O   1 
HETATM 8412 O O   . HOH H 5 .   ? 21.936  -39.415 380.994 1.00 64.10  ? 743  HOH A O   1 
HETATM 8413 O O   . HOH H 5 .   ? 66.062  -27.218 372.689 1.00 52.79  ? 744  HOH A O   1 
HETATM 8414 O O   . HOH H 5 .   ? 55.904  -31.220 376.878 1.00 56.99  ? 745  HOH A O   1 
HETATM 8415 O O   . HOH H 5 .   ? 44.409  -10.051 322.434 1.00 56.33  ? 746  HOH A O   1 
HETATM 8416 O O   . HOH H 5 .   ? 34.197  -35.018 352.786 1.00 28.37  ? 747  HOH A O   1 
HETATM 8417 O O   . HOH H 5 .   ? 46.709  -34.149 325.236 1.00 38.19  ? 748  HOH A O   1 
HETATM 8418 O O   . HOH H 5 .   ? 34.713  -35.706 330.019 1.00 39.65  ? 749  HOH A O   1 
HETATM 8419 O O   . HOH H 5 .   ? 37.115  -19.601 331.481 1.00 60.45  ? 750  HOH A O   1 
HETATM 8420 O O   . HOH H 5 .   ? 51.410  -33.176 376.712 1.00 47.81  ? 751  HOH A O   1 
HETATM 8421 O O   . HOH H 5 .   ? 57.652  -13.852 314.319 1.00 37.67  ? 752  HOH A O   1 
HETATM 8422 O O   . HOH H 5 .   ? 49.295  -45.169 358.306 1.00 25.61  ? 753  HOH A O   1 
HETATM 8423 O O   . HOH H 5 .   ? 57.371  -17.007 344.965 1.00 48.72  ? 754  HOH A O   1 
HETATM 8424 O O   . HOH H 5 .   ? 77.706  -25.016 365.104 1.00 54.81  ? 755  HOH A O   1 
HETATM 8425 O O   . HOH H 5 .   ? 43.198  -32.065 328.119 1.00 57.74  ? 756  HOH A O   1 
HETATM 8426 O O   . HOH H 5 .   ? 60.817  -37.735 332.183 1.00 62.79  ? 757  HOH A O   1 
HETATM 8427 O O   . HOH H 5 .   ? 66.985  -33.687 358.211 1.00 52.50  ? 758  HOH A O   1 
HETATM 8428 O O   . HOH H 5 .   ? 51.820  -39.968 369.060 1.00 40.24  ? 759  HOH A O   1 
HETATM 8429 O O   . HOH H 5 .   ? 58.957  -25.822 365.040 1.00 24.06  ? 760  HOH A O   1 
HETATM 8430 O O   . HOH H 5 .   ? 40.138  -22.989 330.756 1.00 48.15  ? 761  HOH A O   1 
HETATM 8431 O O   . HOH H 5 .   ? 25.708  -36.779 353.175 1.00 60.27  ? 762  HOH A O   1 
HETATM 8432 O O   . HOH H 5 .   ? 53.914  -3.892  333.719 1.00 70.33  ? 763  HOH A O   1 
HETATM 8433 O O   . HOH H 5 .   ? 57.039  -24.529 366.632 1.00 21.89  ? 764  HOH A O   1 
HETATM 8434 O O   . HOH H 5 .   ? 40.663  -32.124 357.194 1.00 20.75  ? 765  HOH A O   1 
HETATM 8435 O O   . HOH H 5 .   ? 61.315  -41.097 361.187 1.00 46.01  ? 766  HOH A O   1 
HETATM 8436 O O   . HOH H 5 .   ? 43.024  -29.938 329.446 1.00 63.86  ? 767  HOH A O   1 
HETATM 8437 O O   . HOH H 5 .   ? 25.711  -21.834 341.646 1.00 53.59  ? 768  HOH A O   1 
HETATM 8438 O O   . HOH H 5 .   ? 25.371  -26.966 347.109 1.00 35.26  ? 769  HOH A O   1 
HETATM 8439 O O   . HOH H 5 .   ? 67.898  -35.058 359.997 1.00 54.03  ? 770  HOH A O   1 
HETATM 8440 O O   . HOH H 5 .   ? 59.581  -31.222 335.643 1.00 34.03  ? 771  HOH A O   1 
HETATM 8441 O O   . HOH H 5 .   ? 43.661  -11.990 350.014 1.00 64.52  ? 772  HOH A O   1 
HETATM 8442 O O   . HOH H 5 .   ? 54.187  -18.868 356.742 1.00 25.84  ? 773  HOH A O   1 
HETATM 8443 O O   . HOH H 5 .   ? 33.725  -22.481 344.272 1.00 41.70  ? 774  HOH A O   1 
HETATM 8444 O O   . HOH H 5 .   ? 45.309  -36.086 381.887 1.00 43.78  ? 775  HOH A O   1 
HETATM 8445 O O   . HOH H 5 .   ? 21.821  -30.309 348.556 1.00 41.85  ? 776  HOH A O   1 
HETATM 8446 O O   . HOH H 5 .   ? 39.438  -48.436 377.320 1.00 63.45  ? 777  HOH A O   1 
HETATM 8447 O O   . HOH H 5 .   ? 64.993  -33.992 360.246 1.00 42.55  ? 778  HOH A O   1 
HETATM 8448 O O   . HOH H 5 .   ? 49.261  -11.164 356.932 1.00 47.26  ? 779  HOH A O   1 
HETATM 8449 O O   . HOH H 5 .   ? 56.013  -26.864 323.980 1.00 66.38  ? 780  HOH A O   1 
HETATM 8450 O O   . HOH H 5 .   ? 25.344  -27.377 336.287 1.00 54.60  ? 781  HOH A O   1 
HETATM 8451 O O   . HOH H 5 .   ? 37.520  -13.387 330.226 1.00 56.10  ? 782  HOH A O   1 
HETATM 8452 O O   . HOH H 5 .   ? 33.809  -32.022 360.087 1.00 32.08  ? 783  HOH A O   1 
HETATM 8453 O O   . HOH H 5 .   ? 22.778  -32.080 349.818 1.00 43.33  ? 784  HOH A O   1 
HETATM 8454 O O   . HOH H 5 .   ? 72.840  -20.916 347.622 1.00 40.12  ? 785  HOH A O   1 
HETATM 8455 O O   . HOH H 5 .   ? 71.713  -17.289 371.301 1.00 69.90  ? 786  HOH A O   1 
HETATM 8456 O O   . HOH H 5 .   ? 49.776  -31.626 370.371 1.00 26.17  ? 787  HOH A O   1 
HETATM 8457 O O   . HOH H 5 .   ? 37.453  -51.692 340.956 1.00 57.43  ? 788  HOH A O   1 
HETATM 8458 O O   . HOH H 5 .   ? 29.920  -41.078 345.951 1.00 32.21  ? 789  HOH A O   1 
HETATM 8459 O O   . HOH H 5 .   ? 41.470  -52.238 350.642 1.00 39.86  ? 790  HOH A O   1 
HETATM 8460 O O   . HOH H 5 .   ? 45.717  -25.814 352.873 1.00 20.91  ? 791  HOH A O   1 
HETATM 8461 O O   . HOH H 5 .   ? 50.777  -29.425 369.492 1.00 21.57  ? 792  HOH A O   1 
HETATM 8462 O O   . HOH H 5 .   ? 57.363  -22.587 352.356 1.00 21.41  ? 793  HOH A O   1 
HETATM 8463 O O   . HOH H 5 .   ? 42.742  -16.069 358.680 1.00 45.24  ? 794  HOH A O   1 
HETATM 8464 O O   . HOH H 5 .   ? 64.495  -28.119 361.804 1.00 24.67  ? 795  HOH A O   1 
HETATM 8465 O O   . HOH H 5 .   ? 71.528  -30.909 348.926 1.00 34.02  ? 796  HOH A O   1 
HETATM 8466 O O   . HOH H 5 .   ? 39.387  -38.213 323.120 1.00 52.37  ? 797  HOH A O   1 
HETATM 8467 O O   . HOH H 5 .   ? 60.717  -7.269  329.311 1.00 40.83  ? 798  HOH A O   1 
HETATM 8468 O O   . HOH H 5 .   ? 35.325  -22.487 346.227 1.00 52.51  ? 799  HOH A O   1 
HETATM 8469 O O   . HOH H 5 .   ? 53.325  -11.415 358.085 1.00 49.48  ? 800  HOH A O   1 
HETATM 8470 O O   . HOH H 5 .   ? 55.863  -29.263 374.950 1.00 42.48  ? 801  HOH A O   1 
HETATM 8471 O O   . HOH H 5 .   ? 60.936  -21.126 370.924 1.00 32.50  ? 802  HOH A O   1 
HETATM 8472 O O   . HOH H 5 .   ? 34.141  -36.707 333.373 1.00 30.94  ? 803  HOH A O   1 
HETATM 8473 O O   . HOH H 5 .   ? 38.102  -29.484 357.594 1.00 30.72  ? 804  HOH A O   1 
HETATM 8474 O O   . HOH H 5 .   ? 26.484  -33.946 336.558 1.00 51.20  ? 805  HOH A O   1 
HETATM 8475 O O   . HOH H 5 .   ? 50.117  -47.851 334.906 1.00 26.99  ? 806  HOH A O   1 
HETATM 8476 O O   . HOH H 5 .   ? 38.387  -26.446 346.017 1.00 26.13  ? 807  HOH A O   1 
HETATM 8477 O O   . HOH H 5 .   ? 48.836  -19.330 319.515 1.00 47.74  ? 808  HOH A O   1 
HETATM 8478 O O   . HOH H 5 .   ? 45.825  -21.763 338.589 1.00 29.85  ? 809  HOH A O   1 
HETATM 8479 O O   . HOH H 5 .   ? 44.644  -28.359 342.334 1.00 22.67  ? 810  HOH A O   1 
HETATM 8480 O O   . HOH H 5 .   ? 75.070  -20.918 359.473 1.00 49.15  ? 811  HOH A O   1 
HETATM 8481 O O   . HOH H 5 .   ? 45.432  -51.621 339.560 1.00 65.08  ? 812  HOH A O   1 
HETATM 8482 O O   . HOH H 5 .   ? 45.513  -28.560 349.636 1.00 18.86  ? 813  HOH A O   1 
HETATM 8483 O O   . HOH H 5 .   ? 42.905  -28.699 362.413 1.00 46.64  ? 814  HOH A O   1 
HETATM 8484 O O   . HOH H 5 .   ? 63.743  -28.948 334.158 1.00 57.74  ? 815  HOH A O   1 
HETATM 8485 O O   . HOH H 5 .   ? 58.003  -21.318 371.116 1.00 34.10  ? 816  HOH A O   1 
HETATM 8486 O O   . HOH H 5 .   ? 45.012  -42.656 333.152 1.00 29.88  ? 817  HOH A O   1 
HETATM 8487 O O   . HOH H 5 .   ? 44.311  -31.774 340.919 1.00 22.15  ? 818  HOH A O   1 
HETATM 8488 O O   . HOH H 5 .   ? 63.151  -11.616 348.298 1.00 66.34  ? 819  HOH A O   1 
HETATM 8489 O O   . HOH H 5 .   ? 40.213  -52.471 362.122 1.00 53.65  ? 820  HOH A O   1 
HETATM 8490 O O   . HOH H 5 .   ? 20.745  -23.727 347.159 1.00 69.04  ? 821  HOH A O   1 
HETATM 8491 O O   . HOH H 5 .   ? 42.683  -47.031 351.411 1.00 33.35  ? 822  HOH A O   1 
HETATM 8492 O O   . HOH H 5 .   ? 23.095  -28.077 348.932 1.00 52.03  ? 823  HOH A O   1 
HETATM 8493 O O   . HOH H 5 .   ? 42.025  -50.480 335.136 1.00 46.90  ? 824  HOH A O   1 
HETATM 8494 O O   . HOH H 5 .   ? 54.008  -10.948 333.356 1.00 48.08  ? 825  HOH A O   1 
HETATM 8495 O O   . HOH H 5 .   ? 46.254  -32.556 356.344 1.00 15.63  ? 826  HOH A O   1 
HETATM 8496 O O   . HOH H 5 .   ? 47.218  -41.333 319.264 1.00 50.36  ? 827  HOH A O   1 
HETATM 8497 O O   . HOH H 5 .   ? 39.928  -29.278 370.144 1.00 28.88  ? 828  HOH A O   1 
HETATM 8498 O O   . HOH H 5 .   ? 57.278  -32.387 369.844 1.00 36.07  ? 829  HOH A O   1 
HETATM 8499 O O   . HOH H 5 .   ? 47.424  -18.562 355.459 1.00 32.56  ? 830  HOH A O   1 
HETATM 8500 O O   . HOH H 5 .   ? 66.224  -23.090 355.875 1.00 20.98  ? 831  HOH A O   1 
HETATM 8501 O O   . HOH H 5 .   ? 54.500  -19.148 370.405 1.00 31.29  ? 832  HOH A O   1 
HETATM 8502 O O   . HOH H 5 .   ? 63.454  -28.332 355.777 1.00 20.11  ? 833  HOH A O   1 
HETATM 8503 O O   . HOH H 5 .   ? 49.452  -20.094 314.928 1.00 44.45  ? 834  HOH A O   1 
HETATM 8504 O O   . HOH H 5 .   ? 40.653  -25.452 369.215 1.00 56.12  ? 835  HOH A O   1 
HETATM 8505 O O   . HOH H 5 .   ? 36.725  -42.634 375.800 1.00 34.68  ? 836  HOH A O   1 
HETATM 8506 O O   . HOH H 5 .   ? 45.016  -20.574 331.736 1.00 59.57  ? 837  HOH A O   1 
HETATM 8507 O O   . HOH H 5 .   ? 66.434  -20.012 373.445 1.00 37.57  ? 838  HOH A O   1 
HETATM 8508 O O   . HOH H 5 .   ? 35.641  -19.679 345.084 1.00 54.11  ? 839  HOH A O   1 
HETATM 8509 O O   . HOH H 5 .   ? 60.333  -23.069 346.964 1.00 23.65  ? 840  HOH A O   1 
HETATM 8510 O O   . HOH H 5 .   ? 49.738  -3.632  331.987 1.00 66.91  ? 841  HOH A O   1 
HETATM 8511 O O   . HOH H 5 .   ? 27.903  -42.939 358.677 1.00 55.59  ? 842  HOH A O   1 
HETATM 8512 O O   . HOH H 5 .   ? 52.017  -7.061  322.938 1.00 56.18  ? 843  HOH A O   1 
HETATM 8513 O O   . HOH H 5 .   ? 36.051  -25.539 339.667 1.00 36.56  ? 844  HOH A O   1 
HETATM 8514 O O   . HOH H 5 .   ? 42.288  -42.368 383.087 1.00 56.67  ? 845  HOH A O   1 
HETATM 8515 O O   . HOH H 5 .   ? 48.170  -25.695 360.168 1.00 23.33  ? 846  HOH A O   1 
HETATM 8516 O O   . HOH H 5 .   ? 46.590  -43.374 379.355 1.00 42.06  ? 847  HOH A O   1 
HETATM 8517 O O   . HOH H 5 .   ? 52.409  -17.488 322.515 1.00 28.78  ? 848  HOH A O   1 
HETATM 8518 O O   . HOH H 5 .   ? 35.615  -50.415 345.426 1.00 36.09  ? 849  HOH A O   1 
HETATM 8519 O O   . HOH H 5 .   ? 25.128  -38.709 370.395 1.00 60.21  ? 850  HOH A O   1 
HETATM 8520 O O   . HOH H 5 .   ? 26.500  -45.899 377.711 0.5  60.78  ? 851  HOH A O   1 
HETATM 8521 O O   . HOH H 5 .   ? 70.101  -24.145 370.467 1.00 51.62  ? 852  HOH A O   1 
HETATM 8522 O O   . HOH H 5 .   ? 63.879  -24.596 345.366 1.00 40.41  ? 853  HOH A O   1 
HETATM 8523 O O   . HOH H 5 .   ? 37.089  -49.193 369.617 1.00 48.12  ? 854  HOH A O   1 
HETATM 8524 O O   . HOH H 5 .   ? 58.257  -20.839 353.748 1.00 34.09  ? 855  HOH A O   1 
HETATM 8525 O O   . HOH H 5 .   ? 53.072  -15.580 320.809 1.00 32.28  ? 856  HOH A O   1 
HETATM 8526 O O   . HOH H 5 .   ? 42.773  -47.822 325.956 1.00 63.41  ? 857  HOH A O   1 
HETATM 8527 O O   . HOH H 5 .   ? 46.404  -19.595 316.424 1.00 58.45  ? 858  HOH A O   1 
HETATM 8528 O O   . HOH H 5 .   ? 45.480  -38.827 387.071 1.00 52.33  ? 859  HOH A O   1 
HETATM 8529 O O   . HOH H 5 .   ? 45.536  -16.101 365.490 1.00 31.72  ? 860  HOH A O   1 
HETATM 8530 O O   . HOH H 5 .   ? 30.276  -34.979 372.448 1.00 46.07  ? 861  HOH A O   1 
HETATM 8531 O O   . HOH H 5 .   ? 65.488  -16.532 335.540 1.00 43.56  ? 862  HOH A O   1 
HETATM 8532 O O   . HOH H 5 .   ? 47.156  -5.829  332.014 1.00 54.97  ? 863  HOH A O   1 
HETATM 8533 O O   . HOH H 5 .   ? 26.389  -31.420 362.516 1.00 55.38  ? 864  HOH A O   1 
HETATM 8534 O O   . HOH H 5 .   ? 44.919  -17.216 350.387 1.00 37.23  ? 865  HOH A O   1 
HETATM 8535 O O   . HOH H 5 .   ? 51.670  -26.436 353.000 1.00 16.01  ? 866  HOH A O   1 
HETATM 8536 O O   . HOH H 5 .   ? 50.046  -44.178 369.413 1.00 52.24  ? 867  HOH A O   1 
HETATM 8537 O O   . HOH H 5 .   ? 54.141  -5.506  322.646 1.00 57.40  ? 868  HOH A O   1 
HETATM 8538 O O   . HOH H 5 .   ? 51.107  -9.516  339.842 1.00 55.13  ? 869  HOH A O   1 
HETATM 8539 O O   . HOH H 5 .   ? 65.871  -35.069 356.519 1.00 36.09  ? 870  HOH A O   1 
HETATM 8540 O O   . HOH H 5 .   ? 54.794  -47.466 330.854 1.00 42.59  ? 871  HOH A O   1 
HETATM 8541 O O   . HOH H 5 .   ? 54.071  -35.292 329.358 1.00 27.45  ? 872  HOH A O   1 
HETATM 8542 O O   . HOH H 5 .   ? 59.931  -28.442 335.487 1.00 32.06  ? 873  HOH A O   1 
HETATM 8543 O O   . HOH H 5 .   ? 37.671  -22.535 355.763 1.00 34.80  ? 874  HOH A O   1 
HETATM 8544 O O   . HOH H 5 .   ? 53.928  -23.528 361.542 1.00 17.45  ? 875  HOH A O   1 
HETATM 8545 O O   . HOH H 5 .   ? 42.441  -30.265 364.758 1.00 21.37  ? 876  HOH A O   1 
HETATM 8546 O O   . HOH H 5 .   ? 64.895  -41.291 350.864 1.00 49.63  ? 877  HOH A O   1 
HETATM 8547 O O   . HOH H 5 .   ? 54.217  -2.682  328.090 1.00 55.81  ? 878  HOH A O   1 
HETATM 8548 O O   . HOH H 5 .   ? 48.883  -51.964 363.369 1.00 56.06  ? 879  HOH A O   1 
HETATM 8549 O O   . HOH H 5 .   ? 49.162  -31.748 372.991 1.00 27.28  ? 880  HOH A O   1 
HETATM 8550 O O   . HOH H 5 .   ? 36.805  -45.427 375.295 1.00 41.74  ? 881  HOH A O   1 
HETATM 8551 O O   . HOH H 5 .   ? 41.346  -18.548 329.548 1.00 60.88  ? 882  HOH A O   1 
HETATM 8552 O O   . HOH H 5 .   ? 47.305  -21.104 351.420 1.00 36.47  ? 883  HOH A O   1 
HETATM 8553 O O   . HOH H 5 .   ? 63.763  -34.068 334.545 1.00 37.98  ? 884  HOH A O   1 
HETATM 8554 O O   . HOH H 5 .   ? 33.025  -47.399 373.013 1.00 62.50  ? 885  HOH A O   1 
HETATM 8555 O O   . HOH H 5 .   ? 22.436  -25.973 346.192 1.00 44.94  ? 886  HOH A O   1 
HETATM 8556 O O   . HOH H 5 .   ? 67.178  -20.631 345.236 1.00 49.16  ? 887  HOH A O   1 
HETATM 8557 O O   . HOH H 5 .   ? 43.383  -16.813 362.879 1.00 46.78  ? 888  HOH A O   1 
HETATM 8558 O O   . HOH H 5 .   ? 63.795  -40.414 357.311 1.00 44.13  ? 889  HOH A O   1 
HETATM 8559 O O   . HOH H 5 .   ? 43.699  -55.473 353.455 1.00 58.29  ? 890  HOH A O   1 
HETATM 8560 O O   . HOH H 5 .   ? 45.651  -52.636 350.928 1.00 35.90  ? 891  HOH A O   1 
HETATM 8561 O O   . HOH H 5 .   ? 51.897  -20.173 369.888 1.00 29.80  ? 892  HOH A O   1 
HETATM 8562 O O   . HOH H 5 .   ? 32.173  -37.711 327.196 1.00 71.02  ? 893  HOH A O   1 
HETATM 8563 O O   . HOH H 5 .   ? 45.678  -22.977 352.640 1.00 23.48  ? 894  HOH A O   1 
HETATM 8564 O O   . HOH H 5 .   ? 35.362  -22.066 359.070 1.00 57.09  ? 895  HOH A O   1 
HETATM 8565 O O   . HOH H 5 .   ? 49.149  -16.791 350.905 1.00 61.69  ? 896  HOH A O   1 
HETATM 8566 O O   . HOH H 5 .   ? 38.697  -36.439 381.944 1.00 53.45  ? 897  HOH A O   1 
HETATM 8567 O O   . HOH H 5 .   ? 51.354  -22.615 325.297 1.00 59.96  ? 898  HOH A O   1 
HETATM 8568 O O   . HOH H 5 .   ? 34.349  -48.559 351.736 1.00 45.79  ? 899  HOH A O   1 
HETATM 8569 O O   . HOH H 5 .   ? 47.707  -39.776 370.763 1.00 34.89  ? 900  HOH A O   1 
HETATM 8570 O O   . HOH H 5 .   ? 43.728  -26.167 362.410 1.00 22.63  ? 901  HOH A O   1 
HETATM 8571 O O   . HOH H 5 .   ? 61.525  -9.988  335.508 1.00 41.37  ? 902  HOH A O   1 
HETATM 8572 O O   . HOH H 5 .   ? 58.137  -11.471 354.695 1.00 53.13  ? 903  HOH A O   1 
HETATM 8573 O O   . HOH H 5 .   ? 50.346  -14.235 360.371 1.00 28.45  ? 904  HOH A O   1 
HETATM 8574 O O   . HOH H 5 .   ? 48.234  -45.161 328.869 1.00 34.71  ? 905  HOH A O   1 
HETATM 8575 O O   . HOH H 5 .   ? 64.385  -24.539 341.485 1.00 55.25  ? 906  HOH A O   1 
HETATM 8576 O O   . HOH H 5 .   ? 55.447  -16.861 369.889 1.00 42.75  ? 907  HOH A O   1 
HETATM 8577 O O   . HOH H 5 .   ? 67.251  -33.193 366.319 1.00 36.83  ? 908  HOH A O   1 
HETATM 8578 O O   . HOH H 5 .   ? 41.479  -13.971 357.191 1.00 62.20  ? 909  HOH A O   1 
HETATM 8579 O O   . HOH H 5 .   ? 51.884  -48.175 326.391 1.00 62.01  ? 910  HOH A O   1 
HETATM 8580 O O   . HOH H 5 .   ? 53.325  -50.725 352.553 1.00 48.11  ? 911  HOH A O   1 
HETATM 8581 O O   . HOH H 5 .   ? 47.673  -42.377 371.162 1.00 38.78  ? 912  HOH A O   1 
HETATM 8582 O O   . HOH H 5 .   ? 59.408  -30.777 368.669 1.00 32.56  ? 913  HOH A O   1 
HETATM 8583 O O   . HOH H 5 .   ? 45.292  -21.949 356.562 1.00 33.17  ? 914  HOH A O   1 
HETATM 8584 O O   . HOH H 5 .   ? 54.853  -30.371 341.272 1.00 50.61  ? 915  HOH A O   1 
HETATM 8585 O O   . HOH H 5 .   ? 37.926  -48.031 372.130 1.00 45.52  ? 916  HOH A O   1 
HETATM 8586 O O   . HOH H 5 .   ? 45.363  -49.607 364.130 1.00 28.67  ? 917  HOH A O   1 
HETATM 8587 O O   . HOH H 5 .   ? 32.074  -21.927 357.990 1.00 61.21  ? 918  HOH A O   1 
HETATM 8588 O O   . HOH H 5 .   ? 48.197  -54.695 353.007 1.00 52.93  ? 919  HOH A O   1 
HETATM 8589 O O   . HOH H 5 .   ? 47.297  -26.434 333.298 1.00 32.42  ? 920  HOH A O   1 
HETATM 8590 O O   . HOH H 5 .   ? 55.893  -5.020  324.470 1.00 49.37  ? 921  HOH A O   1 
HETATM 8591 O O   . HOH H 5 .   ? 33.438  -25.942 333.075 1.00 44.31  ? 922  HOH A O   1 
HETATM 8592 O O   . HOH H 5 .   ? 37.689  -23.442 353.234 1.00 33.63  ? 923  HOH A O   1 
HETATM 8593 O O   . HOH H 5 .   ? 72.544  -15.670 354.456 1.00 42.05  ? 924  HOH A O   1 
HETATM 8594 O O   . HOH H 5 .   ? 50.703  -12.808 358.196 1.00 35.57  ? 925  HOH A O   1 
HETATM 8595 O O   . HOH H 5 .   ? 33.904  -12.957 347.627 1.00 55.27  ? 926  HOH A O   1 
HETATM 8596 O O   . HOH H 5 .   ? 37.276  -11.771 341.038 1.00 46.79  ? 927  HOH A O   1 
HETATM 8597 O O   . HOH H 5 .   ? 49.917  -35.927 378.009 1.00 57.86  ? 928  HOH A O   1 
HETATM 8598 O O   . HOH H 5 .   ? 49.557  -52.677 358.808 1.00 53.03  ? 929  HOH A O   1 
HETATM 8599 O O   . HOH H 5 .   ? 55.191  -19.980 359.139 1.00 26.69  ? 930  HOH A O   1 
HETATM 8600 O O   . HOH H 5 .   ? 35.495  -12.427 334.763 1.00 42.04  ? 931  HOH A O   1 
HETATM 8601 O O   . HOH H 5 .   ? 48.581  -28.250 375.144 1.00 65.51  ? 932  HOH A O   1 
HETATM 8602 O O   . HOH H 5 .   ? 53.936  -14.392 368.065 1.00 45.92  ? 933  HOH A O   1 
HETATM 8603 O O   . HOH H 5 .   ? 66.263  -44.315 349.697 1.00 54.06  ? 934  HOH A O   1 
HETATM 8604 O O   . HOH H 5 .   ? 58.758  -45.301 360.458 1.00 53.20  ? 935  HOH A O   1 
HETATM 8605 O O   . HOH H 5 .   ? 68.419  -25.428 345.840 1.00 35.65  ? 936  HOH A O   1 
HETATM 8606 O O   . HOH H 5 .   ? 65.079  -12.002 330.392 1.00 66.46  ? 937  HOH A O   1 
HETATM 8607 O O   . HOH H 5 .   ? 47.857  -15.987 367.841 1.00 45.61  ? 938  HOH A O   1 
HETATM 8608 O O   . HOH H 5 .   ? 69.962  -43.104 347.503 1.00 53.15  ? 939  HOH A O   1 
HETATM 8609 O O   . HOH H 5 .   ? 46.542  -48.506 329.514 1.00 46.99  ? 940  HOH A O   1 
HETATM 8610 O O   . HOH H 5 .   ? 37.780  -12.734 332.867 1.00 48.89  ? 941  HOH A O   1 
HETATM 8611 O O   . HOH H 5 .   ? 54.783  -25.176 365.668 1.00 32.79  ? 942  HOH A O   1 
HETATM 8612 O O   . HOH H 5 .   ? 39.613  -52.905 354.561 1.00 50.51  ? 943  HOH A O   1 
HETATM 8613 O O   . HOH H 5 .   ? 42.291  -2.391  335.245 1.00 70.95  ? 944  HOH A O   1 
HETATM 8614 O O   . HOH H 5 .   ? 76.250  -27.495 363.299 1.00 49.08  ? 945  HOH A O   1 
HETATM 8615 O O   . HOH H 5 .   ? 70.437  -32.126 358.813 1.00 45.15  ? 946  HOH A O   1 
HETATM 8616 O O   . HOH H 5 .   ? 45.995  -24.129 330.509 1.00 64.92  ? 947  HOH A O   1 
HETATM 8617 O O   . HOH H 5 .   ? 43.615  -55.406 359.811 1.00 55.96  ? 948  HOH A O   1 
HETATM 8618 O O   . HOH H 5 .   ? 54.338  -47.891 327.741 1.00 53.23  ? 949  HOH A O   1 
HETATM 8619 O O   . HOH H 5 .   ? 64.289  -21.427 341.910 1.00 54.75  ? 950  HOH A O   1 
HETATM 8620 O O   . HOH H 5 .   ? 52.764  -8.384  363.080 1.00 48.53  ? 951  HOH A O   1 
HETATM 8621 O O   . HOH H 5 .   ? 27.751  -21.904 347.620 1.00 59.97  ? 952  HOH A O   1 
HETATM 8622 O O   . HOH H 5 .   ? 64.853  -37.879 326.265 1.00 46.43  ? 953  HOH A O   1 
HETATM 8623 O O   . HOH H 5 .   ? 64.526  -38.926 358.455 1.00 55.75  ? 954  HOH A O   1 
HETATM 8624 O O   . HOH H 5 .   ? 20.236  -35.931 357.255 1.00 61.63  ? 955  HOH A O   1 
HETATM 8625 O O   . HOH H 5 .   ? 26.192  -39.011 348.725 1.00 50.34  ? 956  HOH A O   1 
HETATM 8626 O O   . HOH H 5 .   ? 43.141  -30.022 373.011 1.00 32.13  ? 957  HOH A O   1 
HETATM 8627 O O   . HOH H 5 .   ? 66.323  -31.441 344.799 1.00 70.06  ? 958  HOH A O   1 
HETATM 8628 O O   . HOH H 5 .   ? 31.628  -41.152 333.067 1.00 51.84  ? 959  HOH A O   1 
HETATM 8629 O O   . HOH H 5 .   ? 33.678  -41.509 379.882 1.00 53.80  ? 960  HOH A O   1 
HETATM 8630 O O   . HOH H 5 .   ? 45.144  -28.388 330.382 1.00 46.16  ? 961  HOH A O   1 
HETATM 8631 O O   . HOH H 5 .   ? 30.107  -49.276 370.390 1.00 66.75  ? 962  HOH A O   1 
HETATM 8632 O O   . HOH H 5 .   ? 46.380  -36.210 322.101 1.00 50.12  ? 963  HOH A O   1 
HETATM 8633 O O   . HOH H 5 .   ? 43.104  -24.152 328.866 1.00 62.09  ? 964  HOH A O   1 
HETATM 8634 O O   . HOH H 5 .   ? 37.612  -8.348  345.376 1.00 56.03  ? 965  HOH A O   1 
HETATM 8635 O O   . HOH H 5 .   ? 61.712  -12.488 321.994 1.00 42.27  ? 966  HOH A O   1 
HETATM 8636 O O   . HOH H 5 .   ? 30.255  -46.925 347.824 1.00 48.03  ? 967  HOH A O   1 
HETATM 8637 O O   . HOH H 5 .   ? 56.994  -35.764 330.180 1.00 27.45  ? 968  HOH A O   1 
HETATM 8638 O O   . HOH H 5 .   ? 46.784  -28.846 332.657 1.00 53.42  ? 969  HOH A O   1 
HETATM 8639 O O   . HOH H 5 .   ? 58.990  -40.942 363.394 1.00 56.72  ? 970  HOH A O   1 
HETATM 8640 O O   . HOH H 5 .   ? 61.244  -45.518 349.269 1.00 58.67  ? 971  HOH A O   1 
HETATM 8641 O O   . HOH H 5 .   ? 64.938  -38.337 360.352 1.00 66.14  ? 972  HOH A O   1 
HETATM 8642 O O   . HOH H 5 .   ? 71.774  -28.868 336.037 1.00 66.01  ? 973  HOH A O   1 
HETATM 8643 O O   . HOH H 5 .   ? 47.117  -30.165 374.578 1.00 53.75  ? 974  HOH A O   1 
HETATM 8644 O O   . HOH H 5 .   ? 49.830  -36.454 380.635 1.00 59.46  ? 975  HOH A O   1 
HETATM 8645 O O   . HOH H 5 .   ? 46.678  -18.565 352.723 1.00 35.14  ? 976  HOH A O   1 
HETATM 8646 O O   . HOH H 5 .   ? 35.456  -43.066 378.586 1.00 47.76  ? 977  HOH A O   1 
HETATM 8647 O O   . HOH H 5 .   ? 32.165  -42.806 339.772 1.00 49.64  ? 978  HOH A O   1 
HETATM 8648 O O   . HOH H 5 .   ? 36.829  -55.933 355.920 1.00 57.75  ? 979  HOH A O   1 
HETATM 8649 O O   . HOH H 5 .   ? 47.884  -23.067 332.982 1.00 39.92  ? 980  HOH A O   1 
HETATM 8650 O O   . HOH H 5 .   ? 59.195  -13.520 345.468 1.00 56.70  ? 981  HOH A O   1 
HETATM 8651 O O   . HOH H 5 .   ? 72.283  -25.611 347.703 1.00 32.67  ? 982  HOH A O   1 
HETATM 8652 O O   . HOH H 5 .   ? 47.480  -37.031 382.385 1.00 53.45  ? 983  HOH A O   1 
HETATM 8653 O O   . HOH H 5 .   ? 37.885  -9.240  336.174 1.00 61.27  ? 984  HOH A O   1 
HETATM 8654 O O   . HOH H 5 .   ? 80.900  -21.177 364.331 1.00 67.36  ? 985  HOH A O   1 
HETATM 8655 O O   . HOH H 5 .   ? 63.145  -13.116 329.287 1.00 40.17  ? 986  HOH A O   1 
HETATM 8656 O O   . HOH H 5 .   ? 53.399  -17.144 344.270 1.00 68.66  ? 987  HOH A O   1 
HETATM 8657 O O   . HOH H 5 .   ? 70.717  -33.312 361.367 1.00 57.42  ? 988  HOH A O   1 
HETATM 8658 O O   . HOH H 5 .   ? 27.662  -37.821 351.651 1.00 50.96  ? 989  HOH A O   1 
HETATM 8659 O O   . HOH H 5 .   ? 56.083  -24.621 320.373 1.00 60.28  ? 990  HOH A O   1 
HETATM 8660 O O   . HOH H 5 .   ? 62.134  -45.506 333.028 1.00 67.34  ? 991  HOH A O   1 
HETATM 8661 O O   . HOH H 5 .   ? 35.832  -20.573 357.424 1.00 66.59  ? 992  HOH A O   1 
HETATM 8662 O O   . HOH H 5 .   ? 20.395  -26.910 340.004 1.00 51.11  ? 993  HOH A O   1 
HETATM 8663 O O   . HOH H 5 .   ? 70.620  -29.645 335.323 1.00 60.87  ? 994  HOH A O   1 
HETATM 8664 O O   . HOH H 5 .   ? 36.896  -41.779 325.335 1.00 44.72  ? 995  HOH A O   1 
HETATM 8665 O O   . HOH H 5 .   ? 47.630  -32.037 326.735 1.00 64.50  ? 996  HOH A O   1 
HETATM 8666 O O   . HOH H 5 .   ? 53.754  -23.289 364.157 1.00 19.49  ? 997  HOH A O   1 
HETATM 8667 O O   . HOH H 5 .   ? 63.516  -8.815  366.037 1.00 61.23  ? 998  HOH A O   1 
HETATM 8668 O O   . HOH H 5 .   ? 43.635  -49.124 371.751 1.00 70.65  ? 999  HOH A O   1 
HETATM 8669 O O   . HOH H 5 .   ? 37.249  -40.057 383.392 1.00 64.28  ? 1000 HOH A O   1 
HETATM 8670 O O   . HOH H 5 .   ? 48.868  -19.202 323.964 1.00 37.69  ? 1001 HOH A O   1 
HETATM 8671 O O   . HOH H 5 .   ? 60.895  -32.307 337.185 1.00 55.98  ? 1002 HOH A O   1 
HETATM 8672 O O   . HOH H 5 .   ? 43.490  -43.493 323.577 1.00 55.31  ? 1003 HOH A O   1 
HETATM 8673 O O   . HOH H 5 .   ? 56.230  -40.482 328.768 1.00 53.40  ? 1004 HOH A O   1 
HETATM 8674 O O   . HOH H 5 .   ? 25.308  -42.524 358.003 1.00 50.45  ? 1005 HOH A O   1 
HETATM 8675 O O   . HOH H 5 .   ? 72.278  -14.438 351.708 1.00 46.95  ? 1006 HOH A O   1 
HETATM 8676 O O   . HOH H 5 .   ? 66.682  -37.616 329.316 1.00 62.51  ? 1007 HOH A O   1 
HETATM 8677 O O   . HOH H 5 .   ? 65.215  -22.873 353.206 1.00 29.64  ? 1008 HOH A O   1 
HETATM 8678 O O   . HOH H 5 .   ? 21.795  -28.848 337.285 1.00 50.03  ? 1009 HOH A O   1 
HETATM 8679 O O   . HOH H 5 .   ? 35.046  -37.821 381.826 1.00 58.46  ? 1010 HOH A O   1 
HETATM 8680 O O   . HOH H 5 .   ? 65.159  -6.187  359.470 1.00 64.26  ? 1011 HOH A O   1 
HETATM 8681 O O   . HOH H 5 .   ? 48.730  -4.923  326.266 1.00 66.54  ? 1012 HOH A O   1 
HETATM 8682 O O   . HOH H 5 .   ? 56.388  -50.169 345.984 1.00 57.32  ? 1013 HOH A O   1 
HETATM 8683 O O   . HOH H 5 .   ? 32.011  -19.415 337.448 1.00 62.52  ? 1014 HOH A O   1 
HETATM 8684 O O   . HOH H 5 .   ? 48.666  -20.243 371.731 1.00 73.74  ? 1015 HOH A O   1 
HETATM 8685 O O   . HOH H 5 .   ? 46.262  -21.524 329.549 1.00 55.05  ? 1016 HOH A O   1 
HETATM 8686 O O   . HOH H 5 .   ? 51.323  -10.512 316.967 1.00 37.52  ? 1017 HOH A O   1 
HETATM 8687 O O   . HOH H 5 .   ? 42.199  -38.133 385.568 1.00 55.90  ? 1018 HOH A O   1 
HETATM 8688 O O   . HOH H 5 .   ? 58.084  -27.688 375.096 1.00 46.30  ? 1019 HOH A O   1 
HETATM 8689 O O   . HOH H 5 .   ? 43.936  -17.037 327.262 1.00 79.92  ? 1020 HOH A O   1 
HETATM 8690 O O   . HOH H 5 .   ? 52.769  -39.282 380.600 1.00 55.34  ? 1021 HOH A O   1 
HETATM 8691 O O   . HOH H 5 .   ? 51.280  -52.518 356.243 1.00 58.45  ? 1022 HOH A O   1 
HETATM 8692 O O   . HOH H 5 .   ? 27.636  -34.811 369.642 1.00 41.02  ? 1023 HOH A O   1 
HETATM 8693 O O   . HOH H 5 .   ? 22.325  -36.321 359.827 1.00 51.33  ? 1024 HOH A O   1 
HETATM 8694 O O   . HOH H 5 .   ? 50.408  -40.664 371.242 1.00 59.99  ? 1025 HOH A O   1 
HETATM 8695 O O   . HOH H 5 .   ? 42.053  -56.654 356.426 1.00 59.60  ? 1026 HOH A O   1 
HETATM 8696 O O   . HOH H 5 .   ? 49.451  -3.835  330.794 1.00 69.56  ? 1027 HOH A O   1 
HETATM 8697 O O   . HOH H 5 .   ? 57.829  -36.002 327.235 1.00 33.44  ? 1028 HOH A O   1 
HETATM 8698 O O   . HOH H 5 .   ? 49.891  -33.726 324.651 1.00 39.09  ? 1029 HOH A O   1 
HETATM 8699 O O   . HOH H 5 .   ? 63.225  -29.414 339.025 1.00 64.05  ? 1030 HOH A O   1 
HETATM 8700 O O   . HOH H 5 .   ? 63.142  -44.633 347.694 1.00 51.20  ? 1031 HOH A O   1 
HETATM 8701 O O   . HOH H 5 .   ? 68.668  -42.312 354.181 1.00 47.19  ? 1032 HOH A O   1 
HETATM 8702 O O   . HOH H 5 .   ? 73.100  -15.832 332.276 1.00 56.64  ? 1033 HOH A O   1 
HETATM 8703 O O   . HOH H 5 .   ? 28.309  -35.866 336.116 1.00 35.71  ? 1034 HOH A O   1 
HETATM 8704 O O   . HOH H 5 .   ? 59.562  -22.892 318.530 1.00 46.58  ? 1035 HOH A O   1 
HETATM 8705 O O   . HOH H 5 .   ? 32.015  -29.462 332.837 1.00 40.28  ? 1036 HOH A O   1 
HETATM 8706 O O   . HOH H 5 .   ? 45.241  -46.258 377.001 1.00 49.79  ? 1037 HOH A O   1 
HETATM 8707 O O   . HOH H 5 .   ? 62.426  -48.439 345.608 1.00 70.44  ? 1038 HOH A O   1 
HETATM 8708 O O   . HOH H 5 .   ? 63.276  -11.401 371.700 1.00 78.31  ? 1039 HOH A O   1 
HETATM 8709 O O   . HOH H 5 .   ? 33.612  -29.946 360.862 1.00 37.05  ? 1040 HOH A O   1 
HETATM 8710 O O   . HOH H 5 .   ? 25.899  -33.762 333.890 1.00 67.79  ? 1041 HOH A O   1 
HETATM 8711 O O   . HOH H 5 .   ? 54.183  2.033   338.261 1.00 68.08  ? 1042 HOH A O   1 
HETATM 8712 O O   . HOH H 5 .   ? 32.249  -27.380 355.211 1.00 59.00  ? 1043 HOH A O   1 
HETATM 8713 O O   . HOH H 5 .   ? 35.709  -9.336  344.509 1.00 62.15  ? 1044 HOH A O   1 
HETATM 8714 O O   . HOH H 5 .   ? 56.843  -42.100 324.803 1.00 44.61  ? 1045 HOH A O   1 
HETATM 8715 O O   . HOH H 5 .   ? 44.004  -49.686 367.315 1.00 53.96  ? 1046 HOH A O   1 
HETATM 8716 O O   . HOH H 5 .   ? 39.979  -13.488 326.378 1.00 62.03  ? 1047 HOH A O   1 
HETATM 8717 O O   . HOH H 5 .   ? 29.056  -47.913 357.506 1.00 79.55  ? 1048 HOH A O   1 
HETATM 8718 O O   . HOH H 5 .   ? 73.099  -37.485 355.694 1.00 60.81  ? 1049 HOH A O   1 
HETATM 8719 O O   . HOH H 5 .   ? 74.247  -32.054 328.734 1.00 65.11  ? 1050 HOH A O   1 
HETATM 8720 O O   . HOH H 5 .   ? 31.393  -47.561 341.017 1.00 53.96  ? 1051 HOH A O   1 
HETATM 8721 O O   . HOH H 5 .   ? 32.723  -28.905 366.070 1.00 44.38  ? 1052 HOH A O   1 
HETATM 8722 O O   . HOH H 5 .   ? 50.741  -32.682 323.699 1.00 60.50  ? 1053 HOH A O   1 
HETATM 8723 O O   . HOH H 5 .   ? 73.281  -17.937 329.821 1.00 51.29  ? 1054 HOH A O   1 
HETATM 8724 O O   . HOH H 5 .   ? 46.346  -4.923  326.066 1.00 60.29  ? 1055 HOH A O   1 
HETATM 8725 O O   . HOH H 5 .   ? 46.731  -31.999 328.621 1.00 64.74  ? 1056 HOH A O   1 
HETATM 8726 O O   . HOH H 5 .   ? 32.168  -49.196 356.235 1.00 60.16  ? 1057 HOH A O   1 
HETATM 8727 O O   . HOH H 5 .   ? 60.709  -10.548 321.265 1.00 46.01  ? 1058 HOH A O   1 
HETATM 8728 O O   . HOH H 5 .   ? 62.768  -22.622 346.398 1.00 31.64  ? 1059 HOH A O   1 
HETATM 8729 O O   . HOH H 5 .   ? 30.745  -47.788 349.951 1.00 61.45  ? 1060 HOH A O   1 
HETATM 8730 O O   . HOH H 5 .   ? 57.135  -20.903 374.080 1.00 52.88  ? 1061 HOH A O   1 
HETATM 8731 O O   . HOH H 5 .   ? 21.967  -21.974 342.876 1.00 61.58  ? 1062 HOH A O   1 
HETATM 8732 O O   . HOH H 5 .   ? 61.283  -31.986 370.965 1.00 51.52  ? 1063 HOH A O   1 
HETATM 8733 O O   . HOH H 5 .   ? 43.836  -37.030 322.653 1.00 41.30  ? 1064 HOH A O   1 
HETATM 8734 O O   . HOH H 5 .   ? 36.177  -25.132 331.599 1.00 56.47  ? 1065 HOH A O   1 
