data_6CST
# 
_entry.id   6CST 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CST         
WWPDB D_1000233317 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6CST 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Jha, V.'  1 ? 
'Ling, H.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Rep' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2045-2322 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            8 
_citation.language                  ? 
_citation.page_first                15125 
_citation.page_last                 15125 
_citation.title                     
'2.0 angstrom resolution crystal structure of human pol kappa reveals a new catalytic function of N-clasp in DNA replication.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41598-018-33371-5 
_citation.pdbx_database_id_PubMed   30310122 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jha, V.'  1 ? 
primary 'Ling, H.' 2 ? 
# 
_cell.entry_id           6CST 
_cell.length_a           67.579 
_cell.length_b           124.630 
_cell.length_c           165.040 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         6CST 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA polymerase kappa'                                                                       63287.078 2   
2.7.7.7 ? ? ? 
2  polymer     syn 
;DNA (5'-D(P*AP*TP*AP*CP*AP*TP*AP*CP*C)-3')
;
2683.801  2   ?       ? ? ? 
3  polymer     syn 
;DNA (5'-D(P*TP*AP*CP*TP*GP*GP*TP*AP*TP*GP*TP*AP*T)-3')
;
3996.618  2   ?       ? ? ? 
4  non-polymer syn 'MAGNESIUM ION'                                                                              24.305    4   ? ? 
? ? 
5  non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                                                      106.120   5   ? ? 
? ? 
6  non-polymer syn 'IODIDE ION'                                                                                 126.904   6   ? ? 
? ? 
7  non-polymer syn 1,2-ETHANEDIOL                                                                               62.068    10  ? ? 
? ? 
8  non-polymer syn "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]adenosine" 490.197   2   ? ? 
? ? 
9  non-polymer syn 'TRIETHYLENE GLYCOL'                                                                         150.173   1   ? ? 
? ? 
10 non-polymer syn 'CHLORIDE ION'                                                                               35.453    9   ? ? 
? ? 
11 non-polymer syn 'POTASSIUM ION'                                                                              39.098    4   ? ? 
? ? 
12 water       nat water                                                                                        18.015    483 ? ? 
? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DINB protein,DINP' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MSYYHHHHHHDYDIPTTENLYFQGAMDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELK
KEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSM
LSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEAYLNITKHLEERQNWP
EDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVK
EIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTE
LYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKERLKGRT
VTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKELLKTEIDADFPHPLRLRLMGVRISSFPNEEDRKHQQ
;
;MSYYHHHHHHDYDIPTTENLYFQGAMDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELK
KEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSM
LSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEAYLNITKHLEERQNWP
EDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVK
EIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTE
LYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKERLKGRT
VTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKELLKTEIDADFPHPLRLRLMGVRISSFPNEEDRKHQQ
;
A,B ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DA)(DC)(DA)(DT)(DA)(DC)(DC)' ATACATACC C,P ? 
3 polydeoxyribonucleotide no no '(DT)(DA)(DC)(DT)(DG)(DG)(DT)(DA)(DT)(DG)(DT)(DA)(DT)' TACTGGTATGTAT D,T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   TYR n 
1 4   TYR n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  ASP n 
1 12  TYR n 
1 13  ASP n 
1 14  ILE n 
1 15  PRO n 
1 16  THR n 
1 17  THR n 
1 18  GLU n 
1 19  ASN n 
1 20  LEU n 
1 21  TYR n 
1 22  PHE n 
1 23  GLN n 
1 24  GLY n 
1 25  ALA n 
1 26  MET n 
1 27  ASP n 
1 28  SER n 
1 29  THR n 
1 30  LYS n 
1 31  GLU n 
1 32  LYS n 
1 33  CYS n 
1 34  ASP n 
1 35  SER n 
1 36  TYR n 
1 37  LYS n 
1 38  ASP n 
1 39  ASP n 
1 40  LEU n 
1 41  LEU n 
1 42  LEU n 
1 43  ARG n 
1 44  MET n 
1 45  GLY n 
1 46  LEU n 
1 47  ASN n 
1 48  ASP n 
1 49  ASN n 
1 50  LYS n 
1 51  ALA n 
1 52  GLY n 
1 53  MET n 
1 54  GLU n 
1 55  GLY n 
1 56  LEU n 
1 57  ASP n 
1 58  LYS n 
1 59  GLU n 
1 60  LYS n 
1 61  ILE n 
1 62  ASN n 
1 63  LYS n 
1 64  ILE n 
1 65  ILE n 
1 66  MET n 
1 67  GLU n 
1 68  ALA n 
1 69  THR n 
1 70  LYS n 
1 71  GLY n 
1 72  SER n 
1 73  ARG n 
1 74  PHE n 
1 75  TYR n 
1 76  GLY n 
1 77  ASN n 
1 78  GLU n 
1 79  LEU n 
1 80  LYS n 
1 81  LYS n 
1 82  GLU n 
1 83  LYS n 
1 84  GLN n 
1 85  VAL n 
1 86  ASN n 
1 87  GLN n 
1 88  ARG n 
1 89  ILE n 
1 90  GLU n 
1 91  ASN n 
1 92  MET n 
1 93  MET n 
1 94  GLN n 
1 95  GLN n 
1 96  LYS n 
1 97  ALA n 
1 98  GLN n 
1 99  ILE n 
1 100 THR n 
1 101 SER n 
1 102 GLN n 
1 103 GLN n 
1 104 LEU n 
1 105 ARG n 
1 106 LYS n 
1 107 ALA n 
1 108 GLN n 
1 109 LEU n 
1 110 GLN n 
1 111 VAL n 
1 112 ASP n 
1 113 ARG n 
1 114 PHE n 
1 115 ALA n 
1 116 MET n 
1 117 GLU n 
1 118 LEU n 
1 119 GLU n 
1 120 GLN n 
1 121 SER n 
1 122 ARG n 
1 123 ASN n 
1 124 LEU n 
1 125 SER n 
1 126 ASN n 
1 127 THR n 
1 128 ILE n 
1 129 VAL n 
1 130 HIS n 
1 131 ILE n 
1 132 ASP n 
1 133 MET n 
1 134 ASP n 
1 135 ALA n 
1 136 PHE n 
1 137 TYR n 
1 138 ALA n 
1 139 ALA n 
1 140 VAL n 
1 141 GLU n 
1 142 MET n 
1 143 ARG n 
1 144 ASP n 
1 145 ASN n 
1 146 PRO n 
1 147 GLU n 
1 148 LEU n 
1 149 LYS n 
1 150 ASP n 
1 151 LYS n 
1 152 PRO n 
1 153 ILE n 
1 154 ALA n 
1 155 VAL n 
1 156 GLY n 
1 157 SER n 
1 158 MET n 
1 159 SER n 
1 160 MET n 
1 161 LEU n 
1 162 SER n 
1 163 THR n 
1 164 SER n 
1 165 ASN n 
1 166 TYR n 
1 167 HIS n 
1 168 ALA n 
1 169 ARG n 
1 170 ARG n 
1 171 PHE n 
1 172 GLY n 
1 173 VAL n 
1 174 ARG n 
1 175 ALA n 
1 176 ALA n 
1 177 MET n 
1 178 PRO n 
1 179 GLY n 
1 180 PHE n 
1 181 ILE n 
1 182 ALA n 
1 183 LYS n 
1 184 ARG n 
1 185 LEU n 
1 186 CYS n 
1 187 PRO n 
1 188 GLN n 
1 189 LEU n 
1 190 ILE n 
1 191 ILE n 
1 192 VAL n 
1 193 PRO n 
1 194 PRO n 
1 195 ASN n 
1 196 PHE n 
1 197 ASP n 
1 198 LYS n 
1 199 TYR n 
1 200 ARG n 
1 201 ALA n 
1 202 VAL n 
1 203 SER n 
1 204 LYS n 
1 205 GLU n 
1 206 VAL n 
1 207 LYS n 
1 208 GLU n 
1 209 ILE n 
1 210 LEU n 
1 211 ALA n 
1 212 ASP n 
1 213 TYR n 
1 214 ASP n 
1 215 PRO n 
1 216 ASN n 
1 217 PHE n 
1 218 MET n 
1 219 ALA n 
1 220 MET n 
1 221 SER n 
1 222 LEU n 
1 223 ASP n 
1 224 GLU n 
1 225 ALA n 
1 226 TYR n 
1 227 LEU n 
1 228 ASN n 
1 229 ILE n 
1 230 THR n 
1 231 LYS n 
1 232 HIS n 
1 233 LEU n 
1 234 GLU n 
1 235 GLU n 
1 236 ARG n 
1 237 GLN n 
1 238 ASN n 
1 239 TRP n 
1 240 PRO n 
1 241 GLU n 
1 242 ASP n 
1 243 LYS n 
1 244 ARG n 
1 245 ARG n 
1 246 TYR n 
1 247 PHE n 
1 248 ILE n 
1 249 LYS n 
1 250 MET n 
1 251 GLY n 
1 252 SER n 
1 253 SER n 
1 254 VAL n 
1 255 GLU n 
1 256 ASN n 
1 257 ASP n 
1 258 ASN n 
1 259 PRO n 
1 260 GLY n 
1 261 LYS n 
1 262 GLU n 
1 263 VAL n 
1 264 ASN n 
1 265 LYS n 
1 266 LEU n 
1 267 SER n 
1 268 GLU n 
1 269 HIS n 
1 270 GLU n 
1 271 ARG n 
1 272 SER n 
1 273 ILE n 
1 274 SER n 
1 275 PRO n 
1 276 LEU n 
1 277 LEU n 
1 278 PHE n 
1 279 GLU n 
1 280 GLU n 
1 281 SER n 
1 282 PRO n 
1 283 SER n 
1 284 ASP n 
1 285 VAL n 
1 286 GLN n 
1 287 PRO n 
1 288 PRO n 
1 289 GLY n 
1 290 ASP n 
1 291 PRO n 
1 292 PHE n 
1 293 GLN n 
1 294 VAL n 
1 295 ASN n 
1 296 PHE n 
1 297 GLU n 
1 298 GLU n 
1 299 GLN n 
1 300 ASN n 
1 301 ASN n 
1 302 PRO n 
1 303 GLN n 
1 304 ILE n 
1 305 LEU n 
1 306 GLN n 
1 307 ASN n 
1 308 SER n 
1 309 VAL n 
1 310 VAL n 
1 311 PHE n 
1 312 GLY n 
1 313 THR n 
1 314 SER n 
1 315 ALA n 
1 316 GLN n 
1 317 GLU n 
1 318 VAL n 
1 319 VAL n 
1 320 LYS n 
1 321 GLU n 
1 322 ILE n 
1 323 ARG n 
1 324 PHE n 
1 325 ARG n 
1 326 ILE n 
1 327 GLU n 
1 328 GLN n 
1 329 LYS n 
1 330 THR n 
1 331 THR n 
1 332 LEU n 
1 333 THR n 
1 334 ALA n 
1 335 SER n 
1 336 ALA n 
1 337 GLY n 
1 338 ILE n 
1 339 ALA n 
1 340 PRO n 
1 341 ASN n 
1 342 THR n 
1 343 MET n 
1 344 LEU n 
1 345 ALA n 
1 346 LYS n 
1 347 VAL n 
1 348 CYS n 
1 349 SER n 
1 350 ASP n 
1 351 LYS n 
1 352 ASN n 
1 353 LYS n 
1 354 PRO n 
1 355 ASN n 
1 356 GLY n 
1 357 GLN n 
1 358 TYR n 
1 359 GLN n 
1 360 ILE n 
1 361 LEU n 
1 362 PRO n 
1 363 ASN n 
1 364 ARG n 
1 365 GLN n 
1 366 ALA n 
1 367 VAL n 
1 368 MET n 
1 369 ASP n 
1 370 PHE n 
1 371 ILE n 
1 372 LYS n 
1 373 ASP n 
1 374 LEU n 
1 375 PRO n 
1 376 ILE n 
1 377 ARG n 
1 378 LYS n 
1 379 VAL n 
1 380 SER n 
1 381 GLY n 
1 382 ILE n 
1 383 GLY n 
1 384 LYS n 
1 385 VAL n 
1 386 THR n 
1 387 GLU n 
1 388 LYS n 
1 389 MET n 
1 390 LEU n 
1 391 LYS n 
1 392 ALA n 
1 393 LEU n 
1 394 GLY n 
1 395 ILE n 
1 396 ILE n 
1 397 THR n 
1 398 CYS n 
1 399 THR n 
1 400 GLU n 
1 401 LEU n 
1 402 TYR n 
1 403 GLN n 
1 404 GLN n 
1 405 ARG n 
1 406 ALA n 
1 407 LEU n 
1 408 LEU n 
1 409 SER n 
1 410 LEU n 
1 411 LEU n 
1 412 PHE n 
1 413 SER n 
1 414 GLU n 
1 415 THR n 
1 416 SER n 
1 417 TRP n 
1 418 HIS n 
1 419 TYR n 
1 420 PHE n 
1 421 LEU n 
1 422 HIS n 
1 423 ILE n 
1 424 SER n 
1 425 LEU n 
1 426 GLY n 
1 427 LEU n 
1 428 GLY n 
1 429 SER n 
1 430 THR n 
1 431 HIS n 
1 432 LEU n 
1 433 THR n 
1 434 ARG n 
1 435 ASP n 
1 436 GLY n 
1 437 GLU n 
1 438 ARG n 
1 439 LYS n 
1 440 SER n 
1 441 MET n 
1 442 SER n 
1 443 VAL n 
1 444 GLU n 
1 445 ARG n 
1 446 THR n 
1 447 PHE n 
1 448 SER n 
1 449 GLU n 
1 450 ILE n 
1 451 ASN n 
1 452 LYS n 
1 453 ALA n 
1 454 GLU n 
1 455 GLU n 
1 456 GLN n 
1 457 TYR n 
1 458 SER n 
1 459 LEU n 
1 460 CYS n 
1 461 GLN n 
1 462 GLU n 
1 463 LEU n 
1 464 CYS n 
1 465 SER n 
1 466 GLU n 
1 467 LEU n 
1 468 ALA n 
1 469 GLN n 
1 470 ASP n 
1 471 LEU n 
1 472 GLN n 
1 473 LYS n 
1 474 GLU n 
1 475 ARG n 
1 476 LEU n 
1 477 LYS n 
1 478 GLY n 
1 479 ARG n 
1 480 THR n 
1 481 VAL n 
1 482 THR n 
1 483 ILE n 
1 484 LYS n 
1 485 LEU n 
1 486 LYS n 
1 487 ASN n 
1 488 VAL n 
1 489 ASN n 
1 490 PHE n 
1 491 GLU n 
1 492 VAL n 
1 493 LYS n 
1 494 THR n 
1 495 ARG n 
1 496 ALA n 
1 497 SER n 
1 498 THR n 
1 499 VAL n 
1 500 SER n 
1 501 SER n 
1 502 VAL n 
1 503 VAL n 
1 504 SER n 
1 505 THR n 
1 506 ALA n 
1 507 GLU n 
1 508 GLU n 
1 509 ILE n 
1 510 PHE n 
1 511 ALA n 
1 512 ILE n 
1 513 ALA n 
1 514 LYS n 
1 515 GLU n 
1 516 LEU n 
1 517 LEU n 
1 518 LYS n 
1 519 THR n 
1 520 GLU n 
1 521 ILE n 
1 522 ASP n 
1 523 ALA n 
1 524 ASP n 
1 525 PHE n 
1 526 PRO n 
1 527 HIS n 
1 528 PRO n 
1 529 LEU n 
1 530 ARG n 
1 531 LEU n 
1 532 ARG n 
1 533 LEU n 
1 534 MET n 
1 535 GLY n 
1 536 VAL n 
1 537 ARG n 
1 538 ILE n 
1 539 SER n 
1 540 SER n 
1 541 PHE n 
1 542 PRO n 
1 543 ASN n 
1 544 GLU n 
1 545 GLU n 
1 546 ASP n 
1 547 ARG n 
1 548 LYS n 
1 549 HIS n 
1 550 GLN n 
1 551 GLN n 
2 1   DA  n 
2 2   DT  n 
2 3   DA  n 
2 4   DC  n 
2 5   DA  n 
2 6   DT  n 
2 7   DA  n 
2 8   DC  n 
2 9   DC  n 
3 1   DT  n 
3 2   DA  n 
3 3   DC  n 
3 4   DT  n 
3 5   DG  n 
3 6   DG  n 
3 7   DT  n 
3 8   DA  n 
3 9   DT  n 
3 10  DG  n 
3 11  DT  n 
3 12  DA  n 
3 13  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   551 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLK, DINB1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 9  'synthetic construct' ? 32630 ? 
3 1 sample 1 13 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLK_HUMAN Q9UBT6 ? 1 
;MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLR
KAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRL
CPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNK
LSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFRIEQKTTLTASAGIAPNTMLA
KVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISL
GLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVST
AEEIFAIAKELLKTEIDADFPHPLRLRLMGVRISSFPNEEDRKHQQ
;
1 
2 PDB 6CST       6CST   ? 2 ? 1 
3 PDB 6CST       6CST   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6CST A 26 ? 551 ? Q9UBT6 1 ? 526 ? 1 526 
2 1 6CST B 26 ? 551 ? Q9UBT6 1 ? 526 ? 1 526 
3 2 6CST C 1  ? 9   ? 6CST   5 ? 13  ? 5 13  
4 3 6CST D 1  ? 13  ? 6CST   2 ? 14  ? 2 14  
5 2 6CST P 1  ? 9   ? 6CST   5 ? 13  ? 5 13  
6 3 6CST T 1  ? 13  ? 6CST   2 ? 14  ? 2 14  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6CST MET A 1  ? UNP Q9UBT6 ? ? 'initiating methionine' -24 1  
1 6CST SER A 2  ? UNP Q9UBT6 ? ? 'expression tag'        -23 2  
1 6CST TYR A 3  ? UNP Q9UBT6 ? ? 'expression tag'        -22 3  
1 6CST TYR A 4  ? UNP Q9UBT6 ? ? 'expression tag'        -21 4  
1 6CST HIS A 5  ? UNP Q9UBT6 ? ? 'expression tag'        -20 5  
1 6CST HIS A 6  ? UNP Q9UBT6 ? ? 'expression tag'        -19 6  
1 6CST HIS A 7  ? UNP Q9UBT6 ? ? 'expression tag'        -18 7  
1 6CST HIS A 8  ? UNP Q9UBT6 ? ? 'expression tag'        -17 8  
1 6CST HIS A 9  ? UNP Q9UBT6 ? ? 'expression tag'        -16 9  
1 6CST HIS A 10 ? UNP Q9UBT6 ? ? 'expression tag'        -15 10 
1 6CST ASP A 11 ? UNP Q9UBT6 ? ? 'expression tag'        -14 11 
1 6CST TYR A 12 ? UNP Q9UBT6 ? ? 'expression tag'        -13 12 
1 6CST ASP A 13 ? UNP Q9UBT6 ? ? 'expression tag'        -12 13 
1 6CST ILE A 14 ? UNP Q9UBT6 ? ? 'expression tag'        -11 14 
1 6CST PRO A 15 ? UNP Q9UBT6 ? ? 'expression tag'        -10 15 
1 6CST THR A 16 ? UNP Q9UBT6 ? ? 'expression tag'        -9  16 
1 6CST THR A 17 ? UNP Q9UBT6 ? ? 'expression tag'        -8  17 
1 6CST GLU A 18 ? UNP Q9UBT6 ? ? 'expression tag'        -7  18 
1 6CST ASN A 19 ? UNP Q9UBT6 ? ? 'expression tag'        -6  19 
1 6CST LEU A 20 ? UNP Q9UBT6 ? ? 'expression tag'        -5  20 
1 6CST TYR A 21 ? UNP Q9UBT6 ? ? 'expression tag'        -4  21 
1 6CST PHE A 22 ? UNP Q9UBT6 ? ? 'expression tag'        -3  22 
1 6CST GLN A 23 ? UNP Q9UBT6 ? ? 'expression tag'        -2  23 
1 6CST GLY A 24 ? UNP Q9UBT6 ? ? 'expression tag'        -1  24 
1 6CST ALA A 25 ? UNP Q9UBT6 ? ? 'expression tag'        0   25 
2 6CST MET B 1  ? UNP Q9UBT6 ? ? 'initiating methionine' -24 26 
2 6CST SER B 2  ? UNP Q9UBT6 ? ? 'expression tag'        -23 27 
2 6CST TYR B 3  ? UNP Q9UBT6 ? ? 'expression tag'        -22 28 
2 6CST TYR B 4  ? UNP Q9UBT6 ? ? 'expression tag'        -21 29 
2 6CST HIS B 5  ? UNP Q9UBT6 ? ? 'expression tag'        -20 30 
2 6CST HIS B 6  ? UNP Q9UBT6 ? ? 'expression tag'        -19 31 
2 6CST HIS B 7  ? UNP Q9UBT6 ? ? 'expression tag'        -18 32 
2 6CST HIS B 8  ? UNP Q9UBT6 ? ? 'expression tag'        -17 33 
2 6CST HIS B 9  ? UNP Q9UBT6 ? ? 'expression tag'        -16 34 
2 6CST HIS B 10 ? UNP Q9UBT6 ? ? 'expression tag'        -15 35 
2 6CST ASP B 11 ? UNP Q9UBT6 ? ? 'expression tag'        -14 36 
2 6CST TYR B 12 ? UNP Q9UBT6 ? ? 'expression tag'        -13 37 
2 6CST ASP B 13 ? UNP Q9UBT6 ? ? 'expression tag'        -12 38 
2 6CST ILE B 14 ? UNP Q9UBT6 ? ? 'expression tag'        -11 39 
2 6CST PRO B 15 ? UNP Q9UBT6 ? ? 'expression tag'        -10 40 
2 6CST THR B 16 ? UNP Q9UBT6 ? ? 'expression tag'        -9  41 
2 6CST THR B 17 ? UNP Q9UBT6 ? ? 'expression tag'        -8  42 
2 6CST GLU B 18 ? UNP Q9UBT6 ? ? 'expression tag'        -7  43 
2 6CST ASN B 19 ? UNP Q9UBT6 ? ? 'expression tag'        -6  44 
2 6CST LEU B 20 ? UNP Q9UBT6 ? ? 'expression tag'        -5  45 
2 6CST TYR B 21 ? UNP Q9UBT6 ? ? 'expression tag'        -4  46 
2 6CST PHE B 22 ? UNP Q9UBT6 ? ? 'expression tag'        -3  47 
2 6CST GLN B 23 ? UNP Q9UBT6 ? ? 'expression tag'        -2  48 
2 6CST GLY B 24 ? UNP Q9UBT6 ? ? 'expression tag'        -1  49 
2 6CST ALA B 25 ? UNP Q9UBT6 ? ? 'expression tag'        0   50 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                      ? 
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                                                     ? 
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                   ? 
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                              ? 
'C4 H7 N O4'        133.103 
CL  non-polymer         . 'CHLORIDE ION'                                                                               ? 'Cl -1' 
35.453  
CYS 'L-peptide linking' y CYSTEINE                                                                                     ? 
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                         ? 
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                          ? 
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                         ? 
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                                 ? 
'C10 H15 N2 O8 P'   322.208 
DZ4 non-polymer         . "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]adenosine" ? 
'C10 H17 N6 O11 P3' 490.197 
EDO non-polymer         . 1,2-ETHANEDIOL                                                                               
'ETHYLENE GLYCOL' 'C2 H6 O2'          62.068  
GLN 'L-peptide linking' y GLUTAMINE                                                                                    ? 
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                              ? 
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                                      ? 
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                    ? 
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                                        ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                   ? 
'C6 H13 N O2'       131.173 
IOD non-polymer         . 'IODIDE ION'                                                                                 ? 'I -1' 
126.904 
K   non-polymer         . 'POTASSIUM ION'                                                                              ? 'K 1' 
39.098  
LEU 'L-peptide linking' y LEUCINE                                                                                      ? 
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                       ? 
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                                   ? 
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                              ? 'Mg 2' 
24.305  
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER'                                                                      ? 
'C4 H10 O3'         106.120 
PGE non-polymer         . 'TRIETHYLENE GLYCOL'                                                                         ? 
'C6 H14 O4'         150.173 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                ? 
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                                      ? 
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                                                       ? 
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                                                    ? 
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                   ? 
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                     ? 
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                                                       ? 
'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CST 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.48 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.47 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '25% PEG 400 and 0.2M ammonium iodide' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-07-31 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6CST 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.0 
_reflns.d_resolution_low                 44.14 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       93082 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.5 
_reflns.pdbx_Rmerge_I_obs                0.07 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.079 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.00 
_reflns_shell.d_res_low                   2.11 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.8 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           13313 
_reflns_shell.percent_possible_all        97.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.55 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.88 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 6CST 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     90700 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.14 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    98.05 
_refine.ls_R_factor_obs                          0.19923 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19833 
_refine.ls_R_factor_R_free                       0.23416 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.5 
_refine.ls_number_reflns_R_free                  2327 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.957 
_refine.correlation_coeff_Fo_to_Fc_free          0.937 
_refine.B_iso_mean                               41.577 
_refine.aniso_B[1][1]                            4.99 
_refine.aniso_B[2][2]                            -1.65 
_refine.aniso_B[3][3]                            -3.34 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.156 
_refine.pdbx_overall_ESU_R_Free                  0.146 
_refine.overall_SU_ML                            0.127 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             4.796 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        6979 
_refine_hist.pdbx_number_atoms_nucleic_acid   898 
_refine_hist.pdbx_number_atoms_ligand         168 
_refine_hist.number_atoms_solvent             483 
_refine_hist.number_atoms_total               8528 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        44.14 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.018  ? 8231  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.003  0.020  ? 7608  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.532  1.866  ? 11238 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.072  3.000  ? 17513 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.729  5.000  ? 886   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.540 24.114 ? 316   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.035 15.000 ? 1352  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.345 15.000 ? 55    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.095  0.200  ? 1227  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 8492  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 1807  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.695  3.955  ? 3550  'X-RAY DIFFRACTION' ? 
r_mcbond_other               2.694  3.953  ? 3549  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 4.036  5.910  ? 4431  'X-RAY DIFFRACTION' ? 
r_mcangle_other              4.036  5.912  ? 4432  'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.614  4.345  ? 4681  'X-RAY DIFFRACTION' ? 
r_scbond_other               3.614  4.345  ? 4680  'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              5.572  6.357  ? 6807  'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       7.584  32.702 ? 9703  'X-RAY DIFFRACTION' ? 
r_long_range_B_other         7.549  32.567 ? 9514  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' A 6826 0.420 0.500 ? ? ? 
2 'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    A 6826 6.610 2.000 ? ? ? 
3 'X-RAY DIFFRACTION' 2 1 'MEDIUM POSITIONAL' C 282  0.110 0.500 ? ? ? 
4 'X-RAY DIFFRACTION' 2 1 'MEDIUM THERMAL'    C 282  2.360 2.000 ? ? ? 
5 'X-RAY DIFFRACTION' 3 1 'MEDIUM POSITIONAL' D 417  0.210 0.500 ? ? ? 
6 'X-RAY DIFFRACTION' 3 1 'MEDIUM THERMAL'    D 417  3.150 2.000 ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.number_reflns_R_work             6498 
_refine_ls_shell.R_factor_R_work                  0.301 
_refine_ls_shell.percent_reflns_obs               96.15 
_refine_ls_shell.R_factor_R_free                  0.310 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             175 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_struct_ncs_oper.code 
_struct_ncs_oper.id 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
_struct_ncs_oper.details 
given 1 1.000000 0.000000 0.000000 0.000000 1.000000  0.000000 0.000000 0.000000 1.000000  0.000000    0.000000  0.000000   ? 
given 2 0.817381 0.005808 0.576068 0.006596 -0.999978 0.000723 0.576060 0.003209 -0.817401 -112.851097 57.063320 355.734009 ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
2 1 C 
2 2 P 
3 1 D 
3 2 T 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 4 A 20 A 517 ? ? ? ? ? ? ? ? ? 
1 2 1 4 B 20 B 517 ? ? ? ? ? ? ? ? ? 
2 1 1 4 C 5  C 13  ? ? ? ? ? ? ? ? ? 
2 2 1 4 P 5  P 13  ? ? ? ? ? ? ? ? ? 
3 1 1 4 D 2  D 14  ? ? ? ? ? ? ? ? ? 
3 2 1 4 T 2  T 14  ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                     6CST 
_struct.title                        'Structure of human DNA polymerase kappa with DNA' 
_struct.pdbx_descriptor              'DNA polymerase kappa/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CST 
_struct_keywords.text            
'DNA polymerase kappa, translesion synthesis, DNA replication, REPLICATION, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   'REPLICATION, TRANSFERASE/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 2  ? 
D  N N 3  ? 
E  N N 2  ? 
F  N N 3  ? 
G  N N 4  ? 
H  N N 4  ? 
I  N N 5  ? 
J  N N 5  ? 
K  N N 5  ? 
L  N N 5  ? 
M  N N 6  ? 
N  N N 6  ? 
O  N N 6  ? 
P  N N 7  ? 
Q  N N 7  ? 
R  N N 7  ? 
S  N N 7  ? 
T  N N 7  ? 
U  N N 7  ? 
V  N N 7  ? 
W  N N 7  ? 
X  N N 7  ? 
Y  N N 8  ? 
Z  N N 9  ? 
AA N N 10 ? 
BA N N 10 ? 
CA N N 10 ? 
DA N N 10 ? 
EA N N 10 ? 
FA N N 11 ? 
GA N N 4  ? 
HA N N 4  ? 
IA N N 5  ? 
JA N N 6  ? 
KA N N 6  ? 
LA N N 6  ? 
MA N N 7  ? 
NA N N 8  ? 
OA N N 10 ? 
PA N N 10 ? 
QA N N 10 ? 
RA N N 10 ? 
SA N N 11 ? 
TA N N 11 ? 
UA N N 11 ? 
VA N N 12 ? 
WA N N 12 ? 
XA N N 12 ? 
YA N N 12 ? 
ZA N N 12 ? 
AB N N 12 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 57  ? LYS A 70  ? ASP A 32  LYS A 45  1 ? 14 
HELX_P HELX_P2  AA2 SER A 72  ? ILE A 99  ? SER A 47  ILE A 74  1 ? 28 
HELX_P HELX_P3  AA3 THR A 100 ? SER A 121 ? THR A 75  SER A 96  1 ? 22 
HELX_P HELX_P4  AA4 ALA A 135 ? ASN A 145 ? ALA A 110 ASN A 120 1 ? 11 
HELX_P HELX_P5  AA5 PRO A 146 ? LYS A 149 ? PRO A 121 LYS A 124 5 ? 4  
HELX_P HELX_P6  AA6 ASN A 165 ? ARG A 170 ? ASN A 140 ARG A 145 1 ? 6  
HELX_P HELX_P7  AA7 PRO A 178 ? CYS A 186 ? PRO A 153 CYS A 161 1 ? 9  
HELX_P HELX_P8  AA8 ASN A 195 ? ASP A 212 ? ASN A 170 ASP A 187 1 ? 18 
HELX_P HELX_P9  AA9 ILE A 229 ? GLN A 237 ? ILE A 204 GLN A 212 1 ? 9  
HELX_P HELX_P10 AB1 ASN A 238 ? TRP A 239 ? ASN A 213 TRP A 214 5 ? 2  
HELX_P HELX_P11 AB2 PRO A 240 ? LYS A 243 ? PRO A 215 LYS A 218 5 ? 4  
HELX_P HELX_P12 AB3 SER A 314 ? THR A 331 ? SER A 289 THR A 306 1 ? 18 
HELX_P HELX_P13 AB4 ASN A 341 ? ASN A 352 ? ASN A 316 ASN A 327 1 ? 12 
HELX_P HELX_P14 AB5 ASN A 363 ? LYS A 372 ? ASN A 338 LYS A 347 1 ? 10 
HELX_P HELX_P15 AB6 PRO A 375 ? VAL A 379 ? PRO A 350 VAL A 354 5 ? 5  
HELX_P HELX_P16 AB7 GLY A 383 ? LEU A 393 ? GLY A 358 LEU A 368 1 ? 11 
HELX_P HELX_P17 AB8 THR A 397 ? GLN A 404 ? THR A 372 GLN A 379 1 ? 8  
HELX_P HELX_P18 AB9 GLN A 404 ? PHE A 412 ? GLN A 379 PHE A 387 1 ? 9  
HELX_P HELX_P19 AC1 SER A 413 ? LEU A 425 ? SER A 388 LEU A 400 1 ? 13 
HELX_P HELX_P20 AC2 LYS A 452 ? GLU A 474 ? LYS A 427 GLU A 449 1 ? 23 
HELX_P HELX_P21 AC3 THR A 505 ? PHE A 525 ? THR A 480 PHE A 500 1 ? 21 
HELX_P HELX_P22 AC4 ASP B 57  ? LYS B 70  ? ASP B 32  LYS B 45  1 ? 14 
HELX_P HELX_P23 AC5 SER B 72  ? ILE B 99  ? SER B 47  ILE B 74  1 ? 28 
HELX_P HELX_P24 AC6 THR B 100 ? SER B 121 ? THR B 75  SER B 96  1 ? 22 
HELX_P HELX_P25 AC7 ALA B 135 ? ASP B 144 ? ALA B 110 ASP B 119 1 ? 10 
HELX_P HELX_P26 AC8 ASN B 145 ? LYS B 149 ? ASN B 120 LYS B 124 5 ? 5  
HELX_P HELX_P27 AC9 ASN B 165 ? ARG B 170 ? ASN B 140 ARG B 145 1 ? 6  
HELX_P HELX_P28 AD1 PRO B 178 ? CYS B 186 ? PRO B 153 CYS B 161 1 ? 9  
HELX_P HELX_P29 AD2 ASN B 195 ? ASP B 214 ? ASN B 170 ASP B 189 1 ? 20 
HELX_P HELX_P30 AD3 ILE B 229 ? GLN B 237 ? ILE B 204 GLN B 212 1 ? 9  
HELX_P HELX_P31 AD4 ASN B 238 ? TRP B 239 ? ASN B 213 TRP B 214 5 ? 2  
HELX_P HELX_P32 AD5 PRO B 240 ? LYS B 243 ? PRO B 215 LYS B 218 5 ? 4  
HELX_P HELX_P33 AD6 SER B 314 ? THR B 331 ? SER B 289 THR B 306 1 ? 18 
HELX_P HELX_P34 AD7 ASN B 341 ? ASN B 352 ? ASN B 316 ASN B 327 1 ? 12 
HELX_P HELX_P35 AD8 ASN B 363 ? LYS B 372 ? ASN B 338 LYS B 347 1 ? 10 
HELX_P HELX_P36 AD9 PRO B 375 ? VAL B 379 ? PRO B 350 VAL B 354 5 ? 5  
HELX_P HELX_P37 AE1 GLY B 383 ? LEU B 393 ? GLY B 358 LEU B 368 1 ? 11 
HELX_P HELX_P38 AE2 THR B 397 ? GLN B 404 ? THR B 372 GLN B 379 1 ? 8  
HELX_P HELX_P39 AE3 GLN B 404 ? PHE B 412 ? GLN B 379 PHE B 387 1 ? 9  
HELX_P HELX_P40 AE4 SER B 413 ? LEU B 425 ? SER B 388 LEU B 400 1 ? 13 
HELX_P HELX_P41 AE5 LYS B 452 ? GLU B 474 ? LYS B 427 GLU B 449 1 ? 23 
HELX_P HELX_P42 AE6 THR B 505 ? PHE B 525 ? THR B 480 PHE B 500 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A  ASP 132 OD1 ? ? ? 1_555 G  MG  .  MG  ? ? A ASP 107 A MG  601 1_555 ? ? ? ? ? ? ?            2.001 ? 
metalc2  metalc ? ? A  ASP 132 OD2 ? ? ? 1_555 H  MG  .  MG  ? ? A ASP 107 A MG  602 1_555 ? ? ? ? ? ? ?            2.662 ? 
metalc3  metalc ? ? A  MET 133 O   ? ? ? 1_555 G  MG  .  MG  ? ? A MET 108 A MG  601 1_555 ? ? ? ? ? ? ?            2.148 ? 
metalc4  metalc ? ? A  ASP 223 OD1 ? ? ? 1_555 H  MG  .  MG  ? ? A ASP 198 A MG  602 1_555 ? ? ? ? ? ? ?            2.438 ? 
metalc5  metalc ? ? A  ASP 223 OD2 ? ? ? 1_555 G  MG  .  MG  ? ? A ASP 198 A MG  601 1_555 ? ? ? ? ? ? ?            2.097 ? 
metalc6  metalc ? ? A  GLU 224 OE1 ? ? ? 1_555 H  MG  .  MG  ? ? A GLU 199 A MG  602 1_555 ? ? ? ? ? ? ?            2.178 ? 
metalc7  metalc ? ? B  ASP 132 OD1 ? ? ? 1_555 GA MG  .  MG  ? ? B ASP 107 B MG  601 1_555 ? ? ? ? ? ? ?            2.082 ? 
metalc8  metalc ? ? B  MET 133 O   ? ? ? 1_555 GA MG  .  MG  ? ? B MET 108 B MG  601 1_555 ? ? ? ? ? ? ?            2.283 ? 
metalc9  metalc ? ? B  ASP 223 OD1 ? ? ? 1_555 HA MG  .  MG  ? ? B ASP 198 B MG  602 1_555 ? ? ? ? ? ? ?            2.621 ? 
metalc10 metalc ? ? B  ASP 223 OD2 ? ? ? 1_555 GA MG  .  MG  ? ? B ASP 198 B MG  601 1_555 ? ? ? ? ? ? ?            2.174 ? 
metalc11 metalc ? ? B  GLU 224 OE2 ? ? ? 1_555 HA MG  .  MG  ? ? B GLU 199 B MG  602 1_555 ? ? ? ? ? ? ?            2.466 ? 
metalc12 metalc ? ? D  DC  3   OP2 ? ? ? 1_555 UA K   .  K   ? ? D DC  4   D K   101 1_555 ? ? ? ? ? ? ?            2.889 ? 
metalc13 metalc ? ? G  MG  .   MG  ? ? ? 1_555 Y  DZ4 .  O1B ? ? A MG  601 A DZ4 619 1_555 ? ? ? ? ? ? ?            2.239 ? 
metalc14 metalc ? ? G  MG  .   MG  ? ? ? 1_555 Y  DZ4 .  O2G ? ? A MG  601 A DZ4 619 1_555 ? ? ? ? ? ? ?            2.145 ? 
metalc15 metalc ? ? G  MG  .   MG  ? ? ? 1_555 Y  DZ4 .  O2A ? ? A MG  601 A DZ4 619 1_555 ? ? ? ? ? ? ?            2.072 ? 
metalc16 metalc ? ? H  MG  .   MG  ? ? ? 1_555 Y  DZ4 .  O2A ? ? A MG  602 A DZ4 619 1_555 ? ? ? ? ? ? ?            2.489 ? 
metalc17 metalc ? ? H  MG  .   MG  ? ? ? 1_555 VA HOH .  O   ? ? A MG  602 A HOH 804 1_555 ? ? ? ? ? ? ?            2.157 ? 
metalc18 metalc ? ? FA K   .   K   ? ? ? 1_555 VA HOH .  O   ? ? A K   626 A HOH 865 1_555 ? ? ? ? ? ? ?            3.313 ? 
metalc19 metalc ? ? GA MG  .   MG  ? ? ? 1_555 NA DZ4 .  O1B ? ? B MG  601 B DZ4 608 1_555 ? ? ? ? ? ? ?            2.227 ? 
metalc20 metalc ? ? GA MG  .   MG  ? ? ? 1_555 NA DZ4 .  O2A ? ? B MG  601 B DZ4 608 1_555 ? ? ? ? ? ? ?            2.015 ? 
metalc21 metalc ? ? GA MG  .   MG  ? ? ? 1_555 NA DZ4 .  O2G ? ? B MG  601 B DZ4 608 1_555 ? ? ? ? ? ? ?            2.132 ? 
metalc22 metalc ? ? HA MG  .   MG  ? ? ? 1_555 NA DZ4 .  O2A ? ? B MG  602 B DZ4 608 1_555 ? ? ? ? ? ? ?            2.659 ? 
metalc23 metalc ? ? SA K   .   K   ? ? ? 1_555 WA HOH .  O   ? ? B K   613 B HOH 836 1_555 ? ? ? ? ? ? ?            2.355 ? 
metalc24 metalc ? ? SA K   .   K   ? ? ? 1_555 WA HOH .  O   ? ? B K   613 B HOH 803 1_555 ? ? ? ? ? ? ?            3.035 ? 
metalc25 metalc ? ? TA K   .   K   ? ? ? 1_555 WA HOH .  O   ? ? B K   614 B HOH 824 1_555 ? ? ? ? ? ? ?            3.315 ? 
metalc26 metalc ? ? UA K   .   K   ? ? ? 1_555 VA HOH .  O   ? ? D K   101 A HOH 869 1_555 ? ? ? ? ? ? ?            3.344 ? 
hydrog1  hydrog ? ? C  DA  1   N1  ? ? ? 1_555 D  DT  13 N3  ? ? C DA  5   D DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C  DA  1   N6  ? ? ? 1_555 D  DT  13 O4  ? ? C DA  5   D DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C  DT  2   N3  ? ? ? 1_555 D  DA  12 N1  ? ? C DT  6   D DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C  DT  2   O4  ? ? ? 1_555 D  DA  12 N6  ? ? C DT  6   D DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C  DA  3   N1  ? ? ? 1_555 D  DT  11 N3  ? ? C DA  7   D DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C  DA  3   N6  ? ? ? 1_555 D  DT  11 O4  ? ? C DA  7   D DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C  DC  4   N3  ? ? ? 1_555 D  DG  10 N1  ? ? C DC  8   D DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C  DC  4   N4  ? ? ? 1_555 D  DG  10 O6  ? ? C DC  8   D DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C  DC  4   O2  ? ? ? 1_555 D  DG  10 N2  ? ? C DC  8   D DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C  DA  5   N1  ? ? ? 1_555 D  DT  9  N3  ? ? C DA  9   D DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C  DA  5   N6  ? ? ? 1_555 D  DT  9  O4  ? ? C DA  9   D DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C  DT  6   N3  ? ? ? 1_555 D  DA  8  N1  ? ? C DT  10  D DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C  DT  6   O4  ? ? ? 1_555 D  DA  8  N6  ? ? C DT  10  D DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C  DA  7   N1  ? ? ? 1_555 D  DT  7  N3  ? ? C DA  11  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C  DA  7   N6  ? ? ? 1_555 D  DT  7  O4  ? ? C DA  11  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C  DC  8   N3  ? ? ? 1_555 D  DG  6  N1  ? ? C DC  12  D DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C  DC  8   N4  ? ? ? 1_555 D  DG  6  O6  ? ? C DC  12  D DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C  DC  8   O2  ? ? ? 1_555 D  DG  6  N2  ? ? C DC  12  D DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C  DC  9   N3  ? ? ? 1_555 D  DG  5  N1  ? ? C DC  13  D DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C  DC  9   N4  ? ? ? 1_555 D  DG  5  O6  ? ? C DC  13  D DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C  DC  9   O2  ? ? ? 1_555 D  DG  5  N2  ? ? C DC  13  D DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? E  DA  1   N1  ? ? ? 1_555 F  DT  13 N3  ? ? P DA  5   T DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? E  DA  1   N6  ? ? ? 1_555 F  DT  13 O4  ? ? P DA  5   T DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? E  DT  2   N3  ? ? ? 1_555 F  DA  12 N1  ? ? P DT  6   T DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? E  DT  2   O4  ? ? ? 1_555 F  DA  12 N6  ? ? P DT  6   T DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? E  DA  3   N1  ? ? ? 1_555 F  DT  11 N3  ? ? P DA  7   T DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? E  DA  3   N6  ? ? ? 1_555 F  DT  11 O4  ? ? P DA  7   T DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? E  DC  4   N3  ? ? ? 1_555 F  DG  10 N1  ? ? P DC  8   T DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? E  DC  4   N4  ? ? ? 1_555 F  DG  10 O6  ? ? P DC  8   T DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? E  DC  4   O2  ? ? ? 1_555 F  DG  10 N2  ? ? P DC  8   T DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? E  DA  5   N1  ? ? ? 1_555 F  DT  9  N3  ? ? P DA  9   T DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? E  DA  5   N6  ? ? ? 1_555 F  DT  9  O4  ? ? P DA  9   T DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? E  DT  6   N3  ? ? ? 1_555 F  DA  8  N1  ? ? P DT  10  T DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? E  DT  6   O4  ? ? ? 1_555 F  DA  8  N6  ? ? P DT  10  T DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? E  DA  7   N1  ? ? ? 1_555 F  DT  7  N3  ? ? P DA  11  T DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? E  DA  7   N6  ? ? ? 1_555 F  DT  7  O4  ? ? P DA  11  T DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E  DC  8   N3  ? ? ? 1_555 F  DG  6  N1  ? ? P DC  12  T DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E  DC  8   N4  ? ? ? 1_555 F  DG  6  O6  ? ? P DC  12  T DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? E  DC  8   O2  ? ? ? 1_555 F  DG  6  N2  ? ? P DC  12  T DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? E  DC  9   N3  ? ? ? 1_555 F  DG  5  N1  ? ? P DC  13  T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? E  DC  9   N4  ? ? ? 1_555 F  DG  5  O6  ? ? P DC  13  T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? E  DC  9   O2  ? ? ? 1_555 F  DG  5  N2  ? ? P DC  13  T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 353 A . ? LYS 328 A PRO 354 A ? PRO 329 A 1 -4.29 
2 PHE 525 A . ? PHE 500 A PRO 526 A ? PRO 501 A 1 6.33  
3 LYS 353 B . ? LYS 328 B PRO 354 B ? PRO 329 B 1 0.09  
4 PHE 525 B . ? PHE 500 B PRO 526 B ? PRO 501 B 1 2.68  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 4 ? 
AA5 ? 5 ? 
AA6 ? 3 ? 
AA7 ? 2 ? 
AA8 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 218 ? ALA A 219 ? MET A 193 ALA A 194 
AA1 2 GLU A 224 ? ASN A 228 ? GLU A 199 ASN A 203 
AA1 3 ILE A 128 ? MET A 133 ? ILE A 103 MET A 108 
AA1 4 ALA A 334 ? ALA A 339 ? ALA A 309 ALA A 314 
AA1 5 GLN A 357 ? GLN A 359 ? GLN A 332 GLN A 334 
AA2 1 LEU A 161 ? SER A 164 ? LEU A 136 SER A 139 
AA2 2 ILE A 153 ? GLY A 156 ? ILE A 128 GLY A 131 
AA2 3 ILE A 190 ? VAL A 192 ? ILE A 165 VAL A 167 
AA3 1 ARG A 245 ? PHE A 247 ? ARG A 220 PHE A 222 
AA3 2 SER A 308 ? VAL A 310 ? SER A 283 VAL A 285 
AA4 1 SER A 440 ? ILE A 450 ? SER A 415 ILE A 425 
AA4 2 LEU A 531 ? SER A 539 ? LEU A 506 SER A 514 
AA4 3 GLY A 478 ? ASN A 487 ? GLY A 453 ASN A 462 
AA4 4 VAL A 492 ? VAL A 503 ? VAL A 467 VAL A 478 
AA5 1 MET B 218 ? ALA B 219 ? MET B 193 ALA B 194 
AA5 2 GLU B 224 ? ASN B 228 ? GLU B 199 ASN B 203 
AA5 3 ILE B 128 ? MET B 133 ? ILE B 103 MET B 108 
AA5 4 ALA B 334 ? ALA B 339 ? ALA B 309 ALA B 314 
AA5 5 GLN B 357 ? GLN B 359 ? GLN B 332 GLN B 334 
AA6 1 MET B 160 ? SER B 164 ? MET B 135 SER B 139 
AA6 2 ILE B 153 ? SER B 157 ? ILE B 128 SER B 132 
AA6 3 ILE B 190 ? VAL B 192 ? ILE B 165 VAL B 167 
AA7 1 ARG B 245 ? PHE B 247 ? ARG B 220 PHE B 222 
AA7 2 SER B 308 ? VAL B 310 ? SER B 283 VAL B 285 
AA8 1 SER B 440 ? ILE B 450 ? SER B 415 ILE B 425 
AA8 2 LEU B 531 ? SER B 539 ? LEU B 506 SER B 514 
AA8 3 GLY B 478 ? ASN B 487 ? GLY B 453 ASN B 462 
AA8 4 VAL B 492 ? VAL B 503 ? VAL B 467 VAL B 478 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N MET A 218 ? N MET A 193 O TYR A 226 ? O TYR A 201 
AA1 2 3 O ALA A 225 ? O ALA A 200 N ILE A 131 ? N ILE A 106 
AA1 3 4 N ILE A 128 ? N ILE A 103 O ALA A 339 ? O ALA A 314 
AA1 4 5 N ILE A 338 ? N ILE A 313 O TYR A 358 ? O TYR A 333 
AA2 1 2 O SER A 162 ? O SER A 137 N VAL A 155 ? N VAL A 130 
AA2 2 3 N ALA A 154 ? N ALA A 129 O VAL A 192 ? O VAL A 167 
AA3 1 2 N TYR A 246 ? N TYR A 221 O VAL A 309 ? O VAL A 284 
AA4 1 2 N MET A 441 ? N MET A 416 O ILE A 538 ? O ILE A 513 
AA4 2 3 O ARG A 537 ? O ARG A 512 N THR A 482 ? N THR A 457 
AA4 3 4 N GLY A 478 ? N GLY A 453 O VAL A 503 ? O VAL A 478 
AA5 1 2 N MET B 218 ? N MET B 193 O TYR B 226 ? O TYR B 201 
AA5 2 3 O LEU B 227 ? O LEU B 202 N VAL B 129 ? N VAL B 104 
AA5 3 4 N ILE B 128 ? N ILE B 103 O ALA B 339 ? O ALA B 314 
AA5 4 5 N ILE B 338 ? N ILE B 313 O TYR B 358 ? O TYR B 333 
AA6 1 2 O MET B 160 ? O MET B 135 N SER B 157 ? N SER B 132 
AA6 2 3 N ALA B 154 ? N ALA B 129 O VAL B 192 ? O VAL B 167 
AA7 1 2 N TYR B 246 ? N TYR B 221 O VAL B 309 ? O VAL B 284 
AA8 1 2 N MET B 441 ? N MET B 416 O ILE B 538 ? O ILE B 513 
AA8 2 3 O ARG B 532 ? O ARG B 507 N LYS B 486 ? N LYS B 461 
AA8 3 4 N LEU B 485 ? N LEU B 460 O LYS B 493 ? O LYS B 468 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  601 ? 4  'binding site for residue MG A 601'  
AC2 Software A MG  602 ? 6  'binding site for residue MG A 602'  
AC3 Software A PEG 603 ? 4  'binding site for residue PEG A 603' 
AC4 Software A PEG 604 ? 5  'binding site for residue PEG A 604' 
AC5 Software A PEG 605 ? 3  'binding site for residue PEG A 605' 
AC6 Software A PEG 606 ? 4  'binding site for residue PEG A 606' 
AC7 Software A IOD 608 ? 1  'binding site for residue IOD A 608' 
AC8 Software A EDO 612 ? 3  'binding site for residue EDO A 612' 
AC9 Software A EDO 613 ? 1  'binding site for residue EDO A 613' 
AD1 Software A EDO 614 ? 2  'binding site for residue EDO A 614' 
AD2 Software A EDO 615 ? 5  'binding site for residue EDO A 615' 
AD3 Software A EDO 616 ? 5  'binding site for residue EDO A 616' 
AD4 Software A EDO 617 ? 8  'binding site for residue EDO A 617' 
AD5 Software A EDO 618 ? 4  'binding site for residue EDO A 618' 
AD6 Software A DZ4 619 ? 25 'binding site for residue DZ4 A 619' 
AD7 Software A PGE 620 ? 2  'binding site for residue PGE A 620' 
AD8 Software A CL  623 ? 2  'binding site for residue CL A 623'  
AD9 Software A CL  625 ? 1  'binding site for residue CL A 625'  
AE1 Software B MG  601 ? 4  'binding site for residue MG B 601'  
AE2 Software B MG  602 ? 5  'binding site for residue MG B 602'  
AE3 Software B PEG 603 ? 5  'binding site for residue PEG B 603' 
AE4 Software B EDO 607 ? 1  'binding site for residue EDO B 607' 
AE5 Software B DZ4 608 ? 22 'binding site for residue DZ4 B 608' 
AE6 Software B CL  610 ? 1  'binding site for residue CL B 610'  
AE7 Software B CL  612 ? 2  'binding site for residue CL B 612'  
AE8 Software B K   613 ? 2  'binding site for residue K B 613'   
AE9 Software D K   101 ? 1  'binding site for residue K D 101'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  ASP A  132 ? ASP A 107 . ? 1_555 ? 
2   AC1 4  MET A  133 ? MET A 108 . ? 1_555 ? 
3   AC1 4  ASP A  223 ? ASP A 198 . ? 1_555 ? 
4   AC1 4  DZ4 Y  .   ? DZ4 A 619 . ? 1_555 ? 
5   AC2 6  ASP A  132 ? ASP A 107 . ? 1_555 ? 
6   AC2 6  ASP A  223 ? ASP A 198 . ? 1_555 ? 
7   AC2 6  GLU A  224 ? GLU A 199 . ? 1_555 ? 
8   AC2 6  DZ4 Y  .   ? DZ4 A 619 . ? 1_555 ? 
9   AC2 6  HOH VA .   ? HOH A 804 . ? 1_555 ? 
10  AC2 6  DC  C  9   ? DC  C 13  . ? 1_555 ? 
11  AC3 4  ALA A  135 ? ALA A 110 . ? 1_555 ? 
12  AC3 4  ASN A  165 ? ASN A 140 . ? 1_555 ? 
13  AC3 4  TYR A  166 ? TYR A 141 . ? 1_555 ? 
14  AC3 4  HIS A  167 ? HIS A 142 . ? 1_555 ? 
15  AC4 5  HIS A  422 ? HIS A 397 . ? 1_555 ? 
16  AC4 5  GLY A  428 ? GLY A 403 . ? 1_555 ? 
17  AC4 5  HOH VA .   ? HOH A 710 . ? 1_555 ? 
18  AC4 5  HOH VA .   ? HOH A 769 . ? 1_555 ? 
19  AC4 5  HOH VA .   ? HOH A 832 . ? 1_555 ? 
20  AC5 3  LYS A  96  ? LYS A 71  . ? 1_555 ? 
21  AC5 3  ALA A  97  ? ALA A 72  . ? 1_555 ? 
22  AC5 3  PEG L  .   ? PEG A 606 . ? 1_555 ? 
23  AC6 4  MET A  93  ? MET A 68  . ? 1_555 ? 
24  AC6 4  LYS A  96  ? LYS A 71  . ? 1_555 ? 
25  AC6 4  GLN A  404 ? GLN A 379 . ? 1_555 ? 
26  AC6 4  PEG K  .   ? PEG A 605 . ? 1_555 ? 
27  AC7 1  ASP A  57  ? ASP A 32  . ? 1_555 ? 
28  AC8 3  ASN A  352 ? ASN A 327 . ? 1_555 ? 
29  AC8 3  GLY A  356 ? GLY A 331 . ? 1_555 ? 
30  AC8 3  GLN A  357 ? GLN A 332 . ? 1_555 ? 
31  AC9 1  PRO A  542 ? PRO A 517 . ? 1_555 ? 
32  AD1 2  LYS A  351 ? LYS A 326 . ? 1_555 ? 
33  AD1 2  EDO U  .   ? EDO A 615 . ? 1_555 ? 
34  AD2 5  LYS A  351 ? LYS A 326 . ? 1_555 ? 
35  AD2 5  PHE A  370 ? PHE A 345 . ? 1_555 ? 
36  AD2 5  LEU A  374 ? LEU A 349 . ? 1_555 ? 
37  AD2 5  EDO T  .   ? EDO A 614 . ? 1_555 ? 
38  AD2 5  HOH VA .   ? HOH A 747 . ? 1_555 ? 
39  AD3 5  GLN A  461 ? GLN A 436 . ? 1_555 ? 
40  AD3 5  ALA A  506 ? ALA A 481 . ? 1_555 ? 
41  AD3 5  GLU A  507 ? GLU A 482 . ? 1_555 ? 
42  AD3 5  PHE A  510 ? PHE A 485 . ? 1_555 ? 
43  AD3 5  HOH VA .   ? HOH A 723 . ? 1_555 ? 
44  AD4 8  GLU A  234 ? GLU A 209 . ? 4_457 ? 
45  AD4 8  PRO A  375 ? PRO A 350 . ? 1_555 ? 
46  AD4 8  ILE A  396 ? ILE A 371 . ? 1_555 ? 
47  AD4 8  THR A  397 ? THR A 372 . ? 1_555 ? 
48  AD4 8  HOH VA .   ? HOH A 701 . ? 1_555 ? 
49  AD4 8  HOH VA .   ? HOH A 702 . ? 1_555 ? 
50  AD4 8  HOH VA .   ? HOH A 718 . ? 1_555 ? 
51  AD4 8  HOH VA .   ? HOH A 853 . ? 1_555 ? 
52  AD5 4  ARG A  43  ? ARG A 18  . ? 1_555 ? 
53  AD5 4  HOH VA .   ? HOH A 703 . ? 1_555 ? 
54  AD5 4  HOH VA .   ? HOH A 819 . ? 1_555 ? 
55  AD5 4  DA  C  7   ? DA  C 11  . ? 1_555 ? 
56  AD6 25 LYS A  50  ? LYS A 25  . ? 1_555 ? 
57  AD6 25 ASP A  132 ? ASP A 107 . ? 1_555 ? 
58  AD6 25 MET A  133 ? MET A 108 . ? 1_555 ? 
59  AD6 25 ASP A  134 ? ASP A 109 . ? 1_555 ? 
60  AD6 25 ALA A  135 ? ALA A 110 . ? 1_555 ? 
61  AD6 25 PHE A  136 ? PHE A 111 . ? 1_555 ? 
62  AD6 25 TYR A  137 ? TYR A 112 . ? 1_555 ? 
63  AD6 25 SER A  162 ? SER A 137 . ? 1_555 ? 
64  AD6 25 THR A  163 ? THR A 138 . ? 1_555 ? 
65  AD6 25 TYR A  166 ? TYR A 141 . ? 1_555 ? 
66  AD6 25 ARG A  169 ? ARG A 144 . ? 1_555 ? 
67  AD6 25 ASP A  223 ? ASP A 198 . ? 1_555 ? 
68  AD6 25 LYS A  353 ? LYS A 328 . ? 1_555 ? 
69  AD6 25 MG  G  .   ? MG  A 601 . ? 1_555 ? 
70  AD6 25 MG  H  .   ? MG  A 602 . ? 1_555 ? 
71  AD6 25 HOH VA .   ? HOH A 732 . ? 1_555 ? 
72  AD6 25 HOH VA .   ? HOH A 757 . ? 1_555 ? 
73  AD6 25 HOH VA .   ? HOH A 778 . ? 1_555 ? 
74  AD6 25 HOH VA .   ? HOH A 791 . ? 1_555 ? 
75  AD6 25 HOH VA .   ? HOH A 796 . ? 1_555 ? 
76  AD6 25 HOH VA .   ? HOH A 804 . ? 1_555 ? 
77  AD6 25 HOH VA .   ? HOH A 850 . ? 1_555 ? 
78  AD6 25 HOH VA .   ? HOH A 874 . ? 1_555 ? 
79  AD6 25 DC  C  9   ? DC  C 13  . ? 1_555 ? 
80  AD6 25 DT  D  4   ? DT  D 5   . ? 1_555 ? 
81  AD7 2  ASN A  352 ? ASN A 327 . ? 1_555 ? 
82  AD7 2  PRO A  354 ? PRO A 329 . ? 1_555 ? 
83  AD8 2  ASP A  197 ? ASP A 172 . ? 1_555 ? 
84  AD8 2  HOH VA .   ? HOH A 760 . ? 1_555 ? 
85  AD9 1  MET A  44  ? MET A 19  . ? 1_555 ? 
86  AE1 4  ASP B  132 ? ASP B 107 . ? 1_555 ? 
87  AE1 4  MET B  133 ? MET B 108 . ? 1_555 ? 
88  AE1 4  ASP B  223 ? ASP B 198 . ? 1_555 ? 
89  AE1 4  DZ4 NA .   ? DZ4 B 608 . ? 1_555 ? 
90  AE2 5  ASP B  132 ? ASP B 107 . ? 1_555 ? 
91  AE2 5  ASP B  223 ? ASP B 198 . ? 1_555 ? 
92  AE2 5  GLU B  224 ? GLU B 199 . ? 1_555 ? 
93  AE2 5  DZ4 NA .   ? DZ4 B 608 . ? 1_555 ? 
94  AE2 5  DC  E  9   ? DC  P 13  . ? 1_555 ? 
95  AE3 5  ASP B  134 ? ASP B 109 . ? 1_555 ? 
96  AE3 5  MET B  142 ? MET B 117 . ? 1_555 ? 
97  AE3 5  ASN B  165 ? ASN B 140 . ? 1_555 ? 
98  AE3 5  TYR B  166 ? TYR B 141 . ? 1_555 ? 
99  AE3 5  HIS B  167 ? HIS B 142 . ? 1_555 ? 
100 AE4 1  TYR B  457 ? TYR B 432 . ? 1_555 ? 
101 AE5 22 ASP B  132 ? ASP B 107 . ? 1_555 ? 
102 AE5 22 MET B  133 ? MET B 108 . ? 1_555 ? 
103 AE5 22 ASP B  134 ? ASP B 109 . ? 1_555 ? 
104 AE5 22 ALA B  135 ? ALA B 110 . ? 1_555 ? 
105 AE5 22 PHE B  136 ? PHE B 111 . ? 1_555 ? 
106 AE5 22 TYR B  137 ? TYR B 112 . ? 1_555 ? 
107 AE5 22 SER B  162 ? SER B 137 . ? 1_555 ? 
108 AE5 22 THR B  163 ? THR B 138 . ? 1_555 ? 
109 AE5 22 TYR B  166 ? TYR B 141 . ? 1_555 ? 
110 AE5 22 ARG B  169 ? ARG B 144 . ? 1_555 ? 
111 AE5 22 ASP B  223 ? ASP B 198 . ? 1_555 ? 
112 AE5 22 LYS B  353 ? LYS B 328 . ? 1_555 ? 
113 AE5 22 MG  GA .   ? MG  B 601 . ? 1_555 ? 
114 AE5 22 MG  HA .   ? MG  B 602 . ? 1_555 ? 
115 AE5 22 HOH WA .   ? HOH B 756 . ? 1_555 ? 
116 AE5 22 HOH WA .   ? HOH B 769 . ? 1_555 ? 
117 AE5 22 HOH WA .   ? HOH B 772 . ? 1_555 ? 
118 AE5 22 HOH WA .   ? HOH B 773 . ? 1_555 ? 
119 AE5 22 HOH WA .   ? HOH B 833 . ? 1_555 ? 
120 AE5 22 DC  E  9   ? DC  P 13  . ? 1_555 ? 
121 AE5 22 DT  F  4   ? DT  T 5   . ? 1_555 ? 
122 AE5 22 DG  F  5   ? DG  T 6   . ? 1_555 ? 
123 AE6 1  ARG B  200 ? ARG B 175 . ? 1_555 ? 
124 AE7 2  LYS B  207 ? LYS B 182 . ? 1_555 ? 
125 AE7 2  SER B  221 ? SER B 196 . ? 1_555 ? 
126 AE8 2  HOH WA .   ? HOH B 803 . ? 1_555 ? 
127 AE8 2  HOH WA .   ? HOH B 836 . ? 1_555 ? 
128 AE9 1  DC  D  3   ? DC  D 4   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6CST 
_atom_sites.fract_transf_matrix[1][1]   0.014797 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008024 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006059 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
I  
K  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LEU A  1  41  ? 9.004   51.153  180.402 1.00 74.47  ? 16  LEU A N     1 
ATOM   2    C  CA    . LEU A  1  41  ? 8.581   49.789  180.877 1.00 79.85  ? 16  LEU A CA    1 
ATOM   3    C  C     . LEU A  1  41  ? 9.528   49.199  181.941 1.00 83.33  ? 16  LEU A C     1 
ATOM   4    O  O     . LEU A  1  41  ? 9.086   48.498  182.863 1.00 78.59  ? 16  LEU A O     1 
ATOM   5    C  CB    . LEU A  1  41  ? 8.412   48.836  179.682 1.00 81.90  ? 16  LEU A CB    1 
ATOM   6    C  CG    . LEU A  1  41  ? 7.239   49.186  178.742 1.00 81.13  ? 16  LEU A CG    1 
ATOM   7    C  CD1   . LEU A  1  41  ? 7.415   48.587  177.351 1.00 76.16  ? 16  LEU A CD1   1 
ATOM   8    C  CD2   . LEU A  1  41  ? 5.903   48.758  179.348 1.00 82.56  ? 16  LEU A CD2   1 
ATOM   9    N  N     . LEU A  1  42  ? 10.823  49.477  181.777 1.00 85.07  ? 17  LEU A N     1 
ATOM   10   C  CA    . LEU A  1  42  ? 11.858  49.330  182.821 1.00 88.00  ? 17  LEU A CA    1 
ATOM   11   C  C     . LEU A  1  42  ? 12.382  47.883  183.006 1.00 92.64  ? 17  LEU A C     1 
ATOM   12   O  O     . LEU A  1  42  ? 13.134  47.394  182.154 1.00 90.82  ? 17  LEU A O     1 
ATOM   13   C  CB    . LEU A  1  42  ? 11.412  49.993  184.143 1.00 85.60  ? 17  LEU A CB    1 
ATOM   14   N  N     . ARG A  1  43  ? 12.010  47.217  184.102 1.00 95.62  ? 18  ARG A N     1 
ATOM   15   C  CA    . ARG A  1  43  ? 12.450  45.844  184.401 1.00 96.33  ? 18  ARG A CA    1 
ATOM   16   C  C     . ARG A  1  43  ? 11.259  44.887  184.266 1.00 97.30  ? 18  ARG A C     1 
ATOM   17   O  O     . ARG A  1  43  ? 11.272  43.949  183.451 1.00 88.48  ? 18  ARG A O     1 
ATOM   18   C  CB    . ARG A  1  43  ? 13.015  45.753  185.829 1.00 95.28  ? 18  ARG A CB    1 
ATOM   19   C  CG    . ARG A  1  43  ? 14.380  46.392  186.068 1.00 95.26  ? 18  ARG A CG    1 
ATOM   20   C  CD    . ARG A  1  43  ? 14.870  46.069  187.481 1.00 94.89  ? 18  ARG A CD    1 
ATOM   21   N  NE    . ARG A  1  43  ? 14.898  44.615  187.722 1.00 98.95  ? 18  ARG A NE    1 
ATOM   22   C  CZ    . ARG A  1  43  ? 15.836  43.767  187.272 1.00 94.62  ? 18  ARG A CZ    1 
ATOM   23   N  NH1   . ARG A  1  43  ? 16.882  44.202  186.554 1.00 95.06  ? 18  ARG A NH1   1 
ATOM   24   N  NH2   . ARG A  1  43  ? 15.733  42.462  187.541 1.00 75.64  ? 18  ARG A NH2   1 
ATOM   25   N  N     . MET A  1  44  ? 10.259  45.139  185.115 1.00 94.64  ? 19  MET A N     1 
ATOM   26   C  CA    . MET A  1  44  ? 8.944   44.480  185.121 1.00 92.97  ? 19  MET A CA    1 
ATOM   27   C  C     . MET A  1  44  ? 8.297   44.177  183.756 1.00 90.25  ? 19  MET A C     1 
ATOM   28   O  O     . MET A  1  44  ? 8.021   43.002  183.478 1.00 101.90 ? 19  MET A O     1 
ATOM   29   C  CB    . MET A  1  44  ? 7.972   45.311  185.969 1.00 92.89  ? 19  MET A CB    1 
ATOM   30   C  CG    . MET A  1  44  ? 7.837   46.780  185.546 1.00 90.29  ? 19  MET A CG    1 
ATOM   31   S  SD    . MET A  1  44  ? 7.424   47.835  186.930 1.00 78.73  ? 19  MET A SD    1 
ATOM   32   C  CE    . MET A  1  44  ? 5.925   46.996  187.423 1.00 83.38  ? 19  MET A CE    1 
ATOM   33   N  N     . GLY A  1  45  ? 8.068   45.199  182.912 1.00 78.24  ? 20  GLY A N     1 
ATOM   34   C  CA    . GLY A  1  45  ? 7.459   45.000  181.587 1.00 70.81  ? 20  GLY A CA    1 
ATOM   35   C  C     . GLY A  1  45  ? 8.229   43.886  180.899 1.00 58.76  ? 20  GLY A C     1 
ATOM   36   O  O     . GLY A  1  45  ? 9.463   43.893  180.936 1.00 55.27  ? 20  GLY A O     1 
ATOM   37   N  N     . LEU A  1  46  ? 7.517   42.908  180.334 1.00 49.64  ? 21  LEU A N     1 
ATOM   38   C  CA    . LEU A  1  46  ? 8.144   41.665  179.866 1.00 45.19  ? 21  LEU A CA    1 
ATOM   39   C  C     . LEU A  1  46  ? 9.425   41.905  179.071 1.00 41.82  ? 21  LEU A C     1 
ATOM   40   O  O     . LEU A  1  46  ? 9.448   42.710  178.152 1.00 36.67  ? 21  LEU A O     1 
ATOM   41   C  CB    . LEU A  1  46  ? 7.203   40.822  179.000 1.00 44.68  ? 21  LEU A CB    1 
ATOM   42   C  CG    . LEU A  1  46  ? 7.842   39.465  178.581 1.00 46.70  ? 21  LEU A CG    1 
ATOM   43   C  CD1   . LEU A  1  46  ? 8.172   38.610  179.822 1.00 47.02  ? 21  LEU A CD1   1 
ATOM   44   C  CD2   . LEU A  1  46  ? 6.984   38.690  177.602 1.00 41.69  ? 21  LEU A CD2   1 
ATOM   45   N  N     . ASN A  1  47  ? 10.476  41.190  179.444 1.00 42.77  ? 22  ASN A N     1 
ATOM   46   C  CA    . ASN A  1  47  ? 11.718  41.168  178.691 1.00 43.41  ? 22  ASN A CA    1 
ATOM   47   C  C     . ASN A  1  47  ? 11.754  39.867  177.911 1.00 40.43  ? 22  ASN A C     1 
ATOM   48   O  O     . ASN A  1  47  ? 12.025  38.796  178.467 1.00 34.94  ? 22  ASN A O     1 
ATOM   49   C  CB    . ASN A  1  47  ? 12.895  41.281  179.654 1.00 46.91  ? 22  ASN A CB    1 
ATOM   50   C  CG    . ASN A  1  47  ? 14.242  41.249  178.961 1.00 51.93  ? 22  ASN A CG    1 
ATOM   51   O  OD1   . ASN A  1  47  ? 14.343  41.249  177.729 1.00 46.78  ? 22  ASN A OD1   1 
ATOM   52   N  ND2   . ASN A  1  47  ? 15.302  41.209  179.771 1.00 50.06  ? 22  ASN A ND2   1 
ATOM   53   N  N     . ASP A  1  48  ? 11.470  39.958  176.612 1.00 39.00  ? 23  ASP A N     1 
ATOM   54   C  CA    . ASP A  1  48  ? 11.522  38.781  175.721 1.00 37.11  ? 23  ASP A CA    1 
ATOM   55   C  C     . ASP A  1  48  ? 12.866  38.540  175.050 1.00 35.34  ? 23  ASP A C     1 
ATOM   56   O  O     . ASP A  1  48  ? 12.928  37.731  174.118 1.00 34.28  ? 23  ASP A O     1 
ATOM   57   C  CB    . ASP A  1  48  ? 10.381  38.798  174.693 1.00 38.62  ? 23  ASP A CB    1 
ATOM   58   C  CG    . ASP A  1  48  ? 10.542  39.881  173.608 1.00 44.58  ? 23  ASP A CG    1 
ATOM   59   O  OD1   . ASP A  1  48  ? 9.570   40.034  172.849 1.00 50.42  ? 23  ASP A OD1   1 
ATOM   60   O  OD2   . ASP A  1  48  ? 11.569  40.599  173.521 1.00 40.62  ? 23  ASP A OD2   1 
ATOM   61   N  N     . ASN A  1  49  ? 13.948  39.162  175.543 1.00 35.76  ? 24  ASN A N     1 
ATOM   62   C  CA    . ASN A  1  49  ? 15.279  38.991  174.920 1.00 37.76  ? 24  ASN A CA    1 
ATOM   63   C  C     . ASN A  1  49  ? 15.995  37.750  175.464 1.00 39.76  ? 24  ASN A C     1 
ATOM   64   O  O     . ASN A  1  49  ? 16.990  37.845  176.190 1.00 40.63  ? 24  ASN A O     1 
ATOM   65   C  CB    . ASN A  1  49  ? 16.156  40.247  175.074 1.00 37.51  ? 24  ASN A CB    1 
ATOM   66   C  CG    . ASN A  1  49  ? 17.473  40.149  174.270 1.00 40.60  ? 24  ASN A CG    1 
ATOM   67   O  OD1   . ASN A  1  49  ? 17.564  39.424  173.276 1.00 34.04  ? 24  ASN A OD1   1 
ATOM   68   N  ND2   . ASN A  1  49  ? 18.501  40.875  174.718 1.00 40.60  ? 24  ASN A ND2   1 
ATOM   69   N  N     . LYS A  1  50  ? 15.396  36.602  175.178 1.00 39.04  ? 25  LYS A N     1 
ATOM   70   C  CA    . LYS A  1  50  ? 15.781  35.289  175.656 1.00 38.13  ? 25  LYS A CA    1 
ATOM   71   C  C     . LYS A  1  50  ? 15.285  34.207  174.724 1.00 32.85  ? 25  LYS A C     1 
ATOM   72   O  O     . LYS A  1  50  ? 14.260  34.367  174.098 1.00 29.19  ? 25  LYS A O     1 
ATOM   73   C  CB    . LYS A  1  50  ? 15.106  35.052  176.992 1.00 44.95  ? 25  LYS A CB    1 
ATOM   74   C  CG    . LYS A  1  50  ? 15.973  35.342  178.160 1.00 54.52  ? 25  LYS A CG    1 
ATOM   75   C  CD    . LYS A  1  50  ? 16.609  34.083  178.663 1.00 56.67  ? 25  LYS A CD    1 
ATOM   76   C  CE    . LYS A  1  50  ? 18.075  34.316  179.011 1.00 56.24  ? 25  LYS A CE    1 
ATOM   77   N  NZ    . LYS A  1  50  ? 18.799  33.041  179.174 1.00 51.19  ? 25  LYS A NZ    1 
ATOM   78   N  N     . ALA A  1  51  ? 16.000  33.095  174.645 1.00 29.89  ? 26  ALA A N     1 
ATOM   79   C  CA    . ALA A  1  51  ? 15.560  32.062  173.711 1.00 29.30  ? 26  ALA A CA    1 
ATOM   80   C  C     . ALA A  1  51  ? 14.167  31.558  174.090 1.00 29.49  ? 26  ALA A C     1 
ATOM   81   O  O     . ALA A  1  51  ? 13.852  31.440  175.293 1.00 29.09  ? 26  ALA A O     1 
ATOM   82   C  CB    . ALA A  1  51  ? 16.527  30.892  173.690 1.00 32.31  ? 26  ALA A CB    1 
ATOM   83   N  N     . GLY A  1  52  ? 13.366  31.239  173.079 1.00 27.09  ? 27  GLY A N     1 
ATOM   84   C  CA    . GLY A  1  52  ? 12.092  30.583  173.295 1.00 29.41  ? 27  GLY A CA    1 
ATOM   85   C  C     . GLY A  1  52  ? 10.943  31.514  173.619 1.00 28.77  ? 27  GLY A C     1 
ATOM   86   O  O     . GLY A  1  52  ? 9.882   31.041  173.991 1.00 29.68  ? 27  GLY A O     1 
ATOM   87   N  N     . MET A  1  53  ? 11.147  32.821  173.479 1.00 27.00  ? 28  MET A N     1 
ATOM   88   C  CA    . MET A  1  53  ? 10.156  33.836  173.890 1.00 29.66  ? 28  MET A CA    1 
ATOM   89   C  C     . MET A  1  53  ? 9.668   34.715  172.736 1.00 27.57  ? 28  MET A C     1 
ATOM   90   O  O     . MET A  1  53  ? 9.101   35.778  172.963 1.00 31.32  ? 28  MET A O     1 
ATOM   91   C  CB    . MET A  1  53  ? 10.716  34.705  175.022 1.00 30.88  ? 28  MET A CB    1 
ATOM   92   C  CG    . MET A  1  53  ? 11.064  33.914  176.285 1.00 33.13  ? 28  MET A CG    1 
ATOM   93   S  SD    . MET A  1  53  ? 11.393  35.002  177.677 1.00 36.41  ? 28  MET A SD    1 
ATOM   94   C  CE    . MET A  1  53  ? 9.715   35.435  178.147 1.00 35.22  ? 28  MET A CE    1 
ATOM   95   N  N     . GLU A  1  54  ? 9.854   34.272  171.507 1.00 27.02  ? 29  GLU A N     1 
ATOM   96   C  CA    . GLU A  1  54  ? 9.359   35.018  170.330 1.00 30.71  ? 29  GLU A CA    1 
ATOM   97   C  C     . GLU A  1  54  ? 7.845   34.905  170.135 1.00 29.49  ? 29  GLU A C     1 
ATOM   98   O  O     . GLU A  1  54  ? 7.254   33.848  170.415 1.00 27.39  ? 29  GLU A O     1 
ATOM   99   C  CB    . GLU A  1  54  ? 10.023  34.521  169.048 1.00 33.55  ? 29  GLU A CB    1 
ATOM   100  C  CG    . GLU A  1  54  ? 11.544  34.567  169.120 1.00 39.39  ? 29  GLU A CG    1 
ATOM   101  C  CD    . GLU A  1  54  ? 12.159  33.222  169.427 1.00 45.52  ? 29  GLU A CD    1 
ATOM   102  O  OE1   . GLU A  1  54  ? 13.253  33.006  168.864 1.00 50.17  ? 29  GLU A OE1   1 
ATOM   103  O  OE2   . GLU A  1  54  ? 11.563  32.392  170.199 1.00 43.31  ? 29  GLU A OE2   1 
ATOM   104  N  N     . GLY A  1  55  ? 7.260   35.967  169.590 1.00 27.87  ? 30  GLY A N     1 
ATOM   105  C  CA    . GLY A  1  55  ? 5.862   35.970  169.173 1.00 29.02  ? 30  GLY A CA    1 
ATOM   106  C  C     . GLY A  1  55  ? 4.801   36.123  170.251 1.00 30.30  ? 30  GLY A C     1 
ATOM   107  O  O     . GLY A  1  55  ? 3.625   35.778  170.031 1.00 28.78  ? 30  GLY A O     1 
ATOM   108  N  N     . LEU A  1  56  ? 5.196   36.648  171.404 1.00 29.93  ? 31  LEU A N     1 
ATOM   109  C  CA    . LEU A  1  56  ? 4.274   36.850  172.519 1.00 34.07  ? 31  LEU A CA    1 
ATOM   110  C  C     . LEU A  1  56  ? 3.663   38.238  172.426 1.00 32.96  ? 31  LEU A C     1 
ATOM   111  O  O     . LEU A  1  56  ? 4.284   39.166  171.932 1.00 34.21  ? 31  LEU A O     1 
ATOM   112  C  CB    . LEU A  1  56  ? 4.990   36.699  173.862 1.00 32.89  ? 31  LEU A CB    1 
ATOM   113  C  CG    . LEU A  1  56  ? 5.735   35.376  174.062 1.00 33.01  ? 31  LEU A CG    1 
ATOM   114  C  CD1   . LEU A  1  56  ? 6.596   35.463  175.331 1.00 33.28  ? 31  LEU A CD1   1 
ATOM   115  C  CD2   . LEU A  1  56  ? 4.776   34.191  174.102 1.00 32.37  ? 31  LEU A CD2   1 
ATOM   116  N  N     . ASP A  1  57  ? 2.457   38.361  172.969 1.00 32.09  ? 32  ASP A N     1 
ATOM   117  C  CA    . ASP A  1  57  ? 1.708   39.601  173.003 1.00 31.77  ? 32  ASP A CA    1 
ATOM   118  C  C     . ASP A  1  57  ? 2.097   40.393  174.247 1.00 29.97  ? 32  ASP A C     1 
ATOM   119  O  O     . ASP A  1  57  ? 1.485   40.221  175.320 1.00 30.53  ? 32  ASP A O     1 
ATOM   120  C  CB    . ASP A  1  57  ? 0.223   39.248  173.028 1.00 31.50  ? 32  ASP A CB    1 
ATOM   121  C  CG    . ASP A  1  57  ? -0.676  40.468  172.841 1.00 34.54  ? 32  ASP A CG    1 
ATOM   122  O  OD1   . ASP A  1  57  ? -1.733  40.331  172.155 1.00 33.96  ? 32  ASP A OD1   1 
ATOM   123  O  OD2   . ASP A  1  57  ? -0.300  41.547  173.359 1.00 32.62  ? 32  ASP A OD2   1 
ATOM   124  N  N     . LYS A  1  58  ? 3.084   41.263  174.122 1.00 30.67  ? 33  LYS A N     1 
ATOM   125  C  CA    . LYS A  1  58  ? 3.548   42.039  175.281 1.00 37.31  ? 33  LYS A CA    1 
ATOM   126  C  C     . LYS A  1  58  ? 2.510   43.028  175.877 1.00 39.75  ? 33  LYS A C     1 
ATOM   127  O  O     . LYS A  1  58  ? 2.535   43.292  177.066 1.00 36.13  ? 33  LYS A O     1 
ATOM   128  C  CB    . LYS A  1  58  ? 4.882   42.719  174.993 1.00 44.02  ? 33  LYS A CB    1 
ATOM   129  C  CG    . LYS A  1  58  ? 6.033   41.700  174.956 1.00 50.67  ? 33  LYS A CG    1 
ATOM   130  C  CD    . LYS A  1  58  ? 7.399   42.385  174.885 1.00 57.21  ? 33  LYS A CD    1 
ATOM   131  C  CE    . LYS A  1  58  ? 7.717   42.923  173.498 1.00 58.16  ? 33  LYS A CE    1 
ATOM   132  N  NZ    . LYS A  1  58  ? 7.823   41.821  172.496 1.00 57.64  ? 33  LYS A NZ    1 
ATOM   133  N  N     . GLU A  1  59  ? 1.594   43.534  175.061 1.00 39.26  ? 34  GLU A N     1 
ATOM   134  C  CA    . GLU A  1  59  ? 0.466   44.328  175.551 1.00 42.52  ? 34  GLU A CA    1 
ATOM   135  C  C     . GLU A  1  59  ? -0.405  43.531  176.553 1.00 36.87  ? 34  GLU A C     1 
ATOM   136  O  O     . GLU A  1  59  ? -0.681  44.007  177.638 1.00 36.76  ? 34  GLU A O     1 
ATOM   137  C  CB    . GLU A  1  59  ? -0.384  44.872  174.364 1.00 44.41  ? 34  GLU A CB    1 
ATOM   138  C  CG    . GLU A  1  59  ? -1.578  45.729  174.783 1.00 51.92  ? 34  GLU A CG    1 
ATOM   139  C  CD    . GLU A  1  59  ? -2.128  46.655  173.679 1.00 56.57  ? 34  GLU A CD    1 
ATOM   140  O  OE1   . GLU A  1  59  ? -1.367  47.227  172.875 1.00 60.50  ? 34  GLU A OE1   1 
ATOM   141  O  OE2   . GLU A  1  59  ? -3.358  46.827  173.621 1.00 64.87  ? 34  GLU A OE2   1 
ATOM   142  N  N     . LYS A  1  60  ? -0.825  42.330  176.190 1.00 31.82  ? 35  LYS A N     1 
ATOM   143  C  CA    . LYS A  1  60  ? -1.629  41.491  177.069 1.00 35.12  ? 35  LYS A CA    1 
ATOM   144  C  C     . LYS A  1  60  ? -0.855  41.040  178.323 1.00 35.77  ? 35  LYS A C     1 
ATOM   145  O  O     . LYS A  1  60  ? -1.401  41.019  179.432 1.00 33.63  ? 35  LYS A O     1 
ATOM   146  C  CB    . LYS A  1  60  ? -2.121  40.273  176.312 1.00 38.65  ? 35  LYS A CB    1 
ATOM   147  C  CG    . LYS A  1  60  ? -2.939  39.301  177.141 1.00 45.20  ? 35  LYS A CG    1 
ATOM   148  C  CD    . LYS A  1  60  ? -3.582  38.227  176.267 1.00 51.68  ? 35  LYS A CD    1 
ATOM   149  C  CE    . LYS A  1  60  ? -3.291  36.829  176.791 1.00 54.74  ? 35  LYS A CE    1 
ATOM   150  N  NZ    . LYS A  1  60  ? -1.855  36.426  176.599 1.00 53.36  ? 35  LYS A NZ    1 
ATOM   151  N  N     . ILE A  1  61  ? 0.395   40.648  178.131 1.00 31.44  ? 36  ILE A N     1 
ATOM   152  C  CA    . ILE A  1  61  ? 1.219   40.147  179.231 1.00 30.39  ? 36  ILE A CA    1 
ATOM   153  C  C     . ILE A  1  61  ? 1.541   41.289  180.209 1.00 28.86  ? 36  ILE A C     1 
ATOM   154  O  O     . ILE A  1  61  ? 1.434   41.101  181.408 1.00 26.36  ? 36  ILE A O     1 
ATOM   155  C  CB    . ILE A  1  61  ? 2.515   39.471  178.697 1.00 29.50  ? 36  ILE A CB    1 
ATOM   156  C  CG1   . ILE A  1  61  ? 2.174   38.067  178.171 1.00 29.12  ? 36  ILE A CG1   1 
ATOM   157  C  CG2   . ILE A  1  61  ? 3.600   39.408  179.774 1.00 30.55  ? 36  ILE A CG2   1 
ATOM   158  C  CD1   . ILE A  1  61  ? 3.196   37.491  177.226 1.00 30.46  ? 36  ILE A CD1   1 
ATOM   159  N  N     . ASN A  1  62  ? 1.949   42.444  179.693 1.00 28.60  ? 37  ASN A N     1 
ATOM   160  C  CA    . ASN A  1  62  ? 2.231   43.597  180.534 1.00 31.83  ? 37  ASN A CA    1 
ATOM   161  C  C     . ASN A  1  62  ? 1.020   44.126  181.306 1.00 33.49  ? 37  ASN A C     1 
ATOM   162  O  O     . ASN A  1  62  ? 1.203   44.620  182.403 1.00 32.41  ? 37  ASN A O     1 
ATOM   163  C  CB    . ASN A  1  62  ? 2.897   44.731  179.766 1.00 34.36  ? 37  ASN A CB    1 
ATOM   164  C  CG    . ASN A  1  62  ? 4.316   44.391  179.341 1.00 36.80  ? 37  ASN A CG    1 
ATOM   165  O  OD1   . ASN A  1  62  ? 4.949   43.475  179.866 1.00 39.21  ? 37  ASN A OD1   1 
ATOM   166  N  ND2   . ASN A  1  62  ? 4.811   45.119  178.381 1.00 37.06  ? 37  ASN A ND2   1 
ATOM   167  N  N     . LYS A  1  63  ? -0.192  44.007  180.766 1.00 33.18  ? 38  LYS A N     1 
ATOM   168  C  CA    . LYS A  1  63  ? -1.396  44.376  181.544 1.00 36.99  ? 38  LYS A CA    1 
ATOM   169  C  C     . LYS A  1  63  ? -1.475  43.495  182.801 1.00 37.32  ? 38  LYS A C     1 
ATOM   170  O  O     . LYS A  1  63  ? -1.744  43.995  183.891 1.00 35.29  ? 38  LYS A O     1 
ATOM   171  C  CB    . LYS A  1  63  ? -2.691  44.229  180.741 1.00 38.58  ? 38  LYS A CB    1 
ATOM   172  C  CG    . LYS A  1  63  ? -2.879  45.233  179.601 1.00 43.04  ? 38  LYS A CG    1 
ATOM   173  C  CD    . LYS A  1  63  ? -3.700  44.628  178.440 1.00 51.37  ? 38  LYS A CD    1 
ATOM   174  C  CE    . LYS A  1  63  ? -5.200  44.922  178.440 1.00 52.27  ? 38  LYS A CE    1 
ATOM   175  N  NZ    . LYS A  1  63  ? -5.837  45.241  179.746 1.00 50.36  ? 38  LYS A NZ    1 
ATOM   176  N  N     . ILE A  1  64  ? -1.252  42.195  182.638 1.00 34.19  ? 39  ILE A N     1 
ATOM   177  C  CA    . ILE A  1  64  ? -1.258  41.277  183.764 1.00 34.80  ? 39  ILE A CA    1 
ATOM   178  C  C     . ILE A  1  64  ? -0.144  41.620  184.750 1.00 34.56  ? 39  ILE A C     1 
ATOM   179  O  O     . ILE A  1  64  ? -0.409  41.771  185.933 1.00 35.46  ? 39  ILE A O     1 
ATOM   180  C  CB    . ILE A  1  64  ? -1.232  39.823  183.284 1.00 38.21  ? 39  ILE A CB    1 
ATOM   181  C  CG1   . ILE A  1  64  ? -2.606  39.528  182.671 1.00 42.30  ? 39  ILE A CG1   1 
ATOM   182  C  CG2   . ILE A  1  64  ? -0.939  38.855  184.429 1.00 37.83  ? 39  ILE A CG2   1 
ATOM   183  C  CD1   . ILE A  1  64  ? -2.757  38.188  182.030 1.00 45.13  ? 39  ILE A CD1   1 
ATOM   184  N  N     . ILE A  1  65  ? 1.079   41.825  184.280 1.00 32.82  ? 40  ILE A N     1 
ATOM   185  C  CA    . ILE A  1  65  ? 2.184   42.189  185.190 1.00 33.26  ? 40  ILE A CA    1 
ATOM   186  C  C     . ILE A  1  65  ? 1.843   43.457  186.000 1.00 34.68  ? 40  ILE A C     1 
ATOM   187  O  O     . ILE A  1  65  ? 2.005   43.493  187.232 1.00 32.91  ? 40  ILE A O     1 
ATOM   188  C  CB    . ILE A  1  65  ? 3.528   42.357  184.448 1.00 33.04  ? 40  ILE A CB    1 
ATOM   189  C  CG1   . ILE A  1  65  ? 3.979   41.021  183.867 1.00 33.81  ? 40  ILE A CG1   1 
ATOM   190  C  CG2   . ILE A  1  65  ? 4.627   42.868  185.383 1.00 35.34  ? 40  ILE A CG2   1 
ATOM   191  C  CD1   . ILE A  1  65  ? 5.209   41.126  182.990 1.00 36.00  ? 40  ILE A CD1   1 
ATOM   192  N  N     . MET A  1  66  ? 1.343   44.474  185.298 1.00 38.09  ? 41  MET A N     1 
ATOM   193  C  CA    . MET A  1  66  ? 0.975   45.761  185.900 1.00 38.90  ? 41  MET A CA    1 
ATOM   194  C  C     . MET A  1  66  ? -0.135  45.664  186.913 1.00 35.37  ? 41  MET A C     1 
ATOM   195  O  O     . MET A  1  66  ? -0.071  46.303  187.943 1.00 38.32  ? 41  MET A O     1 
ATOM   196  C  CB    . MET A  1  66  ? 0.557   46.774  184.824 1.00 43.55  ? 41  MET A CB    1 
ATOM   197  C  CG    . MET A  1  66  ? 1.680   47.345  183.987 1.00 46.82  ? 41  MET A CG    1 
ATOM   198  S  SD    . MET A  1  66  ? 2.972   48.122  184.949 1.00 54.41  ? 41  MET A SD    1 
ATOM   199  C  CE    . MET A  1  66  ? 2.003   49.406  185.740 1.00 51.87  ? 41  MET A CE    1 
ATOM   200  N  N     . GLU A  1  67  ? -1.157  44.882  186.619 1.00 36.72  ? 42  GLU A N     1 
ATOM   201  C  CA    . GLU A  1  67  ? -2.222  44.628  187.576 1.00 41.25  ? 42  GLU A CA    1 
ATOM   202  C  C     . GLU A  1  67  ? -1.631  43.975  188.840 1.00 43.59  ? 42  GLU A C     1 
ATOM   203  O  O     . GLU A  1  67  ? -1.970  44.369  189.944 1.00 40.74  ? 42  GLU A O     1 
ATOM   204  C  CB    . GLU A  1  67  ? -3.375  43.846  186.912 1.00 46.31  ? 42  GLU A CB    1 
ATOM   205  C  CG    . GLU A  1  67  ? -4.111  42.751  187.677 1.00 55.59  ? 42  GLU A CG    1 
ATOM   206  C  CD    . GLU A  1  67  ? -4.251  41.472  186.818 1.00 66.65  ? 42  GLU A CD    1 
ATOM   207  O  OE1   . GLU A  1  67  ? -3.528  40.469  187.105 1.00 72.30  ? 42  GLU A OE1   1 
ATOM   208  O  OE2   . GLU A  1  67  ? -5.048  41.476  185.834 1.00 62.85  ? 42  GLU A OE2   1 
ATOM   209  N  N     . ALA A  1  68  ? -0.708  43.031  188.679 1.00 43.71  ? 43  ALA A N     1 
ATOM   210  C  CA    . ALA A  1  68  ? -0.100  42.361  189.838 1.00 44.45  ? 43  ALA A CA    1 
ATOM   211  C  C     . ALA A  1  68  ? 0.909   43.230  190.611 1.00 45.20  ? 43  ALA A C     1 
ATOM   212  O  O     . ALA A  1  68  ? 1.234   42.936  191.761 1.00 46.47  ? 43  ALA A O     1 
ATOM   213  C  CB    . ALA A  1  68  ? 0.536   41.054  189.403 1.00 43.07  ? 43  ALA A CB    1 
ATOM   214  N  N     . THR A  1  69  ? 1.390   44.301  189.993 1.00 46.49  ? 44  THR A N     1 
ATOM   215  C  CA    . THR A  1  69  ? 2.418   45.137  190.587 1.00 45.60  ? 44  THR A CA    1 
ATOM   216  C  C     . THR A  1  69  ? 1.913   46.504  191.081 1.00 50.82  ? 44  THR A C     1 
ATOM   217  O  O     . THR A  1  69  ? 2.685   47.259  191.706 1.00 46.64  ? 44  THR A O     1 
ATOM   218  C  CB    . THR A  1  69  ? 3.558   45.369  189.575 1.00 44.91  ? 44  THR A CB    1 
ATOM   219  O  OG1   . THR A  1  69  ? 3.916   44.130  188.947 1.00 43.30  ? 44  THR A OG1   1 
ATOM   220  C  CG2   . THR A  1  69  ? 4.787   45.952  190.283 1.00 46.78  ? 44  THR A CG2   1 
ATOM   221  N  N     . LYS A  1  70  ? 0.634   46.810  190.829 1.00 56.92  ? 45  LYS A N     1 
ATOM   222  C  CA    . LYS A  1  70  ? 0.081   48.175  191.022 1.00 61.00  ? 45  LYS A CA    1 
ATOM   223  C  C     . LYS A  1  70  ? 0.256   48.684  192.452 1.00 54.47  ? 45  LYS A C     1 
ATOM   224  O  O     . LYS A  1  70  ? -0.106  47.993  193.398 1.00 57.75  ? 45  LYS A O     1 
ATOM   225  C  CB    . LYS A  1  70  ? -1.418  48.231  190.643 1.00 58.20  ? 45  LYS A CB    1 
ATOM   226  N  N     . GLY A  1  71  ? 0.844   49.868  192.594 1.00 53.73  ? 46  GLY A N     1 
ATOM   227  C  CA    . GLY A  1  71  ? 0.918   50.554  193.893 1.00 57.45  ? 46  GLY A CA    1 
ATOM   228  C  C     . GLY A  1  71  ? 2.004   50.074  194.852 1.00 55.65  ? 46  GLY A C     1 
ATOM   229  O  O     . GLY A  1  71  ? 2.148   50.602  195.955 1.00 58.99  ? 46  GLY A O     1 
ATOM   230  N  N     . SER A  1  72  ? 2.791   49.093  194.431 1.00 45.60  ? 47  SER A N     1 
ATOM   231  C  CA    . SER A  1  72  ? 3.792   48.520  195.284 1.00 43.63  ? 47  SER A CA    1 
ATOM   232  C  C     . SER A  1  72  ? 4.932   49.497  195.415 1.00 40.87  ? 47  SER A C     1 
ATOM   233  O  O     . SER A  1  72  ? 5.148   50.343  194.556 1.00 39.87  ? 47  SER A O     1 
ATOM   234  C  CB    . SER A  1  72  ? 4.290   47.199  194.674 1.00 44.34  ? 47  SER A CB    1 
ATOM   235  O  OG    . SER A  1  72  ? 5.060   47.428  193.502 1.00 38.53  ? 47  SER A OG    1 
ATOM   236  N  N     . ARG A  1  73  ? 5.704   49.351  196.473 1.00 40.73  ? 48  ARG A N     1 
ATOM   237  C  CA    . ARG A  1  73  ? 6.926   50.139  196.613 1.00 37.90  ? 48  ARG A CA    1 
ATOM   238  C  C     . ARG A  1  73  ? 7.936   49.813  195.520 1.00 33.71  ? 48  ARG A C     1 
ATOM   239  O  O     . ARG A  1  73  ? 8.701   50.681  195.101 1.00 34.68  ? 48  ARG A O     1 
ATOM   240  C  CB    . ARG A  1  73  ? 7.595   49.885  197.954 1.00 40.34  ? 48  ARG A CB    1 
ATOM   241  C  CG    . ARG A  1  73  ? 6.903   50.536  199.139 1.00 46.46  ? 48  ARG A CG    1 
ATOM   242  C  CD    . ARG A  1  73  ? 6.434   49.506  200.128 1.00 52.07  ? 48  ARG A CD    1 
ATOM   243  N  NE    . ARG A  1  73  ? 6.845   49.801  201.486 1.00 57.86  ? 48  ARG A NE    1 
ATOM   244  C  CZ    . ARG A  1  73  ? 6.660   48.964  202.508 1.00 63.65  ? 48  ARG A CZ    1 
ATOM   245  N  NH1   . ARG A  1  73  ? 7.071   49.314  203.715 1.00 67.90  ? 48  ARG A NH1   1 
ATOM   246  N  NH2   . ARG A  1  73  ? 6.067   47.779  202.342 1.00 65.28  ? 48  ARG A NH2   1 
ATOM   247  N  N     . PHE A  1  74  ? 7.978   48.557  195.089 1.00 31.22  ? 49  PHE A N     1 
ATOM   248  C  CA    . PHE A  1  74  ? 8.884   48.178  193.993 1.00 31.34  ? 49  PHE A CA    1 
ATOM   249  C  C     . PHE A  1  74  ? 8.598   49.049  192.769 1.00 32.87  ? 49  PHE A C     1 
ATOM   250  O  O     . PHE A  1  74  ? 9.513   49.605  192.160 1.00 29.47  ? 49  PHE A O     1 
ATOM   251  C  CB    . PHE A  1  74  ? 8.704   46.701  193.632 1.00 32.26  ? 49  PHE A CB    1 
ATOM   252  C  CG    . PHE A  1  74  ? 9.566   46.255  192.505 1.00 31.54  ? 49  PHE A CG    1 
ATOM   253  C  CD1   . PHE A  1  74  ? 10.903  45.978  192.717 1.00 31.69  ? 49  PHE A CD1   1 
ATOM   254  C  CD2   . PHE A  1  74  ? 9.052   46.116  191.219 1.00 33.82  ? 49  PHE A CD2   1 
ATOM   255  C  CE1   . PHE A  1  74  ? 11.716  45.551  191.669 1.00 32.11  ? 49  PHE A CE1   1 
ATOM   256  C  CE2   . PHE A  1  74  ? 9.871   45.710  190.161 1.00 33.23  ? 49  PHE A CE2   1 
ATOM   257  C  CZ    . PHE A  1  74  ? 11.213  45.440  190.395 1.00 32.32  ? 49  PHE A CZ    1 
ATOM   258  N  N     . TYR A  1  75  ? 7.307   49.152  192.434 1.00 36.25  ? 50  TYR A N     1 
ATOM   259  C  CA    . TYR A  1  75  ? 6.847   49.952  191.289 1.00 39.53  ? 50  TYR A CA    1 
ATOM   260  C  C     . TYR A  1  75  ? 7.251   51.424  191.398 1.00 34.39  ? 50  TYR A C     1 
ATOM   261  O  O     . TYR A  1  75  ? 7.784   51.988  190.462 1.00 34.91  ? 50  TYR A O     1 
ATOM   262  C  CB    . TYR A  1  75  ? 5.318   49.838  191.118 1.00 42.87  ? 50  TYR A CB    1 
ATOM   263  C  CG    . TYR A  1  75  ? 4.808   50.561  189.890 1.00 48.43  ? 50  TYR A CG    1 
ATOM   264  C  CD1   . TYR A  1  75  ? 5.381   50.319  188.639 1.00 51.79  ? 50  TYR A CD1   1 
ATOM   265  C  CD2   . TYR A  1  75  ? 3.782   51.504  189.971 1.00 51.58  ? 50  TYR A CD2   1 
ATOM   266  C  CE1   . TYR A  1  75  ? 4.946   50.989  187.506 1.00 56.66  ? 50  TYR A CE1   1 
ATOM   267  C  CE2   . TYR A  1  75  ? 3.324   52.173  188.833 1.00 50.21  ? 50  TYR A CE2   1 
ATOM   268  C  CZ    . TYR A  1  75  ? 3.914   51.913  187.612 1.00 55.97  ? 50  TYR A CZ    1 
ATOM   269  O  OH    . TYR A  1  75  ? 3.502   52.560  186.476 1.00 63.50  ? 50  TYR A OH    1 
ATOM   270  N  N     . GLY A  1  76  ? 7.018   52.013  192.565 1.00 36.17  ? 51  GLY A N     1 
ATOM   271  C  CA    . GLY A  1  76  ? 7.470   53.371  192.897 1.00 35.62  ? 51  GLY A CA    1 
ATOM   272  C  C     . GLY A  1  76  ? 8.933   53.568  192.574 1.00 36.07  ? 51  GLY A C     1 
ATOM   273  O  O     . GLY A  1  76  ? 9.293   54.529  191.896 1.00 37.00  ? 51  GLY A O     1 
ATOM   274  N  N     . ASN A  1  77  ? 9.769   52.626  192.994 1.00 33.32  ? 52  ASN A N     1 
ATOM   275  C  CA    . ASN A  1  77  ? 11.192  52.703  192.698 1.00 33.42  ? 52  ASN A CA    1 
ATOM   276  C  C     . ASN A  1  77  ? 11.499  52.544  191.212 1.00 33.94  ? 52  ASN A C     1 
ATOM   277  O  O     . ASN A  1  77  ? 12.346  53.249  190.692 1.00 34.13  ? 52  ASN A O     1 
ATOM   278  C  CB    . ASN A  1  77  ? 11.991  51.676  193.493 1.00 34.07  ? 52  ASN A CB    1 
ATOM   279  C  CG    . ASN A  1  77  ? 13.486  51.898  193.375 1.00 34.13  ? 52  ASN A CG    1 
ATOM   280  O  OD1   . ASN A  1  77  ? 14.208  51.125  192.747 1.00 38.43  ? 52  ASN A OD1   1 
ATOM   281  N  ND2   . ASN A  1  77  ? 13.938  52.983  193.920 1.00 32.44  ? 52  ASN A ND2   1 
ATOM   282  N  N     . GLU A  1  78  ? 10.806  51.638  190.533 1.00 36.72  ? 53  GLU A N     1 
ATOM   283  C  CA    . GLU A  1  78  ? 11.002  51.478  189.086 1.00 39.72  ? 53  GLU A CA    1 
ATOM   284  C  C     . GLU A  1  78  ? 10.702  52.781  188.300 1.00 38.21  ? 53  GLU A C     1 
ATOM   285  O  O     . GLU A  1  78  ? 11.436  53.122  187.373 1.00 33.81  ? 53  GLU A O     1 
ATOM   286  C  CB    . GLU A  1  78  ? 10.203  50.291  188.527 1.00 40.07  ? 53  GLU A CB    1 
ATOM   287  C  CG    . GLU A  1  78  ? 10.780  48.936  188.961 1.00 46.27  ? 53  GLU A CG    1 
ATOM   288  C  CD    . GLU A  1  78  ? 12.236  48.705  188.515 1.00 49.73  ? 53  GLU A CD    1 
ATOM   289  O  OE1   . GLU A  1  78  ? 12.482  48.661  187.290 1.00 55.07  ? 53  GLU A OE1   1 
ATOM   290  O  OE2   . GLU A  1  78  ? 13.141  48.576  189.379 1.00 47.96  ? 53  GLU A OE2   1 
ATOM   291  N  N     . LEU A  1  79  ? 9.661   53.498  188.695 1.00 37.19  ? 54  LEU A N     1 
ATOM   292  C  CA    . LEU A  1  79  ? 9.347   54.799  188.084 1.00 42.31  ? 54  LEU A CA    1 
ATOM   293  C  C     . LEU A  1  79  ? 10.474  55.794  188.312 1.00 41.49  ? 54  LEU A C     1 
ATOM   294  O  O     . LEU A  1  79  ? 10.904  56.477  187.369 1.00 42.96  ? 54  LEU A O     1 
ATOM   295  C  CB    . LEU A  1  79  ? 8.045   55.370  188.629 1.00 43.84  ? 54  LEU A CB    1 
ATOM   296  C  CG    . LEU A  1  79  ? 6.792   54.618  188.201 1.00 50.95  ? 54  LEU A CG    1 
ATOM   297  C  CD1   . LEU A  1  79  ? 5.590   55.155  188.966 1.00 54.87  ? 54  LEU A CD1   1 
ATOM   298  C  CD2   . LEU A  1  79  ? 6.559   54.725  186.696 1.00 53.24  ? 54  LEU A CD2   1 
ATOM   299  N  N     . LYS A  1  80  ? 10.966  55.877  189.548 1.00 38.99  ? 55  LYS A N     1 
ATOM   300  C  CA    . LYS A  1  80  ? 12.163  56.696  189.809 1.00 41.00  ? 55  LYS A CA    1 
ATOM   301  C  C     . LYS A  1  80  ? 13.307  56.303  188.864 1.00 39.07  ? 55  LYS A C     1 
ATOM   302  O  O     . LYS A  1  80  ? 13.883  57.171  188.197 1.00 40.28  ? 55  LYS A O     1 
ATOM   303  C  CB    . LYS A  1  80  ? 12.592  56.650  191.274 1.00 42.08  ? 55  LYS A CB    1 
ATOM   304  C  CG    . LYS A  1  80  ? 13.845  57.428  191.581 1.00 49.26  ? 55  LYS A CG    1 
ATOM   305  C  CD    . LYS A  1  80  ? 14.129  57.474  193.072 1.00 56.74  ? 55  LYS A CD    1 
ATOM   306  C  CE    . LYS A  1  80  ? 15.424  58.234  193.358 1.00 61.80  ? 55  LYS A CE    1 
ATOM   307  N  NZ    . LYS A  1  80  ? 15.758  58.214  194.810 1.00 66.00  ? 55  LYS A NZ    1 
ATOM   308  N  N     . LYS A  1  81  ? 13.608  55.018  188.735 1.00 38.31  ? 56  LYS A N     1 
ATOM   309  C  CA    . LYS A  1  81  ? 14.745  54.651  187.864 1.00 43.66  ? 56  LYS A CA    1 
ATOM   310  C  C     . LYS A  1  81  ? 14.505  54.982  186.373 1.00 39.00  ? 56  LYS A C     1 
ATOM   311  O  O     . LYS A  1  81  ? 15.429  55.354  185.644 1.00 33.97  ? 56  LYS A O     1 
ATOM   312  C  CB    . LYS A  1  81  ? 15.160  53.195  188.065 1.00 49.09  ? 56  LYS A CB    1 
ATOM   313  C  CG    . LYS A  1  81  ? 16.072  53.026  189.278 1.00 52.42  ? 56  LYS A CG    1 
ATOM   314  C  CD    . LYS A  1  81  ? 16.124  51.582  189.763 1.00 60.63  ? 56  LYS A CD    1 
ATOM   315  C  CE    . LYS A  1  81  ? 16.656  50.588  188.724 1.00 65.34  ? 56  LYS A CE    1 
ATOM   316  N  NZ    . LYS A  1  81  ? 15.914  49.285  188.733 1.00 66.26  ? 56  LYS A NZ    1 
ATOM   317  N  N     . GLU A  1  82  ? 13.264  54.850  185.940 1.00 38.76  ? 57  GLU A N     1 
ATOM   318  C  CA    . GLU A  1  82  ? 12.910  55.125  184.566 1.00 46.22  ? 57  GLU A CA    1 
ATOM   319  C  C     . GLU A  1  82  ? 13.098  56.624  184.285 1.00 45.53  ? 57  GLU A C     1 
ATOM   320  O  O     . GLU A  1  82  ? 13.635  57.017  183.253 1.00 38.51  ? 57  GLU A O     1 
ATOM   321  C  CB    . GLU A  1  82  ? 11.469  54.702  184.336 1.00 53.37  ? 57  GLU A CB    1 
ATOM   322  C  CG    . GLU A  1  82  ? 10.953  54.863  182.926 1.00 65.43  ? 57  GLU A CG    1 
ATOM   323  C  CD    . GLU A  1  82  ? 9.483   54.517  182.851 1.00 75.34  ? 57  GLU A CD    1 
ATOM   324  O  OE1   . GLU A  1  82  ? 8.649   55.388  183.197 1.00 86.36  ? 57  GLU A OE1   1 
ATOM   325  O  OE2   . GLU A  1  82  ? 9.168   53.369  182.469 1.00 83.17  ? 57  GLU A OE2   1 
ATOM   326  N  N     . LYS A  1  83  ? 12.669  57.460  185.222 1.00 44.64  ? 58  LYS A N     1 
ATOM   327  C  CA    . LYS A  1  83  ? 12.827  58.902  185.083 1.00 42.92  ? 58  LYS A CA    1 
ATOM   328  C  C     . LYS A  1  83  ? 14.316  59.292  185.034 1.00 41.93  ? 58  LYS A C     1 
ATOM   329  O  O     . LYS A  1  83  ? 14.700  60.200  184.293 1.00 34.72  ? 58  LYS A O     1 
ATOM   330  C  CB    . LYS A  1  83  ? 12.114  59.583  186.242 1.00 49.12  ? 58  LYS A CB    1 
ATOM   331  C  CG    . LYS A  1  83  ? 12.116  61.091  186.180 1.00 54.71  ? 58  LYS A CG    1 
ATOM   332  C  CD    . LYS A  1  83  ? 11.335  61.667  187.337 1.00 60.07  ? 58  LYS A CD    1 
ATOM   333  C  CE    . LYS A  1  83  ? 11.131  63.150  187.140 1.00 63.76  ? 58  LYS A CE    1 
ATOM   334  N  NZ    . LYS A  1  83  ? 10.605  63.739  188.398 1.00 68.42  ? 58  LYS A NZ    1 
ATOM   335  N  N     . GLN A  1  84  ? 15.149  58.601  185.811 1.00 37.26  ? 59  GLN A N     1 
ATOM   336  C  CA    . GLN A  1  84  ? 16.599  58.802  185.757 1.00 39.34  ? 59  GLN A CA    1 
ATOM   337  C  C     . GLN A  1  84  ? 17.159  58.510  184.355 1.00 40.12  ? 59  GLN A C     1 
ATOM   338  O  O     . GLN A  1  84  ? 17.955  59.308  183.800 1.00 33.19  ? 59  GLN A O     1 
ATOM   339  C  CB    . GLN A  1  84  ? 17.305  57.910  186.785 1.00 45.81  ? 59  GLN A CB    1 
ATOM   340  C  CG    . GLN A  1  84  ? 18.738  58.303  187.125 1.00 55.38  ? 59  GLN A CG    1 
ATOM   341  C  CD    . GLN A  1  84  ? 19.837  57.727  186.201 1.00 66.17  ? 59  GLN A CD    1 
ATOM   342  O  OE1   . GLN A  1  84  ? 19.703  56.645  185.579 1.00 65.08  ? 59  GLN A OE1   1 
ATOM   343  N  NE2   . GLN A  1  84  ? 20.964  58.450  186.140 1.00 66.77  ? 59  GLN A NE2   1 
ATOM   344  N  N     . VAL A  1  85  ? 16.760  57.360  183.799 1.00 35.91  ? 60  VAL A N     1 
ATOM   345  C  CA    . VAL A  1  85  ? 17.256  56.947  182.503 1.00 35.54  ? 60  VAL A CA    1 
ATOM   346  C  C     . VAL A  1  85  ? 16.840  57.978  181.428 1.00 33.93  ? 60  VAL A C     1 
ATOM   347  O  O     . VAL A  1  85  ? 17.655  58.375  180.591 1.00 30.09  ? 60  VAL A O     1 
ATOM   348  C  CB    . VAL A  1  85  ? 16.786  55.512  182.132 1.00 35.66  ? 60  VAL A CB    1 
ATOM   349  C  CG1   . VAL A  1  85  ? 17.095  55.206  180.678 1.00 36.23  ? 60  VAL A CG1   1 
ATOM   350  C  CG2   . VAL A  1  85  ? 17.471  54.472  183.027 1.00 37.20  ? 60  VAL A CG2   1 
ATOM   351  N  N     . ASN A  1  86  ? 15.573  58.361  181.457 1.00 33.63  ? 61  ASN A N     1 
ATOM   352  C  CA    . ASN A  1  86  ? 15.025  59.375  180.555 1.00 37.28  ? 61  ASN A CA    1 
ATOM   353  C  C     . ASN A  1  86  ? 15.728  60.741  180.646 1.00 37.66  ? 61  ASN A C     1 
ATOM   354  O  O     . ASN A  1  86  ? 15.933  61.379  179.626 1.00 35.29  ? 61  ASN A O     1 
ATOM   355  C  CB    . ASN A  1  86  ? 13.511  59.513  180.760 1.00 39.73  ? 61  ASN A CB    1 
ATOM   356  C  CG    . ASN A  1  86  ? 12.737  58.307  180.240 1.00 42.21  ? 61  ASN A CG    1 
ATOM   357  O  OD1   . ASN A  1  86  ? 13.274  57.455  179.536 1.00 50.28  ? 61  ASN A OD1   1 
ATOM   358  N  ND2   . ASN A  1  86  ? 11.474  58.226  180.595 1.00 45.29  ? 61  ASN A ND2   1 
ATOM   359  N  N     . GLN A  1  87  ? 16.135  61.143  181.848 1.00 36.92  ? 62  GLN A N     1 
ATOM   360  C  CA    . GLN A  1  87  ? 16.933  62.349  182.045 1.00 39.63  ? 62  GLN A CA    1 
ATOM   361  C  C     . GLN A  1  87  ? 18.296  62.205  181.375 1.00 38.34  ? 62  GLN A C     1 
ATOM   362  O  O     . GLN A  1  87  ? 18.780  63.131  180.751 1.00 36.58  ? 62  GLN A O     1 
ATOM   363  C  CB    . GLN A  1  87  ? 17.140  62.648  183.545 1.00 42.39  ? 62  GLN A CB    1 
ATOM   364  C  CG    . GLN A  1  87  ? 17.932  63.914  183.844 1.00 44.40  ? 62  GLN A CG    1 
ATOM   365  C  CD    . GLN A  1  87  ? 17.221  65.139  183.270 1.00 48.38  ? 62  GLN A CD    1 
ATOM   366  O  OE1   . GLN A  1  87  ? 16.063  65.410  183.608 1.00 48.06  ? 62  GLN A OE1   1 
ATOM   367  N  NE2   . GLN A  1  87  ? 17.878  65.835  182.338 1.00 48.83  ? 62  GLN A NE2   1 
ATOM   368  N  N     . ARG A  1  88  ? 18.910  61.045  181.541 1.00 35.94  ? 63  ARG A N     1 
ATOM   369  C  CA    . ARG A  1  88  ? 20.189  60.743  180.942 1.00 37.42  ? 63  ARG A CA    1 
ATOM   370  C  C     . ARG A  1  88  ? 20.100  60.779  179.398 1.00 35.89  ? 63  ARG A C     1 
ATOM   371  O  O     . ARG A  1  88  ? 20.985  61.297  178.738 1.00 35.25  ? 63  ARG A O     1 
ATOM   372  C  CB    . ARG A  1  88  ? 20.639  59.374  181.447 1.00 43.95  ? 63  ARG A CB    1 
ATOM   373  C  CG    . ARG A  1  88  ? 22.094  59.066  181.227 1.00 51.47  ? 63  ARG A CG    1 
ATOM   374  C  CD    . ARG A  1  88  ? 22.479  57.733  181.870 1.00 55.51  ? 63  ARG A CD    1 
ATOM   375  N  NE    . ARG A  1  88  ? 23.655  57.182  181.192 1.00 60.45  ? 63  ARG A NE    1 
ATOM   376  C  CZ    . ARG A  1  88  ? 24.035  55.897  181.190 1.00 68.83  ? 63  ARG A CZ    1 
ATOM   377  N  NH1   . ARG A  1  88  ? 23.341  54.951  181.843 1.00 64.76  ? 63  ARG A NH1   1 
ATOM   378  N  NH2   . ARG A  1  88  ? 25.137  55.550  180.513 1.00 68.72  ? 63  ARG A NH2   1 
ATOM   379  N  N     . ILE A  1  89  ? 19.001  60.252  178.855 1.00 35.81  ? 64  ILE A N     1 
ATOM   380  C  CA    . ILE A  1  89  ? 18.701  60.277  177.426 1.00 35.51  ? 64  ILE A CA    1 
ATOM   381  C  C     . ILE A  1  89  ? 18.517  61.739  176.980 1.00 38.08  ? 64  ILE A C     1 
ATOM   382  O  O     . ILE A  1  89  ? 19.094  62.154  175.968 1.00 37.72  ? 64  ILE A O     1 
ATOM   383  C  CB    . ILE A  1  89  ? 17.456  59.400  177.079 1.00 35.01  ? 64  ILE A CB    1 
ATOM   384  C  CG1   . ILE A  1  89  ? 17.819  57.898  177.139 1.00 35.08  ? 64  ILE A CG1   1 
ATOM   385  C  CG2   . ILE A  1  89  ? 16.893  59.745  175.699 1.00 37.08  ? 64  ILE A CG2   1 
ATOM   386  C  CD1   . ILE A  1  89  ? 16.627  56.951  177.089 1.00 34.67  ? 64  ILE A CD1   1 
ATOM   387  N  N     . GLU A  1  90  ? 17.747  62.511  177.745 1.00 37.16  ? 65  GLU A N     1 
ATOM   388  C  CA    . GLU A  1  90  ? 17.566  63.932  177.475 1.00 41.61  ? 65  GLU A CA    1 
ATOM   389  C  C     . GLU A  1  90  ? 18.899  64.707  177.454 1.00 37.62  ? 65  GLU A C     1 
ATOM   390  O  O     . GLU A  1  90  ? 19.122  65.481  176.540 1.00 35.27  ? 65  GLU A O     1 
ATOM   391  C  CB    . GLU A  1  90  ? 16.568  64.561  178.454 1.00 48.99  ? 65  GLU A CB    1 
ATOM   392  C  CG    . GLU A  1  90  ? 16.203  66.014  178.119 1.00 57.71  ? 65  GLU A CG    1 
ATOM   393  C  CD    . GLU A  1  90  ? 14.704  66.257  178.112 1.00 69.45  ? 65  GLU A CD    1 
ATOM   394  O  OE1   . GLU A  1  90  ? 14.061  66.009  177.059 1.00 76.74  ? 65  GLU A OE1   1 
ATOM   395  O  OE2   . GLU A  1  90  ? 14.167  66.695  179.156 1.00 78.33  ? 65  GLU A OE2   1 
ATOM   396  N  N     . ASN A  1  91  ? 19.785  64.451  178.409 1.00 34.23  ? 66  ASN A N     1 
ATOM   397  C  CA    . ASN A  1  91  ? 21.079  65.098  178.435 1.00 37.73  ? 66  ASN A CA    1 
ATOM   398  C  C     . ASN A  1  91  ? 21.896  64.740  177.209 1.00 37.79  ? 66  ASN A C     1 
ATOM   399  O  O     . ASN A  1  91  ? 22.561  65.603  176.634 1.00 38.94  ? 66  ASN A O     1 
ATOM   400  C  CB    . ASN A  1  91  ? 21.865  64.772  179.715 1.00 39.42  ? 66  ASN A CB    1 
ATOM   401  C  CG    . ASN A  1  91  ? 21.177  65.279  180.977 1.00 46.24  ? 66  ASN A CG    1 
ATOM   402  O  OD1   . ASN A  1  91  ? 20.126  65.926  180.927 1.00 44.66  ? 66  ASN A OD1   1 
ATOM   403  N  ND2   . ASN A  1  91  ? 21.750  64.951  182.124 1.00 45.61  ? 66  ASN A ND2   1 
ATOM   404  N  N     . MET A  1  92  ? 21.828  63.481  176.780 1.00 36.96  ? 67  MET A N     1 
ATOM   405  C  CA    . MET A  1  92  ? 22.535  63.073  175.576 1.00 37.35  ? 67  MET A CA    1 
ATOM   406  C  C     . MET A  1  92  ? 21.978  63.786  174.325 1.00 34.99  ? 67  MET A C     1 
ATOM   407  O  O     . MET A  1  92  ? 22.756  64.209  173.462 1.00 33.21  ? 67  MET A O     1 
ATOM   408  C  CB    . MET A  1  92  ? 22.508  61.552  175.419 1.00 37.14  ? 67  MET A CB    1 
ATOM   409  C  CG    . MET A  1  92  ? 23.260  61.008  174.217 1.00 37.23  ? 67  MET A CG    1 
ATOM   410  S  SD    . MET A  1  92  ? 22.924  59.240  173.915 1.00 37.85  ? 67  MET A SD    1 
ATOM   411  C  CE    . MET A  1  92  ? 21.149  59.243  173.639 1.00 34.13  ? 67  MET A CE    1 
ATOM   412  N  N     . MET A  1  93  ? 20.662  63.901  174.223 1.00 34.69  ? 68  MET A N     1 
ATOM   413  C  CA    . MET A  1  93  ? 20.024  64.541  173.063 1.00 39.41  ? 68  MET A CA    1 
ATOM   414  C  C     . MET A  1  93  ? 20.316  66.054  172.972 1.00 42.33  ? 68  MET A C     1 
ATOM   415  O  O     . MET A  1  93  ? 20.382  66.595  171.870 1.00 42.29  ? 68  MET A O     1 
ATOM   416  C  CB    . MET A  1  93  ? 18.503  64.322  173.072 1.00 41.10  ? 68  MET A CB    1 
ATOM   417  C  CG    . MET A  1  93  ? 18.022  62.892  172.897 1.00 44.12  ? 68  MET A CG    1 
ATOM   418  S  SD    . MET A  1  93  ? 18.853  61.920  171.622 1.00 49.75  ? 68  MET A SD    1 
ATOM   419  C  CE    . MET A  1  93  ? 17.917  62.517  170.207 1.00 51.48  ? 68  MET A CE    1 
ATOM   420  N  N     . GLN A  1  94  ? 20.495  66.706  174.127 1.00 44.94  ? 69  GLN A N     1 
ATOM   421  C  CA    . GLN A  1  94  ? 20.872  68.115  174.216 1.00 49.62  ? 69  GLN A CA    1 
ATOM   422  C  C     . GLN A  1  94  ? 22.310  68.309  173.792 1.00 48.77  ? 69  GLN A C     1 
ATOM   423  O  O     . GLN A  1  94  ? 22.638  69.301  173.144 1.00 46.18  ? 69  GLN A O     1 
ATOM   424  C  CB    . GLN A  1  94  ? 20.709  68.638  175.650 1.00 55.83  ? 69  GLN A CB    1 
ATOM   425  C  CG    . GLN A  1  94  ? 19.257  68.839  176.060 1.00 67.92  ? 69  GLN A CG    1 
ATOM   426  C  CD    . GLN A  1  94  ? 18.730  70.248  175.806 1.00 78.73  ? 69  GLN A CD    1 
ATOM   427  O  OE1   . GLN A  1  94  ? 19.300  71.024  175.027 1.00 80.97  ? 69  GLN A OE1   1 
ATOM   428  N  NE2   . GLN A  1  94  ? 17.619  70.580  176.464 1.00 90.61  ? 69  GLN A NE2   1 
ATOM   429  N  N     . GLN A  1  95  ? 23.167  67.375  174.183 1.00 44.54  ? 70  GLN A N     1 
ATOM   430  C  CA    . GLN A  1  95  ? 24.551  67.376  173.728 1.00 44.65  ? 70  GLN A CA    1 
ATOM   431  C  C     . GLN A  1  95  ? 24.591  67.146  172.211 1.00 45.98  ? 70  GLN A C     1 
ATOM   432  O  O     . GLN A  1  95  ? 25.339  67.816  171.486 1.00 46.10  ? 70  GLN A O     1 
ATOM   433  C  CB    . GLN A  1  95  ? 25.370  66.320  174.465 1.00 49.02  ? 70  GLN A CB    1 
ATOM   434  C  CG    . GLN A  1  95  ? 26.645  66.833  175.092 1.00 57.54  ? 70  GLN A CG    1 
ATOM   435  C  CD    . GLN A  1  95  ? 27.801  65.873  174.899 1.00 65.46  ? 70  GLN A CD    1 
ATOM   436  O  OE1   . GLN A  1  95  ? 27.730  64.716  175.317 1.00 64.27  ? 70  GLN A OE1   1 
ATOM   437  N  NE2   . GLN A  1  95  ? 28.879  66.347  174.260 1.00 67.34  ? 70  GLN A NE2   1 
ATOM   438  N  N     . LYS A  1  96  ? 23.758  66.229  171.728 1.00 44.51  ? 71  LYS A N     1 
ATOM   439  C  CA    . LYS A  1  96  ? 23.698  65.921  170.301 1.00 44.12  ? 71  LYS A CA    1 
ATOM   440  C  C     . LYS A  1  96  ? 23.335  67.140  169.427 1.00 45.97  ? 71  LYS A C     1 
ATOM   441  O  O     . LYS A  1  96  ? 23.917  67.310  168.348 1.00 40.87  ? 71  LYS A O     1 
ATOM   442  C  CB    . LYS A  1  96  ? 22.692  64.807  170.024 1.00 44.84  ? 71  LYS A CB    1 
ATOM   443  C  CG    . LYS A  1  96  ? 22.594  64.454  168.551 1.00 46.81  ? 71  LYS A CG    1 
ATOM   444  C  CD    . LYS A  1  96  ? 21.649  63.325  168.252 1.00 47.92  ? 71  LYS A CD    1 
ATOM   445  C  CE    . LYS A  1  96  ? 21.615  63.108  166.753 1.00 49.61  ? 71  LYS A CE    1 
ATOM   446  N  NZ    . LYS A  1  96  ? 20.617  64.005  166.100 1.00 52.78  ? 71  LYS A NZ    1 
ATOM   447  N  N     . ALA A  1  97  ? 22.355  67.932  169.873 1.00 45.31  ? 72  ALA A N     1 
ATOM   448  C  CA    . ALA A  1  97  ? 21.911  69.145  169.145 1.00 47.75  ? 72  ALA A CA    1 
ATOM   449  C  C     . ALA A  1  97  ? 23.003  70.195  168.988 1.00 47.31  ? 72  ALA A C     1 
ATOM   450  O  O     . ALA A  1  97  ? 22.986  70.955  168.024 1.00 56.18  ? 72  ALA A O     1 
ATOM   451  C  CB    . ALA A  1  97  ? 20.675  69.755  169.794 1.00 46.27  ? 72  ALA A CB    1 
ATOM   452  N  N     . GLN A  1  98  ? 23.943  70.232  169.926 1.00 47.27  ? 73  GLN A N     1 
ATOM   453  C  CA    . GLN A  1  98  ? 25.110  71.102  169.836 1.00 51.91  ? 73  GLN A CA    1 
ATOM   454  C  C     . GLN A  1  98  ? 26.153  70.645  168.829 1.00 52.14  ? 73  GLN A C     1 
ATOM   455  O  O     . GLN A  1  98  ? 27.010  71.437  168.447 1.00 59.67  ? 73  GLN A O     1 
ATOM   456  C  CB    . GLN A  1  98  ? 25.805  71.273  171.203 1.00 58.73  ? 73  GLN A CB    1 
ATOM   457  C  CG    . GLN A  1  98  ? 25.363  72.482  172.017 1.00 64.56  ? 73  GLN A CG    1 
ATOM   458  C  CD    . GLN A  1  98  ? 24.054  72.256  172.740 1.00 74.88  ? 73  GLN A CD    1 
ATOM   459  O  OE1   . GLN A  1  98  ? 24.035  72.010  173.953 1.00 86.24  ? 73  GLN A OE1   1 
ATOM   460  N  NE2   . GLN A  1  98  ? 22.946  72.338  172.006 1.00 80.40  ? 73  GLN A NE2   1 
ATOM   461  N  N     . ILE A  1  99  ? 26.122  69.390  168.396 1.00 51.28  ? 74  ILE A N     1 
ATOM   462  C  CA    . ILE A  1  99  ? 27.176  68.896  167.509 1.00 47.42  ? 74  ILE A CA    1 
ATOM   463  C  C     . ILE A  1  99  ? 26.999  69.476  166.091 1.00 44.45  ? 74  ILE A C     1 
ATOM   464  O  O     . ILE A  1  99  ? 25.909  69.423  165.531 1.00 42.01  ? 74  ILE A O     1 
ATOM   465  C  CB    . ILE A  1  99  ? 27.252  67.351  167.496 1.00 48.19  ? 74  ILE A CB    1 
ATOM   466  C  CG1   . ILE A  1  99  ? 27.666  66.841  168.891 1.00 48.27  ? 74  ILE A CG1   1 
ATOM   467  C  CG2   . ILE A  1  99  ? 28.252  66.862  166.446 1.00 45.54  ? 74  ILE A CG2   1 
ATOM   468  C  CD1   . ILE A  1  99  ? 27.475  65.351  169.103 1.00 48.79  ? 74  ILE A CD1   1 
ATOM   469  N  N     . THR A  1  100 ? 28.098  69.974  165.532 1.00 42.46  ? 75  THR A N     1 
ATOM   470  C  CA    . THR A  1  100 ? 28.128  70.612  164.213 1.00 49.22  ? 75  THR A CA    1 
ATOM   471  C  C     . THR A  1  100 ? 28.682  69.684  163.143 1.00 51.04  ? 75  THR A C     1 
ATOM   472  O  O     . THR A  1  100 ? 29.376  68.708  163.448 1.00 48.87  ? 75  THR A O     1 
ATOM   473  C  CB    . THR A  1  100 ? 29.024  71.876  164.222 1.00 48.81  ? 75  THR A CB    1 
ATOM   474  O  OG1   . THR A  1  100 ? 30.387  71.518  164.514 1.00 45.21  ? 75  THR A OG1   1 
ATOM   475  C  CG2   . THR A  1  100 ? 28.513  72.896  165.255 1.00 48.00  ? 75  THR A CG2   1 
ATOM   476  N  N     . SER A  1  101 ? 28.381  70.016  161.889 1.00 49.95  ? 76  SER A N     1 
ATOM   477  C  CA    . SER A  1  101 ? 28.926  69.318  160.735 1.00 52.39  ? 76  SER A CA    1 
ATOM   478  C  C     . SER A  1  101 ? 30.448  69.187  160.772 1.00 52.79  ? 76  SER A C     1 
ATOM   479  O  O     . SER A  1  101 ? 30.982  68.130  160.416 1.00 52.89  ? 76  SER A O     1 
ATOM   480  C  CB    . SER A  1  101 ? 28.519  70.023  159.434 1.00 55.04  ? 76  SER A CB    1 
ATOM   481  O  OG    . SER A  1  101 ? 27.165  69.757  159.126 1.00 61.62  ? 76  SER A OG    1 
ATOM   482  N  N     . GLN A  1  102 ? 31.131  70.253  161.189 1.00 50.75  ? 77  GLN A N     1 
ATOM   483  C  CA    . GLN A  1  102 ? 32.595  70.261  161.262 1.00 53.98  ? 77  GLN A CA    1 
ATOM   484  C  C     . GLN A  1  102 ? 33.055  69.204  162.255 1.00 48.98  ? 77  GLN A C     1 
ATOM   485  O  O     . GLN A  1  102 ? 33.861  68.352  161.909 1.00 48.08  ? 77  GLN A O     1 
ATOM   486  C  CB    . GLN A  1  102 ? 33.150  71.661  161.639 1.00 58.96  ? 77  GLN A CB    1 
ATOM   487  C  CG    . GLN A  1  102 ? 34.623  71.723  162.125 1.00 65.23  ? 77  GLN A CG    1 
ATOM   488  C  CD    . GLN A  1  102 ? 34.825  71.705  163.663 1.00 69.97  ? 77  GLN A CD    1 
ATOM   489  O  OE1   . GLN A  1  102 ? 35.702  70.994  164.201 1.00 67.94  ? 77  GLN A OE1   1 
ATOM   490  N  NE2   . GLN A  1  102 ? 34.036  72.513  164.372 1.00 73.44  ? 77  GLN A NE2   1 
ATOM   491  N  N     . GLN A  1  103 ? 32.546  69.276  163.481 1.00 48.97  ? 78  GLN A N     1 
ATOM   492  C  CA    . GLN A  1  103 ? 32.927  68.323  164.541 1.00 47.56  ? 78  GLN A CA    1 
ATOM   493  C  C     . GLN A  1  103 ? 32.698  66.862  164.101 1.00 44.27  ? 78  GLN A C     1 
ATOM   494  O  O     . GLN A  1  103 ? 33.570  66.017  164.257 1.00 46.36  ? 78  GLN A O     1 
ATOM   495  C  CB    . GLN A  1  103 ? 32.150  68.606  165.826 1.00 49.59  ? 78  GLN A CB    1 
ATOM   496  C  CG    . GLN A  1  103 ? 32.516  69.921  166.489 1.00 50.22  ? 78  GLN A CG    1 
ATOM   497  C  CD    . GLN A  1  103 ? 31.481  70.409  167.486 1.00 55.10  ? 78  GLN A CD    1 
ATOM   498  O  OE1   . GLN A  1  103 ? 30.282  70.117  167.387 1.00 52.60  ? 78  GLN A OE1   1 
ATOM   499  N  NE2   . GLN A  1  103 ? 31.941  71.189  168.449 1.00 61.23  ? 78  GLN A NE2   1 
ATOM   500  N  N     . LEU A  1  104 ? 31.538  66.614  163.511 1.00 42.80  ? 79  LEU A N     1 
ATOM   501  C  CA    . LEU A  1  104 ? 31.160  65.284  163.026 1.00 43.35  ? 79  LEU A CA    1 
ATOM   502  C  C     . LEU A  1  104 ? 32.124  64.779  161.964 1.00 46.75  ? 79  LEU A C     1 
ATOM   503  O  O     . LEU A  1  104 ? 32.542  63.617  162.006 1.00 45.76  ? 79  LEU A O     1 
ATOM   504  C  CB    . LEU A  1  104 ? 29.728  65.305  162.508 1.00 41.49  ? 79  LEU A CB    1 
ATOM   505  C  CG    . LEU A  1  104 ? 28.952  63.995  162.469 1.00 47.30  ? 79  LEU A CG    1 
ATOM   506  C  CD1   . LEU A  1  104 ? 28.807  63.327  163.827 1.00 45.83  ? 79  LEU A CD1   1 
ATOM   507  C  CD2   . LEU A  1  104 ? 27.570  64.267  161.886 1.00 48.55  ? 79  LEU A CD2   1 
ATOM   508  N  N     . ARG A  1  105 ? 32.496  65.662  161.039 1.00 46.56  ? 80  ARG A N     1 
ATOM   509  C  CA    . ARG A  1  105 ? 33.500  65.370  160.011 1.00 48.00  ? 80  ARG A CA    1 
ATOM   510  C  C     . ARG A  1  105 ? 34.819  64.943  160.611 1.00 45.47  ? 80  ARG A C     1 
ATOM   511  O  O     . ARG A  1  105 ? 35.426  63.954  160.174 1.00 47.89  ? 80  ARG A O     1 
ATOM   512  C  CB    . ARG A  1  105 ? 33.770  66.602  159.114 1.00 56.05  ? 80  ARG A CB    1 
ATOM   513  C  CG    . ARG A  1  105 ? 33.325  66.462  157.669 1.00 62.19  ? 80  ARG A CG    1 
ATOM   514  C  CD    . ARG A  1  105 ? 33.971  67.518  156.764 1.00 69.45  ? 80  ARG A CD    1 
ATOM   515  N  NE    . ARG A  1  105 ? 33.795  68.891  157.268 1.00 75.81  ? 80  ARG A NE    1 
ATOM   516  C  CZ    . ARG A  1  105 ? 32.667  69.610  157.203 1.00 72.41  ? 80  ARG A CZ    1 
ATOM   517  N  NH1   . ARG A  1  105 ? 31.560  69.112  156.649 1.00 69.05  ? 80  ARG A NH1   1 
ATOM   518  N  NH2   . ARG A  1  105 ? 32.648  70.846  157.706 1.00 71.15  ? 80  ARG A NH2   1 
ATOM   519  N  N     . LYS A  1  106 ? 35.275  65.705  161.593 1.00 43.60  ? 81  LYS A N     1 
ATOM   520  C  CA    . LYS A  1  106 ? 36.548  65.412  162.216 1.00 46.26  ? 81  LYS A CA    1 
ATOM   521  C  C     . LYS A  1  106 ? 36.481  64.059  162.938 1.00 45.31  ? 81  LYS A C     1 
ATOM   522  O  O     . LYS A  1  106 ? 37.380  63.239  162.798 1.00 44.52  ? 81  LYS A O     1 
ATOM   523  C  CB    . LYS A  1  106 ? 36.977  66.526  163.176 1.00 48.44  ? 81  LYS A CB    1 
ATOM   524  C  CG    . LYS A  1  106 ? 38.212  66.136  163.982 1.00 53.78  ? 81  LYS A CG    1 
ATOM   525  C  CD    . LYS A  1  106 ? 39.013  67.299  164.540 1.00 58.89  ? 81  LYS A CD    1 