HETATM 8735 O O   . HOH H 5 .   ? 58.804  -38.646 363.093 1.00 39.48  ? 1066 HOH A O   1 
HETATM 8736 O O   . HOH H 5 .   ? 42.901  -54.160 347.025 1.00 62.30  ? 1067 HOH A O   1 
HETATM 8737 O O   . HOH H 5 .   ? 44.884  -18.387 331.270 1.00 56.11  ? 1068 HOH A O   1 
HETATM 8738 O O   . HOH H 5 .   ? 42.520  -41.349 323.045 1.00 55.51  ? 1069 HOH A O   1 
HETATM 8739 O O   . HOH H 5 .   ? 55.139  -26.090 323.916 1.00 71.41  ? 1070 HOH A O   1 
HETATM 8740 O O   . HOH H 5 .   ? 63.557  -37.833 331.576 1.00 55.00  ? 1071 HOH A O   1 
HETATM 8741 O O   . HOH H 5 .   ? 46.532  -28.161 327.271 1.00 69.16  ? 1072 HOH A O   1 
HETATM 8742 O O   . HOH H 5 .   ? 45.726  -26.284 373.795 1.00 43.53  ? 1073 HOH A O   1 
HETATM 8743 O O   . HOH H 5 .   ? 34.863  -28.138 364.008 1.00 62.28  ? 1074 HOH A O   1 
HETATM 8744 O O   . HOH H 5 .   ? 51.705  -15.428 322.453 1.00 40.72  ? 1075 HOH A O   1 
HETATM 8745 O O   . HOH H 5 .   ? 56.594  -37.800 326.837 1.00 38.35  ? 1076 HOH A O   1 
HETATM 8746 O O   . HOH H 5 .   ? 60.928  -47.506 346.049 1.00 60.65  ? 1077 HOH A O   1 
HETATM 8747 O O   . HOH H 5 .   ? 35.665  -13.898 352.891 1.00 66.92  ? 1078 HOH A O   1 
HETATM 8748 O O   . HOH H 5 .   ? 47.933  -53.247 349.404 1.00 64.42  ? 1079 HOH A O   1 
HETATM 8749 O O   . HOH H 5 .   ? 23.291  -31.547 356.759 1.00 56.09  ? 1080 HOH A O   1 
HETATM 8750 O O   . HOH H 5 .   ? 68.336  -12.732 372.257 1.00 64.03  ? 1081 HOH A O   1 
HETATM 8751 O O   . HOH H 5 .   ? 38.038  -52.512 363.310 1.00 74.14  ? 1082 HOH A O   1 
HETATM 8752 O O   . HOH H 5 .   ? 64.065  -13.273 327.191 1.00 51.86  ? 1083 HOH A O   1 
HETATM 8753 O O   . HOH H 5 .   ? 74.867  -26.981 354.851 1.00 35.85  ? 1084 HOH A O   1 
HETATM 8754 O O   . HOH H 5 .   ? 64.208  -17.055 321.573 1.00 51.07  ? 1085 HOH A O   1 
HETATM 8755 O O   . HOH H 5 .   ? 58.309  -8.011  363.143 1.00 44.36  ? 1086 HOH A O   1 
HETATM 8756 O O   . HOH H 5 .   ? 73.711  -24.813 337.044 1.00 68.67  ? 1087 HOH A O   1 
HETATM 8757 O O   . HOH H 5 .   ? 49.639  -54.614 345.566 1.00 62.60  ? 1088 HOH A O   1 
HETATM 8758 O O   . HOH H 5 .   ? 77.286  -28.328 375.717 1.00 75.44  ? 1089 HOH A O   1 
HETATM 8759 O O   . HOH H 5 .   ? 80.070  -23.321 364.713 1.00 45.90  ? 1090 HOH A O   1 
HETATM 8760 O O   . HOH H 5 .   ? 27.645  -49.251 342.444 1.00 66.31  ? 1091 HOH A O   1 
HETATM 8761 O O   . HOH H 5 .   ? 51.921  -29.731 324.721 1.00 30.32  ? 1092 HOH A O   1 
HETATM 8762 O O   . HOH H 5 .   ? 33.214  -14.456 338.534 1.00 57.79  ? 1093 HOH A O   1 
HETATM 8763 O O   . HOH H 5 .   ? 35.119  -28.640 358.380 1.00 47.93  ? 1094 HOH A O   1 
HETATM 8764 O O   . HOH H 5 .   ? 64.192  -48.696 337.834 1.00 64.09  ? 1095 HOH A O   1 
HETATM 8765 O O   . HOH H 5 .   ? 58.176  -9.013  350.740 1.00 60.82  ? 1096 HOH A O   1 
HETATM 8766 O O   . HOH H 5 .   ? 65.471  -36.412 335.215 1.00 67.13  ? 1097 HOH A O   1 
HETATM 8767 O O   . HOH H 5 .   ? 32.142  -26.793 357.686 1.00 69.45  ? 1098 HOH A O   1 
HETATM 8768 O O   . HOH H 5 .   ? 50.686  -17.623 370.524 1.00 73.84  ? 1099 HOH A O   1 
HETATM 8769 O O   . HOH H 5 .   ? 61.876  -51.792 338.305 1.00 76.18  ? 1100 HOH A O   1 
HETATM 8770 O O   . HOH H 5 .   ? 64.165  -28.278 343.143 1.00 74.38  ? 1101 HOH A O   1 
HETATM 8771 O O   . HOH H 5 .   ? 52.085  -42.693 367.694 1.00 47.78  ? 1102 HOH A O   1 
HETATM 8772 O O   . HOH H 5 .   ? 38.838  -17.144 356.950 1.00 59.35  ? 1103 HOH A O   1 
HETATM 8773 O O   . HOH H 5 .   ? 71.028  -17.653 345.926 1.00 59.29  ? 1104 HOH A O   1 
HETATM 8774 O O   . HOH H 5 .   ? 50.881  -51.313 364.132 1.00 65.77  ? 1105 HOH A O   1 
HETATM 8775 O O   . HOH H 5 .   ? 64.138  -31.876 335.979 1.00 50.81  ? 1106 HOH A O   1 
HETATM 8776 O O   . HOH H 5 .   ? 40.441  -26.876 371.171 1.00 29.62  ? 1107 HOH A O   1 
HETATM 8777 O O   . HOH H 5 .   ? 42.939  -34.747 380.219 1.00 53.34  ? 1108 HOH A O   1 
HETATM 8778 O O   . HOH H 5 .   ? 59.592  -43.400 331.508 1.00 59.25  ? 1109 HOH A O   1 
HETATM 8779 O O   . HOH H 5 .   ? 71.970  -34.663 357.583 1.00 58.28  ? 1110 HOH A O   1 
HETATM 8780 O O   . HOH H 5 .   ? 34.833  -22.673 348.136 1.00 74.09  ? 1111 HOH A O   1 
HETATM 8781 O O   . HOH H 5 .   ? 46.438  -11.506 316.452 1.00 61.99  ? 1112 HOH A O   1 
HETATM 8782 O O   . HOH H 5 .   ? 53.270  -42.931 367.765 1.00 47.10  ? 1113 HOH A O   1 
HETATM 8783 O O   . HOH H 5 .   ? 30.562  -38.043 382.066 1.00 63.80  ? 1114 HOH A O   1 
HETATM 8784 O O   . HOH H 5 .   ? 26.208  -30.478 356.847 1.00 60.69  ? 1115 HOH A O   1 
HETATM 8785 O O   . HOH H 5 .   ? 31.098  -22.223 347.562 1.00 67.63  ? 1116 HOH A O   1 
HETATM 8786 O O   . HOH H 5 .   ? 40.653  -52.935 367.125 1.00 56.41  ? 1117 HOH A O   1 
HETATM 8787 O O   . HOH H 5 .   ? 41.633  -23.654 368.519 1.00 56.24  ? 1118 HOH A O   1 
HETATM 8788 O O   . HOH H 5 .   ? 51.285  -51.634 349.520 1.00 75.43  ? 1119 HOH A O   1 
HETATM 8789 O O   . HOH H 5 .   ? 49.639  -25.341 332.774 1.00 39.98  ? 1120 HOH A O   1 
HETATM 8790 O O   . HOH H 5 .   ? 62.761  -9.348  330.285 1.00 59.01  ? 1121 HOH A O   1 
HETATM 8791 O O   . HOH H 5 .   ? 49.375  -17.740 346.666 1.00 69.24  ? 1122 HOH A O   1 
HETATM 8792 O O   . HOH H 5 .   ? 64.592  -41.597 326.570 1.00 66.81  ? 1123 HOH A O   1 
HETATM 8793 O O   . HOH H 5 .   ? 54.482  -47.174 363.542 1.00 55.98  ? 1124 HOH A O   1 
HETATM 8794 O O   . HOH H 5 .   ? 39.082  -47.172 327.983 1.00 55.47  ? 1125 HOH A O   1 
HETATM 8795 O O   . HOH H 5 .   ? 47.536  -26.847 330.246 1.00 74.05  ? 1126 HOH A O   1 
HETATM 8796 O O   . HOH H 5 .   ? 49.661  -10.389 362.018 1.00 60.55  ? 1127 HOH A O   1 
HETATM 8797 O O   . HOH H 5 .   ? 63.859  -14.967 321.047 1.00 58.25  ? 1128 HOH A O   1 
HETATM 8798 O O   . HOH H 5 .   ? 46.994  -38.774 319.495 1.00 66.10  ? 1129 HOH A O   1 
HETATM 8799 O O   . HOH H 5 .   ? 19.393  -27.054 347.466 1.00 51.76  ? 1130 HOH A O   1 
HETATM 8800 O O   . HOH H 5 .   ? 62.377  -20.951 374.228 1.00 54.78  ? 1131 HOH A O   1 
HETATM 8801 O O   . HOH H 5 .   ? 45.302  -52.542 341.197 1.00 61.02  ? 1132 HOH A O   1 
HETATM 8802 O O   . HOH H 5 .   ? 27.131  -40.226 340.869 1.00 51.57  ? 1133 HOH A O   1 
HETATM 8803 O O   . HOH H 5 .   ? 63.133  -11.590 337.972 1.00 68.51  ? 1134 HOH A O   1 
HETATM 8804 O O   . HOH H 5 .   ? 40.081  -17.516 363.106 1.00 52.04  ? 1135 HOH A O   1 
HETATM 8805 O O   . HOH H 5 .   ? 60.488  -37.529 364.454 1.00 48.35  ? 1136 HOH A O   1 
HETATM 8806 O O   . HOH H 5 .   ? 63.995  -19.229 374.296 1.00 58.23  ? 1137 HOH A O   1 
HETATM 8807 O O   . HOH H 5 .   ? 49.608  -24.854 323.724 1.00 58.24  ? 1138 HOH A O   1 
HETATM 8808 O O   . HOH H 5 .   ? 62.193  -4.542  359.660 1.00 57.31  ? 1139 HOH A O   1 
HETATM 8809 O O   . HOH H 5 .   ? 26.473  -38.105 374.106 1.00 62.06  ? 1140 HOH A O   1 
HETATM 8810 O O   . HOH H 5 .   ? 63.292  -47.989 356.824 1.00 59.42  ? 1141 HOH A O   1 
HETATM 8811 O O   . HOH H 5 .   ? 39.884  -17.415 365.626 1.00 69.18  ? 1142 HOH A O   1 
HETATM 8812 O O   . HOH H 5 .   ? 64.400  -35.785 358.758 1.00 37.90  ? 1143 HOH A O   1 
HETATM 8813 O O   . HOH H 5 .   ? 48.914  -41.420 382.255 1.00 59.54  ? 1144 HOH A O   1 
HETATM 8814 O O   . HOH H 5 .   ? 57.407  -22.233 375.977 1.00 62.01  ? 1145 HOH A O   1 
HETATM 8815 O O   . HOH H 5 .   ? 32.109  -49.727 350.919 1.00 58.31  ? 1146 HOH A O   1 
HETATM 8816 O O   . HOH H 5 .   ? 51.436  -43.298 373.484 1.00 51.70  ? 1147 HOH A O   1 
HETATM 8817 O O   . HOH H 5 .   ? 54.987  -44.033 321.928 1.00 75.13  ? 1148 HOH A O   1 
HETATM 8818 O O   . HOH H 5 .   ? 72.055  -19.051 336.533 1.00 55.66  ? 1149 HOH A O   1 
HETATM 8819 O O   . HOH H 5 .   ? 50.663  -45.998 322.278 1.00 63.51  ? 1150 HOH A O   1 
HETATM 8820 O O   . HOH H 5 .   ? 53.450  -44.675 321.352 1.00 72.35  ? 1151 HOH A O   1 
HETATM 8821 O O   . HOH H 5 .   ? 34.655  -25.836 361.480 1.00 43.12  ? 1152 HOH A O   1 
HETATM 8822 O O   . HOH H 5 .   ? 55.324  -35.421 378.703 1.00 56.46  ? 1153 HOH A O   1 
HETATM 8823 O O   . HOH H 5 .   ? 67.291  -29.488 345.299 1.00 51.51  ? 1154 HOH A O   1 
HETATM 8824 O O   . HOH H 5 .   ? 45.700  -24.648 348.384 1.00 62.37  ? 1155 HOH A O   1 
HETATM 8825 O O   . HOH H 5 .   ? 43.583  -53.858 350.911 1.00 44.51  ? 1156 HOH A O   1 
HETATM 8826 O O   . HOH H 5 .   ? 79.831  -15.271 362.589 1.00 49.62  ? 1157 HOH A O   1 
HETATM 8827 O O   . HOH H 5 .   ? 64.084  -19.521 343.971 1.00 54.30  ? 1158 HOH A O   1 
HETATM 8828 O O   . HOH H 5 .   ? 52.903  -55.503 340.210 1.00 53.52  ? 1159 HOH A O   1 
HETATM 8829 O O   . HOH H 5 .   ? 56.041  -51.138 351.509 1.00 60.17  ? 1160 HOH A O   1 
HETATM 8830 O O   . HOH H 5 .   ? 65.891  -14.364 337.059 1.00 53.76  ? 1161 HOH A O   1 
HETATM 8831 O O   . HOH H 5 .   ? 27.334  -25.892 336.400 1.00 51.95  ? 1162 HOH A O   1 
HETATM 8832 O O   . HOH H 5 .   ? 61.704  -51.707 337.255 1.00 66.67  ? 1163 HOH A O   1 
HETATM 8833 O O   . HOH H 5 .   ? 58.554  -37.614 331.092 1.00 42.84  ? 1164 HOH A O   1 
HETATM 8834 O O   . HOH H 5 .   ? 55.090  -56.723 344.188 1.00 61.77  ? 1165 HOH A O   1 
HETATM 8835 O O   . HOH H 5 .   ? 41.381  -1.306  329.810 1.00 62.93  ? 1166 HOH A O   1 
HETATM 8836 O O   . HOH H 5 .   ? 27.762  -42.145 342.200 1.00 46.39  ? 1167 HOH A O   1 
HETATM 8837 O O   . HOH H 5 .   ? 27.245  -19.569 350.272 1.00 49.35  ? 1168 HOH A O   1 
HETATM 8838 O O   . HOH H 5 .   ? 24.644  -47.843 357.975 1.00 65.80  ? 1169 HOH A O   1 
HETATM 8839 O O   . HOH H 5 .   ? 58.740  -17.373 372.242 1.00 45.12  ? 1170 HOH A O   1 
HETATM 8840 O O   . HOH H 5 .   ? 62.778  -10.697 370.795 1.00 67.03  ? 1171 HOH A O   1 
HETATM 8841 O O   . HOH H 5 .   ? 48.176  -13.148 361.659 1.00 52.06  ? 1172 HOH A O   1 
HETATM 8842 O O   . HOH H 5 .   ? 35.938  -52.096 365.842 1.00 66.86  ? 1173 HOH A O   1 
HETATM 8843 O O   . HOH H 5 .   ? 66.707  -27.397 343.999 1.00 71.52  ? 1174 HOH A O   1 
HETATM 8844 O O   . HOH H 5 .   ? 59.877  -6.773  324.119 1.00 58.47  ? 1175 HOH A O   1 
HETATM 8845 O O   . HOH H 5 .   ? 29.372  -37.382 374.059 1.00 51.23  ? 1176 HOH A O   1 
HETATM 8846 O O   . HOH H 5 .   ? 45.029  -53.903 346.274 1.00 62.83  ? 1177 HOH A O   1 
HETATM 8847 O O   . HOH H 5 .   ? 53.109  -21.837 321.003 1.00 46.83  ? 1178 HOH A O   1 
HETATM 8848 O O   . HOH H 5 .   ? 72.641  -13.236 355.907 1.00 49.30  ? 1179 HOH A O   1 
HETATM 8849 O O   . HOH H 5 .   ? 65.651  -7.658  368.201 1.00 69.77  ? 1180 HOH A O   1 
HETATM 8850 O O   . HOH H 5 .   ? 19.427  -40.879 367.379 1.00 52.34  ? 1181 HOH A O   1 
HETATM 8851 O O   . HOH H 5 .   ? 35.936  -18.521 354.014 1.00 59.27  ? 1182 HOH A O   1 
HETATM 8852 O O   . HOH H 5 .   ? 51.736  -25.753 375.542 1.00 56.15  ? 1183 HOH A O   1 
HETATM 8853 O O   . HOH H 5 .   ? 76.027  -29.703 369.718 1.00 58.12  ? 1184 HOH A O   1 
HETATM 8854 O O   . HOH H 5 .   ? 51.373  -7.551  342.095 1.00 69.45  ? 1185 HOH A O   1 
HETATM 8855 O O   . HOH H 5 .   ? 35.228  -22.796 351.705 1.00 49.49  ? 1186 HOH A O   1 
HETATM 8856 O O   . HOH H 5 .   ? 64.616  -26.026 336.994 1.00 56.42  ? 1187 HOH A O   1 
HETATM 8857 O O   . HOH H 5 .   ? 71.525  -36.460 358.966 1.00 58.88  ? 1188 HOH A O   1 
HETATM 8858 O O   . HOH H 5 .   ? 40.176  -20.478 329.926 1.00 45.66  ? 1189 HOH A O   1 
HETATM 8859 O O   . HOH H 5 .   ? 54.417  -12.391 349.485 1.00 77.61  ? 1190 HOH A O   1 
HETATM 8860 O O   . HOH H 5 .   ? 27.010  -41.067 347.051 1.00 43.61  ? 1191 HOH A O   1 
HETATM 8861 O O   . HOH H 5 .   ? 37.450  -23.154 331.696 1.00 58.21  ? 1192 HOH A O   1 
HETATM 8862 O O   . HOH H 5 .   ? 44.108  -32.276 324.150 1.00 66.35  ? 1193 HOH A O   1 
HETATM 8863 O O   . HOH H 5 .   ? 50.091  -18.979 321.880 1.00 41.44  ? 1194 HOH A O   1 
HETATM 8864 O O   . HOH H 5 .   ? 45.755  -52.359 364.791 1.00 53.75  ? 1195 HOH A O   1 
HETATM 8865 O O   . HOH H 5 .   ? 79.981  -16.423 365.407 1.00 69.28  ? 1196 HOH A O   1 
HETATM 8866 O O   . HOH H 5 .   ? 27.026  -38.179 335.967 1.00 63.85  ? 1197 HOH A O   1 
HETATM 8867 O O   . HOH H 5 .   ? 72.710  -35.207 349.393 1.00 53.96  ? 1198 HOH A O   1 
HETATM 8868 O O   . HOH H 5 .   ? 31.928  -45.075 339.352 1.00 64.30  ? 1199 HOH A O   1 
HETATM 8869 O O   . HOH H 5 .   ? 54.893  -27.208 322.147 1.00 70.05  ? 1200 HOH A O   1 
HETATM 8870 O O   . HOH H 5 .   ? 35.863  -45.710 377.979 1.00 57.14  ? 1201 HOH A O   1 
HETATM 8871 O O   . HOH H 5 .   ? 39.679  -53.408 352.322 1.00 56.96  ? 1202 HOH A O   1 
HETATM 8872 O O   . HOH H 5 .   ? 46.852  -10.656 358.486 1.00 61.84  ? 1203 HOH A O   1 
HETATM 8873 O O   . HOH H 5 .   ? 65.696  -35.304 362.413 1.00 42.97  ? 1204 HOH A O   1 
HETATM 8874 O O   . HOH H 5 .   ? 35.716  -53.004 346.717 1.00 53.84  ? 1205 HOH A O   1 
HETATM 8875 O O   . HOH H 5 .   ? 59.411  -22.518 376.951 1.00 60.34  ? 1206 HOH A O   1 
HETATM 8876 O O   . HOH H 5 .   ? 58.130  -5.786  359.279 1.00 69.54  ? 1207 HOH A O   1 
HETATM 8877 O O   . HOH H 5 .   ? 70.677  -31.325 346.294 1.00 54.28  ? 1208 HOH A O   1 
HETATM 8878 O O   . HOH H 5 .   ? 28.930  -42.669 340.336 1.00 57.64  ? 1209 HOH A O   1 
HETATM 8879 O O   . HOH H 5 .   ? 34.926  -50.955 352.495 1.00 61.95  ? 1210 HOH A O   1 
HETATM 8880 O O   . HOH H 5 .   ? 50.797  -11.284 367.081 1.00 58.19  ? 1211 HOH A O   1 
HETATM 8881 O O   . HOH H 5 .   ? 61.546  -6.568  326.663 1.00 55.35  ? 1212 HOH A O   1 
HETATM 8882 O O   . HOH H 5 .   ? 52.969  -14.664 348.696 1.00 60.75  ? 1213 HOH A O   1 
HETATM 8883 O O   . HOH H 5 .   ? 44.610  -15.451 361.089 1.00 42.53  ? 1214 HOH A O   1 
HETATM 8884 O O   . HOH H 5 .   ? 55.174  -19.002 373.147 1.00 75.27  ? 1215 HOH A O   1 
HETATM 8885 O O   . HOH H 5 .   ? 57.029  -12.992 347.620 1.00 75.12  ? 1216 HOH A O   1 
HETATM 8886 O O   . HOH H 5 .   ? 72.375  -38.603 357.792 1.00 63.02  ? 1217 HOH A O   1 
HETATM 8887 O O   . HOH H 5 .   ? 56.075  -15.117 372.302 1.00 64.92  ? 1218 HOH A O   1 
HETATM 8888 O O   . HOH H 5 .   ? 53.557  -9.220  314.877 1.00 70.33  ? 1219 HOH A O   1 
HETATM 8889 O O   . HOH H 5 .   ? 22.198  -44.893 364.316 1.00 63.96  ? 1220 HOH A O   1 
HETATM 8890 O O   . HOH H 5 .   ? 60.673  -48.355 350.206 1.00 55.20  ? 1221 HOH A O   1 
HETATM 8891 O O   . HOH H 5 .   ? 57.198  -4.987  332.958 1.00 57.07  ? 1222 HOH A O   1 
HETATM 8892 O O   . HOH H 5 .   ? 67.124  -31.526 336.701 1.00 61.46  ? 1223 HOH A O   1 
HETATM 8893 O O   . HOH H 5 .   ? 65.832  -34.213 368.656 1.00 52.10  ? 1224 HOH A O   1 
HETATM 8894 O O   . HOH H 5 .   ? 46.776  -30.240 330.755 1.00 38.70  ? 1225 HOH A O   1 
HETATM 8895 O O   . HOH H 5 .   ? 37.178  -52.740 351.071 1.00 53.82  ? 1226 HOH A O   1 
HETATM 8896 O O   . HOH H 5 .   ? 67.411  -34.792 364.076 1.00 47.03  ? 1227 HOH A O   1 
HETATM 8897 O O   . HOH H 5 .   ? 39.224  -44.924 324.511 1.00 63.42  ? 1228 HOH A O   1 
HETATM 8898 O O   . HOH H 5 .   ? 82.481  -17.634 366.422 1.00 63.69  ? 1229 HOH A O   1 
HETATM 8899 O O   . HOH H 5 .   ? 64.279  -37.707 363.602 1.00 49.26  ? 1230 HOH A O   1 
HETATM 8900 O O   . HOH H 5 .   ? 63.077  -49.783 351.006 1.00 59.31  ? 1231 HOH A O   1 
HETATM 8901 O O   . HOH H 5 .   ? 20.059  -28.821 356.463 1.00 62.51  ? 1232 HOH A O   1 
HETATM 8902 O O   . HOH I 5 .   ? 83.990  -34.737 367.483 1.00 50.98  ? 701  HOH B O   1 
HETATM 8903 O O   . HOH I 5 .   ? 84.063  -61.971 343.827 1.00 60.49  ? 702  HOH B O   1 
HETATM 8904 O O   . HOH I 5 .   ? 90.674  -64.983 344.541 1.00 60.13  ? 703  HOH B O   1 
HETATM 8905 O O   . HOH I 5 .   ? 109.218 -52.468 328.469 1.00 48.76  ? 704  HOH B O   1 
HETATM 8906 O O   . HOH I 5 .   ? 99.839  -49.699 371.103 1.00 50.22  ? 705  HOH B O   1 
HETATM 8907 O O   . HOH I 5 .   ? 109.870 -57.101 345.245 1.00 58.78  ? 706  HOH B O   1 
HETATM 8908 O O   . HOH I 5 .   ? 92.221  -12.293 345.381 1.00 52.97  ? 707  HOH B O   1 
HETATM 8909 O O   . HOH I 5 .   ? 92.968  -36.991 375.340 1.00 49.01  ? 708  HOH B O   1 
HETATM 8910 O O   . HOH I 5 .   ? 117.794 -41.275 379.605 1.00 45.90  ? 709  HOH B O   1 
HETATM 8911 O O   . HOH I 5 .   ? 122.930 -49.548 365.615 1.00 50.67  ? 710  HOH B O   1 
HETATM 8912 O O   . HOH I 5 .   ? 124.462 -47.251 359.797 1.00 41.12  ? 711  HOH B O   1 
HETATM 8913 O O   . HOH I 5 .   ? 87.252  -29.802 354.604 1.00 33.24  ? 712  HOH B O   1 
HETATM 8914 O O   . HOH I 5 .   ? 106.833 -40.831 387.853 1.00 54.20  ? 713  HOH B O   1 
HETATM 8915 O O   . HOH I 5 .   ? 120.669 -35.603 354.488 1.00 38.99  ? 714  HOH B O   1 
HETATM 8916 O O   . HOH I 5 .   ? 92.974  -44.054 355.198 1.00 63.96  ? 715  HOH B O   1 
HETATM 8917 O O   . HOH I 5 .   ? 114.947 -27.863 342.962 1.00 51.23  ? 716  HOH B O   1 
HETATM 8918 O O   . HOH I 5 .   ? 120.133 -56.559 357.730 1.00 47.44  ? 717  HOH B O   1 
HETATM 8919 O O   . HOH I 5 .   ? 100.380 -19.719 351.884 1.00 49.19  ? 718  HOH B O   1 
HETATM 8920 O O   . HOH I 5 .   ? 114.498 -44.780 339.271 1.00 30.27  ? 719  HOH B O   1 
HETATM 8921 O O   . HOH I 5 .   ? 93.871  -42.661 341.087 1.00 51.85  ? 720  HOH B O   1 
HETATM 8922 O O   . HOH I 5 .   ? 80.469  -23.529 341.159 1.00 64.64  ? 721  HOH B O   1 
HETATM 8923 O O   . HOH I 5 .   ? 95.099  -38.316 336.536 1.00 47.80  ? 722  HOH B O   1 
HETATM 8924 O O   . HOH I 5 .   ? 73.406  -52.019 343.986 1.00 75.80  ? 723  HOH B O   1 
HETATM 8925 O O   . HOH I 5 .   ? 84.930  -24.488 365.044 1.00 32.17  ? 724  HOH B O   1 
HETATM 8926 O O   . HOH I 5 .   ? 83.361  -43.211 354.018 1.00 43.58  ? 725  HOH B O   1 
HETATM 8927 O O   . HOH I 5 .   ? 107.709 -56.938 345.317 1.00 70.14  ? 726  HOH B O   1 
HETATM 8928 O O   . HOH I 5 .   ? 114.961 -52.013 367.614 1.00 26.06  ? 727  HOH B O   1 
HETATM 8929 O O   . HOH I 5 .   ? 103.720 -45.142 384.939 1.00 63.52  ? 728  HOH B O   1 
HETATM 8930 O O   . HOH I 5 .   ? 113.632 -60.626 352.359 1.00 39.19  ? 729  HOH B O   1 
HETATM 8931 O O   . HOH I 5 .   ? 83.289  -58.860 341.584 1.00 55.56  ? 730  HOH B O   1 
HETATM 8932 O O   . HOH I 5 .   ? 103.295 -23.156 346.300 1.00 34.15  ? 731  HOH B O   1 
HETATM 8933 O O   . HOH I 5 .   ? 92.610  -41.220 356.826 1.00 28.49  ? 732  HOH B O   1 
HETATM 8934 O O   . HOH I 5 .   ? 113.308 -28.912 363.270 1.00 21.82  ? 733  HOH B O   1 
HETATM 8935 O O   . HOH I 5 .   ? 106.840 -46.210 368.896 1.00 25.99  ? 734  HOH B O   1 
HETATM 8936 O O   . HOH I 5 .   ? 113.448 -48.560 339.323 1.00 28.81  ? 735  HOH B O   1 
HETATM 8937 O O   . HOH I 5 .   ? 100.037 -41.846 357.881 1.00 26.04  ? 736  HOH B O   1 
HETATM 8938 O O   . HOH I 5 .   ? 97.352  -24.498 369.760 1.00 21.06  ? 737  HOH B O   1 
HETATM 8939 O O   . HOH I 5 .   ? 94.058  -60.789 323.052 1.00 32.85  ? 738  HOH B O   1 
HETATM 8940 O O   . HOH I 5 .   ? 105.862 -47.729 353.022 1.00 25.99  ? 739  HOH B O   1 
HETATM 8941 O O   . HOH I 5 .   ? 98.494  -63.067 365.320 1.00 44.44  ? 740  HOH B O   1 
HETATM 8942 O O   . HOH I 5 .   ? 121.421 -38.781 378.269 1.00 64.95  ? 741  HOH B O   1 
HETATM 8943 O O   . HOH I 5 .   ? 98.019  -42.324 355.258 1.00 57.10  ? 742  HOH B O   1 
HETATM 8944 O O   . HOH I 5 .   ? 102.697 -52.757 384.944 1.00 35.64  ? 743  HOH B O   1 
HETATM 8945 O O   . HOH I 5 .   ? 105.420 -65.534 362.531 1.00 66.43  ? 744  HOH B O   1 
HETATM 8946 O O   . HOH I 5 .   ? 109.106 -54.727 381.455 1.00 43.91  ? 745  HOH B O   1 
HETATM 8947 O O   . HOH I 5 .   ? 105.547 -38.379 338.804 1.00 38.19  ? 746  HOH B O   1 
HETATM 8948 O O   . HOH I 5 .   ? 93.980  -26.714 347.332 1.00 21.78  ? 747  HOH B O   1 
HETATM 8949 O O   . HOH I 5 .   ? 116.834 -22.489 371.702 1.00 50.77  ? 748  HOH B O   1 
HETATM 8950 O O   . HOH I 5 .   ? 79.735  -11.110 346.458 1.00 63.87  ? 749  HOH B O   1 
HETATM 8951 O O   . HOH I 5 .   ? 96.274  -43.099 371.025 1.00 33.47  ? 750  HOH B O   1 
HETATM 8952 O O   . HOH I 5 .   ? 117.667 -37.721 363.343 1.00 23.21  ? 751  HOH B O   1 
HETATM 8953 O O   . HOH I 5 .   ? 91.215  -28.332 371.686 1.00 29.89  ? 752  HOH B O   1 
HETATM 8954 O O   . HOH I 5 .   ? 99.195  -62.104 333.436 1.00 40.35  ? 753  HOH B O   1 
HETATM 8955 O O   . HOH I 5 .   ? 116.356 -44.600 380.294 1.00 31.02  ? 754  HOH B O   1 
HETATM 8956 O O   . HOH I 5 .   ? 106.250 -46.036 383.908 1.00 56.41  ? 755  HOH B O   1 
HETATM 8957 O O   . HOH I 5 .   ? 102.375 -33.371 342.668 1.00 26.11  ? 756  HOH B O   1 
HETATM 8958 O O   . HOH I 5 .   ? 90.246  -62.817 349.969 1.00 45.75  ? 757  HOH B O   1 
HETATM 8959 O O   . HOH I 5 .   ? 117.126 -30.122 349.711 1.00 68.46  ? 758  HOH B O   1 
HETATM 8960 O O   . HOH I 5 .   ? 101.059 -17.791 349.598 1.00 49.20  ? 759  HOH B O   1 
HETATM 8961 O O   . HOH I 5 .   ? 101.086 -56.176 356.859 1.00 41.88  ? 760  HOH B O   1 
HETATM 8962 O O   . HOH I 5 .   ? 90.885  -12.695 358.842 1.00 51.12  ? 761  HOH B O   1 
HETATM 8963 O O   . HOH I 5 .   ? 121.338 -49.375 343.298 1.00 23.95  ? 762  HOH B O   1 
HETATM 8964 O O   . HOH I 5 .   ? 120.350 -31.142 372.780 1.00 48.59  ? 763  HOH B O   1 
HETATM 8965 O O   . HOH I 5 .   ? 101.689 -57.985 370.146 1.00 31.64  ? 764  HOH B O   1 
HETATM 8966 O O   . HOH I 5 .   ? 94.203  -66.506 337.307 1.00 52.20  ? 765  HOH B O   1 
HETATM 8967 O O   . HOH I 5 .   ? 121.900 -43.570 377.584 1.00 64.20  ? 766  HOH B O   1 
HETATM 8968 O O   . HOH I 5 .   ? 92.621  -33.219 350.736 1.00 25.25  ? 767  HOH B O   1 
HETATM 8969 O O   . HOH I 5 .   ? 123.688 -30.969 361.587 1.00 56.42  ? 768  HOH B O   1 
HETATM 8970 O O   . HOH I 5 .   ? 88.937  -55.437 325.448 1.00 60.20  ? 769  HOH B O   1 
HETATM 8971 O O   . HOH I 5 .   ? 124.721 -26.455 343.076 1.00 54.81  ? 770  HOH B O   1 
HETATM 8972 O O   . HOH I 5 .   ? 97.563  -62.283 349.961 1.00 65.79  ? 771  HOH B O   1 
HETATM 8973 O O   . HOH I 5 .   ? 96.538  -57.534 367.993 1.00 46.77  ? 772  HOH B O   1 
HETATM 8974 O O   . HOH I 5 .   ? 96.585  -50.951 349.252 1.00 32.93  ? 773  HOH B O   1 
HETATM 8975 O O   . HOH I 5 .   ? 94.171  -16.326 370.404 1.00 60.92  ? 774  HOH B O   1 
HETATM 8976 O O   . HOH I 5 .   ? 88.161  -33.604 355.709 1.00 21.09  ? 775  HOH B O   1 
HETATM 8977 O O   . HOH I 5 .   ? 99.714  -41.694 368.833 1.00 26.58  ? 776  HOH B O   1 
HETATM 8978 O O   . HOH I 5 .   ? 118.458 -59.131 356.895 1.00 63.12  ? 777  HOH B O   1 
HETATM 8979 O O   . HOH I 5 .   ? 94.558  -20.718 352.821 1.00 22.45  ? 778  HOH B O   1 
HETATM 8980 O O   . HOH I 5 .   ? 93.814  -49.969 368.777 1.00 58.52  ? 779  HOH B O   1 
HETATM 8981 O O   . HOH I 5 .   ? 86.543  -40.756 336.305 1.00 56.48  ? 780  HOH B O   1 
HETATM 8982 O O   . HOH I 5 .   ? 96.723  -40.439 359.687 1.00 15.85  ? 781  HOH B O   1 
HETATM 8983 O O   . HOH I 5 .   ? 113.347 -44.878 378.325 1.00 27.79  ? 782  HOH B O   1 
HETATM 8984 O O   . HOH I 5 .   ? 101.998 -47.495 353.257 1.00 24.96  ? 783  HOH B O   1 
HETATM 8985 O O   . HOH I 5 .   ? 101.630 -61.307 371.623 1.00 71.06  ? 784  HOH B O   1 
HETATM 8986 O O   . HOH I 5 .   ? 97.147  -17.940 373.454 1.00 53.08  ? 785  HOH B O   1 
HETATM 8987 O O   . HOH I 5 .   ? 88.618  -39.853 344.868 1.00 48.54  ? 786  HOH B O   1 
HETATM 8988 O O   . HOH I 5 .   ? 97.586  -56.135 344.726 1.00 62.31  ? 787  HOH B O   1 
HETATM 8989 O O   . HOH I 5 .   ? 98.789  -56.370 342.286 1.00 53.16  ? 788  HOH B O   1 
HETATM 8990 O O   . HOH I 5 .   ? 92.655  -44.768 370.227 1.00 51.60  ? 789  HOH B O   1 
HETATM 8991 O O   . HOH I 5 .   ? 89.956  -65.679 337.726 1.00 53.32  ? 790  HOH B O   1 
HETATM 8992 O O   . HOH I 5 .   ? 112.585 -38.101 389.363 1.00 56.67  ? 791  HOH B O   1 
HETATM 8993 O O   . HOH I 5 .   ? 107.380 -37.451 334.936 1.00 44.15  ? 792  HOH B O   1 
HETATM 8994 O O   . HOH I 5 .   ? 83.524  -50.585 330.581 1.00 58.70  ? 793  HOH B O   1 
HETATM 8995 O O   . HOH I 5 .   ? 75.996  -29.933 356.559 1.00 44.78  ? 794  HOH B O   1 
HETATM 8996 O O   . HOH I 5 .   ? 105.698 -57.767 373.905 1.00 53.40  ? 795  HOH B O   1 
HETATM 8997 O O   . HOH I 5 .   ? 110.660 -44.943 336.834 1.00 30.87  ? 796  HOH B O   1 
HETATM 8998 O O   . HOH I 5 .   ? 86.179  -20.998 363.163 1.00 41.12  ? 797  HOH B O   1 
HETATM 8999 O O   . HOH I 5 .   ? 92.081  -22.709 358.854 1.00 19.50  ? 798  HOH B O   1 
HETATM 9000 O O   . HOH I 5 .   ? 90.643  -49.348 365.894 1.00 63.20  ? 799  HOH B O   1 
HETATM 9001 O O   . HOH I 5 .   ? 98.057  -15.565 348.208 1.00 50.12  ? 800  HOH B O   1 
HETATM 9002 O O   . HOH I 5 .   ? 104.513 -20.684 382.191 1.00 28.22  ? 801  HOH B O   1 
HETATM 9003 O O   . HOH I 5 .   ? 113.849 -52.414 374.069 1.00 33.99  ? 802  HOH B O   1 
HETATM 9004 O O   . HOH I 5 .   ? 123.452 -30.048 347.374 1.00 52.73  ? 803  HOH B O   1 
HETATM 9005 O O   . HOH I 5 .   ? 86.538  -17.287 342.461 1.00 56.41  ? 804  HOH B O   1 
HETATM 9006 O O   . HOH I 5 .   ? 80.829  -35.408 356.434 1.00 43.67  ? 805  HOH B O   1 
HETATM 9007 O O   . HOH I 5 .   ? 124.551 -37.032 349.364 1.00 40.54  ? 806  HOH B O   1 
HETATM 9008 O O   . HOH I 5 .   ? 95.725  -37.414 324.136 1.00 55.53  ? 807  HOH B O   1 
HETATM 9009 O O   . HOH I 5 .   ? 116.867 -36.154 383.174 1.00 44.16  ? 808  HOH B O   1 
HETATM 9010 O O   . HOH I 5 .   ? 102.126 -21.123 349.178 1.00 32.14  ? 809  HOH B O   1 
HETATM 9011 O O   . HOH I 5 .   ? 89.171  -39.361 359.409 1.00 29.25  ? 810  HOH B O   1 
HETATM 9012 O O   . HOH I 5 .   ? 122.017 -43.471 346.112 1.00 23.10  ? 811  HOH B O   1 
HETATM 9013 O O   . HOH I 5 .   ? 89.596  -47.613 327.447 1.00 53.72  ? 812  HOH B O   1 
HETATM 9014 O O   . HOH I 5 .   ? 88.674  -41.811 354.974 1.00 57.27  ? 813  HOH B O   1 
HETATM 9015 O O   . HOH I 5 .   ? 84.430  -47.348 357.916 1.00 45.35  ? 814  HOH B O   1 
HETATM 9016 O O   . HOH I 5 .   ? 111.504 -20.997 358.204 1.00 40.88  ? 815  HOH B O   1 
HETATM 9017 O O   . HOH I 5 .   ? 104.708 -23.368 372.501 1.00 24.21  ? 816  HOH B O   1 
HETATM 9018 O O   . HOH I 5 .   ? 93.342  -23.198 373.434 1.00 35.13  ? 817  HOH B O   1 
HETATM 9019 O O   . HOH I 5 .   ? 97.113  -19.371 364.248 1.00 28.61  ? 818  HOH B O   1 
HETATM 9020 O O   . HOH I 5 .   ? 125.357 -47.839 352.355 1.00 34.63  ? 819  HOH B O   1 
HETATM 9021 O O   . HOH I 5 .   ? 95.131  -24.883 367.973 1.00 17.74  ? 820  HOH B O   1 
HETATM 9022 O O   . HOH I 5 .   ? 91.370  -44.443 365.591 1.00 26.71  ? 821  HOH B O   1 
HETATM 9023 O O   . HOH I 5 .   ? 102.097 -36.063 362.598 1.00 14.32  ? 822  HOH B O   1 
HETATM 9024 O O   . HOH I 5 .   ? 96.657  -27.287 380.449 1.00 49.07  ? 823  HOH B O   1 
HETATM 9025 O O   . HOH I 5 .   ? 86.072  -14.894 343.811 1.00 56.24  ? 824  HOH B O   1 
HETATM 9026 O O   . HOH I 5 .   ? 93.631  -35.861 338.373 1.00 52.75  ? 825  HOH B O   1 
HETATM 9027 O O   . HOH I 5 .   ? 85.906  -37.662 367.086 1.00 42.59  ? 826  HOH B O   1 
HETATM 9028 O O   . HOH I 5 .   ? 100.646 -59.677 347.995 1.00 47.35  ? 827  HOH B O   1 
HETATM 9029 O O   . HOH I 5 .   ? 111.834 -55.973 340.734 1.00 34.41  ? 828  HOH B O   1 
HETATM 9030 O O   . HOH I 5 .   ? 94.830  -35.235 368.002 1.00 24.49  ? 829  HOH B O   1 
HETATM 9031 O O   . HOH I 5 .   ? 84.158  -60.007 330.441 1.00 55.41  ? 830  HOH B O   1 
HETATM 9032 O O   . HOH I 5 .   ? 92.086  -39.270 361.983 1.00 28.32  ? 831  HOH B O   1 
HETATM 9033 O O   . HOH I 5 .   ? 107.327 -22.667 373.443 1.00 33.40  ? 832  HOH B O   1 
HETATM 9034 O O   . HOH I 5 .   ? 81.671  -55.955 356.250 1.00 60.90  ? 833  HOH B O   1 
HETATM 9035 O O   . HOH I 5 .   ? 94.402  -33.818 363.082 1.00 18.72  ? 834  HOH B O   1 
HETATM 9036 O O   . HOH I 5 .   ? 86.775  -51.874 338.388 1.00 40.64  ? 835  HOH B O   1 
HETATM 9037 O O   . HOH I 5 .   ? 101.384 -58.504 344.563 1.00 60.84  ? 836  HOH B O   1 
HETATM 9038 O O   . HOH I 5 .   ? 102.282 -41.431 337.852 1.00 22.28  ? 837  HOH B O   1 
HETATM 9039 O O   . HOH I 5 .   ? 91.312  -29.604 359.469 1.00 21.06  ? 838  HOH B O   1 
HETATM 9040 O O   . HOH I 5 .   ? 102.183 -39.550 366.830 1.00 25.14  ? 839  HOH B O   1 
HETATM 9041 O O   . HOH I 5 .   ? 97.101  -31.991 376.993 1.00 35.95  ? 840  HOH B O   1 
HETATM 9042 O O   . HOH I 5 .   ? 105.339 -21.408 368.351 1.00 31.47  ? 841  HOH B O   1 
HETATM 9043 O O   . HOH I 5 .   ? 122.865 -37.932 364.538 1.00 34.52  ? 842  HOH B O   1 
HETATM 9044 O O   . HOH I 5 .   ? 101.689 -42.427 373.891 1.00 32.21  ? 843  HOH B O   1 
HETATM 9045 O O   . HOH I 5 .   ? 117.332 -51.748 370.469 1.00 39.10  ? 844  HOH B O   1 
HETATM 9046 O O   . HOH I 5 .   ? 113.181 -41.407 329.081 1.00 58.88  ? 845  HOH B O   1 
HETATM 9047 O O   . HOH I 5 .   ? 102.012 -30.021 340.154 1.00 43.16  ? 846  HOH B O   1 
HETATM 9048 O O   . HOH I 5 .   ? 118.032 -49.410 348.166 1.00 17.67  ? 847  HOH B O   1 
HETATM 9049 O O   . HOH I 5 .   ? 95.885  -39.302 375.622 1.00 43.59  ? 848  HOH B O   1 
HETATM 9050 O O   . HOH I 5 .   ? 90.075  -32.071 350.800 1.00 34.35  ? 849  HOH B O   1 
HETATM 9051 O O   . HOH I 5 .   ? 98.132  -17.414 346.773 1.00 51.54  ? 850  HOH B O   1 
HETATM 9052 O O   . HOH I 5 .   ? 113.568 -58.517 355.173 1.00 31.53  ? 851  HOH B O   1 
HETATM 9053 O O   . HOH I 5 .   ? 86.740  -55.278 362.742 1.00 43.57  ? 852  HOH B O   1 
HETATM 9054 O O   . HOH I 5 .   ? 96.035  -58.079 332.971 1.00 31.36  ? 853  HOH B O   1 
HETATM 9055 O O   . HOH I 5 .   ? 92.828  -39.260 377.720 1.00 66.71  ? 854  HOH B O   1 
HETATM 9056 O O   . HOH I 5 .   ? 109.722 -54.763 340.400 1.00 55.54  ? 855  HOH B O   1 
HETATM 9057 O O   . HOH I 5 .   ? 91.115  -24.428 347.003 1.00 24.34  ? 856  HOH B O   1 
HETATM 9058 O O   . HOH I 5 .   ? 98.094  -33.692 370.754 1.00 25.05  ? 857  HOH B O   1 
HETATM 9059 O O   . HOH I 5 .   ? 109.166 -19.055 346.151 1.00 46.39  ? 858  HOH B O   1 
HETATM 9060 O O   . HOH I 5 .   ? 84.783  -43.682 364.349 1.00 50.64  ? 859  HOH B O   1 
HETATM 9061 O O   . HOH I 5 .   ? 95.245  -46.472 365.235 1.00 27.21  ? 860  HOH B O   1 
HETATM 9062 O O   . HOH I 5 .   ? 85.776  -19.048 360.864 1.00 33.00  ? 861  HOH B O   1 
HETATM 9063 O O   . HOH I 5 .   ? 91.066  -16.600 366.491 1.00 42.46  ? 862  HOH B O   1 
HETATM 9064 O O   . HOH I 5 .   ? 116.931 -49.267 375.003 1.00 33.61  ? 863  HOH B O   1 
HETATM 9065 O O   . HOH I 5 .   ? 100.009 -49.920 360.279 1.00 23.01  ? 864  HOH B O   1 
HETATM 9066 O O   . HOH I 5 .   ? 91.530  -27.652 374.676 1.00 61.98  ? 865  HOH B O   1 
HETATM 9067 O O   . HOH I 5 .   ? 97.006  -55.367 361.452 1.00 45.47  ? 866  HOH B O   1 
HETATM 9068 O O   . HOH I 5 .   ? 97.427  -59.255 336.507 1.00 33.90  ? 867  HOH B O   1 
HETATM 9069 O O   . HOH I 5 .   ? 91.738  -25.799 362.260 1.00 19.40  ? 868  HOH B O   1 
HETATM 9070 O O   . HOH I 5 .   ? 109.692 -61.908 370.001 1.00 48.85  ? 869  HOH B O   1 
HETATM 9071 O O   . HOH I 5 .   ? 93.994  -34.839 344.832 1.00 23.27  ? 870  HOH B O   1 
HETATM 9072 O O   . HOH I 5 .   ? 95.646  -28.919 338.809 1.00 36.44  ? 871  HOH B O   1 
HETATM 9073 O O   . HOH I 5 .   ? 123.690 -41.286 344.597 1.00 38.67  ? 872  HOH B O   1 
HETATM 9074 O O   . HOH I 5 .   ? 110.168 -23.989 346.374 1.00 36.05  ? 873  HOH B O   1 
HETATM 9075 O O   . HOH I 5 .   ? 74.289  -27.608 348.588 1.00 33.33  ? 874  HOH B O   1 
HETATM 9076 O O   . HOH I 5 .   ? 116.048 -45.178 336.843 1.00 36.05  ? 875  HOH B O   1 
HETATM 9077 O O   . HOH I 5 .   ? 100.541 -65.008 330.176 1.00 60.02  ? 876  HOH B O   1 
HETATM 9078 O O   . HOH I 5 .   ? 102.243 -52.712 341.423 1.00 55.14  ? 877  HOH B O   1 
HETATM 9079 O O   . HOH I 5 .   ? 94.495  -59.240 331.000 1.00 29.77  ? 878  HOH B O   1 
HETATM 9080 O O   . HOH I 5 .   ? 120.178 -26.738 364.156 1.00 53.28  ? 879  HOH B O   1 
HETATM 9081 O O   . HOH I 5 .   ? 95.487  -34.727 331.628 1.00 47.09  ? 880  HOH B O   1 
HETATM 9082 O O   . HOH I 5 .   ? 88.474  -31.146 356.735 1.00 24.33  ? 881  HOH B O   1 
HETATM 9083 O O   . HOH I 5 .   ? 94.902  -61.871 358.151 1.00 59.32  ? 882  HOH B O   1 
HETATM 9084 O O   . HOH I 5 .   ? 110.790 -22.349 384.493 1.00 54.78  ? 883  HOH B O   1 
HETATM 9085 O O   . HOH I 5 .   ? 100.710 -13.949 376.177 1.00 55.02  ? 884  HOH B O   1 
HETATM 9086 O O   . HOH I 5 .   ? 93.569  -54.357 360.747 1.00 52.64  ? 885  HOH B O   1 
HETATM 9087 O O   . HOH I 5 .   ? 108.237 -17.715 378.731 1.00 47.74  ? 886  HOH B O   1 
HETATM 9088 O O   . HOH I 5 .   ? 94.818  -25.189 374.914 1.00 48.89  ? 887  HOH B O   1 
HETATM 9089 O O   . HOH I 5 .   ? 88.672  -34.991 349.851 1.00 32.57  ? 888  HOH B O   1 
HETATM 9090 O O   . HOH I 5 .   ? 113.157 -27.385 381.350 1.00 40.24  ? 889  HOH B O   1 
HETATM 9091 O O   . HOH I 5 .   ? 96.223  -22.703 336.775 1.00 44.96  ? 890  HOH B O   1 
HETATM 9092 O O   . HOH I 5 .   ? 113.054 -28.769 335.853 1.00 48.74  ? 891  HOH B O   1 
HETATM 9093 O O   . HOH I 5 .   ? 120.028 -43.053 369.518 1.00 42.06  ? 892  HOH B O   1 
HETATM 9094 O O   . HOH I 5 .   ? 112.647 -30.416 385.787 1.00 53.36  ? 893  HOH B O   1 
HETATM 9095 O O   . HOH I 5 .   ? 96.671  -35.948 355.630 1.00 12.52  ? 894  HOH B O   1 
HETATM 9096 O O   . HOH I 5 .   ? 90.719  -23.550 361.048 1.00 25.47  ? 895  HOH B O   1 
HETATM 9097 O O   . HOH I 5 .   ? 83.242  -13.660 358.666 1.00 51.15  ? 896  HOH B O   1 
HETATM 9098 O O   . HOH I 5 .   ? 80.359  -12.351 352.723 1.00 57.55  ? 897  HOH B O   1 
HETATM 9099 O O   . HOH I 5 .   ? 90.082  -40.642 332.609 1.00 42.24  ? 898  HOH B O   1 
HETATM 9100 O O   . HOH I 5 .   ? 99.589  -43.294 374.118 1.00 46.46  ? 899  HOH B O   1 
HETATM 9101 O O   . HOH I 5 .   ? 81.979  -34.546 339.352 1.00 79.24  ? 900  HOH B O   1 
HETATM 9102 O O   . HOH I 5 .   ? 118.519 -24.472 368.064 1.00 47.22  ? 901  HOH B O   1 
HETATM 9103 O O   . HOH I 5 .   ? 102.972 -44.768 387.817 1.00 65.88  ? 902  HOH B O   1 
HETATM 9104 O O   . HOH I 5 .   ? 94.060  -41.220 359.271 1.00 21.59  ? 903  HOH B O   1 
HETATM 9105 O O   . HOH I 5 .   ? 120.924 -27.438 361.803 1.00 45.27  ? 904  HOH B O   1 
HETATM 9106 O O   . HOH I 5 .   ? 116.241 -33.123 379.461 1.00 47.96  ? 905  HOH B O   1 
HETATM 9107 O O   . HOH I 5 .   ? 85.659  -40.251 345.402 1.00 69.68  ? 906  HOH B O   1 
HETATM 9108 O O   . HOH I 5 .   ? 96.953  -62.206 357.397 1.00 50.36  ? 907  HOH B O   1 
HETATM 9109 O O   . HOH I 5 .   ? 103.079 -40.475 345.617 1.00 41.71  ? 908  HOH B O   1 
HETATM 9110 O O   . HOH I 5 .   ? 99.073  -18.238 375.742 1.00 46.96  ? 909  HOH B O   1 
HETATM 9111 O O   . HOH I 5 .   ? 109.635 -26.750 384.157 1.00 34.98  ? 910  HOH B O   1 
HETATM 9112 O O   . HOH I 5 .   ? 104.897 -40.828 338.394 1.00 30.47  ? 911  HOH B O   1 
HETATM 9113 O O   . HOH I 5 .   ? 86.311  -45.191 365.941 1.00 59.88  ? 912  HOH B O   1 
HETATM 9114 O O   . HOH I 5 .   ? 101.331 -14.763 367.741 1.00 55.13  ? 913  HOH B O   1 
HETATM 9115 O O   . HOH I 5 .   ? 102.320 -52.040 345.076 1.00 35.52  ? 914  HOH B O   1 
HETATM 9116 O O   . HOH I 5 .   ? 73.598  -23.669 347.198 1.00 46.01  ? 915  HOH B O   1 
HETATM 9117 O O   . HOH I 5 .   ? 88.524  -36.381 340.459 1.00 52.34  ? 916  HOH B O   1 
HETATM 9118 O O   . HOH I 5 .   ? 125.334 -50.658 351.884 1.00 53.32  ? 917  HOH B O   1 
HETATM 9119 O O   . HOH I 5 .   ? 90.794  -64.380 329.215 1.00 34.99  ? 918  HOH B O   1 
HETATM 9120 O O   . HOH I 5 .   ? 119.550 -28.583 356.796 1.00 37.32  ? 919  HOH B O   1 
HETATM 9121 O O   . HOH I 5 .   ? 112.423 -53.360 371.640 1.00 40.47  ? 920  HOH B O   1 
HETATM 9122 O O   . HOH I 5 .   ? 98.585  -15.300 359.843 1.00 54.63  ? 921  HOH B O   1 
HETATM 9123 O O   . HOH I 5 .   ? 109.401 -25.668 334.751 1.00 60.92  ? 922  HOH B O   1 
HETATM 9124 O O   . HOH I 5 .   ? 97.168  -50.629 374.106 1.00 65.54  ? 923  HOH B O   1 
HETATM 9125 O O   . HOH I 5 .   ? 105.048 -34.298 387.552 1.00 50.91  ? 924  HOH B O   1 
HETATM 9126 O O   . HOH I 5 .   ? 101.477 -46.437 380.116 1.00 40.64  ? 925  HOH B O   1 
HETATM 9127 O O   . HOH I 5 .   ? 116.059 -26.816 370.819 1.00 25.50  ? 926  HOH B O   1 
HETATM 9128 O O   . HOH I 5 .   ? 83.821  -56.811 358.852 1.00 63.67  ? 927  HOH B O   1 
HETATM 9129 O O   . HOH I 5 .   ? 96.957  -29.094 376.169 1.00 34.61  ? 928  HOH B O   1 
HETATM 9130 O O   . HOH I 5 .   ? 123.485 -45.936 364.372 1.00 34.44  ? 929  HOH B O   1 
HETATM 9131 O O   . HOH I 5 .   ? 115.975 -58.330 340.895 1.00 42.85  ? 930  HOH B O   1 
HETATM 9132 O O   . HOH I 5 .   ? 90.036  -43.572 346.902 1.00 57.00  ? 931  HOH B O   1 
HETATM 9133 O O   . HOH I 5 .   ? 105.908 -17.704 379.989 1.00 34.79  ? 932  HOH B O   1 
HETATM 9134 O O   . HOH I 5 .   ? 99.111  -47.511 370.734 1.00 51.15  ? 933  HOH B O   1 
HETATM 9135 O O   . HOH I 5 .   ? 111.802 -45.684 334.291 1.00 26.57  ? 934  HOH B O   1 
HETATM 9136 O O   . HOH I 5 .   ? 98.881  -52.704 344.010 1.00 39.03  ? 935  HOH B O   1 
HETATM 9137 O O   . HOH I 5 .   ? 102.648 -22.826 389.458 1.00 68.97  ? 936  HOH B O   1 
HETATM 9138 O O   . HOH I 5 .   ? 88.609  -29.591 336.417 1.00 58.58  ? 937  HOH B O   1 
HETATM 9139 O O   . HOH I 5 .   ? 84.306  -45.331 334.598 1.00 61.54  ? 938  HOH B O   1 
HETATM 9140 O O   . HOH I 5 .   ? 83.717  -49.282 344.888 1.00 57.87  ? 939  HOH B O   1 
HETATM 9141 O O   . HOH I 5 .   ? 98.504  -17.789 380.627 1.00 44.61  ? 940  HOH B O   1 
HETATM 9142 O O   . HOH I 5 .   ? 96.230  -23.250 372.224 1.00 37.25  ? 941  HOH B O   1 
HETATM 9143 O O   . HOH I 5 .   ? 81.164  -27.663 363.405 1.00 31.20  ? 942  HOH B O   1 
HETATM 9144 O O   . HOH I 5 .   ? 105.221 -63.303 371.840 1.00 54.90  ? 943  HOH B O   1 
HETATM 9145 O O   . HOH I 5 .   ? 107.549 -49.717 381.702 1.00 33.83  ? 944  HOH B O   1 
HETATM 9146 O O   . HOH I 5 .   ? 76.923  -31.238 348.002 1.00 43.92  ? 945  HOH B O   1 
HETATM 9147 O O   . HOH I 5 .   ? 83.055  -25.751 338.985 1.00 53.01  ? 946  HOH B O   1 
HETATM 9148 O O   . HOH I 5 .   ? 111.452 -62.505 362.609 1.00 43.38  ? 947  HOH B O   1 
HETATM 9149 O O   . HOH I 5 .   ? 107.159 -27.224 384.302 1.00 31.92  ? 948  HOH B O   1 
HETATM 9150 O O   . HOH I 5 .   ? 76.862  -33.438 359.841 1.00 61.49  ? 949  HOH B O   1 
HETATM 9151 O O   . HOH I 5 .   ? 95.175  -42.787 373.587 1.00 47.86  ? 950  HOH B O   1 
HETATM 9152 O O   . HOH I 5 .   ? 122.844 -34.584 361.815 1.00 56.47  ? 951  HOH B O   1 
HETATM 9153 O O   . HOH I 5 .   ? 107.136 -19.786 356.386 1.00 38.61  ? 952  HOH B O   1 
HETATM 9154 O O   . HOH I 5 .   ? 92.019  -10.586 348.269 1.00 71.64  ? 953  HOH B O   1 
HETATM 9155 O O   . HOH I 5 .   ? 118.400 -37.250 336.440 1.00 55.17  ? 954  HOH B O   1 
HETATM 9156 O O   . HOH I 5 .   ? 93.520  -57.799 370.113 1.00 58.37  ? 955  HOH B O   1 
HETATM 9157 O O   . HOH I 5 .   ? 106.522 -26.679 335.423 1.00 60.27  ? 956  HOH B O   1 
HETATM 9158 O O   . HOH I 5 .   ? 90.505  -28.051 361.759 1.00 27.06  ? 957  HOH B O   1 
HETATM 9159 O O   . HOH I 5 .   ? 107.390 -20.698 351.834 1.00 37.50  ? 958  HOH B O   1 
HETATM 9160 O O   . HOH I 5 .   ? 111.075 -47.613 338.320 1.00 26.78  ? 959  HOH B O   1 
HETATM 9161 O O   . HOH I 5 .   ? 103.632 -62.070 354.606 1.00 41.15  ? 960  HOH B O   1 
HETATM 9162 O O   . HOH I 5 .   ? 100.215 -65.392 333.123 1.00 62.41  ? 961  HOH B O   1 
HETATM 9163 O O   . HOH I 5 .   ? 89.464  -21.010 338.030 1.00 51.39  ? 962  HOH B O   1 
HETATM 9164 O O   . HOH I 5 .   ? 106.788 -26.379 386.915 1.00 55.86  ? 963  HOH B O   1 
HETATM 9165 O O   . HOH I 5 .   ? 104.796 -52.038 345.208 1.00 50.38  ? 964  HOH B O   1 
HETATM 9166 O O   . HOH I 5 .   ? 88.912  -10.617 344.604 1.00 64.58  ? 965  HOH B O   1 
HETATM 9167 O O   . HOH I 5 .   ? 95.297  -52.826 372.435 1.00 60.77  ? 966  HOH B O   1 
HETATM 9168 O O   . HOH I 5 .   ? 83.177  -35.250 360.449 1.00 28.60  ? 967  HOH B O   1 
HETATM 9169 O O   . HOH I 5 .   ? 90.298  -53.499 325.229 1.00 37.08  ? 968  HOH B O   1 
HETATM 9170 O O   . HOH I 5 .   ? 89.252  -44.513 357.644 1.00 30.92  ? 969  HOH B O   1 
HETATM 9171 O O   . HOH I 5 .   ? 97.858  -14.339 354.452 1.00 41.03  ? 970  HOH B O   1 
HETATM 9172 O O   . HOH I 5 .   ? 113.007 -60.974 360.899 1.00 37.87  ? 971  HOH B O   1 
HETATM 9173 O O   . HOH I 5 .   ? 85.778  -41.045 364.551 1.00 33.41  ? 972  HOH B O   1 
HETATM 9174 O O   . HOH I 5 .   ? 124.471 -49.112 345.121 1.00 40.78  ? 973  HOH B O   1 
HETATM 9175 O O   . HOH I 5 .   ? 86.405  -12.613 357.646 1.00 49.39  ? 974  HOH B O   1 
HETATM 9176 O O   . HOH I 5 .   ? 120.268 -60.494 348.166 1.00 42.94  ? 975  HOH B O   1 
HETATM 9177 O O   . HOH I 5 .   ? 100.651 -55.101 343.844 1.00 53.99  ? 976  HOH B O   1 
HETATM 9178 O O   . HOH I 5 .   ? 103.592 -16.019 343.553 1.00 45.38  ? 977  HOH B O   1 
HETATM 9179 O O   . HOH I 5 .   ? 96.554  -25.354 349.280 1.00 18.59  ? 978  HOH B O   1 
HETATM 9180 O O   . HOH I 5 .   ? 98.878  -45.184 377.919 1.00 47.15  ? 979  HOH B O   1 
HETATM 9181 O O   . HOH I 5 .   ? 82.276  -24.887 363.961 1.00 34.64  ? 980  HOH B O   1 
HETATM 9182 O O   . HOH I 5 .   ? 109.295 -51.913 374.724 1.00 49.70  ? 981  HOH B O   1 
HETATM 9183 O O   . HOH I 5 .   ? 108.882 -21.421 370.221 1.00 41.65  ? 982  HOH B O   1 
HETATM 9184 O O   . HOH I 5 .   ? 108.060 -60.755 346.068 1.00 50.04  ? 983  HOH B O   1 
HETATM 9185 O O   . HOH I 5 .   ? 91.785  -27.260 345.840 1.00 31.38  ? 984  HOH B O   1 
HETATM 9186 O O   . HOH I 5 .   ? 88.634  -35.635 372.962 1.00 43.27  ? 985  HOH B O   1 
HETATM 9187 O O   . HOH I 5 .   ? 95.547  -33.110 341.300 1.00 43.83  ? 986  HOH B O   1 
HETATM 9188 O O   . HOH I 5 .   ? 91.559  -31.976 338.692 1.00 48.01  ? 987  HOH B O   1 
HETATM 9189 O O   . HOH I 5 .   ? 83.236  -31.688 367.876 1.00 53.54  ? 988  HOH B O   1 
HETATM 9190 O O   . HOH I 5 .   ? 102.173 -39.388 334.101 1.00 53.49  ? 989  HOH B O   1 
HETATM 9191 O O   . HOH I 5 .   ? 99.480  -23.628 338.973 1.00 44.08  ? 990  HOH B O   1 
HETATM 9192 O O   . HOH I 5 .   ? 99.994  -55.442 335.838 1.00 62.04  ? 991  HOH B O   1 
HETATM 9193 O O   . HOH I 5 .   ? 95.729  -19.013 361.594 1.00 29.64  ? 992  HOH B O   1 
HETATM 9194 O O   . HOH I 5 .   ? 93.473  -45.028 367.060 1.00 32.05  ? 993  HOH B O   1 
HETATM 9195 O O   . HOH I 5 .   ? 95.054  -25.585 337.555 1.00 35.73  ? 994  HOH B O   1 
HETATM 9196 O O   . HOH I 5 .   ? 75.146  -16.651 354.277 1.00 41.09  ? 995  HOH B O   1 
HETATM 9197 O O   . HOH I 5 .   ? 118.222 -30.719 378.414 1.00 50.22  ? 996  HOH B O   1 
HETATM 9198 O O   . HOH I 5 .   ? 113.677 -29.567 383.286 1.00 54.92  ? 997  HOH B O   1 
HETATM 9199 O O   . HOH I 5 .   ? 96.190  -53.312 361.873 1.00 42.16  ? 998  HOH B O   1 
HETATM 9200 O O   . HOH I 5 .   ? 106.649 -62.287 355.768 1.00 42.71  ? 999  HOH B O   1 
HETATM 9201 O O   . HOH I 5 .   ? 103.061 -39.820 385.262 1.00 38.21  ? 1000 HOH B O   1 
HETATM 9202 O O   . HOH I 5 .   ? 103.704 -53.138 332.846 1.00 55.12  ? 1001 HOH B O   1 
HETATM 9203 O O   . HOH I 5 .   ? 89.594  -37.486 325.330 1.00 45.82  ? 1002 HOH B O   1 
HETATM 9204 O O   . HOH I 5 .   ? 97.825  -60.743 373.538 1.00 60.71  ? 1003 HOH B O   1 
HETATM 9205 O O   . HOH I 5 .   ? 102.757 -55.217 329.341 1.00 54.60  ? 1004 HOH B O   1 
HETATM 9206 O O   . HOH I 5 .   ? 117.966 -54.118 361.861 1.00 50.69  ? 1005 HOH B O   1 
HETATM 9207 O O   . HOH I 5 .   ? 100.708 -53.722 381.859 1.00 59.74  ? 1006 HOH B O   1 
HETATM 9208 O O   . HOH I 5 .   ? 90.012  -63.245 352.860 1.00 48.27  ? 1007 HOH B O   1 
HETATM 9209 O O   . HOH I 5 .   ? 116.303 -63.781 352.166 1.00 57.17  ? 1008 HOH B O   1 
HETATM 9210 O O   . HOH I 5 .   ? 115.397 -22.704 357.062 1.00 44.81  ? 1009 HOH B O   1 
HETATM 9211 O O   . HOH I 5 .   ? 85.548  -61.053 331.956 1.00 49.23  ? 1010 HOH B O   1 
HETATM 9212 O O   . HOH I 5 .   ? 125.452 -32.515 367.363 1.00 73.99  ? 1011 HOH B O   1 
HETATM 9213 O O   . HOH I 5 .   ? 111.283 -53.995 337.972 1.00 31.66  ? 1012 HOH B O   1 
HETATM 9214 O O   . HOH I 5 .   ? 105.396 -19.524 352.188 1.00 39.63  ? 1013 HOH B O   1 
HETATM 9215 O O   . HOH I 5 .   ? 122.539 -36.573 368.463 1.00 46.09  ? 1014 HOH B O   1 
HETATM 9216 O O   . HOH I 5 .   ? 126.434 -38.942 346.355 1.00 47.77  ? 1015 HOH B O   1 
HETATM 9217 O O   . HOH I 5 .   ? 92.341  -64.492 347.834 1.00 58.87  ? 1016 HOH B O   1 
HETATM 9218 O O   . HOH I 5 .   ? 89.710  -41.734 357.945 1.00 29.32  ? 1017 HOH B O   1 
HETATM 9219 O O   . HOH I 5 .   ? 85.989  -26.199 366.796 1.00 31.47  ? 1018 HOH B O   1 
HETATM 9220 O O   . HOH I 5 .   ? 113.418 -22.996 377.373 1.00 48.83  ? 1019 HOH B O   1 
HETATM 9221 O O   . HOH I 5 .   ? 115.449 -57.965 365.844 1.00 40.54  ? 1020 HOH B O   1 
HETATM 9222 O O   . HOH I 5 .   ? 126.733 -43.271 357.269 1.00 53.17  ? 1021 HOH B O   1 
HETATM 9223 O O   . HOH I 5 .   ? 121.762 -31.010 350.987 1.00 56.84  ? 1022 HOH B O   1 
HETATM 9224 O O   . HOH I 5 .   ? 113.432 -24.006 374.823 1.00 29.38  ? 1023 HOH B O   1 
HETATM 9225 O O   . HOH I 5 .   ? 103.251 -18.400 386.326 1.00 68.20  ? 1024 HOH B O   1 
HETATM 9226 O O   . HOH I 5 .   ? 104.206 -66.582 368.277 1.00 56.89  ? 1025 HOH B O   1 
HETATM 9227 O O   . HOH I 5 .   ? 85.849  -28.857 352.290 1.00 53.25  ? 1026 HOH B O   1 
HETATM 9228 O O   . HOH I 5 .   ? 112.416 -38.430 335.179 1.00 76.16  ? 1027 HOH B O   1 
HETATM 9229 O O   . HOH I 5 .   ? 91.761  -38.930 323.152 1.00 48.45  ? 1028 HOH B O   1 
HETATM 9230 O O   . HOH I 5 .   ? 119.464 -54.980 370.228 1.00 53.12  ? 1029 HOH B O   1 
HETATM 9231 O O   . HOH I 5 .   ? 87.734  -59.386 359.094 1.00 61.47  ? 1030 HOH B O   1 
HETATM 9232 O O   . HOH I 5 .   ? 118.525 -46.772 333.929 1.00 48.08  ? 1031 HOH B O   1 
HETATM 9233 O O   . HOH I 5 .   ? 120.572 -48.978 369.032 1.00 62.47  ? 1032 HOH B O   1 
HETATM 9234 O O   . HOH I 5 .   ? 111.540 -22.494 340.363 1.00 54.07  ? 1033 HOH B O   1 
HETATM 9235 O O   . HOH I 5 .   ? 105.053 -21.011 370.615 1.00 37.65  ? 1034 HOH B O   1 
HETATM 9236 O O   . HOH I 5 .   ? 115.097 -21.578 374.299 1.00 59.29  ? 1035 HOH B O   1 
HETATM 9237 O O   . HOH I 5 .   ? 108.740 -41.868 326.386 1.00 56.18  ? 1036 HOH B O   1 
HETATM 9238 O O   . HOH I 5 .   ? 126.791 -49.740 354.775 1.00 55.05  ? 1037 HOH B O   1 
HETATM 9239 O O   . HOH I 5 .   ? 99.191  -23.786 386.661 1.00 59.55  ? 1038 HOH B O   1 
HETATM 9240 O O   . HOH I 5 .   ? 83.497  -23.493 340.459 1.00 50.12  ? 1039 HOH B O   1 
HETATM 9241 O O   . HOH I 5 .   ? 114.167 -46.352 334.948 1.00 29.18  ? 1040 HOH B O   1 
HETATM 9242 O O   . HOH I 5 .   ? 113.018 -23.455 345.146 1.00 39.20  ? 1041 HOH B O   1 
HETATM 9243 O O   . HOH I 5 .   ? 101.067 -51.060 342.796 1.00 36.76  ? 1042 HOH B O   1 
HETATM 9244 O O   . HOH I 5 .   ? 114.797 -26.525 348.708 1.00 41.25  ? 1043 HOH B O   1 
HETATM 9245 O O   . HOH I 5 .   ? 112.406 -47.621 335.000 1.00 38.74  ? 1044 HOH B O   1 
HETATM 9246 O O   . HOH I 5 .   ? 110.616 -51.017 372.512 1.00 54.92  ? 1045 HOH B O   1 
HETATM 9247 O O   . HOH I 5 .   ? 93.513  -33.504 342.862 1.00 32.00  ? 1046 HOH B O   1 
HETATM 9248 O O   . HOH I 5 .   ? 82.758  -51.682 348.544 1.00 59.59  ? 1047 HOH B O   1 
HETATM 9249 O O   . HOH I 5 .   ? 125.506 -38.614 351.137 1.00 51.12  ? 1048 HOH B O   1 
HETATM 9250 O O   . HOH I 5 .   ? 101.139 -54.501 325.515 1.00 65.67  ? 1049 HOH B O   1 
HETATM 9251 O O   . HOH I 5 .   ? 94.532  -50.151 323.564 1.00 48.45  ? 1050 HOH B O   1 
HETATM 9252 O O   . HOH I 5 .   ? 82.239  -36.611 358.398 1.00 32.08  ? 1051 HOH B O   1 
HETATM 9253 O O   . HOH I 5 .   ? 79.500  -19.240 344.508 1.00 59.28  ? 1052 HOH B O   1 
HETATM 9254 O O   . HOH I 5 .   ? 87.501  -59.085 355.639 1.00 64.00  ? 1053 HOH B O   1 
HETATM 9255 O O   . HOH I 5 .   ? 103.191 -54.767 342.974 1.00 63.96  ? 1054 HOH B O   1 
HETATM 9256 O O   . HOH I 5 .   ? 83.220  -61.347 336.676 1.00 58.92  ? 1055 HOH B O   1 
HETATM 9257 O O   . HOH I 5 .   ? 93.869  -18.201 340.413 1.00 65.61  ? 1056 HOH B O   1 
HETATM 9258 O O   . HOH I 5 .   ? 111.018 -59.535 370.995 1.00 52.96  ? 1057 HOH B O   1 
HETATM 9259 O O   . HOH I 5 .   ? 127.736 -34.651 349.563 1.00 42.03  ? 1058 HOH B O   1 
HETATM 9260 O O   . HOH I 5 .   ? 114.047 -26.504 345.710 1.00 48.42  ? 1059 HOH B O   1 
HETATM 9261 O O   . HOH I 5 .   ? 83.029  -57.899 330.305 1.00 53.77  ? 1060 HOH B O   1 
HETATM 9262 O O   . HOH I 5 .   ? 95.766  -57.205 344.709 1.00 57.12  ? 1061 HOH B O   1 
HETATM 9263 O O   . HOH I 5 .   ? 111.479 -30.267 334.618 1.00 52.10  ? 1062 HOH B O   1 
HETATM 9264 O O   . HOH I 5 .   ? 88.835  -47.355 329.468 1.00 51.16  ? 1063 HOH B O   1 
HETATM 9265 O O   . HOH I 5 .   ? 115.226 -25.590 374.223 1.00 34.19  ? 1064 HOH B O   1 
HETATM 9266 O O   . HOH I 5 .   ? 125.053 -48.256 339.763 1.00 67.55  ? 1065 HOH B O   1 
HETATM 9267 O O   . HOH I 5 .   ? 110.829 -57.316 378.090 1.00 45.64  ? 1066 HOH B O   1 
HETATM 9268 O O   . HOH I 5 .   ? 123.131 -29.441 369.827 1.00 71.20  ? 1067 HOH B O   1 
HETATM 9269 O O   . HOH I 5 .   ? 89.890  -41.379 347.518 1.00 77.30  ? 1068 HOH B O   1 
HETATM 9270 O O   . HOH I 5 .   ? 122.173 -54.401 357.672 1.00 54.49  ? 1069 HOH B O   1 
HETATM 9271 O O   . HOH I 5 .   ? 92.799  -51.508 323.083 1.00 62.30  ? 1070 HOH B O   1 
HETATM 9272 O O   . HOH I 5 .   ? 97.998  -22.378 381.507 1.00 52.64  ? 1071 HOH B O   1 
HETATM 9273 O O   . HOH I 5 .   ? 114.423 -57.762 338.476 1.00 56.05  ? 1072 HOH B O   1 
HETATM 9274 O O   . HOH I 5 .   ? 89.191  -43.107 371.861 1.00 55.17  ? 1073 HOH B O   1 
HETATM 9275 O O   . HOH I 5 .   ? 110.553 -19.567 379.424 1.00 53.40  ? 1074 HOH B O   1 
HETATM 9276 O O   . HOH I 5 .   ? 94.821  -35.443 328.827 1.00 61.92  ? 1075 HOH B O   1 
HETATM 9277 O O   . HOH I 5 .   ? 123.703 -45.421 338.494 1.00 45.46  ? 1076 HOH B O   1 
HETATM 9278 O O   . HOH I 5 .   ? 90.829  -61.159 357.252 1.00 50.38  ? 1077 HOH B O   1 
HETATM 9279 O O   . HOH I 5 .   ? 108.881 -54.134 342.663 1.00 53.57  ? 1078 HOH B O   1 
HETATM 9280 O O   . HOH I 5 .   ? 90.296  -30.481 374.663 1.00 60.26  ? 1079 HOH B O   1 
HETATM 9281 O O   . HOH I 5 .   ? 125.923 -52.208 345.036 1.00 70.65  ? 1080 HOH B O   1 
HETATM 9282 O O   . HOH I 5 .   ? 95.492  -51.724 364.402 1.00 59.63  ? 1081 HOH B O   1 
HETATM 9283 O O   . HOH I 5 .   ? 105.485 -55.256 344.671 1.00 44.28  ? 1082 HOH B O   1 
HETATM 9284 O O   . HOH I 5 .   ? 122.027 -31.245 339.732 1.00 52.74  ? 1083 HOH B O   1 
HETATM 9285 O O   . HOH I 5 .   ? 99.412  -43.266 371.171 1.00 41.48  ? 1084 HOH B O   1 
HETATM 9286 O O   . HOH I 5 .   ? 87.817  -27.315 371.657 1.00 57.86  ? 1085 HOH B O   1 
HETATM 9287 O O   . HOH I 5 .   ? 105.272 -21.230 359.298 1.00 40.12  ? 1086 HOH B O   1 
HETATM 9288 O O   . HOH I 5 .   ? 101.511 -42.240 385.129 1.00 58.27  ? 1087 HOH B O   1 
HETATM 9289 O O   . HOH I 5 .   ? 109.897 -17.677 370.277 1.00 66.06  ? 1088 HOH B O   1 
HETATM 9290 O O   . HOH I 5 .   ? 121.945 -54.716 369.319 1.00 68.92  ? 1089 HOH B O   1 
HETATM 9291 O O   . HOH I 5 .   ? 106.331 -66.800 365.594 1.00 45.03  ? 1090 HOH B O   1 
HETATM 9292 O O   . HOH I 5 .   ? 85.829  -13.929 361.033 1.00 55.24  ? 1091 HOH B O   1 
HETATM 9293 O O   . HOH I 5 .   ? 85.038  -38.700 343.599 1.00 46.33  ? 1092 HOH B O   1 
HETATM 9294 O O   . HOH I 5 .   ? 82.475  -19.469 363.097 1.00 46.55  ? 1093 HOH B O   1 
HETATM 9295 O O   . HOH I 5 .   ? 82.640  -21.733 363.167 1.00 62.85  ? 1094 HOH B O   1 
HETATM 9296 O O   . HOH I 5 .   ? 109.200 -37.258 330.049 1.00 63.20  ? 1095 HOH B O   1 
HETATM 9297 O O   . HOH I 5 .   ? 102.284 -54.322 334.156 1.00 61.21  ? 1096 HOH B O   1 
HETATM 9298 O O   . HOH I 5 .   ? 102.920 -51.013 376.508 1.00 69.46  ? 1097 HOH B O   1 
HETATM 9299 O O   . HOH I 5 .   ? 82.005  -36.043 341.033 1.00 76.36  ? 1098 HOH B O   1 
HETATM 9300 O O   . HOH I 5 .   ? 100.792 -49.305 374.748 1.00 60.92  ? 1099 HOH B O   1 
HETATM 9301 O O   . HOH I 5 .   ? 97.353  -40.558 378.135 1.00 48.69  ? 1100 HOH B O   1 
HETATM 9302 O O   . HOH I 5 .   ? 87.707  -38.944 335.640 1.00 68.87  ? 1101 HOH B O   1 
HETATM 9303 O O   . HOH I 5 .   ? 105.080 -27.517 389.043 1.00 62.37  ? 1102 HOH B O   1 
HETATM 9304 O O   . HOH I 5 .   ? 87.475  -11.412 354.873 1.00 54.76  ? 1103 HOH B O   1 
HETATM 9305 O O   . HOH I 5 .   ? 90.065  -25.056 336.427 1.00 75.20  ? 1104 HOH B O   1 
HETATM 9306 O O   . HOH I 5 .   ? 121.290 -31.500 355.625 1.00 79.61  ? 1105 HOH B O   1 
HETATM 9307 O O   . HOH I 5 .   ? 112.899 -43.698 337.597 1.00 52.42  ? 1106 HOH B O   1 
HETATM 9308 O O   . HOH I 5 .   ? 86.221  -25.343 369.699 1.00 67.91  ? 1107 HOH B O   1 
HETATM 9309 O O   . HOH I 5 .   ? 118.065 -58.095 337.138 1.00 65.94  ? 1108 HOH B O   1 
HETATM 9310 O O   . HOH I 5 .   ? 84.476  -27.899 367.811 1.00 50.42  ? 1109 HOH B O   1 
HETATM 9311 O O   . HOH I 5 .   ? 107.175 -53.759 335.904 1.00 33.81  ? 1110 HOH B O   1 
HETATM 9312 O O   . HOH I 5 .   ? 125.427 -38.774 341.603 1.00 55.64  ? 1111 HOH B O   1 
HETATM 9313 O O   . HOH I 5 .   ? 117.786 -28.195 345.656 1.00 56.09  ? 1112 HOH B O   1 
HETATM 9314 O O   . HOH I 5 .   ? 97.502  -21.602 377.021 1.00 39.45  ? 1113 HOH B O   1 
HETATM 9315 O O   . HOH I 5 .   ? 94.229  -59.328 333.094 1.00 42.19  ? 1114 HOH B O   1 
HETATM 9316 O O   . HOH I 5 .   ? 110.526 -54.502 335.900 1.00 54.89  ? 1115 HOH B O   1 
HETATM 9317 O O   . HOH I 5 .   ? 117.339 -26.182 376.435 1.00 59.01  ? 1116 HOH B O   1 
HETATM 9318 O O   . HOH I 5 .   ? 112.155 -42.271 336.674 1.00 45.22  ? 1117 HOH B O   1 
HETATM 9319 O O   . HOH I 5 .   ? 101.353 -37.339 385.274 1.00 51.74  ? 1118 HOH B O   1 
HETATM 9320 O O   . HOH I 5 .   ? 95.846  -11.274 357.107 1.00 62.60  ? 1119 HOH B O   1 
HETATM 9321 O O   . HOH I 5 .   ? 89.251  -58.526 324.805 1.00 64.95  ? 1120 HOH B O   1 
HETATM 9322 O O   . HOH I 5 .   ? 125.539 -54.342 345.827 1.00 65.97  ? 1121 HOH B O   1 
HETATM 9323 O O   . HOH I 5 .   ? 102.041 -50.253 376.175 1.00 65.92  ? 1122 HOH B O   1 
HETATM 9324 O O   . HOH I 5 .   ? 125.024 -37.413 361.173 1.00 60.21  ? 1123 HOH B O   1 
HETATM 9325 O O   . HOH I 5 .   ? 112.379 -27.547 384.289 1.00 64.40  ? 1124 HOH B O   1 
HETATM 9326 O O   . HOH I 5 .   ? 99.554  -33.108 340.038 1.00 60.64  ? 1125 HOH B O   1 
HETATM 9327 O O   . HOH I 5 .   ? 82.311  -36.231 343.357 1.00 70.76  ? 1126 HOH B O   1 
HETATM 9328 O O   . HOH I 5 .   ? 114.624 -19.482 352.955 1.00 58.28  ? 1127 HOH B O   1 
HETATM 9329 O O   . HOH I 5 .   ? 122.076 -51.242 334.477 1.00 76.04  ? 1128 HOH B O   1 
HETATM 9330 O O   . HOH I 5 .   ? 119.669 -30.579 349.670 1.00 54.27  ? 1129 HOH B O   1 
HETATM 9331 O O   . HOH I 5 .   ? 121.269 -31.292 380.027 1.00 68.09  ? 1130 HOH B O   1 
HETATM 9332 O O   . HOH I 5 .   ? 97.350  -23.576 376.036 1.00 59.78  ? 1131 HOH B O   1 
HETATM 9333 O O   . HOH I 5 .   ? 87.746  -39.550 333.302 1.00 57.59  ? 1132 HOH B O   1 
HETATM 9334 O O   . HOH I 5 .   ? 123.823 -33.897 359.149 1.00 65.88  ? 1133 HOH B O   1 
HETATM 9335 O O   . HOH I 5 .   ? 116.503 -40.468 333.295 1.00 59.33  ? 1134 HOH B O   1 
HETATM 9336 O O   . HOH I 5 .   ? 92.825  -48.686 366.871 1.00 67.84  ? 1135 HOH B O   1 
HETATM 9337 O O   . HOH I 5 .   ? 120.147 -31.843 375.562 1.00 67.62  ? 1136 HOH B O   1 
HETATM 9338 O O   . HOH I 5 .   ? 97.110  -44.185 356.050 1.00 65.67  ? 1137 HOH B O   1 
HETATM 9339 O O   . HOH I 5 .   ? 122.956 -42.729 340.570 1.00 58.67  ? 1138 HOH B O   1 
HETATM 9340 O O   . HOH I 5 .   ? 117.144 -55.499 366.418 1.00 48.72  ? 1139 HOH B O   1 
HETATM 9341 O O   . HOH I 5 .   ? 92.562  -63.148 356.355 1.00 60.98  ? 1140 HOH B O   1 
HETATM 9342 O O   . HOH I 5 .   ? 113.224 -21.683 363.902 1.00 63.51  ? 1141 HOH B O   1 
HETATM 9343 O O   . HOH I 5 .   ? 100.792 -16.194 345.188 1.00 65.10  ? 1142 HOH B O   1 
HETATM 9344 O O   . HOH I 5 .   ? 88.339  -44.413 366.681 1.00 57.98  ? 1143 HOH B O   1 
HETATM 9345 O O   . HOH I 5 .   ? 118.106 -22.974 369.689 1.00 62.00  ? 1144 HOH B O   1 
HETATM 9346 O O   . HOH I 5 .   ? 89.584  -43.747 351.530 1.00 65.90  ? 1145 HOH B O   1 
HETATM 9347 O O   . HOH I 5 .   ? 91.943  -34.766 339.686 1.00 59.03  ? 1146 HOH B O   1 
HETATM 9348 O O   . HOH I 5 .   ? 89.146  -12.429 342.290 1.00 63.09  ? 1147 HOH B O   1 
HETATM 9349 O O   . HOH I 5 .   ? 103.876 -64.426 361.291 1.00 56.28  ? 1148 HOH B O   1 
HETATM 9350 O O   . HOH I 5 .   ? 93.853  -20.681 373.525 1.00 64.66  ? 1149 HOH B O   1 
HETATM 9351 O O   . HOH I 5 .   ? 120.418 -31.543 336.686 1.00 63.07  ? 1150 HOH B O   1 
HETATM 9352 O O   . HOH I 5 .   ? 124.575 -31.438 354.458 1.00 70.29  ? 1151 HOH B O   1 
HETATM 9353 O O   . HOH I 5 .   ? 115.911 -62.385 359.773 1.00 51.15  ? 1152 HOH B O   1 
HETATM 9354 O O   . HOH I 5 .   ? 106.597 -19.685 383.656 1.00 52.51  ? 1153 HOH B O   1 
HETATM 9355 O O   . HOH I 5 .   ? 113.510 -22.797 384.093 1.00 63.53  ? 1154 HOH B O   1 
HETATM 9356 O O   . HOH I 5 .   ? 86.541  -61.972 351.186 1.00 63.75  ? 1155 HOH B O   1 
HETATM 9357 O O   . HOH I 5 .   ? 109.476 -39.775 390.973 1.00 65.30  ? 1156 HOH B O   1 
HETATM 9358 O O   . HOH I 5 .   ? 108.121 -21.731 367.276 1.00 35.44  ? 1157 HOH B O   1 
HETATM 9359 O O   . HOH I 5 .   ? 108.326 -19.687 366.091 1.00 44.73  ? 1158 HOH B O   1 
HETATM 9360 O O   . HOH I 5 .   ? 102.564 -61.598 351.250 1.00 67.84  ? 1159 HOH B O   1 
HETATM 9361 O O   . HOH I 5 .   ? 107.412 -20.856 371.851 1.00 40.61  ? 1160 HOH B O   1 
HETATM 9362 O O   . HOH I 5 .   ? 104.861 -36.645 335.557 1.00 64.19  ? 1161 HOH B O   1 
HETATM 9363 O O   . HOH I 5 .   ? 79.100  -36.169 361.003 1.00 66.61  ? 1162 HOH B O   1 
HETATM 9364 O O   . HOH I 5 .   ? 90.408  -39.450 376.145 1.00 64.24  ? 1163 HOH B O   1 
HETATM 9365 O O   . HOH I 5 .   ? 79.302  -13.148 355.270 1.00 65.27  ? 1164 HOH B O   1 
HETATM 9366 O O   . HOH I 5 .   ? 84.316  -54.809 327.781 1.00 49.39  ? 1165 HOH B O   1 
HETATM 9367 O O   . HOH I 5 .   ? 105.785 -15.751 370.265 1.00 60.23  ? 1166 HOH B O   1 
HETATM 9368 O O   . HOH I 5 .   ? 120.216 -28.154 353.481 1.00 61.05  ? 1167 HOH B O   1 
HETATM 9369 O O   . HOH I 5 .   ? 106.165 -20.443 390.040 1.00 69.51  ? 1168 HOH B O   1 
HETATM 9370 O O   . HOH I 5 .   ? 127.266 -45.627 359.144 1.00 51.32  ? 1169 HOH B O   1 
HETATM 9371 O O   . HOH I 5 .   ? 112.442 -38.885 334.134 1.00 70.47  ? 1170 HOH B O   1 
HETATM 9372 O O   . HOH I 5 .   ? 71.914  -21.985 344.905 1.00 56.47  ? 1171 HOH B O   1 
HETATM 9373 O O   . HOH I 5 .   ? 86.847  -20.582 339.251 1.00 54.35  ? 1172 HOH B O   1 
HETATM 9374 O O   . HOH I 5 .   ? 103.682 -19.330 358.929 1.00 52.50  ? 1173 HOH B O   1 
HETATM 9375 O O   . HOH I 5 .   ? 84.525  -15.726 362.606 1.00 50.72  ? 1174 HOH B O   1 
HETATM 9376 O O   . HOH I 5 .   ? 120.991 -57.340 342.506 1.00 55.18  ? 1175 HOH B O   1 
HETATM 9377 O O   . HOH I 5 .   ? 110.014 -18.479 357.515 1.00 66.48  ? 1176 HOH B O   1 
HETATM 9378 O O   . HOH I 5 .   ? 103.033 -20.847 351.551 1.00 50.81  ? 1177 HOH B O   1 
HETATM 9379 O O   . HOH I 5 .   ? 89.173  -23.381 336.108 1.00 70.60  ? 1178 HOH B O   1 
HETATM 9380 O O   . HOH I 5 .   ? 122.054 -59.015 350.960 1.00 62.41  ? 1179 HOH B O   1 