ATOM   526  C  CE    . LYS A  1  106 ? 40.477  66.877  164.640 1.00 67.20  ? 81  LYS A CE    1 
ATOM   527  N  NZ    . LYS A  1  106 ? 41.374  67.917  165.207 1.00 74.10  ? 81  LYS A NZ    1 
ATOM   528  N  N     . ALA A  1  107 ? 35.406  63.837  163.690 1.00 42.39  ? 82  ALA A N     1 
ATOM   529  C  CA    . ALA A  1  107 ? 35.208  62.568  164.424 1.00 42.12  ? 82  ALA A CA    1 
ATOM   530  C  C     . ALA A  1  107 ? 35.183  61.378  163.478 1.00 38.66  ? 82  ALA A C     1 
ATOM   531  O  O     . ALA A  1  107 ? 35.796  60.357  163.736 1.00 39.37  ? 82  ALA A O     1 
ATOM   532  C  CB    . ALA A  1  107 ? 33.910  62.628  165.232 1.00 42.39  ? 82  ALA A CB    1 
ATOM   533  N  N     . GLN A  1  108 ? 34.494  61.555  162.362 1.00 41.35  ? 83  GLN A N     1 
ATOM   534  C  CA    . GLN A  1  108 ? 34.402  60.564  161.323 1.00 45.01  ? 83  GLN A CA    1 
ATOM   535  C  C     . GLN A  1  108 ? 35.790  60.114  160.866 1.00 50.64  ? 83  GLN A C     1 
ATOM   536  O  O     . GLN A  1  108 ? 36.057  58.906  160.803 1.00 47.54  ? 83  GLN A O     1 
ATOM   537  C  CB    . GLN A  1  108 ? 33.552  61.131  160.178 1.00 46.68  ? 83  GLN A CB    1 
ATOM   538  C  CG    . GLN A  1  108 ? 33.288  60.225  158.993 1.00 50.26  ? 83  GLN A CG    1 
ATOM   539  C  CD    . GLN A  1  108 ? 32.538  58.982  159.367 1.00 49.51  ? 83  GLN A CD    1 
ATOM   540  O  OE1   . GLN A  1  108 ? 33.142  57.994  159.784 1.00 61.69  ? 83  GLN A OE1   1 
ATOM   541  N  NE2   . GLN A  1  108 ? 31.230  59.002  159.207 1.00 44.58  ? 83  GLN A NE2   1 
ATOM   542  N  N     . LEU A  1  109 ? 36.687  61.069  160.597 1.00 51.98  ? 84  LEU A N     1 
ATOM   543  C  CA    . LEU A  1  109 ? 38.065  60.722  160.196 1.00 51.86  ? 84  LEU A CA    1 
ATOM   544  C  C     . LEU A  1  109 ? 38.828  59.986  161.274 1.00 46.22  ? 84  LEU A C     1 
ATOM   545  O  O     . LEU A  1  109 ? 39.531  59.046  160.966 1.00 50.21  ? 84  LEU A O     1 
ATOM   546  C  CB    . LEU A  1  109 ? 38.897  61.946  159.775 1.00 56.39  ? 84  LEU A CB    1 
ATOM   547  C  CG    . LEU A  1  109 ? 38.906  62.278  158.285 1.00 60.78  ? 84  LEU A CG    1 
ATOM   548  C  CD1   . LEU A  1  109 ? 37.593  62.930  157.900 1.00 65.81  ? 84  LEU A CD1   1 
ATOM   549  C  CD2   . LEU A  1  109 ? 40.074  63.200  157.951 1.00 64.92  ? 84  LEU A CD2   1 
ATOM   550  N  N     . GLN A  1  110 ? 38.710  60.433  162.517 1.00 44.84  ? 85  GLN A N     1 
ATOM   551  C  CA    . GLN A  1  110 ? 39.454  59.839  163.638 1.00 49.14  ? 85  GLN A CA    1 
ATOM   552  C  C     . GLN A  1  110 ? 38.953  58.414  163.900 1.00 46.74  ? 85  GLN A C     1 
ATOM   553  O  O     . GLN A  1  110 ? 39.761  57.496  164.002 1.00 47.21  ? 85  GLN A O     1 
ATOM   554  C  CB    . GLN A  1  110 ? 39.361  60.705  164.907 1.00 55.99  ? 85  GLN A CB    1 
ATOM   555  C  CG    . GLN A  1  110 ? 39.708  62.176  164.651 1.00 63.35  ? 85  GLN A CG    1 
ATOM   556  C  CD    . GLN A  1  110 ? 40.195  62.946  165.871 1.00 71.45  ? 85  GLN A CD    1 
ATOM   557  O  OE1   . GLN A  1  110 ? 39.390  63.400  166.680 1.00 74.01  ? 85  GLN A OE1   1 
ATOM   558  N  NE2   . GLN A  1  110 ? 41.514  63.141  165.981 1.00 73.47  ? 85  GLN A NE2   1 
ATOM   559  N  N     . VAL A  1  111 ? 37.626  58.238  163.924 1.00 44.53  ? 86  VAL A N     1 
ATOM   560  C  CA    . VAL A  1  111 ? 36.988  56.915  164.067 1.00 41.45  ? 86  VAL A CA    1 
ATOM   561  C  C     . VAL A  1  111 ? 37.400  55.986  162.916 1.00 41.33  ? 86  VAL A C     1 
ATOM   562  O  O     . VAL A  1  111 ? 37.826  54.866  163.187 1.00 40.84  ? 86  VAL A O     1 
ATOM   563  C  CB    . VAL A  1  111 ? 35.443  57.006  164.205 1.00 40.74  ? 86  VAL A CB    1 
ATOM   564  C  CG1   . VAL A  1  111 ? 34.811  55.621  164.243 1.00 41.84  ? 86  VAL A CG1   1 
ATOM   565  C  CG2   . VAL A  1  111 ? 35.053  57.733  165.481 1.00 39.98  ? 86  VAL A CG2   1 
ATOM   566  N  N     . ASP A  1  112 ? 37.359  56.451  161.660 1.00 43.84  ? 87  ASP A N     1 
ATOM   567  C  CA    . ASP A  1  112 ? 37.718  55.584  160.517 1.00 43.32  ? 87  ASP A CA    1 
ATOM   568  C  C     . ASP A  1  112 ? 39.203  55.190  160.548 1.00 48.01  ? 87  ASP A C     1 
ATOM   569  O  O     . ASP A  1  112 ? 39.573  54.147  160.014 1.00 47.10  ? 87  ASP A O     1 
ATOM   570  C  CB    . ASP A  1  112 ? 37.390  56.224  159.157 1.00 46.64  ? 87  ASP A CB    1 
ATOM   571  C  CG    . ASP A  1  112 ? 35.872  56.319  158.865 1.00 51.63  ? 87  ASP A CG    1 
ATOM   572  O  OD1   . ASP A  1  112 ? 35.034  55.694  159.547 1.00 53.45  ? 87  ASP A OD1   1 
ATOM   573  O  OD2   . ASP A  1  112 ? 35.508  57.039  157.923 1.00 54.12  ? 87  ASP A OD2   1 
ATOM   574  N  N     . ARG A  1  113 ? 40.052  56.009  161.164 1.00 49.00  ? 88  ARG A N     1 
ATOM   575  C  CA    . ARG A  1  113 ? 41.456  55.650  161.333 1.00 54.97  ? 88  ARG A CA    1 
ATOM   576  C  C     . ARG A  1  113 ? 41.563  54.460  162.271 1.00 50.63  ? 88  ARG A C     1 
ATOM   577  O  O     . ARG A  1  113 ? 42.252  53.505  161.977 1.00 47.49  ? 88  ARG A O     1 
ATOM   578  C  CB    . ARG A  1  113 ? 42.262  56.818  161.912 1.00 62.17  ? 88  ARG A CB    1 
ATOM   579  C  CG    . ARG A  1  113 ? 43.767  56.575  162.028 1.00 72.92  ? 88  ARG A CG    1 
ATOM   580  C  CD    . ARG A  1  113 ? 44.570  57.220  160.902 1.00 82.94  ? 88  ARG A CD    1 
ATOM   581  N  NE    . ARG A  1  113 ? 45.686  58.013  161.428 1.00 93.44  ? 88  ARG A NE    1 
ATOM   582  C  CZ    . ARG A  1  113 ? 45.576  59.215  162.015 1.00 102.75 ? 88  ARG A CZ    1 
ATOM   583  N  NH1   . ARG A  1  113 ? 46.675  59.833  162.447 1.00 107.10 ? 88  ARG A NH1   1 
ATOM   584  N  NH2   . ARG A  1  113 ? 44.387  59.811  162.186 1.00 104.45 ? 88  ARG A NH2   1 
ATOM   585  N  N     . PHE A  1  114 ? 40.909  54.560  163.423 1.00 49.06  ? 89  PHE A N     1 
ATOM   586  C  CA    . PHE A  1  114 ? 40.853  53.459  164.385 1.00 49.09  ? 89  PHE A CA    1 
ATOM   587  C  C     . PHE A  1  114 ? 40.232  52.191  163.757 1.00 41.69  ? 89  PHE A C     1 
ATOM   588  O  O     . PHE A  1  114 ? 40.781  51.101  163.887 1.00 45.20  ? 89  PHE A O     1 
ATOM   589  C  CB    . PHE A  1  114 ? 40.096  53.907  165.648 1.00 51.98  ? 89  PHE A CB    1 
ATOM   590  C  CG    . PHE A  1  114 ? 40.256  52.988  166.824 1.00 54.08  ? 89  PHE A CG    1 
ATOM   591  C  CD1   . PHE A  1  114 ? 41.512  52.704  167.340 1.00 62.07  ? 89  PHE A CD1   1 
ATOM   592  C  CD2   . PHE A  1  114 ? 39.148  52.435  167.448 1.00 56.48  ? 89  PHE A CD2   1 
ATOM   593  C  CE1   . PHE A  1  114 ? 41.658  51.860  168.437 1.00 63.55  ? 89  PHE A CE1   1 
ATOM   594  C  CE2   . PHE A  1  114 ? 39.284  51.595  168.547 1.00 53.28  ? 89  PHE A CE2   1 
ATOM   595  C  CZ    . PHE A  1  114 ? 40.537  51.300  169.036 1.00 58.33  ? 89  PHE A CZ    1 
ATOM   596  N  N     . ALA A  1  115 ? 39.131  52.344  163.036 1.00 36.96  ? 90  ALA A N     1 
ATOM   597  C  CA    . ALA A  1  115 ? 38.487  51.214  162.348 1.00 38.41  ? 90  ALA A CA    1 
ATOM   598  C  C     . ALA A  1  115 ? 39.421  50.490  161.365 1.00 42.85  ? 90  ALA A C     1 
ATOM   599  O  O     . ALA A  1  115 ? 39.369  49.251  161.232 1.00 37.71  ? 90  ALA A O     1 
ATOM   600  C  CB    . ALA A  1  115 ? 37.216  51.684  161.647 1.00 35.99  ? 90  ALA A CB    1 
ATOM   601  N  N     . MET A  1  116 ? 40.280  51.256  160.683 1.00 41.76  ? 91  MET A N     1 
ATOM   602  C  CA    . MET A  1  116 ? 41.249  50.687  159.731 1.00 42.76  ? 91  MET A CA    1 
ATOM   603  C  C     . MET A  1  116 ? 42.242  49.791  160.455 1.00 39.86  ? 91  MET A C     1 
ATOM   604  O  O     . MET A  1  116 ? 42.550  48.719  159.945 1.00 43.29  ? 91  MET A O     1 
ATOM   605  C  CB    . MET A  1  116 ? 42.009  51.766  158.916 1.00 42.61  ? 91  MET A CB    1 
ATOM   606  N  N     . GLU A  1  117 ? 42.698  50.211  161.634 1.00 37.60  ? 92  GLU A N     1 
ATOM   607  C  CA    . GLU A  1  117 ? 43.616  49.414  162.451 1.00 42.05  ? 92  GLU A CA    1 
ATOM   608  C  C     . GLU A  1  117 ? 42.919  48.144  162.985 1.00 44.95  ? 92  GLU A C     1 
ATOM   609  O  O     . GLU A  1  117 ? 43.527  47.075  162.980 1.00 46.06  ? 92  GLU A O     1 
ATOM   610  C  CB    . GLU A  1  117 ? 44.197  50.232  163.616 1.00 41.11  ? 92  GLU A CB    1 
ATOM   611  N  N     . LEU A  1  118 ? 41.652  48.258  163.415 1.00 41.04  ? 93  LEU A N     1 
ATOM   612  C  CA    . LEU A  1  118 ? 40.891  47.087  163.888 1.00 39.60  ? 93  LEU A CA    1 
ATOM   613  C  C     . LEU A  1  118 ? 40.728  46.093  162.755 1.00 38.78  ? 93  LEU A C     1 
ATOM   614  O  O     . LEU A  1  118 ? 41.029  44.912  162.909 1.00 40.27  ? 93  LEU A O     1 
ATOM   615  C  CB    . LEU A  1  118 ? 39.516  47.490  164.424 1.00 38.43  ? 93  LEU A CB    1 
ATOM   616  C  CG    . LEU A  1  118 ? 39.471  48.310  165.704 1.00 37.81  ? 93  LEU A CG    1 
ATOM   617  C  CD1   . LEU A  1  118 ? 38.028  48.562  166.146 1.00 38.44  ? 93  LEU A CD1   1 
ATOM   618  C  CD2   . LEU A  1  118 ? 40.239  47.626  166.819 1.00 39.32  ? 93  LEU A CD2   1 
ATOM   619  N  N     . GLU A  1  119 ? 40.298  46.600  161.606 1.00 38.72  ? 94  GLU A N     1 
ATOM   620  C  CA    . GLU A  1  119 ? 40.110  45.802  160.419 1.00 39.79  ? 94  GLU A CA    1 
ATOM   621  C  C     . GLU A  1  119 ? 41.370  45.060  159.969 1.00 42.93  ? 94  GLU A C     1 
ATOM   622  O  O     . GLU A  1  119 ? 41.301  43.876  159.646 1.00 37.83  ? 94  GLU A O     1 
ATOM   623  C  CB    . GLU A  1  119 ? 39.582  46.675  159.283 1.00 39.82  ? 94  GLU A CB    1 
ATOM   624  C  CG    . GLU A  1  119 ? 39.159  45.909  158.051 1.00 40.56  ? 94  GLU A CG    1 
ATOM   625  C  CD    . GLU A  1  119 ? 38.068  44.883  158.353 1.00 41.14  ? 94  GLU A CD    1 
ATOM   626  O  OE1   . GLU A  1  119 ? 36.935  45.297  158.747 1.00 36.57  ? 94  GLU A OE1   1 
ATOM   627  O  OE2   . GLU A  1  119 ? 38.350  43.672  158.220 1.00 33.77  ? 94  GLU A OE2   1 
ATOM   628  N  N     . GLN A  1  120 ? 42.521  45.738  159.985 1.00 43.69  ? 95  GLN A N     1 
ATOM   629  C  CA    . GLN A  1  120 ? 43.768  45.126  159.510 1.00 45.45  ? 95  GLN A CA    1 
ATOM   630  C  C     . GLN A  1  120 ? 44.228  44.003  160.423 1.00 43.34  ? 95  GLN A C     1 
ATOM   631  O  O     . GLN A  1  120 ? 44.837  43.049  159.956 1.00 44.88  ? 95  GLN A O     1 
ATOM   632  C  CB    . GLN A  1  120 ? 44.887  46.163  159.296 1.00 50.02  ? 95  GLN A CB    1 
ATOM   633  C  CG    . GLN A  1  120 ? 44.634  46.996  158.030 1.00 60.49  ? 95  GLN A CG    1 
ATOM   634  C  CD    . GLN A  1  120 ? 45.824  47.819  157.576 1.00 68.22  ? 95  GLN A CD    1 
ATOM   635  O  OE1   . GLN A  1  120 ? 46.722  48.140  158.367 1.00 67.49  ? 95  GLN A OE1   1 
ATOM   636  N  NE2   . GLN A  1  120 ? 45.837  48.170  156.283 1.00 71.91  ? 95  GLN A NE2   1 
ATOM   637  N  N     . SER A  1  121 ? 43.925  44.111  161.709 1.00 37.93  ? 96  SER A N     1 
ATOM   638  C  CA    . SER A  1  121 ? 44.227  43.038  162.653 1.00 41.74  ? 96  SER A CA    1 
ATOM   639  C  C     . SER A  1  121 ? 43.146  41.931  162.763 1.00 37.13  ? 96  SER A C     1 
ATOM   640  O  O     . SER A  1  121 ? 43.334  41.044  163.557 1.00 36.35  ? 96  SER A O     1 
ATOM   641  C  CB    . SER A  1  121 ? 44.450  43.640  164.034 1.00 43.10  ? 96  SER A CB    1 
ATOM   642  O  OG    . SER A  1  121 ? 43.308  44.390  164.387 1.00 48.65  ? 96  SER A OG    1 
ATOM   643  N  N     . ARG A  1  122 ? 42.045  41.973  161.988 1.00 34.35  ? 97  ARG A N     1 
ATOM   644  C  CA    . ARG A  1  122 ? 40.973  40.968  162.105 1.00 30.34  ? 97  ARG A CA    1 
ATOM   645  C  C     . ARG A  1  122 ? 41.554  39.556  162.047 1.00 29.19  ? 97  ARG A C     1 
ATOM   646  O  O     . ARG A  1  122 ? 42.218  39.172  161.108 1.00 28.09  ? 97  ARG A O     1 
ATOM   647  C  CB    . ARG A  1  122 ? 39.917  41.107  161.013 1.00 30.04  ? 97  ARG A CB    1 
ATOM   648  C  CG    . ARG A  1  122 ? 38.706  40.198  161.211 1.00 29.50  ? 97  ARG A CG    1 
ATOM   649  C  CD    . ARG A  1  122 ? 37.725  40.291  160.042 1.00 26.14  ? 97  ARG A CD    1 
ATOM   650  N  NE    . ARG A  1  122 ? 37.175  41.630  159.914 1.00 27.07  ? 97  ARG A NE    1 
ATOM   651  C  CZ    . ARG A  1  122 ? 36.060  42.094  160.499 1.00 28.78  ? 97  ARG A CZ    1 
ATOM   652  N  NH1   . ARG A  1  122 ? 35.297  41.330  161.291 1.00 27.50  ? 97  ARG A NH1   1 
ATOM   653  N  NH2   . ARG A  1  122 ? 35.678  43.339  160.258 1.00 27.93  ? 97  ARG A NH2   1 
ATOM   654  N  N     . ASN A  1  123 ? 41.298  38.790  163.076 1.00 29.63  ? 98  ASN A N     1 
ATOM   655  C  CA    . ASN A  1  123 ? 41.772  37.442  163.126 1.00 30.11  ? 98  ASN A CA    1 
ATOM   656  C  C     . ASN A  1  123 ? 40.600  36.484  162.933 1.00 27.68  ? 98  ASN A C     1 
ATOM   657  O  O     . ASN A  1  123 ? 39.674  36.447  163.783 1.00 24.10  ? 98  ASN A O     1 
ATOM   658  C  CB    . ASN A  1  123 ? 42.463  37.216  164.465 1.00 28.67  ? 98  ASN A CB    1 
ATOM   659  C  CG    . ASN A  1  123 ? 43.159  35.900  164.516 1.00 32.67  ? 98  ASN A CG    1 
ATOM   660  O  OD1   . ASN A  1  123 ? 42.683  34.924  163.949 1.00 33.01  ? 98  ASN A OD1   1 
ATOM   661  N  ND2   . ASN A  1  123 ? 44.321  35.865  165.150 1.00 35.86  ? 98  ASN A ND2   1 
ATOM   662  N  N     . LEU A  1  124 ? 40.668  35.714  161.851 1.00 23.19  ? 99  LEU A N     1 
ATOM   663  C  CA    . LEU A  1  124 ? 39.627  34.750  161.476 1.00 25.31  ? 99  LEU A CA    1 
ATOM   664  C  C     . LEU A  1  124 ? 40.070  33.296  161.621 1.00 26.29  ? 99  LEU A C     1 
ATOM   665  O  O     . LEU A  1  124 ? 39.330  32.379  161.227 1.00 28.45  ? 99  LEU A O     1 
ATOM   666  C  CB    . LEU A  1  124 ? 39.095  34.980  160.059 1.00 23.70  ? 99  LEU A CB    1 
ATOM   667  C  CG    . LEU A  1  124 ? 38.359  36.289  159.870 1.00 25.15  ? 99  LEU A CG    1 
ATOM   668  C  CD1   . LEU A  1  124 ? 38.016  36.495  158.412 1.00 25.22  ? 99  LEU A CD1   1 
ATOM   669  C  CD2   . LEU A  1  124 ? 37.117  36.398  160.757 1.00 27.79  ? 99  LEU A CD2   1 
ATOM   670  N  N     . SER A  1  125 ? 41.199  33.085  162.285 1.00 26.80  ? 100 SER A N     1 
ATOM   671  C  CA    . SER A  1  125 ? 41.837  31.777  162.283 1.00 32.47  ? 100 SER A CA    1 
ATOM   672  C  C     . SER A  1  125 ? 41.525  30.893  163.481 1.00 28.24  ? 100 SER A C     1 
ATOM   673  O  O     . SER A  1  125 ? 41.853  29.722  163.460 1.00 29.08  ? 100 SER A O     1 
ATOM   674  C  CB    . SER A  1  125 ? 43.360  31.940  162.148 1.00 32.30  ? 100 SER A CB    1 
ATOM   675  O  OG    . SER A  1  125 ? 43.562  32.448  160.862 1.00 38.43  ? 100 SER A OG    1 
ATOM   676  N  N     . ASN A  1  126 ? 40.875  31.432  164.495 1.00 30.98  ? 101 ASN A N     1 
ATOM   677  C  CA    . ASN A  1  126 ? 40.551  30.628  165.721 1.00 29.97  ? 101 ASN A CA    1 
ATOM   678  C  C     . ASN A  1  126 ? 39.091  30.142  165.713 1.00 29.61  ? 101 ASN A C     1 
ATOM   679  O  O     . ASN A  1  126 ? 38.210  30.824  165.219 1.00 35.44  ? 101 ASN A O     1 
ATOM   680  C  CB    . ASN A  1  126 ? 40.773  31.451  166.957 1.00 29.20  ? 101 ASN A CB    1 
ATOM   681  C  CG    . ASN A  1  126 ? 42.237  31.717  167.218 1.00 34.55  ? 101 ASN A CG    1 
ATOM   682  O  OD1   . ASN A  1  126 ? 42.806  31.198  168.160 1.00 38.54  ? 101 ASN A OD1   1 
ATOM   683  N  ND2   . ASN A  1  126 ? 42.840  32.546  166.395 1.00 36.72  ? 101 ASN A ND2   1 
ATOM   684  N  N     . THR A  1  127 ? 38.846  28.986  166.255 1.00 26.84  ? 102 THR A N     1 
ATOM   685  C  CA    . THR A  1  127 ? 37.506  28.455  166.285 1.00 27.42  ? 102 THR A CA    1 
ATOM   686  C  C     . THR A  1  127 ? 37.076  28.526  167.729 1.00 23.90  ? 102 THR A C     1 
ATOM   687  O  O     . THR A  1  127 ? 37.565  27.777  168.572 1.00 25.91  ? 102 THR A O     1 
ATOM   688  C  CB    . THR A  1  127 ? 37.463  27.065  165.683 1.00 26.23  ? 102 THR A CB    1 
ATOM   689  O  OG1   . THR A  1  127 ? 37.957  27.156  164.349 1.00 26.53  ? 102 THR A OG1   1 
ATOM   690  C  CG2   . THR A  1  127 ? 36.049  26.537  165.631 1.00 26.21  ? 102 THR A CG2   1 
ATOM   691  N  N     . ILE A  1  128 ? 36.237  29.519  168.007 1.00 21.57  ? 103 ILE A N     1 
ATOM   692  C  CA    . ILE A  1  128 ? 35.691  29.733  169.314 1.00 22.17  ? 103 ILE A CA    1 
ATOM   693  C  C     . ILE A  1  128 ? 34.325  29.086  169.380 1.00 22.91  ? 103 ILE A C     1 
ATOM   694  O  O     . ILE A  1  128 ? 33.488  29.279  168.479 1.00 21.59  ? 103 ILE A O     1 
ATOM   695  C  CB    . ILE A  1  128 ? 35.605  31.228  169.660 1.00 21.96  ? 103 ILE A CB    1 
ATOM   696  C  CG1   . ILE A  1  128 ? 36.970  31.887  169.501 1.00 22.64  ? 103 ILE A CG1   1 
ATOM   697  C  CG2   . ILE A  1  128 ? 35.103  31.428  171.098 1.00 21.56  ? 103 ILE A CG2   1 
ATOM   698  C  CD1   . ILE A  1  128 ? 38.058  31.280  170.391 1.00 22.43  ? 103 ILE A CD1   1 
ATOM   699  N  N     . VAL A  1  129 ? 34.117  28.335  170.461 1.00 22.52  ? 104 VAL A N     1 
ATOM   700  C  CA    . VAL A  1  129 ? 32.858  27.653  170.720 1.00 22.93  ? 104 VAL A CA    1 
ATOM   701  C  C     . VAL A  1  129 ? 32.314  28.170  172.022 1.00 23.98  ? 104 VAL A C     1 
ATOM   702  O  O     . VAL A  1  129 ? 33.043  28.246  172.992 1.00 27.36  ? 104 VAL A O     1 
ATOM   703  C  CB    . VAL A  1  129 ? 33.078  26.129  170.824 1.00 23.06  ? 104 VAL A CB    1 
ATOM   704  C  CG1   . VAL A  1  129 ? 31.798  25.409  171.260 1.00 23.44  ? 104 VAL A CG1   1 
ATOM   705  C  CG2   . VAL A  1  129 ? 33.572  25.578  169.506 1.00 22.87  ? 104 VAL A CG2   1 
ATOM   706  N  N     . HIS A  1  130 ? 31.055  28.564  172.037 1.00 22.74  ? 105 HIS A N     1 
ATOM   707  C  CA    . HIS A  1  130 ? 30.358  28.871  173.266 1.00 23.82  ? 105 HIS A CA    1 
ATOM   708  C  C     . HIS A  1  130 ? 29.307  27.794  173.496 1.00 24.43  ? 105 HIS A C     1 
ATOM   709  O  O     . HIS A  1  130 ? 28.492  27.544  172.593 1.00 24.66  ? 105 HIS A O     1 
ATOM   710  C  CB    . HIS A  1  130 ? 29.686  30.207  173.169 1.00 24.22  ? 105 HIS A CB    1 
ATOM   711  C  CG    . HIS A  1  130 ? 29.060  30.621  174.444 1.00 24.39  ? 105 HIS A CG    1 
ATOM   712  N  ND1   . HIS A  1  130 ? 27.698  30.642  174.632 1.00 25.88  ? 105 HIS A ND1   1 
ATOM   713  C  CD2   . HIS A  1  130 ? 29.614  30.953  175.628 1.00 26.43  ? 105 HIS A CD2   1 
ATOM   714  C  CE1   . HIS A  1  130 ? 27.437  30.982  175.878 1.00 27.45  ? 105 HIS A CE1   1 
ATOM   715  N  NE2   . HIS A  1  130 ? 28.585  31.203  176.496 1.00 27.91  ? 105 HIS A NE2   1 
ATOM   716  N  N     . ILE A  1  131 ? 29.356  27.154  174.663 1.00 23.26  ? 106 ILE A N     1 
ATOM   717  C  CA    . ILE A  1  131 ? 28.449  26.055  175.046 1.00 25.91  ? 106 ILE A CA    1 
ATOM   718  C  C     . ILE A  1  131 ? 27.536  26.617  176.136 1.00 25.00  ? 106 ILE A C     1 
ATOM   719  O  O     . ILE A  1  131 ? 28.001  27.320  177.032 1.00 22.94  ? 106 ILE A O     1 
ATOM   720  C  CB    . ILE A  1  131 ? 29.209  24.858  175.649 1.00 29.63  ? 106 ILE A CB    1 
ATOM   721  C  CG1   . ILE A  1  131 ? 30.241  24.274  174.699 1.00 31.81  ? 106 ILE A CG1   1 
ATOM   722  C  CG2   . ILE A  1  131 ? 28.238  23.770  176.082 1.00 34.40  ? 106 ILE A CG2   1 
ATOM   723  C  CD1   . ILE A  1  131 ? 29.689  23.550  173.510 1.00 32.01  ? 106 ILE A CD1   1 
ATOM   724  N  N     . ASP A  1  132 ? 26.245  26.351  176.042 1.00 22.83  ? 107 ASP A N     1 
ATOM   725  C  CA    . ASP A  1  132 ? 25.283  26.916  176.987 1.00 23.15  ? 107 ASP A CA    1 
ATOM   726  C  C     . ASP A  1  132 ? 24.145  25.927  177.220 1.00 22.74  ? 107 ASP A C     1 
ATOM   727  O  O     . ASP A  1  132 ? 23.401  25.622  176.301 1.00 23.52  ? 107 ASP A O     1 
ATOM   728  C  CB    . ASP A  1  132 ? 24.729  28.232  176.437 1.00 25.22  ? 107 ASP A CB    1 
ATOM   729  C  CG    . ASP A  1  132 ? 23.863  28.967  177.451 1.00 28.34  ? 107 ASP A CG    1 
ATOM   730  O  OD1   . ASP A  1  132 ? 22.958  28.388  178.082 1.00 23.38  ? 107 ASP A OD1   1 
ATOM   731  O  OD2   . ASP A  1  132 ? 24.112  30.151  177.634 1.00 42.05  ? 107 ASP A OD2   1 
ATOM   732  N  N     . MET A  1  133 ? 24.011  25.432  178.440 1.00 22.65  ? 108 MET A N     1 
ATOM   733  C  CA    . MET A  1  133 ? 22.967  24.465  178.781 1.00 21.81  ? 108 MET A CA    1 
ATOM   734  C  C     . MET A  1  133 ? 21.541  25.039  178.581 1.00 21.66  ? 108 MET A C     1 
ATOM   735  O  O     . MET A  1  133 ? 21.265  26.207  178.893 1.00 19.89  ? 108 MET A O     1 
ATOM   736  C  CB    . MET A  1  133 ? 23.120  23.962  180.225 1.00 22.88  ? 108 MET A CB    1 
ATOM   737  C  CG    . MET A  1  133 ? 24.476  23.291  180.591 1.00 22.37  ? 108 MET A CG    1 
ATOM   738  S  SD    . MET A  1  133 ? 24.837  21.831  179.614 1.00 24.99  ? 108 MET A SD    1 
ATOM   739  C  CE    . MET A  1  133 ? 23.617  20.677  180.237 1.00 25.38  ? 108 MET A CE    1 
ATOM   740  N  N     . ASP A  1  134 ? 20.645  24.180  178.110 1.00 20.42  ? 109 ASP A N     1 
ATOM   741  C  CA    . ASP A  1  134 ? 19.255  24.570  177.881 1.00 22.59  ? 109 ASP A CA    1 
ATOM   742  C  C     . ASP A  1  134 ? 18.439  24.541  179.162 1.00 22.91  ? 109 ASP A C     1 
ATOM   743  O  O     . ASP A  1  134 ? 18.397  23.499  179.865 1.00 23.47  ? 109 ASP A O     1 
ATOM   744  C  CB    . ASP A  1  134 ? 18.633  23.690  176.804 1.00 20.40  ? 109 ASP A CB    1 
ATOM   745  C  CG    . ASP A  1  134 ? 19.444  23.711  175.496 1.00 21.93  ? 109 ASP A CG    1 
ATOM   746  O  OD1   . ASP A  1  134 ? 19.883  24.813  175.091 1.00 23.29  ? 109 ASP A OD1   1 
ATOM   747  O  OD2   . ASP A  1  134 ? 19.574  22.655  174.814 1.00 21.10  ? 109 ASP A OD2   1 
ATOM   748  N  N     . ALA A  1  135 ? 17.804  25.679  179.455 1.00 19.65  ? 110 ALA A N     1 
ATOM   749  C  CA    . ALA A  1  135 ? 16.929  25.837  180.629 1.00 22.03  ? 110 ALA A CA    1 
ATOM   750  C  C     . ALA A  1  135 ? 17.535  25.167  181.885 1.00 21.38  ? 110 ALA A C     1 
ATOM   751  O  O     . ALA A  1  135 ? 16.834  24.515  182.626 1.00 20.37  ? 110 ALA A O     1 
ATOM   752  C  CB    . ALA A  1  135 ? 15.551  25.267  180.312 1.00 21.59  ? 110 ALA A CB    1 
ATOM   753  N  N     . PHE A  1  136 ? 18.831  25.398  182.115 1.00 21.01  ? 111 PHE A N     1 
ATOM   754  C  CA    . PHE A  1  136 ? 19.661  24.537  182.953 1.00 21.99  ? 111 PHE A CA    1 
ATOM   755  C  C     . PHE A  1  136 ? 19.005  24.022  184.242 1.00 21.46  ? 111 PHE A C     1 
ATOM   756  O  O     . PHE A  1  136 ? 18.816  22.839  184.393 1.00 22.36  ? 111 PHE A O     1 
ATOM   757  C  CB    . PHE A  1  136 ? 20.991  25.243  183.291 1.00 22.79  ? 111 PHE A CB    1 
ATOM   758  C  CG    . PHE A  1  136 ? 21.968  24.373  184.038 1.00 23.69  ? 111 PHE A CG    1 
ATOM   759  C  CD1   . PHE A  1  136 ? 22.176  23.042  183.669 1.00 26.40  ? 111 PHE A CD1   1 
ATOM   760  C  CD2   . PHE A  1  136 ? 22.748  24.901  185.041 1.00 25.15  ? 111 PHE A CD2   1 
ATOM   761  C  CE1   . PHE A  1  136 ? 23.090  22.252  184.342 1.00 25.84  ? 111 PHE A CE1   1 
ATOM   762  C  CE2   . PHE A  1  136 ? 23.661  24.117  185.707 1.00 23.25  ? 111 PHE A CE2   1 
ATOM   763  C  CZ    . PHE A  1  136 ? 23.837  22.810  185.361 1.00 24.26  ? 111 PHE A CZ    1 
ATOM   764  N  N     . TYR A  1  137 ? 18.674  24.895  185.180 1.00 21.13  ? 112 TYR A N     1 
ATOM   765  C  CA    . TYR A  1  137 ? 18.107  24.412  186.454 1.00 22.52  ? 112 TYR A CA    1 
ATOM   766  C  C     . TYR A  1  137 ? 16.800  23.654  186.227 1.00 22.61  ? 112 TYR A C     1 
ATOM   767  O  O     . TYR A  1  137 ? 16.563  22.632  186.873 1.00 21.06  ? 112 TYR A O     1 
ATOM   768  C  CB    . TYR A  1  137 ? 17.848  25.547  187.454 1.00 22.00  ? 112 TYR A CB    1 
ATOM   769  C  CG    . TYR A  1  137 ? 19.051  26.326  188.014 1.00 22.20  ? 112 TYR A CG    1 
ATOM   770  C  CD1   . TYR A  1  137 ? 18.835  27.321  188.966 1.00 21.78  ? 112 TYR A CD1   1 
ATOM   771  C  CD2   . TYR A  1  137 ? 20.364  26.097  187.593 1.00 21.70  ? 112 TYR A CD2   1 
ATOM   772  C  CE1   . TYR A  1  137 ? 19.867  28.078  189.470 1.00 22.61  ? 112 TYR A CE1   1 
ATOM   773  C  CE2   . TYR A  1  137 ? 21.415  26.839  188.105 1.00 21.39  ? 112 TYR A CE2   1 
ATOM   774  C  CZ    . TYR A  1  137 ? 21.153  27.824  189.033 1.00 22.50  ? 112 TYR A CZ    1 
ATOM   775  O  OH    . TYR A  1  137 ? 22.151  28.556  189.546 1.00 24.20  ? 112 TYR A OH    1 
ATOM   776  N  N     . ALA A  1  138 ? 15.937  24.163  185.336 1.00 23.60  ? 113 ALA A N     1 
ATOM   777  C  CA    . ALA A  1  138 ? 14.653  23.509  185.074 1.00 22.34  ? 113 ALA A CA    1 
ATOM   778  C  C     . ALA A  1  138 ? 14.840  22.183  184.431 1.00 22.85  ? 113 ALA A C     1 
ATOM   779  O  O     . ALA A  1  138 ? 14.113  21.249  184.749 1.00 24.52  ? 113 ALA A O     1 
ATOM   780  C  CB    . ALA A  1  138 ? 13.743  24.371  184.211 1.00 23.35  ? 113 ALA A CB    1 
ATOM   781  N  N     . ALA A  1  139 ? 15.802  22.088  183.513 1.00 20.54  ? 114 ALA A N     1 
ATOM   782  C  CA    . ALA A  1  139 ? 16.097  20.832  182.843 1.00 21.99  ? 114 ALA A CA    1 
ATOM   783  C  C     . ALA A  1  139 ? 16.579  19.737  183.814 1.00 22.13  ? 114 ALA A C     1 
ATOM   784  O  O     . ALA A  1  139 ? 16.213  18.559  183.690 1.00 21.20  ? 114 ALA A O     1 
ATOM   785  C  CB    . ALA A  1  139 ? 17.091  21.029  181.685 1.00 20.59  ? 114 ALA A CB    1 
ATOM   786  N  N     . VAL A  1  140 ? 17.395  20.117  184.775 1.00 22.54  ? 115 VAL A N     1 
ATOM   787  C  CA    . VAL A  1  140 ? 17.790  19.182  185.820 1.00 22.87  ? 115 VAL A CA    1 
ATOM   788  C  C     . VAL A  1  140 ? 16.553  18.730  186.616 1.00 23.48  ? 115 VAL A C     1 
ATOM   789  O  O     . VAL A  1  140 ? 16.397  17.539  186.908 1.00 23.48  ? 115 VAL A O     1 
ATOM   790  C  CB    . VAL A  1  140 ? 18.811  19.842  186.782 1.00 23.61  ? 115 VAL A CB    1 
ATOM   791  C  CG1   . VAL A  1  140 ? 18.984  18.988  188.027 1.00 26.07  ? 115 VAL A CG1   1 
ATOM   792  C  CG2   . VAL A  1  140 ? 20.158  20.018  186.082 1.00 23.72  ? 115 VAL A CG2   1 
ATOM   793  N  N     . GLU A  1  141 ? 15.661  19.658  186.953 1.00 23.67  ? 116 GLU A N     1 
ATOM   794  C  CA    . GLU A  1  141 ? 14.483  19.254  187.751 1.00 25.16  ? 116 GLU A CA    1 
ATOM   795  C  C     . GLU A  1  141 ? 13.552  18.359  186.981 1.00 27.08  ? 116 GLU A C     1 
ATOM   796  O  O     . GLU A  1  141 ? 12.976  17.419  187.549 1.00 27.73  ? 116 GLU A O     1 
ATOM   797  C  CB    . GLU A  1  141 ? 13.736  20.450  188.328 1.00 25.44  ? 116 GLU A CB    1 
ATOM   798  C  CG    . GLU A  1  141 ? 14.605  21.318  189.239 1.00 26.34  ? 116 GLU A CG    1 
ATOM   799  C  CD    . GLU A  1  141 ? 15.244  20.563  190.401 1.00 29.33  ? 116 GLU A CD    1 
ATOM   800  O  OE1   . GLU A  1  141 ? 14.658  19.545  190.860 1.00 28.13  ? 116 GLU A OE1   1 
ATOM   801  O  OE2   . GLU A  1  141 ? 16.326  21.025  190.851 1.00 28.26  ? 116 GLU A OE2   1 
ATOM   802  N  N     . MET A  1  142 ? 13.416  18.603  185.690 1.00 26.40  ? 117 MET A N     1 
ATOM   803  C  CA    . MET A  1  142 ? 12.554  17.767  184.861 1.00 27.67  ? 117 MET A CA    1 
ATOM   804  C  C     . MET A  1  142 ? 13.169  16.387  184.666 1.00 28.30  ? 117 MET A C     1 
ATOM   805  O  O     . MET A  1  142 ? 12.462  15.397  184.582 1.00 27.97  ? 117 MET A O     1 
ATOM   806  C  CB    . MET A  1  142 ? 12.319  18.393  183.478 1.00 28.90  ? 117 MET A CB    1 
ATOM   807  C  CG    . MET A  1  142 ? 11.448  19.634  183.487 1.00 32.15  ? 117 MET A CG    1 
ATOM   808  S  SD    . MET A  1  142 ? 11.630  20.580  181.958 1.00 35.86  ? 117 MET A SD    1 
ATOM   809  C  CE    . MET A  1  142 ? 10.760  19.574  180.812 1.00 36.74  ? 117 MET A CE    1 
ATOM   810  N  N     . ARG A  1  143 ? 14.490  16.339  184.562 1.00 27.99  ? 118 ARG A N     1 
ATOM   811  C  CA    . ARG A  1  143 ? 15.198  15.088  184.384 1.00 27.84  ? 118 ARG A CA    1 
ATOM   812  C  C     . ARG A  1  143 ? 14.888  14.151  185.547 1.00 29.46  ? 118 ARG A C     1 
ATOM   813  O  O     . ARG A  1  143 ? 14.680  12.960  185.342 1.00 26.38  ? 118 ARG A O     1 
ATOM   814  C  CB    . ARG A  1  143 ? 16.703  15.329  184.362 1.00 26.89  ? 118 ARG A CB    1 
ATOM   815  C  CG    . ARG A  1  143 ? 17.538  14.076  184.171 1.00 27.27  ? 118 ARG A CG    1 
ATOM   816  C  CD    . ARG A  1  143 ? 19.017  14.357  184.418 1.00 26.78  ? 118 ARG A CD    1 
ATOM   817  N  NE    . ARG A  1  143 ? 19.316  14.677  185.815 1.00 25.88  ? 118 ARG A NE    1 
ATOM   818  C  CZ    . ARG A  1  143 ? 20.536  14.846  186.317 1.00 27.43  ? 118 ARG A CZ    1 
ATOM   819  N  NH1   . ARG A  1  143 ? 21.605  14.734  185.548 1.00 26.18  ? 118 ARG A NH1   1 
ATOM   820  N  NH2   . ARG A  1  143 ? 20.699  15.105  187.616 1.00 25.49  ? 118 ARG A NH2   1 
ATOM   821  N  N     . ASP A  1  144 ? 14.857  14.710  186.750 1.00 26.50  ? 119 ASP A N     1 
ATOM   822  C  CA    . ASP A  1  144 ? 14.748  13.920  187.949 1.00 28.15  ? 119 ASP A CA    1 
ATOM   823  C  C     . ASP A  1  144 ? 13.343  13.800  188.570 1.00 30.55  ? 119 ASP A C     1 
ATOM   824  O  O     . ASP A  1  144 ? 13.194  13.129  189.598 1.00 30.73  ? 119 ASP A O     1 
ATOM   825  C  CB    . ASP A  1  144 ? 15.763  14.460  188.933 1.00 27.90  ? 119 ASP A CB    1 
ATOM   826  C  CG    . ASP A  1  144 ? 17.207  14.254  188.430 1.00 28.38  ? 119 ASP A CG    1 
ATOM   827  O  OD1   . ASP A  1  144 ? 17.474  13.281  187.691 1.00 28.22  ? 119 ASP A OD1   1 
ATOM   828  O  OD2   . ASP A  1  144 ? 18.060  15.095  188.751 1.00 28.64  ? 119 ASP A OD2   1 
ATOM   829  N  N     . ASN A  1  145 ? 12.347  14.438  187.951 1.00 27.37  ? 120 ASN A N     1 
ATOM   830  C  CA    . ASN A  1  145 ? 10.948  14.209  188.235 1.00 28.28  ? 120 ASN A CA    1 
ATOM   831  C  C     . ASN A  1  145 ? 10.174  14.218  186.895 1.00 31.33  ? 120 ASN A C     1 
ATOM   832  O  O     . ASN A  1  145 ? 9.623   15.232  186.493 1.00 28.55  ? 120 ASN A O     1 
ATOM   833  C  CB    . ASN A  1  145 ? 10.441  15.268  189.181 1.00 30.43  ? 120 ASN A CB    1 
ATOM   834  C  CG    . ASN A  1  145 ? 9.003   15.004  189.641 1.00 32.96  ? 120 ASN A CG    1 
ATOM   835  O  OD1   . ASN A  1  145 ? 8.315   14.120  189.140 1.00 30.53  ? 120 ASN A OD1   1 
ATOM   836  N  ND2   . ASN A  1  145 ? 8.565   15.776  190.609 1.00 33.68  ? 120 ASN A ND2   1 
ATOM   837  N  N     . PRO A  1  146 ? 10.169  13.084  186.168 1.00 36.83  ? 121 PRO A N     1 
ATOM   838  C  CA    . PRO A  1  146 ? 9.734   13.121  184.760 1.00 38.27  ? 121 PRO A CA    1 
ATOM   839  C  C     . PRO A  1  146 ? 8.236   13.471  184.556 1.00 41.08  ? 121 PRO A C     1 
ATOM   840  O  O     . PRO A  1  146 ? 7.855   13.876  183.456 1.00 42.13  ? 121 PRO A O     1 
ATOM   841  C  CB    . PRO A  1  146 ? 10.072  11.715  184.240 1.00 41.71  ? 121 PRO A CB    1 
ATOM   842  C  CG    . PRO A  1  146 ? 11.044  11.131  185.225 1.00 40.99  ? 121 PRO A CG    1 
ATOM   843  C  CD    . PRO A  1  146 ? 10.677  11.751  186.553 1.00 41.83  ? 121 PRO A CD    1 
ATOM   844  N  N     . GLU A  1  147 ? 7.505   13.496  185.639 1.00 39.54  ? 122 GLU A N     1 
ATOM   845  C  CA    . GLU A  1  147 ? 6.152   13.934  185.670 1.00 48.70  ? 122 GLU A CA    1 
ATOM   846  C  C     . GLU A  1  147 ? 6.107   15.409  185.277 1.00 48.54  ? 122 GLU A C     1 
ATOM   847  O  O     . GLU A  1  147 ? 5.081   15.913  184.892 1.00 49.43  ? 122 GLU A O     1 
ATOM   848  C  CB    . GLU A  1  147 ? 5.717   13.857  187.103 1.00 56.44  ? 122 GLU A CB    1 
ATOM   849  C  CG    . GLU A  1  147 ? 4.422   14.532  187.438 1.00 65.59  ? 122 GLU A CG    1 
ATOM   850  C  CD    . GLU A  1  147 ? 3.556   13.658  188.322 1.00 72.79  ? 122 GLU A CD    1 
ATOM   851  O  OE1   . GLU A  1  147 ? 3.761   13.660  189.542 1.00 72.26  ? 122 GLU A OE1   1 
ATOM   852  O  OE2   . GLU A  1  147 ? 2.676   12.956  187.780 1.00 80.91  ? 122 GLU A OE2   1 
ATOM   853  N  N     . LEU A  1  148 ? 7.235   16.089  185.406 1.00 39.34  ? 123 LEU A N     1 
ATOM   854  C  CA    . LEU A  1  148 ? 7.336   17.488  185.088 1.00 36.47  ? 123 LEU A CA    1 
ATOM   855  C  C     . LEU A  1  148 ? 7.641   17.788  183.637 1.00 37.12  ? 123 LEU A C     1 
ATOM   856  O  O     . LEU A  1  148 ? 7.500   18.882  183.199 1.00 37.10  ? 123 LEU A O     1 
ATOM   857  C  CB    . LEU A  1  148 ? 8.416   18.139  185.939 1.00 33.68  ? 123 LEU A CB    1 
ATOM   858  C  CG    . LEU A  1  148 ? 8.239   18.174  187.433 1.00 35.83  ? 123 LEU A CG    1 
ATOM   859  C  CD1   . LEU A  1  148 ? 9.321   18.946  188.136 1.00 35.50  ? 123 LEU A CD1   1 
ATOM   860  C  CD2   . LEU A  1  148 ? 6.879   18.684  187.817 1.00 32.83  ? 123 LEU A CD2   1 
ATOM   861  N  N     . LYS A  1  149 ? 8.093   16.796  182.907 1.00 40.33  ? 124 LYS A N     1 
ATOM   862  C  CA    . LYS A  1  149 ? 8.480   16.964  181.533 1.00 44.85  ? 124 LYS A CA    1 
ATOM   863  C  C     . LYS A  1  149 ? 7.526   17.649  180.568 1.00 39.47  ? 124 LYS A C     1 
ATOM   864  O  O     . LYS A  1  149 ? 7.954   18.419  179.774 1.00 39.06  ? 124 LYS A O     1 
ATOM   865  C  CB    . LYS A  1  149 ? 8.947   15.645  180.970 1.00 51.05  ? 124 LYS A CB    1 
ATOM   866  C  CG    . LYS A  1  149 ? 10.184  15.801  180.131 1.00 60.72  ? 124 LYS A CG    1 
ATOM   867  C  CD    . LYS A  1  149 ? 11.387  15.186  180.809 1.00 66.53  ? 124 LYS A CD    1 
ATOM   868  C  CE    . LYS A  1  149 ? 12.496  16.192  181.016 1.00 69.28  ? 124 LYS A CE    1 
ATOM   869  N  NZ    . LYS A  1  149 ? 13.308  16.397  179.810 1.00 66.37  ? 124 LYS A NZ    1 
ATOM   870  N  N     . ASP A  1  150 ? 6.250   17.358  180.650 1.00 35.92  ? 125 ASP A N     1 
ATOM   871  C  CA    . ASP A  1  150 ? 5.236   17.975  179.776 1.00 38.95  ? 125 ASP A CA    1 
ATOM   872  C  C     . ASP A  1  150 ? 4.571   19.192  180.408 1.00 33.85  ? 125 ASP A C     1 
ATOM   873  O  O     . ASP A  1  150 ? 3.518   19.600  179.953 1.00 34.27  ? 125 ASP A O     1 
ATOM   874  C  CB    . ASP A  1  150 ? 4.170   16.934  179.329 1.00 41.24  ? 125 ASP A CB    1 
ATOM   875  C  CG    . ASP A  1  150 ? 3.409   16.310  180.489 1.00 47.72  ? 125 ASP A CG    1 
ATOM   876  O  OD1   . ASP A  1  150 ? 3.667   16.639  181.672 1.00 48.04  ? 125 ASP A OD1   1 
ATOM   877  O  OD2   . ASP A  1  150 ? 2.545   15.449  180.207 1.00 56.34  ? 125 ASP A OD2   1 
ATOM   878  N  N     . LYS A  1  151 ? 5.153   19.773  181.460 1.00 28.60  ? 126 LYS A N     1 
ATOM   879  C  CA    . LYS A  1  151 ? 4.501   20.878  182.130 1.00 28.53  ? 126 LYS A CA    1 
ATOM   880  C  C     . LYS A  1  151 ? 5.321   22.167  181.995 1.00 27.29  ? 126 LYS A C     1 
ATOM   881  O  O     . LYS A  1  151 ? 6.508   22.116  181.767 1.00 25.15  ? 126 LYS A O     1 
ATOM   882  C  CB    . LYS A  1  151 ? 4.249   20.511  183.588 1.00 31.96  ? 126 LYS A CB    1 
ATOM   883  C  CG    . LYS A  1  151 ? 3.341   19.283  183.739 1.00 35.89  ? 126 LYS A CG    1 
ATOM   884  C  CD    . LYS A  1  151 ? 2.839   19.120  185.170 1.00 41.16  ? 126 LYS A CD    1 
ATOM   885  C  CE    . LYS A  1  151 ? 2.315   17.722  185.465 1.00 42.86  ? 126 LYS A CE    1 
ATOM   886  N  NZ    . LYS A  1  151 ? 1.220   17.362  184.560 1.00 46.12  ? 126 LYS A NZ    1 
ATOM   887  N  N     . PRO A  1  152 ? 4.673   23.329  182.112 1.00 25.28  ? 127 PRO A N     1 
ATOM   888  C  CA    . PRO A  1  152 ? 5.418   24.567  182.237 1.00 25.36  ? 127 PRO A CA    1 
ATOM   889  C  C     . PRO A  1  152 ? 5.963   24.642  183.651 1.00 23.61  ? 127 PRO A C     1 
ATOM   890  O  O     . PRO A  1  152 ? 5.205   24.510  184.617 1.00 22.51  ? 127 PRO A O     1 
ATOM   891  C  CB    . PRO A  1  152 ? 4.374   25.668  181.993 1.00 25.57  ? 127 PRO A CB    1 
ATOM   892  C  CG    . PRO A  1  152 ? 3.055   25.023  182.285 1.00 26.21  ? 127 PRO A CG    1 
ATOM   893  C  CD    . PRO A  1  152 ? 3.219   23.543  182.054 1.00 26.62  ? 127 PRO A CD    1 
ATOM   894  N  N     . ILE A  1  153 ? 7.279   24.761  183.783 1.00 22.29  ? 128 ILE A N     1 
ATOM   895  C  CA    . ILE A  1  153 ? 7.858   24.855  185.116 1.00 22.37  ? 128 ILE A CA    1 
ATOM   896  C  C     . ILE A  1  153 ? 8.807   26.007  185.204 1.00 22.52  ? 128 ILE A C     1 
ATOM   897  O  O     . ILE A  1  153 ? 9.288   26.521  184.176 1.00 23.83  ? 128 ILE A O     1 
ATOM   898  C  CB    . ILE A  1  153 ? 8.506   23.526  185.599 1.00 23.97  ? 128 ILE A CB    1 
ATOM   899  C  CG1   . ILE A  1  153 ? 9.910   23.281  185.027 1.00 24.10  ? 128 ILE A CG1   1 
ATOM   900  C  CG2   . ILE A  1  153 ? 7.639   22.348  185.232 1.00 24.79  ? 128 ILE A CG2   1 
ATOM   901  C  CD1   . ILE A  1  153 ? 10.765  22.411  185.925 1.00 26.01  ? 128 ILE A CD1   1 
ATOM   902  N  N     . ALA A  1  154 ? 9.084   26.400  186.442 1.00 21.35  ? 129 ALA A N     1 
ATOM   903  C  CA    . ALA A  1  154 ? 10.118  27.350  186.746 1.00 21.02  ? 129 ALA A CA    1 
ATOM   904  C  C     . ALA A  1  154 ? 10.842  26.911  188.020 1.00 21.60  ? 129 ALA A C     1 
ATOM   905  O  O     . ALA A  1  154 ? 10.315  26.150  188.833 1.00 24.93  ? 129 ALA A O     1 
ATOM   906  C  CB    . ALA A  1  154 ? 9.551   28.733  186.918 1.00 21.95  ? 129 ALA A CB    1 
ATOM   907  N  N     . VAL A  1  155 ? 12.038  27.432  188.202 1.00 21.25  ? 130 VAL A N     1 
ATOM   908  C  CA    . VAL A  1  155 ? 12.813  27.164  189.419 1.00 21.06  ? 130 VAL A CA    1 
ATOM   909  C  C     . VAL A  1  155 ? 12.947  28.435  190.184 1.00 21.71  ? 130 VAL A C     1 
ATOM   910  O  O     . VAL A  1  155 ? 13.334  29.481  189.607 1.00 24.64  ? 130 VAL A O     1 
ATOM   911  C  CB    . VAL A  1  155 ? 14.209  26.602  189.092 1.00 20.60  ? 130 VAL A CB    1 
ATOM   912  C  CG1   . VAL A  1  155 ? 14.993  26.351  190.371 1.00 21.81  ? 130 VAL A CG1   1 
ATOM   913  C  CG2   . VAL A  1  155 ? 14.061  25.321  188.303 1.00 21.97  ? 130 VAL A CG2   1 
ATOM   914  N  N     . GLY A  1  156 ? 12.602  28.356  191.467 1.00 21.96  ? 131 GLY A N     1 
ATOM   915  C  CA    . GLY A  1  156 ? 12.794  29.447  192.431 1.00 22.28  ? 131 GLY A CA    1 
ATOM   916  C  C     . GLY A  1  156 ? 11.672  29.412  193.447 1.00 23.47  ? 131 GLY A C     1 
ATOM   917  O  O     . GLY A  1  156 ? 11.386  28.375  193.995 1.00 25.77  ? 131 GLY A O     1 
ATOM   918  N  N     . SER A  1  157 ? 11.013  30.541  193.648 1.00 25.79  ? 132 SER A N     1 
ATOM   919  C  CA    . SER A  1  157 ? 9.985   30.683  194.688 1.00 25.94  ? 132 SER A CA    1 
ATOM   920  C  C     . SER A  1  157 ? 8.943   31.661  194.208 1.00 26.15  ? 132 SER A C     1 
ATOM   921  O  O     . SER A  1  157 ? 9.075   32.279  193.133 1.00 23.65  ? 132 SER A O     1 
ATOM   922  C  CB    . SER A  1  157 ? 10.634  31.222  195.973 1.00 26.63  ? 132 SER A CB    1 
ATOM   923  O  OG    . SER A  1  157 ? 11.179  32.492  195.717 1.00 29.12  ? 132 SER A OG    1 
ATOM   924  N  N     . MET A  1  158 ? 7.929   31.868  195.028 1.00 28.60  ? 133 MET A N     1 
ATOM   925  C  CA    . MET A  1  158 ? 6.937   32.898  194.741 1.00 28.53  ? 133 MET A CA    1 
ATOM   926  C  C     . MET A  1  158 ? 7.507   34.298  194.728 1.00 28.25  ? 133 MET A C     1 
ATOM   927  O  O     . MET A  1  158 ? 6.928   35.179  194.097 1.00 26.29  ? 133 MET A O     1 
ATOM   928  C  CB    . MET A  1  158 ? 5.764   32.791  195.691 1.00 31.39  ? 133 MET A CB    1 
ATOM   929  C  CG    . MET A  1  158 ? 4.922   31.550  195.382 1.00 31.47  ? 133 MET A CG    1 
ATOM   930  S  SD    . MET A  1  158 ? 3.978   31.620  193.834 1.00 33.63  ? 133 MET A SD    1 
ATOM   931  C  CE    . MET A  1  158 ? 2.487   32.508  194.340 1.00 34.56  ? 133 MET A CE    1 
ATOM   932  N  N     . SER A  1  159 ? 8.648   34.505  195.385 1.00 26.62  ? 134 SER A N     1 
ATOM   933  C  CA    . SER A  1  159 ? 9.336   35.792  195.353 1.00 29.38  ? 134 SER A CA    1 
ATOM   934  C  C     . SER A  1  159 ? 10.135  36.037  194.119 1.00 27.03  ? 134 SER A C     1 
ATOM   935  O  O     . SER A  1  159 ? 10.272  37.182  193.755 1.00 31.07  ? 134 SER A O     1 
ATOM   936  C  CB    . SER A  1  159 ? 10.354  35.915  196.511 1.00 32.39  ? 134 SER A CB    1 
ATOM   937  O  OG    . SER A  1  159 ? 9.681   35.779  197.694 1.00 39.15  ? 134 SER A OG    1 
ATOM   938  N  N     . MET A  1  160 ? 10.749  34.991  193.546 1.00 25.86  ? 135 MET A N     1 
ATOM   939  C  CA    . MET A  1  160 ? 11.734  35.157  192.473 1.00 24.46  ? 135 MET A CA    1 
ATOM   940  C  C     . MET A  1  160 ? 12.021  33.855  191.719 1.00 23.15  ? 135 MET A C     1 
ATOM   941  O  O     . MET A  1  160 ? 12.206  32.820  192.340 1.00 24.78  ? 135 MET A O     1 
ATOM   942  C  CB    . MET A  1  160 ? 13.070  35.674  193.038 1.00 26.21  ? 135 MET A CB    1 
ATOM   943  C  CG    . MET A  1  160 ? 14.133  36.045  191.971 1.00 25.41  ? 135 MET A CG    1 
ATOM   944  S  SD    . MET A  1  160 ? 13.536  37.167  190.703 1.00 28.91  ? 135 MET A SD    1 
ATOM   945  C  CE    . MET A  1  160 ? 13.010  38.588  191.675 1.00 29.36  ? 135 MET A CE    1 
ATOM   946  N  N     . LEU A  1  161 ? 12.083  33.919  190.386 1.00 22.84  ? 136 LEU A N     1 
ATOM   947  C  CA    . LEU A  1  161 ? 12.470  32.773  189.580 1.00 24.36  ? 136 LEU A CA    1 
ATOM   948  C  C     . LEU A  1  161 ? 13.871  33.001  189.026 1.00 24.34  ? 136 LEU A C     1 
ATOM   949  O  O     . LEU A  1  161 ? 14.213  34.117  188.627 1.00 24.06  ? 136 LEU A O     1 
ATOM   950  C  CB    . LEU A  1  161 ? 11.491  32.550  188.422 1.00 22.86  ? 136 LEU A CB    1 
ATOM   951  C  CG    . LEU A  1  161 ? 10.042  32.370  188.806 1.00 23.77  ? 136 LEU A CG    1 
ATOM   952  C  CD1   . LEU A  1  161 ? 9.192   32.332  187.548 1.00 25.22  ? 136 LEU A CD1   1 
ATOM   953  C  CD2   . LEU A  1  161 ? 9.864   31.126  189.653 1.00 24.61  ? 136 LEU A CD2   1 
ATOM   954  N  N     . SER A  1  162 ? 14.653  31.935  189.033 1.00 24.35  ? 137 SER A N     1 
ATOM   955  C  CA    . SER A  1  162 ? 16.009  31.931  188.469 1.00 26.08  ? 137 SER A CA    1 
ATOM   956  C  C     . SER A  1  162 ? 15.996  31.422  187.027 1.00 25.72  ? 137 SER A C     1 
ATOM   957  O  O     . SER A  1  162 ? 16.886  31.770  186.252 1.00 25.37  ? 137 SER A O     1 
ATOM   958  C  CB    . SER A  1  162 ? 16.902  31.058  189.341 1.00 27.41  ? 137 SER A CB    1 
ATOM   959  O  OG    . SER A  1  162 ? 16.396  29.742  189.352 1.00 27.42  ? 137 SER A OG    1 
ATOM   960  N  N     . THR A  1  163 ? 14.993  30.608  186.674 1.00 22.53  ? 138 THR A N     1 
ATOM   961  C  CA    . THR A  1  163 ? 14.761  30.235  185.306 1.00 23.19  ? 138 THR A CA    1 
ATOM   962  C  C     . THR A  1  163 ? 13.417  29.590  185.043 1.00 23.06  ? 138 THR A C     1 
ATOM   963  O  O     . THR A  1  163 ? 12.682  29.285  185.973 1.00 22.60  ? 138 THR A O     1 
ATOM   964  C  CB    . THR A  1  163 ? 15.849  29.302  184.741 1.00 25.16  ? 138 THR A CB    1 
ATOM   965  O  OG1   . THR A  1  163 ? 15.843  29.423  183.331 1.00 24.01  ? 138 THR A OG1   1 
ATOM   966  C  CG2   . THR A  1  163 ? 15.645  27.849  185.097 1.00 25.53  ? 138 THR A CG2   1 
ATOM   967  N  N     . SER A  1  164 ? 13.139  29.338  183.765 1.00 21.13  ? 139 SER A N     1 
ATOM   968  C  CA    . SER A  1  164 ? 11.958  28.625  183.384 1.00 22.41  ? 139 SER A CA    1 
ATOM   969  C  C     . SER A  1  164 ? 12.220  27.726  182.224 1.00 22.08  ? 139 SER A C     1 
ATOM   970  O  O     . SER A  1  164 ? 13.110  28.010  181.428 1.00 21.31  ? 139 SER A O     1 
ATOM   971  C  CB    . SER A  1  164 ? 10.859  29.609  183.004 1.00 24.26  ? 139 SER A CB    1 
ATOM   972  O  OG    . SER A  1  164 ? 11.215  30.329  181.856 1.00 24.13  ? 139 SER A OG    1 
ATOM   973  N  N     . ASN A  1  165 ? 11.412  26.665  182.116 1.00 19.61  ? 140 ASN A N     1 
ATOM   974  C  CA    . ASN A  1  165 ? 11.523  25.785  180.993 1.00 21.44  ? 140 ASN A CA    1 
ATOM   975  C  C     . ASN A  1  165 ? 10.828  26.387  179.755 1.00 22.87  ? 140 ASN A C     1 
ATOM   976  O  O     . ASN A  1  165 ? 10.181  27.427  179.811 1.00 21.55  ? 140 ASN A O     1 
ATOM   977  C  CB    . ASN A  1  165 ? 11.079  24.359  181.324 1.00 21.16  ? 140 ASN A CB    1 
ATOM   978  C  CG    . ASN A  1  165 ? 9.576   24.174  181.370 1.00 22.16  ? 140 ASN A CG    1 
ATOM   979  O  OD1   . ASN A  1  165 ? 8.807   25.132  181.334 1.00 22.37  ? 140 ASN A OD1   1 
ATOM   980  N  ND2   . ASN A  1  165 ? 9.158   22.916  181.542 1.00 20.86  ? 140 ASN A ND2   1 
ATOM   981  N  N     . TYR A  1  166 ? 11.034  25.735  178.631 1.00 23.99  ? 141 TYR A N     1 
ATOM   982  C  CA    . TYR A  1  166 ? 10.613  26.278  177.359 1.00 24.53  ? 141 TYR A CA    1 
ATOM   983  C  C     . TYR A  1  166 ? 9.104   26.289  177.222 1.00 24.72  ? 141 TYR A C     1 
ATOM   984  O  O     . TYR A  1  166 ? 8.567   27.191  176.574 1.00 26.02  ? 141 TYR A O     1 
ATOM   985  C  CB    . TYR A  1  166 ? 11.323  25.610  176.172 1.00 25.98  ? 141 TYR A CB    1 
ATOM   986  C  CG    . TYR A  1  166 ? 12.719  26.206  175.986 1.00 24.75  ? 141 TYR A CG    1 
ATOM   987  C  CD1   . TYR A  1  166 ? 12.940  27.230  175.064 1.00 23.76  ? 141 TYR A CD1   1 
ATOM   988  C  CD2   . TYR A  1  166 ? 13.783  25.790  176.761 1.00 23.14  ? 141 TYR A CD2   1 
ATOM   989  C  CE1   . TYR A  1  166 ? 14.190  27.803  174.904 1.00 22.45  ? 141 TYR A CE1   1 
ATOM   990  C  CE2   . TYR A  1  166 ? 15.023  26.353  176.617 1.00 22.88  ? 141 TYR A CE2   1 
ATOM   991  C  CZ    . TYR A  1  166 ? 15.228  27.359  175.686 1.00 23.41  ? 141 TYR A CZ    1 
ATOM   992  O  OH    . TYR A  1  166 ? 16.473  27.901  175.541 1.00 22.25  ? 141 TYR A OH    1 
ATOM   993  N  N     . HIS A  1  167 ? 8.419   25.322  177.825 1.00 23.50  ? 142 HIS A N     1 
ATOM   994  C  CA    . HIS A  1  167 ? 6.954   25.373  177.892 1.00 25.61  ? 142 HIS A CA    1 
ATOM   995  C  C     . HIS A  1  167 ? 6.478   26.639  178.587 1.00 24.09  ? 142 HIS A C     1 
ATOM   996  O  O     . HIS A  1  167 ? 5.625   27.343  178.072 1.00 24.72  ? 142 HIS A O     1 
ATOM   997  C  CB    . HIS A  1  167 ? 6.384   24.157  178.617 1.00 27.95  ? 142 HIS A CB    1 
ATOM   998  C  CG    . HIS A  1  167 ? 6.548   22.862  177.886 1.00 31.33  ? 142 HIS A CG    1 
ATOM   999  N  ND1   . HIS A  1  167 ? 6.414   22.745  176.523 1.00 34.20  ? 142 HIS A ND1   1 
ATOM   1000 C  CD2   . HIS A  1  167 ? 6.835   21.613  178.340 1.00 37.08  ? 142 HIS A CD2   1 
ATOM   1001 C  CE1   . HIS A  1  167 ? 6.586   21.485  176.160 1.00 33.55  ? 142 HIS A CE1   1 
ATOM   1002 N  NE2   . HIS A  1  167 ? 6.843   20.776  177.245 1.00 38.52  ? 142 HIS A NE2   1 
ATOM   1003 N  N     . ALA A  1  168 ? 7.059   26.945  179.742 1.00 22.86  ? 143 ALA A N     1 
ATOM   1004 C  CA    . ALA A  1  168 ? 6.659   28.131  180.512 1.00 21.25  ? 143 ALA A CA    1 
ATOM   1005 C  C     . ALA A  1  168 ? 6.987   29.437  179.829 1.00 21.47  ? 143 ALA A C     1 
ATOM   1006 O  O     . ALA A  1  168 ? 6.237   30.425  179.987 1.00 19.94  ? 143 ALA A O     1 
ATOM   1007 C  CB    . ALA A  1  168 ? 7.277   28.092  181.895 1.00 24.39  ? 143 ALA A CB    1 
ATOM   1008 N  N     . ARG A  1  169 ? 8.057   29.453  179.026 1.00 20.53  ? 144 ARG A N     1 
ATOM   1009 C  CA    . ARG A  1  169 ? 8.438   30.663  178.291 1.00 22.08  ? 144 ARG A CA    1 
ATOM   1010 C  C     . ARG A  1  169 ? 7.409   31.115  177.265 1.00 21.55  ? 144 ARG A C     1 
ATOM   1011 O  O     . ARG A  1  169 ? 7.376   32.290  176.915 1.00 20.52  ? 144 ARG A O     1 
ATOM   1012 C  CB    . ARG A  1  169 ? 9.819   30.479  177.590 1.00 22.37  ? 144 ARG A CB    1 
ATOM   1013 C  CG    . ARG A  1  169 ? 10.961  30.411  178.593 1.00 21.93  ? 144 ARG A CG    1 
ATOM   1014 C  CD    . ARG A  1  169 ? 12.298  30.158  177.933 1.00 22.27  ? 144 ARG A CD    1 
ATOM   1015 N  NE    . ARG A  1  169 ? 13.256  29.760  178.954 1.00 24.13  ? 144 ARG A NE    1 
ATOM   1016 C  CZ    . ARG A  1  169 ? 14.592  29.779  178.861 1.00 23.44  ? 144 ARG A CZ    1 
ATOM   1017 N  NH1   . ARG A  1  169 ? 15.316  29.324  179.891 1.00 23.47  ? 144 ARG A NH1   1 
ATOM   1018 N  NH2   . ARG A  1  169 ? 15.202  30.195  177.783 1.00 21.06  ? 144 ARG A NH2   1 
ATOM   1019 N  N     . ARG A  1  170 ? 6.600   30.179  176.783 1.00 22.33  ? 145 ARG A N     1 
ATOM   1020 C  CA    . ARG A  1  170 ? 5.492   30.486  175.911 1.00 25.46  ? 145 ARG A CA    1 
ATOM   1021 C  C     . ARG A  1  170 ? 4.362   31.251  176.570 1.00 26.25  ? 145 ARG A C     1 
ATOM   1022 O  O     . ARG A  1  170 ? 3.450   31.675  175.839 1.00 28.65  ? 145 ARG A O     1 
ATOM   1023 C  CB    . ARG A  1  170 ? 4.926   29.196  175.257 1.00 25.32  ? 145 ARG A CB    1 
ATOM   1024 C  CG    . ARG A  1  170 ? 5.943   28.411  174.435 1.00 25.32  ? 145 ARG A CG    1 
ATOM   1025 C  CD    . ARG A  1  170 ? 6.847   29.280  173.552 1.00 26.61  ? 145 ARG A CD    1 
ATOM   1026 N  NE    . ARG A  1  170 ? 6.058   30.110  172.647 1.00 28.62  ? 145 ARG A NE    1 
ATOM   1027 C  CZ    . ARG A  1  170 ? 6.487   31.171  171.984 1.00 30.86  ? 145 ARG A CZ    1 
ATOM   1028 N  NH1   . ARG A  1  170 ? 7.733   31.636  172.137 1.00 32.65  ? 145 ARG A NH1   1 
ATOM   1029 N  NH2   . ARG A  1  170 ? 5.625   31.838  171.208 1.00 33.71  ? 145 ARG A NH2   1 
ATOM   1030 N  N     . PHE A  1  171 ? 4.390   31.411  177.902 1.00 26.30  ? 146 PHE A N     1 
ATOM   1031 C  CA    . PHE A  1  171 ? 3.425   32.277  178.648 1.00 25.14  ? 146 PHE A CA    1 
ATOM   1032 C  C     . PHE A  1  171 ? 4.068   33.579  179.126 1.00 25.79  ? 146 PHE A C     1 
ATOM   1033 O  O     . PHE A  1  171 ? 3.455   34.400  179.840 1.00 25.72  ? 146 PHE A O     1 
ATOM   1034 C  CB    . PHE A  1  171 ? 2.888   31.515  179.862 1.00 26.41  ? 146 PHE A CB    1 
ATOM   1035 C  CG    . PHE A  1  171 ? 2.111   30.270  179.507 1.00 26.00  ? 146 PHE A CG    1 
ATOM   1036 C  CD1   . PHE A  1  171 ? 2.751   29.075  179.307 1.00 25.42  ? 146 PHE A CD1   1 
ATOM   1037 C  CD2   . PHE A  1  171 ? 0.721   30.317  179.373 1.00 27.88  ? 146 PHE A CD2   1 
ATOM   1038 C  CE1   . PHE A  1  171 ? 2.038   27.919  179.003 1.00 24.96  ? 146 PHE A CE1   1 
ATOM   1039 C  CE2   . PHE A  1  171 ? -0.008  29.186  179.072 1.00 25.95  ? 146 PHE A CE2   1 
ATOM   1040 C  CZ    . PHE A  1  171 ? 0.660   27.972  178.862 1.00 26.35  ? 146 PHE A CZ    1 
ATOM   1041 N  N     . GLY A  1  172 ? 5.314   33.802  178.718 1.00 23.27  ? 147 GLY A N     1 
ATOM   1042 C  CA    . GLY A  1  172 ? 6.043   34.932  179.176 1.00 23.54  ? 147 GLY A CA    1 
ATOM   1043 C  C     . GLY A  1  172 ? 6.785   34.713  180.470 1.00 23.43  ? 147 GLY A C     1 
ATOM   1044 O  O     . GLY A  1  172 ? 7.391   35.673  180.982 1.00 24.79  ? 147 GLY A O     1 
ATOM   1045 N  N     . VAL A  1  173 ? 6.819   33.480  180.996 1.00 24.42  ? 148 VAL A N     1 
ATOM   1046 C  CA    . VAL A  1  173 ? 7.513   33.285  182.298 1.00 24.79  ? 148 VAL A CA    1 
ATOM   1047 C  C     . VAL A  1  173 ? 9.000   33.040  182.129 1.00 25.67  ? 148 VAL A C     1 
ATOM   1048 O  O     . VAL A  1  173 ? 9.450   32.322  181.208 1.00 23.83  ? 148 VAL A O     1 
ATOM   1049 C  CB    . VAL A  1  173 ? 6.793   32.407  183.363 1.00 28.97  ? 148 VAL A CB    1 
ATOM   1050 C  CG1   . VAL A  1  173 ? 5.406   31.945  182.955 1.00 30.26  ? 148 VAL A CG1   1 
ATOM   1051 C  CG2   . VAL A  1  173 ? 7.683   31.391  184.091 1.00 27.72  ? 148 VAL A CG2   1 
ATOM   1052 N  N     . ARG A  1  174 ? 9.778   33.718  182.979 1.00 25.21  ? 149 ARG A N     1 
ATOM   1053 C  CA    . ARG A  1  174 ? 11.223  33.710  182.782 1.00 26.38  ? 149 ARG A CA    1 
ATOM   1054 C  C     . ARG A  1  174 ? 12.003  34.090  184.019 1.00 26.66  ? 149 ARG A C     1 
ATOM   1055 O  O     . ARG A  1  174 ? 11.439  34.585  185.006 1.00 25.48  ? 149 ARG A O     1 
ATOM   1056 C  CB    . ARG A  1  174 ? 11.612  34.661  181.638 1.00 27.68  ? 149 ARG A CB    1 
ATOM   1057 C  CG    . ARG A  1  174 ? 11.121  36.096  181.808 1.00 29.92  ? 149 ARG A CG    1 
ATOM   1058 C  CD    . ARG A  1  174 ? 12.038  37.080  181.072 1.00 32.66  ? 149 ARG A CD    1 
ATOM   1059 N  NE    . ARG A  1  174 ? 13.346  37.135  181.738 1.00 36.23  ? 149 ARG A NE    1 
ATOM   1060 C  CZ    . ARG A  1  174 ? 14.490  37.576  181.212 1.00 39.47  ? 149 ARG A CZ    1 
ATOM   1061 N  NH1   . ARG A  1  174 ? 15.582  37.565  181.965 1.00 39.37  ? 149 ARG A NH1   1 
ATOM   1062 N  NH2   . ARG A  1  174 ? 14.558  38.048  179.960 1.00 40.69  ? 149 ARG A NH2   1 
ATOM   1063 N  N     . ALA A  1  175 ? 13.315  33.895  183.927 1.00 24.73  ? 150 ALA A N     1 
ATOM   1064 C  CA    . ALA A  1  175 ? 14.240  34.306  184.989 1.00 26.03  ? 150 ALA A CA    1 
ATOM   1065 C  C     . ALA A  1  175 ? 14.036  35.788  185.332 1.00 27.32  ? 150 ALA A C     1 
ATOM   1066 O  O     . ALA A  1  175 ? 13.728  36.621  184.457 1.00 26.03  ? 150 ALA A O     1 
ATOM   1067 C  CB    . ALA A  1  175 ? 15.690  34.047  184.564 1.00 26.68  ? 150 ALA A CB    1 
ATOM   1068 N  N     . ALA A  1  176 ? 14.209  36.093  186.615 1.00 25.88  ? 151 ALA A N     1 
ATOM   1069 C  CA    . ALA A  1  176 ? 14.121  37.429  187.182 1.00 24.53  ? 151 ALA A CA    1 
ATOM   1070 C  C     . ALA A  1  176 ? 12.687  37.937  187.382 1.00 28.04  ? 151 ALA A C     1 
ATOM   1071 O  O     . ALA A  1  176 ? 12.508  39.044  187.836 1.00 27.80  ? 151 ALA A O     1 
ATOM   1072 C  CB    . ALA A  1  176 ? 14.985  38.471  186.428 1.00 25.35  ? 151 ALA A CB    1 
ATOM   1073 N  N     . MET A  1  177 ? 11.686  37.110  187.100 1.00 28.08  ? 152 MET A N     1 
ATOM   1074 C  CA    . MET A  1  177 ? 10.303  37.440  187.348 1.00 27.68  ? 152 MET A CA    1 
ATOM   1075 C  C     . MET A  1  177 ? 9.925   36.811  188.685 1.00 29.02  ? 152 MET A C     1 
ATOM   1076 O  O     . MET A  1  177 ? 10.287  35.669  188.953 1.00 29.67  ? 152 MET A O     1 
ATOM   1077 C  CB    . MET A  1  177 ? 9.441   36.828  186.249 1.00 28.79  ? 152 MET A CB    1 
ATOM   1078 C  CG    . MET A  1  177 ? 7.947   37.087  186.394 1.00 28.99  ? 152 MET A CG    1 
ATOM   1079 S  SD    . MET A  1  177 ? 7.108   36.336  184.994 1.00 29.37  ? 152 MET A SD    1 
ATOM   1080 C  CE    . MET A  1  177 ? 7.454   37.522  183.706 1.00 26.61  ? 152 MET A CE    1 
ATOM   1081 N  N     . PRO A  1  178 ? 9.194   37.550  189.541 1.00 28.29  ? 153 PRO A N     1 
ATOM   1082 C  CA    . PRO A  1  178 ? 8.707   36.936  190.738 1.00 25.54  ? 153 PRO A CA    1 
ATOM   1083 C  C     . PRO A  1  178 ? 7.724   35.807  190.420 1.00 26.32  ? 153 PRO A C     1 
ATOM   1084 O  O     . PRO A  1  178 ? 6.876   35.934  189.509 1.00 26.43  ? 153 PRO A O     1 
ATOM   1085 C  CB    . PRO A  1  178 ? 7.988   38.079  191.453 1.00 27.42  ? 153 PRO A CB    1 
ATOM   1086 C  CG    . PRO A  1  178 ? 8.533   39.300  190.886 1.00 27.89  ? 153 PRO A CG    1 
ATOM   1087 C  CD    . PRO A  1  178 ? 8.830   38.972  189.461 1.00 28.95  ? 153 PRO A CD    1 
ATOM   1088 N  N     . GLY A  1  179 ? 7.836   34.720  191.163 1.00 25.96  ? 154 GLY A N     1 
ATOM   1089 C  CA    . GLY A  1  179 ? 6.932   33.614  191.017 1.00 26.51  ? 154 GLY A CA    1 
ATOM   1090 C  C     . GLY A  1  179 ? 5.457   33.999  191.115 1.00 27.55  ? 154 GLY A C     1 
ATOM   1091 O  O     . GLY A  1  179 ? 4.647   33.437  190.379 1.00 27.11  ? 154 GLY A O     1 
ATOM   1092 N  N     . PHE A  1  180 ? 5.091   34.927  192.007 1.00 25.63  ? 155 PHE A N     1 
ATOM   1093 C  CA    . PHE A  1  180 ? 3.669   35.275  192.145 1.00 27.95  ? 155 PHE A CA    1 
ATOM   1094 C  C     . PHE A  1  180 ? 3.113   35.919  190.859 1.00 28.63  ? 155 PHE A C     1 
ATOM   1095 O  O     . PHE A  1  180 ? 1.973   35.666  190.466 1.00 30.58  ? 155 PHE A O     1 
ATOM   1096 C  CB    . PHE A  1  180 ? 3.367   36.099  193.413 1.00 27.76  ? 155 PHE A CB    1 
ATOM   1097 C  CG    . PHE A  1  180 ? 3.779   37.528  193.350 1.00 30.31  ? 155 PHE A CG    1 
ATOM   1098 C  CD1   . PHE A  1  180 ? 2.874   38.497  192.942 1.00 31.42  ? 155 PHE A CD1   1 
ATOM   1099 C  CD2   . PHE A  1  180 ? 5.059   37.924  193.730 1.00 31.26  ? 155 PHE A CD2   1 
ATOM   1100 C  CE1   . PHE A  1  180 ? 3.237   39.830  192.909 1.00 33.65  ? 155 PHE A CE1   1 
ATOM   1101 C  CE2   . PHE A  1  180 ? 5.439   39.256  193.668 1.00 35.58  ? 155 PHE A CE2   1 
ATOM   1102 C  CZ    . PHE A  1  180 ? 4.522   40.218  193.270 1.00 36.09  ? 155 PHE A CZ    1 
ATOM   1103 N  N     . ILE A  1  181 ? 3.948   36.688  190.176 1.00 28.97  ? 156 ILE A N     1 
ATOM   1104 C  CA    . ILE A  1  181 ? 3.593   37.244  188.862 1.00 28.48  ? 156 ILE A CA    1 
ATOM   1105 C  C     . ILE A  1  181 ? 3.520   36.150  187.797 1.00 27.95  ? 156 ILE A C     1 
ATOM   1106 O  O     . ILE A  1  181 ? 2.560   36.096  187.008 1.00 23.95  ? 156 ILE A O     1 
ATOM   1107 C  CB    . ILE A  1  181 ? 4.548   38.378  188.506 1.00 32.20  ? 156 ILE A CB    1 
ATOM   1108 C  CG1   . ILE A  1  181 ? 4.287   39.533  189.496 1.00 35.53  ? 156 ILE A CG1   1 
ATOM   1109 C  CG2   . ILE A  1  181 ? 4.397   38.818  187.065 1.00 33.40  ? 156 ILE A CG2   1 
ATOM   1110 C  CD1   . ILE A  1  181 ? 5.182   40.731  189.344 1.00 37.58  ? 156 ILE A CD1   1 
ATOM   1111 N  N     . ALA A  1  182 ? 4.503   35.245  187.801 1.00 26.89  ? 157 ALA A N     1 
ATOM   1112 C  CA    . ALA A  1  182 ? 4.525   34.148  186.854 1.00 25.65  ? 157 ALA A CA    1 
ATOM   1113 C  C     . ALA A  1  182 ? 3.265   33.266  186.904 1.00 26.59  ? 157 ALA A C     1 
ATOM   1114 O  O     . ALA A  1  182 ? 2.756   32.825  185.844 1.00 23.97  ? 157 ALA A O     1 
ATOM   1115 C  CB    . ALA A  1  182 ? 5.775   33.310  187.057 1.00 24.98  ? 157 ALA A CB    1 
ATOM   1116 N  N     . LYS A  1  183 ? 2.747   33.076  188.103 1.00 25.94  ? 158 LYS A N     1 
ATOM   1117 C  CA    . LYS A  1  183 ? 1.531   32.326  188.284 1.00 29.42  ? 158 LYS A CA    1 
ATOM   1118 C  C     . LYS A  1  183 ? 0.311   33.058  187.709 1.00 27.52  ? 158 LYS A C     1 
ATOM   1119 O  O     . LYS A  1  183 ? -0.638  32.446  187.380 1.00 27.04  ? 158 LYS A O     1 
ATOM   1120 C  CB    . LYS A  1  183 ? 1.303   31.935  189.734 1.00 33.18  ? 158 LYS A CB    1 
ATOM   1121 C  CG    . LYS A  1  183 ? 2.310   30.957  190.279 1.00 38.80  ? 158 LYS A CG    1 
ATOM   1122 C  CD    . LYS A  1  183 ? 1.792   29.556  190.243 1.00 43.37  ? 158 LYS A CD    1 
ATOM   1123 C  CE    . LYS A  1  183 ? 1.935   28.891  191.579 1.00 50.63  ? 158 LYS A CE    1 
ATOM   1124 N  NZ    . LYS A  1  183 ? 2.692   27.617  191.594 1.00 51.61  ? 158 LYS A NZ    1 
ATOM   1125 N  N     . ARG A  1  184 ? 0.377   34.369  187.598 1.00 28.92  ? 159 ARG A N     1 
ATOM   1126 C  CA    . ARG A  1  184 ? -0.710  35.124  187.011 1.00 32.58  ? 159 ARG A CA    1 
ATOM   1127 C  C     . ARG A  1  184 ? -0.669  34.928  185.524 1.00 33.11  ? 159 ARG A C     1 
ATOM   1128 O  O     . ARG A  1  184 ? -1.685  34.873  184.901 1.00 30.28  ? 159 ARG A O     1 
ATOM   1129 C  CB    . ARG A  1  184 ? -0.629  36.601  187.298 1.00 40.06  ? 159 ARG A CB    1 
ATOM   1130 C  CG    . ARG A  1  184 ? -0.569  36.966  188.742 1.00 50.48  ? 159 ARG A CG    1 
ATOM   1131 C  CD    . ARG A  1  184 ? -1.884  36.993  189.470 1.00 55.44  ? 159 ARG A CD    1 
ATOM   1132 N  NE    . ARG A  1  184 ? -1.577  37.567  190.771 1.00 66.56  ? 159 ARG A NE    1 
ATOM   1133 C  CZ    . ARG A  1  184 ? -1.909  38.789  191.158 1.00 70.14  ? 159 ARG A CZ    1 
ATOM   1134 N  NH1   . ARG A  1  184 ? -1.515  39.229  192.344 1.00 66.43  ? 159 ARG A NH1   1 
ATOM   1135 N  NH2   . ARG A  1  184 ? -2.633  39.564  190.364 1.00 67.20  ? 159 ARG A NH2   1 
ATOM   1136 N  N     . LEU A  1  185 ? 0.534   34.823  184.983 1.00 29.49  ? 160 LEU A N     1 
ATOM   1137 C  CA    . LEU A  1  185 ? 0.722   34.569  183.573 1.00 29.72  ? 160 LEU A CA    1 
ATOM   1138 C  C     . LEU A  1  185 ? 0.376   33.151  183.167 1.00 29.72  ? 160 LEU A C     1 
ATOM   1139 O  O     . LEU A  1  185 ? -0.074  32.917  182.043 1.00 30.67  ? 160 LEU A O     1 
ATOM   1140 C  CB    . LEU A  1  185 ? 2.167   34.913  183.154 1.00 29.57  ? 160 LEU A CB    1 
ATOM   1141 C  CG    . LEU A  1  185 ? 2.540   36.395  183.323 1.00 31.48  ? 160 LEU A CG    1 
ATOM   1142 C  CD1   . LEU A  1  185 ? 4.052   36.607  183.092 1.00 33.40  ? 160 LEU A CD1   1 
ATOM   1143 C  CD2   . LEU A  1  185 ? 1.702   37.303  182.426 1.00 32.47  ? 160 LEU A CD2   1 
ATOM   1144 N  N     . CYS A  1  186 ? 0.611   32.201  184.073 1.00 29.12  ? 161 CYS A N     1 
ATOM   1145 C  CA    . CYS A  1  186 ? 0.482   30.806  183.793 1.00 26.21  ? 161 CYS A CA    1 
ATOM   1146 C  C     . CYS A  1  186 ? -0.016  30.125  185.052 1.00 29.03  ? 161 CYS A C     1 
ATOM   1147 O  O     . CYS A  1  186 ? 0.805   29.676  185.874 1.00 24.99  ? 161 CYS A O     1 
ATOM   1148 C  CB    . CYS A  1  186 ? 1.865   30.275  183.389 1.00 26.64  ? 161 CYS A CB    1 
ATOM   1149 S  SG    . CYS A  1  186 ? 1.887   28.523  182.980 1.00 27.27  ? 161 CYS A SG    1 
ATOM   1150 N  N     . PRO A  1  187 ? -1.315  30.110  185.280 1.00 32.14  ? 162 PRO A N     1 
ATOM   1151 C  CA    . PRO A  1  187 ? -1.845  29.549  186.513 1.00 31.05  ? 162 PRO A CA    1 
ATOM   1152 C  C     . PRO A  1  187 ? -1.396  28.148  186.842 1.00 30.97  ? 162 PRO A C     1 
ATOM   1153 O  O     . PRO A  1  187 ? -1.235  27.869  187.979 1.00 33.34  ? 162 PRO A O     1 
ATOM   1154 C  CB    . PRO A  1  187 ? -3.344  29.608  186.299 1.00 33.71  ? 162 PRO A CB    1 
ATOM   1155 C  CG    . PRO A  1  187 ? -3.521  30.760  185.439 1.00 33.79  ? 162 PRO A CG    1 
ATOM   1156 C  CD    . PRO A  1  187 ? -2.386  30.699  184.479 1.00 33.39  ? 162 PRO A CD    1 
ATOM   1157 N  N     . GLN A  1  188 ? -1.210  27.306  185.855 1.00 30.70  ? 163 GLN A N     1 
ATOM   1158 C  CA    . GLN A  1  188 ? -0.789  25.943  186.050 1.00 30.19  ? 163 GLN A CA    1 
ATOM   1159 C  C     . GLN A  1  188 ? 0.724   25.745  186.228 1.00 28.05  ? 163 GLN A C     1 
ATOM   1160 O  O     . GLN A  1  188 ? 1.197   24.666  186.269 1.00 27.11  ? 163 GLN A O     1 
ATOM   1161 C  CB    . GLN A  1  188 ? -1.269  25.120  184.870 1.00 30.83  ? 163 GLN A CB    1 
ATOM   1162 C  CG    . GLN A  1  188 ? -0.539  25.398  183.575 1.00 31.94  ? 163 GLN A CG    1 
ATOM   1163 C  CD    . GLN A  1  188 ? -1.274  26.359  182.659 1.00 33.01  ? 163 GLN A CD    1 
ATOM   1164 O  OE1   . GLN A  1  188 ? -1.822  27.337  183.098 1.00 33.32  ? 163 GLN A OE1   1 
ATOM   1165 N  NE2   . GLN A  1  188 ? -1.271  26.069  181.393 1.00 29.78  ? 163 GLN A NE2   1 
ATOM   1166 N  N     . LEU A  1  189 ? 1.458   26.822  186.317 1.00 25.69  ? 164 LEU A N     1 
ATOM   1167 C  CA    . LEU A  1  189 ? 2.898   26.754  186.433 1.00 25.61  ? 164 LEU A CA    1 
ATOM   1168 C  C     . LEU A  1  189 ? 3.389   26.011  187.667 1.00 25.50  ? 164 LEU A C     1 
ATOM   1169 O  O     . LEU A  1  189 ? 2.941   26.261  188.729 1.00 27.13  ? 164 LEU A O     1 
ATOM   1170 C  CB    . LEU A  1  189 ? 3.484   28.155  186.383 1.00 25.75  ? 164 LEU A CB    1 
ATOM   1171 C  CG    . LEU A  1  189 ? 4.991   28.264  186.565 1.00 24.43  ? 164 LEU A CG    1 
ATOM   1172 C  CD1   . LEU A  1  189 ? 5.733   27.777  185.352 1.00 24.23  ? 164 LEU A CD1   1 
ATOM   1173 C  CD2   . LEU A  1  189 ? 5.468   29.630  186.994 1.00 25.72  ? 164 LEU A CD2   1 
ATOM   1174 N  N     . ILE A  1  190 ? 4.311   25.092  187.499 1.00 25.19  ? 165 ILE A N     1 
ATOM   1175 C  CA    . ILE A  1  190 ? 4.913   24.382  188.625 1.00 25.88  ? 165 ILE A CA    1 
ATOM   1176 C  C     . ILE A  1  190 ? 6.202   25.112  188.985 1.00 28.01  ? 165 ILE A C     1 
ATOM   1177 O  O     . ILE A  1  190 ? 7.126   25.172  188.158 1.00 28.24  ? 165 ILE A O     1 
ATOM   1178 C  CB    . ILE A  1  190 ? 5.252   22.922  188.247 1.00 26.74  ? 165 ILE A CB    1 
ATOM   1179 C  CG1   . ILE A  1  190 ? 4.053   22.178  187.628 1.00 28.39  ? 165 ILE A CG1   1 
ATOM   1180 C  CG2   . ILE A  1  190 ? 5.777   22.172  189.452 1.00 27.00  ? 165 ILE A CG2   1 
ATOM   1181 C  CD1   . ILE A  1  190 ? 2.767   22.273  188.428 1.00 28.76  ? 165 ILE A CD1   1 
ATOM   1182 N  N     . ILE A  1  191 ? 6.299   25.632  190.199 1.00 27.87  ? 166 ILE A N     1 
ATOM   1183 C  CA    . ILE A  1  191 ? 7.518   26.280  190.675 1.00 26.12  ? 166 ILE A CA    1 
ATOM   1184 C  C     . ILE A  1  191 ? 8.229   25.283  191.581 1.00 29.37  ? 166 ILE A C     1 
ATOM   1185 O  O     . ILE A  1  191 ? 7.680   24.811  192.556 1.00 28.59  ? 166 ILE A O     1 
ATOM   1186 C  CB    . ILE A  1  191 ? 7.287   27.596  191.414 1.00 27.19  ? 166 ILE A CB    1 
ATOM   1187 C  CG1   . ILE A  1  191 ? 6.678   28.628  190.491 1.00 27.42  ? 166 ILE A CG1   1 
ATOM   1188 C  CG2   . ILE A  1  191 ? 8.575   28.109  192.015 1.00 25.96  ? 166 ILE A CG2   1 
ATOM   1189 C  CD1   . ILE A  1  191 ? 6.063   29.792  191.207 1.00 29.65  ? 166 ILE A CD1   1 
ATOM   1190 N  N     . VAL A  1  192 ? 9.444   24.958  191.208 1.00 26.78  ? 167 VAL A N     1 
ATOM   1191 C  CA    . VAL A  1  192 ? 10.260  23.994  191.889 1.00 29.31  ? 167 VAL A CA    1 
ATOM   1192 C  C     . VAL A  1  192 ? 11.391  24.675  192.644 1.00 26.24  ? 167 VAL A C     1 
ATOM   1193 O  O     . VAL A  1  192 ? 12.093  25.452  192.097 1.00 24.48  ? 167 VAL A O     1 
ATOM   1194 C  CB    . VAL A  1  192 ? 10.850  23.007  190.865 1.00 33.15  ? 167 VAL A CB    1 
ATOM   1195 C  CG1   . VAL A  1  192 ? 11.888  22.111  191.461 1.00 37.36  ? 167 VAL A CG1   1 
ATOM   1196 C  CG2   . VAL A  1  192 ? 9.774   22.211  190.188 1.00 36.56  ? 167 VAL A CG2   1 
ATOM   1197 N  N     . PRO A  1  193 ? 11.537  24.312  193.969 1.00 24.81  ? 168 PRO A N     1 
ATOM   1198 C  CA    . PRO A  1  193 ? 12.647  24.967  194.688 1.00 24.68  ? 168 PRO A CA    1 
ATOM   1199 C  C     . PRO A  1  193 ? 14.033  24.603  194.128 1.00 24.81  ? 168 PRO A C     1 
ATOM   1200 O  O     . PRO A  1  193 ? 14.136  23.545  193.607 1.00 24.40  ? 168 PRO A O     1 
ATOM   1201 C  CB    . PRO A  1  193 ? 12.531  24.438  196.102 1.00 28.38  ? 168 PRO A CB    1 
ATOM   1202 C  CG    . PRO A  1  193 ? 11.208  23.859  196.223 1.00 29.88  ? 168 PRO A CG    1 
ATOM   1203 C  CD    . PRO A  1  193 ? 10.888  23.311  194.915 1.00 28.03  ? 168 PRO A CD    1 
ATOM   1204 N  N     . PRO A  1  194 ? 15.052  25.448  194.254 1.00 24.98  ? 169 PRO A N     1 
ATOM   1205 C  CA    . PRO A  1  194 ? 16.358  25.111  193.661 1.00 24.33  ? 169 PRO A CA    1 
ATOM   1206 C  C     . PRO A  1  194 ? 17.116  24.055  194.446 1.00 24.57  ? 169 PRO A C     1 
ATOM   1207 O  O     . PRO A  1  194 ? 16.968  23.978  195.667 1.00 23.84  ? 169 PRO A O     1 
ATOM   1208 C  CB    . PRO A  1  194 ? 17.124  26.445  193.720 1.00 25.59  ? 169 PRO A CB    1 
ATOM   1209 C  CG    . PRO A  1  194 ? 16.515  27.205  194.827 1.00 26.83  ? 169 PRO A CG    1 
ATOM   1210 C  CD    . PRO A  1  194 ? 15.055  26.786  194.868 1.00 25.95  ? 169 PRO A CD    1 
ATOM   1211 N  N     . ASN A  1  195 ? 17.946  23.278  193.752 1.00 23.19  ? 170 ASN A N     1 
ATOM   1212 C  CA    . ASN A  1  195 ? 18.911  22.344  194.354 1.00 23.97  ? 170 ASN A CA    1 
ATOM   1213 C  C     . ASN A  1  195 ? 20.355  22.673  193.875 1.00 24.87  ? 170 ASN A C     1 
ATOM   1214 O  O     . ASN A  1  195 ? 20.898  22.010  193.005 1.00 22.10  ? 170 ASN A O     1 
ATOM   1215 C  CB    . ASN A  1  195 ? 18.495  20.920  193.997 1.00 24.62  ? 170 ASN A CB    1 
ATOM   1216 C  CG    . ASN A  1  195 ? 17.136  20.550  194.587 1.00 27.79  ? 170 ASN A CG    1 
ATOM   1217 O  OD1   . ASN A  1  195 ? 16.972  20.509  195.801 1.00 31.20  ? 170 ASN A OD1   1 
ATOM   1218 N  ND2   . ASN A  1  195 ? 16.160  20.324  193.740 1.00 26.95  ? 170 ASN A ND2   1 
ATOM   1219 N  N     . PHE A  1  196 ? 20.948  23.714  194.455 1.00 26.78  ? 171 PHE A N     1 
ATOM   1220 C  CA    . PHE A  1  196 ? 22.184  24.306  193.934 1.00 29.37  ? 171 PHE A CA    1 
ATOM   1221 C  C     . PHE A  1  196 ? 23.321  23.308  193.855 1.00 27.36  ? 171 PHE A C     1 
ATOM   1222 O  O     . PHE A  1  196 ? 24.061  23.342  192.895 1.00 25.29  ? 171 PHE A O     1 
ATOM   1223 C  CB    . PHE A  1  196 ? 22.625  25.595  194.687 1.00 32.39  ? 171 PHE A CB    1 
ATOM   1224 C  CG    . PHE A  1  196 ? 21.634  26.727  194.601 1.00 37.37  ? 171 PHE A CG    1 
ATOM   1225 C  CD1   . PHE A  1  196 ? 21.357  27.353  193.368 1.00 39.83  ? 171 PHE A CD1   1 
ATOM   1226 C  CD2   . PHE A  1  196 ? 20.962  27.200  195.751 1.00 42.93  ? 171 PHE A CD2   1 
ATOM   1227 C  CE1   . PHE A  1  196 ? 20.420  28.389  193.275 1.00 37.16  ? 171 PHE A CE1   1 
ATOM   1228 C  CE2   . PHE A  1  196 ? 20.027  28.235  195.654 1.00 41.00  ? 171 PHE A CE2   1 
ATOM   1229 C  CZ    . PHE A  1  196 ? 19.768  28.835  194.402 1.00 41.44  ? 171 PHE A CZ    1 
ATOM   1230 N  N     . ASP A  1  197 ? 23.421  22.397  194.821 1.00 29.14  ? 172 ASP A N     1 
ATOM   1231 C  CA    . ASP A  1  197 ? 24.505  21.382  194.832 1.00 29.93  ? 172 ASP A CA    1 
ATOM   1232 C  C     . ASP A  1  197 ? 24.387  20.383  193.718 1.00 26.42  ? 172 ASP A C     1 
ATOM   1233 O  O     . ASP A  1  197 ? 25.401  19.947  193.174 1.00 25.10  ? 172 ASP A O     1 
ATOM   1234 C  CB    . ASP A  1  197 ? 24.556  20.621  196.144 1.00 33.45  ? 172 ASP A CB    1 
ATOM   1235 C  CG    . ASP A  1  197 ? 24.694  21.512  197.292 1.00 40.17  ? 172 ASP A CG    1 
ATOM   1236 O  OD1   . ASP A  1  197 ? 25.716  22.226  197.351 1.00 38.60  ? 172 ASP A OD1   1 
ATOM   1237 O  OD2   . ASP A  1  197 ? 23.734  21.540  198.106 1.00 51.31  ? 172 ASP A OD2   1 
ATOM   1238 N  N     . LYS A  1  198 ? 23.154  20.015  193.369 1.00 25.11  ? 173 LYS A N     1 
ATOM   1239 C  CA    . LYS A  1  198 ? 22.909  19.259  192.131 1.00 27.11  ? 173 LYS A CA    1 
ATOM   1240 C  C     . LYS A  1  198 ? 23.399  19.954  190.868 1.00 26.74  ? 173 LYS A C     1 
ATOM   1241 O  O     . LYS A  1  198 ? 23.992  19.315  190.007 1.00 26.08  ? 173 LYS A O     1 
ATOM   1242 C  CB    . LYS A  1  198 ? 21.426  18.950  191.934 1.00 29.30  ? 173 LYS A CB    1 
ATOM   1243 C  CG    . LYS A  1  198 ? 20.942  17.862  192.828 1.00 27.88  ? 173 LYS A CG    1 
ATOM   1244 C  CD    . LYS A  1  198 ? 19.485  17.445  192.568 1.00 29.23  ? 173 LYS A CD    1 
ATOM   1245 C  CE    . LYS A  1  198 ? 19.310  16.767  191.239 1.00 28.06  ? 173 LYS A CE    1 
ATOM   1246 N  NZ    . LYS A  1  198 ? 17.947  16.195  191.130 1.00 28.63  ? 173 LYS A NZ    1 
ATOM   1247 N  N     . TYR A  1  199 ? 23.154  21.262  190.769 1.00 25.99  ? 174 TYR A N     1 
ATOM   1248 C  CA    . TYR A  1  199 ? 23.540  21.997  189.580 1.00 25.01  ? 174 TYR A CA    1 
ATOM   1249 C  C     . TYR A  1  199 ? 25.051  22.118  189.504 1.00 26.02  ? 174 TYR A C     1 
ATOM   1250 O  O     . TYR A  1  199 ? 25.585  22.041  188.409 1.00 25.99  ? 174 TYR A O     1 
ATOM   1251 C  CB    . TYR A  1  199 ? 22.874  23.358  189.484 1.00 25.29  ? 174 TYR A CB    1 
ATOM   1252 C  CG    . TYR A  1  199 ? 21.375  23.355  189.804 1.00 23.46  ? 174 TYR A CG    1 
ATOM   1253 C  CD1   . TYR A  1  199 ? 20.804  24.414  190.476 1.00 23.79  ? 174 TYR A CD1   1 
ATOM   1254 C  CD2   . TYR A  1  199 ? 20.560  22.317  189.413 1.00 21.90  ? 174 TYR A CD2   1 
ATOM   1255 C  CE1   . TYR A  1  199 ? 19.451  24.427  190.771 1.00 24.74  ? 174 TYR A CE1   1 
ATOM   1256 C  CE2   . TYR A  1  199 ? 19.202  22.313  189.705 1.00 23.97  ? 174 TYR A CE2   1 
ATOM   1257 C  CZ    . TYR A  1  199 ? 18.652  23.378  190.388 1.00 24.85  ? 174 TYR A CZ    1 
ATOM   1258 O  OH    . TYR A  1  199 ? 17.300  23.425  190.695 1.00 26.69  ? 174 TYR A OH    1 
ATOM   1259 N  N     . ARG A  1  200 ? 25.733  22.271  190.649 1.00 26.66  ? 175 ARG A N     1 
ATOM   1260 C  CA    . ARG A  1  200 ? 27.217  22.251  190.680 1.00 28.64  ? 175 ARG A CA    1 
ATOM   1261 C  C     . ARG A  1  200 ? 27.723  20.906  190.218 1.00 26.20  ? 175 ARG A C     1 
ATOM   1262 O  O     . ARG A  1  200 ? 28.662  20.841  189.452 1.00 25.53  ? 175 ARG A O     1 
ATOM   1263 C  CB    . ARG A  1  200 ? 27.780  22.531  192.084 1.00 32.97  ? 175 ARG A CB    1 
ATOM   1264 C  CG    . ARG A  1  200 ? 27.771  23.994  192.495 1.00 41.62  ? 175 ARG A CG    1 
ATOM   1265 C  CD    . ARG A  1  200 ? 28.676  24.291  193.711 1.00 47.19  ? 175 ARG A CD    1 
ATOM   1266 N  NE    . ARG A  1  200 ? 27.990  24.078  194.978 1.00 59.04  ? 175 ARG A NE    1 
ATOM   1267 C  CZ    . ARG A  1  200 ? 27.030  24.866  195.485 1.00 69.78  ? 175 ARG A CZ    1 
ATOM   1268 N  NH1   . ARG A  1  200 ? 26.481  24.549  196.662 1.00 75.39  ? 175 ARG A NH1   1 
ATOM   1269 N  NH2   . ARG A  1  200 ? 26.599  25.965  194.844 1.00 66.95  ? 175 ARG A NH2   1 
ATOM   1270 N  N     . ALA A  1  201 ? 27.087  19.830  190.676 1.00 25.40  ? 176 ALA A N     1 
ATOM   1271 C  CA    . ALA A  1  201 ? 27.476  18.471  190.277 1.00 26.54  ? 176 ALA A CA    1 
ATOM   1272 C  C     . ALA A  1  201 ? 27.327  18.234  188.756 1.00 27.97  ? 176 ALA A C     1 
ATOM   1273 O  O     . ALA A  1  201 ? 28.238  17.705  188.108 1.00 25.30  ? 176 ALA A O     1 
ATOM   1274 C  CB    . ALA A  1  201 ? 26.669  17.422  191.068 1.00 27.63  ? 176 ALA A CB    1 
ATOM   1275 N  N     . VAL A  1  202 ? 26.200  18.654  188.182 1.00 27.60  ? 177 VAL A N     1 
ATOM   1276 C  CA    . VAL A  1  202 ? 26.003  18.522  186.743 1.00 26.80  ? 177 VAL A CA    1 
ATOM   1277 C  C     . VAL A  1  202 ? 27.053  19.338  186.001 1.00 27.00  ? 177 VAL A C     1 
ATOM   1278 O  O     . VAL A  1  202 ? 27.627  18.899  184.992 1.00 26.68  ? 177 VAL A O     1 
ATOM   1279 C  CB    . VAL A  1  202 ? 24.574  18.922  186.303 1.00 29.73  ? 177 VAL A CB    1 
ATOM   1280 C  CG1   . VAL A  1  202 ? 24.436  18.887  184.795 1.00 30.88  ? 177 VAL A CG1   1 
ATOM   1281 C  CG2   . VAL A  1  202 ? 23.541  18.006  186.931 1.00 30.85  ? 177 VAL A CG2   1 
ATOM   1282 N  N     . SER A  1  203 ? 27.313  20.525  186.506 1.00 26.27  ? 178 SER A N     1 
ATOM   1283 C  CA    . SER A  1  203 ? 28.275  21.392  185.900 1.00 28.77  ? 178 SER A CA    1 
ATOM   1284 C  C     . SER A  1  203 ? 29.677  20.748  185.866 1.00 30.26  ? 178 SER A C     1 
ATOM   1285 O  O     . SER A  1  203 ? 30.397  20.853  184.865 1.00 27.88  ? 178 SER A O     1 
ATOM   1286 C  CB    . SER A  1  203 ? 28.265  22.736  186.615 1.00 30.38  ? 178 SER A CB    1 
ATOM   1287 O  OG    . SER A  1  203 ? 29.177  23.620  186.016 1.00 34.65  ? 178 SER A OG    1 
ATOM   1288 N  N     . LYS A  1  204 ? 30.050  20.057  186.933 1.00 30.70  ? 179 LYS A N     1 
ATOM   1289 C  CA    . LYS A  1  204 ? 31.346  19.342  186.976 1.00 31.45  ? 179 LYS A CA    1 
ATOM   1290 C  C     . LYS A  1  204 ? 31.438  18.272  185.905 1.00 28.49  ? 179 LYS A C     1 
ATOM   1291 O  O     . LYS A  1  204 ? 32.459  18.156  185.225 1.00 29.32  ? 179 LYS A O     1 
ATOM   1292 C  CB    . LYS A  1  204 ? 31.569  18.727  188.368 1.00 33.64  ? 179 LYS A CB    1 
ATOM   1293 C  CG    . LYS A  1  204 ? 32.782  17.813  188.489 1.00 39.48  ? 179 LYS A CG    1 
ATOM   1294 C  CD    . LYS A  1  204 ? 32.980  17.399  189.945 1.00 43.39  ? 179 LYS A CD    1 
ATOM   1295 C  CE    . LYS A  1  204 ? 34.192  16.492  190.134 1.00 47.45  ? 179 LYS A CE    1 
ATOM   1296 N  NZ    . LYS A  1  204 ? 34.016  15.166  189.477 1.00 47.48  ? 179 LYS A NZ    1 
ATOM   1297 N  N     . GLU A  1  205 ? 30.357  17.518  185.723 1.00 26.40  ? 180 GLU A N     1 
ATOM   1298 C  CA    . GLU A  1  205 ? 30.271  16.547  184.622 1.00 27.70  ? 180 GLU A CA    1 
ATOM   1299 C  C     . GLU A  1  205 ? 30.422  17.164  183.230 1.00 26.55  ? 180 GLU A C     1 
ATOM   1300 O  O     . GLU A  1  205 ? 31.150  16.632  182.397 1.00 24.95  ? 180 GLU A O     1 
ATOM   1301 C  CB    . GLU A  1  205 ? 28.988  15.754  184.667 1.00 26.68  ? 180 GLU A CB    1 
ATOM   1302 C  CG    . GLU A  1  205 ? 28.894  14.790  185.850 1.00 29.61  ? 180 GLU A CG    1 
ATOM   1303 C  CD    . GLU A  1  205 ? 27.484  14.253  186.032 1.00 28.71  ? 180 GLU A CD    1 
ATOM   1304 O  OE1   . GLU A  1  205 ? 26.504  15.031  185.997 1.00 30.48  ? 180 GLU A OE1   1 
ATOM   1305 O  OE2   . GLU A  1  205 ? 27.339  13.063  186.215 1.00 32.52  ? 180 GLU A OE2   1 
ATOM   1306 N  N     . VAL A  1  206 ? 29.792  18.312  183.011 1.00 25.14  ? 181 VAL A N     1 
ATOM   1307 C  CA    . VAL A  1  206 ? 29.905  19.020  181.729 1.00 24.46  ? 181 VAL A CA    1 
ATOM   1308 C  C     . VAL A  1  206 ? 31.346  19.496  181.491 1.00 26.39  ? 181 VAL A C     1 
ATOM   1309 O  O     . VAL A  1  206 ? 31.942  19.191  180.464 1.00 25.03  ? 181 VAL A O     1 
ATOM   1310 C  CB    . VAL A  1  206 ? 28.923  20.174  181.638 1.00 23.47  ? 181 VAL A CB    1 
ATOM   1311 C  CG1   . VAL A  1  206 ? 29.185  21.042  180.386 1.00 23.29  ? 181 VAL A CG1   1 
ATOM   1312 C  CG2   . VAL A  1  206 ? 27.502  19.610  181.657 1.00 23.52  ? 181 VAL A CG2   1 
ATOM   1313 N  N     . LYS A  1  207 ? 31.903  20.180  182.472 1.00 28.30  ? 182 LYS A N     1 
ATOM   1314 C  CA    . LYS A  1  207 ? 33.279  20.690  182.394 1.00 31.13  ? 182 LYS A CA    1 
ATOM   1315 C  C     . LYS A  1  207 ? 34.314  19.592  182.145 1.00 29.57  ? 182 LYS A C     1 
ATOM   1316 O  O     . LYS A  1  207 ? 35.273  19.818  181.453 1.00 29.22  ? 182 LYS A O     1 
ATOM   1317 C  CB    . LYS A  1  207 ? 33.632  21.446  183.669 1.00 35.94  ? 182 LYS A CB    1 
ATOM   1318 C  CG    . LYS A  1  207 ? 32.932  22.790  183.878 1.00 42.27  ? 182 LYS A CG    1 
ATOM   1319 C  CD    . LYS A  1  207 ? 33.047  23.198  185.351 1.00 49.33  ? 182 LYS A CD    1 
ATOM   1320 C  CE    . LYS A  1  207 ? 33.008  24.700  185.577 1.00 58.36  ? 182 LYS A CE    1 
ATOM   1321 N  NZ    . LYS A  1  207 ? 31.645  25.288  185.381 1.00 67.23  ? 182 LYS A NZ    1 
ATOM   1322 N  N     . GLU A  1  208 ? 34.129  18.403  182.713 1.00 30.38  ? 183 GLU A N     1 
ATOM   1323 C  CA    . GLU A  1  208 ? 35.033  17.286  182.400 1.00 32.82  ? 183 GLU A CA    1 
ATOM   1324 C  C     . GLU A  1  208 ? 35.035  16.877  180.930 1.00 29.92  ? 183 GLU A C     1 
ATOM   1325 O  O     . GLU A  1  208 ? 36.058  16.492  180.388 1.00 29.84  ? 183 GLU A O     1 
ATOM   1326 C  CB    . GLU A  1  208 ? 34.681  16.062  183.227 1.00 35.81  ? 183 GLU A CB    1 
ATOM   1327 C  CG    . GLU A  1  208 ? 35.096  16.232  184.660 1.00 40.30  ? 183 GLU A CG    1 
ATOM   1328 C  CD    . GLU A  1  208 ? 34.483  15.195  185.580 1.00 41.31  ? 183 GLU A CD    1 
ATOM   1329 O  OE1   . GLU A  1  208 ? 33.722  14.319  185.111 1.00 38.04  ? 183 GLU A OE1   1 
ATOM   1330 O  OE2   . GLU A  1  208 ? 34.800  15.286  186.782 1.00 49.52  ? 183 GLU A OE2   1 
ATOM   1331 N  N     . ILE A  1  209 ? 33.888  16.964  180.278 1.00 29.45  ? 184 ILE A N     1 
ATOM   1332 C  CA    . ILE A  1  209 ? 33.854  16.753  178.824 1.00 28.11  ? 184 ILE A CA    1 
ATOM   1333 C  C     . ILE A  1  209 ? 34.539  17.937  178.137 1.00 27.02  ? 184 ILE A C     1 
ATOM   1334 O  O     . ILE A  1  209 ? 35.393  17.754  177.268 1.00 25.53  ? 184 ILE A O     1 
ATOM   1335 C  CB    . ILE A  1  209 ? 32.428  16.549  178.328 1.00 27.54  ? 184 ILE A CB    1 
ATOM   1336 C  CG1   . ILE A  1  209 ? 31.847  15.282  178.963 1.00 27.17  ? 184 ILE A CG1   1 
ATOM   1337 C  CG2   . ILE A  1  209 ? 32.400  16.482  176.814 1.00 27.23  ? 184 ILE A CG2   1 
ATOM   1338 C  CD1   . ILE A  1  209 ? 30.337  15.230  178.934 1.00 29.18  ? 184 ILE A CD1   1 
ATOM   1339 N  N     . LEU A  1  210 ? 34.228  19.150  178.567 1.00 26.00  ? 185 LEU A N     1 
ATOM   1340 C  CA    . LEU A  1  210 ? 34.772  20.309  177.873 1.00 27.13  ? 185 LEU A CA    1 
ATOM   1341 C  C     . LEU A  1  210 ? 36.316  20.358  177.880 1.00 27.74  ? 185 LEU A C     1 
ATOM   1342 O  O     . LEU A  1  210 ? 36.923  20.775  176.895 1.00 25.35  ? 185 LEU A O     1 
ATOM   1343 C  CB    . LEU A  1  210 ? 34.185  21.584  178.418 1.00 25.91  ? 185 LEU A CB    1 
ATOM   1344 C  CG    . LEU A  1  210 ? 32.660  21.660  178.302 1.00 27.40  ? 185 LEU A CG    1 
ATOM   1345 C  CD1   . LEU A  1  210 ? 32.228  23.000  178.836 1.00 27.34  ? 185 LEU A CD1   1 
ATOM   1346 C  CD2   . LEU A  1  210 ? 32.163  21.421  176.903 1.00 27.05  ? 185 LEU A CD2   1 
ATOM   1347 N  N     . ALA A  1  211 ? 36.922  19.874  178.954 1.00 28.43  ? 186 ALA A N     1 
ATOM   1348 C  CA    . ALA A  1  211 ? 38.393  19.846  179.113 1.00 29.98  ? 186 ALA A CA    1 
ATOM   1349 C  C     . ALA A  1  211 ? 39.105  19.037  178.054 1.00 31.29  ? 186 ALA A C     1 
ATOM   1350 O  O     . ALA A  1  211 ? 40.231  19.362  177.705 1.00 33.65  ? 186 ALA A O     1 
ATOM   1351 C  CB    . ALA A  1  211 ? 38.782  19.331  180.511 1.00 29.92  ? 186 ALA A CB    1 
ATOM   1352 N  N     . ASP A  1  212 ? 38.450  18.003  177.521 1.00 32.44  ? 187 ASP A N     1 
ATOM   1353 C  CA    . ASP A  1  212 ? 39.010  17.228  176.434 1.00 32.58  ? 187 ASP A CA    1 
ATOM   1354 C  C     . ASP A  1  212 ? 39.310  18.011  175.176 1.00 33.29  ? 187 ASP A C     1 
ATOM   1355 O  O     . ASP A  1  212 ? 40.164  17.572  174.425 1.00 37.68  ? 187 ASP A O     1 
ATOM   1356 C  CB    . ASP A  1  212 ? 38.077  16.088  176.012 1.00 36.91  ? 187 ASP A CB    1 
ATOM   1357 C  CG    . ASP A  1  212 ? 38.052  14.959  177.000 1.00 40.13  ? 187 ASP A CG    1 
ATOM   1358 O  OD1   . ASP A  1  212 ? 38.875  14.989  177.919 1.00 44.11  ? 187 ASP A OD1   1 
ATOM   1359 O  OD2   . ASP A  1  212 ? 37.184  14.069  176.873 1.00 44.30  ? 187 ASP A OD2   1 
ATOM   1360 N  N     . TYR A  1  213 ? 38.565  19.096  174.922 1.00 29.20  ? 188 TYR A N     1 
ATOM   1361 C  CA    . TYR A  1  213 ? 38.629  19.860  173.662 1.00 28.31  ? 188 TYR A CA    1 
ATOM   1362 C  C     . TYR A  1  213 ? 39.392  21.179  173.810 1.00 29.00  ? 188 TYR A C     1 
ATOM   1363 O  O     . TYR A  1  213 ? 40.003  21.639  172.850 1.00 30.90  ? 188 TYR A O     1 
ATOM   1364 C  CB    . TYR A  1  213 ? 37.206  20.137  173.133 1.00 26.67  ? 188 TYR A CB    1 
ATOM   1365 C  CG    . TYR A  1  213 ? 36.451  18.883  172.955 1.00 26.48  ? 188 TYR A CG    1 
ATOM   1366 C  CD1   . TYR A  1  213 ? 35.733  18.335  174.002 1.00 26.63  ? 188 TYR A CD1   1 
ATOM   1367 C  CD2   . TYR A  1  213 ? 36.520  18.182  171.768 1.00 26.08  ? 188 TYR A CD2   1 
ATOM   1368 C  CE1   . TYR A  1  213 ? 35.067  17.119  173.854 1.00 27.07  ? 188 TYR A CE1   1 
ATOM   1369 C  CE2   . TYR A  1  213 ? 35.882  16.967  171.612 1.00 26.74  ? 188 TYR A CE2   1 
ATOM   1370 C  CZ    . TYR A  1  213 ? 35.148  16.443  172.655 1.00 27.46  ? 188 TYR A CZ    1 
ATOM   1371 O  OH    . TYR A  1  213 ? 34.506  15.239  172.495 1.00 27.60  ? 188 TYR A OH    1 
ATOM   1372 N  N     . ASP A  1  214 ? 39.293  21.815  174.979 1.00 29.75  ? 189 ASP A N     1 
ATOM   1373 C  CA    . ASP A  1  214 ? 40.149  22.944  175.315 1.00 31.07  ? 189 ASP A CA    1 
ATOM   1374 C  C     . ASP A  1  214 ? 40.470  22.854  176.805 1.00 33.46  ? 189 ASP A C     1 
ATOM   1375 O  O     . ASP A  1  214 ? 39.626  23.240  177.649 1.00 31.47  ? 189 ASP A O     1 
ATOM   1376 C  CB    . ASP A  1  214 ? 39.485  24.286  174.972 1.00 30.13  ? 189 ASP A CB    1 
ATOM   1377 C  CG    . ASP A  1  214 ? 40.374  25.482  175.282 1.00 31.96  ? 189 ASP A CG    1 
ATOM   1378 O  OD1   . ASP A  1  214 ? 39.893  26.647  175.211 1.00 30.10  ? 189 ASP A OD1   1 
ATOM   1379 O  OD2   . ASP A  1  214 ? 41.564  25.271  175.609 1.00 34.59  ? 189 ASP A OD2   1 
ATOM   1380 N  N     . PRO A  1  215 ? 41.695  22.383  177.147 1.00 34.05  ? 190 PRO A N     1 
ATOM   1381 C  CA    . PRO A  1  215 ? 42.014  22.324  178.576 1.00 35.63  ? 190 PRO A CA    1 
ATOM   1382 C  C     . PRO A  1  215 ? 42.052  23.692  179.262 1.00 35.53  ? 190 PRO A C     1 
ATOM   1383 O  O     . PRO A  1  215 ? 41.846  23.757  180.457 1.00 38.36  ? 190 PRO A O     1 
ATOM   1384 C  CB    . PRO A  1  215 ? 43.378  21.614  178.616 1.00 37.49  ? 190 PRO A CB    1 
ATOM   1385 C  CG    . PRO A  1  215 ? 43.953  21.793  177.257 1.00 37.95  ? 190 PRO A CG    1 
ATOM   1386 C  CD    . PRO A  1  215 ? 42.793  21.850  176.312 1.00 36.64  ? 190 PRO A CD    1 
ATOM   1387 N  N     . ASN A  1  216 ? 42.247  24.774  178.510 1.00 34.43  ? 191 ASN A N     1 
ATOM   1388 C  CA    . ASN A  1  216 ? 42.110  26.148  179.038 1.00 37.31  ? 191 ASN A CA    1 
ATOM   1389 C  C     . ASN A  1  216 ? 40.724  26.818  178.842 1.00 34.65  ? 191 ASN A C     1 
ATOM   1390 O  O     . ASN A  1  216 ? 40.624  28.019  178.849 1.00 34.60  ? 191 ASN A O     1 
ATOM   1391 C  CB    . ASN A  1  216 ? 43.233  27.017  178.462 1.00 41.56  ? 191 ASN A CB    1 
ATOM   1392 C  CG    . ASN A  1  216 ? 44.585  26.690  179.087 1.00 52.51  ? 191 ASN A CG    1 
ATOM   1393 O  OD1   . ASN A  1  216 ? 44.805  25.588  179.583 1.00 53.22  ? 191 ASN A OD1   1 
ATOM   1394 N  ND2   . ASN A  1  216 ? 45.488  27.667  179.092 1.00 68.14  ? 191 ASN A ND2   1 
ATOM   1395 N  N     . PHE A  1  217 ? 39.654  26.040  178.691 1.00 36.14  ? 192 PHE A N     1 
ATOM   1396 C  CA    . PHE A  1  217 ? 38.305  26.596  178.492 1.00 34.37  ? 192 PHE A CA    1 
ATOM   1397 C  C     . PHE A  1  217 ? 37.969  27.543  179.639 1.00 35.40  ? 192 PHE A C     1 
ATOM   1398 O  O     . PHE A  1  217 ? 38.441  27.361  180.751 1.00 33.60  ? 192 PHE A O     1 
ATOM   1399 C  CB    . PHE A  1  217 ? 37.243  25.474  178.370 1.00 36.00  ? 192 PHE A CB    1 
ATOM   1400 C  CG    . PHE A  1  217 ? 36.924  24.788  179.670 1.00 35.50  ? 192 PHE A CG    1 
ATOM   1401 C  CD1   . PHE A  1  217 ? 35.935  25.291  180.505 1.00 37.72  ? 192 PHE A CD1   1 
ATOM   1402 C  CD2   . PHE A  1  217 ? 37.633  23.673  180.082 1.00 36.87  ? 192 PHE A CD2   1 
ATOM   1403 C  CE1   . PHE A  1  217 ? 35.657  24.686  181.725 1.00 40.62  ? 192 PHE A CE1   1 
ATOM   1404 C  CE2   . PHE A  1  217 ? 37.363  23.063  181.292 1.00 40.67  ? 192 PHE A CE2   1 
ATOM   1405 C  CZ    . PHE A  1  217 ? 36.372  23.572  182.119 1.00 40.74  ? 192 PHE A CZ    1 
ATOM   1406 N  N     . MET A  1  218 ? 37.123  28.516  179.357 1.00 34.62  ? 193 MET A N     1 
ATOM   1407 C  CA    . MET A  1  218 ? 36.765  29.574  180.292 1.00 39.33  ? 193 MET A CA    1 
ATOM   1408 C  C     . MET A  1  218 ? 35.302  29.384  180.681 1.00 40.03  ? 193 MET A C     1 
ATOM   1409 O  O     . MET A  1  218 ? 34.387  29.664  179.889 1.00 35.87  ? 193 MET A O     1 
ATOM   1410 C  CB    . MET A  1  218 ? 36.975  30.908  179.594 1.00 42.23  ? 193 MET A CB    1 
ATOM   1411 C  CG    . MET A  1  218 ? 36.577  32.168  180.352 1.00 54.21  ? 193 MET A CG    1 
ATOM   1412 S  SD    . MET A  1  218 ? 36.573  33.614  179.244 1.00 69.29  ? 193 MET A SD    1 
ATOM   1413 C  CE    . MET A  1  218 ? 38.315  33.800  178.902 1.00 65.89  ? 193 MET A CE    1 
ATOM   1414 N  N     . ALA A  1  219 ? 35.090  28.911  181.898 1.00 41.56  ? 194 ALA A N     1 
ATOM   1415 C  CA    . ALA A  1  219 ? 33.758  28.674  182.422 1.00 43.13  ? 194 ALA A CA    1 
ATOM   1416 C  C     . ALA A  1  219 ? 33.246  29.981  182.988 1.00 46.60  ? 194 ALA A C     1 
ATOM   1417 O  O     . ALA A  1  219 ? 33.909  30.632  183.770 1.00 44.51  ? 194 ALA A O     1 
ATOM   1418 C  CB    . ALA A  1  219 ? 33.793  27.619  183.493 1.00 44.51  ? 194 ALA A CB    1 
ATOM   1419 N  N     . MET A  1  220 ? 32.055  30.362  182.575 1.00 46.29  ? 195 MET A N     1 
ATOM   1420 C  CA    . MET A  1  220 ? 31.518  31.660  182.905 1.00 48.36  ? 195 MET A CA    1 
ATOM   1421 C  C     . MET A  1  220 ? 30.591  31.557  184.104 1.00 49.37  ? 195 MET A C     1 
ATOM   1422 O  O     . MET A  1  220 ? 30.675  32.348  185.022 1.00 58.58  ? 195 MET A O     1 
ATOM   1423 C  CB    . MET A  1  220 ? 30.779  32.208  181.687 1.00 50.09  ? 195 MET A CB    1 
ATOM   1424 C  CG    . MET A  1  220 ? 31.672  32.366  180.460 1.00 47.43  ? 195 MET A CG    1 
ATOM   1425 S  SD    . MET A  1  220 ? 33.016  33.524  180.793 1.00 53.62  ? 195 MET A SD    1 
ATOM   1426 C  CE    . MET A  1  220 ? 32.146  35.085  180.943 1.00 56.68  ? 195 MET A CE    1 
ATOM   1427 N  N     . SER A  1  221 ? 29.700  30.588  184.076 1.00 45.77  ? 196 SER A N     1 
ATOM   1428 C  CA    . SER A  1  221 ? 28.851  30.292  185.212 1.00 45.22  ? 196 SER A CA    1 
ATOM   1429 C  C     . SER A  1  221 ? 28.845  28.762  185.286 1.00 41.50  ? 196 SER A C     1 
ATOM   1430 O  O     . SER A  1  221 ? 29.654  28.107  184.602 1.00 40.55  ? 196 SER A O     1 
ATOM   1431 C  CB    . SER A  1  221 ? 27.451  30.869  184.942 1.00 50.37  ? 196 SER A CB    1 
ATOM   1432 O  OG    . SER A  1  221 ? 26.953  30.441  183.670 1.00 48.00  ? 196 SER A OG    1 
ATOM   1433 N  N     . LEU A  1  222 ? 27.918  28.191  186.043 1.00 32.09  ? 197 LEU A N     1 
ATOM   1434 C  CA    . LEU A  1  222 ? 27.737  26.739  186.030 1.00 32.10  ? 197 LEU A CA    1 
ATOM   1435 C  C     . LEU A  1  222 ? 27.345  26.200  184.653 1.00 30.25  ? 197 LEU A C     1 
ATOM   1436 O  O     . LEU A  1  222 ? 27.761  25.086  184.291 1.00 27.92  ? 197 LEU A O     1 
ATOM   1437 C  CB    . LEU A  1  222 ? 26.651  26.299  187.029 1.00 32.60  ? 197 LEU A CB    1 
ATOM   1438 C  CG    . LEU A  1  222 ? 26.905  26.547  188.494 1.00 32.26  ? 197 LEU A CG    1 
ATOM   1439 C  CD1   . LEU A  1  222 ? 25.739  26.003  189.285 1.00 32.98  ? 197 LEU A CD1   1 
ATOM   1440 C  CD2   . LEU A  1  222 ? 28.230  25.939  188.961 1.00 34.99  ? 197 LEU A CD2   1 
ATOM   1441 N  N     . ASP A  1  223 ? 26.556  26.967  183.893 1.00 26.72  ? 198 ASP A N     1 
ATOM   1442 C  CA    . ASP A  1  223 ? 25.902  26.390  182.715 1.00 27.01  ? 198 ASP A CA    1 
ATOM   1443 C  C     . ASP A  1  223 ? 26.556  26.731  181.352 1.00 25.23  ? 198 ASP A C     1 
ATOM   1444 O  O     . ASP A  1  223 ? 26.078  26.266  180.330 1.00 25.42  ? 198 ASP A O     1 
ATOM   1445 C  CB    . ASP A  1  223 ? 24.394  26.729  182.716 1.00 26.12  ? 198 ASP A CB    1 
ATOM   1446 C  CG    . ASP A  1  223 ? 24.006  27.702  181.648 1.00 26.15  ? 198 ASP A CG    1 
ATOM   1447 O  OD1   . ASP A  1  223 ? 24.638  28.758  181.571 1.00 27.92  ? 198 ASP A OD1   1 
ATOM   1448 O  OD2   . ASP A  1  223 ? 23.087  27.389  180.862 1.00 26.27  ? 198 ASP A OD2   1 
ATOM   1449 N  N     . GLU A  1  224 ? 27.583  27.563  181.322 1.00 24.92  ? 199 GLU A N     1 
ATOM   1450 C  CA    . GLU A  1  224 ? 28.180  27.937  180.041 1.00 29.02  ? 199 GLU A CA    1 
ATOM   1451 C  C     . GLU A  1  224 ? 29.673  28.057  180.072 1.00 29.13  ? 199 GLU A C     1 
ATOM   1452 O  O     . GLU A  1  224 ? 30.293  28.210  181.143 1.00 28.55  ? 199 GLU A O     1 
ATOM   1453 C  CB    . GLU A  1  224 ? 27.555  29.203  179.463 1.00 33.16  ? 199 GLU A CB    1 
ATOM   1454 C  CG    . GLU A  1  224 ? 27.874  30.496  180.172 1.00 36.01  ? 199 GLU A CG    1 
ATOM   1455 C  CD    . GLU A  1  224 ? 27.290  31.697  179.452 1.00 41.39  ? 199 GLU A CD    1 
ATOM   1456 O  OE1   . GLU A  1  224 ? 26.041  31.836  179.482 1.00 38.59  ? 199 GLU A OE1   1 
ATOM   1457 O  OE2   . GLU A  1  224 ? 28.078  32.483  178.834 1.00 42.25  ? 199 GLU A OE2   1 
ATOM   1458 N  N     . ALA A  1  225 ? 30.249  28.025  178.875 1.00 27.04  ? 200 ALA A N     1 
ATOM   1459 C  CA    . ALA A  1  225 ? 31.698  28.112  178.726 1.00 27.59  ? 200 ALA A CA    1 
ATOM   1460 C  C     . ALA A  1  225 ? 32.121  28.445  177.320 1.00 27.26  ? 200 ALA A C     1 
ATOM   1461 O  O     . ALA A  1  225 ? 31.449  28.032  176.358 1.00 25.94  ? 200 ALA A O     1 
ATOM   1462 C  CB    . ALA A  1  225 ? 32.319  26.785  179.096 1.00 29.91  ? 200 ALA A CB    1 
ATOM   1463 N  N     . TYR A  1  226 ? 33.266  29.121  177.223 1.00 25.38  ? 201 TYR A N     1 
ATOM   1464 C  CA    . TYR A  1  226 ? 33.962  29.353  175.975 1.00 24.08  ? 201 TYR A CA    1 
ATOM   1465 C  C     . TYR A  1  226 ? 35.115  28.391  175.857 1.00 25.07  ? 201 TYR A C     1 
ATOM   1466 O  O     . TYR A  1  226 ? 35.813  28.139  176.837 1.00 26.58  ? 201 TYR A O     1 
ATOM   1467 C  CB    . TYR A  1  226 ? 34.512  30.786  175.887 1.00 26.07  ? 201 TYR A CB    1 
ATOM   1468 C  CG    . TYR A  1  226 ? 33.481  31.899  175.887 1.00 25.75  ? 201 TYR A CG    1 
ATOM   1469 C  CD1   . TYR A  1  226 ? 32.907  32.324  174.701 1.00 26.64  ? 201 TYR A CD1   1 
ATOM   1470 C  CD2   . TYR A  1  226 ? 33.095  32.528  177.080 1.00 28.01  ? 201 TYR A CD2   1 
ATOM   1471 C  CE1   . TYR A  1  226 ? 31.971  33.327  174.688 1.00 28.48  ? 201 TYR A CE1   1 
ATOM   1472 C  CE2   . TYR A  1  226 ? 32.130  33.530  177.081 1.00 29.81  ? 201 TYR A CE2   1 
ATOM   1473 C  CZ    . TYR A  1  226 ? 31.581  33.920  175.869 1.00 30.86  ? 201 TYR A CZ    1 
ATOM   1474 O  OH    . TYR A  1  226 ? 30.631  34.894  175.805 1.00 34.22  ? 201 TYR A OH    1 
ATOM   1475 N  N     . LEU A  1  227 ? 35.291  27.839  174.657 1.00 25.08  ? 202 LEU A N     1 
ATOM   1476 C  CA    . LEU A  1  227 ? 36.386  26.947  174.318 1.00 26.20  ? 202 LEU A CA    1 
ATOM   1477 C  C     . LEU A  1  227 ? 37.054  27.520  173.065 1.00 28.41  ? 202 LEU A C     1 
ATOM   1478 O  O     . LEU A  1  227 ? 36.388  28.054  172.152 1.00 24.41  ? 202 LEU A O     1 
ATOM   1479 C  CB    . LEU A  1  227 ? 35.910  25.540  173.986 1.00 27.29  ? 202 LEU A CB    1 
ATOM   1480 C  CG    . LEU A  1  227 ? 35.306  24.643  175.068 1.00 29.55  ? 202 LEU A CG    1 
ATOM   1481 C  CD1   . LEU A  1  227 ? 33.906  25.078  175.419 1.00 32.54  ? 202 LEU A CD1   1 
ATOM   1482 C  CD2   . LEU A  1  227 ? 35.265  23.199  174.609 1.00 31.05  ? 202 LEU A CD2   1 
ATOM   1483 N  N     . ASN A  1  228 ? 38.365  27.407  173.021 1.00 25.43  ? 203 ASN A N     1 
ATOM   1484 C  CA    . ASN A  1  228 ? 39.091  27.634  171.800 1.00 25.85  ? 203 ASN A CA    1 
ATOM   1485 C  C     . ASN A  1  228 ? 39.492  26.261  171.293 1.00 25.32  ? 203 ASN A C     1 
ATOM   1486 O  O     . ASN A  1  228 ? 40.434  25.670  171.790 1.00 25.63  ? 203 ASN A O     1 
ATOM   1487 C  CB    . ASN A  1  228 ? 40.322  28.509  172.070 1.00 26.24  ? 203 ASN A CB    1 
ATOM   1488 C  CG    . ASN A  1  228 ? 41.024  28.933  170.791 1.00 26.76  ? 203 ASN A CG    1 
ATOM   1489 O  OD1   . ASN A  1  228 ? 40.943  28.271  169.778 1.00 27.99  ? 203 ASN A OD1   1 
ATOM   1490 N  ND2   . ASN A  1  228 ? 41.743  30.035  170.848 1.00 29.99  ? 203 ASN A ND2   1 
ATOM   1491 N  N     . ILE A  1  229 ? 38.809  25.770  170.267 1.00 24.87  ? 204 ILE A N     1 
ATOM   1492 C  CA    . ILE A  1  229 ? 39.058  24.415  169.757 1.00 25.86  ? 204 ILE A CA    1 
ATOM   1493 C  C     . ILE A  1  229 ? 40.031  24.380  168.561 1.00 25.79  ? 204 ILE A C     1 
ATOM   1494 O  O     . ILE A  1  229 ? 40.129  23.366  167.894 1.00 24.91  ? 204 ILE A O     1 
ATOM   1495 C  CB    . ILE A  1  229 ? 37.733  23.677  169.425 1.00 25.32  ? 204 ILE A CB    1 
ATOM   1496 C  CG1   . ILE A  1  229 ? 36.981  24.293  168.249 1.00 24.59  ? 204 ILE A CG1   1 
ATOM   1497 C  CG2   . ILE A  1  229 ? 36.844  23.616  170.672 1.00 25.42  ? 204 ILE A CG2   1 
ATOM   1498 C  CD1   . ILE A  1  229 ? 35.952  23.351  167.657 1.00 24.66  ? 204 ILE A CD1   1 
ATOM   1499 N  N     . THR A  1  230 ? 40.712  25.497  168.309 1.00 27.82  ? 205 THR A N     1 
ATOM   1500 C  CA    . THR A  1  230 ? 41.716  25.635  167.233 1.00 30.23  ? 205 THR A CA    1 
ATOM   1501 C  C     . THR A  1  230 ? 42.749  24.503  167.251 1.00 30.02  ? 205 THR A C     1 
ATOM   1502 O  O     . THR A  1  230 ? 42.919  23.806  166.261 1.00 31.67  ? 205 THR A O     1 
ATOM   1503 C  CB    . THR A  1  230 ? 42.408  27.014  167.359 1.00 30.10  ? 205 THR A CB    1 
ATOM   1504 O  OG1   . THR A  1  230 ? 41.389  28.021  167.268 1.00 28.54  ? 205 THR A OG1   1 
ATOM   1505 C  CG2   . THR A  1  230 ? 43.477  27.263  166.255 1.00 28.14  ? 205 THR A CG2   1 
ATOM   1506 N  N     . LYS A  1  231 ? 43.408  24.319  168.381 1.00 30.07  ? 206 LYS A N     1 
ATOM   1507 C  CA    . LYS A  1  231 ? 44.411  23.253  168.504 1.00 32.86  ? 206 LYS A CA    1 
ATOM   1508 C  C     . LYS A  1  231 ? 43.810  21.878  168.318 1.00 31.98  ? 206 LYS A C     1 
ATOM   1509 O  O     . LYS A  1  231 ? 44.294  21.044  167.553 1.00 29.78  ? 206 LYS A O     1 
ATOM   1510 C  CB    . LYS A  1  231 ? 45.054  23.328  169.893 1.00 39.97  ? 206 LYS A CB    1 
ATOM   1511 C  CG    . LYS A  1  231 ? 45.976  22.172  170.272 1.00 47.81  ? 206 LYS A CG    1 
ATOM   1512 C  CD    . LYS A  1  231 ? 47.444  22.549  170.170 1.00 59.33  ? 206 LYS A CD    1 
ATOM   1513 C  CE    . LYS A  1  231 ? 47.904  23.357  171.380 1.00 65.13  ? 206 LYS A CE    1 
ATOM   1514 N  NZ    . LYS A  1  231 ? 49.396  23.428  171.420 1.00 71.99  ? 206 LYS A NZ    1 
ATOM   1515 N  N     . HIS A  1  232 ? 42.757  21.613  169.071 1.00 31.04  ? 207 HIS A N     1 
ATOM   1516 C  CA    . HIS A  1  232 ? 42.058  20.363  168.937 1.00 29.45  ? 207 HIS A CA    1 
ATOM   1517 C  C     . HIS A  1  232 ? 41.707  20.062  167.496 1.00 29.56  ? 207 HIS A C     1 
ATOM   1518 O  O     . HIS A  1  232 ? 41.917  18.923  167.041 1.00 28.72  ? 207 HIS A O     1 
ATOM   1519 C  CB    . HIS A  1  232 ? 40.803  20.348  169.817 1.00 29.36  ? 207 HIS A CB    1 
ATOM   1520 C  CG    . HIS A  1  232 ? 39.961  19.145  169.618 1.00 29.55  ? 207 HIS A CG    1 
ATOM   1521 N  ND1   . HIS A  1  232 ? 40.168  17.977  170.313 1.00 32.47  ? 207 HIS A ND1   1 
ATOM   1522 C  CD2   . HIS A  1  232 ? 38.943  18.900  168.764 1.00 31.14  ? 207 HIS A CD2   1 
ATOM   1523 C  CE1   . HIS A  1  232 ? 39.307  17.061  169.901 1.00 32.33  ? 207 HIS A CE1   1 
ATOM   1524 N  NE2   . HIS A  1  232 ? 38.558  17.596  168.959 1.00 31.82  ? 207 HIS A NE2   1 
ATOM   1525 N  N     . LEU A  1  233 ? 41.165  21.046  166.760 1.00 30.43  ? 208 LEU A N     1 
ATOM   1526 C  CA    . LEU A  1  233 ? 40.773  20.795  165.359 1.00 30.59  ? 208 LEU A CA    1 
ATOM   1527 C  C     . LEU A  1  233 ? 41.963  20.384  164.502 1.00 33.58  ? 208 LEU A C     1 
ATOM   1528 O  O     . LEU A  1  233 ? 41.842  19.518  163.626 1.00 33.20  ? 208 LEU A O     1 
ATOM   1529 C  CB    . LEU A  1  233 ? 40.147  22.030  164.708 1.00 33.23  ? 208 LEU A CB    1 
ATOM   1530 C  CG    . LEU A  1  233 ? 38.645  22.198  164.816 1.00 32.76  ? 208 LEU A CG    1 
ATOM   1531 C  CD1   . LEU A  1  233 ? 38.318  23.590  164.279 1.00 34.96  ? 208 LEU A CD1   1 
ATOM   1532 C  CD2   . LEU A  1  233 ? 37.933  21.138  164.007 1.00 31.48  ? 208 LEU A CD2   1 
ATOM   1533 N  N     . GLU A  1  234 ? 43.098  21.027  164.763 1.00 34.51  ? 209 GLU A N     1 
ATOM   1534 C  CA    . GLU A  1  234 ? 44.342  20.732  164.058 1.00 41.05  ? 209 GLU A CA    1 
ATOM   1535 C  C     . GLU A  1  234 ? 44.792  19.282  164.322 1.00 37.52  ? 209 GLU A C     1 
ATOM   1536 O  O     . GLU A  1  234 ? 45.075  18.548  163.391 1.00 35.70  ? 209 GLU A O     1 
ATOM   1537 C  CB    . GLU A  1  234 ? 45.430  21.740  164.459 1.00 44.24  ? 209 GLU A CB    1 
ATOM   1538 C  CG    . GLU A  1  234 ? 46.542  21.846  163.437 1.00 54.09  ? 209 GLU A CG    1 
ATOM   1539 C  CD    . GLU A  1  234 ? 47.483  23.014  163.678 1.00 65.26  ? 209 GLU A CD    1 
ATOM   1540 O  OE1   . GLU A  1  234 ? 47.033  24.059  164.221 1.00 74.42  ? 209 GLU A OE1   1 
ATOM   1541 O  OE2   . GLU A  1  234 ? 48.671  22.889  163.303 1.00 62.08  ? 209 GLU A OE2   1 
ATOM   1542 N  N     . GLU A  1  235 ? 44.789  18.858  165.577 1.00 34.43  ? 210 GLU A N     1 
ATOM   1543 C  CA    . GLU A  1  235 ? 45.116  17.467  165.915 1.00 37.33  ? 210 GLU A CA    1 
ATOM   1544 C  C     . GLU A  1  235 ? 44.084  16.501  165.345 1.00 36.16  ? 210 GLU A C     1 
ATOM   1545 O  O     . GLU A  1  235 ? 44.415  15.466  164.730 1.00 31.20  ? 210 GLU A O     1 
ATOM   1546 C  CB    . GLU A  1  235 ? 45.160  17.294  167.436 1.00 40.96  ? 210 GLU A CB    1 
ATOM   1547 C  CG    . GLU A  1  235 ? 46.306  18.048  168.099 1.00 48.52  ? 210 GLU A CG    1 
ATOM   1548 C  CD    . GLU A  1  235 ? 46.181  18.070  169.617 1.00 50.06  ? 210 GLU A CD    1 
ATOM   1549 O  OE1   . GLU A  1  235 ? 45.488  17.195  170.168 1.00 53.55  ? 210 GLU A OE1   1 
ATOM   1550 O  OE2   . GLU A  1  235 ? 46.772  18.967  170.253 1.00 52.28  ? 210 GLU A OE2   1 
ATOM   1551 N  N     . ARG A  1  236 ? 42.817  16.842  165.569 1.00 36.05  ? 211 ARG A N     1 
ATOM   1552 C  CA    . ARG A  1  236 ? 41.718  16.016  165.121 1.00 32.92  ? 211 ARG A CA    1 
ATOM   1553 C  C     . ARG A  1  236 ? 41.748  15.575  163.696 1.00 31.36  ? 211 ARG A C     1 