HETATM 9381 O O   . HOH I 5 .   ? 100.315 -28.067 339.296 1.00 53.44  ? 1180 HOH B O   1 
HETATM 9382 O O   . HOH I 5 .   ? 81.318  -51.764 334.674 1.00 58.09  ? 1181 HOH B O   1 
HETATM 9383 O O   . HOH I 5 .   ? 99.937  -56.656 333.510 1.00 62.74  ? 1182 HOH B O   1 
HETATM 9384 O O   . HOH I 5 .   ? 90.618  -33.513 373.614 1.00 51.87  ? 1183 HOH B O   1 
HETATM 9385 O O   . HOH I 5 .   ? 117.485 -40.147 336.424 1.00 54.38  ? 1184 HOH B O   1 
HETATM 9386 O O   . HOH I 5 .   ? 96.925  -14.841 361.442 1.00 54.69  ? 1185 HOH B O   1 
HETATM 9387 O O   . HOH I 5 .   ? 115.189 -53.460 370.093 1.00 36.19  ? 1186 HOH B O   1 
HETATM 9388 O O   . HOH I 5 .   ? 76.039  -48.309 343.733 1.00 66.08  ? 1187 HOH B O   1 
HETATM 9389 O O   . HOH I 5 .   ? 86.261  -39.713 369.297 1.00 59.57  ? 1188 HOH B O   1 
HETATM 9390 O O   . HOH I 5 .   ? 115.519 -25.904 378.875 1.00 61.08  ? 1189 HOH B O   1 
HETATM 9391 O O   . HOH I 5 .   ? 98.236  -57.294 378.355 1.00 66.13  ? 1190 HOH B O   1 
HETATM 9392 O O   . HOH I 5 .   ? 118.523 -55.713 364.608 1.00 65.17  ? 1191 HOH B O   1 
HETATM 9393 O O   . HOH I 5 .   ? 110.514 -54.676 374.453 1.00 59.47  ? 1192 HOH B O   1 
HETATM 9394 O O   . HOH I 5 .   ? 117.780 -60.956 359.636 1.00 54.35  ? 1193 HOH B O   1 
HETATM 9395 O O   . HOH I 5 .   ? 100.196 -67.621 329.679 1.00 65.01  ? 1194 HOH B O   1 
HETATM 9396 O O   . HOH I 5 .   ? 103.733 -18.207 339.879 1.00 48.15  ? 1195 HOH B O   1 
HETATM 9397 O O   . HOH I 5 .   ? 104.986 -22.096 338.278 1.00 53.61  ? 1196 HOH B O   1 
HETATM 9398 O O   . HOH I 5 .   ? 100.505 -57.819 331.712 1.00 48.73  ? 1197 HOH B O   1 
HETATM 9399 O O   . HOH I 5 .   ? 95.476  -62.576 365.306 1.00 59.81  ? 1198 HOH B O   1 
HETATM 9400 O O   . HOH I 5 .   ? 74.271  -33.619 356.720 1.00 61.49  ? 1199 HOH B O   1 
HETATM 9401 O O   . HOH I 5 .   ? 97.549  -46.660 373.124 1.00 64.67  ? 1200 HOH B O   1 
HETATM 9402 O O   . HOH I 5 .   ? 100.470 -60.706 350.666 1.00 55.83  ? 1201 HOH B O   1 
HETATM 9403 O O   . HOH I 5 .   ? 84.619  -21.966 366.106 1.00 54.17  ? 1202 HOH B O   1 
HETATM 9404 O O   . HOH I 5 .   ? 123.308 -51.183 369.622 1.00 68.49  ? 1203 HOH B O   1 
HETATM 9405 O O   . HOH I 5 .   ? 96.742  -26.400 376.051 1.00 42.01  ? 1204 HOH B O   1 
HETATM 9406 O O   . HOH I 5 .   ? 95.581  -45.555 355.099 1.00 65.12  ? 1205 HOH B O   1 
HETATM 9407 O O   . HOH I 5 .   ? 115.717 -33.145 385.155 1.00 59.70  ? 1206 HOH B O   1 
HETATM 9408 O O   . HOH I 5 .   ? 90.985  -47.407 367.029 1.00 64.68  ? 1207 HOH B O   1 
HETATM 9409 O O   . HOH I 5 .   ? 102.152 -46.894 324.637 1.00 51.63  ? 1208 HOH B O   1 
HETATM 9410 O O   . HOH I 5 .   ? 91.240  -43.216 321.558 1.00 48.00  ? 1209 HOH B O   1 
HETATM 9411 O O   . HOH I 5 .   ? 89.849  -42.502 349.674 1.00 58.86  ? 1210 HOH B O   1 
HETATM 9412 O O   . HOH I 5 .   ? 94.879  -49.297 365.921 1.00 45.41  ? 1211 HOH B O   1 
HETATM 9413 O O   . HOH I 5 .   ? 103.793 -20.569 339.424 1.00 40.30  ? 1212 HOH B O   1 
HETATM 9414 O O   . HOH I 5 .   ? 82.596  -14.908 361.730 1.00 61.28  ? 1213 HOH B O   1 
HETATM 9415 O O   . HOH I 5 .   ? 85.654  -41.148 350.714 1.00 63.94  ? 1214 HOH B O   1 
HETATM 9416 O O   . HOH I 5 .   ? 101.715 -37.148 337.655 1.00 57.64  ? 1215 HOH B O   1 
HETATM 9417 O O   . HOH I 5 .   ? 106.999 -21.401 336.360 1.00 69.74  ? 1216 HOH B O   1 
HETATM 9418 O O   . HOH I 5 .   ? 106.290 -56.064 341.781 1.00 67.68  ? 1217 HOH B O   1 
HETATM 9419 O O   . HOH I 5 .   ? 120.630 -25.638 366.412 1.00 60.27  ? 1218 HOH B O   1 
HETATM 9420 O O   . HOH I 5 .   ? 102.036 -60.137 330.613 1.00 55.28  ? 1219 HOH B O   1 
HETATM 9421 O O   . HOH I 5 .   ? 74.676  -18.627 346.751 1.00 56.71  ? 1220 HOH B O   1 
HETATM 9422 O O   . HOH I 5 .   ? 103.662 -52.448 379.601 1.00 54.42  ? 1221 HOH B O   1 
HETATM 9423 O O   . HOH I 5 .   ? 103.133 -14.801 380.363 1.00 56.83  ? 1222 HOH B O   1 
HETATM 9424 O O   . HOH I 5 .   ? 111.338 -56.815 329.827 1.00 72.56  ? 1223 HOH B O   1 
HETATM 9425 O O   . HOH I 5 .   ? 123.347 -33.895 337.519 1.00 65.55  ? 1224 HOH B O   1 
HETATM 9426 O O   . HOH I 5 .   ? 74.058  -30.121 348.452 1.00 48.40  ? 1225 HOH B O   1 
HETATM 9427 O O   . HOH I 5 .   ? 124.131 -51.010 336.271 1.00 65.31  ? 1226 HOH B O   1 
HETATM 9428 O O   . HOH I 5 .   ? 98.016  -60.760 346.716 1.00 51.29  ? 1227 HOH B O   1 
HETATM 9429 O O   . HOH I 5 .   ? 109.095 -30.779 334.270 1.00 55.19  ? 1228 HOH B O   1 
HETATM 9430 O O   . HOH I 5 .   ? 116.369 -42.086 336.582 1.00 58.34  ? 1229 HOH B O   1 
HETATM 9431 O O   . HOH I 5 .   ? 91.660  -15.364 338.242 1.00 66.22  ? 1230 HOH B O   1 
HETATM 9432 O O   . HOH I 5 .   ? 86.499  -18.285 339.516 1.00 56.03  ? 1231 HOH B O   1 
HETATM 9433 O O   . HOH I 5 .   ? 97.531  -37.326 335.673 1.00 63.65  ? 1232 HOH B O   1 
HETATM 9434 O O   . HOH I 5 .   ? 95.141  -42.806 356.158 1.00 50.85  ? 1233 HOH B O   1 
HETATM 9435 O O   . HOH I 5 .   ? 81.960  -34.704 365.225 1.00 51.35  ? 1234 HOH B O   1 
HETATM 9436 O O   . HOH I 5 .   ? 82.339  -36.416 362.728 1.00 45.45  ? 1235 HOH B O   1 
HETATM 9437 O O   . HOH I 5 .   ? 97.785  -59.750 334.059 1.00 38.84  ? 1236 HOH B O   1 
HETATM 9438 O O   . HOH I 5 .   ? 93.599  -36.617 322.575 1.00 61.36  ? 1237 HOH B O   1 
HETATM 9439 O O   . HOH I 5 .   ? 103.093 -15.176 346.207 1.00 64.42  ? 1238 HOH B O   1 
HETATM 9440 O O   . HOH I 5 .   ? 88.245  -66.590 332.241 1.00 63.20  ? 1239 HOH B O   1 
HETATM 9441 O O   . HOH I 5 .   ? 98.023  -13.395 357.628 1.00 67.24  ? 1240 HOH B O   1 
HETATM 9442 O O   . HOH I 5 .   ? 112.656 -64.490 363.825 1.00 56.78  ? 1241 HOH B O   1 
HETATM 9443 O O   . HOH I 5 .   ? 107.836 -62.675 372.276 1.00 56.58  ? 1242 HOH B O   1 
HETATM 9444 O O   . HOH I 5 .   ? 118.780 -25.511 371.346 1.00 46.21  ? 1243 HOH B O   1 
HETATM 9445 O O   . HOH I 5 .   ? 100.012 -14.857 350.448 1.00 52.76  ? 1244 HOH B O   1 
HETATM 9446 O O   . HOH I 5 .   ? 107.834 -17.894 368.908 1.00 53.50  ? 1245 HOH B O   1 
HETATM 9447 O O   . HOH I 5 .   ? 94.581  -64.358 346.567 1.00 64.79  ? 1246 HOH B O   1 
HETATM 9448 O O   . HOH I 5 .   ? 82.584  -46.483 336.979 1.00 52.61  ? 1247 HOH B O   1 
HETATM 9449 O O   . HOH I 5 .   ? 101.062 -17.297 353.092 1.00 38.73  ? 1248 HOH B O   1 
HETATM 9450 O O   . HOH I 5 .   ? 117.792 -44.988 330.819 1.00 56.88  ? 1249 HOH B O   1 
HETATM 9451 O O   . HOH I 5 .   ? 97.534  -41.294 375.963 1.00 60.98  ? 1250 HOH B O   1 
HETATM 9452 O O   . HOH I 5 .   ? 91.272  -19.492 336.964 1.00 65.62  ? 1251 HOH B O   1 
HETATM 9453 O O   . HOH I 5 .   ? 89.966  -35.544 339.092 1.00 58.94  ? 1252 HOH B O   1 
HETATM 9454 O O   . HOH I 5 .   ? 85.116  -65.140 333.615 1.00 58.40  ? 1253 HOH B O   1 
HETATM 9455 O O   . HOH I 5 .   ? 80.381  -39.732 360.946 1.00 54.00  ? 1254 HOH B O   1 
HETATM 9456 O O   . HOH I 5 .   ? 90.431  -40.102 321.198 1.00 58.50  ? 1255 HOH B O   1 
HETATM 9457 O O   . HOH I 5 .   ? 84.809  -40.146 348.500 1.00 48.41  ? 1256 HOH B O   1 
HETATM 9458 O O   . HOH I 5 .   ? 100.393 -20.516 388.531 1.00 66.98  ? 1257 HOH B O   1 
HETATM 9459 O O   . HOH I 5 .   ? 100.884 -25.604 338.121 1.00 55.27  ? 1258 HOH B O   1 
HETATM 9460 O O   . HOH I 5 .   ? 105.286 -18.203 354.648 1.00 58.38  ? 1259 HOH B O   1 
HETATM 9461 O O   . HOH I 5 .   ? 126.113 -32.250 370.082 1.00 59.28  ? 1260 HOH B O   1 
HETATM 9462 O O   . HOH I 5 .   ? 89.415  -62.980 324.484 1.00 65.86  ? 1261 HOH B O   1 
HETATM 9463 O O   . HOH I 5 .   ? 84.342  -21.730 338.949 1.00 57.69  ? 1262 HOH B O   1 
HETATM 9464 O O   . HOH I 5 .   ? 117.150 -25.451 349.745 1.00 50.65  ? 1263 HOH B O   1 
HETATM 9465 O O   . HOH I 5 .   ? 80.806  -49.468 331.672 1.00 60.93  ? 1264 HOH B O   1 
HETATM 9466 O O   . HOH I 5 .   ? 109.158 -20.157 382.981 1.00 51.38  ? 1265 HOH B O   1 
HETATM 9467 O O   . HOH I 5 .   ? 116.858 -59.680 364.255 1.00 55.72  ? 1266 HOH B O   1 
HETATM 9468 O O   . HOH I 5 .   ? 83.347  -16.609 364.379 1.00 58.18  ? 1267 HOH B O   1 
HETATM 9469 O O   . HOH I 5 .   ? 113.652 -18.556 355.406 1.00 65.21  ? 1268 HOH B O   1 
HETATM 9470 O O   . HOH I 5 .   ? 122.726 -41.577 369.341 1.00 60.59  ? 1269 HOH B O   1 
HETATM 9471 O O   . HOH I 5 .   ? 124.917 -43.825 346.044 1.00 43.95  ? 1270 HOH B O   1 
HETATM 9472 O O   . HOH I 5 .   ? 103.571 -16.997 357.558 1.00 58.28  ? 1271 HOH B O   1 
HETATM 9473 O O   . HOH I 5 .   ? 104.443 -65.795 358.444 1.00 64.10  ? 1272 HOH B O   1 
HETATM 9474 O O   . HOH I 5 .   ? 126.145 -46.410 345.423 1.00 48.69  ? 1273 HOH B O   1 
HETATM 9475 O O   . HOH I 5 .   ? 99.888  -14.961 352.867 1.00 49.30  ? 1274 HOH B O   1 
HETATM 9476 O O   . HOH I 5 .   ? 106.940 -53.312 344.023 1.00 55.86  ? 1275 HOH B O   1 
HETATM 9477 O O   . HOH I 5 .   ? 121.088 -27.513 371.382 1.00 53.88  ? 1276 HOH B O   1 
HETATM 9478 O O   . HOH I 5 .   ? 125.964 -27.025 366.415 1.00 63.20  ? 1277 HOH B O   1 
HETATM 9479 O O   . HOH I 5 .   ? 119.773 -31.661 382.056 1.00 55.81  ? 1278 HOH B O   1 
HETATM 9480 O O   . HOH I 5 .   ? 120.142 -41.116 335.431 1.00 53.09  ? 1279 HOH B O   1 
HETATM 9481 O O   . HOH I 5 .   ? 98.148  -42.881 379.711 1.00 64.90  ? 1280 HOH B O   1 
HETATM 9482 O O   . HOH I 5 .   ? 105.912 -34.556 333.543 1.00 65.21  ? 1281 HOH B O   1 
HETATM 9483 O O   . HOH I 5 .   ? 103.176 -16.996 355.053 1.00 51.75  ? 1282 HOH B O   1 
HETATM 9484 O O   . HOH I 5 .   ? 103.300 -13.946 353.838 1.00 71.42  ? 1283 HOH B O   1 
HETATM 9485 O O   . HOH I 5 .   ? 88.579  -68.123 328.463 1.00 60.35  ? 1284 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ARG A 2   ? 1.2907 1.4980 1.2214 -0.1195 0.1889  -0.0041 3   ARG A N   
2    C CA  . ARG A 2   ? 1.3097 1.5018 1.2204 -0.1101 0.1857  -0.0034 3   ARG A CA  
3    C C   . ARG A 2   ? 1.2111 1.3892 1.1233 -0.1018 0.1762  -0.0016 3   ARG A C   
4    O O   . ARG A 2   ? 1.2554 1.4381 1.1760 -0.0895 0.1728  -0.0083 3   ARG A O   
5    C CB  . ARG A 2   ? 1.3911 1.5637 1.2677 -0.1183 0.1882  0.0064  3   ARG A CB  
6    C CG  . ARG A 2   ? 1.4726 1.6164 1.3294 -0.1238 0.1830  0.0189  3   ARG A CG  
7    C CD  . ARG A 2   ? 1.5529 1.6778 1.3800 -0.1332 0.1863  0.0303  3   ARG A CD  
8    N NE  . ARG A 2   ? 1.6122 1.7120 1.4299 -0.1403 0.1829  0.0403  3   ARG A NE  
9    C CZ  . ARG A 2   ? 1.6578 1.7280 1.4506 -0.1378 0.1782  0.0517  3   ARG A CZ  
10   N NH1 . ARG A 2   ? 1.6658 1.7306 1.4403 -0.1286 0.1755  0.0554  3   ARG A NH1 
11   N NH2 . ARG A 2   ? 1.6764 1.7223 1.4628 -0.1442 0.1759  0.0592  3   ARG A NH2 
12   N N   . GLU A 3   ? 1.0693 1.2302 0.9741 -0.1088 0.1723  0.0066  4   GLU A N   
13   C CA  . GLU A 3   ? 0.9334 1.0774 0.8344 -0.1025 0.1642  0.0097  4   GLU A CA  
14   C C   . GLU A 3   ? 0.8128 0.9495 0.7199 -0.1122 0.1620  0.0137  4   GLU A C   
15   O O   . GLU A 3   ? 0.8488 0.9802 0.7488 -0.1253 0.1659  0.0185  4   GLU A O   
16   C CB  . GLU A 3   ? 0.9484 1.0657 0.8173 -0.0995 0.1611  0.0184  4   GLU A CB  
17   C CG  . GLU A 3   ? 0.9763 1.0992 0.8363 -0.0896 0.1609  0.0143  4   GLU A CG  
18   C CD  . GLU A 3   ? 0.9596 1.0853 0.8294 -0.0765 0.1543  0.0080  4   GLU A CD  
19   O OE1 . GLU A 3   ? 0.9166 1.0530 0.8113 -0.0734 0.1523  0.0021  4   GLU A OE1 
20   O OE2 . GLU A 3   ? 0.9343 1.0524 0.7871 -0.0696 0.1506  0.0093  4   GLU A OE2 
21   N N   . ASP A 4   ? 0.7230 0.8594 0.6429 -0.1064 0.1556  0.0115  5   ASP A N   
22   C CA  . ASP A 4   ? 0.6460 0.7737 0.5698 -0.1151 0.1523  0.0145  5   ASP A CA  
23   C C   . ASP A 4   ? 0.6270 0.7197 0.5252 -0.1139 0.1484  0.0222  5   ASP A C   
24   O O   . ASP A 4   ? 0.6114 0.6986 0.5073 -0.1022 0.1440  0.0212  5   ASP A O   
25   C CB  . ASP A 4   ? 0.6025 0.7536 0.5571 -0.1097 0.1477  0.0074  5   ASP A CB  
26   C CG  . ASP A 4   ? 0.6783 0.8263 0.6391 -0.1207 0.1441  0.0093  5   ASP A CG  
27   O OD1 . ASP A 4   ? 0.6437 0.8159 0.6310 -0.1191 0.1404  0.0047  5   ASP A OD1 
28   O OD2 . ASP A 4   ? 0.7266 0.8473 0.6655 -0.1307 0.1446  0.0154  5   ASP A OD2 
29   N N   . ALA A 5   ? 0.5727 0.6408 0.4520 -0.1254 0.1503  0.0299  6   ALA A N   
30   C CA  . ALA A 5   ? 0.6195 0.6503 0.4730 -0.1227 0.1475  0.0383  6   ALA A CA  
31   C C   . ALA A 5   ? 0.5675 0.5901 0.4279 -0.1178 0.1416  0.0358  6   ALA A C   
32   O O   . ALA A 5   ? 0.6070 0.6050 0.4546 -0.1061 0.1354  0.0401  6   ALA A O   
33   C CB  . ALA A 5   ? 0.6553 0.6597 0.4899 -0.1359 0.1510  0.0462  6   ALA A CB  
34   N N   . GLU A 6   ? 0.5176 0.5613 0.4021 -0.1228 0.1397  0.0287  7   GLU A N   
35   C CA  . GLU A 6   ? 0.5100 0.5470 0.4043 -0.1155 0.1303  0.0259  7   GLU A CA  
36   C C   . GLU A 6   ? 0.4572 0.5021 0.3617 -0.0955 0.1226  0.0228  7   GLU A C   
37   O O   . GLU A 6   ? 0.4360 0.4665 0.3399 -0.0866 0.1151  0.0228  7   GLU A O   
38   C CB  . GLU A 6   ? 0.5616 0.6233 0.4790 -0.1262 0.1293  0.0201  7   GLU A CB  
39   C CG  . GLU A 6   ? 0.7354 0.7860 0.6431 -0.1468 0.1344  0.0220  7   GLU A CG  
40   C CD  . GLU A 6   ? 0.8614 0.8692 0.7443 -0.1503 0.1338  0.0263  7   GLU A CD  
41   O OE1 . GLU A 6   ? 0.8773 0.8745 0.7621 -0.1387 0.1259  0.0246  7   GLU A OE1 
42   O OE2 . GLU A 6   ? 0.9359 0.9201 0.8008 -0.1606 0.1383  0.0307  7   GLU A OE2 
43   N N   . LEU A 7   ? 0.4141 0.4811 0.3273 -0.0891 0.1250  0.0193  8   LEU A N   
44   C CA  . LEU A 7   ? 0.4638 0.5391 0.3869 -0.0721 0.1188  0.0152  8   LEU A CA  
45   C C   . LEU A 7   ? 0.4394 0.4978 0.3405 -0.0635 0.1179  0.0196  8   LEU A C   
46   O O   . LEU A 7   ? 0.4640 0.5316 0.3712 -0.0516 0.1142  0.0154  8   LEU A O   
47   C CB  . LEU A 7   ? 0.4385 0.5479 0.3861 -0.0697 0.1221  0.0072  8   LEU A CB  
48   C CG  . LEU A 7   ? 0.3879 0.5195 0.3600 -0.0772 0.1223  0.0040  8   LEU A CG  
49   C CD1 . LEU A 7   ? 0.3273 0.4922 0.3246 -0.0727 0.1266  -0.0032 8   LEU A CD1 
50   C CD2 . LEU A 7   ? 0.3034 0.4283 0.2843 -0.0724 0.1122  0.0042  8   LEU A CD2 
51   N N   . LEU A 8   ? 0.4596 0.4935 0.3352 -0.0694 0.1211  0.0283  9   LEU A N   
52   C CA  . LEU A 8   ? 0.5085 0.5266 0.3618 -0.0613 0.1193  0.0350  9   LEU A CA  
53   C C   . LEU A 8   ? 0.5219 0.5076 0.3607 -0.0568 0.1142  0.0428  9   LEU A C   
54   O O   . LEU A 8   ? 0.6323 0.5980 0.4615 -0.0670 0.1180  0.0475  9   LEU A O   
55   C CB  . LEU A 8   ? 0.4798 0.4976 0.3139 -0.0712 0.1282  0.0403  9   LEU A CB  
56   C CG  . LEU A 8   ? 0.5336 0.5834 0.3800 -0.0753 0.1352  0.0319  9   LEU A CG  
57   C CD1 . LEU A 8   ? 0.5294 0.5768 0.3554 -0.0855 0.1434  0.0380  9   LEU A CD1 
58   C CD2 . LEU A 8   ? 0.4801 0.5456 0.3357 -0.0614 0.1302  0.0244  9   LEU A CD2 
59   N N   . VAL A 9   ? 0.4805 0.4612 0.3181 -0.0418 0.1063  0.0436  10  VAL A N   
60   C CA  . VAL A 9   ? 0.5238 0.4764 0.3506 -0.0344 0.1016  0.0502  10  VAL A CA  
61   C C   . VAL A 9   ? 0.5209 0.4689 0.3340 -0.0214 0.0967  0.0568  10  VAL A C   
62   O O   . VAL A 9   ? 0.5308 0.5008 0.3503 -0.0154 0.0935  0.0521  10  VAL A O   
63   C CB  . VAL A 9   ? 0.5189 0.4745 0.3647 -0.0290 0.0958  0.0431  10  VAL A CB  
64   C CG1 . VAL A 9   ? 0.4908 0.4217 0.3273 -0.0181 0.0910  0.0483  10  VAL A CG1 
65   C CG2 . VAL A 9   ? 0.5558 0.5130 0.4113 -0.0429 0.0997  0.0386  10  VAL A CG2 
66   N N   . THR A 10  ? 0.4777 0.3971 0.2717 -0.0172 0.0961  0.0677  11  THR A N   
67   C CA  . THR A 10  ? 0.4997 0.4146 0.2818 -0.0033 0.0899  0.0758  11  THR A CA  
68   C C   . THR A 10  ? 0.5193 0.4209 0.3080 0.0097  0.0838  0.0762  11  THR A C   
69   O O   . THR A 10  ? 0.5672 0.4426 0.3515 0.0079  0.0868  0.0790  11  THR A O   
70   C CB  . THR A 10  ? 0.5585 0.4518 0.3132 -0.0062 0.0938  0.0903  11  THR A CB  
71   O OG1 . THR A 10  ? 0.5540 0.4625 0.3020 -0.0188 0.1002  0.0894  11  THR A OG1 
72   C CG2 . THR A 10  ? 0.6084 0.4996 0.3519 0.0095  0.0859  0.1000  11  THR A CG2 
73   N N   . VAL A 11  ? 0.4634 0.3834 0.2627 0.0218  0.0760  0.0725  12  VAL A N   
74   C CA  . VAL A 11  ? 0.4672 0.3789 0.2725 0.0355  0.0701  0.0736  12  VAL A CA  
75   C C   . VAL A 11  ? 0.5200 0.4332 0.3135 0.0484  0.0640  0.0839  12  VAL A C   
76   O O   . VAL A 11  ? 0.5631 0.4809 0.3416 0.0451  0.0647  0.0904  12  VAL A O   
77   C CB  . VAL A 11  ? 0.4975 0.4307 0.3266 0.0381  0.0658  0.0610  12  VAL A CB  
78   C CG1 . VAL A 11  ? 0.3815 0.3148 0.2217 0.0256  0.0708  0.0527  12  VAL A CG1 
79   C CG2 . VAL A 11  ? 0.4339 0.3968 0.2701 0.0398  0.0616  0.0557  12  VAL A CG2 
80   N N   . ARG A 12  ? 0.5904 0.5020 0.3906 0.0627  0.0581  0.0855  13  ARG A N   
81   C CA  . ARG A 12  ? 0.6570 0.5725 0.4480 0.0762  0.0513  0.0964  13  ARG A CA  
82   C C   . ARG A 12  ? 0.5518 0.4980 0.3413 0.0739  0.0464  0.0941  13  ARG A C   
83   O O   . ARG A 12  ? 0.6322 0.5795 0.4039 0.0757  0.0442  0.1048  13  ARG A O   
84   C CB  . ARG A 12  ? 0.7206 0.6388 0.5254 0.0914  0.0456  0.0953  13  ARG A CB  
85   C CG  . ARG A 12  ? 0.8661 0.7512 0.6668 0.0977  0.0502  0.1008  13  ARG A CG  
86   C CD  . ARG A 12  ? 1.0606 0.9476 0.8690 0.1166  0.0446  0.1053  13  ARG A CD  
87   N NE  . ARG A 12  ? 1.2088 1.0676 1.0199 0.1220  0.0503  0.1043  13  ARG A NE  
88   C CZ  . ARG A 12  ? 1.2891 1.1112 1.0867 0.1168  0.0588  0.1082  13  ARG A CZ  
89   N NH1 . ARG A 12  ? 1.3314 1.1389 1.1110 0.1057  0.0628  0.1152  13  ARG A NH1 
90   N NH2 . ARG A 12  ? 1.2635 1.0627 1.0648 0.1221  0.0639  0.1047  13  ARG A NH2 
91   N N   . GLY A 13  ? 0.4882 0.4588 0.2954 0.0701  0.0446  0.0803  14  GLY A N   
92   C CA  . GLY A 13  ? 0.4716 0.4705 0.2785 0.0686  0.0400  0.0758  14  GLY A CA  
93   C C   . GLY A 13  ? 0.5226 0.5249 0.3145 0.0565  0.0456  0.0762  14  GLY A C   
94   O O   . GLY A 13  ? 0.5506 0.5707 0.3326 0.0557  0.0423  0.0770  14  GLY A O   
95   N N   . GLY A 14  ? 0.5363 0.5236 0.3261 0.0462  0.0544  0.0753  15  GLY A N   
96   C CA  . GLY A 14  ? 0.4558 0.4479 0.2333 0.0339  0.0613  0.0749  15  GLY A CA  
97   C C   . GLY A 14  ? 0.4467 0.4337 0.2347 0.0223  0.0700  0.0673  15  GLY A C   
98   O O   . GLY A 14  ? 0.5004 0.4730 0.2986 0.0229  0.0710  0.0663  15  GLY A O   
99   N N   . ARG A 15  ? 0.4548 0.4558 0.2407 0.0115  0.0765  0.0617  16  ARG A N   
100  C CA  . ARG A 15  ? 0.4419 0.4424 0.2369 -0.0005 0.0854  0.0559  16  ARG A CA  
101  C C   . ARG A 15  ? 0.4556 0.4770 0.2771 -0.0006 0.0853  0.0410  16  ARG A C   
102  O O   . ARG A 15  ? 0.4147 0.4543 0.2431 0.0042  0.0818  0.0334  16  ARG A O   
103  C CB  . ARG A 15  ? 0.4505 0.4553 0.2290 -0.0123 0.0940  0.0588  16  ARG A CB  
104  C CG  . ARG A 15  ? 0.5126 0.4920 0.2648 -0.0152 0.0961  0.0750  16  ARG A CG  
105  C CD  . ARG A 15  ? 0.5805 0.5660 0.3156 -0.0283 0.1052  0.0778  16  ARG A CD  
106  N NE  . ARG A 15  ? 0.6724 0.6768 0.3953 -0.0256 0.1026  0.0770  16  ARG A NE  
107  C CZ  . ARG A 15  ? 0.7333 0.7555 0.4487 -0.0358 0.1105  0.0720  16  ARG A CZ  
108  N NH1 . ARG A 15  ? 0.6705 0.6957 0.3925 -0.0483 0.1211  0.0677  16  ARG A NH1 
109  N NH2 . ARG A 15  ? 0.7424 0.7811 0.4449 -0.0337 0.1076  0.0706  16  ARG A NH2 
110  N N   . LEU A 16  ? 0.3970 0.4154 0.2331 -0.0066 0.0891  0.0372  17  LEU A N   
111  C CA  . LEU A 16  ? 0.3618 0.3978 0.2237 -0.0064 0.0889  0.0254  17  LEU A CA  
112  C C   . LEU A 16  ? 0.4047 0.4508 0.2752 -0.0183 0.0977  0.0214  17  LEU A C   
113  O O   . LEU A 16  ? 0.4502 0.4850 0.3089 -0.0278 0.1032  0.0277  17  LEU A O   
114  C CB  . LEU A 16  ? 0.3575 0.3845 0.2326 -0.0009 0.0829  0.0247  17  LEU A CB  
115  C CG  . LEU A 16  ? 0.3553 0.3750 0.2272 0.0113  0.0745  0.0277  17  LEU A CG  
116  C CD1 . LEU A 16  ? 0.3544 0.3630 0.2365 0.0139  0.0713  0.0274  17  LEU A CD1 
117  C CD2 . LEU A 16  ? 0.3662 0.4059 0.2476 0.0174  0.0703  0.0198  17  LEU A CD2 
118  N N   . ARG A 17  ? 0.4011 0.4685 0.2930 -0.0175 0.0992  0.0109  18  ARG A N   
119  C CA  . ARG A 17  ? 0.3310 0.4134 0.2377 -0.0265 0.1067  0.0061  18  ARG A CA  
120  C C   . ARG A 17  ? 0.3672 0.4598 0.3009 -0.0221 0.1025  0.0000  18  ARG A C   
121  O O   . ARG A 17  ? 0.3473 0.4469 0.2921 -0.0130 0.0983  -0.0058 18  ARG A O   
122  C CB  . ARG A 17  ? 0.3741 0.4754 0.2804 -0.0293 0.1148  -0.0004 18  ARG A CB  
123  C CG  . ARG A 17  ? 0.3274 0.4482 0.2516 -0.0373 0.1235  -0.0057 18  ARG A CG  
124  C CD  . ARG A 17  ? 0.2938 0.4336 0.2185 -0.0384 0.1325  -0.0140 18  ARG A CD  
125  N NE  . ARG A 17  ? 0.4297 0.5622 0.3260 -0.0451 0.1371  -0.0084 18  ARG A NE  
126  C CZ  . ARG A 17  ? 0.4803 0.6101 0.3595 -0.0407 0.1351  -0.0094 18  ARG A CZ  
127  N NH1 . ARG A 17  ? 0.4448 0.5799 0.3318 -0.0311 0.1303  -0.0173 18  ARG A NH1 
128  N NH2 . ARG A 17  ? 0.4454 0.5674 0.2997 -0.0463 0.1375  -0.0023 18  ARG A NH2 
129  N N   . GLY A 18  ? 0.3370 0.4302 0.2803 -0.0294 0.1035  0.0018  19  GLY A N   
130  C CA  . GLY A 18  ? 0.2560 0.3594 0.2229 -0.0265 0.0988  -0.0019 19  GLY A CA  
131  C C   . GLY A 18  ? 0.3055 0.4344 0.2945 -0.0311 0.1045  -0.0068 19  GLY A C   
132  O O   . GLY A 18  ? 0.2812 0.4224 0.2697 -0.0348 0.1128  -0.0098 19  GLY A O   
133  N N   . ILE A 19  ? 0.2423 0.3806 0.2513 -0.0305 0.0998  -0.0075 20  ILE A N   
134  C CA  . ILE A 19  ? 0.2861 0.4512 0.3199 -0.0334 0.1034  -0.0108 20  ILE A CA  
135  C C   . ILE A 19  ? 0.3058 0.4743 0.3448 -0.0439 0.1004  -0.0066 20  ILE A C   
136  O O   . ILE A 19  ? 0.3090 0.4594 0.3368 -0.0461 0.0943  -0.0028 20  ILE A O   
137  C CB  . ILE A 19  ? 0.3549 0.5339 0.4128 -0.0208 0.1001  -0.0157 20  ILE A CB  
138  C CG1 . ILE A 19  ? 0.4250 0.5958 0.4881 -0.0164 0.0895  -0.0123 20  ILE A CG1 
139  C CG2 . ILE A 19  ? 0.3359 0.5102 0.3876 -0.0120 0.1031  -0.0215 20  ILE A CG2 
140  C CD1 . ILE A 19  ? 0.4543 0.6331 0.5376 -0.0042 0.0859  -0.0156 20  ILE A CD1 
141  N N   . ARG A 20  ? 0.3193 0.5133 0.3762 -0.0507 0.1051  -0.0079 21  ARG A N   
142  C CA  . ARG A 20  ? 0.3418 0.5473 0.4086 -0.0614 0.1017  -0.0051 21  ARG A CA  
143  C C   . ARG A 20  ? 0.3371 0.5640 0.4321 -0.0523 0.0948  -0.0057 21  ARG A C   
144  O O   . ARG A 20  ? 0.3131 0.5621 0.4299 -0.0442 0.0982  -0.0090 21  ARG A O   
145  C CB  . ARG A 20  ? 0.3708 0.5945 0.4410 -0.0757 0.1107  -0.0054 21  ARG A CB  
146  C CG  . ARG A 20  ? 0.4270 0.6704 0.5116 -0.0879 0.1074  -0.0036 21  ARG A CG  
147  C CD  . ARG A 20  ? 0.5893 0.8484 0.6797 -0.0978 0.1138  -0.0043 21  ARG A CD  
148  N NE  . ARG A 20  ? 0.6659 0.9529 0.7814 -0.1008 0.1084  -0.0038 21  ARG A NE  
149  C CZ  . ARG A 20  ? 0.7021 0.9937 0.8148 -0.1170 0.1073  -0.0023 21  ARG A CZ  
150  N NH1 . ARG A 20  ? 0.7924 1.0597 0.8784 -0.1314 0.1117  -0.0013 21  ARG A NH1 
151  N NH2 . ARG A 20  ? 0.6467 0.9662 0.7828 -0.1184 0.1015  -0.0018 21  ARG A NH2 
152  N N   . LEU A 21  ? 0.2973 0.5169 0.3913 -0.0531 0.0855  -0.0024 22  LEU A N   
153  C CA  . LEU A 21  ? 0.3249 0.5616 0.4421 -0.0447 0.0775  -0.0008 22  LEU A CA  
154  C C   . LEU A 21  ? 0.2958 0.5590 0.4288 -0.0557 0.0744  0.0020  22  LEU A C   
155  O O   . LEU A 21  ? 0.2983 0.5550 0.4171 -0.0709 0.0738  0.0032  22  LEU A O   
156  C CB  . LEU A 21  ? 0.3773 0.5919 0.4831 -0.0390 0.0689  0.0013  22  LEU A CB  
157  C CG  . LEU A 21  ? 0.4003 0.5981 0.5009 -0.0250 0.0688  -0.0011 22  LEU A CG  
158  C CD1 . LEU A 21  ? 0.3797 0.5633 0.4746 -0.0207 0.0600  0.0015  22  LEU A CD1 
159  C CD2 . LEU A 21  ? 0.3448 0.5606 0.4685 -0.0136 0.0718  -0.0041 22  LEU A CD2 
160  N N   . LYS A 22  ? 0.3331 0.6262 0.4957 -0.0481 0.0724  0.0031  23  LYS A N   
161  C CA  . LYS A 22  ? 0.3125 0.6334 0.4924 -0.0562 0.0664  0.0071  23  LYS A CA  
162  C C   . LYS A 22  ? 0.3213 0.6379 0.4999 -0.0546 0.0545  0.0121  23  LYS A C   
163  O O   . LYS A 22  ? 0.4280 0.7347 0.6104 -0.0403 0.0504  0.0137  23  LYS A O   
164  C CB  . LYS A 22  ? 0.3857 0.7289 0.5938 -0.0453 0.0670  0.0073  23  LYS A CB  
165  C CG  . LYS A 22  ? 0.5657 0.9133 0.7750 -0.0476 0.0783  0.0024  23  LYS A CG  
166  C CD  . LYS A 22  ? 0.7058 1.0741 0.9447 -0.0351 0.0797  0.0021  23  LYS A CD  
167  C CE  . LYS A 22  ? 0.7582 1.1326 0.9983 -0.0382 0.0917  -0.0028 23  LYS A CE  
168  N NZ  . LYS A 22  ? 0.8013 1.1853 1.0331 -0.0570 0.0930  -0.0019 23  LYS A NZ  
169  N N   . THR A 23  ? 0.2563 0.5779 0.4272 -0.0703 0.0494  0.0142  24  THR A N   
170  C CA  . THR A 23  ? 0.3697 0.6940 0.5405 -0.0715 0.0378  0.0190  24  THR A CA  
171  C C   . THR A 23  ? 0.4398 0.7926 0.6246 -0.0805 0.0316  0.0220  24  THR A C   
172  O O   . THR A 23  ? 0.3727 0.7348 0.5598 -0.0891 0.0366  0.0192  24  THR A O   
173  C CB  . THR A 23  ? 0.2875 0.5781 0.4262 -0.0812 0.0363  0.0166  24  THR A CB  
174  O OG1 . THR A 23  ? 0.3359 0.6295 0.4633 -0.1019 0.0384  0.0142  24  THR A OG1 
175  C CG2 . THR A 23  ? 0.2954 0.5511 0.4146 -0.0734 0.0435  0.0126  24  THR A CG2 
176  N N   . PRO A 24  ? 0.5245 0.8888 0.7166 -0.0779 0.0201  0.0279  25  PRO A N   
177  C CA  . PRO A 24  ? 0.5577 0.9460 0.7582 -0.0868 0.0130  0.0308  25  PRO A CA  
178  C C   . PRO A 24  ? 0.5301 0.9150 0.7118 -0.1092 0.0159  0.0256  25  PRO A C   
179  O O   . PRO A 24  ? 0.6587 1.0641 0.8495 -0.1166 0.0152  0.0254  25  PRO A O   
180  C CB  . PRO A 24  ? 0.6001 0.9920 0.7999 -0.0835 0.0008  0.0377  25  PRO A CB  
181  C CG  . PRO A 24  ? 0.5736 0.9524 0.7799 -0.0650 0.0016  0.0403  25  PRO A CG  
182  C CD  . PRO A 24  ? 0.5476 0.9054 0.7426 -0.0649 0.0133  0.0331  25  PRO A CD  
183  N N   . GLY A 25  ? 0.4585 0.8166 0.6142 -0.1202 0.0198  0.0210  26  GLY A N   
184  C CA  . GLY A 25  ? 0.4007 0.7481 0.5351 -0.1417 0.0229  0.0156  26  GLY A CA  
185  C C   . GLY A 25  ? 0.4330 0.7629 0.5562 -0.1486 0.0354  0.0103  26  GLY A C   
186  O O   . GLY A 25  ? 0.5898 0.9085 0.6955 -0.1665 0.0386  0.0060  26  GLY A O   
187  N N   . GLY A 26  ? 0.3396 0.6650 0.4705 -0.1352 0.0429  0.0105  27  GLY A N   
188  C CA  . GLY A 26  ? 0.3596 0.6680 0.4779 -0.1411 0.0547  0.0067  27  GLY A CA  
189  C C   . GLY A 26  ? 0.3781 0.6683 0.4913 -0.1278 0.0620  0.0063  27  GLY A C   
190  O O   . GLY A 26  ? 0.3738 0.6576 0.4906 -0.1124 0.0570  0.0081  27  GLY A O   
191  N N   . PRO A 27  ? 0.3555 0.6308 0.4565 -0.1314 0.0725  0.0040  28  PRO A N   
192  C CA  . PRO A 27  ? 0.2476 0.5019 0.3398 -0.1170 0.0782  0.0034  28  PRO A CA  
193  C C   . PRO A 27  ? 0.3195 0.5326 0.3842 -0.1136 0.0758  0.0034  28  PRO A C   
194  O O   . PRO A 27  ? 0.2988 0.4930 0.3451 -0.1265 0.0750  0.0028  28  PRO A O   
195  C CB  . PRO A 27  ? 0.2727 0.5257 0.3577 -0.1253 0.0896  0.0018  28  PRO A CB  
196  C CG  . PRO A 27  ? 0.3246 0.5733 0.3991 -0.1450 0.0890  0.0015  28  PRO A CG  
197  C CD  . PRO A 27  ? 0.3551 0.6288 0.4477 -0.1469 0.0781  0.0022  28  PRO A CD  
198  N N   . VAL A 28  ? 0.3169 0.5168 0.3798 -0.0961 0.0752  0.0035  29  VAL A N   
199  C CA  . VAL A 28  ? 0.2701 0.4344 0.3100 -0.0898 0.0736  0.0037  29  VAL A CA  
200  C C   . VAL A 28  ? 0.3086 0.4604 0.3410 -0.0786 0.0794  0.0033  29  VAL A C   
201  O O   . VAL A 28  ? 0.2763 0.4475 0.3254 -0.0701 0.0815  0.0019  29  VAL A O   
202  C CB  . VAL A 28  ? 0.3190 0.4840 0.3659 -0.0800 0.0639  0.0044  29  VAL A CB  
203  C CG1 . VAL A 28  ? 0.3683 0.5018 0.3963 -0.0701 0.0631  0.0042  29  VAL A CG1 
204  C CG2 . VAL A 28  ? 0.2963 0.4694 0.3437 -0.0930 0.0581  0.0048  29  VAL A CG2 
205  N N   . SER A 29  ? 0.2840 0.4041 0.2912 -0.0787 0.0821  0.0044  30  SER A N   
206  C CA  . SER A 29  ? 0.3389 0.4469 0.3361 -0.0681 0.0858  0.0049  30  SER A CA  
207  C C   . SER A 29  ? 0.3493 0.4484 0.3472 -0.0528 0.0792  0.0044  30  SER A C   
208  O O   . SER A 29  ? 0.3431 0.4269 0.3333 -0.0521 0.0744  0.0051  30  SER A O   
209  C CB  . SER A 29  ? 0.3317 0.4114 0.3018 -0.0751 0.0919  0.0083  30  SER A CB  
210  O OG  . SER A 29  ? 0.4727 0.5592 0.4408 -0.0911 0.0988  0.0089  30  SER A OG  
211  N N   . ALA A 30  ? 0.2571 0.3661 0.2640 -0.0414 0.0796  0.0023  31  ALA A N   
212  C CA  . ALA A 30  ? 0.2609 0.3642 0.2700 -0.0282 0.0738  0.0012  31  ALA A CA  
213  C C   . ALA A 30  ? 0.2917 0.3860 0.2887 -0.0208 0.0768  0.0004  31  ALA A C   
214  O O   . ALA A 30  ? 0.3124 0.4170 0.3108 -0.0219 0.0828  -0.0015 31  ALA A O   
215  C CB  . ALA A 30  ? 0.1950 0.3204 0.2296 -0.0216 0.0699  -0.0012 31  ALA A CB  
216  N N   . PHE A 31  ? 0.2892 0.3665 0.2743 -0.0135 0.0726  0.0018  32  PHE A N   
217  C CA  . PHE A 31  ? 0.2812 0.3522 0.2550 -0.0058 0.0733  0.0016  32  PHE A CA  
218  C C   . PHE A 31  ? 0.2589 0.3332 0.2424 0.0044  0.0670  -0.0015 32  PHE A C   
219  O O   . PHE A 31  ? 0.3175 0.3799 0.2952 0.0084  0.0623  0.0006  32  PHE A O   
220  C CB  . PHE A 31  ? 0.2409 0.2890 0.1907 -0.0070 0.0743  0.0076  32  PHE A CB  
221  C CG  . PHE A 31  ? 0.2841 0.3262 0.2225 -0.0184 0.0812  0.0112  32  PHE A CG  
222  C CD1 . PHE A 31  ? 0.2805 0.3238 0.2072 -0.0202 0.0866  0.0130  32  PHE A CD1 
223  C CD2 . PHE A 31  ? 0.3448 0.3807 0.2834 -0.0286 0.0826  0.0124  32  PHE A CD2 
224  C CE1 . PHE A 31  ? 0.3888 0.4264 0.3044 -0.0320 0.0936  0.0168  32  PHE A CE1 
225  C CE2 . PHE A 31  ? 0.4144 0.4445 0.3424 -0.0409 0.0894  0.0155  32  PHE A CE2 
226  C CZ  . PHE A 31  ? 0.3449 0.3754 0.2616 -0.0425 0.0952  0.0180  32  PHE A CZ  
227  N N   . LEU A 32  ? 0.2352 0.3251 0.2339 0.0083  0.0677  -0.0067 33  LEU A N   
228  C CA  . LEU A 32  ? 0.2202 0.3138 0.2307 0.0160  0.0626  -0.0100 33  LEU A CA  
229  C C   . LEU A 32  ? 0.2435 0.3362 0.2466 0.0217  0.0626  -0.0137 33  LEU A C   
230  O O   . LEU A 32  ? 0.2568 0.3551 0.2554 0.0205  0.0679  -0.0170 33  LEU A O   
231  C CB  . LEU A 32  ? 0.2685 0.3780 0.3021 0.0167  0.0634  -0.0131 33  LEU A CB  
232  C CG  . LEU A 32  ? 0.2188 0.3358 0.2610 0.0097  0.0635  -0.0094 33  LEU A CG  
233  C CD1 . LEU A 32  ? 0.1960 0.3317 0.2627 0.0123  0.0642  -0.0113 33  LEU A CD1 
234  C CD2 . LEU A 32  ? 0.2006 0.3076 0.2374 0.0073  0.0573  -0.0051 33  LEU A CD2 
235  N N   . GLY A 33  ? 0.2189 0.3062 0.2204 0.0271  0.0570  -0.0137 34  GLY A N   
236  C CA  . GLY A 33  ? 0.2284 0.3175 0.2238 0.0314  0.0558  -0.0177 34  GLY A CA  
237  C C   . GLY A 33  ? 0.2558 0.3385 0.2302 0.0316  0.0560  -0.0136 34  GLY A C   
238  O O   . GLY A 33  ? 0.2562 0.3445 0.2226 0.0313  0.0583  -0.0167 34  GLY A O   
239  N N   . ILE A 34  ? 0.2262 0.2967 0.1908 0.0323  0.0538  -0.0065 35  ILE A N   
240  C CA  . ILE A 34  ? 0.2129 0.2747 0.1580 0.0347  0.0530  -0.0004 35  ILE A CA  
241  C C   . ILE A 34  ? 0.2929 0.3585 0.2374 0.0423  0.0466  -0.0009 35  ILE A C   
242  O O   . ILE A 34  ? 0.2731 0.3370 0.2263 0.0457  0.0430  -0.0013 35  ILE A O   
243  C CB  . ILE A 34  ? 0.2948 0.3390 0.2302 0.0328  0.0543  0.0071  35  ILE A CB  
244  C CG1 . ILE A 34  ? 0.3248 0.3681 0.2627 0.0232  0.0602  0.0070  35  ILE A CG1 
245  C CG2 . ILE A 34  ? 0.3103 0.3434 0.2256 0.0367  0.0537  0.0149  35  ILE A CG2 
246  C CD1 . ILE A 34  ? 0.3402 0.3654 0.2702 0.0189  0.0618  0.0123  35  ILE A CD1 
247  N N   . PRO A 35  ? 0.3132 0.3858 0.2475 0.0445  0.0450  -0.0011 36  PRO A N   
248  C CA  . PRO A 35  ? 0.2620 0.3416 0.1965 0.0511  0.0383  -0.0012 36  PRO A CA  
249  C C   . PRO A 35  ? 0.3176 0.3858 0.2439 0.0580  0.0352  0.0082  36  PRO A C   
250  O O   . PRO A 35  ? 0.3324 0.3896 0.2435 0.0588  0.0370  0.0162  36  PRO A O   
251  C CB  . PRO A 35  ? 0.2694 0.3610 0.1931 0.0496  0.0377  -0.0036 36  PRO A CB  
252  C CG  . PRO A 35  ? 0.2771 0.3619 0.1876 0.0446  0.0438  0.0002  36  PRO A CG  
253  C CD  . PRO A 35  ? 0.2766 0.3531 0.1981 0.0401  0.0492  -0.0011 36  PRO A CD  
254  N N   . PHE A 36  ? 0.2882 0.3581 0.2245 0.0632  0.0314  0.0074  37  PHE A N   
255  C CA  . PHE A 36  ? 0.3460 0.4069 0.2766 0.0717  0.0290  0.0150  37  PHE A CA  
256  C C   . PHE A 36  ? 0.2829 0.3597 0.2171 0.0795  0.0224  0.0154  37  PHE A C   
257  O O   . PHE A 36  ? 0.3364 0.4085 0.2668 0.0887  0.0202  0.0224  37  PHE A O   
258  C CB  . PHE A 36  ? 0.2757 0.3235 0.2135 0.0716  0.0315  0.0146  37  PHE A CB  
259  C CG  . PHE A 36  ? 0.2586 0.3176 0.2129 0.0707  0.0294  0.0077  37  PHE A CG  
260  C CD1 . PHE A 36  ? 0.2681 0.3333 0.2281 0.0779  0.0260  0.0079  37  PHE A CD1 
261  C CD2 . PHE A 36  ? 0.2043 0.2671 0.1687 0.0629  0.0311  0.0018  37  PHE A CD2 
262  C CE1 . PHE A 36  ? 0.2192 0.2941 0.1931 0.0757  0.0247  0.0022  37  PHE A CE1 
263  C CE2 . PHE A 36  ? 0.2464 0.3172 0.2245 0.0618  0.0292  -0.0030 37  PHE A CE2 
264  C CZ  . PHE A 36  ? 0.2531 0.3295 0.2351 0.0674  0.0262  -0.0028 37  PHE A CZ  
265  N N   . ALA A 37  ? 0.2423 0.3378 0.1839 0.0760  0.0194  0.0079  38  ALA A N   
266  C CA  . ALA A 37  ? 0.2361 0.3505 0.1808 0.0811  0.0127  0.0077  38  ALA A CA  
267  C C   . ALA A 37  ? 0.3062 0.4365 0.2463 0.0749  0.0107  0.0018  38  ALA A C   
268  O O   . ALA A 37  ? 0.3094 0.4366 0.2489 0.0668  0.0153  -0.0045 38  ALA A O   
269  C CB  . ALA A 37  ? 0.1913 0.3137 0.1530 0.0818  0.0111  0.0023  38  ALA A CB  
270  N N   . GLU A 38  ? 0.3206 0.4690 0.2574 0.0787  0.0040  0.0037  39  GLU A N   
271  C CA  . GLU A 38  ? 0.3079 0.4743 0.2416 0.0712  0.0015  -0.0043 39  GLU A CA  
272  C C   . GLU A 38  ? 0.3038 0.4751 0.2536 0.0638  0.0032  -0.0166 39  GLU A C   
273  O O   . GLU A 38  ? 0.3326 0.5039 0.2960 0.0665  0.0024  -0.0169 39  GLU A O   
274  C CB  . GLU A 38  ? 0.3619 0.5503 0.2902 0.0762  -0.0073 0.0005  39  GLU A CB  
275  C CG  . GLU A 38  ? 0.4700 0.6548 0.3795 0.0825  -0.0096 0.0134  39  GLU A CG  
276  C CD  . GLU A 38  ? 0.5912 0.7726 0.4838 0.0736  -0.0057 0.0107  39  GLU A CD  
277  O OE1 . GLU A 38  ? 0.6070 0.8025 0.4990 0.0641  -0.0058 -0.0007 39  GLU A OE1 
278  O OE2 . GLU A 38  ? 0.5990 0.7633 0.4786 0.0754  -0.0018 0.0194  39  GLU A OE2 
279  N N   . PRO A 39  ? 0.3229 0.4969 0.2712 0.0546  0.0064  -0.0268 40  PRO A N   
280  C CA  . PRO A 39  ? 0.3004 0.4752 0.2637 0.0478  0.0088  -0.0378 40  PRO A CA  
281  C C   . PRO A 39  ? 0.3468 0.5394 0.3187 0.0472  0.0024  -0.0405 40  PRO A C   
282  O O   . PRO A 39  ? 0.3348 0.5464 0.2997 0.0455  -0.0032 -0.0419 40  PRO A O   
283  C CB  . PRO A 39  ? 0.3991 0.5750 0.3553 0.0392  0.0132  -0.0481 40  PRO A CB  
284  C CG  . PRO A 39  ? 0.4478 0.6166 0.3889 0.0414  0.0163  -0.0416 40  PRO A CG  
285  C CD  . PRO A 39  ? 0.3705 0.5435 0.3032 0.0499  0.0098  -0.0285 40  PRO A CD  
286  N N   . PRO A 40  ? 0.3597 0.5488 0.3466 0.0479  0.0030  -0.0411 41  PRO A N   
287  C CA  . PRO A 40  ? 0.3519 0.5594 0.3487 0.0465  -0.0022 -0.0434 41  PRO A CA  
288  C C   . PRO A 40  ? 0.3727 0.5878 0.3738 0.0345  -0.0017 -0.0562 41  PRO A C   
289  O O   . PRO A 40  ? 0.3829 0.5962 0.3965 0.0294  -0.0001 -0.0608 41  PRO A O   
290  C CB  . PRO A 40  ? 0.2976 0.4950 0.3063 0.0508  0.0000  -0.0390 41  PRO A CB  
291  C CG  . PRO A 40  ? 0.2910 0.4661 0.3000 0.0483  0.0066  -0.0402 41  PRO A CG  
292  C CD  . PRO A 40  ? 0.3091 0.4787 0.3040 0.0493  0.0083  -0.0388 41  PRO A CD  
293  N N   . MET A 41  ? 0.3947 0.6174 0.3841 0.0290  -0.0025 -0.0621 42  MET A N   
294  C CA  . MET A 41  ? 0.4467 0.6741 0.4370 0.0166  -0.0010 -0.0759 42  MET A CA  
295  C C   . MET A 41  ? 0.3698 0.6257 0.3588 0.0114  -0.0090 -0.0792 42  MET A C   
296  O O   . MET A 41  ? 0.4297 0.7035 0.4141 0.0186  -0.0161 -0.0703 42  MET A O   
297  C CB  . MET A 41  ? 0.6031 0.8217 0.5804 0.0121  0.0044  -0.0829 42  MET A CB  
298  C CG  . MET A 41  ? 0.6873 0.8859 0.6622 0.0189  0.0105  -0.0768 42  MET A CG  
299  S SD  . MET A 41  ? 0.8489 1.0241 0.8407 0.0172  0.0188  -0.0816 42  MET A SD  
300  C CE  . MET A 41  ? 0.8163 0.9906 0.8068 0.0050  0.0238  -0.0996 42  MET A CE  
301  N N   . GLY A 42  ? 0.3842 0.6441 0.3775 -0.0014 -0.0076 -0.0921 43  GLY A N   
302  C CA  . GLY A 42  ? 0.4017 0.6897 0.3925 -0.0104 -0.0146 -0.0984 43  GLY A CA  
303  C C   . GLY A 42  ? 0.4002 0.7131 0.4002 -0.0037 -0.0230 -0.0888 43  GLY A C   
304  O O   . GLY A 42  ? 0.3026 0.6149 0.3181 -0.0030 -0.0220 -0.0870 43  GLY A O   
305  N N   . PRO A 43  ? 0.4125 0.7488 0.4032 0.0019  -0.0312 -0.0819 44  PRO A N   
306  C CA  . PRO A 43  ? 0.3667 0.7293 0.3678 0.0106  -0.0393 -0.0721 44  PRO A CA  
307  C C   . PRO A 43  ? 0.3453 0.6931 0.3551 0.0262  -0.0366 -0.0595 44  PRO A C   
308  O O   . PRO A 43  ? 0.3299 0.6963 0.3523 0.0334  -0.0408 -0.0533 44  PRO A O   
309  C CB  . PRO A 43  ? 0.3914 0.7782 0.3779 0.0141  -0.0483 -0.0663 44  PRO A CB  
310  C CG  . PRO A 43  ? 0.4120 0.7764 0.3793 0.0128  -0.0432 -0.0678 44  PRO A CG  
311  C CD  . PRO A 43  ? 0.3797 0.7207 0.3500 0.0005  -0.0334 -0.0825 44  PRO A CD  
312  N N   . ARG A 44  ? 0.3103 0.6269 0.3144 0.0313  -0.0295 -0.0562 45  ARG A N   
313  C CA  . ARG A 44  ? 0.3516 0.6530 0.3617 0.0446  -0.0267 -0.0454 45  ARG A CA  
314  C C   . ARG A 44  ? 0.2746 0.5573 0.2971 0.0408  -0.0196 -0.0494 45  ARG A C   
315  O O   . ARG A 44  ? 0.2536 0.5223 0.2800 0.0498  -0.0165 -0.0420 45  ARG A O   
316  C CB  . ARG A 44  ? 0.3500 0.6312 0.3452 0.0529  -0.0242 -0.0372 45  ARG A CB  
317  C CG  . ARG A 44  ? 0.4848 0.7829 0.4658 0.0575  -0.0314 -0.0306 45  ARG A CG  
318  C CD  . ARG A 44  ? 0.6346 0.9116 0.5980 0.0602  -0.0274 -0.0255 45  ARG A CD  
319  N NE  . ARG A 44  ? 0.7966 1.0756 0.7511 0.0735  -0.0320 -0.0106 45  ARG A NE  
320  C CZ  . ARG A 44  ? 0.9063 1.1790 0.8416 0.0749  -0.0323 -0.0042 45  ARG A CZ  
321  N NH1 . ARG A 44  ? 0.9898 1.2560 0.9137 0.0637  -0.0278 -0.0128 45  ARG A NH1 
322  N NH2 . ARG A 44  ? 0.9766 1.2488 0.9041 0.0875  -0.0364 0.0107  45  ARG A NH2 
323  N N   . ARG A 45  ? 0.2668 0.5482 0.2947 0.0274  -0.0170 -0.0606 46  ARG A N   
324  C CA  . ARG A 45  ? 0.2940 0.5620 0.3344 0.0235  -0.0117 -0.0627 46  ARG A CA  
325  C C   . ARG A 45  ? 0.2559 0.5424 0.3088 0.0284  -0.0144 -0.0576 46  ARG A C   
326  O O   . ARG A 45  ? 0.2186 0.5338 0.2756 0.0276  -0.0205 -0.0584 46  ARG A O   
327  C CB  . ARG A 45  ? 0.2076 0.4717 0.2511 0.0081  -0.0087 -0.0751 46  ARG A CB  
328  C CG  . ARG A 45  ? 0.2025 0.4513 0.2577 0.0031  -0.0034 -0.0762 46  ARG A CG  
329  C CD  . ARG A 45  ? 0.2264 0.4732 0.2852 -0.0127 -0.0010 -0.0880 46  ARG A CD  
330  N NE  . ARG A 45  ? 0.2307 0.4536 0.2829 -0.0165 0.0045  -0.0947 46  ARG A NE  
331  C CZ  . ARG A 45  ? 0.3025 0.5161 0.3560 -0.0291 0.0084  -0.1059 46  ARG A CZ  
332  N NH1 . ARG A 45  ? 0.2880 0.5140 0.3480 -0.0409 0.0070  -0.1114 46  ARG A NH1 
333  N NH2 . ARG A 45  ? 0.2312 0.4228 0.2798 -0.0303 0.0144  -0.1118 46  ARG A NH2 
334  N N   . PHE A 46  ? 0.1750 0.4463 0.2339 0.0335  -0.0099 -0.0526 47  PHE A N   
335  C CA  . PHE A 46  ? 0.1742 0.4580 0.2443 0.0391  -0.0099 -0.0479 47  PHE A CA  
336  C C   . PHE A 46  ? 0.2005 0.4943 0.2685 0.0549  -0.0132 -0.0389 47  PHE A C   
337  O O   . PHE A 46  ? 0.2389 0.5421 0.3164 0.0617  -0.0121 -0.0352 47  PHE A O   
338  C CB  . PHE A 46  ? 0.1714 0.4818 0.2539 0.0293  -0.0122 -0.0540 47  PHE A CB  
339  C CG  . PHE A 46  ? 0.2077 0.5078 0.2921 0.0129  -0.0088 -0.0630 47  PHE A CG  
340  C CD1 . PHE A 46  ? 0.2122 0.4869 0.2982 0.0095  -0.0025 -0.0623 47  PHE A CD1 
341  C CD2 . PHE A 46  ? 0.1938 0.5093 0.2781 0.0008  -0.0121 -0.0720 47  PHE A CD2 
342  C CE1 . PHE A 46  ? 0.1661 0.4289 0.2542 -0.0043 0.0008  -0.0692 47  PHE A CE1 
343  C CE2 . PHE A 46  ? 0.1685 0.4709 0.2542 -0.0143 -0.0080 -0.0807 47  PHE A CE2 
344  C CZ  . PHE A 46  ? 0.1785 0.4535 0.2666 -0.0161 -0.0015 -0.0788 47  PHE A CZ  
345  N N   . LEU A 47  ? 0.1731 0.4645 0.2290 0.0610  -0.0165 -0.0350 48  LEU A N   
346  C CA  . LEU A 47  ? 0.1930 0.4919 0.2465 0.0765  -0.0198 -0.0251 48  LEU A CA  
347  C C   . LEU A 47  ? 0.2425 0.5111 0.2878 0.0854  -0.0143 -0.0184 48  LEU A C   
348  O O   . LEU A 47  ? 0.2199 0.4648 0.2584 0.0794  -0.0097 -0.0208 48  LEU A O   
349  C CB  . LEU A 47  ? 0.2043 0.5185 0.2474 0.0781  -0.0271 -0.0228 48  LEU A CB  
350  C CG  . LEU A 47  ? 0.2640 0.6144 0.3142 0.0709  -0.0345 -0.0280 48  LEU A CG  
351  C CD1 . LEU A 47  ? 0.2545 0.6191 0.2914 0.0737  -0.0422 -0.0237 48  LEU A CD1 
352  C CD2 . LEU A 47  ? 0.2767 0.6472 0.3427 0.0767  -0.0356 -0.0251 48  LEU A CD2 
353  N N   . PRO A 48  ? 0.2658 0.5347 0.3123 0.0998  -0.0143 -0.0101 49  PRO A N   
354  C CA  . PRO A 48  ? 0.2054 0.4443 0.2426 0.1070  -0.0088 -0.0044 49  PRO A CA  
355  C C   . PRO A 48  ? 0.2745 0.4971 0.2949 0.1051  -0.0094 -0.0014 49  PRO A C   
356  O O   . PRO A 48  ? 0.2971 0.5341 0.3114 0.1036  -0.0151 -0.0008 49  PRO A O   
357  C CB  . PRO A 48  ? 0.2566 0.5021 0.2978 0.1236  -0.0096 0.0037  49  PRO A CB  
358  C CG  . PRO A 48  ? 0.3295 0.6012 0.3844 0.1203  -0.0125 0.0000  49  PRO A CG  
359  C CD  . PRO A 48  ? 0.2349 0.5290 0.2917 0.1090  -0.0183 -0.0063 49  PRO A CD  
360  N N   . PRO A 49  ? 0.3034 0.4977 0.3156 0.1042  -0.0035 0.0001  50  PRO A N   
361  C CA  . PRO A 49  ? 0.2984 0.4783 0.2954 0.1010  -0.0029 0.0023  50  PRO A CA  
362  C C   . PRO A 49  ? 0.2875 0.4678 0.2730 0.1118  -0.0065 0.0126  50  PRO A C   
363  O O   . PRO A 49  ? 0.3339 0.5088 0.3202 0.1238  -0.0059 0.0199  50  PRO A O   
364  C CB  . PRO A 49  ? 0.2796 0.4323 0.2734 0.0981  0.0043  0.0022  50  PRO A CB  
365  C CG  . PRO A 49  ? 0.2739 0.4229 0.2751 0.1054  0.0068  0.0041  50  PRO A CG  
366  C CD  . PRO A 49  ? 0.2073 0.3832 0.2229 0.1054  0.0030  -0.0002 50  PRO A CD  
367  N N   . GLU A 50  ? 0.2901 0.4763 0.2642 0.1075  -0.0097 0.0133  51  GLU A N   
368  C CA  . GLU A 50  ? 0.4105 0.5934 0.3695 0.1155  -0.0127 0.0243  51  GLU A CA  
369  C C   . GLU A 50  ? 0.4181 0.5718 0.3630 0.1124  -0.0061 0.0276  51  GLU A C   
370  O O   . GLU A 50  ? 0.3611 0.5081 0.3047 0.1012  -0.0019 0.0200  51  GLU A O   
371  C CB  . GLU A 50  ? 0.5778 0.7849 0.5296 0.1109  -0.0199 0.0233  51  GLU A CB  
372  C CG  . GLU A 50  ? 0.8507 1.0905 0.8135 0.1158  -0.0284 0.0237  51  GLU A CG  
373  C CD  . GLU A 50  ? 1.0772 1.3186 1.0470 0.1330  -0.0304 0.0347  51  GLU A CD  
374  O OE1 . GLU A 50  ? 1.1482 1.3823 1.1061 0.1434  -0.0327 0.0474  51  GLU A OE1 
375  O OE2 . GLU A 50  ? 1.1079 1.3582 1.0953 0.1362  -0.0293 0.0308  51  GLU A OE2 
376  N N   . PRO A 51  ? 0.4226 0.5582 0.3572 0.1219  -0.0046 0.0389  52  PRO A N   
377  C CA  . PRO A 51  ? 0.3810 0.4893 0.3018 0.1170  0.0021  0.0419  52  PRO A CA  
378  C C   . PRO A 51  ? 0.3839 0.4978 0.2916 0.1074  0.0017  0.0405  52  PRO A C   
379  O O   . PRO A 51  ? 0.4087 0.5427 0.3106 0.1081  -0.0046 0.0424  52  PRO A O   
380  C CB  . PRO A 51  ? 0.4357 0.5258 0.3468 0.1298  0.0027  0.0554  52  PRO A CB  
381  C CG  . PRO A 51  ? 0.4501 0.5535 0.3757 0.1422  -0.0011 0.0566  52  PRO A CG  
382  C CD  . PRO A 51  ? 0.4309 0.5688 0.3675 0.1377  -0.0080 0.0492  52  PRO A CD  
383  N N   . LYS A 52  ? 0.3798 0.4776 0.2829 0.0979  0.0088  0.0366  53  LYS A N   
384  C CA  . LYS A 52  ? 0.3639 0.4664 0.2557 0.0883  0.0106  0.0337  53  LYS A CA  
385  C C   . LYS A 52  ? 0.4088 0.5069 0.2796 0.0922  0.0087  0.0463  53  LYS A C   
386  O O   . LYS A 52  ? 0.4340 0.5107 0.2964 0.0979  0.0111  0.0569  53  LYS A O   
387  C CB  . LYS A 52  ? 0.4049 0.4924 0.2988 0.0787  0.0190  0.0279  53  LYS A CB  
388  C CG  . LYS A 52  ? 0.3821 0.4736 0.2652 0.0692  0.0230  0.0244  53  LYS A CG  
389  C CD  . LYS A 52  ? 0.4163 0.5297 0.3057 0.0640  0.0207  0.0129  53  LYS A CD  
390  C CE  . LYS A 52  ? 0.4624 0.5784 0.3427 0.0543  0.0268  0.0071  53  LYS A CE  
391  N NZ  . LYS A 52  ? 0.4412 0.5749 0.3273 0.0487  0.0262  -0.0061 53  LYS A NZ  
392  N N   . GLN A 53  ? 0.4215 0.5388 0.2826 0.0885  0.0045  0.0453  54  GLN A N   
393  C CA  . GLN A 53  ? 0.4909 0.6061 0.3303 0.0916  0.0019  0.0584  54  GLN A CA  
394  C C   . GLN A 53  ? 0.5038 0.6010 0.3280 0.0822  0.0107  0.0601  54  GLN A C   
395  O O   . GLN A 53  ? 0.4929 0.5908 0.3229 0.0718  0.0171  0.0484  54  GLN A O   
396  C CB  . GLN A 53  ? 0.5196 0.6639 0.3518 0.0896  -0.0061 0.0568  54  GLN A CB  
397  C CG  . GLN A 53  ? 0.6920 0.8565 0.5358 0.1001  -0.0160 0.0597  54  GLN A CG  
398  C CD  . GLN A 53  ? 0.8904 1.0430 0.7308 0.1159  -0.0195 0.0771  54  GLN A CD  
399  O OE1 . GLN A 53  ? 0.9841 1.1332 0.8057 0.1201  -0.0225 0.0909  54  GLN A OE1 
400  N NE2 . GLN A 53  ? 0.9189 1.0640 0.7771 0.1248  -0.0186 0.0765  54  GLN A NE2 
401  N N   . PRO A 54  ? 0.5225 0.6040 0.3279 0.0859  0.0113  0.0750  55  PRO A N   
402  C CA  . PRO A 54  ? 0.4978 0.5621 0.2885 0.0758  0.0203  0.0774  55  PRO A CA  
403  C C   . PRO A 54  ? 0.5213 0.6043 0.3034 0.0637  0.0229  0.0684  55  PRO A C   
404  O O   . PRO A 54  ? 0.4730 0.5795 0.2514 0.0636  0.0164  0.0651  55  PRO A O   
405  C CB  . PRO A 54  ? 0.5331 0.5796 0.3032 0.0832  0.0185  0.0968  55  PRO A CB  
406  C CG  . PRO A 54  ? 0.5937 0.6400 0.3744 0.0993  0.0109  0.1035  55  PRO A CG  
407  C CD  . PRO A 54  ? 0.5233 0.6006 0.3212 0.1000  0.0042  0.0911  55  PRO A CD  
408  N N   . TRP A 55  ? 0.5314 0.6046 0.3106 0.0530  0.0329  0.0638  56  TRP A N   
409  C CA  . TRP A 55  ? 0.4723 0.5611 0.2453 0.0413  0.0382  0.0535  56  TRP A CA  
410  C C   . TRP A 55  ? 0.5001 0.5764 0.2520 0.0330  0.0462  0.0619  56  TRP A C   
411  O O   . TRP A 55  ? 0.4606 0.5137 0.2098 0.0332  0.0504  0.0709  56  TRP A O   
412  C CB  . TRP A 55  ? 0.3753 0.4696 0.1711 0.0357  0.0440  0.0364  56  TRP A CB  
413  C CG  . TRP A 55  ? 0.4278 0.5030 0.2337 0.0332  0.0512  0.0372  56  TRP A CG  
414  C CD1 . TRP A 55  ? 0.4369 0.5056 0.2379 0.0235  0.0610  0.0367  56  TRP A CD1 
415  C CD2 . TRP A 55  ? 0.4246 0.4868 0.2468 0.0393  0.0492  0.0383  56  TRP A CD2 
416  N NE1 . TRP A 55  ? 0.4129 0.4663 0.2264 0.0228  0.0644  0.0375  56  TRP A NE1 
417  C CE2 . TRP A 55  ? 0.3665 0.4149 0.1921 0.0323  0.0573  0.0383  56  TRP A CE2 
418  C CE3 . TRP A 55  ? 0.4642 0.5268 0.2981 0.0493  0.0416  0.0388  56  TRP A CE3 
419  C CZ2 . TRP A 55  ? 0.3840 0.4184 0.2227 0.0345  0.0577  0.0386  56  TRP A CZ2 
420  C CZ3 . TRP A 55  ? 0.4508 0.4988 0.2978 0.0519  0.0429  0.0390  56  TRP A CZ3 
421  C CH2 . TRP A 55  ? 0.4065 0.4402 0.2549 0.0443  0.0506  0.0387  56  TRP A CH2 
422  N N   . SER A 56  ? 0.4741 0.5660 0.2104 0.0247  0.0488  0.0583  57  SER A N   
423  C CA  . SER A 56  ? 0.5439 0.6283 0.2619 0.0141  0.0585  0.0630  57  SER A CA  
424  C C   . SER A 56  ? 0.5239 0.6143 0.2575 0.0043  0.0697  0.0469  57  SER A C   
425  O O   . SER A 56  ? 0.5460 0.6500 0.2992 0.0051  0.0695  0.0317  57  SER A O   
426  C CB  . SER A 56  ? 0.6054 0.7002 0.2997 0.0090  0.0555  0.0670  57  SER A CB  
427  O OG  . SER A 56  ? 0.6316 0.7484 0.3326 0.0040  0.0553  0.0498  57  SER A OG  
428  N N   . GLY A 57  ? 0.5307 0.6110 0.2561 -0.0048 0.0797  0.0510  58  GLY A N   
429  C CA  . GLY A 57  ? 0.4370 0.5245 0.1791 -0.0133 0.0906  0.0375  58  GLY A CA  
430  C C   . GLY A 57  ? 0.4852 0.5612 0.2524 -0.0099 0.0907  0.0350  58  GLY A C   
431  O O   . GLY A 57  ? 0.4717 0.5301 0.2403 -0.0029 0.0846  0.0444  58  GLY A O   
432  N N   . VAL A 58  ? 0.4061 0.4933 0.1937 -0.0146 0.0981  0.0219  59  VAL A N   
433  C CA  . VAL A 58  ? 0.3905 0.4710 0.2018 -0.0137 0.0991  0.0190  59  VAL A CA  
434  C C   . VAL A 58  ? 0.3703 0.4634 0.2062 -0.0071 0.0954  0.0059  59  VAL A C   
435  O O   . VAL A 58  ? 0.3824 0.4923 0.2250 -0.0089 0.1000  -0.0060 59  VAL A O   
436  C CB  . VAL A 58  ? 0.4222 0.5059 0.2386 -0.0250 0.1105  0.0170  59  VAL A CB  
437  C CG1 . VAL A 58  ? 0.3675 0.4451 0.2062 -0.0248 0.1099  0.0158  59  VAL A CG1 
438  C CG2 . VAL A 58  ? 0.3943 0.4656 0.1839 -0.0337 0.1154  0.0297  59  VAL A CG2 
439  N N   . VAL A 59  ? 0.3434 0.4273 0.1920 0.0003  0.0880  0.0080  60  VAL A N   
440  C CA  . VAL A 59  ? 0.3708 0.4636 0.2428 0.0060  0.0844  -0.0025 60  VAL A CA  
441  C C   . VAL A 59  ? 0.3338 0.4295 0.2274 0.0024  0.0898  -0.0072 60  VAL A C   
442  O O   . VAL A 59  ? 0.3862 0.4709 0.2812 -0.0005 0.0902  -0.0005 60  VAL A O   
443  C CB  . VAL A 59  ? 0.3955 0.4792 0.2702 0.0152  0.0741  0.0023  60  VAL A CB  
444  C CG1 . VAL A 59  ? 0.3492 0.4380 0.2491 0.0189  0.0716  -0.0062 60  VAL A CG1 
445  C CG2 . VAL A 59  ? 0.3376 0.4269 0.1975 0.0197  0.0677  0.0040  60  VAL A CG2 
446  N N   . ASP A 60  ? 0.2951 0.4059 0.2058 0.0026  0.0939  -0.0189 61  ASP A N   
447  C CA  . ASP A 60  ? 0.2613 0.3787 0.1957 0.0011  0.0980  -0.0231 61  ASP A CA  
448  C C   . ASP A 60  ? 0.3107 0.4222 0.2608 0.0075  0.0897  -0.0221 61  ASP A C   
449  O O   . ASP A 60  ? 0.2362 0.3515 0.1968 0.0135  0.0862  -0.0286 61  ASP A O   
450  C CB  . ASP A 60  ? 0.3136 0.4480 0.2614 0.0010  0.1058  -0.0354 61  ASP A CB  
451  C CG  . ASP A 60  ? 0.4677 0.6110 0.4037 -0.0071 0.1163  -0.0369 61  ASP A CG  
452  O OD1 . ASP A 60  ? 0.5413 0.6909 0.4670 -0.0077 0.1201  -0.0440 61  ASP A OD1 
453  O OD2 . ASP A 60  ? 0.4711 0.6151 0.4075 -0.0140 0.1208  -0.0313 61  ASP A OD2 
454  N N   . ALA A 61  ? 0.2826 0.3838 0.2329 0.0053  0.0871  -0.0143 62  ALA A N   
455  C CA  . ALA A 61  ? 0.2807 0.3777 0.2454 0.0097  0.0804  -0.0134 62  ALA A CA  
456  C C   . ALA A 61  ? 0.3229 0.4315 0.3093 0.0064  0.0834  -0.0161 62  ALA A C   
457  O O   . ALA A 61  ? 0.2565 0.3619 0.2454 0.0012  0.0828  -0.0113 62  ALA A O   
458  C CB  . ALA A 61  ? 0.2319 0.3107 0.1831 0.0094  0.0758  -0.0045 62  ALA A CB  
459  N N   . THR A 62  ? 0.2630 0.3858 0.2656 0.0098  0.0867  -0.0240 63  THR A N   
460  C CA  . THR A 62  ? 0.2472 0.3853 0.2714 0.0079  0.0910  -0.0264 63  THR A CA  
461  C C   . THR A 62  ? 0.2219 0.3661 0.2694 0.0156  0.0873  -0.0298 63  THR A C   
462  O O   . THR A 62  ? 0.2307 0.3893 0.2986 0.0161  0.0901  -0.0310 63  THR A O   
463  C CB  . THR A 62  ? 0.3295 0.4808 0.3539 0.0048  0.1015  -0.0324 63  THR A CB  
464  O OG1 . THR A 62  ? 0.2744 0.4263 0.2964 0.0105  0.1034  -0.0407 63  THR A OG1 
465  C CG2 . THR A 62  ? 0.3071 0.4527 0.3085 -0.0044 0.1057  -0.0272 63  THR A CG2 
466  N N   . THR A 63  ? 0.2306 0.3651 0.2761 0.0214  0.0811  -0.0308 64  THR A N   
467  C CA  . THR A 63  ? 0.1919 0.3290 0.2574 0.0278  0.0772  -0.0323 64  THR A CA  
468  C C   . THR A 63  ? 0.1962 0.3204 0.2537 0.0307  0.0695  -0.0304 64  THR A C   
469  O O   . THR A 63  ? 0.2263 0.3426 0.2655 0.0299  0.0680  -0.0304 64  THR A O   
470  C CB  . THR A 63  ? 0.3080 0.4526 0.3874 0.0331  0.0836  -0.0415 64  THR A CB  
471  O OG1 . THR A 63  ? 0.3170 0.4647 0.4189 0.0391  0.0807  -0.0404 64  THR A OG1 
472  C CG2 . THR A 63  ? 0.3405 0.4767 0.4069 0.0349  0.0839  -0.0485 64  THR A CG2 
473  N N   . PHE A 64  ? 0.1668 0.2905 0.2385 0.0341  0.0644  -0.0281 65  PHE A N   
474  C CA  . PHE A 64  ? 0.2069 0.3208 0.2733 0.0363  0.0578  -0.0266 65  PHE A CA  
475  C C   . PHE A 64  ? 0.2243 0.3349 0.2862 0.0392  0.0592  -0.0343 65  PHE A C   
476  O O   . PHE A 64  ? 0.1855 0.2999 0.2566 0.0413  0.0643  -0.0412 65  PHE A O   
477  C CB  . PHE A 64  ? 0.2389 0.3539 0.3214 0.0386  0.0531  -0.0226 65  PHE A CB  
478  C CG  . PHE A 64  ? 0.2287 0.3465 0.3119 0.0342  0.0494  -0.0150 65  PHE A CG  
479  C CD1 . PHE A 64  ? 0.1910 0.3002 0.2581 0.0304  0.0463  -0.0116 65  PHE A CD1 
480  C CD2 . PHE A 64  ? 0.2113 0.3407 0.3116 0.0341  0.0492  -0.0117 65  PHE A CD2 
481  C CE1 . PHE A 64  ? 0.2763 0.3867 0.3423 0.0249  0.0437  -0.0062 65  PHE A CE1 
482  C CE2 . PHE A 64  ? 0.2170 0.3509 0.3168 0.0283  0.0453  -0.0054 65  PHE A CE2 
483  C CZ  . PHE A 64  ? 0.2498 0.3732 0.3316 0.0230  0.0428  -0.0034 65  PHE A CZ  
484  N N   . GLN A 65  ? 0.2449 0.3494 0.2932 0.0390  0.0548  -0.0334 66  GLN A N   
485  C CA  . GLN A 65  ? 0.2964 0.4003 0.3396 0.0401  0.0547  -0.0405 66  GLN A CA  
486  C C   . GLN A 65  ? 0.2686 0.3692 0.3241 0.0419  0.0516  -0.0425 66  GLN A C   
487  O O   . GLN A 65  ? 0.2649 0.3638 0.3329 0.0432  0.0496  -0.0378 66  GLN A O   
488  C CB  . GLN A 65  ? 0.3367 0.4389 0.3611 0.0395  0.0510  -0.0379 66  GLN A CB  
489  C CG  . GLN A 65  ? 0.3343 0.4403 0.3438 0.0375  0.0548  -0.0411 66  GLN A CG  
490  C CD  . GLN A 65  ? 0.3639 0.4750 0.3733 0.0365  0.0570  -0.0517 66  GLN A CD  
491  O OE1 . GLN A 65  ? 0.3920 0.5017 0.4125 0.0372  0.0558  -0.0567 66  GLN A OE1 
492  N NE2 . GLN A 65  ? 0.2861 0.4021 0.2815 0.0338  0.0608  -0.0553 66  GLN A NE2 
493  N N   . SER A 66  ? 0.2544 0.3546 0.3053 0.0412  0.0510  -0.0492 67  SER A N   
494  C CA  . SER A 66  ? 0.2399 0.3357 0.3014 0.0412  0.0494  -0.0525 67  SER A CA  
495  C C   . SER A 66  ? 0.2156 0.3091 0.2795 0.0414  0.0431  -0.0446 67  SER A C   
496  O O   . SER A 66  ? 0.2400 0.3353 0.2944 0.0415  0.0395  -0.0390 67  SER A O   
497  C CB  . SER A 66  ? 0.1551 0.2528 0.2086 0.0380  0.0497  -0.0619 67  SER A CB  
498  O OG  . SER A 66  ? 0.2135 0.3124 0.2651 0.0370  0.0566  -0.0711 67  SER A OG  
499  N N   . VAL A 67  ? 0.1836 0.2718 0.2599 0.0413  0.0423  -0.0443 68  VAL A N   
500  C CA  . VAL A 67  ? 0.1757 0.2622 0.2538 0.0402  0.0372  -0.0380 68  VAL A CA  
501  C C   . VAL A 67  ? 0.2536 0.3426 0.3257 0.0369  0.0349  -0.0427 68  VAL A C   
502  O O   . VAL A 67  ? 0.2323 0.3201 0.3053 0.0344  0.0373  -0.0512 68  VAL A O   
503  C CB  . VAL A 67  ? 0.2425 0.3224 0.3355 0.0411  0.0373  -0.0340 68  VAL A CB  
504  C CG1 . VAL A 67  ? 0.2115 0.2898 0.3047 0.0383  0.0326  -0.0281 68  VAL A CG1 
505  C CG2 . VAL A 67  ? 0.2602 0.3426 0.3606 0.0443  0.0382  -0.0281 68  VAL A CG2 
506  N N   . CYS A 68  ? 0.1649 0.2584 0.2309 0.0366  0.0306  -0.0381 69  CYS A N   
507  C CA  . CYS A 68  ? 0.2076 0.3075 0.2708 0.0336  0.0281  -0.0418 69  CYS A CA  
508  C C   . CYS A 68  ? 0.2516 0.3459 0.3249 0.0288  0.0289  -0.0445 69  CYS A C   
509  O O   . CYS A 68  ? 0.2606 0.3469 0.3418 0.0289  0.0292  -0.0390 69  CYS A O   
510  C CB  . CYS A 68  ? 0.1930 0.2988 0.2512 0.0354  0.0245  -0.0358 69  CYS A CB  
511  S SG  . CYS A 68  ? 0.2960 0.4046 0.3409 0.0413  0.0238  -0.0320 69  CYS A SG  
512  N N   . TYR A 69  ? 0.1927 0.2910 0.2649 0.0239  0.0291  -0.0526 70  TYR A N   
513  C CA  . TYR A 69  ? 0.2814 0.3715 0.3619 0.0178  0.0309  -0.0566 70  TYR A CA  
514  C C   . TYR A 69  ? 0.2225 0.3105 0.3083 0.0158  0.0288  -0.0484 70  TYR A C   
515  O O   . TYR A 69  ? 0.1763 0.2753 0.2583 0.0158  0.0255  -0.0448 70  TYR A O   
516  C CB  . TYR A 69  ? 0.2847 0.3827 0.3611 0.0106  0.0306  -0.0669 70  TYR A CB  
517  C CG  . TYR A 69  ? 0.2907 0.3790 0.3676 0.0075  0.0359  -0.0775 70  TYR A CG  
518  C CD1 . TYR A 69  ? 0.3558 0.4509 0.4234 0.0085  0.0372  -0.0845 70  TYR A CD1 
519  C CD2 . TYR A 69  ? 0.3608 0.4317 0.4467 0.0037  0.0402  -0.0806 70  TYR A CD2 
520  C CE1 . TYR A 69  ? 0.4130 0.4993 0.4801 0.0053  0.0432  -0.0957 70  TYR A CE1 
521  C CE2 . TYR A 69  ? 0.3494 0.4091 0.4359 0.0015  0.0464  -0.0916 70  TYR A CE2 
522  C CZ  . TYR A 69  ? 0.5129 0.5810 0.5900 0.0021  0.0481  -0.0999 70  TYR A CZ  
523  O OH  . TYR A 69  ? 0.7468 0.8041 0.8233 -0.0005 0.0554  -0.1123 70  TYR A OH  
524  N N   . GLN A 70  ? 0.1988 0.2724 0.2932 0.0146  0.0310  -0.0453 71  GLN A N   
525  C CA  . GLN A 70  ? 0.2237 0.2945 0.3217 0.0124  0.0290  -0.0360 71  GLN A CA  
526  C C   . GLN A 70  ? 0.2350 0.2885 0.3419 0.0094  0.0318  -0.0343 71  GLN A C   
527  O O   . GLN A 70  ? 0.2723 0.3143 0.3844 0.0120  0.0355  -0.0389 71  GLN A O   
528  C CB  . GLN A 70  ? 0.1617 0.2349 0.2579 0.0184  0.0267  -0.0265 71  GLN A CB  
529  C CG  . GLN A 70  ? 0.1709 0.2374 0.2722 0.0247  0.0284  -0.0247 71  GLN A CG  
530  C CD  . GLN A 70  ? 0.2205 0.2926 0.3183 0.0285  0.0259  -0.0171 71  GLN A CD  
531  O OE1 . GLN A 70  ? 0.1908 0.2598 0.2938 0.0294  0.0243  -0.0088 71  GLN A OE1 
532  N NE2 . GLN A 70  ? 0.1725 0.2528 0.2611 0.0303  0.0254  -0.0197 71  GLN A NE2 
533  N N   . TYR A 71  ? 0.3148 0.3658 0.4231 0.0040  0.0304  -0.0275 72  TYR A N   
534  C CA  . TYR A 71  ? 0.3298 0.3625 0.4457 0.0019  0.0323  -0.0218 72  TYR A CA  
535  C C   . TYR A 71  ? 0.3092 0.3351 0.4311 0.0111  0.0315  -0.0129 72  TYR A C   
536  O O   . TYR A 71  ? 0.3956 0.4323 0.5143 0.0154  0.0281  -0.0071 72  TYR A O   
537  C CB  . TYR A 71  ? 0.3290 0.3631 0.4426 -0.0062 0.0307  -0.0146 72  TYR A CB  
538  C CG  . TYR A 71  ? 0.3804 0.3955 0.4998 -0.0082 0.0317  -0.0047 72  TYR A CG  
539  C CD1 . TYR A 71  ? 0.3991 0.3965 0.5224 -0.0149 0.0359  -0.0088 72  TYR A CD1 
540  C CD2 . TYR A 71  ? 0.3554 0.3697 0.4753 -0.0041 0.0282  0.0090  72  TYR A CD2 
541  C CE1 . TYR A 71  ? 0.4621 0.4394 0.5902 -0.0161 0.0370  0.0017  72  TYR A CE1 
542  C CE2 . TYR A 71  ? 0.4950 0.4925 0.6196 -0.0053 0.0283  0.0200  72  TYR A CE2 
543  C CZ  . TYR A 71  ? 0.5124 0.4902 0.6412 -0.0107 0.0328  0.0168  72  TYR A CZ  
544  O OH  . TYR A 71  ? 0.6312 0.5896 0.7643 -0.0112 0.0331  0.0292  72  TYR A OH  
545  N N   . VAL A 72  ? 0.2870 0.2952 0.4184 0.0140  0.0348  -0.0122 73  VAL A N   
546  C CA  . VAL A 72  ? 0.3029 0.3065 0.4435 0.0237  0.0340  -0.0035 73  VAL A CA  
547  C C   . VAL A 72  ? 0.4120 0.4028 0.5578 0.0226  0.0321  0.0100  73  VAL A C   
548  O O   . VAL A 72  ? 0.4299 0.4027 0.5786 0.0182  0.0356  0.0090  73  VAL A O   
549  C CB  . VAL A 72  ? 0.3647 0.3591 0.5139 0.0306  0.0399  -0.0123 73  VAL A CB  
550  C CG1 . VAL A 72  ? 0.3111 0.3030 0.4734 0.0413  0.0392  -0.0024 73  VAL A CG1 
551  C CG2 . VAL A 72  ? 0.3530 0.3614 0.4948 0.0311  0.0413  -0.0240 73  VAL A CG2 
552  N N   . ASP A 73  ? 0.3788 0.3786 0.5247 0.0257  0.0266  0.0229  74  ASP A N   
553  C CA  . ASP A 73  ? 0.4415 0.4325 0.5898 0.0243  0.0234  0.0379  74  ASP A CA  
554  C C   . ASP A 73  ? 0.4617 0.4335 0.6248 0.0327  0.0260  0.0430  74  ASP A C   
555  O O   . ASP A 73  ? 0.4997 0.4742 0.6732 0.0429  0.0272  0.0413  74  ASP A O   
556  C CB  . ASP A 73  ? 0.5661 0.5740 0.7099 0.0254  0.0166  0.0493  74  ASP A CB  
557  C CG  . ASP A 73  ? 0.7257 0.7276 0.8692 0.0228  0.0123  0.0660  74  ASP A CG  
558  O OD1 . ASP A 73  ? 0.8083 0.8029 0.9443 0.0135  0.0135  0.0679  74  ASP A OD1 
559  O OD2 . ASP A 73  ? 0.8304 0.8364 0.9810 0.0296  0.0076  0.0777  74  ASP A OD2 
560  N N   . THR A 74  ? 0.5351 0.4869 0.6993 0.0284  0.0275  0.0496  75  THR A N   
561  C CA  . THR A 74  ? 0.6218 0.5508 0.8000 0.0369  0.0306  0.0556  75  THR A CA  
562  C C   . THR A 74  ? 0.6666 0.5850 0.8452 0.0359  0.0261  0.0756  75  THR A C   
563  O O   . THR A 74  ? 0.7179 0.6112 0.9056 0.0404  0.0294  0.0816  75  THR A O   
564  C CB  . THR A 74  ? 0.6726 0.5788 0.8526 0.0330  0.0396  0.0412  75  THR A CB  
565  O OG1 . THR A 74  ? 0.6649 0.5664 0.8327 0.0179  0.0405  0.0386  75  THR A OG1 
566  C CG2 . THR A 74  ? 0.6525 0.5685 0.8328 0.0357  0.0441  0.0227  75  THR A CG2 
567  N N   . LEU A 75  ? 0.6556 0.5915 0.8237 0.0301  0.0190  0.0860  76  LEU A N   
568  C CA  . LEU A 75  ? 0.6700 0.5973 0.8348 0.0270  0.0145  0.1053  76  LEU A CA  
569  C C   . LEU A 75  ? 0.6715 0.5941 0.8512 0.0412  0.0104  0.1211  76  LEU A C   
570  O O   . LEU A 75  ? 0.7184 0.6188 0.9028 0.0434  0.0106  0.1343  76  LEU A O   
571  C CB  . LEU A 75  ? 0.7019 0.6517 0.8508 0.0172  0.0085  0.1111  76  LEU A CB  
572  C CG  . LEU A 75  ? 0.7429 0.6891 0.8850 0.0126  0.0030  0.1319  76  LEU A CG  