ATOM   1554 O  O     . ARG A  1  236 ? 41.262  14.514  163.394 1.00 30.30  ? 211 ARG A O     1 
ATOM   1555 C  CB    . ARG A  1  236 ? 40.359  16.651  165.490 1.00 31.94  ? 211 ARG A CB    1 
ATOM   1556 C  CG    . ARG A  1  236 ? 39.135  15.778  165.245 1.00 30.02  ? 211 ARG A CG    1 
ATOM   1557 C  CD    . ARG A  1  236 ? 37.865  16.506  165.664 1.00 30.34  ? 211 ARG A CD    1 
ATOM   1558 N  NE    . ARG A  1  236 ? 36.713  15.608  165.622 1.00 29.75  ? 211 ARG A NE    1 
ATOM   1559 C  CZ    . ARG A  1  236 ? 36.146  15.022  166.668 1.00 29.59  ? 211 ARG A CZ    1 
ATOM   1560 N  NH1   . ARG A  1  236 ? 36.574  15.225  167.914 1.00 31.56  ? 211 ARG A NH1   1 
ATOM   1561 N  NH2   . ARG A  1  236 ? 35.115  14.216  166.465 1.00 31.68  ? 211 ARG A NH2   1 
ATOM   1562 N  N     . GLN A  1  237 ? 42.282  16.389  162.793 1.00 34.96  ? 212 GLN A N     1 
ATOM   1563 C  CA    . GLN A  1  237 ? 42.310  16.045  161.360 1.00 38.02  ? 212 GLN A CA    1 
ATOM   1564 C  C     . GLN A  1  237 ? 43.029  14.711  161.077 1.00 36.60  ? 212 GLN A C     1 
ATOM   1565 O  O     . GLN A  1  237 ? 42.714  14.094  160.101 1.00 37.35  ? 212 GLN A O     1 
ATOM   1566 C  CB    . GLN A  1  237 ? 42.938  17.150  160.483 1.00 42.35  ? 212 GLN A CB    1 
ATOM   1567 C  CG    . GLN A  1  237 ? 42.315  18.560  160.539 1.00 47.85  ? 212 GLN A CG    1 
ATOM   1568 C  CD    . GLN A  1  237 ? 40.768  18.626  160.435 1.00 53.22  ? 212 GLN A CD    1 
ATOM   1569 O  OE1   . GLN A  1  237 ? 40.211  18.432  159.347 1.00 53.96  ? 212 GLN A OE1   1 
ATOM   1570 N  NE2   . GLN A  1  237 ? 40.070  18.934  161.581 1.00 44.97  ? 212 GLN A NE2   1 
ATOM   1571 N  N     . ASN A  1  238 ? 43.945  14.276  161.940 1.00 37.43  ? 213 ASN A N     1 
ATOM   1572 C  CA    . ASN A  1  238 ? 44.628  12.965  161.829 1.00 42.80  ? 213 ASN A CA    1 
ATOM   1573 C  C     . ASN A  1  238 ? 44.217  11.908  162.845 1.00 44.22  ? 213 ASN A C     1 
ATOM   1574 O  O     . ASN A  1  238 ? 44.936  10.940  163.064 1.00 52.93  ? 213 ASN A O     1 
ATOM   1575 C  CB    . ASN A  1  238 ? 46.132  13.170  161.957 1.00 40.60  ? 213 ASN A CB    1 
ATOM   1576 C  CG    . ASN A  1  238 ? 46.651  14.110  160.925 1.00 40.63  ? 213 ASN A CG    1 
ATOM   1577 O  OD1   . ASN A  1  238 ? 46.420  13.904  159.745 1.00 45.06  ? 213 ASN A OD1   1 
ATOM   1578 N  ND2   . ASN A  1  238 ? 47.320  15.161  161.346 1.00 43.56  ? 213 ASN A ND2   1 
ATOM   1579 N  N     . TRP A  1  239 ? 43.061  12.064  163.460 1.00 40.98  ? 214 TRP A N     1 
ATOM   1580 C  CA    . TRP A  1  239 ? 42.638  11.112  164.462 1.00 38.70  ? 214 TRP A CA    1 
ATOM   1581 C  C     . TRP A  1  239 ? 41.884  9.997   163.760 1.00 39.17  ? 214 TRP A C     1 
ATOM   1582 O  O     . TRP A  1  239 ? 40.984  10.271  162.943 1.00 36.52  ? 214 TRP A O     1 
ATOM   1583 C  CB    . TRP A  1  239 ? 41.730  11.780  165.484 1.00 39.98  ? 214 TRP A CB    1 
ATOM   1584 C  CG    . TRP A  1  239 ? 42.419  12.494  166.560 1.00 40.21  ? 214 TRP A CG    1 
ATOM   1585 C  CD1   . TRP A  1  239 ? 43.735  12.862  166.620 1.00 39.25  ? 214 TRP A CD1   1 
ATOM   1586 C  CD2   . TRP A  1  239 ? 41.813  12.968  167.750 1.00 39.65  ? 214 TRP A CD2   1 
ATOM   1587 N  NE1   . TRP A  1  239 ? 43.985  13.514  167.789 1.00 40.03  ? 214 TRP A NE1   1 
ATOM   1588 C  CE2   . TRP A  1  239 ? 42.816  13.605  168.502 1.00 38.93  ? 214 TRP A CE2   1 
ATOM   1589 C  CE3   . TRP A  1  239 ? 40.507  12.909  168.262 1.00 41.07  ? 214 TRP A CE3   1 
ATOM   1590 C  CZ2   . TRP A  1  239 ? 42.562  14.187  169.752 1.00 39.45  ? 214 TRP A CZ2   1 
ATOM   1591 C  CZ3   . TRP A  1  239 ? 40.251  13.495  169.505 1.00 38.73  ? 214 TRP A CZ3   1 
ATOM   1592 C  CH2   . TRP A  1  239 ? 41.281  14.118  170.236 1.00 41.02  ? 214 TRP A CH2   1 
ATOM   1593 N  N     . PRO A  1  240 ? 42.231  8.735   164.072 1.00 40.50  ? 215 PRO A N     1 
ATOM   1594 C  CA    . PRO A  1  240 ? 41.464  7.629   163.493 1.00 43.25  ? 215 PRO A CA    1 
ATOM   1595 C  C     . PRO A  1  240 ? 40.077  7.546   164.116 1.00 44.18  ? 215 PRO A C     1 
ATOM   1596 O  O     . PRO A  1  240 ? 39.854  8.089   165.214 1.00 46.72  ? 215 PRO A O     1 
ATOM   1597 C  CB    . PRO A  1  240 ? 42.302  6.395   163.857 1.00 45.18  ? 215 PRO A CB    1 
ATOM   1598 C  CG    . PRO A  1  240 ? 43.040  6.784   165.080 1.00 42.42  ? 215 PRO A CG    1 
ATOM   1599 C  CD    . PRO A  1  240 ? 43.342  8.249   164.916 1.00 41.90  ? 215 PRO A CD    1 
ATOM   1600 N  N     . GLU A  1  241 ? 39.154  6.892   163.424 1.00 47.27  ? 216 GLU A N     1 
ATOM   1601 C  CA    . GLU A  1  241 ? 37.765  6.769   163.901 1.00 53.27  ? 216 GLU A CA    1 
ATOM   1602 C  C     . GLU A  1  241 ? 37.637  6.337   165.364 1.00 55.91  ? 216 GLU A C     1 
ATOM   1603 O  O     . GLU A  1  241 ? 36.735  6.821   166.063 1.00 61.93  ? 216 GLU A O     1 
ATOM   1604 C  CB    . GLU A  1  241 ? 36.953  5.816   163.021 1.00 56.16  ? 216 GLU A CB    1 
ATOM   1605 C  CG    . GLU A  1  241 ? 36.653  6.355   161.628 1.00 60.05  ? 216 GLU A CG    1 
ATOM   1606 C  CD    . GLU A  1  241 ? 35.541  5.581   160.927 1.00 65.13  ? 216 GLU A CD    1 
ATOM   1607 O  OE1   . GLU A  1  241 ? 35.213  4.461   161.379 1.00 68.69  ? 216 GLU A OE1   1 
ATOM   1608 O  OE2   . GLU A  1  241 ? 34.982  6.096   159.927 1.00 66.57  ? 216 GLU A OE2   1 
ATOM   1609 N  N     . ASP A  1  242 ? 38.536  5.456   165.826 1.00 50.88  ? 217 ASP A N     1 
ATOM   1610 C  CA    . ASP A  1  242 ? 38.563  5.006   167.226 1.00 51.72  ? 217 ASP A CA    1 
ATOM   1611 C  C     . ASP A  1  242 ? 38.616  6.141   168.271 1.00 50.92  ? 217 ASP A C     1 
ATOM   1612 O  O     . ASP A  1  242 ? 38.051  6.008   169.348 1.00 49.20  ? 217 ASP A O     1 
ATOM   1613 C  CB    . ASP A  1  242 ? 39.755  4.052   167.471 1.00 55.76  ? 217 ASP A CB    1 
ATOM   1614 N  N     . LYS A  1  243 ? 39.313  7.237   167.969 1.00 45.57  ? 218 LYS A N     1 
ATOM   1615 C  CA    . LYS A  1  243 ? 39.360  8.381   168.874 1.00 42.09  ? 218 LYS A CA    1 
ATOM   1616 C  C     . LYS A  1  243 ? 38.157  9.351   168.732 1.00 38.78  ? 218 LYS A C     1 
ATOM   1617 O  O     . LYS A  1  243 ? 38.069  10.323  169.477 1.00 40.44  ? 218 LYS A O     1 
ATOM   1618 C  CB    . LYS A  1  243 ? 40.688  9.117   168.687 1.00 47.04  ? 218 LYS A CB    1 
ATOM   1619 C  CG    . LYS A  1  243 ? 41.903  8.306   169.136 1.00 49.91  ? 218 LYS A CG    1 
ATOM   1620 C  CD    . LYS A  1  243 ? 43.232  8.970   168.789 1.00 53.07  ? 218 LYS A CD    1 
ATOM   1621 C  CE    . LYS A  1  243 ? 43.476  10.263  169.531 1.00 55.52  ? 218 LYS A CE    1 
ATOM   1622 N  NZ    . LYS A  1  243 ? 43.513  10.101  170.999 1.00 58.96  ? 218 LYS A NZ    1 
ATOM   1623 N  N     . ARG A  1  244 ? 37.258  9.079   167.786 1.00 39.44  ? 219 ARG A N     1 
ATOM   1624 C  CA    . ARG A  1  244 ? 36.060  9.885   167.509 1.00 38.28  ? 219 ARG A CA    1 
ATOM   1625 C  C     . ARG A  1  244 ? 34.800  9.032   167.569 1.00 41.54  ? 219 ARG A C     1 
ATOM   1626 O  O     . ARG A  1  244 ? 33.812  9.332   166.900 1.00 35.16  ? 219 ARG A O     1 
ATOM   1627 C  CB    . ARG A  1  244 ? 36.196  10.490  166.097 1.00 36.53  ? 219 ARG A CB    1 
ATOM   1628 C  CG    . ARG A  1  244 ? 37.356  11.465  165.969 1.00 36.97  ? 219 ARG A CG    1 
ATOM   1629 C  CD    . ARG A  1  244 ? 37.428  12.072  164.577 1.00 40.94  ? 219 ARG A CD    1 
ATOM   1630 N  NE    . ARG A  1  244 ? 38.117  11.194  163.636 1.00 40.18  ? 219 ARG A NE    1 
ATOM   1631 C  CZ    . ARG A  1  244 ? 37.518  10.556  162.637 1.00 40.16  ? 219 ARG A CZ    1 
ATOM   1632 N  NH1   . ARG A  1  244 ? 38.222  9.776   161.827 1.00 42.64  ? 219 ARG A NH1   1 
ATOM   1633 N  NH2   . ARG A  1  244 ? 36.214  10.697  162.445 1.00 37.03  ? 219 ARG A NH2   1 
ATOM   1634 N  N     . ARG A  1  245 ? 34.855  7.944   168.348 1.00 47.52  ? 220 ARG A N     1 
ATOM   1635 C  CA    . ARG A  1  245 ? 33.772  6.945   168.400 1.00 52.23  ? 220 ARG A CA    1 
ATOM   1636 C  C     . ARG A  1  245 ? 33.215  6.873   169.813 1.00 51.12  ? 220 ARG A C     1 
ATOM   1637 O  O     . ARG A  1  245 ? 33.959  6.905   170.785 1.00 51.32  ? 220 ARG A O     1 
ATOM   1638 C  CB    . ARG A  1  245 ? 34.245  5.565   167.893 1.00 59.86  ? 220 ARG A CB    1 
ATOM   1639 C  CG    . ARG A  1  245 ? 33.473  4.335   168.428 1.00 64.41  ? 220 ARG A CG    1 
ATOM   1640 C  CD    . ARG A  1  245 ? 33.163  3.266   167.387 1.00 66.08  ? 220 ARG A CD    1 
ATOM   1641 N  NE    . ARG A  1  245 ? 34.183  3.112   166.354 1.00 64.76  ? 220 ARG A NE    1 
ATOM   1642 C  CZ    . ARG A  1  245 ? 33.931  2.876   165.066 1.00 63.08  ? 220 ARG A CZ    1 
ATOM   1643 N  NH1   . ARG A  1  245 ? 32.682  2.761   164.603 1.00 62.79  ? 220 ARG A NH1   1 
ATOM   1644 N  NH2   . ARG A  1  245 ? 34.946  2.773   164.215 1.00 62.14  ? 220 ARG A NH2   1 
ATOM   1645 N  N     . TYR A  1  246 ? 31.890  6.824   169.907 1.00 54.59  ? 221 TYR A N     1 
ATOM   1646 C  CA    . TYR A  1  246 ? 31.180  6.748   171.185 1.00 56.18  ? 221 TYR A CA    1 
ATOM   1647 C  C     . TYR A  1  246 ? 30.041  5.722   171.071 1.00 62.81  ? 221 TYR A C     1 
ATOM   1648 O  O     . TYR A  1  246 ? 29.398  5.594   170.014 1.00 66.61  ? 221 TYR A O     1 
ATOM   1649 C  CB    . TYR A  1  246 ? 30.696  8.153   171.626 1.00 51.68  ? 221 TYR A CB    1 
ATOM   1650 C  CG    . TYR A  1  246 ? 31.872  9.060   171.908 1.00 45.87  ? 221 TYR A CG    1 
ATOM   1651 C  CD1   . TYR A  1  246 ? 32.385  9.177   173.187 1.00 40.39  ? 221 TYR A CD1   1 
ATOM   1652 C  CD2   . TYR A  1  246 ? 32.528  9.731   170.878 1.00 39.74  ? 221 TYR A CD2   1 
ATOM   1653 C  CE1   . TYR A  1  246 ? 33.502  9.944   173.442 1.00 42.04  ? 221 TYR A CE1   1 
ATOM   1654 C  CE2   . TYR A  1  246 ? 33.642  10.507  171.130 1.00 37.85  ? 221 TYR A CE2   1 
ATOM   1655 C  CZ    . TYR A  1  246 ? 34.124  10.608  172.403 1.00 39.22  ? 221 TYR A CZ    1 
ATOM   1656 O  OH    . TYR A  1  246 ? 35.234  11.356  172.664 1.00 42.59  ? 221 TYR A OH    1 
ATOM   1657 N  N     . PHE A  1  247 ? 29.840  4.969   172.153 1.00 73.69  ? 222 PHE A N     1 
ATOM   1658 C  CA    . PHE A  1  247 ? 28.775  3.960   172.267 1.00 77.62  ? 222 PHE A CA    1 
ATOM   1659 C  C     . PHE A  1  247 ? 27.587  4.645   172.943 1.00 78.40  ? 222 PHE A C     1 
ATOM   1660 O  O     . PHE A  1  247 ? 27.797  5.497   173.808 1.00 75.58  ? 222 PHE A O     1 
ATOM   1661 C  CB    . PHE A  1  247 ? 29.284  2.747   173.077 1.00 80.98  ? 222 PHE A CB    1 
ATOM   1662 C  CG    . PHE A  1  247 ? 30.560  2.143   172.526 1.00 84.42  ? 222 PHE A CG    1 
ATOM   1663 C  CD1   . PHE A  1  247 ? 31.808  2.588   172.963 1.00 85.83  ? 222 PHE A CD1   1 
ATOM   1664 C  CD2   . PHE A  1  247 ? 30.518  1.158   171.538 1.00 85.14  ? 222 PHE A CD2   1 
ATOM   1665 C  CE1   . PHE A  1  247 ? 32.983  2.056   172.438 1.00 85.06  ? 222 PHE A CE1   1 
ATOM   1666 C  CE2   . PHE A  1  247 ? 31.692  0.623   171.007 1.00 85.11  ? 222 PHE A CE2   1 
ATOM   1667 C  CZ    . PHE A  1  247 ? 32.926  1.073   171.457 1.00 86.03  ? 222 PHE A CZ    1 
ATOM   1668 N  N     . ILE A  1  248 ? 26.356  4.312   172.541 1.00 82.52  ? 223 ILE A N     1 
ATOM   1669 C  CA    . ILE A  1  248 ? 25.154  4.986   173.085 1.00 85.65  ? 223 ILE A CA    1 
ATOM   1670 C  C     . ILE A  1  248 ? 24.680  4.405   174.441 1.00 89.60  ? 223 ILE A C     1 
ATOM   1671 O  O     . ILE A  1  248 ? 24.711  3.192   174.650 1.00 99.10  ? 223 ILE A O     1 
ATOM   1672 C  CB    . ILE A  1  248 ? 23.999  5.000   172.050 1.00 87.79  ? 223 ILE A CB    1 
ATOM   1673 C  CG1   . ILE A  1  248 ? 24.468  5.743   170.789 1.00 83.94  ? 223 ILE A CG1   1 
ATOM   1674 C  CG2   . ILE A  1  248 ? 22.722  5.622   172.643 1.00 92.26  ? 223 ILE A CG2   1 
ATOM   1675 C  CD1   . ILE A  1  248 ? 23.374  6.211   169.850 1.00 81.83  ? 223 ILE A CD1   1 
ATOM   1676 N  N     . LYS A  1  249 ? 24.223  5.294   175.330 1.00 84.69  ? 224 LYS A N     1 
ATOM   1677 C  CA    . LYS A  1  249 ? 23.745  4.969   176.678 1.00 88.31  ? 224 LYS A CA    1 
ATOM   1678 C  C     . LYS A  1  249 ? 22.378  5.604   176.916 1.00 90.14  ? 224 LYS A C     1 
ATOM   1679 O  O     . LYS A  1  249 ? 21.368  5.168   176.361 1.00 92.62  ? 224 LYS A O     1 
ATOM   1680 C  CB    . LYS A  1  249 ? 24.724  5.493   177.734 1.00 84.02  ? 224 LYS A CB    1 
ATOM   1681 N  N     . ASN A  1  307 ? 26.590  -1.117  168.951 1.00 75.81  ? 282 ASN A N     1 
ATOM   1682 C  CA    . ASN A  1  307 ? 26.027  0.156   168.519 1.00 80.75  ? 282 ASN A CA    1 
ATOM   1683 C  C     . ASN A  1  307 ? 26.859  1.374   168.956 1.00 80.16  ? 282 ASN A C     1 
ATOM   1684 O  O     . ASN A  1  307 ? 26.751  1.837   170.081 1.00 80.61  ? 282 ASN A O     1 
ATOM   1685 C  CB    . ASN A  1  307 ? 24.575  0.297   168.981 1.00 76.14  ? 282 ASN A CB    1 
ATOM   1686 N  N     . SER A  1  308 ? 27.694  1.886   168.062 1.00 73.07  ? 283 SER A N     1 
ATOM   1687 C  CA    . SER A  1  308 ? 28.505  3.051   168.395 1.00 68.80  ? 283 SER A CA    1 
ATOM   1688 C  C     . SER A  1  308 ? 28.377  4.112   167.317 1.00 60.14  ? 283 SER A C     1 
ATOM   1689 O  O     . SER A  1  308 ? 27.946  3.820   166.226 1.00 60.08  ? 283 SER A O     1 
ATOM   1690 C  CB    . SER A  1  308 ? 29.964  2.666   168.635 1.00 69.08  ? 283 SER A CB    1 
ATOM   1691 O  OG    . SER A  1  308 ? 30.660  2.585   167.422 1.00 62.60  ? 283 SER A OG    1 
ATOM   1692 N  N     . VAL A  1  309 ? 28.743  5.343   167.627 1.00 53.19  ? 284 VAL A N     1 
ATOM   1693 C  CA    . VAL A  1  309 ? 28.665  6.396   166.631 1.00 48.19  ? 284 VAL A CA    1 
ATOM   1694 C  C     . VAL A  1  309 ? 29.989  7.087   166.433 1.00 40.84  ? 284 VAL A C     1 
ATOM   1695 O  O     . VAL A  1  309 ? 30.763  7.208   167.333 1.00 43.57  ? 284 VAL A O     1 
ATOM   1696 C  CB    . VAL A  1  309 ? 27.635  7.451   166.978 1.00 51.69  ? 284 VAL A CB    1 
ATOM   1697 C  CG1   . VAL A  1  309 ? 26.242  6.932   166.793 1.00 56.17  ? 284 VAL A CG1   1 
ATOM   1698 C  CG2   . VAL A  1  309 ? 27.846  7.929   168.374 1.00 54.46  ? 284 VAL A CG2   1 
ATOM   1699 N  N     . VAL A  1  310 ? 30.228  7.537   165.228 1.00 38.43  ? 285 VAL A N     1 
ATOM   1700 C  CA    . VAL A  1  310 ? 31.476  8.240   164.888 1.00 35.15  ? 285 VAL A CA    1 
ATOM   1701 C  C     . VAL A  1  310 ? 31.188  9.682   164.489 1.00 32.65  ? 285 VAL A C     1 
ATOM   1702 O  O     . VAL A  1  310 ? 30.234  9.934   163.711 1.00 29.87  ? 285 VAL A O     1 
ATOM   1703 C  CB    . VAL A  1  310 ? 32.168  7.567   163.691 1.00 36.78  ? 285 VAL A CB    1 
ATOM   1704 C  CG1   . VAL A  1  310 ? 33.408  8.334   163.266 1.00 33.07  ? 285 VAL A CG1   1 
ATOM   1705 C  CG2   . VAL A  1  310 ? 32.539  6.149   164.066 1.00 39.94  ? 285 VAL A CG2   1 
ATOM   1706 N  N     . PHE A  1  311 ? 32.009  10.605  165.005 1.00 27.18  ? 286 PHE A N     1 
ATOM   1707 C  CA    . PHE A  1  311 ? 31.900  12.021  164.676 1.00 27.43  ? 286 PHE A CA    1 
ATOM   1708 C  C     . PHE A  1  311 ? 33.071  12.394  163.777 1.00 27.67  ? 286 PHE A C     1 
ATOM   1709 O  O     . PHE A  1  311 ? 34.191  11.933  163.976 1.00 29.44  ? 286 PHE A O     1 
ATOM   1710 C  CB    . PHE A  1  311 ? 31.851  12.879  165.955 1.00 27.04  ? 286 PHE A CB    1 
ATOM   1711 C  CG    . PHE A  1  311 ? 30.585  12.677  166.736 1.00 25.81  ? 286 PHE A CG    1 
ATOM   1712 C  CD1   . PHE A  1  311 ? 30.519  11.722  167.735 1.00 27.97  ? 286 PHE A CD1   1 
ATOM   1713 C  CD2   . PHE A  1  311 ? 29.447  13.370  166.410 1.00 24.87  ? 286 PHE A CD2   1 
ATOM   1714 C  CE1   . PHE A  1  311 ? 29.336  11.478  168.414 1.00 27.43  ? 286 PHE A CE1   1 
ATOM   1715 C  CE2   . PHE A  1  311 ? 28.261  13.138  167.081 1.00 25.93  ? 286 PHE A CE2   1 
ATOM   1716 C  CZ    . PHE A  1  311 ? 28.208  12.203  168.092 1.00 27.15  ? 286 PHE A CZ    1 
ATOM   1717 N  N     . GLY A  1  312 ? 32.797  13.227  162.790 1.00 26.88  ? 287 GLY A N     1 
ATOM   1718 C  CA    . GLY A  1  312 ? 33.798  13.682  161.828 1.00 27.53  ? 287 GLY A CA    1 
ATOM   1719 C  C     . GLY A  1  312 ? 34.796  14.663  162.416 1.00 28.27  ? 287 GLY A C     1 
ATOM   1720 O  O     . GLY A  1  312 ? 34.904  14.835  163.632 1.00 29.45  ? 287 GLY A O     1 
ATOM   1721 N  N     . THR A  1  313 ? 35.466  15.376  161.530 1.00 28.48  ? 288 THR A N     1 
ATOM   1722 C  CA    . THR A  1  313 ? 36.664  16.131  161.876 1.00 31.24  ? 288 THR A CA    1 
ATOM   1723 C  C     . THR A  1  313 ? 36.447  17.674  161.857 1.00 28.38  ? 288 THR A C     1 
ATOM   1724 O  O     . THR A  1  313 ? 37.271  18.427  162.362 1.00 29.53  ? 288 THR A O     1 
ATOM   1725 C  CB    . THR A  1  313 ? 37.789  15.630  160.929 1.00 36.35  ? 288 THR A CB    1 
ATOM   1726 O  OG1   . THR A  1  313 ? 39.071  15.999  161.436 1.00 54.73  ? 288 THR A OG1   1 
ATOM   1727 C  CG2   . THR A  1  313 ? 37.618  16.128  159.575 1.00 31.78  ? 288 THR A CG2   1 
ATOM   1728 N  N     . SER A  1  314 ? 35.335  18.129  161.301 1.00 26.10  ? 289 SER A N     1 
ATOM   1729 C  CA    . SER A  1  314 ? 35.005  19.566  161.221 1.00 26.49  ? 289 SER A CA    1 
ATOM   1730 C  C     . SER A  1  314 ? 34.627  20.148  162.579 1.00 26.00  ? 289 SER A C     1 
ATOM   1731 O  O     . SER A  1  314 ? 34.282  19.429  163.506 1.00 25.39  ? 289 SER A O     1 
ATOM   1732 C  CB    . SER A  1  314 ? 33.803  19.803  160.295 1.00 27.06  ? 289 SER A CB    1 
ATOM   1733 O  OG    . SER A  1  314 ? 32.595  19.295  160.866 1.00 28.29  ? 289 SER A OG    1 
ATOM   1734 N  N     . ALA A  1  315 ? 34.639  21.460  162.656 1.00 24.75  ? 290 ALA A N     1 
ATOM   1735 C  CA    . ALA A  1  315 ? 34.177  22.147  163.842 1.00 24.56  ? 290 ALA A CA    1 
ATOM   1736 C  C     . ALA A  1  315 ? 32.725  21.769  164.188 1.00 25.42  ? 290 ALA A C     1 
ATOM   1737 O  O     . ALA A  1  315 ? 32.441  21.499  165.354 1.00 23.90  ? 290 ALA A O     1 
ATOM   1738 C  CB    . ALA A  1  315 ? 34.323  23.646  163.678 1.00 23.91  ? 290 ALA A CB    1 
ATOM   1739 N  N     . GLN A  1  316 ? 31.826  21.735  163.196 1.00 24.11  ? 291 GLN A N     1 
ATOM   1740 C  CA    . GLN A  1  316 ? 30.437  21.396  163.496 1.00 26.26  ? 291 GLN A CA    1 
ATOM   1741 C  C     . GLN A  1  316 ? 30.374  19.989  164.083 1.00 24.78  ? 291 GLN A C     1 
ATOM   1742 O  O     . GLN A  1  316 ? 29.574  19.743  164.984 1.00 22.46  ? 291 GLN A O     1 
ATOM   1743 C  CB    . GLN A  1  316 ? 29.435  21.640  162.311 1.00 28.34  ? 291 GLN A CB    1 
ATOM   1744 C  CG    . GLN A  1  316 ? 29.052  23.170  162.176 1.00 33.21  ? 291 GLN A CG    1 
ATOM   1745 C  CD    . GLN A  1  316 ? 27.563  23.649  161.921 1.00 38.18  ? 291 GLN A CD    1 
ATOM   1746 O  OE1   . GLN A  1  316 ? 26.658  23.790  162.813 1.00 26.66  ? 291 GLN A OE1   1 
ATOM   1747 N  NE2   . GLN A  1  316 ? 27.375  24.075  160.693 1.00 45.17  ? 291 GLN A NE2   1 
ATOM   1748 N  N     . GLU A  1  317 ? 31.209  19.071  163.579 1.00 24.20  ? 292 GLU A N     1 
ATOM   1749 C  CA    . GLU A  1  317 ? 31.228  17.690  164.083 1.00 26.85  ? 292 GLU A CA    1 
ATOM   1750 C  C     . GLU A  1  317 ? 31.799  17.597  165.480 1.00 24.77  ? 292 GLU A C     1 
ATOM   1751 O  O     . GLU A  1  317 ? 31.288  16.831  166.328 1.00 23.57  ? 292 GLU A O     1 
ATOM   1752 C  CB    . GLU A  1  317 ? 31.950  16.694  163.118 1.00 28.71  ? 292 GLU A CB    1 
ATOM   1753 C  CG    . GLU A  1  317 ? 31.097  16.291  161.925 1.00 29.02  ? 292 GLU A CG    1 
ATOM   1754 C  CD    . GLU A  1  317 ? 29.985  15.336  162.286 1.00 30.95  ? 292 GLU A CD    1 
ATOM   1755 O  OE1   . GLU A  1  317 ? 30.296  14.196  162.661 1.00 32.26  ? 292 GLU A OE1   1 
ATOM   1756 O  OE2   . GLU A  1  317 ? 28.790  15.693  162.173 1.00 31.50  ? 292 GLU A OE2   1 
ATOM   1757 N  N     . VAL A  1  318 ? 32.849  18.359  165.741 1.00 25.24  ? 293 VAL A N     1 
ATOM   1758 C  CA    . VAL A  1  318 ? 33.369  18.438  167.113 1.00 25.60  ? 293 VAL A CA    1 
ATOM   1759 C  C     . VAL A  1  318 ? 32.288  18.853  168.093 1.00 24.27  ? 293 VAL A C     1 
ATOM   1760 O  O     . VAL A  1  318 ? 32.157  18.242  169.136 1.00 24.11  ? 293 VAL A O     1 
ATOM   1761 C  CB    . VAL A  1  318 ? 34.547  19.398  167.227 1.00 26.71  ? 293 VAL A CB    1 
ATOM   1762 C  CG1   . VAL A  1  318 ? 34.893  19.703  168.680 1.00 27.00  ? 293 VAL A CG1   1 
ATOM   1763 C  CG2   . VAL A  1  318 ? 35.748  18.781  166.533 1.00 26.90  ? 293 VAL A CG2   1 
ATOM   1764 N  N     . VAL A  1  319 ? 31.507  19.872  167.751 1.00 25.33  ? 294 VAL A N     1 
ATOM   1765 C  CA    . VAL A  1  319 ? 30.489  20.388  168.664 1.00 24.07  ? 294 VAL A CA    1 
ATOM   1766 C  C     . VAL A  1  319 ? 29.296  19.422  168.781 1.00 23.98  ? 294 VAL A C     1 
ATOM   1767 O  O     . VAL A  1  319 ? 28.699  19.287  169.850 1.00 24.71  ? 294 VAL A O     1 
ATOM   1768 C  CB    . VAL A  1  319 ? 30.090  21.816  168.250 1.00 24.91  ? 294 VAL A CB    1 
ATOM   1769 C  CG1   . VAL A  1  319 ? 28.908  22.338  169.036 1.00 26.00  ? 294 VAL A CG1   1 
ATOM   1770 C  CG2   . VAL A  1  319 ? 31.287  22.745  168.435 1.00 25.48  ? 294 VAL A CG2   1 
ATOM   1771 N  N     . LYS A  1  320 ? 28.984  18.707  167.707 1.00 25.51  ? 295 LYS A N     1 
ATOM   1772 C  CA    . LYS A  1  320 ? 28.007  17.623  167.785 1.00 26.26  ? 295 LYS A CA    1 
ATOM   1773 C  C     . LYS A  1  320 ? 28.486  16.530  168.723 1.00 25.57  ? 295 LYS A C     1 
ATOM   1774 O  O     . LYS A  1  320 ? 27.711  16.031  169.526 1.00 23.58  ? 295 LYS A O     1 
ATOM   1775 C  CB    . LYS A  1  320 ? 27.682  17.073  166.410 1.00 28.35  ? 295 LYS A CB    1 
ATOM   1776 C  CG    . LYS A  1  320 ? 26.823  18.057  165.686 1.00 30.41  ? 295 LYS A CG    1 
ATOM   1777 C  CD    . LYS A  1  320 ? 26.340  17.561  164.386 1.00 36.69  ? 295 LYS A CD    1 
ATOM   1778 C  CE    . LYS A  1  320 ? 25.458  18.639  163.786 1.00 42.06  ? 295 LYS A CE    1 
ATOM   1779 N  NZ    . LYS A  1  320 ? 24.960  18.129  162.500 1.00 48.07  ? 295 LYS A NZ    1 
ATOM   1780 N  N     . GLU A  1  321 ? 29.768  16.221  168.665 1.00 22.04  ? 296 GLU A N     1 
ATOM   1781 C  CA    . GLU A  1  321 ? 30.362  15.278  169.600 1.00 23.34  ? 296 GLU A CA    1 
ATOM   1782 C  C     . GLU A  1  321 ? 30.268  15.789  171.039 1.00 22.61  ? 296 GLU A C     1 
ATOM   1783 O  O     . GLU A  1  321 ? 29.866  15.031  171.936 1.00 22.28  ? 296 GLU A O     1 
ATOM   1784 C  CB    . GLU A  1  321 ? 31.818  14.987  169.227 1.00 22.73  ? 296 GLU A CB    1 
ATOM   1785 C  CG    . GLU A  1  321 ? 32.514  13.960  170.097 1.00 24.18  ? 296 GLU A CG    1 
ATOM   1786 C  CD    . GLU A  1  321 ? 33.916  13.690  169.581 1.00 25.74  ? 296 GLU A CD    1 
ATOM   1787 O  OE1   . GLU A  1  321 ? 34.046  12.852  168.663 1.00 27.81  ? 296 GLU A OE1   1 
ATOM   1788 O  OE2   . GLU A  1  321 ? 34.881  14.345  170.058 1.00 28.12  ? 296 GLU A OE2   1 
ATOM   1789 N  N     . ILE A  1  322 ? 30.639  17.060  171.266 1.00 23.10  ? 297 ILE A N     1 
ATOM   1790 C  CA    . ILE A  1  322 ? 30.504  17.635  172.605 1.00 23.25  ? 297 ILE A CA    1 
ATOM   1791 C  C     . ILE A  1  322 ? 29.078  17.513  173.143 1.00 22.41  ? 297 ILE A C     1 
ATOM   1792 O  O     . ILE A  1  322 ? 28.898  17.066  174.281 1.00 21.96  ? 297 ILE A O     1 
ATOM   1793 C  CB    . ILE A  1  322 ? 30.994  19.065  172.702 1.00 22.24  ? 297 ILE A CB    1 
ATOM   1794 C  CG1   . ILE A  1  322 ? 32.519  19.085  172.501 1.00 22.43  ? 297 ILE A CG1   1 
ATOM   1795 C  CG2   . ILE A  1  322 ? 30.638  19.657  174.049 1.00 22.79  ? 297 ILE A CG2   1 
ATOM   1796 C  CD1   . ILE A  1  322 ? 33.045  20.435  172.125 1.00 23.70  ? 297 ILE A CD1   1 
ATOM   1797 N  N     . ARG A  1  323 ? 28.105  17.922  172.349 1.00 22.54  ? 298 ARG A N     1 
ATOM   1798 C  CA    . ARG A  1  323 ? 26.708  17.861  172.763 1.00 26.21  ? 298 ARG A CA    1 
ATOM   1799 C  C     . ARG A  1  323 ? 26.158  16.505  173.023 1.00 25.69  ? 298 ARG A C     1 
ATOM   1800 O  O     . ARG A  1  323 ? 25.395  16.312  173.945 1.00 24.41  ? 298 ARG A O     1 
ATOM   1801 C  CB    . ARG A  1  323 ? 25.846  18.739  171.824 1.00 27.16  ? 298 ARG A CB    1 
ATOM   1802 C  CG    . ARG A  1  323 ? 26.210  20.240  171.855 1.00 27.28  ? 298 ARG A CG    1 
ATOM   1803 C  CD    . ARG A  1  323 ? 25.540  20.982  170.712 1.00 28.40  ? 298 ARG A CD    1 
ATOM   1804 N  NE    . ARG A  1  323 ? 24.110  20.708  170.723 1.00 27.21  ? 298 ARG A NE    1 
ATOM   1805 C  CZ    . ARG A  1  323 ? 23.404  20.309  169.671 1.00 27.43  ? 298 ARG A CZ    1 
ATOM   1806 N  NH1   . ARG A  1  323 ? 22.106  20.075  169.805 1.00 29.75  ? 298 ARG A NH1   1 
ATOM   1807 N  NH2   . ARG A  1  323 ? 23.985  20.149  168.489 1.00 26.10  ? 298 ARG A NH2   1 
ATOM   1808 N  N     . PHE A  1  324 ? 26.583  15.545  172.191 1.00 26.45  ? 299 PHE A N     1 
ATOM   1809 C  CA    . PHE A  1  324 ? 26.239  14.139  172.318 1.00 26.63  ? 299 PHE A CA    1 
ATOM   1810 C  C     . PHE A  1  324 ? 26.769  13.594  173.644 1.00 26.42  ? 299 PHE A C     1 
ATOM   1811 O  O     . PHE A  1  324 ? 26.007  12.989  174.392 1.00 24.54  ? 299 PHE A O     1 
ATOM   1812 C  CB    . PHE A  1  324 ? 26.797  13.336  171.135 1.00 28.84  ? 299 PHE A CB    1 
ATOM   1813 C  CG    . PHE A  1  324 ? 26.706  11.825  171.311 1.00 31.14  ? 299 PHE A CG    1 
ATOM   1814 C  CD1   . PHE A  1  324 ? 25.553  11.136  170.940 1.00 32.04  ? 299 PHE A CD1   1 
ATOM   1815 C  CD2   . PHE A  1  324 ? 27.766  11.115  171.862 1.00 30.30  ? 299 PHE A CD2   1 
ATOM   1816 C  CE1   . PHE A  1  324 ? 25.457  9.761   171.118 1.00 33.78  ? 299 PHE A CE1   1 
ATOM   1817 C  CE2   . PHE A  1  324 ? 27.680  9.742   172.046 1.00 33.58  ? 299 PHE A CE2   1 
ATOM   1818 C  CZ    . PHE A  1  324 ? 26.528  9.064   171.671 1.00 33.63  ? 299 PHE A CZ    1 
ATOM   1819 N  N     . ARG A  1  325 ? 28.043  13.852  173.942 1.00 22.84  ? 300 ARG A N     1 
ATOM   1820 C  CA    . ARG A  1  325 ? 28.657  13.403  175.200 1.00 23.92  ? 300 ARG A CA    1 
ATOM   1821 C  C     . ARG A  1  325 ? 27.982  14.004  176.419 1.00 24.05  ? 300 ARG A C     1 
ATOM   1822 O  O     . ARG A  1  325 ? 27.743  13.306  177.385 1.00 25.86  ? 300 ARG A O     1 
ATOM   1823 C  CB    . ARG A  1  325 ? 30.151  13.721  175.226 1.00 24.77  ? 300 ARG A CB    1 
ATOM   1824 C  CG    . ARG A  1  325 ? 30.925  12.839  174.255 1.00 27.95  ? 300 ARG A CG    1 
ATOM   1825 C  CD    . ARG A  1  325 ? 32.391  13.215  174.211 1.00 27.98  ? 300 ARG A CD    1 
ATOM   1826 N  NE    . ARG A  1  325 ? 33.036  12.838  175.456 1.00 28.49  ? 300 ARG A NE    1 
ATOM   1827 C  CZ    . ARG A  1  325 ? 34.256  13.203  175.835 1.00 31.91  ? 300 ARG A CZ    1 
ATOM   1828 N  NH1   . ARG A  1  325 ? 35.021  13.938  175.055 1.00 32.10  ? 300 ARG A NH1   1 
ATOM   1829 N  NH2   . ARG A  1  325 ? 34.725  12.789  177.011 1.00 33.03  ? 300 ARG A NH2   1 
ATOM   1830 N  N     . ILE A  1  326 ? 27.645  15.285  176.361 1.00 22.46  ? 301 ILE A N     1 
ATOM   1831 C  CA    . ILE A  1  326 ? 26.891  15.934  177.425 1.00 24.31  ? 301 ILE A CA    1 
ATOM   1832 C  C     . ILE A  1  326 ? 25.546  15.245  177.644 1.00 23.52  ? 301 ILE A C     1 
ATOM   1833 O  O     . ILE A  1  326 ? 25.205  14.903  178.785 1.00 25.26  ? 301 ILE A O     1 
ATOM   1834 C  CB    . ILE A  1  326 ? 26.691  17.439  177.130 1.00 25.56  ? 301 ILE A CB    1 
ATOM   1835 C  CG1   . ILE A  1  326 ? 28.032  18.159  177.335 1.00 27.95  ? 301 ILE A CG1   1 
ATOM   1836 C  CG2   . ILE A  1  326 ? 25.587  18.079  178.020 1.00 25.64  ? 301 ILE A CG2   1 
ATOM   1837 C  CD1   . ILE A  1  326 ? 28.073  19.563  176.792 1.00 29.59  ? 301 ILE A CD1   1 
ATOM   1838 N  N     . GLU A  1  327 ? 24.805  15.031  176.569 1.00 23.52  ? 302 GLU A N     1 
ATOM   1839 C  CA    . GLU A  1  327 ? 23.492  14.417  176.668 1.00 26.64  ? 302 GLU A CA    1 
ATOM   1840 C  C     . GLU A  1  327 ? 23.583  12.979  177.197 1.00 29.39  ? 302 GLU A C     1 
ATOM   1841 O  O     . GLU A  1  327 ? 22.790  12.590  178.062 1.00 27.79  ? 302 GLU A O     1 
ATOM   1842 C  CB    . GLU A  1  327 ? 22.728  14.456  175.340 1.00 28.45  ? 302 GLU A CB    1 
ATOM   1843 C  CG    . GLU A  1  327 ? 21.281  13.952  175.490 1.00 33.81  ? 302 GLU A CG    1 
ATOM   1844 C  CD    . GLU A  1  327 ? 20.353  14.298  174.328 1.00 38.60  ? 302 GLU A CD    1 
ATOM   1845 O  OE1   . GLU A  1  327 ? 20.846  14.730  173.272 1.00 39.94  ? 302 GLU A OE1   1 
ATOM   1846 O  OE2   . GLU A  1  327 ? 19.103  14.148  174.477 1.00 44.89  ? 302 GLU A OE2   1 
ATOM   1847 N  N     . GLN A  1  328 ? 24.559  12.212  176.709 1.00 28.15  ? 303 GLN A N     1 
ATOM   1848 C  CA    . GLN A  1  328 ? 24.768  10.855  177.200 1.00 32.63  ? 303 GLN A CA    1 
ATOM   1849 C  C     . GLN A  1  328 ? 25.180  10.809  178.656 1.00 30.22  ? 303 GLN A C     1 
ATOM   1850 O  O     . GLN A  1  328 ? 24.716  9.950   179.353 1.00 30.14  ? 303 GLN A O     1 
ATOM   1851 C  CB    . GLN A  1  328 ? 25.807  10.066  176.368 1.00 34.93  ? 303 GLN A CB    1 
ATOM   1852 C  CG    . GLN A  1  328 ? 25.389  9.841   174.930 1.00 40.65  ? 303 GLN A CG    1 
ATOM   1853 C  CD    . GLN A  1  328 ? 24.202  8.897   174.798 1.00 47.94  ? 303 GLN A CD    1 
ATOM   1854 O  OE1   . GLN A  1  328 ? 24.382  7.686   174.798 1.00 61.85  ? 303 GLN A OE1   1 
ATOM   1855 N  NE2   . GLN A  1  328 ? 22.990  9.444   174.668 1.00 47.12  ? 303 GLN A NE2   1 
ATOM   1856 N  N     . LYS A  1  329 ? 26.076  11.688  179.087 1.00 30.32  ? 304 LYS A N     1 
ATOM   1857 C  CA    . LYS A  1  329 ? 26.518  11.692  180.466 1.00 30.87  ? 304 LYS A CA    1 
ATOM   1858 C  C     . LYS A  1  329 ? 25.481  12.248  181.456 1.00 30.83  ? 304 LYS A C     1 
ATOM   1859 O  O     . LYS A  1  329 ? 25.336  11.707  182.535 1.00 26.08  ? 304 LYS A O     1 
ATOM   1860 C  CB    . LYS A  1  329 ? 27.808  12.471  180.628 1.00 33.78  ? 304 LYS A CB    1 
ATOM   1861 C  CG    . LYS A  1  329 ? 28.330  12.403  182.071 1.00 39.84  ? 304 LYS A CG    1 
ATOM   1862 C  CD    . LYS A  1  329 ? 29.835  12.219  182.205 1.00 45.32  ? 304 LYS A CD    1 
ATOM   1863 C  CE    . LYS A  1  329 ? 30.627  13.507  181.985 1.00 45.85  ? 304 LYS A CE    1 
ATOM   1864 N  NZ    . LYS A  1  329 ? 31.767  13.688  182.951 1.00 43.14  ? 304 LYS A NZ    1 
ATOM   1865 N  N     . THR A  1  330 ? 24.857  13.347  181.112 1.00 28.02  ? 305 THR A N     1 
ATOM   1866 C  CA    . THR A  1  330 ? 23.966  14.020  182.004 1.00 26.45  ? 305 THR A CA    1 
ATOM   1867 C  C     . THR A  1  330 ? 22.493  13.919  181.765 1.00 26.85  ? 305 THR A C     1 
ATOM   1868 O  O     . THR A  1  330 ? 21.750  14.319  182.595 1.00 25.84  ? 305 THR A O     1 
ATOM   1869 C  CB    . THR A  1  330 ? 24.265  15.536  182.052 1.00 27.05  ? 305 THR A CB    1 
ATOM   1870 O  OG1   . THR A  1  330 ? 23.776  16.176  180.890 1.00 25.73  ? 305 THR A OG1   1 
ATOM   1871 C  CG2   . THR A  1  330 ? 25.726  15.843  182.230 1.00 28.08  ? 305 THR A CG2   1 
ATOM   1872 N  N     . THR A  1  331 ? 22.092  13.422  180.617 1.00 26.71  ? 306 THR A N     1 
ATOM   1873 C  CA    . THR A  1  331 ? 20.710  13.341  180.215 1.00 29.70  ? 306 THR A CA    1 
ATOM   1874 C  C     . THR A  1  331 ? 20.142  14.748  179.920 1.00 31.45  ? 306 THR A C     1 
ATOM   1875 O  O     . THR A  1  331 ? 18.962  14.906  179.839 1.00 35.80  ? 306 THR A O     1 
ATOM   1876 C  CB    . THR A  1  331 ? 19.809  12.616  181.236 1.00 33.72  ? 306 THR A CB    1 
ATOM   1877 O  OG1   . THR A  1  331 ? 20.522  11.562  181.853 1.00 34.53  ? 306 THR A OG1   1 
ATOM   1878 C  CG2   . THR A  1  331 ? 18.625  12.048  180.567 1.00 34.40  ? 306 THR A CG2   1 
ATOM   1879 N  N     . LEU A  1  332 ? 20.999  15.747  179.772 1.00 28.25  ? 307 LEU A N     1 
ATOM   1880 C  CA    . LEU A  1  332 ? 20.584  17.118  179.499 1.00 28.48  ? 307 LEU A CA    1 
ATOM   1881 C  C     . LEU A  1  332 ? 21.167  17.656  178.191 1.00 27.64  ? 307 LEU A C     1 
ATOM   1882 O  O     . LEU A  1  332 ? 22.213  17.241  177.815 1.00 24.23  ? 307 LEU A O     1 
ATOM   1883 C  CB    . LEU A  1  332 ? 21.001  18.025  180.641 1.00 29.65  ? 307 LEU A CB    1 
ATOM   1884 C  CG    . LEU A  1  332 ? 20.695  17.665  182.086 1.00 30.51  ? 307 LEU A CG    1 
ATOM   1885 C  CD1   . LEU A  1  332 ? 21.333  18.715  182.958 1.00 32.32  ? 307 LEU A CD1   1 
ATOM   1886 C  CD2   . LEU A  1  332 ? 19.211  17.676  182.305 1.00 32.59  ? 307 LEU A CD2   1 
ATOM   1887 N  N     . THR A  1  333 ? 20.482  18.594  177.539 1.00 25.03  ? 308 THR A N     1 
ATOM   1888 C  CA    . THR A  1  333 ? 20.971  19.124  176.276 1.00 22.89  ? 308 THR A CA    1 
ATOM   1889 C  C     . THR A  1  333 ? 21.638  20.466  176.465 1.00 22.99  ? 308 THR A C     1 
ATOM   1890 O  O     . THR A  1  333 ? 21.309  21.237  177.392 1.00 20.75  ? 308 THR A O     1 
ATOM   1891 C  CB    . THR A  1  333 ? 19.856  19.273  175.232 1.00 24.72  ? 308 THR A CB    1 
ATOM   1892 O  OG1   . THR A  1  333 ? 18.895  20.227  175.685 1.00 27.18  ? 308 THR A OG1   1 
ATOM   1893 C  CG2   . THR A  1  333 ? 19.160  17.902  174.977 1.00 26.13  ? 308 THR A CG2   1 
ATOM   1894 N  N     . ALA A  1  334 ? 22.543  20.758  175.543 1.00 24.00  ? 309 ALA A N     1 
ATOM   1895 C  CA    . ALA A  1  334 ? 23.165  22.072  175.425 1.00 24.95  ? 309 ALA A CA    1 
ATOM   1896 C  C     . ALA A  1  334 ? 23.014  22.569  174.034 1.00 23.50  ? 309 ALA A C     1 
ATOM   1897 O  O     . ALA A  1  334 ? 22.907  21.788  173.096 1.00 23.63  ? 309 ALA A O     1 
ATOM   1898 C  CB    . ALA A  1  334 ? 24.653  21.968  175.745 1.00 25.26  ? 309 ALA A CB    1 
ATOM   1899 N  N     . SER A  1  335 ? 23.054  23.887  173.900 1.00 22.32  ? 310 SER A N     1 
ATOM   1900 C  CA    . SER A  1  335 ? 23.210  24.531  172.624 1.00 22.67  ? 310 SER A CA    1 
ATOM   1901 C  C     . SER A  1  335 ? 24.610  25.121  172.487 1.00 22.39  ? 310 SER A C     1 
ATOM   1902 O  O     . SER A  1  335 ? 25.289  25.312  173.478 1.00 22.73  ? 310 SER A O     1 
ATOM   1903 C  CB    . SER A  1  335 ? 22.120  25.592  172.469 1.00 22.57  ? 310 SER A CB    1 
ATOM   1904 O  OG    . SER A  1  335 ? 20.864  24.930  172.449 1.00 23.24  ? 310 SER A OG    1 
ATOM   1905 N  N     . ALA A  1  336 ? 25.015  25.436  171.269 1.00 20.65  ? 311 ALA A N     1 
ATOM   1906 C  CA    . ALA A  1  336 ? 26.384  25.903  171.022 1.00 22.35  ? 311 ALA A CA    1 
ATOM   1907 C  C     . ALA A  1  336 ? 26.466  26.842  169.843 1.00 22.15  ? 311 ALA A C     1 
ATOM   1908 O  O     . ALA A  1  336 ? 25.675  26.721  168.890 1.00 21.79  ? 311 ALA A O     1 
ATOM   1909 C  CB    . ALA A  1  336 ? 27.317  24.711  170.812 1.00 22.81  ? 311 ALA A CB    1 
ATOM   1910 N  N     . GLY A  1  337 ? 27.387  27.807  169.932 1.00 20.73  ? 312 GLY A N     1 
ATOM   1911 C  CA    . GLY A  1  337 ? 27.694  28.713  168.843 1.00 19.30  ? 312 GLY A CA    1 
ATOM   1912 C  C     . GLY A  1  337 ? 29.156  28.479  168.477 1.00 21.01  ? 312 GLY A C     1 
ATOM   1913 O  O     . GLY A  1  337 ? 30.001  28.193  169.363 1.00 21.20  ? 312 GLY A O     1 
ATOM   1914 N  N     . ILE A  1  338 ? 29.454  28.589  167.189 1.00 19.87  ? 313 ILE A N     1 
ATOM   1915 C  CA    . ILE A  1  338 ? 30.817  28.360  166.669 1.00 20.92  ? 313 ILE A CA    1 
ATOM   1916 C  C     . ILE A  1  338 ? 31.106  29.570  165.787 1.00 21.91  ? 313 ILE A C     1 
ATOM   1917 O  O     . ILE A  1  338 ? 30.357  29.817  164.803 1.00 21.68  ? 313 ILE A O     1 
ATOM   1918 C  CB    . ILE A  1  338 ? 30.904  27.116  165.788 1.00 22.19  ? 313 ILE A CB    1 
ATOM   1919 C  CG1   . ILE A  1  338 ? 30.296  25.916  166.490 1.00 22.54  ? 313 ILE A CG1   1 
ATOM   1920 C  CG2   . ILE A  1  338 ? 32.351  26.860  165.333 1.00 22.02  ? 313 ILE A CG2   1 
ATOM   1921 C  CD1   . ILE A  1  338 ? 30.093  24.716  165.591 1.00 22.70  ? 313 ILE A CD1   1 
ATOM   1922 N  N     . ALA A  1  339 ? 32.129  30.336  166.162 1.00 20.51  ? 314 ALA A N     1 
ATOM   1923 C  CA    . ALA A  1  339 ? 32.451  31.601  165.486 1.00 23.40  ? 314 ALA A CA    1 
ATOM   1924 C  C     . ALA A  1  339 ? 33.937  31.954  165.618 1.00 22.96  ? 314 ALA A C     1 
ATOM   1925 O  O     . ALA A  1  339 ? 34.648  31.316  166.395 1.00 22.07  ? 314 ALA A O     1 
ATOM   1926 C  CB    . ALA A  1  339 ? 31.575  32.730  165.976 1.00 22.87  ? 314 ALA A CB    1 
ATOM   1927 N  N     . PRO A  1  340 ? 34.422  32.900  164.809 1.00 23.29  ? 315 PRO A N     1 
ATOM   1928 C  CA    . PRO A  1  340 ? 35.856  33.275  164.950 1.00 24.08  ? 315 PRO A CA    1 
ATOM   1929 C  C     . PRO A  1  340 ? 36.239  34.063  166.203 1.00 25.99  ? 315 PRO A C     1 
ATOM   1930 O  O     . PRO A  1  340 ? 37.457  34.253  166.466 1.00 23.84  ? 315 PRO A O     1 
ATOM   1931 C  CB    . PRO A  1  340 ? 36.130  34.135  163.715 1.00 25.92  ? 315 PRO A CB    1 
ATOM   1932 C  CG    . PRO A  1  340 ? 35.010  33.849  162.772 1.00 25.68  ? 315 PRO A CG    1 
ATOM   1933 C  CD    . PRO A  1  340 ? 33.818  33.454  163.583 1.00 24.43  ? 315 PRO A CD    1 
ATOM   1934 N  N     . ASN A  1  341 ? 35.248  34.530  166.984 1.00 22.55  ? 316 ASN A N     1 
ATOM   1935 C  CA    . ASN A  1  341 ? 35.512  35.219  168.245 1.00 22.84  ? 316 ASN A CA    1 
ATOM   1936 C  C     . ASN A  1  341 ? 34.400  34.999  169.296 1.00 22.56  ? 316 ASN A C     1 
ATOM   1937 O  O     . ASN A  1  341 ? 33.328  34.428  168.964 1.00 21.51  ? 316 ASN A O     1 
ATOM   1938 C  CB    . ASN A  1  341 ? 35.801  36.719  168.013 1.00 21.91  ? 316 ASN A CB    1 
ATOM   1939 C  CG    . ASN A  1  341 ? 34.621  37.488  167.440 1.00 25.55  ? 316 ASN A CG    1 
ATOM   1940 O  OD1   . ASN A  1  341 ? 33.560  37.624  168.073 1.00 23.21  ? 316 ASN A OD1   1 
ATOM   1941 N  ND2   . ASN A  1  341 ? 34.810  38.044  166.250 1.00 24.30  ? 316 ASN A ND2   1 
ATOM   1942 N  N     . THR A  1  342 ? 34.665  35.425  170.531 1.00 21.24  ? 317 THR A N     1 
ATOM   1943 C  CA    . THR A  1  342 ? 33.774  35.151  171.662 1.00 23.83  ? 317 THR A CA    1 
ATOM   1944 C  C     . THR A  1  342 ? 32.446  35.889  171.552 1.00 23.76  ? 317 THR A C     1 
ATOM   1945 O  O     . THR A  1  342 ? 31.399  35.388  171.978 1.00 24.48  ? 317 THR A O     1 
ATOM   1946 C  CB    . THR A  1  342 ? 34.429  35.578  172.986 1.00 26.76  ? 317 THR A CB    1 
ATOM   1947 O  OG1   . THR A  1  342 ? 34.933  36.907  172.830 1.00 27.89  ? 317 THR A OG1   1 
ATOM   1948 C  CG2   . THR A  1  342 ? 35.562  34.651  173.353 1.00 27.96  ? 317 THR A CG2   1 
ATOM   1949 N  N     . MET A  1  343 ? 32.488  37.096  171.019 1.00 24.00  ? 318 MET A N     1 
ATOM   1950 C  CA    . MET A  1  343 ? 31.298  37.930  170.885 1.00 26.04  ? 318 MET A CA    1 
ATOM   1951 C  C     . MET A  1  343 ? 30.318  37.230  169.933 1.00 25.41  ? 318 MET A C     1 
ATOM   1952 O  O     . MET A  1  343 ? 29.157  37.044  170.268 1.00 24.87  ? 318 MET A O     1 
ATOM   1953 C  CB    . MET A  1  343 ? 31.668  39.317  170.342 1.00 28.34  ? 318 MET A CB    1 
ATOM   1954 C  CG    . MET A  1  343 ? 30.540  40.318  170.315 1.00 30.94  ? 318 MET A CG    1 
ATOM   1955 S  SD    . MET A  1  343 ? 29.515  40.213  168.852 1.00 36.98  ? 318 MET A SD    1 
ATOM   1956 C  CE    . MET A  1  343 ? 30.668  40.865  167.598 1.00 32.43  ? 318 MET A CE    1 
ATOM   1957 N  N     . LEU A  1  344 ? 30.804  36.814  168.772 1.00 22.79  ? 319 LEU A N     1 
ATOM   1958 C  CA    . LEU A  1  344 ? 29.967  36.116  167.795 1.00 22.65  ? 319 LEU A CA    1 
ATOM   1959 C  C     . LEU A  1  344 ? 29.506  34.732  168.272 1.00 22.80  ? 319 LEU A C     1 
ATOM   1960 O  O     . LEU A  1  344 ? 28.329  34.381  168.071 1.00 21.47  ? 319 LEU A O     1 
ATOM   1961 C  CB    . LEU A  1  344 ? 30.662  36.022  166.447 1.00 22.11  ? 319 LEU A CB    1 
ATOM   1962 C  CG    . LEU A  1  344 ? 30.980  37.323  165.723 1.00 22.98  ? 319 LEU A CG    1 
ATOM   1963 C  CD1   . LEU A  1  344 ? 31.778  37.003  164.488 1.00 24.06  ? 319 LEU A CD1   1 
ATOM   1964 C  CD2   . LEU A  1  344 ? 29.699  38.062  165.350 1.00 24.55  ? 319 LEU A CD2   1 
ATOM   1965 N  N     . ALA A  1  345 ? 30.396  33.991  168.932 1.00 21.25  ? 320 ALA A N     1 
ATOM   1966 C  CA    . ALA A  1  345 ? 30.079  32.625  169.382 1.00 22.25  ? 320 ALA A CA    1 
ATOM   1967 C  C     . ALA A  1  345 ? 28.922  32.651  170.413 1.00 23.55  ? 320 ALA A C     1 
ATOM   1968 O  O     . ALA A  1  345 ? 28.001  31.831  170.358 1.00 22.68  ? 320 ALA A O     1 
ATOM   1969 C  CB    . ALA A  1  345 ? 31.286  31.941  169.978 1.00 21.48  ? 320 ALA A CB    1 
ATOM   1970 N  N     . LYS A  1  346 ? 28.966  33.616  171.313 1.00 24.64  ? 321 LYS A N     1 
ATOM   1971 C  CA    . LYS A  1  346 ? 27.884  33.832  172.253 1.00 26.56  ? 321 LYS A CA    1 
ATOM   1972 C  C     . LYS A  1  346 ? 26.536  34.130  171.580 1.00 26.07  ? 321 LYS A C     1 
ATOM   1973 O  O     . LYS A  1  346 ? 25.547  33.539  171.963 1.00 28.00  ? 321 LYS A O     1 
ATOM   1974 C  CB    . LYS A  1  346 ? 28.276  34.921  173.247 1.00 30.10  ? 321 LYS A CB    1 
ATOM   1975 C  CG    . LYS A  1  346 ? 27.197  35.344  174.244 1.00 34.64  ? 321 LYS A CG    1 
ATOM   1976 C  CD    . LYS A  1  346 ? 27.059  34.390  175.388 1.00 39.66  ? 321 LYS A CD    1 
ATOM   1977 C  CE    . LYS A  1  346 ? 26.198  34.974  176.506 1.00 41.72  ? 321 LYS A CE    1 
ATOM   1978 N  NZ    . LYS A  1  346 ? 25.463  33.841  177.142 1.00 44.01  ? 321 LYS A NZ    1 
ATOM   1979 N  N     . VAL A  1  347 ? 26.490  34.997  170.573 1.00 25.40  ? 322 VAL A N     1 
ATOM   1980 C  CA    . VAL A  1  347 ? 25.246  35.252  169.835 1.00 27.95  ? 322 VAL A CA    1 
ATOM   1981 C  C     . VAL A  1  347 ? 24.736  33.966  169.146 1.00 29.98  ? 322 VAL A C     1 
ATOM   1982 O  O     . VAL A  1  347 ? 23.530  33.640  169.204 1.00 28.23  ? 322 VAL A O     1 
ATOM   1983 C  CB    . VAL A  1  347 ? 25.411  36.404  168.806 1.00 28.38  ? 322 VAL A CB    1 
ATOM   1984 C  CG1   . VAL A  1  347 ? 24.122  36.640  168.047 1.00 27.30  ? 322 VAL A CG1   1 
ATOM   1985 C  CG2   . VAL A  1  347 ? 25.806  37.687  169.519 1.00 29.60  ? 322 VAL A CG2   1 
ATOM   1986 N  N     . CYS A  1  348 ? 25.668  33.207  168.566 1.00 27.04  ? 323 CYS A N     1 
ATOM   1987 C  CA    . CYS A  1  348 ? 25.328  31.977  167.893 1.00 26.61  ? 323 CYS A CA    1 
ATOM   1988 C  C     . CYS A  1  348 ? 24.757  30.882  168.768 1.00 24.49  ? 323 CYS A C     1 
ATOM   1989 O  O     . CYS A  1  348 ? 23.905  30.144  168.302 1.00 26.72  ? 323 CYS A O     1 
ATOM   1990 C  CB    . CYS A  1  348 ? 26.541  31.407  167.142 1.00 26.27  ? 323 CYS A CB    1 
ATOM   1991 S  SG    . CYS A  1  348 ? 27.004  32.441  165.774 1.00 29.47  ? 323 CYS A SG    1 
ATOM   1992 N  N     . SER A  1  349 ? 25.213  30.757  169.995 1.00 24.31  ? 324 SER A N     1 
ATOM   1993 C  CA    . SER A  1  349 ? 24.751  29.681  170.854 1.00 26.58  ? 324 SER A CA    1 
ATOM   1994 C  C     . SER A  1  349 ? 23.324  29.835  171.279 1.00 27.85  ? 324 SER A C     1 
ATOM   1995 O  O     . SER A  1  349 ? 22.706  28.844  171.643 1.00 26.08  ? 324 SER A O     1 
ATOM   1996 C  CB    . SER A  1  349 ? 25.617  29.465  172.107 1.00 26.96  ? 324 SER A CB    1 
ATOM   1997 O  OG    . SER A  1  349 ? 25.618  30.592  172.959 1.00 27.33  ? 324 SER A OG    1 
ATOM   1998 N  N     . ASP A  1  350 ? 22.811  31.054  171.260 1.00 29.28  ? 325 ASP A N     1 
ATOM   1999 C  CA    . ASP A  1  350 ? 21.416  31.281  171.595 1.00 32.47  ? 325 ASP A CA    1 
ATOM   2000 C  C     . ASP A  1  350 ? 20.530  31.104  170.370 1.00 30.74  ? 325 ASP A C     1 
ATOM   2001 O  O     . ASP A  1  350 ? 19.324  30.897  170.497 1.00 28.19  ? 325 ASP A O     1 
ATOM   2002 C  CB    . ASP A  1  350 ? 21.218  32.699  172.155 1.00 37.64  ? 325 ASP A CB    1 
ATOM   2003 C  CG    . ASP A  1  350 ? 20.599  32.686  173.528 1.00 45.38  ? 325 ASP A CG    1 
ATOM   2004 O  OD1   . ASP A  1  350 ? 21.272  32.237  174.480 1.00 44.77  ? 325 ASP A OD1   1 
ATOM   2005 O  OD2   . ASP A  1  350 ? 19.437  33.129  173.648 1.00 57.57  ? 325 ASP A OD2   1 
ATOM   2006 N  N     . LYS A  1  351 ? 21.111  31.190  169.182 1.00 27.67  ? 326 LYS A N     1 
ATOM   2007 C  CA    . LYS A  1  351 ? 20.300  31.264  167.974 1.00 30.32  ? 326 LYS A CA    1 
ATOM   2008 C  C     . LYS A  1  351 ? 19.371  30.069  167.696 1.00 29.64  ? 326 LYS A C     1 
ATOM   2009 O  O     . LYS A  1  351 ? 18.215  30.269  167.313 1.00 30.85  ? 326 LYS A O     1 
ATOM   2010 C  CB    . LYS A  1  351 ? 21.201  31.518  166.780 1.00 34.31  ? 326 LYS A CB    1 
ATOM   2011 C  CG    . LYS A  1  351 ? 20.489  31.847  165.494 1.00 38.98  ? 326 LYS A CG    1 
ATOM   2012 C  CD    . LYS A  1  351 ? 21.478  32.230  164.399 1.00 41.30  ? 326 LYS A CD    1 
ATOM   2013 C  CE    . LYS A  1  351 ? 20.827  32.193  163.022 1.00 45.28  ? 326 LYS A CE    1 
ATOM   2014 N  NZ    . LYS A  1  351 ? 19.717  33.162  162.833 1.00 49.32  ? 326 LYS A NZ    1 
ATOM   2015 N  N     . ASN A  1  352 ? 19.878  28.848  167.843 1.00 27.46  ? 327 ASN A N     1 
ATOM   2016 C  CA    . ASN A  1  352 ? 19.112  27.611  167.591 1.00 27.90  ? 327 ASN A CA    1 
ATOM   2017 C  C     . ASN A  1  352 ? 18.719  26.879  168.894 1.00 28.17  ? 327 ASN A C     1 
ATOM   2018 O  O     . ASN A  1  352 ? 18.481  25.680  168.896 1.00 29.74  ? 327 ASN A O     1 
ATOM   2019 C  CB    . ASN A  1  352 ? 19.904  26.673  166.653 1.00 26.62  ? 327 ASN A CB    1 
ATOM   2020 C  CG    . ASN A  1  352 ? 19.861  27.107  165.196 1.00 28.98  ? 327 ASN A CG    1 
ATOM   2021 O  OD1   . ASN A  1  352 ? 19.058  27.930  164.819 1.00 32.23  ? 327 ASN A OD1   1 
ATOM   2022 N  ND2   . ASN A  1  352 ? 20.748  26.546  164.373 1.00 29.41  ? 327 ASN A ND2   1 
ATOM   2023 N  N     . LYS A  1  353 ? 18.623  27.619  169.993 1.00 27.85  ? 328 LYS A N     1 
ATOM   2024 C  CA    . LYS A  1  353 ? 18.155  27.089  171.278 1.00 27.49  ? 328 LYS A CA    1 
ATOM   2025 C  C     . LYS A  1  353 ? 16.677  26.700  171.253 1.00 26.41  ? 328 LYS A C     1 
ATOM   2026 O  O     . LYS A  1  353 ? 15.915  27.371  170.623 1.00 27.68  ? 328 LYS A O     1 
ATOM   2027 C  CB    . LYS A  1  353 ? 18.322  28.152  172.376 1.00 27.76  ? 328 LYS A CB    1 
ATOM   2028 C  CG    . LYS A  1  353 ? 19.455  27.856  173.273 1.00 29.22  ? 328 LYS A CG    1 
ATOM   2029 C  CD    . LYS A  1  353 ? 19.647  28.899  174.361 1.00 27.67  ? 328 LYS A CD    1 
ATOM   2030 C  CE    . LYS A  1  353 ? 20.938  28.550  175.094 1.00 25.77  ? 328 LYS A CE    1 
ATOM   2031 N  NZ    . LYS A  1  353 ? 20.831  27.301  175.897 1.00 25.57  ? 328 LYS A NZ    1 
ATOM   2032 N  N     . PRO A  1  354 ? 16.244  25.646  171.935 1.00 26.54  ? 329 PRO A N     1 
ATOM   2033 C  CA    . PRO A  1  354 ? 17.066  24.718  172.678 1.00 25.06  ? 329 PRO A CA    1 
ATOM   2034 C  C     . PRO A  1  354 ? 17.583  23.594  171.789 1.00 25.56  ? 329 PRO A C     1 
ATOM   2035 O  O     . PRO A  1  354 ? 17.052  23.369  170.704 1.00 23.24  ? 329 PRO A O     1 
ATOM   2036 C  CB    . PRO A  1  354 ? 16.079  24.173  173.724 1.00 27.06  ? 329 PRO A CB    1 
ATOM   2037 C  CG    . PRO A  1  354 ? 14.758  24.168  173.000 1.00 26.74  ? 329 PRO A CG    1 
ATOM   2038 C  CD    . PRO A  1  354 ? 14.799  25.405  172.139 1.00 26.86  ? 329 PRO A CD    1 
ATOM   2039 N  N     . ASN A  1  355 ? 18.590  22.875  172.286 1.00 23.14  ? 330 ASN A N     1 
ATOM   2040 C  CA    . ASN A  1  355 ? 19.158  21.707  171.635 1.00 25.26  ? 330 ASN A CA    1 
ATOM   2041 C  C     . ASN A  1  355 ? 19.501  21.954  170.154 1.00 25.02  ? 330 ASN A C     1 
ATOM   2042 O  O     . ASN A  1  355 ? 19.151  21.175  169.284 1.00 23.13  ? 330 ASN A O     1 
ATOM   2043 C  CB    . ASN A  1  355 ? 18.249  20.480  171.847 1.00 26.94  ? 330 ASN A CB    1 
ATOM   2044 C  CG    . ASN A  1  355 ? 18.944  19.150  171.559 1.00 29.84  ? 330 ASN A CG    1 
ATOM   2045 O  OD1   . ASN A  1  355 ? 20.152  19.019  171.619 1.00 30.66  ? 330 ASN A OD1   1 
ATOM   2046 N  ND2   . ASN A  1  355 ? 18.151  18.148  171.244 1.00 32.11  ? 330 ASN A ND2   1 
ATOM   2047 N  N     . GLY A  1  356 ? 20.234  23.042  169.898 1.00 24.12  ? 331 GLY A N     1 
ATOM   2048 C  CA    . GLY A  1  356 ? 20.757  23.318  168.557 1.00 23.81  ? 331 GLY A CA    1 
ATOM   2049 C  C     . GLY A  1  356 ? 22.148  23.888  168.590 1.00 25.78  ? 331 GLY A C     1 
ATOM   2050 O  O     . GLY A  1  356 ? 22.725  24.123  169.654 1.00 24.18  ? 331 GLY A O     1 
ATOM   2051 N  N     . GLN A  1  357 ? 22.669  24.150  167.401 1.00 24.42  ? 332 GLN A N     1 
ATOM   2052 C  CA    . GLN A  1  357 ? 23.935  24.810  167.275 1.00 24.83  ? 332 GLN A CA    1 
ATOM   2053 C  C     . GLN A  1  357 ? 23.941  25.642  166.006 1.00 25.41  ? 332 GLN A C     1 
ATOM   2054 O  O     . GLN A  1  357 ? 23.095  25.453  165.109 1.00 22.66  ? 332 GLN A O     1 
ATOM   2055 C  CB    . GLN A  1  357 ? 25.080  23.794  167.318 1.00 25.01  ? 332 GLN A CB    1 
ATOM   2056 C  CG    . GLN A  1  357 ? 25.228  22.868  166.099 1.00 26.90  ? 332 GLN A CG    1 
ATOM   2057 C  CD    . GLN A  1  357 ? 26.320  21.828  166.335 1.00 28.39  ? 332 GLN A CD    1 
ATOM   2058 O  OE1   . GLN A  1  357 ? 26.298  21.072  167.331 1.00 24.24  ? 332 GLN A OE1   1 
ATOM   2059 N  NE2   . GLN A  1  357 ? 27.280  21.785  165.443 1.00 30.08  ? 332 GLN A NE2   1 
ATOM   2060 N  N     . TYR A  1  358 ? 24.876  26.580  165.945 1.00 24.35  ? 333 TYR A N     1 
ATOM   2061 C  CA    . TYR A  1  358 ? 25.006  27.417  164.797 1.00 24.44  ? 333 TYR A CA    1 
ATOM   2062 C  C     . TYR A  1  358 ? 26.464  27.819  164.596 1.00 26.06  ? 333 TYR A C     1 
ATOM   2063 O  O     . TYR A  1  358 ? 27.153  28.205  165.566 1.00 25.38  ? 333 TYR A O     1 
ATOM   2064 C  CB    . TYR A  1  358 ? 24.116  28.635  164.957 1.00 23.61  ? 333 TYR A CB    1 
ATOM   2065 C  CG    . TYR A  1  358 ? 24.046  29.466  163.682 1.00 27.25  ? 333 TYR A CG    1 
ATOM   2066 C  CD1   . TYR A  1  358 ? 23.086  29.191  162.672 1.00 28.95  ? 333 TYR A CD1   1 
ATOM   2067 C  CD2   . TYR A  1  358 ? 24.968  30.492  163.455 1.00 25.73  ? 333 TYR A CD2   1 
ATOM   2068 C  CE1   . TYR A  1  358 ? 23.064  29.935  161.486 1.00 30.29  ? 333 TYR A CE1   1 
ATOM   2069 C  CE2   . TYR A  1  358 ? 24.961  31.234  162.286 1.00 28.24  ? 333 TYR A CE2   1 
ATOM   2070 C  CZ    . TYR A  1  358 ? 24.003  30.971  161.301 1.00 30.25  ? 333 TYR A CZ    1 
ATOM   2071 O  OH    . TYR A  1  358 ? 24.001  31.736  160.142 1.00 31.98  ? 333 TYR A OH    1 
ATOM   2072 N  N     . GLN A  1  359 ? 26.915  27.763  163.336 1.00 24.23  ? 334 GLN A N     1 
ATOM   2073 C  CA    . GLN A  1  359 ? 28.254  28.224  162.963 1.00 23.86  ? 334 GLN A CA    1 
ATOM   2074 C  C     . GLN A  1  359 ? 28.249  29.415  161.991 1.00 23.02  ? 334 GLN A C     1 
ATOM   2075 O  O     . GLN A  1  359 ? 27.592  29.397  160.968 1.00 22.02  ? 334 GLN A O     1 
ATOM   2076 C  CB    . GLN A  1  359 ? 29.119  27.090  162.382 1.00 24.96  ? 334 GLN A CB    1 
ATOM   2077 C  CG    . GLN A  1  359 ? 30.538  27.580  162.054 1.00 27.67  ? 334 GLN A CG    1 
ATOM   2078 C  CD    . GLN A  1  359 ? 31.455  26.512  161.493 1.00 28.72  ? 334 GLN A CD    1 
ATOM   2079 O  OE1   . GLN A  1  359 ? 30.987  25.525  160.997 1.00 29.57  ? 334 GLN A OE1   1 
ATOM   2080 N  NE2   . GLN A  1  359 ? 32.781  26.711  161.604 1.00 28.62  ? 334 GLN A NE2   1 
ATOM   2081 N  N     . ILE A  1  360 ? 29.036  30.435  162.302 1.00 22.29  ? 335 ILE A N     1 
ATOM   2082 C  CA    . ILE A  1  360 ? 29.379  31.452  161.330 1.00 21.90  ? 335 ILE A CA    1 
ATOM   2083 C  C     . ILE A  1  360 ? 30.646  30.989  160.625 1.00 23.09  ? 335 ILE A C     1 
ATOM   2084 O  O     . ILE A  1  360 ? 31.702  30.884  161.232 1.00 22.49  ? 335 ILE A O     1 
ATOM   2085 C  CB    . ILE A  1  360 ? 29.646  32.820  161.968 1.00 22.67  ? 335 ILE A CB    1 
ATOM   2086 C  CG1   . ILE A  1  360 ? 28.354  33.358  162.593 1.00 23.61  ? 335 ILE A CG1   1 
ATOM   2087 C  CG2   . ILE A  1  360 ? 30.170  33.798  160.897 1.00 24.40  ? 335 ILE A CG2   1 
ATOM   2088 C  CD1   . ILE A  1  360 ? 28.483  34.569  163.501 1.00 25.06  ? 335 ILE A CD1   1 
ATOM   2089 N  N     . LEU A  1  361 ? 30.559  30.722  159.340 1.00 22.50  ? 336 LEU A N     1 
ATOM   2090 C  CA    . LEU A  1  361 ? 31.786  30.297  158.639 1.00 27.86  ? 336 LEU A CA    1 
ATOM   2091 C  C     . LEU A  1  361 ? 32.868  31.387  158.770 1.00 27.12  ? 336 LEU A C     1 
ATOM   2092 O  O     . LEU A  1  361 ? 32.555  32.589  158.709 1.00 26.89  ? 336 LEU A O     1 
ATOM   2093 C  CB    . LEU A  1  361 ? 31.500  29.952  157.194 1.00 29.55  ? 336 LEU A CB    1 
ATOM   2094 C  CG    . LEU A  1  361 ? 30.467  28.828  156.961 1.00 32.03  ? 336 LEU A CG    1 
ATOM   2095 C  CD1   . LEU A  1  361 ? 30.202  28.668  155.477 1.00 33.80  ? 336 LEU A CD1   1 
ATOM   2096 C  CD2   . LEU A  1  361 ? 30.919  27.520  157.567 1.00 34.34  ? 336 LEU A CD2   1 
ATOM   2097 N  N     . PRO A  1  362 ? 34.139  30.992  158.971 1.00 26.50  ? 337 PRO A N     1 
ATOM   2098 C  CA    . PRO A  1  362 ? 35.180  31.947  159.315 1.00 26.24  ? 337 PRO A CA    1 
ATOM   2099 C  C     . PRO A  1  362 ? 35.819  32.697  158.125 1.00 26.45  ? 337 PRO A C     1 
ATOM   2100 O  O     . PRO A  1  362 ? 37.050  32.650  157.907 1.00 27.13  ? 337 PRO A O     1 
ATOM   2101 C  CB    . PRO A  1  362 ? 36.180  31.049  160.044 1.00 26.01  ? 337 PRO A CB    1 
ATOM   2102 C  CG    . PRO A  1  362 ? 36.122  29.808  159.239 1.00 25.38  ? 337 PRO A CG    1 
ATOM   2103 C  CD    . PRO A  1  362 ? 34.669  29.619  159.014 1.00 27.90  ? 337 PRO A CD    1 
ATOM   2104 N  N     . ASN A  1  363 ? 34.979  33.403  157.371 1.00 26.69  ? 338 ASN A N     1 
ATOM   2105 C  CA    . ASN A  1  363 ? 35.408  34.295  156.287 1.00 24.49  ? 338 ASN A CA    1 
ATOM   2106 C  C     . ASN A  1  363 ? 34.737  35.638  156.564 1.00 25.81  ? 338 ASN A C     1 
ATOM   2107 O  O     . ASN A  1  363 ? 33.690  35.704  157.242 1.00 23.55  ? 338 ASN A O     1 
ATOM   2108 C  CB    . ASN A  1  363 ? 35.103  33.715  154.880 1.00 24.40  ? 338 ASN A CB    1 
ATOM   2109 C  CG    . ASN A  1  363 ? 33.599  33.560  154.594 1.00 24.49  ? 338 ASN A CG    1 
ATOM   2110 O  OD1   . ASN A  1  363 ? 32.941  34.529  154.323 1.00 23.15  ? 338 ASN A OD1   1 
ATOM   2111 N  ND2   . ASN A  1  363 ? 33.076  32.343  154.669 1.00 24.23  ? 338 ASN A ND2   1 
ATOM   2112 N  N     . ARG A  1  364 ? 35.353  36.720  156.095 1.00 25.61  ? 339 ARG A N     1 
ATOM   2113 C  CA    . ARG A  1  364 ? 34.905  38.053  156.478 1.00 26.41  ? 339 ARG A CA    1 
ATOM   2114 C  C     . ARG A  1  364 ? 33.482  38.305  156.001 1.00 23.04  ? 339 ARG A C     1 
ATOM   2115 O  O     . ARG A  1  364 ? 32.702  38.956  156.687 1.00 23.95  ? 339 ARG A O     1 
ATOM   2116 C  CB    . ARG A  1  364 ? 35.841  39.150  155.940 1.00 27.13  ? 339 ARG A CB    1 
ATOM   2117 C  CG    . ARG A  1  364 ? 35.625  40.520  156.577 1.00 30.25  ? 339 ARG A CG    1 
ATOM   2118 C  CD    . ARG A  1  364 ? 36.491  41.631  155.922 1.00 31.95  ? 339 ARG A CD    1 
ATOM   2119 N  NE    . ARG A  1  364 ? 36.144  42.969  156.431 1.00 30.96  ? 339 ARG A NE    1 
ATOM   2120 C  CZ    . ARG A  1  364 ? 35.119  43.721  156.025 1.00 32.89  ? 339 ARG A CZ    1 
ATOM   2121 N  NH1   . ARG A  1  364 ? 34.285  43.328  155.069 1.00 33.40  ? 339 ARG A NH1   1 
ATOM   2122 N  NH2   . ARG A  1  364 ? 34.923  44.901  156.585 1.00 35.67  ? 339 ARG A NH2   1 
ATOM   2123 N  N     . GLN A  1  365 ? 33.176  37.821  154.829 1.00 25.40  ? 340 GLN A N     1 
ATOM   2124 C  CA    . GLN A  1  365 ? 31.866  38.090  154.205 1.00 28.03  ? 340 GLN A CA    1 
ATOM   2125 C  C     . GLN A  1  365 ? 30.738  37.468  155.045 1.00 26.09  ? 340 GLN A C     1 
ATOM   2126 O  O     . GLN A  1  365 ? 29.756  38.104  155.300 1.00 23.90  ? 340 GLN A O     1 
ATOM   2127 C  CB    . GLN A  1  365 ? 31.846  37.571  152.753 1.00 26.97  ? 340 GLN A CB    1 
ATOM   2128 C  CG    . GLN A  1  365 ? 30.578  37.942  151.984 1.00 27.41  ? 340 GLN A CG    1 
ATOM   2129 C  CD    . GLN A  1  365 ? 30.498  39.441  151.776 1.00 32.37  ? 340 GLN A CD    1 
ATOM   2130 O  OE1   . GLN A  1  365 ? 31.361  40.024  151.127 1.00 35.41  ? 340 GLN A OE1   1 
ATOM   2131 N  NE2   . GLN A  1  365 ? 29.516  40.086  152.380 1.00 34.45  ? 340 GLN A NE2   1 
ATOM   2132 N  N     . ALA A  1  366 ? 30.949  36.241  155.509 1.00 26.36  ? 341 ALA A N     1 
ATOM   2133 C  CA    . ALA A  1  366 ? 30.009  35.565  156.398 1.00 26.97  ? 341 ALA A CA    1 
ATOM   2134 C  C     . ALA A  1  366 ? 29.763  36.341  157.695 1.00 27.80  ? 341 ALA A C     1 
ATOM   2135 O  O     . ALA A  1  366 ? 28.604  36.502  158.112 1.00 25.41  ? 341 ALA A O     1 
ATOM   2136 C  CB    . ALA A  1  366 ? 30.490  34.151  156.688 1.00 25.34  ? 341 ALA A CB    1 
ATOM   2137 N  N     . VAL A  1  367 ? 30.845  36.859  158.298 1.00 23.96  ? 342 VAL A N     1 
ATOM   2138 C  CA    . VAL A  1  367 ? 30.748  37.647  159.505 1.00 24.02  ? 342 VAL A CA    1 
ATOM   2139 C  C     . VAL A  1  367 ? 29.883  38.888  159.283 1.00 24.87  ? 342 VAL A C     1 
ATOM   2140 O  O     . VAL A  1  367 ? 28.953  39.161  160.058 1.00 25.62  ? 342 VAL A O     1 
ATOM   2141 C  CB    . VAL A  1  367 ? 32.156  38.030  160.020 1.00 23.59  ? 342 VAL A CB    1 
ATOM   2142 C  CG1   . VAL A  1  367 ? 32.068  39.042  161.134 1.00 24.40  ? 342 VAL A CG1   1 
ATOM   2143 C  CG2   . VAL A  1  367 ? 32.887  36.793  160.518 1.00 24.05  ? 342 VAL A CG2   1 
ATOM   2144 N  N     . MET A  1  368 ? 30.202  39.653  158.239 1.00 27.10  ? 343 MET A N     1 
ATOM   2145 C  CA    . MET A  1  368 ? 29.466  40.870  157.926 1.00 28.42  ? 343 MET A CA    1 
ATOM   2146 C  C     . MET A  1  368 ? 28.014  40.598  157.556 1.00 26.95  ? 343 MET A C     1 
ATOM   2147 O  O     . MET A  1  368 ? 27.163  41.374  157.954 1.00 25.44  ? 343 MET A O     1 
ATOM   2148 C  CB    . MET A  1  368 ? 30.099  41.655  156.776 1.00 31.64  ? 343 MET A CB    1 
ATOM   2149 C  CG    . MET A  1  368 ? 31.487  42.190  157.045 1.00 35.05  ? 343 MET A CG    1 
ATOM   2150 S  SD    . MET A  1  368 ? 31.612  43.098  158.577 1.00 46.27  ? 343 MET A SD    1 
ATOM   2151 C  CE    . MET A  1  368 ? 32.945  42.196  159.265 1.00 45.38  ? 343 MET A CE    1 
ATOM   2152 N  N     . ASP A  1  369 ? 27.731  39.528  156.803 1.00 26.82  ? 344 ASP A N     1 
ATOM   2153 C  CA    . ASP A  1  369 ? 26.338  39.196  156.498 1.00 28.16  ? 344 ASP A CA    1 
ATOM   2154 C  C     . ASP A  1  369 ? 25.598  38.775  157.760 1.00 27.40  ? 344 ASP A C     1 
ATOM   2155 O  O     . ASP A  1  369 ? 24.421  39.042  157.859 1.00 27.17  ? 344 ASP A O     1 
ATOM   2156 C  CB    . ASP A  1  369 ? 26.205  38.116  155.426 1.00 30.85  ? 344 ASP A CB    1 
ATOM   2157 C  CG    . ASP A  1  369 ? 26.785  38.554  154.083 1.00 33.29  ? 344 ASP A CG    1 
ATOM   2158 O  OD1   . ASP A  1  369 ? 27.025  39.754  153.845 1.00 37.12  ? 344 ASP A OD1   1 
ATOM   2159 O  OD2   . ASP A  1  369 ? 27.039  37.678  153.278 1.00 35.65  ? 344 ASP A OD2   1 
ATOM   2160 N  N     . PHE A  1  370 ? 26.273  38.146  158.722 1.00 25.01  ? 345 PHE A N     1 
ATOM   2161 C  CA    . PHE A  1  370 ? 25.629  37.816  159.998 1.00 25.35  ? 345 PHE A CA    1 
ATOM   2162 C  C     . PHE A  1  370 ? 25.249  39.075  160.798 1.00 27.27  ? 345 PHE A C     1 
ATOM   2163 O  O     . PHE A  1  370 ? 24.175  39.187  161.344 1.00 24.80  ? 345 PHE A O     1 
ATOM   2164 C  CB    . PHE A  1  370 ? 26.561  36.937  160.845 1.00 24.61  ? 345 PHE A CB    1 
ATOM   2165 C  CG    . PHE A  1  370 ? 25.950  36.442  162.112 1.00 24.53  ? 345 PHE A CG    1 
ATOM   2166 C  CD1   . PHE A  1  370 ? 25.168  35.294  162.116 1.00 25.95  ? 345 PHE A CD1   1 
ATOM   2167 C  CD2   . PHE A  1  370 ? 26.149  37.122  163.308 1.00 25.96  ? 345 PHE A CD2   1 
ATOM   2168 C  CE1   . PHE A  1  370 ? 24.597  34.818  163.297 1.00 27.97  ? 345 PHE A CE1   1 
ATOM   2169 C  CE2   . PHE A  1  370 ? 25.580  36.665  164.486 1.00 28.50  ? 345 PHE A CE2   1 
ATOM   2170 C  CZ    . PHE A  1  370 ? 24.789  35.507  164.479 1.00 27.86  ? 345 PHE A CZ    1 
ATOM   2171 N  N     . ILE A  1  371 ? 26.204  39.977  160.900 1.00 27.17  ? 346 ILE A N     1 
ATOM   2172 C  CA    . ILE A  1  371 ? 26.098  41.185  161.691 1.00 31.31  ? 346 ILE A CA    1 
ATOM   2173 C  C     . ILE A  1  371 ? 25.090  42.222  161.115 1.00 32.52  ? 346 ILE A C     1 
ATOM   2174 O  O     . ILE A  1  371 ? 24.459  42.966  161.878 1.00 26.93  ? 346 ILE A O     1 
ATOM   2175 C  CB    . ILE A  1  371 ? 27.553  41.735  161.811 1.00 32.99  ? 346 ILE A CB    1 
ATOM   2176 C  CG1   . ILE A  1  371 ? 28.231  41.058  163.004 1.00 35.78  ? 346 ILE A CG1   1 
ATOM   2177 C  CG2   . ILE A  1  371 ? 27.671  43.241  161.772 1.00 35.77  ? 346 ILE A CG2   1 
ATOM   2178 C  CD1   . ILE A  1  371 ? 27.812  41.558  164.367 1.00 41.52  ? 346 ILE A CD1   1 
ATOM   2179 N  N     . LYS A  1  372 ? 24.998  42.253  159.786 1.00 32.34  ? 347 LYS A N     1 
ATOM   2180 C  CA    . LYS A  1  372 ? 24.192  43.186  158.966 1.00 39.40  ? 347 LYS A CA    1 
ATOM   2181 C  C     . LYS A  1  372 ? 22.868  43.619  159.592 1.00 39.00  ? 347 LYS A C     1 
ATOM   2182 O  O     . LYS A  1  372 ? 22.663  44.794  159.906 1.00 40.61  ? 347 LYS A O     1 
ATOM   2183 C  CB    . LYS A  1  372 ? 23.907  42.549  157.582 1.00 45.67  ? 347 LYS A CB    1 
ATOM   2184 C  CG    . LYS A  1  372 ? 24.300  43.360  156.352 1.00 53.90  ? 347 LYS A CG    1 
ATOM   2185 C  CD    . LYS A  1  372 ? 23.208  44.264  155.807 1.00 60.44  ? 347 LYS A CD    1 
ATOM   2186 N  N     . ASP A  1  373 ? 21.957  42.697  159.800 1.00 35.94  ? 348 ASP A N     1 
ATOM   2187 C  CA    . ASP A  1  373 ? 20.710  43.141  160.421 1.00 42.19  ? 348 ASP A CA    1 
ATOM   2188 C  C     . ASP A  1  373 ? 20.559  42.635  161.852 1.00 37.78  ? 348 ASP A C     1 
ATOM   2189 O  O     . ASP A  1  373 ? 19.454  42.595  162.380 1.00 38.61  ? 348 ASP A O     1 
ATOM   2190 C  CB    . ASP A  1  373 ? 19.551  42.809  159.478 1.00 46.46  ? 348 ASP A CB    1 
ATOM   2191 C  CG    . ASP A  1  373 ? 19.659  43.586  158.154 1.00 51.54  ? 348 ASP A CG    1 
ATOM   2192 O  OD1   . ASP A  1  373 ? 19.773  44.835  158.200 1.00 58.34  ? 348 ASP A OD1   1 
ATOM   2193 O  OD2   . ASP A  1  373 ? 19.676  42.956  157.077 1.00 61.43  ? 348 ASP A OD2   1 
ATOM   2194 N  N     . LEU A  1  374 ? 21.682  42.285  162.494 1.00 32.47  ? 349 LEU A N     1 
ATOM   2195 C  CA    . LEU A  1  374 ? 21.635  41.752  163.855 1.00 30.93  ? 349 LEU A CA    1 
ATOM   2196 C  C     . LEU A  1  374 ? 21.178  42.841  164.819 1.00 29.34  ? 349 LEU A C     1 
ATOM   2197 O  O     . LEU A  1  374 ? 21.852  43.882  164.911 1.00 29.00  ? 349 LEU A O     1 
ATOM   2198 C  CB    . LEU A  1  374 ? 23.009  41.277  164.301 1.00 30.13  ? 349 LEU A CB    1 
ATOM   2199 C  CG    . LEU A  1  374 ? 23.120  40.677  165.686 1.00 30.44  ? 349 LEU A CG    1 
ATOM   2200 C  CD1   . LEU A  1  374 ? 22.362  39.362  165.684 1.00 34.33  ? 349 LEU A CD1   1 
ATOM   2201 C  CD2   . LEU A  1  374 ? 24.577  40.431  166.035 1.00 32.20  ? 349 LEU A CD2   1 
ATOM   2202 N  N     . PRO A  1  375 ? 20.064  42.611  165.552 1.00 28.42  ? 350 PRO A N     1 
ATOM   2203 C  CA    . PRO A  1  375 ? 19.682  43.594  166.567 1.00 29.94  ? 350 PRO A CA    1 
ATOM   2204 C  C     . PRO A  1  375 ? 20.762  43.717  167.645 1.00 27.31  ? 350 PRO A C     1 
ATOM   2205 O  O     . PRO A  1  375 ? 21.308  42.702  168.082 1.00 25.01  ? 350 PRO A O     1 
ATOM   2206 C  CB    . PRO A  1  375 ? 18.368  43.020  167.145 1.00 31.47  ? 350 PRO A CB    1 
ATOM   2207 C  CG    . PRO A  1  375 ? 17.827  42.161  166.036 1.00 31.25  ? 350 PRO A CG    1 
ATOM   2208 C  CD    . PRO A  1  375 ? 19.084  41.506  165.493 1.00 31.37  ? 350 PRO A CD    1 
ATOM   2209 N  N     . ILE A  1  376 ? 21.082  44.939  168.053 1.00 27.48  ? 351 ILE A N     1 
ATOM   2210 C  CA    . ILE A  1  376 ? 22.176  45.128  169.034 1.00 28.56  ? 351 ILE A CA    1 
ATOM   2211 C  C     . ILE A  1  376 ? 21.865  44.515  170.379 1.00 26.75  ? 351 ILE A C     1 
ATOM   2212 O  O     . ILE A  1  376 ? 22.784  44.151  171.103 1.00 23.94  ? 351 ILE A O     1 
ATOM   2213 C  CB    . ILE A  1  376 ? 22.563  46.592  169.235 1.00 32.73  ? 351 ILE A CB    1 
ATOM   2214 C  CG1   . ILE A  1  376 ? 21.355  47.426  169.717 1.00 34.74  ? 351 ILE A CG1   1 
ATOM   2215 C  CG2   . ILE A  1  376 ? 23.129  47.130  167.934 1.00 35.39  ? 351 ILE A CG2   1 
ATOM   2216 C  CD1   . ILE A  1  376 ? 21.765  48.767  170.247 1.00 38.33  ? 351 ILE A CD1   1 
ATOM   2217 N  N     . ARG A  1  377 ? 20.575  44.392  170.703 1.00 28.25  ? 352 ARG A N     1 
ATOM   2218 C  CA    . ARG A  1  377 ? 20.142  43.799  171.996 1.00 29.45  ? 352 ARG A CA    1 
ATOM   2219 C  C     . ARG A  1  377 ? 20.594  42.312  172.125 1.00 28.36  ? 352 ARG A C     1 
ATOM   2220 O  O     . ARG A  1  377 ? 20.710  41.805  173.236 1.00 29.88  ? 352 ARG A O     1 
ATOM   2221 C  CB    . ARG A  1  377 ? 18.609  43.829  172.171 1.00 34.19  ? 352 ARG A CB    1 
ATOM   2222 C  CG    . ARG A  1  377 ? 17.884  42.657  171.515 1.00 37.25  ? 352 ARG A CG    1 
ATOM   2223 C  CD    . ARG A  1  377 ? 16.431  42.900  171.195 1.00 43.24  ? 352 ARG A CD    1 
ATOM   2224 N  NE    . ARG A  1  377 ? 15.526  42.878  172.350 1.00 46.06  ? 352 ARG A NE    1 
ATOM   2225 C  CZ    . ARG A  1  377 ? 14.448  42.098  172.449 1.00 47.53  ? 352 ARG A CZ    1 
ATOM   2226 N  NH1   . ARG A  1  377 ? 14.144  41.256  171.471 1.00 47.62  ? 352 ARG A NH1   1 
ATOM   2227 N  NH2   . ARG A  1  377 ? 13.675  42.149  173.528 1.00 44.47  ? 352 ARG A NH2   1 
ATOM   2228 N  N     . LYS A  1  378 ? 20.869  41.655  171.012 1.00 27.76  ? 353 LYS A N     1 
ATOM   2229 C  CA    . LYS A  1  378 ? 21.399  40.283  171.020 1.00 26.71  ? 353 LYS A CA    1 
ATOM   2230 C  C     . LYS A  1  378 ? 22.867  40.165  171.440 1.00 25.11  ? 353 LYS A C     1 
ATOM   2231 O  O     . LYS A  1  378 ? 23.340  39.084  171.664 1.00 24.96  ? 353 LYS A O     1 
ATOM   2232 C  CB    . LYS A  1  378 ? 21.250  39.662  169.645 1.00 27.69  ? 353 LYS A CB    1 
ATOM   2233 C  CG    . LYS A  1  378 ? 19.812  39.501  169.165 1.00 32.88  ? 353 LYS A CG    1 
ATOM   2234 C  CD    . LYS A  1  378 ? 19.026  38.551  170.042 1.00 38.16  ? 353 LYS A CD    1 
ATOM   2235 C  CE    . LYS A  1  378 ? 17.774  38.010  169.324 1.00 47.00  ? 353 LYS A CE    1 
ATOM   2236 N  NZ    . LYS A  1  378 ? 16.714  37.704  170.342 1.00 48.75  ? 353 LYS A NZ    1 
ATOM   2237 N  N     . VAL A  1  379 ? 23.596  41.261  171.502 1.00 26.68  ? 354 VAL A N     1 
ATOM   2238 C  CA    . VAL A  1  379 ? 25.027  41.227  171.879 1.00 25.20  ? 354 VAL A CA    1 
ATOM   2239 C  C     . VAL A  1  379 ? 25.184  41.405  173.393 1.00 28.00  ? 354 VAL A C     1 
ATOM   2240 O  O     . VAL A  1  379 ? 24.546  42.271  174.003 1.00 24.80  ? 354 VAL A O     1 
ATOM   2241 C  CB    . VAL A  1  379 ? 25.776  42.342  171.136 1.00 27.39  ? 354 VAL A CB    1 
ATOM   2242 C  CG1   . VAL A  1  379 ? 27.247  42.392  171.552 1.00 29.55  ? 354 VAL A CG1   1 
ATOM   2243 C  CG2   . VAL A  1  379 ? 25.640  42.119  169.647 1.00 27.56  ? 354 VAL A CG2   1 
ATOM   2244 N  N     . SER A  1  380 ? 26.046  40.575  173.971 1.00 30.01  ? 355 SER A N     1 
ATOM   2245 C  CA    . SER A  1  380 ? 26.388  40.578  175.384 1.00 32.58  ? 355 SER A CA    1 
ATOM   2246 C  C     . SER A  1  380 ? 26.937  41.926  175.803 1.00 31.30  ? 355 SER A C     1 
ATOM   2247 O  O     . SER A  1  380 ? 27.823  42.462  175.160 1.00 32.02  ? 355 SER A O     1 
ATOM   2248 C  CB    . SER A  1  380 ? 27.461  39.516  175.646 1.00 36.64  ? 355 SER A CB    1 
ATOM   2249 O  OG    . SER A  1  380 ? 27.478  39.172  176.998 1.00 44.07  ? 355 SER A OG    1 
ATOM   2250 N  N     . GLY A  1  381 ? 26.365  42.496  176.844 1.00 29.73  ? 356 GLY A N     1 
ATOM   2251 C  CA    . GLY A  1  381 ? 26.790  43.812  177.332 1.00 30.08  ? 356 GLY A CA    1 
ATOM   2252 C  C     . GLY A  1  381 ? 25.878  44.933  176.860 1.00 29.93  ? 356 GLY A C     1 
ATOM   2253 O  O     . GLY A  1  381 ? 25.964  46.015  177.387 1.00 28.48  ? 356 GLY A O     1 
ATOM   2254 N  N     . ILE A  1  382 ? 25.007  44.684  175.870 1.00 29.22  ? 357 ILE A N     1 
ATOM   2255 C  CA    . ILE A  1  382 ? 24.026  45.668  175.472 1.00 30.82  ? 357 ILE A CA    1 
ATOM   2256 C  C     . ILE A  1  382 ? 22.729  45.352  176.213 1.00 31.29  ? 357 ILE A C     1 
ATOM   2257 O  O     . ILE A  1  382 ? 21.894  44.587  175.720 1.00 29.68  ? 357 ILE A O     1 
ATOM   2258 C  CB    . ILE A  1  382 ? 23.790  45.671  173.955 1.00 33.29  ? 357 ILE A CB    1 
ATOM   2259 C  CG1   . ILE A  1  382 ? 25.113  45.754  173.172 1.00 33.75  ? 357 ILE A CG1   1 
ATOM   2260 C  CG2   . ILE A  1  382 ? 22.849  46.811  173.562 1.00 35.41  ? 357 ILE A CG2   1 
ATOM   2261 C  CD1   . ILE A  1  382 ? 25.829  47.063  173.268 1.00 34.99  ? 357 ILE A CD1   1 
ATOM   2262 N  N     . GLY A  1  383 ? 22.562  45.937  177.401 1.00 28.52  ? 358 GLY A N     1 
ATOM   2263 C  CA    . GLY A  1  383 ? 21.370  45.714  178.239 1.00 25.99  ? 358 GLY A CA    1 
ATOM   2264 C  C     . GLY A  1  383 ? 20.248  46.692  177.953 1.00 28.84  ? 358 GLY A C     1 
ATOM   2265 O  O     . GLY A  1  383 ? 20.337  47.482  176.992 1.00 26.53  ? 358 GLY A O     1 
ATOM   2266 N  N     . LYS A  1  384 ? 19.188  46.637  178.766 1.00 27.12  ? 359 LYS A N     1 
ATOM   2267 C  CA    . LYS A  1  384 ? 17.975  47.473  178.559 1.00 29.31  ? 359 LYS A CA    1 
ATOM   2268 C  C     . LYS A  1  384 ? 18.277  48.961  178.400 1.00 28.45  ? 359 LYS A C     1 
ATOM   2269 O  O     . LYS A  1  384 ? 17.769  49.603  177.478 1.00 28.74  ? 359 LYS A O     1 
ATOM   2270 C  CB    . LYS A  1  384 ? 16.922  47.303  179.694 1.00 28.00  ? 359 LYS A CB    1 
ATOM   2271 N  N     . VAL A  1  385 ? 19.136  49.487  179.259 1.00 28.11  ? 360 VAL A N     1 
ATOM   2272 C  CA    . VAL A  1  385 ? 19.443  50.907  179.274 1.00 28.53  ? 360 VAL A CA    1 
ATOM   2273 C  C     . VAL A  1  385 ? 20.258  51.324  178.076 1.00 28.36  ? 360 VAL A C     1 
ATOM   2274 O  O     . VAL A  1  385 ? 19.895  52.288  177.414 1.00 28.04  ? 360 VAL A O     1 
ATOM   2275 C  CB    . VAL A  1  385 ? 20.163  51.323  180.569 1.00 29.08  ? 360 VAL A CB    1 
ATOM   2276 C  CG1   . VAL A  1  385 ? 20.537  52.805  180.534 1.00 30.36  ? 360 VAL A CG1   1 
ATOM   2277 C  CG2   . VAL A  1  385 ? 19.239  51.048  181.753 1.00 32.69  ? 360 VAL A CG2   1 
ATOM   2278 N  N     . THR A  1  386 ? 21.340  50.591  177.776 1.00 28.42  ? 361 THR A N     1 
ATOM   2279 C  CA    . THR A  1  386 ? 22.146  50.890  176.587 1.00 27.60  ? 361 THR A CA    1 
ATOM   2280 C  C     . THR A  1  386 ? 21.302  50.820  175.327 1.00 28.90  ? 361 THR A C     1 
ATOM   2281 O  O     . THR A  1  386 ? 21.418  51.671  174.454 1.00 27.61  ? 361 THR A O     1 
ATOM   2282 C  CB    . THR A  1  386 ? 23.345  49.993  176.502 1.00 28.27  ? 361 THR A CB    1 
ATOM   2283 O  OG1   . THR A  1  386 ? 24.076  50.128  177.720 1.00 27.73  ? 361 THR A OG1   1 
ATOM   2284 C  CG2   . THR A  1  386 ? 24.243  50.352  175.358 1.00 30.20  ? 361 THR A CG2   1 
ATOM   2285 N  N     . GLU A  1  387 ? 20.391  49.849  175.286 1.00 29.26  ? 362 GLU A N     1 
ATOM   2286 C  CA    . GLU A  1  387 ? 19.490  49.672  174.164 1.00 31.08  ? 362 GLU A CA    1 
ATOM   2287 C  C     . GLU A  1  387 ? 18.598  50.888  174.017 1.00 30.15  ? 362 GLU A C     1 
ATOM   2288 O  O     . GLU A  1  387 ? 18.351  51.357  172.897 1.00 33.04  ? 362 GLU A O     1 
ATOM   2289 C  CB    . GLU A  1  387 ? 18.658  48.387  174.379 1.00 32.76  ? 362 GLU A CB    1 
ATOM   2290 C  CG    . GLU A  1  387 ? 17.719  48.033  173.274 1.00 37.89  ? 362 GLU A CG    1 
ATOM   2291 C  CD    . GLU A  1  387 ? 16.859  46.796  173.558 1.00 40.40  ? 362 GLU A CD    1 
ATOM   2292 O  OE1   . GLU A  1  387 ? 15.986  46.524  172.712 1.00 44.13  ? 362 GLU A OE1   1 
ATOM   2293 O  OE2   . GLU A  1  387 ? 17.036  46.103  174.600 1.00 41.02  ? 362 GLU A OE2   1 
ATOM   2294 N  N     . LYS A  1  388 ? 18.110  51.389  175.146 1.00 31.55  ? 363 LYS A N     1 
ATOM   2295 C  CA    . LYS A  1  388 ? 17.197  52.518  175.140 1.00 33.50  ? 363 LYS A CA    1 
ATOM   2296 C  C     . LYS A  1  388 ? 17.924  53.781  174.662 1.00 32.39  ? 363 LYS A C     1 
ATOM   2297 O  O     . LYS A  1  388 ? 17.418  54.538  173.827 1.00 30.50  ? 363 LYS A O     1 
ATOM   2298 C  CB    . LYS A  1  388 ? 16.584  52.721  176.525 1.00 36.68  ? 363 LYS A CB    1 
ATOM   2299 C  CG    . LYS A  1  388 ? 15.299  53.526  176.488 1.00 43.47  ? 363 LYS A CG    1 
ATOM   2300 C  CD    . LYS A  1  388 ? 14.598  53.607  177.841 1.00 47.36  ? 363 LYS A CD    1 
ATOM   2301 C  CE    . LYS A  1  388 ? 13.217  54.248  177.700 1.00 52.17  ? 363 LYS A CE    1 
ATOM   2302 N  NZ    . LYS A  1  388 ? 12.697  54.763  178.999 1.00 55.56  ? 363 LYS A NZ    1 
ATOM   2303 N  N     . MET A  1  389 ? 19.131  53.978  175.162 1.00 28.55  ? 364 MET A N     1 
ATOM   2304 C  CA    . MET A  1  389 ? 19.911  55.134  174.760 1.00 32.70  ? 364 MET A CA    1 
ATOM   2305 C  C     . MET A  1  389 ? 20.226  55.099  173.274 1.00 31.40  ? 364 MET A C     1 
ATOM   2306 O  O     . MET A  1  389 ? 20.059  56.105  172.604 1.00 31.89  ? 364 MET A O     1 
ATOM   2307 C  CB    . MET A  1  389 ? 21.188  55.242  175.585 1.00 32.96  ? 364 MET A CB    1 
ATOM   2308 C  CG    . MET A  1  389 ? 20.840  55.405  177.057 1.00 38.25  ? 364 MET A CG    1 
ATOM   2309 S  SD    . MET A  1  389 ? 22.161  56.012  178.069 1.00 50.02  ? 364 MET A SD    1 
ATOM   2310 C  CE    . MET A  1  389 ? 23.541  55.021  177.539 1.00 51.24  ? 364 MET A CE    1 
ATOM   2311 N  N     . LEU A  1  390 ? 20.657  53.947  172.755 1.00 29.01  ? 365 LEU A N     1 
ATOM   2312 C  CA    . LEU A  1  390 ? 20.934  53.832  171.338 1.00 28.23  ? 365 LEU A CA    1 
ATOM   2313 C  C     . LEU A  1  390 ? 19.672  53.972  170.477 1.00 29.61  ? 365 LEU A C     1 
ATOM   2314 O  O     . LEU A  1  390 ? 19.714  54.621  169.442 1.00 26.97  ? 365 LEU A O     1 
ATOM   2315 C  CB    . LEU A  1  390 ? 21.674  52.525  171.028 1.00 30.52  ? 365 LEU A CB    1 
ATOM   2316 C  CG    . LEU A  1  390 ? 23.073  52.467  171.668 1.00 33.00  ? 365 LEU A CG    1 
ATOM   2317 C  CD1   . LEU A  1  390 ? 23.638  51.070  171.545 1.00 34.49  ? 365 LEU A CD1   1 
ATOM   2318 C  CD2   . LEU A  1  390 ? 24.044  53.473  171.072 1.00 34.67  ? 365 LEU A CD2   1 
ATOM   2319 N  N     . LYS A  1  391 ? 18.560  53.377  170.907 1.00 30.67  ? 366 LYS A N     1 
ATOM   2320 C  CA    . LYS A  1  391 ? 17.300  53.553  170.219 1.00 33.14  ? 366 LYS A CA    1 
ATOM   2321 C  C     . LYS A  1  391 ? 16.947  55.050  170.053 1.00 36.86  ? 366 LYS A C     1 
ATOM   2322 O  O     . LYS A  1  391 ? 16.512  55.444  168.962 1.00 35.29  ? 366 LYS A O     1 
ATOM   2323 C  CB    . LYS A  1  391 ? 16.185  52.824  170.943 1.00 35.67  ? 366 LYS A CB    1 
ATOM   2324 C  CG    . LYS A  1  391 ? 14.832  52.925  170.289 1.00 41.68  ? 366 LYS A CG    1 
ATOM   2325 C  CD    . LYS A  1  391 ? 13.835  52.012  170.987 1.00 46.46  ? 366 LYS A CD    1 
ATOM   2326 C  CE    . LYS A  1  391 ? 12.430  52.407  170.583 1.00 50.57  ? 366 LYS A CE    1 
ATOM   2327 N  NZ    . LYS A  1  391 ? 11.462  51.503  171.236 1.00 58.72  ? 366 LYS A NZ    1 
ATOM   2328 N  N     . ALA A  1  392 ? 17.182  55.876  171.087 1.00 36.07  ? 367 ALA A N     1 
ATOM   2329 C  CA    . ALA A  1  392 ? 16.964  57.341  170.982 1.00 38.42  ? 367 ALA A CA    1 
ATOM   2330 C  C     . ALA A  1  392 ? 17.744  57.978  169.829 1.00 36.89  ? 367 ALA A C     1 
ATOM   2331 O  O     . ALA A  1  392 ? 17.287  58.932  169.224 1.00 39.77  ? 367 ALA A O     1 
ATOM   2332 C  CB    . ALA A  1  392 ? 17.295  58.047  172.295 1.00 36.28  ? 367 ALA A CB    1 
ATOM   2333 N  N     . LEU A  1  393 ? 18.909  57.416  169.519 1.00 34.63  ? 368 LEU A N     1 
ATOM   2334 C  CA    . LEU A  1  393 ? 19.681  57.795  168.349 1.00 33.11  ? 368 LEU A CA    1 
ATOM   2335 C  C     . LEU A  1  393 ? 19.250  57.130  167.029 1.00 32.76  ? 368 LEU A C     1 
ATOM   2336 O  O     . LEU A  1  393 ? 19.878  57.374  166.010 1.00 36.23  ? 368 LEU A O     1 
ATOM   2337 C  CB    . LEU A  1  393 ? 21.176  57.576  168.604 1.00 32.37  ? 368 LEU A CB    1 
ATOM   2338 C  CG    . LEU A  1  393 ? 21.754  58.245  169.857 1.00 35.41  ? 368 LEU A CG    1 
ATOM   2339 C  CD1   . LEU A  1  393 ? 23.181  57.792  170.160 1.00 33.42  ? 368 LEU A CD1   1 
ATOM   2340 C  CD2   . LEU A  1  393 ? 21.700  59.763  169.695 1.00 36.06  ? 368 LEU A CD2   1 
ATOM   2341 N  N     . GLY A  1  394 ? 18.176  56.346  167.020 1.00 31.97  ? 369 GLY A N     1 
ATOM   2342 C  CA    . GLY A  1  394 ? 17.766  55.614  165.821 1.00 33.95  ? 369 GLY A CA    1 
ATOM   2343 C  C     . GLY A  1  394 ? 18.538  54.316  165.583 1.00 34.39  ? 369 GLY A C     1 
ATOM   2344 O  O     . GLY A  1  394 ? 18.416  53.714  164.535 1.00 34.41  ? 369 GLY A O     1 
ATOM   2345 N  N     . ILE A  1  395 ? 19.303  53.856  166.573 1.00 34.15  ? 370 ILE A N     1 
ATOM   2346 C  CA    . ILE A  1  395 ? 20.151  52.688  166.422 1.00 31.47  ? 370 ILE A CA    1 
ATOM   2347 C  C     . ILE A  1  395 ? 19.463  51.438  167.012 1.00 30.75  ? 370 ILE A C     1 
ATOM   2348 O  O     . ILE A  1  395 ? 19.299  51.341  168.228 1.00 30.43  ? 370 ILE A O     1 
ATOM   2349 C  CB    . ILE A  1  395 ? 21.529  52.948  167.074 1.00 33.19  ? 370 ILE A CB    1 
ATOM   2350 C  CG1   . ILE A  1  395 ? 22.224  54.125  166.378 1.00 34.55  ? 370 ILE A CG1   1 
ATOM   2351 C  CG2   . ILE A  1  395 ? 22.419  51.702  167.007 1.00 32.22  ? 370 ILE A CG2   1 
ATOM   2352 C  CD1   . ILE A  1  395 ? 23.439  54.688  167.103 1.00 35.13  ? 370 ILE A CD1   1 
ATOM   2353 N  N     . ILE A  1  396 ? 19.091  50.495  166.143 1.00 30.15  ? 371 ILE A N     1 
ATOM   2354 C  CA    . ILE A  1  396 ? 18.545  49.183  166.536 1.00 30.64  ? 371 ILE A CA    1 
ATOM   2355 C  C     . ILE A  1  396 ? 19.434  48.005  166.110 1.00 29.83  ? 371 ILE A C     1 
ATOM   2356 O  O     . ILE A  1  396 ? 19.501  46.991  166.802 1.00 33.34  ? 371 ILE A O     1 
ATOM   2357 C  CB    . ILE A  1  396 ? 17.166  48.909  165.889 1.00 34.30  ? 371 ILE A CB    1 
ATOM   2358 C  CG1   . ILE A  1  396 ? 16.180  50.066  166.084 1.00 36.23  ? 371 ILE A CG1   1 
ATOM   2359 C  CG2   . ILE A  1  396 ? 16.548  47.636  166.460 1.00 34.96  ? 371 ILE A CG2   1 
ATOM   2360 C  CD1   . ILE A  1  396 ? 15.737  50.275  167.519 1.00 35.87  ? 371 ILE A CD1   1 
ATOM   2361 N  N     . THR A  1  397 ? 20.061  48.103  164.948 1.00 28.64  ? 372 THR A N     1 
ATOM   2362 C  CA    . THR A  1  397 ? 20.881  47.033  164.405 1.00 27.71  ? 372 THR A CA    1 
ATOM   2363 C  C     . THR A  1  397 ? 22.365  47.388  164.401 1.00 26.35  ? 372 THR A C     1 
ATOM   2364 O  O     . THR A  1  397 ? 22.729  48.554  164.481 1.00 25.35  ? 372 THR A O     1 
ATOM   2365 C  CB    . THR A  1  397 ? 20.473  46.715  162.983 1.00 28.69  ? 372 THR A CB    1 
ATOM   2366 O  OG1   . THR A  1  397 ? 20.917  47.755  162.113 1.00 27.34  ? 372 THR A OG1   1 
ATOM   2367 C  CG2   . THR A  1  397 ? 18.940  46.556  162.884 1.00 32.10  ? 372 THR A CG2   1 
ATOM   2368 N  N     . CYS A  1  398 ? 23.207  46.380  164.230 1.00 27.34  ? 373 CYS A N     1 
ATOM   2369 C  CA    . CYS A  1  398 ? 24.652  46.610  164.145 1.00 28.85  ? 373 CYS A CA    1 
ATOM   2370 C  C     . CYS A  1  398 ? 25.082  47.462  162.935 1.00 27.88  ? 373 CYS A C     1 
ATOM   2371 O  O     . CYS A  1  398 ? 26.062  48.180  163.041 1.00 29.90  ? 373 CYS A O     1 
ATOM   2372 C  CB    . CYS A  1  398 ? 25.412  45.290  164.159 1.00 30.11  ? 373 CYS A CB    1 
ATOM   2373 S  SG    . CYS A  1  398 ? 25.214  44.356  165.693 1.00 31.80  ? 373 CYS A SG    1 
ATOM   2374 N  N     . THR A  1  399 ? 24.338  47.411  161.830 1.00 28.13  ? 374 THR A N     1 
ATOM   2375 C  CA    . THR A  1  399 ? 24.583  48.285  160.676 1.00 30.40  ? 374 THR A CA    1 
ATOM   2376 C  C     . THR A  1  399 ? 24.433  49.739  161.079 1.00 30.06  ? 374 THR A C     1 
ATOM   2377 O  O     . THR A  1  399 ? 25.279  50.549  160.745 1.00 30.82  ? 374 THR A O     1 
ATOM   2378 C  CB    . THR A  1  399 ? 23.561  48.053  159.531 1.00 33.58  ? 374 THR A CB    1 
ATOM   2379 O  OG1   . THR A  1  399 ? 23.663  46.726  159.063 1.00 34.40  ? 374 THR A OG1   1 
ATOM   2380 C  CG2   . THR A  1  399 ? 23.781  48.969  158.339 1.00 34.81  ? 374 THR A CG2   1 
ATOM   2381 N  N     . GLU A  1  400 ? 23.333  50.047  161.776 1.00 28.88  ? 375 GLU A N     1 
ATOM   2382 C  CA    . GLU A  1  400 ? 23.072  51.388  162.253 1.00 28.39  ? 375 GLU A CA    1 
ATOM   2383 C  C     . GLU A  1  400 ? 24.148  51.826  163.246 1.00 27.93  ? 375 GLU A C     1 
ATOM   2384 O  O     . GLU A  1  400 ? 24.592  52.961  163.218 1.00 27.96  ? 375 GLU A O     1 
ATOM   2385 C  CB    . GLU A  1  400 ? 21.673  51.478  162.861 1.00 30.33  ? 375 GLU A CB    1 
ATOM   2386 C  CG    . GLU A  1  400 ? 20.596  51.356  161.782 1.00 32.91  ? 375 GLU A CG    1 
ATOM   2387 C  CD    . GLU A  1  400 ? 19.208  50.987  162.266 1.00 36.20  ? 375 GLU A CD    1 
ATOM   2388 O  OE1   . GLU A  1  400 ? 18.288  51.242  161.478 1.00 45.03  ? 375 GLU A OE1   1 
ATOM   2389 O  OE2   . GLU A  1  400 ? 18.994  50.443  163.375 1.00 34.96  ? 375 GLU A OE2   1 
ATOM   2390 N  N     . LEU A  1  401 ? 24.579  50.919  164.100 1.00 25.18  ? 376 LEU A N     1 
ATOM   2391 C  CA    . LEU A  1  401 ? 25.639  51.216  165.054 1.00 27.87  ? 376 LEU A CA    1 
ATOM   2392 C  C     . LEU A  1  401 ? 26.915  51.681  164.338 1.00 27.51  ? 376 LEU A C     1 
ATOM   2393 O  O     . LEU A  1  401 ? 27.550  52.624  164.785 1.00 32.60  ? 376 LEU A O     1 
ATOM   2394 C  CB    . LEU A  1  401 ? 25.960  49.976  165.916 1.00 28.57  ? 376 LEU A CB    1 
ATOM   2395 C  CG    . LEU A  1  401 ? 26.754  50.141  167.185 1.00 30.44  ? 376 LEU A CG    1 
ATOM   2396 C  CD1   . LEU A  1  401 ? 25.949  50.969  168.176 1.00 30.83  ? 376 LEU A CD1   1 
ATOM   2397 C  CD2   . LEU A  1  401 ? 27.101  48.781  167.797 1.00 32.35  ? 376 LEU A CD2   1 
ATOM   2398 N  N     . TYR A  1  402 ? 27.274  51.000  163.263 1.00 26.71  ? 377 TYR A N     1 
ATOM   2399 C  CA    . TYR A  1  402 ? 28.410  51.341  162.448 1.00 29.63  ? 377 TYR A CA    1 
ATOM   2400 C  C     . TYR A  1  402 ? 28.197  52.682  161.750 1.00 30.51  ? 377 TYR A C     1 
ATOM   2401 O  O     . TYR A  1  402 ? 29.073  53.535  161.788 1.00 31.53  ? 377 TYR A O     1 
ATOM   2402 C  CB    . TYR A  1  402 ? 28.649  50.272  161.380 1.00 30.36  ? 377 TYR A CB    1 
ATOM   2403 C  CG    . TYR A  1  402 ? 29.835  50.595  160.532 1.00 32.96  ? 377 TYR A CG    1 
ATOM   2404 C  CD1   . TYR A  1  402 ? 31.113  50.558  161.073 1.00 35.20  ? 377 TYR A CD1   1 
ATOM   2405 C  CD2   . TYR A  1  402 ? 29.684  50.998  159.202 1.00 35.68  ? 377 TYR A CD2   1 
ATOM   2406 C  CE1   . TYR A  1  402 ? 32.223  50.899  160.312 1.00 37.83  ? 377 TYR A CE1   1 
ATOM   2407 C  CE2   . TYR A  1  402 ? 30.784  51.332  158.425 1.00 38.21  ? 377 TYR A CE2   1 
ATOM   2408 C  CZ    . TYR A  1  402 ? 32.046  51.271  158.990 1.00 39.62  ? 377 TYR A CZ    1 
ATOM   2409 O  OH    . TYR A  1  402 ? 33.135  51.585  158.252 1.00 42.69  ? 377 TYR A OH    1 
ATOM   2410 N  N     . GLN A  1  403 ? 27.043  52.861  161.122 1.00 30.21  ? 378 GLN A N     1 
ATOM   2411 C  CA    . GLN A  1  403 ? 26.716  54.102  160.393 1.00 33.14  ? 378 GLN A CA    1 
ATOM   2412 C  C     . GLN A  1  403 ? 26.816  55.360  161.244 1.00 34.28  ? 378 GLN A C     1 
ATOM   2413 O  O     . GLN A  1  403 ? 27.185  56.399  160.734 1.00 35.38  ? 378 GLN A O     1 
ATOM   2414 C  CB    . GLN A  1  403 ? 25.293  54.059  159.802 1.00 34.98  ? 378 GLN A CB    1 
ATOM   2415 C  CG    . GLN A  1  403 ? 25.154  53.106  158.620 1.00 38.95  ? 378 GLN A CG    1 
ATOM   2416 C  CD    . GLN A  1  403 ? 23.708  52.828  158.251 1.00 43.55  ? 378 GLN A CD    1 
ATOM   2417 O  OE1   . GLN A  1  403 ? 22.779  53.015  159.042 1.00 46.07  ? 378 GLN A OE1   1 
ATOM   2418 N  NE2   . GLN A  1  403 ? 23.513  52.359  157.043 1.00 50.22  ? 378 GLN A NE2   1 
ATOM   2419 N  N     . GLN A  1  404 ? 26.470  55.256  162.530 1.00 31.54  ? 379 GLN A N     1 
ATOM   2420 C  CA    . GLN A  1  404 ? 26.531  56.386  163.454 1.00 31.87  ? 379 GLN A CA    1 
ATOM   2421 C  C     . GLN A  1  404 ? 27.810  56.416  164.276 1.00 29.09  ? 379 GLN A C     1 
ATOM   2422 O  O     . GLN A  1  404 ? 27.856  57.090  165.290 1.00 30.19  ? 379 GLN A O     1 
ATOM   2423 C  CB    . GLN A  1  404 ? 25.357  56.310  164.411 1.00 33.06  ? 379 GLN A CB    1 
ATOM   2424 C  CG    . GLN A  1  404 ? 24.036  56.151  163.696 1.00 39.26  ? 379 GLN A CG    1 
ATOM   2425 C  CD    . GLN A  1  404 ? 23.347  57.450  163.555 1.00 46.97  ? 379 GLN A CD    1 
ATOM   2426 O  OE1   . GLN A  1  404 ? 23.944  58.420  163.114 1.00 51.84  ? 379 GLN A OE1   1 
ATOM   2427 N  NE2   . GLN A  1  404 ? 22.095  57.505  163.994 1.00 55.83  ? 379 GLN A NE2   1 
ATOM   2428 N  N     . ARG A  1  405 ? 28.847  55.703  163.866 1.00 28.91  ? 380 ARG A N     1 
ATOM   2429 C  CA    . ARG A  1  405 ? 30.055  55.626  164.687 1.00 30.32  ? 380 ARG A CA    1 
ATOM   2430 C  C     . ARG A  1  405 ? 30.677  56.995  165.039 1.00 32.51  ? 380 ARG A C     1 
ATOM   2431 O  O     . ARG A  1  405 ? 31.188  57.186  166.150 1.00 33.90  ? 380 ARG A O     1 
ATOM   2432 C  CB    . ARG A  1  405 ? 31.093  54.759  164.002 1.00 28.49  ? 380 ARG A CB    1 
ATOM   2433 C  CG    . ARG A  1  405 ? 31.559  55.272  162.645 1.00 30.22  ? 380 ARG A CG    1 
ATOM   2434 C  CD    . ARG A  1  405 ? 32.209  54.161  161.825 1.00 31.09  ? 380 ARG A CD    1 
ATOM   2435 N  NE    . ARG A  1  405 ? 32.650  54.622  160.521 1.00 32.16  ? 380 ARG A NE    1 
ATOM   2436 C  CZ    . ARG A  1  405 ? 31.873  54.842  159.459 1.00 37.71  ? 380 ARG A CZ    1 
ATOM   2437 N  NH1   . ARG A  1  405 ? 30.550  54.642  159.492 1.00 38.91  ? 380 ARG A NH1   1 
ATOM   2438 N  NH2   . ARG A  1  405 ? 32.436  55.267  158.325 1.00 37.87  ? 380 ARG A NH2   1 
ATOM   2439 N  N     . ALA A  1  406 ? 30.639  57.949  164.105 1.00 35.66  ? 381 ALA A N     1 
ATOM   2440 C  CA    . ALA A  1  406 ? 31.210  59.291  164.373 1.00 34.63  ? 381 ALA A CA    1 
ATOM   2441 C  C     . ALA A  1  406 ? 30.470  59.941  165.541 1.00 32.19  ? 381 ALA A C     1 
ATOM   2442 O  O     . ALA A  1  406 ? 31.077  60.379  166.522 1.00 31.63  ? 381 ALA A O     1 
ATOM   2443 C  CB    . ALA A  1  406 ? 31.170  60.169  163.115 1.00 34.91  ? 381 ALA A CB    1 
ATOM   2444 N  N     . LEU A  1  407 ? 29.148  59.958  165.452 1.00 31.72  ? 382 LEU A N     1 
ATOM   2445 C  CA    . LEU A  1  407 ? 28.305  60.517  166.514 1.00 32.85  ? 382 LEU A CA    1 
ATOM   2446 C  C     . LEU A  1  407 ? 28.533  59.835  167.868 1.00 33.11  ? 382 LEU A C     1 
ATOM   2447 O  O     . LEU A  1  407 ? 28.607  60.506  168.921 1.00 34.69  ? 382 LEU A O     1 
ATOM   2448 C  CB    . LEU A  1  407 ? 26.837  60.446  166.087 1.00 33.49  ? 382 LEU A CB    1 
ATOM   2449 C  CG    . LEU A  1  407 ? 25.732  61.069  166.936 1.00 34.45  ? 382 LEU A CG    1 
ATOM   2450 C  CD1   . LEU A  1  407 ? 25.948  62.538  167.135 1.00 35.99  ? 382 LEU A CD1   1 
ATOM   2451 C  CD2   . LEU A  1  407 ? 24.377  60.872  166.291 1.00 35.14  ? 382 LEU A CD2   1 
ATOM   2452 N  N     . LEU A  1  408 ? 28.692  58.511  167.850 1.00 32.73  ? 383 LEU A N     1 
ATOM   2453 C  CA    . LEU A  1  408 ? 28.876  57.755  169.092 1.00 33.49  ? 383 LEU A CA    1 
ATOM   2454 C  C     . LEU A  1  408 ? 30.170  58.162  169.774 1.00 30.71  ? 383 LEU A C     1 
ATOM   2455 O  O     . LEU A  1  408 ? 30.235  58.191  171.006 1.00 31.98  ? 383 LEU A O     1 
ATOM   2456 C  CB    . LEU A  1  408 ? 28.865  56.242  168.838 1.00 34.43  ? 383 LEU A CB    1 
ATOM   2457 C  CG    . LEU A  1  408 ? 27.538  55.631  168.321 1.00 36.69  ? 383 LEU A CG    1 
ATOM   2458 C  CD1   . LEU A  1  408 ? 27.752  54.193  167.894 1.00 35.91  ? 383 LEU A CD1   1 
ATOM   2459 C  CD2   . LEU A  1  408 ? 26.436  55.721  169.365 1.00 36.49  ? 383 LEU A CD2   1 
ATOM   2460 N  N     . SER A  1  409 ? 31.182  58.492  168.979 1.00 30.27  ? 384 SER A N     1 
ATOM   2461 C  CA    . SER A  1  409 ? 32.490  58.917  169.501 1.00 32.87  ? 384 SER A CA    1 
ATOM   2462 C  C     . SER A  1  409 ? 32.444  60.271  170.228 1.00 32.74  ? 384 SER A C     1 
ATOM   2463 O  O     . SER A  1  409 ? 33.329  60.574  171.017 1.00 35.14  ? 384 SER A O     1 
ATOM   2464 C  CB    . SER A  1  409 ? 33.553  58.945  168.390 1.00 32.94  ? 384 SER A CB    1 
ATOM   2465 O  OG    . SER A  1  409 ? 33.359  60.065  167.525 1.00 34.76  ? 384 SER A OG    1 
ATOM   2466 N  N     . LEU A  1  410 ? 31.415  61.056  169.945 1.00 33.56  ? 385 LEU A N     1 
ATOM   2467 C  CA    . LEU A  1  410 ? 31.184  62.332  170.575 1.00 35.72  ? 385 LEU A CA    1 
ATOM   2468 C  C     . LEU A  1  410 ? 30.158  62.262  171.692 1.00 36.14  ? 385 LEU A C     1 
ATOM   2469 O  O     . LEU A  1  410 ? 30.100  63.174  172.489 1.00 37.51  ? 385 LEU A O     1 
ATOM   2470 C  CB    . LEU A  1  410 ? 30.752  63.367  169.517 1.00 37.39  ? 385 LEU A CB    1 
ATOM   2471 C  CG    . LEU A  1  410 ? 31.817  63.687  168.446 1.00 39.02  ? 385 LEU A CG    1 
ATOM   2472 C  CD1   . LEU A  1  410 ? 31.290  64.672  167.419 1.00 39.16  ? 385 LEU A CD1   1 
ATOM   2473 C  CD2   . LEU A  1  410 ? 33.121  64.219  169.034 1.00 39.88  ? 385 LEU A CD2   1 
ATOM   2474 N  N     . LEU A  1  411 ? 29.323  61.222  171.751 1.00 33.89  ? 386 LEU A N     1 
ATOM   2475 C  CA    . LEU A  1  411 ? 28.300  61.128  172.804 1.00 33.14  ? 386 LEU A CA    1 
ATOM   2476 C  C     . LEU A  1  411 ? 28.601  60.132  173.911 1.00 33.49  ? 386 LEU A C     1 
ATOM   2477 O  O     . LEU A  1  411 ? 27.959  60.181  174.933 1.00 33.45  ? 386 LEU A O     1 
ATOM   2478 C  CB    . LEU A  1  411 ? 26.937  60.793  172.209 1.00 35.72  ? 386 LEU A CB    1 
ATOM   2479 C  CG    . LEU A  1  411 ? 26.360  61.819  171.239 1.00 36.85  ? 386 LEU A CG    1 
ATOM   2480 C  CD1   . LEU A  1  411 ? 25.100  61.248  170.614 1.00 38.16  ? 386 LEU A CD1   1 
ATOM   2481 C  CD2   . LEU A  1  411 ? 26.055  63.138  171.946 1.00 37.39  ? 386 LEU A CD2   1 
ATOM   2482 N  N     . PHE A  1  412 ? 29.587  59.260  173.728 1.00 33.26  ? 387 PHE A N     1 
ATOM   2483 C  CA    . PHE A  1  412 ? 29.887  58.199  174.684 1.00 34.84  ? 387 PHE A CA    1 
ATOM   2484 C  C     . PHE A  1  412 ? 31.357  58.255  174.978 1.00 35.30  ? 387 PHE A C     1 
ATOM   2485 O  O     . PHE A  1  412 ? 32.133  58.746  174.160 1.00 35.26  ? 387 PHE A O     1 
ATOM   2486 C  CB    . PHE A  1  412 ? 29.551  56.827  174.073 1.00 32.81  ? 387 PHE A CB    1 
ATOM   2487 C  CG    . PHE A  1  412 ? 28.090  56.572  173.989 1.00 33.00  ? 387 PHE A CG    1 
ATOM   2488 C  CD1   . PHE A  1  412 ? 27.436  55.896  175.023 1.00 34.86  ? 387 PHE A CD1   1 
ATOM   2489 C  CD2   . PHE A  1  412 ? 27.353  57.028  172.921 1.00 32.28  ? 387 PHE A CD2   1 
ATOM   2490 C  CE1   . PHE A  1  412 ? 26.078  55.666  174.970 1.00 32.46  ? 387 PHE A CE1   1 
ATOM   2491 C  CE2   . PHE A  1  412 ? 25.986  56.793  172.860 1.00 33.36  ? 387 PHE A CE2   1 
ATOM   2492 C  CZ    . PHE A  1  412 ? 25.350  56.121  173.893 1.00 31.85  ? 387 PHE A CZ    1 
ATOM   2493 N  N     . SER A  1  413 ? 31.719  57.715  176.132 1.00 37.21  ? 388 SER A N     1 
ATOM   2494 C  CA    . SER A  1  413 ? 33.106  57.568  176.521 1.00 38.65  ? 388 SER A CA    1 
ATOM   2495 C  C     . SER A  1  413 ? 33.871  56.744  175.506 1.00 41.31  ? 388 SER A C     1 
ATOM   2496 O  O     . SER A  1  413 ? 33.289  56.024  174.683 1.00 39.67  ? 388 SER A O     1 
ATOM   2497 C  CB    . SER A  1  413 ? 33.194  56.855  177.872 1.00 39.40  ? 388 SER A CB    1 
ATOM   2498 O  OG    . SER A  1  413 ? 32.651  55.536  177.780 1.00 41.98  ? 388 SER A OG    1 
ATOM   2499 N  N     . GLU A  1  414 ? 35.184  56.826  175.615 1.00 38.91  ? 389 GLU A N     1 
ATOM   2500 C  CA    . GLU A  1  414 ? 36.080  56.058  174.791 1.00 42.51  ? 389 GLU A CA    1 
ATOM   2501 C  C     . GLU A  1  414 ? 35.856  54.551  174.960 1.00 39.94  ? 389 GLU A C     1 
ATOM   2502 O  O     . GLU A  1  414 ? 35.842  53.832  173.980 1.00 37.41  ? 389 GLU A O     1 
ATOM   2503 C  CB    . GLU A  1  414 ? 37.517  56.427  175.124 1.00 46.97  ? 389 GLU A CB    1 
ATOM   2504 C  CG    . GLU A  1  414 ? 38.546  55.876  174.157 1.00 54.25  ? 389 GLU A CG    1 
ATOM   2505 C  CD    . GLU A  1  414 ? 39.862  56.635  174.189 1.00 62.17  ? 389 GLU A CD    1 
ATOM   2506 O  OE1   . GLU A  1  414 ? 40.031  57.542  175.029 1.00 63.45  ? 389 GLU A OE1   1 
ATOM   2507 O  OE2   . GLU A  1  414 ? 40.738  56.324  173.352 1.00 69.60  ? 389 GLU A OE2   1 
ATOM   2508 N  N     . THR A  1  415 ? 35.652  54.077  176.186 1.00 40.84  ? 390 THR A N     1 
ATOM   2509 C  CA    . THR A  1  415 ? 35.484  52.633  176.407 1.00 42.08  ? 390 THR A CA    1 
ATOM   2510 C  C     . THR A  1  415 ? 34.198  52.146  175.765 1.00 39.30  ? 390 THR A C     1 
ATOM   2511 O  O     . THR A  1  415 ? 34.182  51.067  175.196 1.00 39.78  ? 390 THR A O     1 
ATOM   2512 C  CB    . THR A  1  415 ? 35.486  52.197  177.892 1.00 44.46  ? 390 THR A CB    1 
ATOM   2513 O  OG1   . THR A  1  415 ? 34.335  52.708  178.571 1.00 57.57  ? 390 THR A OG1   1 
ATOM   2514 C  CG2   . THR A  1  415 ? 36.743  52.637  178.585 1.00 43.14  ? 390 THR A CG2   1 
ATOM   2515 N  N     . SER A  1  416 ? 33.149  52.954  175.843 1.00 32.87  ? 391 SER A N     1 
ATOM   2516 C  CA    . SER A  1  416 ? 31.906  52.637  175.198 1.00 33.69  ? 391 SER A CA    1 
ATOM   2517 C  C     . SER A  1  416 ? 31.928  52.714  173.681 1.00 34.79  ? 391 SER A C     1 
ATOM   2518 O  O     . SER A  1  416 ? 31.521  51.732  173.043 1.00 32.71  ? 391 SER A O     1 
ATOM   2519 C  CB    . SER A  1  416 ? 30.777  53.465  175.743 1.00 31.87  ? 391 SER A CB    1 
ATOM   2520 O  OG    . SER A  1  416 ? 30.501  53.023  177.040 1.00 32.26  ? 391 SER A OG    1 
ATOM   2521 N  N     . TRP A  1  417 ? 32.350  53.831  173.069 1.00 32.55  ? 392 TRP A N     1 
ATOM   2522 C  CA    . TRP A  1  417 ? 32.370  53.840  171.592 1.00 31.47  ? 392 TRP A CA    1 
ATOM   2523 C  C     . TRP A  1  417 ? 33.390  52.863  170.980 1.00 32.28  ? 392 TRP A C     1 
ATOM   2524 O  O     . TRP A  1  417 ? 33.159  52.346  169.894 1.00 32.71  ? 392 TRP A O     1 
ATOM   2525 C  CB    . TRP A  1  417 ? 32.442  55.230  170.965 1.00 35.24  ? 392 TRP A CB    1 
ATOM   2526 C  CG    . TRP A  1  417 ? 33.766  55.919  170.937 1.00 34.10  ? 392 TRP A CG    1 
ATOM   2527 C  CD1   . TRP A  1  417 ? 34.179  56.902  171.788 1.00 34.39  ? 392 TRP A CD1   1 
ATOM   2528 C  CD2   . TRP A  1  417 ? 34.811  55.758  169.965 1.00 34.73  ? 392 TRP A CD2   1 
ATOM   2529 N  NE1   . TRP A  1  417 ? 35.428  57.353  171.415 1.00 35.33  ? 392 TRP A NE1   1 
ATOM   2530 C  CE2   . TRP A  1  417 ? 35.837  56.682  170.298 1.00 36.02  ? 392 TRP A CE2   1 
ATOM   2531 C  CE3   . TRP A  1  417 ? 34.985  54.931  168.847 1.00 35.07  ? 392 TRP A CE3   1 
ATOM   2532 C  CZ2   . TRP A  1  417 ? 37.043  56.767  169.578 1.00 37.65  ? 392 TRP A CZ2   1 
ATOM   2533 C  CZ3   . TRP A  1  417 ? 36.173  55.039  168.111 1.00 37.16  ? 392 TRP A CZ3   1 
ATOM   2534 C  CH2   . TRP A  1  417 ? 37.190  55.951  168.492 1.00 36.42  ? 392 TRP A CH2   1 
ATOM   2535 N  N     . HIS A  1  418 ? 34.490  52.579  171.673 1.00 31.02  ? 393 HIS A N     1 
ATOM   2536 C  CA    . HIS A  1  418 ? 35.408  51.514  171.225 1.00 32.69  ? 393 HIS A CA    1 
ATOM   2537 C  C     . HIS A  1  418 ? 34.697  50.148  171.195 1.00 29.52  ? 393 HIS A C     1 
ATOM   2538 O  O     . HIS A  1  418 ? 34.850  49.390  170.258 1.00 28.06  ? 393 HIS A O     1 
ATOM   2539 C  CB    . HIS A  1  418 ? 36.647  51.415  172.145 1.00 36.31  ? 393 HIS A CB    1 
ATOM   2540 C  CG    . HIS A  1  418 ? 37.701  52.442  171.861 1.00 41.93  ? 393 HIS A CG    1 
ATOM   2541 N  ND1   . HIS A  1  418 ? 39.001  52.326  172.319 1.00 46.64  ? 393 HIS A ND1   1 
ATOM   2542 C  CD2   . HIS A  1  418 ? 37.654  53.598  171.154 1.00 45.27  ? 393 HIS A CD2   1 
ATOM   2543 C  CE1   . HIS A  1  418 ? 39.702  53.372  171.914 1.00 46.82  ? 393 HIS A CE1   1 
ATOM   2544 N  NE2   . HIS A  1  418 ? 38.910  54.157  171.203 1.00 44.83  ? 393 HIS A NE2   1 
ATOM   2545 N  N     . TYR A  1  419 ? 33.919  49.867  172.231 1.00 27.83  ? 394 TYR A N     1 
ATOM   2546 C  CA    . TYR A  1  419 ? 33.159  48.622  172.327 1.00 30.75  ? 394 TYR A CA    1 
ATOM   2547 C  C     . TYR A  1  419 ? 32.128  48.554  171.222 1.00 27.85  ? 394 TYR A C     1 
ATOM   2548 O  O     . TYR A  1  419 ? 32.083  47.573  170.491 1.00 28.56  ? 394 TYR A O     1 
ATOM   2549 C  CB    . TYR A  1  419 ? 32.556  48.490  173.723 1.00 33.45  ? 394 TYR A CB    1 
ATOM   2550 C  CG    . TYR A  1  419 ? 31.473  47.441  173.917 1.00 37.98  ? 394 TYR A CG    1 
ATOM   2551 C  CD1   . TYR A  1  419 ? 31.753  46.073  173.926 1.00 39.66  ? 394 TYR A CD1   1 
ATOM   2552 C  CD2   . TYR A  1  419 ? 30.170  47.844  174.173 1.00 42.51  ? 394 TYR A CD2   1 
ATOM   2553 C  CE1   . TYR A  1  419 ? 30.735  45.132  174.154 1.00 41.83  ? 394 TYR A CE1   1 
ATOM   2554 C  CE2   . TYR A  1  419 ? 29.160  46.938  174.393 1.00 45.99  ? 394 TYR A CE2   1 
ATOM   2555 C  CZ    . TYR A  1  419 ? 29.429  45.591  174.395 1.00 45.96  ? 394 TYR A CZ    1 
ATOM   2556 O  OH    . TYR A  1  419 ? 28.333  44.780  174.635 1.00 48.30  ? 394 TYR A OH    1 
ATOM   2557 N  N     . PHE A  1  420 ? 31.370  49.628  171.040 1.00 28.03  ? 395 PHE A N     1 
ATOM   2558 C  CA    . PHE A  1  420 ? 30.403  49.701  169.942 1.00 27.80  ? 395 PHE A CA    1 
ATOM   2559 C  C     . PHE A  1  420 ? 31.018  49.471  168.573 1.00 28.48  ? 395 PHE A C     1 
ATOM   2560 O  O     . PHE A  1  420 ? 30.446  48.751  167.743 1.00 25.55  ? 395 PHE A O     1 
ATOM   2561 C  CB    . PHE A  1  420 ? 29.642  51.014  169.912 1.00 25.93  ? 395 PHE A CB    1 
ATOM   2562 C  CG    . PHE A  1  420 ? 28.841  51.320  171.131 1.00 26.83  ? 395 PHE A CG    1 
ATOM   2563 C  CD1   . PHE A  1  420 ? 28.298  50.323  171.946 1.00 27.20  ? 395 PHE A CD1   1 
ATOM   2564 C  CD2   . PHE A  1  420 ? 28.553  52.648  171.436 1.00 28.03  ? 395 PHE A CD2   1 
ATOM   2565 C  CE1   . PHE A  1  420 ? 27.530  50.649  173.046 1.00 27.46  ? 395 PHE A CE1   1 
ATOM   2566 C  CE2   . PHE A  1  420 ? 27.809  52.977  172.559 1.00 28.64  ? 395 PHE A CE2   1 
ATOM   2567 C  CZ    . PHE A  1  420 ? 27.292  51.978  173.362 1.00 29.04  ? 395 PHE A CZ    1 
ATOM   2568 N  N     . LEU A  1  421 ? 32.184  50.059  168.333 1.00 28.70  ? 396 LEU A N     1 
ATOM   2569 C  CA    . LEU A  1  421 ? 32.852  49.884  167.049 1.00 30.45  ? 396 LEU A CA    1 
ATOM   2570 C  C     . LEU A  1  421 ? 33.299  48.417  166.782 1.00 29.83  ? 396 LEU A C     1 
ATOM   2571 O  O     . LEU A  1  421 ? 33.117  47.906  165.672 1.00 31.41  ? 396 LEU A O     1 
ATOM   2572 C  CB    . LEU A  1  421 ? 34.049  50.828  166.943 1.00 33.54  ? 396 LEU A CB    1 
ATOM   2573 C  CG    . LEU A  1  421 ? 34.764  50.814  165.603 1.00 36.23  ? 396 LEU A CG    1 
ATOM   2574 C  CD1   . LEU A  1  421 ? 33.834  51.317  164.517 1.00 37.58  ? 396 LEU A CD1   1 
ATOM   2575 C  CD2   . LEU A  1  421 ? 35.992  51.693  165.705 1.00 40.70  ? 396 LEU A CD2   1 
ATOM   2576 N  N     . HIS A  1  422 ? 33.872  47.755  167.785 1.00 29.32  ? 397 HIS A N     1 
ATOM   2577 C  CA    . HIS A  1  422 ? 34.157  46.306  167.701 1.00 29.58  ? 397 HIS A CA    1 
ATOM   2578 C  C     . HIS A  1  422 ? 32.895  45.512  167.330 1.00 28.57  ? 397 HIS A C     1 
ATOM   2579 O  O     . HIS A  1  422 ? 32.927  44.727  166.371 1.00 27.73  ? 397 HIS A O     1 
ATOM   2580 C  CB    . HIS A  1  422 ? 34.753  45.771  168.994 1.00 29.39  ? 397 HIS A CB    1 
ATOM   2581 C  CG    . HIS A  1  422 ? 36.199  46.117  169.183 1.00 34.16  ? 397 HIS A CG    1 
ATOM   2582 N  ND1   . HIS A  1  422 ? 36.615  47.318  169.711 1.00 35.38  ? 397 HIS A ND1   1 
ATOM   2583 C  CD2   . HIS A  1  422 ? 37.330  45.403  168.951 1.00 38.25  ? 397 HIS A CD2   1 
ATOM   2584 C  CE1   . HIS A  1  422 ? 37.933  47.325  169.822 1.00 37.27  ? 397 HIS A CE1   1 
ATOM   2585 N  NE2   . HIS A  1  422 ? 38.393  46.179  169.358 1.00 38.40  ? 397 HIS A NE2   1 
ATOM   2586 N  N     . ILE A  1  423 ? 31.792  45.758  168.044 1.00 26.51  ? 398 ILE A N     1 
ATOM   2587 C  CA    . ILE A  1  423 ? 30.506  45.074  167.750 1.00 30.20  ? 398 ILE A CA    1 
ATOM   2588 C  C     . ILE A  1  423 ? 30.167  45.302  166.304 1.00 27.55  ? 398 ILE A C     1 
ATOM   2589 O  O     . ILE A  1  423 ? 29.905  44.352  165.552 1.00 25.65  ? 398 ILE A O     1 
ATOM   2590 C  CB    . ILE A  1  423 ? 29.308  45.587  168.597 1.00 30.23  ? 398 ILE A CB    1 
ATOM   2591 C  CG1   . ILE A  1  423 ? 29.494  45.390  170.104 1.00 35.45  ? 398 ILE A CG1   1 
ATOM   2592 C  CG2   . ILE A  1  423 ? 27.981  44.979  168.159 1.00 32.90  ? 398 ILE A CG2   1 
ATOM   2593 C  CD1   . ILE A  1  423 ? 30.294  44.206  170.525 1.00 39.24  ? 398 ILE A CD1   1 
ATOM   2594 N  N     . SER A  1  424 ? 30.213  46.567  165.892 1.00 27.81  ? 399 SER A N     1 
ATOM   2595 C  CA    . SER A  1  424 ? 29.739  46.954  164.575 1.00 30.52  ? 399 SER A CA    1 
ATOM   2596 C  C     . SER A  1  424 ? 30.625  46.396  163.456 1.00 29.04  ? 399 SER A C     1 
ATOM   2597 O  O     . SER A  1  424 ? 30.164  46.243  162.343 1.00 26.53  ? 399 SER A O     1 
ATOM   2598 C  CB    . SER A  1  424 ? 29.546  48.492  164.487 1.00 31.29  ? 399 SER A CB    1 
ATOM   2599 O  OG    . SER A  1  424 ? 30.780  49.145  164.359 1.00 37.22  ? 399 SER A OG    1 
ATOM   2600 N  N     . LEU A  1  425 ? 31.873  46.041  163.758 1.00 27.03  ? 400 LEU A N     1 
ATOM   2601 C  CA    . LEU A  1  425 ? 32.694  45.351  162.799 1.00 28.07  ? 400 LEU A CA    1 
ATOM   2602 C  C     . LEU A  1  425 ? 32.681  43.814  162.942 1.00 28.86  ? 400 LEU A C     1 
ATOM   2603 O  O     . LEU A  1  425 ? 33.422  43.147  162.232 1.00 28.97  ? 400 LEU A O     1 
ATOM   2604 C  CB    . LEU A  1  425 ? 34.116  45.895  162.883 1.00 30.56  ? 400 LEU A CB    1 
ATOM   2605 C  CG    . LEU A  1  425 ? 34.219  47.373  162.454 1.00 32.33  ? 400 LEU A CG    1 
ATOM   2606 C  CD1   . LEU A  1  425 ? 35.604  47.902  162.776 1.00 34.75  ? 400 LEU A CD1   1 
ATOM   2607 C  CD2   . LEU A  1  425 ? 33.965  47.481  160.962 1.00 35.97  ? 400 LEU A CD2   1 
ATOM   2608 N  N     . GLY A  1  426 ? 31.899  43.264  163.876 1.00 28.03  ? 401 GLY A N     1 
ATOM   2609 C  CA    . GLY A  1  426 ? 31.878  41.811  164.121 1.00 26.18  ? 401 GLY A CA    1 
ATOM   2610 C  C     . GLY A  1  426 ? 33.173  41.261  164.750 1.00 27.83  ? 401 GLY A C     1 
ATOM   2611 O  O     . GLY A  1  426 ? 33.532  40.105  164.476 1.00 26.33  ? 401 GLY A O     1 
ATOM   2612 N  N     . LEU A  1  427 ? 33.834  42.063  165.593 1.00 23.66  ? 402 LEU A N     1 
ATOM   2613 C  CA    . LEU A  1  427 ? 35.119  41.705  166.261 1.00 28.00  ? 402 LEU A CA    1 
ATOM   2614 C  C     . LEU A  1  427 ? 34.897  41.379  167.708 1.00 26.76  ? 402 LEU A C     1 
ATOM   2615 O  O     . LEU A  1  427 ? 33.954  41.843  168.305 1.00 31.88  ? 402 LEU A O     1 
ATOM   2616 C  CB    . LEU A  1  427 ? 36.128  42.855  166.213 1.00 26.79  ? 402 LEU A CB    1 
ATOM   2617 C  CG    . LEU A  1  427 ? 36.484  43.334  164.817 1.00 29.46  ? 402 LEU A CG    1 
ATOM   2618 C  CD1   . LEU A  1  427 ? 37.192  44.678  164.822 1.00 33.81  ? 402 LEU A CD1   1 
ATOM   2619 C  CD2   . LEU A  1  427 ? 37.348  42.315  164.082 1.00 29.48  ? 402 LEU A CD2   1 
ATOM   2620 N  N     . GLY A  1  428 ? 35.784  40.585  168.269 1.00 28.27  ? 403 GLY A N     1 
ATOM   2621 C  CA    . GLY A  1  428 ? 35.790  40.299  169.709 1.00 27.96  ? 403 GLY A CA    1 
ATOM   2622 C  C     . GLY A  1  428 ? 37.014  39.453  169.997 1.00 28.64  ? 403 GLY A C     1 
ATOM   2623 O  O     . GLY A  1  428 ? 37.827  39.274  169.097 1.00 28.38  ? 403 GLY A O     1 
ATOM   2624 N  N     . SER A  1  429 ? 37.110  38.877  171.201 1.00 30.17  ? 404 SER A N     1 
ATOM   2625 C  CA    . SER A  1  429 ? 38.295  38.112  171.619 1.00 31.57  ? 404 SER A CA    1 
ATOM   2626 C  C     . SER A  1  429 ? 38.434  36.816  170.862 1.00 33.01  ? 404 SER A C     1 
ATOM   2627 O  O     . SER A  1  429 ? 37.467  36.070  170.716 1.00 31.53  ? 404 SER A O     1 
ATOM   2628 C  CB    . SER A  1  429 ? 38.265  37.771  173.120 1.00 33.28  ? 404 SER A CB    1 
ATOM   2629 O  OG    . SER A  1  429 ? 38.235  38.936  173.885 1.00 39.99  ? 404 SER A OG    1 
ATOM   2630 N  N     . THR A  1  430 ? 39.659  36.561  170.407 1.00 32.12  ? 405 THR A N     1 
ATOM   2631 C  CA    . THR A  1  430 ? 39.996  35.374  169.662 1.00 34.92  ? 405 THR A CA    1 
ATOM   2632 C  C     . THR A  1  430 ? 40.938  34.500  170.464 1.00 36.27  ? 405 THR A C     1 
ATOM   2633 O  O     . THR A  1  430 ? 41.448  33.542  169.941 1.00 39.29  ? 405 THR A O     1 
ATOM   2634 C  CB    . THR A  1  430 ? 40.637  35.729  168.302 1.00 35.00  ? 405 THR A CB    1 
ATOM   2635 O  OG1   . THR A  1  430 ? 41.831  36.489  168.521 1.00 35.58  ? 405 THR A OG1   1 
ATOM   2636 C  CG2   . THR A  1  430 ? 39.672  36.575  167.456 1.00 33.54  ? 405 THR A CG2   1 
ATOM   2637 N  N     . HIS A  1  431 ? 41.179  34.840  171.720 1.00 36.98  ? 406 HIS A N     1 
ATOM   2638 C  CA    . HIS A  1  431 ? 41.844  33.937  172.633 1.00 43.82  ? 406 HIS A CA    1 
ATOM   2639 C  C     . HIS A  1  431 ? 41.249  34.158  174.014 1.00 40.50  ? 406 HIS A C     1 
ATOM   2640 O  O     . HIS A  1  431 ? 40.739  35.231  174.305 1.00 40.92  ? 406 HIS A O     1 
ATOM   2641 C  CB    . HIS A  1  431 ? 43.366  34.097  172.619 1.00 49.85  ? 406 HIS A CB    1 
ATOM   2642 C  CG    . HIS A  1  431 ? 43.853  35.325  173.305 1.00 57.98  ? 406 HIS A CG    1 
ATOM   2643 N  ND1   . HIS A  1  431 ? 44.092  36.504  172.631 1.00 74.03  ? 406 HIS A ND1   1 
ATOM   2644 C  CD2   . HIS A  1  431 ? 44.156  35.563  174.602 1.00 67.51  ? 406 HIS A CD2   1 
ATOM   2645 C  CE1   . HIS A  1  431 ? 44.521  37.418  173.483 1.00 73.98  ? 406 HIS A CE1   1 
ATOM   2646 N  NE2   . HIS A  1  431 ? 44.568  36.873  174.687 1.00 76.01  ? 406 HIS A NE2   1 
ATOM   2647 N  N     . LEU A  1  432 ? 41.292  33.110  174.824 1.00 36.57  ? 407 LEU A N     1 
ATOM   2648 C  CA    . LEU A  1  432 ? 40.659  33.080  176.113 1.00 40.03  ? 407 LEU A CA    1 
ATOM   2649 C  C     . LEU A  1  432 ? 41.768  33.249  177.140 1.00 47.25  ? 407 LEU A C     1 
ATOM   2650 O  O     . LEU A  1  432 ? 42.858  32.696  176.973 1.00 49.75  ? 407 LEU A O     1 
ATOM   2651 C  CB    . LEU A  1  432 ? 39.951  31.740  176.300 1.00 37.06  ? 407 LEU A CB    1 
ATOM   2652 C  CG    . LEU A  1  432 ? 39.029  31.333  175.139 1.00 38.20  ? 407 LEU A CG    1 
ATOM   2653 C  CD1   . LEU A  1  432 ? 38.371  30.008  175.471 1.00 39.64  ? 407 LEU A CD1   1 
ATOM   2654 C  CD2   . LEU A  1  432 ? 37.989  32.395  174.869 1.00 37.97  ? 407 LEU A CD2   1 
ATOM   2655 N  N     . THR A  1  433 ? 41.503  34.042  178.163 1.00 54.72  ? 408 THR A N     1 
ATOM   2656 C  CA    . THR A  1  433 ? 42.447  34.266  179.253 1.00 68.13  ? 408 THR A CA    1 
ATOM   2657 C  C     . THR A  1  433 ? 42.099  33.392  180.456 1.00 76.07  ? 408 THR A C     1 
ATOM   2658 O  O     . THR A  1  433 ? 40.915  33.138  180.725 1.00 81.96  ? 408 THR A O     1 
ATOM   2659 C  CB    . THR A  1  433 ? 42.411  35.734  179.665 1.00 70.05  ? 408 THR A CB    1 
ATOM   2660 O  OG1   . THR A  1  433 ? 41.064  36.088  180.031 1.00 72.67  ? 408 THR A OG1   1 
ATOM   2661 C  CG2   . THR A  1  433 ? 42.890  36.607  178.500 1.00 70.67  ? 408 THR A CG2   1 
ATOM   2662 N  N     . ARG A  1  434 ? 43.131  32.931  181.169 1.00 86.33  ? 409 ARG A N     1 
ATOM   2663 C  CA    . ARG A  1  434 ? 42.947  32.108  182.379 1.00 91.02  ? 409 ARG A CA    1 
ATOM   2664 C  C     . ARG A  1  434 ? 42.259  32.928  183.475 1.00 93.66  ? 409 ARG A C     1 
ATOM   2665 O  O     . ARG A  1  434 ? 42.506  34.136  183.592 1.00 85.47  ? 409 ARG A O     1 
ATOM   2666 C  CB    . ARG A  1  434 ? 44.296  31.575  182.887 1.00 86.47  ? 409 ARG A CB    1 
ATOM   2667 N  N     . ASP A  1  435 ? 41.392  32.279  184.258 1.00 98.46  ? 410 ASP A N     1 
ATOM   2668 C  CA    . ASP A  1  435 ? 40.664  32.955  185.349 1.00 103.85 ? 410 ASP A CA    1 
ATOM   2669 C  C     . ASP A  1  435 ? 41.641  33.678  186.306 1.00 106.02 ? 410 ASP A C     1 
ATOM   2670 O  O     . ASP A  1  435 ? 42.389  33.024  187.039 1.00 117.44 ? 410 ASP A O     1 
ATOM   2671 C  CB    . ASP A  1  435 ? 39.789  31.956  186.121 1.00 96.21  ? 410 ASP A CB    1 
ATOM   2672 N  N     . GLY A  1  436 ? 41.642  35.016  186.276 1.00 97.98  ? 411 GLY A N     1 
ATOM   2673 C  CA    . GLY A  1  436 ? 42.598  35.822  187.049 1.00 92.32  ? 411 GLY A CA    1 
ATOM   2674 C  C     . GLY A  1  436 ? 42.336  35.847  188.550 1.00 90.18  ? 411 GLY A C     1 
ATOM   2675 O  O     . GLY A  1  436 ? 41.495  35.098  189.060 1.00 86.97  ? 411 GLY A O     1 
ATOM   2676 N  N     . GLU A  1  437 ? 43.075  36.698  189.263 1.00 82.11  ? 412 GLU A N     1 
ATOM   2677 C  CA    . GLU A  1  437 ? 42.823  36.947  190.687 1.00 77.43  ? 412 GLU A CA    1 
ATOM   2678 C  C     . GLU A  1  437 ? 41.478  37.680  190.866 1.00 73.95  ? 412 GLU A C     1 
ATOM   2679 O  O     . GLU A  1  437 ? 41.275  38.748  190.271 1.00 70.11  ? 412 GLU A O     1 
ATOM   2680 C  CB    . GLU A  1  437 ? 43.959  37.780  191.299 1.00 75.63  ? 412 GLU A CB    1 
ATOM   2681 N  N     . ARG A  1  438 ? 40.566  37.102  191.665 1.00 70.29  ? 413 ARG A N     1 
ATOM   2682 C  CA    . ARG A  1  438 ? 39.304  37.777  192.047 1.00 63.42  ? 413 ARG A CA    1 
ATOM   2683 C  C     . ARG A  1  438 ? 39.571  39.108  192.743 1.00 58.89  ? 413 ARG A C     1 
ATOM   2684 O  O     . ARG A  1  438 ? 40.559  39.249  193.456 1.00 61.82  ? 413 ARG A O     1 
ATOM   2685 C  CB    . ARG A  1  438 ? 38.407  36.912  192.939 1.00 61.94  ? 413 ARG A CB    1 
ATOM   2686 C  CG    . ARG A  1  438 ? 39.015  36.510  194.277 1.00 64.45  ? 413 ARG A CG    1 
ATOM   2687 C  CD    . ARG A  1  438 ? 37.963  36.236  195.341 1.00 65.89  ? 413 ARG A CD    1 
ATOM   2688 N  NE    . ARG A  1  438 ? 37.151  35.044  195.059 1.00 69.05  ? 413 ARG A NE    1 
ATOM   2689 C  CZ    . ARG A  1  438 ? 35.845  35.027  194.763 1.00 68.81  ? 413 ARG A CZ    1 
ATOM   2690 N  NH1   . ARG A  1  438 ? 35.116  36.145  194.681 1.00 63.54  ? 413 ARG A NH1   1 
ATOM   2691 N  NH2   . ARG A  1  438 ? 35.253  33.858  194.540 1.00 72.03  ? 413 ARG A NH2   1 
ATOM   2692 N  N     . LYS A  1  439 ? 38.708  40.084  192.497 1.00 52.34  ? 414 LYS A N     1 
ATOM   2693 C  CA    . LYS A  1  439 ? 38.905  41.447  192.991 1.00 49.64  ? 414 LYS A CA    1 
ATOM   2694 C  C     . LYS A  1  439 ? 38.007  41.740  194.169 1.00 45.04  ? 414 LYS A C     1 
ATOM   2695 O  O     . LYS A  1  439 ? 38.283  42.650  194.943 1.00 42.30  ? 414 LYS A O     1 
ATOM   2696 C  CB    . LYS A  1  439 ? 38.672  42.469  191.872 1.00 53.63  ? 414 LYS A CB    1 
ATOM   2697 C  CG    . LYS A  1  439 ? 39.295  42.047  190.547 1.00 62.13  ? 414 LYS A CG    1 
ATOM   2698 C  CD    . LYS A  1  439 ? 39.451  43.179  189.546 1.00 63.89  ? 414 LYS A CD    1 
ATOM   2699 C  CE    . LYS A  1  439 ? 39.876  42.599  188.204 1.00 66.90  ? 414 LYS A CE    1 
ATOM   2700 N  NZ    . LYS A  1  439 ? 40.371  43.653  187.290 1.00 69.12  ? 414 LYS A NZ    1 
ATOM   2701 N  N     . SER A  1  440 ? 36.927  40.980  194.326 1.00 46.64  ? 415 SER A N     1 
ATOM   2702 C  CA    . SER A  1  440 ? 36.035  41.210  195.453 1.00 42.42  ? 415 SER A CA    1 
ATOM   2703 C  C     . SER A  1  440 ? 35.393  39.932  195.903 1.00 43.00  ? 415 SER A C     1 
ATOM   2704 O  O     . SER A  1  440 ? 35.384  38.939  195.181 1.00 46.89  ? 415 SER A O     1 
ATOM   2705 C  CB    . SER A  1  440 ? 34.974  42.289  195.108 1.00 39.03  ? 415 SER A CB    1 
ATOM   2706 O  OG    . SER A  1  440 ? 33.905  41.761  194.353 1.00 40.59  ? 415 SER A OG    1 
ATOM   2707 N  N     . MET A  1  441 ? 34.881  39.965  197.129 1.00 43.19  ? 416 MET A N     1 
ATOM   2708 C  CA    . MET A  1  441 ? 34.011  38.928  197.635 1.00 41.07  ? 416 MET A CA    1 
ATOM   2709 C  C     . MET A  1  441 ? 32.933  39.613  198.437 1.00 36.27  ? 416 MET A C     1 
ATOM   2710 O  O     . MET A  1  441 ? 33.190  40.632  199.082 1.00 35.03  ? 416 MET A O     1 
ATOM   2711 C  CB    . MET A  1  441 ? 34.828  37.985  198.510 1.00 46.09  ? 416 MET A CB    1 
ATOM   2712 C  CG    . MET A  1  441 ? 34.222  36.623  198.721 1.00 51.36  ? 416 MET A CG    1 
ATOM   2713 S  SD    . MET A  1  441 ? 35.371  35.533  199.621 1.00 59.21  ? 416 MET A SD    1 
ATOM   2714 C  CE    . MET A  1  441 ? 36.718  35.339  198.473 1.00 56.01  ? 416 MET A CE    1 
ATOM   2715 N  N     . SER A  1  442 ? 31.729  39.059  198.406 1.00 35.70  ? 417 SER A N     1 
ATOM   2716 C  CA    . SER A  1  442 ? 30.600  39.696  199.049 1.00 35.04  ? 417 SER A CA    1 
ATOM   2717 C  C     . SER A  1  442 ? 29.503  38.729  199.449 1.00 33.44  ? 417 SER A C     1 
ATOM   2718 O  O     . SER A  1  442 ? 29.395  37.631  198.921 1.00 34.12  ? 417 SER A O     1 
ATOM   2719 C  CB    . SER A  1  442 ? 30.012  40.800  198.128 1.00 36.77  ? 417 SER A CB    1 
ATOM   2720 O  OG    . SER A  1  442 ? 29.239  40.256  197.083 1.00 39.57  ? 417 SER A OG    1 
ATOM   2721 N  N     . VAL A  1  443 ? 28.662  39.195  200.355 1.00 29.36  ? 418 VAL A N     1 
ATOM   2722 C  CA    . VAL A  1  443 ? 27.497  38.486  200.782 1.00 31.62  ? 418 VAL A CA    1 
ATOM   2723 C  C     . VAL A  1  443 ? 26.407  39.513  201.029 1.00 31.36  ? 418 VAL A C     1 
ATOM   2724 O  O     . VAL A  1  443 ? 26.652  40.566  201.623 1.00 29.85  ? 418 VAL A O     1 
ATOM   2725 C  CB    . VAL A  1  443 ? 27.781  37.612  202.045 1.00 34.18  ? 418 VAL A CB    1 
ATOM   2726 C  CG1   . VAL A  1  443 ? 28.177  38.447  203.233 1.00 37.69  ? 418 VAL A CG1   1 
ATOM   2727 C  CG2   . VAL A  1  443 ? 26.589  36.744  202.385 1.00 37.14  ? 418 VAL A CG2   1 
ATOM   2728 N  N     . GLU A  1  444 ? 25.202  39.202  200.581 1.00 29.07  ? 419 GLU A N     1 
ATOM   2729 C  CA    . GLU A  1  444 ? 24.065  40.058  200.855 1.00 29.56  ? 419 GLU A CA    1 
ATOM   2730 C  C     . GLU A  1  444 ? 22.846  39.213  200.990 1.00 28.93  ? 419 GLU A C     1 
ATOM   2731 O  O     . GLU A  1  444 ? 22.806  38.104  200.461 1.00 32.15  ? 419 GLU A O     1 
ATOM   2732 C  CB    . GLU A  1  444 ? 23.868  41.081  199.725 1.00 29.30  ? 419 GLU A CB    1 
ATOM   2733 C  CG    . GLU A  1  444 ? 23.211  40.514  198.467 1.00 32.79  ? 419 GLU A CG    1 
ATOM   2734 C  CD    . GLU A  1  444 ? 23.373  41.410  197.239 1.00 39.69  ? 419 GLU A CD    1 
ATOM   2735 O  OE1   . GLU A  1  444 ? 24.499  41.886  196.993 1.00 46.71  ? 419 GLU A OE1   1 
ATOM   2736 O  OE2   . GLU A  1  444 ? 22.388  41.625  196.519 1.00 38.25  ? 419 GLU A OE2   1 
ATOM   2737 N  N     . ARG A  1  445 ? 21.833  39.765  201.632 1.00 26.79  ? 420 ARG A N     1 
ATOM   2738 C  CA    . ARG A  1  445 ? 20.642  39.029  201.919 1.00 28.99  ? 420 ARG A CA    1 
ATOM   2739 C  C     . ARG A  1  445 ? 19.438  39.942  202.028 1.00 27.64  ? 420 ARG A C     1 
ATOM   2740 O  O     . ARG A  1  445 ? 19.522  41.029  202.604 1.00 26.04  ? 420 ARG A O     1 
ATOM   2741 C  CB    . ARG A  1  445 ? 20.828  38.310  203.255 1.00 34.46  ? 420 ARG A CB    1 
ATOM   2742 C  CG    . ARG A  1  445 ? 19.749  37.289  203.537 1.00 38.71  ? 420 ARG A CG    1 
ATOM   2743 C  CD    . ARG A  1  445 ? 20.235  36.213  204.503 1.00 44.53  ? 420 ARG A CD    1 
ATOM   2744 N  NE    . ARG A  1  445 ? 21.403  35.551  203.937 1.00 44.36  ? 420 ARG A NE    1 
ATOM   2745 C  CZ    . ARG A  1  445 ? 22.587  35.392  204.528 1.00 42.98  ? 420 ARG A CZ    1 
ATOM   2746 N  NH1   . ARG A  1  445 ? 22.801  35.779  205.779 1.00 45.63  ? 420 ARG A NH1   1 
ATOM   2747 N  NH2   . ARG A  1  445 ? 23.565  34.800  203.842 1.00 41.74  ? 420 ARG A NH2   1 
ATOM   2748 N  N     . THR A  1  446 ? 18.316  39.469  201.525 1.00 27.98  ? 421 THR A N     1 
ATOM   2749 C  CA    . THR A  1  446 ? 17.034  40.190  201.575 1.00 29.29  ? 421 THR A CA    1 
ATOM   2750 C  C     . THR A  1  446 ? 16.167  39.600  202.678 1.00 30.43  ? 421 THR A C     1 
ATOM   2751 O  O     . THR A  1  446 ? 16.189  38.396  202.900 1.00 32.32  ? 421 THR A O     1 
ATOM   2752 C  CB    . THR A  1  446 ? 16.318  40.093  200.200 1.00 29.01  ? 421 THR A CB    1 
ATOM   2753 O  OG1   . THR A  1  446 ? 17.051  40.877  199.254 1.00 28.28  ? 421 THR A OG1   1 
ATOM   2754 C  CG2   . THR A  1  446 ? 14.876  40.601  200.253 1.00 28.61  ? 421 THR A CG2   1 
ATOM   2755 N  N     . PHE A  1  447 ? 15.402  40.434  203.379 1.00 31.62  ? 422 PHE A N     1 
ATOM   2756 C  CA    . PHE A  1  447 ? 14.609  39.948  204.517 1.00 30.59  ? 422 PHE A CA    1 
ATOM   2757 C  C     . PHE A  1  447 ? 13.385  40.775  204.663 1.00 30.43  ? 422 PHE A C     1 
ATOM   2758 O  O     . PHE A  1  447 ? 13.284  41.848  204.079 1.00 32.10  ? 422 PHE A O     1 
ATOM   2759 C  CB    . PHE A  1  447 ? 15.434  39.978  205.825 1.00 32.80  ? 422 PHE A CB    1 
ATOM   2760 C  CG    . PHE A  1  447 ? 16.423  41.109  205.894 1.00 32.26  ? 422 PHE A CG    1 
ATOM   2761 C  CD1   . PHE A  1  447 ? 15.996  42.406  206.094 1.00 32.84  ? 422 PHE A CD1   1 
ATOM   2762 C  CD2   . PHE A  1  447 ? 17.776  40.878  205.743 1.00 32.54  ? 422 PHE A CD2   1 
ATOM   2763 C  CE1   . PHE A  1  447 ? 16.898  43.453  206.126 1.00 32.15  ? 422 PHE A CE1   1 
ATOM   2764 C  CE2   . PHE A  1  447 ? 18.685  41.933  205.764 1.00 33.33  ? 422 PHE A CE2   1 
ATOM   2765 C  CZ    . PHE A  1  447 ? 18.243  43.223  205.959 1.00 32.48  ? 422 PHE A CZ    1 
ATOM   2766 N  N     . SER A  1  448 ? 12.431  40.272  205.431 1.00 29.92  ? 423 SER A N     1 
ATOM   2767 C  CA    . SER A  1  448 ? 11.295  41.091  205.847 1.00 31.49  ? 423 SER A CA    1 
ATOM   2768 C  C     . SER A  1  448 ? 11.869  42.251  206.709 1.00 30.51  ? 423 SER A C     1 
ATOM   2769 O  O     . SER A  1  448 ? 12.982  42.139  207.295 1.00 28.96  ? 423 SER A O     1 
ATOM   2770 C  CB    . SER A  1  448 ? 10.247  40.258  206.604 1.00 31.24  ? 423 SER A CB    1 
ATOM   2771 O  OG    . SER A  1  448 ? 10.891  39.593  207.661 1.00 32.78  ? 423 SER A OG    1 
ATOM   2772 N  N     . GLU A  1  449 ? 11.136  43.351  206.735 1.00 29.79  ? 424 GLU A N     1 
ATOM   2773 C  CA    . GLU A  1  449 ? 11.634  44.643  207.238 1.00 31.26  ? 424 GLU A CA    1 
ATOM   2774 C  C     . GLU A  1  449 ? 12.363  44.544  208.554 1.00 31.26  ? 424 GLU A C     1 
ATOM   2775 O  O     . GLU A  1  449 ? 11.805  44.018  209.546 1.00 29.50  ? 424 GLU A O     1 
ATOM   2776 C  CB    . GLU A  1  449 ? 10.496  45.646  207.400 1.00 31.51  ? 424 GLU A CB    1 
ATOM   2777 C  CG    . GLU A  1  449 ? 11.025  47.031  207.765 1.00 34.64  ? 424 GLU A CG    1 
ATOM   2778 C  CD    . GLU A  1  449 ? 9.956   48.094  207.885 1.00 35.26  ? 424 GLU A CD    1 
ATOM   2779 O  OE1   . GLU A  1  449 ? 8.878   47.974  207.259 1.00 33.37  ? 424 GLU A OE1   1 
ATOM   2780 O  OE2   . GLU A  1  449 ? 10.219  49.093  208.607 1.00 40.14  ? 424 GLU A OE2   1 
ATOM   2781 N  N     . ILE A  1  450 ? 13.604  45.020  208.565 1.00 30.07  ? 425 ILE A N     1 
ATOM   2782 C  CA    . ILE A  1  450 ? 14.341  45.213  209.818 1.00 31.87  ? 425 ILE A CA    1 
ATOM   2783 C  C     . ILE A  1  450 ? 14.506  46.727  210.073 1.00 32.45  ? 425 ILE A C     1 
ATOM   2784 O  O     . ILE A  1  450 ? 15.121  47.445  209.249 1.00 30.18  ? 425 ILE A O     1 
ATOM   2785 C  CB    . ILE A  1  450 ? 15.720  44.532  209.811 1.00 33.94  ? 425 ILE A CB    1 
ATOM   2786 C  CG1   . ILE A  1  450 ? 15.560  43.031  209.618 1.00 35.07  ? 425 ILE A CG1   1 
ATOM   2787 C  CG2   . ILE A  1  450 ? 16.459  44.741  211.144 1.00 32.89  ? 425 ILE A CG2   1 
ATOM   2788 C  CD1   . ILE A  1  450 ? 16.896  42.327  209.524 1.00 35.08  ? 425 ILE A CD1   1 
ATOM   2789 N  N     . ASN A  1  451 ? 13.962  47.191  211.202 1.00 32.20  ? 426 ASN A N     1 
ATOM   2790 C  CA    . ASN A  1  451 ? 14.052  48.618  211.599 1.00 34.02  ? 426 ASN A CA    1 
ATOM   2791 C  C     . ASN A  1  451 ? 14.665  48.939  212.971 1.00 34.56  ? 426 ASN A C     1 
ATOM   2792 O  O     . ASN A  1  451 ? 14.947  50.102  213.264 1.00 36.47  ? 426 ASN A O     1 
ATOM   2793 C  CB    . ASN A  1  451 ? 12.684  49.286  211.434 1.00 35.85  ? 426 ASN A CB    1 
ATOM   2794 C  CG    . ASN A  1  451 ? 11.592  48.556  212.182 1.00 36.15  ? 426 ASN A CG    1 
ATOM   2795 O  OD1   . ASN A  1  451 ? 11.821  48.070  213.277 1.00 41.85  ? 426 ASN A OD1   1 
ATOM   2796 N  ND2   . ASN A  1  451 ? 10.417  48.439  211.582 1.00 34.80  ? 426 ASN A ND2   1 
ATOM   2797 N  N     . LYS A  1  452 ? 14.921  47.929  213.790 1.00 33.79  ? 427 LYS A N     1 
ATOM   2798 C  CA    . LYS A  1  452 ? 15.549  48.128  215.083 1.00 35.99  ? 427 LYS A CA    1 
ATOM   2799 C  C     . LYS A  1  452 ? 17.071  48.099  214.941 1.00 35.31  ? 427 LYS A C     1 
ATOM   2800 O  O     . LYS A  1  452 ? 17.639  47.144  214.395 1.00 33.85  ? 427 LYS A O     1 
ATOM   2801 C  CB    . LYS A  1  452 ? 15.090  47.056  216.084 1.00 37.08  ? 427 LYS A CB    1 
ATOM   2802 C  CG    . LYS A  1  452 ? 13.626  47.172  216.493 1.00 37.36  ? 427 LYS A CG    1 
ATOM   2803 C  CD    . LYS A  1  452 ? 13.248  46.030  217.420 1.00 41.09  ? 427 LYS A CD    1 
ATOM   2804 C  CE    . LYS A  1  452 ? 11.936  46.280  218.164 1.00 44.49  ? 427 LYS A CE    1 
ATOM   2805 N  NZ    . LYS A  1  452 ? 10.725  46.194  217.292 1.00 46.23  ? 427 LYS A NZ    1 
ATOM   2806 N  N     . ALA A  1  453 ? 17.724  49.130  215.472 1.00 33.28  ? 428 ALA A N     1 
ATOM   2807 C  CA    . ALA A  1  453 ? 19.159  49.313  215.286 1.00 34.51  ? 428 ALA A CA    1 
ATOM   2808 C  C     . ALA A  1  453 ? 19.952  48.130  215.793 1.00 33.59  ? 428 ALA A C     1 
ATOM   2809 O  O     . ALA A  1  453 ? 20.869  47.678  215.125 1.00 33.16  ? 428 ALA A O     1 
ATOM   2810 C  CB    . ALA A  1  453 ? 19.631  50.581  215.968 1.00 37.01  ? 428 ALA A CB    1 
ATOM   2811 N  N     . GLU A  1  454 ? 19.600  47.608  216.966 1.00 32.45  ? 429 GLU A N     1 
ATOM   2812 C  CA    . GLU A  1  454 ? 20.334  46.453  217.484 1.00 34.11  ? 429 GLU A CA    1 
ATOM   2813 C  C     . GLU A  1  454 ? 20.252  45.200  216.552 1.00 29.46  ? 429 GLU A C     1 
ATOM   2814 O  O     . GLU A  1  454 ? 21.237  44.503  216.389 1.00 28.86  ? 429 GLU A O     1 
ATOM   2815 C  CB    . GLU A  1  454 ? 19.879  46.091  218.893 1.00 35.20  ? 429 GLU A CB    1 
ATOM   2816 C  CG    . GLU A  1  454 ? 20.703  44.944  219.440 1.00 37.42  ? 429 GLU A CG    1 
ATOM   2817 C  CD    . GLU A  1  454 ? 20.617  44.720  220.945 1.00 40.88  ? 429 GLU A CD    1 
ATOM   2818 O  OE1   . GLU A  1  454 ? 19.767  45.334  221.628 1.00 36.94  ? 429 GLU A OE1   1 
ATOM   2819 O  OE2   . GLU A  1  454 ? 21.424  43.885  221.407 1.00 42.18  ? 429 GLU A OE2   1 
ATOM   2820 N  N     . GLU A  1  455 ? 19.111  44.975  215.917 1.00 27.91  ? 430 GLU A N     1 
ATOM   2821 C  CA    . GLU A  1  455 ? 18.952  43.842  214.976 1.00 30.89  ? 430 GLU A CA    1 
ATOM   2822 C  C     . GLU A  1  455 ? 19.808  44.062  213.688 1.00 32.45  ? 430 GLU A C     1 
ATOM   2823 O  O     . GLU A  1  455 ? 20.448  43.134  213.173 1.00 29.41  ? 430 GLU A O     1 
ATOM   2824 C  CB    . GLU A  1  455 ? 17.451  43.592  214.699 1.00 31.67  ? 430 GLU A CB    1 
ATOM   2825 C  CG    . GLU A  1  455 ? 16.701  43.163  215.976 1.00 33.59  ? 430 GLU A CG    1 
ATOM   2826 C  CD    . GLU A  1  455 ? 15.182  43.012  215.826 1.00 36.73  ? 430 GLU A CD    1 
ATOM   2827 O  OE1   . GLU A  1  455 ? 14.684  43.080  214.685 1.00 37.37  ? 430 GLU A OE1   1 
ATOM   2828 O  OE2   . GLU A  1  455 ? 14.466  42.813  216.855 1.00 36.04  ? 430 GLU A OE2   1 
ATOM   2829 N  N     . GLN A  1  456 ? 19.878  45.316  213.232 1.00 33.24  ? 431 GLN A N     1 
ATOM   2830 C  CA    . GLN A  1  456 ? 20.713  45.695  212.072 1.00 33.15  ? 431 GLN A CA    1 
ATOM   2831 C  C     . GLN A  1  456 ? 22.187  45.453  212.332 1.00 34.80  ? 431 GLN A C     1 
ATOM   2832 O  O     . GLN A  1  456 ? 22.925  44.877  211.471 1.00 32.68  ? 431 GLN A O     1 
ATOM   2833 C  CB    . GLN A  1  456 ? 20.443  47.149  211.700 1.00 34.01  ? 431 GLN A CB    1 
ATOM   2834 C  CG    . GLN A  1  456 ? 19.009  47.332  211.228 1.00 33.85  ? 431 GLN A CG    1 
ATOM   2835 C  CD    . GLN A  1  456 ? 18.527  48.766  211.211 1.00 37.30  ? 431 GLN A CD    1 
ATOM   2836 O  OE1   . GLN A  1  456 ? 19.164  49.679  211.782 1.00 34.58  ? 431 GLN A OE1   1 
ATOM   2837 N  NE2   . GLN A  1  456 ? 17.374  48.986  210.546 1.00 36.91  ? 431 GLN A NE2   1 
ATOM   2838 N  N     . TYR A  1  457 ? 22.632  45.837  213.533 1.00 34.55  ? 432 TYR A N     1 
ATOM   2839 C  CA    . TYR A  1  457 ? 24.009  45.506  213.945 1.00 34.15  ? 432 TYR A CA    1 
ATOM   2840 C  C     . TYR A  1  457 ? 24.252  44.006  213.985 1.00 32.36  ? 432 TYR A C     1 
ATOM   2841 O  O     . TYR A  1  457 ? 25.300  43.545  213.529 1.00 31.47  ? 432 TYR A O     1 
ATOM   2842 C  CB    . TYR A  1  457 ? 24.372  46.143  215.286 1.00 36.03  ? 432 TYR A CB    1 
ATOM   2843 C  CG    . TYR A  1  457 ? 24.561  47.642  215.208 1.00 35.70  ? 432 TYR A CG    1 
ATOM   2844 C  CD1   . TYR A  1  457 ? 25.608  48.177  214.478 1.00 39.62  ? 432 TYR A CD1   1 
ATOM   2845 C  CD2   . TYR A  1  457 ? 23.723  48.516  215.882 1.00 36.63  ? 432 TYR A CD2   1 
ATOM   2846 C  CE1   . TYR A  1  457 ? 25.801  49.543  214.395 1.00 40.16  ? 432 TYR A CE1   1 
ATOM   2847 C  CE2   . TYR A  1  457 ? 23.916  49.892  215.821 1.00 39.16  ? 432 TYR A CE2   1 
ATOM   2848 C  CZ    . TYR A  1  457 ? 24.970  50.394  215.073 1.00 38.89  ? 432 TYR A CZ    1 
ATOM   2849 O  OH    . TYR A  1  457 ? 25.210  51.742  214.975 1.00 39.48  ? 432 TYR A OH    1 
ATOM   2850 N  N     . SER A  1  458 ? 23.286  43.248  214.502 1.00 32.10  ? 433 SER A N     1 
ATOM   2851 C  CA    . SER A  1  458 ? 23.418  41.802  214.553 1.00 34.45  ? 433 SER A CA    1 
ATOM   2852 C  C     . SER A  1  458 ? 23.493  41.216  213.151 1.00 32.69  ? 433 SER A C     1 
ATOM   2853 O  O     . SER A  1  458 ? 24.365  40.381  212.860 1.00 28.16  ? 433 SER A O     1 
ATOM   2854 C  CB    . SER A  1  458 ? 22.274  41.154  215.351 1.00 39.87  ? 433 SER A CB    1 
ATOM   2855 O  OG    . SER A  1  458 ? 22.313  41.583  216.703 1.00 45.17  ? 433 SER A OG    1 
ATOM   2856 N  N     . LEU A  1  459 ? 22.638  41.687  212.259 1.00 33.69  ? 434 LEU A N     1 
ATOM   2857 C  CA    . LEU A  1  459 ? 22.664  41.250  210.878 1.00 35.99  ? 434 LEU A CA    1 
ATOM   2858 C  C     . LEU A  1  459 ? 24.000  41.556  210.218 1.00 34.08  ? 434 LEU A C     1 
ATOM   2859 O  O     . LEU A  1  459 ? 24.545  40.760  209.530 1.00 32.73  ? 434 LEU A O     1 
ATOM   2860 C  CB    . LEU A  1  459 ? 21.574  41.932  210.096 1.00 41.44  ? 434 LEU A CB    1 
ATOM   2861 C  CG    . LEU A  1  459 ? 20.706  41.056  209.232 1.00 50.16  ? 434 LEU A CG    1 
ATOM   2862 C  CD1   . LEU A  1  459 ? 21.545  40.002  208.566 1.00 51.04  ? 434 LEU A CD1   1 
ATOM   2863 C  CD2   . LEU A  1  459 ? 19.667  40.423  210.117 1.00 54.20  ? 434 LEU A CD2   1 
ATOM   2864 N  N     . CYS A  1  460 ? 24.503  42.747  210.449 1.00 34.72  ? 435 CYS A N     1 
ATOM   2865 C  CA    . CYS A  1  460 ? 25.764  43.174  209.908 1.00 33.09  ? 435 CYS A CA    1 
ATOM   2866 C  C     . CYS A  1  460 ? 26.884  42.252  210.381 1.00 32.58  ? 435 CYS A C     1 
ATOM   2867 O  O     . CYS A  1  460 ? 27.709  41.810  209.583 1.00 34.31  ? 435 CYS A O     1 
ATOM   2868 C  CB    . CYS A  1  460 ? 26.006  44.630  210.304 1.00 32.47  ? 435 CYS A CB    1 
ATOM   2869 S  SG    . CYS A  1  460 ? 27.519  45.281  209.634 1.00 37.15  ? 435 CYS A SG    1 
ATOM   2870 N  N     . GLN A  1  461 ? 26.883  41.926  211.673 1.00 33.14  ? 436 GLN A N     1 
ATOM   2871 C  CA    . GLN A  1  461 ? 27.919  41.055  212.256 1.00 37.67  ? 436 GLN A CA    1 
ATOM   2872 C  C     . GLN A  1  461 ? 27.871  39.654  211.642 1.00 33.72  ? 436 GLN A C     1 
ATOM   2873 O  O     . GLN A  1  461 ? 28.925  39.061  211.328 1.00 30.33  ? 436 GLN A O     1 
ATOM   2874 C  CB    . GLN A  1  461 ? 27.765  40.963  213.798 1.00 42.80  ? 436 GLN A CB    1 
ATOM   2875 C  CG    . GLN A  1  461 ? 28.998  40.432  214.530 1.00 49.17  ? 436 GLN A CG    1 
ATOM   2876 C  CD    . GLN A  1  461 ? 29.107  38.911  214.552 1.00 58.91  ? 436 GLN A CD    1 
ATOM   2877 O  OE1   . GLN A  1  461 ? 30.110  38.333  214.113 1.00 64.58  ? 436 GLN A OE1   1 
ATOM   2878 N  NE2   . GLN A  1  461 ? 28.081  38.254  215.073 1.00 64.57  ? 436 GLN A NE2   1 
ATOM   2879 N  N     . GLU A  1  462 ? 26.659  39.125  211.479 1.00 32.81  ? 437 GLU A N     1 
ATOM   2880 C  CA    . GLU A  1  462 ? 26.495  37.812  210.816 1.00 35.32  ? 437 GLU A CA    1 
ATOM   2881 C  C     . GLU A  1  462 ? 27.057  37.781  209.403 1.00 34.46  ? 437 GLU A C     1 
ATOM   2882 O  O     . GLU A  1  462 ? 27.712  36.805  209.008 1.00 33.58  ? 437 GLU A O     1 
ATOM   2883 C  CB    . GLU A  1  462 ? 25.027  37.373  210.787 1.00 39.59  ? 437 GLU A CB    1 
ATOM   2884 C  CG    . GLU A  1  462 ? 24.774  36.105  209.950 1.00 44.72  ? 437 GLU A CG    1 
ATOM   2885 C  CD    . GLU A  1  462 ? 25.553  34.885  210.430 1.00 50.39  ? 437 GLU A CD    1 
ATOM   2886 O  OE1   . GLU A  1  462 ? 25.776  34.779  211.655 1.00 57.71  ? 437 GLU A OE1   1 
ATOM   2887 O  OE2   . GLU A  1  462 ? 25.922  34.019  209.599 1.00 50.35  ? 437 GLU A OE2   1 
ATOM   2888 N  N     . LEU A  1  463 ? 26.767  38.832  208.631 1.00 34.22  ? 438 LEU A N     1 
ATOM   2889 C  CA    . LEU A  1  463 ? 27.266  38.931  207.275 1.00 34.26  ? 438 LEU A CA    1 
ATOM   2890 C  C     . LEU A  1  463 ? 28.791  39.035  207.267 1.00 33.25  ? 438 LEU A C     1 
ATOM   2891 O  O     . LEU A  1  463 ? 29.459  38.449  206.429 1.00 30.26  ? 438 LEU A O     1 
ATOM   2892 C  CB    . LEU A  1  463 ? 26.627  40.135  206.557 1.00 34.54  ? 438 LEU A CB    1 
ATOM   2893 C  CG    . LEU A  1  463 ? 25.122  39.984  206.301 1.00 36.41  ? 438 LEU A CG    1 
ATOM   2894 C  CD1   . LEU A  1  463 ? 24.480  41.314  205.940 1.00 37.28  ? 438 LEU A CD1   1 
ATOM   2895 C  CD2   . LEU A  1  463 ? 24.857  38.982  205.198 1.00 37.47  ? 438 LEU A CD2   1 
ATOM   2896 N  N     . CYS A  1  464 ? 29.337  39.793  208.203 1.00 33.33  ? 439 CYS A N     1 
ATOM   2897 C  CA    . CYS A  1  464 ? 30.791  39.913  208.313 1.00 34.19  ? 439 CYS A CA    1 
ATOM   2898 C  C     . CYS A  1  464 ? 31.442  38.573  208.608 1.00 33.28  ? 439 CYS A C     1 
ATOM   2899 O  O     . CYS A  1  464 ? 32.479  38.275  208.031 1.00 32.82  ? 439 CYS A O     1 
ATOM   2900 C  CB    . CYS A  1  464 ? 31.173  40.969  209.358 1.00 34.58  ? 439 CYS A CB    1 
ATOM   2901 S  SG    . CYS A  1  464 ? 30.720  42.666  208.872 1.00 34.68  ? 439 CYS A SG    1 
ATOM   2902 N  N     . SER A  1  465 ? 30.800  37.755  209.455 1.00 36.03  ? 440 SER A N     1 
ATOM   2903 C  CA    . SER A  1  465 ? 31.288  36.397  209.763 1.00 38.99  ? 440 SER A CA    1 
ATOM   2904 C  C     . SER A  1  465 ? 31.213  35.441  208.598 1.00 37.39  ? 440 SER A C     1 
ATOM   2905 O  O     . SER A  1  465 ? 32.183  34.736  208.358 1.00 34.35  ? 440 SER A O     1 
ATOM   2906 C  CB    . SER A  1  465 ? 30.542  35.763  210.942 1.00 42.78  ? 440 SER A CB    1 
ATOM   2907 O  OG    . SER A  1  465 ? 30.712  36.563  212.087 1.00 50.88  ? 440 SER A OG    1 
ATOM   2908 N  N     . GLU A  1  466 ? 30.072  35.393  207.892 1.00 37.03  ? 441 GLU A N     1 
ATOM   2909 C  CA    . GLU A  1  466 ? 29.976  34.568  206.668 1.00 37.97  ? 441 GLU A CA    1 
ATOM   2910 C  C     . GLU A  1  466 ? 31.065  34.959  205.683 1.00 38.06  ? 441 GLU A C     1 
ATOM   2911 O  O     . GLU A  1  466 ? 31.726  34.098  205.118 1.00 37.30  ? 441 GLU A O     1 
ATOM   2912 C  CB    . GLU A  1  466 ? 28.618  34.677  205.984 1.00 40.06  ? 441 GLU A CB    1 
ATOM   2913 C  CG    . GLU A  1  466 ? 27.504  34.099  206.812 1.00 42.26  ? 441 GLU A CG    1 
ATOM   2914 C  CD    . GLU A  1  466 ? 26.140  34.396  206.247 1.00 46.16  ? 441 GLU A CD    1 
ATOM   2915 O  OE1   . GLU A  1  466 ? 26.001  34.410  205.011 1.00 45.92  ? 441 GLU A OE1   1 
ATOM   2916 O  OE2   . GLU A  1  466 ? 25.200  34.599  207.041 1.00 50.67  ? 441 GLU A OE2   1 
ATOM   2917 N  N     . LEU A  1  467 ? 31.265  36.262  205.504 1.00 37.90  ? 442 LEU A N     1 
ATOM   2918 C  CA    . LEU A  1  467 ? 32.249  36.741  204.551 1.00 41.16  ? 442 LEU A CA    1 
ATOM   2919 C  C     . LEU A  1  467 ? 33.695  36.394  204.983 1.00 41.45  ? 442 LEU A C     1 
ATOM   2920 O  O     . LEU A  1  467 ? 34.538  36.076  204.141 1.00 38.48  ? 442 LEU A O     1 
ATOM   2921 C  CB    . LEU A  1  467 ? 32.068  38.246  204.328 1.00 42.20  ? 442 LEU A CB    1 
ATOM   2922 C  CG    . LEU A  1  467 ? 32.983  38.902  203.288 1.00 42.27  ? 442 LEU A CG    1 
ATOM   2923 C  CD1   . LEU A  1  467 ? 32.704  38.356  201.908 1.00 41.24  ? 442 LEU A CD1   1 
ATOM   2924 C  CD2   . LEU A  1  467 ? 32.829  40.417  203.309 1.00 43.24  ? 442 LEU A CD2   1 
ATOM   2925 N  N     . ALA A  1  468 ? 33.973  36.475  206.286 1.00 42.17  ? 443 ALA A N     1 
ATOM   2926 C  CA    . ALA A  1  468 ? 35.267  36.029  206.813 1.00 44.18  ? 443 ALA A CA    1 
ATOM   2927 C  C     . ALA A  1  468 ? 35.462  34.536  206.580 1.00 41.65  ? 443 ALA A C     1 
ATOM   2928 O  O     . ALA A  1  468 ? 36.545  34.131  206.199 1.00 44.49  ? 443 ALA A O     1 
ATOM   2929 C  CB    . ALA A  1  468 ? 35.407  36.370  208.291 1.00 45.77  ? 443 ALA A CB    1 
ATOM   2930 N  N     . GLN A  1  469 ? 34.429  33.723  206.786 1.00 42.12  ? 444 GLN A N     1 
ATOM   2931 C  CA    . GLN A  1  469 ? 34.526  32.286  206.459 1.00 47.83  ? 444 GLN A CA    1 
ATOM   2932 C  C     . GLN A  1  469 ? 34.884  32.083  204.981 1.00 48.87  ? 444 GLN A C     1 
ATOM   2933 O  O     . GLN A  1  469 ? 35.822  31.336  204.678 1.00 46.33  ? 444 GLN A O     1 
ATOM   2934 C  CB    . GLN A  1  469 ? 33.255  31.497  206.847 1.00 48.14  ? 444 GLN A CB    1 
ATOM   2935 N  N     . ASP A  1  470 ? 34.200  32.802  204.075 1.00 48.44  ? 445 ASP A N     1 
ATOM   2936 C  CA    . ASP A  1  470 ? 34.477  32.714  202.612 1.00 44.00  ? 445 ASP A CA    1 
ATOM   2937 C  C     . ASP A  1  470 ? 35.890  33.136  202.236 1.00 43.94  ? 445 ASP A C     1 
ATOM   2938 O  O     . ASP A  1  470 ? 36.488  32.531  201.346 1.00 45.39  ? 445 ASP A O     1 
ATOM   2939 C  CB    . ASP A  1  470 ? 33.506  33.575  201.781 1.00 45.20  ? 445 ASP A CB    1 
ATOM   2940 C  CG    . ASP A  1  470 ? 32.045  33.186  201.966 1.00 45.18  ? 445 ASP A CG    1 
ATOM   2941 O  OD1   . ASP A  1  470 ? 31.763  32.030  202.330 1.00 46.83  ? 445 ASP A OD1   1 
ATOM   2942 O  OD2   . ASP A  1  470 ? 31.170  34.050  201.741 1.00 43.48  ? 445 ASP A OD2   1 
ATOM   2943 N  N     . LEU A  1  471 ? 36.397  34.206  202.856 1.00 45.19  ? 446 LEU A N     1 
ATOM   2944 C  CA    . LEU A  1  471 ? 37.796  34.638  202.646 1.00 48.47  ? 446 LEU A CA    1 
ATOM   2945 C  C     . LEU A  1  471 ? 38.824  33.595  203.128 1.00 50.46  ? 446 LEU A C     1 
ATOM   2946 O  O     . LEU A  1  471 ? 39.883  33.418  202.514 1.00 46.82  ? 446 LEU A O     1 
ATOM   2947 C  CB    . LEU A  1  471 ? 38.088  35.939  203.384 1.00 47.02  ? 446 LEU A CB    1 
ATOM   2948 C  CG    . LEU A  1  471 ? 37.522  37.232  202.823 1.00 48.75  ? 446 LEU A CG    1 
ATOM   2949 C  CD1   . LEU A  1  471 ? 37.524  38.293  203.904 1.00 48.36  ? 446 LEU A CD1   1 
ATOM   2950 C  CD2   . LEU A  1  471 ? 38.344  37.682  201.627 1.00 51.79  ? 446 LEU A CD2   1 
ATOM   2951 N  N     . GLN A  1  472 ? 38.500  32.959  204.250 1.00 51.90  ? 447 GLN A N     1 
ATOM   2952 C  CA    . GLN A  1  472 ? 39.349  31.942  204.884 1.00 58.09  ? 447 GLN A CA    1 
ATOM   2953 C  C     . GLN A  1  472 ? 39.600  30.773  203.920 1.00 59.39  ? 447 GLN A C     1 
ATOM   2954 O  O     . GLN A  1  472 ? 40.717  30.269  203.816 1.00 56.18  ? 447 GLN A O     1 
ATOM   2955 C  CB    . GLN A  1  472 ? 38.686  31.435  206.185 1.00 62.06  ? 447 GLN A CB    1 
ATOM   2956 C  CG    . GLN A  1  472 ? 39.633  31.230  207.354 1.00 67.35  ? 447 GLN A CG    1 
ATOM   2957 C  CD    . GLN A  1  472 ? 40.604  30.099  207.116 1.00 70.71  ? 447 GLN A CD    1 
ATOM   2958 O  OE1   . GLN A  1  472 ? 40.195  28.997  206.739 1.00 77.51  ? 447 GLN A OE1   1 
ATOM   2959 N  NE2   . GLN A  1  472 ? 41.900  30.354  207.334 1.00 76.52  ? 447 GLN A NE2   1 
ATOM   2960 N  N     . LYS A  1  473 ? 38.556  30.385  203.196 1.00 62.03  ? 448 LYS A N     1 
ATOM   2961 C  CA    . LYS A  1  473 ? 38.625  29.308  202.218 1.00 65.30  ? 448 LYS A CA    1 
ATOM   2962 C  C     . LYS A  1  473 ? 39.685  29.527  201.131 1.00 66.10  ? 448 LYS A C     1 
ATOM   2963 O  O     . LYS A  1  473 ? 40.290  28.559  200.673 1.00 71.18  ? 448 LYS A O     1 
ATOM   2964 C  CB    . LYS A  1  473 ? 37.241  29.064  201.593 1.00 73.15  ? 448 LYS A CB    1 
ATOM   2965 C  CG    . LYS A  1  473 ? 37.104  27.731  200.859 1.00 81.37  ? 448 LYS A CG    1 
ATOM   2966 C  CD    . LYS A  1  473 ? 35.666  27.211  200.831 1.00 87.88  ? 448 LYS A CD    1 
ATOM   2967 C  CE    . LYS A  1  473 ? 34.675  28.238  200.285 1.00 90.87  ? 448 LYS A CE    1 
ATOM   2968 N  NZ    . LYS A  1  473 ? 33.431  27.607  199.751 1.00 89.21  ? 448 LYS A NZ    1 
ATOM   2969 N  N     . GLU A  1  474 ? 39.925  30.776  200.732 1.00 66.65  ? 449 GLU A N     1 
ATOM   2970 C  CA    . GLU A  1  474 ? 40.939  31.095  199.698 1.00 67.75  ? 449 GLU A CA    1 
ATOM   2971 C  C     . GLU A  1  474 ? 42.124  31.898  200.239 1.00 69.27  ? 449 GLU A C     1 
ATOM   2972 O  O     . GLU A  1  474 ? 42.942  32.390  199.461 1.00 65.39  ? 449 GLU A O     1 
ATOM   2973 C  CB    . GLU A  1  474 ? 40.284  31.852  198.534 1.00 74.06  ? 449 GLU A CB    1 
ATOM   2974 C  CG    . GLU A  1  474 ? 39.064  31.155  197.939 1.00 77.19  ? 449 GLU A CG    1 
ATOM   2975 C  CD    . GLU A  1  474 ? 38.456  31.927  196.782 1.00 83.23  ? 449 GLU A CD    1 
ATOM   2976 O  OE1   . GLU A  1  474 ? 37.554  32.754  197.029 1.00 80.45  ? 449 GLU A OE1   1 
ATOM   2977 O  OE2   . GLU A  1  474 ? 38.867  31.700  195.623 1.00 85.02  ? 449 GLU A OE2   1 
ATOM   2978 N  N     . ARG A  1  475 ? 42.207  32.015  201.568 1.00 73.95  ? 450 ARG A N     1 
ATOM   2979 C  CA    . ARG A  1  475 ? 43.230  32.798  202.283 1.00 78.63  ? 450 ARG A CA    1 
ATOM   2980 C  C     . ARG A  1  475 ? 43.446  34.212  201.738 1.00 74.42  ? 450 ARG A C     1 
ATOM   2981 O  O     . ARG A  1  475 ? 44.580  34.655  201.546 1.00 77.20  ? 450 ARG A O     1 
ATOM   2982 C  CB    . ARG A  1  475 ? 44.544  32.003  202.377 1.00 85.76  ? 450 ARG A CB    1 
ATOM   2983 C  CG    . ARG A  1  475 ? 44.467  30.861  203.384 1.00 94.32  ? 450 ARG A CG    1 
ATOM   2984 C  CD    . ARG A  1  475 ? 45.238  29.628  202.937 1.00 101.46 ? 450 ARG A CD    1 
ATOM   2985 N  NE    . ARG A  1  475 ? 45.030  28.496  203.843 1.00 105.80 ? 450 ARG A NE    1 
ATOM   2986 C  CZ    . ARG A  1  475 ? 45.620  28.333  205.032 1.00 113.34 ? 450 ARG A CZ    1 
ATOM   2987 N  NH1   . ARG A  1  475 ? 46.481  29.237  205.515 1.00 116.76 ? 450 ARG A NH1   1 
ATOM   2988 N  NH2   . ARG A  1  475 ? 45.343  27.249  205.755 1.00 113.00 ? 450 ARG A NH2   1 
ATOM   2989 N  N     . LEU A  1  476 ? 42.343  34.923  201.516 1.00 67.24  ? 451 LEU A N     1 
ATOM   2990 C  CA    . LEU A  1  476 ? 42.407  36.289  201.019 1.00 63.66  ? 451 LEU A CA    1 
ATOM   2991 C  C     . LEU A  1  476 ? 42.178  37.304  202.127 1.00 59.82  ? 451 LEU A C     1 
ATOM   2992 O  O     . LEU A  1  476 ? 41.497  37.015  203.116 1.00 57.39  ? 451 LEU A O     1 
ATOM   2993 C  CB    . LEU A  1  476 ? 41.413  36.492  199.877 1.00 65.11  ? 451 LEU A CB    1 
ATOM   2994 C  CG    . LEU A  1  476 ? 41.800  35.803  198.559 1.00 65.08  ? 451 LEU A CG    1 
ATOM   2995 C  CD1   . LEU A  1  476 ? 40.666  35.942  197.559 1.00 63.52  ? 451 LEU A CD1   1 
ATOM   2996 C  CD2   . LEU A  1  476 ? 43.092  36.367  197.973 1.00 63.21  ? 451 LEU A CD2   1 
ATOM   2997 N  N     . LYS A  1  477 ? 42.794  38.475  201.956 1.00 54.16  ? 452 LYS A N     1 
ATOM   2998 C  CA    . LYS A  1  477 ? 42.654  39.616  202.852 1.00 55.00  ? 452 LYS A CA    1 
ATOM   2999 C  C     . LYS A  1  477 ? 42.602  40.884  202.005 1.00 54.57  ? 452 LYS A C     1 
ATOM   3000 O  O     . LYS A  1  477 ? 43.341  41.007  201.027 1.00 53.38  ? 452 LYS A O     1 
ATOM   3001 C  CB    . LYS A  1  477 ? 43.821  39.711  203.832 1.00 60.36  ? 452 LYS A CB    1 
ATOM   3002 C  CG    . LYS A  1  477 ? 44.286  38.375  204.388 1.00 67.34  ? 452 LYS A CG    1 
ATOM   3003 C  CD    . LYS A  1  477 ? 45.115  38.494  205.659 1.00 74.28  ? 452 LYS A CD    1 
ATOM   3004 C  CE    . LYS A  1  477 ? 45.620  37.108  206.037 1.00 80.67  ? 452 LYS A CE    1 
ATOM   3005 N  NZ    . LYS A  1  477 ? 46.286  37.078  207.361 1.00 86.60  ? 452 LYS A NZ    1 
ATOM   3006 N  N     . GLY A  1  478 ? 41.748  41.824  202.401 1.00 51.19  ? 453 GLY A N     1 
ATOM   3007 C  CA    . GLY A  1  478 ? 41.433  42.995  201.589 1.00 51.75  ? 453 GLY A CA    1 
ATOM   3008 C  C     . GLY A  1  478 ? 41.536  44.256  202.410 1.00 50.56  ? 453 GLY A C     1 
ATOM   3009 O  O     . GLY A  1  478 ? 41.525  44.193  203.636 1.00 48.58  ? 453 GLY A O     1 
ATOM   3010 N  N     . ARG A  1  479 ? 41.633  45.399  201.730 1.00 49.72  ? 454 ARG A N     1 
ATOM   3011 C  CA    . ARG A  1  479 ? 41.780  46.708  202.397 1.00 50.55  ? 454 ARG A CA    1 
ATOM   3012 C  C     . ARG A  1  479 ? 40.518  47.572  202.381 1.00 45.70  ? 454 ARG A C     1 
ATOM   3013 O  O     . ARG A  1  479 ? 40.492  48.609  203.046 1.00 41.65  ? 454 ARG A O     1 
ATOM   3014 C  CB    . ARG A  1  479 ? 42.938  47.493  201.763 1.00 54.23  ? 454 ARG A CB    1 
ATOM   3015 C  CG    . ARG A  1  479 ? 44.297  46.862  202.019 1.00 59.97  ? 454 ARG A CG    1 
ATOM   3016 C  CD    . ARG A  1  479 ? 45.458  47.566  201.320 1.00 63.89  ? 454 ARG A CD    1 
ATOM   3017 N  NE    . ARG A  1  479 ? 45.311  49.020  201.343 1.00 67.56  ? 454 ARG A NE    1 
ATOM   3018 C  CZ    . ARG A  1  479 ? 44.887  49.782  200.331 1.00 65.36  ? 454 ARG A CZ    1 
ATOM   3019 N  NH1   . ARG A  1  479 ? 44.576  49.265  199.145 1.00 65.96  ? 454 ARG A NH1   1 
ATOM   3020 N  NH2   . ARG A  1  479 ? 44.774  51.094  200.514 1.00 66.01  ? 454 ARG A NH2   1 
ATOM   3021 N  N     . THR A  1  480 ? 39.496  47.178  201.620 1.00 43.39  ? 455 THR A N     1 
ATOM   3022 C  CA    . THR A  1  480 ? 38.288  48.008  201.472 1.00 43.84  ? 455 THR A CA    1 
ATOM   3023 C  C     . THR A  1  480 ? 37.072  47.204  201.858 1.00 40.12  ? 455 THR A C     1 
ATOM   3024 O  O     . THR A  1  480 ? 36.851  46.127  201.319 1.00 35.83  ? 455 THR A O     1 
ATOM   3025 C  CB    . THR A  1  480 ? 38.079  48.517  200.018 1.00 45.14  ? 455 THR A CB    1 
ATOM   3026 O  OG1   . THR A  1  480 ? 39.242  49.213  199.572 1.00 44.97  ? 455 THR A OG1   1 
ATOM   3027 C  CG2   . THR A  1  480 ? 36.864  49.462  199.918 1.00 43.77  ? 455 THR A CG2   1 
ATOM   3028 N  N     . VAL A  1  481 ? 36.274  47.757  202.768 1.00 37.46  ? 456 VAL A N     1 
ATOM   3029 C  CA    . VAL A  1  481 ? 35.034  47.156  203.164 1.00 35.49  ? 456 VAL A CA    1 
ATOM   3030 C  C     . VAL A  1  481 ? 33.911  48.096  202.774 1.00 36.96  ? 456 VAL A C     1 
ATOM   3031 O  O     . VAL A  1  481 ? 33.959  49.296  203.073 1.00 39.97  ? 456 VAL A O     1 
ATOM   3032 C  CB    . VAL A  1  481 ? 35.022  46.862  204.675 1.00 35.31  ? 456 VAL A CB    1 
ATOM   3033 C  CG1   . VAL A  1  481 ? 33.633  46.440  205.150 1.00 34.38  ? 456 VAL A CG1   1 
ATOM   3034 C  CG2   . VAL A  1  481 ? 36.036  45.773  204.971 1.00 38.57  ? 456 VAL A CG2   1 
ATOM   3035 N  N     . THR A  1  482 ? 32.888  47.529  202.149 1.00 34.75  ? 457 THR A N     1 
ATOM   3036 C  CA    . THR A  1  482 ? 31.727  48.256  201.690 1.00 34.60  ? 457 THR A CA    1 
ATOM   3037 C  C     . THR A  1  482 ? 30.484  47.581  202.217 1.00 34.07  ? 457 THR A C     1 
ATOM   3038 O  O     . THR A  1  482 ? 30.366  46.369  202.105 1.00 32.55  ? 457 THR A O     1 
ATOM   3039 C  CB    . THR A  1  482 ? 31.674  48.224  200.161 1.00 35.00  ? 457 THR A CB    1 
ATOM   3040 O  OG1   . THR A  1  482 ? 32.930  48.651  199.674 1.00 34.42  ? 457 THR A OG1   1 
ATOM   3041 C  CG2   . THR A  1  482 ? 30.596  49.139  199.635 1.00 37.60  ? 457 THR A CG2   1 
ATOM   3042 N  N     . ILE A  1  483 ? 29.576  48.363  202.814 1.00 35.46  ? 458 ILE A N     1 
ATOM   3043 C  CA    . ILE A  1  483 ? 28.248  47.870  203.159 1.00 32.07  ? 458 ILE A CA    1 
ATOM   3044 C  C     . ILE A  1  483 ? 27.273  48.367  202.101 1.00 31.85  ? 458 ILE A C     1 
ATOM   3045 O  O     . ILE A  1  483 ? 27.541  49.340  201.414 1.00 31.37  ? 458 ILE A O     1 
ATOM   3046 C  CB    . ILE A  1  483 ? 27.789  48.256  204.582 1.00 33.93  ? 458 ILE A CB    1 
ATOM   3047 C  CG1   . ILE A  1  483 ? 27.645  49.789  204.753 1.00 36.06  ? 458 ILE A CG1   1 
ATOM   3048 C  CG2   . ILE A  1  483 ? 28.804  47.722  205.577 1.00 36.12  ? 458 ILE A CG2   1 
ATOM   3049 C  CD1   . ILE A  1  483 ? 26.938  50.220  206.019 1.00 38.78  ? 458 ILE A CD1   1 
ATOM   3050 N  N     . LYS A  1  484 ? 26.179  47.636  201.953 1.00 29.41  ? 459 LYS A N     1 
ATOM   3051 C  CA    . LYS A  1  484 ? 25.132  47.918  201.006 1.00 29.86  ? 459 LYS A CA    1 
ATOM   3052 C  C     . LYS A  1  484 ? 23.860  47.845  201.806 1.00 26.99  ? 459 LYS A C     1 
ATOM   3053 O  O     . LYS A  1  484 ? 23.665  46.911  202.563 1.00 27.65  ? 459 LYS A O     1 
ATOM   3054 C  CB    . LYS A  1  484 ? 25.131  46.819  199.950 1.00 33.61  ? 459 LYS A CB    1 
ATOM   3055 C  CG    . LYS A  1  484 ? 24.049  46.955  198.908 1.00 32.91  ? 459 LYS A CG    1 
ATOM   3056 C  CD    . LYS A  1  484 ? 24.308  45.961  197.790 1.00 33.89  ? 459 LYS A CD    1 
ATOM   3057 C  CE    . LYS A  1  484 ? 23.077  45.898  196.930 1.00 37.04  ? 459 LYS A CE    1 
ATOM   3058 N  NZ    . LYS A  1  484 ? 23.371  45.148  195.674 1.00 43.01  ? 459 LYS A NZ    1 
ATOM   3059 N  N     . LEU A  1  485 ? 23.017  48.843  201.684 1.00 28.10  ? 460 LEU A N     1 
ATOM   3060 C  CA    . LEU A  1  485 ? 21.752  48.895  202.398 1.00 27.10  ? 460 LEU A CA    1 
ATOM   3061 C  C     . LEU A  1  485 ? 20.682  49.153  201.393 1.00 27.56  ? 460 LEU A C     1 
ATOM   3062 O  O     . LEU A  1  485 ? 20.838  50.016  200.521 1.00 29.45  ? 460 LEU A O     1 
ATOM   3063 C  CB    . LEU A  1  485 ? 21.767  50.043  203.435 1.00 29.25  ? 460 LEU A CB    1 
ATOM   3064 C  CG    . LEU A  1  485 ? 22.935  49.986  204.441 1.00 31.01  ? 460 LEU A CG    1 
ATOM   3065 C  CD1   . LEU A  1  485 ? 23.024  51.272  205.241 1.00 33.92  ? 460 LEU A CD1   1 
ATOM   3066 C  CD2   . LEU A  1  485 ? 22.789  48.816  205.394 1.00 29.39  ? 460 LEU A CD2   1 
ATOM   3067 N  N     . LYS A  1  486 ? 19.575  48.447  201.495 1.00 26.02  ? 461 LYS A N     1 
ATOM   3068 C  CA    . LYS A  1  486 ? 18.477  48.711  200.610 1.00 26.55  ? 461 LYS A CA    1 
ATOM   3069 C  C     . LYS A  1  486 ? 17.280  48.943  201.498 1.00 28.30  ? 461 LYS A C     1 
ATOM   3070 O  O     . LYS A  1  486 ? 16.916  48.089  202.308 1.00 27.69  ? 461 LYS A O     1 
ATOM   3071 C  CB    . LYS A  1  486 ? 18.240  47.555  199.650 1.00 27.30  ? 461 LYS A CB    1 
ATOM   3072 C  CG    . LYS A  1  486 ? 17.102  47.790  198.627 1.00 28.08  ? 461 LYS A CG    1 
ATOM   3073 C  CD    . LYS A  1  486 ? 16.704  46.522  197.861 1.00 27.70  ? 461 LYS A CD    1 
ATOM   3074 C  CE    . LYS A  1  486 ? 17.849  45.866  197.083 1.00 29.57  ? 461 LYS A CE    1 
ATOM   3075 N  NZ    . LYS A  1  486 ? 17.363  44.649  196.321 1.00 31.86  ? 461 LYS A NZ    1 
ATOM   3076 N  N     . ASN A  1  487 ? 16.648  50.086  201.347 1.00 27.50  ? 462 ASN A N     1 
ATOM   3077 C  CA    . ASN A  1  487 ? 15.518  50.361  202.195 1.00 29.79  ? 462 ASN A CA    1 
ATOM   3078 C  C     . ASN A  1  487 ? 14.270  49.722  201.644 1.00 29.58  ? 462 ASN A C     1 
ATOM   3079 O  O     . ASN A  1  487 ? 14.310  49.134  200.549 1.00 28.63  ? 462 ASN A O     1 
ATOM   3080 C  CB    . ASN A  1  487 ? 15.391  51.851  202.481 1.00 32.49  ? 462 ASN A CB    1 
ATOM   3081 C  CG    . ASN A  1  487 ? 15.044  52.692  201.253 1.00 34.67  ? 462 ASN A CG    1 
ATOM   3082 O  OD1   . ASN A  1  487 ? 14.303  52.276  200.336 1.00 32.72  ? 462 ASN A OD1   1 
ATOM   3083 N  ND2   . ASN A  1  487 ? 15.575  53.916  201.246 1.00 35.18  ? 462 ASN A ND2   1 
ATOM   3084 N  N     . VAL A  1  488 ? 13.172  49.805  202.386 1.00 29.85  ? 463 VAL A N     1 
ATOM   3085 C  CA    . VAL A  1  488 ? 11.919  49.184  201.955 1.00 32.35  ? 463 VAL A CA    1 
ATOM   3086 C  C     . VAL A  1  488 ? 11.308  49.815  200.709 1.00 31.46  ? 463 VAL A C     1 
ATOM   3087 O  O     . VAL A  1  488 ? 10.415  49.229  200.102 1.00 33.10  ? 463 VAL A O     1 
ATOM   3088 C  CB    . VAL A  1  488 ? 10.855  49.069  203.087 1.00 33.73  ? 463 VAL A CB    1 
ATOM   3089 C  CG1   . VAL A  1  488 ? 11.459  48.394  204.305 1.00 37.16  ? 463 VAL A CG1   1 
ATOM   3090 C  CG2   . VAL A  1  488 ? 10.273  50.410  203.468 1.00 34.03  ? 463 VAL A CG2   1 
ATOM   3091 N  N     . ASN A  1  489 ? 11.773  51.002  200.321 1.00 33.58  ? 464 ASN A N     1 
ATOM   3092 C  CA    . ASN A  1  489 ? 11.374  51.594  199.040 1.00 33.74  ? 464 ASN A CA    1 
ATOM   3093 C  C     . ASN A  1  489 ? 12.318  51.218  197.904 1.00 33.59  ? 464 ASN A C     1 
ATOM   3094 O  O     . ASN A  1  489 ? 12.245  51.798  196.840 1.00 33.36  ? 464 ASN A O     1 
ATOM   3095 C  CB    . ASN A  1  489 ? 11.244  53.115  199.174 1.00 38.86  ? 464 ASN A CB    1 
ATOM   3096 C  CG    . ASN A  1  489 ? 9.930   53.528  199.820 1.00 43.05  ? 464 ASN A CG    1 
ATOM   3097 O  OD1   . ASN A  1  489 ? 8.863   53.024  199.479 1.00 45.31  ? 464 ASN A OD1   1 
ATOM   3098 N  ND2   . ASN A  1  489 ? 10.000  54.468  200.734 1.00 47.27  ? 464 ASN A ND2   1 
ATOM   3099 N  N     . PHE A  1  490 ? 13.191  50.243  198.147 1.00 30.07  ? 465 PHE A N     1 
ATOM   3100 C  CA    . PHE A  1  490 ? 14.086  49.650  197.163 1.00 31.88  ? 465 PHE A CA    1 
ATOM   3101 C  C     . PHE A  1  490 ? 15.264  50.528  196.754 1.00 33.52  ? 465 PHE A C     1 
ATOM   3102 O  O     . PHE A  1  490 ? 15.985  50.207  195.796 1.00 32.67  ? 465 PHE A O     1 
ATOM   3103 C  CB    . PHE A  1  490 ? 13.307  49.113  195.945 1.00 31.15  ? 465 PHE A CB    1 
ATOM   3104 C  CG    . PHE A  1  490 ? 12.476  47.904  196.257 1.00 31.81  ? 465 PHE A CG    1 
ATOM   3105 C  CD1   . PHE A  1  490 ? 11.202  48.034  196.791 1.00 33.25  ? 465 PHE A CD1   1 
ATOM   3106 C  CD2   . PHE A  1  490 ? 12.971  46.635  196.025 1.00 33.78  ? 465 PHE A CD2   1 
ATOM   3107 C  CE1   . PHE A  1  490 ? 10.439  46.925  197.089 1.00 33.92  ? 465 PHE A CE1   1 
ATOM   3108 C  CE2   . PHE A  1  490 ? 12.212  45.517  196.318 1.00 30.74  ? 465 PHE A CE2   1 
ATOM   3109 C  CZ    . PHE A  1  490 ? 10.935  45.664  196.834 1.00 33.32  ? 465 PHE A CZ    1 
ATOM   3110 N  N     . GLU A  1  491 ? 15.523  51.579  197.516 1.00 31.96  ? 466 GLU A N     1 
ATOM   3111 C  CA    . GLU A  1  491 ? 16.645  52.472  197.240 1.00 33.32  ? 466 GLU A CA    1 
ATOM   3112 C  C     . GLU A  1  491 ? 17.906  51.909  197.819 1.00 31.93  ? 466 GLU A C     1 
ATOM   3113 O  O     . GLU A  1  491 ? 17.941  51.570  198.999 1.00 33.58  ? 466 GLU A O     1 
ATOM   3114 C  CB    . GLU A  1  491 ? 16.381  53.848  197.850 1.00 39.08  ? 466 GLU A CB    1 
ATOM   3115 C  CG    . GLU A  1  491 ? 15.154  54.518  197.234 1.00 49.25  ? 466 GLU A CG    1 
ATOM   3116 C  CD    . GLU A  1  491 ? 14.562  55.655  198.055 1.00 54.24  ? 466 GLU A CD    1 
ATOM   3117 O  OE1   . GLU A  1  491 ? 15.013  55.929  199.195 1.00 57.58  ? 466 GLU A OE1   1 
ATOM   3118 O  OE2   . GLU A  1  491 ? 13.623  56.288  197.523 1.00 64.19  ? 466 GLU A OE2   1 
ATOM   3119 N  N     . VAL A  1  492 ? 18.947  51.846  197.004 1.00 29.86  ? 467 VAL A N     1 
ATOM   3120 C  CA    . VAL A  1  492 ? 20.183  51.211  197.383 1.00 32.07  ? 467 VAL A CA    1 
ATOM   3121 C  C     . VAL A  1  492 ? 21.202  52.285  197.701 1.00 34.32  ? 467 VAL A C     1 
ATOM   3122 O  O     . VAL A  1  492 ? 21.353  53.222  196.930 1.00 32.64  ? 467 VAL A O     1 
ATOM   3123 C  CB    . VAL A  1  492 ? 20.726  50.358  196.236 1.00 33.98  ? 467 VAL A CB    1 
ATOM   3124 C  CG1   . VAL A  1  492 ? 22.115  49.832  196.571 1.00 35.50  ? 467 VAL A CG1   1 
ATOM   3125 C  CG2   . VAL A  1  492 ? 19.753  49.224  195.940 1.00 37.23  ? 467 VAL A CG2   1 
ATOM   3126 N  N     . LYS A  1  493 ? 21.919  52.113  198.804 1.00 32.00  ? 468 LYS A N     1 
ATOM   3127 C  CA    . LYS A  1  493 ? 23.098  52.895  199.124 1.00 37.11  ? 468 LYS A CA    1 
ATOM   3128 C  C     . LYS A  1  493 ? 24.257  51.957  199.341 1.00 34.60  ? 468 LYS A C     1 
ATOM   3129 O  O     . LYS A  1  493 ? 24.070  50.892  199.933 1.00 34.58  ? 468 LYS A O     1 
ATOM   3130 C  CB    . LYS A  1  493 ? 22.910  53.620  200.469 1.00 40.49  ? 468 LYS A CB    1 
ATOM   3131 C  CG    . LYS A  1  493 ? 21.953  54.802  200.524 1.00 46.79  ? 468 LYS A CG    1 
ATOM   3132 C  CD    . LYS A  1  493 ? 21.863  55.281  201.997 1.00 49.75  ? 468 LYS A CD    1 
ATOM   3133 C  CE    . LYS A  1  493 ? 21.791  56.795  202.162 1.00 53.34  ? 468 LYS A CE    1 
ATOM   3134 N  NZ    . LYS A  1  493 ? 20.431  57.309  202.461 1.00 56.64  ? 468 LYS A NZ    1 
ATOM   3135 N  N     . THR A  1  494 ? 25.454  52.380  198.957 1.00 30.56  ? 469 THR A N     1 
ATOM   3136 C  CA    . THR A  1  494 ? 26.676  51.703  199.357 1.00 33.41  ? 469 THR A CA    1 
ATOM   3137 C  C     . THR A  1  494 ? 27.598  52.699  200.031 1.00 35.00  ? 469 THR A C     1 
ATOM   3138 O  O     . THR A  1  494 ? 27.615  53.876  199.669 1.00 37.94  ? 469 THR A O     1 
ATOM   3139 C  CB    . THR A  1  494 ? 27.391  51.052  198.178 1.00 35.26  ? 469 THR A CB    1 
ATOM   3140 O  OG1   . THR A  1  494 ? 27.831  52.057  197.257 1.00 37.65  ? 469 THR A OG1   1 
ATOM   3141 C  CG2   . THR A  1  494 ? 26.428  50.060  197.458 1.00 36.29  ? 469 THR A CG2   1 
ATOM   3142 N  N     . ARG A  1  495 ? 28.346  52.213  201.018 1.00 34.60  ? 470 ARG A N     1 
ATOM   3143 C  CA    . ARG A  1  495 ? 29.190  53.031  201.864 1.00 33.02  ? 470 ARG A CA    1 
ATOM   3144 C  C     . ARG A  1  495 ? 30.443  52.246  202.096 1.00 32.29  ? 470 ARG A C     1 
ATOM   3145 O  O     . ARG A  1  495 ? 30.385  51.182  202.680 1.00 31.12  ? 470 ARG A O     1 
ATOM   3146 C  CB    . ARG A  1  495 ? 28.506  53.311  203.198 1.00 32.79  ? 470 ARG A CB    1 
ATOM   3147 C  CG    . ARG A  1  495 ? 27.314  54.216  203.135 1.00 34.59  ? 470 ARG A CG    1 
ATOM   3148 C  CD    . ARG A  1  495 ? 27.718  55.651  202.753 1.00 37.79  ? 470 ARG A CD    1 
ATOM   3149 N  NE    . ARG A  1  495 ? 26.544  56.502  202.589 1.00 40.42  ? 470 ARG A NE    1 
ATOM   3150 C  CZ    . ARG A  1  495 ? 25.891  56.735  201.449 1.00 40.77  ? 470 ARG A CZ    1 
ATOM   3151 N  NH1   . ARG A  1  495 ? 26.274  56.197  200.296 1.00 42.81  ? 470 ARG A NH1   1 
ATOM   3152 N  NH2   . ARG A  1  495 ? 24.832  57.540  201.462 1.00 42.48  ? 470 ARG A NH2   1 
ATOM   3153 N  N     . ALA A  1  496 ? 31.566  52.772  201.615 1.00 33.36  ? 471 ALA A N     1 
ATOM   3154 C  CA    . ALA A  1  496 ? 32.850  52.090  201.643 1.00 34.21  ? 471 ALA A CA    1 
ATOM   3155 C  C     . ALA A  1  496 ? 33.840  52.776  202.578 1.00 36.09  ? 471 ALA A C     1 
ATOM   3156 O  O     . ALA A  1  496 ? 33.723  53.954  202.862 1.00 38.21  ? 471 ALA A O     1 
ATOM   3157 C  CB    . ALA A  1  496 ? 33.430  52.006  200.237 1.00 38.12  ? 471 ALA A CB    1 
ATOM   3158 N  N     . SER A  1  497 ? 34.798  52.007  203.078 1.00 38.99  ? 472 SER A N     1 
ATOM   3159 C  CA    . SER A  1  497 ? 35.913  52.547  203.809 1.00 40.11  ? 472 SER A CA    1 
ATOM   3160 C  C     . SER A  1  497 ? 37.155  51.738  203.454 1.00 41.38  ? 472 SER A C     1 
ATOM   3161 O  O     . SER A  1  497 ? 37.113  50.505  203.393 1.00 39.25  ? 472 SER A O     1 
ATOM   3162 C  CB    . SER A  1  497 ? 35.623  52.513  205.311 1.00 44.70  ? 472 SER A CB    1 
ATOM   3163 O  OG    . SER A  1  497 ? 36.796  52.765  206.061 1.00 48.72  ? 472 SER A OG    1 
ATOM   3164 N  N     . THR A  1  498 ? 38.252  52.440  203.181 1.00 43.91  ? 473 THR A N     1 
ATOM   3165 C  CA    . THR A  1  498 ? 39.538  51.808  202.907 1.00 44.40  ? 473 THR A CA    1 
ATOM   3166 C  C     . THR A  1  498 ? 40.470  52.019  204.099 1.00 47.49  ? 473 THR A C     1 
ATOM   3167 O  O     . THR A  1  498 ? 40.475  53.070  204.712 1.00 54.02  ? 473 THR A O     1 
ATOM   3168 C  CB    . THR A  1  498 ? 40.137  52.312  201.585 1.00 45.08  ? 473 THR A CB    1 
ATOM   3169 O  OG1   . THR A  1  498 ? 39.399  51.730  200.507 1.00 46.40  ? 473 THR A OG1   1 
ATOM   3170 C  CG2   . THR A  1  498 ? 41.619  51.900  201.422 1.00 46.98  ? 473 THR A CG2   1 
ATOM   3171 N  N     . VAL A  1  499 ? 41.230  50.979  204.417 1.00 51.83  ? 474 VAL A N     1 
ATOM   3172 C  CA    . VAL A  1  499 ? 42.108  50.926  205.570 1.00 55.40  ? 474 VAL A CA    1 
ATOM   3173 C  C     . VAL A  1  499 ? 43.550  50.681  205.069 1.00 57.28  ? 474 VAL A C     1 
ATOM   3174 O  O     . VAL A  1  499 ? 43.766  50.204  203.953 1.00 46.70  ? 474 VAL A O     1 
ATOM   3175 C  CB    . VAL A  1  499 ? 41.563  49.863  206.563 1.00 58.38  ? 474 VAL A CB    1 
ATOM   3176 C  CG1   . VAL A  1  499 ? 42.620  49.326  207.513 1.00 66.09  ? 474 VAL A CG1   1 
ATOM   3177 C  CG2   . VAL A  1  499 ? 40.414  50.468  207.362 1.00 56.20  ? 474 VAL A CG2   1 
ATOM   3178 N  N     . SER A  1  500 ? 44.527  51.067  205.888 1.00 60.97  ? 475 SER A N     1 
ATOM   3179 C  CA    . SER A  1  500 ? 45.945  50.974  205.527 1.00 63.64  ? 475 SER A CA    1 
ATOM   3180 C  C     . SER A  1  500 ? 46.421  49.535  205.409 1.00 62.46  ? 475 SER A C     1 
ATOM   3181 O  O     . SER A  1  500 ? 47.010  49.171  204.398 1.00 67.24  ? 475 SER A O     1 
ATOM   3182 C  CB    . SER A  1  500 ? 46.784  51.713  206.562 1.00 64.44  ? 475 SER A CB    1 
ATOM   3183 O  OG    . SER A  1  500 ? 46.118  52.903  206.941 1.00 68.50  ? 475 SER A OG    1 
ATOM   3184 N  N     . SER A  1  501 ? 46.151  48.725  206.434 1.00 62.40  ? 476 SER A N     1 
ATOM   3185 C  CA    . SER A  1  501 ? 46.560  47.308  206.452 1.00 61.98  ? 476 SER A CA    1 
ATOM   3186 C  C     . SER A  1  501 ? 45.374  46.404  206.086 1.00 60.62  ? 476 SER A C     1 
ATOM   3187 O  O     . SER A  1  501 ? 44.241  46.661  206.503 1.00 56.93  ? 476 SER A O     1 
ATOM   3188 C  CB    . SER A  1  501 ? 47.099  46.929  207.836 1.00 56.56  ? 476 SER A CB    1 
ATOM   3189 N  N     . VAL A  1  502 ? 45.652  45.342  205.331 1.00 60.49  ? 477 VAL A N     1 
ATOM   3190 C  CA    . VAL A  1  502 ? 44.633  44.344  204.936 1.00 62.67  ? 477 VAL A CA    1 
ATOM   3191 C  C     . VAL A  1  502 ? 43.899  43.741  206.139 1.00 62.12  ? 477 VAL A C     1 
ATOM   3192 O  O     . VAL A  1  502 ? 44.473  43.657  207.224 1.00 65.16  ? 477 VAL A O     1 
ATOM   3193 C  CB    . VAL A  1  502 ? 45.232  43.178  204.107 1.00 64.81  ? 477 VAL A CB    1 
ATOM   3194 C  CG1   . VAL A  1  502 ? 45.802  43.678  202.790 1.00 66.05  ? 477 VAL A CG1   1 
ATOM   3195 C  CG2   . VAL A  1  502 ? 46.309  42.417  204.877 1.00 66.24  ? 477 VAL A CG2   1 
ATOM   3196 N  N     . VAL A  1  503 ? 42.640  43.338  205.942 1.00 55.19  ? 478 VAL A N     1 
ATOM   3197 C  CA    . VAL A  1  503 ? 41.831  42.688  206.983 1.00 50.57  ? 478 VAL A CA    1 
ATOM   3198 C  C     . VAL A  1  503 ? 41.204  41.388  206.480 1.00 51.79  ? 478 VAL A C     1 
ATOM   3199 O  O     . VAL A  1  503 ? 41.021  41.196  205.268 1.00 55.24  ? 478 VAL A O     1 
ATOM   3200 C  CB    . VAL A  1  503 ? 40.707  43.603  207.541 1.00 51.56  ? 478 VAL A CB    1 
ATOM   3201 C  CG1   . VAL A  1  503 ? 41.285  44.848  208.196 1.00 50.34  ? 478 VAL A CG1   1 
ATOM   3202 C  CG2   . VAL A  1  503 ? 39.680  43.989  206.478 1.00 50.61  ? 478 VAL A CG2   1 
ATOM   3203 N  N     . SER A  1  504 ? 40.869  40.502  207.417 1.00 49.06  ? 479 SER A N     1 
ATOM   3204 C  CA    . SER A  1  504 ? 40.280  39.197  207.085 1.00 51.21  ? 479 SER A CA    1 
ATOM   3205 C  C     . SER A  1  504 ? 39.284  38.598  208.069 1.00 48.54  ? 479 SER A C     1 
ATOM   3206 O  O     . SER A  1  504 ? 38.434  37.827  207.645 1.00 51.80  ? 479 SER A O     1 
ATOM   3207 C  CB    . SER A  1  504 ? 41.383  38.163  206.815 1.00 53.58  ? 479 SER A CB    1 
ATOM   3208 O  OG    . SER A  1  504 ? 42.309  38.105  207.879 1.00 61.45  ? 479 SER A OG    1 
ATOM   3209 N  N     . THR A  1  505 ? 39.365  38.918  209.353 1.00 43.46  ? 480 THR A N     1 
ATOM   3210 C  CA    . THR A  1  505 ? 38.605  38.178  210.351 1.00 42.55  ? 480 THR A CA    1 
ATOM   3211 C  C     . THR A  1  505 ? 37.229  38.800  210.521 1.00 41.37  ? 480 THR A C     1 
ATOM   3212 O  O     . THR A  1  505 ? 37.034  39.972  210.219 1.00 43.66  ? 480 THR A O     1 
ATOM   3213 C  CB    . THR A  1  505 ? 39.335  38.189  211.714 1.00 43.38  ? 480 THR A CB    1 
ATOM   3214 O  OG1   . THR A  1  505 ? 39.310  39.515  212.248 1.00 41.19  ? 480 THR A OG1   1 
ATOM   3215 C  CG2   . THR A  1  505 ? 40.822  37.718  211.562 1.00 41.55  ? 480 THR A CG2   1 
ATOM   3216 N  N     . ALA A  1  506 ? 36.284  38.029  211.045 1.00 40.51  ? 481 ALA A N     1 
ATOM   3217 C  CA    . ALA A  1  506 ? 34.936  38.547  211.328 1.00 45.00  ? 481 ALA A CA    1 
ATOM   3218 C  C     . ALA A  1  506 ? 34.997  39.829  212.145 1.00 45.44  ? 481 ALA A C     1 
ATOM   3219 O  O     . ALA A  1  506 ? 34.278  40.775  211.883 1.00 44.67  ? 481 ALA A O     1 
ATOM   3220 C  CB    . ALA A  1  506 ? 34.110  37.502  212.055 1.00 46.12  ? 481 ALA A CB    1 
ATOM   3221 N  N     . GLU A  1  507 ? 35.923  39.845  213.099 1.00 49.74  ? 482 GLU A N     1 
ATOM   3222 C  CA    . GLU A  1  507 ? 36.130  40.949  214.030 1.00 49.43  ? 482 GLU A CA    1 
ATOM   3223 C  C     . GLU A  1  507 ? 36.585  42.206  213.290 1.00 41.63  ? 482 GLU A C     1 
ATOM   3224 O  O     . GLU A  1  507 ? 36.028  43.255  213.474 1.00 35.52  ? 482 GLU A O     1 
ATOM   3225 C  CB    . GLU A  1  507 ? 37.186  40.571  215.105 1.00 51.57  ? 482 GLU A CB    1 
ATOM   3226 C  CG    . GLU A  1  507 ? 36.744  39.503  216.106 1.00 57.65  ? 482 GLU A CG    1 
ATOM   3227 C  CD    . GLU A  1  507 ? 36.633  38.076  215.542 1.00 59.42  ? 482 GLU A CD    1 
ATOM   3228 O  OE1   . GLU A  1  507 ? 35.748  37.327  216.008 1.00 59.98  ? 482 GLU A OE1   1 
ATOM   3229 O  OE2   . GLU A  1  507 ? 37.399  37.693  214.627 1.00 55.23  ? 482 GLU A OE2   1 
ATOM   3230 N  N     . GLU A  1  508 ? 37.618  42.070  212.472 1.00 41.52  ? 483 GLU A N     1 
ATOM   3231 C  CA    . GLU A  1  508 ? 38.192  43.197  211.744 1.00 42.03  ? 483 GLU A CA    1 
ATOM   3232 C  C     . GLU A  1  508 ? 37.213  43.764  210.723 1.00 40.19  ? 483 GLU A C     1 
ATOM   3233 O  O     . GLU A  1  508 ? 37.003  44.978  210.658 1.00 38.43  ? 483 GLU A O     1 
ATOM   3234 C  CB    . GLU A  1  508 ? 39.445  42.748  210.986 1.00 46.04  ? 483 GLU A CB    1 
ATOM   3235 C  CG    . GLU A  1  508 ? 40.615  42.331  211.860 1.00 47.19  ? 483 GLU A CG    1 
ATOM   3236 C  CD    . GLU A  1  508 ? 41.708  41.639  211.078 1.00 49.65  ? 483 GLU A CD    1 
ATOM   3237 O  OE1   . GLU A  1  508 ? 41.414  40.879  210.139 1.00 49.06  ? 483 GLU A OE1   1 
ATOM   3238 O  OE2   . GLU A  1  508 ? 42.882  41.853  211.414 1.00 59.08  ? 483 GLU A OE2   1 
ATOM   3239 N  N     . ILE A  1  509 ? 36.611  42.875  209.935 1.00 36.28  ? 484 ILE A N     1 
ATOM   3240 C  CA    . ILE A  1  509 ? 35.614  43.309  208.948 1.00 36.95  ? 484 ILE A CA    1 
ATOM   3241 C  C     . ILE A  1  509 ? 34.479  44.038  209.641 1.00 34.95  ? 484 ILE A C     1 
ATOM   3242 O  O     . ILE A  1  509 ? 34.146  45.164  209.267 1.00 35.94  ? 484 ILE A O     1 
ATOM   3243 C  CB    . ILE A  1  509 ? 35.122  42.159  208.047 1.00 37.93  ? 484 ILE A CB    1 
ATOM   3244 C  CG1   . ILE A  1  509 ? 36.271  41.637  207.183 1.00 38.41  ? 484 ILE A CG1   1 
ATOM   3245 C  CG2   . ILE A  1  509 ? 33.992  42.623  207.123 1.00 39.36  ? 484 ILE A CG2   1 
ATOM   3246 C  CD1   . ILE A  1  509 ? 36.012  40.286  206.533 1.00 37.49  ? 484 ILE A CD1   1 
ATOM   3247 N  N     . PHE A  1  510 ? 33.923  43.438  210.684 1.00 38.42  ? 485 PHE A N     1 
ATOM   3248 C  CA    . PHE A  1  510 ? 32.808  44.066  211.423 1.00 37.82  ? 485 PHE A CA    1 
ATOM   3249 C  C     . PHE A  1  510 ? 33.162  45.396  212.130 1.00 35.57  ? 485 PHE A C     1 
ATOM   3250 O  O     . PHE A  1  510 ? 32.300  46.271  212.294 1.00 32.05  ? 485 PHE A O     1 
ATOM   3251 C  CB    . PHE A  1  510 ? 32.222  43.068  212.432 1.00 39.56  ? 485 PHE A CB    1 
ATOM   3252 C  CG    . PHE A  1  510 ? 31.022  43.588  213.184 1.00 40.40  ? 485 PHE A CG    1 
ATOM   3253 C  CD1   . PHE A  1  510 ? 29.892  44.046  212.501 1.00 38.21  ? 485 PHE A CD1   1 
ATOM   3254 C  CD2   . PHE A  1  510 ? 31.021  43.622  214.568 1.00 42.49  ? 485 PHE A CD2   1 
ATOM   3255 C  CE1   . PHE A  1  510 ? 28.786  44.527  213.181 1.00 37.74  ? 485 PHE A CE1   1 
ATOM   3256 C  CE2   . PHE A  1  510 ? 29.913  44.093  215.266 1.00 45.31  ? 485 PHE A CE2   1 
ATOM   3257 C  CZ    . PHE A  1  510 ? 28.791  44.554  214.568 1.00 42.97  ? 485 PHE A CZ    1 
ATOM   3258 N  N     . ALA A  1  511 ? 34.411  45.560  212.553 1.00 37.06  ? 486 ALA A N     1 
ATOM   3259 C  CA    . ALA A  1  511 ? 34.822  46.826  213.196 1.00 36.96  ? 486 ALA A CA    1 
ATOM   3260 C  C     . ALA A  1  511 ? 34.711  48.018  212.212 1.00 37.56  ? 486 ALA A C     1 
ATOM   3261 O  O     . ALA A  1  511 ? 34.296  49.115  212.589 1.00 38.00  ? 486 ALA A O     1 
ATOM   3262 C  CB    . ALA A  1  511 ? 36.224  46.703  213.778 1.00 36.99  ? 486 ALA A CB    1 
ATOM   3263 N  N     . ILE A  1  512 ? 34.981  47.757  210.937 1.00 37.13  ? 487 ILE A N     1 
ATOM   3264 C  CA    . ILE A  1  512 ? 34.796  48.743  209.871 1.00 36.38  ? 487 ILE A CA    1 
ATOM   3265 C  C     . ILE A  1  512 ? 33.319  48.872  209.489 1.00 35.52  ? 487 ILE A C     1 
ATOM   3266 O  O     . ILE A  1  512 ? 32.759  49.976  209.500 1.00 34.60  ? 487 ILE A O     1 
ATOM   3267 C  CB    . ILE A  1  512 ? 35.636  48.347  208.633 1.00 38.76  ? 487 ILE A CB    1 
ATOM   3268 C  CG1   . ILE A  1  512 ? 37.117  48.239  209.014 1.00 37.09  ? 487 ILE A CG1   1 
ATOM   3269 C  CG2   . ILE A  1  512 ? 35.467  49.371  207.513 1.00 40.10  ? 487 ILE A CG2   1 
ATOM   3270 C  CD1   . ILE A  1  512 ? 37.953  47.451  208.050 1.00 37.62  ? 487 ILE A CD1   1 
ATOM   3271 N  N     . ALA A  1  513 ? 32.680  47.754  209.148 1.00 35.02  ? 488 ALA A N     1 
ATOM   3272 C  CA    . ALA A  1  513 ? 31.272  47.789  208.685 1.00 35.48  ? 488 ALA A CA    1 
ATOM   3273 C  C     . ALA A  1  513 ? 30.314  48.415  209.680 1.00 35.21  ? 488 ALA A C     1 
ATOM   3274 O  O     . ALA A  1  513 ? 29.391  49.133  209.288 1.00 36.81  ? 488 ALA A O     1 
ATOM   3275 C  CB    . ALA A  1  513 ? 30.777  46.385  208.339 1.00 37.40  ? 488 ALA A CB    1 
ATOM   3276 N  N     . LYS A  1  514 ? 30.515  48.099  210.963 1.00 36.48  ? 489 LYS A N     1 
ATOM   3277 C  CA    . LYS A  1  514 ? 29.711  48.616  212.068 1.00 38.21  ? 489 LYS A CA    1 
ATOM   3278 C  C     . LYS A  1  514 ? 29.743  50.144  212.108 1.00 36.73  ? 489 LYS A C     1 
ATOM   3279 O  O     . LYS A  1  514 ? 28.713  50.775  212.334 1.00 34.92  ? 489 LYS A O     1 
ATOM   3280 C  CB    . LYS A  1  514 ? 30.238  48.030  213.399 1.00 44.22  ? 489 LYS A CB    1 
ATOM   3281 C  CG    . LYS A  1  514 ? 29.836  48.704  214.696 1.00 52.47  ? 489 LYS A CG    1 
ATOM   3282 C  CD    . LYS A  1  514 ? 30.491  48.013  215.897 1.00 58.35  ? 489 LYS A CD    1 
ATOM   3283 C  CE    . LYS A  1  514 ? 32.009  48.190  215.911 1.00 62.86  ? 489 LYS A CE    1 
ATOM   3284 N  NZ    . LYS A  1  514 ? 32.599  47.947  217.259 1.00 69.19  ? 489 LYS A NZ    1 
ATOM   3285 N  N     . GLU A  1  515 ? 30.914  50.729  211.868 1.00 38.43  ? 490 GLU A N     1 
ATOM   3286 C  CA    . GLU A  1  515 ? 31.056  52.203  211.828 1.00 40.28  ? 490 GLU A CA    1 
ATOM   3287 C  C     . GLU A  1  515 ? 30.341  52.811  210.636 1.00 36.95  ? 490 GLU A C     1 
ATOM   3288 O  O     . GLU A  1  515 ? 29.646  53.826  210.766 1.00 36.65  ? 490 GLU A O     1 
ATOM   3289 C  CB    . GLU A  1  515 ? 32.541  52.634  211.819 1.00 43.31  ? 490 GLU A CB    1 
ATOM   3290 C  CG    . GLU A  1  515 ? 33.303  52.439  213.117 1.00 46.76  ? 490 GLU A CG    1 
ATOM   3291 C  CD    . GLU A  1  515 ? 32.555  52.927  214.352 1.00 52.97  ? 490 GLU A CD    1 
ATOM   3292 O  OE1   . GLU A  1  515 ? 32.002  54.061  214.346 1.00 52.62  ? 490 GLU A OE1   1 
ATOM   3293 O  OE2   . GLU A  1  515 ? 32.501  52.149  215.336 1.00 58.02  ? 490 GLU A OE2   1 
ATOM   3294 N  N     . LEU A  1  516 ? 30.492  52.183  209.472 1.00 36.32  ? 491 LEU A N     1 
ATOM   3295 C  CA    . LEU A  1  516 ? 29.769  52.625  208.268 1.00 36.05  ? 491 LEU A CA    1 
ATOM   3296 C  C     . LEU A  1  516 ? 28.275  52.592  208.510 1.00 34.04  ? 491 LEU A C     1 
ATOM   3297 O  O     . LEU A  1  516 ? 27.540  53.504  208.113 1.00 33.48  ? 491 LEU A O     1 
ATOM   3298 C  CB    . LEU A  1  516 ? 30.131  51.757  207.044 1.00 38.11  ? 491 LEU A CB    1 
ATOM   3299 C  CG    . LEU A  1  516 ? 31.592  51.888  206.604 1.00 40.39  ? 491 LEU A CG    1 
ATOM   3300 C  CD1   . LEU A  1  516 ? 32.051  50.717  205.750 1.00 38.61  ? 491 LEU A CD1   1 
ATOM   3301 C  CD2   . LEU A  1  516 ? 31.821  53.230  205.894 1.00 43.26  ? 491 LEU A CD2   1 
ATOM   3302 N  N     . LEU A  1  517 ? 27.814  51.555  209.200 1.00 35.34  ? 492 LEU A N     1 
ATOM   3303 C  CA    . LEU A  1  517 ? 26.378  51.386  209.436 1.00 33.10  ? 492 LEU A CA    1 
ATOM   3304 C  C     . LEU A  1  517 ? 25.904  52.420  210.443 1.00 33.84  ? 492 LEU A C     1 
ATOM   3305 O  O     . LEU A  1  517 ? 24.830  53.038  210.286 1.00 33.59  ? 492 LEU A O     1 
ATOM   3306 C  CB    . LEU A  1  517 ? 26.099  49.951  209.915 1.00 32.20  ? 492 LEU A CB    1 
ATOM   3307 C  CG    . LEU A  1  517 ? 24.668  49.624  210.322 1.00 34.50  ? 492 LEU A CG    1 
ATOM   3308 C  CD1   . LEU A  1  517 ? 23.694  49.967  209.212 1.00 34.84  ? 492 LEU A CD1   1 
ATOM   3309 C  CD2   . LEU A  1  517 ? 24.575  48.157  210.734 1.00 37.22  ? 492 LEU A CD2   1 
ATOM   3310 N  N     . LYS A  1  518 ? 26.694  52.590  211.497 1.00 35.43  ? 493 LYS A N     1 
ATOM   3311 C  CA    . LYS A  1  518 ? 26.405  53.600  212.524 1.00 38.85  ? 493 LYS A CA    1 
ATOM   3312 C  C     . LYS A  1  518 ? 26.195  54.999  211.912 1.00 37.01  ? 493 LYS A C     1 
ATOM   3313 O  O     . LYS A  1  518 ? 25.244  55.729  212.259 1.00 40.24  ? 493 LYS A O     1 
ATOM   3314 C  CB    . LYS A  1  518 ? 27.562  53.635  213.540 1.00 42.33  ? 493 LYS A CB    1 
ATOM   3315 C  CG    . LYS A  1  518 ? 27.409  54.677  214.656 1.00 46.36  ? 493 LYS A CG    1 
ATOM   3316 C  CD    . LYS A  1  518 ? 28.680  54.764  215.498 1.00 51.63  ? 493 LYS A CD    1 
ATOM   3317 C  CE    . LYS A  1  518 ? 28.433  55.444  216.836 1.00 54.41  ? 493 LYS A CE    1 
ATOM   3318 N  NZ    . LYS A  1  518 ? 27.687  56.739  216.736 1.00 55.45  ? 493 LYS A NZ    1 
ATOM   3319 N  N     . THR A  1  519 ? 27.098  55.383  211.019 1.00 36.06  ? 494 THR A N     1 
ATOM   3320 C  CA    . THR A  1  519 ? 26.982  56.673  210.330 1.00 36.11  ? 494 THR A CA    1 
ATOM   3321 C  C     . THR A  1  519 ? 25.624  56.815  209.637 1.00 37.25  ? 494 THR A C     1 
ATOM   3322 O  O     . THR A  1  519 ? 24.981  57.852  209.748 1.00 36.87  ? 494 THR A O     1 
ATOM   3323 C  CB    . THR A  1  519 ? 28.097  56.838  209.306 1.00 37.19  ? 494 THR A CB    1 
ATOM   3324 O  OG1   . THR A  1  519 ? 29.365  56.791  209.968 1.00 36.99  ? 494 THR A OG1   1 
ATOM   3325 C  CG2   . THR A  1  519 ? 27.958  58.147  208.567 1.00 39.91  ? 494 THR A CG2   1 
ATOM   3326 N  N     . GLU A  1  520 ? 25.164  55.770  208.953 1.00 35.59  ? 495 GLU A N     1 
ATOM   3327 C  CA    . GLU A  1  520 ? 23.825  55.814  208.335 1.00 34.79  ? 495 GLU A CA    1 
ATOM   3328 C  C     . GLU A  1  520 ? 22.687  55.855  209.329 1.00 35.82  ? 495 GLU A C     1 
ATOM   3329 O  O     . GLU A  1  520 ? 21.692  56.562  209.112 1.00 40.96  ? 495 GLU A O     1 
ATOM   3330 C  CB    . GLU A  1  520 ? 23.638  54.643  207.370 1.00 37.95  ? 495 GLU A CB    1 
ATOM   3331 C  CG    . GLU A  1  520 ? 24.603  54.653  206.194 1.00 40.03  ? 495 GLU A CG    1 
ATOM   3332 C  CD    . GLU A  1  520 ? 24.710  56.025  205.525 1.00 41.33  ? 495 GLU A CD    1 
ATOM   3333 O  OE1   . GLU A  1  520 ? 23.645  56.587  205.166 1.00 41.46  ? 495 GLU A OE1   1 
ATOM   3334 O  OE2   . GLU A  1  520 ? 25.846  56.539  205.421 1.00 40.20  ? 495 GLU A OE2   1 
ATOM   3335 N  N     . ILE A  1  521 ? 22.802  55.099  210.418 1.00 40.10  ? 496 ILE A N     1 
ATOM   3336 C  CA    . ILE A  1  521 ? 21.740  55.109  211.445 1.00 40.67  ? 496 ILE A CA    1 
ATOM   3337 C  C     . ILE A  1  521 ? 21.656  56.517  212.055 1.00 42.52  ? 496 ILE A C     1 
ATOM   3338 O  O     . ILE A  1  521 ? 20.559  57.059  212.210 1.00 43.96  ? 496 ILE A O     1 
ATOM   3339 C  CB    . ILE A  1  521 ? 21.952  54.032  212.529 1.00 41.19  ? 496 ILE A CB    1 
ATOM   3340 C  CG1   . ILE A  1  521 ? 21.712  52.621  211.946 1.00 36.30  ? 496 ILE A CG1   1 
ATOM   3341 C  CG2   . ILE A  1  521 ? 21.002  54.268  213.707 1.00 43.74  ? 496 ILE A CG2   1 
ATOM   3342 C  CD1   . ILE A  1  521 ? 22.310  51.506  212.765 1.00 34.35  ? 496 ILE A CD1   1 
ATOM   3343 N  N     . ASP A  1  522 ? 22.816  57.109  212.332 1.00 40.48  ? 497 ASP A N     1 
ATOM   3344 C  CA    . ASP A  1  522 ? 22.894  58.467  212.894 1.00 46.09  ? 497 ASP A CA    1 
ATOM   3345 C  C     . ASP A  1  522 ? 22.373  59.559  211.950 1.00 48.00  ? 497 ASP A C     1 
ATOM   3346 O  O     . ASP A  1  522 ? 21.718  60.491  212.406 1.00 50.76  ? 497 ASP A O     1 
ATOM   3347 C  CB    . ASP A  1  522 ? 24.335  58.812  213.317 1.00 43.71  ? 497 ASP A CB    1 
ATOM   3348 C  CG    . ASP A  1  522 ? 24.806  58.009  214.523 1.00 49.12  ? 497 ASP A CG    1 
ATOM   3349 O  OD1   . ASP A  1  522 ? 23.987  57.297  215.151 1.00 52.16  ? 497 ASP A OD1   1 
ATOM   3350 O  OD2   . ASP A  1  522 ? 26.012  58.087  214.848 1.00 51.27  ? 497 ASP A OD2   1 
ATOM   3351 N  N     . ALA A  1  523 ? 22.644  59.443  210.659 1.00 45.88  ? 498 ALA A N     1 
ATOM   3352 C  CA    . ALA A  1  523 ? 22.192  60.440  209.689 1.00 48.63  ? 498 ALA A CA    1 
ATOM   3353 C  C     . ALA A  1  523 ? 20.677  60.633  209.635 1.00 50.89  ? 498 ALA A C     1 
ATOM   3354 O  O     . ALA A  1  523 ? 20.210  61.748  209.436 1.00 51.63  ? 498 ALA A O     1 
ATOM   3355 C  CB    . ALA A  1  523 ? 22.725  60.111  208.301 1.00 51.23  ? 498 ALA A CB    1 
ATOM   3356 N  N     . ASP A  1  524 ? 19.907  59.564  209.815 1.00 56.66  ? 499 ASP A N     1 
ATOM   3357 C  CA    . ASP A  1  524 ? 18.437  59.650  209.772 1.00 54.80  ? 499 ASP A CA    1 
ATOM   3358 C  C     . ASP A  1  524 ? 17.805  59.852  211.151 1.00 55.40  ? 499 ASP A C     1 
ATOM   3359 O  O     . ASP A  1  524 ? 16.596  60.028  211.255 1.00 48.33  ? 499 ASP A O     1 
ATOM   3360 C  CB    . ASP A  1  524 ? 17.848  58.363  209.163 1.00 63.12  ? 499 ASP A CB    1 
ATOM   3361 C  CG    . ASP A  1  524 ? 18.160  58.199  207.673 1.00 64.57  ? 499 ASP A CG    1 
ATOM   3362 O  OD1   . ASP A  1  524 ? 19.345  58.299  207.268 1.00 70.52  ? 499 ASP A OD1   1 
ATOM   3363 O  OD2   . ASP A  1  524 ? 17.209  57.919  206.915 1.00 64.87  ? 499 ASP A OD2   1 
ATOM   3364 N  N     . PHE A  1  525 ? 18.605  59.780  212.211 1.00 59.36  ? 500 PHE A N     1 
ATOM   3365 C  CA    . PHE A  1  525 ? 18.098  59.832  213.586 1.00 67.40  ? 500 PHE A CA    1 
ATOM   3366 C  C     . PHE A  1  525 ? 17.253  61.102  213.802 1.00 62.59  ? 500 PHE A C     1 
ATOM   3367 O  O     . PHE A  1  525 ? 17.644  62.148  213.312 1.00 66.62  ? 500 PHE A O     1 
ATOM   3368 C  CB    . PHE A  1  525 ? 19.279  59.791  214.563 1.00 73.37  ? 500 PHE A CB    1 
ATOM   3369 C  CG    . PHE A  1  525 ? 18.866  59.752  215.994 1.00 82.89  ? 500 PHE A CG    1 
ATOM   3370 C  CD1   . PHE A  1  525 ? 18.532  58.541  216.601 1.00 87.21  ? 500 PHE A CD1   1 
ATOM   3371 C  CD2   . PHE A  1  525 ? 18.771  60.924  216.733 1.00 85.98  ? 500 PHE A CD2   1 
ATOM   3372 C  CE1   . PHE A  1  525 ? 18.120  58.500  217.927 1.00 90.44  ? 500 PHE A CE1   1 
ATOM   3373 C  CE2   . PHE A  1  525 ? 18.364  60.890  218.060 1.00 92.20  ? 500 PHE A CE2   1 
ATOM   3374 C  CZ    . PHE A  1  525 ? 18.039  59.676  218.657 1.00 92.83  ? 500 PHE A CZ    1 
ATOM   3375 N  N     . PRO A  1  526 ? 16.101  61.047  214.485 1.00 61.05  ? 501 PRO A N     1 
ATOM   3376 C  CA    . PRO A  1  526 ? 15.560  59.893  215.203 1.00 61.12  ? 501 PRO A CA    1 
ATOM   3377 C  C     . PRO A  1  526 ? 14.724  58.896  214.357 1.00 59.11  ? 501 PRO A C     1 
ATOM   3378 O  O     . PRO A  1  526 ? 14.021  58.064  214.934 1.00 61.54  ? 501 PRO A O     1 
ATOM   3379 C  CB    . PRO A  1  526 ? 14.633  60.580  216.208 1.00 59.39  ? 501 PRO A CB    1 
ATOM   3380 C  CG    . PRO A  1  526 ? 14.045  61.698  215.401 1.00 58.02  ? 501 PRO A CG    1 
ATOM   3381 C  CD    . PRO A  1  526 ? 15.048  62.069  214.328 1.00 59.56  ? 501 PRO A CD    1 
ATOM   3382 N  N     . HIS A  1  527 ? 14.781  58.973  213.028 1.00 58.40  ? 502 HIS A N     1 
ATOM   3383 C  CA    . HIS A  1  527 ? 14.060  58.013  212.177 1.00 61.22  ? 502 HIS A CA    1 
ATOM   3384 C  C     . HIS A  1  527 ? 14.884  56.719  212.049 1.00 51.48  ? 502 HIS A C     1 
ATOM   3385 O  O     . HIS A  1  527 ? 16.041  56.764  211.641 1.00 49.54  ? 502 HIS A O     1 
ATOM   3386 C  CB    . HIS A  1  527 ? 13.774  58.596  210.785 1.00 64.64  ? 502 HIS A CB    1 
ATOM   3387 C  CG    . HIS A  1  527 ? 13.069  59.921  210.811 1.00 73.90  ? 502 HIS A CG    1 
ATOM   3388 N  ND1   . HIS A  1  527 ? 11.960  60.163  211.598 1.00 78.11  ? 502 HIS A ND1   1 
ATOM   3389 C  CD2   . HIS A  1  527 ? 13.307  61.071  210.134 1.00 75.23  ? 502 HIS A CD2   1 
ATOM   3390 C  CE1   . HIS A  1  527 ? 11.551  61.405  211.410 1.00 78.49  ? 502 HIS A CE1   1 
ATOM   3391 N  NE2   . HIS A  1  527 ? 12.347  61.974  210.521 1.00 81.28  ? 502 HIS A NE2   1 
ATOM   3392 N  N     . PRO A  1  528 ? 14.296  55.561  212.392 1.00 49.11  ? 503 PRO A N     1 
ATOM   3393 C  CA    . PRO A  1  528 ? 15.058  54.321  212.119 1.00 46.27  ? 503 PRO A CA    1 
ATOM   3394 C  C     . PRO A  1  528 ? 15.290  54.101  210.616 1.00 37.81  ? 503 PRO A C     1 
ATOM   3395 O  O     . PRO A  1  528 ? 14.476  54.516  209.801 1.00 32.95  ? 503 PRO A O     1 
ATOM   3396 C  CB    . PRO A  1  528 ? 14.157  53.224  212.687 1.00 44.81  ? 503 PRO A CB    1 
ATOM   3397 C  CG    . PRO A  1  528 ? 12.791  53.789  212.579 1.00 49.48  ? 503 PRO A CG    1 
ATOM   3398 C  CD    . PRO A  1  528 ? 12.923  55.268  212.828 1.00 48.13  ? 503 PRO A CD    1 
ATOM   3399 N  N     . LEU A  1  529 ? 16.409  53.480  210.267 1.00 36.11  ? 504 LEU A N     1 
ATOM   3400 C  CA    . LEU A  1  529 ? 16.569  52.900  208.931 1.00 36.51  ? 504 LEU A CA    1 
ATOM   3401 C  C     . LEU A  1  529 ? 15.570  51.760  208.802 1.00 34.56  ? 504 LEU A C     1 
ATOM   3402 O  O     . LEU A  1  529 ? 15.457  50.956  209.722 1.00 32.47  ? 504 LEU A O     1 
ATOM   3403 C  CB    . LEU A  1  529 ? 17.953  52.314  208.766 1.00 39.86  ? 504 LEU A CB    1 
ATOM   3404 C  CG    . LEU A  1  529 ? 19.165  53.217  208.747 1.00 42.73  ? 504 LEU A CG    1 
ATOM   3405 C  CD1   . LEU A  1  529 ? 20.333  52.368  208.269 1.00 43.34  ? 504 LEU A CD1   1 
ATOM   3406 C  CD2   . LEU A  1  529 ? 18.955  54.425  207.840 1.00 46.94  ? 504 LEU A CD2   1 
ATOM   3407 N  N     . ARG A  1  530 ? 14.838  51.714  207.691 1.00 32.82  ? 505 ARG A N     1 
ATOM   3408 C  CA    . ARG A  1  530 ? 13.892  50.631  207.410 1.00 32.04  ? 505 ARG A CA    1 
ATOM   3409 C  C     . ARG A  1  530 ? 14.426  49.803  206.249 1.00 33.49  ? 505 ARG A C     1 
ATOM   3410 O  O     . ARG A  1  530 ? 14.367  50.229  205.089 1.00 32.53  ? 505 ARG A O     1 
ATOM   3411 C  CB    . ARG A  1  530 ? 12.529  51.199  207.087 1.00 34.65  ? 505 ARG A CB    1 
ATOM   3412 C  CG    . ARG A  1  530 ? 11.982  52.100  208.184 1.00 34.94  ? 505 ARG A CG    1 
ATOM   3413 C  CD    . ARG A  1  530 ? 10.625  52.655  207.825 1.00 35.00  ? 505 ARG A CD    1 
ATOM   3414 N  NE    . ARG A  1  530 ? 9.670   51.578  207.578 1.00 36.98  ? 505 ARG A NE    1 
ATOM   3415 C  CZ    . ARG A  1  530 ? 8.536   51.702  206.888 1.00 37.62  ? 505 ARG A CZ    1 
ATOM   3416 N  NH1   . ARG A  1  530 ? 8.181   52.856  206.330 1.00 41.12  ? 505 ARG A NH1   1 
ATOM   3417 N  NH2   . ARG A  1  530 ? 7.759   50.653  206.721 1.00 38.68  ? 505 ARG A NH2   1 
ATOM   3418 N  N     . LEU A  1  531 ? 15.027  48.666  206.575 1.00 30.72  ? 506 LEU A N     1 
ATOM   3419 C  CA    . LEU A  1  531 ? 15.805  47.904  205.604 1.00 32.70  ? 506 LEU A CA    1 
ATOM   3420 C  C     . LEU A  1  531 ? 15.093  46.642  205.163 1.00 31.61  ? 506 LEU A C     1 
ATOM   3421 O  O     . LEU A  1  531 ? 14.473  45.955  205.994 1.00 31.64  ? 506 LEU A O     1 
ATOM   3422 C  CB    . LEU A  1  531 ? 17.154  47.508  206.196 1.00 31.75  ? 506 LEU A CB    1 
ATOM   3423 C  CG    . LEU A  1  531 ? 18.003  48.663  206.677 1.00 32.37  ? 506 LEU A CG    1 
ATOM   3424 C  CD1   . LEU A  1  531 ? 19.327  48.122  207.184 1.00 33.11  ? 506 LEU A CD1   1 
ATOM   3425 C  CD2   . LEU A  1  531 ? 18.239  49.650  205.558 1.00 35.20  ? 506 LEU A CD2   1 
ATOM   3426 N  N     . ARG A  1  532 ? 15.203  46.347  203.860 1.00 29.23  ? 507 ARG A N     1 
ATOM   3427 C  CA    . ARG A  1  532 ? 14.850  45.038  203.300 1.00 29.66  ? 507 ARG A CA    1 
ATOM   3428 C  C     . ARG A  1  532 ? 16.077  44.230  202.873 1.00 27.51  ? 507 ARG A C     1 
ATOM   3429 O  O     . ARG A  1  532 ? 15.950  43.032  202.603 1.00 29.24  ? 507 ARG A O     1 
ATOM   3430 C  CB    . ARG A  1  532 ? 13.863  45.194  202.145 1.00 29.83  ? 507 ARG A CB    1 
ATOM   3431 C  CG    . ARG A  1  532 ? 14.461  45.782  200.862 1.00 30.93  ? 507 ARG A CG    1 
ATOM   3432 C  CD    . ARG A  1  532 ? 13.487  45.700  199.694 1.00 29.88  ? 507 ARG A CD    1 
ATOM   3433 N  NE    . ARG A  1  532 ? 13.391  44.344  199.120 1.00 30.15  ? 507 ARG A NE    1 
ATOM   3434 C  CZ    . ARG A  1  532 ? 12.306  43.568  199.141 1.00 29.59  ? 507 ARG A CZ    1 
ATOM   3435 N  NH1   . ARG A  1  532 ? 12.333  42.384  198.554 1.00 32.05  ? 507 ARG A NH1   1 
ATOM   3436 N  NH2   . ARG A  1  532 ? 11.190  43.951  199.735 1.00 29.39  ? 507 ARG A NH2   1 
ATOM   3437 N  N     . LEU A  1  533 ? 17.244  44.863  202.767 1.00 26.46  ? 508 LEU A N     1 
ATOM   3438 C  CA    . LEU A  1  533 ? 18.464  44.130  202.420 1.00 26.59  ? 508 LEU A CA    1 
ATOM   3439 C  C     . LEU A  1  533 ? 19.667  44.761  203.058 1.00 27.29  ? 508 LEU A C     1 
ATOM   3440 O  O     . LEU A  1  533 ? 19.741  45.983  203.136 1.00 29.09  ? 508 LEU A O     1 
ATOM   3441 C  CB    . LEU A  1  533 ? 18.682  44.031  200.884 1.00 26.67  ? 508 LEU A CB    1 
ATOM   3442 C  CG    . LEU A  1  533 ? 20.069  43.561  200.369 1.00 27.40  ? 508 LEU A CG    1 
ATOM   3443 C  CD1   . LEU A  1  533 ? 20.018  42.899  198.987 1.00 29.15  ? 508 LEU A CD1   1 
ATOM   3444 C  CD2   . LEU A  1  533 ? 21.072  44.702  200.313 1.00 27.72  ? 508 LEU A CD2   1 
ATOM   3445 N  N     . MET A  1  534 ? 20.629  43.932  203.452 1.00 26.46  ? 509 MET A N     1 
ATOM   3446 C  CA    . MET A  1  534 ? 21.976  44.391  203.794 1.00 27.30  ? 509 MET A CA    1 
ATOM   3447 C  C     . MET A  1  534 ? 23.038  43.484  203.170 1.00 25.74  ? 509 MET A C     1 
ATOM   3448 O  O     . MET A  1  534 ? 22.828  42.294  203.010 1.00 28.16  ? 509 MET A O     1 
ATOM   3449 C  CB    . MET A  1  534 ? 22.138  44.390  205.314 1.00 29.77  ? 509 MET A CB    1 
ATOM   3450 C  CG    . MET A  1  534 ? 23.498  44.868  205.841 1.00 33.56  ? 509 MET A CG    1 
ATOM   3451 S  SD    . MET A  1  534 ? 23.634  44.816  207.657 1.00 37.97  ? 509 MET A SD    1 
ATOM   3452 C  CE    . MET A  1  534 ? 22.198  45.788  208.106 1.00 36.39  ? 509 MET A CE    1 
ATOM   3453 N  N     . GLY A  1  535 ? 24.193  44.036  202.856 1.00 25.18  ? 510 GLY A N     1 
ATOM   3454 C  CA    . GLY A  1  535 ? 25.306  43.258  202.363 1.00 27.53  ? 510 GLY A CA    1 
ATOM   3455 C  C     . GLY A  1  535 ? 26.642  43.812  202.818 1.00 30.78  ? 510 GLY A C     1 
ATOM   3456 O  O     . GLY A  1  535 ? 26.752  44.983  203.225 1.00 31.92  ? 510 GLY A O     1 
ATOM   3457 N  N     . VAL A  1  536 ? 27.661  42.974  202.775 1.00 29.33  ? 511 VAL A N     1 
ATOM   3458 C  CA    . VAL A  1  536 ? 29.006  43.408  203.089 1.00 31.47  ? 511 VAL A CA    1 
ATOM   3459 C  C     . VAL A  1  536 ? 29.873  42.854  201.984 1.00 32.68  ? 511 VAL A C     1 
ATOM   3460 O  O     . VAL A  1  536 ? 29.669  41.725  201.554 1.00 33.03  ? 511 VAL A O     1 
ATOM   3461 C  CB    . VAL A  1  536 ? 29.473  42.884  204.466 1.00 33.33  ? 511 VAL A CB    1 
ATOM   3462 C  CG1   . VAL A  1  536 ? 30.828  43.488  204.848 1.00 33.90  ? 511 VAL A CG1   1 
ATOM   3463 C  CG2   . VAL A  1  536 ? 28.441  43.236  205.529 1.00 35.08  ? 511 VAL A CG2   1 
ATOM   3464 N  N     . ARG A  1  537 ? 30.816  43.657  201.532 1.00 33.33  ? 512 ARG A N     1 
ATOM   3465 C  CA    . ARG A  1  537 ? 31.717  43.307  200.460 1.00 35.52  ? 512 ARG A CA    1 
ATOM   3466 C  C     . ARG A  1  537 ? 33.126  43.682  200.894 1.00 35.67  ? 512 ARG A C     1 
ATOM   3467 O  O     . ARG A  1  537 ? 33.346  44.780  201.463 1.00 32.29  ? 512 ARG A O     1 
ATOM   3468 C  CB    . ARG A  1  537 ? 31.316  44.128  199.228 1.00 39.53  ? 512 ARG A CB    1 
ATOM   3469 C  CG    . ARG A  1  537 ? 32.239  44.103  198.018 1.00 44.65  ? 512 ARG A CG    1 
ATOM   3470 C  CD    . ARG A  1  537 ? 31.721  45.111  196.989 1.00 47.05  ? 512 ARG A CD    1 
ATOM   3471 N  NE    . ARG A  1  537 ? 32.437  45.075  195.714 1.00 50.68  ? 512 ARG A NE    1 
ATOM   3472 C  CZ    . ARG A  1  537 ? 33.520  45.787  195.391 1.00 53.50  ? 512 ARG A CZ    1 
ATOM   3473 N  NH1   . ARG A  1  537 ? 34.043  45.653  194.180 1.00 56.80  ? 512 ARG A NH1   1 
ATOM   3474 N  NH2   . ARG A  1  537 ? 34.093  46.631  196.242 1.00 57.75  ? 512 ARG A NH2   1 
ATOM   3475 N  N     . ILE A  1  538 ? 34.076  42.800  200.603 1.00 34.99  ? 513 ILE A N     1 
ATOM   3476 C  CA    . ILE A  1  538 ? 35.495  43.138  200.752 1.00 39.19  ? 513 ILE A CA    1 
ATOM   3477 C  C     . ILE A  1  538 ? 36.202  43.133  199.395 1.00 39.97  ? 513 ILE A C     1 
ATOM   3478 O  O     . ILE A  1  538 ? 35.918  42.287  198.535 1.00 38.45  ? 513 ILE A O     1 
ATOM   3479 C  CB    . ILE A  1  538 ? 36.219  42.236  201.773 1.00 43.10  ? 513 ILE A CB    1 
ATOM   3480 C  CG1   . ILE A  1  538 ? 37.618  42.796  202.073 1.00 45.04  ? 513 ILE A CG1   1 
ATOM   3481 C  CG2   . ILE A  1  538 ? 36.311  40.807  201.273 1.00 44.56  ? 513 ILE A CG2   1 
ATOM   3482 C  CD1   . ILE A  1  538 ? 38.288  42.171  203.268 1.00 46.98  ? 513 ILE A CD1   1 
ATOM   3483 N  N     . SER A  1  539 ? 37.116  44.094  199.224 1.00 40.65  ? 514 SER A N     1 
ATOM   3484 C  CA    . SER A  1  539 ? 37.874  44.268  197.980 1.00 42.97  ? 514 SER A CA    1 
ATOM   3485 C  C     . SER A  1  539 ? 39.224  44.917  198.288 1.00 44.36  ? 514 SER A C     1 
ATOM   3486 O  O     . SER A  1  539 ? 39.588  45.057  199.465 1.00 41.69  ? 514 SER A O     1 
ATOM   3487 C  CB    . SER A  1  539 ? 37.059  45.133  197.007 1.00 43.48  ? 514 SER A CB    1 
ATOM   3488 O  OG    . SER A  1  539 ? 36.916  46.440  197.514 1.00 41.25  ? 514 SER A OG    1 
ATOM   3489 N  N     . SER A  1  540 ? 39.940  45.326  197.238 1.00 45.20  ? 515 SER A N     1 
ATOM   3490 C  CA    . SER A  1  540 ? 41.323  45.809  197.325 1.00 47.15  ? 515 SER A CA    1 
ATOM   3491 C  C     . SER A  1  540 ? 42.228  44.738  197.911 1.00 45.62  ? 515 SER A C     1 
ATOM   3492 O  O     . SER A  1  540 ? 42.908  44.968  198.902 1.00 46.61  ? 515 SER A O     1 
ATOM   3493 C  CB    . SER A  1  540 ? 41.450  47.125  198.099 1.00 48.96  ? 515 SER A CB    1 
ATOM   3494 O  OG    . SER A  1  540 ? 40.803  48.175  197.413 1.00 51.55  ? 515 SER A OG    1 
ATOM   3495 N  N     . PHE A  1  541 ? 42.196  43.561  197.291 1.00 48.41  ? 516 PHE A N     1 
ATOM   3496 C  CA    . PHE A  1  541 ? 43.132  42.482  197.596 1.00 51.49  ? 516 PHE A CA    1 
ATOM   3497 C  C     . PHE A  1  541 ? 44.489  42.862  196.989 1.00 55.71  ? 516 PHE A C     1 
ATOM   3498 O  O     . PHE A  1  541 ? 44.533  43.452  195.906 1.00 50.45  ? 516 PHE A O     1 
ATOM   3499 C  CB    . PHE A  1  541 ? 42.666  41.137  197.014 1.00 50.86  ? 516 PHE A CB    1 
ATOM   3500 C  CG    . PHE A  1  541 ? 41.253  40.746  197.401 1.00 52.97  ? 516 PHE A CG    1 
ATOM   3501 C  CD1   . PHE A  1  541 ? 40.394  40.233  196.462 1.00 52.31  ? 516 PHE A CD1   1 
ATOM   3502 C  CD2   . PHE A  1  541 ? 40.784  40.902  198.702 1.00 55.19  ? 516 PHE A CD2   1 
ATOM   3503 C  CE1   . PHE A  1  541 ? 39.095  39.870  196.797 1.00 53.15  ? 516 PHE A CE1   1 
ATOM   3504 C  CE2   . PHE A  1  541 ? 39.490  40.544  199.043 1.00 52.90  ? 516 PHE A CE2   1 
ATOM   3505 C  CZ    . PHE A  1  541 ? 38.640  40.042  198.082 1.00 50.92  ? 516 PHE A CZ    1 
ATOM   3506 N  N     . PRO A  1  542 ? 45.598  42.543  197.678 1.00 62.46  ? 517 PRO A N     1 
ATOM   3507 C  CA    . PRO A  1  542 ? 46.889  42.892  197.071 1.00 68.43  ? 517 PRO A CA    1 
ATOM   3508 C  C     . PRO A  1  542 ? 47.112  42.045  195.818 1.00 69.17  ? 517 PRO A C     1 
ATOM   3509 O  O     . PRO A  1  542 ? 46.851  40.844  195.857 1.00 63.23  ? 517 PRO A O     1 
ATOM   3510 C  CB    . PRO A  1  542 ? 47.911  42.594  198.176 1.00 69.12  ? 517 PRO A CB    1 
ATOM   3511 C  CG    . PRO A  1  542 ? 47.213  41.746  199.189 1.00 69.32  ? 517 PRO A CG    1 
ATOM   3512 C  CD    . PRO A  1  542 ? 45.746  41.678  198.862 1.00 66.21  ? 517 PRO A CD    1 
ATOM   3513 N  N     . ASN A  1  543 ? 47.547  42.693  194.727 1.00 73.62  ? 518 ASN A N     1 
ATOM   3514 C  CA    . ASN A  1  543 ? 47.555  42.110  193.371 1.00 79.50  ? 518 ASN A CA    1 
ATOM   3515 C  C     . ASN A  1  543 ? 48.933  41.614  192.942 1.00 82.60  ? 518 ASN A C     1 
ATOM   3516 O  O     . ASN A  1  543 ? 49.890  42.385  192.878 1.00 86.84  ? 518 ASN A O     1 
ATOM   3517 C  CB    . ASN A  1  543 ? 47.044  43.141  192.352 1.00 73.63  ? 518 ASN A CB    1 
ATOM   3518 N  N     . GLY B  1  45  ? -1.630  11.331  211.372 1.00 95.29  ? 20  GLY B N     1 
ATOM   3519 C  CA    . GLY B  1  45  ? -2.645  12.363  211.767 1.00 94.29  ? 20  GLY B CA    1 
ATOM   3520 C  C     . GLY B  1  45  ? -2.085  13.538  212.557 1.00 86.73  ? 20  GLY B C     1 
ATOM   3521 O  O     . GLY B  1  45  ? -0.876  13.650  212.734 1.00 85.72  ? 20  GLY B O     1 
ATOM   3522 N  N     . LEU B  1  46  ? -2.978  14.395  213.047 1.00 85.49  ? 21  LEU B N     1 
ATOM   3523 C  CA    . LEU B  1  46  ? -2.603  15.630  213.753 1.00 87.47  ? 21  LEU B CA    1 
ATOM   3524 C  C     . LEU B  1  46  ? -1.990  15.391  215.149 1.00 87.67  ? 21  LEU B C     1 
ATOM   3525 O  O     . LEU B  1  46  ? -2.692  14.972  216.080 1.00 84.07  ? 21  LEU B O     1 
ATOM   3526 C  CB    . LEU B  1  46  ? -3.820  16.564  213.886 1.00 84.36  ? 21  LEU B CB    1 
ATOM   3527 N  N     . ASN B  1  47  ? -0.685  15.660  215.273 1.00 89.26  ? 22  ASN B N     1 
ATOM   3528 C  CA    . ASN B  1  47  ? -0.008  15.759  216.572 1.00 91.76  ? 22  ASN B CA    1 
ATOM   3529 C  C     . ASN B  1  47  ? -0.404  17.086  217.243 1.00 92.08  ? 22  ASN B C     1 
ATOM   3530 O  O     . ASN B  1  47  ? 0.187   18.149  216.969 1.00 84.04  ? 22  ASN B O     1 
ATOM   3531 C  CB    . ASN B  1  47  ? 1.517   15.668  216.413 1.00 92.66  ? 22  ASN B CB    1 
ATOM   3532 N  N     . ASP B  1  48  ? -1.417  17.009  218.111 1.00 88.30  ? 23  ASP B N     1 
ATOM   3533 C  CA    . ASP B  1  48  ? -1.976  18.195  218.774 1.00 85.58  ? 23  ASP B CA    1 
ATOM   3534 C  C     . ASP B  1  48  ? -1.305  18.568  220.105 1.00 81.17  ? 23  ASP B C     1 
ATOM   3535 O  O     . ASP B  1  48  ? -1.846  19.400  220.836 1.00 80.73  ? 23  ASP B O     1 
ATOM   3536 C  CB    . ASP B  1  48  ? -3.511  18.071  218.945 1.00 81.04  ? 23  ASP B CB    1 
ATOM   3537 C  CG    . ASP B  1  48  ? -3.935  17.079  220.044 1.00 77.30  ? 23  ASP B CG    1 
ATOM   3538 O  OD1   . ASP B  1  48  ? -5.130  16.718  220.047 1.00 75.69  ? 23  ASP B OD1   1 
ATOM   3539 O  OD2   . ASP B  1  48  ? -3.115  16.667  220.897 1.00 66.72  ? 23  ASP B OD2   1 
ATOM   3540 N  N     . ASN B  1  49  ? -0.145  17.983  220.425 1.00 81.68  ? 24  ASN B N     1 
ATOM   3541 C  CA    . ASN B  1  49  ? 0.573   18.346  221.655 1.00 81.77  ? 24  ASN B CA    1 
ATOM   3542 C  C     . ASN B  1  49  ? 1.379   19.654  221.520 1.00 81.12  ? 24  ASN B C     1 
ATOM   3543 O  O     . ASN B  1  49  ? 2.616   19.672  221.592 1.00 79.12  ? 24  ASN B O     1 
ATOM   3544 C  CB    . ASN B  1  49  ? 1.456   17.196  222.170 1.00 78.59  ? 24  ASN B CB    1 
ATOM   3545 C  CG    . ASN B  1  49  ? 1.806   17.365  223.647 1.00 78.75  ? 24  ASN B CG    1 
ATOM   3546 O  OD1   . ASN B  1  49  ? 0.913   17.489  224.488 1.00 67.68  ? 24  ASN B OD1   1 
ATOM   3547 N  ND2   . ASN B  1  49  ? 3.096   17.402  223.963 1.00 78.01  ? 24  ASN B ND2   1 
ATOM   3548 N  N     . LYS B  1  50  ? 0.640   20.746  221.336 1.00 77.35  ? 25  LYS B N     1 
ATOM   3549 C  CA    . LYS B  1  50  ? 1.182   22.101  221.280 1.00 76.97  ? 25  LYS B CA    1 
ATOM   3550 C  C     . LYS B  1  50  ? 0.103   23.055  221.798 1.00 76.38  ? 25  LYS B C     1 
ATOM   3551 O  O     . LYS B  1  50  ? -1.100  22.720  221.813 1.00 71.72  ? 25  LYS B O     1 
ATOM   3552 C  CB    . LYS B  1  50  ? 1.599   22.488  219.853 1.00 71.76  ? 25  LYS B CB    1 
ATOM   3553 N  N     . ALA B  1  51  ? 0.548   24.231  222.238 1.00 73.80  ? 26  ALA B N     1 
ATOM   3554 C  CA    . ALA B  1  51  ? -0.348  25.336  222.608 1.00 64.46  ? 26  ALA B CA    1 
ATOM   3555 C  C     . ALA B  1  51  ? -1.183  25.771  221.392 1.00 62.15  ? 26  ALA B C     1 
ATOM   3556 O  O     . ALA B  1  51  ? -0.690  25.700  220.251 1.00 51.60  ? 26  ALA B O     1 
ATOM   3557 C  CB    . ALA B  1  51  ? 0.462   26.507  223.148 1.00 59.91  ? 26  ALA B CB    1 
ATOM   3558 N  N     . GLY B  1  52  ? -2.432  26.196  221.651 1.00 59.67  ? 27  GLY B N     1 
ATOM   3559 C  CA    . GLY B  1  52  ? -3.371  26.675  220.612 1.00 63.15  ? 27  GLY B CA    1 
ATOM   3560 C  C     . GLY B  1  52  ? -4.142  25.625  219.808 1.00 67.54  ? 27  GLY B C     1 
ATOM   3561 O  O     . GLY B  1  52  ? -4.960  25.981  218.938 1.00 63.92  ? 27  GLY B O     1 
ATOM   3562 N  N     . MET B  1  53  ? -3.909  24.343  220.113 1.00 75.58  ? 28  MET B N     1 
ATOM   3563 C  CA    . MET B  1  53  ? -4.440  23.213  219.334 1.00 78.50  ? 28  MET B CA    1 
ATOM   3564 C  C     . MET B  1  53  ? -5.392  22.352  220.175 1.00 79.85  ? 28  MET B C     1 
ATOM   3565 O  O     . MET B  1  53  ? -5.375  21.125  220.091 1.00 81.86  ? 28  MET B O     1 
ATOM   3566 C  CB    . MET B  1  53  ? -3.274  22.369  218.802 1.00 77.19  ? 28  MET B CB    1 
ATOM   3567 C  CG    . MET B  1  53  ? -2.177  23.192  218.128 1.00 76.59  ? 28  MET B CG    1 
ATOM   3568 S  SD    . MET B  1  53  ? -1.283  22.323  216.823 1.00 73.70  ? 28  MET B SD    1 
ATOM   3569 C  CE    . MET B  1  53  ? -2.528  22.254  215.536 1.00 64.12  ? 28  MET B CE    1 
ATOM   3570 N  N     . GLU B  1  54  ? -6.239  23.028  220.951 1.00 85.94  ? 29  GLU B N     1 
ATOM   3571 C  CA    . GLU B  1  54  ? -7.171  22.404  221.906 1.00 87.40  ? 29  GLU B CA    1 
ATOM   3572 C  C     . GLU B  1  54  ? -8.577  22.416  221.288 1.00 83.21  ? 29  GLU B C     1 
ATOM   3573 O  O     . GLU B  1  54  ? -9.020  23.451  220.790 1.00 72.45  ? 29  GLU B O     1 
ATOM   3574 C  CB    . GLU B  1  54  ? -7.195  23.149  223.266 1.00 87.82  ? 29  GLU B CB    1 
ATOM   3575 C  CG    . GLU B  1  54  ? -5.970  24.016  223.612 1.00 95.52  ? 29  GLU B CG    1 
ATOM   3576 C  CD    . GLU B  1  54  ? -6.036  25.460  223.083 1.00 96.22  ? 29  GLU B CD    1 
ATOM   3577 O  OE1   . GLU B  1  54  ? -5.270  26.311  223.589 1.00 96.89  ? 29  GLU B OE1   1 
ATOM   3578 O  OE2   . GLU B  1  54  ? -6.834  25.759  222.162 1.00 94.78  ? 29  GLU B OE2   1 
ATOM   3579 N  N     . GLY B  1  55  ? -9.264  21.272  221.314 1.00 84.48  ? 30  GLY B N     1 
ATOM   3580 C  CA    . GLY B  1  55  ? -10.652 21.171  220.838 1.00 86.43  ? 30  GLY B CA    1 
ATOM   3581 C  C     . GLY B  1  55  ? -10.865 21.352  219.337 1.00 88.12  ? 30  GLY B C     1 
ATOM   3582 O  O     . GLY B  1  55  ? -11.862 21.949  218.917 1.00 81.53  ? 30  GLY B O     1 
ATOM   3583 N  N     . LEU B  1  56  ? -9.938  20.831  218.530 1.00 92.31  ? 31  LEU B N     1 
ATOM   3584 C  CA    . LEU B  1  56  ? -10.035 20.905  217.059 1.00 92.83  ? 31  LEU B CA    1 
ATOM   3585 C  C     . LEU B  1  56  ? -10.940 19.796  216.524 1.00 93.86  ? 31  LEU B C     1 
ATOM   3586 O  O     . LEU B  1  56  ? -11.081 18.741  217.158 1.00 92.74  ? 31  LEU B O     1 
ATOM   3587 C  CB    . LEU B  1  56  ? -8.644  20.786  216.411 1.00 87.14  ? 31  LEU B CB    1 
ATOM   3588 C  CG    . LEU B  1  56  ? -7.670  21.931  216.703 1.00 87.82  ? 31  LEU B CG    1 
ATOM   3589 C  CD1   . LEU B  1  56  ? -6.239  21.563  216.327 1.00 86.95  ? 31  LEU B CD1   1 
ATOM   3590 C  CD2   . LEU B  1  56  ? -8.113  23.198  215.987 1.00 87.04  ? 31  LEU B CD2   1 
ATOM   3591 N  N     . ASP B  1  57  ? -11.537 20.025  215.352 1.00 91.26  ? 32  ASP B N     1 
ATOM   3592 C  CA    . ASP B  1  57  ? -12.275 18.969  214.654 1.00 86.70  ? 32  ASP B CA    1 
ATOM   3593 C  C     . ASP B  1  57  ? -11.261 18.052  213.973 1.00 79.32  ? 32  ASP B C     1 
ATOM   3594 O  O     . ASP B  1  57  ? -11.104 18.071  212.755 1.00 70.99  ? 32  ASP B O     1 
ATOM   3595 C  CB    . ASP B  1  57  ? -13.287 19.548  213.651 1.00 86.63  ? 32  ASP B CB    1 
ATOM   3596 C  CG    . ASP B  1  57  ? -14.301 18.506  213.158 1.00 89.02  ? 32  ASP B CG    1 
ATOM   3597 O  OD1   . ASP B  1  57  ? -15.260 18.910  212.466 1.00 91.23  ? 32  ASP B OD1   1 
ATOM   3598 O  OD2   . ASP B  1  57  ? -14.159 17.294  213.458 1.00 87.85  ? 32  ASP B OD2   1 
ATOM   3599 N  N     . LYS B  1  58  ? -10.596 17.229  214.785 1.00 76.10  ? 33  LYS B N     1 
ATOM   3600 C  CA    . LYS B  1  58  ? -9.530  16.359  214.304 1.00 78.73  ? 33  LYS B CA    1 
ATOM   3601 C  C     . LYS B  1  58  ? -10.017 15.348  213.276 1.00 79.90  ? 33  LYS B C     1 
ATOM   3602 O  O     . LYS B  1  58  ? -9.212  14.881  212.469 1.00 78.37  ? 33  LYS B O     1 
ATOM   3603 C  CB    . LYS B  1  58  ? -8.832  15.637  215.463 1.00 79.44  ? 33  LYS B CB    1 
ATOM   3604 C  CG    . LYS B  1  58  ? -7.990  16.557  216.345 1.00 81.71  ? 33  LYS B CG    1 
ATOM   3605 C  CD    . LYS B  1  58  ? -6.806  15.834  216.976 1.00 83.09  ? 33  LYS B CD    1 
ATOM   3606 C  CE    . LYS B  1  58  ? -7.261  14.761  217.954 1.00 88.73  ? 33  LYS B CE    1 
ATOM   3607 N  NZ    . LYS B  1  58  ? -6.122  14.030  218.571 1.00 92.13  ? 33  LYS B NZ    1 
ATOM   3608 N  N     . GLU B  1  59  ? -11.314 15.012  213.314 1.00 80.00  ? 34  GLU B N     1 
ATOM   3609 C  CA    . GLU B  1  59  ? -11.947 14.143  212.310 1.00 77.33  ? 34  GLU B CA    1 
ATOM   3610 C  C     . GLU B  1  59  ? -11.752 14.734  210.918 1.00 70.13  ? 34  GLU B C     1 