573  C CD1 . LEU A 75  ? 0.7049 0.6233 0.8449 0.0050  0.0082  0.1360  76  LEU A CD1 
574  C CD2 . LEU A 75  ? 0.7569 0.7269 0.8819 0.0023  -0.0014 0.1338  76  LEU A CD2 
575  N N   . TYR A 76  ? 0.6148 0.5583 0.8027 0.0508  0.0065  0.1207  77  TYR A N   
576  C CA  . TYR A 76  ? 0.6721 0.6176 0.8773 0.0654  0.0021  0.1350  77  TYR A CA  
577  C C   . TYR A 76  ? 0.6833 0.6334 0.9043 0.0771  0.0074  0.1215  77  TYR A C   
578  O O   . TYR A 76  ? 0.5955 0.5712 0.8182 0.0795  0.0043  0.1176  77  TYR A O   
579  C CB  . TYR A 76  ? 0.5989 0.5711 0.7988 0.0641  -0.0089 0.1501  77  TYR A CB  
580  C CG  . TYR A 76  ? 0.6073 0.5765 0.7903 0.0524  -0.0139 0.1641  77  TYR A CG  
581  C CD1 . TYR A 76  ? 0.6392 0.5865 0.8253 0.0547  -0.0151 0.1812  77  TYR A CD1 
582  C CD2 . TYR A 76  ? 0.6538 0.6414 0.8173 0.0391  -0.0168 0.1605  77  TYR A CD2 
583  C CE1 . TYR A 76  ? 0.7208 0.6659 0.8899 0.0429  -0.0192 0.1946  77  TYR A CE1 
584  C CE2 . TYR A 76  ? 0.6965 0.6829 0.8439 0.0278  -0.0203 0.1725  77  TYR A CE2 
585  C CZ  . TYR A 76  ? 0.7307 0.6966 0.8803 0.0291  -0.0216 0.1897  77  TYR A CZ  
586  O OH  . TYR A 76  ? 0.7074 0.6726 0.8395 0.0167  -0.0247 0.2022  77  TYR A OH  
587  N N   . PRO A 77  ? 0.7454 0.6704 0.9773 0.0835  0.0163  0.1135  78  PRO A N   
588  C CA  . PRO A 77  ? 0.7515 0.6804 0.9963 0.0932  0.0232  0.0982  78  PRO A CA  
589  C C   . PRO A 77  ? 0.6865 0.6341 0.9509 0.1084  0.0189  0.1084  78  PRO A C   
590  O O   . PRO A 77  ? 0.7070 0.6512 0.9781 0.1151  0.0140  0.1242  78  PRO A O   
591  C CB  . PRO A 77  ? 0.8035 0.6976 1.0548 0.0959  0.0337  0.0898  78  PRO A CB  
592  C CG  . PRO A 77  ? 0.8300 0.7049 1.0660 0.0823  0.0330  0.0948  78  PRO A CG  
593  C CD  . PRO A 77  ? 0.7883 0.6790 1.0184 0.0799  0.0218  0.1157  78  PRO A CD  
594  N N   . GLY A 78  ? 0.6738 0.6439 0.9419 0.1109  0.0205  0.0970  79  GLY A N   
595  C CA  . GLY A 78  ? 0.6941 0.6880 0.9727 0.1195  0.0164  0.1016  79  GLY A CA  
596  C C   . GLY A 78  ? 0.6581 0.6780 0.9325 0.1157  0.0041  0.1174  79  GLY A C   
597  O O   . GLY A 78  ? 0.6852 0.7280 0.9661 0.1201  0.0001  0.1197  79  GLY A O   
598  N N   . PHE A 79  ? 0.5897 0.6074 0.8521 0.1066  -0.0018 0.1276  80  PHE A N   
599  C CA  . PHE A 79  ? 0.4681 0.5101 0.7228 0.1009  -0.0134 0.1417  80  PHE A CA  
600  C C   . PHE A 79  ? 0.4304 0.4967 0.6743 0.0923  -0.0143 0.1299  80  PHE A C   
601  O O   . PHE A 79  ? 0.4493 0.5092 0.6780 0.0833  -0.0090 0.1151  80  PHE A O   
602  C CB  . PHE A 79  ? 0.4910 0.5207 0.7271 0.0897  -0.0177 0.1519  80  PHE A CB  
603  C CG  . PHE A 79  ? 0.4901 0.5439 0.7147 0.0818  -0.0289 0.1650  80  PHE A CG  
604  C CD1 . PHE A 79  ? 0.4297 0.5022 0.6640 0.0882  -0.0371 0.1786  80  PHE A CD1 
605  C CD2 . PHE A 79  ? 0.4527 0.5107 0.6532 0.0662  -0.0302 0.1604  80  PHE A CD2 
606  C CE1 . PHE A 79  ? 0.4056 0.5007 0.6271 0.0790  -0.0471 0.1889  80  PHE A CE1 
607  C CE2 . PHE A 79  ? 0.4214 0.5005 0.6095 0.0580  -0.0394 0.1708  80  PHE A CE2 
608  C CZ  . PHE A 79  ? 0.4071 0.5056 0.6069 0.0646  -0.0488 0.1868  80  PHE A CZ  
609  N N   . GLU A 80  ? 0.4682 0.5621 0.7192 0.0945  -0.0211 0.1366  81  GLU A N   
610  C CA  . GLU A 80  ? 0.5049 0.6205 0.7482 0.0872  -0.0213 0.1261  81  GLU A CA  
611  C C   . GLU A 80  ? 0.4431 0.5581 0.6594 0.0714  -0.0236 0.1224  81  GLU A C   
612  O O   . GLU A 80  ? 0.3604 0.4781 0.5652 0.0648  -0.0194 0.1084  81  GLU A O   
613  C CB  . GLU A 80  ? 0.6617 0.8043 0.9119 0.0884  -0.0281 0.1325  81  GLU A CB  
614  C CG  . GLU A 80  ? 0.8212 0.9823 1.0718 0.0851  -0.0249 0.1198  81  GLU A CG  
615  C CD  . GLU A 80  ? 0.9478 1.1258 1.1825 0.0717  -0.0304 0.1202  81  GLU A CD  
616  O OE1 . GLU A 80  ? 1.0167 1.2042 1.2431 0.0653  -0.0395 0.1323  81  GLU A OE1 
617  O OE2 . GLU A 80  ? 0.9499 1.1274 1.1744 0.0656  -0.0246 0.1060  81  GLU A OE2 
618  N N   . GLY A 81  ? 0.4243 0.5355 0.6301 0.0657  -0.0299 0.1352  82  GLY A N   
619  C CA  . GLY A 81  ? 0.3495 0.4628 0.5307 0.0511  -0.0317 0.1319  82  GLY A CA  
620  C C   . GLY A 81  ? 0.3982 0.4937 0.5674 0.0460  -0.0230 0.1164  82  GLY A C   
621  O O   . GLY A 81  ? 0.4213 0.5214 0.5729 0.0362  -0.0222 0.1086  82  GLY A O   
622  N N   . THR A 82  ? 0.3907 0.4661 0.5693 0.0526  -0.0163 0.1115  83  THR A N   
623  C CA  . THR A 82  ? 0.4010 0.4622 0.5700 0.0477  -0.0087 0.0965  83  THR A CA  
624  C C   . THR A 82  ? 0.3754 0.4364 0.5518 0.0533  -0.0018 0.0813  83  THR A C   
625  O O   . THR A 82  ? 0.4099 0.4695 0.5750 0.0479  0.0024  0.0686  83  THR A O   
626  C CB  . THR A 82  ? 0.4131 0.4507 0.5834 0.0471  -0.0054 0.0998  83  THR A CB  
627  O OG1 . THR A 82  ? 0.4646 0.4903 0.6544 0.0591  -0.0033 0.1043  83  THR A OG1 
628  C CG2 . THR A 82  ? 0.4355 0.4727 0.5947 0.0392  -0.0112 0.1143  83  THR A CG2 
629  N N   . GLU A 83  ? 0.3399 0.4035 0.5348 0.0642  -0.0004 0.0827  84  GLU A N   
630  C CA  . GLU A 83  ? 0.4579 0.5212 0.6590 0.0690  0.0071  0.0681  84  GLU A CA  
631  C C   . GLU A 83  ? 0.4201 0.5021 0.6122 0.0643  0.0064  0.0612  84  GLU A C   
632  O O   . GLU A 83  ? 0.4130 0.4936 0.6013 0.0639  0.0125  0.0480  84  GLU A O   
633  C CB  . GLU A 83  ? 0.4995 0.5620 0.7239 0.0824  0.0099  0.0711  84  GLU A CB  
634  C CG  . GLU A 83  ? 0.6431 0.6817 0.8776 0.0887  0.0126  0.0765  84  GLU A CG  
635  C CD  . GLU A 83  ? 0.7743 0.7903 1.0021 0.0853  0.0215  0.0616  84  GLU A CD  
636  O OE1 . GLU A 83  ? 0.8157 0.8087 1.0480 0.0873  0.0243  0.0648  84  GLU A OE1 
637  O OE2 . GLU A 83  ? 0.7869 0.8080 1.0047 0.0800  0.0255  0.0472  84  GLU A OE2 
638  N N   . MET A 84  ? 0.3218 0.4207 0.5094 0.0599  -0.0008 0.0700  85  MET A N   
639  C CA  . MET A 84  ? 0.2471 0.3609 0.4256 0.0544  -0.0010 0.0636  85  MET A CA  
640  C C   . MET A 84  ? 0.2888 0.3947 0.4472 0.0465  0.0022  0.0533  85  MET A C   
641  O O   . MET A 84  ? 0.2773 0.3894 0.4281 0.0435  0.0044  0.0457  85  MET A O   
642  C CB  . MET A 84  ? 0.2892 0.4217 0.4658 0.0495  -0.0094 0.0746  85  MET A CB  
643  C CG  . MET A 84  ? 0.3966 0.5259 0.5629 0.0435  -0.0157 0.0851  85  MET A CG  
644  S SD  . MET A 84  ? 0.4301 0.5816 0.5871 0.0339  -0.0256 0.0956  85  MET A SD  
645  C CE  . MET A 84  ? 0.3600 0.5214 0.5063 0.0266  -0.0222 0.0827  85  MET A CE  
646  N N   . TRP A 85  ? 0.2178 0.3108 0.3681 0.0430  0.0024  0.0535  86  TRP A N   
647  C CA  . TRP A 85  ? 0.2186 0.3064 0.3528 0.0370  0.0054  0.0441  86  TRP A CA  
648  C C   . TRP A 85  ? 0.2608 0.3372 0.3971 0.0399  0.0118  0.0332  86  TRP A C   
649  O O   . TRP A 85  ? 0.2171 0.2919 0.3419 0.0360  0.0140  0.0253  86  TRP A O   
650  C CB  . TRP A 85  ? 0.1505 0.2352 0.2739 0.0298  0.0023  0.0499  86  TRP A CB  
651  C CG  . TRP A 85  ? 0.2699 0.3654 0.3896 0.0257  -0.0042 0.0609  86  TRP A CG  
652  C CD1 . TRP A 85  ? 0.3148 0.4107 0.4396 0.0257  -0.0093 0.0741  86  TRP A CD1 
653  C CD2 . TRP A 85  ? 0.2943 0.4017 0.4030 0.0202  -0.0065 0.0598  86  TRP A CD2 
654  N NE1 . TRP A 85  ? 0.3146 0.4245 0.4319 0.0201  -0.0152 0.0812  86  TRP A NE1 
655  C CE2 . TRP A 85  ? 0.2920 0.4085 0.3993 0.0161  -0.0132 0.0718  86  TRP A CE2 
656  C CE3 . TRP A 85  ? 0.2477 0.3576 0.3467 0.0180  -0.0033 0.0501  86  TRP A CE3 
657  C CZ2 . TRP A 85  ? 0.2369 0.3657 0.3332 0.0087  -0.0166 0.0726  86  TRP A CZ2 
658  C CZ3 . TRP A 85  ? 0.2488 0.3679 0.3375 0.0113  -0.0060 0.0513  86  TRP A CZ3 
659  C CH2 . TRP A 85  ? 0.2743 0.4031 0.3614 0.0061  -0.0125 0.0617  86  TRP A CH2 
660  N N   . ASN A 86  ? 0.2299 0.2993 0.3807 0.0466  0.0148  0.0325  87  ASN A N   
661  C CA  . ASN A 86  ? 0.3407 0.3985 0.4928 0.0480  0.0212  0.0212  87  ASN A CA  
662  C C   . ASN A 86  ? 0.2946 0.3592 0.4449 0.0505  0.0256  0.0108  87  ASN A C   
663  O O   . ASN A 86  ? 0.2336 0.3098 0.3872 0.0529  0.0247  0.0133  87  ASN A O   
664  C CB  . ASN A 86  ? 0.3383 0.3823 0.5056 0.0541  0.0238  0.0241  87  ASN A CB  
665  C CG  . ASN A 86  ? 0.4334 0.4641 0.5984 0.0493  0.0220  0.0306  87  ASN A CG  
666  O OD1 . ASN A 86  ? 0.4253 0.4566 0.5774 0.0410  0.0208  0.0285  87  ASN A OD1 
667  N ND2 . ASN A 86  ? 0.3845 0.4034 0.5624 0.0549  0.0221  0.0391  87  ASN A ND2 
668  N N   . PRO A 87  ? 0.3394 0.3981 0.4836 0.0488  0.0302  -0.0007 88  PRO A N   
669  C CA  . PRO A 87  ? 0.3427 0.4081 0.4824 0.0502  0.0343  -0.0099 88  PRO A CA  
670  C C   . PRO A 87  ? 0.2852 0.3537 0.4390 0.0573  0.0385  -0.0106 88  PRO A C   
671  O O   . PRO A 87  ? 0.3243 0.3840 0.4918 0.0624  0.0416  -0.0108 88  PRO A O   
672  C CB  . PRO A 87  ? 0.2950 0.3529 0.4279 0.0469  0.0380  -0.0212 88  PRO A CB  
673  C CG  . PRO A 87  ? 0.3220 0.3745 0.4510 0.0414  0.0344  -0.0175 88  PRO A CG  
674  C CD  . PRO A 87  ? 0.3057 0.3538 0.4449 0.0437  0.0313  -0.0055 88  PRO A CD  
675  N N   . ASN A 88  ? 0.2389 0.3199 0.3901 0.0576  0.0390  -0.0109 89  ASN A N   
676  C CA  . ASN A 88  ? 0.2944 0.3827 0.4582 0.0633  0.0441  -0.0132 89  ASN A CA  
677  C C   . ASN A 88  ? 0.2883 0.3781 0.4436 0.0622  0.0510  -0.0252 89  ASN A C   
678  O O   . ASN A 88  ? 0.3349 0.4336 0.4971 0.0652  0.0561  -0.0281 89  ASN A O   
679  C CB  . ASN A 88  ? 0.2796 0.3835 0.4480 0.0629  0.0401  -0.0042 89  ASN A CB  
680  C CG  . ASN A 88  ? 0.3064 0.4156 0.4566 0.0555  0.0378  -0.0046 89  ASN A CG  
681  O OD1 . ASN A 88  ? 0.2719 0.3734 0.4067 0.0516  0.0371  -0.0083 89  ASN A OD1 
682  N ND2 . ASN A 88  ? 0.2903 0.4125 0.4425 0.0535  0.0370  -0.0007 89  ASN A ND2 
683  N N   . ARG A 89  ? 0.2901 0.3733 0.4300 0.0574  0.0510  -0.0318 90  ARG A N   
684  C CA  . ARG A 89  ? 0.2822 0.3657 0.4124 0.0558  0.0568  -0.0432 90  ARG A CA  
685  C C   . ARG A 89  ? 0.3166 0.3889 0.4424 0.0530  0.0577  -0.0510 90  ARG A C   
686  O O   . ARG A 89  ? 0.2229 0.2879 0.3507 0.0514  0.0533  -0.0466 90  ARG A O   
687  C CB  . ARG A 89  ? 0.2953 0.3864 0.4075 0.0513  0.0547  -0.0424 90  ARG A CB  
688  C CG  . ARG A 89  ? 0.3191 0.4204 0.4333 0.0516  0.0556  -0.0371 90  ARG A CG  
689  C CD  . ARG A 89  ? 0.3661 0.4736 0.4852 0.0536  0.0641  -0.0444 90  ARG A CD  
690  N NE  . ARG A 89  ? 0.4726 0.5913 0.5903 0.0515  0.0656  -0.0401 90  ARG A NE  
691  C CZ  . ARG A 89  ? 0.4845 0.6126 0.6175 0.0533  0.0648  -0.0338 90  ARG A CZ  
692  N NH1 . ARG A 89  ? 0.3799 0.5071 0.5305 0.0586  0.0621  -0.0296 90  ARG A NH1 
693  N NH2 . ARG A 89  ? 0.5414 0.6803 0.6719 0.0492  0.0665  -0.0309 90  ARG A NH2 
694  N N   . GLU A 90  ? 0.2795 0.3512 0.3986 0.0514  0.0636  -0.0628 91  GLU A N   
695  C CA  . GLU A 90  ? 0.3739 0.4372 0.4866 0.0465  0.0644  -0.0719 91  GLU A CA  
696  C C   . GLU A 90  ? 0.2404 0.3076 0.3412 0.0411  0.0566  -0.0678 91  GLU A C   
697  O O   . GLU A 90  ? 0.3050 0.3811 0.3975 0.0411  0.0521  -0.0610 91  GLU A O   
698  C CB  . GLU A 90  ? 0.4604 0.5268 0.5633 0.0440  0.0711  -0.0852 91  GLU A CB  
699  C CG  . GLU A 90  ? 0.7716 0.8502 0.8556 0.0396  0.0668  -0.0842 91  GLU A CG  
700  C CD  . GLU A 90  ? 1.0059 1.0895 1.0766 0.0357  0.0720  -0.0960 91  GLU A CD  
701  O OE1 . GLU A 90  ? 1.0670 1.1591 1.1214 0.0314  0.0674  -0.0960 91  GLU A OE1 
702  O OE2 . GLU A 90  ? 1.1010 1.1810 1.1774 0.0373  0.0808  -0.1051 91  GLU A OE2 
703  N N   . LEU A 91  ? 0.2118 0.2718 0.3121 0.0362  0.0557  -0.0724 92  LEU A N   
704  C CA  . LEU A 91  ? 0.2320 0.2988 0.3225 0.0308  0.0493  -0.0705 92  LEU A CA  
705  C C   . LEU A 91  ? 0.2733 0.3502 0.3493 0.0265  0.0494  -0.0796 92  LEU A C   
706  O O   . LEU A 91  ? 0.2759 0.3498 0.3495 0.0239  0.0549  -0.0909 92  LEU A O   
707  C CB  . LEU A 91  ? 0.2868 0.3439 0.3836 0.0258  0.0483  -0.0710 92  LEU A CB  
708  C CG  . LEU A 91  ? 0.3279 0.3741 0.4377 0.0292  0.0475  -0.0608 92  LEU A CG  
709  C CD1 . LEU A 91  ? 0.2602 0.2979 0.3724 0.0222  0.0463  -0.0608 92  LEU A CD1 
710  C CD2 . LEU A 91  ? 0.3125 0.3677 0.4213 0.0330  0.0423  -0.0486 92  LEU A CD2 
711  N N   . SER A 92  ? 0.1974 0.2863 0.2633 0.0261  0.0435  -0.0746 93  SER A N   
712  C CA  . SER A 92  ? 0.2233 0.3243 0.2751 0.0228  0.0418  -0.0805 93  SER A CA  
713  C C   . SER A 92  ? 0.2607 0.3732 0.3069 0.0235  0.0344  -0.0731 93  SER A C   
714  O O   . SER A 92  ? 0.3015 0.4121 0.3509 0.0279  0.0321  -0.0634 93  SER A O   
715  C CB  . SER A 92  ? 0.2160 0.3205 0.2586 0.0257  0.0454  -0.0818 93  SER A CB  
716  O OG  . SER A 92  ? 0.2685 0.3856 0.2956 0.0227  0.0426  -0.0854 93  SER A OG  
717  N N   . GLU A 93  ? 0.2093 0.3346 0.2476 0.0192  0.0309  -0.0782 94  GLU A N   
718  C CA  . GLU A 93  ? 0.2864 0.4255 0.3194 0.0221  0.0243  -0.0712 94  GLU A CA  
719  C C   . GLU A 93  ? 0.2877 0.4299 0.3089 0.0286  0.0234  -0.0648 94  GLU A C   
720  O O   . GLU A 93  ? 0.2981 0.4457 0.3162 0.0340  0.0193  -0.0564 94  GLU A O   
721  C CB  . GLU A 93  ? 0.3248 0.4805 0.3547 0.0156  0.0201  -0.0778 94  GLU A CB  
722  C CG  . GLU A 93  ? 0.3252 0.4787 0.3662 0.0080  0.0205  -0.0827 94  GLU A CG  
723  C CD  . GLU A 93  ? 0.4087 0.5826 0.4477 0.0006  0.0156  -0.0886 94  GLU A CD  
724  O OE1 . GLU A 93  ? 0.3777 0.5678 0.4182 0.0042  0.0101  -0.0821 94  GLU A OE1 
725  O OE2 . GLU A 93  ? 0.4192 0.5938 0.4554 -0.0088 0.0174  -0.1001 94  GLU A OE2 
726  N N   . ASP A 94  ? 0.2442 0.3821 0.2588 0.0280  0.0280  -0.0687 95  ASP A N   
727  C CA  . ASP A 94  ? 0.2331 0.3705 0.2362 0.0326  0.0288  -0.0622 95  ASP A CA  
728  C C   . ASP A 94  ? 0.2515 0.3762 0.2626 0.0365  0.0320  -0.0555 95  ASP A C   
729  O O   . ASP A 94  ? 0.2308 0.3486 0.2463 0.0358  0.0378  -0.0583 95  ASP A O   
730  C CB  . ASP A 94  ? 0.1997 0.3397 0.1925 0.0287  0.0333  -0.0701 95  ASP A CB  
731  C CG  . ASP A 94  ? 0.2709 0.4107 0.2502 0.0320  0.0347  -0.0629 95  ASP A CG  
732  O OD1 . ASP A 94  ? 0.3036 0.4394 0.2813 0.0373  0.0320  -0.0521 95  ASP A OD1 
733  O OD2 . ASP A 94  ? 0.3528 0.4954 0.3221 0.0285  0.0391  -0.0686 95  ASP A OD2 
734  N N   . CYS A 95  ? 0.2682 0.3911 0.2815 0.0405  0.0283  -0.0469 96  CYS A N   
735  C CA  . CYS A 95  ? 0.2440 0.3564 0.2653 0.0422  0.0304  -0.0415 96  CYS A CA  
736  C C   . CYS A 95  ? 0.2283 0.3370 0.2428 0.0464  0.0285  -0.0323 96  CYS A C   
737  O O   . CYS A 95  ? 0.2029 0.3043 0.2226 0.0466  0.0295  -0.0281 96  CYS A O   
738  C CB  . CYS A 95  ? 0.1991 0.3091 0.2342 0.0402  0.0293  -0.0426 96  CYS A CB  
739  S SG  . CYS A 95  ? 0.2433 0.3613 0.2788 0.0410  0.0237  -0.0397 96  CYS A SG  
740  N N   . LEU A 96  ? 0.1816 0.2946 0.1842 0.0499  0.0258  -0.0289 97  LEU A N   
741  C CA  . LEU A 96  ? 0.2405 0.3467 0.2369 0.0547  0.0248  -0.0206 97  LEU A CA  
742  C C   . LEU A 96  ? 0.2521 0.3488 0.2382 0.0542  0.0286  -0.0165 97  LEU A C   
743  O O   . LEU A 96  ? 0.2447 0.3412 0.2176 0.0565  0.0283  -0.0128 97  LEU A O   
744  C CB  . LEU A 96  ? 0.1927 0.3077 0.1839 0.0604  0.0200  -0.0178 97  LEU A CB  
745  C CG  . LEU A 96  ? 0.2594 0.3845 0.2627 0.0597  0.0171  -0.0214 97  LEU A CG  
746  C CD1 . LEU A 96  ? 0.2120 0.3493 0.2133 0.0662  0.0125  -0.0182 97  LEU A CD1 
747  C CD2 . LEU A 96  ? 0.1499 0.2660 0.1619 0.0582  0.0192  -0.0202 97  LEU A CD2 
748  N N   . TYR A 97  ? 0.2670 0.3566 0.2593 0.0506  0.0322  -0.0165 98  TYR A N   
749  C CA  . TYR A 97  ? 0.1986 0.2805 0.1840 0.0480  0.0365  -0.0131 98  TYR A CA  
750  C C   . TYR A 97  ? 0.2580 0.3310 0.2473 0.0462  0.0372  -0.0094 98  TYR A C   
751  O O   . TYR A 97  ? 0.2113 0.2861 0.2111 0.0460  0.0351  -0.0106 98  TYR A O   
752  C CB  . TYR A 97  ? 0.1646 0.2521 0.1551 0.0437  0.0409  -0.0185 98  TYR A CB  
753  C CG  . TYR A 97  ? 0.2336 0.3299 0.2189 0.0437  0.0411  -0.0242 98  TYR A CG  
754  C CD1 . TYR A 97  ? 0.2154 0.3187 0.2090 0.0439  0.0387  -0.0310 98  TYR A CD1 
755  C CD2 . TYR A 97  ? 0.2325 0.3300 0.2032 0.0423  0.0438  -0.0231 98  TYR A CD2 
756  C CE1 . TYR A 97  ? 0.1942 0.3059 0.1818 0.0422  0.0389  -0.0375 98  TYR A CE1 
757  C CE2 . TYR A 97  ? 0.2540 0.3608 0.2178 0.0411  0.0438  -0.0289 98  TYR A CE2 
758  C CZ  . TYR A 97  ? 0.2484 0.3626 0.2208 0.0408  0.0413  -0.0367 98  TYR A CZ  
759  O OH  . TYR A 97  ? 0.3255 0.4493 0.2899 0.0380  0.0414  -0.0438 98  TYR A OH  
760  N N   . LEU A 98  ? 0.2071 0.2702 0.1866 0.0439  0.0402  -0.0049 99  LEU A N   
761  C CA  . LEU A 98  ? 0.2451 0.2998 0.2260 0.0400  0.0413  -0.0023 99  LEU A CA  
762  C C   . LEU A 98  ? 0.2306 0.2852 0.2116 0.0328  0.0457  -0.0018 99  LEU A C   
763  O O   . LEU A 98  ? 0.2625 0.3211 0.2400 0.0314  0.0489  -0.0026 99  LEU A O   
764  C CB  . LEU A 98  ? 0.2856 0.3257 0.2540 0.0434  0.0412  0.0021  99  LEU A CB  
765  C CG  . LEU A 98  ? 0.3362 0.3654 0.2880 0.0464  0.0432  0.0073  99  LEU A CG  
766  C CD1 . LEU A 98  ? 0.2274 0.2456 0.1706 0.0385  0.0483  0.0101  99  LEU A CD1 
767  C CD2 . LEU A 98  ? 0.2846 0.3030 0.2297 0.0543  0.0417  0.0107  99  LEU A CD2 
768  N N   . ASN A 99  ? 0.2345 0.2861 0.2194 0.0272  0.0461  -0.0006 100 ASN A N   
769  C CA  . ASN A 99  ? 0.2277 0.2836 0.2163 0.0192  0.0496  -0.0003 100 ASN A CA  
770  C C   . ASN A 99  ? 0.3061 0.3482 0.2835 0.0124  0.0515  0.0028  100 ASN A C   
771  O O   . ASN A 99  ? 0.3670 0.4000 0.3404 0.0132  0.0494  0.0032  100 ASN A O   
772  C CB  . ASN A 99  ? 0.1786 0.2495 0.1867 0.0176  0.0474  -0.0023 100 ASN A CB  
773  C CG  . ASN A 99  ? 0.2526 0.3314 0.2713 0.0247  0.0450  -0.0057 100 ASN A CG  
774  O OD1 . ASN A 99  ? 0.2786 0.3629 0.2993 0.0271  0.0477  -0.0090 100 ASN A OD1 
775  N ND2 . ASN A 99  ? 0.2106 0.2895 0.2352 0.0270  0.0406  -0.0053 100 ASN A ND2 
776  N N   . VAL A 100 ? 0.2683 0.3086 0.2401 0.0049  0.0562  0.0043  101 VAL A N   
777  C CA  . VAL A 100 ? 0.2918 0.3176 0.2522 -0.0041 0.0591  0.0064  101 VAL A CA  
778  C C   . VAL A 100 ? 0.2801 0.3202 0.2502 -0.0152 0.0613  0.0055  101 VAL A C   
779  O O   . VAL A 100 ? 0.3288 0.3801 0.3034 -0.0170 0.0649  0.0053  101 VAL A O   
780  C CB  . VAL A 100 ? 0.2757 0.2809 0.2158 -0.0037 0.0635  0.0106  101 VAL A CB  
781  C CG1 . VAL A 100 ? 0.2544 0.2417 0.1826 -0.0145 0.0676  0.0120  101 VAL A CG1 
782  C CG2 . VAL A 100 ? 0.2950 0.2896 0.2277 0.0086  0.0606  0.0123  101 VAL A CG2 
783  N N   . TRP A 101 ? 0.2903 0.3320 0.2638 -0.0230 0.0593  0.0048  102 TRP A N   
784  C CA  . TRP A 101 ? 0.2186 0.2740 0.1996 -0.0355 0.0609  0.0045  102 TRP A CA  
785  C C   . TRP A 101 ? 0.2826 0.3180 0.2456 -0.0475 0.0650  0.0049  102 TRP A C   
786  O O   . TRP A 101 ? 0.3179 0.3339 0.2687 -0.0473 0.0643  0.0041  102 TRP A O   
787  C CB  . TRP A 101 ? 0.2526 0.3275 0.2508 -0.0372 0.0546  0.0037  102 TRP A CB  
788  C CG  . TRP A 101 ? 0.2154 0.3101 0.2337 -0.0272 0.0512  0.0037  102 TRP A CG  
789  C CD1 . TRP A 101 ? 0.1666 0.2843 0.2036 -0.0275 0.0520  0.0038  102 TRP A CD1 
790  C CD2 . TRP A 101 ? 0.2216 0.3141 0.2441 -0.0159 0.0470  0.0034  102 TRP A CD2 
791  N NE1 . TRP A 101 ? 0.1599 0.2868 0.2117 -0.0163 0.0489  0.0035  102 TRP A NE1 
792  C CE2 . TRP A 101 ? 0.1506 0.2622 0.1933 -0.0099 0.0457  0.0033  102 TRP A CE2 
793  C CE3 . TRP A 101 ? 0.1762 0.2530 0.1880 -0.0102 0.0449  0.0030  102 TRP A CE3 
794  C CZ2 . TRP A 101 ? 0.1634 0.2759 0.2142 0.0001  0.0423  0.0028  102 TRP A CZ2 
795  C CZ3 . TRP A 101 ? 0.2575 0.3388 0.2783 -0.0008 0.0412  0.0025  102 TRP A CZ3 
796  C CH2 . TRP A 101 ? 0.1682 0.2660 0.2075 0.0036  0.0400  0.0024  102 TRP A CH2 
797  N N   . THR A 102 ? 0.2426 0.2824 0.2041 -0.0586 0.0703  0.0057  103 THR A N   
798  C CA  . THR A 102 ? 0.3144 0.3334 0.2581 -0.0721 0.0753  0.0059  103 THR A CA  
799  C C   . THR A 102 ? 0.3467 0.3864 0.2999 -0.0880 0.0777  0.0049  103 THR A C   
800  O O   . THR A 102 ? 0.3873 0.4540 0.3582 -0.0862 0.0776  0.0052  103 THR A O   
801  C CB  . THR A 102 ? 0.4344 0.4271 0.3581 -0.0688 0.0815  0.0099  103 THR A CB  
802  O OG1 . THR A 102 ? 0.5790 0.5429 0.4832 -0.0793 0.0861  0.0102  103 THR A OG1 
803  C CG2 . THR A 102 ? 0.4285 0.4346 0.3553 -0.0720 0.0865  0.0122  103 THR A CG2 
804  N N   . PRO A 103 ? 0.3476 0.3764 0.2902 -0.1040 0.0799  0.0031  104 PRO A N   
805  C CA  . PRO A 103 ? 0.3856 0.4370 0.3379 -0.1210 0.0819  0.0020  104 PRO A CA  
806  C C   . PRO A 103 ? 0.4234 0.4791 0.3748 -0.1247 0.0897  0.0047  104 PRO A C   
807  O O   . PRO A 103 ? 0.4284 0.4599 0.3631 -0.1193 0.0948  0.0079  104 PRO A O   
808  C CB  . PRO A 103 ? 0.4095 0.4393 0.3441 -0.1380 0.0841  -0.0012 104 PRO A CB  
809  C CG  . PRO A 103 ? 0.3621 0.3705 0.2869 -0.1280 0.0802  -0.0031 104 PRO A CG  
810  C CD  . PRO A 103 ? 0.3964 0.3961 0.3209 -0.1074 0.0800  0.0007  104 PRO A CD  
811  N N   . TYR A 104 ? 0.4423 0.5310 0.4122 -0.1339 0.0905  0.0038  105 TYR A N   
812  C CA  . TYR A 104 ? 0.4402 0.5392 0.4115 -0.1404 0.0989  0.0054  105 TYR A CA  
813  C C   . TYR A 104 ? 0.4817 0.5857 0.4497 -0.1642 0.1033  0.0040  105 TYR A C   
814  O O   . TYR A 104 ? 0.5066 0.6402 0.4929 -0.1726 0.0985  0.0015  105 TYR A O   
815  C CB  . TYR A 104 ? 0.4134 0.5502 0.4121 -0.1302 0.0978  0.0046  105 TYR A CB  
816  C CG  . TYR A 104 ? 0.5029 0.6503 0.5026 -0.1331 0.1074  0.0053  105 TYR A CG  
817  C CD1 . TYR A 104 ? 0.4922 0.6555 0.4964 -0.1500 0.1129  0.0048  105 TYR A CD1 
818  C CD2 . TYR A 104 ? 0.4877 0.6300 0.4840 -0.1186 0.1102  0.0060  105 TYR A CD2 
819  C CE1 . TYR A 104 ? 0.4404 0.6109 0.4452 -0.1498 0.1199  0.0052  105 TYR A CE1 
820  C CE2 . TYR A 104 ? 0.4677 0.6205 0.4631 -0.1219 0.1196  0.0060  105 TYR A CE2 
821  C CZ  . TYR A 104 ? 0.5035 0.6696 0.5033 -0.1369 0.1242  0.0058  105 TYR A CZ  
822  O OH  . TYR A 104 ? 0.5343 0.7077 0.5330 -0.1373 0.1312  0.0058  105 TYR A OH  
823  N N   . PRO A 105 ? 0.5563 0.6331 0.5015 -0.1764 0.1120  0.0060  106 PRO A N   
824  C CA  . PRO A 105 ? 0.5698 0.6129 0.4925 -0.1675 0.1174  0.0109  106 PRO A CA  
825  C C   . PRO A 105 ? 0.5289 0.5338 0.4329 -0.1574 0.1138  0.0118  106 PRO A C   
826  O O   . PRO A 105 ? 0.4968 0.4972 0.4016 -0.1607 0.1088  0.0077  106 PRO A O   
827  C CB  . PRO A 105 ? 0.5962 0.6250 0.5044 -0.1837 0.1248  0.0128  106 PRO A CB  
828  C CG  . PRO A 105 ? 0.5451 0.5791 0.4575 -0.1997 0.1212  0.0074  106 PRO A CG  
829  C CD  . PRO A 105 ? 0.5574 0.6330 0.4983 -0.1954 0.1132  0.0036  106 PRO A CD  
830  N N   . ARG A 106 ? 0.5884 0.5683 0.4761 -0.1452 0.1164  0.0172  107 ARG A N   
831  C CA  . ARG A 106 ? 0.6061 0.5527 0.4785 -0.1328 0.1134  0.0188  107 ARG A CA  
832  C C   . ARG A 106 ? 0.6235 0.5389 0.4789 -0.1467 0.1166  0.0166  107 ARG A C   
833  O O   . ARG A 106 ? 0.7471 0.6516 0.5916 -0.1648 0.1240  0.0177  107 ARG A O   
834  C CB  . ARG A 106 ? 0.6761 0.6017 0.5319 -0.1209 0.1166  0.0265  107 ARG A CB  
835  C CG  . ARG A 106 ? 0.7312 0.6379 0.5808 -0.1013 0.1112  0.0284  107 ARG A CG  
836  C CD  . ARG A 106 ? 0.7948 0.6929 0.6326 -0.0894 0.1126  0.0364  107 ARG A CD  
837  N NE  . ARG A 106 ? 0.7848 0.7159 0.6356 -0.0883 0.1128  0.0354  107 ARG A NE  
838  C CZ  . ARG A 106 ? 0.7880 0.7189 0.6282 -0.0846 0.1160  0.0413  107 ARG A CZ  
839  N NH1 . ARG A 106 ? 0.7887 0.6886 0.6053 -0.0809 0.1181  0.0504  107 ARG A NH1 
840  N NH2 . ARG A 106 ? 0.7736 0.7353 0.6264 -0.0843 0.1171  0.0381  107 ARG A NH2 
841  N N   . PRO A 107 ? 0.6916 0.5923 0.5442 -0.1397 0.1121  0.0129  108 PRO A N   
842  C CA  . PRO A 107 ? 0.7631 0.6320 0.5983 -0.1529 0.1162  0.0091  108 PRO A CA  
843  C C   . PRO A 107 ? 0.8736 0.6989 0.6832 -0.1547 0.1252  0.0156  108 PRO A C   
844  O O   . PRO A 107 ? 0.8994 0.7119 0.7020 -0.1386 0.1255  0.0233  108 PRO A O   
845  C CB  . PRO A 107 ? 0.7260 0.5886 0.5633 -0.1398 0.1101  0.0045  108 PRO A CB  
846  C CG  . PRO A 107 ? 0.6353 0.5372 0.4965 -0.1272 0.1015  0.0044  108 PRO A CG  
847  C CD  . PRO A 107 ? 0.5946 0.5092 0.4605 -0.1214 0.1035  0.0109  108 PRO A CD  
848  N N   . THR A 108 ? 0.9516 0.7540 0.7467 -0.1752 0.1322  0.0127  109 THR A N   
849  C CA  . THR A 108 ? 1.1177 0.8746 0.8873 -0.1793 0.1416  0.0193  109 THR A CA  
850  C C   . THR A 108 ? 1.1047 0.8179 0.8580 -0.1682 0.1435  0.0183  109 THR A C   
851  O O   . THR A 108 ? 1.1958 0.8724 0.9312 -0.1596 0.1487  0.0269  109 THR A O   
852  C CB  . THR A 108 ? 1.2326 0.9900 0.9995 -0.2008 0.1443  0.0144  109 THR A CB  
853  O OG1 . THR A 108 ? 1.2969 1.0344 1.0555 -0.2113 0.1454  0.0044  109 THR A OG1 
854  C CG2 . THR A 108 ? 1.2225 1.0318 1.0127 -0.2112 0.1399  0.0111  109 THR A CG2 
855  N N   . SER A 109 ? 0.9886 0.7059 0.7479 -0.1677 0.1396  0.0082  110 SER A N   
856  C CA  . SER A 109 ? 0.9767 0.6581 0.7239 -0.1558 0.1416  0.0052  110 SER A CA  
857  C C   . SER A 109 ? 0.9196 0.6253 0.6834 -0.1343 0.1324  0.0034  110 SER A C   
858  O O   . SER A 109 ? 0.8706 0.6192 0.6546 -0.1344 0.1245  0.0010  110 SER A O   
859  C CB  . SER A 109 ? 1.0568 0.7184 0.7931 -0.1759 0.1467  -0.0069 110 SER A CB  
860  O OG  . SER A 109 ? 1.0961 0.7987 0.8476 -0.1929 0.1410  -0.0147 110 SER A OG  
861  N N   . PRO A 110 ? 0.9107 0.5902 0.6674 -0.1153 0.1334  0.0050  111 PRO A N   
862  C CA  . PRO A 110 ? 0.8504 0.5534 0.6228 -0.0955 0.1252  0.0035  111 PRO A CA  
863  C C   . PRO A 110 ? 0.7956 0.5262 0.5803 -0.1044 0.1200  -0.0076 111 PRO A C   
864  O O   . PRO A 110 ? 0.7501 0.4671 0.5256 -0.1200 0.1240  -0.0167 111 PRO A O   
865  C CB  . PRO A 110 ? 0.9342 0.5990 0.6943 -0.0784 0.1300  0.0051  111 PRO A CB  
866  C CG  . PRO A 110 ? 0.9777 0.6051 0.7187 -0.0815 0.1381  0.0141  111 PRO A CG  
867  C CD  . PRO A 110 ? 0.9603 0.5889 0.6956 -0.1092 0.1423  0.0102  111 PRO A CD  
868  N N   . THR A 111 ? 0.6946 0.4639 0.4994 -0.0946 0.1109  -0.0065 112 THR A N   
869  C CA  . THR A 111 ? 0.6676 0.4706 0.4873 -0.1017 0.1039  -0.0134 112 THR A CA  
870  C C   . THR A 111 ? 0.6000 0.4129 0.4286 -0.0841 0.0986  -0.0153 112 THR A C   
871  O O   . THR A 111 ? 0.5689 0.3838 0.4028 -0.0657 0.0964  -0.0092 112 THR A O   
872  C CB  . THR A 111 ? 0.6830 0.5250 0.5206 -0.1068 0.0983  -0.0095 112 THR A CB  
873  O OG1 . THR A 111 ? 0.7255 0.5620 0.5559 -0.1254 0.1038  -0.0086 112 THR A OG1 
874  C CG2 . THR A 111 ? 0.6524 0.5303 0.5073 -0.1111 0.0901  -0.0142 112 THR A CG2 
875  N N   . PRO A 112 ? 0.5639 0.3841 0.3935 -0.0902 0.0965  -0.0236 113 PRO A N   
876  C CA  . PRO A 112 ? 0.5561 0.3872 0.3940 -0.0751 0.0921  -0.0254 113 PRO A CA  
877  C C   . PRO A 112 ? 0.4419 0.3078 0.3005 -0.0644 0.0834  -0.0192 113 PRO A C   
878  O O   . PRO A 112 ? 0.4152 0.3055 0.2851 -0.0719 0.0792  -0.0165 113 PRO A O   
879  C CB  . PRO A 112 ? 0.6528 0.4907 0.4872 -0.0892 0.0911  -0.0349 113 PRO A CB  
880  C CG  . PRO A 112 ? 0.7012 0.5470 0.5333 -0.1113 0.0911  -0.0365 113 PRO A CG  
881  C CD  . PRO A 112 ? 0.6401 0.4586 0.4616 -0.1124 0.0985  -0.0321 113 PRO A CD  
882  N N   . VAL A 113 ? 0.4139 0.2819 0.2781 -0.0466 0.0813  -0.0175 114 VAL A N   
883  C CA  . VAL A 113 ? 0.4000 0.2950 0.2816 -0.0351 0.0743  -0.0122 114 VAL A CA  
884  C C   . VAL A 113 ? 0.4202 0.3345 0.3121 -0.0314 0.0690  -0.0156 114 VAL A C   
885  O O   . VAL A 113 ? 0.4585 0.3610 0.3440 -0.0264 0.0716  -0.0199 114 VAL A O   
886  C CB  . VAL A 113 ? 0.4295 0.3132 0.3092 -0.0181 0.0757  -0.0063 114 VAL A CB  
887  C CG1 . VAL A 113 ? 0.3368 0.2483 0.2332 -0.0088 0.0689  -0.0023 114 VAL A CG1 
888  C CG2 . VAL A 113 ? 0.4028 0.2640 0.2692 -0.0220 0.0815  -0.0016 114 VAL A CG2 
889  N N   . LEU A 114 ? 0.3974 0.3409 0.3051 -0.0337 0.0620  -0.0134 115 LEU A N   
890  C CA  . LEU A 114 ? 0.3864 0.3493 0.3053 -0.0287 0.0564  -0.0140 115 LEU A CA  
891  C C   . LEU A 114 ? 0.3514 0.3263 0.2831 -0.0146 0.0530  -0.0094 115 LEU A C   
892  O O   . LEU A 114 ? 0.3602 0.3436 0.2989 -0.0137 0.0518  -0.0058 115 LEU A O   
893  C CB  . LEU A 114 ? 0.3288 0.3150 0.2567 -0.0408 0.0506  -0.0138 115 LEU A CB  
894  C CG  . LEU A 114 ? 0.4642 0.4469 0.3809 -0.0559 0.0515  -0.0193 115 LEU A CG  
895  C CD1 . LEU A 114 ? 0.4643 0.4724 0.3912 -0.0684 0.0453  -0.0168 115 LEU A CD1 
896  C CD2 . LEU A 114 ? 0.5077 0.4902 0.4204 -0.0527 0.0509  -0.0228 115 LEU A CD2 
897  N N   . VAL A 115 ? 0.3287 0.3050 0.2631 -0.0044 0.0520  -0.0104 116 VAL A N   
898  C CA  . VAL A 115 ? 0.3052 0.2930 0.2507 0.0076  0.0488  -0.0073 116 VAL A CA  
899  C C   . VAL A 115 ? 0.3171 0.3236 0.2743 0.0079  0.0437  -0.0077 116 VAL A C   
900  O O   . VAL A 115 ? 0.3748 0.3794 0.3283 0.0078  0.0447  -0.0106 116 VAL A O   
901  C CB  . VAL A 115 ? 0.3061 0.2801 0.2452 0.0201  0.0521  -0.0070 116 VAL A CB  
902  C CG1 . VAL A 115 ? 0.2952 0.2844 0.2456 0.0304  0.0480  -0.0044 116 VAL A CG1 
903  C CG2 . VAL A 115 ? 0.2906 0.2429 0.2164 0.0199  0.0571  -0.0049 116 VAL A CG2 
904  N N   . TRP A 116 ? 0.2518 0.2754 0.2227 0.0083  0.0392  -0.0047 117 TRP A N   
905  C CA  . TRP A 116 ? 0.2234 0.2630 0.2059 0.0078  0.0344  -0.0035 117 TRP A CA  
906  C C   . TRP A 116 ? 0.2301 0.2747 0.2197 0.0178  0.0332  -0.0035 117 TRP A C   
907  O O   . TRP A 116 ? 0.1741 0.2184 0.1661 0.0241  0.0338  -0.0032 117 TRP A O   
908  C CB  . TRP A 116 ? 0.1906 0.2447 0.1852 0.0029  0.0305  -0.0001 117 TRP A CB  
909  C CG  . TRP A 116 ? 0.2063 0.2744 0.2135 0.0039  0.0255  0.0030  117 TRP A CG  
910  C CD1 . TRP A 116 ? 0.2006 0.2770 0.2215 0.0098  0.0234  0.0048  117 TRP A CD1 
911  C CD2 . TRP A 116 ? 0.1882 0.2619 0.1941 -0.0019 0.0223  0.0047  117 TRP A CD2 
912  N NE1 . TRP A 116 ? 0.1886 0.2734 0.2173 0.0086  0.0193  0.0084  117 TRP A NE1 
913  C CE2 . TRP A 116 ? 0.1876 0.2721 0.2070 0.0014  0.0182  0.0090  117 TRP A CE2 
914  C CE3 . TRP A 116 ? 0.1906 0.2606 0.1840 -0.0101 0.0230  0.0028  117 TRP A CE3 