ATOM   3611 O  O     . GLU B  1  59  ? -11.208 14.075  210.025 1.00 69.78  ? 34  GLU B O     1 
ATOM   3612 C  CB    . GLU B  1  59  ? -13.446 13.965  212.600 1.00 73.46  ? 34  GLU B CB    1 
ATOM   3613 N  N     . LYS B  1  60  ? -12.172 15.986  210.771 1.00 61.17  ? 35  LYS B N     1 
ATOM   3614 C  CA    . LYS B  1  60  ? -12.113 16.707  209.503 1.00 61.98  ? 35  LYS B CA    1 
ATOM   3615 C  C     . LYS B  1  60  ? -10.660 16.933  209.041 1.00 60.36  ? 35  LYS B C     1 
ATOM   3616 O  O     . LYS B  1  60  ? -10.304 16.621  207.905 1.00 60.76  ? 35  LYS B O     1 
ATOM   3617 C  CB    . LYS B  1  60  ? -12.844 18.042  209.665 1.00 65.84  ? 35  LYS B CB    1 
ATOM   3618 C  CG    . LYS B  1  60  ? -12.927 18.905  208.420 1.00 72.22  ? 35  LYS B CG    1 
ATOM   3619 C  CD    . LYS B  1  60  ? -13.872 18.328  207.374 1.00 76.95  ? 35  LYS B CD    1 
ATOM   3620 C  CE    . LYS B  1  60  ? -13.721 19.060  206.047 1.00 81.18  ? 35  LYS B CE    1 
ATOM   3621 N  NZ    . LYS B  1  60  ? -13.968 20.524  206.184 1.00 85.62  ? 35  LYS B NZ    1 
ATOM   3622 N  N     . ILE B  1  61  ? -9.839  17.452  209.948 1.00 56.86  ? 36  ILE B N     1 
ATOM   3623 C  CA    . ILE B  1  61  ? -8.402  17.668  209.731 1.00 56.79  ? 36  ILE B CA    1 
ATOM   3624 C  C     . ILE B  1  61  ? -7.692  16.384  209.290 1.00 57.50  ? 36  ILE B C     1 
ATOM   3625 O  O     . ILE B  1  61  ? -6.955  16.405  208.297 1.00 54.83  ? 36  ILE B O     1 
ATOM   3626 C  CB    . ILE B  1  61  ? -7.725  18.283  210.996 1.00 54.21  ? 36  ILE B CB    1 
ATOM   3627 C  CG1   . ILE B  1  61  ? -8.151  19.751  211.147 1.00 54.48  ? 36  ILE B CG1   1 
ATOM   3628 C  CG2   . ILE B  1  61  ? -6.203  18.184  210.954 1.00 49.70  ? 36  ILE B CG2   1 
ATOM   3629 C  CD1   . ILE B  1  61  ? -7.978  20.305  212.552 1.00 55.97  ? 36  ILE B CD1   1 
ATOM   3630 N  N     . ASN B  1  62  ? -7.910  15.278  210.003 1.00 58.07  ? 37  ASN B N     1 
ATOM   3631 C  CA    . ASN B  1  62  ? -7.254  14.020  209.630 1.00 60.92  ? 37  ASN B CA    1 
ATOM   3632 C  C     . ASN B  1  62  ? -7.754  13.446  208.308 1.00 59.70  ? 37  ASN B C     1 
ATOM   3633 O  O     . ASN B  1  62  ? -6.985  12.788  207.625 1.00 62.00  ? 37  ASN B O     1 
ATOM   3634 C  CB    . ASN B  1  62  ? -7.318  12.971  210.744 1.00 62.86  ? 37  ASN B CB    1 
ATOM   3635 C  CG    . ASN B  1  62  ? -6.472  13.350  211.956 1.00 70.17  ? 37  ASN B CG    1 
ATOM   3636 O  OD1   . ASN B  1  62  ? -5.377  13.899  211.822 1.00 72.68  ? 37  ASN B OD1   1 
ATOM   3637 N  ND2   . ASN B  1  62  ? -6.979  13.059  213.149 1.00 74.64  ? 37  ASN B ND2   1 
ATOM   3638 N  N     . LYS B  1  63  ? -9.005  13.710  207.928 1.00 57.55  ? 38  LYS B N     1 
ATOM   3639 C  CA    . LYS B  1  63  ? -9.476  13.333  206.583 1.00 56.83  ? 38  LYS B CA    1 
ATOM   3640 C  C     . LYS B  1  63  ? -8.677  14.080  205.513 1.00 53.90  ? 38  LYS B C     1 
ATOM   3641 O  O     . LYS B  1  63  ? -8.208  13.470  204.550 1.00 48.48  ? 38  LYS B O     1 
ATOM   3642 C  CB    . LYS B  1  63  ? -10.976 13.595  206.390 1.00 55.36  ? 38  LYS B CB    1 
ATOM   3643 N  N     . ILE B  1  64  ? -8.526  15.395  205.691 1.00 52.78  ? 39  ILE B N     1 
ATOM   3644 C  CA    . ILE B  1  64  ? -7.821  16.248  204.707 1.00 47.85  ? 39  ILE B CA    1 
ATOM   3645 C  C     . ILE B  1  64  ? -6.334  15.878  204.610 1.00 44.80  ? 39  ILE B C     1 
ATOM   3646 O  O     . ILE B  1  64  ? -5.785  15.783  203.503 1.00 44.53  ? 39  ILE B O     1 
ATOM   3647 C  CB    . ILE B  1  64  ? -8.023  17.755  204.994 1.00 47.83  ? 39  ILE B CB    1 
ATOM   3648 C  CG1   . ILE B  1  64  ? -9.487  18.140  204.718 1.00 49.39  ? 39  ILE B CG1   1 
ATOM   3649 C  CG2   . ILE B  1  64  ? -7.076  18.603  204.156 1.00 46.81  ? 39  ILE B CG2   1 
ATOM   3650 C  CD1   . ILE B  1  64  ? -9.920  19.468  205.303 1.00 50.58  ? 39  ILE B CD1   1 
ATOM   3651 N  N     . ILE B  1  65  ? -5.699  15.653  205.755 1.00 43.60  ? 40  ILE B N     1 
ATOM   3652 C  CA    . ILE B  1  65  ? -4.293  15.235  205.777 1.00 46.43  ? 40  ILE B CA    1 
ATOM   3653 C  C     . ILE B  1  65  ? -4.169  13.873  205.077 1.00 48.58  ? 40  ILE B C     1 
ATOM   3654 O  O     . ILE B  1  65  ? -3.252  13.674  204.261 1.00 42.37  ? 40  ILE B O     1 
ATOM   3655 C  CB    . ILE B  1  65  ? -3.699  15.208  207.208 1.00 45.32  ? 40  ILE B CB    1 
ATOM   3656 C  CG1   . ILE B  1  65  ? -3.624  16.628  207.786 1.00 48.11  ? 40  ILE B CG1   1 
ATOM   3657 C  CG2   . ILE B  1  65  ? -2.297  14.605  207.222 1.00 47.40  ? 40  ILE B CG2   1 
ATOM   3658 C  CD1   . ILE B  1  65  ? -3.464  16.670  209.301 1.00 47.61  ? 40  ILE B CD1   1 
ATOM   3659 N  N     . MET B  1  66  ? -5.105  12.961  205.365 1.00 50.82  ? 41  MET B N     1 
ATOM   3660 C  CA    . MET B  1  66  ? -5.038  11.592  204.847 1.00 53.03  ? 41  MET B CA    1 
ATOM   3661 C  C     . MET B  1  66  ? -5.304  11.531  203.348 1.00 49.00  ? 41  MET B C     1 
ATOM   3662 O  O     . MET B  1  66  ? -4.552  10.862  202.637 1.00 48.83  ? 41  MET B O     1 
ATOM   3663 C  CB    . MET B  1  66  ? -5.968  10.655  205.637 1.00 58.55  ? 41  MET B CB    1 
ATOM   3664 C  CG    . MET B  1  66  ? -5.763  9.152   205.426 1.00 65.54  ? 41  MET B CG    1 
ATOM   3665 S  SD    . MET B  1  66  ? -4.098  8.468   205.678 1.00 77.90  ? 41  MET B SD    1 
ATOM   3666 C  CE    . MET B  1  66  ? -3.424  9.415   207.056 1.00 72.94  ? 41  MET B CE    1 
ATOM   3667 N  N     . GLU B  1  67  ? -6.316  12.246  202.850 1.00 44.79  ? 42  GLU B N     1 
ATOM   3668 C  CA    . GLU B  1  67  ? -6.496  12.392  201.395 1.00 45.70  ? 42  GLU B CA    1 
ATOM   3669 C  C     . GLU B  1  67  ? -5.239  12.946  200.694 1.00 43.13  ? 42  GLU B C     1 
ATOM   3670 O  O     . GLU B  1  67  ? -4.916  12.527  199.588 1.00 46.10  ? 42  GLU B O     1 
ATOM   3671 C  CB    . GLU B  1  67  ? -7.712  13.275  201.046 1.00 43.23  ? 42  GLU B CB    1 
ATOM   3672 N  N     . ALA B  1  68  ? -4.541  13.885  201.330 1.00 39.93  ? 43  ALA B N     1 
ATOM   3673 C  CA    . ALA B  1  68  ? -3.285  14.436  200.778 1.00 41.86  ? 43  ALA B CA    1 
ATOM   3674 C  C     . ALA B  1  68  ? -2.073  13.489  200.813 1.00 40.86  ? 43  ALA B C     1 
ATOM   3675 O  O     . ALA B  1  68  ? -1.093  13.718  200.121 1.00 40.27  ? 43  ALA B O     1 
ATOM   3676 C  CB    . ALA B  1  68  ? -2.914  15.733  201.492 1.00 43.69  ? 43  ALA B CB    1 
ATOM   3677 N  N     . THR B  1  69  ? -2.125  12.461  201.641 1.00 39.44  ? 44  THR B N     1 
ATOM   3678 C  CA    . THR B  1  69  ? -0.947  11.664  201.952 1.00 43.50  ? 44  THR B CA    1 
ATOM   3679 C  C     . THR B  1  69  ? -1.001  10.222  201.452 1.00 45.60  ? 44  THR B C     1 
ATOM   3680 O  O     . THR B  1  69  ? 0.040   9.670   201.065 1.00 45.12  ? 44  THR B O     1 
ATOM   3681 C  CB    . THR B  1  69  ? -0.727  11.663  203.474 1.00 44.79  ? 44  THR B CB    1 
ATOM   3682 O  OG1   . THR B  1  69  ? -0.676  13.020  203.956 1.00 47.38  ? 44  THR B OG1   1 
ATOM   3683 C  CG2   . THR B  1  69  ? 0.556   10.925  203.846 1.00 44.58  ? 44  THR B CG2   1 
ATOM   3684 N  N     . LYS B  1  70  ? -2.186  9.611   201.460 1.00 46.78  ? 45  LYS B N     1 
ATOM   3685 C  CA    . LYS B  1  70  ? -2.333  8.184   201.084 1.00 51.52  ? 45  LYS B CA    1 
ATOM   3686 C  C     . LYS B  1  70  ? -1.779  7.942   199.679 1.00 49.31  ? 45  LYS B C     1 
ATOM   3687 O  O     . LYS B  1  70  ? -1.895  8.791   198.804 1.00 46.22  ? 45  LYS B O     1 
ATOM   3688 C  CB    . LYS B  1  70  ? -3.808  7.723   201.156 1.00 50.88  ? 45  LYS B CB    1 
ATOM   3689 N  N     . GLY B  1  71  ? -1.135  6.800   199.481 1.00 51.53  ? 46  GLY B N     1 
ATOM   3690 C  CA    . GLY B  1  71  ? -0.574  6.462   198.186 1.00 47.81  ? 46  GLY B CA    1 
ATOM   3691 C  C     . GLY B  1  71  ? 0.825   6.991   197.944 1.00 47.86  ? 46  GLY B C     1 
ATOM   3692 O  O     . GLY B  1  71  ? 1.512   6.470   197.086 1.00 49.46  ? 46  GLY B O     1 
ATOM   3693 N  N     . SER B  1  72  ? 1.270   8.003   198.689 1.00 44.52  ? 47  SER B N     1 
ATOM   3694 C  CA    . SER B  1  72  ? 2.618   8.543   198.504 1.00 40.90  ? 47  SER B CA    1 
ATOM   3695 C  C     . SER B  1  72  ? 3.713   7.586   199.002 1.00 40.06  ? 47  SER B C     1 
ATOM   3696 O  O     . SER B  1  72  ? 3.466   6.694   199.818 1.00 37.54  ? 47  SER B O     1 
ATOM   3697 C  CB    . SER B  1  72  ? 2.754   9.887   199.237 1.00 43.43  ? 47  SER B CB    1 
ATOM   3698 O  OG    . SER B  1  72  ? 2.836   9.715   200.653 1.00 40.58  ? 47  SER B OG    1 
ATOM   3699 N  N     . ARG B  1  73  ? 4.935   7.811   198.540 1.00 35.88  ? 48  ARG B N     1 
ATOM   3700 C  CA    . ARG B  1  73  ? 6.112   7.134   199.087 1.00 37.81  ? 48  ARG B CA    1 
ATOM   3701 C  C     . ARG B  1  73  ? 6.345   7.445   200.562 1.00 37.85  ? 48  ARG B C     1 
ATOM   3702 O  O     . ARG B  1  73  ? 6.693   6.559   201.350 1.00 34.77  ? 48  ARG B O     1 
ATOM   3703 C  CB    . ARG B  1  73  ? 7.350   7.531   198.308 1.00 37.43  ? 48  ARG B CB    1 
ATOM   3704 C  CG    . ARG B  1  73  ? 7.346   6.915   196.935 1.00 44.08  ? 48  ARG B CG    1 
ATOM   3705 C  CD    . ARG B  1  73  ? 8.258   7.675   196.016 1.00 46.81  ? 48  ARG B CD    1 
ATOM   3706 N  NE    . ARG B  1  73  ? 8.834   6.738   195.085 1.00 57.64  ? 48  ARG B NE    1 
ATOM   3707 C  CZ    . ARG B  1  73  ? 9.452   7.076   193.963 1.00 64.38  ? 48  ARG B CZ    1 
ATOM   3708 N  NH1   . ARG B  1  73  ? 9.611   8.358   193.620 1.00 61.40  ? 48  ARG B NH1   1 
ATOM   3709 N  NH2   . ARG B  1  73  ? 9.918   6.103   193.181 1.00 67.83  ? 48  ARG B NH2   1 
ATOM   3710 N  N     . PHE B  1  74  ? 6.148   8.712   200.921 1.00 35.76  ? 49  PHE B N     1 
ATOM   3711 C  CA    . PHE B  1  74  ? 6.191   9.118   202.313 1.00 37.74  ? 49  PHE B CA    1 
ATOM   3712 C  C     . PHE B  1  74  ? 5.267   8.251   203.201 1.00 38.96  ? 49  PHE B C     1 
ATOM   3713 O  O     . PHE B  1  74  ? 5.695   7.732   204.245 1.00 34.21  ? 49  PHE B O     1 
ATOM   3714 C  CB    . PHE B  1  74  ? 5.778   10.574  202.442 1.00 34.68  ? 49  PHE B CB    1 
ATOM   3715 C  CG    . PHE B  1  74  ? 5.758   11.043  203.830 1.00 34.18  ? 49  PHE B CG    1 
ATOM   3716 C  CD1   . PHE B  1  74  ? 6.954   11.315  204.481 1.00 36.78  ? 49  PHE B CD1   1 
ATOM   3717 C  CD2   . PHE B  1  74  ? 4.565   11.173  204.515 1.00 34.65  ? 49  PHE B CD2   1 
ATOM   3718 C  CE1   . PHE B  1  74  ? 6.954   11.727  205.805 1.00 36.79  ? 49  PHE B CE1   1 
ATOM   3719 C  CE2   . PHE B  1  74  ? 4.561   11.571  205.846 1.00 35.82  ? 49  PHE B CE2   1 
ATOM   3720 C  CZ    . PHE B  1  74  ? 5.761   11.855  206.487 1.00 34.49  ? 49  PHE B CZ    1 
ATOM   3721 N  N     . TYR B  1  75  ? 4.011   8.142   202.773 1.00 39.36  ? 50  TYR B N     1 
ATOM   3722 C  CA    . TYR B  1  75  ? 2.979   7.397   203.493 1.00 40.47  ? 50  TYR B CA    1 
ATOM   3723 C  C     . TYR B  1  75  ? 3.327   5.909   203.614 1.00 37.92  ? 50  TYR B C     1 
ATOM   3724 O  O     . TYR B  1  75  ? 3.139   5.320   204.674 1.00 38.73  ? 50  TYR B O     1 
ATOM   3725 C  CB    . TYR B  1  75  ? 1.636   7.541   202.790 1.00 45.67  ? 50  TYR B CB    1 
ATOM   3726 C  CG    . TYR B  1  75  ? 0.512   6.842   203.518 1.00 52.41  ? 50  TYR B CG    1 
ATOM   3727 C  CD1   . TYR B  1  75  ? 0.114   7.276   204.780 1.00 56.55  ? 50  TYR B CD1   1 
ATOM   3728 C  CD2   . TYR B  1  75  ? -0.127  5.729   202.968 1.00 56.85  ? 50  TYR B CD2   1 
ATOM   3729 C  CE1   . TYR B  1  75  ? -0.901  6.641   205.471 1.00 63.49  ? 50  TYR B CE1   1 
ATOM   3730 C  CE2   . TYR B  1  75  ? -1.156  5.091   203.649 1.00 60.61  ? 50  TYR B CE2   1 
ATOM   3731 C  CZ    . TYR B  1  75  ? -1.533  5.555   204.902 1.00 63.73  ? 50  TYR B CZ    1 
ATOM   3732 O  OH    . TYR B  1  75  ? -2.537  4.949   205.612 1.00 74.71  ? 50  TYR B OH    1 
ATOM   3733 N  N     . GLY B  1  76  ? 3.846   5.334   202.534 1.00 34.39  ? 51  GLY B N     1 
ATOM   3734 C  CA    . GLY B  1  76  ? 4.383   3.976   202.521 1.00 37.06  ? 51  GLY B CA    1 
ATOM   3735 C  C     . GLY B  1  76  ? 5.394   3.739   203.641 1.00 37.98  ? 51  GLY B C     1 
ATOM   3736 O  O     . GLY B  1  76  ? 5.295   2.764   204.391 1.00 34.42  ? 51  GLY B O     1 
ATOM   3737 N  N     . ASN B  1  77  ? 6.338   4.661   203.796 1.00 37.34  ? 52  ASN B N     1 
ATOM   3738 C  CA    . ASN B  1  77  ? 7.344   4.528   204.839 1.00 35.38  ? 52  ASN B CA    1 
ATOM   3739 C  C     . ASN B  1  77  ? 6.788   4.790   206.247 1.00 35.94  ? 52  ASN B C     1 
ATOM   3740 O  O     . ASN B  1  77  ? 7.228   4.160   207.197 1.00 34.92  ? 52  ASN B O     1 
ATOM   3741 C  CB    . ASN B  1  77  ? 8.482   5.469   204.547 1.00 36.54  ? 52  ASN B CB    1 
ATOM   3742 C  CG    . ASN B  1  77  ? 9.623   5.313   205.506 1.00 33.51  ? 52  ASN B CG    1 
ATOM   3743 O  OD1   . ASN B  1  77  ? 9.904   6.202   206.274 1.00 38.27  ? 52  ASN B OD1   1 
ATOM   3744 N  ND2   . ASN B  1  77  ? 10.278  4.199   205.458 1.00 36.79  ? 52  ASN B ND2   1 
ATOM   3745 N  N     . GLU B  1  78  ? 5.856   5.735   206.390 1.00 35.65  ? 53  GLU B N     1 
ATOM   3746 C  CA    . GLU B  1  78  ? 5.169   5.917   207.677 1.00 39.10  ? 53  GLU B CA    1 
ATOM   3747 C  C     . GLU B  1  78  ? 4.513   4.593   208.163 1.00 39.90  ? 53  GLU B C     1 
ATOM   3748 O  O     . GLU B  1  78  ? 4.613   4.254   209.344 1.00 38.61  ? 53  GLU B O     1 
ATOM   3749 C  CB    . GLU B  1  78  ? 4.090   6.996   207.605 1.00 37.04  ? 53  GLU B CB    1 
ATOM   3750 C  CG    . GLU B  1  78  ? 4.611   8.404   207.458 1.00 44.96  ? 53  GLU B CG    1 
ATOM   3751 C  CD    . GLU B  1  78  ? 5.402   8.916   208.665 1.00 48.21  ? 53  GLU B CD    1 
ATOM   3752 O  OE1   . GLU B  1  78  ? 4.761   9.436   209.617 1.00 51.51  ? 53  GLU B OE1   1 
ATOM   3753 O  OE2   . GLU B  1  78  ? 6.660   8.845   208.623 1.00 43.47  ? 53  GLU B OE2   1 
ATOM   3754 N  N     . LEU B  1  79  ? 3.831   3.889   207.250 1.00 39.09  ? 54  LEU B N     1 
ATOM   3755 C  CA    . LEU B  1  79  ? 3.173   2.617   207.583 1.00 43.06  ? 54  LEU B CA    1 
ATOM   3756 C  C     . LEU B  1  79  ? 4.172   1.588   208.079 1.00 40.14  ? 54  LEU B C     1 
ATOM   3757 O  O     . LEU B  1  79  ? 3.929   0.929   209.068 1.00 36.46  ? 54  LEU B O     1 
ATOM   3758 C  CB    . LEU B  1  79  ? 2.405   2.037   206.403 1.00 43.00  ? 54  LEU B CB    1 
ATOM   3759 C  CG    . LEU B  1  79  ? 1.018   2.614   206.197 1.00 46.99  ? 54  LEU B CG    1 
ATOM   3760 C  CD1   . LEU B  1  79  ? 0.503   2.147   204.846 1.00 49.99  ? 54  LEU B CD1   1 
ATOM   3761 C  CD2   . LEU B  1  79  ? 0.055   2.204   207.312 1.00 49.21  ? 54  LEU B CD2   1 
ATOM   3762 N  N     . LYS B  1  80  ? 5.306   1.481   207.401 1.00 37.89  ? 55  LYS B N     1 
ATOM   3763 C  CA    . LYS B  1  80  ? 6.361   0.610   207.840 1.00 40.56  ? 55  LYS B CA    1 
ATOM   3764 C  C     . LYS B  1  80  ? 6.822   0.973   209.256 1.00 40.78  ? 55  LYS B C     1 
ATOM   3765 O  O     . LYS B  1  80  ? 6.956   0.088   210.100 1.00 38.26  ? 55  LYS B O     1 
ATOM   3766 C  CB    . LYS B  1  80  ? 7.522   0.650   206.853 1.00 45.42  ? 55  LYS B CB    1 
ATOM   3767 C  CG    . LYS B  1  80  ? 8.680   -0.277  207.177 1.00 51.82  ? 55  LYS B CG    1 
ATOM   3768 C  CD    . LYS B  1  80  ? 9.706   -0.217  206.049 1.00 57.49  ? 55  LYS B CD    1 
ATOM   3769 C  CE    . LYS B  1  80  ? 11.067  -0.753  206.450 1.00 60.36  ? 55  LYS B CE    1 
ATOM   3770 N  NZ    . LYS B  1  80  ? 12.130  -0.058  205.681 1.00 60.75  ? 55  LYS B NZ    1 
ATOM   3771 N  N     . LYS B  1  81  ? 7.031   2.256   209.539 1.00 39.44  ? 56  LYS B N     1 
ATOM   3772 C  CA    . LYS B  1  81  ? 7.506   2.643   210.871 1.00 43.82  ? 56  LYS B CA    1 
ATOM   3773 C  C     . LYS B  1  81  ? 6.458   2.396   211.961 1.00 40.54  ? 56  LYS B C     1 
ATOM   3774 O  O     . LYS B  1  81  ? 6.801   1.965   213.036 1.00 37.67  ? 56  LYS B O     1 
ATOM   3775 C  CB    . LYS B  1  81  ? 7.973   4.086   210.890 1.00 46.15  ? 56  LYS B CB    1 
ATOM   3776 C  CG    . LYS B  1  81  ? 9.255   4.276   210.085 1.00 50.64  ? 56  LYS B CG    1 
ATOM   3777 C  CD    . LYS B  1  81  ? 9.809   5.696   210.115 1.00 56.26  ? 56  LYS B CD    1 
ATOM   3778 C  CE    . LYS B  1  81  ? 8.750   6.798   210.215 1.00 57.58  ? 56  LYS B CE    1 
ATOM   3779 N  NZ    . LYS B  1  81  ? 9.350   8.159   210.332 1.00 59.34  ? 56  LYS B NZ    1 
ATOM   3780 N  N     . GLU B  1  82  ? 5.201   2.650   211.642 1.00 41.76  ? 57  GLU B N     1 
ATOM   3781 C  CA    . GLU B  1  82  ? 4.083   2.388   212.542 1.00 47.01  ? 57  GLU B CA    1 
ATOM   3782 C  C     . GLU B  1  82  ? 3.918   0.880   212.862 1.00 45.89  ? 57  GLU B C     1 
ATOM   3783 O  O     . GLU B  1  82  ? 3.625   0.506   214.012 1.00 45.58  ? 57  GLU B O     1 
ATOM   3784 C  CB    . GLU B  1  82  ? 2.802   2.938   211.908 1.00 51.56  ? 57  GLU B CB    1 
ATOM   3785 C  CG    . GLU B  1  82  ? 1.577   2.973   212.806 1.00 62.39  ? 57  GLU B CG    1 
ATOM   3786 C  CD    . GLU B  1  82  ? 0.274   3.090   212.026 1.00 72.82  ? 57  GLU B CD    1 
ATOM   3787 O  OE1   . GLU B  1  82  ? 0.301   3.554   210.862 1.00 82.58  ? 57  GLU B OE1   1 
ATOM   3788 O  OE2   . GLU B  1  82  ? -0.788  2.719   212.579 1.00 83.27  ? 57  GLU B OE2   1 
ATOM   3789 N  N     . LYS B  1  83  ? 4.087   0.033   211.847 1.00 43.67  ? 58  LYS B N     1 
ATOM   3790 C  CA    . LYS B  1  83  ? 4.188   -1.414  212.056 1.00 44.91  ? 58  LYS B CA    1 
ATOM   3791 C  C     . LYS B  1  83  ? 5.333   -1.821  212.959 1.00 41.87  ? 58  LYS B C     1 
ATOM   3792 O  O     . LYS B  1  83  ? 5.156   -2.710  213.778 1.00 40.28  ? 58  LYS B O     1 
ATOM   3793 C  CB    . LYS B  1  83  ? 4.348   -2.184  210.746 1.00 49.28  ? 58  LYS B CB    1 
ATOM   3794 C  CG    . LYS B  1  83  ? 3.039   -2.510  210.050 1.00 58.51  ? 58  LYS B CG    1 
ATOM   3795 C  CD    . LYS B  1  83  ? 3.289   -3.311  208.774 1.00 65.96  ? 58  LYS B CD    1 
ATOM   3796 C  CE    . LYS B  1  83  ? 2.105   -3.237  207.824 1.00 72.63  ? 58  LYS B CE    1 
ATOM   3797 N  NZ    . LYS B  1  83  ? 0.892   -3.863  208.421 1.00 79.59  ? 58  LYS B NZ    1 
ATOM   3798 N  N     . GLN B  1  84  ? 6.515   -1.242  212.781 1.00 39.10  ? 59  GLN B N     1 
ATOM   3799 C  CA    . GLN B  1  84  ? 7.638   -1.554  213.674 1.00 41.10  ? 59  GLN B CA    1 
ATOM   3800 C  C     . GLN B  1  84  ? 7.351   -1.155  215.147 1.00 41.40  ? 59  GLN B C     1 
ATOM   3801 O  O     . GLN B  1  84  ? 7.748   -1.849  216.083 1.00 37.00  ? 59  GLN B O     1 
ATOM   3802 C  CB    . GLN B  1  84  ? 8.907   -0.849  213.234 1.00 44.00  ? 59  GLN B CB    1 
ATOM   3803 C  CG    . GLN B  1  84  ? 9.520   -1.404  211.979 1.00 49.88  ? 59  GLN B CG    1 
ATOM   3804 C  CD    . GLN B  1  84  ? 10.534  -0.454  211.337 1.00 56.64  ? 59  GLN B CD    1 
ATOM   3805 O  OE1   . GLN B  1  84  ? 10.873  0.618   211.877 1.00 64.30  ? 59  GLN B OE1   1 
ATOM   3806 N  NE2   . GLN B  1  84  ? 11.035  -0.854  210.182 1.00 60.55  ? 59  GLN B NE2   1 
ATOM   3807 N  N     . VAL B  1  85  ? 6.693   -0.021  215.352 1.00 39.94  ? 60  VAL B N     1 
ATOM   3808 C  CA    . VAL B  1  85  ? 6.368   0.396   216.708 1.00 40.71  ? 60  VAL B CA    1 
ATOM   3809 C  C     . VAL B  1  85  ? 5.336   -0.577  217.285 1.00 43.22  ? 60  VAL B C     1 
ATOM   3810 O  O     . VAL B  1  85  ? 5.455   -0.985  218.445 1.00 40.22  ? 60  VAL B O     1 
ATOM   3811 C  CB    . VAL B  1  85  ? 5.877   1.867   216.776 1.00 42.35  ? 60  VAL B CB    1 
ATOM   3812 C  CG1   . VAL B  1  85  ? 5.276   2.196   218.137 1.00 41.07  ? 60  VAL B CG1   1 
ATOM   3813 C  CG2   . VAL B  1  85  ? 7.038   2.821   216.490 1.00 42.63  ? 60  VAL B CG2   1 
ATOM   3814 N  N     . ASN B  1  86  ? 4.342   -0.950  216.479 1.00 41.43  ? 61  ASN B N     1 
ATOM   3815 C  CA    . ASN B  1  86  ? 3.316   -1.884  216.929 1.00 41.43  ? 61  ASN B CA    1 
ATOM   3816 C  C     . ASN B  1  86  ? 3.904   -3.245  217.306 1.00 43.18  ? 61  ASN B C     1 
ATOM   3817 O  O     . ASN B  1  86  ? 3.496   -3.853  218.311 1.00 40.47  ? 61  ASN B O     1 
ATOM   3818 C  CB    . ASN B  1  86  ? 2.207   -2.033  215.888 1.00 41.77  ? 61  ASN B CB    1 
ATOM   3819 C  CG    . ASN B  1  86  ? 1.258   -0.851  215.872 1.00 45.23  ? 61  ASN B CG    1 
ATOM   3820 O  OD1   . ASN B  1  86  ? 1.275   0.001   216.770 1.00 49.95  ? 61  ASN B OD1   1 
ATOM   3821 N  ND2   . ASN B  1  86  ? 0.408   -0.798  214.857 1.00 45.72  ? 61  ASN B ND2   1 
ATOM   3822 N  N     . GLN B  1  87  ? 4.873   -3.697  216.517 1.00 42.34  ? 62  GLN B N     1 
ATOM   3823 C  CA    . GLN B  1  87  ? 5.613   -4.905  216.807 1.00 47.03  ? 62  GLN B CA    1 
ATOM   3824 C  C     . GLN B  1  87  ? 6.326   -4.773  218.145 1.00 47.60  ? 62  GLN B C     1 
ATOM   3825 O  O     . GLN B  1  87  ? 6.352   -5.719  218.940 1.00 44.74  ? 62  GLN B O     1 
ATOM   3826 C  CB    . GLN B  1  87  ? 6.649   -5.198  215.702 1.00 53.23  ? 62  GLN B CB    1 
ATOM   3827 C  CG    . GLN B  1  87  ? 7.501   -6.447  215.924 1.00 59.76  ? 62  GLN B CG    1 
ATOM   3828 C  CD    . GLN B  1  87  ? 6.652   -7.697  216.133 1.00 68.62  ? 62  GLN B CD    1 
ATOM   3829 O  OE1   . GLN B  1  87  ? 6.766   -8.381  217.155 1.00 76.17  ? 62  GLN B OE1   1 
ATOM   3830 N  NE2   . GLN B  1  87  ? 5.765   -7.981  215.181 1.00 69.94  ? 62  GLN B NE2   1 
ATOM   3831 N  N     . ARG B  1  88  ? 6.924   -3.610  218.375 1.00 43.44  ? 63  ARG B N     1 
ATOM   3832 C  CA    . ARG B  1  88  ? 7.643   -3.350  219.604 1.00 44.70  ? 63  ARG B CA    1 
ATOM   3833 C  C     . ARG B  1  88  ? 6.673   -3.328  220.799 1.00 40.86  ? 63  ARG B C     1 
ATOM   3834 O  O     . ARG B  1  88  ? 6.994   -3.815  221.853 1.00 40.87  ? 63  ARG B O     1 
ATOM   3835 C  CB    . ARG B  1  88  ? 8.424   -2.038  219.479 1.00 49.40  ? 63  ARG B CB    1 
ATOM   3836 C  CG    . ARG B  1  88  ? 9.491   -1.818  220.540 1.00 55.34  ? 63  ARG B CG    1 
ATOM   3837 C  CD    . ARG B  1  88  ? 10.219  -0.488  220.325 1.00 61.48  ? 63  ARG B CD    1 
ATOM   3838 N  NE    . ARG B  1  88  ? 10.922  -0.048  221.538 1.00 63.50  ? 63  ARG B NE    1 
ATOM   3839 C  CZ    . ARG B  1  88  ? 11.268  1.215   221.840 1.00 66.24  ? 63  ARG B CZ    1 
ATOM   3840 N  NH1   . ARG B  1  88  ? 10.993  2.239   221.021 1.00 65.08  ? 63  ARG B NH1   1 
ATOM   3841 N  NH2   . ARG B  1  88  ? 11.904  1.461   222.988 1.00 62.57  ? 63  ARG B NH2   1 
ATOM   3842 N  N     . ILE B  1  89  ? 5.492   -2.750  220.621 1.00 38.96  ? 64  ILE B N     1 
ATOM   3843 C  CA    . ILE B  1  89  ? 4.443   -2.786  221.634 1.00 40.36  ? 64  ILE B CA    1 
ATOM   3844 C  C     . ILE B  1  89  ? 4.014   -4.247  221.877 1.00 45.03  ? 64  ILE B C     1 
ATOM   3845 O  O     . ILE B  1  89  ? 3.863   -4.654  223.029 1.00 42.39  ? 64  ILE B O     1 
ATOM   3846 C  CB    . ILE B  1  89  ? 3.226   -1.935  221.239 1.00 41.08  ? 64  ILE B CB    1 
ATOM   3847 C  CG1   . ILE B  1  89  ? 3.599   -0.455  221.322 1.00 41.12  ? 64  ILE B CG1   1 
ATOM   3848 C  CG2   . ILE B  1  89  ? 2.021   -2.233  222.139 1.00 42.46  ? 64  ILE B CG2   1 
ATOM   3849 C  CD1   . ILE B  1  89  ? 2.532   0.476   220.791 1.00 40.95  ? 64  ILE B CD1   1 
ATOM   3850 N  N     . GLU B  1  90  ? 3.839   -5.026  220.806 1.00 44.27  ? 65  GLU B N     1 
ATOM   3851 C  CA    . GLU B  1  90  ? 3.470   -6.436  220.951 1.00 47.93  ? 65  GLU B CA    1 
ATOM   3852 C  C     . GLU B  1  90  ? 4.534   -7.238  221.690 1.00 44.70  ? 65  GLU B C     1 
ATOM   3853 O  O     . GLU B  1  90  ? 4.163   -8.000  222.575 1.00 41.48  ? 65  GLU B O     1 
ATOM   3854 C  CB    . GLU B  1  90  ? 3.152   -7.118  219.611 1.00 53.91  ? 65  GLU B CB    1 
ATOM   3855 C  CG    . GLU B  1  90  ? 1.683   -7.058  219.227 1.00 60.05  ? 65  GLU B CG    1 
ATOM   3856 C  CD    . GLU B  1  90  ? 1.305   -8.010  218.090 1.00 67.92  ? 65  GLU B CD    1 
ATOM   3857 O  OE1   . GLU B  1  90  ? 2.038   -8.994  217.828 1.00 68.11  ? 65  GLU B OE1   1 
ATOM   3858 O  OE2   . GLU B  1  90  ? 0.251   -7.773  217.458 1.00 72.78  ? 65  GLU B OE2   1 
ATOM   3859 N  N     . ASN B  1  91  ? 5.823   -7.063  221.358 1.00 40.42  ? 66  ASN B N     1 
ATOM   3860 C  CA    . ASN B  1  91  ? 6.898   -7.730  222.105 1.00 40.77  ? 66  ASN B CA    1 
ATOM   3861 C  C     . ASN B  1  91  ? 6.832   -7.418  223.605 1.00 44.54  ? 66  ASN B C     1 
ATOM   3862 O  O     . ASN B  1  91  ? 6.983   -8.331  224.446 1.00 41.38  ? 66  ASN B O     1 
ATOM   3863 C  CB    . ASN B  1  91  ? 8.309   -7.398  221.579 1.00 39.88  ? 66  ASN B CB    1 
ATOM   3864 C  CG    . ASN B  1  91  ? 8.573   -7.882  220.139 1.00 44.28  ? 66  ASN B CG    1 
ATOM   3865 O  OD1   . ASN B  1  91  ? 9.506   -7.404  219.494 1.00 49.17  ? 66  ASN B OD1   1 
ATOM   3866 N  ND2   . ASN B  1  91  ? 7.769   -8.807  219.632 1.00 43.97  ? 66  ASN B ND2   1 
ATOM   3867 N  N     . MET B  1  92  ? 6.586   -6.141  223.930 1.00 42.50  ? 67  MET B N     1 
ATOM   3868 C  CA    . MET B  1  92  ? 6.499   -5.707  225.323 1.00 42.11  ? 67  MET B CA    1 
ATOM   3869 C  C     . MET B  1  92  ? 5.313   -6.366  226.040 1.00 41.13  ? 67  MET B C     1 
ATOM   3870 O  O     . MET B  1  92  ? 5.484   -6.870  227.131 1.00 37.33  ? 67  MET B O     1 
ATOM   3871 C  CB    . MET B  1  92  ? 6.393   -4.187  225.408 1.00 42.96  ? 67  MET B CB    1 
ATOM   3872 C  CG    . MET B  1  92  ? 6.461   -3.608  226.818 1.00 43.88  ? 67  MET B CG    1 
ATOM   3873 S  SD    . MET B  1  92  ? 6.070   -1.846  226.866 1.00 41.73  ? 67  MET B SD    1 
ATOM   3874 C  CE    . MET B  1  92  ? 4.337   -1.781  226.412 1.00 40.18  ? 67  MET B CE    1 
ATOM   3875 N  N     . MET B  1  93  ? 4.133   -6.353  225.422 1.00 41.01  ? 68  MET B N     1 
ATOM   3876 C  CA    . MET B  1  93  ? 2.925   -6.923  226.029 1.00 45.85  ? 68  MET B CA    1 
ATOM   3877 C  C     . MET B  1  93  ? 3.030   -8.432  226.242 1.00 45.64  ? 68  MET B C     1 
ATOM   3878 O  O     . MET B  1  93  ? 2.492   -8.960  227.226 1.00 44.56  ? 68  MET B O     1 
ATOM   3879 C  CB    . MET B  1  93  ? 1.680   -6.631  225.182 1.00 46.98  ? 68  MET B CB    1 
ATOM   3880 C  CG    . MET B  1  93  ? 1.314   -5.169  225.072 1.00 50.40  ? 68  MET B CG    1 
ATOM   3881 S  SD    . MET B  1  93  ? 1.202   -4.316  226.653 1.00 58.63  ? 68  MET B SD    1 
ATOM   3882 C  CE    . MET B  1  93  ? -0.241  -5.145  227.342 1.00 60.72  ? 68  MET B CE    1 
ATOM   3883 N  N     . GLN B  1  94  ? 3.721   -9.114  225.333 1.00 42.68  ? 69  GLN B N     1 
ATOM   3884 C  CA    . GLN B  1  94  ? 3.969   -10.539 225.487 1.00 48.08  ? 69  GLN B CA    1 
ATOM   3885 C  C     . GLN B  1  94  ? 4.951   -10.800 226.616 1.00 48.80  ? 69  GLN B C     1 
ATOM   3886 O  O     . GLN B  1  94  ? 4.768   -11.770 227.358 1.00 43.20  ? 69  GLN B O     1 
ATOM   3887 C  CB    . GLN B  1  94  ? 4.446   -11.170 224.181 1.00 49.40  ? 69  GLN B CB    1 
ATOM   3888 C  CG    . GLN B  1  94  ? 3.341   -11.192 223.132 1.00 53.76  ? 69  GLN B CG    1 
ATOM   3889 C  CD    . GLN B  1  94  ? 3.823   -11.630 221.757 1.00 58.09  ? 69  GLN B CD    1 
ATOM   3890 O  OE1   . GLN B  1  94  ? 4.927   -12.175 221.607 1.00 57.74  ? 69  GLN B OE1   1 
ATOM   3891 N  NE2   . GLN B  1  94  ? 2.994   -11.395 220.740 1.00 58.31  ? 69  GLN B NE2   1 
ATOM   3892 N  N     . GLN B  1  95  ? 5.977   -9.946  226.743 1.00 47.52  ? 70  GLN B N     1 
ATOM   3893 C  CA    . GLN B  1  95  ? 6.849   -9.965  227.929 1.00 47.91  ? 70  GLN B CA    1 
ATOM   3894 C  C     . GLN B  1  95  ? 6.043   -9.718  229.208 1.00 44.91  ? 70  GLN B C     1 
ATOM   3895 O  O     . GLN B  1  95  ? 6.160   -10.477 230.173 1.00 38.46  ? 70  GLN B O     1 
ATOM   3896 C  CB    . GLN B  1  95  ? 7.947   -8.918  227.857 1.00 52.68  ? 70  GLN B CB    1 
ATOM   3897 C  CG    . GLN B  1  95  ? 9.324   -9.423  227.506 1.00 58.89  ? 70  GLN B CG    1 
ATOM   3898 C  CD    . GLN B  1  95  ? 10.334  -8.305  227.691 1.00 67.22  ? 70  GLN B CD    1 
ATOM   3899 O  OE1   . GLN B  1  95  ? 10.812  -7.722  226.720 1.00 78.77  ? 70  GLN B OE1   1 
ATOM   3900 N  NE2   . GLN B  1  95  ? 10.617  -7.959  228.948 1.00 66.26  ? 70  GLN B NE2   1 
ATOM   3901 N  N     . LYS B  1  96  ? 5.225   -8.666  229.215 1.00 40.27  ? 71  LYS B N     1 
ATOM   3902 C  CA    . LYS B  1  96  ? 4.428   -8.350  230.391 1.00 41.61  ? 71  LYS B CA    1 
ATOM   3903 C  C     . LYS B  1  96  ? 3.635   -9.581  230.879 1.00 44.66  ? 71  LYS B C     1 
ATOM   3904 O  O     . LYS B  1  96  ? 3.603   -9.857  232.066 1.00 42.57  ? 71  LYS B O     1 
ATOM   3905 C  CB    . LYS B  1  96  ? 3.448   -7.207  230.122 1.00 43.67  ? 71  LYS B CB    1 
ATOM   3906 C  CG    . LYS B  1  96  ? 2.737   -6.703  231.363 1.00 45.89  ? 71  LYS B CG    1 
ATOM   3907 C  CD    . LYS B  1  96  ? 1.309   -6.333  231.074 1.00 55.31  ? 71  LYS B CD    1 
ATOM   3908 C  CE    . LYS B  1  96  ? 0.556   -5.973  232.340 1.00 59.51  ? 71  LYS B CE    1 
ATOM   3909 N  NZ    . LYS B  1  96  ? -0.660  -5.179  231.984 1.00 67.55  ? 71  LYS B NZ    1 
ATOM   3910 N  N     . ALA B  1  97  ? 3.007   -10.311 229.956 1.00 46.09  ? 72  ALA B N     1 
ATOM   3911 C  CA    . ALA B  1  97  ? 2.129   -11.414 230.331 1.00 48.61  ? 72  ALA B CA    1 
ATOM   3912 C  C     . ALA B  1  97  ? 2.890   -12.599 230.972 1.00 46.04  ? 72  ALA B C     1 
ATOM   3913 O  O     . ALA B  1  97  ? 2.273   -13.433 231.632 1.00 46.49  ? 72  ALA B O     1 
ATOM   3914 C  CB    . ALA B  1  97  ? 1.302   -11.864 229.134 1.00 51.14  ? 72  ALA B CB    1 
ATOM   3915 N  N     . GLN B  1  98  ? 4.207   -12.666 230.771 1.00 39.42  ? 73  GLN B N     1 
ATOM   3916 C  CA    . GLN B  1  98  ? 5.049   -13.680 231.395 1.00 41.12  ? 73  GLN B CA    1 
ATOM   3917 C  C     . GLN B  1  98  ? 5.622   -13.302 232.757 1.00 42.88  ? 73  GLN B C     1 
ATOM   3918 O  O     . GLN B  1  98  ? 6.229   -14.168 233.412 1.00 39.95  ? 73  GLN B O     1 
ATOM   3919 C  CB    . GLN B  1  98  ? 6.195   -14.089 230.446 1.00 42.59  ? 73  GLN B CB    1 
ATOM   3920 C  CG    . GLN B  1  98  ? 5.715   -14.713 229.126 1.00 42.41  ? 73  GLN B CG    1 
ATOM   3921 C  CD    . GLN B  1  98  ? 4.763   -15.911 229.329 1.00 41.86  ? 73  GLN B CD    1 
ATOM   3922 O  OE1   . GLN B  1  98  ? 5.094   -16.838 230.036 1.00 48.25  ? 73  GLN B OE1   1 
ATOM   3923 N  NE2   . GLN B  1  98  ? 3.585   -15.875 228.716 1.00 43.05  ? 73  GLN B NE2   1 
ATOM   3924 N  N     . ILE B  1  99  ? 5.394   -12.056 233.202 1.00 41.70  ? 74  ILE B N     1 
ATOM   3925 C  CA    . ILE B  1  99  ? 5.931   -11.561 234.478 1.00 43.92  ? 74  ILE B CA    1 
ATOM   3926 C  C     . ILE B  1  99  ? 5.189   -12.273 235.647 1.00 42.26  ? 74  ILE B C     1 
ATOM   3927 O  O     . ILE B  1  99  ? 3.938   -12.269 235.694 1.00 37.06  ? 74  ILE B O     1 
ATOM   3928 C  CB    . ILE B  1  99  ? 5.751   -10.018 234.651 1.00 44.86  ? 74  ILE B CB    1 
ATOM   3929 C  CG1   . ILE B  1  99  ? 6.434   -9.206  233.520 1.00 47.58  ? 74  ILE B CG1   1 
ATOM   3930 C  CG2   . ILE B  1  99  ? 6.275   -9.558  236.015 1.00 44.76  ? 74  ILE B CG2   1 
ATOM   3931 C  CD1   . ILE B  1  99  ? 7.941   -9.250  233.506 1.00 50.77  ? 74  ILE B CD1   1 
ATOM   3932 N  N     . THR B  1  100 ? 5.944   -12.832 236.590 1.00 35.76  ? 75  THR B N     1 
ATOM   3933 C  CA    . THR B  1  100 ? 5.325   -13.449 237.791 1.00 41.51  ? 75  THR B CA    1 
ATOM   3934 C  C     . THR B  1  100 ? 5.120   -12.479 238.970 1.00 42.87  ? 75  THR B C     1 
ATOM   3935 O  O     . THR B  1  100 ? 5.824   -11.471 239.092 1.00 39.56  ? 75  THR B O     1 
ATOM   3936 C  CB    . THR B  1  100 ? 6.126   -14.677 238.284 1.00 39.29  ? 75  THR B CB    1 
ATOM   3937 O  OG1   . THR B  1  100 ? 7.421   -14.291 238.758 1.00 38.81  ? 75  THR B OG1   1 
ATOM   3938 C  CG2   . THR B  1  100 ? 6.283   -15.686 237.137 1.00 43.77  ? 75  THR B CG2   1 
ATOM   3939 N  N     . SER B  1  101 ? 4.155   -12.808 239.836 1.00 42.16  ? 76  SER B N     1 
ATOM   3940 C  CA    . SER B  1  101 ? 4.039   -12.197 241.164 1.00 39.35  ? 76  SER B CA    1 
ATOM   3941 C  C     . SER B  1  101 ? 5.374   -12.073 241.891 1.00 38.22  ? 76  SER B C     1 
ATOM   3942 O  O     . SER B  1  101 ? 5.650   -11.054 242.499 1.00 41.20  ? 76  SER B O     1 
ATOM   3943 C  CB    . SER B  1  101 ? 3.064   -12.986 242.029 1.00 42.26  ? 76  SER B CB    1 
ATOM   3944 O  OG    . SER B  1  101 ? 1.728   -12.726 241.617 1.00 45.64  ? 76  SER B OG    1 
ATOM   3945 N  N     . GLN B  1  102 ? 6.202   -13.100 241.834 1.00 35.75  ? 77  GLN B N     1 
ATOM   3946 C  CA    . GLN B  1  102 ? 7.457   -13.062 242.538 1.00 39.69  ? 77  GLN B CA    1 
ATOM   3947 C  C     . GLN B  1  102 ? 8.430   -12.093 241.886 1.00 36.98  ? 77  GLN B C     1 
ATOM   3948 O  O     . GLN B  1  102 ? 9.232   -11.472 242.586 1.00 35.09  ? 77  GLN B O     1 
ATOM   3949 C  CB    . GLN B  1  102 ? 8.108   -14.439 242.580 1.00 44.38  ? 77  GLN B CB    1 
ATOM   3950 C  CG    . GLN B  1  102 ? 9.403   -14.464 243.410 1.00 51.26  ? 77  GLN B CG    1 
ATOM   3951 C  CD    . GLN B  1  102 ? 10.201  -15.763 243.316 1.00 60.89  ? 77  GLN B CD    1 
ATOM   3952 O  OE1   . GLN B  1  102 ? 11.271  -15.874 243.935 1.00 64.20  ? 77  GLN B OE1   1 
ATOM   3953 N  NE2   . GLN B  1  102 ? 9.700   -16.753 242.554 1.00 61.24  ? 77  GLN B NE2   1 
ATOM   3954 N  N     . GLN B  1  103 ? 8.432   -12.059 240.554 1.00 36.83  ? 78  GLN B N     1 
ATOM   3955 C  CA    . GLN B  1  103 ? 9.307   -11.135 239.796 1.00 38.52  ? 78  GLN B CA    1 
ATOM   3956 C  C     . GLN B  1  103 ? 8.893   -9.704  240.089 1.00 37.92  ? 78  GLN B C     1 
ATOM   3957 O  O     . GLN B  1  103 ? 9.719   -8.842  240.347 1.00 39.50  ? 78  GLN B O     1 
ATOM   3958 C  CB    . GLN B  1  103 ? 9.228   -11.404 238.301 1.00 40.72  ? 78  GLN B CB    1 
ATOM   3959 C  CG    . GLN B  1  103 ? 10.065  -12.584 237.823 1.00 44.41  ? 78  GLN B CG    1 
ATOM   3960 C  CD    . GLN B  1  103 ? 9.619   -13.132 236.466 1.00 48.45  ? 78  GLN B CD    1 
ATOM   3961 O  OE1   . GLN B  1  103 ? 8.544   -12.798 235.966 1.00 47.06  ? 78  GLN B OE1   1 
ATOM   3962 N  NE2   . GLN B  1  103 ? 10.429  -14.021 235.887 1.00 51.61  ? 78  GLN B NE2   1 
ATOM   3963 N  N     . LEU B  1  104 ? 7.589   -9.481  240.099 1.00 37.92  ? 79  LEU B N     1 
ATOM   3964 C  CA    . LEU B  1  104 ? 7.033   -8.179  240.349 1.00 39.76  ? 79  LEU B CA    1 
ATOM   3965 C  C     . LEU B  1  104 ? 7.427   -7.717  241.744 1.00 42.91  ? 79  LEU B C     1 
ATOM   3966 O  O     . LEU B  1  104 ? 7.872   -6.595  241.918 1.00 44.45  ? 79  LEU B O     1 
ATOM   3967 C  CB    . LEU B  1  104 ? 5.516   -8.224  240.179 1.00 40.60  ? 79  LEU B CB    1 
ATOM   3968 C  CG    . LEU B  1  104 ? 4.757   -6.962  239.782 1.00 47.01  ? 79  LEU B CG    1 
ATOM   3969 C  CD1   . LEU B  1  104 ? 5.359   -6.292  238.542 1.00 48.44  ? 79  LEU B CD1   1 
ATOM   3970 C  CD2   . LEU B  1  104 ? 3.279   -7.307  239.554 1.00 49.15  ? 79  LEU B CD2   1 
ATOM   3971 N  N     . ARG B  1  105 ? 7.280   -8.603  242.729 1.00 41.23  ? 80  ARG B N     1 
ATOM   3972 C  CA    . ARG B  1  105 ? 7.624   -8.309  244.110 1.00 38.98  ? 80  ARG B CA    1 
ATOM   3973 C  C     . ARG B  1  105 ? 9.122   -7.999  244.310 1.00 37.92  ? 80  ARG B C     1 
ATOM   3974 O  O     . ARG B  1  105 ? 9.461   -7.084  245.041 1.00 40.58  ? 80  ARG B O     1 
ATOM   3975 C  CB    . ARG B  1  105 ? 7.127   -9.458  245.028 1.00 39.70  ? 80  ARG B CB    1 
ATOM   3976 C  CG    . ARG B  1  105 ? 7.793   -9.546  246.391 1.00 36.73  ? 80  ARG B CG    1 
ATOM   3977 C  CD    . ARG B  1  105 ? 7.054   -10.527 247.293 1.00 34.72  ? 80  ARG B CD    1 
ATOM   3978 N  NE    . ARG B  1  105 ? 7.318   -11.922 246.943 1.00 31.44  ? 80  ARG B NE    1 
ATOM   3979 C  CZ    . ARG B  1  105 ? 6.469   -12.705 246.282 1.00 29.96  ? 80  ARG B CZ    1 
ATOM   3980 N  NH1   . ARG B  1  105 ? 5.295   -12.232 245.889 1.00 30.32  ? 80  ARG B NH1   1 
ATOM   3981 N  NH2   . ARG B  1  105 ? 6.795   -13.963 246.010 1.00 30.74  ? 80  ARG B NH2   1 
ATOM   3982 N  N     . LYS B  1  106 ? 10.005  -8.724  243.649 1.00 41.47  ? 81  LYS B N     1 
ATOM   3983 C  CA    . LYS B  1  106 ? 11.447  -8.423  243.691 1.00 45.11  ? 81  LYS B CA    1 
ATOM   3984 C  C     . LYS B  1  106 ? 11.767  -7.053  243.030 1.00 49.34  ? 81  LYS B C     1 
ATOM   3985 O  O     . LYS B  1  106 ? 12.550  -6.267  243.572 1.00 46.20  ? 81  LYS B O     1 
ATOM   3986 C  CB    . LYS B  1  106 ? 12.248  -9.527  242.994 1.00 49.60  ? 81  LYS B CB    1 
ATOM   3987 C  CG    . LYS B  1  106 ? 13.770  -9.430  243.172 1.00 55.49  ? 81  LYS B CG    1 
ATOM   3988 C  CD    . LYS B  1  106 ? 14.522  -10.360 242.225 1.00 59.60  ? 81  LYS B CD    1 
ATOM   3989 C  CE    . LYS B  1  106 ? 15.677  -11.090 242.906 1.00 67.91  ? 81  LYS B CE    1 
ATOM   3990 N  NZ    . LYS B  1  106 ? 16.771  -10.207 243.407 1.00 70.97  ? 81  LYS B NZ    1 
ATOM   3991 N  N     . ALA B  1  107 ? 11.151  -6.768  241.884 1.00 46.79  ? 82  ALA B N     1 
ATOM   3992 C  CA    . ALA B  1  107 ? 11.339  -5.462  241.210 1.00 47.74  ? 82  ALA B CA    1 
ATOM   3993 C  C     . ALA B  1  107 ? 10.876  -4.309  242.096 1.00 46.33  ? 82  ALA B C     1 
ATOM   3994 O  O     . ALA B  1  107 ? 11.599  -3.337  242.302 1.00 43.47  ? 82  ALA B O     1 
ATOM   3995 C  CB    . ALA B  1  107 ? 10.577  -5.433  239.899 1.00 45.39  ? 82  ALA B CB    1 
ATOM   3996 N  N     . GLN B  1  108 ? 9.661   -4.450  242.617 1.00 45.95  ? 83  GLN B N     1 
ATOM   3997 C  CA    . GLN B  1  108 ? 9.036   -3.477  243.505 1.00 48.91  ? 83  GLN B CA    1 
ATOM   3998 C  C     . GLN B  1  108 ? 9.934   -3.016  244.662 1.00 51.58  ? 83  GLN B C     1 
ATOM   3999 O  O     . GLN B  1  108 ? 9.975   -1.831  244.972 1.00 50.88  ? 83  GLN B O     1 
ATOM   4000 C  CB    . GLN B  1  108 ? 7.743   -4.067  244.069 1.00 50.58  ? 83  GLN B CB    1 
ATOM   4001 C  CG    . GLN B  1  108 ? 6.892   -3.133  244.902 1.00 50.91  ? 83  GLN B CG    1 
ATOM   4002 C  CD    . GLN B  1  108 ? 6.264   -2.073  244.063 1.00 49.62  ? 83  GLN B CD    1 
ATOM   4003 O  OE1   . GLN B  1  108 ? 5.131   -2.214  243.596 1.00 47.32  ? 83  GLN B OE1   1 
ATOM   4004 N  NE2   . GLN B  1  108 ? 6.997   -1.004  243.844 1.00 57.30  ? 83  GLN B NE2   1 
ATOM   4005 N  N     . LEU B  1  109 ? 10.623  -3.955  245.297 1.00 51.78  ? 84  LEU B N     1 
ATOM   4006 C  CA    . LEU B  1  109 ? 11.544  -3.637  246.394 1.00 56.55  ? 84  LEU B CA    1 
ATOM   4007 C  C     . LEU B  1  109 ? 12.781  -2.881  245.932 1.00 56.05  ? 84  LEU B C     1 
ATOM   4008 O  O     . LEU B  1  109 ? 13.265  -2.027  246.663 1.00 53.80  ? 84  LEU B O     1 
ATOM   4009 C  CB    . LEU B  1  109 ? 12.010  -4.907  247.117 1.00 56.78  ? 84  LEU B CB    1 
ATOM   4010 C  CG    . LEU B  1  109 ? 10.983  -5.509  248.062 1.00 59.67  ? 84  LEU B CG    1 
ATOM   4011 C  CD1   . LEU B  1  109 ? 11.264  -6.990  248.265 1.00 62.58  ? 84  LEU B CD1   1 
ATOM   4012 C  CD2   . LEU B  1  109 ? 10.966  -4.768  249.387 1.00 60.03  ? 84  LEU B CD2   1 
ATOM   4013 N  N     . GLN B  1  110 ? 13.306  -3.232  244.754 1.00 58.19  ? 85  GLN B N     1 
ATOM   4014 C  CA    . GLN B  1  110 ? 14.495  -2.565  244.185 1.00 59.77  ? 85  GLN B CA    1 
ATOM   4015 C  C     . GLN B  1  110 ? 14.173  -1.126  243.756 1.00 56.42  ? 85  GLN B C     1 
ATOM   4016 O  O     . GLN B  1  110 ? 14.982  -0.209  243.941 1.00 59.18  ? 85  GLN B O     1 
ATOM   4017 C  CB    . GLN B  1  110 ? 15.058  -3.336  242.978 1.00 61.92  ? 85  GLN B CB    1 
ATOM   4018 C  CG    . GLN B  1  110 ? 15.396  -4.816  243.187 1.00 68.38  ? 85  GLN B CG    1 
ATOM   4019 C  CD    . GLN B  1  110 ? 16.546  -5.105  244.154 1.00 74.71  ? 85  GLN B CD    1 
ATOM   4020 O  OE1   . GLN B  1  110 ? 17.145  -4.199  244.746 1.00 77.18  ? 85  GLN B OE1   1 
ATOM   4021 N  NE2   . GLN B  1  110 ? 16.849  -6.393  244.326 1.00 73.60  ? 85  GLN B NE2   1 
ATOM   4022 N  N     . VAL B  1  111 ? 12.983  -0.949  243.191 1.00 55.12  ? 86  VAL B N     1 
ATOM   4023 C  CA    . VAL B  1  111 ? 12.488  0.345   242.739 1.00 55.28  ? 86  VAL B CA    1 
ATOM   4024 C  C     . VAL B  1  111 ? 12.135  1.229   243.933 1.00 56.88  ? 86  VAL B C     1 
ATOM   4025 O  O     . VAL B  1  111 ? 12.441  2.429   243.919 1.00 54.68  ? 86  VAL B O     1 
ATOM   4026 C  CB    . VAL B  1  111 ? 11.269  0.182   241.782 1.00 55.28  ? 86  VAL B CB    1 
ATOM   4027 C  CG1   . VAL B  1  111 ? 10.526  1.496   241.545 1.00 55.69  ? 86  VAL B CG1   1 
ATOM   4028 C  CG2   . VAL B  1  111 ? 11.718  -0.424  240.457 1.00 56.07  ? 86  VAL B CG2   1 
ATOM   4029 N  N     . ASP B  1  112 ? 11.467  0.657   244.941 1.00 54.47  ? 87  ASP B N     1 
ATOM   4030 C  CA    . ASP B  1  112 ? 11.171  1.400   246.179 1.00 55.20  ? 87  ASP B CA    1 
ATOM   4031 C  C     . ASP B  1  112 ? 12.468  1.857   246.891 1.00 52.95  ? 87  ASP B C     1 
ATOM   4032 O  O     . ASP B  1  112 ? 12.551  2.988   247.344 1.00 56.14  ? 87  ASP B O     1 
ATOM   4033 C  CB    . ASP B  1  112 ? 10.255  0.598   247.115 1.00 54.60  ? 87  ASP B CB    1 
ATOM   4034 C  CG    . ASP B  1  112 ? 8.803   0.524   246.624 1.00 54.10  ? 87  ASP B CG    1 
ATOM   4035 O  OD1   . ASP B  1  112 ? 8.086   -0.366  247.111 1.00 59.71  ? 87  ASP B OD1   1 
ATOM   4036 O  OD2   . ASP B  1  112 ? 8.358   1.333   245.772 1.00 57.64  ? 87  ASP B OD2   1 
ATOM   4037 N  N     . ARG B  1  113 ? 13.486  1.003   246.929 1.00 53.53  ? 88  ARG B N     1 
ATOM   4038 C  CA    . ARG B  1  113 ? 14.807  1.386   247.458 1.00 58.85  ? 88  ARG B CA    1 
ATOM   4039 C  C     . ARG B  1  113 ? 15.394  2.596   246.707 1.00 62.75  ? 88  ARG B C     1 
ATOM   4040 O  O     . ARG B  1  113 ? 15.834  3.567   247.323 1.00 58.57  ? 88  ARG B O     1 
ATOM   4041 C  CB    . ARG B  1  113 ? 15.783  0.211   247.373 1.00 56.66  ? 88  ARG B CB    1 
ATOM   4042 N  N     . PHE B  1  114 ? 15.364  2.534   245.377 1.00 62.84  ? 89  PHE B N     1 
ATOM   4043 C  CA    . PHE B  1  114 ? 15.838  3.633   244.536 1.00 60.47  ? 89  PHE B CA    1 
ATOM   4044 C  C     . PHE B  1  114 ? 15.007  4.894   244.703 1.00 54.44  ? 89  PHE B C     1 
ATOM   4045 O  O     . PHE B  1  114 ? 15.573  5.981   244.695 1.00 54.27  ? 89  PHE B O     1 
ATOM   4046 C  CB    . PHE B  1  114 ? 15.847  3.235   243.066 1.00 62.10  ? 89  PHE B CB    1 
ATOM   4047 C  CG    . PHE B  1  114 ? 16.638  4.168   242.192 1.00 63.31  ? 89  PHE B CG    1 
ATOM   4048 C  CD1   . PHE B  1  114 ? 18.031  4.214   242.285 1.00 67.19  ? 89  PHE B CD1   1 
ATOM   4049 C  CD2   . PHE B  1  114 ? 16.002  4.985   241.263 1.00 58.36  ? 89  PHE B CD2   1 
ATOM   4050 C  CE1   . PHE B  1  114 ? 18.771  5.064   241.469 1.00 68.04  ? 89  PHE B CE1   1 
ATOM   4051 C  CE2   . PHE B  1  114 ? 16.734  5.834   240.448 1.00 60.05  ? 89  PHE B CE2   1 
ATOM   4052 C  CZ    . PHE B  1  114 ? 18.122  5.877   240.548 1.00 61.60  ? 89  PHE B CZ    1 
ATOM   4053 N  N     . ALA B  1  115 ? 13.688  4.751   244.860 1.00 48.88  ? 90  ALA B N     1 
ATOM   4054 C  CA    . ALA B  1  115 ? 12.809  5.906   245.075 1.00 48.75  ? 90  ALA B CA    1 
ATOM   4055 C  C     . ALA B  1  115 ? 13.027  6.609   246.422 1.00 56.42  ? 90  ALA B C     1 
ATOM   4056 O  O     . ALA B  1  115 ? 12.748  7.801   246.553 1.00 53.38  ? 90  ALA B O     1 
ATOM   4057 C  CB    . ALA B  1  115 ? 11.350  5.506   244.945 1.00 48.62  ? 90  ALA B CB    1 
ATOM   4058 N  N     . MET B  1  116 ? 13.489  5.850   247.415 1.00 62.82  ? 91  MET B N     1 
ATOM   4059 C  CA    . MET B  1  116 ? 13.789  6.367   248.751 1.00 66.98  ? 91  MET B CA    1 
ATOM   4060 C  C     . MET B  1  116 ? 14.929  7.376   248.652 1.00 57.92  ? 91  MET B C     1 
ATOM   4061 O  O     . MET B  1  116 ? 14.816  8.475   249.180 1.00 54.88  ? 91  MET B O     1 
ATOM   4062 C  CB    . MET B  1  116 ? 14.185  5.215   249.712 1.00 76.60  ? 91  MET B CB    1 
ATOM   4063 C  CG    . MET B  1  116 ? 13.681  5.338   251.148 1.00 84.16  ? 91  MET B CG    1 
ATOM   4064 S  SD    . MET B  1  116 ? 12.105  4.488   251.453 1.00 98.34  ? 91  MET B SD    1 
ATOM   4065 C  CE    . MET B  1  116 ? 12.548  2.753   251.285 1.00 91.82  ? 91  MET B CE    1 
ATOM   4066 N  N     . GLU B  1  117 ? 16.015  6.980   247.978 1.00 56.90  ? 92  GLU B N     1 
ATOM   4067 C  CA    . GLU B  1  117 ? 17.188  7.846   247.744 1.00 63.35  ? 92  GLU B CA    1 
ATOM   4068 C  C     . GLU B  1  117 ? 16.821  9.137   247.012 1.00 62.69  ? 92  GLU B C     1 
ATOM   4069 O  O     . GLU B  1  117 ? 17.339  10.201  247.351 1.00 60.64  ? 92  GLU B O     1 
ATOM   4070 C  CB    . GLU B  1  117 ? 18.238  7.143   246.882 1.00 69.23  ? 92  GLU B CB    1 
ATOM   4071 C  CG    . GLU B  1  117 ? 18.968  5.976   247.520 1.00 75.51  ? 92  GLU B CG    1 
ATOM   4072 C  CD    . GLU B  1  117 ? 19.867  5.248   246.524 1.00 80.95  ? 92  GLU B CD    1 
ATOM   4073 O  OE1   . GLU B  1  117 ? 20.314  5.870   245.533 1.00 83.97  ? 92  GLU B OE1   1 
ATOM   4074 O  OE2   . GLU B  1  117 ? 20.128  4.045   246.731 1.00 86.66  ? 92  GLU B OE2   1 
ATOM   4075 N  N     . LEU B  1  118 ? 15.954  9.008   245.995 1.00 61.32  ? 93  LEU B N     1 
ATOM   4076 C  CA    . LEU B  1  118 ? 15.478  10.139  245.186 1.00 58.83  ? 93  LEU B CA    1 
ATOM   4077 C  C     . LEU B  1  118 ? 14.646  11.077  246.027 1.00 62.24  ? 93  LEU B C     1 
ATOM   4078 O  O     . LEU B  1  118 ? 14.898  12.282  246.039 1.00 66.77  ? 93  LEU B O     1 
ATOM   4079 C  CB    . LEU B  1  118 ? 14.642  9.679   243.975 1.00 54.80  ? 93  LEU B CB    1 
ATOM   4080 C  CG    . LEU B  1  118 ? 15.341  8.894   242.858 1.00 51.11  ? 93  LEU B CG    1 
ATOM   4081 C  CD1   . LEU B  1  118 ? 14.356  8.601   241.737 1.00 47.54  ? 93  LEU B CD1   1 
ATOM   4082 C  CD2   . LEU B  1  118 ? 16.562  9.625   242.320 1.00 48.40  ? 93  LEU B CD2   1 
ATOM   4083 N  N     . GLU B  1  119 ? 13.665  10.527  246.738 1.00 59.21  ? 94  GLU B N     1 
ATOM   4084 C  CA    . GLU B  1  119 ? 12.821  11.336  247.607 1.00 57.98  ? 94  GLU B CA    1 
ATOM   4085 C  C     . GLU B  1  119 ? 13.626  12.035  248.706 1.00 60.51  ? 94  GLU B C     1 
ATOM   4086 O  O     . GLU B  1  119 ? 13.325  13.187  249.051 1.00 56.15  ? 94  GLU B O     1 
ATOM   4087 C  CB    . GLU B  1  119 ? 11.744  10.484  248.250 1.00 58.67  ? 94  GLU B CB    1 
ATOM   4088 C  CG    . GLU B  1  119 ? 10.789  11.261  249.126 1.00 57.04  ? 94  GLU B CG    1 
ATOM   4089 C  CD    . GLU B  1  119 ? 10.071  12.319  248.345 1.00 57.32  ? 94  GLU B CD    1 
ATOM   4090 O  OE1   . GLU B  1  119 ? 9.384   11.940  247.370 1.00 53.98  ? 94  GLU B OE1   1 
ATOM   4091 O  OE2   . GLU B  1  119 ? 10.170  13.515  248.695 1.00 54.92  ? 94  GLU B OE2   1 
ATOM   4092 N  N     . GLN B  1  120 ? 14.636  11.339  249.238 1.00 62.16  ? 95  GLN B N     1 
ATOM   4093 C  CA    . GLN B  1  120 ? 15.489  11.877  250.304 1.00 61.55  ? 95  GLN B CA    1 
ATOM   4094 C  C     . GLN B  1  120 ? 16.077  13.178  249.804 1.00 65.82  ? 95  GLN B C     1 
ATOM   4095 O  O     . GLN B  1  120 ? 15.881  14.229  250.415 1.00 71.36  ? 95  GLN B O     1 
ATOM   4096 C  CB    . GLN B  1  120 ? 16.622  10.911  250.682 1.00 57.39  ? 95  GLN B CB    1 
ATOM   4097 N  N     . SER B  1  121 ? 16.724  13.105  248.644 1.00 61.25  ? 96  SER B N     1 
ATOM   4098 C  CA    . SER B  1  121 ? 17.456  14.231  248.098 1.00 60.51  ? 96  SER B CA    1 
ATOM   4099 C  C     . SER B  1  121 ? 16.610  15.307  247.366 1.00 59.06  ? 96  SER B C     1 
ATOM   4100 O  O     . SER B  1  121 ? 17.195  16.220  246.765 1.00 57.62  ? 96  SER B O     1 
ATOM   4101 C  CB    . SER B  1  121 ? 18.537  13.700  247.167 1.00 62.93  ? 96  SER B CB    1 
ATOM   4102 O  OG    . SER B  1  121 ? 17.938  13.075  246.053 1.00 66.95  ? 96  SER B OG    1 
ATOM   4103 N  N     . ARG B  1  122 ? 15.269  15.230  247.430 1.00 51.72  ? 97  ARG B N     1 
ATOM   4104 C  CA    . ARG B  1  122 ? 14.400  16.212  246.783 1.00 47.50  ? 97  ARG B CA    1 
ATOM   4105 C  C     . ARG B  1  122 ? 14.830  17.638  247.139 1.00 50.27  ? 97  ARG B C     1 
ATOM   4106 O  O     . ARG B  1  122 ? 14.796  18.021  248.300 1.00 48.86  ? 97  ARG B O     1 
ATOM   4107 C  CB    . ARG B  1  122 ? 12.937  16.025  247.170 1.00 45.04  ? 97  ARG B CB    1 
ATOM   4108 C  CG    . ARG B  1  122 ? 11.994  17.064  246.558 1.00 47.55  ? 97  ARG B CG    1 
ATOM   4109 C  CD    . ARG B  1  122 ? 10.550  16.894  246.989 1.00 46.20  ? 97  ARG B CD    1 
ATOM   4110 N  NE    . ARG B  1  122 ? 10.090  15.548  246.682 1.00 51.17  ? 97  ARG B NE    1 
ATOM   4111 C  CZ    . ARG B  1  122 ? 9.620   15.122  245.503 1.00 52.38  ? 97  ARG B CZ    1 
ATOM   4112 N  NH1   . ARG B  1  122 ? 9.514   15.930  244.439 1.00 50.48  ? 97  ARG B NH1   1 
ATOM   4113 N  NH2   . ARG B  1  122 ? 9.252   13.851  245.379 1.00 54.15  ? 97  ARG B NH2   1 
ATOM   4114 N  N     . ASN B  1  123 ? 15.204  18.416  246.127 1.00 48.38  ? 98  ASN B N     1 
ATOM   4115 C  CA    . ASN B  1  123 ? 15.687  19.775  246.319 1.00 47.16  ? 98  ASN B CA    1 
ATOM   4116 C  C     . ASN B  1  123 ? 14.622  20.789  245.892 1.00 45.95  ? 98  ASN B C     1 
ATOM   4117 O  O     . ASN B  1  123 ? 14.315  20.909  244.699 1.00 43.87  ? 98  ASN B O     1 
ATOM   4118 C  CB    . ASN B  1  123 ? 16.983  19.957  245.544 1.00 48.49  ? 98  ASN B CB    1 
ATOM   4119 C  CG    . ASN B  1  123 ? 17.623  21.317  245.782 1.00 49.88  ? 98  ASN B CG    1 
ATOM   4120 O  OD1   . ASN B  1  123 ? 16.986  22.254  246.272 1.00 50.99  ? 98  ASN B OD1   1 
ATOM   4121 N  ND2   . ASN B  1  123 ? 18.894  21.422  245.447 1.00 50.36  ? 98  ASN B ND2   1 
ATOM   4122 N  N     . LEU B  1  124 ? 14.051  21.489  246.878 1.00 45.07  ? 99  LEU B N     1 
ATOM   4123 C  CA    . LEU B  1  124 ? 13.019  22.508  246.655 1.00 45.53  ? 99  LEU B CA    1 
ATOM   4124 C  C     . LEU B  1  124 ? 13.554  23.920  246.931 1.00 44.12  ? 99  LEU B C     1 
ATOM   4125 O  O     . LEU B  1  124 ? 12.778  24.830  247.162 1.00 43.19  ? 99  LEU B O     1 
ATOM   4126 C  CB    . LEU B  1  124 ? 11.798  22.242  247.530 1.00 46.77  ? 99  LEU B CB    1 
ATOM   4127 C  CG    . LEU B  1  124 ? 10.956  21.006  247.211 1.00 53.57  ? 99  LEU B CG    1 
ATOM   4128 C  CD1   . LEU B  1  124 ? 9.886   20.825  248.286 1.00 50.66  ? 99  LEU B CD1   1 
ATOM   4129 C  CD2   . LEU B  1  124 ? 10.317  21.105  245.821 1.00 55.32  ? 99  LEU B CD2   1 
ATOM   4130 N  N     . SER B  1  125 ? 14.870  24.114  246.865 1.00 44.75  ? 100 SER B N     1 
ATOM   4131 C  CA    . SER B  1  125 ? 15.460  25.405  247.250 1.00 49.15  ? 100 SER B CA    1 
ATOM   4132 C  C     . SER B  1  125 ? 15.735  26.397  246.088 1.00 50.09  ? 100 SER B C     1 
ATOM   4133 O  O     . SER B  1  125 ? 16.008  27.574  246.345 1.00 49.42  ? 100 SER B O     1 
ATOM   4134 C  CB    . SER B  1  125 ? 16.732  25.170  248.054 1.00 47.00  ? 100 SER B CB    1 
ATOM   4135 O  OG    . SER B  1  125 ? 17.797  24.804  247.215 1.00 55.16  ? 100 SER B OG    1 
ATOM   4136 N  N     . ASN B  1  126 ? 15.661  25.924  244.839 1.00 49.78  ? 101 ASN B N     1 
ATOM   4137 C  CA    . ASN B  1  126 ? 15.979  26.722  243.648 1.00 44.72  ? 101 ASN B CA    1 
ATOM   4138 C  C     . ASN B  1  126 ? 14.724  27.173  242.924 1.00 42.63  ? 101 ASN B C     1 
ATOM   4139 O  O     . ASN B  1  126 ? 13.758  26.433  242.833 1.00 44.28  ? 101 ASN B O     1 
ATOM   4140 C  CB    . ASN B  1  126 ? 16.835  25.920  242.680 1.00 44.44  ? 101 ASN B CB    1 
ATOM   4141 C  CG    . ASN B  1  126 ? 18.208  25.591  243.235 1.00 46.43  ? 101 ASN B CG    1 
ATOM   4142 O  OD1   . ASN B  1  126 ? 19.167  26.309  242.996 1.00 44.99  ? 101 ASN B OD1   1 
ATOM   4143 N  ND2   . ASN B  1  126 ? 18.309  24.496  243.970 1.00 49.65  ? 101 ASN B ND2   1 
ATOM   4144 N  N     . THR B  1  127 ? 14.728  28.395  242.413 1.00 41.39  ? 102 THR B N     1 
ATOM   4145 C  CA    . THR B  1  127 ? 13.627  28.858  241.583 1.00 41.86  ? 102 THR B CA    1 
ATOM   4146 C  C     . THR B  1  127 ? 14.129  28.848  240.128 1.00 41.35  ? 102 THR B C     1 
ATOM   4147 O  O     . THR B  1  127 ? 15.002  29.656  239.753 1.00 41.13  ? 102 THR B O     1 
ATOM   4148 C  CB    . THR B  1  127 ? 13.111  30.225  242.046 1.00 44.10  ? 102 THR B CB    1 
ATOM   4149 O  OG1   . THR B  1  127 ? 12.730  30.135  243.424 1.00 43.43  ? 102 THR B OG1   1 
ATOM   4150 C  CG2   . THR B  1  127 ? 11.898  30.650  241.235 1.00 44.38  ? 102 THR B CG2   1 
ATOM   4151 N  N     . ILE B  1  128 ? 13.602  27.887  239.353 1.00 38.66  ? 103 ILE B N     1 
ATOM   4152 C  CA    . ILE B  1  128 ? 13.998  27.644  237.974 1.00 37.29  ? 103 ILE B CA    1 
ATOM   4153 C  C     . ILE B  1  128 ? 12.910  28.204  237.090 1.00 36.74  ? 103 ILE B C     1 
ATOM   4154 O  O     . ILE B  1  128 ? 11.714  27.964  237.330 1.00 36.18  ? 103 ILE B O     1 
ATOM   4155 C  CB    . ILE B  1  128 ? 14.240  26.136  237.690 1.00 38.76  ? 103 ILE B CB    1 
ATOM   4156 C  CG1   . ILE B  1  128 ? 15.340  25.594  238.616 1.00 39.71  ? 103 ILE B CG1   1 
ATOM   4157 C  CG2   . ILE B  1  128 ? 14.613  25.886  236.224 1.00 38.85  ? 103 ILE B CG2   1 
ATOM   4158 C  CD1   . ILE B  1  128 ? 16.693  26.271  238.485 1.00 38.72  ? 103 ILE B CD1   1 
ATOM   4159 N  N     . VAL B  1  129 ? 13.336  29.005  236.108 1.00 34.01  ? 104 VAL B N     1 
ATOM   4160 C  CA    . VAL B  1  129 ? 12.449  29.629  235.166 1.00 32.62  ? 104 VAL B CA    1 
ATOM   4161 C  C     . VAL B  1  129 ? 12.757  29.060  233.764 1.00 34.74  ? 104 VAL B C     1 
ATOM   4162 O  O     . VAL B  1  129 ? 13.934  28.955  233.365 1.00 32.92  ? 104 VAL B O     1 
ATOM   4163 C  CB    . VAL B  1  129 ? 12.617  31.170  235.188 1.00 34.55  ? 104 VAL B CB    1 
ATOM   4164 C  CG1   . VAL B  1  129 ? 11.735  31.834  234.144 1.00 34.36  ? 104 VAL B CG1   1 
ATOM   4165 C  CG2   . VAL B  1  129 ? 12.246  31.718  236.563 1.00 35.59  ? 104 VAL B CG2   1 
ATOM   4166 N  N     . HIS B  1  130 ? 11.704  28.687  233.041 1.00 30.96  ? 105 HIS B N     1 
ATOM   4167 C  CA    . HIS B  1  130 ? 11.814  28.407  231.627 1.00 33.97  ? 105 HIS B CA    1 
ATOM   4168 C  C     . HIS B  1  130 ? 11.054  29.475  230.830 1.00 32.36  ? 105 HIS B C     1 
ATOM   4169 O  O     . HIS B  1  130 ? 9.863   29.649  231.018 1.00 34.61  ? 105 HIS B O     1 
ATOM   4170 C  CB    . HIS B  1  130 ? 11.249  27.026  231.335 1.00 34.62  ? 105 HIS B CB    1 
ATOM   4171 C  CG    . HIS B  1  130 ? 11.402  26.605  229.916 1.00 34.16  ? 105 HIS B CG    1 
ATOM   4172 N  ND1   . HIS B  1  130 ? 10.340  26.545  229.041 1.00 35.80  ? 105 HIS B ND1   1 
ATOM   4173 C  CD2   . HIS B  1  130 ? 12.499  26.240  229.210 1.00 34.68  ? 105 HIS B CD2   1 
ATOM   4174 C  CE1   . HIS B  1  130 ? 10.772  26.156  227.852 1.00 36.76  ? 105 HIS B CE1   1 
ATOM   4175 N  NE2   . HIS B  1  130 ? 12.080  25.964  227.930 1.00 36.86  ? 105 HIS B NE2   1 
ATOM   4176 N  N     . ILE B  1  131 ? 11.761  30.159  229.938 1.00 32.48  ? 106 ILE B N     1 
ATOM   4177 C  CA    . ILE B  1  131 ? 11.201  31.200  229.045 1.00 32.92  ? 106 ILE B CA    1 
ATOM   4178 C  C     . ILE B  1  131 ? 11.089  30.587  227.659 1.00 31.65  ? 106 ILE B C     1 
ATOM   4179 O  O     . ILE B  1  131 ? 12.021  29.942  227.211 1.00 29.34  ? 106 ILE B O     1 
ATOM   4180 C  CB    . ILE B  1  131 ? 12.148  32.423  228.908 1.00 34.87  ? 106 ILE B CB    1 
ATOM   4181 C  CG1   . ILE B  1  131 ? 12.397  33.090  230.265 1.00 36.59  ? 106 ILE B CG1   1 
ATOM   4182 C  CG2   . ILE B  1  131 ? 11.572  33.437  227.924 1.00 35.88  ? 106 ILE B CG2   1 
ATOM   4183 C  CD1   . ILE B  1  131 ? 11.169  33.767  230.860 1.00 37.12  ? 106 ILE B CD1   1 
ATOM   4184 N  N     . ASP B  1  132 ? 9.954   30.813  227.000 1.00 31.00  ? 107 ASP B N     1 
ATOM   4185 C  CA    . ASP B  1  132 ? 9.650   30.256  225.702 1.00 32.37  ? 107 ASP B CA    1 
ATOM   4186 C  C     . ASP B  1  132 ? 8.844   31.275  224.876 1.00 33.43  ? 107 ASP B C     1 
ATOM   4187 O  O     . ASP B  1  132 ? 7.675   31.573  225.206 1.00 28.78  ? 107 ASP B O     1 
ATOM   4188 C  CB    . ASP B  1  132 ? 8.852   28.964  225.914 1.00 34.51  ? 107 ASP B CB    1 
ATOM   4189 C  CG    . ASP B  1  132 ? 8.650   28.142  224.628 1.00 36.76  ? 107 ASP B CG    1 
ATOM   4190 O  OD1   . ASP B  1  132 ? 8.373   28.687  223.549 1.00 39.41  ? 107 ASP B OD1   1 
ATOM   4191 O  OD2   . ASP B  1  132 ? 8.690   26.910  224.733 1.00 42.65  ? 107 ASP B OD2   1 
ATOM   4192 N  N     . MET B  1  133 ? 9.450   31.773  223.791 1.00 29.47  ? 108 MET B N     1 
ATOM   4193 C  CA    . MET B  1  133 ? 8.806   32.759  222.913 1.00 28.89  ? 108 MET B CA    1 
ATOM   4194 C  C     . MET B  1  133 ? 7.546   32.182  222.264 1.00 27.45  ? 108 MET B C     1 
ATOM   4195 O  O     . MET B  1  133 ? 7.464   30.968  221.985 1.00 29.74  ? 108 MET B O     1 
ATOM   4196 C  CB    . MET B  1  133 ? 9.780   33.256  221.836 1.00 29.91  ? 108 MET B CB    1 
ATOM   4197 C  CG    . MET B  1  133 ? 11.084  33.877  222.347 1.00 32.05  ? 108 MET B CG    1 
ATOM   4198 S  SD    . MET B  1  133 ? 10.825  35.360  223.370 1.00 35.52  ? 108 MET B SD    1 
ATOM   4199 C  CE    . MET B  1  133 ? 10.054  36.486  222.192 1.00 39.95  ? 108 MET B CE    1 
ATOM   4200 N  N     . ASP B  1  134 ? 6.527   33.021  222.125 1.00 28.54  ? 109 ASP B N     1 
ATOM   4201 C  CA    . ASP B  1  134 ? 5.252   32.579  221.539 1.00 30.61  ? 109 ASP B CA    1 
ATOM   4202 C  C     . ASP B  1  134 ? 5.313   32.641  220.015 1.00 31.97  ? 109 ASP B C     1 
ATOM   4203 O  O     . ASP B  1  134 ? 5.694   33.682  219.456 1.00 30.57  ? 109 ASP B O     1 
ATOM   4204 C  CB    . ASP B  1  134 ? 4.092   33.425  222.054 1.00 32.27  ? 109 ASP B CB    1 
ATOM   4205 C  CG    . ASP B  1  134 ? 3.940   33.342  223.585 1.00 31.15  ? 109 ASP B CG    1 
ATOM   4206 O  OD1   . ASP B  1  134 ? 4.058   32.232  224.154 1.00 35.63  ? 109 ASP B OD1   1 
ATOM   4207 O  OD2   . ASP B  1  134 ? 3.738   34.391  224.221 1.00 31.43  ? 109 ASP B OD2   1 
ATOM   4208 N  N     . ALA B  1  135 ? 4.924   31.534  219.366 1.00 27.36  ? 110 ALA B N     1 
ATOM   4209 C  CA    . ALA B  1  135 ? 4.918   31.401  217.915 1.00 28.12  ? 110 ALA B CA    1 
ATOM   4210 C  C     . ALA B  1  135 ? 6.154   32.040  217.264 1.00 26.43  ? 110 ALA B C     1 
ATOM   4211 O  O     . ALA B  1  135 ? 6.025   32.782  216.320 1.00 26.69  ? 110 ALA B O     1 
ATOM   4212 C  CB    . ALA B  1  135 ? 3.643   31.991  217.346 1.00 28.41  ? 110 ALA B CB    1 
ATOM   4213 N  N     . PHE B  1  136 ? 7.337   31.757  217.809 1.00 26.79  ? 111 PHE B N     1 
ATOM   4214 C  CA    . PHE B  1  136 ? 8.492   32.627  217.629 1.00 30.19  ? 111 PHE B CA    1 
ATOM   4215 C  C     . PHE B  1  136 ? 8.706   33.176  216.222 1.00 28.36  ? 111 PHE B C     1 
ATOM   4216 O  O     . PHE B  1  136 ? 8.675   34.381  216.043 1.00 31.60  ? 111 PHE B O     1 
ATOM   4217 C  CB    . PHE B  1  136 ? 9.782   31.965  218.167 1.00 30.17  ? 111 PHE B CB    1 
ATOM   4218 C  CG    . PHE B  1  136 ? 11.004  32.860  218.125 1.00 32.07  ? 111 PHE B CG    1 
ATOM   4219 C  CD1   . PHE B  1  136 ? 10.935  34.203  218.450 1.00 32.93  ? 111 PHE B CD1   1 
ATOM   4220 C  CD2   . PHE B  1  136 ? 12.252  32.335  217.785 1.00 33.79  ? 111 PHE B CD2   1 
ATOM   4221 C  CE1   . PHE B  1  136 ? 12.071  35.007  218.424 1.00 33.87  ? 111 PHE B CE1   1 
ATOM   4222 C  CE2   . PHE B  1  136 ? 13.386  33.128  217.771 1.00 33.15  ? 111 PHE B CE2   1 
ATOM   4223 C  CZ    . PHE B  1  136 ? 13.296  34.467  218.086 1.00 33.58  ? 111 PHE B CZ    1 
ATOM   4224 N  N     . TYR B  1  137 ? 8.921   32.322  215.222 1.00 29.90  ? 112 TYR B N     1 
ATOM   4225 C  CA    . TYR B  1  137 ? 9.278   32.835  213.878 1.00 28.98  ? 112 TYR B CA    1 
ATOM   4226 C  C     . TYR B  1  137 ? 8.109   33.601  213.266 1.00 28.75  ? 112 TYR B C     1 
ATOM   4227 O  O     . TYR B  1  137 ? 8.305   34.621  212.622 1.00 28.78  ? 112 TYR B O     1 
ATOM   4228 C  CB    . TYR B  1  137 ? 9.677   31.747  212.889 1.00 29.57  ? 112 TYR B CB    1 
ATOM   4229 C  CG    . TYR B  1  137 ? 10.939  30.973  213.139 1.00 28.11  ? 112 TYR B CG    1 
ATOM   4230 C  CD1   . TYR B  1  137 ? 11.303  29.966  212.260 1.00 28.62  ? 112 TYR B CD1   1 
ATOM   4231 C  CD2   . TYR B  1  137 ? 11.740  31.191  214.247 1.00 27.81  ? 112 TYR B CD2   1 
ATOM   4232 C  CE1   . TYR B  1  137 ? 12.452  29.208  212.453 1.00 28.33  ? 112 TYR B CE1   1 
ATOM   4233 C  CE2   . TYR B  1  137 ? 12.890  30.442  214.444 1.00 29.47  ? 112 TYR B CE2   1 
ATOM   4234 C  CZ    . TYR B  1  137 ? 13.240  29.457  213.539 1.00 28.26  ? 112 TYR B CZ    1 
ATOM   4235 O  OH    . TYR B  1  137 ? 14.369  28.721  213.762 1.00 30.05  ? 112 TYR B OH    1 
ATOM   4236 N  N     . ALA B  1  138 ? 6.909   33.072  213.441 1.00 27.78  ? 113 ALA B N     1 
ATOM   4237 C  CA    . ALA B  1  138 ? 5.702   33.692  212.917 1.00 29.87  ? 113 ALA B CA    1 
ATOM   4238 C  C     . ALA B  1  138 ? 5.429   35.060  213.544 1.00 30.62  ? 113 ALA B C     1 
ATOM   4239 O  O     . ALA B  1  138 ? 5.088   35.997  212.848 1.00 31.42  ? 113 ALA B O     1 
ATOM   4240 C  CB    . ALA B  1  138 ? 4.518   32.765  213.131 1.00 31.20  ? 113 ALA B CB    1 
ATOM   4241 N  N     . ALA B  1  139 ? 5.604   35.153  214.861 1.00 32.23  ? 114 ALA B N     1 
ATOM   4242 C  CA    . ALA B  1  139 ? 5.495   36.429  215.603 1.00 32.35  ? 114 ALA B CA    1 
ATOM   4243 C  C     . ALA B  1  139 ? 6.457   37.506  215.066 1.00 30.73  ? 114 ALA B C     1 
ATOM   4244 O  O     . ALA B  1  139 ? 6.073   38.660  214.889 1.00 27.69  ? 114 ALA B O     1 
ATOM   4245 C  CB    . ALA B  1  139 ? 5.735   36.188  217.108 1.00 30.77  ? 114 ALA B CB    1 
ATOM   4246 N  N     . VAL B  1  140 ? 7.689   37.106  214.769 1.00 30.88  ? 115 VAL B N     1 
ATOM   4247 C  CA    . VAL B  1  140 ? 8.672   38.018  214.151 1.00 30.81  ? 115 VAL B CA    1 
ATOM   4248 C  C     . VAL B  1  140 ? 8.160   38.509  212.792 1.00 34.59  ? 115 VAL B C     1 
ATOM   4249 O  O     . VAL B  1  140 ? 8.138   39.716  212.541 1.00 38.25  ? 115 VAL B O     1 
ATOM   4250 C  CB    . VAL B  1  140 ? 10.062  37.367  214.036 1.00 31.90  ? 115 VAL B CB    1 
ATOM   4251 C  CG1   . VAL B  1  140 ? 11.035  38.244  213.268 1.00 32.75  ? 115 VAL B CG1   1 
ATOM   4252 C  CG2   . VAL B  1  140 ? 10.626  37.096  215.430 1.00 31.29  ? 115 VAL B CG2   1 
ATOM   4253 N  N     . GLU B  1  141 ? 7.681   37.597  211.952 1.00 32.13  ? 116 GLU B N     1 
ATOM   4254 C  CA    . GLU B  1  141 ? 7.154   37.991  210.652 1.00 34.52  ? 116 GLU B CA    1 
ATOM   4255 C  C     . GLU B  1  141 ? 5.903   38.874  210.746 1.00 34.26  ? 116 GLU B C     1 
ATOM   4256 O  O     . GLU B  1  141 ? 5.737   39.788  209.931 1.00 33.11  ? 116 GLU B O     1 
ATOM   4257 C  CB    . GLU B  1  141 ? 6.866   36.767  209.761 1.00 33.45  ? 116 GLU B CB    1 
ATOM   4258 C  CG    . GLU B  1  141 ? 8.072   35.891  209.438 1.00 33.30  ? 116 GLU B CG    1 
ATOM   4259 C  CD    . GLU B  1  141 ? 9.281   36.651  208.905 1.00 35.95  ? 116 GLU B CD    1 
ATOM   4260 O  OE1   . GLU B  1  141 ? 9.090   37.677  208.220 1.00 37.02  ? 116 GLU B OE1   1 
ATOM   4261 O  OE2   . GLU B  1  141 ? 10.429  36.209  209.146 1.00 33.74  ? 116 GLU B OE2   1 
ATOM   4262 N  N     . MET B  1  142 ? 5.022   38.594  211.701 1.00 33.00  ? 117 MET B N     1 
ATOM   4263 C  CA    . MET B  1  142 ? 3.818   39.433  211.893 1.00 36.70  ? 117 MET B CA    1 
ATOM   4264 C  C     . MET B  1  142 ? 4.186   40.830  212.370 1.00 36.65  ? 117 MET B C     1 
ATOM   4265 O  O     . MET B  1  142 ? 3.584   41.822  211.944 1.00 39.79  ? 117 MET B O     1 
ATOM   4266 C  CB    . MET B  1  142 ? 2.861   38.807  212.901 1.00 36.88  ? 117 MET B CB    1 
ATOM   4267 C  CG    . MET B  1  142 ? 2.173   37.571  212.357 1.00 40.24  ? 117 MET B CG    1 
ATOM   4268 S  SD    . MET B  1  142 ? 1.424   36.608  213.664 1.00 44.68  ? 117 MET B SD    1 
ATOM   4269 C  CE    . MET B  1  142 ? -0.102  37.522  213.833 1.00 49.84  ? 117 MET B CE    1 
ATOM   4270 N  N     . ARG B  1  143 ? 5.163   40.891  213.272 1.00 35.64  ? 118 ARG B N     1 
ATOM   4271 C  CA    . ARG B  1  143 ? 5.679   42.144  213.780 1.00 34.73  ? 118 ARG B CA    1 
ATOM   4272 C  C     . ARG B  1  143 ? 6.116   43.037  212.637 1.00 37.15  ? 118 ARG B C     1 
ATOM   4273 O  O     . ARG B  1  143 ? 5.844   44.230  212.667 1.00 34.56  ? 118 ARG B O     1 
ATOM   4274 C  CB    . ARG B  1  143 ? 6.858   41.889  214.718 1.00 33.31  ? 118 ARG B CB    1 
ATOM   4275 C  CG    . ARG B  1  143 ? 7.538   43.141  215.236 1.00 34.00  ? 118 ARG B CG    1 
ATOM   4276 C  CD    . ARG B  1  143 ? 8.837   42.838  215.950 1.00 32.22  ? 118 ARG B CD    1 
ATOM   4277 N  NE    . ARG B  1  143 ? 9.912   42.556  215.011 1.00 32.04  ? 118 ARG B NE    1 
ATOM   4278 C  CZ    . ARG B  1  143 ? 11.189  42.382  215.340 1.00 32.60  ? 118 ARG B CZ    1 
ATOM   4279 N  NH1   . ARG B  1  143 ? 11.590  42.455  216.605 1.00 31.58  ? 118 ARG B NH1   1 
ATOM   4280 N  NH2   . ARG B  1  143 ? 12.093  42.188  214.379 1.00 30.77  ? 118 ARG B NH2   1 
ATOM   4281 N  N     . ASP B  1  144 ? 6.793   42.468  211.632 1.00 35.87  ? 119 ASP B N     1 
ATOM   4282 C  CA    . ASP B  1  144 ? 7.431   43.288  210.618 1.00 37.06  ? 119 ASP B CA    1 
ATOM   4283 C  C     . ASP B  1  144 ? 6.687   43.401  209.306 1.00 37.37  ? 119 ASP B C     1 
ATOM   4284 O  O     . ASP B  1  144 ? 7.209   43.985  208.385 1.00 38.04  ? 119 ASP B O     1 
ATOM   4285 C  CB    . ASP B  1  144 ? 8.875   42.852  210.429 1.00 38.60  ? 119 ASP B CB    1 
ATOM   4286 C  CG    . ASP B  1  144 ? 9.720   43.098  211.678 1.00 41.39  ? 119 ASP B CG    1 
ATOM   4287 O  OD1   . ASP B  1  144 ? 9.447   44.060  212.438 1.00 42.76  ? 119 ASP B OD1   1 
ATOM   4288 O  OD2   . ASP B  1  144 ? 10.666  42.320  211.900 1.00 42.27  ? 119 ASP B OD2   1 
ATOM   4289 N  N     . ASN B  1  145 ? 5.462   42.888  209.241 1.00 37.29  ? 120 ASN B N     1 
ATOM   4290 C  CA    . ASN B  1  145 ? 4.600   43.137  208.120 1.00 40.10  ? 120 ASN B CA    1 
ATOM   4291 C  C     . ASN B  1  145 ? 3.151   43.222  208.596 1.00 45.28  ? 120 ASN B C     1 
ATOM   4292 O  O     . ASN B  1  145 ? 2.508   42.193  208.769 1.00 39.66  ? 120 ASN B O     1 
ATOM   4293 C  CB    . ASN B  1  145 ? 4.762   42.073  207.029 1.00 40.65  ? 120 ASN B CB    1 
ATOM   4294 C  CG    . ASN B  1  145 ? 3.909   42.371  205.811 1.00 41.62  ? 120 ASN B CG    1 
ATOM   4295 O  OD1   . ASN B  1  145 ? 3.204   43.379  205.763 1.00 43.02  ? 120 ASN B OD1   1 
ATOM   4296 N  ND2   . ASN B  1  145 ? 3.950   41.495  204.826 1.00 42.32  ? 120 ASN B ND2   1 
ATOM   4297 N  N     . PRO B  1  146 ? 2.627   44.460  208.767 1.00 55.81  ? 121 PRO B N     1 
ATOM   4298 C  CA    . PRO B  1  146 ? 1.312   44.702  209.399 1.00 60.36  ? 121 PRO B CA    1 
ATOM   4299 C  C     . PRO B  1  146 ? 0.128   44.006  208.729 1.00 59.46  ? 121 PRO B C     1 
ATOM   4300 O  O     . PRO B  1  146 ? -0.760  43.528  209.433 1.00 64.77  ? 121 PRO B O     1 
ATOM   4301 C  CB    . PRO B  1  146 ? 1.135   46.233  209.341 1.00 62.52  ? 121 PRO B CB    1 
ATOM   4302 C  CG    . PRO B  1  146 ? 2.407   46.811  208.830 1.00 63.80  ? 121 PRO B CG    1 
ATOM   4303 C  CD    . PRO B  1  146 ? 3.306   45.711  208.360 1.00 59.36  ? 121 PRO B CD    1 
ATOM   4304 N  N     . GLU B  1  147 ? 0.170   43.851  207.431 1.00 63.59  ? 122 GLU B N     1 
ATOM   4305 C  CA    . GLU B  1  147 ? -0.869  43.114  206.752 1.00 69.35  ? 122 GLU B CA    1 
ATOM   4306 C  C     . GLU B  1  147 ? -1.088  41.733  207.327 1.00 63.05  ? 122 GLU B C     1 
ATOM   4307 O  O     . GLU B  1  147 ? -2.108  41.150  207.065 1.00 64.14  ? 122 GLU B O     1 
ATOM   4308 C  CB    . GLU B  1  147 ? -0.450  42.827  205.342 1.00 75.33  ? 122 GLU B CB    1 
ATOM   4309 C  CG    . GLU B  1  147 ? -0.775  43.905  204.375 1.00 82.70  ? 122 GLU B CG    1 
ATOM   4310 C  CD    . GLU B  1  147 ? 0.435   44.282  203.605 1.00 85.87  ? 122 GLU B CD    1 
ATOM   4311 O  OE1   . GLU B  1  147 ? 1.017   43.381  202.996 1.00 91.19  ? 122 GLU B OE1   1 
ATOM   4312 O  OE2   . GLU B  1  147 ? 0.797   45.462  203.640 1.00 87.99  ? 122 GLU B OE2   1 
ATOM   4313 N  N     . LEU B  1  148 ? -0.135  41.201  208.072 1.00 53.91  ? 123 LEU B N     1 
ATOM   4314 C  CA    . LEU B  1  148 ? -0.275  39.858  208.594 1.00 53.14  ? 123 LEU B CA    1 
ATOM   4315 C  C     . LEU B  1  148 ? -0.864  39.617  209.973 1.00 56.82  ? 123 LEU B C     1 
ATOM   4316 O  O     . LEU B  1  148 ? -1.279  38.515  210.245 1.00 49.46  ? 123 LEU B O     1 
ATOM   4317 C  CB    . LEU B  1  148 ? 1.057   39.113  208.541 1.00 48.81  ? 123 LEU B CB    1 
ATOM   4318 C  CG    . LEU B  1  148 ? 1.861   39.098  207.259 1.00 51.57  ? 123 LEU B CG    1 
ATOM   4319 C  CD1   . LEU B  1  148 ? 3.108   38.268  207.378 1.00 50.34  ? 123 LEU B CD1   1 
ATOM   4320 C  CD2   . LEU B  1  148 ? 1.032   38.724  206.060 1.00 48.96  ? 123 LEU B CD2   1 
ATOM   4321 N  N     . LYS B  1  149 ? -0.883  40.606  210.851 1.00 62.31  ? 124 LYS B N     1 
ATOM   4322 C  CA    . LYS B  1  149 ? -1.377  40.363  212.215 1.00 63.86  ? 124 LYS B CA    1 
ATOM   4323 C  C     . LYS B  1  149 ? -2.779  39.745  212.401 1.00 57.69  ? 124 LYS B C     1 
ATOM   4324 O  O     . LYS B  1  149 ? -3.011  39.097  213.393 1.00 54.15  ? 124 LYS B O     1 
ATOM   4325 C  CB    . LYS B  1  149 ? -1.116  41.551  213.134 1.00 69.87  ? 124 LYS B CB    1 
ATOM   4326 C  CG    . LYS B  1  149 ? -0.636  41.163  214.527 1.00 74.47  ? 124 LYS B CG    1 
ATOM   4327 C  CD    . LYS B  1  149 ? 0.821   41.490  214.851 1.00 73.42  ? 124 LYS B CD    1 
ATOM   4328 C  CE    . LYS B  1  149 ? 1.365   42.640  214.020 1.00 75.61  ? 124 LYS B CE    1 
ATOM   4329 N  NZ    . LYS B  1  149 ? 1.550   43.864  214.823 1.00 76.11  ? 124 LYS B NZ    1 
ATOM   4330 N  N     . ASP B  1  150 ? -3.690  39.931  211.459 1.00 51.14  ? 125 ASP B N     1 
ATOM   4331 C  CA    . ASP B  1  150 ? -5.022  39.300  211.567 1.00 57.25  ? 125 ASP B CA    1 
ATOM   4332 C  C     . ASP B  1  150 ? -5.248  38.029  210.710 1.00 53.20  ? 125 ASP B C     1 
ATOM   4333 O  O     . ASP B  1  150 ? -6.372  37.549  210.622 1.00 55.61  ? 125 ASP B O     1 
ATOM   4334 C  CB    . ASP B  1  150 ? -6.109  40.331  211.215 1.00 63.65  ? 125 ASP B CB    1 
ATOM   4335 C  CG    . ASP B  1  150 ? -6.088  41.556  212.132 1.00 71.94  ? 125 ASP B CG    1 
ATOM   4336 O  OD1   . ASP B  1  150 ? -5.703  41.421  213.316 1.00 73.47  ? 125 ASP B OD1   1 
ATOM   4337 O  OD2   . ASP B  1  150 ? -6.463  42.657  211.662 1.00 78.37  ? 125 ASP B OD2   1 
ATOM   4338 N  N     . LYS B  1  151 ? -4.208  37.483  210.083 1.00 47.49  ? 126 LYS B N     1 
ATOM   4339 C  CA    . LYS B  1  151 ? -4.379  36.347  209.159 1.00 44.67  ? 126 LYS B CA    1 
ATOM   4340 C  C     . LYS B  1  151 ? -3.744  35.093  209.725 1.00 38.34  ? 126 LYS B C     1 
ATOM   4341 O  O     . LYS B  1  151 ? -2.859  35.187  210.585 1.00 35.77  ? 126 LYS B O     1 
ATOM   4342 C  CB    . LYS B  1  151 ? -3.791  36.698  207.786 1.00 48.11  ? 126 LYS B CB    1 
ATOM   4343 C  CG    . LYS B  1  151 ? -4.583  37.817  207.131 1.00 50.02  ? 126 LYS B CG    1 
ATOM   4344 C  CD    . LYS B  1  151 ? -3.995  38.333  205.833 1.00 54.94  ? 126 LYS B CD    1 
ATOM   4345 C  CE    . LYS B  1  151 ? -4.699  39.645  205.470 1.00 59.67  ? 126 LYS B CE    1 
ATOM   4346 N  NZ    . LYS B  1  151 ? -4.739  39.927  204.017 1.00 65.65  ? 126 LYS B NZ    1 
ATOM   4347 N  N     . PRO B  1  152 ? -4.201  33.914  209.264 1.00 34.39  ? 127 PRO B N     1 
ATOM   4348 C  CA    . PRO B  1  152 ? -3.437  32.717  209.597 1.00 35.18  ? 127 PRO B CA    1 
ATOM   4349 C  C     . PRO B  1  152 ? -2.180  32.740  208.757 1.00 33.77  ? 127 PRO B C     1 
ATOM   4350 O  O     . PRO B  1  152 ? -2.269  32.948  207.548 1.00 33.89  ? 127 PRO B O     1 
ATOM   4351 C  CB    . PRO B  1  152 ? -4.330  31.568  209.139 1.00 35.15  ? 127 PRO B CB    1 
ATOM   4352 C  CG    . PRO B  1  152 ? -5.234  32.151  208.095 1.00 36.05  ? 127 PRO B CG    1 
ATOM   4353 C  CD    . PRO B  1  152 ? -5.281  33.640  208.297 1.00 36.44  ? 127 PRO B CD    1 
ATOM   4354 N  N     . ILE B  1  153 ? -1.040  32.558  209.406 1.00 31.20  ? 128 ILE B N     1 
ATOM   4355 C  CA    . ILE B  1  153 ? 0.238   32.459  208.734 1.00 33.54  ? 128 ILE B CA    1 
ATOM   4356 C  C     . ILE B  1  153 ? 1.097   31.330  209.294 1.00 33.26  ? 128 ILE B C     1 
ATOM   4357 O  O     . ILE B  1  153 ? 0.936   30.878  210.446 1.00 33.67  ? 128 ILE B O     1 
ATOM   4358 C  CB    . ILE B  1  153 ? 1.045   33.784  208.779 1.00 34.33  ? 128 ILE B CB    1 
ATOM   4359 C  CG1   . ILE B  1  153 ? 1.939   33.880  210.022 1.00 35.60  ? 128 ILE B CG1   1 
ATOM   4360 C  CG2   . ILE B  1  153 ? 0.117   34.999  208.722 1.00 36.19  ? 128 ILE B CG2   1 
ATOM   4361 C  CD1   . ILE B  1  153 ? 3.124   34.783  209.838 1.00 37.23  ? 128 ILE B CD1   1 
ATOM   4362 N  N     . ALA B  1  154 ? 2.054   30.935  208.469 1.00 30.33  ? 129 ALA B N     1 
ATOM   4363 C  CA    . ALA B  1  154 ? 3.037   29.942  208.822 1.00 29.61  ? 129 ALA B CA    1 
ATOM   4364 C  C     . ALA B  1  154 ? 4.379   30.374  208.249 1.00 30.64  ? 129 ALA B C     1 
ATOM   4365 O  O     . ALA B  1  154 ? 4.428   31.167  207.318 1.00 29.89  ? 129 ALA B O     1 
ATOM   4366 C  CB    . ALA B  1  154 ? 2.620   28.607  208.251 1.00 31.15  ? 129 ALA B CB    1 
ATOM   4367 N  N     . VAL B  1  155 ? 5.467   29.857  208.807 1.00 29.30  ? 130 VAL B N     1 
ATOM   4368 C  CA    . VAL B  1  155 ? 6.770   30.141  208.270 1.00 28.99  ? 130 VAL B CA    1 
ATOM   4369 C  C     . VAL B  1  155 ? 7.318   28.852  207.655 1.00 29.45  ? 130 VAL B C     1 
ATOM   4370 O  O     . VAL B  1  155 ? 7.262   27.779  208.272 1.00 29.77  ? 130 VAL B O     1 
ATOM   4371 C  CB    . VAL B  1  155 ? 7.706   30.678  209.363 1.00 31.22  ? 130 VAL B CB    1 
ATOM   4372 C  CG1   . VAL B  1  155 ? 9.137   30.890  208.831 1.00 28.33  ? 130 VAL B CG1   1 
ATOM   4373 C  CG2   . VAL B  1  155 ? 7.132   31.986  209.941 1.00 31.91  ? 130 VAL B CG2   1 
ATOM   4374 N  N     . GLY B  1  156 ? 7.903   28.973  206.471 1.00 27.90  ? 131 GLY B N     1 
ATOM   4375 C  CA    . GLY B  1  156 ? 8.590   27.833  205.828 1.00 29.27  ? 131 GLY B CA    1 
ATOM   4376 C  C     . GLY B  1  156 ? 8.327   27.889  204.350 1.00 30.51  ? 131 GLY B C     1 
ATOM   4377 O  O     . GLY B  1  156 ? 8.452   28.955  203.758 1.00 30.98  ? 131 GLY B O     1 
ATOM   4378 N  N     . SER B  1  157 ? 7.922   26.762  203.777 1.00 32.34  ? 132 SER B N     1 
ATOM   4379 C  CA    . SER B  1  157 ? 7.687   26.634  202.339 1.00 32.12  ? 132 SER B CA    1 
ATOM   4380 C  C     . SER B  1  157 ? 6.561   25.639  202.115 1.00 32.45  ? 132 SER B C     1 
ATOM   4381 O  O     . SER B  1  157 ? 6.080   24.995  203.071 1.00 30.69  ? 132 SER B O     1 
ATOM   4382 C  CB    . SER B  1  157 ? 8.943   26.079  201.667 1.00 30.91  ? 132 SER B CB    1 
ATOM   4383 O  OG    . SER B  1  157 ? 9.165   24.744  202.127 1.00 33.13  ? 132 SER B OG    1 
ATOM   4384 N  N     . MET B  1  158 ? 6.203   25.455  200.843 1.00 33.09  ? 133 MET B N     1 
ATOM   4385 C  CA    . MET B  1  158 ? 5.249   24.421  200.454 1.00 32.71  ? 133 MET B CA    1 
ATOM   4386 C  C     . MET B  1  158 ? 5.711   23.013  200.786 1.00 33.83  ? 133 MET B C     1 
ATOM   4387 O  O     . MET B  1  158 ? 4.868   22.131  200.935 1.00 33.86  ? 133 MET B O     1 
ATOM   4388 C  CB    . MET B  1  158 ? 4.825   24.552  198.986 1.00 32.74  ? 133 MET B CB    1 
ATOM   4389 C  CG    . MET B  1  158 ? 4.002   25.799  198.726 1.00 33.61  ? 133 MET B CG    1 
ATOM   4390 S  SD    . MET B  1  158 ? 2.317   25.720  199.410 1.00 39.51  ? 133 MET B SD    1 
ATOM   4391 C  CE    . MET B  1  158 ? 1.464   24.830  198.111 1.00 37.80  ? 133 MET B CE    1 
ATOM   4392 N  N     . SER B  1  159 ? 7.015   22.804  200.968 1.00 30.90  ? 134 SER B N     1 
ATOM   4393 C  CA    . SER B  1  159 ? 7.543   21.518  201.411 1.00 35.16  ? 134 SER B CA    1 
ATOM   4394 C  C     . SER B  1  159 ? 7.541   21.282  202.901 1.00 33.52  ? 134 SER B C     1 
ATOM   4395 O  O     . SER B  1  159 ? 7.507   20.130  203.331 1.00 35.14  ? 134 SER B O     1 
ATOM   4396 C  CB    . SER B  1  159 ? 9.010   21.376  200.968 1.00 39.02  ? 134 SER B CB    1 
ATOM   4397 O  OG    . SER B  1  159 ? 9.083   21.664  199.597 1.00 48.77  ? 134 SER B OG    1 
ATOM   4398 N  N     . MET B  1  160 ? 7.645   22.346  203.693 1.00 29.33  ? 135 MET B N     1 
ATOM   4399 C  CA    . MET B  1  160 ? 7.834   22.195  205.144 1.00 30.70  ? 135 MET B CA    1 
ATOM   4400 C  C     . MET B  1  160 ? 7.648   23.516  205.877 1.00 27.92  ? 135 MET B C     1 
ATOM   4401 O  O     . MET B  1  160 ? 8.218   24.535  205.480 1.00 28.68  ? 135 MET B O     1 
ATOM   4402 C  CB    . MET B  1  160 ? 9.231   21.635  205.490 1.00 31.58  ? 135 MET B CB    1 
ATOM   4403 C  CG    . MET B  1  160 ? 9.426   21.259  206.963 1.00 31.68  ? 135 MET B CG    1 
ATOM   4404 S  SD    . MET B  1  160 ? 8.202   20.110  207.636 1.00 33.22  ? 135 MET B SD    1 
ATOM   4405 C  CE    . MET B  1  160 ? 8.232   18.801  206.391 1.00 31.70  ? 135 MET B CE    1 
ATOM   4406 N  N     . LEU B  1  161 ? 6.843   23.467  206.925 1.00 27.07  ? 136 LEU B N     1 
ATOM   4407 C  CA    . LEU B  1  161 ? 6.656   24.563  207.860 1.00 26.98  ? 136 LEU B CA    1 
ATOM   4408 C  C     . LEU B  1  161 ? 7.455   24.307  209.136 1.00 26.58  ? 136 LEU B C     1 
ATOM   4409 O  O     . LEU B  1  161 ? 7.489   23.181  209.663 1.00 28.24  ? 136 LEU B O     1 
ATOM   4410 C  CB    . LEU B  1  161 ? 5.184   24.687  208.224 1.00 26.82  ? 136 LEU B CB    1 
ATOM   4411 C  CG    . LEU B  1  161 ? 4.225   24.872  207.059 1.00 29.28  ? 136 LEU B CG    1 
ATOM   4412 C  CD1   . LEU B  1  161 ? 2.796   24.910  207.599 1.00 29.40  ? 136 LEU B CD1   1 
ATOM   4413 C  CD2   . LEU B  1  161 ? 4.572   26.126  206.274 1.00 29.99  ? 136 LEU B CD2   1 
ATOM   4414 N  N     . SER B  1  162 ? 8.081   25.366  209.626 1.00 26.80  ? 137 SER B N     1 
ATOM   4415 C  CA    . SER B  1  162 ? 8.800   25.363  210.884 1.00 28.07  ? 137 SER B CA    1 
ATOM   4416 C  C     . SER B  1  162 ? 7.924   25.748  212.070 1.00 28.01  ? 137 SER B C     1 
ATOM   4417 O  O     . SER B  1  162 ? 8.196   25.313  213.176 1.00 28.41  ? 137 SER B O     1 
ATOM   4418 C  CB    . SER B  1  162 ? 9.994   26.302  210.802 1.00 28.85  ? 137 SER B CB    1 
ATOM   4419 O  OG    . SER B  1  162 ? 9.621   27.602  210.374 1.00 31.62  ? 137 SER B OG    1 
ATOM   4420 N  N     . THR B  1  163 ? 6.945   26.610  211.839 1.00 29.95  ? 138 THR B N     1 
ATOM   4421 C  CA    . THR B  1  163 ? 5.888   26.901  212.813 1.00 28.89  ? 138 THR B CA    1 
ATOM   4422 C  C     . THR B  1  163 ? 4.705   27.600  212.152 1.00 30.36  ? 138 THR B C     1 
ATOM   4423 O  O     . THR B  1  163 ? 4.720   27.897  210.941 1.00 31.91  ? 138 THR B O     1 
ATOM   4424 C  CB    . THR B  1  163 ? 6.401   27.793  213.946 1.00 31.14  ? 138 THR B CB    1 
ATOM   4425 O  OG1   . THR B  1  163 ? 5.450   27.803  215.022 1.00 33.24  ? 138 THR B OG1   1 
ATOM   4426 C  CG2   . THR B  1  163 ? 6.658   29.219  213.459 1.00 30.41  ? 138 THR B CG2   1 
ATOM   4427 N  N     . SER B  1  164 ? 3.706   27.910  212.975 1.00 29.63  ? 139 SER B N     1 
ATOM   4428 C  CA    . SER B  1  164 ? 2.515   28.636  212.547 1.00 30.85  ? 139 SER B CA    1 
ATOM   4429 C  C     . SER B  1  164 ? 2.035   29.523  213.686 1.00 31.02  ? 139 SER B C     1 
ATOM   4430 O  O     . SER B  1  164 ? 2.357   29.279  214.841 1.00 31.68  ? 139 SER B O     1 
ATOM   4431 C  CB    . SER B  1  164 ? 1.410   27.649  212.177 1.00 32.83  ? 139 SER B CB    1 
ATOM   4432 O  OG    . SER B  1  164 ? 0.940   26.979  213.335 1.00 33.25  ? 139 SER B OG    1 
ATOM   4433 N  N     . ASN B  1  165 ? 1.255   30.534  213.360 1.00 29.93  ? 140 ASN B N     1 
ATOM   4434 C  CA    . ASN B  1  165 ? 0.710   31.418  214.373 1.00 32.67  ? 140 ASN B CA    1 
ATOM   4435 C  C     . ASN B  1  165 ? -0.577  30.813  214.934 1.00 32.93  ? 140 ASN B C     1 
ATOM   4436 O  O     . ASN B  1  165 ? -1.075  29.825  214.387 1.00 32.66  ? 140 ASN B O     1 
ATOM   4437 C  CB    . ASN B  1  165 ? 0.524   32.854  213.845 1.00 30.98  ? 140 ASN B CB    1 
ATOM   4438 C  CG    . ASN B  1  165 ? -0.680  33.027  212.902 1.00 32.21  ? 140 ASN B CG    1 
ATOM   4439 O  OD1   . ASN B  1  165 ? -1.344  32.087  212.487 1.00 33.22  ? 140 ASN B OD1   1 
ATOM   4440 N  ND2   . ASN B  1  165 ? -0.896  34.251  212.500 1.00 32.35  ? 140 ASN B ND2   1 
ATOM   4441 N  N     . TYR B  1  166 ? -1.106  31.403  216.010 1.00 34.45  ? 141 TYR B N     1 
ATOM   4442 C  CA    . TYR B  1  166 ? -2.225  30.779  216.745 1.00 32.92  ? 141 TYR B CA    1 
ATOM   4443 C  C     . TYR B  1  166 ? -3.501  30.794  215.892 1.00 36.50  ? 141 TYR B C     1 
ATOM   4444 O  O     . TYR B  1  166 ? -4.268  29.826  215.938 1.00 40.57  ? 141 TYR B O     1 
ATOM   4445 C  CB    . TYR B  1  166 ? -2.392  31.366  218.165 1.00 33.46  ? 141 TYR B CB    1 
ATOM   4446 C  CG    . TYR B  1  166 ? -1.336  30.830  219.113 1.00 33.24  ? 141 TYR B CG    1 
ATOM   4447 C  CD1   . TYR B  1  166 ? -1.629  29.777  219.967 1.00 32.89  ? 141 TYR B CD1   1 
ATOM   4448 C  CD2   . TYR B  1  166 ? -0.023  31.346  219.123 1.00 32.58  ? 141 TYR B CD2   1 
ATOM   4449 C  CE1   . TYR B  1  166 ? -0.666  29.244  220.828 1.00 34.19  ? 141 TYR B CE1   1 
ATOM   4450 C  CE2   . TYR B  1  166 ? 0.952   30.817  219.977 1.00 32.60  ? 141 TYR B CE2   1 
ATOM   4451 C  CZ    . TYR B  1  166 ? 0.619   29.765  220.836 1.00 32.93  ? 141 TYR B CZ    1 
ATOM   4452 O  OH    . TYR B  1  166 ? 1.544   29.201  221.683 1.00 32.94  ? 141 TYR B OH    1 
ATOM   4453 N  N     . HIS B  1  167 ? -3.695  31.807  215.042 1.00 35.46  ? 142 HIS B N     1 
ATOM   4454 C  CA    . HIS B  1  167 ? -4.849  31.765  214.120 1.00 39.97  ? 142 HIS B CA    1 
ATOM   4455 C  C     . HIS B  1  167 ? -4.794  30.524  213.224 1.00 38.63  ? 142 HIS B C     1 
ATOM   4456 O  O     . HIS B  1  167 ? -5.802  29.842  213.017 1.00 37.26  ? 142 HIS B O     1 
ATOM   4457 C  CB    . HIS B  1  167 ? -4.917  32.991  213.202 1.00 45.08  ? 142 HIS B CB    1 
ATOM   4458 C  CG    . HIS B  1  167 ? -5.253  34.284  213.887 1.00 57.47  ? 142 HIS B CG    1 
ATOM   4459 N  ND1   . HIS B  1  167 ? -6.033  34.368  215.025 1.00 63.97  ? 142 HIS B ND1   1 
ATOM   4460 C  CD2   . HIS B  1  167 ? -4.939  35.562  213.554 1.00 62.62  ? 142 HIS B CD2   1 
ATOM   4461 C  CE1   . HIS B  1  167 ? -6.170  35.637  215.370 1.00 63.26  ? 142 HIS B CE1   1 
ATOM   4462 N  NE2   . HIS B  1  167 ? -5.520  36.381  214.493 1.00 62.83  ? 142 HIS B NE2   1 
ATOM   4463 N  N     . ALA B  1  168 ? -3.608  30.236  212.681 1.00 37.83  ? 143 ALA B N     1 
ATOM   4464 C  CA    . ALA B  1  168 ? -3.439  29.086  211.766 1.00 36.24  ? 143 ALA B CA    1 
ATOM   4465 C  C     . ALA B  1  168 ? -3.608  27.746  212.494 1.00 35.44  ? 143 ALA B C     1 
ATOM   4466 O  O     . ALA B  1  168 ? -4.154  26.798  211.944 1.00 32.46  ? 143 ALA B O     1 
ATOM   4467 C  CB    . ALA B  1  168 ? -2.086  29.159  211.067 1.00 36.27  ? 143 ALA B CB    1 
ATOM   4468 N  N     . ARG B  1  169 ? -3.146  27.689  213.742 1.00 35.88  ? 144 ARG B N     1 
ATOM   4469 C  CA    . ARG B  1  169 ? -3.293  26.498  214.543 1.00 38.01  ? 144 ARG B CA    1 
ATOM   4470 C  C     . ARG B  1  169 ? -4.740  26.073  214.727 1.00 38.69  ? 144 ARG B C     1 
ATOM   4471 O  O     . ARG B  1  169 ? -4.979  24.904  214.937 1.00 37.14  ? 144 ARG B O     1 
ATOM   4472 C  CB    . ARG B  1  169 ? -2.628  26.665  215.902 1.00 37.73  ? 144 ARG B CB    1 
ATOM   4473 C  CG    . ARG B  1  169 ? -1.132  26.644  215.788 1.00 36.39  ? 144 ARG B CG    1 
ATOM   4474 C  CD    . ARG B  1  169 ? -0.450  26.986  217.096 1.00 36.57  ? 144 ARG B CD    1 
ATOM   4475 N  NE    . ARG B  1  169 ? 0.905   27.490  216.875 1.00 33.55  ? 144 ARG B NE    1 
ATOM   4476 C  CZ    . ARG B  1  169 ? 1.892   27.464  217.766 1.00 34.87  ? 144 ARG B CZ    1 
ATOM   4477 N  NH1   . ARG B  1  169 ? 1.733   26.948  218.981 1.00 34.46  ? 144 ARG B NH1   1 
ATOM   4478 N  NH2   . ARG B  1  169 ? 3.077   27.978  217.433 1.00 35.11  ? 144 ARG B NH2   1 
ATOM   4479 N  N     . ARG B  1  170 ? -5.692  26.994  214.635 1.00 42.37  ? 145 ARG B N     1 
ATOM   4480 C  CA    . ARG B  1  170 ? -7.119  26.617  214.697 1.00 44.73  ? 145 ARG B CA    1 
ATOM   4481 C  C     . ARG B  1  170 ? -7.580  25.786  213.491 1.00 44.37  ? 145 ARG B C     1 
ATOM   4482 O  O     . ARG B  1  170 ? -8.622  25.148  213.549 1.00 43.57  ? 145 ARG B O     1 
ATOM   4483 C  CB    . ARG B  1  170 ? -8.042  27.845  214.876 1.00 47.28  ? 145 ARG B CB    1 
ATOM   4484 C  CG    . ARG B  1  170 ? -7.774  28.753  216.087 1.00 51.68  ? 145 ARG B CG    1 
ATOM   4485 C  CD    . ARG B  1  170 ? -7.607  28.013  217.413 1.00 56.69  ? 145 ARG B CD    1 
ATOM   4486 N  NE    . ARG B  1  170 ? -8.756  27.155  217.747 1.00 61.62  ? 145 ARG B NE    1 
ATOM   4487 C  CZ    . ARG B  1  170 ? -8.764  26.177  218.664 1.00 63.43  ? 145 ARG B CZ    1 
ATOM   4488 N  NH1   . ARG B  1  170 ? -7.681  25.877  219.384 1.00 63.93  ? 145 ARG B NH1   1 
ATOM   4489 N  NH2   . ARG B  1  170 ? -9.878  25.478  218.861 1.00 64.99  ? 145 ARG B NH2   1 
ATOM   4490 N  N     . PHE B  1  171 ? -6.814  25.792  212.402 1.00 43.41  ? 146 PHE B N     1 
ATOM   4491 C  CA    . PHE B  1  171 ? -7.090  24.934  211.235 1.00 42.00  ? 146 PHE B CA    1 
ATOM   4492 C  C     . PHE B  1  171 ? -6.265  23.638  211.248 1.00 39.52  ? 146 PHE B C     1 
ATOM   4493 O  O     . PHE B  1  171 ? -6.290  22.875  210.300 1.00 39.58  ? 146 PHE B O     1 
ATOM   4494 C  CB    . PHE B  1  171 ? -6.790  25.687  209.943 1.00 43.18  ? 146 PHE B CB    1 
ATOM   4495 C  CG    . PHE B  1  171 ? -7.643  26.914  209.715 1.00 44.01  ? 146 PHE B CG    1 
ATOM   4496 C  CD1   . PHE B  1  171 ? -8.711  26.879  208.823 1.00 44.45  ? 146 PHE B CD1   1 
ATOM   4497 C  CD2   . PHE B  1  171 ? -7.339  28.122  210.334 1.00 42.81  ? 146 PHE B CD2   1 
ATOM   4498 C  CE1   . PHE B  1  171 ? -9.474  28.025  208.580 1.00 45.51  ? 146 PHE B CE1   1 
ATOM   4499 C  CE2   . PHE B  1  171 ? -8.101  29.262  210.101 1.00 44.79  ? 146 PHE B CE2   1 
ATOM   4500 C  CZ    . PHE B  1  171 ? -9.168  29.218  209.222 1.00 43.23  ? 146 PHE B CZ    1 
ATOM   4501 N  N     . GLY B  1  172 ? -5.561  23.367  212.336 1.00 39.69  ? 147 GLY B N     1 
ATOM   4502 C  CA    . GLY B  1  172 ? -4.638  22.246  212.404 1.00 39.05  ? 147 GLY B CA    1 
ATOM   4503 C  C     . GLY B  1  172 ? -3.271  22.483  211.764 1.00 38.53  ? 147 GLY B C     1 
ATOM   4504 O  O     . GLY B  1  172 ? -2.466  21.551  211.720 1.00 39.31  ? 147 GLY B O     1 
ATOM   4505 N  N     . VAL B  1  173 ? -2.970  23.695  211.322 1.00 39.42  ? 148 VAL B N     1 
ATOM   4506 C  CA    . VAL B  1  173 ? -1.664  24.039  210.728 1.00 37.57  ? 148 VAL B CA    1 
ATOM   4507 C  C     . VAL B  1  173 ? -0.557  24.198  211.784 1.00 36.41  ? 148 VAL B C     1 
ATOM   4508 O  O     . VAL B  1  173 ? -0.710  24.926  212.726 1.00 35.38  ? 148 VAL B O     1 
ATOM   4509 C  CB    . VAL B  1  173 ? -1.756  25.319  209.904 1.00 38.54  ? 148 VAL B CB    1 
ATOM   4510 C  CG1   . VAL B  1  173 ? -0.410  25.738  209.385 1.00 38.54  ? 148 VAL B CG1   1 
ATOM   4511 C  CG2   . VAL B  1  173 ? -2.771  25.202  208.813 1.00 39.17  ? 148 VAL B CG2   1 
ATOM   4512 N  N     . ARG B  1  174 ? 0.565   23.524  211.604 1.00 35.67  ? 149 ARG B N     1 
ATOM   4513 C  CA    . ARG B  1  174 ? 1.635   23.552  212.604 1.00 40.98  ? 149 ARG B CA    1 
ATOM   4514 C  C     . ARG B  1  174 ? 3.005   23.115  212.064 1.00 38.51  ? 149 ARG B C     1 
ATOM   4515 O  O     . ARG B  1  174 ? 3.097   22.586  210.967 1.00 36.69  ? 149 ARG B O     1 
ATOM   4516 C  CB    . ARG B  1  174 ? 1.256   22.667  213.797 1.00 47.08  ? 149 ARG B CB    1 
ATOM   4517 C  CG    . ARG B  1  174 ? 1.015   21.195  213.462 1.00 50.71  ? 149 ARG B CG    1 
ATOM   4518 C  CD    . ARG B  1  174 ? 1.494   20.300  214.607 1.00 59.69  ? 149 ARG B CD    1 
ATOM   4519 N  NE    . ARG B  1  174 ? 2.964   20.170  214.627 1.00 62.54  ? 149 ARG B NE    1 
ATOM   4520 C  CZ    . ARG B  1  174 ? 3.710   19.735  215.652 1.00 64.99  ? 149 ARG B CZ    1 
ATOM   4521 N  NH1   . ARG B  1  174 ? 3.159   19.363  216.815 1.00 66.54  ? 149 ARG B NH1   1 
ATOM   4522 N  NH2   . ARG B  1  174 ? 5.038   19.667  215.505 1.00 58.92  ? 149 ARG B NH2   1 
ATOM   4523 N  N     . ALA B  1  175 ? 4.040   23.331  212.880 1.00 36.56  ? 150 ALA B N     1 
ATOM   4524 C  CA    . ALA B  1  175 ? 5.407   22.861  212.651 1.00 35.05  ? 150 ALA B CA    1 
ATOM   4525 C  C     . ALA B  1  175 ? 5.449   21.417  212.168 1.00 33.87  ? 150 ALA B C     1 
ATOM   4526 O  O     . ALA B  1  175 ? 4.636   20.604  212.593 1.00 33.05  ? 150 ALA B O     1 
ATOM   4527 C  CB    . ALA B  1  175 ? 6.205   22.984  213.939 1.00 35.13  ? 150 ALA B CB    1 
ATOM   4528 N  N     . ALA B  1  176 ? 6.377   21.109  211.260 1.00 31.77  ? 151 ALA B N     1 
ATOM   4529 C  CA    . ALA B  1  176 ? 6.632   19.726  210.780 1.00 31.28  ? 151 ALA B CA    1 
ATOM   4530 C  C     . ALA B  1  176 ? 5.636   19.242  209.710 1.00 33.05  ? 151 ALA B C     1 
ATOM   4531 O  O     . ALA B  1  176 ? 5.825   18.173  209.159 1.00 35.68  ? 151 ALA B O     1 
ATOM   4532 C  CB    . ALA B  1  176 ? 6.750   18.710  211.929 1.00 29.79  ? 151 ALA B CB    1 
ATOM   4533 N  N     . MET B  1  177 ? 4.638   20.063  209.377 1.00 33.43  ? 152 MET B N     1 
ATOM   4534 C  CA    . MET B  1  177 ? 3.667   19.765  208.326 1.00 34.93  ? 152 MET B CA    1 
ATOM   4535 C  C     . MET B  1  177 ? 4.112   20.477  207.059 1.00 33.51  ? 152 MET B C     1 
ATOM   4536 O  O     . MET B  1  177 ? 4.510   21.633  207.118 1.00 34.38  ? 152 MET B O     1 
ATOM   4537 C  CB    . MET B  1  177 ? 2.278   20.253  208.744 1.00 35.57  ? 152 MET B CB    1 
ATOM   4538 C  CG    . MET B  1  177 ? 1.177   20.186  207.694 1.00 38.16  ? 152 MET B CG    1 
ATOM   4539 S  SD    . MET B  1  177 ? -0.310  21.039  208.291 1.00 40.88  ? 152 MET B SD    1 
ATOM   4540 C  CE    . MET B  1  177 ? -0.844  19.876  209.555 1.00 41.72  ? 152 MET B CE    1 
ATOM   4541 N  N     . PRO B  1  178 ? 4.033   19.803  205.898 1.00 33.42  ? 153 PRO B N     1 
ATOM   4542 C  CA    . PRO B  1  178 ? 4.315   20.490  204.647 1.00 33.95  ? 153 PRO B CA    1 
ATOM   4543 C  C     . PRO B  1  178 ? 3.314   21.606  204.389 1.00 34.29  ? 153 PRO B C     1 
ATOM   4544 O  O     . PRO B  1  178 ? 2.138   21.434  204.659 1.00 34.27  ? 153 PRO B O     1 
ATOM   4545 C  CB    . PRO B  1  178 ? 4.161   19.398  203.593 1.00 36.59  ? 153 PRO B CB    1 
ATOM   4546 C  CG    . PRO B  1  178 ? 4.181   18.112  204.333 1.00 35.53  ? 153 PRO B CG    1 
ATOM   4547 C  CD    . PRO B  1  178 ? 3.702   18.384  205.699 1.00 34.51  ? 153 PRO B CD    1 
ATOM   4548 N  N     . GLY B  1  179 ? 3.782   22.734  203.858 1.00 34.91  ? 154 GLY B N     1 
ATOM   4549 C  CA    . GLY B  1  179 ? 2.909   23.837  203.452 1.00 32.77  ? 154 GLY B CA    1 
ATOM   4550 C  C     . GLY B  1  179 ? 1.802   23.434  202.467 1.00 36.22  ? 154 GLY B C     1 
ATOM   4551 O  O     . GLY B  1  179 ? 0.668   23.945  202.545 1.00 31.19  ? 154 GLY B O     1 
ATOM   4552 N  N     . PHE B  1  180 ? 2.104   22.499  201.566 1.00 34.75  ? 155 PHE B N     1 
ATOM   4553 C  CA    . PHE B  1  180 ? 1.099   22.062  200.601 1.00 35.41  ? 155 PHE B CA    1 
ATOM   4554 C  C     . PHE B  1  180 ? -0.086  21.395  201.300 1.00 36.15  ? 155 PHE B C     1 
ATOM   4555 O  O     . PHE B  1  180 ? -1.229  21.601  200.909 1.00 43.46  ? 155 PHE B O     1 
ATOM   4556 C  CB    . PHE B  1  180 ? 1.704   21.240  199.436 1.00 35.82  ? 155 PHE B CB    1 
ATOM   4557 C  CG    . PHE B  1  180 ? 1.897   19.775  199.712 1.00 33.42  ? 155 PHE B CG    1 
ATOM   4558 C  CD1   . PHE B  1  180 ? 0.884   18.859  199.416 1.00 36.85  ? 155 PHE B CD1   1 
ATOM   4559 C  CD2   . PHE B  1  180 ? 3.109   19.292  200.206 1.00 35.23  ? 155 PHE B CD2   1 
ATOM   4560 C  CE1   . PHE B  1  180 ? 1.065   17.503  199.635 1.00 34.77  ? 155 PHE B CE1   1 
ATOM   4561 C  CE2   . PHE B  1  180 ? 3.311   17.936  200.411 1.00 36.26  ? 155 PHE B CE2   1 
ATOM   4562 C  CZ    . PHE B  1  180 ? 2.286   17.040  200.135 1.00 37.03  ? 155 PHE B CZ    1 
ATOM   4563 N  N     . ILE B  1  181 ? 0.170   20.685  202.385 1.00 37.13  ? 156 ILE B N     1 
ATOM   4564 C  CA    . ILE B  1  181 ? -0.914  20.111  203.178 1.00 37.86  ? 156 ILE B CA    1 
ATOM   4565 C  C     . ILE B  1  181 ? -1.621  21.196  204.009 1.00 40.10  ? 156 ILE B C     1 
ATOM   4566 O  O     . ILE B  1  181 ? -2.875  21.237  204.040 1.00 40.99  ? 156 ILE B O     1 
ATOM   4567 C  CB    . ILE B  1  181 ? -0.409  18.911  203.996 1.00 39.85  ? 156 ILE B CB    1 
ATOM   4568 C  CG1   . ILE B  1  181 ? 0.041   17.829  203.015 1.00 41.42  ? 156 ILE B CG1   1 
ATOM   4569 C  CG2   . ILE B  1  181 ? -1.480  18.353  204.921 1.00 38.15  ? 156 ILE B CG2   1 
ATOM   4570 C  CD1   . ILE B  1  181 ? 0.793   16.697  203.644 1.00 43.71  ? 156 ILE B CD1   1 
ATOM   4571 N  N     . ALA B  1  182 ? -0.846  22.101  204.625 1.00 36.07  ? 157 ALA B N     1 
ATOM   4572 C  CA    . ALA B  1  182 ? -1.419  23.196  205.433 1.00 35.05  ? 157 ALA B CA    1 
ATOM   4573 C  C     . ALA B  1  182 ? -2.411  24.049  204.627 1.00 36.42  ? 157 ALA B C     1 
ATOM   4574 O  O     . ALA B  1  182 ? -3.493  24.417  205.122 1.00 34.59  ? 157 ALA B O     1 
ATOM   4575 C  CB    . ALA B  1  182 ? -0.306  24.076  205.995 1.00 35.18  ? 157 ALA B CB    1 
ATOM   4576 N  N     . LYS B  1  183 ? -2.032  24.354  203.390 1.00 38.34  ? 158 LYS B N     1 
ATOM   4577 C  CA    . LYS B  1  183 ? -2.894  25.085  202.451 1.00 41.13  ? 158 LYS B CA    1 
ATOM   4578 C  C     . LYS B  1  183 ? -4.226  24.385  202.110 1.00 42.76  ? 158 LYS B C     1 
ATOM   4579 O  O     . LYS B  1  183 ? -5.186  25.074  201.780 1.00 43.28  ? 158 LYS B O     1 
ATOM   4580 C  CB    . LYS B  1  183 ? -2.138  25.386  201.158 1.00 43.48  ? 158 LYS B CB    1 
ATOM   4581 C  CG    . LYS B  1  183 ? -1.016  26.420  201.269 1.00 46.90  ? 158 LYS B CG    1 
ATOM   4582 C  CD    . LYS B  1  183 ? -1.527  27.857  201.242 1.00 50.13  ? 158 LYS B CD    1 
ATOM   4583 C  CE    . LYS B  1  183 ? -0.978  28.708  200.104 1.00 54.39  ? 158 LYS B CE    1 
ATOM   4584 N  NZ    . LYS B  1  183 ? 0.086   29.686  200.473 1.00 53.00  ? 158 LYS B NZ    1 
ATOM   4585 N  N     . ARG B  1  184 ? -4.271  23.043  202.165 1.00 47.15  ? 159 ARG B N     1 
ATOM   4586 C  CA    . ARG B  1  184 ? -5.537  22.277  202.030 1.00 45.39  ? 159 ARG B CA    1 
ATOM   4587 C  C     . ARG B  1  184 ? -6.433  22.444  203.250 1.00 47.56  ? 159 ARG B C     1 
ATOM   4588 O  O     . ARG B  1  184 ? -7.643  22.471  203.120 1.00 49.35  ? 159 ARG B O     1 
ATOM   4589 C  CB    . ARG B  1  184 ? -5.301  20.783  201.799 1.00 46.32  ? 159 ARG B CB    1 
ATOM   4590 C  CG    . ARG B  1  184 ? -4.981  20.414  200.358 1.00 54.83  ? 159 ARG B CG    1 
ATOM   4591 C  CD    . ARG B  1  184 ? -4.189  19.118  200.313 1.00 63.56  ? 159 ARG B CD    1 
ATOM   4592 N  NE    . ARG B  1  184 ? -3.730  18.737  198.969 1.00 70.50  ? 159 ARG B NE    1 
ATOM   4593 C  CZ    . ARG B  1  184 ? -4.287  17.816  198.176 1.00 73.99  ? 159 ARG B CZ    1 
ATOM   4594 N  NH1   . ARG B  1  184 ? -3.736  17.585  196.987 1.00 82.55  ? 159 ARG B NH1   1 
ATOM   4595 N  NH2   . ARG B  1  184 ? -5.378  17.126  198.529 1.00 71.39  ? 159 ARG B NH2   1 
ATOM   4596 N  N     . LEU B  1  185 ? -5.828  22.515  204.435 1.00 46.77  ? 160 LEU B N     1 
ATOM   4597 C  CA    . LEU B  1  185 ? -6.551  22.746  205.677 1.00 40.79  ? 160 LEU B CA    1 
ATOM   4598 C  C     . LEU B  1  185 ? -6.982  24.179  205.808 1.00 41.62  ? 160 LEU B C     1 
ATOM   4599 O  O     . LEU B  1  185 ? -7.976  24.452  206.467 1.00 41.09  ? 160 LEU B O     1 
ATOM   4600 C  CB    . LEU B  1  185 ? -5.685  22.389  206.885 1.00 42.06  ? 160 LEU B CB    1 
ATOM   4601 C  CG    . LEU B  1  185 ? -5.210  20.943  207.005 1.00 43.50  ? 160 LEU B CG    1 
ATOM   4602 C  CD1   . LEU B  1  185 ? -4.112  20.817  208.045 1.00 43.69  ? 160 LEU B CD1   1 
ATOM   4603 C  CD2   . LEU B  1  185 ? -6.376  20.015  207.349 1.00 46.56  ? 160 LEU B CD2   1 
ATOM   4604 N  N     . CYS B  1  186 ? -6.233  25.092  205.192 1.00 43.12  ? 161 CYS B N     1 
ATOM   4605 C  CA    . CYS B  1  186 ? -6.433  26.525  205.349 1.00 40.92  ? 161 CYS B CA    1 
ATOM   4606 C  C     . CYS B  1  186 ? -6.037  27.244  204.045 1.00 44.35  ? 161 CYS B C     1 
ATOM   4607 O  O     . CYS B  1  186 ? -4.916  27.769  203.933 1.00 43.16  ? 161 CYS B O     1 
ATOM   4608 C  CB    . CYS B  1  186 ? -5.595  26.999  206.535 1.00 43.81  ? 161 CYS B CB    1 
ATOM   4609 S  SG    . CYS B  1  186 ? -5.644  28.755  206.909 1.00 44.17  ? 161 CYS B SG    1 
ATOM   4610 N  N     . PRO B  1  187 ? -6.945  27.251  203.038 1.00 45.34  ? 162 PRO B N     1 
ATOM   4611 C  CA    . PRO B  1  187 ? -6.762  27.914  201.737 1.00 45.48  ? 162 PRO B CA    1 
ATOM   4612 C  C     . PRO B  1  187 ? -6.186  29.310  201.779 1.00 41.40  ? 162 PRO B C     1 
ATOM   4613 O  O     . PRO B  1  187 ? -5.385  29.637  200.944 1.00 42.95  ? 162 PRO B O     1 
ATOM   4614 C  CB    . PRO B  1  187 ? -8.188  27.954  201.183 1.00 45.21  ? 162 PRO B CB    1 
ATOM   4615 C  CG    . PRO B  1  187 ? -8.737  26.658  201.628 1.00 45.41  ? 162 PRO B CG    1 
ATOM   4616 C  CD    . PRO B  1  187 ? -8.188  26.455  203.028 1.00 47.48  ? 162 PRO B CD    1 
ATOM   4617 N  N     . GLN B  1  188 ? -6.574  30.090  202.784 1.00 44.72  ? 163 GLN B N     1 
ATOM   4618 C  CA    . GLN B  1  188 ? -6.167  31.483  202.982 1.00 43.68  ? 163 GLN B CA    1 
ATOM   4619 C  C     . GLN B  1  188 ? -4.803  31.620  203.691 1.00 39.65  ? 163 GLN B C     1 
ATOM   4620 O  O     . GLN B  1  188 ? -4.347  32.746  203.941 1.00 34.25  ? 163 GLN B O     1 
ATOM   4621 C  CB    . GLN B  1  188 ? -7.191  32.245  203.875 1.00 52.21  ? 163 GLN B CB    1 
ATOM   4622 C  CG    . GLN B  1  188 ? -8.647  31.741  203.906 1.00 60.09  ? 163 GLN B CG    1 
ATOM   4623 C  CD    . GLN B  1  188 ? -8.983  30.836  205.105 1.00 58.96  ? 163 GLN B CD    1 
ATOM   4624 O  OE1   . GLN B  1  188 ? -9.106  31.303  206.246 1.00 63.61  ? 163 GLN B OE1   1 
ATOM   4625 N  NE2   . GLN B  1  188 ? -9.175  29.556  204.841 1.00 55.73  ? 163 GLN B NE2   1 
ATOM   4626 N  N     . LEU B  1  189 ? -4.199  30.506  204.102 1.00 36.14  ? 164 LEU B N     1 
ATOM   4627 C  CA    . LEU B  1  189 ? -2.924  30.545  204.843 1.00 36.66  ? 164 LEU B CA    1 
ATOM   4628 C  C     . LEU B  1  189 ? -1.832  31.327  204.091 1.00 34.99  ? 164 LEU B C     1 
ATOM   4629 O  O     . LEU B  1  189 ? -1.632  31.152  202.887 1.00 38.40  ? 164 LEU B O     1 
ATOM   4630 C  CB    . LEU B  1  189 ? -2.415  29.128  205.167 1.00 35.77  ? 164 LEU B CB    1 
ATOM   4631 C  CG    . LEU B  1  189 ? -1.114  28.990  205.989 1.00 36.64  ? 164 LEU B CG    1 
ATOM   4632 C  CD1   . LEU B  1  189 ? -1.366  29.324  207.430 1.00 37.24  ? 164 LEU B CD1   1 
ATOM   4633 C  CD2   . LEU B  1  189 ? -0.567  27.576  205.913 1.00 38.12  ? 164 LEU B CD2   1 
ATOM   4634 N  N     . ILE B  1  190 ? -1.148  32.190  204.825 1.00 33.70  ? 165 ILE B N     1 
ATOM   4635 C  CA    . ILE B  1  190 ? -0.015  32.925  204.316 1.00 36.53  ? 165 ILE B CA    1 
ATOM   4636 C  C     . ILE B  1  190 ? 1.257   32.195  204.768 1.00 33.41  ? 165 ILE B C     1 
ATOM   4637 O  O     . ILE B  1  190 ? 1.528   32.095  205.977 1.00 32.70  ? 165 ILE B O     1 
ATOM   4638 C  CB    . ILE B  1  190 ? -0.005  34.371  204.862 1.00 36.80  ? 165 ILE B CB    1 
ATOM   4639 C  CG1   . ILE B  1  190 ? -1.383  35.040  204.691 1.00 38.91  ? 165 ILE B CG1   1 
ATOM   4640 C  CG2   . ILE B  1  190 ? 1.114   35.180  204.205 1.00 36.36  ? 165 ILE B CG2   1 
ATOM   4641 C  CD1   . ILE B  1  190 ? -1.976  34.951  203.303 1.00 40.90  ? 165 ILE B CD1   1 
ATOM   4642 N  N     . ILE B  1  191 ? 2.034   31.702  203.808 1.00 33.06  ? 166 ILE B N     1 
ATOM   4643 C  CA    . ILE B  1  191 ? 3.319   31.062  204.106 1.00 31.48  ? 166 ILE B CA    1 
ATOM   4644 C  C     . ILE B  1  191 ? 4.451   32.046  203.844 1.00 32.42  ? 166 ILE B C     1 
ATOM   4645 O  O     . ILE B  1  191 ? 4.672   32.441  202.722 1.00 34.11  ? 166 ILE B O     1 
ATOM   4646 C  CB    . ILE B  1  191 ? 3.502   29.772  203.305 1.00 30.05  ? 166 ILE B CB    1 
ATOM   4647 C  CG1   . ILE B  1  191 ? 2.454   28.744  203.729 1.00 30.65  ? 166 ILE B CG1   1 
ATOM   4648 C  CG2   . ILE B  1  191 ? 4.865   29.156  203.549 1.00 29.15  ? 166 ILE B CG2   1 
ATOM   4649 C  CD1   . ILE B  1  191 ? 2.369   27.534  202.844 1.00 29.64  ? 166 ILE B CD1   1 
ATOM   4650 N  N     . VAL B  1  192 ? 5.161   32.434  204.893 1.00 32.00  ? 167 VAL B N     1 
ATOM   4651 C  CA    . VAL B  1  192 ? 6.248   33.392  204.803 1.00 31.26  ? 167 VAL B CA    1 
ATOM   4652 C  C     . VAL B  1  192 ? 7.583   32.623  204.814 1.00 30.82  ? 167 VAL B C     1 
ATOM   4653 O  O     . VAL B  1  192 ? 7.815   31.844  205.717 1.00 29.83  ? 167 VAL B O     1 
ATOM   4654 C  CB    . VAL B  1  192 ? 6.175   34.378  205.993 1.00 32.35  ? 167 VAL B CB    1 
ATOM   4655 C  CG1   . VAL B  1  192 ? 7.266   35.411  205.916 1.00 36.50  ? 167 VAL B CG1   1 
ATOM   4656 C  CG2   . VAL B  1  192 ? 4.829   35.073  206.016 1.00 36.13  ? 167 VAL B CG2   1 
ATOM   4657 N  N     . PRO B  1  193 ? 8.466   32.864  203.830 1.00 29.36  ? 168 PRO B N     1 
ATOM   4658 C  CA    . PRO B  1  193 ? 9.776   32.255  203.872 1.00 30.12  ? 168 PRO B CA    1 
ATOM   4659 C  C     . PRO B  1  193 ? 10.539  32.678  205.105 1.00 29.66  ? 168 PRO B C     1 
ATOM   4660 O  O     . PRO B  1  193 ? 10.357  33.811  205.551 1.00 31.30  ? 168 PRO B O     1 
ATOM   4661 C  CB    . PRO B  1  193 ? 10.498  32.775  202.570 1.00 31.50  ? 168 PRO B CB    1 
ATOM   4662 C  CG    . PRO B  1  193 ? 9.460   33.464  201.752 1.00 31.51  ? 168 PRO B CG    1 
ATOM   4663 C  CD    . PRO B  1  193 ? 8.233   33.665  202.602 1.00 32.49  ? 168 PRO B CD    1 
ATOM   4664 N  N     . PRO B  1  194 ? 11.410  31.801  205.637 1.00 30.31  ? 169 PRO B N     1 
ATOM   4665 C  CA    . PRO B  1  194 ? 12.096  32.114  206.896 1.00 29.78  ? 169 PRO B CA    1 
ATOM   4666 C  C     . PRO B  1  194 ? 13.167  33.179  206.756 1.00 30.29  ? 169 PRO B C     1 
ATOM   4667 O  O     . PRO B  1  194 ? 13.772  33.305  205.694 1.00 29.84  ? 169 PRO B O     1 
ATOM   4668 C  CB    . PRO B  1  194 ? 12.711  30.780  207.286 1.00 30.20  ? 169 PRO B CB    1 
ATOM   4669 C  CG    . PRO B  1  194 ? 12.926  30.046  205.981 1.00 31.55  ? 169 PRO B CG    1 
ATOM   4670 C  CD    . PRO B  1  194 ? 11.700  30.419  205.190 1.00 31.99  ? 169 PRO B CD    1 
ATOM   4671 N  N     . ASN B  1  195 ? 13.384  33.961  207.810 1.00 28.26  ? 170 ASN B N     1 
ATOM   4672 C  CA    . ASN B  1  195 ? 14.513  34.901  207.854 1.00 28.46  ? 170 ASN B CA    1 
ATOM   4673 C  C     . ASN B  1  195 ? 15.373  34.591  209.066 1.00 29.01  ? 170 ASN B C     1 
ATOM   4674 O  O     . ASN B  1  195 ? 15.245  35.236  210.139 1.00 29.17  ? 170 ASN B O     1 
ATOM   4675 C  CB    . ASN B  1  195 ? 14.011  36.347  207.900 1.00 28.98  ? 170 ASN B CB    1 
ATOM   4676 C  CG    . ASN B  1  195 ? 13.206  36.728  206.672 1.00 30.33  ? 170 ASN B CG    1 
ATOM   4677 O  OD1   . ASN B  1  195 ? 13.748  36.833  205.597 1.00 32.73  ? 170 ASN B OD1   1 
ATOM   4678 N  ND2   . ASN B  1  195 ? 11.907  36.914  206.833 1.00 30.21  ? 170 ASN B ND2   1 
ATOM   4679 N  N     . PHE B  1  196 ? 16.196  33.559  208.926 1.00 30.01  ? 171 PHE B N     1 
ATOM   4680 C  CA    . PHE B  1  196 ? 16.911  32.976  210.069 1.00 33.38  ? 171 PHE B CA    1 
ATOM   4681 C  C     . PHE B  1  196 ? 17.773  33.996  210.825 1.00 33.43  ? 171 PHE B C     1 
ATOM   4682 O  O     . PHE B  1  196 ? 17.892  33.884  212.043 1.00 31.21  ? 171 PHE B O     1 
ATOM   4683 C  CB    . PHE B  1  196 ? 17.777  31.769  209.663 1.00 37.37  ? 171 PHE B CB    1 
ATOM   4684 C  CG    . PHE B  1  196 ? 16.984  30.592  209.123 1.00 44.91  ? 171 PHE B CG    1 
ATOM   4685 C  CD1   . PHE B  1  196 ? 16.004  29.954  209.907 1.00 46.36  ? 171 PHE B CD1   1 
ATOM   4686 C  CD2   . PHE B  1  196 ? 17.206  30.108  207.821 1.00 49.11  ? 171 PHE B CD2   1 
ATOM   4687 C  CE1   . PHE B  1  196 ? 15.259  28.878  209.395 1.00 43.21  ? 171 PHE B CE1   1 
ATOM   4688 C  CE2   . PHE B  1  196 ? 16.465  29.036  207.318 1.00 48.24  ? 171 PHE B CE2   1 
ATOM   4689 C  CZ    . PHE B  1  196 ? 15.498  28.419  208.121 1.00 47.88  ? 171 PHE B CZ    1 
ATOM   4690 N  N     . ASP B  1  197 ? 18.383  34.952  210.116 1.00 32.88  ? 172 ASP B N     1 
ATOM   4691 C  CA    . ASP B  1  197 ? 19.291  35.924  210.757 1.00 37.14  ? 172 ASP B CA    1 
ATOM   4692 C  C     . ASP B  1  197 ? 18.531  36.911  211.611 1.00 34.09  ? 172 ASP B C     1 
ATOM   4693 O  O     . ASP B  1  197 ? 19.054  37.382  212.588 1.00 30.22  ? 172 ASP B O     1 
ATOM   4694 C  CB    . ASP B  1  197 ? 20.127  36.715  209.768 1.00 38.05  ? 172 ASP B CB    1 
ATOM   4695 C  CG    . ASP B  1  197 ? 20.841  35.840  208.803 1.00 46.75  ? 172 ASP B CG    1 
ATOM   4696 O  OD1   . ASP B  1  197 ? 21.801  35.139  209.223 1.00 42.91  ? 172 ASP B OD1   1 
ATOM   4697 O  OD2   . ASP B  1  197 ? 20.398  35.860  207.621 1.00 54.16  ? 172 ASP B OD2   1 
ATOM   4698 N  N     . LYS B  1  198 ? 17.308  37.228  211.229 1.00 33.21  ? 173 LYS B N     1 
ATOM   4699 C  CA    . LYS B  1  198 ? 16.444  38.021  212.090 1.00 33.38  ? 173 LYS B CA    1 
ATOM   4700 C  C     . LYS B  1  198 ? 16.119  37.311  213.375 1.00 34.52  ? 173 LYS B C     1 
ATOM   4701 O  O     . LYS B  1  198 ? 16.179  37.914  214.442 1.00 35.99  ? 173 LYS B O     1 
ATOM   4702 C  CB    . LYS B  1  198 ? 15.138  38.390  211.402 1.00 32.88  ? 173 LYS B CB    1 
ATOM   4703 C  CG    . LYS B  1  198 ? 15.302  39.469  210.380 1.00 37.21  ? 173 LYS B CG    1 
ATOM   4704 C  CD    . LYS B  1  198 ? 13.995  39.813  209.691 1.00 38.05  ? 173 LYS B CD    1 
ATOM   4705 C  CE    . LYS B  1  198 ? 13.020  40.484  210.632 1.00 35.77  ? 173 LYS B CE    1 
ATOM   4706 N  NZ    . LYS B  1  198 ? 11.855  40.928  209.843 1.00 36.31  ? 173 LYS B NZ    1 
ATOM   4707 N  N     . TYR B  1  199 ? 15.758  36.034  213.279 1.00 34.29  ? 174 TYR B N     1 
ATOM   4708 C  CA    . TYR B  1  199 ? 15.453  35.252  214.473 1.00 33.51  ? 174 TYR B CA    1 
ATOM   4709 C  C     . TYR B  1  199 ? 16.665  35.172  215.421 1.00 32.02  ? 174 TYR B C     1 
ATOM   4710 O  O     . TYR B  1  199 ? 16.497  35.290  216.640 1.00 32.11  ? 174 TYR B O     1 
ATOM   4711 C  CB    . TYR B  1  199 ? 14.911  33.841  214.140 1.00 31.75  ? 174 TYR B CB    1 
ATOM   4712 C  CG    . TYR B  1  199 ? 13.877  33.803  213.030 1.00 30.40  ? 174 TYR B CG    1 
ATOM   4713 C  CD1   . TYR B  1  199 ? 13.869  32.764  212.110 1.00 31.35  ? 174 TYR B CD1   1 
ATOM   4714 C  CD2   . TYR B  1  199 ? 12.942  34.821  212.875 1.00 28.75  ? 174 TYR B CD2   1 
ATOM   4715 C  CE1   . TYR B  1  199 ? 12.956  32.739  211.069 1.00 30.93  ? 174 TYR B CE1   1 
ATOM   4716 C  CE2   . TYR B  1  199 ? 12.038  34.820  211.831 1.00 28.53  ? 174 TYR B CE2   1 
ATOM   4717 C  CZ    . TYR B  1  199 ? 12.038  33.763  210.932 1.00 30.40  ? 174 TYR B CZ    1 
ATOM   4718 O  OH    . TYR B  1  199 ? 11.130  33.756  209.881 1.00 29.62  ? 174 TYR B OH    1 
ATOM   4719 N  N     . ARG B  1  200 ? 17.861  35.003  214.875 1.00 28.56  ? 175 ARG B N     1 
ATOM   4720 C  CA    . ARG B  1  200 ? 19.083  35.029  215.682 1.00 32.89  ? 175 ARG B CA    1 
ATOM   4721 C  C     . ARG B  1  200 ? 19.244  36.382  216.403 1.00 33.85  ? 175 ARG B C     1 
ATOM   4722 O  O     . ARG B  1  200 ? 19.612  36.423  217.573 1.00 32.76  ? 175 ARG B O     1 
ATOM   4723 C  CB    . ARG B  1  200 ? 20.316  34.761  214.806 1.00 37.41  ? 175 ARG B CB    1 
ATOM   4724 C  CG    . ARG B  1  200 ? 21.628  34.621  215.579 1.00 45.61  ? 175 ARG B CG    1 
ATOM   4725 C  CD    . ARG B  1  200 ? 22.831  34.136  214.748 1.00 53.55  ? 175 ARG B CD    1 
ATOM   4726 N  NE    . ARG B  1  200 ? 22.474  33.091  213.767 1.00 55.97  ? 175 ARG B NE    1 
ATOM   4727 C  CZ    . ARG B  1  200 ? 22.253  33.283  212.458 1.00 63.05  ? 175 ARG B CZ    1 
ATOM   4728 N  NH1   . ARG B  1  200 ? 22.365  34.498  211.885 1.00 63.92  ? 175 ARG B NH1   1 
ATOM   4729 N  NH2   . ARG B  1  200 ? 21.922  32.233  211.692 1.00 64.96  ? 175 ARG B NH2   1 
ATOM   4730 N  N     . ALA B  1  201 ? 18.976  37.472  215.682 1.00 33.30  ? 176 ALA B N     1 
ATOM   4731 C  CA    . ALA B  1  201 ? 19.098  38.813  216.221 1.00 32.80  ? 176 ALA B CA    1 
ATOM   4732 C  C     . ALA B  1  201 ? 18.101  39.049  217.345 1.00 31.59  ? 176 ALA B C     1 
ATOM   4733 O  O     . ALA B  1  201 ? 18.458  39.591  218.375 1.00 30.90  ? 176 ALA B O     1 
ATOM   4734 C  CB    . ALA B  1  201 ? 18.913  39.843  215.113 1.00 34.46  ? 176 ALA B CB    1 
ATOM   4735 N  N     . VAL B  1  202 ? 16.858  38.622  217.162 1.00 30.68  ? 177 VAL B N     1 
ATOM   4736 C  CA    . VAL B  1  202 ? 15.866  38.792  218.208 1.00 32.64  ? 177 VAL B CA    1 
ATOM   4737 C  C     . VAL B  1  202 ? 16.308  37.986  219.432 1.00 34.14  ? 177 VAL B C     1 
ATOM   4738 O  O     . VAL B  1  202 ? 16.268  38.490  220.563 1.00 38.58  ? 177 VAL B O     1 
ATOM   4739 C  CB    . VAL B  1  202 ? 14.472  38.375  217.746 1.00 33.34  ? 177 VAL B CB    1 
ATOM   4740 C  CG1   . VAL B  1  202 ? 13.498  38.357  218.912 1.00 35.00  ? 177 VAL B CG1   1 
ATOM   4741 C  CG2   . VAL B  1  202 ? 13.977  39.348  216.693 1.00 34.88  ? 177 VAL B CG2   1 
ATOM   4742 N  N     . SER B  1  203 ? 16.770  36.759  219.205 1.00 34.31  ? 178 SER B N     1 
ATOM   4743 C  CA    . SER B  1  203 ? 17.254  35.901  220.290 1.00 33.99  ? 178 SER B CA    1 
ATOM   4744 C  C     . SER B  1  203 ? 18.349  36.581  221.120 1.00 35.27  ? 178 SER B C     1 
ATOM   4745 O  O     . SER B  1  203 ? 18.377  36.423  222.347 1.00 33.49  ? 178 SER B O     1 
ATOM   4746 C  CB    . SER B  1  203 ? 17.758  34.573  219.751 1.00 33.85  ? 178 SER B CB    1 
ATOM   4747 O  OG    . SER B  1  203 ? 18.258  33.748  220.788 1.00 38.18  ? 178 SER B OG    1 
ATOM   4748 N  N     . LYS B  1  204 ? 19.243  37.306  220.451 1.00 32.69  ? 179 LYS B N     1 
ATOM   4749 C  CA    . LYS B  1  204 ? 20.294  38.033  221.118 1.00 37.04  ? 179 LYS B CA    1 
ATOM   4750 C  C     . LYS B  1  204 ? 19.682  39.100  222.030 1.00 36.40  ? 179 LYS B C     1 
ATOM   4751 O  O     . LYS B  1  204 ? 20.090  39.237  223.169 1.00 34.58  ? 179 LYS B O     1 
ATOM   4752 C  CB    . LYS B  1  204 ? 21.252  38.671  220.108 1.00 41.19  ? 179 LYS B CB    1 
ATOM   4753 C  CG    . LYS B  1  204 ? 22.367  39.497  220.762 1.00 44.59  ? 179 LYS B CG    1 
ATOM   4754 C  CD    . LYS B  1  204 ? 23.383  39.983  219.731 1.00 47.46  ? 179 LYS B CD    1 
ATOM   4755 C  CE    . LYS B  1  204 ? 24.477  40.850  220.343 1.00 46.44  ? 179 LYS B CE    1 
ATOM   4756 N  NZ    . LYS B  1  204 ? 23.938  42.133  220.863 1.00 47.07  ? 179 LYS B NZ    1 
ATOM   4757 N  N     . GLU B  1  205 ? 18.712  39.847  221.519 1.00 36.65  ? 180 GLU B N     1 
ATOM   4758 C  CA    . GLU B  1  205 ? 18.020  40.846  222.308 1.00 36.45  ? 180 GLU B CA    1 
ATOM   4759 C  C     . GLU B  1  205 ? 17.376  40.196  223.545 1.00 39.59  ? 180 GLU B C     1 
ATOM   4760 O  O     . GLU B  1  205 ? 17.518  40.732  224.635 1.00 38.90  ? 180 GLU B O     1 
ATOM   4761 C  CB    . GLU B  1  205 ? 16.978  41.618  221.477 1.00 37.80  ? 180 GLU B CB    1 
ATOM   4762 C  CG    . GLU B  1  205 ? 17.549  42.552  220.387 1.00 37.02  ? 180 GLU B CG    1 
ATOM   4763 C  CD    . GLU B  1  205 ? 16.460  43.128  219.493 1.00 38.25  ? 180 GLU B CD    1 
ATOM   4764 O  OE1   . GLU B  1  205 ? 15.652  42.324  218.942 1.00 37.13  ? 180 GLU B OE1   1 
ATOM   4765 O  OE2   . GLU B  1  205 ? 16.393  44.374  219.330 1.00 37.47  ? 180 GLU B OE2   1 
ATOM   4766 N  N     . VAL B  1  206 ? 16.759  39.044  223.404 1.00 36.97  ? 181 VAL B N     1 
ATOM   4767 C  CA    . VAL B  1  206 ? 16.139  38.358  224.518 1.00 36.60  ? 181 VAL B CA    1 
ATOM   4768 C  C     . VAL B  1  206 ? 17.147  37.882  225.539 1.00 34.73  ? 181 VAL B C     1 
ATOM   4769 O  O     . VAL B  1  206 ? 16.978  38.103  226.692 1.00 34.35  ? 181 VAL B O     1 
ATOM   4770 C  CB    . VAL B  1  206 ? 15.246  37.212  224.034 1.00 36.58  ? 181 VAL B CB    1 
ATOM   4771 C  CG1   . VAL B  1  206 ? 14.726  36.410  225.182 1.00 34.90  ? 181 VAL B CG1   1 
ATOM   4772 C  CG2   . VAL B  1  206 ? 14.102  37.741  223.207 1.00 40.04  ? 181 VAL B CG2   1 
ATOM   4773 N  N     . LYS B  1  207 ? 18.204  37.252  225.080 1.00 35.23  ? 182 LYS B N     1 
ATOM   4774 C  CA    . LYS B  1  207 ? 19.300  36.742  225.934 1.00 39.93  ? 182 LYS B CA    1 
ATOM   4775 C  C     . LYS B  1  207 ? 20.015  37.812  226.776 1.00 40.87  ? 182 LYS B C     1 
ATOM   4776 O  O     . LYS B  1  207 ? 20.508  37.526  227.870 1.00 38.04  ? 182 LYS B O     1 
ATOM   4777 C  CB    . LYS B  1  207 ? 20.349  36.001  225.096 1.00 41.84  ? 182 LYS B CB    1 
ATOM   4778 C  CG    . LYS B  1  207 ? 19.918  34.632  224.556 1.00 47.61  ? 182 LYS B CG    1 
ATOM   4779 C  CD    . LYS B  1  207 ? 20.848  34.198  223.415 1.00 53.93  ? 182 LYS B CD    1 
ATOM   4780 C  CE    . LYS B  1  207 ? 20.943  32.694  223.226 1.00 63.74  ? 182 LYS B CE    1 
ATOM   4781 N  NZ    . LYS B  1  207 ? 19.688  32.075  222.692 1.00 70.47  ? 182 LYS B NZ    1 
ATOM   4782 N  N     . GLU B  1  208 ? 20.107  39.029  226.244 1.00 39.27  ? 183 GLU B N     1 
ATOM   4783 C  CA    . GLU B  1  208 ? 20.645  40.168  226.992 1.00 38.99  ? 183 GLU B CA    1 
ATOM   4784 C  C     . GLU B  1  208 ? 19.800  40.555  228.209 1.00 38.67  ? 183 GLU B C     1 
ATOM   4785 O  O     . GLU B  1  208 ? 20.335  40.962  229.240 1.00 38.30  ? 183 GLU B O     1 
ATOM   4786 C  CB    . GLU B  1  208 ? 20.751  41.383  226.076 1.00 37.86  ? 183 GLU B CB    1 
ATOM   4787 C  CG    . GLU B  1  208 ? 21.881  41.238  225.100 1.00 39.13  ? 183 GLU B CG    1 
ATOM   4788 C  CD    . GLU B  1  208 ? 21.924  42.354  224.086 1.00 43.17  ? 183 GLU B CD    1 
ATOM   4789 O  OE1   . GLU B  1  208 ? 20.929  43.150  223.942 1.00 37.34  ? 183 GLU B OE1   1 
ATOM   4790 O  OE2   . GLU B  1  208 ? 23.003  42.419  223.450 1.00 46.10  ? 183 GLU B OE2   1 
ATOM   4791 N  N     . ILE B  1  209 ? 18.483  40.461  228.079 1.00 34.52  ? 184 ILE B N     1 
ATOM   4792 C  CA    . ILE B  1  209 ? 17.604  40.661  229.228 1.00 34.80  ? 184 ILE B CA    1 
ATOM   4793 C  C     . ILE B  1  209 ? 17.800  39.526  230.252 1.00 36.15  ? 184 ILE B C     1 
ATOM   4794 O  O     . ILE B  1  209 ? 17.959  39.787  231.438 1.00 34.58  ? 184 ILE B O     1 
ATOM   4795 C  CB    . ILE B  1  209 ? 16.130  40.774  228.811 1.00 35.60  ? 184 ILE B CB    1 
ATOM   4796 C  CG1   . ILE B  1  209 ? 15.952  41.996  227.877 1.00 36.62  ? 184 ILE B CG1   1 
ATOM   4797 C  CG2   . ILE B  1  209 ? 15.226  40.845  230.049 1.00 36.41  ? 184 ILE B CG2   1 
ATOM   4798 C  CD1   . ILE B  1  209 ? 14.623  42.071  227.140 1.00 37.17  ? 184 ILE B CD1   1 
ATOM   4799 N  N     . LEU B  1  210 ? 17.820  38.281  229.793 1.00 35.10  ? 185 LEU B N     1 
ATOM   4800 C  CA    . LEU B  1  210 ? 17.877  37.133  230.702 1.00 37.38  ? 185 LEU B CA    1 
ATOM   4801 C  C     . LEU B  1  210 ? 19.158  37.135  231.538 1.00 38.15  ? 185 LEU B C     1 
ATOM   4802 O  O     . LEU B  1  210 ? 19.123  36.727  232.701 1.00 35.08  ? 185 LEU B O     1 
ATOM   4803 C  CB    . LEU B  1  210 ? 17.740  35.791  229.944 1.00 37.01  ? 185 LEU B CB    1 
ATOM   4804 C  CG    . LEU B  1  210 ? 16.489  35.599  229.061 1.00 36.61  ? 185 LEU B CG    1 
ATOM   4805 C  CD1   . LEU B  1  210 ? 16.515  34.230  228.402 1.00 36.89  ? 185 LEU B CD1   1 
ATOM   4806 C  CD2   . LEU B  1  210 ? 15.190  35.819  229.816 1.00 34.40  ? 185 LEU B CD2   1 
ATOM   4807 N  N     . ALA B  1  211 ? 20.261  37.622  230.964 1.00 37.78  ? 186 ALA B N     1 
ATOM   4808 C  CA    . ALA B  1  211 ? 21.543  37.680  231.683 1.00 40.36  ? 186 ALA B CA    1 
ATOM   4809 C  C     . ALA B  1  211 ? 21.524  38.589  232.928 1.00 41.08  ? 186 ALA B C     1 
ATOM   4810 O  O     . ALA B  1  211 ? 22.302  38.367  233.837 1.00 41.53  ? 186 ALA B O     1 
ATOM   4811 C  CB    . ALA B  1  211 ? 22.665  38.095  230.762 1.00 38.28  ? 186 ALA B CB    1 
ATOM   4812 N  N     . ASP B  1  212 ? 20.638  39.584  232.979 1.00 41.75  ? 187 ASP B N     1 
ATOM   4813 C  CA    . ASP B  1  212 ? 20.449  40.384  234.196 1.00 41.78  ? 187 ASP B CA    1 
ATOM   4814 C  C     . ASP B  1  212 ? 19.983  39.544  235.369 1.00 45.47  ? 187 ASP B C     1 
ATOM   4815 O  O     . ASP B  1  212 ? 20.342  39.831  236.495 1.00 50.37  ? 187 ASP B O     1 
ATOM   4816 C  CB    . ASP B  1  212 ? 19.407  41.491  233.992 1.00 45.10  ? 187 ASP B CB    1 
ATOM   4817 C  CG    . ASP B  1  212 ? 19.892  42.615  233.083 1.00 50.39  ? 187 ASP B CG    1 
ATOM   4818 O  OD1   . ASP B  1  212 ? 21.123  42.816  232.956 1.00 50.53  ? 187 ASP B OD1   1 
ATOM   4819 O  OD2   . ASP B  1  212 ? 19.020  43.298  232.494 1.00 54.03  ? 187 ASP B OD2   1 
ATOM   4820 N  N     . TYR B  1  213 ? 19.167  38.524  235.114 1.00 44.11  ? 188 TYR B N     1 
ATOM   4821 C  CA    . TYR B  1  213 ? 18.520  37.760  236.187 1.00 39.93  ? 188 TYR B CA    1 
ATOM   4822 C  C     . TYR B  1  213 ? 19.276  36.497  236.554 1.00 42.20  ? 188 TYR B C     1 
ATOM   4823 O  O     . TYR B  1  213 ? 19.211  36.060  237.689 1.00 43.47  ? 188 TYR B O     1 
ATOM   4824 C  CB    . TYR B  1  213 ? 17.109  37.419  235.792 1.00 37.31  ? 188 TYR B CB    1 
ATOM   4825 C  CG    . TYR B  1  213 ? 16.326  38.656  235.518 1.00 38.90  ? 188 TYR B CG    1 
ATOM   4826 C  CD1   . TYR B  1  213 ? 16.301  39.212  234.246 1.00 37.72  ? 188 TYR B CD1   1 
ATOM   4827 C  CD2   . TYR B  1  213 ? 15.631  39.304  236.538 1.00 38.37  ? 188 TYR B CD2   1 
ATOM   4828 C  CE1   . TYR B  1  213 ? 15.593  40.374  233.988 1.00 39.03  ? 188 TYR B CE1   1 
ATOM   4829 C  CE2   . TYR B  1  213 ? 14.915  40.467  236.288 1.00 38.39  ? 188 TYR B CE2   1 
ATOM   4830 C  CZ    . TYR B  1  213 ? 14.900  41.004  235.007 1.00 38.24  ? 188 TYR B CZ    1 
ATOM   4831 O  OH    . TYR B  1  213 ? 14.200  42.160  234.729 1.00 36.11  ? 188 TYR B OH    1 
ATOM   4832 N  N     . ASP B  1  214 ? 19.963  35.893  235.591 1.00 41.74  ? 189 ASP B N     1 
ATOM   4833 C  CA    . ASP B  1  214 ? 20.864  34.782  235.866 1.00 40.77  ? 189 ASP B CA    1 
ATOM   4834 C  C     . ASP B  1  214 ? 21.940  34.814  234.805 1.00 43.06  ? 189 ASP B C     1 
ATOM   4835 O  O     . ASP B  1  214 ? 21.670  34.437  233.657 1.00 36.68  ? 189 ASP B O     1 
ATOM   4836 C  CB    . ASP B  1  214 ? 20.126  33.431  235.865 1.00 41.29  ? 189 ASP B CB    1 
ATOM   4837 C  CG    . ASP B  1  214 ? 21.079  32.212  235.982 1.00 43.06  ? 189 ASP B CG    1 
ATOM   4838 O  OD1   . ASP B  1  214 ? 20.612  31.060  235.749 1.00 42.13  ? 189 ASP B OD1   1 
ATOM   4839 O  OD2   . ASP B  1  214 ? 22.292  32.383  236.263 1.00 42.83  ? 189 ASP B OD2   1 
ATOM   4840 N  N     . PRO B  1  215 ? 23.163  35.250  235.180 1.00 46.00  ? 190 PRO B N     1 
ATOM   4841 C  CA    . PRO B  1  215 ? 24.248  35.324  234.192 1.00 47.63  ? 190 PRO B CA    1 
ATOM   4842 C  C     . PRO B  1  215 ? 24.677  33.972  233.642 1.00 49.49  ? 190 PRO B C     1 
ATOM   4843 O  O     . PRO B  1  215 ? 25.242  33.921  232.558 1.00 55.17  ? 190 PRO B O     1 
ATOM   4844 C  CB    . PRO B  1  215 ? 25.402  35.989  234.963 1.00 49.54  ? 190 PRO B CB    1 
ATOM   4845 C  CG    . PRO B  1  215 ? 25.107  35.747  236.407 1.00 50.52  ? 190 PRO B CG    1 
ATOM   4846 C  CD    . PRO B  1  215 ? 23.605  35.681  236.524 1.00 48.42  ? 190 PRO B CD    1 
ATOM   4847 N  N     . ASN B  1  216 ? 24.404  32.898  234.378 1.00 52.20  ? 191 ASN B N     1 
ATOM   4848 C  CA    . ASN B  1  216 ? 24.665  31.529  233.939 1.00 52.43  ? 191 ASN B CA    1 
ATOM   4849 C  C     . ASN B  1  216 ? 23.400  30.851  233.388 1.00 50.23  ? 191 ASN B C     1 
ATOM   4850 O  O     . ASN B  1  216 ? 23.223  29.646  233.535 1.00 51.83  ? 191 ASN B O     1 
ATOM   4851 C  CB    . ASN B  1  216 ? 25.209  30.714  235.120 1.00 55.02  ? 191 ASN B CB    1 
ATOM   4852 C  CG    . ASN B  1  216 ? 26.553  31.209  235.599 1.00 61.90  ? 191 ASN B CG    1 
ATOM   4853 O  OD1   . ASN B  1  216 ? 27.374  31.672  234.809 1.00 65.49  ? 191 ASN B OD1   1 
ATOM   4854 N  ND2   . ASN B  1  216 ? 26.802  31.085  236.894 1.00 67.09  ? 191 ASN B ND2   1 
ATOM   4855 N  N     . PHE B  1  217 ? 22.506  31.619  232.772 1.00 45.54  ? 192 PHE B N     1 
ATOM   4856 C  CA    . PHE B  1  217 ? 21.305  31.041  232.187 1.00 42.41  ? 192 PHE B CA    1 
ATOM   4857 C  C     . PHE B  1  217 ? 21.708  30.088  231.067 1.00 41.79  ? 192 PHE B C     1 
ATOM   4858 O  O     . PHE B  1  217 ? 22.758  30.236  230.434 1.00 36.80  ? 192 PHE B O     1 
ATOM   4859 C  CB    . PHE B  1  217 ? 20.358  32.119  231.668 1.00 42.88  ? 192 PHE B CB    1 
ATOM   4860 C  CG    . PHE B  1  217 ? 20.809  32.747  230.380 1.00 42.77  ? 192 PHE B CG    1 
ATOM   4861 C  CD1   . PHE B  1  217 ? 20.340  32.269  229.170 1.00 44.47  ? 192 PHE B CD1   1 
ATOM   4862 C  CD2   . PHE B  1  217 ? 21.725  33.796  230.369 1.00 45.27  ? 192 PHE B CD2   1 
ATOM   4863 C  CE1   . PHE B  1  217 ? 20.779  32.825  227.972 1.00 46.18  ? 192 PHE B CE1   1 
ATOM   4864 C  CE2   . PHE B  1  217 ? 22.157  34.357  229.170 1.00 45.85  ? 192 PHE B CE2   1 
ATOM   4865 C  CZ    . PHE B  1  217 ? 21.684  33.862  227.974 1.00 44.02  ? 192 PHE B CZ    1 
ATOM   4866 N  N     . MET B  1  218 ? 20.853  29.123  230.812 1.00 42.88  ? 193 MET B N     1 
ATOM   4867 C  CA    . MET B  1  218 ? 21.128  28.093  229.816 1.00 48.97  ? 193 MET B CA    1 
ATOM   4868 C  C     . MET B  1  218 ? 20.208  28.274  228.604 1.00 45.12  ? 193 MET B C     1 
ATOM   4869 O  O     . MET B  1  218 ? 18.993  28.048  228.685 1.00 43.61  ? 193 MET B O     1 
ATOM   4870 C  CB    . MET B  1  218 ? 20.915  26.739  230.482 1.00 53.27  ? 193 MET B CB    1 
ATOM   4871 C  CG    . MET B  1  218 ? 21.280  25.520  229.664 1.00 60.68  ? 193 MET B CG    1 
ATOM   4872 S  SD    . MET B  1  218 ? 20.648  24.065  230.526 1.00 67.86  ? 193 MET B SD    1 
ATOM   4873 C  CE    . MET B  1  218 ? 21.880  23.838  231.792 1.00 66.30  ? 193 MET B CE    1 
ATOM   4874 N  N     . ALA B  1  219 ? 20.791  28.689  227.489 1.00 45.06  ? 194 ALA B N     1 
ATOM   4875 C  CA    . ALA B  1  219 ? 20.046  28.824  226.238 1.00 47.80  ? 194 ALA B CA    1 
ATOM   4876 C  C     . ALA B  1  219 ? 19.925  27.445  225.607 1.00 49.22  ? 194 ALA B C     1 
ATOM   4877 O  O     . ALA B  1  219 ? 20.916  26.750  225.434 1.00 52.41  ? 194 ALA B O     1 
ATOM   4878 C  CB    . ALA B  1  219 ? 20.771  29.762  225.303 1.00 51.64  ? 194 ALA B CB    1 
ATOM   4879 N  N     . MET B  1  220 ? 18.702  27.055  225.285 1.00 47.91  ? 195 MET B N     1 
ATOM   4880 C  CA    . MET B  1  220 ? 18.398  25.743  224.695 1.00 50.26  ? 195 MET B CA    1 
ATOM   4881 C  C     . MET B  1  220 ? 18.228  25.784  223.180 1.00 49.34  ? 195 MET B C     1 
ATOM   4882 O  O     . MET B  1  220 ? 18.528  24.821  222.487 1.00 49.37  ? 195 MET B O     1 
ATOM   4883 C  CB    . MET B  1  220 ? 17.091  25.222  225.291 1.00 51.47  ? 195 MET B CB    1 
ATOM   4884 C  CG    . MET B  1  220 ? 17.121  25.046  226.801 1.00 50.41  ? 195 MET B CG    1 
ATOM   4885 S  SD    . MET B  1  220 ? 18.426  23.900  227.274 1.00 52.36  ? 195 MET B SD    1 
ATOM   4886 C  CE    . MET B  1  220 ? 17.769  22.363  226.601 1.00 48.41  ? 195 MET B CE    1 
ATOM   4887 N  N     . SER B  1  221 ? 17.677  26.877  222.686 1.00 46.70  ? 196 SER B N     1 
ATOM   4888 C  CA    . SER B  1  221 ? 17.549  27.112  221.253 1.00 50.06  ? 196 SER B CA    1 
ATOM   4889 C  C     . SER B  1  221 ? 17.457  28.647  221.094 1.00 46.44  ? 196 SER B C     1 
ATOM   4890 O  O     . SER B  1  221 ? 17.755  29.371  222.049 1.00 47.28  ? 196 SER B O     1 
ATOM   4891 C  CB    . SER B  1  221 ? 16.303  26.380  220.728 1.00 48.49  ? 196 SER B CB    1 
ATOM   4892 O  OG    . SER B  1  221 ? 15.122  26.826  221.385 1.00 49.68  ? 196 SER B OG    1 
ATOM   4893 N  N     . LEU B  1  222 ? 17.043  29.144  219.934 1.00 39.44  ? 197 LEU B N     1 
ATOM   4894 C  CA    . LEU B  1  222 ? 16.866  30.577  219.799 1.00 39.93  ? 197 LEU B CA    1 
ATOM   4895 C  C     . LEU B  1  222 ? 15.704  31.095  220.639 1.00 36.78  ? 197 LEU B C     1 
ATOM   4896 O  O     . LEU B  1  222 ? 15.768  32.223  221.111 1.00 34.26  ? 197 LEU B O     1 
ATOM   4897 C  CB    . LEU B  1  222 ? 16.647  31.000  218.342 1.00 39.57  ? 197 LEU B CB    1 
ATOM   4898 C  CG    . LEU B  1  222 ? 17.752  30.750  217.317 1.00 38.42  ? 197 LEU B CG    1 
ATOM   4899 C  CD1   . LEU B  1  222 ? 17.234  31.273  215.986 1.00 38.42  ? 197 LEU B CD1   1 
ATOM   4900 C  CD2   . LEU B  1  222 ? 19.085  31.405  217.659 1.00 37.70  ? 197 LEU B CD2   1 
ATOM   4901 N  N     . ASP B  1  223 ? 14.642  30.311  220.815 1.00 35.56  ? 198 ASP B N     1 
ATOM   4902 C  CA    . ASP B  1  223 ? 13.455  30.877  221.448 1.00 37.00  ? 198 ASP B CA    1 
ATOM   4903 C  C     . ASP B  1  223 ? 13.258  30.552  222.928 1.00 33.97  ? 198 ASP B C     1 
ATOM   4904 O  O     . ASP B  1  223 ? 12.269  30.984  223.513 1.00 35.03  ? 198 ASP B O     1 
ATOM   4905 C  CB    . ASP B  1  223 ? 12.203  30.591  220.607 1.00 34.50  ? 198 ASP B CB    1 
ATOM   4906 C  CG    . ASP B  1  223 ? 11.366  29.489  221.149 1.00 35.43  ? 198 ASP B CG    1 
ATOM   4907 O  OD1   . ASP B  1  223 ? 11.960  28.450  221.452 1.00 35.39  ? 198 ASP B OD1   1 
ATOM   4908 O  OD2   . ASP B  1  223 ? 10.115  29.658  221.231 1.00 37.88  ? 198 ASP B OD2   1 
ATOM   4909 N  N     . GLU B  1  224 ? 14.164  29.803  223.534 1.00 34.79  ? 199 GLU B N     1 
ATOM   4910 C  CA    . GLU B  1  224 ? 13.904  29.278  224.880 1.00 38.23  ? 199 GLU B CA    1 
ATOM   4911 C  C     . GLU B  1  224 ? 15.139  29.164  225.739 1.00 38.40  ? 199 GLU B C     1 
ATOM   4912 O  O     . GLU B  1  224 ? 16.240  28.853  225.242 1.00 34.03  ? 199 GLU B O     1 
ATOM   4913 C  CB    . GLU B  1  224 ? 13.115  27.947  224.840 1.00 41.60  ? 199 GLU B CB    1 
ATOM   4914 C  CG    . GLU B  1  224 ? 13.921  26.666  224.915 1.00 48.17  ? 199 GLU B CG    1 
ATOM   4915 C  CD    . GLU B  1  224 ? 13.062  25.400  225.087 1.00 57.69  ? 199 GLU B CD    1 
ATOM   4916 O  OE1   . GLU B  1  224 ? 13.496  24.480  225.864 1.00 51.12  ? 199 GLU B OE1   1 
ATOM   4917 O  OE2   . GLU B  1  224 ? 11.943  25.346  224.495 1.00 57.91  ? 199 GLU B OE2   1 
ATOM   4918 N  N     . ALA B  1  225 ? 14.941  29.387  227.041 1.00 34.47  ? 200 ALA B N     1 
ATOM   4919 C  CA    . ALA B  1  225 ? 16.051  29.299  227.983 1.00 35.19  ? 200 ALA B CA    1 
ATOM   4920 C  C     . ALA B  1  225 ? 15.588  28.911  229.383 1.00 34.80  ? 200 ALA B C     1 
ATOM   4921 O  O     . ALA B  1  225 ? 14.430  29.175  229.776 1.00 32.16  ? 200 ALA B O     1 
ATOM   4922 C  CB    . ALA B  1  225 ? 16.789  30.628  228.053 1.00 33.43  ? 200 ALA B CB    1 
ATOM   4923 N  N     . TYR B  1  226 ? 16.520  28.326  230.132 1.00 33.56  ? 201 TYR B N     1 
ATOM   4924 C  CA    . TYR B  1  226 ? 16.346  28.123  231.572 1.00 35.20  ? 201 TYR B CA    1 
ATOM   4925 C  C     . TYR B  1  226 ? 17.173  29.140  232.339 1.00 36.22  ? 201 TYR B C     1 
ATOM   4926 O  O     . TYR B  1  226 ? 18.328  29.428  231.973 1.00 35.10  ? 201 TYR B O     1 
ATOM   4927 C  CB    . TYR B  1  226 ? 16.779  26.737  232.000 1.00 36.28  ? 201 TYR B CB    1 
ATOM   4928 C  CG    . TYR B  1  226 ? 15.939  25.608  231.444 1.00 38.75  ? 201 TYR B CG    1 
ATOM   4929 C  CD1   . TYR B  1  226 ? 14.733  25.254  232.050 1.00 37.31  ? 201 TYR B CD1   1 
ATOM   4930 C  CD2   . TYR B  1  226 ? 16.365  24.874  230.324 1.00 39.26  ? 201 TYR B CD2   1 
ATOM   4931 C  CE1   . TYR B  1  226 ? 13.968  24.204  231.568 1.00 38.94  ? 201 TYR B CE1   1 
ATOM   4932 C  CE2   . TYR B  1  226 ? 15.599  23.823  229.825 1.00 41.29  ? 201 TYR B CE2   1 
ATOM   4933 C  CZ    . TYR B  1  226 ? 14.405  23.495  230.460 1.00 41.94  ? 201 TYR B CZ    1 
ATOM   4934 O  OH    . TYR B  1  226 ? 13.635  22.469  229.997 1.00 46.08  ? 201 TYR B OH    1 
ATOM   4935 N  N     . LEU B  1  227 ? 16.579  29.676  233.399 1.00 35.23  ? 202 LEU B N     1 
ATOM   4936 C  CA    . LEU B  1  227 ? 17.294  30.540  234.336 1.00 39.04  ? 202 LEU B CA    1 
ATOM   4937 C  C     . LEU B  1  227 ? 17.097  30.016  235.735 1.00 38.98  ? 202 LEU B C     1 
ATOM   4938 O  O     . LEU B  1  227 ? 16.015  29.504  236.078 1.00 37.13  ? 202 LEU B O     1 
ATOM   4939 C  CB    . LEU B  1  227 ? 16.753  31.952  234.322 1.00 41.18  ? 202 LEU B CB    1 
ATOM   4940 C  CG    . LEU B  1  227 ? 16.705  32.739  233.031 1.00 43.35  ? 202 LEU B CG    1 
ATOM   4941 C  CD1   . LEU B  1  227 ? 15.468  32.374  232.217 1.00 43.13  ? 202 LEU B CD1   1 
ATOM   4942 C  CD2   . LEU B  1  227 ? 16.682  34.216  233.402 1.00 45.87  ? 202 LEU B CD2   1 
ATOM   4943 N  N     . ASN B  1  228 ? 18.152  30.140  236.529 1.00 38.92  ? 203 ASN B N     1 
ATOM   4944 C  CA    . ASN B  1  228 ? 18.066  29.954  237.972 1.00 38.51  ? 203 ASN B CA    1 
ATOM   4945 C  C     . ASN B  1  228 ? 18.035  31.334  238.628 1.00 36.15  ? 203 ASN B C     1 
ATOM   4946 O  O     . ASN B  1  228 ? 19.070  31.951  238.806 1.00 34.05  ? 203 ASN B O     1 
ATOM   4947 C  CB    . ASN B  1  228 ? 19.235  29.121  238.489 1.00 37.40  ? 203 ASN B CB    1 
ATOM   4948 C  CG    . ASN B  1  228 ? 19.032  28.671  239.932 1.00 40.18  ? 203 ASN B CG    1 
ATOM   4949 O  OD1   . ASN B  1  228 ? 18.294  29.289  240.699 1.00 39.95  ? 203 ASN B OD1   1 
ATOM   4950 N  ND2   . ASN B  1  228 ? 19.661  27.577  240.291 1.00 40.65  ? 203 ASN B ND2   1 
ATOM   4951 N  N     . ILE B  1  229 ? 16.842  31.801  238.981 1.00 31.39  ? 204 ILE B N     1 
ATOM   4952 C  CA    . ILE B  1  229 ? 16.701  33.130  239.575 1.00 34.49  ? 204 ILE B CA    1 
ATOM   4953 C  C     . ILE B  1  229 ? 16.835  33.182  241.118 1.00 35.68  ? 204 ILE B C     1 
ATOM   4954 O  O     . ILE B  1  229 ? 16.489  34.182  241.715 1.00 35.79  ? 204 ILE B O     1 
ATOM   4955 C  CB    . ILE B  1  229 ? 15.392  33.808  239.145 1.00 33.54  ? 204 ILE B CB    1 
ATOM   4956 C  CG1   . ILE B  1  229 ? 14.156  33.074  239.666 1.00 33.58  ? 204 ILE B CG1   1 
ATOM   4957 C  CG2   . ILE B  1  229 ? 15.360  33.941  237.631 1.00 34.85  ? 204 ILE B CG2   1 
ATOM   4958 C  CD1   . ILE B  1  229 ? 12.874  33.851  239.450 1.00 34.98  ? 204 ILE B CD1   1 
ATOM   4959 N  N     . THR B  1  230 ? 17.349  32.118  241.739 1.00 37.50  ? 205 THR B N     1 
ATOM   4960 C  CA    . THR B  1  230 ? 17.442  32.016  243.195 1.00 41.09  ? 205 THR B CA    1 
ATOM   4961 C  C     . THR B  1  230 ? 18.259  33.168  243.764 1.00 39.31  ? 205 THR B C     1 
ATOM   4962 O  O     . THR B  1  230 ? 17.753  33.892  244.628 1.00 40.83  ? 205 THR B O     1 
ATOM   4963 C  CB    . THR B  1  230 ? 18.068  30.672  243.639 1.00 41.58  ? 205 THR B CB    1 
ATOM   4964 O  OG1   . THR B  1  230 ? 17.283  29.600  243.119 1.00 41.13  ? 205 THR B OG1   1 
ATOM   4965 C  CG2   . THR B  1  230 ? 18.145  30.569  245.178 1.00 41.45  ? 205 THR B CG2   1 
ATOM   4966 N  N     . LYS B  1  231 ? 19.489  33.330  243.269 1.00 40.94  ? 206 LYS B N     1 
ATOM   4967 C  CA    . LYS B  1  231 ? 20.390  34.429  243.703 1.00 43.17  ? 206 LYS B CA    1 
ATOM   4968 C  C     . LYS B  1  231 ? 19.742  35.801  243.529 1.00 43.81  ? 206 LYS B C     1 
ATOM   4969 O  O     . LYS B  1  231 ? 19.691  36.592  244.464 1.00 45.69  ? 206 LYS B O     1 
ATOM   4970 C  CB    . LYS B  1  231 ? 21.748  34.385  242.981 1.00 40.50  ? 206 LYS B CB    1 
ATOM   4971 N  N     . HIS B  1  232 ? 19.196  36.060  242.344 1.00 42.29  ? 207 HIS B N     1 
ATOM   4972 C  CA    . HIS B  1  232 ? 18.539  37.329  242.064 1.00 37.56  ? 207 HIS B CA    1 
ATOM   4973 C  C     . HIS B  1  232 ? 17.387  37.631  243.016 1.00 39.89  ? 207 HIS B C     1 
ATOM   4974 O  O     . HIS B  1  232 ? 17.222  38.778  243.430 1.00 39.29  ? 207 HIS B O     1 
ATOM   4975 C  CB    . HIS B  1  232 ? 18.029  37.349  240.633 1.00 36.94  ? 207 HIS B CB    1 
ATOM   4976 C  CG    . HIS B  1  232 ? 17.218  38.557  240.305 1.00 37.67  ? 207 HIS B CG    1 
ATOM   4977 N  ND1   . HIS B  1  232 ? 17.785  39.744  239.894 1.00 38.83  ? 207 HIS B ND1   1 
ATOM   4978 C  CD2   . HIS B  1  232 ? 15.883  38.768  240.349 1.00 37.77  ? 207 HIS B CD2   1 
ATOM   4979 C  CE1   . HIS B  1  232 ? 16.829  40.627  239.674 1.00 37.05  ? 207 HIS B CE1   1 
ATOM   4980 N  NE2   . HIS B  1  232 ? 15.668  40.059  239.943 1.00 37.70  ? 207 HIS B NE2   1 
ATOM   4981 N  N     . LEU B  1  233 ? 16.584  36.619  243.341 1.00 40.44  ? 208 LEU B N     1 
ATOM   4982 C  CA    . LEU B  1  233 ? 15.517  36.775  244.326 1.00 41.71  ? 208 LEU B CA    1 
ATOM   4983 C  C     . LEU B  1  233 ? 16.044  37.152  245.699 1.00 43.02  ? 208 LEU B C     1 
ATOM   4984 O  O     . LEU B  1  233 ? 15.423  37.958  246.374 1.00 45.55  ? 208 LEU B O     1 
ATOM   4985 C  CB    . LEU B  1  233 ? 14.694  35.510  244.460 1.00 42.34  ? 208 LEU B CB    1 
ATOM   4986 C  CG    . LEU B  1  233 ? 13.617  35.395  243.408 1.00 42.13  ? 208 LEU B CG    1 
ATOM   4987 C  CD1   . LEU B  1  233 ? 13.161  33.947  243.317 1.00 44.66  ? 208 LEU B CD1   1 
ATOM   4988 C  CD2   . LEU B  1  233 ? 12.458  36.320  243.726 1.00 41.48  ? 208 LEU B CD2   1 
ATOM   4989 N  N     . GLU B  1  234 ? 17.187  36.601  246.097 1.00 46.44  ? 209 GLU B N     1 
ATOM   4990 C  CA    . GLU B  1  234 ? 17.800  36.985  247.373 1.00 54.35  ? 209 GLU B CA    1 
ATOM   4991 C  C     . GLU B  1  234 ? 18.135  38.478  247.357 1.00 50.94  ? 209 GLU B C     1 
ATOM   4992 O  O     . GLU B  1  234 ? 17.690  39.216  248.227 1.00 48.63  ? 209 GLU B O     1 
ATOM   4993 C  CB    . GLU B  1  234 ? 19.069  36.179  247.685 1.00 58.09  ? 209 GLU B CB    1 
ATOM   4994 C  CG    . GLU B  1  234 ? 18.837  34.707  247.981 1.00 62.58  ? 209 GLU B CG    1 
ATOM   4995 C  CD    . GLU B  1  234 ? 20.146  33.944  248.143 1.00 67.69  ? 209 GLU B CD    1 
ATOM   4996 O  OE1   . GLU B  1  234 ? 21.054  34.476  248.823 1.00 69.83  ? 209 GLU B OE1   1 
ATOM   4997 O  OE2   . GLU B  1  234 ? 20.268  32.816  247.599 1.00 66.61  ? 209 GLU B OE2   1 
ATOM   4998 N  N     . GLU B  1  235 ? 18.879  38.905  246.342 1.00 48.44  ? 210 GLU B N     1 
ATOM   4999 C  CA    . GLU B  1  235 ? 19.278  40.306  246.203 1.00 49.50  ? 210 GLU B CA    1 
ATOM   5000 C  C     . GLU B  1  235 ? 18.067  41.221  246.114 1.00 50.03  ? 210 GLU B C     1 
ATOM   5001 O  O     . GLU B  1  235 ? 18.034  42.269  246.739 1.00 47.04  ? 210 GLU B O     1 
ATOM   5002 C  CB    . GLU B  1  235 ? 20.138  40.501  244.954 1.00 53.77  ? 210 GLU B CB    1 
ATOM   5003 C  CG    . GLU B  1  235 ? 21.509  39.849  245.027 1.00 57.77  ? 210 GLU B CG    1 
ATOM   5004 C  CD    . GLU B  1  235 ? 22.201  39.810  243.675 1.00 65.34  ? 210 GLU B CD    1 
ATOM   5005 O  OE1   . GLU B  1  235 ? 21.992  40.735  242.864 1.00 70.41  ? 210 GLU B OE1   1 
ATOM   5006 O  OE2   . GLU B  1  235 ? 22.951  38.844  243.416 1.00 75.42  ? 210 GLU B OE2   1 
ATOM   5007 N  N     . ARG B  1  236 ? 17.066  40.805  245.346 1.00 46.31  ? 211 ARG B N     1 
ATOM   5008 C  CA    . ARG B  1  236 ? 15.928  41.656  245.039 1.00 46.94  ? 211 ARG B CA    1 
ATOM   5009 C  C     . ARG B  1  236 ? 15.016  42.005  246.222 1.00 47.90  ? 211 ARG B C     1 
ATOM   5010 O  O     . ARG B  1  236 ? 14.274  43.011  246.148 1.00 45.40  ? 211 ARG B O     1 
ATOM   5011 C  CB    . ARG B  1  236 ? 15.075  41.001  243.924 1.00 45.82  ? 211 ARG B CB    1 
ATOM   5012 C  CG    . ARG B  1  236 ? 14.007  41.871  243.276 1.00 41.05  ? 211 ARG B CG    1 
ATOM   5013 C  CD    . ARG B  1  236 ? 13.133  41.010  242.371 1.00 39.59  ? 211 ARG B CD    1 
ATOM   5014 N  NE    . ARG B  1  236 ? 12.103  41.784  241.677 1.00 37.97  ? 211 ARG B NE    1 
ATOM   5015 C  CZ    . ARG B  1  236 ? 12.253  42.417  240.512 1.00 37.75  ? 211 ARG B CZ    1 
ATOM   5016 N  NH1   . ARG B  1  236 ? 13.403  42.398  239.837 1.00 38.30  ? 211 ARG B NH1   1 
ATOM   5017 N  NH2   . ARG B  1  236 ? 11.228  43.087  240.017 1.00 37.78  ? 211 ARG B NH2   1 
ATOM   5018 N  N     . GLN B  1  237 ? 15.022  41.189  247.278 1.00 47.79  ? 212 GLN B N     1 
ATOM   5019 C  CA    . GLN B  1  237 ? 14.141  41.430  248.429 1.00 51.57  ? 212 GLN B CA    1 
ATOM   5020 C  C     . GLN B  1  237 ? 14.293  42.857  248.972 1.00 49.67  ? 212 GLN B C     1 
ATOM   5021 O  O     . GLN B  1  237 ? 13.296  43.487  249.303 1.00 49.25  ? 212 GLN B O     1 
ATOM   5022 C  CB    . GLN B  1  237 ? 14.383  40.408  249.560 1.00 58.01  ? 212 GLN B CB    1 
ATOM   5023 C  CG    . GLN B  1  237 ? 13.755  39.026  249.339 1.00 63.62  ? 212 GLN B CG    1 
ATOM   5024 C  CD    . GLN B  1  237 ? 12.224  39.043  249.283 1.00 67.98  ? 212 GLN B CD    1 
ATOM   5025 O  OE1   . GLN B  1  237 ? 11.618  38.580  248.321 1.00 66.99  ? 212 GLN B OE1   1 
ATOM   5026 N  NE2   . GLN B  1  237 ? 11.595  39.582  250.325 1.00 75.45  ? 212 GLN B NE2   1 
ATOM   5027 N  N     . ASN B  1  238 ? 15.534  43.357  248.997 1.00 51.34  ? 213 ASN B N     1 
ATOM   5028 C  CA    . ASN B  1  238 ? 15.875  44.684  249.538 1.00 57.31  ? 213 ASN B CA    1 
ATOM   5029 C  C     . ASN B  1  238 ? 16.071  45.812  248.506 1.00 59.09  ? 213 ASN B C     1 
ATOM   5030 O  O     . ASN B  1  238 ? 16.570  46.881  248.859 1.00 59.64  ? 213 ASN B O     1 
ATOM   5031 C  CB    . ASN B  1  238 ? 17.129  44.545  250.420 1.00 59.30  ? 213 ASN B CB    1 
ATOM   5032 C  CG    . ASN B  1  238 ? 16.879  43.643  251.624 1.00 63.32  ? 213 ASN B CG    1 
ATOM   5033 O  OD1   . ASN B  1  238 ? 15.851  43.783  252.308 1.00 63.02  ? 213 ASN B OD1   1 
ATOM   5034 N  ND2   . ASN B  1  238 ? 17.787  42.697  251.875 1.00 64.01  ? 213 ASN B ND2   1 
ATOM   5035 N  N     . TRP B  1  239 ? 15.644  45.595  247.260 1.00 52.56  ? 214 TRP B N     1 
ATOM   5036 C  CA    . TRP B  1  239 ? 15.799  46.592  246.198 1.00 47.78  ? 214 TRP B CA    1 
ATOM   5037 C  C     . TRP B  1  239 ? 14.727  47.688  246.272 1.00 45.48  ? 214 TRP B C     1 
ATOM   5038 O  O     . TRP B  1  239 ? 13.525  47.382  246.368 1.00 41.48  ? 214 TRP B O     1 
ATOM   5039 C  CB    . TRP B  1  239 ? 15.713  45.941  244.814 1.00 47.66  ? 214 TRP B CB    1 
ATOM   5040 C  CG    . TRP B  1  239 ? 16.958  45.331  244.323 1.00 48.12  ? 214 TRP B CG    1 
ATOM   5041 C  CD1   . TRP B  1  239 ? 18.124  45.115  245.015 1.00 49.05  ? 214 TRP B CD1   1 
ATOM   5042 C  CD2   . TRP B  1  239 ? 17.168  44.827  243.015 1.00 47.49  ? 214 TRP B CD2   1 
ATOM   5043 N  NE1   . TRP B  1  239 ? 19.051  44.525  244.203 1.00 49.73  ? 214 TRP B NE1   1 
ATOM   5044 C  CE2   . TRP B  1  239 ? 18.489  44.327  242.968 1.00 49.94  ? 214 TRP B CE2   1 
ATOM   5045 C  CE3   . TRP B  1  239 ? 16.367  44.748  241.867 1.00 47.21  ? 214 TRP B CE3   1 
ATOM   5046 C  CZ2   . TRP B  1  239 ? 19.030  43.751  241.810 1.00 49.92  ? 214 TRP B CZ2   1 
ATOM   5047 C  CZ3   . TRP B  1  239 ? 16.903  44.170  240.714 1.00 45.55  ? 214 TRP B CZ3   1 
ATOM   5048 C  CH2   . TRP B  1  239 ? 18.225  43.692  240.695 1.00 47.62  ? 214 TRP B CH2   1 
ATOM   5049 N  N     . PRO B  1  240 ? 15.156  48.968  246.210 1.00 45.14  ? 215 PRO B N     1 
ATOM   5050 C  CA    . PRO B  1  240 ? 14.198  50.080  246.081 1.00 47.12  ? 215 PRO B CA    1 
ATOM   5051 C  C     . PRO B  1  240 ? 13.419  50.041  244.761 1.00 50.31  ? 215 PRO B C     1 
ATOM   5052 O  O     . PRO B  1  240 ? 13.873  49.404  243.789 1.00 49.43  ? 215 PRO B O     1 
ATOM   5053 C  CB    . PRO B  1  240 ? 15.084  51.347  246.141 1.00 50.06  ? 215 PRO B CB    1 
ATOM   5054 C  CG    . PRO B  1  240 ? 16.514  50.897  246.020 1.00 50.61  ? 215 PRO B CG    1 
ATOM   5055 C  CD    . PRO B  1  240 ? 16.570  49.412  246.251 1.00 47.83  ? 215 PRO B CD    1 
ATOM   5056 N  N     . GLU B  1  241 ? 12.274  50.728  244.721 1.00 49.31  ? 216 GLU B N     1 
ATOM   5057 C  CA    . GLU B  1  241 ? 11.476  50.846  243.490 1.00 50.45  ? 216 GLU B CA    1 
ATOM   5058 C  C     . GLU B  1  241 ? 12.262  51.302  242.275 1.00 54.66  ? 216 GLU B C     1 
ATOM   5059 O  O     . GLU B  1  241 ? 11.954  50.877  241.153 1.00 55.72  ? 216 GLU B O     1 
ATOM   5060 C  CB    . GLU B  1  241 ? 10.256  51.739  243.684 1.00 50.56  ? 216 GLU B CB    1 
ATOM   5061 C  CG    . GLU B  1  241 ? 9.094   51.042  244.395 1.00 49.69  ? 216 GLU B CG    1 
ATOM   5062 C  CD    . GLU B  1  241 ? 7.752   51.737  244.201 1.00 50.64  ? 216 GLU B CD    1 
ATOM   5063 O  OE1   . GLU B  1  241 ? 6.717   51.142  244.544 1.00 53.27  ? 216 GLU B OE1   1 
ATOM   5064 O  OE2   . GLU B  1  241 ? 7.710   52.884  243.716 1.00 54.92  ? 216 GLU B OE2   1 
ATOM   5065 N  N     . ASP B  1  242 ? 13.277  52.141  242.486 1.00 58.04  ? 217 ASP B N     1 
ATOM   5066 C  CA    . ASP B  1  242 ? 14.215  52.542  241.413 1.00 63.15  ? 217 ASP B CA    1 
ATOM   5067 C  C     . ASP B  1  242 ? 14.788  51.370  240.596 1.00 59.79  ? 217 ASP B C     1 
ATOM   5068 O  O     . ASP B  1  242 ? 14.961  51.485  239.384 1.00 57.32  ? 217 ASP B O     1 
ATOM   5069 C  CB    . ASP B  1  242 ? 15.393  53.363  241.986 1.00 67.92  ? 217 ASP B CB    1 
ATOM   5070 C  CG    . ASP B  1  242 ? 15.002  54.792  242.358 1.00 77.94  ? 217 ASP B CG    1 
ATOM   5071 O  OD1   . ASP B  1  242 ? 13.871  55.233  242.046 1.00 81.12  ? 217 ASP B OD1   1 
ATOM   5072 O  OD2   . ASP B  1  242 ? 15.843  55.483  242.978 1.00 86.26  ? 217 ASP B OD2   1 
ATOM   5073 N  N     . LYS B  1  243 ? 15.099  50.257  241.258 1.00 60.23  ? 218 LYS B N     1 
ATOM   5074 C  CA    . LYS B  1  243 ? 15.740  49.117  240.589 1.00 55.14  ? 218 LYS B CA    1 
ATOM   5075 C  C     . LYS B  1  243 ? 14.736  48.136  239.963 1.00 50.45  ? 218 LYS B C     1 
ATOM   5076 O  O     . LYS B  1  243 ? 15.152  47.145  239.372 1.00 47.42  ? 218 LYS B O     1 
ATOM   5077 C  CB    . LYS B  1  243 ? 16.683  48.417  241.559 1.00 56.80  ? 218 LYS B CB    1 
ATOM   5078 C  CG    . LYS B  1  243 ? 17.840  49.313  241.984 1.00 63.84  ? 218 LYS B CG    1 
ATOM   5079 C  CD    . LYS B  1  243 ? 18.739  48.654  243.018 1.00 67.64  ? 218 LYS B CD    1 
ATOM   5080 C  CE    . LYS B  1  243 ? 19.653  47.601  242.414 1.00 71.12  ? 218 LYS B CE    1 
ATOM   5081 N  NZ    . LYS B  1  243 ? 20.851  48.193  241.772 1.00 75.00  ? 218 LYS B NZ    1 
ATOM   5082 N  N     . ARG B  1  244 ? 13.437  48.412  240.109 1.00 44.49  ? 219 ARG B N     1 
ATOM   5083 C  CA    . ARG B  1  244 ? 12.362  47.567  239.592 1.00 46.85  ? 219 ARG B CA    1 
ATOM   5084 C  C     . ARG B  1  244 ? 11.310  48.306  238.797 1.00 47.25  ? 219 ARG B C     1 
ATOM   5085 O  O     . ARG B  1  244 ? 10.163  47.843  238.685 1.00 43.97  ? 219 ARG B O     1 
ATOM   5086 C  CB    . ARG B  1  244 ? 11.676  46.857  240.801 1.00 45.54  ? 219 ARG B CB    1 
ATOM   5087 C  CG    . ARG B  1  244 ? 12.615  46.074  241.708 1.00 46.84  ? 219 ARG B CG    1 
ATOM   5088 C  CD    . ARG B  1  244 ? 11.859  45.447  242.877 1.00 47.03  ? 219 ARG B CD    1 
ATOM   5089 N  NE    . ARG B  1  244 ? 11.659  46.389  243.982 1.00 45.50  ? 219 ARG B NE    1 
ATOM   5090 C  CZ    . ARG B  1  244 ? 10.484  46.861  244.404 1.00 46.64  ? 219 ARG B CZ    1 
ATOM   5091 N  NH1   . ARG B  1  244 ? 10.459  47.715  245.419 1.00 48.51  ? 219 ARG B NH1   1 
ATOM   5092 N  NH2   . ARG B  1  244 ? 9.339   46.499  243.835 1.00 48.45  ? 219 ARG B NH2   1 
ATOM   5093 N  N     . ARG B  1  245 ? 11.716  49.444  238.225 1.00 51.03  ? 220 ARG B N     1 
ATOM   5094 C  CA    . ARG B  1  245 ? 10.851  50.317  237.433 1.00 55.50  ? 220 ARG B CA    1 
ATOM   5095 C  C     . ARG B  1  245 ? 11.323  50.259  235.988 1.00 56.99  ? 220 ARG B C     1 
ATOM   5096 O  O     . ARG B  1  245 ? 12.518  50.421  235.715 1.00 55.33  ? 220 ARG B O     1 
ATOM   5097 C  CB    . ARG B  1  245 ? 10.903  51.762  237.949 1.00 60.88  ? 220 ARG B CB    1 
ATOM   5098 C  CG    . ARG B  1  245 ? 10.372  52.832  236.980 1.00 68.07  ? 220 ARG B CG    1 
ATOM   5099 C  CD    . ARG B  1  245 ? 10.000  54.159  237.663 1.00 71.66  ? 220 ARG B CD    1 
ATOM   5100 N  NE    . ARG B  1  245 ? 10.833  54.466  238.839 1.00 69.71  ? 220 ARG B NE    1 
ATOM   5101 C  CZ    . ARG B  1  245 ? 10.409  54.588  240.102 1.00 70.28  ? 220 ARG B CZ    1 
ATOM   5102 N  NH1   . ARG B  1  245 ? 11.298  54.855  241.058 1.00 74.86  ? 220 ARG B NH1   1 
ATOM   5103 N  NH2   . ARG B  1  245 ? 9.125   54.463  240.442 1.00 69.20  ? 220 ARG B NH2   1 
ATOM   5104 N  N     . TYR B  1  246 ? 10.396  49.979  235.077 1.00 58.01  ? 221 TYR B N     1 
ATOM   5105 C  CA    . TYR B  1  246 ? 10.674  50.029  233.638 1.00 58.93  ? 221 TYR B CA    1 
ATOM   5106 C  C     . TYR B  1  246 ? 9.590   50.884  232.985 1.00 69.83  ? 221 TYR B C     1 
ATOM   5107 O  O     . TYR B  1  246 ? 8.425   50.843  233.393 1.00 73.52  ? 221 TYR B O     1 
ATOM   5108 C  CB    . TYR B  1  246 ? 10.805  48.614  233.032 1.00 51.30  ? 221 TYR B CB    1 
ATOM   5109 C  CG    . TYR B  1  246 ? 12.018  47.918  233.591 1.00 44.69  ? 221 TYR B CG    1 
ATOM   5110 C  CD1   . TYR B  1  246 ? 13.251  48.040  232.977 1.00 43.20  ? 221 TYR B CD1   1 
ATOM   5111 C  CD2   . TYR B  1  246 ? 11.949  47.199  234.792 1.00 44.79  ? 221 TYR B CD2   1 
ATOM   5112 C  CE1   . TYR B  1  246 ? 14.387  47.452  233.517 1.00 42.02  ? 221 TYR B CE1   1 
ATOM   5113 C  CE2   . TYR B  1  246 ? 13.080  46.608  235.341 1.00 41.04  ? 221 TYR B CE2   1 
ATOM   5114 C  CZ    . TYR B  1  246 ? 14.291  46.739  234.703 1.00 41.38  ? 221 TYR B CZ    1 
ATOM   5115 O  OH    . TYR B  1  246 ? 15.414  46.167  235.251 1.00 42.37  ? 221 TYR B OH    1 
ATOM   5116 N  N     . PHE B  1  247 ? 10.008  51.716  232.031 1.00 79.90  ? 222 PHE B N     1 
ATOM   5117 C  CA    . PHE B  1  247 ? 9.106   52.619  231.322 1.00 81.54  ? 222 PHE B CA    1 
ATOM   5118 C  C     . PHE B  1  247 ? 8.581   51.891  230.087 1.00 75.06  ? 222 PHE B C     1 
ATOM   5119 O  O     . PHE B  1  247 ? 9.273   51.039  229.516 1.00 70.36  ? 222 PHE B O     1 
ATOM   5120 C  CB    . PHE B  1  247 ? 9.834   53.919  230.942 1.00 85.24  ? 222 PHE B CB    1 
ATOM   5121 C  CG    . PHE B  1  247 ? 10.372  54.688  232.123 1.00 91.28  ? 222 PHE B CG    1 
ATOM   5122 C  CD1   . PHE B  1  247 ? 9.576   55.621  232.788 1.00 90.88  ? 222 PHE B CD1   1 
ATOM   5123 C  CD2   . PHE B  1  247 ? 11.679  54.482  232.580 1.00 93.87  ? 222 PHE B CD2   1 
ATOM   5124 C  CE1   . PHE B  1  247 ? 10.070  56.329  233.881 1.00 94.68  ? 222 PHE B CE1   1 
ATOM   5125 C  CE2   . PHE B  1  247 ? 12.178  55.191  233.671 1.00 91.29  ? 222 PHE B CE2   1 
ATOM   5126 C  CZ    . PHE B  1  247 ? 11.374  56.116  234.322 1.00 94.48  ? 222 PHE B CZ    1 
ATOM   5127 N  N     . ILE B  1  248 ? 7.351   52.216  229.689 1.00 75.97  ? 223 ILE B N     1 
ATOM   5128 C  CA    . ILE B  1  248 ? 6.732   51.607  228.500 1.00 77.82  ? 223 ILE B CA    1 
ATOM   5129 C  C     . ILE B  1  248 ? 7.257   52.304  227.232 1.00 76.77  ? 223 ILE B C     1 
ATOM   5130 O  O     . ILE B  1  248 ? 7.438   53.522  227.223 1.00 77.85  ? 223 ILE B O     1 
ATOM   5131 C  CB    . ILE B  1  248 ? 5.184   51.675  228.544 1.00 79.56  ? 223 ILE B CB    1 
ATOM   5132 C  CG1   . ILE B  1  248 ? 4.651   51.066  229.859 1.00 77.41  ? 223 ILE B CG1   1 
ATOM   5133 C  CG2   . ILE B  1  248 ? 4.590   50.973  227.316 1.00 79.27  ? 223 ILE B CG2   1 
ATOM   5134 C  CD1   . ILE B  1  248 ? 3.139   51.016  229.998 1.00 75.14  ? 223 ILE B CD1   1 
ATOM   5135 N  N     . LYS B  1  249 ? 7.497   51.524  226.175 1.00 80.47  ? 224 LYS B N     1 
ATOM   5136 C  CA    . LYS B  1  249 ? 8.045   52.029  224.903 1.00 76.97  ? 224 LYS B CA    1 
ATOM   5137 C  C     . LYS B  1  249 ? 7.157   51.627  223.737 1.00 71.92  ? 224 LYS B C     1 
ATOM   5138 O  O     . LYS B  1  249 ? 5.947   51.840  223.777 1.00 68.20  ? 224 LYS B O     1 
ATOM   5139 C  CB    . LYS B  1  249 ? 9.468   51.504  224.687 1.00 77.53  ? 224 LYS B CB    1 
ATOM   5140 N  N     . ASN B  1  307 ? 5.051   56.975  231.042 1.00 79.76  ? 282 ASN B N     1 
ATOM   5141 C  CA    . ASN B  1  307 ? 4.426   56.028  231.953 1.00 79.56  ? 282 ASN B CA    1 
ATOM   5142 C  C     . ASN B  1  307 ? 5.416   54.938  232.403 1.00 87.75  ? 282 ASN B C     1 
ATOM   5143 O  O     . ASN B  1  307 ? 6.007   54.226  231.569 1.00 87.92  ? 282 ASN B O     1 
ATOM   5144 C  CB    . ASN B  1  307 ? 3.193   55.395  231.301 1.00 76.15  ? 282 ASN B CB    1 
ATOM   5145 N  N     . SER B  1  308 ? 5.592   54.826  233.724 1.00 87.81  ? 283 SER B N     1 
ATOM   5146 C  CA    . SER B  1  308 ? 6.460   53.823  234.347 1.00 78.61  ? 283 SER B CA    1 
ATOM   5147 C  C     . SER B  1  308 ? 5.633   52.625  234.807 1.00 74.09  ? 283 SER B C     1 
ATOM   5148 O  O     . SER B  1  308 ? 4.417   52.742  234.990 1.00 74.36  ? 283 SER B O     1 
ATOM   5149 C  CB    . SER B  1  308 ? 7.182   54.437  235.552 1.00 75.09  ? 283 SER B CB    1 
ATOM   5150 N  N     . VAL B  1  309 ? 6.298   51.479  234.981 1.00 65.78  ? 284 VAL B N     1 
ATOM   5151 C  CA    . VAL B  1  309 ? 5.717   50.307  235.679 1.00 60.06  ? 284 VAL B CA    1 
ATOM   5152 C  C     . VAL B  1  309 ? 6.724   49.805  236.697 1.00 48.60  ? 284 VAL B C     1 
ATOM   5153 O  O     . VAL B  1  309 ? 7.907   49.734  236.393 1.00 53.21  ? 284 VAL B O     1 
ATOM   5154 C  CB    . VAL B  1  309 ? 5.378   49.141  234.709 1.00 61.52  ? 284 VAL B CB    1 
ATOM   5155 C  CG1   . VAL B  1  309 ? 4.750   47.967  235.461 1.00 61.26  ? 284 VAL B CG1   1 
ATOM   5156 C  CG2   . VAL B  1  309 ? 4.440   49.621  233.608 1.00 63.86  ? 284 VAL B CG2   1 
ATOM   5157 N  N     . VAL B  1  310 ? 6.247   49.460  237.888 1.00 44.64  ? 285 VAL B N     1 
ATOM   5158 C  CA    . VAL B  1  310 ? 7.079   48.887  238.957 1.00 46.37  ? 285 VAL B CA    1 
ATOM   5159 C  C     . VAL B  1  310 ? 6.672   47.426  239.209 1.00 45.81  ? 285 VAL B C     1 
ATOM   5160 O  O     . VAL B  1  310 ? 5.487   47.108  239.232 1.00 45.23  ? 285 VAL B O     1 
ATOM   5161 C  CB    . VAL B  1  310 ? 6.942   49.677  240.297 1.00 47.53  ? 285 VAL B CB    1 
ATOM   5162 C  CG1   . VAL B  1  310 ? 7.831   49.079  241.382 1.00 48.42  ? 285 VAL B CG1   1 
ATOM   5163 C  CG2   . VAL B  1  310 ? 7.295   51.145  240.106 1.00 47.18  ? 285 VAL B CG2   1 
ATOM   5164 N  N     . PHE B  1  311 ? 7.663   46.559  239.406 1.00 43.00  ? 286 PHE B N     1 
ATOM   5165 C  CA    . PHE B  1  311 ? 7.436   45.131  239.612 1.00 42.87  ? 286 PHE B CA    1 
ATOM   5166 C  C     . PHE B  1  311 ? 7.889   44.786  241.014 1.00 43.53  ? 286 PHE B C     1 
ATOM   5167 O  O     . PHE B  1  311 ? 8.874   45.345  241.505 1.00 39.27  ? 286 PHE B O     1 
ATOM   5168 C  CB    . PHE B  1  311 ? 8.193   44.298  238.554 1.00 43.77  ? 286 PHE B CB    1 
ATOM   5169 C  CG    . PHE B  1  311 ? 7.641   44.486  237.154 1.00 41.36  ? 286 PHE B CG    1 
ATOM   5170 C  CD1   . PHE B  1  311 ? 6.470   43.835  236.763 1.00 38.57  ? 286 PHE B CD1   1 
ATOM   5171 C  CD2   . PHE B  1  311 ? 8.243   45.353  236.264 1.00 37.97  ? 286 PHE B CD2   1 
ATOM   5172 C  CE1   . PHE B  1  311 ? 5.925   44.035  235.506 1.00 38.45  ? 286 PHE B CE1   1 
ATOM   5173 C  CE2   . PHE B  1  311 ? 7.697   45.561  235.006 1.00 38.95  ? 286 PHE B CE2   1 
ATOM   5174 C  CZ    . PHE B  1  311 ? 6.538   44.898  234.624 1.00 37.30  ? 286 PHE B CZ    1 
ATOM   5175 N  N     . GLY B  1  312 ? 7.155   43.872  241.644 1.00 41.44  ? 287 GLY B N     1 
ATOM   5176 C  CA    . GLY B  1  312 ? 7.449   43.402  242.986 1.00 41.21  ? 287 GLY B CA    1 
ATOM   5177 C  C     . GLY B  1  312 ? 8.705   42.562  243.129 1.00 42.27  ? 287 GLY B C     1 
ATOM   5178 O  O     . GLY B  1  312 ? 9.559   42.517  242.229 1.00 40.14  ? 287 GLY B O     1 
ATOM   5179 N  N     . THR B  1  313 ? 8.785   41.882  244.273 1.00 41.41  ? 288 THR B N     1 
ATOM   5180 C  CA    . THR B  1  313 ? 9.960   41.114  244.694 1.00 42.30  ? 288 THR B CA    1 
ATOM   5181 C  C     . THR B  1  313 ? 9.794   39.596  244.617 1.00 38.54  ? 288 THR B C     1 
ATOM   5182 O  O     . THR B  1  313 ? 10.776  38.882  244.791 1.00 39.56  ? 288 THR B O     1 
ATOM   5183 C  CB    . THR B  1  313 ? 10.299  41.433  246.154 1.00 45.49  ? 288 THR B CB    1 
ATOM   5184 O  OG1   . THR B  1  313 ? 9.147   41.143  246.960 1.00 44.80  ? 288 THR B OG1   1 
ATOM   5185 C  CG2   . THR B  1  313 ? 10.712  42.919  246.304 1.00 46.50  ? 288 THR B CG2   1 
ATOM   5186 N  N     . SER B  1  314 ? 8.574   39.102  244.395 1.00 38.53  ? 289 SER B N     1 
ATOM   5187 C  CA    . SER B  1  314 ? 8.337   37.659  244.269 1.00 39.89  ? 289 SER B CA    1 
ATOM   5188 C  C     . SER B  1  314 ? 8.827   37.113  242.922 1.00 42.18  ? 289 SER B C     1 
ATOM   5189 O  O     . SER B  1  314 ? 9.055   37.860  241.967 1.00 37.92  ? 289 SER B O     1 
ATOM   5190 C  CB    . SER B  1  314 ? 6.861   37.328  244.370 1.00 40.67  ? 289 SER B CB    1 
ATOM   5191 O  OG    . SER B  1  314 ? 6.196   37.662  243.161 1.00 42.31  ? 289 SER B OG    1 
ATOM   5192 N  N     . ALA B  1  315 ? 8.948   35.795  242.867 1.00 42.82  ? 290 ALA B N     1 
ATOM   5193 C  CA    . ALA B  1  315 ? 9.290   35.077  241.641 1.00 41.30  ? 290 ALA B CA    1 
ATOM   5194 C  C     . ALA B  1  315 ? 8.317   35.405  240.491 1.00 39.51  ? 290 ALA B C     1 
ATOM   5195 O  O     . ALA B  1  315 ? 8.758   35.735  239.378 1.00 40.13  ? 290 ALA B O     1 
ATOM   5196 C  CB    . ALA B  1  315 ? 9.339   33.587  241.917 1.00 40.10  ? 290 ALA B CB    1 
ATOM   5197 N  N     . GLN B  1  316 ? 7.016   35.370  240.766 1.00 36.06  ? 291 GLN B N     1 
ATOM   5198 C  CA    . GLN B  1  316 ? 6.019   35.759  239.781 1.00 39.62  ? 291 GLN B CA    1 
ATOM   5199 C  C     . GLN B  1  316 ? 6.257   37.172  239.228 1.00 43.85  ? 291 GLN B C     1 
ATOM   5200 O  O     . GLN B  1  316 ? 6.128   37.388  238.014 1.00 40.21  ? 291 GLN B O     1 
ATOM   5201 C  CB    . GLN B  1  316 ? 4.594   35.643  240.343 1.00 42.62  ? 291 GLN B CB    1 
ATOM   5202 C  CG    . GLN B  1  316 ? 4.110   34.200  240.500 1.00 45.25  ? 291 GLN B CG    1 
ATOM   5203 C  CD    . GLN B  1  316 ? 3.146   33.707  239.402 1.00 45.69  ? 291 GLN B CD    1 
ATOM   5204 O  OE1   . GLN B  1  316 ? 3.259   34.051  238.238 1.00 40.34  ? 291 GLN B OE1   1 
ATOM   5205 N  NE2   . GLN B  1  316 ? 2.205   32.872  239.793 1.00 46.08  ? 291 GLN B NE2   1 
ATOM   5206 N  N     . GLU B  1  317 ? 6.613   38.124  240.106 1.00 42.10  ? 292 GLU B N     1 
ATOM   5207 C  CA    . GLU B  1  317 ? 6.865   39.514  239.681 1.00 42.33  ? 292 GLU B CA    1 
ATOM   5208 C  C     . GLU B  1  317 ? 8.164   39.672  238.876 1.00 37.81  ? 292 GLU B C     1 
ATOM   5209 O  O     . GLU B  1  317 ? 8.231   40.445  237.935 1.00 38.34  ? 292 GLU B O     1 
ATOM   5210 C  CB    . GLU B  1  317 ? 6.839   40.482  240.894 1.00 41.77  ? 292 GLU B CB    1 
ATOM   5211 C  CG    . GLU B  1  317 ? 5.409   40.715  241.411 1.00 43.85  ? 292 GLU B CG    1 
ATOM   5212 C  CD    . GLU B  1  317 ? 4.617   41.681  240.546 1.00 44.91  ? 292 GLU B CD    1 
ATOM   5213 O  OE1   . GLU B  1  317 ? 5.215   42.681  240.069 1.00 47.77  ? 292 GLU B OE1   1 
ATOM   5214 O  OE2   . GLU B  1  317 ? 3.404   41.461  240.350 1.00 44.74  ? 292 GLU B OE2   1 
ATOM   5215 N  N     . VAL B  1  318 ? 9.196   38.944  239.258 1.00 34.07  ? 293 VAL B N     1 
ATOM   5216 C  CA    . VAL B  1  318 ? 10.420  38.900  238.462 1.00 35.75  ? 293 VAL B CA    1 
ATOM   5217 C  C     . VAL B  1  318 ? 10.110  38.439  237.035 1.00 35.95  ? 293 VAL B C     1 
ATOM   5218 O  O     . VAL B  1  318 ? 10.568  39.038  236.057 1.00 36.18  ? 293 VAL B O     1 
ATOM   5219 C  CB    . VAL B  1  318 ? 11.424  37.935  239.099 1.00 35.54  ? 293 VAL B CB    1 
ATOM   5220 C  CG1   . VAL B  1  318 ? 12.613  37.628  238.165 1.00 36.06  ? 293 VAL B CG1   1 
ATOM   5221 C  CG2   . VAL B  1  318 ? 11.929  38.547  240.395 1.00 37.76  ? 293 VAL B CG2   1 
ATOM   5222 N  N     . VAL B  1  319 ? 9.323   37.378  236.923 1.00 34.71  ? 294 VAL B N     1 
ATOM   5223 C  CA    . VAL B  1  319 ? 9.053   36.780  235.619 1.00 33.72  ? 294 VAL B CA    1 
ATOM   5224 C  C     . VAL B  1  319 ? 8.167   37.692  234.819 1.00 36.02  ? 294 VAL B C     1 
ATOM   5225 O  O     . VAL B  1  319 ? 8.347   37.776  233.619 1.00 34.58  ? 294 VAL B O     1 
ATOM   5226 C  CB    . VAL B  1  319 ? 8.457   35.374  235.761 1.00 36.18  ? 294 VAL B CB    1 
ATOM   5227 C  CG1   . VAL B  1  319 ? 7.999   34.824  234.412 1.00 37.88  ? 294 VAL B CG1   1 
ATOM   5228 C  CG2   . VAL B  1  319 ? 9.513   34.451  236.367 1.00 35.23  ? 294 VAL B CG2   1 
ATOM   5229 N  N     . LYS B  1  320 ? 7.216   38.377  235.474 1.00 36.86  ? 295 LYS B N     1 
ATOM   5230 C  CA    . LYS B  1  320 ? 6.458   39.451  234.818 1.00 38.11  ? 295 LYS B CA    1 
ATOM   5231 C  C     . LYS B  1  320 ? 7.368   40.541  234.305 1.00 36.58  ? 295 LYS B C     1 
ATOM   5232 O  O     . LYS B  1  320 ? 7.170   41.050  233.199 1.00 34.06  ? 295 LYS B O     1 
ATOM   5233 C  CB    . LYS B  1  320 ? 5.425   40.067  235.759 1.00 42.42  ? 295 LYS B CB    1 
ATOM   5234 C  CG    . LYS B  1  320 ? 4.173   39.221  235.857 1.00 46.14  ? 295 LYS B CG    1 
ATOM   5235 C  CD    . LYS B  1  320 ? 2.998   40.031  236.358 1.00 52.17  ? 295 LYS B CD    1 
ATOM   5236 C  CE    . LYS B  1  320 ? 2.750   39.780  237.818 1.00 56.56  ? 295 LYS B CE    1 
ATOM   5237 N  NZ    . LYS B  1  320 ? 1.847   40.839  238.350 1.00 64.80  ? 295 LYS B NZ    1 
ATOM   5238 N  N     . GLU B  1  321 ? 8.372   40.891  235.104 1.00 34.71  ? 296 GLU B N     1 
ATOM   5239 C  CA    . GLU B  1  321 ? 9.306   41.939  234.713 1.00 37.58  ? 296 GLU B CA    1 
ATOM   5240 C  C     . GLU B  1  321 ? 10.094  41.460  233.462 1.00 38.41  ? 296 GLU B C     1 
ATOM   5241 O  O     . GLU B  1  321 ? 10.215  42.207  232.510 1.00 35.59  ? 296 GLU B O     1 
ATOM   5242 C  CB    . GLU B  1  321 ? 10.239  42.302  235.873 1.00 36.42  ? 296 GLU B CB    1 
ATOM   5243 C  CG    . GLU B  1  321 ? 11.245  43.403  235.568 1.00 37.56  ? 296 GLU B CG    1 
ATOM   5244 C  CD    . GLU B  1  321 ? 12.087  43.729  236.784 1.00 39.06  ? 296 GLU B CD    1 
ATOM   5245 O  OE1   . GLU B  1  321 ? 11.569  44.487  237.634 1.00 39.51  ? 296 GLU B OE1   1 
ATOM   5246 O  OE2   . GLU B  1  321 ? 13.250  43.248  236.903 1.00 37.84  ? 296 GLU B OE2   1 
ATOM   5247 N  N     . ILE B  1  322 ? 10.586  40.216  233.476 1.00 39.13  ? 297 ILE B N     1 
ATOM   5248 C  CA    . ILE B  1  322 ? 11.303  39.647  232.315 1.00 36.78  ? 297 ILE B CA    1 
ATOM   5249 C  C     . ILE B  1  322 ? 10.438  39.693  231.053 1.00 33.85  ? 297 ILE B C     1 
ATOM   5250 O  O     . ILE B  1  322 ? 10.870  40.192  230.000 1.00 32.29  ? 297 ILE B O     1 
ATOM   5251 C  CB    . ILE B  1  322 ? 11.831  38.229  232.587 1.00 36.54  ? 297 ILE B CB    1 
ATOM   5252 C  CG1   . ILE B  1  322 ? 12.992  38.282  233.588 1.00 37.20  ? 297 ILE B CG1   1 
ATOM   5253 C  CG2   . ILE B  1  322 ? 12.352  37.556  231.295 1.00 36.23  ? 297 ILE B CG2   1 
ATOM   5254 C  CD1   . ILE B  1  322 ? 13.193  37.001  234.367 1.00 36.60  ? 297 ILE B CD1   1 
ATOM   5255 N  N     . ARG B  1  323 ? 9.198   39.246  231.177 1.00 31.60  ? 298 ARG B N     1 
ATOM   5256 C  CA    . ARG B  1  323 ? 8.287   39.204  230.029 1.00 31.81  ? 298 ARG B CA    1 
ATOM   5257 C  C     . ARG B  1  323 ? 7.882   40.593  229.513 1.00 34.33  ? 298 ARG B C     1 
ATOM   5258 O  O     . ARG B  1  323 ? 7.740   40.800  228.295 1.00 31.32  ? 298 ARG B O     1 
ATOM   5259 C  CB    . ARG B  1  323 ? 7.038   38.363  230.351 1.00 33.17  ? 298 ARG B CB    1 
ATOM   5260 C  CG    . ARG B  1  323 ? 7.359   36.893  230.538 1.00 34.96  ? 298 ARG B CG    1 
ATOM   5261 C  CD    . ARG B  1  323 ? 6.163   36.070  230.952 1.00 35.68  ? 298 ARG B CD    1 
ATOM   5262 N  NE    . ARG B  1  323 ? 5.018   36.410  230.123 1.00 37.92  ? 298 ARG B NE    1 
ATOM   5263 C  CZ    . ARG B  1  323 ? 3.841   36.838  230.552 1.00 40.80  ? 298 ARG B CZ    1 
ATOM   5264 N  NH1   . ARG B  1  323 ? 2.905   37.132  229.664 1.00 44.01  ? 298 ARG B NH1   1 
ATOM   5265 N  NH2   . ARG B  1  323 ? 3.560   36.947  231.846 1.00 42.54  ? 298 ARG B NH2   1 
ATOM   5266 N  N     . PHE B  1  324 ? 7.667   41.530  230.443 1.00 34.98  ? 299 PHE B N     1 
ATOM   5267 C  CA    . PHE B  1  324 ? 7.458   42.926  230.092 1.00 34.86  ? 299 PHE B CA    1 
ATOM   5268 C  C     . PHE B  1  324 ? 8.660   43.471  229.318 1.00 33.75  ? 299 PHE B C     1 
ATOM   5269 O  O     . PHE B  1  324 ? 8.474   44.065  228.274 1.00 34.53  ? 299 PHE B O     1 
ATOM   5270 C  CB    . PHE B  1  324 ? 7.193   43.779  231.344 1.00 38.30  ? 299 PHE B CB    1 
ATOM   5271 C  CG    . PHE B  1  324 ? 7.110   45.246  231.067 1.00 36.77  ? 299 PHE B CG    1 
ATOM   5272 C  CD1   . PHE B  1  324 ? 5.908   45.817  230.682 1.00 38.83  ? 299 PHE B CD1   1 
ATOM   5273 C  CD2   . PHE B  1  324 ? 8.241   46.059  231.189 1.00 39.11  ? 299 PHE B CD2   1 
ATOM   5274 C  CE1   . PHE B  1  324 ? 5.825   47.182  230.424 1.00 38.24  ? 299 PHE B CE1   1 
ATOM   5275 C  CE2   . PHE B  1  324 ? 8.164   47.435  230.944 1.00 40.42  ? 299 PHE B CE2   1 
ATOM   5276 C  CZ    . PHE B  1  324 ? 6.951   47.988  230.548 1.00 39.57  ? 299 PHE B CZ    1 
ATOM   5277 N  N     . ARG B  1  325 ? 9.874   43.256  229.818 1.00 31.69  ? 300 ARG B N     1 
ATOM   5278 C  CA    . ARG B  1  325 ? 11.069  43.774  229.147 1.00 33.61  ? 300 ARG B CA    1 
ATOM   5279 C  C     . ARG B  1  325 ? 11.257  43.221  227.724 1.00 33.64  ? 300 ARG B C     1 
ATOM   5280 O  O     . ARG B  1  325 ? 11.592  43.960  226.813 1.00 33.52  ? 300 ARG B O     1 
ATOM   5281 C  CB    . ARG B  1  325 ? 12.335  43.541  229.990 1.00 34.43  ? 300 ARG B CB    1 
ATOM   5282 C  CG    . ARG B  1  325 ? 12.422  44.472  231.220 1.00 35.76  ? 300 ARG B CG    1 
ATOM   5283 C  CD    . ARG B  1  325 ? 13.619  44.141  232.089 1.00 34.70  ? 300 ARG B CD    1 
ATOM   5284 N  NE    . ARG B  1  325 ? 14.865  44.527  231.455 1.00 34.64  ? 300 ARG B NE    1 
ATOM   5285 C  CZ    . ARG B  1  325 ? 16.080  44.215  231.899 1.00 37.60  ? 300 ARG B CZ    1 
ATOM   5286 N  NH1   . ARG B  1  325 ? 16.248  43.501  232.991 1.00 39.48  ? 300 ARG B NH1   1 
ATOM   5287 N  NH2   . ARG B  1  325 ? 17.152  44.598  231.218 1.00 39.33  ? 300 ARG B NH2   1 
ATOM   5288 N  N     . ILE B  1  326 ? 11.012  41.925  227.548 1.00 37.38  ? 301 ILE B N     1 
ATOM   5289 C  CA    . ILE B  1  326 ? 11.100  41.273  226.231 1.00 34.16  ? 301 ILE B CA    1 
ATOM   5290 C  C     . ILE B  1  326 ? 10.121  41.931  225.278 1.00 32.76  ? 301 ILE B C     1 
ATOM   5291 O  O     . ILE B  1  326 ? 10.509  42.340  224.180 1.00 32.86  ? 301 ILE B O     1 
ATOM   5292 C  CB    . ILE B  1  326 ? 10.858  39.747  226.338 1.00 34.80  ? 301 ILE B CB    1 
ATOM   5293 C  CG1   . ILE B  1  326 ? 12.064  39.091  227.019 1.00 33.52  ? 301 ILE B CG1   1 
ATOM   5294 C  CG2   . ILE B  1  326 ? 10.571  39.121  224.965 1.00 35.02  ? 301 ILE B CG2   1 
ATOM   5295 C  CD1   . ILE B  1  326 ? 11.758  37.737  227.612 1.00 37.72  ? 301 ILE B CD1   1 
ATOM   5296 N  N     . GLU B  1  327 ? 8.878   42.072  225.695 1.00 31.35  ? 302 GLU B N     1 
ATOM   5297 C  CA    . GLU B  1  327 ? 7.880   42.736  224.844 1.00 35.83  ? 302 GLU B CA    1 
ATOM   5298 C  C     . GLU B  1  327 ? 8.224   44.204  224.540 1.00 40.70  ? 302 GLU B C     1 
ATOM   5299 O  O     . GLU B  1  327 ? 7.987   44.649  223.424 1.00 38.75  ? 302 GLU B O     1 
ATOM   5300 C  CB    . GLU B  1  327 ? 6.449   42.610  225.390 1.00 38.29  ? 302 GLU B CB    1 
ATOM   5301 C  CG    . GLU B  1  327 ? 5.400   43.162  224.435 1.00 42.10  ? 302 GLU B CG    1 
ATOM   5302 C  CD    . GLU B  1  327 ? 3.963   42.962  224.900 1.00 50.93  ? 302 GLU B CD    1 
ATOM   5303 O  OE1   . GLU B  1  327 ? 3.721   42.369  225.981 1.00 50.01  ? 302 GLU B OE1   1 
ATOM   5304 O  OE2   . GLU B  1  327 ? 3.051   43.412  224.162 1.00 57.16  ? 302 GLU B OE2   1 
ATOM   5305 N  N     . GLN B  1  328 ? 8.806   44.940  225.490 1.00 39.02  ? 303 GLN B N     1 
ATOM   5306 C  CA    . GLN B  1  328 ? 9.223   46.315  225.198 1.00 42.06  ? 303 GLN B CA    1 
ATOM   5307 C  C     . GLN B  1  328 ? 10.411  46.358  224.253 1.00 39.48  ? 303 GLN B C     1 
ATOM   5308 O  O     . GLN B  1  328 ? 10.474  47.242  223.416 1.00 37.49  ? 303 GLN B O     1 
ATOM   5309 C  CB    . GLN B  1  328 ? 9.544   47.139  226.476 1.00 44.00  ? 303 GLN B CB    1 
ATOM   5310 C  CG    . GLN B  1  328 ? 8.378   47.289  227.455 1.00 45.69  ? 303 GLN B CG    1 
ATOM   5311 C  CD    . GLN B  1  328 ? 7.046   47.684  226.798 1.00 50.20  ? 303 GLN B CD    1 
ATOM   5312 O  OE1   . GLN B  1  328 ? 6.957   48.702  226.118 1.00 56.38  ? 303 GLN B OE1   1 
ATOM   5313 N  NE2   . GLN B  1  328 ? 6.005   46.893  227.027 1.00 53.70  ? 303 GLN B NE2   1 
ATOM   5314 N  N     . LYS B  1  329 ? 11.349  45.423  224.374 1.00 36.81  ? 304 LYS B N     1 
ATOM   5315 C  CA    . LYS B  1  329 ? 12.546  45.492  223.534 1.00 39.56  ? 304 LYS B CA    1 
ATOM   5316 C  C     . LYS B  1  329 ? 12.314  44.966  222.095 1.00 39.61  ? 304 LYS B C     1 
ATOM   5317 O  O     . LYS B  1  329 ? 12.811  45.559  221.149 1.00 36.56  ? 304 LYS B O     1 
ATOM   5318 C  CB    . LYS B  1  329 ? 13.758  44.808  224.182 1.00 38.91  ? 304 LYS B CB    1 
ATOM   5319 C  CG    . LYS B  1  329 ? 15.004  44.960  223.314 1.00 43.95  ? 304 LYS B CG    1 
ATOM   5320 C  CD    . LYS B  1  329 ? 16.300  45.110  224.080 1.00 47.95  ? 304 LYS B CD    1 
ATOM   5321 C  CE    . LYS B  1  329 ? 16.697  43.830  224.786 1.00 46.47  ? 304 LYS B CE    1 
ATOM   5322 N  NZ    . LYS B  1  329 ? 18.179  43.603  224.862 1.00 43.36  ? 304 LYS B NZ    1 
ATOM   5323 N  N     . THR B  1  330 ? 11.617  43.855  221.972 1.00 37.01  ? 305 THR B N     1 
ATOM   5324 C  CA    . THR B  1  330 ? 11.411  43.171  220.732 1.00 34.51  ? 305 THR B CA    1 
ATOM   5325 C  C     . THR B  1  330 ? 10.049  43.214  220.107 1.00 35.47  ? 305 THR B C     1 
ATOM   5326 O  O     . THR B  1  330 ? 9.911   42.844  218.994 1.00 33.84  ? 305 THR B O     1 
ATOM   5327 C  CB    . THR B  1  330 ? 11.745  41.690  220.929 1.00 35.71  ? 305 THR B CB    1 
ATOM   5328 O  OG1   . THR B  1  330 ? 10.704  41.058  221.648 1.00 36.24  ? 305 THR B OG1   1 
ATOM   5329 C  CG2   . THR B  1  330 ? 13.005  41.526  221.676 1.00 37.84  ? 305 THR B CG2   1 
ATOM   5330 N  N     . THR B  1  331 ? 9.058   43.648  220.851 1.00 33.89  ? 306 THR B N     1 
ATOM   5331 C  CA    . THR B  1  331 ? 7.678   43.736  220.413 1.00 35.93  ? 306 THR B CA    1 
ATOM   5332 C  C     . THR B  1  331 ? 7.021   42.356  220.340 1.00 39.43  ? 306 THR B C     1 
ATOM   5333 O  O     . THR B  1  331 ? 6.010   42.185  219.723 1.00 40.12  ? 306 THR B O     1 
ATOM   5334 C  CB    . THR B  1  331 ? 7.505   44.499  219.076 1.00 38.89  ? 306 THR B CB    1 
ATOM   5335 O  OG1   . THR B  1  331 ? 8.461   45.535  218.967 1.00 36.24  ? 306 THR B OG1   1 
ATOM   5336 C  CG2   . THR B  1  331 ? 6.161   45.116  218.984 1.00 39.94  ? 306 THR B CG2   1 
ATOM   5337 N  N     . LEU B  1  332 ? 7.621   41.380  220.982 1.00 37.98  ? 307 LEU B N     1 
ATOM   5338 C  CA    . LEU B  1  332 ? 7.109   40.042  220.952 1.00 39.51  ? 307 LEU B CA    1 
ATOM   5339 C  C     . LEU B  1  332 ? 6.830   39.527  222.324 1.00 39.34  ? 307 LEU B C     1 
ATOM   5340 O  O     . LEU B  1  332 ? 7.453   39.952  223.248 1.00 38.45  ? 307 LEU B O     1 
ATOM   5341 C  CB    . LEU B  1  332 ? 8.143   39.121  220.326 1.00 40.68  ? 307 LEU B CB    1 
ATOM   5342 C  CG    . LEU B  1  332 ? 8.721   39.558  219.002 1.00 40.85  ? 307 LEU B CG    1 
ATOM   5343 C  CD1   . LEU B  1  332 ? 10.025  38.869  218.753 1.00 41.95  ? 307 LEU B CD1   1 
ATOM   5344 C  CD2   . LEU B  1  332 ? 7.737   39.270  217.907 1.00 40.02  ? 307 LEU B CD2   1 
ATOM   5345 N  N     . THR B  1  333 ? 5.914   38.583  222.437 1.00 34.26  ? 308 THR B N     1 
ATOM   5346 C  CA    . THR B  1  333 ? 5.608   38.000  223.727 1.00 34.19  ? 308 THR B CA    1 
ATOM   5347 C  C     . THR B  1  333 ? 6.370   36.695  223.992 1.00 35.24  ? 308 THR B C     1 
ATOM   5348 O  O     . THR B  1  333 ? 6.712   35.937  223.066 1.00 31.63  ? 308 THR B O     1 
ATOM   5349 C  CB    . THR B  1  333 ? 4.092   37.743  223.884 1.00 36.33  ? 308 THR B CB    1 
ATOM   5350 O  OG1   . THR B  1  333 ? 3.623   36.853  222.868 1.00 38.86  ? 308 THR B OG1   1 
ATOM   5351 C  CG2   . THR B  1  333 ? 3.320   39.047  223.815 1.00 37.41  ? 308 THR B CG2   1 
ATOM   5352 N  N     . ALA B  1  334 ? 6.603   36.433  225.279 1.00 35.04  ? 309 ALA B N     1 
ATOM   5353 C  CA    . ALA B  1  334 ? 7.048   35.128  225.768 1.00 33.68  ? 309 ALA B CA    1 
ATOM   5354 C  C     . ALA B  1  334 ? 6.081   34.563  226.806 1.00 35.71  ? 309 ALA B C     1 
ATOM   5355 O  O     . ALA B  1  334 ? 5.309   35.300  227.439 1.00 33.05  ? 309 ALA B O     1 
ATOM   5356 C  CB    . ALA B  1  334 ? 8.430   35.244  226.357 1.00 32.47  ? 309 ALA B CB    1 
ATOM   5357 N  N     . SER B  1  335 ? 6.100   33.240  226.948 1.00 34.49  ? 310 SER B N     1 
ATOM   5358 C  CA    . SER B  1  335 ? 5.447   32.580  228.059 1.00 33.38  ? 310 SER B CA    1 
ATOM   5359 C  C     . SER B  1  335 ? 6.520   32.040  228.985 1.00 35.14  ? 310 SER B C     1 
ATOM   5360 O  O     . SER B  1  335 ? 7.684   31.862  228.583 1.00 33.84  ? 310 SER B O     1 
ATOM   5361 C  CB    . SER B  1  335 ? 4.534   31.469  227.571 1.00 33.88  ? 310 SER B CB    1 
ATOM   5362 O  OG    . SER B  1  335 ? 3.447   32.035  226.898 1.00 34.66  ? 310 SER B OG    1 
ATOM   5363 N  N     . ALA B  1  336 ? 6.151   31.831  230.246 1.00 35.22  ? 311 ALA B N     1 
ATOM   5364 C  CA    . ALA B  1  336 ? 7.139   31.424  231.226 1.00 33.91  ? 311 ALA B CA    1 
ATOM   5365 C  C     . ALA B  1  336 ? 6.588   30.446  232.247 1.00 32.88  ? 311 ALA B C     1 
ATOM   5366 O  O     . ALA B  1  336 ? 5.409   30.422  232.537 1.00 32.53  ? 311 ALA B O     1 
ATOM   5367 C  CB    . ALA B  1  336 ? 7.758   32.647  231.907 1.00 33.67  ? 311 ALA B CB    1 
ATOM   5368 N  N     . GLY B  1  337 ? 7.472   29.590  232.722 1.00 32.52  ? 312 GLY B N     1 
ATOM   5369 C  CA    . GLY B  1  337 ? 7.164   28.603  233.747 1.00 36.47  ? 312 GLY B CA    1 
ATOM   5370 C  C     . GLY B  1  337 ? 8.159   28.768  234.889 1.00 35.07  ? 312 GLY B C     1 
ATOM   5371 O  O     . GLY B  1  337 ? 9.350   28.997  234.648 1.00 33.95  ? 312 GLY B O     1 
ATOM   5372 N  N     . ILE B  1  338 ? 7.654   28.656  236.118 1.00 35.16  ? 313 ILE B N     1 
ATOM   5373 C  CA    . ILE B  1  338 ? 8.446   28.828  237.347 1.00 36.17  ? 313 ILE B CA    1 
ATOM   5374 C  C     . ILE B  1  338 ? 8.242   27.606  238.248 1.00 33.35  ? 313 ILE B C     1 
ATOM   5375 O  O     . ILE B  1  338 ? 7.123   27.247  238.577 1.00 34.03  ? 313 ILE B O     1 
ATOM   5376 C  CB    . ILE B  1  338 ? 7.972   30.061  238.158 1.00 38.10  ? 313 ILE B CB    1 
ATOM   5377 C  CG1   . ILE B  1  338 ? 7.797   31.274  237.235 1.00 39.61  ? 313 ILE B CG1   1 
ATOM   5378 C  CG2   . ILE B  1  338 ? 8.953   30.329  239.300 1.00 38.39  ? 313 ILE B CG2   1 
ATOM   5379 C  CD1   . ILE B  1  338 ? 7.003   32.410  237.860 1.00 43.96  ? 313 ILE B CD1   1 
ATOM   5380 N  N     . ALA B  1  339 ? 9.321   27.001  238.690 1.00 35.84  ? 314 ALA B N     1 
ATOM   5381 C  CA    . ALA B  1  339 ? 9.219   25.734  239.387 1.00 36.91  ? 314 ALA B CA    1 
ATOM   5382 C  C     . ALA B  1  339 ? 10.535  25.426  240.053 1.00 35.92  ? 314 ALA B C     1 
ATOM   5383 O  O     . ALA B  1  339 ? 11.533  26.059  239.740 1.00 37.58  ? 314 ALA B O     1 
ATOM   5384 C  CB    . ALA B  1  339 ? 8.834   24.604  238.408 1.00 36.86  ? 314 ALA B CB    1 
ATOM   5385 N  N     . PRO B  1  340 ? 10.542  24.441  240.971 1.00 38.22  ? 315 PRO B N     1 
ATOM   5386 C  CA    . PRO B  1  340 ? 11.785  24.032  241.629 1.00 38.61  ? 315 PRO B CA    1 
ATOM   5387 C  C     . PRO B  1  340 ? 12.801  23.311  240.781 1.00 38.67  ? 315 PRO B C     1 
ATOM   5388 O  O     . PRO B  1  340 ? 13.939  23.156  241.221 1.00 40.59  ? 315 PRO B O     1 
ATOM   5389 C  CB    . PRO B  1  340 ? 11.308  23.097  242.750 1.00 40.08  ? 315 PRO B CB    1 
ATOM   5390 C  CG    . PRO B  1  340 ? 9.904   23.488  242.980 1.00 39.84  ? 315 PRO B CG    1 
ATOM   5391 C  CD    . PRO B  1  340 ? 9.370   23.826  241.623 1.00 37.88  ? 315 PRO B CD    1 
ATOM   5392 N  N     . ASN B  1  341 ? 12.422  22.849  239.591 1.00 38.65  ? 316 ASN B N     1 
ATOM   5393 C  CA    . ASN B  1  341 ? 13.373  22.156  238.727 1.00 37.70  ? 316 ASN B CA    1 
ATOM   5394 C  C     . ASN B  1  341 ? 13.036  22.345  237.247 1.00 36.16  ? 316 ASN B C     1 
ATOM   5395 O  O     . ASN B  1  341 ? 11.936  22.805  236.906 1.00 33.92  ? 316 ASN B O     1 
ATOM   5396 C  CB    . ASN B  1  341 ? 13.433  20.655  239.111 1.00 38.74  ? 316 ASN B CB    1 
ATOM   5397 C  CG    . ASN B  1  341 ? 12.130  19.928  238.870 1.00 40.92  ? 316 ASN B CG    1 
ATOM   5398 O  OD1   . ASN B  1  341 ? 11.660  19.838  237.729 1.00 41.79  ? 316 ASN B OD1   1 
ATOM   5399 N  ND2   . ASN B  1  341 ? 11.532  19.386  239.942 1.00 40.52  ? 316 ASN B ND2   1 
ATOM   5400 N  N     . THR B  1  342 ? 13.963  21.935  236.386 1.00 34.82  ? 317 THR B N     1 
ATOM   5401 C  CA    . THR B  1  342 ? 13.833  22.186  234.935 1.00 38.42  ? 317 THR B CA    1 
ATOM   5402 C  C     . THR B  1  342 ? 12.689  21.433  234.279 1.00 36.90  ? 317 THR B C     1 
ATOM   5403 O  O     . THR B  1  342 ? 11.973  21.980  233.435 1.00 36.07  ? 317 THR B O     1 
ATOM   5404 C  CB    . THR B  1  342 ? 15.114  21.817  234.219 1.00 40.41  ? 317 THR B CB    1 
ATOM   5405 O  OG1   . THR B  1  342 ? 15.476  20.482  234.577 1.00 40.65  ? 317 THR B OG1   1 
ATOM   5406 C  CG2   . THR B  1  342 ? 16.244  22.766  234.637 1.00 42.37  ? 317 THR B CG2   1 
ATOM   5407 N  N     . MET B  1  343 ? 12.506  20.181  234.687 1.00 37.78  ? 318 MET B N     1 
ATOM   5408 C  CA    . MET B  1  343 ? 11.432  19.343  234.154 1.00 38.09  ? 318 MET B CA    1 
ATOM   5409 C  C     . MET B  1  343 ? 10.080  20.028  234.373 1.00 37.10  ? 318 MET B C     1 
ATOM   5410 O  O     . MET B  1  343 ? 9.297   20.200  233.434 1.00 35.30  ? 318 MET B O     1 
ATOM   5411 C  CB    . MET B  1  343 ? 11.462  17.955  234.815 1.00 42.65  ? 318 MET B CB    1 
ATOM   5412 C  CG    . MET B  1  343 ? 10.516  16.940  234.201 1.00 44.27  ? 318 MET B CG    1 
ATOM   5413 S  SD    . MET B  1  343 ? 8.805   17.075  234.751 1.00 50.31  ? 318 MET B SD    1 
ATOM   5414 C  CE    . MET B  1  343 ? 8.963   16.275  236.359 1.00 52.38  ? 318 MET B CE    1 
ATOM   5415 N  N     . LEU B  1  344 ? 9.830   20.472  235.599 1.00 34.11  ? 319 LEU B N     1 
ATOM   5416 C  CA    . LEU B  1  344 ? 8.553   21.120  235.915 1.00 34.15  ? 319 LEU B CA    1 
ATOM   5417 C  C     . LEU B  1  344 ? 8.417   22.498  235.277 1.00 32.07  ? 319 LEU B C     1 
ATOM   5418 O  O     . LEU B  1  344 ? 7.328   22.891  234.796 1.00 31.56  ? 319 LEU B O     1 
ATOM   5419 C  CB    . LEU B  1  344 ? 8.386   21.231  237.426 1.00 35.83  ? 319 LEU B CB    1 
ATOM   5420 C  CG    . LEU B  1  344 ? 8.233   19.915  238.198 1.00 38.51  ? 319 LEU B CG    1 
ATOM   5421 C  CD1   . LEU B  1  344 ? 8.247   20.209  239.686 1.00 40.64  ? 319 LEU B CD1   1 
ATOM   5422 C  CD2   . LEU B  1  344 ? 6.946   19.201  237.805 1.00 38.24  ? 319 LEU B CD2   1 
ATOM   5423 N  N     . ALA B  1  345 ? 9.518   23.242  235.276 1.00 31.21  ? 320 ALA B N     1 
ATOM   5424 C  CA    . ALA B  1  345 ? 9.537   24.600  234.698 1.00 33.53  ? 320 ALA B CA    1 
ATOM   5425 C  C     . ALA B  1  345 ? 9.064   24.610  233.230 1.00 35.33  ? 320 ALA B C     1 
ATOM   5426 O  O     . ALA B  1  345 ? 8.255   25.454  232.804 1.00 34.59  ? 320 ALA B O     1 
ATOM   5427 C  CB    . ALA B  1  345 ? 10.949  25.153  234.786 1.00 33.43  ? 320 ALA B CB    1 
ATOM   5428 N  N     . LYS B  1  346 ? 9.590   23.665  232.464 1.00 36.18  ? 321 LYS B N     1 
ATOM   5429 C  CA    . LYS B  1  346 ? 9.204   23.519  231.052 1.00 37.07  ? 321 LYS B CA    1 
ATOM   5430 C  C     . LYS B  1  346 ? 7.744   23.173  230.893 1.00 36.78  ? 321 LYS B C     1 
ATOM   5431 O  O     . LYS B  1  346 ? 7.104   23.718  230.026 1.00 38.57  ? 321 LYS B O     1 
ATOM   5432 C  CB    . LYS B  1  346 ? 10.054  22.464  230.348 1.00 41.85  ? 321 LYS B CB    1 
ATOM   5433 C  CG    . LYS B  1  346 ? 9.878   22.459  228.836 1.00 46.82  ? 321 LYS B CG    1 
ATOM   5434 C  CD    . LYS B  1  346 ? 11.220  22.230  228.144 1.00 52.60  ? 321 LYS B CD    1 
ATOM   5435 C  CE    . LYS B  1  346 ? 11.061  21.868  226.676 1.00 53.27  ? 321 LYS B CE    1 
ATOM   5436 N  NZ    . LYS B  1  346 ? 10.388  22.973  225.950 1.00 59.45  ? 321 LYS B NZ    1 
ATOM   5437 N  N     . VAL B  1  347 ? 7.199   22.286  231.727 1.00 36.47  ? 322 VAL B N     1 
ATOM   5438 C  CA    . VAL B  1  347 ? 5.756   22.002  231.660 1.00 37.07  ? 322 VAL B CA    1 
ATOM   5439 C  C     . VAL B  1  347 ? 4.919   23.273  231.914 1.00 38.47  ? 322 VAL B C     1 
ATOM   5440 O  O     . VAL B  1  347 ? 3.927   23.539  231.218 1.00 37.47  ? 322 VAL B O     1 
ATOM   5441 C  CB    . VAL B  1  347 ? 5.350   20.878  232.644 1.00 36.35  ? 322 VAL B CB    1 
ATOM   5442 C  CG1   . VAL B  1  347 ? 3.850   20.691  232.671 1.00 37.76  ? 322 VAL B CG1   1 
ATOM   5443 C  CG2   . VAL B  1  347 ? 6.020   19.565  232.260 1.00 39.59  ? 322 VAL B CG2   1 
ATOM   5444 N  N     . CYS B  1  348 ? 5.330   24.036  232.923 1.00 37.87  ? 323 CYS B N     1 
ATOM   5445 C  CA    . CYS B  1  348 ? 4.647   25.259  233.327 1.00 40.07  ? 323 CYS B CA    1 
ATOM   5446 C  C     . CYS B  1  348 ? 4.654   26.342  232.268 1.00 40.53  ? 323 CYS B C     1 
ATOM   5447 O  O     . CYS B  1  348 ? 3.649   27.049  232.130 1.00 44.30  ? 323 CYS B O     1 
ATOM   5448 C  CB    . CYS B  1  348 ? 5.285   25.838  234.598 1.00 39.56  ? 323 CYS B CB    1 
ATOM   5449 S  SG    . CYS B  1  348 ? 4.974   24.798  236.033 1.00 43.48  ? 323 CYS B SG    1 
ATOM   5450 N  N     . SER B  1  349 ? 5.766   26.485  231.537 1.00 36.52  ? 324 SER B N     1 
ATOM   5451 C  CA    . SER B  1  349 ? 5.828   27.488  230.485 1.00 37.44  ? 324 SER B CA    1 
ATOM   5452 C  C     . SER B  1  349 ? 4.795   27.249  229.389 1.00 40.08  ? 324 SER B C     1 
ATOM   5453 O  O     . SER B  1  349 ? 4.291   28.202  228.800 1.00 44.39  ? 324 SER B O     1 
ATOM   5454 C  CB    . SER B  1  349 ? 7.242   27.637  229.913 1.00 37.07  ? 324 SER B CB    1 
ATOM   5455 O  OG    . SER B  1  349 ? 7.619   26.499  229.163 1.00 35.91  ? 324 SER B OG    1 
ATOM   5456 N  N     . ASP B  1  350 ? 4.459   25.989  229.143 1.00 42.59  ? 325 ASP B N     1 
ATOM   5457 C  CA    . ASP B  1  350 ? 3.434   25.647  228.157 1.00 46.96  ? 325 ASP B CA    1 
ATOM   5458 C  C     . ASP B  1  350 ? 2.000   25.843  228.665 1.00 46.11  ? 325 ASP B C     1 
ATOM   5459 O  O     . ASP B  1  350 ? 1.080   25.990  227.876 1.00 44.67  ? 325 ASP B O     1 
ATOM   5460 C  CB    . ASP B  1  350 ? 3.611   24.195  227.662 1.00 50.20  ? 325 ASP B CB    1 
ATOM   5461 C  CG    . ASP B  1  350 ? 3.513   24.091  226.147 1.00 60.87  ? 325 ASP B CG    1 
ATOM   5462 O  OD1   . ASP B  1  350 ? 4.469   24.604  225.484 1.00 56.20  ? 325 ASP B OD1   1 
ATOM   5463 O  OD2   . ASP B  1  350 ? 2.497   23.535  225.638 1.00 60.74  ? 325 ASP B OD2   1 
ATOM   5464 N  N     . LYS B  1  351 ? 1.804   25.853  229.978 1.00 47.68  ? 326 LYS B N     1 
ATOM   5465 C  CA    . LYS B  1  351 ? 0.447   25.767  230.541 1.00 46.92  ? 326 LYS B CA    1 
ATOM   5466 C  C     . LYS B  1  351 ? -0.483  26.949  230.227 1.00 46.09  ? 326 LYS B C     1 
ATOM   5467 O  O     . LYS B  1  351 ? -1.632  26.735  229.880 1.00 46.88  ? 326 LYS B O     1 
ATOM   5468 C  CB    . LYS B  1  351 ? 0.538   25.535  232.048 1.00 50.11  ? 326 LYS B CB    1 
ATOM   5469 C  CG    . LYS B  1  351 ? -0.802  25.335  232.730 1.00 53.24  ? 326 LYS B CG    1 
ATOM   5470 C  CD    . LYS B  1  351 ? -0.614  24.631  234.066 1.00 56.42  ? 326 LYS B CD    1 
ATOM   5471 C  CE    . LYS B  1  351 ? -1.911  24.612  234.854 1.00 54.98  ? 326 LYS B CE    1 
ATOM   5472 N  NZ    . LYS B  1  351 ? -2.966  23.833  234.157 1.00 58.18  ? 326 LYS B NZ    1 
ATOM   5473 N  N     . ASN B  1  352 ? 0.017   28.179  230.348 1.00 47.43  ? 327 ASN B N     1 
ATOM   5474 C  CA    . ASN B  1  352 ? -0.751  29.404  230.022 1.00 48.08  ? 327 ASN B CA    1 
ATOM   5475 C  C     . ASN B  1  352 ? -0.253  30.101  228.746 1.00 47.15  ? 327 ASN B C     1 
ATOM   5476 O  O     . ASN B  1  352 ? -0.384  31.312  228.604 1.00 50.68  ? 327 ASN B O     1 
ATOM   5477 C  CB    . ASN B  1  352 ? -0.696  30.407  231.194 1.00 49.82  ? 327 ASN B CB    1 
ATOM   5478 C  CG    . ASN B  1  352 ? -1.502  29.964  232.395 1.00 52.24  ? 327 ASN B CG    1 
ATOM   5479 O  OD1   . ASN B  1  352 ? -2.389  29.124  232.298 1.00 52.20  ? 327 ASN B OD1   1 
ATOM   5480 N  ND2   . ASN B  1  352 ? -1.200  30.545  233.542 1.00 54.22  ? 327 ASN B ND2   1 
ATOM   5481 N  N     . LYS B  1  353 ? 0.318   29.327  227.826 1.00 43.77  ? 328 LYS B N     1 
ATOM   5482 C  CA    . LYS B  1  353 ? 0.789   29.837  226.548 1.00 42.75  ? 328 LYS B CA    1 
ATOM   5483 C  C     . LYS B  1  353 ? -0.454  30.175  225.699 1.00 42.14  ? 328 LYS B C     1 
ATOM   5484 O  O     . LYS B  1  353 ? -1.418  29.445  225.769 1.00 41.77  ? 328 LYS B O     1 
ATOM   5485 C  CB    . LYS B  1  353 ? 1.624   28.743  225.859 1.00 45.49  ? 328 LYS B CB    1 
ATOM   5486 C  CG    . LYS B  1  353 ? 2.635   29.233  224.858 1.00 47.01  ? 328 LYS B CG    1 
ATOM   5487 C  CD    . LYS B  1  353 ? 3.643   28.148  224.422 1.00 41.72  ? 328 LYS B CD    1 
ATOM   5488 C  CE    . LYS B  1  353 ? 5.080   28.602  224.722 1.00 39.30  ? 328 LYS B CE    1 
ATOM   5489 N  NZ    . LYS B  1  353 ? 5.487   29.829  223.964 1.00 37.09  ? 328 LYS B NZ    1 
ATOM   5490 N  N     . PRO B  1  354 ? -0.472  31.253  224.916 1.00 40.30  ? 329 PRO B N     1 
ATOM   5491 C  CA    . PRO B  1  354 ? 0.619   32.202  224.764 1.00 40.10  ? 329 PRO B CA    1 
ATOM   5492 C  C     . PRO B  1  354 ? 0.473   33.402  225.697 1.00 41.90  ? 329 PRO B C     1 
ATOM   5493 O  O     . PRO B  1  354 ? -0.615  33.656  226.246 1.00 39.94  ? 329 PRO B O     1 
ATOM   5494 C  CB    . PRO B  1  354 ? 0.450   32.659  223.326 1.00 39.96  ? 329 PRO B CB    1 
ATOM   5495 C  CG    . PRO B  1  354 ? -1.039  32.696  223.160 1.00 40.90  ? 329 PRO B CG    1 
ATOM   5496 C  CD    . PRO B  1  354 ? -1.584  31.566  224.005 1.00 41.22  ? 329 PRO B CD    1 
ATOM   5497 N  N     . ASN B  1  355 ? 1.573   34.135  225.838 1.00 39.31  ? 330 ASN B N     1 
ATOM   5498 C  CA    . ASN B  1  355 ? 1.628   35.364  226.612 1.00 42.83  ? 330 ASN B CA    1 
ATOM   5499 C  C     . ASN B  1  355 ? 1.092   35.155  228.021 1.00 40.94  ? 330 ASN B C     1 
ATOM   5500 O  O     . ASN B  1  355 ? 0.248   35.890  228.507 1.00 43.09  ? 330 ASN B O     1 
ATOM   5501 C  CB    . ASN B  1  355 ? 0.873   36.482  225.901 1.00 42.46  ? 330 ASN B CB    1 
ATOM   5502 C  CG    . ASN B  1  355 ? 1.178   37.849  226.483 1.00 45.82  ? 330 ASN B CG    1 
ATOM   5503 O  OD1   . ASN B  1  355 ? 2.229   38.067  227.104 1.00 41.11  ? 330 ASN B OD1   1 
ATOM   5504 N  ND2   . ASN B  1  355 ? 0.254   38.782  226.288 1.00 47.95  ? 330 ASN B ND2   1 
ATOM   5505 N  N     . GLY B  1  356 ? 1.603   34.124  228.661 1.00 41.33  ? 331 GLY B N     1 
ATOM   5506 C  CA    . GLY B  1  356 ? 1.161   33.766  229.985 1.00 45.04  ? 331 GLY B CA    1 
ATOM   5507 C  C     . GLY B  1  356 ? 2.289   33.153  230.769 1.00 45.75  ? 331 GLY B C     1 
ATOM   5508 O  O     . GLY B  1  356 ? 3.391   32.910  230.258 1.00 36.37  ? 331 GLY B O     1 
ATOM   5509 N  N     . GLN B  1  357 ? 1.960   32.842  232.011 1.00 42.51  ? 332 GLN B N     1 
ATOM   5510 C  CA    . GLN B  1  357 ? 2.942   32.564  233.009 1.00 41.52  ? 332 GLN B CA    1 
ATOM   5511 C  C     . GLN B  1  357 ? 2.302   31.574  234.005 1.00 42.01  ? 332 GLN B C     1 
ATOM   5512 O  O     . GLN B  1  357 ? 1.080   31.631  234.232 1.00 39.64  ? 332 GLN B O     1 
ATOM   5513 C  CB    . GLN B  1  357 ? 3.198   33.915  233.646 1.00 46.15  ? 332 GLN B CB    1 
ATOM   5514 C  CG    . GLN B  1  357 ? 4.308   33.980  234.628 1.00 47.30  ? 332 GLN B CG    1 
ATOM   5515 C  CD    . GLN B  1  357 ? 4.569   35.399  235.060 1.00 42.30  ? 332 GLN B CD    1 
ATOM   5516 O  OE1   . GLN B  1  357 ? 4.805   36.284  234.225 1.00 36.70  ? 332 GLN B OE1   1 
ATOM   5517 N  NE2   . GLN B  1  357 ? 4.584   35.617  236.373 1.00 40.04  ? 332 GLN B NE2   1 
ATOM   5518 N  N     . TYR B  1  358 ? 3.100   30.693  234.603 1.00 39.28  ? 333 TYR B N     1 
ATOM   5519 C  CA    . TYR B  1  358 ? 2.590   29.789  235.630 1.00 40.20  ? 333 TYR B CA    1 
ATOM   5520 C  C     . TYR B  1  358 ? 3.687   29.308  236.585 1.00 40.72  ? 333 TYR B C     1 
ATOM   5521 O  O     . TYR B  1  358 ? 4.798   28.934  236.155 1.00 35.55  ? 333 TYR B O     1 
ATOM   5522 C  CB    . TYR B  1  358 ? 1.890   28.594  234.971 1.00 44.55  ? 333 TYR B CB    1 
ATOM   5523 C  CG    . TYR B  1  358 ? 1.195   27.716  235.961 1.00 45.81  ? 333 TYR B CG    1 
ATOM   5524 C  CD1   . TYR B  1  358 ? -0.161  27.887  236.250 1.00 46.82  ? 333 TYR B CD1   1 
ATOM   5525 C  CD2   . TYR B  1  358 ? 1.906   26.716  236.644 1.00 48.18  ? 333 TYR B CD2   1 
ATOM   5526 C  CE1   . TYR B  1  358 ? -0.794  27.067  237.194 1.00 51.31  ? 333 TYR B CE1   1 
ATOM   5527 C  CE2   . TYR B  1  358 ? 1.290   25.897  237.584 1.00 50.53  ? 333 TYR B CE2   1 
ATOM   5528 C  CZ    . TYR B  1  358 ? -0.052  26.072  237.856 1.00 50.59  ? 333 TYR B CZ    1 
ATOM   5529 O  OH    . TYR B  1  358 ? -0.623  25.251  238.794 1.00 59.28  ? 333 TYR B OH    1 
ATOM   5530 N  N     . GLN B  1  359 ? 3.353   29.291  237.886 1.00 40.67  ? 334 GLN B N     1 
ATOM   5531 C  CA    . GLN B  1  359 ? 4.261   28.812  238.935 1.00 40.50  ? 334 GLN B CA    1 
ATOM   5532 C  C     . GLN B  1  359 ? 3.759   27.599  239.741 1.00 41.66  ? 334 GLN B C     1 
ATOM   5533 O  O     . GLN B  1  359 ? 2.597   27.535  240.148 1.00 40.69  ? 334 GLN B O     1 
ATOM   5534 C  CB    . GLN B  1  359 ? 4.597   29.921  239.953 1.00 38.41  ? 334 GLN B CB    1 
ATOM   5535 C  CG    . GLN B  1  359 ? 5.653   29.487  240.986 1.00 35.05  ? 334 GLN B CG    1 
ATOM   5536 C  CD    . GLN B  1  359 ? 6.000   30.568  242.001 1.00 37.33  ? 334 GLN B CD    1 
ATOM   5537 O  OE1   . GLN B  1  359 ? 5.183   31.435  242.298 1.00 35.01  ? 334 GLN B OE1   1 
ATOM   5538 N  NE2   . GLN B  1  359 ? 7.212   30.508  242.541 1.00 35.71  ? 334 GLN B NE2   1 
ATOM   5539 N  N     . ILE B  1  360 ? 4.685   26.682  240.002 1.00 42.25  ? 335 ILE B N     1 
ATOM   5540 C  CA    . ILE B  1  360 ? 4.519   25.638  241.013 1.00 44.96  ? 335 ILE B CA    1 
ATOM   5541 C  C     . ILE B  1  360 ? 5.336   26.093  242.214 1.00 41.70  ? 335 ILE B C     1 
ATOM   5542 O  O     . ILE B  1  360 ? 6.568   26.094  242.154 1.00 39.58  ? 335 ILE B O     1 
ATOM   5543 C  CB    . ILE B  1  360 ? 5.049   24.267  240.539 1.00 44.14  ? 335 ILE B CB    1 
ATOM   5544 C  CG1   . ILE B  1  360 ? 4.228   23.763  239.335 1.00 43.75  ? 335 ILE B CG1   1 
ATOM   5545 C  CG2   . ILE B  1  360 ? 5.001   23.255  241.697 1.00 46.77  ? 335 ILE B CG2   1 
ATOM   5546 C  CD1   . ILE B  1  360 ? 4.836   22.564  238.628 1.00 41.30  ? 335 ILE B CD1   1 
ATOM   5547 N  N     . LEU B  1  361 ? 4.655   26.468  243.297 1.00 44.01  ? 336 LEU B N     1 
ATOM   5548 C  CA    . LEU B  1  361 ? 5.346   26.891  244.525 1.00 44.15  ? 336 LEU B CA    1 
ATOM   5549 C  C     . LEU B  1  361 ? 6.277   25.805  245.047 1.00 44.23  ? 336 LEU B C     1 
ATOM   5550 O  O     . LEU B  1  361 ? 5.953   24.613  244.948 1.00 43.11  ? 336 LEU B O     1 
ATOM   5551 C  CB    . LEU B  1  361 ? 4.333   27.230  245.613 1.00 47.40  ? 336 LEU B CB    1 
ATOM   5552 C  CG    . LEU B  1  361 ? 3.540   28.508  245.360 1.00 46.76  ? 336 LEU B CG    1 
ATOM   5553 C  CD1   . LEU B  1  361 ? 2.312   28.573  246.274 1.00 45.18  ? 336 LEU B CD1   1 
ATOM   5554 C  CD2   . LEU B  1  361 ? 4.463   29.719  245.516 1.00 44.90  ? 336 LEU B CD2   1 
ATOM   5555 N  N     . PRO B  1  362 ? 7.428   26.191  245.625 1.00 43.72  ? 337 PRO B N     1 
ATOM   5556 C  CA    . PRO B  1  362 ? 8.389   25.190  246.026 1.00 45.20  ? 337 PRO B CA    1 
ATOM   5557 C  C     . PRO B  1  362 ? 8.063   24.493  247.381 1.00 48.92  ? 337 PRO B C     1 
ATOM   5558 O  O     . PRO B  1  362 ? 8.870   24.537  248.309 1.00 45.78  ? 337 PRO B O     1 
ATOM   5559 C  CB    . PRO B  1  362 ? 9.700   25.993  246.094 1.00 43.69  ? 337 PRO B CB    1 
ATOM   5560 C  CG    . PRO B  1  362 ? 9.255   27.307  246.590 1.00 43.07  ? 337 PRO B CG    1 
ATOM   5561 C  CD    . PRO B  1  362 ? 7.891   27.541  245.985 1.00 45.42  ? 337 PRO B CD    1 
ATOM   5562 N  N     . ASN B  1  363 ? 6.905   23.838  247.465 1.00 48.05  ? 338 ASN B N     1 
ATOM   5563 C  CA    . ASN B  1  363 ? 6.637   22.852  248.517 1.00 50.51  ? 338 ASN B CA    1 
ATOM   5564 C  C     . ASN B  1  363 ? 6.242   21.498  247.888 1.00 52.46  ? 338 ASN B C     1 
ATOM   5565 O  O     . ASN B  1  363 ? 5.578   21.470  246.831 1.00 51.57  ? 338 ASN B O     1 
ATOM   5566 C  CB    . ASN B  1  363 ? 5.565   23.382  249.476 1.00 47.37  ? 338 ASN B CB    1 
ATOM   5567 C  CG    . ASN B  1  363 ? 4.205   23.512  248.837 1.00 48.07  ? 338 ASN B CG    1 
ATOM   5568 O  OD1   . ASN B  1  363 ? 3.466   22.535  248.733 1.00 49.10  ? 338 ASN B OD1   1 
ATOM   5569 N  ND2   . ASN B  1  363 ? 3.854   24.723  248.421 1.00 50.66  ? 338 ASN B ND2   1 
ATOM   5570 N  N     . ARG B  1  364 ? 6.631   20.393  248.542 1.00 54.43  ? 339 ARG B N     1 
ATOM   5571 C  CA    . ARG B  1  364 ? 6.331   19.017  248.063 1.00 54.57  ? 339 ARG B CA    1 
ATOM   5572 C  C     . ARG B  1  364 ? 4.869   18.816  247.650 1.00 52.02  ? 339 ARG B C     1 
ATOM   5573 O  O     . ARG B  1  364 ? 4.591   18.229  246.607 1.00 54.74  ? 339 ARG B O     1 
ATOM   5574 C  CB    . ARG B  1  364 ? 6.750   17.933  249.090 1.00 56.19  ? 339 ARG B CB    1 
ATOM   5575 C  CG    . ARG B  1  364 ? 6.768   16.511  248.498 1.00 57.66  ? 339 ARG B CG    1 
ATOM   5576 C  CD    . ARG B  1  364 ? 7.183   15.406  249.481 1.00 57.52  ? 339 ARG B CD    1 
ATOM   5577 N  NE    . ARG B  1  364 ? 7.356   14.096  248.816 1.00 52.32  ? 339 ARG B NE    1 
ATOM   5578 C  CZ    . ARG B  1  364 ? 6.357   13.270  248.474 1.00 50.46  ? 339 ARG B CZ    1 
ATOM   5579 N  NH1   . ARG B  1  364 ? 5.063   13.587  248.682 1.00 46.26  ? 339 ARG B NH1   1 
ATOM   5580 N  NH2   . ARG B  1  364 ? 6.655   12.119  247.865 1.00 50.79  ? 339 ARG B NH2   1 
ATOM   5581 N  N     . GLN B  1  365 ? 3.944   19.327  248.443 1.00 51.23  ? 340 GLN B N     1 
ATOM   5582 C  CA    . GLN B  1  365 ? 2.525   19.147  248.168 1.00 54.68  ? 340 GLN B CA    1 
ATOM   5583 C  C     . GLN B  1  365 ? 2.057   19.803  246.852 1.00 52.68  ? 340 GLN B C     1 
ATOM   5584 O  O     . GLN B  1  365 ? 1.277   19.212  246.103 1.00 50.08  ? 340 GLN B O     1 
ATOM   5585 C  CB    . GLN B  1  365 ? 1.698   19.656  249.361 1.00 57.87  ? 340 GLN B CB    1 
ATOM   5586 C  CG    . GLN B  1  365 ? 0.201   19.367  249.274 1.00 67.58  ? 340 GLN B CG    1 
ATOM   5587 C  CD    . GLN B  1  365 ? -0.128  17.904  249.005 1.00 72.32  ? 340 GLN B CD    1 
ATOM   5588 O  OE1   . GLN B  1  365 ? -1.000  17.597  248.192 1.00 80.82  ? 340 GLN B OE1   1 
ATOM   5589 N  NE2   . GLN B  1  365 ? 0.573   16.995  249.679 1.00 72.38  ? 340 GLN B NE2   1 
ATOM   5590 N  N     . ALA B  1  366 ? 2.521   21.020  246.570 1.00 52.12  ? 341 ALA B N     1 
ATOM   5591 C  CA    . ALA B  1  366 ? 2.172   21.691  245.296 1.00 51.22  ? 341 ALA B CA    1 
ATOM   5592 C  C     . ALA B  1  366 ? 2.693   20.899  244.063 1.00 46.19  ? 341 ALA B C     1 
ATOM   5593 O  O     . ALA B  1  366 ? 1.975   20.761  243.076 1.00 45.21  ? 341 ALA B O     1 
ATOM   5594 C  CB    . ALA B  1  366 ? 2.666   23.132  245.283 1.00 49.25  ? 341 ALA B CB    1 
ATOM   5595 N  N     . VAL B  1  367 ? 3.894   20.329  244.185 1.00 41.62  ? 342 VAL B N     1 
ATOM   5596 C  CA    . VAL B  1  367 ? 4.519   19.530  243.145 1.00 44.36  ? 342 VAL B CA    1 
ATOM   5597 C  C     . VAL B  1  367 ? 3.678   18.281  242.863 1.00 49.45  ? 342 VAL B C     1 
ATOM   5598 O  O     . VAL B  1  367 ? 3.420   17.967  241.693 1.00 44.87  ? 342 VAL B O     1 
ATOM   5599 C  CB    . VAL B  1  367 ? 5.959   19.113  243.528 1.00 42.83  ? 342 VAL B CB    1 
ATOM   5600 C  CG1   . VAL B  1  367 ? 6.573   18.183  242.492 1.00 43.28  ? 342 VAL B CG1   1 
ATOM   5601 C  CG2   . VAL B  1  367 ? 6.856   20.331  243.687 1.00 46.87  ? 342 VAL B CG2   1 
ATOM   5602 N  N     . MET B  1  368 ? 3.246   17.587  243.929 1.00 53.45  ? 343 MET B N     1 
ATOM   5603 C  CA    . MET B  1  368 ? 2.462   16.345  243.789 1.00 51.03  ? 343 MET B CA    1 
ATOM   5604 C  C     . MET B  1  368 ? 1.048   16.567  243.284 1.00 49.20  ? 343 MET B C     1 
ATOM   5605 O  O     . MET B  1  368 ? 0.558   15.771  242.495 1.00 53.18  ? 343 MET B O     1 
ATOM   5606 C  CB    . MET B  1  368 ? 2.428   15.557  245.103 1.00 55.34  ? 343 MET B CB    1 
ATOM   5607 C  CG    . MET B  1  368 ? 3.788   15.051  245.571 1.00 57.97  ? 343 MET B CG    1 
ATOM   5608 S  SD    . MET B  1  368 ? 4.803   14.367  244.251 1.00 64.22  ? 343 MET B SD    1 
ATOM   5609 C  CE    . MET B  1  368 ? 6.377   14.235  245.036 1.00 59.54  ? 343 MET B CE    1 
ATOM   5610 N  N     . ASP B  1  369 ? 0.398   17.638  243.721 1.00 48.24  ? 344 ASP B N     1 
ATOM   5611 C  CA    . ASP B  1  369 ? -0.913  18.028  243.175 1.00 49.09  ? 344 ASP B CA    1 
ATOM   5612 C  C     . ASP B  1  369 ? -0.841  18.411  241.700 1.00 50.23  ? 344 ASP B C     1 
ATOM   5613 O  O     . ASP B  1  369 ? -1.816  18.208  240.962 1.00 47.94  ? 344 ASP B O     1 
ATOM   5614 C  CB    . ASP B  1  369 ? -1.491  19.217  243.946 1.00 55.88  ? 344 ASP B CB    1 
ATOM   5615 C  CG    . ASP B  1  369 ? -1.866  18.865  245.386 1.00 65.45  ? 344 ASP B CG    1 
ATOM   5616 O  OD1   . ASP B  1  369 ? -2.406  17.758  245.599 1.00 72.99  ? 344 ASP B OD1   1 
ATOM   5617 O  OD2   . ASP B  1  369 ? -1.640  19.703  246.294 1.00 67.19  ? 344 ASP B OD2   1 
ATOM   5618 N  N     . PHE B  1  370 ? 0.288   18.987  241.272 1.00 48.60  ? 345 PHE B N     1 
ATOM   5619 C  CA    . PHE B  1  370 ? 0.468   19.329  239.842 1.00 48.45  ? 345 PHE B CA    1 
ATOM   5620 C  C     . PHE B  1  370 ? 0.682   18.078  238.991 1.00 43.13  ? 345 PHE B C     1 
ATOM   5621 O  O     . PHE B  1  370 ? -0.012  17.869  238.029 1.00 45.05  ? 345 PHE B O     1 
ATOM   5622 C  CB    . PHE B  1  370 ? 1.649   20.278  239.621 1.00 47.94  ? 345 PHE B CB    1 
ATOM   5623 C  CG    . PHE B  1  370 ? 1.727   20.791  238.212 1.00 46.70  ? 345 PHE B CG    1 
ATOM   5624 C  CD1   . PHE B  1  370 ? 2.642   20.266  237.314 1.00 46.77  ? 345 PHE B CD1   1 
ATOM   5625 C  CD2   . PHE B  1  370 ? 0.841   21.763  237.778 1.00 45.57  ? 345 PHE B CD2   1 
ATOM   5626 C  CE1   . PHE B  1  370 ? 2.695   20.733  236.013 1.00 47.01  ? 345 PHE B CE1   1 
ATOM   5627 C  CE2   . PHE B  1  370 ? 0.889   22.235  236.482 1.00 47.95  ? 345 PHE B CE2   1 
ATOM   5628 C  CZ    . PHE B  1  370 ? 1.813   21.717  235.594 1.00 47.62  ? 345 PHE B CZ    1 
ATOM   5629 N  N     . ILE B  1  371 ? 1.667   17.287  239.386 1.00 45.96  ? 346 ILE B N     1 
ATOM   5630 C  CA    . ILE B  1  371 ? 2.029   16.000  238.778 1.00 49.94  ? 346 ILE B CA    1 
ATOM   5631 C  C     . ILE B  1  371 ? 0.862   14.991  238.695 1.00 52.55  ? 346 ILE B C     1 
ATOM   5632 O  O     . ILE B  1  371 ? 0.740   14.267  237.707 1.00 48.32  ? 346 ILE B O     1 
ATOM   5633 C  CB    . ILE B  1  371 ? 3.212   15.406  239.591 1.00 55.98  ? 346 ILE B CB    1 
ATOM   5634 C  CG1   . ILE B  1  371 ? 4.516   16.155  239.260 1.00 61.61  ? 346 ILE B CG1   1 
ATOM   5635 C  CG2   . ILE B  1  371 ? 3.395   13.913  239.396 1.00 62.31  ? 346 ILE B CG2   1 
ATOM   5636 C  CD1   . ILE B  1  371 ? 4.920   16.150  237.805 1.00 62.78  ? 346 ILE B CD1   1 
ATOM   5637 N  N     . LYS B  1  372 ? 0.001   14.985  239.706 1.00 52.51  ? 347 LYS B N     1 
ATOM   5638 C  CA    . LYS B  1  372 ? -1.040  13.962  239.894 1.00 61.21  ? 347 LYS B CA    1 
ATOM   5639 C  C     . LYS B  1  372 ? -1.752  13.499  238.616 1.00 58.84  ? 347 LYS B C     1 
ATOM   5640 O  O     . LYS B  1  372 ? -1.600  12.342  238.200 1.00 59.60  ? 347 LYS B O     1 
ATOM   5641 C  CB    . LYS B  1  372 ? -2.090  14.424  240.933 1.00 67.96  ? 347 LYS B CB    1 
ATOM   5642 C  CG    . LYS B  1  372 ? -2.701  13.275  241.728 1.00 76.26  ? 347 LYS B CG    1 
ATOM   5643 C  CD    . LYS B  1  372 ? -4.219  13.375  241.869 1.00 79.76  ? 347 LYS B CD    1 
ATOM   5644 C  CE    . LYS B  1  372 ? -4.858  11.995  241.911 1.00 78.87  ? 347 LYS B CE    1 
ATOM   5645 N  NZ    . LYS B  1  372 ? -6.325  12.087  241.706 1.00 79.68  ? 347 LYS B NZ    1 
ATOM   5646 N  N     . ASP B  1  373 ? -2.503  14.402  237.991 1.00 56.13  ? 348 ASP B N     1 
ATOM   5647 C  CA    . ASP B  1  373 ? -3.257  14.077  236.786 1.00 56.88  ? 348 ASP B CA    1 
ATOM   5648 C  C     . ASP B  1  373 ? -2.616  14.653  235.526 1.00 52.52  ? 348 ASP B C     1 
ATOM   5649 O  O     . ASP B  1  373 ? -3.296  14.809  234.508 1.00 52.32  ? 348 ASP B O     1 
ATOM   5650 C  CB    . ASP B  1  373 ? -4.703  14.564  236.928 1.00 63.06  ? 348 ASP B CB    1 
ATOM   5651 C  CG    . ASP B  1  373 ? -5.406  13.964  238.144 1.00 69.97  ? 348 ASP B CG    1 
ATOM   5652 O  OD1   . ASP B  1  373 ? -4.971  12.894  238.630 1.00 71.60  ? 348 ASP B OD1   1 
ATOM   5653 O  OD2   . ASP B  1  373 ? -6.396  14.568  238.609 1.00 76.02  ? 348 ASP B OD2   1 
ATOM   5654 N  N     . LEU B  1  374 ? -1.319  14.968  235.592 1.00 48.82  ? 349 LEU B N     1 
ATOM   5655 C  CA    . LEU B  1  374 ? -0.576  15.469  234.433 1.00 48.26  ? 349 LEU B CA    1 
ATOM   5656 C  C     . LEU B  1  374 ? -0.473  14.361  233.396 1.00 45.73  ? 349 LEU B C     1 
ATOM   5657 O  O     . LEU B  1  374 ? 0.119   13.315  233.696 1.00 47.63  ? 349 LEU B O     1 
ATOM   5658 C  CB    . LEU B  1  374 ? 0.852   15.882  234.840 1.00 47.90  ? 349 LEU B CB    1 
ATOM   5659 C  CG    . LEU B  1  374 ? 1.760   16.445  233.736 1.00 46.77  ? 349 LEU B CG    1 
ATOM   5660 C  CD1   . LEU B  1  374 ? 1.227   17.779  233.231 1.00 45.73  ? 349 LEU B CD1   1 
ATOM   5661 C  CD2   . LEU B  1  374 ? 3.172   16.616  234.260 1.00 45.92  ? 349 LEU B CD2   1 
ATOM   5662 N  N     . PRO B  1  375 ? -1.014  14.582  232.182 1.00 44.37  ? 350 PRO B N     1 
ATOM   5663 C  CA    . PRO B  1  375 ? -0.691  13.642  231.095 1.00 43.42  ? 350 PRO B CA    1 
ATOM   5664 C  C     . PRO B  1  375 ? 0.826   13.542  230.824 1.00 41.26  ? 350 PRO B C     1 
ATOM   5665 O  O     . PRO B  1  375 ? 1.483   14.566  230.711 1.00 41.32  ? 350 PRO B O     1 
ATOM   5666 C  CB    . PRO B  1  375 ? -1.420  14.239  229.886 1.00 42.79  ? 350 PRO B CB    1 