915  C CZ2 . TRP A 116 ? 0.1953 0.2871 0.2159 -0.0030 0.0142  0.0131  117 TRP A CZ2 
916  C CZ3 . TRP A 116 ? 0.2438 0.3232 0.2378 -0.0150 0.0191  0.0059  117 TRP A CZ3 
917  C CH2 . TRP A 116 ? 0.1922 0.2826 0.1996 -0.0113 0.0145  0.0118  117 TRP A CH2 
918  N N   . ILE A 117 ? 0.2285 0.2789 0.2208 0.0179  0.0317  -0.0040 118 ILE A N   
919  C CA  . ILE A 117 ? 0.2144 0.2724 0.2150 0.0247  0.0303  -0.0042 118 ILE A CA  
920  C C   . ILE A 117 ? 0.2554 0.3247 0.2658 0.0201  0.0262  -0.0012 118 ILE A C   
921  O O   . ILE A 117 ? 0.2157 0.2870 0.2224 0.0144  0.0255  -0.0003 118 ILE A O   
922  C CB  . ILE A 117 ? 0.2501 0.3045 0.2447 0.0296  0.0335  -0.0074 118 ILE A CB  
923  C CG1 . ILE A 117 ? 0.2661 0.3063 0.2503 0.0350  0.0377  -0.0090 118 ILE A CG1 
924  C CG2 . ILE A 117 ? 0.2038 0.2694 0.2081 0.0352  0.0317  -0.0079 118 ILE A CG2 
925  C CD1 . ILE A 117 ? 0.2710 0.3079 0.2514 0.0424  0.0414  -0.0119 118 ILE A CD1 
926  N N   . TYR A 118 ? 0.2344 0.3100 0.2564 0.0225  0.0238  0.0005  119 TYR A N   
927  C CA  . TYR A 118 ? 0.1210 0.2041 0.1530 0.0192  0.0201  0.0047  119 TYR A CA  
928  C C   . TYR A 118 ? 0.1805 0.2667 0.2131 0.0189  0.0200  0.0045  119 TYR A C   
929  O O   . TYR A 118 ? 0.1759 0.2618 0.2058 0.0228  0.0224  0.0004  119 TYR A O   
930  C CB  . TYR A 118 ? 0.2175 0.3038 0.2621 0.0225  0.0190  0.0055  119 TYR A CB  
931  C CG  . TYR A 118 ? 0.1855 0.2708 0.2322 0.0282  0.0209  0.0007  119 TYR A CG  
932  C CD1 . TYR A 118 ? 0.2117 0.2995 0.2624 0.0290  0.0204  -0.0008 119 TYR A CD1 
933  C CD2 . TYR A 118 ? 0.1253 0.2084 0.1691 0.0316  0.0231  -0.0023 119 TYR A CD2 
934  C CE1 . TYR A 118 ? 0.1504 0.2398 0.2026 0.0327  0.0215  -0.0057 119 TYR A CE1 
935  C CE2 . TYR A 118 ? 0.1676 0.2518 0.2117 0.0358  0.0241  -0.0065 119 TYR A CE2 
936  C CZ  . TYR A 118 ? 0.1793 0.2673 0.2278 0.0363  0.0230  -0.0085 119 TYR A CZ  
937  O OH  . TYR A 118 ? 0.1778 0.2693 0.2262 0.0390  0.0234  -0.0132 119 TYR A OH  
938  N N   . GLY A 119 ? 0.1433 0.2339 0.1800 0.0140  0.0170  0.0098  120 GLY A N   
939  C CA  . GLY A 119 ? 0.2078 0.3016 0.2461 0.0120  0.0169  0.0109  120 GLY A CA  
940  C C   . GLY A 119 ? 0.1925 0.2866 0.2434 0.0137  0.0153  0.0130  120 GLY A C   
941  O O   . GLY A 119 ? 0.2031 0.2951 0.2615 0.0179  0.0152  0.0117  120 GLY A O   
942  N N   . GLY A 120 ? 0.2658 0.3618 0.3185 0.0097  0.0149  0.0159  121 GLY A N   
943  C CA  . GLY A 120 ? 0.1228 0.2159 0.1861 0.0100  0.0144  0.0174  121 GLY A CA  
944  C C   . GLY A 120 ? 0.2351 0.3314 0.2982 0.0071  0.0169  0.0137  121 GLY A C   
945  O O   . GLY A 120 ? 0.2402 0.3348 0.3103 0.0079  0.0179  0.0098  121 GLY A O   
946  N N   . GLY A 121 ? 0.1690 0.2712 0.2239 0.0030  0.0184  0.0140  122 GLY A N   
947  C CA  . GLY A 121 ? 0.2521 0.3609 0.3077 -0.0011 0.0212  0.0114  122 GLY A CA  
948  C C   . GLY A 121 ? 0.2141 0.3293 0.2738 0.0034  0.0232  0.0027  122 GLY A C   
949  O O   . GLY A 121 ? 0.2238 0.3459 0.2880 -0.0007 0.0248  0.0003  122 GLY A O   
950  N N   . PHE A 122 ? 0.1713 0.2856 0.2293 0.0109  0.0230  -0.0014 123 PHE A N   
951  C CA  . PHE A 122 ? 0.1752 0.2963 0.2362 0.0160  0.0236  -0.0082 123 PHE A CA  
952  C C   . PHE A 122 ? 0.1710 0.2914 0.2404 0.0136  0.0224  -0.0108 123 PHE A C   
953  O O   . PHE A 122 ? 0.1879 0.3169 0.2597 0.0155  0.0223  -0.0166 123 PHE A O   
954  C CB  . PHE A 122 ? 0.1493 0.2841 0.2097 0.0168  0.0262  -0.0117 123 PHE A CB  
955  C CG  . PHE A 122 ? 0.1883 0.3224 0.2400 0.0210  0.0289  -0.0117 123 PHE A CG  
956  C CD1 . PHE A 122 ? 0.1870 0.3161 0.2337 0.0294  0.0290  -0.0134 123 PHE A CD1 
957  C CD2 . PHE A 122 ? 0.1757 0.3130 0.2232 0.0160  0.0319  -0.0103 123 PHE A CD2 
958  C CE1 . PHE A 122 ? 0.1718 0.2967 0.2099 0.0329  0.0324  -0.0142 123 PHE A CE1 
959  C CE2 . PHE A 122 ? 0.1727 0.3077 0.2112 0.0193  0.0355  -0.0120 123 PHE A CE2 
960  C CZ  . PHE A 122 ? 0.1888 0.3164 0.2229 0.0279  0.0359  -0.0142 123 PHE A CZ  
961  N N   . TYR A 123 ? 0.1320 0.2421 0.2056 0.0093  0.0216  -0.0069 124 TYR A N   
962  C CA  . TYR A 123 ? 0.2330 0.3381 0.3139 0.0069  0.0217  -0.0105 124 TYR A CA  
963  C C   . TYR A 123 ? 0.2221 0.3156 0.3060 0.0112  0.0212  -0.0096 124 TYR A C   
964  O O   . TYR A 123 ? 0.2164 0.3037 0.3057 0.0101  0.0224  -0.0141 124 TYR A O   
965  C CB  . TYR A 123 ? 0.1788 0.2798 0.2641 -0.0020 0.0228  -0.0073 124 TYR A CB  
966  C CG  . TYR A 123 ? 0.2700 0.3583 0.3562 -0.0035 0.0217  0.0027  124 TYR A CG  
967  C CD1 . TYR A 123 ? 0.2418 0.3159 0.3349 -0.0017 0.0215  0.0047  124 TYR A CD1 
968  C CD2 . TYR A 123 ? 0.2611 0.3527 0.3413 -0.0064 0.0209  0.0101  124 TYR A CD2 
969  C CE1 . TYR A 123 ? 0.2588 0.3233 0.3542 -0.0015 0.0197  0.0152  124 TYR A CE1 
970  C CE2 . TYR A 123 ? 0.2637 0.3464 0.3441 -0.0079 0.0188  0.0204  124 TYR A CE2 
971  C CZ  . TYR A 123 ? 0.3053 0.3750 0.3941 -0.0049 0.0177  0.0237  124 TYR A CZ  
972  O OH  . TYR A 123 ? 0.4008 0.4633 0.4912 -0.0049 0.0148  0.0355  124 TYR A OH  
973  N N   . SER A 124 ? 0.1609 0.2519 0.2417 0.0155  0.0201  -0.0049 125 SER A N   
974  C CA  . SER A 124 ? 0.2025 0.2857 0.2881 0.0196  0.0200  -0.0035 125 SER A CA  
975  C C   . SER A 124 ? 0.2029 0.2890 0.2826 0.0233  0.0190  -0.0010 125 SER A C   
976  O O   . SER A 124 ? 0.1735 0.2644 0.2447 0.0229  0.0187  -0.0007 125 SER A O   
977  C CB  . SER A 124 ? 0.2245 0.2984 0.3182 0.0175  0.0192  0.0037  125 SER A CB  
978  O OG  . SER A 124 ? 0.2303 0.3067 0.3201 0.0146  0.0166  0.0126  125 SER A OG  
979  N N   . GLY A 125 ? 0.1690 0.2517 0.2538 0.0267  0.0191  0.0003  126 GLY A N   
980  C CA  . GLY A 125 ? 0.2177 0.3032 0.2977 0.0286  0.0186  0.0023  126 GLY A CA  
981  C C   . GLY A 125 ? 0.2118 0.2977 0.2907 0.0326  0.0212  -0.0035 126 GLY A C   
982  O O   . GLY A 125 ? 0.1715 0.2571 0.2502 0.0339  0.0230  -0.0100 126 GLY A O   
983  N N   . ALA A 126 ? 0.2189 0.3064 0.2964 0.0334  0.0214  -0.0013 127 ALA A N   
984  C CA  . ALA A 126 ? 0.2249 0.3132 0.2998 0.0360  0.0245  -0.0058 127 ALA A CA  
985  C C   . ALA A 126 ? 0.2703 0.3607 0.3410 0.0340  0.0244  -0.0021 127 ALA A C   
986  O O   . ALA A 126 ? 0.1803 0.2739 0.2560 0.0315  0.0218  0.0035  127 ALA A O   
987  C CB  . ALA A 126 ? 0.1596 0.2477 0.2461 0.0389  0.0272  -0.0092 127 ALA A CB  
988  N N   . SER A 127 ? 0.2095 0.2982 0.2702 0.0344  0.0269  -0.0048 128 SER A N   
989  C CA  . SER A 127 ? 0.1943 0.2833 0.2500 0.0309  0.0278  -0.0022 128 SER A CA  
990  C C   . SER A 127 ? 0.2098 0.3066 0.2772 0.0306  0.0294  -0.0014 128 SER A C   
991  O O   . SER A 127 ? 0.1854 0.2858 0.2515 0.0261  0.0299  0.0010  128 SER A O   
992  C CB  . SER A 127 ? 0.1767 0.2590 0.2174 0.0314  0.0306  -0.0043 128 SER A CB  
993  O OG  . SER A 127 ? 0.1848 0.2686 0.2252 0.0346  0.0334  -0.0081 128 SER A OG  
994  N N   . SER A 128 ? 0.2032 0.3030 0.2827 0.0348  0.0308  -0.0039 129 SER A N   
995  C CA  . SER A 128 ? 0.1949 0.3029 0.2875 0.0365  0.0338  -0.0044 129 SER A CA  
996  C C   . SER A 128 ? 0.2427 0.3582 0.3519 0.0376  0.0303  0.0019  129 SER A C   
997  O O   . SER A 128 ? 0.2265 0.3517 0.3493 0.0399  0.0325  0.0025  129 SER A O   
998  C CB  . SER A 128 ? 0.1957 0.3017 0.2921 0.0411  0.0385  -0.0117 129 SER A CB  
999  O OG  . SER A 128 ? 0.1963 0.2962 0.2970 0.0435  0.0367  -0.0132 129 SER A OG  
1000 N N   . LEU A 129 ? 0.2377 0.3502 0.3466 0.0364  0.0251  0.0069  130 LEU A N   
1001 C CA  . LEU A 129 ? 0.2576 0.3772 0.3811 0.0378  0.0209  0.0148  130 LEU A CA  
1002 C C   . LEU A 129 ? 0.2013 0.3352 0.3288 0.0338  0.0188  0.0195  130 LEU A C   
1003 O O   . LEU A 129 ? 0.2398 0.3742 0.3542 0.0270  0.0190  0.0182  130 LEU A O   
1004 C CB  . LEU A 129 ? 0.2179 0.3320 0.3359 0.0352  0.0158  0.0200  130 LEU A CB  
1005 C CG  . LEU A 129 ? 0.2731 0.3752 0.3863 0.0368  0.0175  0.0155  130 LEU A CG  
1006 C CD1 . LEU A 129 ? 0.2519 0.3513 0.3608 0.0330  0.0130  0.0217  130 LEU A CD1 
1007 C CD2 . LEU A 129 ? 0.2239 0.3211 0.3503 0.0431  0.0211  0.0120  130 LEU A CD2 
1008 N N   . ASP A 130 ? 0.1906 0.3362 0.3371 0.0381  0.0170  0.0251  131 ASP A N   
1009 C CA  . ASP A 130 ? 0.2414 0.4056 0.3957 0.0344  0.0149  0.0293  131 ASP A CA  
1010 C C   . ASP A 130 ? 0.2280 0.3962 0.3694 0.0242  0.0088  0.0341  131 ASP A C   
1011 O O   . ASP A 130 ? 0.2168 0.3954 0.3549 0.0166  0.0087  0.0336  131 ASP A O   
1012 C CB  . ASP A 130 ? 0.2125 0.3904 0.3916 0.0424  0.0127  0.0363  131 ASP A CB  
1013 C CG  . ASP A 130 ? 0.3551 0.5300 0.5481 0.0523  0.0204  0.0300  131 ASP A CG  
1014 O OD1 . ASP A 130 ? 0.3502 0.5186 0.5337 0.0508  0.0273  0.0203  131 ASP A OD1 
1015 O OD2 . ASP A 130 ? 0.4290 0.6077 0.6418 0.0616  0.0199  0.0348  131 ASP A OD2 
1016 N N   . VAL A 131 ? 0.2011 0.3614 0.3345 0.0227  0.0043  0.0380  132 VAL A N   
1017 C CA  . VAL A 131 ? 0.2129 0.3774 0.3333 0.0126  -0.0010 0.0418  132 VAL A CA  
1018 C C   . VAL A 131 ? 0.1788 0.3313 0.2779 0.0055  0.0030  0.0338  132 VAL A C   
1019 O O   . VAL A 131 ? 0.2086 0.3629 0.2952 -0.0040 0.0005  0.0345  132 VAL A O   
1020 C CB  . VAL A 131 ? 0.2617 0.4226 0.3807 0.0134  -0.0064 0.0490  132 VAL A CB  
1021 C CG1 . VAL A 131 ? 0.2375 0.3799 0.3417 0.0134  -0.0029 0.0432  132 VAL A CG1 
1022 C CG2 . VAL A 131 ? 0.3170 0.4910 0.4298 0.0040  -0.0137 0.0561  132 VAL A CG2 
1023 N N   . TYR A 132 ? 0.1537 0.2937 0.2477 0.0098  0.0094  0.0265  133 TYR A N   
1024 C CA  . TYR A 132 ? 0.1992 0.3272 0.2747 0.0051  0.0136  0.0201  133 TYR A CA  
1025 C C   . TYR A 132 ? 0.2595 0.3906 0.3350 0.0023  0.0182  0.0169  133 TYR A C   
1026 O O   . TYR A 132 ? 0.2770 0.3954 0.3381 0.0006  0.0227  0.0123  133 TYR A O   
1027 C CB  . TYR A 132 ? 0.1986 0.3119 0.2667 0.0113  0.0168  0.0154  133 TYR A CB  
1028 C CG  . TYR A 132 ? 0.1977 0.3079 0.2658 0.0132  0.0136  0.0178  133 TYR A CG  
1029 C CD1 . TYR A 132 ? 0.1844 0.2990 0.2490 0.0073  0.0091  0.0228  133 TYR A CD1 
1030 C CD2 . TYR A 132 ? 0.1382 0.2419 0.2089 0.0196  0.0154  0.0149  133 TYR A CD2 
1031 C CE1 . TYR A 132 ? 0.2015 0.3136 0.2651 0.0081  0.0069  0.0255  133 TYR A CE1 
1032 C CE2 . TYR A 132 ? 0.1539 0.2552 0.2246 0.0199  0.0131  0.0171  133 TYR A CE2 
1033 C CZ  . TYR A 132 ? 0.1876 0.2928 0.2549 0.0143  0.0091  0.0227  133 TYR A CZ  
1034 O OH  . TYR A 132 ? 0.1814 0.2845 0.2478 0.0136  0.0076  0.0253  133 TYR A OH  
1035 N N   . ASP A 133 ? 0.2338 0.3820 0.3255 0.0022  0.0173  0.0199  134 ASP A N   
1036 C CA  . ASP A 133 ? 0.2187 0.3735 0.3122 -0.0017 0.0221  0.0172  134 ASP A CA  
1037 C C   . ASP A 133 ? 0.2575 0.4076 0.3344 -0.0142 0.0227  0.0158  134 ASP A C   
1038 O O   . ASP A 133 ? 0.3185 0.4796 0.3964 -0.0224 0.0178  0.0191  134 ASP A O   
1039 C CB  . ASP A 133 ? 0.2435 0.4218 0.3605 0.0006  0.0205  0.0212  134 ASP A CB  
1040 C CG  . ASP A 133 ? 0.2739 0.4612 0.3960 -0.0018 0.0271  0.0176  134 ASP A CG  
1041 O OD1 . ASP A 133 ? 0.2695 0.4448 0.3747 -0.0079 0.0322  0.0133  134 ASP A OD1 
1042 O OD2 . ASP A 133 ? 0.3466 0.5533 0.4900 0.0027  0.0278  0.0195  134 ASP A OD2 
1043 N N   . GLY A 134 ? 0.2117 0.3453 0.2727 -0.0162 0.0286  0.0112  135 GLY A N   
1044 C CA  . GLY A 134 ? 0.2401 0.3629 0.2834 -0.0275 0.0304  0.0093  135 GLY A CA  
1045 C C   . GLY A 134 ? 0.2729 0.4068 0.3184 -0.0389 0.0329  0.0092  135 GLY A C   
1046 O O   . GLY A 134 ? 0.2756 0.3978 0.3051 -0.0498 0.0353  0.0070  135 GLY A O   
1047 N N   . ARG A 135 ? 0.2252 0.3813 0.2904 -0.0370 0.0330  0.0111  136 ARG A N   
1048 C CA  . ARG A 135 ? 0.2362 0.4050 0.3046 -0.0481 0.0367  0.0105  136 ARG A CA  
1049 C C   . ARG A 135 ? 0.2598 0.4414 0.3278 -0.0622 0.0316  0.0120  136 ARG A C   
1050 O O   . ARG A 135 ? 0.2515 0.4326 0.3111 -0.0760 0.0352  0.0098  136 ARG A O   
1051 C CB  . ARG A 135 ? 0.1970 0.3891 0.2888 -0.0413 0.0389  0.0115  136 ARG A CB  
1052 C CG  . ARG A 135 ? 0.2932 0.5125 0.4093 -0.0375 0.0317  0.0166  136 ARG A CG  
1053 C CD  . ARG A 135 ? 0.2610 0.5022 0.4011 -0.0298 0.0357  0.0167  136 ARG A CD  
1054 N NE  . ARG A 135 ? 0.2851 0.5156 0.4300 -0.0147 0.0385  0.0146  136 ARG A NE  
1055 C CZ  . ARG A 135 ? 0.3349 0.5763 0.4959 -0.0065 0.0445  0.0120  136 ARG A CZ  
1056 N NH1 . ARG A 135 ? 0.3454 0.6109 0.5211 -0.0110 0.0486  0.0117  136 ARG A NH1 
1057 N NH2 . ARG A 135 ? 0.3442 0.5734 0.5068 0.0055  0.0472  0.0089  136 ARG A NH2 
1058 N N   . PHE A 136 ? 0.2084 0.4014 0.2840 -0.0602 0.0232  0.0159  137 PHE A N   
1059 C CA  . PHE A 136 ? 0.2251 0.4348 0.3007 -0.0743 0.0173  0.0177  137 PHE A CA  
1060 C C   . PHE A 136 ? 0.2569 0.4426 0.3054 -0.0864 0.0191  0.0125  137 PHE A C   
1061 O O   . PHE A 136 ? 0.3460 0.5367 0.3871 -0.1029 0.0193  0.0099  137 PHE A O   
1062 C CB  . PHE A 136 ? 0.1719 0.4018 0.2630 -0.0681 0.0075  0.0248  137 PHE A CB  
1063 C CG  . PHE A 136 ? 0.2187 0.4673 0.3366 -0.0537 0.0065  0.0299  137 PHE A CG  
1064 C CD1 . PHE A 136 ? 0.2111 0.4472 0.3333 -0.0382 0.0069  0.0312  137 PHE A CD1 
1065 C CD2 . PHE A 136 ? 0.2455 0.5242 0.3849 -0.0560 0.0059  0.0326  137 PHE A CD2 
1066 C CE1 . PHE A 136 ? 0.2442 0.4940 0.3903 -0.0251 0.0072  0.0346  137 PHE A CE1 
1067 C CE2 . PHE A 136 ? 0.2607 0.5553 0.4257 -0.0414 0.0063  0.0365  137 PHE A CE2 
1068 C CZ  . PHE A 136 ? 0.2617 0.5401 0.4294 -0.0259 0.0072  0.0372  137 PHE A CZ  
1069 N N   . LEU A 137 ? 0.2124 0.3721 0.2462 -0.0787 0.0208  0.0102  138 LEU A N   
1070 C CA  . LEU A 137 ? 0.2937 0.4279 0.3024 -0.0877 0.0242  0.0045  138 LEU A CA  
1071 C C   . LEU A 137 ? 0.3406 0.4575 0.3366 -0.0964 0.0327  0.0001  138 LEU A C   
1072 O O   . LEU A 137 ? 0.3758 0.4824 0.3562 -0.1115 0.0350  -0.0045 138 LEU A O   
1073 C CB  . LEU A 137 ? 0.3208 0.4330 0.3199 -0.0753 0.0255  0.0032  138 LEU A CB  
1074 C CG  . LEU A 137 ? 0.3570 0.4694 0.3491 -0.0772 0.0205  0.0030  138 LEU A CG  
1075 C CD1 . LEU A 137 ? 0.3619 0.4588 0.3506 -0.0630 0.0220  0.0027  138 LEU A CD1 
1076 C CD2 . LEU A 137 ? 0.3666 0.4660 0.3378 -0.0929 0.0231  -0.0035 138 LEU A CD2 
1077 N N   . VAL A 138 ? 0.3112 0.4236 0.3121 -0.0878 0.0379  0.0012  139 VAL A N   
1078 C CA  . VAL A 138 ? 0.3000 0.3934 0.2869 -0.0951 0.0464  -0.0013 139 VAL A CA  
1079 C C   . VAL A 138 ? 0.3070 0.4184 0.2987 -0.1128 0.0473  -0.0020 139 VAL A C   
1080 O O   . VAL A 138 ? 0.3820 0.4759 0.3567 -0.1271 0.0525  -0.0056 139 VAL A O   
1081 C CB  . VAL A 138 ? 0.2988 0.3866 0.2894 -0.0819 0.0509  0.0008  139 VAL A CB  
1082 C CG1 . VAL A 138 ? 0.3382 0.4119 0.3165 -0.0906 0.0594  0.0002  139 VAL A CG1 
1083 C CG2 . VAL A 138 ? 0.2888 0.3561 0.2707 -0.0673 0.0506  0.0006  139 VAL A CG2 
1084 N N   . GLN A 139 ? 0.2642 0.4109 0.2798 -0.1123 0.0425  0.0014  140 GLN A N   
1085 C CA  . GLN A 139 ? 0.3419 0.5120 0.3655 -0.1291 0.0427  0.0011  140 GLN A CA  
1086 C C   . GLN A 139 ? 0.3854 0.5586 0.3992 -0.1460 0.0378  -0.0018 140 GLN A C   
1087 O O   . GLN A 139 ? 0.4216 0.5925 0.4258 -0.1648 0.0416  -0.0057 140 GLN A O   
1088 C CB  . GLN A 139 ? 0.3429 0.5525 0.3973 -0.1219 0.0385  0.0059  140 GLN A CB  
1089 C CG  . GLN A 139 ? 0.5013 0.7360 0.5674 -0.1354 0.0422  0.0056  140 GLN A CG  
1090 C CD  . GLN A 139 ? 0.6397 0.8947 0.7066 -0.1549 0.0364  0.0047  140 GLN A CD  
1091 O OE1 . GLN A 139 ? 0.7089 0.9776 0.7810 -0.1540 0.0268  0.0072  140 GLN A OE1 
1092 N NE2 . GLN A 139 ? 0.6308 0.8871 0.6910 -0.1733 0.0421  0.0012  140 GLN A NE2 
1093 N N   . ALA A 140 ? 0.3633 0.5413 0.3782 -0.1408 0.0298  -0.0004 141 ALA A N   
1094 C CA  . ALA A 140 ? 0.3623 0.5485 0.3683 -0.1574 0.0243  -0.0031 141 ALA A CA  
1095 C C   . ALA A 140 ? 0.4266 0.5747 0.4023 -0.1685 0.0311  -0.0115 141 ALA A C   
1096 O O   . ALA A 140 ? 0.4754 0.6246 0.4399 -0.1889 0.0315  -0.0168 141 ALA A O   
1097 C CB  . ALA A 140 ? 0.3247 0.5271 0.3392 -0.1486 0.0141  0.0018  141 ALA A CB  
1098 N N   . GLU A 141 ? 0.4066 0.5210 0.3690 -0.1554 0.0368  -0.0132 142 GLU A N   
1099 C CA  . GLU A 141 ? 0.4604 0.5381 0.3958 -0.1620 0.0429  -0.0208 142 GLU A CA  
1100 C C   . GLU A 141 ? 0.4791 0.5211 0.4001 -0.1589 0.0537  -0.0226 142 GLU A C   
1101 O O   . GLU A 141 ? 0.5323 0.5402 0.4317 -0.1616 0.0599  -0.0284 142 GLU A O   
1102 C CB  . GLU A 141 ? 0.2957 0.3646 0.2259 -0.1497 0.0396  -0.0213 142 GLU A CB  
1103 C CG  . GLU A 141 ? 0.3791 0.4766 0.3154 -0.1567 0.0297  -0.0201 142 GLU A CG  
1104 C CD  . GLU A 141 ? 0.4996 0.5959 0.4191 -0.1802 0.0301  -0.0278 142 GLU A CD  
1105 O OE1 . GLU A 141 ? 0.5464 0.6761 0.4753 -0.1918 0.0215  -0.0253 142 GLU A OE1 
1106 O OE2 . GLU A 141 ? 0.5332 0.5952 0.4303 -0.1871 0.0390  -0.0365 142 GLU A OE2 
1107 N N   . ARG A 142 ? 0.5162 0.5647 0.4482 -0.1530 0.0565  -0.0176 143 ARG A N   
1108 C CA  . ARG A 142 ? 0.5784 0.5960 0.4961 -0.1525 0.0663  -0.0176 143 ARG A CA  
1109 C C   . ARG A 142 ? 0.5365 0.5188 0.4387 -0.1375 0.0701  -0.0183 143 ARG A C   
1110 O O   . ARG A 142 ? 0.7169 0.6641 0.5986 -0.1417 0.0779  -0.0211 143 ARG A O   
1111 C CB  . ARG A 142 ? 0.6836 0.6880 0.5864 -0.1757 0.0725  -0.0224 143 ARG A CB  
1112 C CG  . ARG A 142 ? 0.8669 0.9089 0.7857 -0.1921 0.0691  -0.0219 143 ARG A CG  
1113 C CD  . ARG A 142 ? 1.0385 1.0936 0.9698 -0.1886 0.0731  -0.0163 143 ARG A CD  
1114 N NE  . ARG A 142 ? 1.1875 1.2757 1.1324 -0.2069 0.0722  -0.0167 143 ARG A NE  
1115 C CZ  . ARG A 142 ? 1.1967 1.3284 1.1691 -0.2024 0.0663  -0.0128 143 ARG A CZ  
1116 N NH1 . ARG A 142 ? 1.1453 1.2892 1.1333 -0.1808 0.0611  -0.0085 143 ARG A NH1 
1117 N NH2 . ARG A 142 ? 1.1962 1.3560 1.1803 -0.2154 0.0644  -0.0136 143 ARG A NH2 
1118 N N   . THR A 143 ? 0.4067 0.3987 0.3194 -0.1198 0.0648  -0.0156 144 THR A N   
1119 C CA  . THR A 143 ? 0.4647 0.4312 0.3681 -0.1031 0.0677  -0.0149 144 THR A CA  
1120 C C   . THR A 143 ? 0.3872 0.3622 0.3018 -0.0882 0.0671  -0.0086 144 THR A C   
1121 O O   . THR A 143 ? 0.3737 0.3749 0.3044 -0.0894 0.0645  -0.0057 144 THR A O   
1122 C CB  . THR A 143 ? 0.5205 0.4906 0.4254 -0.0957 0.0628  -0.0176 144 THR A CB  
1123 O OG1 . THR A 143 ? 0.5101 0.5136 0.4361 -0.0899 0.0544  -0.0137 144 THR A OG1 
1124 C CG2 . THR A 143 ? 0.5653 0.5283 0.4572 -0.1117 0.0636  -0.0249 144 THR A CG2 
1125 N N   . VAL A 144 ? 0.4361 0.3897 0.3422 -0.0740 0.0699  -0.0068 145 VAL A N   
1126 C CA  . VAL A 144 ? 0.4240 0.3867 0.3394 -0.0589 0.0681  -0.0020 145 VAL A CA  
1127 C C   . VAL A 144 ? 0.4075 0.3820 0.3333 -0.0466 0.0620  -0.0028 145 VAL A C   
1128 O O   . VAL A 144 ? 0.4069 0.3682 0.3250 -0.0438 0.0621  -0.0058 145 VAL A O   
1129 C CB  . VAL A 144 ? 0.3875 0.3229 0.2873 -0.0513 0.0739  0.0018  145 VAL A CB  
1130 C CG1 . VAL A 144 ? 0.3412 0.2882 0.2494 -0.0361 0.0711  0.0059  145 VAL A CG1 
1131 C CG2 . VAL A 144 ? 0.4089 0.3327 0.2980 -0.0647 0.0804  0.0038  145 VAL A CG2 
1132 N N   . LEU A 145 ? 0.3491 0.3479 0.2924 -0.0401 0.0573  -0.0007 146 LEU A N   
1133 C CA  . LEU A 145 ? 0.2479 0.2582 0.2019 -0.0298 0.0518  -0.0010 146 LEU A CA  
1134 C C   . LEU A 145 ? 0.2823 0.2934 0.2400 -0.0161 0.0516  0.0012  146 LEU A C   
1135 O O   . LEU A 145 ? 0.3118 0.3302 0.2738 -0.0155 0.0533  0.0029  146 LEU A O   
1136 C CB  . LEU A 145 ? 0.3230 0.3603 0.2949 -0.0340 0.0459  -0.0003 146 LEU A CB  
1137 C CG  . LEU A 145 ? 0.4795 0.5249 0.4592 -0.0265 0.0404  -0.0001 146 LEU A CG  
1138 C CD1 . LEU A 145 ? 0.4841 0.5459 0.4706 -0.0355 0.0352  0.0006  146 LEU A CD1 
1139 C CD2 . LEU A 145 ? 0.5007 0.5576 0.4947 -0.0150 0.0383  0.0019  146 LEU A CD2 
1140 N N   . VAL A 146 ? 0.2962 0.3016 0.2522 -0.0061 0.0499  0.0005  147 VAL A N   
1141 C CA  . VAL A 146 ? 0.2559 0.2646 0.2156 0.0060  0.0487  0.0019  147 VAL A CA  
1142 C C   . VAL A 146 ? 0.2908 0.3134 0.2630 0.0113  0.0437  0.0004  147 VAL A C   
1143 O O   . VAL A 146 ? 0.2703 0.2914 0.2416 0.0093  0.0423  -0.0011 147 VAL A O   
1144 C CB  . VAL A 146 ? 0.3111 0.2994 0.2560 0.0137  0.0518  0.0034  147 VAL A CB  
1145 C CG1 . VAL A 146 ? 0.2717 0.2676 0.2202 0.0249  0.0495  0.0051  147 VAL A CG1 
1146 C CG2 . VAL A 146 ? 0.3217 0.2916 0.2520 0.0072  0.0574  0.0058  147 VAL A CG2 
1147 N N   . SER A 147 ? 0.2721 0.3077 0.2552 0.0169  0.0415  0.0006  148 SER A N   
1148 C CA  . SER A 147 ? 0.2514 0.2970 0.2451 0.0223  0.0375  -0.0006 148 SER A CA  
1149 C C   . SER A 147 ? 0.2129 0.2615 0.2077 0.0304  0.0372  -0.0015 148 SER A C   
1150 O O   . SER A 147 ? 0.2363 0.2850 0.2281 0.0309  0.0394  -0.0012 148 SER A O   
1151 C CB  . SER A 147 ? 0.2388 0.2993 0.2477 0.0184  0.0344  0.0000  148 SER A CB  
1152 O OG  . SER A 147 ? 0.2952 0.3640 0.3123 0.0185  0.0358  -0.0002 148 SER A OG  
1153 N N   . MET A 148 ? 0.2476 0.2999 0.2460 0.0358  0.0347  -0.0028 149 MET A N   
1154 C CA  . MET A 148 ? 0.2156 0.2731 0.2148 0.0423  0.0336  -0.0043 149 MET A CA  
1155 C C   . MET A 148 ? 0.2640 0.3326 0.2759 0.0429  0.0306  -0.0070 149 MET A C   
1156 O O   . MET A 148 ? 0.1947 0.2651 0.2125 0.0403  0.0291  -0.0064 149 MET A O   
1157 C CB  . MET A 148 ? 0.1934 0.2440 0.1823 0.0491  0.0338  -0.0029 149 MET A CB  
1158 C CG  . MET A 148 ? 0.2476 0.3035 0.2416 0.0526  0.0318  -0.0044 149 MET A CG  
1159 S SD  . MET A 148 ? 0.3087 0.3590 0.3030 0.0469  0.0331  -0.0048 149 MET A SD  
1160 C CE  . MET A 148 ? 0.2991 0.3292 0.2773 0.0479  0.0378  -0.0031 149 MET A CE  
1161 N N   . ASN A 149 ? 0.1849 0.2605 0.2000 0.0455  0.0300  -0.0099 150 ASN A N   
1162 C CA  . ASN A 149 ? 0.1775 0.2613 0.2022 0.0458  0.0277  -0.0132 150 ASN A CA  
1163 C C   . ASN A 149 ? 0.2308 0.3186 0.2516 0.0502  0.0257  -0.0136 150 ASN A C   
1164 O O   . ASN A 149 ? 0.1728 0.2593 0.1842 0.0547  0.0257  -0.0121 150 ASN A O   
1165 C CB  . ASN A 149 ? 0.1985 0.2875 0.2281 0.0452  0.0287  -0.0178 150 ASN A CB  
1166 C CG  . ASN A 149 ? 0.2552 0.3437 0.2961 0.0423  0.0304  -0.0183 150 ASN A CG  
1167 O OD1 . ASN A 149 ? 0.4236 0.5146 0.4696 0.0422  0.0326  -0.0228 150 ASN A OD1 
1168 N ND2 . ASN A 149 ? 0.2414 0.3276 0.2863 0.0402  0.0294  -0.0137 150 ASN A ND2 
1169 N N   . TYR A 150 ? 0.1932 0.2868 0.2218 0.0488  0.0240  -0.0150 151 TYR A N   
1170 C CA  . TYR A 150 ? 0.2131 0.3156 0.2418 0.0523  0.0222  -0.0163 151 TYR A CA  
1171 C C   . TYR A 150 ? 0.1762 0.2877 0.2150 0.0479  0.0207  -0.0205 151 TYR A C   
1172 O O   . TYR A 150 ? 0.1839 0.2914 0.2296 0.0430  0.0213  -0.0206 151 TYR A O   
1173 C CB  . TYR A 150 ? 0.1640 0.2639 0.1901 0.0546  0.0232  -0.0137 151 TYR A CB  
1174 C CG  . TYR A 150 ? 0.1689 0.2665 0.1999 0.0486  0.0239  -0.0129 151 TYR A CG  
1175 C CD1 . TYR A 150 ? 0.1399 0.2277 0.1674 0.0450  0.0252  -0.0103 151 TYR A CD1 
1176 C CD2 . TYR A 150 ? 0.1782 0.2848 0.2167 0.0457  0.0232  -0.0144 151 TYR A CD2 
1177 C CE1 . TYR A 150 ? 0.1500 0.2376 0.1806 0.0393  0.0249  -0.0085 151 TYR A CE1 
1178 C CE2 . TYR A 150 ? 0.1486 0.2531 0.1896 0.0398  0.0236  -0.0123 151 TYR A CE2 
1179 C CZ  . TYR A 150 ? 0.2202 0.3155 0.2569 0.0370  0.0241  -0.0091 151 TYR A CZ  
1180 O OH  . TYR A 150 ? 0.2019 0.2971 0.2399 0.0308  0.0236  -0.0060 151 TYR A OH  
1181 N N   . ARG A 151 ? 0.1719 0.2956 0.2116 0.0495  0.0185  -0.0234 152 ARG A N   
1182 C CA  . ARG A 151 ? 0.1447 0.2769 0.1931 0.0435  0.0174  -0.0284 152 ARG A CA  
1183 C C   . ARG A 151 ? 0.1968 0.3290 0.2521 0.0394  0.0182  -0.0268 152 ARG A C   
1184 O O   . ARG A 151 ? 0.1607 0.2950 0.2143 0.0424  0.0188  -0.0237 152 ARG A O   
1185 C CB  . ARG A 151 ? 0.1190 0.2680 0.1668 0.0451  0.0143  -0.0318 152 ARG A CB  
1186 C CG  . ARG A 151 ? 0.1405 0.2918 0.1810 0.0459  0.0131  -0.0347 152 ARG A CG  
1187 C CD  . ARG A 151 ? 0.1566 0.3276 0.1954 0.0484  0.0087  -0.0359 152 ARG A CD  
1188 N NE  . ARG A 151 ? 0.1908 0.3639 0.2239 0.0587  0.0073  -0.0287 152 ARG A NE  
1189 C CZ  . ARG A 151 ? 0.2120 0.4026 0.2441 0.0643  0.0029  -0.0268 152 ARG A CZ  
1190 N NH1 . ARG A 151 ? 0.1758 0.3861 0.2119 0.0591  -0.0011 -0.0322 152 ARG A NH1 
1191 N NH2 . ARG A 151 ? 0.1723 0.3608 0.1998 0.0750  0.0024  -0.0195 152 ARG A NH2 
1192 N N   . VAL A 152 ? 0.1536 0.2826 0.2160 0.0325  0.0188  -0.0289 153 VAL A N   
1193 C CA  . VAL A 152 ? 0.1844 0.3122 0.2523 0.0271  0.0196  -0.0262 153 VAL A CA  
1194 C C   . VAL A 152 ? 0.2401 0.3749 0.3149 0.0198  0.0194  -0.0312 153 VAL A C   
1195 O O   . VAL A 152 ? 0.2527 0.3924 0.3279 0.0184  0.0186  -0.0373 153 VAL A O   
1196 C CB  . VAL A 152 ? 0.1942 0.3076 0.2638 0.0252  0.0206  -0.0212 153 VAL A CB  
1197 C CG1 . VAL A 152 ? 0.1650 0.2735 0.2276 0.0301  0.0208  -0.0169 153 VAL A CG1 
1198 C CG2 . VAL A 152 ? 0.1474 0.2527 0.2220 0.0238  0.0214  -0.0243 153 VAL A CG2 
1199 N N   . GLY A 153 ? 0.2042 0.3393 0.2831 0.0137  0.0205  -0.0286 154 GLY A N   
1200 C CA  . GLY A 153 ? 0.1458 0.2865 0.2310 0.0048  0.0210  -0.0329 154 GLY A CA  
1201 C C   . GLY A 153 ? 0.1727 0.3350 0.2592 0.0049  0.0193  -0.0385 154 GLY A C   
1202 O O   . GLY A 153 ? 0.2047 0.3789 0.2889 0.0122  0.0183  -0.0370 154 GLY A O   
1203 N N   . ALA A 154 ? 0.1615 0.3292 0.2522 -0.0034 0.0190  -0.0453 155 ALA A N   
1204 C CA  . ALA A 154 ? 0.2381 0.4303 0.3313 -0.0047 0.0163  -0.0507 155 ALA A CA  
1205 C C   . ALA A 154 ? 0.2201 0.4198 0.3070 0.0056  0.0129  -0.0513 155 ALA A C   
1206 O O   . ALA A 154 ? 0.2240 0.4446 0.3123 0.0108  0.0101  -0.0509 155 ALA A O   
1207 C CB  . ALA A 154 ? 0.1372 0.3320 0.2344 -0.0176 0.0166  -0.0590 155 ALA A CB  
1208 N N   . PHE A 155 ? 0.2090 0.3923 0.2895 0.0090  0.0134  -0.0516 156 PHE A N   
1209 C CA  . PHE A 155 ? 0.2059 0.3948 0.2785 0.0172  0.0107  -0.0517 156 PHE A CA  
1210 C C   . PHE A 155 ? 0.2048 0.3966 0.2741 0.0285  0.0100  -0.0441 156 PHE A C   
1211 O O   . PHE A 155 ? 0.1479 0.3503 0.2123 0.0358  0.0069  -0.0427 156 PHE A O   
1212 C CB  . PHE A 155 ? 0.1808 0.3513 0.2477 0.0176  0.0129  -0.0536 156 PHE A CB  
1213 C CG  . PHE A 155 ? 0.2168 0.3794 0.2872 0.0075  0.0153  -0.0617 156 PHE A CG  
1214 C CD1 . PHE A 155 ? 0.2392 0.3830 0.3153 0.0040  0.0191  -0.0601 156 PHE A CD1 
1215 C CD2 . PHE A 155 ? 0.1906 0.3642 0.2580 0.0015  0.0137  -0.0707 156 PHE A CD2 
1216 C CE1 . PHE A 155 ? 0.2867 0.4196 0.3662 -0.0044 0.0222  -0.0675 156 PHE A CE1 
1217 C CE2 . PHE A 155 ? 0.2748 0.4382 0.3443 -0.0085 0.0171  -0.0796 156 PHE A CE2 
1218 C CZ  . PHE A 155 ? 0.2882 0.4298 0.3642 -0.0109 0.0217  -0.0780 156 PHE A CZ  
1219 N N   . GLY A 156 ? 0.1931 0.3749 0.2641 0.0298  0.0128  -0.0391 157 GLY A N   
1220 C CA  . GLY A 156 ? 0.1518 0.3328 0.2187 0.0395  0.0134  -0.0334 157 GLY A CA  
1221 C C   . GLY A 156 ? 0.1992 0.3948 0.2723 0.0411  0.0144  -0.0324 157 GLY A C   
1222 O O   . GLY A 156 ? 0.1981 0.3972 0.2687 0.0507  0.0149  -0.0293 157 GLY A O   
1223 N N   . PHE A 157 ? 0.1672 0.3709 0.2483 0.0317  0.0155  -0.0351 158 PHE A N   
1224 C CA  . PHE A 157 ? 0.1801 0.3964 0.2669 0.0320  0.0181  -0.0341 158 PHE A CA  
1225 C C   . PHE A 157 ? 0.1826 0.4209 0.2800 0.0232  0.0177  -0.0385 158 PHE A C   
1226 O O   . PHE A 157 ? 0.1266 0.3770 0.2296 0.0220  0.0209  -0.0381 158 PHE A O   
1227 C CB  . PHE A 157 ? 0.1224 0.3219 0.2054 0.0283  0.0222  -0.0303 158 PHE A CB  
1228 C CG  . PHE A 157 ? 0.1779 0.3602 0.2512 0.0362  0.0232  -0.0265 158 PHE A CG  
1229 C CD1 . PHE A 157 ? 0.1566 0.3197 0.2246 0.0334  0.0227  -0.0241 158 PHE A CD1 
1230 C CD2 . PHE A 157 ? 0.1258 0.3114 0.1959 0.0465  0.0249  -0.0255 158 PHE A CD2 
1231 C CE1 . PHE A 157 ? 0.1616 0.3110 0.2211 0.0389  0.0236  -0.0210 158 PHE A CE1 
1232 C CE2 . PHE A 157 ? 0.1839 0.3518 0.2441 0.0520  0.0263  -0.0227 158 PHE A CE2 
1233 C CZ  . PHE A 157 ? 0.1916 0.3423 0.2463 0.0474  0.0255  -0.0206 158 PHE A CZ  
1234 N N   . LEU A 158 ? 0.1446 0.3890 0.2446 0.0160  0.0145  -0.0434 159 LEU A N   
1235 C CA  . LEU A 158 ? 0.2056 0.4753 0.3158 0.0076  0.0136  -0.0482 159 LEU A CA  
1236 C C   . LEU A 158 ? 0.1993 0.4965 0.3153 0.0183  0.0110  -0.0475 159 LEU A C   
1237 O O   . LEU A 158 ? 0.2608 0.5607 0.3722 0.0283  0.0068  -0.0461 159 LEU A O   
1238 C CB  . LEU A 158 ? 0.1602 0.4304 0.2705 -0.0031 0.0108  -0.0550 159 LEU A CB  
1239 C CG  . LEU A 158 ? 0.2330 0.5328 0.3537 -0.0133 0.0090  -0.0609 159 LEU A CG  
1240 C CD1 . LEU A 158 ? 0.2382 0.5271 0.3592 -0.0305 0.0106  -0.0674 159 LEU A CD1 
1241 C CD2 . LEU A 158 ? 0.1856 0.5123 0.3078 -0.0069 0.0024  -0.0632 159 LEU A CD2 
1242 N N   . ALA A 159 ? 0.1935 0.5081 0.3180 0.0166  0.0135  -0.0475 160 ALA A N   
1243 C CA  . ALA A 159 ? 0.1996 0.5276 0.3253 0.0275  0.0113  -0.0447 160 ALA A CA  
1244 C C   . ALA A 159 ? 0.1720 0.5257 0.3073 0.0185  0.0097  -0.0485 160 ALA A C   
1245 O O   . ALA A 159 ? 0.1690 0.5262 0.3096 0.0067  0.0140  -0.0508 160 ALA A O   
1246 C CB  . ALA A 159 ? 0.1197 0.4366 0.2429 0.0364  0.0169  -0.0403 160 ALA A CB  
1247 N N   . LEU A 160 ? 0.1608 0.5329 0.2978 0.0233  0.0035  -0.0487 161 LEU A N   
1248 C CA  . LEU A 160 ? 0.1758 0.5748 0.3221 0.0196  0.0018  -0.0505 161 LEU A CA  
1249 C C   . LEU A 160 ? 0.1737 0.5782 0.3220 0.0371  0.0017  -0.0445 161 LEU A C   
1250 O O   . LEU A 160 ? 0.2023 0.6163 0.3491 0.0468  -0.0041 -0.0413 161 LEU A O   
1251 C CB  . LEU A 160 ? 0.2231 0.6412 0.3700 0.0115  -0.0051 -0.0552 161 LEU A CB  
1252 C CG  . LEU A 160 ? 0.2436 0.6568 0.3901 -0.0079 -0.0041 -0.0630 161 LEU A CG  
1253 C CD1 . LEU A 160 ? 0.2471 0.6758 0.3910 -0.0152 -0.0108 -0.0686 161 LEU A CD1 
1254 C CD2 . LEU A 160 ? 0.1846 0.6036 0.3390 -0.0214 0.0013  -0.0658 161 LEU A CD2 
1255 N N   . PRO A 161 ? 0.2043 0.6022 0.3555 0.0414  0.0084  -0.0427 162 PRO A N   
1256 C CA  . PRO A 161 ? 0.2058 0.6013 0.3578 0.0590  0.0099  -0.0375 162 PRO A CA  