ATOM   5667 C  CG    . PRO B  1  375 ? -2.506  15.062  230.464 1.00 44.64  ? 350 PRO B CG    1 
ATOM   5668 C  CD    . PRO B  1  375 ? -1.889  15.666  231.699 1.00 45.85  ? 350 PRO B CD    1 
ATOM   5669 N  N     . ILE B  1  376 ? 1.359   12.326  230.752 1.00 42.60  ? 351 ILE B N     1 
ATOM   5670 C  CA    . ILE B  1  376 ? 2.802   12.101  230.527 1.00 45.51  ? 351 ILE B CA    1 
ATOM   5671 C  C     . ILE B  1  376 ? 3.367   12.724  229.237 1.00 41.32  ? 351 ILE B C     1 
ATOM   5672 O  O     . ILE B  1  376 ? 4.542   13.101  229.191 1.00 39.37  ? 351 ILE B O     1 
ATOM   5673 C  CB    . ILE B  1  376 ? 3.183   10.596  230.520 1.00 49.57  ? 351 ILE B CB    1 
ATOM   5674 C  CG1   . ILE B  1  376 ? 2.358   9.805   229.496 1.00 50.76  ? 351 ILE B CG1   1 
ATOM   5675 C  CG2   . ILE B  1  376 ? 3.035   9.989   231.906 1.00 55.49  ? 351 ILE B CG2   1 
ATOM   5676 C  CD1   . ILE B  1  376 ? 3.083   8.573   229.016 1.00 56.21  ? 351 ILE B CD1   1 
ATOM   5677 N  N     . ARG B  1  377 ? 2.515   12.817  228.216 1.00 42.01  ? 352 ARG B N     1 
ATOM   5678 C  CA    A ARG B  1  377 ? 2.882   13.409  226.930 0.50 44.34  ? 352 ARG B CA    1 
ATOM   5679 C  CA    B ARG B  1  377 ? 2.891   13.407  226.932 0.50 44.35  ? 352 ARG B CA    1 
ATOM   5680 C  C     . ARG B  1  377 ? 3.288   14.879  227.050 1.00 44.62  ? 352 ARG B C     1 
ATOM   5681 O  O     . ARG B  1  377 ? 4.057   15.378  226.229 1.00 43.68  ? 352 ARG B O     1 
ATOM   5682 C  CB    A ARG B  1  377 ? 1.741   13.262  225.921 0.50 44.91  ? 352 ARG B CB    1 
ATOM   5683 C  CB    B ARG B  1  377 ? 1.809   13.188  225.852 0.50 44.87  ? 352 ARG B CB    1 
ATOM   5684 C  CG    A ARG B  1  377 ? 2.122   13.628  224.495 0.50 43.81  ? 352 ARG B CG    1 
ATOM   5685 C  CG    B ARG B  1  377 ? 0.361   13.534  226.207 0.50 43.88  ? 352 ARG B CG    1 
ATOM   5686 C  CD    A ARG B  1  377 ? 3.443   12.993  224.065 0.50 42.87  ? 352 ARG B CD    1 
ATOM   5687 C  CD    B ARG B  1  377 ? 0.001   14.955  225.865 0.50 42.94  ? 352 ARG B CD    1 
ATOM   5688 N  NE    A ARG B  1  377 ? 3.578   13.108  222.628 0.50 41.65  ? 352 ARG B NE    1 
ATOM   5689 N  NE    B ARG B  1  377 ? -1.207  15.359  226.562 0.50 42.65  ? 352 ARG B NE    1 
ATOM   5690 C  CZ    A ARG B  1  377 ? 4.080   14.171  222.022 0.50 43.60  ? 352 ARG B CZ    1 
ATOM   5691 C  CZ    B ARG B  1  377 ? -2.106  16.191  226.057 0.50 42.97  ? 352 ARG B CZ    1 
ATOM   5692 N  NH1   A ARG B  1  377 ? 4.134   14.227  220.697 0.50 41.38  ? 352 ARG B NH1   1 
ATOM   5693 N  NH1   B ARG B  1  377 ? -3.182  16.513  226.765 0.50 41.98  ? 352 ARG B NH1   1 
ATOM   5694 N  NH2   A ARG B  1  377 ? 4.546   15.179  222.748 0.50 46.05  ? 352 ARG B NH2   1 
ATOM   5695 N  NH2   B ARG B  1  377 ? -1.947  16.669  224.833 0.50 45.26  ? 352 ARG B NH2   1 
ATOM   5696 N  N     . LYS B  1  378 ? 2.774   15.567  228.071 1.00 43.79  ? 353 LYS B N     1 
ATOM   5697 C  CA    . LYS B  1  378 ? 3.204   16.938  228.372 1.00 41.02  ? 353 LYS B CA    1 
ATOM   5698 C  C     . LYS B  1  378 ? 4.644   17.048  228.874 1.00 37.33  ? 353 LYS B C     1 
ATOM   5699 O  O     . LYS B  1  378 ? 5.177   18.153  228.926 1.00 38.62  ? 353 LYS B O     1 
ATOM   5700 C  CB    . LYS B  1  378 ? 2.265   17.585  229.391 1.00 44.72  ? 353 LYS B CB    1 
ATOM   5701 C  CG    . LYS B  1  378 ? 0.843   17.778  228.881 1.00 46.59  ? 353 LYS B CG    1 
ATOM   5702 C  CD    . LYS B  1  378 ? 0.214   19.045  229.435 1.00 52.38  ? 353 LYS B CD    1 
ATOM   5703 C  CE    . LYS B  1  378 ? -1.198  19.280  228.902 1.00 57.90  ? 353 LYS B CE    1 
ATOM   5704 N  NZ    . LYS B  1  378 ? -1.204  19.798  227.501 1.00 56.95  ? 353 LYS B NZ    1 
ATOM   5705 N  N     . VAL B  1  379 ? 5.288   15.942  229.241 1.00 37.37  ? 354 VAL B N     1 
ATOM   5706 C  CA    . VAL B  1  379 ? 6.664   16.000  229.758 1.00 38.75  ? 354 VAL B CA    1 
ATOM   5707 C  C     . VAL B  1  379 ? 7.678   15.899  228.616 1.00 39.79  ? 354 VAL B C     1 
ATOM   5708 O  O     . VAL B  1  379 ? 7.545   15.067  227.712 1.00 37.72  ? 354 VAL B O     1 
ATOM   5709 C  CB    . VAL B  1  379 ? 6.940   14.902  230.811 1.00 40.78  ? 354 VAL B CB    1 
ATOM   5710 C  CG1   . VAL B  1  379 ? 8.398   14.895  231.230 1.00 41.43  ? 354 VAL B CG1   1 
ATOM   5711 C  CG2   . VAL B  1  379 ? 6.067   15.111  232.034 1.00 43.77  ? 354 VAL B CG2   1 
ATOM   5712 N  N     . SER B  1  380 ? 8.718   16.719  228.693 1.00 40.92  ? 355 SER B N     1 
ATOM   5713 C  CA    . SER B  1  380 ? 9.720   16.762  227.646 1.00 43.14  ? 355 SER B CA    1 
ATOM   5714 C  C     . SER B  1  380 ? 10.514  15.484  227.686 1.00 41.29  ? 355 SER B C     1 
ATOM   5715 O  O     . SER B  1  380 ? 11.004  15.092  228.735 1.00 41.64  ? 355 SER B O     1 
ATOM   5716 C  CB    . SER B  1  380 ? 10.658  17.938  227.833 1.00 49.14  ? 355 SER B CB    1 
ATOM   5717 O  OG    . SER B  1  380 ? 11.665  17.928  226.825 1.00 56.08  ? 355 SER B OG    1 
ATOM   5718 N  N     . GLY B  1  381 ? 10.605  14.825  226.537 1.00 41.55  ? 356 GLY B N     1 
ATOM   5719 C  CA    . GLY B  1  381 ? 11.299  13.541  226.398 1.00 40.11  ? 356 GLY B CA    1 
ATOM   5720 C  C     . GLY B  1  381 ? 10.339  12.380  226.218 1.00 38.79  ? 356 GLY B C     1 
ATOM   5721 O  O     . GLY B  1  381 ? 10.763  11.304  225.825 1.00 41.19  ? 356 GLY B O     1 
ATOM   5722 N  N     . ILE B  1  382 ? 9.056   12.590  226.502 1.00 39.19  ? 357 ILE B N     1 
ATOM   5723 C  CA    . ILE B  1  382 ? 8.007   11.607  226.219 1.00 38.13  ? 357 ILE B CA    1 
ATOM   5724 C  C     . ILE B  1  382 ? 7.385   11.968  224.888 1.00 35.25  ? 357 ILE B C     1 
ATOM   5725 O  O     . ILE B  1  382 ? 6.470   12.786  224.812 1.00 35.12  ? 357 ILE B O     1 
ATOM   5726 C  CB    . ILE B  1  382 ? 6.925   11.600  227.325 1.00 39.38  ? 357 ILE B CB    1 
ATOM   5727 C  CG1   . ILE B  1  382 ? 7.555   11.341  228.700 1.00 39.66  ? 357 ILE B CG1   1 
ATOM   5728 C  CG2   . ILE B  1  382 ? 5.823   10.597  227.024 1.00 40.19  ? 357 ILE B CG2   1 
ATOM   5729 C  CD1   . ILE B  1  382 ? 8.369   10.080  228.836 1.00 42.15  ? 357 ILE B CD1   1 
ATOM   5730 N  N     . GLY B  1  383 ? 7.873   11.335  223.834 1.00 35.57  ? 358 GLY B N     1 
ATOM   5731 C  CA    . GLY B  1  383 ? 7.343   11.561  222.512 1.00 36.66  ? 358 GLY B CA    1 
ATOM   5732 C  C     . GLY B  1  383 ? 6.210   10.616  222.164 1.00 38.34  ? 358 GLY B C     1 
ATOM   5733 O  O     . GLY B  1  383 ? 5.716   9.859   223.013 1.00 32.40  ? 358 GLY B O     1 
ATOM   5734 N  N     . LYS B  1  384 ? 5.808   10.703  220.900 1.00 37.97  ? 359 LYS B N     1 
ATOM   5735 C  CA    . LYS B  1  384 ? 4.813   9.837   220.289 1.00 39.60  ? 359 LYS B CA    1 
ATOM   5736 C  C     . LYS B  1  384 ? 4.994   8.356   220.610 1.00 38.39  ? 359 LYS B C     1 
ATOM   5737 O  O     . LYS B  1  384 ? 4.032   7.678   220.977 1.00 35.03  ? 359 LYS B O     1 
ATOM   5738 C  CB    . LYS B  1  384 ? 4.883   10.013  218.773 1.00 45.54  ? 359 LYS B CB    1 
ATOM   5739 C  CG    . LYS B  1  384 ? 3.762   9.353   217.991 1.00 51.37  ? 359 LYS B CG    1 
ATOM   5740 C  CD    . LYS B  1  384 ? 3.734   9.802   216.535 1.00 59.31  ? 359 LYS B CD    1 
ATOM   5741 C  CE    . LYS B  1  384 ? 4.969   9.357   215.755 1.00 65.37  ? 359 LYS B CE    1 
ATOM   5742 N  NZ    . LYS B  1  384 ? 4.837   9.739   214.324 1.00 69.79  ? 359 LYS B NZ    1 
ATOM   5743 N  N     . VAL B  1  385 ? 6.215   7.855   220.442 1.00 37.01  ? 360 VAL B N     1 
ATOM   5744 C  CA    . VAL B  1  385 ? 6.477   6.423   220.567 1.00 39.50  ? 360 VAL B CA    1 
ATOM   5745 C  C     . VAL B  1  385 ? 6.344   5.982   222.014 1.00 38.64  ? 360 VAL B C     1 
ATOM   5746 O  O     . VAL B  1  385 ? 5.608   5.042   222.311 1.00 40.31  ? 360 VAL B O     1 
ATOM   5747 C  CB    . VAL B  1  385 ? 7.862   6.014   220.017 1.00 40.35  ? 360 VAL B CB    1 
ATOM   5748 C  CG1   . VAL B  1  385 ? 8.134   4.529   220.263 1.00 43.54  ? 360 VAL B CG1   1 
ATOM   5749 C  CG2   . VAL B  1  385 ? 7.912   6.269   218.519 1.00 43.58  ? 360 VAL B CG2   1 
ATOM   5750 N  N     . THR B  1  386 ? 7.020   6.691   222.916 1.00 37.23  ? 361 THR B N     1 
ATOM   5751 C  CA    . THR B  1  386 ? 6.965   6.367   224.321 1.00 36.14  ? 361 THR B CA    1 
ATOM   5752 C  C     . THR B  1  386 ? 5.549   6.477   224.863 1.00 34.58  ? 361 THR B C     1 
ATOM   5753 O  O     . THR B  1  386 ? 5.108   5.622   225.620 1.00 33.35  ? 361 THR B O     1 
ATOM   5754 C  CB    . THR B  1  386 ? 7.914   7.237   225.129 1.00 35.57  ? 361 THR B CB    1 
ATOM   5755 O  OG1   . THR B  1  386 ? 9.210   7.145   224.557 1.00 31.71  ? 361 THR B OG1   1 
ATOM   5756 C  CG2   . THR B  1  386 ? 8.005   6.748   226.557 1.00 37.85  ? 361 THR B CG2   1 
ATOM   5757 N  N     . GLU B  1  387 ? 4.841   7.519   224.467 1.00 35.25  ? 362 GLU B N     1 
ATOM   5758 C  CA    . GLU B  1  387 ? 3.468   7.707   224.887 1.00 37.61  ? 362 GLU B CA    1 
ATOM   5759 C  C     . GLU B  1  387 ? 2.623   6.483   224.500 1.00 41.07  ? 362 GLU B C     1 
ATOM   5760 O  O     . GLU B  1  387 ? 1.836   5.992   225.317 1.00 39.64  ? 362 GLU B O     1 
ATOM   5761 C  CB    . GLU B  1  387 ? 2.881   8.971   224.248 1.00 38.97  ? 362 GLU B CB    1 
ATOM   5762 C  CG    . GLU B  1  387 ? 1.438   9.267   224.665 1.00 43.05  ? 362 GLU B CG    1 
ATOM   5763 C  CD    . GLU B  1  387 ? 0.774   10.358  223.844 1.00 45.89  ? 362 GLU B CD    1 
ATOM   5764 O  OE1   . GLU B  1  387 ? -0.369  10.727  224.181 1.00 47.98  ? 362 GLU B OE1   1 
ATOM   5765 O  OE2   . GLU B  1  387 ? 1.399   10.872  222.891 1.00 52.20  ? 362 GLU B OE2   1 
ATOM   5766 N  N     . LYS B  1  388 ? 2.781   6.006   223.262 1.00 39.64  ? 363 LYS B N     1 
ATOM   5767 C  CA    . LYS B  1  388 ? 1.969   4.882   222.749 1.00 42.27  ? 363 LYS B CA    1 
ATOM   5768 C  C     . LYS B  1  388 ? 2.280   3.563   223.499 1.00 39.84  ? 363 LYS B C     1 
ATOM   5769 O  O     . LYS B  1  388 ? 1.381   2.815   223.867 1.00 39.35  ? 363 LYS B O     1 
ATOM   5770 C  CB    . LYS B  1  388 ? 2.177   4.710   221.242 1.00 42.84  ? 363 LYS B CB    1 
ATOM   5771 C  CG    . LYS B  1  388 ? 1.104   3.856   220.575 1.00 50.32  ? 363 LYS B CG    1 
ATOM   5772 C  CD    . LYS B  1  388 ? 1.336   3.710   219.073 1.00 54.12  ? 363 LYS B CD    1 
ATOM   5773 C  CE    . LYS B  1  388 ? 0.192   2.986   218.373 1.00 58.53  ? 363 LYS B CE    1 
ATOM   5774 N  NZ    . LYS B  1  388 ? 0.449   2.911   216.903 1.00 61.07  ? 363 LYS B NZ    1 
ATOM   5775 N  N     . MET B  1  389 ? 3.561   3.306   223.726 1.00 39.42  ? 364 MET B N     1 
ATOM   5776 C  CA    . MET B  1  389 ? 3.991   2.150   224.477 1.00 42.80  ? 364 MET B CA    1 
ATOM   5777 C  C     . MET B  1  389 ? 3.418   2.180   225.898 1.00 43.60  ? 364 MET B C     1 
ATOM   5778 O  O     . MET B  1  389 ? 2.854   1.176   226.379 1.00 41.76  ? 364 MET B O     1 
ATOM   5779 C  CB    . MET B  1  389 ? 5.509   2.078   224.508 1.00 44.15  ? 364 MET B CB    1 
ATOM   5780 C  CG    . MET B  1  389 ? 6.106   1.869   223.124 1.00 49.17  ? 364 MET B CG    1 
ATOM   5781 S  SD    . MET B  1  389 ? 7.787   1.240   223.127 1.00 61.49  ? 364 MET B SD    1 
ATOM   5782 C  CE    . MET B  1  389 ? 8.641   2.433   224.148 1.00 60.83  ? 364 MET B CE    1 
ATOM   5783 N  N     . LEU B  1  390 ? 3.509   3.334   226.554 1.00 40.45  ? 365 LEU B N     1 
ATOM   5784 C  CA    . LEU B  1  390 ? 3.001   3.445   227.914 1.00 40.06  ? 365 LEU B CA    1 
ATOM   5785 C  C     . LEU B  1  390 ? 1.469   3.393   227.946 1.00 39.45  ? 365 LEU B C     1 
ATOM   5786 O  O     . LEU B  1  390 ? 0.915   2.817   228.869 1.00 40.28  ? 365 LEU B O     1 
ATOM   5787 C  CB    . LEU B  1  390 ? 3.520   4.695   228.617 1.00 40.83  ? 365 LEU B CB    1 
ATOM   5788 C  CG    . LEU B  1  390 ? 5.008   4.764   228.936 1.00 40.72  ? 365 LEU B CG    1 
ATOM   5789 C  CD1   . LEU B  1  390 ? 5.354   6.155   229.438 1.00 44.32  ? 365 LEU B CD1   1 
ATOM   5790 C  CD2   . LEU B  1  390 ? 5.431   3.735   229.950 1.00 41.20  ? 365 LEU B CD2   1 
ATOM   5791 N  N     . LYS B  1  391 ? 0.792   3.970   226.958 1.00 38.91  ? 366 LYS B N     1 
ATOM   5792 C  CA    . LYS B  1  391 ? -0.666  3.820   226.839 1.00 44.49  ? 366 LYS B CA    1 
ATOM   5793 C  C     . LYS B  1  391 ? -1.106  2.355   226.736 1.00 47.61  ? 366 LYS B C     1 
ATOM   5794 O  O     . LYS B  1  391 ? -2.145  1.986   227.287 1.00 48.21  ? 366 LYS B O     1 
ATOM   5795 C  CB    . LYS B  1  391 ? -1.193  4.580   225.640 1.00 51.83  ? 366 LYS B CB    1 
ATOM   5796 C  CG    . LYS B  1  391 ? -2.709  4.519   225.484 1.00 57.13  ? 366 LYS B CG    1 
ATOM   5797 C  CD    . LYS B  1  391 ? -3.213  5.641   224.591 1.00 62.23  ? 366 LYS B CD    1 
ATOM   5798 C  CE    . LYS B  1  391 ? -4.658  5.408   224.177 1.00 67.75  ? 366 LYS B CE    1 
ATOM   5799 N  NZ    . LYS B  1  391 ? -5.177  6.556   223.380 1.00 71.76  ? 366 LYS B NZ    1 
ATOM   5800 N  N     . ALA B  1  392 ? -0.301  1.535   226.057 1.00 44.47  ? 367 ALA B N     1 
ATOM   5801 C  CA    . ALA B  1  392 ? -0.537  0.095   225.963 1.00 46.05  ? 367 ALA B CA    1 
ATOM   5802 C  C     . ALA B  1  392 ? -0.493  -0.606  227.330 1.00 46.64  ? 367 ALA B C     1 
ATOM   5803 O  O     . ALA B  1  392 ? -1.080  -1.669  227.483 1.00 42.15  ? 367 ALA B O     1 
ATOM   5804 C  CB    . ALA B  1  392 ? 0.478   -0.559  225.024 1.00 43.62  ? 367 ALA B CB    1 
ATOM   5805 N  N     . LEU B  1  393 ? 0.252   -0.036  228.284 1.00 45.38  ? 368 LEU B N     1 
ATOM   5806 C  CA    . LEU B  1  393 ? 0.271   -0.509  229.663 1.00 43.33  ? 368 LEU B CA    1 
ATOM   5807 C  C     . LEU B  1  393 ? -0.796  0.127   230.559 1.00 41.75  ? 368 LEU B C     1 
ATOM   5808 O  O     . LEU B  1  393 ? -0.823  -0.158  231.746 1.00 45.78  ? 368 LEU B O     1 
ATOM   5809 C  CB    . LEU B  1  393 ? 1.652   -0.266  230.276 1.00 43.75  ? 368 LEU B CB    1 
ATOM   5810 C  CG    . LEU B  1  393 ? 2.816   -0.983  229.610 1.00 45.93  ? 368 LEU B CG    1 
ATOM   5811 C  CD1   . LEU B  1  393 ? 4.155   -0.429  230.098 1.00 46.56  ? 368 LEU B CD1   1 
ATOM   5812 C  CD2   . LEU B  1  393 ? 2.715   -2.478  229.908 1.00 46.57  ? 368 LEU B CD2   1 
ATOM   5813 N  N     . GLY B  1  394 ? -1.674  0.959   230.005 1.00 42.30  ? 369 GLY B N     1 
ATOM   5814 C  CA    . GLY B  1  394 ? -2.687  1.696   230.781 1.00 45.31  ? 369 GLY B CA    1 
ATOM   5815 C  C     . GLY B  1  394 ? -2.186  2.966   231.466 1.00 47.59  ? 369 GLY B C     1 
ATOM   5816 O  O     . GLY B  1  394 ? -2.865  3.500   232.345 1.00 49.00  ? 369 GLY B O     1 
ATOM   5817 N  N     . ILE B  1  395 ? -1.007  3.445   231.057 1.00 45.04  ? 370 ILE B N     1 
ATOM   5818 C  CA    . ILE B  1  395 ? -0.346  4.597   231.663 1.00 45.53  ? 370 ILE B CA    1 
ATOM   5819 C  C     . ILE B  1  395 ? -0.582  5.851   230.806 1.00 46.58  ? 370 ILE B C     1 
ATOM   5820 O  O     . ILE B  1  395 ? -0.037  5.970   229.714 1.00 46.08  ? 370 ILE B O     1 
ATOM   5821 C  CB    . ILE B  1  395 ? 1.164   4.334   231.826 1.00 46.04  ? 370 ILE B CB    1 
ATOM   5822 C  CG1   . ILE B  1  395 ? 1.408   3.115   232.738 1.00 45.25  ? 370 ILE B CG1   1 
ATOM   5823 C  CG2   . ILE B  1  395 ? 1.862   5.587   232.353 1.00 47.83  ? 370 ILE B CG2   1 
ATOM   5824 C  CD1   . ILE B  1  395 ? 2.835   2.598   232.694 1.00 45.74  ? 370 ILE B CD1   1 
ATOM   5825 N  N     . ILE B  1  396 ? -1.434  6.746   231.301 1.00 46.14  ? 371 ILE B N     1 
ATOM   5826 C  CA    . ILE B  1  396 ? -1.691  8.062   230.694 1.00 48.50  ? 371 ILE B CA    1 
ATOM   5827 C  C     . ILE B  1  396 ? -1.171  9.231   231.553 1.00 48.66  ? 371 ILE B C     1 
ATOM   5828 O  O     . ILE B  1  396 ? -0.796  10.246  231.000 1.00 50.68  ? 371 ILE B O     1 
ATOM   5829 C  CB    . ILE B  1  396 ? -3.192  8.251   230.430 1.00 51.45  ? 371 ILE B CB    1 
ATOM   5830 C  CG1   . ILE B  1  396 ? -3.695  7.073   229.586 1.00 57.19  ? 371 ILE B CG1   1 
ATOM   5831 C  CG2   . ILE B  1  396 ? -3.463  9.598   229.754 1.00 55.15  ? 371 ILE B CG2   1 
ATOM   5832 C  CD1   . ILE B  1  396 ? -5.125  7.189   229.113 1.00 61.92  ? 371 ILE B CD1   1 
ATOM   5833 N  N     . THR B  1  397 ? -1.157  9.094   232.885 1.00 46.11  ? 372 THR B N     1 
ATOM   5834 C  CA    . THR B  1  397 ? -0.790  10.185  233.801 1.00 42.60  ? 372 THR B CA    1 
ATOM   5835 C  C     . THR B  1  397 ? 0.475   9.826   234.575 1.00 40.97  ? 372 THR B C     1 
ATOM   5836 O  O     . THR B  1  397 ? 0.898   8.657   234.624 1.00 38.08  ? 372 THR B O     1 
ATOM   5837 C  CB    . THR B  1  397 ? -1.913  10.462  234.817 1.00 44.57  ? 372 THR B CB    1 
ATOM   5838 O  OG1   . THR B  1  397 ? -2.055  9.332   235.695 1.00 45.13  ? 372 THR B OG1   1 
ATOM   5839 C  CG2   . THR B  1  397 ? -3.254  10.736  234.098 1.00 45.48  ? 372 THR B CG2   1 
ATOM   5840 N  N     . CYS B  1  398 ? 1.057   10.824  235.218 1.00 39.03  ? 373 CYS B N     1 
ATOM   5841 C  CA    . CYS B  1  398 ? 2.222   10.579  236.072 1.00 40.17  ? 373 CYS B CA    1 
ATOM   5842 C  C     . CYS B  1  398 ? 1.877   9.741   237.328 1.00 40.53  ? 373 CYS B C     1 
ATOM   5843 O  O     . CYS B  1  398 ? 2.729   9.025   237.840 1.00 41.69  ? 373 CYS B O     1 
ATOM   5844 C  CB    . CYS B  1  398 ? 2.883   11.894  236.454 1.00 42.29  ? 373 CYS B CB    1 
ATOM   5845 S  SG    . CYS B  1  398 ? 3.519   12.832  235.037 1.00 47.84  ? 373 CYS B SG    1 
ATOM   5846 N  N     . THR B  1  399 ? 0.635   9.814   237.792 1.00 41.93  ? 374 THR B N     1 
ATOM   5847 C  CA    . THR B  1  399 ? 0.148   8.926   238.863 1.00 45.28  ? 374 THR B CA    1 
ATOM   5848 C  C     . THR B  1  399 ? 0.238   7.452   238.430 1.00 44.16  ? 374 THR B C     1 
ATOM   5849 O  O     . THR B  1  399 ? 0.835   6.613   239.118 1.00 44.88  ? 374 THR B O     1 
ATOM   5850 C  CB    . THR B  1  399 ? -1.306  9.309   239.245 1.00 47.79  ? 374 THR B CB    1 
ATOM   5851 O  OG1   . THR B  1  399 ? -1.278  10.582  239.894 1.00 56.42  ? 374 THR B OG1   1 
ATOM   5852 C  CG2   . THR B  1  399 ? -1.962  8.313   240.193 1.00 50.71  ? 374 THR B CG2   1 
ATOM   5853 N  N     . GLU B  1  400 ? -0.344  7.150   237.276 1.00 44.92  ? 375 GLU B N     1 
ATOM   5854 C  CA    . GLU B  1  400 ? -0.273  5.798   236.713 1.00 45.27  ? 375 GLU B CA    1 
ATOM   5855 C  C     . GLU B  1  400 ? 1.181   5.370   236.451 1.00 44.38  ? 375 GLU B C     1 
ATOM   5856 O  O     . GLU B  1  400 ? 1.537   4.207   236.645 1.00 43.73  ? 375 GLU B O     1 
ATOM   5857 C  CB    . GLU B  1  400 ? -1.125  5.725   235.454 1.00 46.90  ? 375 GLU B CB    1 
ATOM   5858 C  CG    . GLU B  1  400 ? -2.605  5.905   235.773 1.00 48.03  ? 375 GLU B CG    1 
ATOM   5859 C  CD    . GLU B  1  400 ? -3.466  6.244   234.578 1.00 54.96  ? 375 GLU B CD    1 
ATOM   5860 O  OE1   . GLU B  1  400 ? -4.677  5.938   234.642 1.00 63.57  ? 375 GLU B OE1   1 
ATOM   5861 O  OE2   . GLU B  1  400 ? -2.969  6.818   233.579 1.00 56.57  ? 375 GLU B OE2   1 
ATOM   5862 N  N     . LEU B  1  401 ? 2.029   6.316   236.048 1.00 42.66  ? 376 LEU B N     1 
ATOM   5863 C  CA    . LEU B  1  401 ? 3.457   6.031   235.837 1.00 44.09  ? 376 LEU B CA    1 
ATOM   5864 C  C     . LEU B  1  401 ? 4.146   5.589   237.130 1.00 42.63  ? 376 LEU B C     1 
ATOM   5865 O  O     . LEU B  1  401 ? 4.967   4.650   237.140 1.00 43.89  ? 376 LEU B O     1 
ATOM   5866 C  CB    . LEU B  1  401 ? 4.159   7.276   235.264 1.00 41.50  ? 376 LEU B CB    1 
ATOM   5867 C  CG    . LEU B  1  401 ? 5.582   7.139   234.750 1.00 41.47  ? 376 LEU B CG    1 
ATOM   5868 C  CD1   . LEU B  1  401 ? 5.599   6.282   233.493 1.00 40.91  ? 376 LEU B CD1   1 
ATOM   5869 C  CD2   . LEU B  1  401 ? 6.122   8.529   234.424 1.00 43.01  ? 376 LEU B CD2   1 
ATOM   5870 N  N     . TYR B  1  402 ? 3.836   6.288   238.217 1.00 44.66  ? 377 TYR B N     1 
ATOM   5871 C  CA    . TYR B  1  402 ? 4.360   5.915   239.548 1.00 45.79  ? 377 TYR B CA    1 
ATOM   5872 C  C     . TYR B  1  402 ? 3.883   4.503   239.958 1.00 41.05  ? 377 TYR B C     1 
ATOM   5873 O  O     . TYR B  1  402 ? 4.674   3.645   240.339 1.00 41.75  ? 377 TYR B O     1 
ATOM   5874 C  CB    . TYR B  1  402 ? 3.946   6.943   240.632 1.00 45.91  ? 377 TYR B CB    1 
ATOM   5875 C  CG    . TYR B  1  402 ? 4.514   6.603   241.983 1.00 48.08  ? 377 TYR B CG    1 
ATOM   5876 C  CD1   . TYR B  1  402 ? 5.880   6.719   242.230 1.00 50.14  ? 377 TYR B CD1   1 
ATOM   5877 C  CD2   . TYR B  1  402 ? 3.693   6.082   243.002 1.00 52.70  ? 377 TYR B CD2   1 
ATOM   5878 C  CE1   . TYR B  1  402 ? 6.420   6.375   243.464 1.00 50.93  ? 377 TYR B CE1   1 
ATOM   5879 C  CE2   . TYR B  1  402 ? 4.220   5.737   244.241 1.00 51.34  ? 377 TYR B CE2   1 
ATOM   5880 C  CZ    . TYR B  1  402 ? 5.579   5.888   244.468 1.00 53.18  ? 377 TYR B CZ    1 
ATOM   5881 O  OH    . TYR B  1  402 ? 6.103   5.548   245.681 1.00 51.28  ? 377 TYR B OH    1 
ATOM   5882 N  N     . GLN B  1  403 ? 2.590   4.278   239.833 1.00 40.17  ? 378 GLN B N     1 
ATOM   5883 C  CA    . GLN B  1  403 ? 1.974   3.008   240.257 1.00 45.70  ? 378 GLN B CA    1 
ATOM   5884 C  C     . GLN B  1  403 ? 2.556   1.770   239.591 1.00 45.98  ? 378 GLN B C     1 
ATOM   5885 O  O     . GLN B  1  403 ? 2.737   0.753   240.244 1.00 44.35  ? 378 GLN B O     1 
ATOM   5886 C  CB    . GLN B  1  403 ? 0.485   3.053   239.991 1.00 46.80  ? 378 GLN B CB    1 
ATOM   5887 C  CG    . GLN B  1  403 ? -0.237  3.994   240.924 1.00 49.77  ? 378 GLN B CG    1 
ATOM   5888 C  CD    . GLN B  1  403 ? -1.662  4.243   240.499 1.00 54.79  ? 378 GLN B CD    1 
ATOM   5889 O  OE1   . GLN B  1  403 ? -2.112  3.755   239.469 1.00 58.45  ? 378 GLN B OE1   1 
ATOM   5890 N  NE2   . GLN B  1  403 ? -2.386  5.016   241.299 1.00 59.37  ? 378 GLN B NE2   1 
ATOM   5891 N  N     . GLN B  1  404 ? 2.865   1.881   238.298 1.00 46.02  ? 379 GLN B N     1 
ATOM   5892 C  CA    . GLN B  1  404 ? 3.416   0.790   237.495 1.00 44.71  ? 379 GLN B CA    1 
ATOM   5893 C  C     . GLN B  1  404 ? 4.920   0.769   237.505 1.00 41.33  ? 379 GLN B C     1 
ATOM   5894 O  O     . GLN B  1  404 ? 5.524   0.130   236.635 1.00 36.50  ? 379 GLN B O     1 
ATOM   5895 C  CB    . GLN B  1  404 ? 2.953   0.917   236.048 1.00 47.14  ? 379 GLN B CB    1 
ATOM   5896 C  CG    . GLN B  1  404 ? 1.445   0.897   235.873 1.00 56.09  ? 379 GLN B CG    1 
ATOM   5897 C  CD    . GLN B  1  404 ? 0.841   -0.417  236.295 1.00 62.10  ? 379 GLN B CD    1 
ATOM   5898 O  OE1   . GLN B  1  404 ? 1.346   -1.485  235.946 1.00 71.91  ? 379 GLN B OE1   1 
ATOM   5899 N  NE2   . GLN B  1  404 ? -0.238  -0.353  237.061 1.00 69.02  ? 379 GLN B NE2   1 
ATOM   5900 N  N     . ARG B  1  405 ? 5.539   1.455   238.469 1.00 40.65  ? 380 ARG B N     1 
ATOM   5901 C  CA    . ARG B  1  405 ? 7.003   1.575   238.484 1.00 43.96  ? 380 ARG B CA    1 
ATOM   5902 C  C     . ARG B  1  405 ? 7.737   0.253   238.524 1.00 43.04  ? 380 ARG B C     1 
ATOM   5903 O  O     . ARG B  1  405 ? 8.808   0.134   237.930 1.00 41.29  ? 380 ARG B O     1 
ATOM   5904 C  CB    . ARG B  1  405 ? 7.489   2.457   239.638 1.00 47.95  ? 380 ARG B CB    1 
ATOM   5905 C  CG    . ARG B  1  405 ? 7.162   1.924   241.027 1.00 51.32  ? 380 ARG B CG    1 
ATOM   5906 C  CD    . ARG B  1  405 ? 7.353   2.974   242.116 1.00 54.28  ? 380 ARG B CD    1 
ATOM   5907 N  NE    . ARG B  1  405 ? 6.977   2.457   243.442 1.00 51.81  ? 380 ARG B NE    1 
ATOM   5908 C  CZ    . ARG B  1  405 ? 5.725   2.306   243.884 1.00 51.96  ? 380 ARG B CZ    1 
ATOM   5909 N  NH1   . ARG B  1  405 ? 4.667   2.629   243.132 1.00 49.75  ? 380 ARG B NH1   1 
ATOM   5910 N  NH2   . ARG B  1  405 ? 5.531   1.826   245.108 1.00 54.74  ? 380 ARG B NH2   1 
ATOM   5911 N  N     . ALA B  1  406 ? 7.182   -0.739  239.230 1.00 43.61  ? 381 ALA B N     1 
ATOM   5912 C  CA    . ALA B  1  406 ? 7.822   -2.048  239.328 1.00 41.60  ? 381 ALA B CA    1 
ATOM   5913 C  C     . ALA B  1  406 ? 7.804   -2.718  237.964 1.00 38.63  ? 381 ALA B C     1 
ATOM   5914 O  O     . ALA B  1  406 ? 8.832   -3.189  237.468 1.00 35.43  ? 381 ALA B O     1 
ATOM   5915 C  CB    . ALA B  1  406 ? 7.140   -2.935  240.384 1.00 43.27  ? 381 ALA B CB    1 
ATOM   5916 N  N     . LEU B  1  407 ? 6.627   -2.730  237.352 1.00 39.51  ? 382 LEU B N     1 
ATOM   5917 C  CA    . LEU B  1  407 ? 6.468   -3.295  236.017 1.00 41.90  ? 382 LEU B CA    1 
ATOM   5918 C  C     . LEU B  1  407 ? 7.366   -2.576  235.003 1.00 44.20  ? 382 LEU B C     1 
ATOM   5919 O  O     . LEU B  1  407 ? 8.052   -3.237  234.217 1.00 42.75  ? 382 LEU B O     1 
ATOM   5920 C  CB    . LEU B  1  407 ? 5.007   -3.211  235.599 1.00 42.29  ? 382 LEU B CB    1 
ATOM   5921 C  CG    . LEU B  1  407 ? 4.654   -3.736  234.227 1.00 43.32  ? 382 LEU B CG    1 
ATOM   5922 C  CD1   . LEU B  1  407 ? 5.158   -5.156  234.070 1.00 46.50  ? 382 LEU B CD1   1 
ATOM   5923 C  CD2   . LEU B  1  407 ? 3.148   -3.620  234.025 1.00 44.77  ? 382 LEU B CD2   1 
ATOM   5924 N  N     . LEU B  1  408 ? 7.415   -1.237  235.085 1.00 41.40  ? 383 LEU B N     1 
ATOM   5925 C  CA    . LEU B  1  408 ? 8.320   -0.435  234.232 1.00 42.23  ? 383 LEU B CA    1 
ATOM   5926 C  C     . LEU B  1  408 ? 9.773   -0.850  234.333 1.00 41.90  ? 383 LEU B C     1 
ATOM   5927 O  O     . LEU B  1  408 ? 10.462  -0.852  233.318 1.00 42.27  ? 383 LEU B O     1 
ATOM   5928 C  CB    . LEU B  1  408 ? 8.187   1.070   234.510 1.00 41.73  ? 383 LEU B CB    1 
ATOM   5929 C  CG    . LEU B  1  408 ? 6.847   1.673   234.108 1.00 42.65  ? 383 LEU B CG    1 
ATOM   5930 C  CD1   . LEU B  1  408 ? 6.719   3.085   234.638 1.00 44.00  ? 383 LEU B CD1   1 
ATOM   5931 C  CD2   . LEU B  1  408 ? 6.621   1.623   232.593 1.00 45.56  ? 383 LEU B CD2   1 
ATOM   5932 N  N     . SER B  1  409 ? 10.227  -1.219  235.533 1.00 39.30  ? 384 SER B N     1 
ATOM   5933 C  CA    . SER B  1  409 ? 11.613  -1.683  235.732 1.00 41.00  ? 384 SER B CA    1 
ATOM   5934 C  C     . SER B  1  409 ? 11.914  -3.037  235.121 1.00 43.04  ? 384 SER B C     1 
ATOM   5935 O  O     . SER B  1  409 ? 13.066  -3.394  234.992 1.00 43.33  ? 384 SER B O     1 
ATOM   5936 C  CB    . SER B  1  409 ? 11.977  -1.755  237.217 1.00 45.28  ? 384 SER B CB    1 
ATOM   5937 O  OG    . SER B  1  409 ? 11.375  -2.881  237.867 1.00 41.48  ? 384 SER B OG    1 
ATOM   5938 N  N     . LEU B  1  410 ? 10.886  -3.812  234.795 1.00 45.09  ? 385 LEU B N     1 
ATOM   5939 C  CA    . LEU B  1  410 ? 11.097  -5.087  234.113 1.00 47.76  ? 385 LEU B CA    1 
ATOM   5940 C  C     . LEU B  1  410 ? 10.919  -4.952  232.603 1.00 44.96  ? 385 LEU B C     1 
ATOM   5941 O  O     . LEU B  1  410 ? 11.545  -5.685  231.862 1.00 42.73  ? 385 LEU B O     1 
ATOM   5942 C  CB    . LEU B  1  410 ? 10.160  -6.173  234.675 1.00 47.10  ? 385 LEU B CB    1 
ATOM   5943 C  CG    . LEU B  1  410 ? 10.378  -6.522  236.158 1.00 46.52  ? 385 LEU B CG    1 
ATOM   5944 C  CD1   . LEU B  1  410 ? 9.281   -7.456  236.638 1.00 48.57  ? 385 LEU B CD1   1 
ATOM   5945 C  CD2   . LEU B  1  410 ? 11.746  -7.124  236.451 1.00 45.05  ? 385 LEU B CD2   1 
ATOM   5946 N  N     . LEU B  1  411 ? 10.060  -4.033  232.163 1.00 44.10  ? 386 LEU B N     1 
ATOM   5947 C  CA    . LEU B  1  411 ? 9.824   -3.818  230.740 1.00 44.17  ? 386 LEU B CA    1 
ATOM   5948 C  C     . LEU B  1  411 ? 10.731  -2.799  230.039 1.00 44.44  ? 386 LEU B C     1 
ATOM   5949 O  O     . LEU B  1  411 ? 10.687  -2.748  228.835 1.00 43.24  ? 386 LEU B O     1 
ATOM   5950 C  CB    . LEU B  1  411 ? 8.368   -3.424  230.509 1.00 44.67  ? 386 LEU B CB    1 
ATOM   5951 C  CG    . LEU B  1  411 ? 7.320   -4.396  231.036 1.00 42.74  ? 386 LEU B CG    1 
ATOM   5952 C  CD1   . LEU B  1  411 ? 5.921   -3.854  230.775 1.00 43.19  ? 386 LEU B CD1   1 
ATOM   5953 C  CD2   . LEU B  1  411 ? 7.505   -5.756  230.383 1.00 45.27  ? 386 LEU B CD2   1 
ATOM   5954 N  N     . PHE B  1  412 ? 11.530  -2.011  230.768 1.00 43.13  ? 387 PHE B N     1 
ATOM   5955 C  CA    . PHE B  1  412 ? 12.364  -0.973  230.170 1.00 43.00  ? 387 PHE B CA    1 
ATOM   5956 C  C     . PHE B  1  412 ? 13.766  -1.019  230.713 1.00 44.60  ? 387 PHE B C     1 
ATOM   5957 O  O     . PHE B  1  412 ? 14.016  -1.520  231.807 1.00 42.19  ? 387 PHE B O     1 
ATOM   5958 C  CB    . PHE B  1  412 ? 11.793  0.423   230.428 1.00 39.61  ? 387 PHE B CB    1 
ATOM   5959 C  CG    . PHE B  1  412 ? 10.560  0.717   229.645 1.00 41.10  ? 387 PHE B CG    1 
ATOM   5960 C  CD1   . PHE B  1  412 ? 10.647  1.315   228.387 1.00 41.72  ? 387 PHE B CD1   1 
ATOM   5961 C  CD2   . PHE B  1  412 ? 9.310   0.386   230.142 1.00 40.29  ? 387 PHE B CD2   1 
ATOM   5962 C  CE1   . PHE B  1  412 ? 9.500   1.584   227.658 1.00 42.11  ? 387 PHE B CE1   1 
ATOM   5963 C  CE2   . PHE B  1  412 ? 8.156   0.640   229.415 1.00 41.20  ? 387 PHE B CE2   1 
ATOM   5964 C  CZ    . PHE B  1  412 ? 8.246   1.246   228.169 1.00 43.19  ? 387 PHE B CZ    1 
ATOM   5965 N  N     . SER B  1  413 ? 14.672  -0.450  229.932 1.00 43.18  ? 388 SER B N     1 
ATOM   5966 C  CA    . SER B  1  413 ? 16.052  -0.284  230.326 1.00 43.58  ? 388 SER B CA    1 
ATOM   5967 C  C     . SER B  1  413 ? 16.122  0.568   231.580 1.00 45.61  ? 388 SER B C     1 
ATOM   5968 O  O     . SER B  1  413 ? 15.146  1.277   231.936 1.00 42.00  ? 388 SER B O     1 
ATOM   5969 C  CB    . SER B  1  413 ? 16.822  0.451   229.226 1.00 49.09  ? 388 SER B CB    1 
ATOM   5970 O  OG    . SER B  1  413 ? 16.429  1.830   229.181 1.00 44.77  ? 388 SER B OG    1 
ATOM   5971 N  N     . GLU B  1  414 ? 17.289  0.510   232.219 1.00 44.10  ? 389 GLU B N     1 
ATOM   5972 C  CA    . GLU B  1  414 ? 17.540  1.196   233.475 1.00 50.12  ? 389 GLU B CA    1 
ATOM   5973 C  C     . GLU B  1  414 ? 17.421  2.709   233.294 1.00 48.16  ? 389 GLU B C     1 
ATOM   5974 O  O     . GLU B  1  414 ? 16.726  3.380   234.066 1.00 45.81  ? 389 GLU B O     1 
ATOM   5975 C  CB    . GLU B  1  414 ? 18.915  0.803   234.034 1.00 54.03  ? 389 GLU B CB    1 
ATOM   5976 C  CG    . GLU B  1  414 ? 19.261  1.472   235.355 1.00 61.67  ? 389 GLU B CG    1 
ATOM   5977 C  CD    . GLU B  1  414 ? 20.546  0.951   235.988 1.00 69.19  ? 389 GLU B CD    1 
ATOM   5978 O  OE1   . GLU B  1  414 ? 21.336  0.254   235.320 1.00 76.12  ? 389 GLU B OE1   1 
ATOM   5979 O  OE2   . GLU B  1  414 ? 20.774  1.247   237.176 1.00 78.68  ? 389 GLU B OE2   1 
ATOM   5980 N  N     . THR B  1  415 ? 18.082  3.224   232.254 1.00 49.29  ? 390 THR B N     1 
ATOM   5981 C  CA    . THR B  1  415 ? 17.973  4.642   231.866 1.00 47.00  ? 390 THR B CA    1 
ATOM   5982 C  C     . THR B  1  415 ? 16.516  5.106   231.764 1.00 39.96  ? 390 THR B C     1 
ATOM   5983 O  O     . THR B  1  415 ? 16.153  6.147   232.293 1.00 40.50  ? 390 THR B O     1 
ATOM   5984 C  CB    . THR B  1  415 ? 18.699  4.917   230.527 1.00 46.37  ? 390 THR B CB    1 
ATOM   5985 O  OG1   . THR B  1  415 ? 20.023  4.389   230.594 1.00 50.20  ? 390 THR B OG1   1 
ATOM   5986 C  CG2   . THR B  1  415 ? 18.788  6.399   230.242 1.00 48.02  ? 390 THR B CG2   1 
ATOM   5987 N  N     . SER B  1  416 ? 15.687  4.321   231.103 1.00 40.35  ? 391 SER B N     1 
ATOM   5988 C  CA    . SER B  1  416 ? 14.298  4.710   230.889 1.00 40.57  ? 391 SER B CA    1 
ATOM   5989 C  C     . SER B  1  416 ? 13.466  4.711   232.161 1.00 37.48  ? 391 SER B C     1 
ATOM   5990 O  O     . SER B  1  416 ? 12.717  5.662   232.394 1.00 39.72  ? 391 SER B O     1 
ATOM   5991 C  CB    . SER B  1  416 ? 13.627  3.819   229.832 1.00 42.93  ? 391 SER B CB    1 
ATOM   5992 O  OG    . SER B  1  416 ? 14.001  4.196   228.519 1.00 41.60  ? 391 SER B OG    1 
ATOM   5993 N  N     . TRP B  1  417 ? 13.537  3.644   232.962 1.00 42.37  ? 392 TRP B N     1 
ATOM   5994 C  CA    . TRP B  1  417 ? 12.695  3.581   234.194 1.00 41.47  ? 392 TRP B CA    1 
ATOM   5995 C  C     . TRP B  1  417 ? 13.229  4.517   235.258 1.00 39.41  ? 392 TRP B C     1 
ATOM   5996 O  O     . TRP B  1  417 ? 12.433  5.115   235.971 1.00 37.52  ? 392 TRP B O     1 
ATOM   5997 C  CB    . TRP B  1  417 ? 12.403  2.144   234.749 1.00 43.13  ? 392 TRP B CB    1 
ATOM   5998 C  CG    . TRP B  1  417 ? 13.497  1.421   235.469 1.00 42.93  ? 392 TRP B CG    1 
ATOM   5999 C  CD1   . TRP B  1  417 ? 14.291  0.447   234.960 1.00 44.06  ? 392 TRP B CD1   1 
ATOM   6000 C  CD2   . TRP B  1  417 ? 13.890  1.577   236.842 1.00 47.81  ? 392 TRP B CD2   1 
ATOM   6001 N  NE1   . TRP B  1  417 ? 15.174  -0.003  235.914 1.00 45.31  ? 392 TRP B NE1   1 
ATOM   6002 C  CE2   . TRP B  1  417 ? 14.954  0.675   237.078 1.00 44.95  ? 392 TRP B CE2   1 
ATOM   6003 C  CE3   . TRP B  1  417 ? 13.451  2.390   237.891 1.00 47.93  ? 392 TRP B CE3   1 
ATOM   6004 C  CZ2   . TRP B  1  417 ? 15.602  0.573   238.314 1.00 47.50  ? 392 TRP B CZ2   1 
ATOM   6005 C  CZ3   . TRP B  1  417 ? 14.091  2.281   239.132 1.00 52.11  ? 392 TRP B CZ3   1 
ATOM   6006 C  CH2   . TRP B  1  417 ? 15.157  1.372   239.329 1.00 48.00  ? 392 TRP B CH2   1 
ATOM   6007 N  N     . HIS B  1  418 ? 14.552  4.680   235.362 1.00 39.37  ? 393 HIS B N     1 
ATOM   6008 C  CA    . HIS B  1  418 ? 15.084  5.740   236.246 1.00 41.57  ? 393 HIS B CA    1 
ATOM   6009 C  C     . HIS B  1  418 ? 14.422  7.088   235.930 1.00 40.14  ? 393 HIS B C     1 
ATOM   6010 O  O     . HIS B  1  418 ? 13.932  7.791   236.828 1.00 38.20  ? 393 HIS B O     1 
ATOM   6011 C  CB    . HIS B  1  418 ? 16.598  5.867   236.124 1.00 42.97  ? 393 HIS B CB    1 
ATOM   6012 C  CG    . HIS B  1  418 ? 17.354  4.813   236.861 1.00 49.29  ? 393 HIS B CG    1 
ATOM   6013 N  ND1   . HIS B  1  418 ? 18.709  4.890   237.079 1.00 54.76  ? 393 HIS B ND1   1 
ATOM   6014 C  CD2   . HIS B  1  418 ? 16.949  3.655   237.434 1.00 54.52  ? 393 HIS B CD2   1 
ATOM   6015 C  CE1   . HIS B  1  418 ? 19.113  3.821   237.741 1.00 56.33  ? 393 HIS B CE1   1 
ATOM   6016 N  NE2   . HIS B  1  418 ? 18.061  3.057   237.973 1.00 56.90  ? 393 HIS B NE2   1 
ATOM   6017 N  N     . TYR B  1  419 ? 14.369  7.384   234.629 1.00 39.62  ? 394 TYR B N     1 
ATOM   6018 C  CA    . TYR B  1  419 ? 13.804  8.612   234.090 1.00 41.17  ? 394 TYR B CA    1 
ATOM   6019 C  C     . TYR B  1  419 ? 12.319  8.704   234.395 1.00 38.30  ? 394 TYR B C     1 
ATOM   6020 O  O     . TYR B  1  419 ? 11.852  9.729   234.890 1.00 36.17  ? 394 TYR B O     1 
ATOM   6021 C  CB    . TYR B  1  419 ? 14.104  8.685   232.572 1.00 43.04  ? 394 TYR B CB    1 
ATOM   6022 C  CG    . TYR B  1  419 ? 13.341  9.702   231.758 1.00 47.94  ? 394 TYR B CG    1 
ATOM   6023 C  CD1   . TYR B  1  419 ? 13.565  11.073  231.905 1.00 53.80  ? 394 TYR B CD1   1 
ATOM   6024 C  CD2   . TYR B  1  419 ? 12.420  9.290   230.803 1.00 55.14  ? 394 TYR B CD2   1 
ATOM   6025 C  CE1   . TYR B  1  419 ? 12.871  12.006  231.134 1.00 55.93  ? 394 TYR B CE1   1 
ATOM   6026 C  CE2   . TYR B  1  419 ? 11.725  10.205  230.030 1.00 58.00  ? 394 TYR B CE2   1 
ATOM   6027 C  CZ    . TYR B  1  419 ? 11.959  11.559  230.189 1.00 60.91  ? 394 TYR B CZ    1 
ATOM   6028 O  OH    . TYR B  1  419 ? 11.249  12.443  229.407 1.00 69.79  ? 394 TYR B OH    1 
ATOM   6029 N  N     . PHE B  1  420 ? 11.586  7.627   234.124 1.00 39.39  ? 395 PHE B N     1 
ATOM   6030 C  CA    . PHE B  1  420 ? 10.156  7.602   234.399 1.00 39.57  ? 395 PHE B CA    1 
ATOM   6031 C  C     . PHE B  1  420 ? 9.898   7.852   235.887 1.00 41.60  ? 395 PHE B C     1 
ATOM   6032 O  O     . PHE B  1  420 ? 8.914   8.503   236.258 1.00 40.62  ? 395 PHE B O     1 
ATOM   6033 C  CB    . PHE B  1  420 ? 9.543   6.247   234.023 1.00 41.44  ? 395 PHE B CB    1 
ATOM   6034 C  CG    . PHE B  1  420 ? 9.529   5.936   232.539 1.00 42.31  ? 395 PHE B CG    1 
ATOM   6035 C  CD1   . PHE B  1  420 ? 9.315   6.924   231.572 1.00 41.90  ? 395 PHE B CD1   1 
ATOM   6036 C  CD2   . PHE B  1  420 ? 9.652   4.616   232.117 1.00 43.35  ? 395 PHE B CD2   1 
ATOM   6037 C  CE1   . PHE B  1  420 ? 9.269   6.598   230.216 1.00 44.36  ? 395 PHE B CE1   1 
ATOM   6038 C  CE2   . PHE B  1  420 ? 9.607   4.281   230.773 1.00 44.73  ? 395 PHE B CE2   1 
ATOM   6039 C  CZ    . PHE B  1  420 ? 9.407   5.278   229.815 1.00 45.50  ? 395 PHE B CZ    1 
ATOM   6040 N  N     . LEU B  1  421 ? 10.781  7.334   236.734 1.00 40.77  ? 396 LEU B N     1 
ATOM   6041 C  CA    . LEU B  1  421 ? 10.574  7.435   238.173 1.00 46.69  ? 396 LEU B CA    1 
ATOM   6042 C  C     . LEU B  1  421 ? 10.758  8.882   238.641 1.00 47.36  ? 396 LEU B C     1 
ATOM   6043 O  O     . LEU B  1  421 ? 9.958   9.392   239.451 1.00 48.84  ? 396 LEU B O     1 
ATOM   6044 C  CB    . LEU B  1  421 ? 11.505  6.464   238.921 1.00 48.22  ? 396 LEU B CB    1 
ATOM   6045 C  CG    . LEU B  1  421 ? 11.329  6.388   240.445 1.00 49.06  ? 396 LEU B CG    1 
ATOM   6046 C  CD1   . LEU B  1  421 ? 9.937   5.957   240.867 1.00 47.74  ? 396 LEU B CD1   1 
ATOM   6047 C  CD2   . LEU B  1  421 ? 12.383  5.460   240.997 1.00 53.46  ? 396 LEU B CD2   1 
ATOM   6048 N  N     . HIS B  1  422 ? 11.794  9.537   238.112 1.00 46.04  ? 397 HIS B N     1 
ATOM   6049 C  CA    . HIS B  1  422 ? 12.016  10.974  238.341 1.00 45.43  ? 397 HIS B CA    1 
ATOM   6050 C  C     . HIS B  1  422 ? 10.793  11.773  237.959 1.00 40.87  ? 397 HIS B C     1 
ATOM   6051 O  O     . HIS B  1  422 ? 10.343  12.613  238.735 1.00 40.24  ? 397 HIS B O     1 
ATOM   6052 C  CB    . HIS B  1  422 ? 13.205  11.509  237.544 1.00 45.17  ? 397 HIS B CB    1 
ATOM   6053 C  CG    . HIS B  1  422 ? 14.530  11.175  238.136 1.00 46.49  ? 397 HIS B CG    1 
ATOM   6054 N  ND1   . HIS B  1  422 ? 15.185  9.996   237.869 1.00 53.06  ? 397 HIS B ND1   1 
ATOM   6055 C  CD2   . HIS B  1  422 ? 15.345  11.879  238.959 1.00 52.11  ? 397 HIS B CD2   1 
ATOM   6056 C  CE1   . HIS B  1  422 ? 16.347  9.981   238.502 1.00 52.87  ? 397 HIS B CE1   1 
ATOM   6057 N  NE2   . HIS B  1  422 ? 16.467  11.110  239.177 1.00 51.22  ? 397 HIS B NE2   1 
ATOM   6058 N  N     . ILE B  1  423 ? 10.236  11.484  236.784 1.00 38.85  ? 398 ILE B N     1 
ATOM   6059 C  CA    . ILE B  1  423 ? 9.028   12.167  236.342 1.00 39.74  ? 398 ILE B CA    1 
ATOM   6060 C  C     . ILE B  1  423 ? 7.872   11.936  237.304 1.00 39.64  ? 398 ILE B C     1 
ATOM   6061 O  O     . ILE B  1  423 ? 7.224   12.900  237.719 1.00 39.66  ? 398 ILE B O     1 
ATOM   6062 C  CB    . ILE B  1  423 ? 8.625   11.761  234.894 1.00 44.73  ? 398 ILE B CB    1 
ATOM   6063 C  CG1   . ILE B  1  423 ? 9.624   12.376  233.924 1.00 49.20  ? 398 ILE B CG1   1 
ATOM   6064 C  CG2   . ILE B  1  423 ? 7.192   12.200  234.547 1.00 42.84  ? 398 ILE B CG2   1 
ATOM   6065 C  CD1   . ILE B  1  423 ? 9.658   11.703  232.582 1.00 53.71  ? 398 ILE B CD1   1 
ATOM   6066 N  N     . SER B  1  424 ? 7.607   10.671  237.642 1.00 40.54  ? 399 SER B N     1 
ATOM   6067 C  CA    . SER B  1  424 ? 6.453   10.315  238.493 1.00 45.27  ? 399 SER B CA    1 
ATOM   6068 C  C     . SER B  1  424 ? 6.543   10.886  239.924 1.00 44.02  ? 399 SER B C     1 
ATOM   6069 O  O     . SER B  1  424 ? 5.530   10.958  240.626 1.00 41.91  ? 399 SER B O     1 
ATOM   6070 C  CB    . SER B  1  424 ? 6.272   8.785   238.543 1.00 45.51  ? 399 SER B CB    1 
ATOM   6071 O  OG    . SER B  1  424 ? 7.412   8.139   239.097 1.00 45.45  ? 399 SER B OG    1 
ATOM   6072 N  N     . LEU B  1  425 ? 7.759   11.253  240.342 1.00 42.47  ? 400 LEU B N     1 
ATOM   6073 C  CA    . LEU B  1  425 ? 7.988   11.965  241.600 1.00 43.14  ? 400 LEU B CA    1 
ATOM   6074 C  C     . LEU B  1  425 ? 8.083   13.501  241.478 1.00 43.59  ? 400 LEU B C     1 
ATOM   6075 O  O     . LEU B  1  425 ? 8.283   14.175  242.484 1.00 41.11  ? 400 LEU B O     1 
ATOM   6076 C  CB    . LEU B  1  425 ? 9.256   11.414  242.273 1.00 41.11  ? 400 LEU B CB    1 
ATOM   6077 C  CG    . LEU B  1  425 ? 9.115   9.977   242.803 1.00 42.91  ? 400 LEU B CG    1 
ATOM   6078 C  CD1   . LEU B  1  425 ? 10.361  9.576   243.551 1.00 42.19  ? 400 LEU B CD1   1 
ATOM   6079 C  CD2   . LEU B  1  425 ? 7.901   9.826   243.717 1.00 44.80  ? 400 LEU B CD2   1 
ATOM   6080 N  N     . GLY B  1  426 ? 7.927   14.057  240.275 1.00 41.78  ? 401 GLY B N     1 
ATOM   6081 C  CA    . GLY B  1  426 ? 8.077   15.502  240.064 1.00 40.29  ? 401 GLY B CA    1 
ATOM   6082 C  C     . GLY B  1  426 ? 9.489   16.043  240.299 1.00 40.46  ? 401 GLY B C     1 
ATOM   6083 O  O     . GLY B  1  426 ? 9.645   17.174  240.747 1.00 39.88  ? 401 GLY B O     1 
ATOM   6084 N  N     . LEU B  1  427 ? 10.506  15.251  239.958 1.00 41.95  ? 402 LEU B N     1 
ATOM   6085 C  CA    . LEU B  1  427 ? 11.923  15.624  240.129 1.00 43.23  ? 402 LEU B CA    1 
ATOM   6086 C  C     . LEU B  1  427 ? 12.567  16.034  238.794 1.00 44.64  ? 402 LEU B C     1 
ATOM   6087 O  O     . LEU B  1  427 ? 12.003  15.822  237.733 1.00 46.41  ? 402 LEU B O     1 
ATOM   6088 C  CB    . LEU B  1  427 ? 12.704  14.455  240.729 1.00 43.61  ? 402 LEU B CB    1 
ATOM   6089 C  CG    . LEU B  1  427 ? 12.261  14.024  242.142 1.00 45.97  ? 402 LEU B CG    1 
ATOM   6090 C  CD1   . LEU B  1  427 ? 12.738  12.622  242.464 1.00 46.82  ? 402 LEU B CD1   1 
ATOM   6091 C  CD2   . LEU B  1  427 ? 12.815  14.974  243.187 1.00 47.79  ? 402 LEU B CD2   1 
ATOM   6092 N  N     . GLY B  1  428 ? 13.759  16.604  238.873 1.00 42.10  ? 403 GLY B N     1 
ATOM   6093 C  CA    . GLY B  1  428 ? 14.509  17.024  237.692 1.00 44.89  ? 403 GLY B CA    1 
ATOM   6094 C  C     . GLY B  1  428 ? 15.699  17.865  238.089 1.00 43.61  ? 403 GLY B C     1 
ATOM   6095 O  O     . GLY B  1  428 ? 15.985  17.987  239.284 1.00 48.52  ? 403 GLY B O     1 
ATOM   6096 N  N     . SER B  1  429 ? 16.364  18.478  237.108 1.00 45.55  ? 404 SER B N     1 
ATOM   6097 C  CA    . SER B  1  429 ? 17.550  19.299  237.361 1.00 46.04  ? 404 SER B CA    1 
ATOM   6098 C  C     . SER B  1  429 ? 17.209  20.582  238.113 1.00 47.99  ? 404 SER B C     1 
ATOM   6099 O  O     . SER B  1  429 ? 16.252  21.287  237.771 1.00 42.11  ? 404 SER B O     1 
ATOM   6100 C  CB    . SER B  1  429 ? 18.295  19.651  236.068 1.00 48.97  ? 404 SER B CB    1 
ATOM   6101 O  OG    . SER B  1  429 ? 19.006  18.536  235.574 1.00 53.17  ? 404 SER B OG    1 
ATOM   6102 N  N     . THR B  1  430 ? 18.001  20.845  239.154 1.00 50.53  ? 405 THR B N     1 
ATOM   6103 C  CA    . THR B  1  430 ? 17.878  22.044  239.974 1.00 50.35  ? 405 THR B CA    1 
ATOM   6104 C  C     . THR B  1  430 ? 19.096  22.950  239.861 1.00 52.49  ? 405 THR B C     1 
ATOM   6105 O  O     . THR B  1  430 ? 19.083  24.037  240.429 1.00 58.04  ? 405 THR B O     1 
ATOM   6106 C  CB    . THR B  1  430 ? 17.668  21.679  241.453 1.00 47.95  ? 405 THR B CB    1 
ATOM   6107 O  OG1   . THR B  1  430 ? 18.780  20.904  241.916 1.00 48.76  ? 405 THR B OG1   1 
ATOM   6108 C  CG2   . THR B  1  430 ? 16.407  20.870  241.627 1.00 46.83  ? 405 THR B CG2   1 
ATOM   6109 N  N     . HIS B  1  431 ? 20.148  22.516  239.165 1.00 60.55  ? 406 HIS B N     1 
ATOM   6110 C  CA    . HIS B  1  431 ? 21.243  23.423  238.790 1.00 69.91  ? 406 HIS B CA    1 
ATOM   6111 C  C     . HIS B  1  431 ? 21.575  23.308  237.296 1.00 66.41  ? 406 HIS B C     1 
ATOM   6112 O  O     . HIS B  1  431 ? 21.564  22.216  236.723 1.00 63.32  ? 406 HIS B O     1 
ATOM   6113 C  CB    . HIS B  1  431 ? 22.493  23.257  239.685 1.00 77.15  ? 406 HIS B CB    1 
ATOM   6114 C  CG    . HIS B  1  431 ? 23.194  21.937  239.552 1.00 88.93  ? 406 HIS B CG    1 
ATOM   6115 N  ND1   . HIS B  1  431 ? 24.009  21.625  238.482 1.00 95.91  ? 406 HIS B ND1   1 
ATOM   6116 C  CD2   . HIS B  1  431 ? 23.239  20.867  240.382 1.00 93.37  ? 406 HIS B CD2   1 
ATOM   6117 C  CE1   . HIS B  1  431 ? 24.504  20.410  238.647 1.00 100.77 ? 406 HIS B CE1   1 
ATOM   6118 N  NE2   . HIS B  1  431 ? 24.054  19.929  239.793 1.00 100.51 ? 406 HIS B NE2   1 
ATOM   6119 N  N     . LEU B  1  432 ? 21.872  24.454  236.690 1.00 61.01  ? 407 LEU B N     1 
ATOM   6120 C  CA    . LEU B  1  432 ? 22.010  24.570  235.251 1.00 61.38  ? 407 LEU B CA    1 
ATOM   6121 C  C     . LEU B  1  432 ? 23.488  24.580  234.934 1.00 66.35  ? 407 LEU B C     1 
ATOM   6122 O  O     . LEU B  1  432 ? 24.203  25.470  235.386 1.00 74.45  ? 407 LEU B O     1 
ATOM   6123 C  CB    . LEU B  1  432 ? 21.358  25.868  234.758 1.00 51.30  ? 407 LEU B CB    1 
ATOM   6124 C  CG    . LEU B  1  432 ? 19.907  26.128  235.154 1.00 47.66  ? 407 LEU B CG    1 
ATOM   6125 C  CD1   . LEU B  1  432 ? 19.466  27.492  234.650 1.00 47.36  ? 407 LEU B CD1   1 
ATOM   6126 C  CD2   . LEU B  1  432 ? 18.993  25.054  234.619 1.00 46.64  ? 407 LEU B CD2   1 
ATOM   6127 N  N     . THR B  1  433 ? 23.947  23.579  234.186 1.00 73.78  ? 408 THR B N     1 
ATOM   6128 C  CA    . THR B  1  433 ? 25.357  23.483  233.789 1.00 78.22  ? 408 THR B CA    1 
ATOM   6129 C  C     . THR B  1  433 ? 25.677  24.371  232.577 1.00 79.23  ? 408 THR B C     1 
ATOM   6130 O  O     . THR B  1  433 ? 24.814  24.654  231.750 1.00 80.75  ? 408 THR B O     1 
ATOM   6131 C  CB    . THR B  1  433 ? 25.741  22.024  233.472 1.00 79.13  ? 408 THR B CB    1 
ATOM   6132 O  OG1   . THR B  1  433 ? 24.913  21.532  232.410 1.00 74.61  ? 408 THR B OG1   1 
ATOM   6133 C  CG2   . THR B  1  433 ? 25.572  21.140  234.723 1.00 77.55  ? 408 THR B CG2   1 
ATOM   6134 N  N     . ARG B  1  434 ? 26.927  24.818  232.492 1.00 90.03  ? 409 ARG B N     1 
ATOM   6135 C  CA    . ARG B  1  434 ? 27.416  25.535  231.312 1.00 96.59  ? 409 ARG B CA    1 
ATOM   6136 C  C     . ARG B  1  434 ? 27.416  24.579  230.115 1.00 102.95 ? 409 ARG B C     1 
ATOM   6137 O  O     . ARG B  1  434 ? 27.565  23.357  230.288 1.00 98.79  ? 409 ARG B O     1 
ATOM   6138 C  CB    . ARG B  1  434 ? 28.827  26.089  231.553 1.00 96.58  ? 409 ARG B CB    1 
ATOM   6139 N  N     . ASP B  1  435 ? 27.227  25.132  228.914 1.00 105.34 ? 410 ASP B N     1 
ATOM   6140 C  CA    . ASP B  1  435 ? 27.160  24.328  227.684 1.00 105.30 ? 410 ASP B CA    1 
ATOM   6141 C  C     . ASP B  1  435 ? 28.523  23.686  227.420 1.00 106.91 ? 410 ASP B C     1 
ATOM   6142 O  O     . ASP B  1  435 ? 29.478  24.374  227.048 1.00 110.68 ? 410 ASP B O     1 
ATOM   6143 C  CB    . ASP B  1  435 ? 26.724  25.178  226.484 1.00 100.52 ? 410 ASP B CB    1 
ATOM   6144 N  N     . GLY B  1  436 ? 28.604  22.373  227.637 1.00 103.16 ? 411 GLY B N     1 
ATOM   6145 C  CA    . GLY B  1  436 ? 29.864  21.638  227.546 1.00 100.87 ? 411 GLY B CA    1 
ATOM   6146 C  C     . GLY B  1  436 ? 30.377  21.479  226.125 1.00 101.07 ? 411 GLY B C     1 
ATOM   6147 O  O     . GLY B  1  436 ? 29.838  22.076  225.184 1.00 95.88  ? 411 GLY B O     1 
ATOM   6148 N  N     . GLU B  1  437 ? 31.430  20.676  225.975 1.00 98.90  ? 412 GLU B N     1 
ATOM   6149 C  CA    . GLU B  1  437 ? 32.000  20.383  224.659 1.00 95.35  ? 412 GLU B CA    1 
ATOM   6150 C  C     . GLU B  1  437 ? 30.924  19.720  223.798 1.00 86.81  ? 412 GLU B C     1 
ATOM   6151 O  O     . GLU B  1  437 ? 30.226  18.821  224.278 1.00 87.00  ? 412 GLU B O     1 
ATOM   6152 C  CB    . GLU B  1  437 ? 33.229  19.465  224.782 1.00 92.47  ? 412 GLU B CB    1 
ATOM   6153 N  N     . ARG B  1  438 ? 30.761  20.195  222.558 1.00 77.02  ? 413 ARG B N     1 
ATOM   6154 C  CA    . ARG B  1  438 ? 29.881  19.527  221.586 1.00 69.50  ? 413 ARG B CA    1 
ATOM   6155 C  C     . ARG B  1  438 ? 30.437  18.151  221.254 1.00 61.82  ? 413 ARG B C     1 
ATOM   6156 O  O     . ARG B  1  438 ? 31.651  17.942  221.339 1.00 59.30  ? 413 ARG B O     1 
ATOM   6157 C  CB    . ARG B  1  438 ? 29.687  20.339  220.297 1.00 69.60  ? 413 ARG B CB    1 
ATOM   6158 C  CG    . ARG B  1  438 ? 30.954  20.541  219.460 1.00 71.28  ? 413 ARG B CG    1 
ATOM   6159 C  CD    . ARG B  1  438 ? 30.654  20.761  217.982 1.00 67.59  ? 413 ARG B CD    1 
ATOM   6160 N  NE    . ARG B  1  438 ? 30.026  22.060  217.765 1.00 61.82  ? 413 ARG B NE    1 
ATOM   6161 C  CZ    . ARG B  1  438 ? 28.855  22.286  217.173 1.00 60.31  ? 413 ARG B CZ    1 
ATOM   6162 N  NH1   . ARG B  1  438 ? 28.119  21.298  216.660 1.00 57.28  ? 413 ARG B NH1   1 
ATOM   6163 N  NH2   . ARG B  1  438 ? 28.423  23.543  217.074 1.00 62.35  ? 413 ARG B NH2   1 
ATOM   6164 N  N     . LYS B  1  439 ? 29.547  17.222  220.900 1.00 53.88  ? 414 LYS B N     1 
ATOM   6165 C  CA    . LYS B  1  439 ? 29.934  15.847  220.580 1.00 50.47  ? 414 LYS B CA    1 
ATOM   6166 C  C     . LYS B  1  439 ? 29.990  15.538  219.075 1.00 45.88  ? 414 LYS B C     1 
ATOM   6167 O  O     . LYS B  1  439 ? 30.552  14.527  218.688 1.00 44.19  ? 414 LYS B O     1 
ATOM   6168 C  CB    . LYS B  1  439 ? 28.987  14.857  221.264 1.00 48.57  ? 414 LYS B CB    1 
ATOM   6169 N  N     . SER B  1  440 ? 29.385  16.367  218.233 1.00 44.91  ? 415 SER B N     1 
ATOM   6170 C  CA    . SER B  1  440 ? 29.386  16.112  216.789 1.00 43.18  ? 415 SER B CA    1 
ATOM   6171 C  C     . SER B  1  440 ? 29.051  17.354  216.007 1.00 45.91  ? 415 SER B C     1 
ATOM   6172 O  O     . SER B  1  440 ? 28.564  18.346  216.551 1.00 49.21  ? 415 SER B O     1 
ATOM   6173 C  CB    . SER B  1  440 ? 28.380  15.000  216.419 1.00 41.73  ? 415 SER B CB    1 
ATOM   6174 O  OG    . SER B  1  440 ? 27.035  15.400  216.619 1.00 38.93  ? 415 SER B OG    1 
ATOM   6175 N  N     . MET B  1  441 ? 29.290  17.280  214.711 1.00 45.23  ? 416 MET B N     1 
ATOM   6176 C  CA    . MET B  1  441 ? 28.858  18.329  213.786 1.00 43.55  ? 416 MET B CA    1 
ATOM   6177 C  C     . MET B  1  441 ? 28.414  17.679  212.492 1.00 37.92  ? 416 MET B C     1 
ATOM   6178 O  O     . MET B  1  441 ? 29.067  16.751  212.013 1.00 33.53  ? 416 MET B O     1 
ATOM   6179 C  CB    . MET B  1  441 ? 30.026  19.271  213.520 1.00 48.24  ? 416 MET B CB    1 
ATOM   6180 C  CG    . MET B  1  441 ? 29.627  20.703  213.216 1.00 58.45  ? 416 MET B CG    1 
ATOM   6181 S  SD    . MET B  1  441 ? 31.065  21.773  213.435 1.00 66.65  ? 416 MET B SD    1 
ATOM   6182 C  CE    . MET B  1  441 ? 30.334  23.259  214.104 1.00 67.42  ? 416 MET B CE    1 
ATOM   6183 N  N     . SER B  1  442 ? 27.330  18.158  211.908 1.00 35.00  ? 417 SER B N     1 
ATOM   6184 C  CA    . SER B  1  442 ? 26.844  17.542  210.697 1.00 37.22  ? 417 SER B CA    1 
ATOM   6185 C  C     . SER B  1  442 ? 26.200  18.525  209.763 1.00 36.43  ? 417 SER B C     1 
ATOM   6186 O  O     . SER B  1  442 ? 25.825  19.603  210.148 1.00 36.86  ? 417 SER B O     1 
ATOM   6187 C  CB    . SER B  1  442 ? 25.829  16.432  211.030 1.00 39.14  ? 417 SER B CB    1 
ATOM   6188 O  OG    . SER B  1  442 ? 24.748  16.911  211.808 1.00 41.03  ? 417 SER B OG    1 
ATOM   6189 N  N     . VAL B  1  443 ? 26.048  18.079  208.528 1.00 34.96  ? 418 VAL B N     1 
ATOM   6190 C  CA    . VAL B  1  443 ? 25.300  18.770  207.532 1.00 36.49  ? 418 VAL B CA    1 
ATOM   6191 C  C     . VAL B  1  443 ? 24.553  17.714  206.749 1.00 35.22  ? 418 VAL B C     1 
ATOM   6192 O  O     . VAL B  1  443 ? 25.101  16.648  206.439 1.00 35.46  ? 418 VAL B O     1 
ATOM   6193 C  CB    . VAL B  1  443 ? 26.241  19.509  206.551 1.00 38.57  ? 418 VAL B CB    1 
ATOM   6194 C  CG1   . VAL B  1  443 ? 25.436  20.322  205.579 1.00 41.36  ? 418 VAL B CG1   1 
ATOM   6195 C  CG2   . VAL B  1  443 ? 27.186  20.432  207.299 1.00 44.57  ? 418 VAL B CG2   1 
ATOM   6196 N  N     . GLU B  1  444 ? 23.332  18.035  206.360 1.00 29.80  ? 419 GLU B N     1 
ATOM   6197 C  CA    . GLU B  1  444 ? 22.570  17.149  205.519 1.00 30.50  ? 419 GLU B CA    1 
ATOM   6198 C  C     . GLU B  1  444 ? 21.646  17.972  204.658 1.00 28.26  ? 419 GLU B C     1 
ATOM   6199 O  O     . GLU B  1  444 ? 21.338  19.100  205.022 1.00 28.38  ? 419 GLU B O     1 
ATOM   6200 C  CB    . GLU B  1  444 ? 21.800  16.151  206.385 1.00 33.52  ? 419 GLU B CB    1 
ATOM   6201 C  CG    . GLU B  1  444 ? 20.564  16.706  207.051 1.00 34.06  ? 419 GLU B CG    1 
ATOM   6202 C  CD    . GLU B  1  444 ? 19.869  15.725  207.986 1.00 39.34  ? 419 GLU B CD    1 
ATOM   6203 O  OE1   . GLU B  1  444 ? 20.545  14.867  208.553 1.00 46.30  ? 419 GLU B OE1   1 
ATOM   6204 O  OE2   . GLU B  1  444 ? 18.632  15.804  208.150 1.00 39.01  ? 419 GLU B OE2   1 
ATOM   6205 N  N     . ARG B  1  445 ? 21.203  17.415  203.543 1.00 26.66  ? 420 ARG B N     1 
ATOM   6206 C  CA    . ARG B  1  445 ? 20.378  18.176  202.633 1.00 31.50  ? 420 ARG B CA    1 
ATOM   6207 C  C     . ARG B  1  445 ? 19.477  17.297  201.826 1.00 29.67  ? 420 ARG B C     1 
ATOM   6208 O  O     . ARG B  1  445 ? 19.913  16.266  201.348 1.00 28.50  ? 420 ARG B O     1 
ATOM   6209 C  CB    . ARG B  1  445 ? 21.291  18.942  201.678 1.00 36.15  ? 420 ARG B CB    1 
ATOM   6210 C  CG    . ARG B  1  445 ? 20.624  20.077  200.943 1.00 42.10  ? 420 ARG B CG    1 
ATOM   6211 C  CD    . ARG B  1  445 ? 21.670  21.088  200.489 1.00 44.96  ? 420 ARG B CD    1 
ATOM   6212 N  NE    . ARG B  1  445 ? 22.286  21.711  201.658 1.00 47.72  ? 420 ARG B NE    1 
ATOM   6213 C  CZ    . ARG B  1  445 ? 23.569  22.043  201.789 1.00 43.17  ? 420 ARG B CZ    1 
ATOM   6214 N  NH1   . ARG B  1  445 ? 24.444  21.830  200.814 1.00 46.32  ? 420 ARG B NH1   1 
ATOM   6215 N  NH2   . ARG B  1  445 ? 23.971  22.582  202.927 1.00 39.29  ? 420 ARG B NH2   1 
ATOM   6216 N  N     . THR B  1  446 ? 18.244  17.754  201.625 1.00 27.72  ? 421 THR B N     1 
ATOM   6217 C  CA    . THR B  1  446 ? 17.253  17.078  200.792 1.00 27.32  ? 421 THR B CA    1 
ATOM   6218 C  C     . THR B  1  446 ? 17.204  17.713  199.400 1.00 28.44  ? 421 THR B C     1 
ATOM   6219 O  O     . THR B  1  446 ? 17.326  18.914  199.262 1.00 30.85  ? 421 THR B O     1 
ATOM   6220 C  CB    . THR B  1  446 ? 15.846  17.119  201.439 1.00 26.40  ? 421 THR B CB    1 
ATOM   6221 O  OG1   . THR B  1  446 ? 15.884  16.393  202.676 1.00 28.63  ? 421 THR B OG1   1 
ATOM   6222 C  CG2   . THR B  1  446 ? 14.773  16.499  200.547 1.00 26.88  ? 421 THR B CG2   1 
ATOM   6223 N  N     . PHE B  1  447 ? 16.976  16.888  198.387 1.00 27.37  ? 422 PHE B N     1 
ATOM   6224 C  CA    . PHE B  1  447 ? 16.976  17.334  197.009 1.00 28.48  ? 422 PHE B CA    1 
ATOM   6225 C  C     . PHE B  1  447 ? 16.049  16.425  196.232 1.00 30.07  ? 422 PHE B C     1 
ATOM   6226 O  O     . PHE B  1  447 ? 15.715  15.331  196.697 1.00 27.84  ? 422 PHE B O     1 
ATOM   6227 C  CB    . PHE B  1  447 ? 18.405  17.317  196.438 1.00 28.22  ? 422 PHE B CB    1 
ATOM   6228 C  CG    . PHE B  1  447 ? 19.254  16.193  196.958 1.00 27.57  ? 422 PHE B CG    1 
ATOM   6229 C  CD1   . PHE B  1  447 ? 19.031  14.893  196.549 1.00 27.06  ? 422 PHE B CD1   1 
ATOM   6230 C  CD2   . PHE B  1  447 ? 20.261  16.433  197.878 1.00 28.63  ? 422 PHE B CD2   1 
ATOM   6231 C  CE1   . PHE B  1  447 ? 19.819  13.847  197.017 1.00 29.71  ? 422 PHE B CE1   1 
ATOM   6232 C  CE2   . PHE B  1  447 ? 21.025  15.390  198.375 1.00 29.18  ? 422 PHE B CE2   1 
ATOM   6233 C  CZ    . PHE B  1  447 ? 20.813  14.092  197.940 1.00 28.71  ? 422 PHE B CZ    1 
ATOM   6234 N  N     . SER B  1  448 ? 15.605  16.910  195.069 1.00 28.30  ? 423 SER B N     1 
ATOM   6235 C  CA    . SER B  1  448 ? 15.006  16.084  194.050 1.00 27.59  ? 423 SER B CA    1 
ATOM   6236 C  C     . SER B  1  448 ? 16.025  14.965  193.729 1.00 27.93  ? 423 SER B C     1 
ATOM   6237 O  O     . SER B  1  448 ? 17.254  15.138  193.924 1.00 27.16  ? 423 SER B O     1 
ATOM   6238 C  CB    . SER B  1  448 ? 14.669  16.925  192.780 1.00 29.46  ? 423 SER B CB    1 
ATOM   6239 O  OG    . SER B  1  448 ? 15.833  17.518  192.201 1.00 26.43  ? 423 SER B OG    1 
ATOM   6240 N  N     . GLU B  1  449 ? 15.499  13.851  193.229 1.00 26.48  ? 424 GLU B N     1 
ATOM   6241 C  CA    . GLU B  1  449 ? 16.213  12.592  193.183 1.00 26.52  ? 424 GLU B CA    1 
ATOM   6242 C  C     . GLU B  1  449 ? 17.578  12.727  192.531 1.00 28.71  ? 424 GLU B C     1 
ATOM   6243 O  O     . GLU B  1  449 ? 17.682  13.385  191.493 1.00 26.58  ? 424 GLU B O     1 
ATOM   6244 C  CB    . GLU B  1  449 ? 15.378  11.539  192.445 1.00 28.19  ? 424 GLU B CB    1 
ATOM   6245 C  CG    . GLU B  1  449 ? 16.098  10.206  192.306 1.00 29.75  ? 424 GLU B CG    1 
ATOM   6246 C  CD    . GLU B  1  449 ? 15.289  9.125   191.648 1.00 34.11  ? 424 GLU B CD    1 
ATOM   6247 O  OE1   . GLU B  1  449 ? 14.030  9.207   191.642 1.00 32.55  ? 424 GLU B OE1   1 
ATOM   6248 O  OE2   . GLU B  1  449 ? 15.928  8.152   191.148 1.00 35.90  ? 424 GLU B OE2   1 
ATOM   6249 N  N     . ILE B  1  450 ? 18.617  12.157  193.163 1.00 26.84  ? 425 ILE B N     1 
ATOM   6250 C  CA    . ILE B  1  450 ? 19.955  12.015  192.555 1.00 27.11  ? 425 ILE B CA    1 
ATOM   6251 C  C     . ILE B  1  450 ? 20.220  10.510  192.487 1.00 28.44  ? 425 ILE B C     1 
ATOM   6252 O  O     . ILE B  1  450 ? 20.165  9.794   193.516 1.00 29.19  ? 425 ILE B O     1 
ATOM   6253 C  CB    . ILE B  1  450 ? 21.090  12.685  193.339 1.00 28.69  ? 425 ILE B CB    1 
ATOM   6254 C  CG1   . ILE B  1  450 ? 20.821  14.170  193.529 1.00 30.16  ? 425 ILE B CG1   1 
ATOM   6255 C  CG2   . ILE B  1  450 ? 22.451  12.515  192.592 1.00 30.47  ? 425 ILE B CG2   1 
ATOM   6256 C  CD1   . ILE B  1  450 ? 21.845  14.862  194.403 1.00 31.69  ? 425 ILE B CD1   1 
ATOM   6257 N  N     . ASN B  1  451 ? 20.481  10.034  191.281 1.00 28.80  ? 426 ASN B N     1 
ATOM   6258 C  CA    . ASN B  1  451 ? 20.703  8.611   191.030 1.00 31.62  ? 426 ASN B CA    1 
ATOM   6259 C  C     . ASN B  1  451 ? 21.967  8.313   190.219 1.00 33.28  ? 426 ASN B C     1 
ATOM   6260 O  O     . ASN B  1  451 ? 22.264  7.161   189.999 1.00 35.27  ? 426 ASN B O     1 
ATOM   6261 C  CB    . ASN B  1  451 ? 19.469  7.982   190.378 1.00 30.48  ? 426 ASN B CB    1 
ATOM   6262 C  CG    . ASN B  1  451 ? 18.992  8.761   189.163 1.00 33.39  ? 426 ASN B CG    1 
ATOM   6263 O  OD1   . ASN B  1  451 ? 19.790  9.188   188.350 1.00 31.57  ? 426 ASN B OD1   1 
ATOM   6264 N  ND2   . ASN B  1  451 ? 17.702  8.981   189.065 1.00 35.00  ? 426 ASN B ND2   1 
ATOM   6265 N  N     . LYS B  1  452 ? 22.742  9.327   189.845 1.00 32.26  ? 427 LYS B N     1 
ATOM   6266 C  CA    . LYS B  1  452 ? 23.973  9.118   189.080 1.00 31.37  ? 427 LYS B CA    1 
ATOM   6267 C  C     . LYS B  1  452 ? 25.136  9.157   190.057 1.00 31.37  ? 427 LYS B C     1 
ATOM   6268 O  O     . LYS B  1  452 ? 25.300  10.110  190.794 1.00 28.11  ? 427 LYS B O     1 
ATOM   6269 C  CB    . LYS B  1  452 ? 24.122  10.175  187.998 1.00 31.99  ? 427 LYS B CB    1 
ATOM   6270 C  CG    . LYS B  1  452 ? 23.177  9.966   186.807 1.00 33.57  ? 427 LYS B CG    1 
ATOM   6271 C  CD    . LYS B  1  452 ? 23.323  11.134  185.803 1.00 37.95  ? 427 LYS B CD    1 
ATOM   6272 C  CE    . LYS B  1  452 ? 22.709  10.832  184.437 1.00 38.78  ? 427 LYS B CE    1 
ATOM   6273 N  NZ    . LYS B  1  452 ? 21.216  10.863  184.509 1.00 41.02  ? 427 LYS B NZ    1 
ATOM   6274 N  N     . ALA B  1  453 ? 25.935  8.092   190.063 1.00 31.84  ? 428 ALA B N     1 
ATOM   6275 C  CA    . ALA B  1  453 ? 27.046  7.944   190.997 1.00 30.73  ? 428 ALA B CA    1 
ATOM   6276 C  C     . ALA B  1  453 ? 27.996  9.144   191.024 1.00 30.54  ? 428 ALA B C     1 
ATOM   6277 O  O     . ALA B  1  453 ? 28.347  9.632   192.093 1.00 29.33  ? 428 ALA B O     1 
ATOM   6278 C  CB    . ALA B  1  453 ? 27.814  6.659   190.698 1.00 31.09  ? 428 ALA B CB    1 
ATOM   6279 N  N     . GLU B  1  454 ? 28.396  9.654   189.861 1.00 30.27  ? 429 GLU B N     1 
ATOM   6280 C  CA    . GLU B  1  454 ? 29.270  10.828  189.857 1.00 31.25  ? 429 GLU B CA    1 
ATOM   6281 C  C     . GLU B  1  454 ? 28.628  12.027  190.546 1.00 28.37  ? 429 GLU B C     1 
ATOM   6282 O  O     . GLU B  1  454 ? 29.304  12.799  191.229 1.00 30.49  ? 429 GLU B O     1 
ATOM   6283 C  CB    . GLU B  1  454 ? 29.754  11.225  188.446 1.00 31.57  ? 429 GLU B CB    1 
ATOM   6284 C  CG    . GLU B  1  454 ? 30.823  12.301  188.556 1.00 34.48  ? 429 GLU B CG    1 
ATOM   6285 C  CD    . GLU B  1  454 ? 31.546  12.660  187.264 1.00 35.77  ? 429 GLU B CD    1 
ATOM   6286 O  OE1   . GLU B  1  454 ? 31.464  11.928  186.277 1.00 32.57  ? 429 GLU B OE1   1 
ATOM   6287 O  OE2   . GLU B  1  454 ? 32.187  13.721  187.289 1.00 36.74  ? 429 GLU B OE2   1 
ATOM   6288 N  N     . GLU B  1  455 ? 27.329  12.195  190.385 1.00 28.28  ? 430 GLU B N     1 
ATOM   6289 C  CA    . GLU B  1  455 ? 26.651  13.321  191.063 1.00 30.94  ? 430 GLU B CA    1 
ATOM   6290 C  C     . GLU B  1  455 ? 26.589  13.107  192.596 1.00 27.70  ? 430 GLU B C     1 
ATOM   6291 O  O     . GLU B  1  455 ? 26.761  14.033  193.388 1.00 27.77  ? 430 GLU B O     1 
ATOM   6292 C  CB    . GLU B  1  455 ? 25.262  13.588  190.430 1.00 30.53  ? 430 GLU B CB    1 
ATOM   6293 C  CG    . GLU B  1  455 ? 25.400  14.181  189.011 1.00 31.25  ? 430 GLU B CG    1 
ATOM   6294 C  CD    . GLU B  1  455 ? 24.094  14.298  188.213 1.00 33.65  ? 430 GLU B CD    1 
ATOM   6295 O  OE1   . GLU B  1  455 ? 23.001  14.233  188.821 1.00 31.05  ? 430 GLU B OE1   1 
ATOM   6296 O  OE2   . GLU B  1  455 ? 24.147  14.451  186.947 1.00 33.35  ? 430 GLU B OE2   1 
ATOM   6297 N  N     . GLN B  1  456 ? 26.397  11.867  192.985 1.00 26.29  ? 431 GLN B N     1 
ATOM   6298 C  CA    . GLN B  1  456 ? 26.399  11.508  194.402 1.00 27.49  ? 431 GLN B CA    1 
ATOM   6299 C  C     . GLN B  1  456 ? 27.761  11.775  195.055 1.00 27.92  ? 431 GLN B C     1 
ATOM   6300 O  O     . GLN B  1  456 ? 27.824  12.427  196.091 1.00 29.13  ? 431 GLN B O     1 
ATOM   6301 C  CB    . GLN B  1  456 ? 25.972  10.076  194.543 1.00 27.44  ? 431 GLN B CB    1 
ATOM   6302 C  CG    . GLN B  1  456 ? 24.505  9.913   194.181 1.00 27.55  ? 431 GLN B CG    1 
ATOM   6303 C  CD    . GLN B  1  456 ? 24.105  8.493   193.907 1.00 29.58  ? 431 GLN B CD    1 
ATOM   6304 O  OE1   . GLN B  1  456 ? 24.946  7.583   193.840 1.00 30.33  ? 431 GLN B OE1   1 
ATOM   6305 N  NE2   . GLN B  1  456 ? 22.799  8.281   193.715 1.00 32.95  ? 431 GLN B NE2   1 
ATOM   6306 N  N     . TYR B  1  457 ? 28.845  11.374  194.398 1.00 28.39  ? 432 TYR B N     1 
ATOM   6307 C  CA    . TYR B  1  457 ? 30.186  11.750  194.869 1.00 29.03  ? 432 TYR B CA    1 
ATOM   6308 C  C     . TYR B  1  457 ? 30.424  13.217  194.984 1.00 29.10  ? 432 TYR B C     1 
ATOM   6309 O  O     . TYR B  1  457 ? 31.030  13.663  195.962 1.00 29.56  ? 432 TYR B O     1 
ATOM   6310 C  CB    . TYR B  1  457 ? 31.282  11.149  193.994 1.00 28.63  ? 432 TYR B CB    1 
ATOM   6311 C  CG    . TYR B  1  457 ? 31.430  9.680   194.186 1.00 30.21  ? 432 TYR B CG    1 
ATOM   6312 C  CD1   . TYR B  1  457 ? 31.803  9.149   195.419 1.00 32.33  ? 432 TYR B CD1   1 
ATOM   6313 C  CD2   . TYR B  1  457 ? 31.221  8.803   193.140 1.00 31.90  ? 432 TYR B CD2   1 
ATOM   6314 C  CE1   . TYR B  1  457 ? 31.960  7.772   195.584 1.00 32.59  ? 432 TYR B CE1   1 
ATOM   6315 C  CE2   . TYR B  1  457 ? 31.364  7.441   193.295 1.00 33.52  ? 432 TYR B CE2   1 
ATOM   6316 C  CZ    . TYR B  1  457 ? 31.736  6.926   194.519 1.00 33.97  ? 432 TYR B CZ    1 
ATOM   6317 O  OH    . TYR B  1  457 ? 31.866  5.551   194.644 1.00 37.18  ? 432 TYR B OH    1 
ATOM   6318 N  N     . SER B  1  458 ? 29.965  13.992  194.001 1.00 30.47  ? 433 SER B N     1 
ATOM   6319 C  CA    . SER B  1  458 ? 30.128  15.461  194.061 1.00 29.85  ? 433 SER B CA    1 
ATOM   6320 C  C     . SER B  1  458 ? 29.334  16.072  195.205 1.00 28.98  ? 433 SER B C     1 
ATOM   6321 O  O     . SER B  1  458 ? 29.817  16.986  195.883 1.00 29.72  ? 433 SER B O     1 
ATOM   6322 C  CB    . SER B  1  458 ? 29.734  16.156  192.726 1.00 31.91  ? 433 SER B CB    1 
ATOM   6323 O  OG    . SER B  1  458 ? 30.354  15.511  191.617 1.00 35.82  ? 433 SER B OG    1 
ATOM   6324 N  N     . LEU B  1  459 ? 28.130  15.559  195.451 1.00 30.40  ? 434 LEU B N     1 
ATOM   6325 C  CA    . LEU B  1  459 ? 27.357  16.074  196.568 1.00 30.92  ? 434 LEU B CA    1 
ATOM   6326 C  C     . LEU B  1  459 ? 28.027  15.787  197.906 1.00 29.15  ? 434 LEU B C     1 
ATOM   6327 O  O     . LEU B  1  459 ? 28.093  16.634  198.780 1.00 28.70  ? 434 LEU B O     1 
ATOM   6328 C  CB    . LEU B  1  459 ? 25.920  15.545  196.600 1.00 32.43  ? 434 LEU B CB    1 
ATOM   6329 C  CG    . LEU B  1  459 ? 25.061  16.782  196.825 1.00 39.81  ? 434 LEU B CG    1 
ATOM   6330 C  CD1   . LEU B  1  459 ? 24.469  17.162  195.460 1.00 42.83  ? 434 LEU B CD1   1 
ATOM   6331 C  CD2   . LEU B  1  459 ? 24.028  16.578  197.866 1.00 42.07  ? 434 LEU B CD2   1 
ATOM   6332 N  N     . CYS B  1  460 ? 28.511  14.568  198.038 1.00 31.55  ? 435 CYS B N     1 
ATOM   6333 C  CA    . CYS B  1  460 ? 29.271  14.157  199.190 1.00 31.24  ? 435 CYS B CA    1 
ATOM   6334 C  C     . CYS B  1  460 ? 30.468  15.083  199.417 1.00 32.25  ? 435 CYS B C     1 
ATOM   6335 O  O     . CYS B  1  460 ? 30.702  15.541  200.532 1.00 31.06  ? 435 CYS B O     1 
ATOM   6336 C  CB    . CYS B  1  460 ? 29.718  12.716  198.991 1.00 32.52  ? 435 CYS B CB    1 
ATOM   6337 S  SG    . CYS B  1  460 ? 30.622  12.037  200.394 1.00 33.77  ? 435 CYS B SG    1 
ATOM   6338 N  N     . GLN B  1  461 ? 31.185  15.386  198.342 1.00 33.62  ? 436 GLN B N     1 
ATOM   6339 C  CA    . GLN B  1  461 ? 32.319  16.327  198.391 1.00 38.05  ? 436 GLN B CA    1 
ATOM   6340 C  C     . GLN B  1  461 ? 31.956  17.696  198.896 1.00 34.26  ? 436 GLN B C     1 
ATOM   6341 O  O     . GLN B  1  461 ? 32.611  18.255  199.785 1.00 30.85  ? 436 GLN B O     1 
ATOM   6342 C  CB    . GLN B  1  461 ? 32.895  16.510  196.987 1.00 44.41  ? 436 GLN B CB    1 
ATOM   6343 C  CG    . GLN B  1  461 ? 34.297  16.002  196.841 1.00 52.10  ? 436 GLN B CG    1 
ATOM   6344 C  CD    . GLN B  1  461 ? 35.260  17.076  196.458 1.00 60.55  ? 436 GLN B CD    1 
ATOM   6345 O  OE1   . GLN B  1  461 ? 35.899  16.990  195.403 1.00 65.15  ? 436 GLN B OE1   1 
ATOM   6346 N  NE2   . GLN B  1  461 ? 35.357  18.115  197.291 1.00 65.15  ? 436 GLN B NE2   1 
ATOM   6347 N  N     . GLU B  1  462 ? 30.893  18.238  198.317 1.00 34.14  ? 437 GLU B N     1 
ATOM   6348 C  CA    . GLU B  1  462 ? 30.420  19.559  198.727 1.00 36.43  ? 437 GLU B CA    1 
ATOM   6349 C  C     . GLU B  1  462 ? 30.018  19.541  200.198 1.00 35.70  ? 437 GLU B C     1 
ATOM   6350 O  O     . GLU B  1  462 ? 30.372  20.460  200.963 1.00 34.06  ? 437 GLU B O     1 
ATOM   6351 C  CB    . GLU B  1  462 ? 29.259  20.048  197.850 1.00 39.15  ? 437 GLU B CB    1 
ATOM   6352 C  CG    . GLU B  1  462 ? 28.566  21.312  198.395 1.00 46.85  ? 437 GLU B CG    1 
ATOM   6353 C  CD    . GLU B  1  462 ? 29.508  22.501  198.673 1.00 50.69  ? 437 GLU B CD    1 
ATOM   6354 O  OE1   . GLU B  1  462 ? 29.174  23.340  199.540 1.00 50.18  ? 437 GLU B OE1   1 
ATOM   6355 O  OE2   . GLU B  1  462 ? 30.585  22.606  198.030 1.00 55.83  ? 437 GLU B OE2   1 
ATOM   6356 N  N     . LEU B  1  463 ? 29.304  18.489  200.607 1.00 33.64  ? 438 LEU B N     1 
ATOM   6357 C  CA    . LEU B  1  463 ? 28.899  18.376  201.992 1.00 31.73  ? 438 LEU B CA    1 
ATOM   6358 C  C     . LEU B  1  463 ? 30.098  18.284  202.926 1.00 33.47  ? 438 LEU B C     1 
ATOM   6359 O  O     . LEU B  1  463 ? 30.117  18.918  203.999 1.00 30.42  ? 438 LEU B O     1 
ATOM   6360 C  CB    . LEU B  1  463 ? 27.966  17.191  202.184 1.00 32.50  ? 438 LEU B CB    1 
ATOM   6361 C  CG    . LEU B  1  463 ? 26.557  17.356  201.617 1.00 33.75  ? 438 LEU B CG    1 
ATOM   6362 C  CD1   . LEU B  1  463 ? 25.793  16.052  201.685 1.00 33.50  ? 438 LEU B CD1   1 
ATOM   6363 C  CD2   . LEU B  1  463 ? 25.793  18.411  202.392 1.00 36.08  ? 438 LEU B CD2   1 
ATOM   6364 N  N     . CYS B  1  464 ? 31.110  17.526  202.516 1.00 33.25  ? 439 CYS B N     1 
ATOM   6365 C  CA    . CYS B  1  464 ? 32.343  17.455  203.304 1.00 35.00  ? 439 CYS B CA    1 
ATOM   6366 C  C     . CYS B  1  464 ? 33.048  18.817  203.423 1.00 34.07  ? 439 CYS B C     1 
ATOM   6367 O  O     . CYS B  1  464 ? 33.588  19.154  204.484 1.00 35.83  ? 439 CYS B O     1 
ATOM   6368 C  CB    . CYS B  1  464 ? 33.299  16.392  202.718 1.00 35.09  ? 439 CYS B CB    1 
ATOM   6369 S  SG    . CYS B  1  464 ? 32.699  14.675  202.853 1.00 37.20  ? 439 CYS B SG    1 
ATOM   6370 N  N     . SER B  1  465 ? 33.047  19.617  202.356 1.00 36.56  ? 440 SER B N     1 
ATOM   6371 C  CA    . SER B  1  465 ? 33.650  20.971  202.441 1.00 36.78  ? 440 SER B CA    1 
ATOM   6372 C  C     . SER B  1  465 ? 32.897  21.870  203.369 1.00 36.69  ? 440 SER B C     1 
ATOM   6373 O  O     . SER B  1  465 ? 33.506  22.513  204.207 1.00 35.33  ? 440 SER B O     1 
ATOM   6374 C  CB    . SER B  1  465 ? 33.756  21.644  201.094 1.00 38.36  ? 440 SER B CB    1 
ATOM   6375 O  OG    . SER B  1  465 ? 34.473  20.768  200.279 1.00 45.62  ? 440 SER B OG    1 
ATOM   6376 N  N     . GLU B  1  466 ? 31.573  21.905  203.260 1.00 37.32  ? 441 GLU B N     1 
ATOM   6377 C  CA    . GLU B  1  466 ? 30.803  22.716  204.210 1.00 37.65  ? 441 GLU B CA    1 
ATOM   6378 C  C     . GLU B  1  466 ? 31.129  22.335  205.615 1.00 38.95  ? 441 GLU B C     1 
ATOM   6379 O  O     . GLU B  1  466 ? 31.309  23.193  206.476 1.00 43.26  ? 441 GLU B O     1 
ATOM   6380 C  CB    . GLU B  1  466 ? 29.311  22.584  203.994 1.00 39.63  ? 441 GLU B CB    1 
ATOM   6381 C  CG    . GLU B  1  466 ? 28.858  23.209  202.716 1.00 40.15  ? 441 GLU B CG    1 
ATOM   6382 C  CD    . GLU B  1  466 ? 27.399  22.914  202.439 1.00 46.12  ? 441 GLU B CD    1 
ATOM   6383 O  OE1   . GLU B  1  466 ? 27.063  22.515  201.292 1.00 48.53  ? 441 GLU B OE1   1 
ATOM   6384 O  OE2   . GLU B  1  466 ? 26.588  23.062  203.376 1.00 40.27  ? 441 GLU B OE2   1 
ATOM   6385 N  N     . LEU B  1  467 ? 31.235  21.031  205.855 1.00 41.78  ? 442 LEU B N     1 
ATOM   6386 C  CA    . LEU B  1  467 ? 31.481  20.534  207.193 1.00 37.65  ? 442 LEU B CA    1 
ATOM   6387 C  C     . LEU B  1  467 ? 32.885  20.884  207.718 1.00 38.03  ? 442 LEU B C     1 
ATOM   6388 O  O     . LEU B  1  467 ? 33.027  21.266  208.873 1.00 37.58  ? 442 LEU B O     1 
ATOM   6389 C  CB    . LEU B  1  467 ? 31.225  19.020  207.252 1.00 39.01  ? 442 LEU B CB    1 
ATOM   6390 C  CG    . LEU B  1  467 ? 31.255  18.364  208.632 1.00 39.76  ? 442 LEU B CG    1 
ATOM   6391 C  CD1   . LEU B  1  467 ? 30.173  18.947  209.538 1.00 40.53  ? 442 LEU B CD1   1 
ATOM   6392 C  CD2   . LEU B  1  467 ? 31.123  16.848  208.516 1.00 40.50  ? 442 LEU B CD2   1 
ATOM   6393 N  N     . ALA B  1  468 ? 33.909  20.745  206.881 1.00 38.36  ? 443 ALA B N     1 
ATOM   6394 C  CA    . ALA B  1  468 ? 35.251  21.213  207.221 1.00 41.99  ? 443 ALA B CA    1 
ATOM   6395 C  C     . ALA B  1  468 ? 35.242  22.715  207.558 1.00 45.53  ? 443 ALA B C     1 
ATOM   6396 O  O     . ALA B  1  468 ? 35.960  23.164  208.444 1.00 47.43  ? 443 ALA B O     1 
ATOM   6397 C  CB    . ALA B  1  468 ? 36.232  20.926  206.076 1.00 41.08  ? 443 ALA B CB    1 
ATOM   6398 N  N     . GLN B  1  469 ? 34.415  23.474  206.848 1.00 46.31  ? 444 GLN B N     1 
ATOM   6399 C  CA    . GLN B  1  469 ? 34.301  24.914  207.052 1.00 51.95  ? 444 GLN B CA    1 
ATOM   6400 C  C     . GLN B  1  469 ? 33.683  25.197  208.434 1.00 52.30  ? 444 GLN B C     1 
ATOM   6401 O  O     . GLN B  1  469 ? 34.174  26.054  209.170 1.00 52.96  ? 444 GLN B O     1 
ATOM   6402 C  CB    . GLN B  1  469 ? 33.469  25.515  205.922 1.00 55.67  ? 444 GLN B CB    1 
ATOM   6403 C  CG    . GLN B  1  469 ? 33.775  26.947  205.538 1.00 66.92  ? 444 GLN B CG    1 
ATOM   6404 C  CD    . GLN B  1  469 ? 33.082  27.361  204.232 1.00 73.39  ? 444 GLN B CD    1 
ATOM   6405 O  OE1   . GLN B  1  469 ? 32.683  26.516  203.414 1.00 75.38  ? 444 GLN B OE1   1 
ATOM   6406 N  NE2   . GLN B  1  469 ? 32.939  28.667  204.032 1.00 77.80  ? 444 GLN B NE2   1 
ATOM   6407 N  N     . ASP B  1  470 ? 32.639  24.442  208.792 1.00 46.57  ? 445 ASP B N     1 
ATOM   6408 C  CA    . ASP B  1  470 ? 32.015  24.529  210.107 1.00 45.45  ? 445 ASP B CA    1 
ATOM   6409 C  C     . ASP B  1  470 ? 33.004  24.145  211.223 1.00 46.15  ? 445 ASP B C     1 
ATOM   6410 O  O     . ASP B  1  470 ? 33.095  24.819  212.262 1.00 49.17  ? 445 ASP B O     1 
ATOM   6411 C  CB    . ASP B  1  470 ? 30.760  23.647  210.184 1.00 47.31  ? 445 ASP B CB    1 
ATOM   6412 C  CG    . ASP B  1  470 ? 29.648  24.078  209.203 1.00 48.18  ? 445 ASP B CG    1 
ATOM   6413 O  OD1   . ASP B  1  470 ? 29.622  25.256  208.805 1.00 49.45  ? 445 ASP B OD1   1 
ATOM   6414 O  OD2   . ASP B  1  470 ? 28.782  23.233  208.832 1.00 49.99  ? 445 ASP B OD2   1 
ATOM   6415 N  N     . LEU B  1  471 ? 33.783  23.125  210.983 1.00 47.48  ? 446 LEU B N     1 
ATOM   6416 C  CA    . LEU B  1  471 ? 34.771  22.724  211.938 1.00 52.22  ? 446 LEU B CA    1 
ATOM   6417 C  C     . LEU B  1  471 ? 35.846  23.789  212.095 1.00 56.74  ? 446 LEU B C     1 
ATOM   6418 O  O     . LEU B  1  471 ? 36.234  24.089  213.184 1.00 55.29  ? 446 LEU B O     1 
ATOM   6419 C  CB    . LEU B  1  471 ? 35.458  21.453  211.479 1.00 52.43  ? 446 LEU B CB    1 
ATOM   6420 C  CG    . LEU B  1  471 ? 34.705  20.147  211.517 1.00 53.74  ? 446 LEU B CG    1 
ATOM   6421 C  CD1   . LEU B  1  471 ? 35.560  19.027  210.996 1.00 54.87  ? 446 LEU B CD1   1 
ATOM   6422 C  CD2   . LEU B  1  471 ? 34.227  19.838  212.904 1.00 51.77  ? 446 LEU B CD2   1 
ATOM   6423 N  N     . GLN B  1  472 ? 36.334  24.331  210.991 1.00 61.50  ? 447 GLN B N     1 
ATOM   6424 C  CA    . GLN B  1  472 ? 37.417  25.339  211.002 1.00 68.21  ? 447 GLN B CA    1 
ATOM   6425 C  C     . GLN B  1  472 ? 37.041  26.543  211.885 1.00 66.78  ? 447 GLN B C     1 
ATOM   6426 O  O     . GLN B  1  472 ? 37.886  27.102  212.584 1.00 64.56  ? 447 GLN B O     1 
ATOM   6427 C  CB    . GLN B  1  472 ? 37.760  25.803  209.566 1.00 70.90  ? 447 GLN B CB    1 
ATOM   6428 C  CG    . GLN B  1  472 ? 39.240  26.058  209.295 1.00 77.55  ? 447 GLN B CG    1 
ATOM   6429 C  CD    . GLN B  1  472 ? 39.815  27.231  210.083 1.00 81.91  ? 447 GLN B CD    1 
ATOM   6430 O  OE1   . GLN B  1  472 ? 39.296  28.346  210.014 1.00 83.90  ? 447 GLN B OE1   1 
ATOM   6431 N  NE2   . GLN B  1  472 ? 40.896  26.987  210.838 1.00 83.57  ? 447 GLN B NE2   1 
ATOM   6432 N  N     . LYS B  1  473 ? 35.763  26.910  211.864 1.00 68.07  ? 448 LYS B N     1 
ATOM   6433 C  CA    . LYS B  1  473 ? 35.256  28.025  212.661 1.00 72.38  ? 448 LYS B CA    1 
ATOM   6434 C  C     . LYS B  1  473 ? 35.477  27.794  214.156 1.00 73.03  ? 448 LYS B C     1 
ATOM   6435 O  O     . LYS B  1  473 ? 35.846  28.713  214.867 1.00 80.20  ? 448 LYS B O     1 
ATOM   6436 C  CB    . LYS B  1  473 ? 33.769  28.274  212.355 1.00 74.54  ? 448 LYS B CB    1 
ATOM   6437 C  CG    . LYS B  1  473 ? 33.218  29.586  212.896 1.00 75.31  ? 448 LYS B CG    1 
ATOM   6438 C  CD    . LYS B  1  473 ? 31.913  29.967  212.211 1.00 73.48  ? 448 LYS B CD    1 
ATOM   6439 N  N     . GLU B  1  474 ? 35.286  26.563  214.620 1.00 76.40  ? 449 GLU B N     1 
ATOM   6440 C  CA    . GLU B  1  474 ? 35.474  26.218  216.032 1.00 73.94  ? 449 GLU B CA    1 
ATOM   6441 C  C     . GLU B  1  474 ? 36.774  25.428  216.286 1.00 71.72  ? 449 GLU B C     1 
ATOM   6442 O  O     . GLU B  1  474 ? 36.962  24.872  217.370 1.00 69.09  ? 449 GLU B O     1 
ATOM   6443 C  CB    . GLU B  1  474 ? 34.244  25.448  216.527 1.00 81.82  ? 449 GLU B CB    1 
ATOM   6444 C  CG    . GLU B  1  474 ? 32.911  26.110  216.144 1.00 89.12  ? 449 GLU B CG    1 
ATOM   6445 C  CD    . GLU B  1  474 ? 31.685  25.533  216.850 1.00 91.40  ? 449 GLU B CD    1 
ATOM   6446 O  OE1   . GLU B  1  474 ? 31.789  24.466  217.490 1.00 94.60  ? 449 GLU B OE1   1 
ATOM   6447 O  OE2   . GLU B  1  474 ? 30.601  26.151  216.757 1.00 92.23  ? 449 GLU B OE2   1 
ATOM   6448 N  N     . ARG B  1  475 ? 37.673  25.424  215.298 1.00 69.03  ? 450 ARG B N     1 
ATOM   6449 C  CA    . ARG B  1  475 ? 38.926  24.650  215.303 1.00 72.58  ? 450 ARG B CA    1 
ATOM   6450 C  C     . ARG B  1  475 ? 38.846  23.263  215.964 1.00 68.08  ? 450 ARG B C     1 
ATOM   6451 O  O     . ARG B  1  475 ? 39.618  22.943  216.866 1.00 69.26  ? 450 ARG B O     1 
ATOM   6452 C  CB    . ARG B  1  475 ? 40.058  25.503  215.896 1.00 78.82  ? 450 ARG B CB    1 
ATOM   6453 C  CG    . ARG B  1  475 ? 40.524  26.620  214.972 1.00 82.27  ? 450 ARG B CG    1 
ATOM   6454 C  CD    . ARG B  1  475 ? 41.084  27.800  215.749 1.00 91.87  ? 450 ARG B CD    1 
ATOM   6455 N  NE    . ARG B  1  475 ? 41.640  28.835  214.868 1.00 101.74 ? 450 ARG B NE    1 
ATOM   6456 C  CZ    . ARG B  1  475 ? 42.885  28.863  214.371 1.00 105.50 ? 450 ARG B CZ    1 
ATOM   6457 N  NH1   . ARG B  1  475 ? 43.769  27.901  214.647 1.00 107.18 ? 450 ARG B NH1   1 
ATOM   6458 N  NH2   . ARG B  1  475 ? 43.255  29.874  213.578 1.00 104.11 ? 450 ARG B NH2   1 
ATOM   6459 N  N     . LEU B  1  476 ? 37.907  22.448  215.485 1.00 66.22  ? 451 LEU B N     1 
ATOM   6460 C  CA    . LEU B  1  476 ? 37.688  21.089  215.991 1.00 61.29  ? 451 LEU B CA    1 
ATOM   6461 C  C     . LEU B  1  476 ? 38.131  20.045  214.987 1.00 60.66  ? 451 LEU B C     1 
ATOM   6462 O  O     . LEU B  1  476 ? 38.034  20.261  213.777 1.00 59.28  ? 451 LEU B O     1 
ATOM   6463 C  CB    . LEU B  1  476 ? 36.212  20.860  216.309 1.00 65.77  ? 451 LEU B CB    1 
ATOM   6464 C  CG    . LEU B  1  476 ? 35.648  21.491  217.584 1.00 69.73  ? 451 LEU B CG    1 
ATOM   6465 C  CD1   . LEU B  1  476 ? 34.134  21.352  217.601 1.00 71.43  ? 451 LEU B CD1   1 
ATOM   6466 C  CD2   . LEU B  1  476 ? 36.249  20.873  218.841 1.00 70.73  ? 451 LEU B CD2   1 
ATOM   6467 N  N     . LYS B  1  477 ? 38.614  18.917  215.503 1.00 57.53  ? 452 LYS B N     1 
ATOM   6468 C  CA    . LYS B  1  477 ? 38.960  17.751  214.697 1.00 58.34  ? 452 LYS B CA    1 
ATOM   6469 C  C     . LYS B  1  477 ? 38.311  16.530  215.326 1.00 55.71  ? 452 LYS B C     1 
ATOM   6470 O  O     . LYS B  1  477 ? 38.089  16.518  216.539 1.00 61.42  ? 452 LYS B O     1 
ATOM   6471 C  CB    . LYS B  1  477 ? 40.472  17.547  214.631 1.00 62.26  ? 452 LYS B CB    1 
ATOM   6472 C  CG    . LYS B  1  477 ? 41.290  18.822  214.488 1.00 68.43  ? 452 LYS B CG    1 
ATOM   6473 C  CD    . LYS B  1  477 ? 42.675  18.525  213.921 1.00 70.88  ? 452 LYS B CD    1 
ATOM   6474 C  CE    . LYS B  1  477 ? 43.634  19.686  214.124 1.00 72.04  ? 452 LYS B CE    1 
ATOM   6475 N  NZ    . LYS B  1  477 ? 43.123  20.955  213.543 1.00 71.94  ? 452 LYS B NZ    1 
ATOM   6476 N  N     . GLY B  1  478 ? 38.024  15.513  214.503 1.00 53.73  ? 453 GLY B N     1 
ATOM   6477 C  CA    . GLY B  1  478 ? 37.358  14.263  214.944 1.00 49.20  ? 453 GLY B CA    1 
ATOM   6478 C  C     . GLY B  1  478 ? 37.870  13.006  214.252 1.00 46.70  ? 453 GLY B C     1 
ATOM   6479 O  O     . GLY B  1  478 ? 38.546  13.069  213.212 1.00 46.60  ? 453 GLY B O     1 
ATOM   6480 N  N     . ARG B  1  479 ? 37.564  11.857  214.844 1.00 44.39  ? 454 ARG B N     1 
ATOM   6481 C  CA    . ARG B  1  479 ? 37.973  10.557  214.309 1.00 43.29  ? 454 ARG B CA    1 
ATOM   6482 C  C     . ARG B  1  479 ? 36.953  9.693   213.658 1.00 40.68  ? 454 ARG B C     1 
ATOM   6483 O  O     . ARG B  1  479 ? 37.311  8.675   213.052 1.00 37.83  ? 454 ARG B O     1 
ATOM   6484 C  CB    . ARG B  1  479 ? 38.654  9.744   215.429 1.00 45.98  ? 454 ARG B CB    1 
ATOM   6485 C  CG    . ARG B  1  479 ? 39.672  10.508  216.274 1.00 49.24  ? 454 ARG B CG    1 
ATOM   6486 C  CD    . ARG B  1  479 ? 40.058  9.727   217.525 1.00 50.98  ? 454 ARG B CD    1 
ATOM   6487 N  NE    . ARG B  1  479 ? 40.084  8.290   217.273 1.00 52.63  ? 454 ARG B NE    1 
ATOM   6488 C  CZ    . ARG B  1  479 ? 39.244  7.424   217.827 1.00 53.07  ? 454 ARG B CZ    1 
ATOM   6489 N  NH1   . ARG B  1  479 ? 38.316  7.861   218.670 1.00 57.52  ? 454 ARG B NH1   1 
ATOM   6490 N  NH2   . ARG B  1  479 ? 39.328  6.133   217.543 1.00 49.70  ? 454 ARG B NH2   1 
ATOM   6491 N  N     . THR B  1  480 ? 35.672  10.071  213.770 1.00 39.19  ? 455 THR B N     1 
ATOM   6492 C  CA    . THR B  1  480 ? 34.565  9.297   213.198 1.00 40.05  ? 455 THR B CA    1 
ATOM   6493 C  C     . THR B  1  480 ? 33.748  10.133  212.193 1.00 39.19  ? 455 THR B C     1 
ATOM   6494 O  O     . THR B  1  480 ? 33.226  11.194  212.516 1.00 39.12  ? 455 THR B O     1 
ATOM   6495 C  CB    . THR B  1  480 ? 33.650  8.726   214.316 1.00 41.16  ? 455 THR B CB    1 
ATOM   6496 O  OG1   . THR B  1  480 ? 34.419  7.829   215.128 1.00 41.04  ? 455 THR B OG1   1 
ATOM   6497 C  CG2   . THR B  1  480 ? 32.451  7.911   213.742 1.00 40.01  ? 455 THR B CG2   1 
ATOM   6498 N  N     . VAL B  1  481 ? 33.633  9.610   210.981 1.00 38.63  ? 456 VAL B N     1 
ATOM   6499 C  CA    . VAL B  1  481 ? 32.879  10.225  209.916 1.00 36.06  ? 456 VAL B CA    1 
ATOM   6500 C  C     . VAL B  1  481 ? 31.731  9.272   209.604 1.00 36.02  ? 456 VAL B C     1 
ATOM   6501 O  O     . VAL B  1  481 ? 31.965  8.075   209.404 1.00 35.59  ? 456 VAL B O     1 
ATOM   6502 C  CB    . VAL B  1  481 ? 33.782  10.434  208.691 1.00 36.48  ? 456 VAL B CB    1 
ATOM   6503 C  CG1   . VAL B  1  481 ? 32.966  10.887  207.480 1.00 39.23  ? 456 VAL B CG1   1 
ATOM   6504 C  CG2   . VAL B  1  481 ? 34.862  11.457  209.014 1.00 35.02  ? 456 VAL B CG2   1 
ATOM   6505 N  N     . THR B  1  482 ? 30.505  9.800   209.579 1.00 32.61  ? 457 THR B N     1 
ATOM   6506 C  CA    . THR B  1  482 ? 29.306  9.039   209.277 1.00 31.95  ? 457 THR B CA    1 
ATOM   6507 C  C     . THR B  1  482 ? 28.554  9.696   208.104 1.00 32.60  ? 457 THR B C     1 
ATOM   6508 O  O     . THR B  1  482 ? 28.343  10.894  208.096 1.00 29.89  ? 457 THR B O     1 
ATOM   6509 C  CB    . THR B  1  482 ? 28.382  8.981   210.517 1.00 35.26  ? 457 THR B CB    1 
ATOM   6510 O  OG1   . THR B  1  482 ? 29.123  8.452   211.621 1.00 40.39  ? 457 THR B OG1   1 
ATOM   6511 C  CG2   . THR B  1  482 ? 27.150  8.116   210.276 1.00 35.06  ? 457 THR B CG2   1 
ATOM   6512 N  N     . ILE B  1  483 ? 28.179  8.908   207.108 1.00 31.61  ? 458 ILE B N     1 
ATOM   6513 C  CA    . ILE B  1  483 ? 27.363  9.419   206.018 1.00 31.70  ? 458 ILE B CA    1 
ATOM   6514 C  C     . ILE B  1  483 ? 25.971  8.919   206.276 1.00 32.79  ? 458 ILE B C     1 
ATOM   6515 O  O     . ILE B  1  483 ? 25.797  7.898   206.944 1.00 31.67  ? 458 ILE B O     1 
ATOM   6516 C  CB    . ILE B  1  483 ? 27.857  9.010   204.625 1.00 31.86  ? 458 ILE B CB    1 
ATOM   6517 C  CG1   . ILE B  1  483 ? 27.859  7.494   204.441 1.00 32.03  ? 458 ILE B CG1   1 
ATOM   6518 C  CG2   . ILE B  1  483 ? 29.253  9.559   204.396 1.00 32.77  ? 458 ILE B CG2   1 
ATOM   6519 C  CD1   . ILE B  1  483 ? 27.868  7.060   202.995 1.00 32.32  ? 458 ILE B CD1   1 
ATOM   6520 N  N     . LYS B  1  484 ? 25.000  9.671   205.774 1.00 29.14  ? 459 LYS B N     1 
ATOM   6521 C  CA    . LYS B  1  484 ? 23.603  9.381   205.936 1.00 30.13  ? 459 LYS B CA    1 
ATOM   6522 C  C     . LYS B  1  484 ? 23.007  9.454   204.542 1.00 30.34  ? 459 LYS B C     1 
ATOM   6523 O  O     . LYS B  1  484 ? 23.257  10.410  203.781 1.00 27.89  ? 459 LYS B O     1 
ATOM   6524 C  CB    . LYS B  1  484 ? 22.978  10.391  206.884 1.00 30.80  ? 459 LYS B CB    1 
ATOM   6525 C  CG    . LYS B  1  484 ? 21.476  10.312  207.023 1.00 33.90  ? 459 LYS B CG    1 
ATOM   6526 C  CD    . LYS B  1  484 ? 21.062  11.223  208.157 1.00 36.07  ? 459 LYS B CD    1 
ATOM   6527 C  CE    . LYS B  1  484 ? 19.572  11.335  208.304 1.00 39.82  ? 459 LYS B CE    1 
ATOM   6528 N  NZ    . LYS B  1  484 ? 19.284  12.386  209.336 1.00 46.22  ? 459 LYS B NZ    1 
ATOM   6529 N  N     . LEU B  1  485 ? 22.275  8.415   204.183 1.00 28.53  ? 460 LEU B N     1 
ATOM   6530 C  CA    . LEU B  1  485 ? 21.654  8.306   202.873 1.00 27.53  ? 460 LEU B CA    1 
ATOM   6531 C  C     . LEU B  1  485 ? 20.170  8.040   203.076 1.00 28.87  ? 460 LEU B C     1 
ATOM   6532 O  O     . LEU B  1  485 ? 19.819  7.132   203.820 1.00 29.56  ? 460 LEU B O     1 
ATOM   6533 C  CB    . LEU B  1  485 ? 22.312  7.162   202.105 1.00 27.13  ? 460 LEU B CB    1 
ATOM   6534 C  CG    . LEU B  1  485 ? 23.835  7.280   201.897 1.00 29.03  ? 460 LEU B CG    1 
ATOM   6535 C  CD1   . LEU B  1  485 ? 24.420  6.038   201.269 1.00 31.84  ? 460 LEU B CD1   1 
ATOM   6536 C  CD2   . LEU B  1  485 ? 24.148  8.474   201.012 1.00 28.06  ? 460 LEU B CD2   1 
ATOM   6537 N  N     . LYS B  1  486 ? 19.296  8.849   202.471 1.00 26.89  ? 461 LYS B N     1 
ATOM   6538 C  CA    . LYS B  1  486 ? 17.864  8.553   202.435 1.00 25.16  ? 461 LYS B CA    1 
ATOM   6539 C  C     . LYS B  1  486 ? 17.402  8.337   201.015 1.00 26.44  ? 461 LYS B C     1 
ATOM   6540 O  O     . LYS B  1  486 ? 17.552  9.220   200.151 1.00 27.07  ? 461 LYS B O     1 
ATOM   6541 C  CB    . LYS B  1  486 ? 17.079  9.671   203.101 1.00 27.31  ? 461 LYS B CB    1 
ATOM   6542 C  CG    . LYS B  1  486 ? 15.607  9.367   203.346 1.00 26.56  ? 461 LYS B CG    1 
ATOM   6543 C  CD    . LYS B  1  486 ? 14.855  10.647  203.722 1.00 30.29  ? 461 LYS B CD    1 
ATOM   6544 C  CE    . LYS B  1  486 ? 15.334  11.310  205.014 1.00 30.92  ? 461 LYS B CE    1 
ATOM   6545 N  NZ    . LYS B  1  486 ? 14.488  12.485  205.400 1.00 30.32  ? 461 LYS B NZ    1 
ATOM   6546 N  N     . ASN B  1  487 ? 16.806  7.181   200.757 1.00 25.82  ? 462 ASN B N     1 
ATOM   6547 C  CA    . ASN B  1  487 ? 16.321  6.885   199.434 1.00 26.56  ? 462 ASN B CA    1 
ATOM   6548 C  C     . ASN B  1  487 ? 14.976  7.531   199.161 1.00 27.52  ? 462 ASN B C     1 
ATOM   6549 O  O     . ASN B  1  487 ? 14.396  8.146   200.063 1.00 26.87  ? 462 ASN B O     1 
ATOM   6550 C  CB    . ASN B  1  487 ? 16.363  5.381   199.126 1.00 27.59  ? 462 ASN B CB    1 
ATOM   6551 C  CG    . ASN B  1  487 ? 15.406  4.511   199.946 1.00 28.59  ? 462 ASN B CG    1 
ATOM   6552 O  OD1   . ASN B  1  487 ? 14.364  4.928   200.463 1.00 32.75  ? 462 ASN B OD1   1 
ATOM   6553 N  ND2   . ASN B  1  487 ? 15.742  3.243   199.993 1.00 31.66  ? 462 ASN B ND2   1 
ATOM   6554 N  N     . VAL B  1  488 ? 14.506  7.397   197.927 1.00 28.04  ? 463 VAL B N     1 
ATOM   6555 C  CA    . VAL B  1  488 ? 13.253  8.015   197.512 1.00 30.81  ? 463 VAL B CA    1 
ATOM   6556 C  C     . VAL B  1  488 ? 12.027  7.390   198.170 1.00 31.76  ? 463 VAL B C     1 
ATOM   6557 O  O     . VAL B  1  488 ? 10.952  7.984   198.157 1.00 35.69  ? 463 VAL B O     1 
ATOM   6558 C  CB    . VAL B  1  488 ? 13.085  8.073   195.978 1.00 32.55  ? 463 VAL B CB    1 
ATOM   6559 C  CG1   . VAL B  1  488 ? 14.270  8.805   195.343 1.00 32.93  ? 463 VAL B CG1   1 
ATOM   6560 C  CG2   . VAL B  1  488 ? 12.887  6.707   195.354 1.00 32.25  ? 463 VAL B CG2   1 
ATOM   6561 N  N     . ASN B  1  489 ? 12.194  6.227   198.793 1.00 31.69  ? 464 ASN B N     1 
ATOM   6562 C  CA    . ASN B  1  489 ? 11.143  5.659   199.641 1.00 33.09  ? 464 ASN B CA    1 
ATOM   6563 C  C     . ASN B  1  489 ? 11.308  6.015   201.107 1.00 32.80  ? 464 ASN B C     1 
ATOM   6564 O  O     . ASN B  1  489 ? 10.711  5.362   201.965 1.00 31.05  ? 464 ASN B O     1 
ATOM   6565 C  CB    . ASN B  1  489 ? 11.085  4.137   199.451 1.00 37.90  ? 464 ASN B CB    1 
ATOM   6566 C  CG    . ASN B  1  489 ? 10.349  3.757   198.191 1.00 41.04  ? 464 ASN B CG    1 
ATOM   6567 O  OD1   . ASN B  1  489 ? 9.207   4.165   197.988 1.00 48.92  ? 464 ASN B OD1   1 
ATOM   6568 N  ND2   . ASN B  1  489 ? 10.968  2.962   197.360 1.00 44.58  ? 464 ASN B ND2   1 
ATOM   6569 N  N     . PHE B  1  490 ? 12.109  7.046   201.384 1.00 27.76  ? 465 PHE B N     1 
ATOM   6570 C  CA    . PHE B  1  490 ? 12.258  7.636   202.723 1.00 29.04  ? 465 PHE B CA    1 
ATOM   6571 C  C     . PHE B  1  490 ? 13.010  6.750   203.731 1.00 29.94  ? 465 PHE B C     1 
ATOM   6572 O  O     . PHE B  1  490 ? 13.111  7.103   204.907 1.00 28.70  ? 465 PHE B O     1 
ATOM   6573 C  CB    . PHE B  1  490 ? 10.911  8.137   203.284 1.00 29.13  ? 465 PHE B CB    1 
ATOM   6574 C  CG    . PHE B  1  490 ? 10.361  9.314   202.542 1.00 27.88  ? 465 PHE B CG    1 
ATOM   6575 C  CD1   . PHE B  1  490 ? 9.618   9.130   201.397 1.00 28.61  ? 465 PHE B CD1   1 
ATOM   6576 C  CD2   . PHE B  1  490 ? 10.636  10.604  202.964 1.00 27.09  ? 465 PHE B CD2   1 
ATOM   6577 C  CE1   . PHE B  1  490 ? 9.101   10.223  200.705 1.00 29.50  ? 465 PHE B CE1   1 
ATOM   6578 C  CE2   . PHE B  1  490 ? 10.169  11.686  202.262 1.00 27.79  ? 465 PHE B CE2   1 
ATOM   6579 C  CZ    . PHE B  1  490 ? 9.390   11.495  201.131 1.00 28.26  ? 465 PHE B CZ    1 
ATOM   6580 N  N     . GLU B  1  491 ? 13.619  5.665   203.256 1.00 30.86  ? 466 GLU B N     1 
ATOM   6581 C  CA    . GLU B  1  491 ? 14.425  4.787   204.121 1.00 32.71  ? 466 GLU B CA    1 
ATOM   6582 C  C     . GLU B  1  491 ? 15.790  5.361   204.333 1.00 33.15  ? 466 GLU B C     1 
ATOM   6583 O  O     . GLU B  1  491 ? 16.467  5.725   203.371 1.00 32.28  ? 466 GLU B O     1 
ATOM   6584 C  CB    . GLU B  1  491 ? 14.565  3.384   203.518 1.00 34.15  ? 466 GLU B CB    1 
ATOM   6585 C  CG    . GLU B  1  491 ? 13.214  2.706   203.439 1.00 40.96  ? 466 GLU B CG    1 
ATOM   6586 C  CD    . GLU B  1  491 ? 13.084  1.657   202.353 1.00 50.20  ? 466 GLU B CD    1 
ATOM   6587 O  OE1   . GLU B  1  491 ? 14.085  1.258   201.715 1.00 52.87  ? 466 GLU B OE1   1 
ATOM   6588 O  OE2   . GLU B  1  491 ? 11.935  1.225   202.146 1.00 58.39  ? 466 GLU B OE2   1 
ATOM   6589 N  N     . VAL B  1  492 ? 16.208  5.381   205.595 1.00 32.13  ? 467 VAL B N     1 
ATOM   6590 C  CA    . VAL B  1  492 ? 17.452  5.990   205.998 1.00 34.15  ? 467 VAL B CA    1 
ATOM   6591 C  C     . VAL B  1  492 ? 18.489  4.944   206.324 1.00 33.00  ? 467 VAL B C     1 
ATOM   6592 O  O     . VAL B  1  492 ? 18.180  4.020   207.032 1.00 34.64  ? 467 VAL B O     1 
ATOM   6593 C  CB    . VAL B  1  492 ? 17.235  6.857   207.250 1.00 33.39  ? 467 VAL B CB    1 
ATOM   6594 C  CG1   . VAL B  1  492 ? 18.555  7.436   207.743 1.00 34.75  ? 467 VAL B CG1   1 
ATOM   6595 C  CG2   . VAL B  1  492 ? 16.255  7.974   206.922 1.00 35.08  ? 467 VAL B CG2   1 
ATOM   6596 N  N     . LYS B  1  493 ? 19.702  5.112   205.824 1.00 30.62  ? 468 LYS B N     1 
ATOM   6597 C  CA    . LYS B  1  493 ? 20.863  4.332   206.207 1.00 33.83  ? 468 LYS B CA    1 
ATOM   6598 C  C     . LYS B  1  493 ? 21.916  5.269   206.713 1.00 32.67  ? 468 LYS B C     1 
ATOM   6599 O  O     . LYS B  1  493 ? 22.061  6.380   206.167 1.00 30.87  ? 468 LYS B O     1 
ATOM   6600 C  CB    . LYS B  1  493 ? 21.478  3.641   204.997 1.00 38.57  ? 468 LYS B CB    1 
ATOM   6601 C  CG    . LYS B  1  493 ? 20.712  2.464   204.475 1.00 46.34  ? 468 LYS B CG    1 
ATOM   6602 C  CD    . LYS B  1  493 ? 21.543  1.695   203.452 1.00 52.99  ? 468 LYS B CD    1 
ATOM   6603 C  CE    . LYS B  1  493 ? 20.906  0.343   203.184 1.00 60.25  ? 468 LYS B CE    1 
ATOM   6604 N  NZ    . LYS B  1  493 ? 20.825  0.013   201.736 1.00 67.39  ? 468 LYS B NZ    1 
ATOM   6605 N  N     . THR B  1  494 ? 22.674  4.828   207.717 1.00 29.02  ? 469 THR B N     1 
ATOM   6606 C  CA    . THR B  1  494 ? 23.881  5.534   208.164 1.00 30.61  ? 469 THR B CA    1 
ATOM   6607 C  C     . THR B  1  494 ? 25.045  4.569   208.139 1.00 31.53  ? 469 THR B C     1 
ATOM   6608 O  O     . THR B  1  494 ? 24.876  3.370   208.440 1.00 34.24  ? 469 THR B O     1 
ATOM   6609 C  CB    . THR B  1  494 ? 23.738  6.163   209.559 1.00 32.49  ? 469 THR B CB    1 
ATOM   6610 O  OG1   . THR B  1  494 ? 23.430  5.164   210.544 1.00 34.12  ? 469 THR B OG1   1 
ATOM   6611 C  CG2   . THR B  1  494 ? 22.632  7.216   209.548 1.00 33.59  ? 469 THR B CG2   1 
ATOM   6612 N  N     . ARG B  1  495 ? 26.212  5.082   207.756 1.00 30.85  ? 470 ARG B N     1 
ATOM   6613 C  CA    . ARG B  1  495 ? 27.409  4.276   207.585 1.00 32.81  ? 470 ARG B CA    1 
ATOM   6614 C  C     . ARG B  1  495 ? 28.586  5.060   208.122 1.00 33.30  ? 470 ARG B C     1 
ATOM   6615 O  O     . ARG B  1  495 ? 28.828  6.181   207.703 1.00 30.61  ? 470 ARG B O     1 
ATOM   6616 C  CB    . ARG B  1  495 ? 27.626  3.940   206.121 1.00 33.91  ? 470 ARG B CB    1 
ATOM   6617 C  CG    . ARG B  1  495 ? 26.577  3.015   205.538 1.00 38.63  ? 470 ARG B CG    1 
ATOM   6618 C  CD    . ARG B  1  495 ? 26.689  1.592   206.092 1.00 40.96  ? 470 ARG B CD    1 
ATOM   6619 N  NE    . ARG B  1  495 ? 25.681  0.699   205.511 1.00 39.66  ? 470 ARG B NE    1 
ATOM   6620 C  CZ    . ARG B  1  495 ? 24.453  0.510   205.987 1.00 39.09  ? 470 ARG B CZ    1 
ATOM   6621 N  NH1   . ARG B  1  495 ? 24.008  1.159   207.067 1.00 43.26  ? 470 ARG B NH1   1 
ATOM   6622 N  NH2   . ARG B  1  495 ? 23.640  -0.319  205.343 1.00 39.29  ? 470 ARG B NH2   1 
ATOM   6623 N  N     . ALA B  1  496 ? 29.302  4.476   209.074 1.00 34.17  ? 471 ALA B N     1 
ATOM   6624 C  CA    . ALA B  1  496 ? 30.360  5.184   209.803 1.00 31.30  ? 471 ALA B CA    1 
ATOM   6625 C  C     . ALA B  1  496 ? 31.680  4.471   209.638 1.00 32.58  ? 471 ALA B C     1 
ATOM   6626 O  O     . ALA B  1  496 ? 31.725  3.324   209.252 1.00 37.39  ? 471 ALA B O     1 
ATOM   6627 C  CB    . ALA B  1  496 ? 30.012  5.312   211.258 1.00 34.64  ? 471 ALA B CB    1 
ATOM   6628 N  N     . SER B  1  497 ? 32.748  5.188   209.896 1.00 33.60  ? 472 SER B N     1 
ATOM   6629 C  CA    . SER B  1  497 ? 34.081  4.643   209.899 1.00 35.76  ? 472 SER B CA    1 
ATOM   6630 C  C     . SER B  1  497 ? 34.853  5.487   210.872 1.00 38.72  ? 472 SER B C     1 
ATOM   6631 O  O     . SER B  1  497 ? 34.552  6.692   211.038 1.00 37.46  ? 472 SER B O     1 
ATOM   6632 C  CB    . SER B  1  497 ? 34.681  4.703   208.507 1.00 40.67  ? 472 SER B CB    1 
ATOM   6633 O  OG    . SER B  1  497 ? 36.080  4.750   208.568 1.00 45.89  ? 472 SER B OG    1 
ATOM   6634 N  N     . THR B  1  498 ? 35.802  4.859   211.565 1.00 41.09  ? 473 THR B N     1 
ATOM   6635 C  CA    . THR B  1  498 ? 36.627  5.543   212.567 1.00 42.61  ? 473 THR B CA    1 
ATOM   6636 C  C     . THR B  1  498 ? 38.097  5.326   212.205 1.00 43.86  ? 473 THR B C     1 
ATOM   6637 O  O     . THR B  1  498 ? 38.486  4.266   211.738 1.00 41.49  ? 473 THR B O     1 
ATOM   6638 C  CB    . THR B  1  498 ? 36.302  5.068   213.988 1.00 42.88  ? 473 THR B CB    1 
ATOM   6639 O  OG1   . THR B  1  498 ? 34.983  5.499   214.333 1.00 46.45  ? 473 THR B OG1   1 
ATOM   6640 C  CG2   . THR B  1  498 ? 37.271  5.652   215.002 1.00 42.53  ? 473 THR B CG2   1 
ATOM   6641 N  N     . VAL B  1  499 ? 38.881  6.367   212.410 1.00 46.47  ? 474 VAL B N     1 
ATOM   6642 C  CA    . VAL B  1  499 ? 40.272  6.446   211.980 1.00 49.89  ? 474 VAL B CA    1 
ATOM   6643 C  C     . VAL B  1  499 ? 41.117  6.688   213.248 1.00 48.39  ? 474 VAL B C     1 
ATOM   6644 O  O     . VAL B  1  499 ? 40.585  7.130   214.261 1.00 45.85  ? 474 VAL B O     1 
ATOM   6645 C  CB    . VAL B  1  499 ? 40.359  7.566   210.897 1.00 51.11  ? 474 VAL B CB    1 
ATOM   6646 C  CG1   . VAL B  1  499 ? 41.711  8.257   210.833 1.00 58.29  ? 474 VAL B CG1   1 
ATOM   6647 C  CG2   . VAL B  1  499 ? 39.988  6.980   209.540 1.00 50.13  ? 474 VAL B CG2   1 
ATOM   6648 N  N     . SER B  1  500 ? 42.420  6.400   213.196 1.00 57.26  ? 475 SER B N     1 
ATOM   6649 C  CA    . SER B  1  500 ? 43.301  6.535   214.391 1.00 58.85  ? 475 SER B CA    1 
ATOM   6650 C  C     . SER B  1  500 ? 43.454  7.983   214.806 1.00 58.95  ? 475 SER B C     1 
ATOM   6651 O  O     . SER B  1  500 ? 43.102  8.362   215.924 1.00 62.09  ? 475 SER B O     1 
ATOM   6652 C  CB    . SER B  1  500 ? 44.701  5.949   214.145 1.00 56.81  ? 475 SER B CB    1 
ATOM   6653 O  OG    . SER B  1  500 ? 44.657  4.855   213.262 1.00 61.56  ? 475 SER B OG    1 
ATOM   6654 N  N     . SER B  1  501 ? 43.973  8.786   213.881 1.00 62.44  ? 476 SER B N     1 
ATOM   6655 C  CA    . SER B  1  501 ? 44.310  10.177  214.147 1.00 60.05  ? 476 SER B CA    1 
ATOM   6656 C  C     . SER B  1  501 ? 43.157  11.047  213.673 1.00 57.38  ? 476 SER B C     1 
ATOM   6657 O  O     . SER B  1  501 ? 42.513  10.749  212.663 1.00 58.53  ? 476 SER B O     1 
ATOM   6658 C  CB    . SER B  1  501 ? 45.612  10.547  213.432 1.00 57.28  ? 476 SER B CB    1 
ATOM   6659 N  N     . VAL B  1  502 ? 42.903  12.122  214.405 1.00 56.56  ? 477 VAL B N     1 
ATOM   6660 C  CA    . VAL B  1  502 ? 41.840  13.066  214.056 1.00 56.19  ? 477 VAL B CA    1 
ATOM   6661 C  C     . VAL B  1  502 ? 41.974  13.646  212.634 1.00 56.76  ? 477 VAL B C     1 
ATOM   6662 O  O     . VAL B  1  502 ? 43.048  13.609  212.028 1.00 52.73  ? 477 VAL B O     1 
ATOM   6663 C  CB    . VAL B  1  502 ? 41.730  14.241  215.061 1.00 59.10  ? 477 VAL B CB    1 
ATOM   6664 C  CG1   . VAL B  1  502 ? 41.301  13.749  216.431 1.00 60.09  ? 477 VAL B CG1   1 
ATOM   6665 C  CG2   . VAL B  1  502 ? 43.031  15.042  215.163 1.00 59.09  ? 477 VAL B CG2   1 
ATOM   6666 N  N     . VAL B  1  503 ? 40.854  14.163  212.125 1.00 54.24  ? 478 VAL B N     1 
ATOM   6667 C  CA    . VAL B  1  503 ? 40.780  14.807  210.809 1.00 50.06  ? 478 VAL B CA    1 
ATOM   6668 C  C     . VAL B  1  503 ? 39.845  16.002  210.862 1.00 48.05  ? 478 VAL B C     1 
ATOM   6669 O  O     . VAL B  1  503 ? 39.010  16.130  211.770 1.00 43.39  ? 478 VAL B O     1 
ATOM   6670 C  CB    . VAL B  1  503 ? 40.283  13.869  209.684 1.00 49.84  ? 478 VAL B CB    1 
ATOM   6671 C  CG1   . VAL B  1  503 ? 41.290  12.771  209.402 1.00 48.11  ? 478 VAL B CG1   1 
ATOM   6672 C  CG2   . VAL B  1  503 ? 38.887  13.295  209.976 1.00 50.16  ? 478 VAL B CG2   1 
ATOM   6673 N  N     . SER B  1  504 ? 39.997  16.868  209.866 1.00 47.36  ? 479 SER B N     1 
ATOM   6674 C  CA    . SER B  1  504 ? 39.255  18.122  209.821 1.00 47.44  ? 479 SER B CA    1 
ATOM   6675 C  C     . SER B  1  504 ? 39.142  18.779  208.461 1.00 42.41  ? 479 SER B C     1 
ATOM   6676 O  O     . SER B  1  504 ? 38.262  19.604  208.300 1.00 43.45  ? 479 SER B O     1 
ATOM   6677 C  CB    . SER B  1  504 ? 39.878  19.139  210.788 1.00 50.20  ? 479 SER B CB    1 
ATOM   6678 O  OG    . SER B  1  504 ? 41.194  19.470  210.376 1.00 51.13  ? 479 SER B OG    1 
ATOM   6679 N  N     . THR B  1  505 ? 40.017  18.461  207.504 1.00 40.16  ? 480 THR B N     1 
ATOM   6680 C  CA    . THR B  1  505 ? 39.979  19.134  206.195 1.00 42.70  ? 480 THR B CA    1 
ATOM   6681 C  C     . THR B  1  505 ? 38.902  18.505  205.282 1.00 38.93  ? 480 THR B C     1 
ATOM   6682 O  O     . THR B  1  505 ? 38.498  17.350  205.477 1.00 38.05  ? 480 THR B O     1 
ATOM   6683 C  CB    . THR B  1  505 ? 41.359  19.139  205.490 1.00 40.31  ? 480 THR B CB    1 
ATOM   6684 O  OG1   . THR B  1  505 ? 41.720  17.817  205.109 1.00 38.53  ? 480 THR B OG1   1 
ATOM   6685 C  CG2   . THR B  1  505 ? 42.440  19.705  206.410 1.00 43.84  ? 480 THR B CG2   1 
ATOM   6686 N  N     . ALA B  1  506 ? 38.455  19.274  204.293 1.00 37.47  ? 481 ALA B N     1 
ATOM   6687 C  CA    . ALA B  1  506 ? 37.505  18.801  203.296 1.00 37.30  ? 481 ALA B CA    1 
ATOM   6688 C  C     . ALA B  1  506 ? 38.030  17.534  202.640 1.00 37.57  ? 481 ALA B C     1 
ATOM   6689 O  O     . ALA B  1  506 ? 37.289  16.571  202.446 1.00 37.35  ? 481 ALA B O     1 
ATOM   6690 C  CB    . ALA B  1  506 ? 37.246  19.883  202.251 1.00 39.68  ? 481 ALA B CB    1 
ATOM   6691 N  N     . GLU B  1  507 ? 39.320  17.531  202.328 1.00 39.05  ? 482 GLU B N     1 
ATOM   6692 C  CA    . GLU B  1  507 ? 39.975  16.391  201.669 1.00 43.11  ? 482 GLU B CA    1 
ATOM   6693 C  C     . GLU B  1  507 ? 39.971  15.142  202.574 1.00 40.08  ? 482 GLU B C     1 
ATOM   6694 O  O     . GLU B  1  507 ? 39.583  14.062  202.156 1.00 38.72  ? 482 GLU B O     1 
ATOM   6695 C  CB    . GLU B  1  507 ? 41.430  16.742  201.302 1.00 48.71  ? 482 GLU B CB    1 