1257 C C   . PRO A 161 ? 0.2429 0.6660 0.4043 0.0660  0.0049  -0.0358 162 PRO A C   
1258 O O   . PRO A 161 ? 0.2473 0.6952 0.4179 0.0565  0.0033  -0.0394 162 PRO A O   
1259 C CB  . PRO A 161 ? 0.2128 0.6019 0.3680 0.0574  0.0188  -0.0387 162 PRO A CB  
1260 C CG  . PRO A 161 ? 0.2063 0.5843 0.3571 0.0416  0.0216  -0.0419 162 PRO A CG  
1261 C CD  . PRO A 161 ? 0.1897 0.5814 0.3429 0.0300  0.0155  -0.0454 162 PRO A CD  
1262 N N   . GLY A 162 ? 0.2568 0.6754 0.4158 0.0825  0.0025  -0.0298 163 GLY A N   
1263 C CA  . GLY A 162 ? 0.2594 0.7027 0.4264 0.0914  -0.0031 -0.0262 163 GLY A CA  
1264 C C   . GLY A 162 ? 0.3287 0.7817 0.4894 0.0893  -0.0123 -0.0247 163 GLY A C   
1265 O O   . GLY A 162 ? 0.3752 0.8399 0.5374 0.1009  -0.0176 -0.0187 163 GLY A O   
1266 N N   . SER A 163 ? 0.3276 0.7762 0.4815 0.0746  -0.0141 -0.0301 164 SER A N   
1267 C CA  . SER A 163 ? 0.3172 0.7741 0.4637 0.0712  -0.0220 -0.0302 164 SER A CA  
1268 C C   . SER A 163 ? 0.3254 0.7599 0.4590 0.0834  -0.0235 -0.0237 164 SER A C   
1269 O O   . SER A 163 ? 0.3657 0.7735 0.4941 0.0897  -0.0180 -0.0215 164 SER A O   
1270 C CB  . SER A 163 ? 0.2865 0.7431 0.4302 0.0516  -0.0221 -0.0391 164 SER A CB  
1271 O OG  . SER A 163 ? 0.2762 0.7036 0.4112 0.0498  -0.0181 -0.0402 164 SER A OG  
1272 N N   . ARG A 164 ? 0.3123 0.7586 0.4399 0.0859  -0.0310 -0.0207 165 ARG A N   
1273 C CA  . ARG A 164 ? 0.3965 0.8242 0.5102 0.0950  -0.0332 -0.0148 165 ARG A CA  
1274 C C   . ARG A 164 ? 0.2914 0.7096 0.3950 0.0830  -0.0342 -0.0210 165 ARG A C   
1275 O O   . ARG A 164 ? 0.2800 0.6785 0.3721 0.0890  -0.0340 -0.0172 165 ARG A O   
1276 C CB  . ARG A 164 ? 0.5857 1.0313 0.6973 0.1052  -0.0408 -0.0066 165 ARG A CB  
1277 C CG  . ARG A 164 ? 0.7896 1.2677 0.9044 0.0935  -0.0479 -0.0111 165 ARG A CG  
1278 C CD  . ARG A 164 ? 0.9668 1.4660 1.0829 0.1047  -0.0551 -0.0018 165 ARG A CD  
1279 N NE  . ARG A 164 ? 1.0513 1.5323 1.1542 0.1178  -0.0572 0.0082  165 ARG A NE  
1280 C CZ  . ARG A 164 ? 1.0759 1.5534 1.1636 0.1130  -0.0615 0.0087  165 ARG A CZ  
1281 N NH1 . ARG A 164 ? 1.0621 1.5525 1.1461 0.0956  -0.0640 -0.0013 165 ARG A NH1 
1282 N NH2 . ARG A 164 ? 1.1053 1.5653 1.1808 0.1251  -0.0627 0.0188  165 ARG A NH2 
1283 N N   . GLU A 165 ? 0.2943 0.7253 0.4021 0.0659  -0.0347 -0.0307 166 GLU A N   
1284 C CA  . GLU A 165 ? 0.2572 0.6805 0.3570 0.0538  -0.0354 -0.0381 166 GLU A CA  
1285 C C   . GLU A 165 ? 0.2634 0.6613 0.3642 0.0496  -0.0281 -0.0418 166 GLU A C   
1286 O O   . GLU A 165 ? 0.3062 0.6912 0.4000 0.0453  -0.0276 -0.0455 166 GLU A O   
1287 C CB  . GLU A 165 ? 0.3438 0.7900 0.4470 0.0363  -0.0389 -0.0477 166 GLU A CB  
1288 C CG  . GLU A 165 ? 0.5653 1.0365 0.6643 0.0379  -0.0469 -0.0449 166 GLU A CG  
1289 C CD  . GLU A 165 ? 0.6942 1.1568 0.7786 0.0482  -0.0508 -0.0380 166 GLU A CD  
1290 O OE1 . GLU A 165 ? 0.7300 1.2001 0.8132 0.0622  -0.0546 -0.0274 166 GLU A OE1 
1291 O OE2 . GLU A 165 ? 0.6701 1.1181 0.7445 0.0422  -0.0500 -0.0431 166 GLU A OE2 
1292 N N   . ALA A 166 ? 0.1944 0.5858 0.3037 0.0504  -0.0222 -0.0410 167 ALA A N   
1293 C CA  . ALA A 166 ? 0.2419 0.6093 0.3516 0.0468  -0.0151 -0.0430 167 ALA A CA  
1294 C C   . ALA A 166 ? 0.2321 0.5901 0.3454 0.0562  -0.0097 -0.0375 167 ALA A C   
1295 O O   . ALA A 166 ? 0.1941 0.5552 0.3152 0.0491  -0.0054 -0.0401 167 ALA A O   
1296 C CB  . ALA A 166 ? 0.1318 0.5034 0.2481 0.0282  -0.0128 -0.0521 167 ALA A CB  
1297 N N   . PRO A 167 ? 0.2720 0.6176 0.3789 0.0715  -0.0094 -0.0301 168 PRO A N   
1298 C CA  . PRO A 167 ? 0.2582 0.5963 0.3687 0.0805  -0.0042 -0.0262 168 PRO A CA  
1299 C C   . PRO A 167 ? 0.2500 0.5659 0.3585 0.0765  0.0034  -0.0278 168 PRO A C   
1300 O O   . PRO A 167 ? 0.2554 0.5689 0.3680 0.0798  0.0086  -0.0272 168 PRO A O   
1301 C CB  . PRO A 167 ? 0.3338 0.6625 0.4367 0.0968  -0.0061 -0.0182 168 PRO A CB  
1302 C CG  . PRO A 167 ? 0.2814 0.6001 0.3733 0.0952  -0.0094 -0.0178 168 PRO A CG  
1303 C CD  . PRO A 167 ? 0.1859 0.5233 0.2817 0.0805  -0.0133 -0.0252 168 PRO A CD  
1304 N N   . GLY A 168 ? 0.2610 0.5618 0.3636 0.0696  0.0044  -0.0301 169 GLY A N   
1305 C CA  . GLY A 168 ? 0.2952 0.5762 0.3952 0.0655  0.0109  -0.0307 169 GLY A CA  
1306 C C   . GLY A 168 ? 0.2850 0.5415 0.3744 0.0758  0.0137  -0.0261 169 GLY A C   
1307 O O   . GLY A 168 ? 0.2263 0.4796 0.3110 0.0874  0.0119  -0.0217 169 GLY A O   
1308 N N   . ASN A 169 ? 0.2260 0.4652 0.3111 0.0709  0.0184  -0.0269 170 ASN A N   
1309 C CA  . ASN A 169 ? 0.2031 0.4186 0.2777 0.0774  0.0221  -0.0237 170 ASN A CA  
1310 C C   . ASN A 169 ? 0.1990 0.4041 0.2649 0.0835  0.0188  -0.0207 170 ASN A C   
1311 O O   . ASN A 169 ? 0.2132 0.3993 0.2695 0.0903  0.0213  -0.0173 170 ASN A O   
1312 C CB  . ASN A 169 ? 0.1344 0.3451 0.2076 0.0865  0.0263  -0.0221 170 ASN A CB  
1313 C CG  . ASN A 169 ? 0.2066 0.4242 0.2856 0.0804  0.0316  -0.0254 170 ASN A CG  
1314 O OD1 . ASN A 169 ? 0.2197 0.4369 0.2990 0.0699  0.0335  -0.0273 170 ASN A OD1 
1315 N ND2 . ASN A 169 ? 0.1877 0.4116 0.2710 0.0872  0.0346  -0.0257 170 ASN A ND2 
1316 N N   . VAL A 170 ? 0.1378 0.3517 0.2045 0.0792  0.0134  -0.0219 171 VAL A N   
1317 C CA  . VAL A 170 ? 0.1506 0.3534 0.2065 0.0835  0.0106  -0.0187 171 VAL A CA  
1318 C C   . VAL A 170 ? 0.2171 0.3941 0.2638 0.0780  0.0136  -0.0182 171 VAL A C   
1319 O O   . VAL A 170 ? 0.2358 0.3988 0.2722 0.0825  0.0137  -0.0145 171 VAL A O   
1320 C CB  . VAL A 170 ? 0.1538 0.3745 0.2114 0.0794  0.0045  -0.0214 171 VAL A CB  
1321 C CG1 . VAL A 170 ? 0.1578 0.4078 0.2250 0.0857  0.0005  -0.0207 171 VAL A CG1 
1322 C CG2 . VAL A 170 ? 0.1518 0.3722 0.2136 0.0651  0.0049  -0.0280 171 VAL A CG2 
1323 N N   . GLY A 171 ? 0.2349 0.4060 0.2853 0.0683  0.0159  -0.0210 172 GLY A N   
1324 C CA  . GLY A 171 ? 0.1509 0.3007 0.1947 0.0644  0.0185  -0.0195 172 GLY A CA  
1325 C C   . GLY A 171 ? 0.2819 0.4174 0.3180 0.0701  0.0222  -0.0160 172 GLY A C   
1326 O O   . GLY A 171 ? 0.2151 0.3343 0.2429 0.0695  0.0235  -0.0138 172 GLY A O   
1327 N N   . LEU A 172 ? 0.1747 0.3165 0.2136 0.0751  0.0247  -0.0163 173 LEU A N   
1328 C CA  . LEU A 172 ? 0.2208 0.3476 0.2516 0.0813  0.0292  -0.0144 173 LEU A CA  
1329 C C   . LEU A 172 ? 0.2430 0.3626 0.2666 0.0917  0.0283  -0.0104 173 LEU A C   
1330 O O   . LEU A 172 ? 0.2288 0.3280 0.2418 0.0939  0.0316  -0.0081 173 LEU A O   
1331 C CB  . LEU A 172 ? 0.1616 0.2977 0.1979 0.0849  0.0333  -0.0168 173 LEU A CB  
1332 C CG  . LEU A 172 ? 0.2459 0.3830 0.2841 0.0744  0.0362  -0.0196 173 LEU A CG  
1333 C CD1 . LEU A 172 ? 0.1717 0.3220 0.2160 0.0782  0.0410  -0.0227 173 LEU A CD1 
1334 C CD2 . LEU A 172 ? 0.2590 0.3747 0.2857 0.0688  0.0387  -0.0188 173 LEU A CD2 
1335 N N   . LEU A 173 ? 0.1952 0.3313 0.2234 0.0973  0.0237  -0.0090 174 LEU A N   
1336 C CA  . LEU A 173 ? 0.2290 0.3593 0.2493 0.1072  0.0220  -0.0033 174 LEU A CA  
1337 C C   . LEU A 173 ? 0.2327 0.3486 0.2421 0.1014  0.0209  -0.0014 174 LEU A C   
1338 O O   . LEU A 173 ? 0.3200 0.4203 0.3183 0.1068  0.0222  0.0039  174 LEU A O   
1339 C CB  . LEU A 173 ? 0.2231 0.3791 0.2513 0.1141  0.0162  -0.0018 174 LEU A CB  
1340 C CG  . LEU A 173 ? 0.2831 0.4542 0.3226 0.1219  0.0177  -0.0025 174 LEU A CG  
1341 C CD1 . LEU A 173 ? 0.2549 0.4526 0.3022 0.1246  0.0106  -0.0010 174 LEU A CD1 
1342 C CD2 . LEU A 173 ? 0.2685 0.4191 0.3015 0.1327  0.0229  0.0015  174 LEU A CD2 
1343 N N   . ASP A 174 ? 0.2281 0.3484 0.2407 0.0907  0.0193  -0.0054 175 ASP A N   
1344 C CA  . ASP A 174 ? 0.2109 0.3181 0.2150 0.0851  0.0200  -0.0046 175 ASP A CA  
1345 C C   . ASP A 174 ? 0.2662 0.3518 0.2632 0.0829  0.0250  -0.0028 175 ASP A C   
1346 O O   . ASP A 174 ? 0.2708 0.3427 0.2574 0.0828  0.0266  0.0006  175 ASP A O   
1347 C CB  . ASP A 174 ? 0.1921 0.3068 0.2032 0.0752  0.0186  -0.0098 175 ASP A CB  
1348 C CG  . ASP A 174 ? 0.2939 0.4295 0.3124 0.0743  0.0143  -0.0136 175 ASP A CG  
1349 O OD1 . ASP A 174 ? 0.3336 0.4756 0.3613 0.0671  0.0141  -0.0184 175 ASP A OD1 
1350 O OD2 . ASP A 174 ? 0.2788 0.4246 0.2935 0.0802  0.0110  -0.0114 175 ASP A OD2 
1351 N N   . GLN A 175 ? 0.2233 0.3063 0.2246 0.0799  0.0275  -0.0053 176 GLN A N   
1352 C CA  . GLN A 175 ? 0.2034 0.2674 0.1968 0.0768  0.0320  -0.0046 176 GLN A CA  
1353 C C   . GLN A 175 ? 0.2249 0.2738 0.2079 0.0856  0.0353  -0.0010 176 GLN A C   
1354 O O   . GLN A 175 ? 0.2885 0.3189 0.2608 0.0830  0.0382  0.0012  176 GLN A O   
1355 C CB  . GLN A 175 ? 0.2551 0.3216 0.2535 0.0719  0.0340  -0.0080 176 GLN A CB  
1356 C CG  . GLN A 175 ? 0.2213 0.2993 0.2293 0.0634  0.0311  -0.0099 176 GLN A CG  
1357 C CD  . GLN A 175 ? 0.2492 0.3300 0.2599 0.0586  0.0330  -0.0119 176 GLN A CD  
1358 O OE1 . GLN A 175 ? 0.2318 0.3054 0.2364 0.0608  0.0371  -0.0131 176 GLN A OE1 
1359 N NE2 . GLN A 175 ? 0.1850 0.2750 0.2039 0.0519  0.0306  -0.0122 176 GLN A NE2 
1360 N N   . ARG A 176 ? 0.2392 0.2958 0.2260 0.0962  0.0350  -0.0001 177 ARG A N   
1361 C CA  . ARG A 176 ? 0.3119 0.3527 0.2902 0.1069  0.0384  0.0041  177 ARG A CA  
1362 C C   . ARG A 176 ? 0.3468 0.3792 0.3151 0.1098  0.0363  0.0109  177 ARG A C   
1363 O O   . ARG A 176 ? 0.3283 0.3372 0.2844 0.1118  0.0404  0.0148  177 ARG A O   
1364 C CB  . ARG A 176 ? 0.3116 0.3669 0.2992 0.1193  0.0380  0.0044  177 ARG A CB  
1365 C CG  . ARG A 176 ? 0.3786 0.4178 0.3592 0.1333  0.0411  0.0101  177 ARG A CG  
1366 C CD  . ARG A 176 ? 0.4050 0.4623 0.3980 0.1470  0.0408  0.0104  177 ARG A CD  
1367 N NE  . ARG A 176 ? 0.4362 0.4928 0.4347 0.1462  0.0474  0.0031  177 ARG A NE  
1368 C CZ  . ARG A 176 ? 0.4246 0.5007 0.4363 0.1493  0.0467  0.0005  177 ARG A CZ  
1369 N NH1 . ARG A 176 ? 0.3643 0.4629 0.3856 0.1546  0.0396  0.0048  177 ARG A NH1 
1370 N NH2 . ARG A 176 ? 0.3400 0.4138 0.3546 0.1457  0.0531  -0.0065 177 ARG A NH2 
1371 N N   . LEU A 177 ? 0.2993 0.3497 0.2712 0.1090  0.0304  0.0122  178 LEU A N   
1372 C CA  . LEU A 177 ? 0.2889 0.3333 0.2496 0.1102  0.0286  0.0185  178 LEU A CA  
1373 C C   . LEU A 177 ? 0.3109 0.3367 0.2620 0.0996  0.0327  0.0182  178 LEU A C   
1374 O O   . LEU A 177 ? 0.3846 0.3928 0.3225 0.1008  0.0351  0.0242  178 LEU A O   
1375 C CB  . LEU A 177 ? 0.2630 0.3317 0.2287 0.1086  0.0221  0.0175  178 LEU A CB  
1376 C CG  . LEU A 177 ? 0.2774 0.3447 0.2305 0.1093  0.0198  0.0236  178 LEU A CG  
1377 C CD1 . LEU A 177 ? 0.2844 0.3394 0.2275 0.1218  0.0198  0.0339  178 LEU A CD1 
1378 C CD2 . LEU A 177 ? 0.2550 0.3485 0.2130 0.1071  0.0135  0.0206  178 LEU A CD2 
1379 N N   . ALA A 178 ? 0.2849 0.3150 0.2429 0.0889  0.0335  0.0119  179 ALA A N   
1380 C CA  . ALA A 178 ? 0.2926 0.3089 0.2444 0.0788  0.0372  0.0114  179 ALA A CA  
1381 C C   . ALA A 178 ? 0.3514 0.3435 0.2930 0.0788  0.0428  0.0130  179 ALA A C   
1382 O O   . ALA A 178 ? 0.3586 0.3346 0.2892 0.0737  0.0462  0.0160  179 ALA A O   
1383 C CB  . ALA A 178 ? 0.2394 0.2666 0.2025 0.0694  0.0363  0.0054  179 ALA A CB  
1384 N N   . LEU A 179 ? 0.3472 0.3362 0.2920 0.0836  0.0445  0.0105  180 LEU A N   
1385 C CA  . LEU A 179 ? 0.3539 0.3178 0.2881 0.0838  0.0508  0.0104  180 LEU A CA  
1386 C C   . LEU A 179 ? 0.4440 0.3893 0.3664 0.0933  0.0530  0.0180  180 LEU A C   
1387 O O   . LEU A 179 ? 0.4092 0.3290 0.3187 0.0893  0.0585  0.0197  180 LEU A O   
1388 C CB  . LEU A 179 ? 0.3020 0.2683 0.2422 0.0878  0.0531  0.0050  180 LEU A CB  
1389 C CG  . LEU A 179 ? 0.3312 0.3098 0.2789 0.0768  0.0522  -0.0014 180 LEU A CG  
1390 C CD1 . LEU A 179 ? 0.3402 0.3189 0.2904 0.0801  0.0560  -0.0067 180 LEU A CD1 
1391 C CD2 . LEU A 179 ? 0.3977 0.3651 0.3380 0.0631  0.0540  -0.0027 180 LEU A CD2 
1392 N N   . GLN A 180 ? 0.4176 0.3753 0.3439 0.1055  0.0487  0.0231  181 GLN A N   
1393 C CA  . GLN A 180 ? 0.4341 0.3762 0.3488 0.1152  0.0494  0.0327  181 GLN A CA  
1394 C C   . GLN A 180 ? 0.4213 0.3554 0.3240 0.1059  0.0495  0.0374  181 GLN A C   
1395 O O   . GLN A 180 ? 0.4286 0.3376 0.3168 0.1068  0.0537  0.0440  181 GLN A O   
1396 C CB  . GLN A 180 ? 0.3976 0.3609 0.3201 0.1293  0.0430  0.0377  181 GLN A CB  
1397 C CG  . GLN A 180 ? 0.4929 0.4628 0.4269 0.1408  0.0442  0.0346  181 GLN A CG  
1398 C CD  . GLN A 180 ? 0.5515 0.5526 0.4980 0.1511  0.0366  0.0372  181 GLN A CD  
1399 O OE1 . GLN A 180 ? 0.6486 0.6687 0.5960 0.1469  0.0301  0.0388  181 GLN A OE1 
1400 N NE2 . GLN A 180 ? 0.5439 0.5515 0.5004 0.1640  0.0379  0.0370  181 GLN A NE2 
1401 N N   . TRP A 181 ? 0.3303 0.2850 0.2391 0.0968  0.0458  0.0338  182 TRP A N   
1402 C CA  . TRP A 181 ? 0.3769 0.3273 0.2762 0.0870  0.0472  0.0365  182 TRP A CA  
1403 C C   . TRP A 181 ? 0.3834 0.3104 0.2742 0.0761  0.0541  0.0350  182 TRP A C   
1404 O O   . TRP A 181 ? 0.3636 0.2741 0.2406 0.0715  0.0577  0.0408  182 TRP A O   
1405 C CB  . TRP A 181 ? 0.3464 0.3225 0.2565 0.0796  0.0434  0.0305  182 TRP A CB  
1406 C CG  . TRP A 181 ? 0.3117 0.2891 0.2139 0.0714  0.0449  0.0326  182 TRP A CG  
1407 C CD1 . TRP A 181 ? 0.3652 0.3531 0.2610 0.0738  0.0422  0.0366  182 TRP A CD1 
1408 C CD2 . TRP A 181 ? 0.3038 0.2741 0.2037 0.0587  0.0500  0.0303  182 TRP A CD2 
1409 N NE1 . TRP A 181 ? 0.3540 0.3407 0.2432 0.0636  0.0461  0.0366  182 TRP A NE1 
1410 C CE2 . TRP A 181 ? 0.3592 0.3360 0.2520 0.0545  0.0509  0.0329  182 TRP A CE2 
1411 C CE3 . TRP A 181 ? 0.2810 0.2424 0.1842 0.0499  0.0537  0.0262  182 TRP A CE3 
1412 C CZ2 . TRP A 181 ? 0.2998 0.2751 0.1905 0.0425  0.0560  0.0315  182 TRP A CZ2 
1413 C CZ3 . TRP A 181 ? 0.3246 0.2855 0.2260 0.0377  0.0576  0.0253  182 TRP A CZ3 
1414 C CH2 . TRP A 181 ? 0.2897 0.2577 0.1857 0.0344  0.0591  0.0279  182 TRP A CH2 
1415 N N   . VAL A 182 ? 0.3750 0.3012 0.2732 0.0705  0.0559  0.0274  183 VAL A N   
1416 C CA  . VAL A 182 ? 0.3328 0.2398 0.2234 0.0584  0.0619  0.0248  183 VAL A CA  
1417 C C   . VAL A 182 ? 0.4486 0.3228 0.3231 0.0626  0.0678  0.0299  183 VAL A C   
1418 O O   . VAL A 182 ? 0.4318 0.2869 0.2938 0.0532  0.0728  0.0325  183 VAL A O   
1419 C CB  . VAL A 182 ? 0.3711 0.2857 0.2715 0.0524  0.0617  0.0161  183 VAL A CB  
1420 C CG1 . VAL A 182 ? 0.3791 0.2728 0.2696 0.0402  0.0677  0.0128  183 VAL A CG1 
1421 C CG2 . VAL A 182 ? 0.3154 0.2580 0.2306 0.0467  0.0566  0.0125  183 VAL A CG2 
1422 N N   . GLN A 183 ? 0.4260 0.2930 0.3012 0.0770  0.0680  0.0314  184 GLN A N   
1423 C CA  . GLN A 183 ? 0.4402 0.2735 0.3012 0.0836  0.0743  0.0365  184 GLN A CA  
1424 C C   . GLN A 183 ? 0.5012 0.3217 0.3487 0.0853  0.0745  0.0481  184 GLN A C   
1425 O O   . GLN A 183 ? 0.5437 0.3328 0.3757 0.0807  0.0812  0.0521  184 GLN A O   
1426 C CB  . GLN A 183 ? 0.4285 0.2617 0.2962 0.1015  0.0740  0.0368  184 GLN A CB  
1427 C CG  . GLN A 183 ? 0.4772 0.3088 0.3510 0.0991  0.0780  0.0257  184 GLN A CG  
1428 C CD  . GLN A 183 ? 0.6035 0.4006 0.4627 0.0892  0.0873  0.0212  184 GLN A CD  
1429 O OE1 . GLN A 183 ? 0.6892 0.4552 0.5351 0.0940  0.0928  0.0272  184 GLN A OE1 
1430 N NE2 . GLN A 183 ? 0.5754 0.3774 0.4363 0.0746  0.0889  0.0111  184 GLN A NE2 
1431 N N   . GLU A 184 ? 0.4846 0.3289 0.3364 0.0906  0.0677  0.0536  185 GLU A N   
1432 C CA  . GLU A 184 ? 0.5708 0.4056 0.4082 0.0930  0.0673  0.0656  185 GLU A CA  
1433 C C   . GLU A 184 ? 0.5591 0.3935 0.3884 0.0755  0.0701  0.0655  185 GLU A C   
1434 O O   . GLU A 184 ? 0.5389 0.3551 0.3518 0.0734  0.0732  0.0751  185 GLU A O   
1435 C CB  . GLU A 184 ? 0.6368 0.4987 0.4804 0.1053  0.0586  0.0711  185 GLU A CB  
1436 C CG  . GLU A 184 ? 0.8459 0.7046 0.6932 0.1251  0.0561  0.0769  185 GLU A CG  
1437 C CD  . GLU A 184 ? 1.0031 0.8969 0.8610 0.1347  0.0465  0.0791  185 GLU A CD  
1438 O OE1 . GLU A 184 ? 1.0266 0.9309 0.8965 0.1482  0.0437  0.0785  185 GLU A OE1 
1439 O OE2 . GLU A 184 ? 1.0341 0.9459 0.8886 0.1281  0.0422  0.0807  185 GLU A OE2 
1440 N N   . ASN A 185 ? 0.4937 0.3480 0.3344 0.0633  0.0694  0.0555  186 ASN A N   
1441 C CA  . ASN A 185 ? 0.4669 0.3302 0.3044 0.0491  0.0712  0.0552  186 ASN A CA  
1442 C C   . ASN A 185 ? 0.4721 0.3326 0.3130 0.0324  0.0760  0.0474  186 ASN A C   
1443 O O   . ASN A 185 ? 0.4671 0.3323 0.3046 0.0203  0.0789  0.0481  186 ASN A O   
1444 C CB  . ASN A 185 ? 0.4366 0.3344 0.2863 0.0508  0.0650  0.0520  186 ASN A CB  
1445 C CG  . ASN A 185 ? 0.4226 0.3278 0.2669 0.0639  0.0597  0.0599  186 ASN A CG  
1446 O OD1 . ASN A 185 ? 0.5281 0.4226 0.3562 0.0644  0.0611  0.0696  186 ASN A OD1 
1447 N ND2 . ASN A 185 ? 0.4423 0.3672 0.2998 0.0737  0.0534  0.0562  186 ASN A ND2 
1448 N N   . VAL A 186 ? 0.4803 0.3357 0.3279 0.0307  0.0768  0.0401  187 VAL A N   
1449 C CA  . VAL A 186 ? 0.4422 0.3027 0.2950 0.0143  0.0793  0.0326  187 VAL A CA  
1450 C C   . VAL A 186 ? 0.5205 0.3554 0.3573 0.0008  0.0869  0.0353  187 VAL A C   
1451 O O   . VAL A 186 ? 0.4754 0.3198 0.3158 -0.0148 0.0889  0.0312  187 VAL A O   
1452 C CB  . VAL A 186 ? 0.4435 0.3066 0.3054 0.0147  0.0778  0.0242  187 VAL A CB  
1453 C CG1 . VAL A 186 ? 0.4230 0.2523 0.2711 0.0145  0.0841  0.0233  187 VAL A CG1 
1454 C CG2 . VAL A 186 ? 0.4106 0.2945 0.2842 0.0005  0.0763  0.0174  187 VAL A CG2 
1455 N N   . ALA A 187 ? 0.5201 0.3232 0.3396 0.0062  0.0914  0.0426  188 ALA A N   
1456 C CA  . ALA A 187 ? 0.5281 0.3034 0.3308 -0.0077 0.0994  0.0456  188 ALA A CA  
1457 C C   . ALA A 187 ? 0.5470 0.3358 0.3470 -0.0186 0.1008  0.0502  188 ALA A C   
1458 O O   . ALA A 187 ? 0.6292 0.4084 0.4219 -0.0359 0.1069  0.0492  188 ALA A O   
1459 C CB  . ALA A 187 ? 0.5702 0.3063 0.3549 0.0026  0.1040  0.0541  188 ALA A CB  
1460 N N   . ALA A 188 ? 0.4868 0.2988 0.2922 -0.0097 0.0959  0.0543  189 ALA A N   
1461 C CA  . ALA A 188 ? 0.5046 0.3323 0.3080 -0.0198 0.0981  0.0572  189 ALA A CA  
1462 C C   . ALA A 188 ? 0.4889 0.3432 0.3087 -0.0339 0.0986  0.0477  189 ALA A C   
1463 O O   . ALA A 188 ? 0.5264 0.3898 0.3444 -0.0463 0.1031  0.0487  189 ALA A O   
1464 C CB  . ALA A 188 ? 0.4237 0.2718 0.2291 -0.0076 0.0928  0.0616  189 ALA A CB  
1465 N N   . PHE A 189 ? 0.4570 0.3255 0.2933 -0.0318 0.0940  0.0392  190 PHE A N   
1466 C CA  . PHE A 189 ? 0.4912 0.3850 0.3442 -0.0438 0.0934  0.0314  190 PHE A CA  
1467 C C   . PHE A 189 ? 0.5139 0.3932 0.3627 -0.0587 0.0970  0.0273  190 PHE A C   
1468 O O   . PHE A 189 ? 0.5396 0.4407 0.4022 -0.0692 0.0956  0.0213  190 PHE A O   
1469 C CB  . PHE A 189 ? 0.4110 0.3306 0.2843 -0.0338 0.0857  0.0256  190 PHE A CB  
1470 C CG  . PHE A 189 ? 0.4285 0.3637 0.3067 -0.0209 0.0820  0.0277  190 PHE A CG  
1471 C CD1 . PHE A 189 ? 0.3952 0.3195 0.2663 -0.0065 0.0788  0.0316  190 PHE A CD1 
1472 C CD2 . PHE A 189 ? 0.3950 0.3569 0.2854 -0.0236 0.0820  0.0252  190 PHE A CD2 
1473 C CE1 . PHE A 189 ? 0.3554 0.2958 0.2302 0.0034  0.0750  0.0328  190 PHE A CE1 
1474 C CE2 . PHE A 189 ? 0.3504 0.3254 0.2438 -0.0133 0.0793  0.0255  190 PHE A CE2 
1475 C CZ  . PHE A 189 ? 0.3006 0.2653 0.1855 -0.0007 0.0754  0.0292  190 PHE A CZ  
1476 N N   . GLY A 190 ? 0.4734 0.3164 0.3032 -0.0598 0.1018  0.0302  191 GLY A N   
1477 C CA  . GLY A 190 ? 0.5011 0.3262 0.3242 -0.0743 0.1059  0.0247  191 GLY A CA  
1478 C C   . GLY A 190 ? 0.5106 0.3292 0.3368 -0.0678 0.1027  0.0180  191 GLY A C   
1479 O O   . GLY A 190 ? 0.5609 0.3665 0.3811 -0.0807 0.1058  0.0117  191 GLY A O   
1480 N N   . GLY A 191 ? 0.5145 0.3427 0.3492 -0.0495 0.0969  0.0187  192 GLY A N   
1481 C CA  . GLY A 191 ? 0.5011 0.3257 0.3392 -0.0435 0.0946  0.0123  192 GLY A CA  
1482 C C   . GLY A 191 ? 0.5768 0.3628 0.3983 -0.0353 0.1002  0.0136  192 GLY A C   
1483 O O   . GLY A 191 ? 0.5880 0.3535 0.3983 -0.0271 0.1032  0.0221  192 GLY A O   
1484 N N   . ASP A 192 ? 0.5572 0.3331 0.3767 -0.0373 0.1018  0.0054  193 ASP A N   
1485 C CA  . ASP A 192 ? 0.5436 0.2823 0.3488 -0.0292 0.1084  0.0046  193 ASP A CA  
1486 C C   . ASP A 192 ? 0.5957 0.3435 0.4106 -0.0083 0.1044  0.0047  193 ASP A C   
1487 O O   . ASP A 192 ? 0.5700 0.3351 0.3943 -0.0087 0.1013  -0.0031 193 ASP A O   
1488 C CB  . ASP A 192 ? 0.5614 0.2813 0.3564 -0.0452 0.1144  -0.0062 193 ASP A CB  
1489 C CG  . ASP A 192 ? 0.7130 0.3899 0.4923 -0.0372 0.1233  -0.0083 193 ASP A CG  
1490 O OD1 . ASP A 192 ? 0.8143 0.4750 0.5906 -0.0192 0.1246  0.0006  193 ASP A OD1 
1491 O OD2 . ASP A 192 ? 0.8261 0.4856 0.5960 -0.0488 0.1290  -0.0188 193 ASP A OD2 
1492 N N   . PRO A 193 ? 0.6213 0.3595 0.4342 0.0096  0.1041  0.0137  194 PRO A N   
1493 C CA  . PRO A 193 ? 0.6024 0.3521 0.4260 0.0290  0.1003  0.0136  194 PRO A CA  
1494 C C   . PRO A 193 ? 0.6466 0.3759 0.4660 0.0335  0.1065  0.0054  194 PRO A C   
1495 O O   . PRO A 193 ? 0.6677 0.4115 0.4980 0.0470  0.1039  0.0032  194 PRO A O   
1496 C CB  . PRO A 193 ? 0.5944 0.3359 0.4139 0.0449  0.0991  0.0263  194 PRO A CB  
1497 C CG  . PRO A 193 ? 0.5829 0.2917 0.3837 0.0354  0.1060  0.0319  194 PRO A CG  
1498 C CD  . PRO A 193 ? 0.6735 0.3922 0.4742 0.0123  0.1068  0.0251  194 PRO A CD  
1499 N N   . THR A 194 ? 0.6023 0.2990 0.4061 0.0221  0.1153  0.0001  195 THR A N   
1500 C CA  . THR A 194 ? 0.6595 0.3359 0.4579 0.0243  0.1226  -0.0101 195 THR A CA  
1501 C C   . THR A 194 ? 0.6661 0.3611 0.4677 0.0077  0.1213  -0.0226 195 THR A C   
1502 O O   . THR A 194 ? 0.7677 0.4458 0.5617 0.0049  0.1282  -0.0330 195 THR A O   
1503 C CB  . THR A 194 ? 0.6763 0.3032 0.4543 0.0207  0.1339  -0.0104 195 THR A CB  
1504 O OG1 . THR A 194 ? 0.7408 0.3596 0.5079 -0.0046 0.1368  -0.0160 195 THR A OG1 
1505 C CG2 . THR A 194 ? 0.6815 0.2900 0.4542 0.0344  0.1343  0.0047  195 THR A CG2 
1506 N N   . SER A 195 ? 0.6316 0.3613 0.4441 -0.0027 0.1127  -0.0216 196 SER A N   
1507 C CA  . SER A 195 ? 0.6448 0.3958 0.4613 -0.0177 0.1097  -0.0310 196 SER A CA  
1508 C C   . SER A 195 ? 0.5603 0.3536 0.3963 -0.0148 0.0988  -0.0264 196 SER A C   
1509 O O   . SER A 195 ? 0.5255 0.3376 0.3672 -0.0260 0.0938  -0.0237 196 SER A O   
1510 C CB  . SER A 195 ? 0.6214 0.3616 0.4258 -0.0415 0.1129  -0.0360 196 SER A CB  
1511 O OG  . SER A 195 ? 0.6927 0.4565 0.5010 -0.0556 0.1088  -0.0439 196 SER A OG  
1512 N N   . VAL A 196 ? 0.4854 0.2936 0.3324 0.0006  0.0956  -0.0258 197 VAL A N   
1513 C CA  . VAL A 196 ? 0.4174 0.2615 0.2823 0.0050  0.0862  -0.0218 197 VAL A CA  
1514 C C   . VAL A 196 ? 0.4245 0.2860 0.2953 0.0025  0.0842  -0.0286 197 VAL A C   
1515 O O   . VAL A 196 ? 0.4476 0.2998 0.3153 0.0104  0.0889  -0.0335 197 VAL A O   
1516 C CB  . VAL A 196 ? 0.4396 0.2890 0.3126 0.0241  0.0836  -0.0141 197 VAL A CB  
1517 C CG1 . VAL A 196 ? 0.3869 0.2712 0.2777 0.0273  0.0749  -0.0120 197 VAL A CG1 
1518 C CG2 . VAL A 196 ? 0.3865 0.2203 0.2520 0.0257  0.0852  -0.0062 197 VAL A CG2 
1519 N N   . THR A 197 ? 0.4298 0.3171 0.3095 -0.0080 0.0774  -0.0284 198 THR A N   
1520 C CA  . THR A 197 ? 0.3696 0.2752 0.2541 -0.0120 0.0743  -0.0329 198 THR A CA  
1521 C C   . THR A 197 ? 0.3594 0.2938 0.2620 -0.0053 0.0660  -0.0270 198 THR A C   
1522 O O   . THR A 197 ? 0.4110 0.3602 0.3222 -0.0099 0.0606  -0.0222 198 THR A O   
1523 C CB  . THR A 197 ? 0.3814 0.2913 0.2588 -0.0316 0.0733  -0.0374 198 THR A CB  
1524 O OG1 . THR A 197 ? 0.4472 0.3279 0.3061 -0.0394 0.0819  -0.0446 198 THR A OG1 
1525 C CG2 . THR A 197 ? 0.3131 0.2433 0.1941 -0.0358 0.0693  -0.0402 198 THR A CG2 
1526 N N   . LEU A 198 ? 0.3308 0.2730 0.2396 0.0053  0.0659  -0.0278 199 LEU A N   
1527 C CA  . LEU A 198 ? 0.3338 0.3015 0.2585 0.0096  0.0588  -0.0235 199 LEU A CA  
1528 C C   . LEU A 198 ? 0.3307 0.3147 0.2577 -0.0022 0.0546  -0.0244 199 LEU A C   
1529 O O   . LEU A 198 ? 0.3838 0.3630 0.3005 -0.0093 0.0579  -0.0300 199 LEU A O   
1530 C CB  . LEU A 198 ? 0.4243 0.3964 0.3550 0.0233  0.0603  -0.0241 199 LEU A CB  
1531 C CG  . LEU A 198 ? 0.4561 0.4145 0.3849 0.0374  0.0641  -0.0227 199 LEU A CG  
1532 C CD1 . LEU A 198 ? 0.3577 0.3316 0.2979 0.0493  0.0629  -0.0224 199 LEU A CD1 
1533 C CD2 . LEU A 198 ? 0.3918 0.3477 0.3218 0.0389  0.0611  -0.0165 199 LEU A CD2 
1534 N N   . PHE A 199 ? 0.2653 0.2684 0.2052 -0.0039 0.0475  -0.0188 200 PHE A N   
1535 C CA  . PHE A 199 ? 0.2364 0.2568 0.1809 -0.0115 0.0424  -0.0171 200 PHE A CA  
1536 C C   . PHE A 199 ? 0.1971 0.2341 0.1583 -0.0050 0.0368  -0.0113 200 PHE A C   
1537 O O   . PHE A 199 ? 0.2291 0.2673 0.1987 0.0012  0.0355  -0.0086 200 PHE A O   
1538 C CB  . PHE A 199 ? 0.2727 0.2979 0.2130 -0.0259 0.0394  -0.0164 200 PHE A CB  
1539 C CG  . PHE A 199 ? 0.2669 0.3015 0.2185 -0.0271 0.0350  -0.0110 200 PHE A CG  
1540 C CD1 . PHE A 199 ? 0.3079 0.3619 0.2685 -0.0343 0.0281  -0.0059 200 PHE A CD1 
1541 C CD2 . PHE A 199 ? 0.3125 0.3374 0.2653 -0.0214 0.0380  -0.0106 200 PHE A CD2 
1542 C CE1 . PHE A 199 ? 0.3579 0.4225 0.3308 -0.0347 0.0250  -0.0015 200 PHE A CE1 
1543 C CE2 . PHE A 199 ? 0.3288 0.3639 0.2918 -0.0232 0.0352  -0.0065 200 PHE A CE2 
1544 C CZ  . PHE A 199 ? 0.3704 0.4257 0.3444 -0.0295 0.0290  -0.0024 200 PHE A CZ  
1545 N N   . GLY A 200 ? 0.2409 0.2892 0.2055 -0.0068 0.0343  -0.0099 201 GLY A N   
1546 C CA  . GLY A 200 ? 0.2140 0.2751 0.1930 -0.0017 0.0299  -0.0050 201 GLY A CA  
1547 C C   . GLY A 200 ? 0.2530 0.3254 0.2326 -0.0089 0.0264  -0.0014 201 GLY A C   
1548 O O   . GLY A 200 ? 0.2304 0.3021 0.1981 -0.0170 0.0277  -0.0037 201 GLY A O   
1549 N N   . GLU A 201 ? 0.1786 0.2606 0.1711 -0.0063 0.0220  0.0043  202 GLU A N   
1550 C CA  . GLU A 201 ? 0.1846 0.2767 0.1787 -0.0126 0.0177  0.0104  202 GLU A CA  
1551 C C   . GLU A 201 ? 0.2060 0.3015 0.2079 -0.0082 0.0182  0.0120  202 GLU A C   
1552 O O   . GLU A 201 ? 0.1980 0.2919 0.2100 -0.0008 0.0186  0.0110  202 GLU A O   
1553 C CB  . GLU A 201 ? 0.2092 0.3092 0.2125 -0.0154 0.0111  0.0182  202 GLU A CB  
1554 C CG  . GLU A 201 ? 0.1909 0.3013 0.1937 -0.0225 0.0055  0.0266  202 GLU A CG  
1555 C CD  . GLU A 201 ? 0.3373 0.4498 0.3517 -0.0181 0.0034  0.0330  202 GLU A CD  
1556 O OE1 . GLU A 201 ? 0.3165 0.4346 0.3278 -0.0235 0.0002  0.0400  202 GLU A OE1 
1557 O OE2 . GLU A 201 ? 0.2757 0.3835 0.3010 -0.0099 0.0052  0.0309  202 GLU A OE2 
1558 N N   . SER A 202 ? 0.2220 0.3225 0.2180 -0.0141 0.0185  0.0139  203 SER A N   
1559 C CA  . SER A 202 ? 0.2289 0.3336 0.2309 -0.0129 0.0194  0.0157  203 SER A CA  
1560 C C   . SER A 202 ? 0.2621 0.3645 0.2670 -0.0050 0.0248  0.0076  203 SER A C   
1561 O O   . SER A 202 ? 0.1819 0.2817 0.1777 -0.0037 0.0300  0.0010  203 SER A O   
1562 C CB  . SER A 202 ? 0.2554 0.3619 0.2707 -0.0120 0.0138  0.0243  203 SER A CB  
1563 O OG  . SER A 202 ? 0.3433 0.4526 0.3615 -0.0148 0.0143  0.0280  203 SER A OG  
1564 N N   . ALA A 203 ? 0.1378 0.2413 0.1548 0.0005  0.0239  0.0078  204 ALA A N   
1565 C CA  . ALA A 203 ? 0.2020 0.3067 0.2220 0.0080  0.0276  0.0010  204 ALA A CA  
1566 C C   . ALA A 203 ? 0.2036 0.3004 0.2184 0.0143  0.0293  -0.0032 204 ALA A C   
1567 O O   . ALA A 203 ? 0.2108 0.3075 0.2238 0.0207  0.0331  -0.0082 204 ALA A O   
1568 C CB  . ALA A 203 ? 0.1608 0.2686 0.1934 0.0107  0.0255  0.0016  204 ALA A CB  
1569 N N   . GLY A 204 ? 0.2561 0.3467 0.2691 0.0125  0.0267  -0.0005 205 GLY A N   
1570 C CA  . GLY A 204 ? 0.1687 0.2499 0.1743 0.0161  0.0290  -0.0039 205 GLY A CA  
1571 C C   . GLY A 204 ? 0.2422 0.3174 0.2345 0.0135  0.0338  -0.0081 205 GLY A C   
1572 O O   . GLY A 204 ? 0.2288 0.2949 0.2153 0.0193  0.0380  -0.0124 205 GLY A O   
1573 N N   . ALA A 205 ? 0.1579 0.2372 0.1445 0.0048  0.0334  -0.0068 206 ALA A N   
1574 C CA  . ALA A 205 ? 0.2621 0.3358 0.2348 0.0013  0.0391  -0.0125 206 ALA A CA  
1575 C C   . ALA A 205 ? 0.2848 0.3616 0.2588 0.0081  0.0450  -0.0176 206 ALA A C   
1576 O O   . ALA A 205 ? 0.2870 0.3547 0.2533 0.0124  0.0515  -0.0240 206 ALA A O   
1577 C CB  . ALA A 205 ? 0.1794 0.2593 0.1444 -0.0110 0.0367  -0.0097 206 ALA A CB  
1578 N N   . ALA A 206 ? 0.2112 0.3008 0.1957 0.0092  0.0432  -0.0149 207 ALA A N   
1579 C CA  . ALA A 206 ? 0.2222 0.3192 0.2114 0.0160  0.0483  -0.0195 207 ALA A CA  
1580 C C   . ALA A 206 ? 0.2882 0.3800 0.2818 0.0285  0.0497  -0.0221 207 ALA A C   
1581 O O   . ALA A 206 ? 0.2612 0.3530 0.2539 0.0361  0.0555  -0.0271 207 ALA A O   
1582 C CB  . ALA A 206 ? 0.1559 0.2677 0.1564 0.0131  0.0455  -0.0158 207 ALA A CB  
1583 N N   . SER A 207 ? 0.2206 0.3085 0.2189 0.0311  0.0446  -0.0185 208 SER A N   
1584 C CA  . SER A 207 ? 0.2258 0.3083 0.2258 0.0420  0.0452  -0.0195 208 SER A CA  
1585 C C   . SER A 207 ? 0.2878 0.3528 0.2753 0.0452  0.0505  -0.0227 208 SER A C   
1586 O O   . SER A 207 ? 0.2017 0.2631 0.1889 0.0556  0.0546  -0.0250 208 SER A O   
1587 C CB  . SER A 207 ? 0.1814 0.2625 0.1860 0.0420  0.0395  -0.0155 208 SER A CB  
1588 O OG  . SER A 207 ? 0.2267 0.3211 0.2427 0.0401  0.0356  -0.0139 208 SER A OG  
1589 N N   . VAL A 208 ? 0.2220 0.2759 0.1995 0.0362  0.0506  -0.0226 209 VAL A N   
1590 C CA  . VAL A 208 ? 0.3190 0.3536 0.2829 0.0364  0.0564  -0.0266 209 VAL A CA  
1591 C C   . VAL A 208 ? 0.3382 0.3708 0.2978 0.0409  0.0642  -0.0331 209 VAL A C   
1592 O O   . VAL A 208 ? 0.3588 0.3771 0.3136 0.0499  0.0700  -0.0362 209 VAL A O   
1593 C CB  . VAL A 208 ? 0.3046 0.3329 0.2590 0.0229  0.0547  -0.0264 209 VAL A CB  
1594 C CG1 . VAL A 208 ? 0.2271 0.2353 0.1656 0.0200  0.0619  -0.0327 209 VAL A CG1 
1595 C CG2 . VAL A 208 ? 0.2761 0.3046 0.2353 0.0207  0.0488  -0.0208 209 VAL A CG2 
1596 N N   . GLY A 209 ? 0.3127 0.3593 0.2742 0.0351  0.0651  -0.0349 210 GLY A N   
1597 C CA  . GLY A 209 ? 0.2844 0.3320 0.2426 0.0389  0.0737  -0.0420 210 GLY A CA  
1598 C C   . GLY A 209 ? 0.2417 0.2962 0.2118 0.0547  0.0763  -0.0425 210 GLY A C   
1599 O O   . GLY A 209 ? 0.33