ATOM   6696 C  CG    . GLU B  1  507 ? 41.603  17.783  200.190 1.00 53.82  ? 482 GLU B CG    1 
ATOM   6697 C  CD    . GLU B  1  507 ? 41.202  19.213  200.571 1.00 56.90  ? 482 GLU B CD    1 
ATOM   6698 O  OE1   . GLU B  1  507 ? 40.691  19.932  199.682 1.00 61.81  ? 482 GLU B OE1   1 
ATOM   6699 O  OE2   . GLU B  1  507 ? 41.380  19.623  201.740 1.00 52.28  ? 482 GLU B OE2   1 
ATOM   6700 N  N     . GLU B  1  508 ? 40.394  15.313  203.818 1.00 41.01  ? 483 GLU B N     1 
ATOM   6701 C  CA    . GLU B  1  508 ? 40.436  14.191  204.772 1.00 43.86  ? 483 GLU B CA    1 
ATOM   6702 C  C     . GLU B  1  508 ? 39.049  13.629  205.036 1.00 39.80  ? 483 GLU B C     1 
ATOM   6703 O  O     . GLU B  1  508 ? 38.852  12.415  205.001 1.00 38.63  ? 483 GLU B O     1 
ATOM   6704 C  CB    . GLU B  1  508 ? 41.066  14.645  206.088 1.00 47.90  ? 483 GLU B CB    1 
ATOM   6705 C  CG    . GLU B  1  508 ? 42.562  14.921  205.969 1.00 49.90  ? 483 GLU B CG    1 
ATOM   6706 C  CD    . GLU B  1  508 ? 43.148  15.632  207.180 1.00 53.20  ? 483 GLU B CD    1 
ATOM   6707 O  OE1   . GLU B  1  508 ? 42.440  16.408  207.880 1.00 42.88  ? 483 GLU B OE1   1 
ATOM   6708 O  OE2   . GLU B  1  508 ? 44.356  15.408  207.415 1.00 62.44  ? 483 GLU B OE2   1 
ATOM   6709 N  N     . ILE B  1  509 ? 38.078  14.516  205.260 1.00 37.42  ? 484 ILE B N     1 
ATOM   6710 C  CA    . ILE B  1  509 ? 36.725  14.065  205.559 1.00 37.63  ? 484 ILE B CA    1 
ATOM   6711 C  C     . ILE B  1  509 ? 36.215  13.328  204.337 1.00 36.42  ? 484 ILE B C     1 
ATOM   6712 O  O     . ILE B  1  509 ? 35.666  12.238  204.479 1.00 34.58  ? 484 ILE B O     1 
ATOM   6713 C  CB    . ILE B  1  509 ? 35.756  15.190  205.989 1.00 38.90  ? 484 ILE B CB    1 
ATOM   6714 C  CG1   . ILE B  1  509 ? 36.200  15.801  207.320 1.00 40.28  ? 484 ILE B CG1   1 
ATOM   6715 C  CG2   . ILE B  1  509 ? 34.339  14.639  206.160 1.00 39.37  ? 484 ILE B CG2   1 
ATOM   6716 C  CD1   . ILE B  1  509 ? 35.569  17.138  207.648 1.00 39.76  ? 484 ILE B CD1   1 
ATOM   6717 N  N     . PHE B  1  510 ? 36.438  13.905  203.151 1.00 37.39  ? 485 PHE B N     1 
ATOM   6718 C  CA    . PHE B  1  510 ? 35.974  13.310  201.887 1.00 36.23  ? 485 PHE B CA    1 
ATOM   6719 C  C     . PHE B  1  510 ? 36.642  11.976  201.566 1.00 34.56  ? 485 PHE B C     1 
ATOM   6720 O  O     . PHE B  1  510 ? 35.972  11.068  201.092 1.00 33.01  ? 485 PHE B O     1 
ATOM   6721 C  CB    . PHE B  1  510 ? 36.102  14.277  200.700 1.00 35.07  ? 485 PHE B CB    1 
ATOM   6722 C  CG    . PHE B  1  510 ? 35.536  13.727  199.411 1.00 37.07  ? 485 PHE B CG    1 
ATOM   6723 C  CD1   . PHE B  1  510 ? 34.188  13.351  199.322 1.00 37.71  ? 485 PHE B CD1   1 
ATOM   6724 C  CD2   . PHE B  1  510 ? 36.332  13.586  198.284 1.00 39.38  ? 485 PHE B CD2   1 
ATOM   6725 C  CE1   . PHE B  1  510 ? 33.664  12.839  198.138 1.00 37.35  ? 485 PHE B CE1   1 
ATOM   6726 C  CE2   . PHE B  1  510 ? 35.812  13.092  197.087 1.00 39.29  ? 485 PHE B CE2   1 
ATOM   6727 C  CZ    . PHE B  1  510 ? 34.471  12.724  197.015 1.00 40.12  ? 485 PHE B CZ    1 
ATOM   6728 N  N     . ALA B  1  511 ? 37.935  11.828  201.852 1.00 35.29  ? 486 ALA B N     1 
ATOM   6729 C  CA    . ALA B  1  511 ? 38.612  10.534  201.636 1.00 35.47  ? 486 ALA B CA    1 
ATOM   6730 C  C     . ALA B  1  511 ? 37.904  9.353   202.351 1.00 33.80  ? 486 ALA B C     1 
ATOM   6731 O  O     . ALA B  1  511 ? 37.833  8.256   201.807 1.00 35.38  ? 486 ALA B O     1 
ATOM   6732 C  CB    . ALA B  1  511 ? 40.071  10.616  202.062 1.00 38.17  ? 486 ALA B CB    1 
ATOM   6733 N  N     . ILE B  1  512 ? 37.349  9.606   203.535 1.00 33.86  ? 487 ILE B N     1 
ATOM   6734 C  CA    . ILE B  1  512 ? 36.649  8.582   204.331 1.00 33.24  ? 487 ILE B CA    1 
ATOM   6735 C  C     . ILE B  1  512 ? 35.215  8.424   203.823 1.00 33.47  ? 487 ILE B C     1 
ATOM   6736 O  O     . ILE B  1  512 ? 34.746  7.307   203.530 1.00 29.69  ? 487 ILE B O     1 
ATOM   6737 C  CB    . ILE B  1  512 ? 36.655  8.973   205.827 1.00 35.01  ? 487 ILE B CB    1 
ATOM   6738 C  CG1   . ILE B  1  512 ? 38.105  9.052   206.356 1.00 36.75  ? 487 ILE B CG1   1 
ATOM   6739 C  CG2   . ILE B  1  512 ? 35.875  7.974   206.655 1.00 35.42  ? 487 ILE B CG2   1 
ATOM   6740 C  CD1   . ILE B  1  512 ? 38.267  9.901   207.602 1.00 33.34  ? 487 ILE B CD1   1 
ATOM   6741 N  N     . ALA B  1  513 ? 34.527  9.567   203.699 1.00 32.82  ? 488 ALA B N     1 
ATOM   6742 C  CA    . ALA B  1  513 ? 33.143  9.593   203.256 1.00 32.84  ? 488 ALA B CA    1 
ATOM   6743 C  C     . ALA B  1  513 ? 32.984  8.916   201.914 1.00 29.79  ? 488 ALA B C     1 
ATOM   6744 O  O     . ALA B  1  513 ? 32.088  8.097   201.725 1.00 30.55  ? 488 ALA B O     1 
ATOM   6745 C  CB    . ALA B  1  513 ? 32.620  11.034  203.239 1.00 32.83  ? 488 ALA B CB    1 
ATOM   6746 N  N     . LYS B  1  514 ? 33.879  9.197   200.972 1.00 34.28  ? 489 LYS B N     1 
ATOM   6747 C  CA    . LYS B  1  514 ? 33.714  8.630   199.622 1.00 36.14  ? 489 LYS B CA    1 
ATOM   6748 C  C     . LYS B  1  514 ? 33.782  7.096   199.607 1.00 35.19  ? 489 LYS B C     1 
ATOM   6749 O  O     . LYS B  1  514 ? 33.047  6.479   198.854 1.00 33.29  ? 489 LYS B O     1 
ATOM   6750 C  CB    . LYS B  1  514 ? 34.640  9.289   198.577 1.00 41.28  ? 489 LYS B CB    1 
ATOM   6751 C  CG    . LYS B  1  514 ? 35.955  8.596   198.243 1.00 48.03  ? 489 LYS B CG    1 
ATOM   6752 C  CD    . LYS B  1  514 ? 36.829  9.571   197.445 1.00 56.34  ? 489 LYS B CD    1 
ATOM   6753 C  CE    . LYS B  1  514 ? 37.918  8.911   196.608 1.00 62.83  ? 489 LYS B CE    1 
ATOM   6754 N  NZ    . LYS B  1  514 ? 37.423  8.558   195.247 1.00 69.62  ? 489 LYS B NZ    1 
ATOM   6755 N  N     . GLU B  1  515 ? 34.620  6.484   200.458 1.00 37.89  ? 490 GLU B N     1 
ATOM   6756 C  CA    . GLU B  1  515 ? 34.689  5.005   200.540 1.00 35.48  ? 490 GLU B CA    1 
ATOM   6757 C  C     . GLU B  1  515 ? 33.432  4.424   201.155 1.00 32.40  ? 490 GLU B C     1 
ATOM   6758 O  O     . GLU B  1  515 ? 32.953  3.388   200.699 1.00 34.85  ? 490 GLU B O     1 
ATOM   6759 C  CB    . GLU B  1  515 ? 35.915  4.511   201.312 1.00 39.23  ? 490 GLU B CB    1 
ATOM   6760 C  CG    . GLU B  1  515 ? 37.259  4.840   200.657 1.00 45.02  ? 490 GLU B CG    1 
ATOM   6761 C  CD    . GLU B  1  515 ? 37.386  4.319   199.224 1.00 50.81  ? 490 GLU B CD    1 
ATOM   6762 O  OE1   . GLU B  1  515 ? 36.858  3.229   198.923 1.00 58.48  ? 490 GLU B OE1   1 
ATOM   6763 O  OE2   . GLU B  1  515 ? 38.021  4.998   198.390 1.00 54.44  ? 490 GLU B OE2   1 
ATOM   6764 N  N     . LEU B  1  516 ? 32.881  5.097   202.159 1.00 30.66  ? 491 LEU B N     1 
ATOM   6765 C  CA    . LEU B  1  516 ? 31.582  4.692   202.709 1.00 30.33  ? 491 LEU B CA    1 
ATOM   6766 C  C     . LEU B  1  516 ? 30.492  4.720   201.620 1.00 30.96  ? 491 LEU B C     1 
ATOM   6767 O  O     . LEU B  1  516 ? 29.719  3.772   201.476 1.00 30.88  ? 491 LEU B O     1 
ATOM   6768 C  CB    . LEU B  1  516 ? 31.203  5.576   203.903 1.00 31.13  ? 491 LEU B CB    1 
ATOM   6769 C  CG    . LEU B  1  516 ? 32.097  5.363   205.141 1.00 31.00  ? 491 LEU B CG    1 
ATOM   6770 C  CD1   . LEU B  1  516 ? 31.969  6.511   206.098 1.00 31.30  ? 491 LEU B CD1   1 
ATOM   6771 C  CD2   . LEU B  1  516 ? 31.737  4.062   205.829 1.00 32.22  ? 491 LEU B CD2   1 
ATOM   6772 N  N     . LEU B  1  517 ? 30.464  5.798   200.823 1.00 32.80  ? 492 LEU B N     1 
ATOM   6773 C  CA    . LEU B  1  517 ? 29.468  5.908   199.752 1.00 31.92  ? 492 LEU B CA    1 
ATOM   6774 C  C     . LEU B  1  517 ? 29.716  4.847   198.688 1.00 29.95  ? 492 LEU B C     1 
ATOM   6775 O  O     . LEU B  1  517 ? 28.785  4.179   198.221 1.00 29.47  ? 492 LEU B O     1 
ATOM   6776 C  CB    . LEU B  1  517 ? 29.488  7.323   199.118 1.00 31.70  ? 492 LEU B CB    1 
ATOM   6777 C  CG    . LEU B  1  517 ? 28.489  7.567   197.979 1.00 32.54  ? 492 LEU B CG    1 
ATOM   6778 C  CD1   . LEU B  1  517 ? 27.073  7.129   198.326 1.00 31.93  ? 492 LEU B CD1   1 
ATOM   6779 C  CD2   . LEU B  1  517 ? 28.542  9.047   197.564 1.00 32.87  ? 492 LEU B CD2   1 
ATOM   6780 N  N     . LYS B  1  518 ? 30.982  4.685   198.319 1.00 32.44  ? 493 LYS B N     1 
ATOM   6781 C  CA    . LYS B  1  518 ? 31.371  3.659   197.347 1.00 34.52  ? 493 LYS B CA    1 
ATOM   6782 C  C     . LYS B  1  518 ? 30.867  2.280   197.727 1.00 33.24  ? 493 LYS B C     1 
ATOM   6783 O  O     . LYS B  1  518 ? 30.356  1.543   196.872 1.00 35.45  ? 493 LYS B O     1 
ATOM   6784 C  CB    . LYS B  1  518 ? 32.891  3.608   197.173 1.00 39.74  ? 493 LYS B CB    1 
ATOM   6785 C  CG    . LYS B  1  518 ? 33.298  2.622   196.081 1.00 46.06  ? 493 LYS B CG    1 
ATOM   6786 C  CD    . LYS B  1  518 ? 34.796  2.576   195.811 1.00 53.55  ? 493 LYS B CD    1 
ATOM   6787 C  CE    . LYS B  1  518 ? 35.059  1.728   194.565 1.00 62.76  ? 493 LYS B CE    1 
ATOM   6788 N  NZ    . LYS B  1  518 ? 36.286  0.900   194.685 1.00 74.17  ? 493 LYS B NZ    1 
ATOM   6789 N  N     . THR B  1  519 ? 31.019  1.926   199.007 1.00 33.19  ? 494 THR B N     1 
ATOM   6790 C  CA    . THR B  1  519 ? 30.524  0.628   199.490 1.00 35.44  ? 494 THR B CA    1 
ATOM   6791 C  C     . THR B  1  519 ? 29.036  0.478   199.249 1.00 35.64  ? 494 THR B C     1 
ATOM   6792 O  O     . THR B  1  519 ? 28.605  -0.564  198.754 1.00 33.65  ? 494 THR B O     1 
ATOM   6793 C  CB    . THR B  1  519 ? 30.904  0.414   200.962 1.00 36.89  ? 494 THR B CB    1 
ATOM   6794 O  OG1   . THR B  1  519 ? 32.339  0.422   201.043 1.00 34.54  ? 494 THR B OG1   1 
ATOM   6795 C  CG2   . THR B  1  519 ? 30.329  -0.916  201.523 1.00 39.32  ? 494 THR B CG2   1 
ATOM   6796 N  N     . GLU B  1  520 ? 28.253  1.531   199.526 1.00 37.01  ? 495 GLU B N     1 
ATOM   6797 C  CA    . GLU B  1  520 ? 26.793  1.459   199.300 1.00 35.49  ? 495 GLU B CA    1 
ATOM   6798 C  C     . GLU B  1  520 ? 26.435  1.352   197.822 1.00 35.92  ? 495 GLU B C     1 
ATOM   6799 O  O     . GLU B  1  520 ? 25.529  0.597   197.452 1.00 36.62  ? 495 GLU B O     1 
ATOM   6800 C  CB    . GLU B  1  520 ? 26.072  2.648   199.947 1.00 36.02  ? 495 GLU B CB    1 
ATOM   6801 C  CG    . GLU B  1  520 ? 26.241  2.700   201.459 1.00 41.42  ? 495 GLU B CG    1 
ATOM   6802 C  CD    . GLU B  1  520 ? 26.049  1.323   202.101 1.00 43.06  ? 495 GLU B CD    1 
ATOM   6803 O  OE1   . GLU B  1  520 ? 24.965  0.729   201.884 1.00 40.78  ? 495 GLU B OE1   1 
ATOM   6804 O  OE2   . GLU B  1  520 ? 27.004  0.833   202.749 1.00 40.94  ? 495 GLU B OE2   1 
ATOM   6805 N  N     . ILE B  1  521 ? 27.147  2.100   196.974 1.00 37.71  ? 496 ILE B N     1 
ATOM   6806 C  CA    . ILE B  1  521 ? 26.915  2.032   195.534 1.00 38.95  ? 496 ILE B CA    1 
ATOM   6807 C  C     . ILE B  1  521 ? 27.255  0.611   194.994 1.00 42.73  ? 496 ILE B C     1 
ATOM   6808 O  O     . ILE B  1  521 ? 26.470  0.042   194.227 1.00 41.27  ? 496 ILE B O     1 
ATOM   6809 C  CB    . ILE B  1  521 ? 27.699  3.118   194.762 1.00 38.93  ? 496 ILE B CB    1 
ATOM   6810 C  CG1   . ILE B  1  521 ? 27.162  4.526   195.094 1.00 38.10  ? 496 ILE B CG1   1 
ATOM   6811 C  CG2   . ILE B  1  521 ? 27.617  2.849   193.255 1.00 40.62  ? 496 ILE B CG2   1 
ATOM   6812 C  CD1   . ILE B  1  521 ? 28.083  5.669   194.725 1.00 36.38  ? 496 ILE B CD1   1 
ATOM   6813 N  N     . ASP B  1  522 ? 28.396  0.050   195.410 1.00 44.35  ? 497 ASP B N     1 
ATOM   6814 C  CA    . ASP B  1  522 ? 28.799  -1.329  195.004 1.00 46.89  ? 497 ASP B CA    1 
ATOM   6815 C  C     . ASP B  1  522 ? 27.831  -2.429  195.491 1.00 46.07  ? 497 ASP B C     1 
ATOM   6816 O  O     . ASP B  1  522 ? 27.550  -3.385  194.766 1.00 44.95  ? 497 ASP B O     1 
ATOM   6817 C  CB    . ASP B  1  522 ? 30.226  -1.654  195.496 1.00 46.22  ? 497 ASP B CB    1 
ATOM   6818 C  CG    . ASP B  1  522 ? 31.300  -0.771  194.845 1.00 50.63  ? 497 ASP B CG    1 
ATOM   6819 O  OD1   . ASP B  1  522 ? 32.460  -0.774  195.307 1.00 58.99  ? 497 ASP B OD1   1 
ATOM   6820 O  OD2   . ASP B  1  522 ? 31.003  -0.062  193.876 1.00 53.32  ? 497 ASP B OD2   1 
ATOM   6821 N  N     . ALA B  1  523 ? 27.313  -2.292  196.705 1.00 44.75  ? 498 ALA B N     1 
ATOM   6822 C  CA    . ALA B  1  523 ? 26.372  -3.277  197.253 1.00 50.26  ? 498 ALA B CA    1 
ATOM   6823 C  C     . ALA B  1  523 ? 25.032  -3.368  196.509 1.00 52.57  ? 498 ALA B C     1 
ATOM   6824 O  O     . ALA B  1  523 ? 24.372  -4.392  196.604 1.00 57.05  ? 498 ALA B O     1 
ATOM   6825 C  CB    . ALA B  1  523 ? 26.117  -3.016  198.735 1.00 49.89  ? 498 ALA B CB    1 
ATOM   6826 N  N     . ASP B  1  524 ? 24.618  -2.313  195.803 1.00 54.35  ? 499 ASP B N     1 
ATOM   6827 C  CA    . ASP B  1  524 ? 23.376  -2.336  194.994 1.00 57.13  ? 499 ASP B CA    1 
ATOM   6828 C  C     . ASP B  1  524 ? 23.594  -2.574  193.499 1.00 52.18  ? 499 ASP B C     1 
ATOM   6829 O  O     . ASP B  1  524 ? 22.637  -2.808  192.760 1.00 48.01  ? 499 ASP B O     1 
ATOM   6830 C  CB    . ASP B  1  524 ? 22.611  -1.010  195.155 1.00 60.13  ? 499 ASP B CB    1 
ATOM   6831 C  CG    . ASP B  1  524 ? 21.860  -0.922  196.458 1.00 60.78  ? 499 ASP B CG    1 
ATOM   6832 O  OD1   . ASP B  1  524 ? 22.498  -0.958  197.532 1.00 67.74  ? 499 ASP B OD1   1 
ATOM   6833 O  OD2   . ASP B  1  524 ? 20.625  -0.786  196.406 1.00 64.25  ? 499 ASP B OD2   1 
ATOM   6834 N  N     . PHE B  1  525 ? 24.842  -2.483  193.050 1.00 56.49  ? 500 PHE B N     1 
ATOM   6835 C  CA    . PHE B  1  525 ? 25.183  -2.646  191.634 1.00 62.19  ? 500 PHE B CA    1 
ATOM   6836 C  C     . PHE B  1  525 ? 24.510  -3.894  191.045 1.00 59.62  ? 500 PHE B C     1 
ATOM   6837 O  O     . PHE B  1  525 ? 24.451  -4.912  191.727 1.00 63.90  ? 500 PHE B O     1 
ATOM   6838 C  CB    . PHE B  1  525 ? 26.700  -2.763  191.473 1.00 69.57  ? 500 PHE B CB    1 
ATOM   6839 C  CG    . PHE B  1  525 ? 27.162  -2.596  190.061 1.00 76.68  ? 500 PHE B CG    1 
ATOM   6840 C  CD1   . PHE B  1  525 ? 27.481  -3.701  189.285 1.00 79.57  ? 500 PHE B CD1   1 
ATOM   6841 C  CD2   . PHE B  1  525 ? 27.242  -1.328  189.494 1.00 78.87  ? 500 PHE B CD2   1 
ATOM   6842 C  CE1   . PHE B  1  525 ? 27.900  -3.545  187.971 1.00 83.73  ? 500 PHE B CE1   1 
ATOM   6843 C  CE2   . PHE B  1  525 ? 27.653  -1.163  188.178 1.00 83.42  ? 500 PHE B CE2   1 
ATOM   6844 C  CZ    . PHE B  1  525 ? 27.987  -2.275  187.417 1.00 83.87  ? 500 PHE B CZ    1 
ATOM   6845 N  N     . PRO B  1  526 ? 23.971  -3.844  189.821 1.00 56.22  ? 501 PRO B N     1 
ATOM   6846 C  CA    . PRO B  1  526 ? 23.992  -2.707  188.914 1.00 51.97  ? 501 PRO B CA    1 
ATOM   6847 C  C     . PRO B  1  526 ? 22.881  -1.639  189.122 1.00 50.29  ? 501 PRO B C     1 
ATOM   6848 O  O     . PRO B  1  526 ? 22.791  -0.728  188.304 1.00 53.88  ? 501 PRO B O     1 
ATOM   6849 C  CB    . PRO B  1  526 ? 23.777  -3.399  187.574 1.00 51.99  ? 501 PRO B CB    1 
ATOM   6850 C  CG    . PRO B  1  526 ? 22.817  -4.507  187.906 1.00 53.00  ? 501 PRO B CG    1 
ATOM   6851 C  CD    . PRO B  1  526 ? 22.975  -4.829  189.371 1.00 54.65  ? 501 PRO B CD    1 
ATOM   6852 N  N     . HIS B  1  527 ? 22.051  -1.735  190.166 1.00 47.55  ? 502 HIS B N     1 
ATOM   6853 C  CA    . HIS B  1  527 ? 20.988  -0.737  190.394 1.00 50.40  ? 502 HIS B CA    1 
ATOM   6854 C  C     . HIS B  1  527 ? 21.583  0.524   191.037 1.00 45.15  ? 502 HIS B C     1 
ATOM   6855 O  O     . HIS B  1  527 ? 22.294  0.425   192.043 1.00 40.38  ? 502 HIS B O     1 
ATOM   6856 C  CB    . HIS B  1  527 ? 19.878  -1.278  191.295 1.00 52.79  ? 502 HIS B CB    1 
ATOM   6857 C  CG    . HIS B  1  527 ? 19.352  -2.606  190.865 1.00 61.50  ? 502 HIS B CG    1 
ATOM   6858 N  ND1   . HIS B  1  527 ? 19.116  -2.918  189.543 1.00 65.26  ? 502 HIS B ND1   1 
ATOM   6859 C  CD2   . HIS B  1  527 ? 19.041  -3.714  191.578 1.00 65.74  ? 502 HIS B CD2   1 
ATOM   6860 C  CE1   . HIS B  1  527 ? 18.677  -4.161  189.460 1.00 69.74  ? 502 HIS B CE1   1 
ATOM   6861 N  NE2   . HIS B  1  527 ? 18.624  -4.667  190.681 1.00 70.24  ? 502 HIS B NE2   1 
ATOM   6862 N  N     . PRO B  1  528 ? 21.291  1.715   190.475 1.00 40.87  ? 503 PRO B N     1 
ATOM   6863 C  CA    . PRO B  1  528 ? 21.810  2.901   191.159 1.00 37.00  ? 503 PRO B CA    1 
ATOM   6864 C  C     . PRO B  1  528 ? 21.096  3.129   192.498 1.00 34.15  ? 503 PRO B C     1 
ATOM   6865 O  O     . PRO B  1  528 ? 19.951  2.684   192.702 1.00 32.44  ? 503 PRO B O     1 
ATOM   6866 C  CB    . PRO B  1  528 ? 21.499  4.030   190.177 1.00 40.08  ? 503 PRO B CB    1 
ATOM   6867 C  CG    . PRO B  1  528 ? 20.251  3.581   189.495 1.00 42.90  ? 503 PRO B CG    1 
ATOM   6868 C  CD    . PRO B  1  528 ? 20.313  2.067   189.429 1.00 42.30  ? 503 PRO B CD    1 
ATOM   6869 N  N     . LEU B  1  529 ? 21.735  3.917   193.331 1.00 33.42  ? 504 LEU B N     1 
ATOM   6870 C  CA    . LEU B  1  529 ? 21.177  4.383   194.563 1.00 34.75  ? 504 LEU B CA    1 
ATOM   6871 C  C     . LEU B  1  529 ? 20.268  5.541   194.154 1.00 33.67  ? 504 LEU B C     1 
ATOM   6872 O  O     . LEU B  1  529 ? 20.671  6.393   193.421 1.00 30.75  ? 504 LEU B O     1 
ATOM   6873 C  CB    . LEU B  1  529 ? 22.255  4.925   195.474 1.00 35.99  ? 504 LEU B CB    1 
ATOM   6874 C  CG    . LEU B  1  529 ? 23.268  3.944   196.019 1.00 42.12  ? 504 LEU B CG    1 
ATOM   6875 C  CD1   . LEU B  1  529 ? 24.020  4.563   197.169 1.00 40.21  ? 504 LEU B CD1   1 
ATOM   6876 C  CD2   . LEU B  1  529 ? 22.589  2.673   196.448 1.00 43.04  ? 504 LEU B CD2   1 
ATOM   6877 N  N     . ARG B  1  530 ? 19.045  5.540   194.635 1.00 29.73  ? 505 ARG B N     1 
ATOM   6878 C  CA    . ARG B  1  530 ? 18.113  6.595   194.346 1.00 30.20  ? 505 ARG B CA    1 
ATOM   6879 C  C     . ARG B  1  530 ? 17.944  7.414   195.630 1.00 29.35  ? 505 ARG B C     1 
ATOM   6880 O  O     . ARG B  1  530 ? 17.228  7.032   196.525 1.00 29.68  ? 505 ARG B O     1 
ATOM   6881 C  CB    . ARG B  1  530 ? 16.801  6.034   193.842 1.00 30.31  ? 505 ARG B CB    1 
ATOM   6882 C  CG    . ARG B  1  530 ? 16.880  5.200   192.582 1.00 33.58  ? 505 ARG B CG    1 
ATOM   6883 C  CD    . ARG B  1  530 ? 15.514  4.723   192.120 1.00 34.02  ? 505 ARG B CD    1 
ATOM   6884 N  NE    . ARG B  1  530 ? 14.637  5.820   191.796 1.00 36.00  ? 505 ARG B NE    1 
ATOM   6885 C  CZ    . ARG B  1  530 ? 13.343  5.710   191.563 1.00 37.58  ? 505 ARG B CZ    1 
ATOM   6886 N  NH1   . ARG B  1  530 ? 12.765  4.542   191.625 1.00 39.99  ? 505 ARG B NH1   1 
ATOM   6887 N  NH2   . ARG B  1  530 ? 12.634  6.772   191.284 1.00 37.15  ? 505 ARG B NH2   1 
ATOM   6888 N  N     . LEU B  1  531 ? 18.632  8.536   195.705 1.00 27.18  ? 506 LEU B N     1 
ATOM   6889 C  CA    . LEU B  1  531 ? 18.622  9.386   196.876 1.00 27.67  ? 506 LEU B CA    1 
ATOM   6890 C  C     . LEU B  1  531 ? 17.776  10.644  196.856 1.00 28.61  ? 506 LEU B C     1 
ATOM   6891 O  O     . LEU B  1  531 ? 17.661  11.273  195.860 1.00 28.85  ? 506 LEU B O     1 
ATOM   6892 C  CB    . LEU B  1  531 ? 20.037  9.821   197.201 1.00 28.64  ? 506 LEU B CB    1 
ATOM   6893 C  CG    . LEU B  1  531 ? 21.070  8.728   197.278 1.00 32.85  ? 506 LEU B CG    1 
ATOM   6894 C  CD1   . LEU B  1  531 ? 22.462  9.239   197.456 1.00 32.75  ? 506 LEU B CD1   1 
ATOM   6895 C  CD2   . LEU B  1  531 ? 20.695  7.742   198.345 1.00 32.96  ? 506 LEU B CD2   1 
ATOM   6896 N  N     . ARG B  1  532 ? 17.225  10.989  198.003 1.00 26.25  ? 507 ARG B N     1 
ATOM   6897 C  CA    . ARG B  1  532 ? 16.497  12.210  198.213 1.00 26.95  ? 507 ARG B CA    1 
ATOM   6898 C  C     . ARG B  1  532 ? 17.243  13.027  199.256 1.00 27.09  ? 507 ARG B C     1 
ATOM   6899 O  O     . ARG B  1  532 ? 16.971  14.176  199.384 1.00 25.27  ? 507 ARG B O     1 
ATOM   6900 C  CB    . ARG B  1  532 ? 15.042  12.016  198.597 1.00 27.21  ? 507 ARG B CB    1 
ATOM   6901 C  CG    . ARG B  1  532 ? 14.792  11.578  200.012 1.00 27.08  ? 507 ARG B CG    1 
ATOM   6902 C  CD    . ARG B  1  532 ? 13.327  11.580  200.354 1.00 26.94  ? 507 ARG B CD    1 
ATOM   6903 N  NE    . ARG B  1  532 ? 12.885  12.880  200.787 1.00 27.88  ? 507 ARG B NE    1 
ATOM   6904 C  CZ    . ARG B  1  532 ? 12.053  13.645  200.124 1.00 26.08  ? 507 ARG B CZ    1 
ATOM   6905 N  NH1   . ARG B  1  532 ? 11.729  14.796  200.599 1.00 28.65  ? 507 ARG B NH1   1 
ATOM   6906 N  NH2   . ARG B  1  532 ? 11.557  13.255  198.998 1.00 26.97  ? 507 ARG B NH2   1 
ATOM   6907 N  N     . LEU B  1  533 ? 18.176  12.413  199.983 1.00 23.95  ? 508 LEU B N     1 
ATOM   6908 C  CA    . LEU B  1  533 ? 18.967  13.141  200.937 1.00 23.60  ? 508 LEU B CA    1 
ATOM   6909 C  C     . LEU B  1  533 ? 20.313  12.486  201.135 1.00 24.07  ? 508 LEU B C     1 
ATOM   6910 O  O     . LEU B  1  533 ? 20.455  11.250  201.028 1.00 24.00  ? 508 LEU B O     1 
ATOM   6911 C  CB    . LEU B  1  533 ? 18.247  13.344  202.272 1.00 24.20  ? 508 LEU B CB    1 
ATOM   6912 C  CG    . LEU B  1  533 ? 19.026  13.796  203.532 1.00 24.76  ? 508 LEU B CG    1 
ATOM   6913 C  CD1   . LEU B  1  533 ? 18.111  14.508  204.532 1.00 24.93  ? 508 LEU B CD1   1 
ATOM   6914 C  CD2   . LEU B  1  533 ? 19.772  12.677  204.273 1.00 27.62  ? 508 LEU B CD2   1 
ATOM   6915 N  N     . MET B  1  534 ? 21.300  13.338  201.412 1.00 23.77  ? 509 MET B N     1 
ATOM   6916 C  CA    . MET B  1  534 ? 22.606  12.890  201.850 1.00 25.10  ? 509 MET B CA    1 
ATOM   6917 C  C     . MET B  1  534 ? 23.072  13.810  202.964 1.00 24.88  ? 509 MET B C     1 
ATOM   6918 O  O     . MET B  1  534 ? 22.725  15.003  203.012 1.00 25.49  ? 509 MET B O     1 
ATOM   6919 C  CB    . MET B  1  534 ? 23.595  12.919  200.682 1.00 27.37  ? 509 MET B CB    1 
ATOM   6920 C  CG    . MET B  1  534 ? 24.965  12.333  201.021 1.00 31.69  ? 509 MET B CG    1 
ATOM   6921 S  SD    . MET B  1  534 ? 26.216  12.481  199.714 1.00 35.76  ? 509 MET B SD    1 
ATOM   6922 C  CE    . MET B  1  534 ? 25.403  11.499  198.464 1.00 30.34  ? 509 MET B CE    1 
ATOM   6923 N  N     . GLY B  1  535 ? 23.832  13.256  203.895 1.00 23.45  ? 510 GLY B N     1 
ATOM   6924 C  CA    . GLY B  1  535 ? 24.439  14.037  204.921 1.00 25.71  ? 510 GLY B CA    1 
ATOM   6925 C  C     . GLY B  1  535 ? 25.758  13.485  205.329 1.00 26.40  ? 510 GLY B C     1 
ATOM   6926 O  O     . GLY B  1  535 ? 26.062  12.350  205.036 1.00 26.77  ? 510 GLY B O     1 
ATOM   6927 N  N     . VAL B  1  536 ? 26.562  14.319  205.973 1.00 27.29  ? 511 VAL B N     1 
ATOM   6928 C  CA    . VAL B  1  536 ? 27.832  13.883  206.508 1.00 28.03  ? 511 VAL B CA    1 
ATOM   6929 C  C     . VAL B  1  536 ? 27.923  14.427  207.899 1.00 30.22  ? 511 VAL B C     1 
ATOM   6930 O  O     . VAL B  1  536 ? 27.492  15.552  208.138 1.00 30.20  ? 511 VAL B O     1 
ATOM   6931 C  CB    . VAL B  1  536 ? 29.023  14.365  205.690 1.00 30.13  ? 511 VAL B CB    1 
ATOM   6932 C  CG1   . VAL B  1  536 ? 30.321  13.789  206.238 1.00 31.49  ? 511 VAL B CG1   1 
ATOM   6933 C  CG2   . VAL B  1  536 ? 28.856  13.961  204.241 1.00 32.37  ? 511 VAL B CG2   1 
ATOM   6934 N  N     . ARG B  1  537 ? 28.485  13.613  208.805 1.00 31.31  ? 512 ARG B N     1 
ATOM   6935 C  CA    . ARG B  1  537 ? 28.620  13.942  210.220 1.00 32.92  ? 512 ARG B CA    1 
ATOM   6936 C  C     . ARG B  1  537 ? 30.016  13.578  210.718 1.00 34.64  ? 512 ARG B C     1 
ATOM   6937 O  O     . ARG B  1  537 ? 30.585  12.540  210.327 1.00 32.93  ? 512 ARG B O     1 
ATOM   6938 C  CB    . ARG B  1  537 ? 27.561  13.163  210.991 1.00 39.82  ? 512 ARG B CB    1 
ATOM   6939 C  CG    . ARG B  1  537 ? 27.564  13.248  212.516 1.00 43.64  ? 512 ARG B CG    1 
ATOM   6940 C  CD    . ARG B  1  537 ? 26.454  12.327  213.009 1.00 49.02  ? 512 ARG B CD    1 
ATOM   6941 N  NE    . ARG B  1  537 ? 26.299  12.311  214.456 1.00 53.00  ? 512 ARG B NE    1 
ATOM   6942 C  CZ    . ARG B  1  537 ? 27.020  11.586  215.307 1.00 58.14  ? 512 ARG B CZ    1 
ATOM   6943 N  NH1   . ARG B  1  537 ? 28.004  10.801  214.884 1.00 59.92  ? 512 ARG B NH1   1 
ATOM   6944 N  NH2   . ARG B  1  537 ? 26.762  11.662  216.610 1.00 61.32  ? 512 ARG B NH2   1 
ATOM   6945 N  N     . ILE B  1  538 ? 30.581  14.440  211.555 1.00 34.93  ? 513 ILE B N     1 
ATOM   6946 C  CA    . ILE B  1  538 ? 31.863  14.124  212.182 1.00 38.66  ? 513 ILE B CA    1 
ATOM   6947 C  C     . ILE B  1  538 ? 31.643  14.054  213.683 1.00 37.06  ? 513 ILE B C     1 
ATOM   6948 O  O     . ILE B  1  538 ? 30.843  14.819  214.241 1.00 33.79  ? 513 ILE B O     1 
ATOM   6949 C  CB    . ILE B  1  538 ? 33.013  15.075  211.793 1.00 38.44  ? 513 ILE B CB    1 
ATOM   6950 C  CG1   . ILE B  1  538 ? 34.351  14.567  212.362 1.00 40.95  ? 513 ILE B CG1   1 
ATOM   6951 C  CG2   . ILE B  1  538 ? 32.745  16.493  212.251 1.00 40.31  ? 513 ILE B CG2   1 
ATOM   6952 C  CD1   . ILE B  1  538 ? 35.583  15.105  211.668 1.00 43.15  ? 513 ILE B CD1   1 
ATOM   6953 N  N     . SER B  1  539 ? 32.302  13.084  214.309 1.00 37.25  ? 514 SER B N     1 
ATOM   6954 C  CA    . SER B  1  539 ? 32.150  12.856  215.759 1.00 41.03  ? 514 SER B CA    1 
ATOM   6955 C  C     . SER B  1  539 ? 33.464  12.314  216.330 1.00 42.46  ? 514 SER B C     1 
ATOM   6956 O  O     . SER B  1  539 ? 34.500  12.315  215.620 1.00 37.75  ? 514 SER B O     1 
ATOM   6957 C  CB    . SER B  1  539 ? 30.947  11.927  216.022 1.00 36.38  ? 514 SER B CB    1 
ATOM   6958 O  OG    . SER B  1  539 ? 31.168  10.665  215.404 1.00 37.99  ? 514 SER B OG    1 
ATOM   6959 N  N     . SER B  1  540 ? 33.434  11.890  217.608 1.00 44.13  ? 515 SER B N     1 
ATOM   6960 C  CA    . SER B  1  540 ? 34.637  11.422  218.330 1.00 43.28  ? 515 SER B CA    1 
ATOM   6961 C  C     . SER B  1  540 ? 35.717  12.510  218.367 1.00 41.29  ? 515 SER B C     1 
ATOM   6962 O  O     . SER B  1  540 ? 36.836  12.329  217.860 1.00 41.39  ? 515 SER B O     1 
ATOM   6963 C  CB    . SER B  1  540 ? 35.191  10.126  217.736 1.00 44.82  ? 515 SER B CB    1 
ATOM   6964 O  OG    . SER B  1  540 ? 34.196  9.118   217.680 1.00 47.73  ? 515 SER B OG    1 
ATOM   6965 N  N     . PHE B  1  541 ? 35.342  13.651  218.937 1.00 44.37  ? 516 PHE B N     1 
ATOM   6966 C  CA    . PHE B  1  541 ? 36.274  14.736  219.202 1.00 51.46  ? 516 PHE B CA    1 
ATOM   6967 C  C     . PHE B  1  541 ? 37.061  14.368  220.460 1.00 56.73  ? 516 PHE B C     1 
ATOM   6968 O  O     . PHE B  1  541 ? 36.520  13.705  221.339 1.00 60.15  ? 516 PHE B O     1 
ATOM   6969 C  CB    . PHE B  1  541 ? 35.550  16.066  219.426 1.00 50.46  ? 516 PHE B CB    1 
ATOM   6970 C  CG    . PHE B  1  541 ? 34.638  16.482  218.295 1.00 52.67  ? 516 PHE B CG    1 
ATOM   6971 C  CD1   . PHE B  1  541 ? 33.419  17.079  218.575 1.00 52.27  ? 516 PHE B CD1   1 
ATOM   6972 C  CD2   . PHE B  1  541 ? 34.995  16.302  216.956 1.00 54.49  ? 516 PHE B CD2   1 
ATOM   6973 C  CE1   . PHE B  1  541 ? 32.559  17.475  217.557 1.00 54.33  ? 516 PHE B CE1   1 
ATOM   6974 C  CE2   . PHE B  1  541 ? 34.141  16.697  215.932 1.00 54.11  ? 516 PHE B CE2   1 
ATOM   6975 C  CZ    . PHE B  1  541 ? 32.922  17.291  216.233 1.00 53.15  ? 516 PHE B CZ    1 
ATOM   6976 N  N     . PRO B  1  542 ? 38.320  14.820  220.574 1.00 66.09  ? 517 PRO B N     1 
ATOM   6977 C  CA    . PRO B  1  542 ? 39.157  14.414  221.726 1.00 75.24  ? 517 PRO B CA    1 
ATOM   6978 C  C     . PRO B  1  542 ? 38.721  14.868  223.153 1.00 83.43  ? 517 PRO B C     1 
ATOM   6979 O  O     . PRO B  1  542 ? 39.450  14.599  224.119 1.00 88.79  ? 517 PRO B O     1 
ATOM   6980 C  CB    . PRO B  1  542 ? 40.559  14.940  221.363 1.00 75.17  ? 517 PRO B CB    1 
ATOM   6981 C  CG    . PRO B  1  542 ? 40.377  15.917  220.255 1.00 73.67  ? 517 PRO B CG    1 
ATOM   6982 C  CD    . PRO B  1  542 ? 39.013  15.744  219.658 1.00 70.49  ? 517 PRO B CD    1 
ATOM   6983 N  N     . ASN B  1  543 ? 37.571  15.548  223.274 1.00 90.02  ? 518 ASN B N     1 
ATOM   6984 C  CA    . ASN B  1  543 ? 36.850  15.754  224.554 1.00 93.73  ? 518 ASN B CA    1 
ATOM   6985 C  C     . ASN B  1  543 ? 37.525  16.751  225.510 1.00 98.60  ? 518 ASN B C     1 
ATOM   6986 O  O     . ASN B  1  543 ? 38.422  16.406  226.284 1.00 99.17  ? 518 ASN B O     1 
ATOM   6987 C  CB    . ASN B  1  543 ? 36.566  14.413  225.259 1.00 88.80  ? 518 ASN B CB    1 
ATOM   6988 P  P     . DA  C  2  1   ? 42.975  53.169  197.550 1.00 54.20  ? 5   DA  C P     1 
ATOM   6989 O  OP1   . DA  C  2  1   ? 44.048  53.454  198.526 1.00 52.25  ? 5   DA  C OP1   1 
ATOM   6990 O  OP2   . DA  C  2  1   ? 43.252  52.591  196.227 1.00 53.17  ? 5   DA  C OP2   1 
ATOM   6991 O  "O5'" . DA  C  2  1   ? 41.908  54.347  197.431 1.00 53.13  ? 5   DA  C "O5'" 1 
ATOM   6992 C  "C5'" . DA  C  2  1   ? 41.880  55.406  198.389 1.00 42.62  ? 5   DA  C "C5'" 1 
ATOM   6993 C  "C4'" . DA  C  2  1   ? 40.523  56.060  198.362 1.00 41.74  ? 5   DA  C "C4'" 1 
ATOM   6994 O  "O4'" . DA  C  2  1   ? 40.281  56.670  197.073 1.00 37.25  ? 5   DA  C "O4'" 1 
ATOM   6995 C  "C3'" . DA  C  2  1   ? 39.359  55.100  198.608 1.00 38.20  ? 5   DA  C "C3'" 1 
ATOM   6996 O  "O3'" . DA  C  2  1   ? 38.633  55.691  199.680 1.00 36.70  ? 5   DA  C "O3'" 1 
ATOM   6997 C  "C2'" . DA  C  2  1   ? 38.634  55.044  197.270 1.00 37.17  ? 5   DA  C "C2'" 1 
ATOM   6998 C  "C1'" . DA  C  2  1   ? 38.948  56.400  196.678 1.00 38.59  ? 5   DA  C "C1'" 1 
ATOM   6999 N  N9    . DA  C  2  1   ? 38.900  56.510  195.225 1.00 36.47  ? 5   DA  C N9    1 
ATOM   7000 C  C8    . DA  C  2  1   ? 39.771  55.930  194.338 1.00 34.41  ? 5   DA  C C8    1 
ATOM   7001 N  N7    . DA  C  2  1   ? 39.556  56.266  193.091 1.00 34.76  ? 5   DA  C N7    1 
ATOM   7002 C  C5    . DA  C  2  1   ? 38.453  57.103  193.157 1.00 33.36  ? 5   DA  C C5    1 
ATOM   7003 C  C6    . DA  C  2  1   ? 37.727  57.782  192.171 1.00 34.53  ? 5   DA  C C6    1 
ATOM   7004 N  N6    . DA  C  2  1   ? 38.002  57.710  190.871 1.00 39.84  ? 5   DA  C N6    1 
ATOM   7005 N  N1    . DA  C  2  1   ? 36.705  58.567  192.571 1.00 35.43  ? 5   DA  C N1    1 
ATOM   7006 C  C2    . DA  C  2  1   ? 36.420  58.628  193.878 1.00 33.47  ? 5   DA  C C2    1 
ATOM   7007 N  N3    . DA  C  2  1   ? 37.029  58.035  194.899 1.00 33.24  ? 5   DA  C N3    1 
ATOM   7008 C  C4    . DA  C  2  1   ? 38.059  57.289  194.468 1.00 35.43  ? 5   DA  C C4    1 
ATOM   7009 P  P     . DT  C  2  2   ? 37.422  54.912  200.390 1.00 41.56  ? 6   DT  C P     1 
ATOM   7010 O  OP1   . DT  C  2  2   ? 37.323  55.392  201.790 1.00 42.74  ? 6   DT  C OP1   1 
ATOM   7011 O  OP2   . DT  C  2  2   ? 37.557  53.478  200.124 1.00 40.30  ? 6   DT  C OP2   1 
ATOM   7012 O  "O5'" . DT  C  2  2   ? 36.156  55.463  199.600 1.00 38.25  ? 6   DT  C "O5'" 1 
ATOM   7013 C  "C5'" . DT  C  2  2   ? 35.822  56.844  199.677 1.00 34.92  ? 6   DT  C "C5'" 1 
ATOM   7014 C  "C4'" . DT  C  2  2   ? 34.615  57.119  198.819 1.00 35.60  ? 6   DT  C "C4'" 1 
ATOM   7015 O  "O4'" . DT  C  2  2   ? 34.955  57.037  197.413 1.00 35.30  ? 6   DT  C "O4'" 1 
ATOM   7016 C  "C3'" . DT  C  2  2   ? 33.456  56.150  199.032 1.00 33.67  ? 6   DT  C "C3'" 1 
ATOM   7017 O  "O3'" . DT  C  2  2   ? 32.349  56.995  199.334 1.00 36.48  ? 6   DT  C "O3'" 1 
ATOM   7018 C  "C2'" . DT  C  2  2   ? 33.365  55.388  197.715 1.00 34.76  ? 6   DT  C "C2'" 1 
ATOM   7019 C  "C1'" . DT  C  2  2   ? 33.861  56.445  196.738 1.00 35.94  ? 6   DT  C "C1'" 1 
ATOM   7020 N  N1    . DT  C  2  2   ? 34.344  56.000  195.410 1.00 34.83  ? 6   DT  C N1    1 
ATOM   7021 C  C2    . DT  C  2  2   ? 33.837  56.608  194.279 1.00 36.05  ? 6   DT  C C2    1 
ATOM   7022 O  O2    . DT  C  2  2   ? 32.955  57.453  194.309 1.00 34.51  ? 6   DT  C O2    1 
ATOM   7023 N  N3    . DT  C  2  2   ? 34.387  56.167  193.098 1.00 35.25  ? 6   DT  C N3    1 
ATOM   7024 C  C4    . DT  C  2  2   ? 35.371  55.211  192.941 1.00 35.49  ? 6   DT  C C4    1 
ATOM   7025 O  O4    . DT  C  2  2   ? 35.780  54.938  191.820 1.00 37.53  ? 6   DT  C O4    1 
ATOM   7026 C  C5    . DT  C  2  2   ? 35.871  54.632  194.169 1.00 33.94  ? 6   DT  C C5    1 
ATOM   7027 C  C7    . DT  C  2  2   ? 36.928  53.574  194.096 1.00 31.33  ? 6   DT  C C7    1 
ATOM   7028 C  C6    . DT  C  2  2   ? 35.351  55.063  195.326 1.00 30.57  ? 6   DT  C C6    1 
ATOM   7029 P  P     . DA  C  2  3   ? 30.972  56.360  199.748 1.00 36.38  ? 7   DA  C P     1 
ATOM   7030 O  OP1   . DA  C  2  3   ? 30.371  57.158  200.816 1.00 36.97  ? 7   DA  C OP1   1 
ATOM   7031 O  OP2   . DA  C  2  3   ? 31.205  54.907  199.941 1.00 38.58  ? 7   DA  C OP2   1 
ATOM   7032 O  "O5'" . DA  C  2  3   ? 30.096  56.573  198.435 1.00 37.77  ? 7   DA  C "O5'" 1 
ATOM   7033 C  "C5'" . DA  C  2  3   ? 29.557  57.856  198.113 1.00 38.43  ? 7   DA  C "C5'" 1 
ATOM   7034 C  "C4'" . DA  C  2  3   ? 28.680  57.725  196.893 1.00 41.21  ? 7   DA  C "C4'" 1 
ATOM   7035 O  "O4'" . DA  C  2  3   ? 29.500  57.321  195.774 1.00 41.96  ? 7   DA  C "O4'" 1 
ATOM   7036 C  "C3'" . DA  C  2  3   ? 27.582  56.666  197.034 1.00 42.25  ? 7   DA  C "C3'" 1 
ATOM   7037 O  "O3'" . DA  C  2  3   ? 26.306  57.273  196.818 1.00 48.61  ? 7   DA  C "O3'" 1 
ATOM   7038 C  "C2'" . DA  C  2  3   ? 27.984  55.572  196.056 1.00 42.32  ? 7   DA  C "C2'" 1 
ATOM   7039 C  "C1'" . DA  C  2  3   ? 28.836  56.313  195.046 1.00 41.31  ? 7   DA  C "C1'" 1 
ATOM   7040 N  N9    . DA  C  2  3   ? 29.856  55.512  194.383 1.00 39.15  ? 7   DA  C N9    1 
ATOM   7041 C  C8    . DA  C  2  3   ? 30.773  54.655  194.938 1.00 35.15  ? 7   DA  C C8    1 
ATOM   7042 N  N7    . DA  C  2  3   ? 31.587  54.118  194.065 1.00 35.98  ? 7   DA  C N7    1 
ATOM   7043 C  C5    . DA  C  2  3   ? 31.199  54.680  192.857 1.00 34.91  ? 7   DA  C C5    1 
ATOM   7044 C  C6    . DA  C  2  3   ? 31.664  54.510  191.543 1.00 35.37  ? 7   DA  C C6    1 
ATOM   7045 N  N6    . DA  C  2  3   ? 32.670  53.702  191.217 1.00 36.41  ? 7   DA  C N6    1 
ATOM   7046 N  N1    . DA  C  2  3   ? 31.055  55.215  190.565 1.00 34.66  ? 7   DA  C N1    1 
ATOM   7047 C  C2    . DA  C  2  3   ? 30.038  56.022  190.893 1.00 33.58  ? 7   DA  C C2    1 
ATOM   7048 N  N3    . DA  C  2  3   ? 29.501  56.253  192.088 1.00 35.82  ? 7   DA  C N3    1 
ATOM   7049 C  C4    . DA  C  2  3   ? 30.136  55.542  193.039 1.00 37.40  ? 7   DA  C C4    1 
ATOM   7050 P  P     . DC  C  2  4   ? 24.976  56.399  196.924 1.00 48.03  ? 8   DC  C P     1 
ATOM   7051 O  OP1   . DC  C  2  4   ? 23.917  57.243  197.501 1.00 54.57  ? 8   DC  C OP1   1 
ATOM   7052 O  OP2   . DC  C  2  4   ? 25.312  55.097  197.534 1.00 57.21  ? 8   DC  C OP2   1 
ATOM   7053 O  "O5'" . DC  C  2  4   ? 24.680  56.108  195.391 1.00 62.23  ? 8   DC  C "O5'" 1 
ATOM   7054 C  "C5'" . DC  C  2  4   ? 25.017  57.096  194.390 1.00 63.03  ? 8   DC  C "C5'" 1 
ATOM   7055 C  "C4'" . DC  C  2  4   ? 24.879  56.492  193.014 1.00 65.00  ? 8   DC  C "C4'" 1 
ATOM   7056 O  "O4'" . DC  C  2  4   ? 26.123  55.851  192.628 1.00 58.00  ? 8   DC  C "O4'" 1 
ATOM   7057 C  "C3'" . DC  C  2  4   ? 23.787  55.416  192.925 1.00 62.91  ? 8   DC  C "C3'" 1 
ATOM   7058 O  "O3'" . DC  C  2  4   ? 22.929  55.737  191.827 1.00 66.13  ? 8   DC  C "O3'" 1 
ATOM   7059 C  "C2'" . DC  C  2  4   ? 24.574  54.121  192.843 1.00 56.15  ? 8   DC  C "C2'" 1 
ATOM   7060 C  "C1'" . DC  C  2  4   ? 25.810  54.578  192.102 1.00 56.16  ? 8   DC  C "C1'" 1 
ATOM   7061 N  N1    . DC  C  2  4   ? 27.008  53.715  192.200 1.00 51.01  ? 8   DC  C N1    1 
ATOM   7062 C  C2    . DC  C  2  4   ? 27.786  53.559  191.054 1.00 43.81  ? 8   DC  C C2    1 
ATOM   7063 O  O2    . DC  C  2  4   ? 27.491  54.210  190.042 1.00 44.15  ? 8   DC  C O2    1 
ATOM   7064 N  N3    . DC  C  2  4   ? 28.870  52.749  191.091 1.00 41.67  ? 8   DC  C N3    1 
ATOM   7065 C  C4    . DC  C  2  4   ? 29.171  52.089  192.212 1.00 40.60  ? 8   DC  C C4    1 
ATOM   7066 N  N4    . DC  C  2  4   ? 30.256  51.312  192.208 1.00 38.36  ? 8   DC  C N4    1 
ATOM   7067 C  C5    . DC  C  2  4   ? 28.388  52.223  193.397 1.00 44.57  ? 8   DC  C C5    1 
ATOM   7068 C  C6    . DC  C  2  4   ? 27.316  53.027  193.342 1.00 46.24  ? 8   DC  C C6    1 
ATOM   7069 P  P     . DA  C  2  5   ? 21.686  54.782  191.416 1.00 74.82  ? 9   DA  C P     1 
ATOM   7070 O  OP1   . DA  C  2  5   ? 20.531  55.664  191.101 1.00 72.49  ? 9   DA  C OP1   1 
ATOM   7071 O  OP2   . DA  C  2  5   ? 21.546  53.656  192.387 1.00 58.96  ? 9   DA  C OP2   1 
ATOM   7072 O  "O5'" . DA  C  2  5   ? 22.200  54.182  190.047 1.00 55.61  ? 9   DA  C "O5'" 1 
ATOM   7073 C  "C5'" . DA  C  2  5   ? 22.703  55.095  189.070 1.00 54.56  ? 9   DA  C "C5'" 1 
ATOM   7074 C  "C4'" . DA  C  2  5   ? 23.233  54.297  187.912 1.00 52.53  ? 9   DA  C "C4'" 1 
ATOM   7075 O  "O4'" . DA  C  2  5   ? 24.431  53.618  188.350 1.00 49.90  ? 9   DA  C "O4'" 1 
ATOM   7076 C  "C3'" . DA  C  2  5   ? 22.254  53.215  187.448 1.00 51.71  ? 9   DA  C "C3'" 1 
ATOM   7077 O  "O3'" . DA  C  2  5   ? 22.039  53.376  186.054 1.00 54.57  ? 9   DA  C "O3'" 1 
ATOM   7078 C  "C2'" . DA  C  2  5   ? 22.915  51.908  187.851 1.00 47.91  ? 9   DA  C "C2'" 1 
ATOM   7079 C  "C1'" . DA  C  2  5   ? 24.386  52.264  187.949 1.00 46.57  ? 9   DA  C "C1'" 1 
ATOM   7080 N  N9    . DA  C  2  5   ? 25.104  51.485  188.950 1.00 39.42  ? 9   DA  C N9    1 
ATOM   7081 C  C8    . DA  C  2  5   ? 24.811  51.330  190.282 1.00 40.82  ? 9   DA  C C8    1 
ATOM   7082 N  N7    . DA  C  2  5   ? 25.644  50.543  190.918 1.00 41.47  ? 9   DA  C N7    1 
ATOM   7083 C  C5    . DA  C  2  5   ? 26.553  50.163  189.941 1.00 36.53  ? 9   DA  C C5    1 
ATOM   7084 C  C6    . DA  C  2  5   ? 27.691  49.341  189.978 1.00 38.80  ? 9   DA  C C6    1 
ATOM   7085 N  N6    . DA  C  2  5   ? 28.122  48.724  191.081 1.00 35.77  ? 9   DA  C N6    1 
ATOM   7086 N  N1    . DA  C  2  5   ? 28.391  49.183  188.831 1.00 35.96  ? 9   DA  C N1    1 
ATOM   7087 C  C2    . DA  C  2  5   ? 27.947  49.791  187.723 1.00 37.28  ? 9   DA  C C2    1 
ATOM   7088 N  N3    . DA  C  2  5   ? 26.894  50.592  187.566 1.00 36.64  ? 9   DA  C N3    1 
ATOM   7089 C  C4    . DA  C  2  5   ? 26.237  50.743  188.727 1.00 37.43  ? 9   DA  C C4    1 
ATOM   7090 P  P     . DT  C  2  6   ? 21.017  52.438  185.280 1.00 58.94  ? 10  DT  C P     1 
ATOM   7091 O  OP1   . DT  C  2  6   ? 20.302  53.303  184.314 1.00 63.84  ? 10  DT  C OP1   1 
ATOM   7092 O  OP2   . DT  C  2  6   ? 20.246  51.580  186.247 1.00 47.58  ? 10  DT  C OP2   1 
ATOM   7093 O  "O5'" . DT  C  2  6   ? 22.010  51.402  184.587 1.00 45.81  ? 10  DT  C "O5'" 1 
ATOM   7094 C  "C5'" . DT  C  2  6   ? 23.124  51.833  183.795 1.00 36.88  ? 10  DT  C "C5'" 1 
ATOM   7095 C  "C4'" . DT  C  2  6   ? 23.894  50.602  183.391 1.00 37.17  ? 10  DT  C "C4'" 1 
ATOM   7096 O  "O4'" . DT  C  2  6   ? 24.560  50.068  184.555 1.00 34.22  ? 10  DT  C "O4'" 1 
ATOM   7097 C  "C3'" . DT  C  2  6   ? 23.001  49.471  182.857 1.00 34.32  ? 10  DT  C "C3'" 1 
ATOM   7098 O  "O3'" . DT  C  2  6   ? 23.392  49.171  181.508 1.00 32.74  ? 10  DT  C "O3'" 1 
ATOM   7099 C  "C2'" . DT  C  2  6   ? 23.195  48.331  183.851 1.00 34.12  ? 10  DT  C "C2'" 1 
ATOM   7100 C  "C1'" . DT  C  2  6   ? 24.555  48.652  184.454 1.00 34.76  ? 10  DT  C "C1'" 1 
ATOM   7101 N  N1    . DT  C  2  6   ? 24.805  48.115  185.809 1.00 31.86  ? 10  DT  C N1    1 
ATOM   7102 C  C2    . DT  C  2  6   ? 25.939  47.375  186.054 1.00 29.99  ? 10  DT  C C2    1 
ATOM   7103 O  O2    . DT  C  2  6   ? 26.743  47.076  185.191 1.00 32.80  ? 10  DT  C O2    1 
ATOM   7104 N  N3    . DT  C  2  6   ? 26.089  46.975  187.355 1.00 30.88  ? 10  DT  C N3    1 
ATOM   7105 C  C4    . DT  C  2  6   ? 25.249  47.249  188.414 1.00 32.34  ? 10  DT  C C4    1 
ATOM   7106 O  O4    . DT  C  2  6   ? 25.529  46.838  189.531 1.00 32.98  ? 10  DT  C O4    1 
ATOM   7107 C  C5    . DT  C  2  6   ? 24.081  48.039  188.089 1.00 33.85  ? 10  DT  C C5    1 
ATOM   7108 C  C7    . DT  C  2  6   ? 23.095  48.364  189.166 1.00 33.83  ? 10  DT  C C7    1 
ATOM   7109 C  C6    . DT  C  2  6   ? 23.925  48.431  186.821 1.00 30.56  ? 10  DT  C C6    1 
ATOM   7110 P  P     . DA  C  2  7   ? 22.507  48.155  180.608 1.00 31.90  ? 11  DA  C P     1 
ATOM   7111 O  OP1   . DA  C  2  7   ? 22.712  48.513  179.190 1.00 29.88  ? 11  DA  C OP1   1 
ATOM   7112 O  OP2   . DA  C  2  7   ? 21.132  48.101  181.151 1.00 28.82  ? 11  DA  C OP2   1 
ATOM   7113 O  "O5'" . DA  C  2  7   ? 23.199  46.748  180.899 1.00 29.39  ? 11  DA  C "O5'" 1 
ATOM   7114 C  "C5'" . DA  C  2  7   ? 24.604  46.545  180.658 1.00 30.71  ? 11  DA  C "C5'" 1 
ATOM   7115 C  "C4'" . DA  C  2  7   ? 25.040  45.200  181.190 1.00 31.03  ? 11  DA  C "C4'" 1 
ATOM   7116 O  "O4'" . DA  C  2  7   ? 25.204  45.291  182.617 1.00 30.26  ? 11  DA  C "O4'" 1 
ATOM   7117 C  "C3'" . DA  C  2  7   ? 24.053  44.046  180.975 1.00 31.53  ? 11  DA  C "C3'" 1 
ATOM   7118 O  "O3'" . DA  C  2  7   ? 24.380  43.341  179.770 1.00 31.33  ? 11  DA  C "O3'" 1 
ATOM   7119 C  "C2'" . DA  C  2  7   ? 24.189  43.211  182.245 1.00 30.96  ? 11  DA  C "C2'" 1 
ATOM   7120 C  "C1'" . DA  C  2  7   ? 25.187  43.978  183.111 1.00 29.76  ? 11  DA  C "C1'" 1 
ATOM   7121 N  N9    . DA  C  2  7   ? 24.870  44.043  184.534 1.00 30.50  ? 11  DA  C N9    1 
ATOM   7122 C  C8    . DA  C  2  7   ? 23.822  44.658  185.170 1.00 28.93  ? 11  DA  C C8    1 
ATOM   7123 N  N7    . DA  C  2  7   ? 23.836  44.513  186.470 1.00 27.57  ? 11  DA  C N7    1 
ATOM   7124 C  C5    . DA  C  2  7   ? 24.969  43.749  186.707 1.00 28.64  ? 11  DA  C C5    1 
ATOM   7125 C  C6    . DA  C  2  7   ? 25.555  43.269  187.892 1.00 28.75  ? 11  DA  C C6    1 
ATOM   7126 N  N6    . DA  C  2  7   ? 25.046  43.480  189.106 1.00 27.32  ? 11  DA  C N6    1 
ATOM   7127 N  N1    . DA  C  2  7   ? 26.690  42.546  187.782 1.00 27.49  ? 11  DA  C N1    1 
ATOM   7128 C  C2    . DA  C  2  7   ? 27.204  42.344  186.564 1.00 31.28  ? 11  DA  C C2    1 
ATOM   7129 N  N3    . DA  C  2  7   ? 26.755  42.758  185.380 1.00 29.19  ? 11  DA  C N3    1 
ATOM   7130 C  C4    . DA  C  2  7   ? 25.622  43.464  185.526 1.00 28.61  ? 11  DA  C C4    1 
ATOM   7131 P  P     . DC  C  2  8   ? 23.450  42.135  179.249 1.00 30.07  ? 12  DC  C P     1 
ATOM   7132 O  OP1   . DC  C  2  8   ? 23.802  41.864  177.819 1.00 28.62  ? 12  DC  C OP1   1 
ATOM   7133 O  OP2   . DC  C  2  8   ? 22.067  42.439  179.627 1.00 30.14  ? 12  DC  C OP2   1 
ATOM   7134 O  "O5'" . DC  C  2  8   ? 24.053  40.900  180.041 1.00 28.11  ? 12  DC  C "O5'" 1 
ATOM   7135 C  "C5'" . DC  C  2  8   ? 25.444  40.571  179.922 1.00 29.74  ? 12  DC  C "C5'" 1 
ATOM   7136 C  "C4'" . DC  C  2  8   ? 25.787  39.533  180.966 1.00 34.06  ? 12  DC  C "C4'" 1 
ATOM   7137 O  "O4'" . DC  C  2  8   ? 25.809  40.136  182.271 1.00 34.26  ? 12  DC  C "O4'" 1 
ATOM   7138 C  "C3'" . DC  C  2  8   ? 24.763  38.409  181.096 1.00 35.59  ? 12  DC  C "C3'" 1 
ATOM   7139 O  "O3'" . DC  C  2  8   ? 25.079  37.323  180.230 1.00 36.29  ? 12  DC  C "O3'" 1 
ATOM   7140 C  "C2'" . DC  C  2  8   ? 24.929  37.961  182.531 1.00 35.21  ? 12  DC  C "C2'" 1 
ATOM   7141 C  "C1'" . DC  C  2  8   ? 25.625  39.117  183.231 1.00 31.95  ? 12  DC  C "C1'" 1 
ATOM   7142 N  N1    . DC  C  2  8   ? 24.833  39.668  184.340 1.00 31.23  ? 12  DC  C N1    1 
ATOM   7143 C  C2    . DC  C  2  8   ? 25.311  39.503  185.640 1.00 31.64  ? 12  DC  C C2    1 
ATOM   7144 O  O2    . DC  C  2  8   ? 26.403  38.945  185.810 1.00 31.27  ? 12  DC  C O2    1 
ATOM   7145 N  N3    . DC  C  2  8   ? 24.593  39.991  186.678 1.00 32.24  ? 12  DC  C N3    1 
ATOM   7146 C  C4    . DC  C  2  8   ? 23.421  40.588  186.457 1.00 30.18  ? 12  DC  C C4    1 
ATOM   7147 N  N4    . DC  C  2  8   ? 22.746  41.039  187.515 1.00 32.61  ? 12  DC  C N4    1 
ATOM   7148 C  C5    . DC  C  2  8   ? 22.891  40.744  185.142 1.00 29.72  ? 12  DC  C C5    1 
ATOM   7149 C  C6    . DC  C  2  8   ? 23.620  40.265  184.121 1.00 31.01  ? 12  DC  C C6    1 
ATOM   7150 P  P     . DC  C  2  9   ? 23.993  36.141  179.973 1.00 39.30  ? 13  DC  C P     1 
ATOM   7151 O  OP1   . DC  C  2  9   ? 24.377  35.505  178.729 1.00 40.44  ? 13  DC  C OP1   1 
ATOM   7152 O  OP2   . DC  C  2  9   ? 22.589  36.697  180.111 1.00 33.07  ? 13  DC  C OP2   1 
ATOM   7153 O  "O5'" . DC  C  2  9   ? 24.214  35.185  181.231 1.00 35.18  ? 13  DC  C "O5'" 1 
ATOM   7154 C  "C5'" . DC  C  2  9   ? 25.493  34.595  181.546 1.00 35.20  ? 13  DC  C "C5'" 1 
ATOM   7155 C  "C4'" . DC  C  2  9   ? 25.393  33.839  182.852 1.00 36.17  ? 13  DC  C "C4'" 1 
ATOM   7156 O  "O4'" . DC  C  2  9   ? 25.018  34.740  183.925 1.00 32.85  ? 13  DC  C "O4'" 1 
ATOM   7157 C  "C3'" . DC  C  2  9   ? 24.354  32.707  182.842 1.00 37.20  ? 13  DC  C "C3'" 1 
ATOM   7158 O  "O3'" . DC  C  2  9   ? 24.944  31.460  183.205 1.00 44.08  ? 13  DC  C "O3'" 1 
ATOM   7159 C  "C2'" . DC  C  2  9   ? 23.306  33.124  183.862 1.00 36.34  ? 13  DC  C "C2'" 1 
ATOM   7160 C  "C1'" . DC  C  2  9   ? 23.990  34.175  184.719 1.00 34.53  ? 13  DC  C "C1'" 1 
ATOM   7161 N  N1    . DC  C  2  9   ? 23.100  35.269  185.159 1.00 32.20  ? 13  DC  C N1    1 
ATOM   7162 C  C2    . DC  C  2  9   ? 23.002  35.533  186.521 1.00 34.93  ? 13  DC  C C2    1 
ATOM   7163 O  O2    . DC  C  2  9   ? 23.651  34.838  187.310 1.00 35.31  ? 13  DC  C O2    1 
ATOM   7164 N  N3    . DC  C  2  9   ? 22.190  36.528  186.950 1.00 33.30  ? 13  DC  C N3    1 
ATOM   7165 C  C4    . DC  C  2  9   ? 21.503  37.253  186.068 1.00 30.65  ? 13  DC  C C4    1 
ATOM   7166 N  N4    . DC  C  2  9   ? 20.726  38.230  186.538 1.00 30.75  ? 13  DC  C N4    1 
ATOM   7167 C  C5    . DC  C  2  9   ? 21.582  37.007  184.667 1.00 31.75  ? 13  DC  C C5    1 
ATOM   7168 C  C6    . DC  C  2  9   ? 22.380  36.008  184.261 1.00 31.99  ? 13  DC  C C6    1 
ATOM   7169 P  P     . DT  D  3  1   ? -1.821  38.143  199.596 1.00 94.81  ? 2   DT  D P     1 
ATOM   7170 O  OP1   . DT  D  3  1   ? -2.477  36.801  199.563 1.00 78.69  ? 2   DT  D OP1   1 
ATOM   7171 O  OP2   . DT  D  3  1   ? -1.045  38.614  198.412 1.00 83.13  ? 2   DT  D OP2   1 
ATOM   7172 O  "O5'" . DT  D  3  1   ? -0.882  38.129  200.887 1.00 77.42  ? 2   DT  D "O5'" 1 
ATOM   7173 C  "C5'" . DT  D  3  1   ? -0.583  39.301  201.668 1.00 61.54  ? 2   DT  D "C5'" 1 
ATOM   7174 C  "C4'" . DT  D  3  1   ? 0.910   39.400  201.884 1.00 54.96  ? 2   DT  D "C4'" 1 
ATOM   7175 O  "O4'" . DT  D  3  1   ? 1.498   38.107  202.189 1.00 49.40  ? 2   DT  D "O4'" 1 
ATOM   7176 C  "C3'" . DT  D  3  1   ? 1.698   39.920  200.687 1.00 47.88  ? 2   DT  D "C3'" 1 
ATOM   7177 O  "O3'" . DT  D  3  1   ? 2.765   40.653  201.281 1.00 48.11  ? 2   DT  D "O3'" 1 
ATOM   7178 C  "C2'" . DT  D  3  1   ? 2.130   38.643  199.982 1.00 48.58  ? 2   DT  D "C2'" 1 
ATOM   7179 C  "C1'" . DT  D  3  1   ? 2.406   37.707  201.154 1.00 45.56  ? 2   DT  D "C1'" 1 
ATOM   7180 N  N1    . DT  D  3  1   ? 2.223   36.249  200.957 1.00 40.82  ? 2   DT  D N1    1 
ATOM   7181 C  C2    . DT  D  3  1   ? 3.181   35.399  201.464 1.00 35.07  ? 2   DT  D C2    1 
ATOM   7182 O  O2    . DT  D  3  1   ? 4.240   35.785  201.926 1.00 35.17  ? 2   DT  D O2    1 
ATOM   7183 N  N3    . DT  D  3  1   ? 2.885   34.065  201.340 1.00 35.18  ? 2   DT  D N3    1 
ATOM   7184 C  C4    . DT  D  3  1   ? 1.737   33.507  200.814 1.00 34.46  ? 2   DT  D C4    1 
ATOM   7185 O  O4    . DT  D  3  1   ? 1.599   32.285  200.818 1.00 35.63  ? 2   DT  D O4    1 
ATOM   7186 C  C5    . DT  D  3  1   ? 0.757   34.458  200.328 1.00 34.95  ? 2   DT  D C5    1 
ATOM   7187 C  C7    . DT  D  3  1   ? -0.526  33.953  199.745 1.00 33.57  ? 2   DT  D C7    1 
ATOM   7188 C  C6    . DT  D  3  1   ? 1.034   35.762  200.452 1.00 37.76  ? 2   DT  D C6    1 
ATOM   7189 P  P     . DA  D  3  2   ? 3.626   41.692  200.431 1.00 51.22  ? 3   DA  D P     1 
ATOM   7190 O  OP1   . DA  D  3  2   ? 4.349   42.578  201.388 1.00 49.01  ? 3   DA  D OP1   1 
ATOM   7191 O  OP2   . DA  D  3  2   ? 2.751   42.276  199.369 1.00 47.72  ? 3   DA  D OP2   1 
ATOM   7192 O  "O5'" . DA  D  3  2   ? 4.736   40.745  199.789 1.00 46.40  ? 3   DA  D "O5'" 1 
ATOM   7193 C  "C5'" . DA  D  3  2   ? 5.657   40.030  200.625 1.00 45.31  ? 3   DA  D "C5'" 1 
ATOM   7194 C  "C4'" . DA  D  3  2   ? 6.427   39.031  199.794 1.00 44.70  ? 3   DA  D "C4'" 1 
ATOM   7195 O  "O4'" . DA  D  3  2   ? 5.540   37.989  199.345 1.00 39.04  ? 3   DA  D "O4'" 1 
ATOM   7196 C  "C3'" . DA  D  3  2   ? 7.050   39.630  198.538 1.00 46.22  ? 3   DA  D "C3'" 1 
ATOM   7197 O  "O3'" . DA  D  3  2   ? 8.452   39.390  198.503 1.00 49.76  ? 3   DA  D "O3'" 1 
ATOM   7198 C  "C2'" . DA  D  3  2   ? 6.282   39.011  197.383 1.00 45.06  ? 3   DA  D "C2'" 1 
ATOM   7199 C  "C1'" . DA  D  3  2   ? 5.727   37.731  197.969 1.00 41.91  ? 3   DA  D "C1'" 1 
ATOM   7200 N  N9    . DA  D  3  2   ? 4.441   37.282  197.435 1.00 37.83  ? 3   DA  D N9    1 
ATOM   7201 C  C8    . DA  D  3  2   ? 3.455   37.979  196.775 1.00 34.84  ? 3   DA  D C8    1 
ATOM   7202 N  N7    . DA  D  3  2   ? 2.399   37.256  196.491 1.00 37.04  ? 3   DA  D N7    1 
ATOM   7203 C  C5    . DA  D  3  2   ? 2.702   36.006  197.014 1.00 35.18  ? 3   DA  D C5    1 
ATOM   7204 C  C6    . DA  D  3  2   ? 1.989   34.796  197.045 1.00 36.52  ? 3   DA  D C6    1 
ATOM   7205 N  N6    . DA  D  3  2   ? 0.773   34.638  196.520 1.00 36.63  ? 3   DA  D N6    1 
ATOM   7206 N  N1    . DA  D  3  2   ? 2.574   33.737  197.653 1.00 38.82  ? 3   DA  D N1    1 
ATOM   7207 C  C2    . DA  D  3  2   ? 3.798   33.895  198.182 1.00 37.01  ? 3   DA  D C2    1 
ATOM   7208 N  N3    . DA  D  3  2   ? 4.567   34.982  198.213 1.00 35.27  ? 3   DA  D N3    1 
ATOM   7209 C  C4    . DA  D  3  2   ? 3.957   36.010  197.596 1.00 34.19  ? 3   DA  D C4    1 
ATOM   7210 P  P     . DC  D  3  3   ? 9.418   40.606  198.224 1.00 50.36  ? 4   DC  D P     1 
ATOM   7211 O  OP1   . DC  D  3  3   ? 10.382  40.704  199.322 1.00 56.21  ? 4   DC  D OP1   1 
ATOM   7212 O  OP2   . DC  D  3  3   ? 8.605   41.796  197.833 1.00 50.27  ? 4   DC  D OP2   1 
ATOM   7213 O  "O5'" . DC  D  3  3   ? 10.240  40.070  196.974 1.00 53.68  ? 4   DC  D "O5'" 1 
ATOM   7214 C  "C5'" . DC  D  3  3   ? 9.646   40.070  195.692 1.00 37.86  ? 4   DC  D "C5'" 1 
ATOM   7215 C  "C4'" . DC  D  3  3   ? 10.700  40.280  194.639 1.00 35.04  ? 4   DC  D "C4'" 1 
ATOM   7216 O  "O4'" . DC  D  3  3   ? 10.017  40.577  193.404 1.00 34.01  ? 4   DC  D "O4'" 1 
ATOM   7217 C  "C3'" . DC  D  3  3   ? 11.673  41.438  194.865 1.00 31.32  ? 4   DC  D "C3'" 1 
ATOM   7218 O  "O3'" . DC  D  3  3   ? 12.885  40.913  194.344 1.00 29.10  ? 4   DC  D "O3'" 1 
ATOM   7219 C  "C2'" . DC  D  3  3   ? 11.086  42.550  194.013 1.00 32.04  ? 4   DC  D "C2'" 1 
ATOM   7220 C  "C1'" . DC  D  3  3   ? 10.584  41.743  192.834 1.00 34.05  ? 4   DC  D "C1'" 1 
ATOM   7221 N  N1    . DC  D  3  3   ? 9.589   42.298  191.899 1.00 36.05  ? 4   DC  D N1    1 
ATOM   7222 C  C2    . DC  D  3  3   ? 9.900   42.315  190.536 1.00 36.48  ? 4   DC  D C2    1 
ATOM   7223 O  O2    . DC  D  3  3   ? 11.048  42.011  190.179 1.00 39.45  ? 4   DC  D O2    1 
ATOM   7224 N  N3    . DC  D  3  3   ? 8.969   42.731  189.652 1.00 41.07  ? 4   DC  D N3    1 
ATOM   7225 C  C4    . DC  D  3  3   ? 7.749   43.062  190.075 1.00 44.21  ? 4   DC  D C4    1 
ATOM   7226 N  N4    . DC  D  3  3   ? 6.862   43.465  189.161 1.00 46.08  ? 4   DC  D N4    1 
ATOM   7227 C  C5    . DC  D  3  3   ? 7.392   43.018  191.454 1.00 37.48  ? 4   DC  D C5    1 
ATOM   7228 C  C6    . DC  D  3  3   ? 8.329   42.612  192.321 1.00 36.52  ? 4   DC  D C6    1 
ATOM   7229 P  P     . DT  D  3  4   ? 14.305  41.317  194.916 1.00 30.75  ? 5   DT  D P     1 
ATOM   7230 O  OP1   . DT  D  3  4   ? 14.130  41.860  196.292 1.00 31.50  ? 5   DT  D OP1   1 
ATOM   7231 O  OP2   . DT  D  3  4   ? 15.013  42.078  193.873 1.00 30.06  ? 5   DT  D OP2   1 
ATOM   7232 O  "O5'" . DT  D  3  4   ? 15.078  39.936  194.975 1.00 28.05  ? 5   DT  D "O5'" 1 
ATOM   7233 C  "C5'" . DT  D  3  4   ? 14.590  38.871  195.801 1.00 27.05  ? 5   DT  D "C5'" 1 
ATOM   7234 C  "C4'" . DT  D  3  4   ? 15.664  37.825  195.921 1.00 28.66  ? 5   DT  D "C4'" 1 
ATOM   7235 O  "O4'" . DT  D  3  4   ? 15.904  37.231  194.625 1.00 26.89  ? 5   DT  D "O4'" 1 
ATOM   7236 C  "C3'" . DT  D  3  4   ? 17.007  38.377  196.401 1.00 27.40  ? 5   DT  D "C3'" 1 
ATOM   7237 O  "O3'" . DT  D  3  4   ? 17.541  37.495  197.382 1.00 29.36  ? 5   DT  D "O3'" 1 
ATOM   7238 C  "C2'" . DT  D  3  4   ? 17.868  38.415  195.154 1.00 26.77  ? 5   DT  D "C2'" 1 
ATOM   7239 C  "C1'" . DT  D  3  4   ? 17.285  37.312  194.284 1.00 26.19  ? 5   DT  D "C1'" 1 
ATOM   7240 N  N1    . DT  D  3  4   ? 17.363  37.579  192.834 1.00 27.07  ? 5   DT  D N1    1 
ATOM   7241 C  C2    . DT  D  3  4   ? 17.961  36.648  192.015 1.00 25.57  ? 5   DT  D C2    1 
ATOM   7242 O  O2    . DT  D  3  4   ? 18.469  35.620  192.432 1.00 25.09  ? 5   DT  D O2    1 
ATOM   7243 N  N3    . DT  D  3  4   ? 17.931  36.962  190.675 1.00 25.66  ? 5   DT  D N3    1 
ATOM   7244 C  C4    . DT  D  3  4   ? 17.362  38.079  190.090 1.00 25.08  ? 5   DT  D C4    1 
ATOM   7245 O  O4    . DT  D  3  4   ? 17.436  38.238  188.876 1.00 25.11  ? 5   DT  D O4    1 
ATOM   7246 C  C5    . DT  D  3  4   ? 16.737  39.006  191.010 1.00 24.64  ? 5   DT  D C5    1 
ATOM   7247 C  C7    . DT  D  3  4   ? 16.116  40.256  190.469 1.00 25.41  ? 5   DT  D C7    1 
ATOM   7248 C  C6    . DT  D  3  4   ? 16.754  38.706  192.314 1.00 25.05  ? 5   DT  D C6    1 
ATOM   7249 P  P     . DG  D  3  5   ? 18.781  37.952  198.291 1.00 30.02  ? 6   DG  D P     1 
ATOM   7250 O  OP1   . DG  D  3  5   ? 18.659  37.255  199.582 1.00 31.92  ? 6   DG  D OP1   1 
ATOM   7251 O  OP2   . DG  D  3  5   ? 18.880  39.429  198.247 1.00 26.94  ? 6   DG  D OP2   1 
ATOM   7252 O  "O5'" . DG  D  3  5   ? 20.045  37.393  197.521 1.00 28.38  ? 6   DG  D "O5'" 1 
ATOM   7253 C  "C5'" . DG  D  3  5   ? 20.270  35.990  197.473 1.00 31.66  ? 6   DG  D "C5'" 1 
ATOM   7254 C  "C4'" . DG  D  3  5   ? 21.546  35.724  196.722 1.00 30.04  ? 6   DG  D "C4'" 1 
ATOM   7255 O  "O4'" . DG  D  3  5   ? 21.311  36.038  195.330 1.00 29.84  ? 6   DG  D "O4'" 1 
ATOM   7256 C  "C3'" . DG  D  3  5   ? 22.732  36.593  197.163 1.00 32.22  ? 6   DG  D "C3'" 1 
ATOM   7257 O  "O3'" . DG  D  3  5   ? 23.885  35.750  197.142 1.00 32.30  ? 6   DG  D "O3'" 1 
ATOM   7258 C  "C2'" . DG  D  3  5   ? 22.807  37.668  196.086 1.00 31.72  ? 6   DG  D "C2'" 1 
ATOM   7259 C  "C1'" . DG  D  3  5   ? 22.359  36.875  194.861 1.00 32.86  ? 6   DG  D "C1'" 1 
ATOM   7260 N  N9    . DG  D  3  5   ? 21.840  37.622  193.720 1.00 30.51  ? 6   DG  D N9    1 
ATOM   7261 C  C8    . DG  D  3  5   ? 21.043  38.741  193.718 1.00 30.41  ? 6   DG  D C8    1 
ATOM   7262 N  N7    . DG  D  3  5   ? 20.705  39.125  192.515 1.00 32.09  ? 6   DG  D N7    1 
ATOM   7263 C  C5    . DG  D  3  5   ? 21.261  38.166  191.682 1.00 31.78  ? 6   DG  D C5    1 
ATOM   7264 C  C6    . DG  D  3  5   ? 21.231  38.043  190.268 1.00 34.05  ? 6   DG  D C6    1 
ATOM   7265 O  O6    . DG  D  3  5   ? 20.681  38.778  189.441 1.00 31.49  ? 6   DG  D O6    1 
ATOM   7266 N  N1    . DG  D  3  5   ? 21.962  36.940  189.836 1.00 34.50  ? 6   DG  D N1    1 
ATOM   7267 C  C2    . DG  D  3  5   ? 22.606  36.049  190.660 1.00 38.68  ? 6   DG  D C2    1 
ATOM   7268 N  N2    . DG  D  3  5   ? 23.229  35.030  190.062 1.00 41.84  ? 6   DG  D N2    1 
ATOM   7269 N  N3    . DG  D  3  5   ? 22.620  36.140  191.977 1.00 31.70  ? 6   DG  D N3    1 
ATOM   7270 C  C4    . DG  D  3  5   ? 21.950  37.223  192.415 1.00 31.02  ? 6   DG  D C4    1 
ATOM   7271 P  P     . DG  D  3  6   ? 25.283  36.228  197.726 1.00 33.67  ? 7   DG  D P     1 
ATOM   7272 O  OP1   . DG  D  3  6   ? 25.782  35.135  198.569 1.00 33.04  ? 7   DG  D OP1   1 
ATOM   7273 O  OP2   . DG  D  3  6   ? 25.127  37.601  198.270 1.00 34.43  ? 7   DG  D OP2   1 
ATOM   7274 O  "O5'" . DG  D  3  6   ? 26.249  36.324  196.458 1.00 33.06  ? 7   DG  D "O5'" 1 
ATOM   7275 C  "C5'" . DG  D  3  6   ? 26.679  35.108  195.818 1.00 36.59  ? 7   DG  D "C5'" 1 
ATOM   7276 C  "C4'" . DG  D  3  6   ? 27.816  35.343  194.851 1.00 36.22  ? 7   DG  D "C4'" 1 
ATOM   7277 O  "O4'" . DG  D  3  6   ? 27.290  35.926  193.642 1.00 37.81  ? 7   DG  D "O4'" 1 
ATOM   7278 C  "C3'" . DG  D  3  6   ? 28.921  36.282  195.323 1.00 36.74  ? 7   DG  D "C3'" 1 
ATOM   7279 O  "O3'" . DG  D  3  6   ? 30.163  35.747  194.862 1.00 37.17  ? 7   DG  D "O3'" 1 
ATOM   7280 C  "C2'" . DG  D  3  6   ? 28.525  37.622  194.727 1.00 34.48  ? 7   DG  D "C2'" 1 
ATOM   7281 C  "C1'" . DG  D  3  6   ? 27.806  37.229  193.444 1.00 36.55  ? 7   DG  D "C1'" 1 
ATOM   7282 N  N9    . DG  D  3  6   ? 26.704  38.069  192.976 1.00 36.61  ? 7   DG  D N9    1 
ATOM   7283 C  C8    . DG  D  3  6   ? 25.686  38.645  193.700 1.00 38.17  ? 7   DG  D C8    1 
ATOM   7284 N  N7    . DG  D  3  6   ? 24.825  39.284  192.953 1.00 36.66  ? 7   DG  D N7    1 
ATOM   7285 C  C5    . DG  D  3  6   ? 25.296  39.107  191.658 1.00 38.70  ? 7   DG  D C5    1 
ATOM   7286 C  C6    . DG  D  3  6   ? 24.787  39.574  190.413 1.00 36.47  ? 7   DG  D C6    1 
ATOM   7287 O  O6    . DG  D  3  6   ? 23.802  40.283  190.197 1.00 34.16  ? 7   DG  D O6    1 
ATOM   7288 N  N1    . DG  D  3  6   ? 25.561  39.134  189.349 1.00 39.98  ? 7   DG  D N1    1 
ATOM   7289 C  C2    . DG  D  3  6   ? 26.690  38.364  189.458 1.00 40.71  ? 7   DG  D C2    1 
ATOM   7290 N  N2    . DG  D  3  6   ? 27.309  38.051  188.313 1.00 43.45  ? 7   DG  D N2    1 
ATOM   7291 N  N3    . DG  D  3  6   ? 27.193  37.951  190.606 1.00 38.30  ? 7   DG  D N3    1 
ATOM   7292 C  C4    . DG  D  3  6   ? 26.450  38.352  191.657 1.00 40.15  ? 7   DG  D C4    1 
ATOM   7293 P  P     . DT  D  3  7   ? 31.494  36.593  195.031 1.00 43.37  ? 8   DT  D P     1 
ATOM   7294 O  OP1   . DT  D  3  7   ? 32.655  35.668  195.077 1.00 42.66  ? 8   DT  D OP1   1 
ATOM   7295 O  OP2   . DT  D  3  7   ? 31.285  37.573  196.119 1.00 43.79  ? 8   DT  D OP2   1 
ATOM   7296 O  "O5'" . DT  D  3  7   ? 31.605  37.361  193.641 1.00 42.97  ? 8   DT  D "O5'" 1 
ATOM   7297 C  "C5'" . DT  D  3  7   ? 32.057  36.683  192.463 1.00 45.35  ? 8   DT  D "C5'" 1 
ATOM   7298 C  "C4'" . DT  D  3  7   ? 32.235  37.679  191.343 1.00 44.52  ? 8   DT  D "C4'" 1 
ATOM   7299 O  "O4'" . DT  D  3  7   ? 30.963  38.290  191.057 1.00 46.43  ? 8   DT  D "O4'" 1 
ATOM   7300 C  "C3'" . DT  D  3  7   ? 33.206  38.820  191.652 1.00 43.96  ? 8   DT  D "C3'" 1 
ATOM   7301 O  "O3'" . DT  D  3  7   ? 34.315  38.616  190.779 1.00 46.34  ? 8   DT  D "O3'" 1 
ATOM   7302 C  "C2'" . DT  D  3  7   ? 32.390  40.089  191.447 1.00 40.55  ? 8   DT  D "C2'" 1 
ATOM   7303 C  "C1'" . DT  D  3  7   ? 31.180  39.616  190.657 1.00 41.97  ? 8   DT  D "C1'" 1 
ATOM   7304 N  N1    . DT  D  3  7   ? 29.915  40.362  190.866 1.00 41.52  ? 8   DT  D N1    1 
ATOM   7305 C  C2    . DT  D  3  7   ? 29.251  40.815  189.746 1.00 41.96  ? 8   DT  D C2    1 
ATOM   7306 O  O2    . DT  D  3  7   ? 29.659  40.637  188.610 1.00 40.05  ? 8   DT  D O2    1 
ATOM   7307 N  N3    . DT  D  3  7   ? 28.082  41.485  190.005 1.00 39.50  ? 8   DT  D N3    1 
ATOM   7308 C  C4    . DT  D  3  7   ? 27.537  41.767  191.241 1.00 37.38  ? 8   DT  D C4    1 
ATOM   7309 O  O4    . DT  D  3  7   ? 26.494  42.404  191.313 1.00 32.70  ? 8   DT  D O4    1 
ATOM   7310 C  C5    . DT  D  3  7   ? 28.279  41.259  192.375 1.00 36.63  ? 8   DT  D C5    1 
ATOM   7311 C  C7    . DT  D  3  7   ? 27.762  41.513  193.755 1.00 35.82  ? 8   DT  D C7    1 
ATOM   7312 C  C6    . DT  D  3  7   ? 29.417  40.591  192.133 1.00 39.42  ? 8   DT  D C6    1 
ATOM   7313 P  P     . DA  D  3  8   ? 35.483  39.658  190.702 1.00 50.64  ? 9   DA  D P     1 
ATOM   7314 O  OP1   . DA  D  3  8   ? 36.731  38.913  190.388 1.00 56.86  ? 9   DA  D OP1   1 
ATOM   7315 O  OP2   . DA  D  3  8   ? 35.435  40.532  191.893 1.00 49.70  ? 9   DA  D OP2   1 
ATOM   7316 O  "O5'" . DA  D  3  8   ? 35.084  40.517  189.418 1.00 53.42  ? 9   DA  D "O5'" 1 
ATOM   7317 C  "C5'" . DA  D  3  8   ? 34.646  39.878  188.194 1.00 48.06  ? 9   DA  D "C5'" 1 
ATOM   7318 C  "C4'" . DA  D  3  8   ? 34.178  40.906  187.191 1.00 42.67  ? 9   DA  D "C4'" 1 
ATOM   7319 O  "O4'" . DA  D  3  8   ? 32.876  41.396  187.583 1.00 43.04  ? 9   DA  D "O4'" 1 
ATOM   7320 C  "C3'" . DA  D  3  8   ? 35.078  42.139  187.072 1.00 46.48  ? 9   DA  D "C3'" 1 
ATOM   7321 O  "O3'" . DA  D  3  8   ? 35.488  42.313  185.715 1.00 47.13  ? 9   DA  D "O3'" 1 
ATOM   7322 C  "C2'" . DA  D  3  8   ? 34.229  43.280  187.615 1.00 44.05  ? 9   DA  D "C2'" 1 
ATOM   7323 C  "C1'" . DA  D  3  8   ? 32.819  42.791  187.375 1.00 40.74  ? 9   DA  D "C1'" 1 
ATOM   7324 N  N9    . DA  D  3  8   ? 31.813  43.330  188.286 1.00 38.62  ? 9   DA  D N9    1 
ATOM   7325 C  C8    . DA  D  3  8   ? 31.807  43.269  189.658 1.00 38.57  ? 9   DA  D C8    1 
ATOM   7326 N  N7    . DA  D  3  8   ? 30.748  43.814  190.206 1.00 38.59  ? 9   DA  D N7    1 
ATOM   7327 C  C5    . DA  D  3  8   ? 30.005  44.264  189.124 1.00 37.09  ? 9   DA  D C5    1 
ATOM   7328 C  C6    . DA  D  3  8   ? 28.786  44.963  189.036 1.00 36.21  ? 9   DA  D C6    1 
ATOM   7329 N  N6    . DA  D  3  8   ? 28.051  45.305  190.093 1.00 36.32  ? 9   DA  D N6    1 
ATOM   7330 N  N1    . DA  D  3  8   ? 28.344  45.305  187.805 1.00 33.94  ? 9   DA  D N1    1 
ATOM   7331 C  C2    . DA  D  3  8   ? 29.078  44.950  186.738 1.00 34.11  ? 9   DA  D C2    1 
ATOM   7332 N  N3    . DA  D  3  8   ? 30.237  44.294  186.694 1.00 32.52  ? 9   DA  D N3    1 
ATOM   7333 C  C4    . DA  D  3  8   ? 30.658  43.987  187.935 1.00 36.96  ? 9   DA  D C4    1 
ATOM   7334 P  P     . DT  D  3  9   ? 36.578  43.414  185.343 1.00 49.28  ? 10  DT  D P     1 
ATOM   7335 O  OP1   . DT  D  3  9   ? 37.318  42.908  184.168 1.00 50.45  ? 10  DT  D OP1   1 
ATOM   7336 O  OP2   . DT  D  3  9   ? 37.315  43.788  186.581 1.00 49.45  ? 10  DT  D OP2   1 
ATOM   7337 O  "O5'" . DT  D  3  9   ? 35.678  44.645  184.885 1.00 48.61  ? 10  DT  D "O5'" 1 
ATOM   7338 C  "C5'" . DT  D  3  9   ? 34.565  44.408  183.985 1.00 48.56  ? 10  DT  D "C5'" 1 
ATOM   7339 C  "C4'" . DT  D  3  9   ? 33.699  45.640  183.878 1.00 49.41  ? 10  DT  D "C4'" 1 
ATOM   7340 O  "O4'" . DT  D  3  9   ? 32.834  45.760  185.038 1.00 47.84  ? 10  DT  D "O4'" 1 
ATOM   7341 C  "C3'" . DT  D  3  9   ? 34.478  46.959  183.801 1.00 51.93  ? 10  DT  D "C3'" 1 
ATOM   7342 O  "O3'" . DT  D  3  9   ? 33.792  47.787  182.872 1.00 60.16  ? 10  DT  D "O3'" 1 
ATOM   7343 C  "C2'" . DT  D  3  9   ? 34.302  47.547  185.186 1.00 50.74  ? 10  DT  D "C2'" 1 
ATOM   7344 C  "C1'" . DT  D  3  9   ? 32.870  47.116  185.439 1.00 45.84  ? 10  DT  D "C1'" 1 
ATOM   7345 N  N1    . DT  D  3  9   ? 32.356  47.210  186.810 1.00 43.10  ? 10  DT  D N1    1 
ATOM   7346 C  C2    . DT  D  3  9   ? 31.079  47.700  186.958 1.00 40.88  ? 10  DT  D C2    1 
ATOM   7347 O  O2    . DT  D  3  9   ? 30.380  48.028  186.016 1.00 45.12  ? 10  DT  D O2    1 
ATOM   7348 N  N3    . DT  D  3  9   ? 30.644  47.783  188.253 1.00 36.69  ? 10  DT  D N3    1 
ATOM   7349 C  C4    . DT  D  3  9   ? 31.332  47.409  189.390 1.00 40.33  ? 10  DT  D C4    1 
ATOM   7350 O  O4    . DT  D  3  9   ? 30.804  47.544  190.493 1.00 40.16  ? 10  DT  D O4    1 
ATOM   7351 C  C5    . DT  D  3  9   ? 32.672  46.910  189.165 1.00 41.43  ? 10  DT  D C5    1 
ATOM   7352 C  C7    . DT  D  3  9   ? 33.505  46.497  190.339 1.00 41.98  ? 10  DT  D C7    1 
ATOM   7353 C  C6    . DT  D  3  9   ? 33.111  46.837  187.902 1.00 42.48  ? 10  DT  D C6    1 
ATOM   7354 P  P     . DG  D  3  10  ? 34.567  48.745  181.879 1.00 55.34  ? 11  DG  D P     1 
ATOM   7355 O  OP1   . DG  D  3  10  ? 34.868  47.952  180.664 1.00 57.94  ? 11  DG  D OP1   1 
ATOM   7356 O  OP2   . DG  D  3  10  ? 35.666  49.408  182.632 1.00 48.65  ? 11  DG  D OP2   1 
ATOM   7357 O  "O5'" . DG  D  3  10  ? 33.435  49.808  181.547 1.00 47.36  ? 11  DG  D "O5'" 1 
ATOM   7358 C  "C5'" . DG  D  3  10  ? 32.065  49.383  181.378 1.00 44.67  ? 11  DG  D "C5'" 1 
ATOM   7359 C  "C4'" . DG  D  3  10  ? 31.113  50.542  181.574 1.00 47.10  ? 11  DG  D "C4'" 1 
ATOM   7360 O  "O4'" . DG  D  3  10  ? 30.652  50.612  182.949 1.00 44.65  ? 11  DG  D "O4'" 1 
ATOM   7361 C  "C3'" . DG  D  3  10  ? 31.691  51.923  181.274 1.00 42.76  ? 11  DG  D "C3'" 1 
ATOM   7362 O  "O3'" . DG  D  3  10  ? 30.594  52.719  180.809 1.00 44.52  ? 11  DG  D "O3'" 1 
ATOM   7363 C  "C2'" . DG  D  3  10  ? 32.214  52.359  182.633 1.00 43.04  ? 11  DG  D "C2'" 1 
ATOM   7364 C  "C1'" . DG  D  3  10  ? 31.123  51.817  183.551 1.00 43.92  ? 11  DG  D "C1'" 1 
ATOM   7365 N  N9    . DG  D  3  10  ? 31.518  51.505  184.923 1.00 43.18  ? 11  DG  D N9    1 
ATOM   7366 C  C8    . DG  D  3  10  ? 32.589  50.754  185.343 1.00 43.26  ? 11  DG  D C8    1 
ATOM   7367 N  N7    . DG  D  3  10  ? 32.653  50.636  186.641 1.00 38.68  ? 11  DG  D N7    1 
ATOM   7368 C  C5    . DG  D  3  10  ? 31.554  51.344  187.105 1.00 36.90  ? 11  DG  D C5    1 
ATOM   7369 C  C6    . DG  D  3  10  ? 31.095  51.570  188.432 1.00 37.54  ? 11  DG  D C6    1 
ATOM   7370 O  O6    . DG  D  3  10  ? 31.577  51.163  189.496 1.00 36.87  ? 11  DG  D O6    1 
ATOM   7371 N  N1    . DG  D  3  10  ? 29.939  52.343  188.446 1.00 37.50  ? 11  DG  D N1    1 
ATOM   7372 C  C2    . DG  D  3  10  ? 29.316  52.853  187.329 1.00 40.53  ? 11  DG  D C2    1 
ATOM   7373 N  N2    . DG  D  3  10  ? 28.207  53.576  187.538 1.00 43.26  ? 11  DG  D N2    1 
ATOM   7374 N  N3    . DG  D  3  10  ? 29.724  52.634  186.094 1.00 41.29  ? 11  DG  D N3    1 
ATOM   7375 C  C4    . DG  D  3  10  ? 30.843  51.884  186.056 1.00 40.60  ? 11  DG  D C4    1 
ATOM   7376 P  P     . DT  D  3  11  ? 30.826  54.206  180.198 1.00 41.98  ? 12  DT  D P     1 
ATOM   7377 O  OP1   . DT  D  3  11  ? 29.812  54.409  179.119 1.00 43.22  ? 12  DT  D OP1   1 
ATOM   7378 O  OP2   . DT  D  3  11  ? 32.279  54.359  179.884 1.00 39.86  ? 12  DT  D OP2   1 
ATOM   7379 O  "O5'" . DT  D  3  11  ? 30.331  55.136  181.388 1.00 42.23  ? 12  DT  D "O5'" 1 
ATOM   7380 C  "C5'" . DT  D  3  11  ? 28.968  55.043  181.852 1.00 44.62  ? 12  DT  D "C5'" 1 
ATOM   7381 C  "C4'" . DT  D  3  11  ? 28.738  56.041  182.962 1.00 50.48  ? 12  DT  D "C4'" 1 
ATOM   7382 O  "O4'" . DT  D  3  11  ? 29.301  55.563  184.212 1.00 54.18  ? 12  DT  D "O4'" 1 
ATOM   7383 C  "C3'" . DT  D  3  11  ? 29.357  57.420  182.715 1.00 53.33  ? 12  DT  D "C3'" 1 
ATOM   7384 O  "O3'" . DT  D  3  11  ? 28.278  58.340  182.905 1.00 55.73  ? 12  DT  D "O3'" 1 
ATOM   7385 C  "C2'" . DT  D  3  11  ? 30.537  57.476  183.680 1.00 51.71  ? 12  DT  D "C2'" 1 
ATOM   7386 C  "C1'" . DT  D  3  11  ? 30.057  56.594  184.828 1.00 49.94  ? 12  DT  D "C1'" 1 
ATOM   7387 N  N1    . DT  D  3  11  ? 31.062  55.945  185.716 1.00 45.28  ? 12  DT  D N1    1 
ATOM   7388 C  C2    . DT  D  3  11  ? 30.777  55.914  187.065 1.00 41.47  ? 12  DT  D C2    1 
ATOM   7389 O  O2    . DT  D  3  11  ? 29.785  56.433  187.546 1.00 40.60  ? 12  DT  D O2    1 
ATOM   7390 N  N3    . DT  D  3  11  ? 31.716  55.270  187.838 1.00 39.35  ? 12  DT  D N3    1 
ATOM   7391 C  C4    . DT  D  3  11  ? 32.861  54.632  187.402 1.00 42.00  ? 12  DT  D C4    1 
ATOM   7392 O  O4    . DT  D  3  11  ? 33.582  54.047  188.210 1.00 38.89  ? 12  DT  D O4    1 
ATOM   7393 C  C5    . DT  D  3  11  ? 33.087  54.683  185.971 1.00 44.68  ? 12  DT  D C5    1 
ATOM   7394 C  C7    . DT  D  3  11  ? 34.310  54.030  185.407 1.00 45.54  ? 12  DT  D C7    1 
ATOM   7395 C  C6    . DT  D  3  11  ? 32.182  55.318  185.209 1.00 44.80  ? 12  DT  D C6    1 
ATOM   7396 P  P     . DA  D  3  12  ? 28.464  59.902  182.640 1.00 58.04  ? 13  DA  D P     1 
ATOM   7397 O  OP1   . DA  D  3  12  ? 27.136  60.444  182.233 1.00 52.12  ? 13  DA  D OP1   1 
ATOM   7398 O  OP2   . DA  D  3  12  ? 29.672  60.118  181.813 1.00 51.49  ? 13  DA  D OP2   1 
ATOM   7399 O  "O5'" . DA  D  3  12  ? 28.826  60.453  184.089 1.00 56.92  ? 13  DA  D "O5'" 1 
ATOM   7400 C  "C5'" . DA  D  3  12  ? 27.949  60.195  185.202 1.00 54.76  ? 13  DA  D "C5'" 1 
ATOM   7401 C  "C4'" . DA  D  3  12  ? 28.604  60.660  186.479 1.00 55.87  ? 13  DA  D "C4'" 1 
ATOM   7402 O  "O4'" . DA  D  3  12  ? 29.576  59.690  186.929 1.00 52.00  ? 13  DA  D "O4'" 1 
ATOM   7403 C  "C3'" . DA  D  3  12  ? 29.355  61.993  186.348 1.00 53.25  ? 13  DA  D "C3'" 1 
ATOM   7404 O  "O3'" . DA  D  3  12  ? 28.563  62.964  187.037 1.00 58.37  ? 13  DA  D "O3'" 1 
ATOM   7405 C  "C2'" . DA  D  3  12  ? 30.763  61.692  186.847 1.00 51.69  ? 13  DA  D "C2'" 1 
ATOM   7406 C  "C1'" . DA  D  3  12  ? 30.582  60.403  187.617 1.00 51.04  ? 13  DA  D "C1'" 1 
ATOM   7407 N  N9    . DA  D  3  12  ? 31.756  59.542  187.725 1.00 44.34  ? 13  DA  D N9    1 
ATOM   7408 C  C8    . DA  D  3  12  ? 32.655  59.159  186.764 1.00 40.51  ? 13  DA  D C8    1 
ATOM   7409 N  N7    . DA  D  3  12  ? 33.604  58.373  187.212 1.00 38.17  ? 13  DA  D N7    1 
ATOM   7410 C  C5    . DA  D  3  12  ? 33.306  58.224  188.558 1.00 37.67  ? 13  DA  D C5    1 
ATOM   7411 C  C6    . DA  D  3  12  ? 33.924  57.498  189.593 1.00 36.12  ? 13  DA  D C6    1 
ATOM   7412 N  N6    . DA  D  3  12  ? 35.025  56.762  189.429 1.00 37.60  ? 13  DA  D N6    1 
ATOM   7413 N  N1    . DA  D  3  12  ? 33.381  57.576  190.824 1.00 34.24  ? 13  DA  D N1    1 
ATOM   7414 C  C2    . DA  D  3  12  ? 32.278  58.317  190.994 1.00 37.94  ? 13  DA  D C2    1 
ATOM   7415 N  N3    . DA  D  3  12  ? 31.603  59.038  190.102 1.00 38.14  ? 13  DA  D N3    1 
ATOM   7416 C  C4    . DA  D  3  12  ? 32.179  58.952  188.891 1.00 39.35  ? 13  DA  D C4    1 
ATOM   7417 P  P     . DT  D  3  13  ? 29.135  64.428  187.371 1.00 58.32  ? 14  DT  D P     1 
ATOM   7418 O  OP1   . DT  D  3  13  ? 27.973  65.342  187.479 1.00 54.77  ? 14  DT  D OP1   1 
ATOM   7419 O  OP2   . DT  D  3  13  ? 30.291  64.717  186.474 1.00 46.88  ? 14  DT  D OP2   1 
ATOM   7420 O  "O5'" . DT  D  3  13  ? 29.763  64.236  188.819 1.00 53.77  ? 14  DT  D "O5'" 1 
ATOM   7421 C  "C5'" . DT  D  3  13  ? 29.123  63.428  189.824 1.00 51.84  ? 14  DT  D "C5'" 1 
ATOM   7422 C  "C4'" . DT  D  3  13  ? 30.116  63.214  190.937 1.00 50.71  ? 14  DT  D "C4'" 1 
ATOM   7423 O  "O4'" . DT  D  3  13  ? 31.138  62.296  190.516 1.00 47.07  ? 14  DT  D "O4'" 1 
ATOM   7424 C  "C3'" . DT  D  3  13  ? 30.864  64.487  191.343 1.00 48.76  ? 14  DT  D "C3'" 1 
ATOM   7425 O  "O3'" . DT  D  3  13  ? 30.335  64.886  192.601 1.00 51.77  ? 14  DT  D "O3'" 1 
ATOM   7426 C  "C2'" . DT  D  3  13  ? 32.329  64.081  191.364 1.00 46.40  ? 14  DT  D "C2'" 1 
ATOM   7427 C  "C1'" . DT  D  3  13  ? 32.255  62.568  191.321 1.00 46.97  ? 14  DT  D "C1'" 1 
ATOM   7428 N  N1    . DT  D  3  13  ? 33.413  61.859  190.745 1.00 45.53  ? 14  DT  D N1    1 
ATOM   7429 C  C2    . DT  D  3  13  ? 34.105  60.985  191.554 1.00 42.69  ? 14  DT  D C2    1 
ATOM   7430 O  O2    . DT  D  3  13  ? 33.804  60.770  192.716 1.00 43.86  ? 14  DT  D O2    1 
ATOM   7431 N  N3    . DT  D  3  13  ? 35.153  60.345  190.941 1.00 41.12  ? 14  DT  D N3    1 
ATOM   7432 C  C4    . DT  D  3  13  ? 35.574  60.497  189.635 1.00 43.15  ? 14  DT  D C4    1 
ATOM   7433 O  O4    . DT  D  3  13  ? 36.542  59.861  189.229 1.00 42.59  ? 14  DT  D O4    1 
ATOM   7434 C  C5    . DT  D  3  13  ? 34.810  61.439  188.846 1.00 45.65  ? 14  DT  D C5    1 
ATOM   7435 C  C7    . DT  D  3  13  ? 35.194  61.672  187.418 1.00 48.97  ? 14  DT  D C7    1 
ATOM   7436 C  C6    . DT  D  3  13  ? 33.771  62.051  189.428 1.00 41.65  ? 14  DT  D C6    1 
ATOM   7437 P  P     . DA  E  2  1   ? 36.709  3.741   218.931 1.00 44.50  ? 5   DA  P P     1 
ATOM   7438 O  OP1   . DA  E  2  1   ? 37.953  3.993   218.159 1.00 42.29  ? 5   DA  P OP1   1 
ATOM   7439 O  OP2   . DA  E  2  1   ? 36.010  4.782   219.736 1.00 42.10  ? 5   DA  P OP2   1 
ATOM   7440 O  "O5'" . DA  E  2  1   ? 35.654  2.961   218.040 1.00 40.88  ? 5   DA  P "O5'" 1 
ATOM   7441 C  "C5'" . DA  E  2  1   ? 36.054  1.792   217.341 1.00 36.09  ? 5   DA  P "C5'" 1 
ATOM   7442 C  "C4'" . DA  E  2  1   ? 34.833  1.200   216.692 1.00 38.30  ? 5   DA  P "C4'" 1 
ATOM   7443 O  "O4'" . DA  E  2  1   ? 33.956  0.674   217.704 1.00 34.87  ? 5   DA  P "O4'" 1 
ATOM   7444 C  "C3'" . DA  E  2  1   ? 33.997  2.188   215.861 1.00 35.04  ? 5   DA  P "C3'" 1 
ATOM   7445 O  "O3'" . DA  E  2  1   ? 34.043  1.623   214.552 1.00 38.39  ? 5   DA  P "O3'" 1 
ATOM   7446 C  "C2'" . DA  E  2  1   ? 32.628  2.183   216.529 1.00 34.22  ? 5   DA  P "C2'" 1 
ATOM   7447 C  "C1'" . DA  E  2  1   ? 32.622  0.848   217.265 1.00 36.11  ? 5   DA  P "C1'" 1 
ATOM   7448 N  N9    . DA  E  2  1   ? 31.771  0.758   218.444 1.00 33.10  ? 5   DA  P N9    1 
ATOM   7449 C  C8    . DA  E  2  1   ? 31.989  1.359   219.660 1.00 33.07  ? 5   DA  P C8    1 
ATOM   7450 N  N7    . DA  E  2  1   ? 31.096  1.049   220.568 1.00 34.48  ? 5   DA  P N7    1 
ATOM   7451 C  C5    . DA  E  2  1   ? 30.235  0.186   219.906 1.00 32.74  ? 5   DA  P C5    1 
ATOM   7452 C  C6    . DA  E  2  1   ? 29.100  -0.516  220.330 1.00 33.05  ? 5   DA  P C6    1 
ATOM   7453 N  N6    . DA  E  2  1   ? 28.597  -0.425  221.557 1.00 35.01  ? 5   DA  P N6    1 
ATOM   7454 N  N1    . DA  E  2  1   ? 28.485  -1.319  219.435 1.00 32.39  ? 5   DA  P N1    1 
ATOM   7455 C  C2    . DA  E  2  1   ? 28.999  -1.415  218.201 1.00 33.05  ? 5   DA  P C2    1 
ATOM   7456 N  N3    . DA  E  2  1   ? 30.065  -0.809  217.687 1.00 33.17  ? 5   DA  P N3    1 
ATOM   7457 C  C4    . DA  E  2  1   ? 30.653  -0.023  218.606 1.00 32.52  ? 5   DA  P C4    1 
ATOM   7458 P  P     . DT  E  2  2   ? 33.332  2.325   213.292 1.00 36.07  ? 6   DT  P P     1 
ATOM   7459 O  OP1   . DT  E  2  2   ? 33.977  1.785   212.077 1.00 40.94  ? 6   DT  P OP1   1 
ATOM   7460 O  OP2   . DT  E  2  2   ? 33.275  3.780   213.541 1.00 39.05  ? 6   DT  P OP2   1 
ATOM   7461 O  "O5'" . DT  E  2  2   ? 31.871  1.717   213.343 1.00 33.90  ? 6   DT  P "O5'" 1 
ATOM   7462 C  "C5'" . DT  E  2  2   ? 31.682  0.326   213.169 1.00 33.03  ? 6   DT  P "C5'" 1 
ATOM   7463 C  "C4'" . DT  E  2  2   ? 30.204  0.037   213.104 1.00 33.50  ? 6   DT  P "C4'" 1 
ATOM   7464 O  "O4'" . DT  E  2  2   ? 29.653  0.140   214.434 1.00 33.99  ? 6   DT  P "O4'" 1 
ATOM   7465 C  "C3'" . DT  E  2  2   ? 29.397  1.010   212.236 1.00 32.08  ? 6   DT  P "C3'" 1 
ATOM   7466 O  "O3'" . DT  E  2  2   ? 28.591  0.222   211.366 1.00 35.38  ? 6   DT  P "O3'" 1 
ATOM   7467 C  "C2'" . DT  E  2  2   ? 28.536  1.773   213.236 1.00 32.28  ? 6   DT  P "C2'" 1 
ATOM   7468 C  "C1'" . DT  E  2  2   ? 28.373  0.742   214.339 1.00 33.57  ? 6   DT  P "C1'" 1 
ATOM   7469 N  N1    . DT  E  2  2   ? 28.020  1.226   215.686 1.00 32.26  ? 6   DT  P N1    1 
ATOM   7470 C  C2    . DT  E  2  2   ? 26.976  0.626   216.362 1.00 31.08  ? 6   DT  P C2    1 
ATOM   7471 O  O2    . DT  E  2  2   ? 26.256  -0.217  215.863 1.00 33.46  ? 6   DT  P O2    1 
ATOM   7472 N  N3    . DT  E  2  2   ? 26.778  1.091   217.634 1.00 29.45  ? 6   DT  P N3    1 
ATOM   7473 C  C4    . DT  E  2  2   ? 27.510  2.060   218.289 1.00 32.71  ? 6   DT  P C4    1 
ATOM   7474 O  O4    . DT  E  2  2   ? 27.214  2.376   219.430 1.00 37.06  ? 6   DT  P O4    1 
ATOM   7475 C  C5    . DT  E  2  2   ? 28.579  2.655   217.519 1.00 33.13  ? 6   DT  P C5    1 
ATOM   7476 C  C7    . DT  E  2  2   ? 29.422  3.719   218.148 1.00 35.00  ? 6   DT  P C7    1 
ATOM   7477 C  C6    . DT  E  2  2   ? 28.786  2.205   216.277 1.00 30.46  ? 6   DT  P C6    1 
ATOM   7478 P  P     . DA  E  2  3   ? 27.632  0.928   210.288 1.00 33.22  ? 7   DA  P P     1 
ATOM   7479 O  OP1   . DA  E  2  3   ? 27.677  0.118   209.065 1.00 32.13  ? 7   DA  P OP1   1 
ATOM   7480 O  OP2   . DA  E  2  3   ? 27.961  2.395   210.276 1.00 34.68  ? 7   DA  P OP2   1 
ATOM   7481 O  "O5'" . DA  E  2  3   ? 26.194  0.733   210.927 1.00 34.17  ? 7   DA  P "O5'" 1 
ATOM   7482 C  "C5'" . DA  E  2  3   ? 25.577  -0.567  210.927 1.00 36.74  ? 7   DA  P "C5'" 1 
ATOM   7483 C  "C4'" . DA  E  2  3   ? 24.142  -0.422  211.368 1.00 38.54  ? 7   DA  P "C4'" 1 
ATOM   7484 O  "O4'" . DA  E  2  3   ? 24.096  -0.057  212.769 1.00 38.20  ? 7   DA  P "O4'" 1 
ATOM   7485 C  "C3'" . DA  E  2  3   ? 23.376  0.667   210.607 1.00 41.32  ? 7   DA  P "C3'" 1 
ATOM   7486 O  "O3'" . DA  E  2  3   ? 22.211  0.044   210.058 1.00 48.77  ? 7   DA  P "O3'" 1 
ATOM   7487 C  "C2'" . DA  E  2  3   ? 23.172  1.772   211.637 1.00 40.66  ? 7   DA  P "C2'" 1 
ATOM   7488 C  "C1'" . DA  E  2  3   ? 23.204  1.028   212.965 1.00 38.33  ? 7   DA  P "C1'" 1 
ATOM   7489 N  N9    . DA  E  2  3   ? 23.675  1.780   214.127 1.00 36.18  ? 7   DA  P N9    1 
ATOM   7490 C  C8    . DA  E  2  3   ? 24.771  2.597   214.230 1.00 34.06  ? 7   DA  P C8    1 
ATOM   7491 N  N7    . DA  E  2  3   ? 24.960  3.080   215.433 1.00 33.76  ? 7   DA  P N7    1 
ATOM   7492 C  C5    . DA  E  2  3   ? 23.918  2.543   216.175 1.00 34.17  ? 7   DA  P C5    1 
ATOM   7493 C  C6    . DA  E  2  3   ? 23.557  2.668   217.529 1.00 35.70  ? 7   DA  P C6    1 
ATOM   7494 N  N6    . DA  E  2  3   ? 24.235  3.405   218.410 1.00 34.94  ? 7   DA  P N6    1 
ATOM   7495 N  N1    . DA  E  2  3   ? 22.464  1.995   217.954 1.00 36.63  ? 7   DA  P N1    1 
ATOM   7496 C  C2    . DA  E  2  3   ? 21.794  1.239   217.072 1.00 40.50  ? 7   DA  P C2    1 
ATOM   7497 N  N3    . DA  E  2  3   ? 22.034  1.047   215.773 1.00 37.42  ? 7   DA  P N3    1 
ATOM   7498 C  C4    . DA  E  2  3   ? 23.120  1.737   215.384 1.00 36.49  ? 7   DA  P C4    1 
ATOM   7499 P  P     . DC  E  2  4   ? 21.105  0.898   209.290 1.00 51.91  ? 8   DC  P P     1 
ATOM   7500 O  OP1   . DC  E  2  4   ? 20.571  0.065   208.212 1.00 51.60  ? 8   DC  P OP1   1 
ATOM   7501 O  OP2   . DC  E  2  4   ? 21.636  2.262   209.014 1.00 53.22  ? 8   DC  P OP2   1 
ATOM   7502 O  "O5'" . DC  E  2  4   ? 19.994  1.079   210.416 1.00 63.60  ? 8   DC  P "O5'" 1 
ATOM   7503 C  "C5'" . DC  E  2  4   ? 19.802  0.077   211.441 1.00 64.08  ? 8   DC  P "C5'" 1 
ATOM   7504 C  "C4'" . DC  E  2  4   ? 18.831  0.585   212.480 1.00 64.86  ? 8   DC  P "C4'" 1 
ATOM   7505 O  "O4'" . DC  E  2  4   ? 19.540  1.260   213.551 1.00 60.63  ? 8   DC  P "O4'" 1 
ATOM   7506 C  "C3'" . DC  E  2  4   ? 17.823  1.604   211.941 1.00 62.98  ? 8   DC  P "C3'" 1 
ATOM   7507 O  "O3'" . DC  E  2  4   ? 16.578  1.358   212.590 1.00 65.14  ? 8   DC  P "O3'" 1 
ATOM   7508 C  "C2'" . DC  E  2  4   ? 18.432  2.930   212.351 1.00 59.19  ? 8   DC  P "C2'" 1 
ATOM   7509 C  "C1'" . DC  E  2  4   ? 18.970  2.547   213.720 1.00 57.59  ? 8   DC  P "C1'" 1 
ATOM   7510 N  N1    . DC  E  2  4   ? 19.986  3.431   214.320 1.00 46.56  ? 8   DC  P N1    1 
ATOM   7511 C  C2    . DC  E  2  4   ? 19.947  3.633   215.696 1.00 41.91  ? 8   DC  P C2    1 
ATOM   7512 O  O2    . DC  E  2  4   ? 19.094  3.033   216.365 1.00 44.99  ? 8   DC  P O2    1 
ATOM   7513 N  N3    . DC  E  2  4   ? 20.853  4.455   216.272 1.00 42.83  ? 8   DC  P N3    1 
ATOM   7514 C  C4    . DC  E  2  4   ? 21.766  5.072   215.519 1.00 37.32  ? 8   DC  P C4    1 
ATOM   7515 N  N4    . DC  E  2  4   ? 22.650  5.857   216.129 1.00 33.29  ? 8   DC  P N4    1 
ATOM   7516 C  C5    . DC  E  2  4   ? 21.816  4.900   214.107 1.00 39.69  ? 8   DC  P C5    1 
ATOM   7517 C  C6    . DC  E  2  4   ? 20.916  4.078   213.553 1.00 42.16  ? 8   DC  P C6    1 
ATOM   7518 P  P     . DA  E  2  5   ? 15.212  1.990   212.031 1.00 74.15  ? 9   DA  P P     1 
ATOM   7519 O  OP1   . DA  E  2  5   ? 14.347  0.861   211.615 1.00 70.25  ? 9   DA  P OP1   1 
ATOM   7520 O  OP2   . DA  E  2  5   ? 15.529  3.112   211.073 1.00 60.52  ? 9   DA  P OP2   1 
ATOM   7521 O  "O5'" . DA  E  2  5   ? 14.578  2.613   213.349 1.00 60.15  ? 9   DA  P "O5'" 1 
ATOM   7522 C  "C5'" . DA  E  2  5   ? 14.574  1.872   214.582 1.00 64.46  ? 9   DA  P "C5'" 1 
ATOM   7523 C  "C4'" . DA  E  2  5   ? 14.426  2.825   215.741 1.00 60.86  ? 9   DA  P "C4'" 1 
ATOM   7524 O  "O4'" . DA  E  2  5   ? 15.693  3.471   215.991 1.00 55.55  ? 9   DA  P "O4'" 1 
ATOM   7525 C  "C3'" . DA  E  2  5   ? 13.409  3.941   215.487 1.00 58.33  ? 9   DA  P "C3'" 1 
ATOM   7526 O  "O3'" . DA  E  2  5   ? 12.381  3.897   216.465 1.00 63.94  ? 9   DA  P "O3'" 1 
ATOM   7527 C  "C2'" . DA  E  2  5   ? 14.214  5.225   215.574 1.00 53.52  ? 9   DA  P "C2'" 1 
ATOM   7528 C  "C1'" . DA  E  2  5   ? 15.461  4.824   216.324 1.00 52.50  ? 9   DA  P "C1'" 1 
ATOM   7529 N  N9    . DA  E  2  5   ? 16.623  5.590   215.896 1.00 45.45  ? 9   DA  P N9    1 
ATOM   7530 C  C8    . DA  E  2  5   ? 17.140  5.697   214.630 1.00 46.54  ? 9   DA  P C8    1 
ATOM   7531 N  N7    . DA  E  2  5   ? 18.175  6.497   214.549 1.00 48.75  ? 9   DA  P N7    1 
ATOM   7532 C  C5    . DA  E  2  5   ? 18.359  6.935   215.852 1.00 44.08  ? 9   DA  P C5    1 
ATOM   7533 C  C6    . DA  E  2  5   ? 19.310  7.788   216.437 1.00 42.27  ? 9   DA  P C6    1 
ATOM   7534 N  N6    . DA  E  2  5   ? 20.286  8.386   215.751 1.00 40.87  ? 9   DA  P N6    1 
ATOM   7535 N  N1    . DA  E  2  5   ? 19.211  8.022   217.765 1.00 40.04  ? 9   DA  P N1    1 
ATOM   7536 C  C2    . DA  E  2  5   ? 18.228  7.425   218.450 1.00 38.34  ? 9   DA  P C2    1 
ATOM   7537 N  N3    . DA  E  2  5   ? 17.274  6.605   218.010 1.00 40.04  ? 9   DA  P N3    1 
ATOM   7538 C  C4    . DA  E  2  5   ? 17.407  6.388   216.691 1.00 40.44  ? 9   DA  P C4    1 
ATOM   7539 P  P     . DT  E  2  6   ? 11.165  4.904   216.361 1.00 65.06  ? 10  DT  P P     1 
ATOM   7540 O  OP1   . DT  E  2  6   ? 9.929   4.141   216.622 1.00 68.43  ? 10  DT  P OP1   1 
ATOM   7541 O  OP2   . DT  E  2  6   ? 11.302  5.714   215.124 1.00 56.72  ? 10  DT  P OP2   1 
ATOM   7542 O  "O5'" . DT  E  2  6   ? 11.485  5.940   217.527 1.00 58.92  ? 10  DT  P "O5'" 1 
ATOM   7543 C  "C5'" . DT  E  2  6   ? 11.923  5.505   218.829 1.00 49.08  ? 10  DT  P "C5'" 1 
ATOM   7544 C  "C4'" . DT  E  2  6   ? 12.248  6.714   219.675 1.00 46.20  ? 10  DT  P "C4'" 1 
ATOM   7545 O  "O4'" . DT  E  2  6   ? 13.523  7.260   219.261 1.00 41.01  ? 10  DT  P "O4'" 1 
ATOM   7546 C  "C3'" . DT  E  2  6   ? 11.229  7.860   219.579 1.00 41.57  ? 10  DT  P "C3'" 1 
ATOM   7547 O  "O3'" . DT  E  2  6   ? 10.727  8.105   220.898 1.00 37.42  ? 10  DT  P "O3'" 1 
ATOM   7548 C  "C2'" . DT  E  2  6   ? 12.003  8.994   218.911 1.00 41.86  ? 10  DT  P "C2'" 1 
ATOM   7549 C  "C1'" . DT  E  2  6   ? 13.450  8.670   219.241 1.00 40.86  ? 10  DT  P "C1'" 1 
ATOM   7550 N  N1    . DT  E  2  6   ? 14.455  9.144   218.270 1.00 37.99  ? 10  DT  P N1    1 
ATOM   7551 C  C2    . DT  E  2  6   ? 15.532  9.866   218.739 1.00 35.71  ? 10  DT  P C2    1 
ATOM   7552 O  O2    . DT  E  2  6   ? 15.654  10.203  219.903 1.00 34.07  ? 10  DT  P O2    1 
ATOM   7553 N  N3    . DT  E  2  6   ? 16.441  10.227  217.777 1.00 35.31  ? 10  DT  P N3    1 
ATOM   7554 C  C4    . DT  E  2  6   ? 16.398  9.919   216.432 1.00 37.50  ? 10  DT  P C4    1 
ATOM   7555 O  O4    . DT  E  2  6   ? 17.300  10.299  215.693 1.00 39.04  ? 10  DT  P O4    1 
ATOM   7556 C  C5    . DT  E  2  6   ? 15.247  9.146   216.010 1.00 37.16  ? 10  DT  P C5    1 
ATOM   7557 C  C7    . DT  E  2  6   ? 15.113  8.767   214.569 1.00 36.54  ? 10  DT  P C7    1 
ATOM   7558 C  C6    . DT  E  2  6   ? 14.347  8.802   216.939 1.00 34.30  ? 10  DT  P C6    1 
ATOM   7559 P  P     . DA  E  2  7   ? 9.569   9.169   221.161 1.00 35.04  ? 11  DA  P P     1 
ATOM   7560 O  OP1   . DA  E  2  7   ? 9.030   8.950   222.526 1.00 32.63  ? 11  DA  P OP1   1 
ATOM   7561 O  OP2   . DA  E  2  7   ? 8.647   9.186   220.011 1.00 34.95  ? 11  DA  P OP2   1 
ATOM   7562 O  "O5'" . DA  E  2  7   ? 10.385  10.529  221.235 1.00 32.96  ? 11  DA  P "O5'" 1 
ATOM   7563 C  "C5'" . DA  E  2  7   ? 11.311  10.736  222.324 1.00 34.86  ? 11  DA  P "C5'" 1 
ATOM   7564 C  "C4'" . DA  E  2  7   ? 11.966  12.090  222.204 1.00 34.58  ? 11  DA  P "C4'" 1 
ATOM   7565 O  "O4'" . DA  E  2  7   ? 12.977  12.038  221.182 1.00 34.81  ? 11  DA  P "O4'" 1 
ATOM   7566 C  "C3'" . DA  E  2  7   ? 11.029  13.231  221.797 1.00 34.95  ? 11  DA  P "C3'" 1 
ATOM   7567 O  "O3'" . DA  E  2  7   ? 10.602  13.934  222.973 1.00 35.18  ? 11  DA  P "O3'" 1 
ATOM   7568 C  "C2'" . DA  E  2  7   ? 11.852  14.053  220.809 1.00 34.82  ? 11  DA  P "C2'" 1 
ATOM   7569 C  "C1'" . DA  E  2  7   ? 13.206  13.361  220.746 1.00 34.46  ? 11  DA  P "C1'" 1 
ATOM   7570 N  N9    . DA  E  2  7   ? 13.788  13.294  219.408 1.00 31.73  ? 11  DA  P N9    1 
ATOM   7571 C  C8    . DA  E  2  7   ? 13.285  12.646  218.305 1.00 32.89  ? 11  DA  P C8    1 
ATOM   7572 N  N7    . DA  E  2  7   ? 14.046  12.741  217.243 1.00 31.49  ? 11  DA  P N7    1 
ATOM   7573 C  C5    . DA  E  2  7   ? 15.131  13.487  217.678 1.00 32.37  ? 11  DA  P C5    1 
ATOM   7574 C  C6    . DA  E  2  7   ? 16.284  13.944  217.022 1.00 31.74  ? 11  DA  P C6    1 
ATOM   7575 N  N6    . DA  E  2  7   ? 16.546  13.700  215.741 1.00 29.35  ? 11  DA  P N6    1 
ATOM   7576 N  N1    . DA  E  2  7   ? 17.176  14.661  217.742 1.00 31.07  ? 11  DA  P N1    1 
ATOM   7577 C  C2    . DA  E  2  7   ? 16.897  14.926  219.027 1.00 35.63  ? 11  DA  P C2    1 
ATOM   7578 N  N3    . DA  E  2  7   ? 15.852  14.540  219.759 1.00 32.52  ? 11  DA  P N3    1 
ATOM   7579 C  C4    . DA  E  2  7   ? 14.993  13.821  219.014 1.00 32.33  ? 11  DA  P C4    1 
ATOM   7580 P  P     . DC  E  2  8   ? 9.557   15.136  222.864 1.00 35.65  ? 12  DC  P P     1 
ATOM   7581 O  OP1   . DC  E  2  8   ? 9.018   15.399  224.219 1.00 35.41  ? 12  DC  P OP1   1 
ATOM   7582 O  OP2   . DC  E  2  8   ? 8.621   14.835  221.774 1.00 36.20  ? 12  DC  P OP2   1 
ATOM   7583 O  "O5'" . DC  E  2  8   ? 10.511  16.346  222.456 1.00 36.24  ? 12  DC  P "O5'" 1 
ATOM   7584 C  "C5'" . DC  E  2  8   ? 11.538  16.798  223.356 1.00 35.31  ? 12  DC  P "C5'" 1 
ATOM   7585 C  "C4'" . DC  E  2  8   ? 12.430  17.821  222.693 1.00 37.16  ? 12  DC  P "C4'" 1 
ATOM   7586 O  "O4'" . DC  E  2  8   ? 13.198  17.203  221.638 1.00 38.65  ? 12  DC  P "O4'" 1 
ATOM   7587 C  "C3'" . DC  E  2  8   ? 11.678  18.961  222.014 1.00 39.37  ? 12  DC  P "C3'" 1 
ATOM   7588 O  "O3'" . DC  E  2  8   ? 11.550  20.117  222.845 1.00 40.28  ? 12  DC  P "O3'" 1 
ATOM   7589 C  "C2'" . DC  E  2  8   ? 12.546  19.311  220.818 1.00 39.22  ? 12  DC  P "C2'" 1 
ATOM   7590 C  "C1'" . DC  E  2  8   ? 13.571  18.196  220.707 1.00 37.70  ? 12  DC  P "C1'" 1 
ATOM   7591 N  N1    . DC  E  2  8   ? 13.588  17.586  219.373 1.00 36.47  ? 12  DC  P N1    1 
ATOM   7592 C  C2    . DC  E  2  8   ? 14.741  17.698  218.590 1.00 36.19  ? 12  DC  P C2    1 
ATOM   7593 O  O2    . DC  E  2  8   ? 15.741  18.254  219.068 1.00 34.13  ? 12  DC  P O2    1 
ATOM   7594 N  N3    . DC  E  2  8   ? 14.752  17.161  217.351 1.00 34.60  ? 12  DC  P N3    1 
ATOM   7595 C  C4    . DC  E  2  8   ? 13.664  16.549  216.882 1.00 34.45  ? 12  DC  P C4    1 
ATOM   7596 N  N4    . DC  E  2  8   ? 13.721  16.035  215.657 1.00 37.42  ? 12  DC  P N4    1 
ATOM   7597 C  C5    . DC  E  2  8   ? 12.462  16.460  217.641 1.00 33.61  ? 12  DC  P C5    1 
ATOM   7598 C  C6    . DC  E  2  8   ? 12.465  16.994  218.866 1.00 33.16  ? 12  DC  P C6    1 
ATOM   7599 P  P     . DC  E  2  9   ? 10.532  21.269  222.408 1.00 46.63  ? 13  DC  P P     1 
ATOM   7600 O  OP1   . DC  E  2  9   ? 10.218  22.075  223.603 1.00 46.75  ? 13  DC  P OP1   1 
ATOM   7601 O  OP2   . DC  E  2  9   ? 9.432   20.655  221.620 1.00 41.30  ? 13  DC  P OP2   1 
ATOM   7602 O  "O5'" . DC  E  2  9   ? 11.382  22.156  221.377 1.00 43.67  ? 13  DC  P "O5'" 1 
ATOM   7603 C  "C5'" . DC  E  2  9   ? 12.578  22.857  221.779 1.00 41.22  ? 13  DC  P "C5'" 1 
ATOM   7604 C  "C4'" . DC  E  2  9   ? 13.260  23.483  220.581 1.00 41.50  ? 13  DC  P "C4'" 1 
ATOM   7605 O  "O4'" . DC  E  2  9   ? 13.459  22.489  219.546 1.00 40.03  ? 13  DC  P "O4'" 1 
ATOM   7606 C  "C3'" . DC  E  2  9   ? 12.498  24.640  219.920 1.00 44.08  ? 13  DC  P "C3'" 1 
ATOM   7607 O  "O3'" . DC  E  2  9   ? 13.356  25.775  219.680 1.00 44.67  ? 13  DC  P "O3'" 1 
ATOM   7608 C  "C2'" . DC  E  2  9   ? 11.969  24.037  218.629 1.00 40.47  ? 13  DC  P "C2'" 1 
ATOM   7609 C  "C1'" . DC  E  2  9   ? 13.028  23.011  218.302 1.00 40.03  ? 13  DC  P "C1'" 1 
ATOM   7610 N  N1    . DC  E  2  9   ? 12.598  21.877  217.464 1.00 36.98  ? 13  DC  P N1    1 
ATOM   7611 C  C2    . DC  E  2  9   ? 13.251  21.666  216.248 1.00 38.67  ? 13  DC  P C2    1 
ATOM   7612 O  O2    . DC  E  2  9   ? 14.124  22.469  215.892 1.00 37.44  ? 13  DC  P O2    1 
ATOM   7613 N  N3    . DC  E  2  9   ? 12.885  20.619  215.469 1.00 37.61  ? 13  DC  P N3    1 
ATOM   7614 C  C4    . DC  E  2  9   ? 11.917  19.794  215.875 1.00 38.15  ? 13  DC  P C4    1 
ATOM   7615 N  N4    . DC  E  2  9   ? 11.593  18.773  215.080 1.00 36.53  ? 13  DC  P N4    1 
ATOM   7616 C  C5    . DC  E  2  9   ? 11.230  19.988  217.113 1.00 36.60  ? 13  DC  P C5    1 
ATOM   7617 C  C6    . DC  E  2  9   ? 11.598  21.035  217.866 1.00 35.39  ? 13  DC  P C6    1 
ATOM   7618 P  P     . DT  F  3  1   ? 0.720   19.140  190.941 1.00 103.51 ? 2   DT  T P     1 
ATOM   7619 O  OP1   . DT  F  3  1   ? 0.092   19.573  192.223 1.00 84.34  ? 2   DT  T OP1   1 
ATOM   7620 O  OP2   . DT  F  3  1   ? 0.848   20.102  189.805 1.00 93.04  ? 2   DT  T OP2   1 
ATOM   7621 O  "O5'" . DT  F  3  1   ? 2.101   18.417  191.283 1.00 73.13  ? 2   DT  T "O5'" 1 
ATOM   7622 C  "C5'" . DT  F  3  1   ? 3.145   18.189  190.308 1.00 57.96  ? 2   DT  T "C5'" 1 
ATOM   7623 C  "C4'" . DT  F  3  1   ? 4.467   17.980  191.015 1.00 51.00  ? 2   DT  T "C4'" 1 
ATOM   7624 O  "O4'" . DT  F  3  1   ? 5.149   19.248  191.192 1.00 41.96  ? 2   DT  T "O4'" 1 
ATOM   7625 C  "C3'" . DT  F  3  1   ? 4.376   17.384  192.418 1.00 44.88  ? 2   DT  T "C3'" 1 
ATOM   7626 O  "O3'" . DT  F  3  1   ? 5.592   16.635  192.601 1.00 47.81  ? 2   DT  T "O3'" 1 
ATOM   7627 C  "C2'" . DT  F  3  1   ? 4.254   18.626  193.291 1.00 43.70  ? 2   DT  T "C2'" 1 
ATOM   7628 C  "C1'" . DT  F  3  1   ? 5.170   19.620  192.571 1.00 39.74  ? 2   DT  T "C1'" 1 
ATOM   7629 N  N1    . DT  F  3  1   ? 4.852   21.057  192.628 1.00 35.55  ? 2   DT  T N1    1 
ATOM   7630 C  C2    . DT  F  3  1   ? 5.899   21.932  192.803 1.00 34.09  ? 2   DT  T C2    1 
ATOM   7631 O  O2    . DT  F  3  1   ? 7.036   21.567  193.028 1.00 32.62  ? 2   DT  T O2    1 
ATOM   7632 N  N3    . DT  F  3  1   ? 5.557   23.261  192.718 1.00 34.13  ? 2   DT  T N3    1 
ATOM   7633 C  C4    . DT  F  3  1   ? 4.307   23.785  192.434 1.00 32.98  ? 2   DT  T C4    1 
ATOM   7634 O  O4    . DT  F  3  1   ? 4.155   25.001  192.355 1.00 33.85  ? 2   DT  T O4    1 
ATOM   7635 C  C5    . DT  F  3  1   ? 3.258   22.808  192.250 1.00 32.84  ? 2   DT  T C5    1 
ATOM   7636 C  C7    . DT  F  3  1   ? 1.867   23.280  191.959 1.00 32.59  ? 2   DT  T C7    1 
ATOM   7637 C  C6    . DT  F  3  1   ? 3.584   21.511  192.328 1.00 35.65  ? 2   DT  T C6    1 
ATOM   7638 P  P     . DA  F  3  2   ? 5.763   15.582  193.813 1.00 43.13  ? 3   DA  T P     1 
ATOM   7639 O  OP1   . DA  F  3  2   ? 6.937   14.715  193.514 1.00 41.89  ? 3   DA  T OP1   1 
ATOM   7640 O  OP2   . DA  F  3  2   ? 4.430   15.012  194.115 1.00 44.41  ? 3   DA  T OP2   1 
ATOM   7641 O  "O5'" . DA  F  3  2   ? 6.240   16.480  195.026 1.00 41.79  ? 3   DA  T "O5'" 1 
ATOM   7642 C  "C5'" . DA  F  3  2   ? 7.487   17.184  194.994 1.00 40.58  ? 3   DA  T "C5'" 1 
ATOM   7643 C  "C4'" . DA  F  3  2   ? 7.561   18.123  196.174 1.00 41.95  ? 3   DA  T "C4'" 1 
ATOM   7644 O  "O4'" . DA  F  3  2   ? 6.674   19.252  195.990 1.00 40.26  ? 3   DA  T "O4'" 1 
ATOM   7645 C  "C3'" . DA  F  3  2   ? 7.176   17.465  197.502 1.00 43.44  ? 3   DA  T "C3'" 1 
ATOM   7646 O  "O3'" . DA  F  3  2   ? 8.259   17.587  198.420 1.00 45.12  ? 3   DA  T "O3'" 1 
ATOM   7647 C  "C2'" . DA  F  3  2   ? 5.923   18.190  197.961 1.00 43.93  ? 3   DA  T "C2'" 1 
ATOM   7648 C  "C1'" . DA  F  3  2   ? 5.907   19.484  197.166 1.00 42.72  ? 3   DA  T "C1'" 1 
ATOM   7649 N  N9    . DA  F  3  2   ? 4.579   19.947  196.755 1.00 38.03  ? 3   DA  T N9    1 
ATOM   7650 C  C8    . DA  F  3  2   ? 3.393   19.255  196.685 1.00 35.69  ? 3   DA  T C8    1 
ATOM   7651 N  N7    . DA  F  3  2   ? 2.382   19.982  196.276 1.00 36.45  ? 3   DA  T N7    1 
ATOM   7652 C  C5    . DA  F  3  2   ? 2.938   21.236  196.065 1.00 34.77  ? 3   DA  T C5    1 
ATOM   7653 C  C6    . DA  F  3  2   ? 2.389   22.449  195.617 1.00 39.14  ? 3   DA  T C6    1 
ATOM   7654 N  N6    . DA  F  3  2   ? 1.105   22.601  195.290 1.00 40.08  ? 3   DA  T N6    1 
ATOM   7655 N  N1    . DA  F  3  2   ? 3.220   23.509  195.498 1.00 37.26  ? 3   DA  T N1    1 
ATOM   7656 C  C2    . DA  F  3  2   ? 4.512   23.352  195.822 1.00 35.04  ? 3   DA  T C2    1 
ATOM   7657 N  N3    . DA  F  3  2   ? 5.141   22.265  196.264 1.00 34.87  ? 3   DA  T N3    1 
ATOM   7658 C  C4    . DA  F  3  2   ? 4.292   21.225  196.344 1.00 34.79  ? 3   DA  T C4    1 
ATOM   7659 P  P     . DC  F  3  3   ? 8.882   16.272  199.109 1.00 44.40  ? 4   DC  T P     1 
ATOM   7660 O  OP1   . DC  F  3  3   ? 10.337  16.493  199.205 1.00 42.31  ? 4   DC  T OP1   1 
ATOM   7661 O  OP2   . DC  F  3  3   ? 8.360   15.055  198.460 1.00 41.56  ? 4   DC  T OP2   1 
ATOM   7662 O  "O5'" . DC  F  3  3   ? 8.153   16.267  200.529 1.00 44.31  ? 4   DC  T "O5'" 1 
ATOM   7663 C  "C5'" . DC  F  3  3   ? 8.112   17.471  201.298 1.00 36.28  ? 4   DC  T "C5'" 1 
ATOM   7664 C  "C4'" . DC  F  3  3   ? 8.266   17.175  202.769 1.00 35.12  ? 4   DC  T "C4'" 1 
ATOM   7665 O  "O4'" . DC  F  3  3   ? 6.968   16.893  203.324 1.00 33.24  ? 4   DC  T "O4'" 1 
ATOM   7666 C  "C3'" . DC  F  3  3   ? 9.159   15.997  203.146 1.00 33.31  ? 4   DC  T "C3'" 1 
ATOM   7667 O  "O3'" . DC  F  3  3   ? 9.804   16.411  204.329 1.00 30.39  ? 4   DC  T "O3'" 1 
ATOM   7668 C  "C2'" . DC  F  3  3   ? 8.186   14.889  203.488 1.00 33.57  ? 4   DC  T "C2'" 1 
ATOM   7669 C  "C1'" . DC  F  3  3   ? 6.961   15.643  203.980 1.00 36.70  ? 4   DC  T "C1'" 1 
ATOM   7670 N  N1    . DC  F  3  3   ? 5.677   15.017  203.661 1.00 41.05  ? 4   DC  T N1    1 
ATOM   7671 C  C2    . DC  F  3  3   ? 4.713   14.882  204.663 1.00 43.14  ? 4   DC  T C2    1 
ATOM   7672 O  O2    . DC  F  3  3   ? 5.003   15.207  205.824 1.00 38.66  ? 4   DC  T O2    1 
ATOM   7673 N  N3    . DC  F  3  3   ? 3.503   14.369  204.346 1.00 47.20  ? 4   DC  T N3    1 
ATOM   7674 C  C4    . DC  F  3  3   ? 3.231   14.031  203.083 1.00 48.94  ? 4   DC  T C4    1 
ATOM   7675 N  N4    . DC  F  3  3   ? 2.026   13.528  202.813 1.00 49.06  ? 4   DC  T N4    1 
ATOM   7676 C  C5    . DC  F  3  3   ? 4.189   14.182  202.040 1.00 48.26  ? 4   DC  T C5    1 
ATOM   7677 C  C6    . DC  F  3  3   ? 5.379   14.696  202.367 1.00 44.25  ? 4   DC  T C6    1 
ATOM   7678 P  P     . DT  F  3  4   ? 11.264  15.947  204.702 1.00 32.25  ? 5   DT  T P     1 
ATOM   7679 O  OP1   . DT  F  3  4   ? 11.945  15.411  203.501 1.00 29.53  ? 5   DT  T OP1   1 
ATOM   7680 O  OP2   . DT  F  3  4   ? 11.187  15.134  205.937 1.00 31.68  ? 5   DT  T OP2   1 
ATOM   7681 O  "O5'" . DT  F  3  4   ? 11.926  17.317  205.143 1.00 31.12  ? 5   DT  T "O5'" 1 
ATOM   7682 C  "C5'" . DT  F  3  4   ? 11.915  18.443  204.242 1.00 30.03  ? 5   DT  T "C5'" 1 
ATOM   7683 C  "C4'" . DT  F  3  4   ? 12.931  19.448  204.719 1.00 30.60  ? 5   DT  T "C4'" 1 
ATOM   7684 O  "O4'" . DT  F  3  4   ? 12.441  20.074  205.926 1.00 30.55  ? 5   DT  T "O4'" 1 
ATOM   7685 C  "C3'" . DT  F  3  4   ? 14.297  18.849  205.061 1.00 29.68  ? 5   DT  T "C3'" 1 
ATOM   7686 O  "O3'" . DT  F  3  4   ? 15.298  19.731  204.567 1.00 30.19  ? 5   DT  T "O3'" 1 
ATOM   7687 C  "C2'" . DT  F  3  4   ? 14.311  18.784  206.578 1.00 29.02  ? 5   DT  T "C2'" 1 
ATOM   7688 C  "C1'" . DT  F  3  4   ? 13.347  19.890  207.010 1.00 28.83  ? 5   DT  T "C1'" 1 
ATOM   7689 N  N1    . DT  F  3  4   ? 12.532  19.617  208.214 1.00 29.26  ? 5   DT  T N1    1 
ATOM   7690 C  C2    . DT  F  3  4   ? 12.475  20.556  209.221 1.00 29.32  ? 5   DT  T C2    1 
ATOM   7691 O  O2    . DT  F  3  4   ? 13.107  21.596  209.203 1.00 28.34  ? 5   DT  T O2    1 
ATOM   7692 N  N3    . DT  F  3  4   ? 11.656  20.222  210.269 1.00 30.78  ? 5   DT  T N3    1 
ATOM   7693 C  C4    . DT  F  3  4   ? 10.892  19.079  210.402 1.00 33.01  ? 5   DT  T C4    1 
ATOM   7694 O  O4    . DT  F  3  4   ? 10.168  18.941  211.387 1.00 34.33  ? 5   DT  T O4    1 
ATOM   7695 C  C5    . DT  F  3  4   ? 10.985  18.145  209.305 1.00 31.36  ? 5   DT  T C5    1 
ATOM   7696 C  C7    . DT  F  3  4   ? 10.180  16.883  209.351 1.00 31.14  ? 5   DT  T C7    1 
ATOM   7697 C  C6    . DT  F  3  4   ? 11.770  18.469  208.268 1.00 29.92  ? 5   DT  T C6    1 
ATOM   7698 P  P     . DG  F  3  5   ? 16.842  19.280  204.519 1.00 31.26  ? 6   DG  T P     1 
ATOM   7699 O  OP1   . DG  F  3  5   ? 17.461  19.993  203.398 1.00 33.14  ? 6   DG  T OP1   1 
ATOM   7700 O  OP2   . DG  F  3  5   ? 16.930  17.803  204.551 1.00 30.43  ? 6   DG  T OP2   1 
ATOM   7701 O  "O5'" . DG  F  3  5   ? 17.440  19.847  205.870 1.00 31.59  ? 6   DG  T "O5'" 1 
ATOM   7702 C  "C5'" . DG  F  3  5   ? 17.640  21.260  206.022 1.00 31.06  ? 6   DG  T "C5'" 1 
ATOM   7703 C  "C4'" . DG  F  3  5   ? 18.249  21.523  207.372 1.00 31.32  ? 6   DG  T "C4'" 1 
ATOM   7704 O  "O4'" . DG  F  3  5   ? 17.260  21.218  208.380 1.00 33.71  ? 6   DG  T "O4'" 1 
ATOM   7705 C  "C3'" . DG  F  3  5   ? 19.469  20.657  207.706 1.00 32.62  ? 6   DG  T "C3'" 1 
ATOM   7706 O  "O3'" . DG  F  3  5   ? 20.382  21.496  208.413 1.00 30.34  ? 6   DG  T "O3'" 1 
ATOM   7707 C  "C2'" . DG  F  3  5   ? 18.906  19.582  208.619 1.00 32.27  ? 6   DG  T "C2'" 1 
ATOM   7708 C  "C1'" . DG  F  3  5   ? 17.850  20.382  209.361 1.00 31.89  ? 6   DG  T "C1'" 1 
ATOM   7709 N  N9    . DG  F  3  5   ? 16.775  19.631  209.981 1.00 30.68  ? 6   DG  T N9    1 
ATOM   7710 C  C8    . DG  F  3  5   ? 16.204  18.451  209.568 1.00 32.16  ? 6   DG  T C8    1 
ATOM   7711 N  N7    . DG  F  3  5   ? 15.200  18.079  210.315 1.00 30.35  ? 6   DG  T N7    1 
ATOM   7712 C  C5    . DG  F  3  5   ? 15.099  19.077  211.273 1.00 33.85  ? 6   DG  T C5    1 
ATOM   7713 C  C6    . DG  F  3  5   ? 14.219  19.206  212.375 1.00 36.04  ? 6   DG  T C6    1 
ATOM   7714 O  O6    . DG  F  3  5   ? 13.309  18.449  212.727 1.00 34.54  ? 6   DG  T O6    1 
ATOM   7715 N  N1    . DG  F  3  5   ? 14.476  20.366  213.100 1.00 36.88  ? 6   DG  T N1    1 
ATOM   7716 C  C2    . DG  F  3  5   ? 15.453  21.287  212.797 1.00 40.38  ? 6   DG  T C2    1 
ATOM   7717 N  N2    . DG  F  3  5   ? 15.551  22.345  213.612 1.00 40.92  ? 6   DG  T N2    1 
ATOM   7718 N  N3    . DG  F  3  5   ? 16.276  21.176  211.772 1.00 33.10  ? 6   DG  T N3    1 
ATOM   7719 C  C4    . DG  F  3  5   ? 16.058  20.048  211.070 1.00 33.25  ? 6   DG  T C4    1 
ATOM   7720 P  P     . DG  F  3  6   ? 21.833  21.003  208.767 1.00 38.26  ? 7   DG  T P     1 
ATOM   7721 O  OP1   . DG  F  3  6   ? 22.763  22.049  208.352 1.00 33.88  ? 7   DG  T OP1   1 
ATOM   7722 O  OP2   . DG  F  3  6   ? 21.990  19.590  208.330 1.00 34.79  ? 7   DG  T OP2   1 
ATOM   7723 O  "O5'" . DG  F  3  6   ? 21.831  20.919  210.364 1.00 37.31  ? 7   DG  T "O5'" 1 
ATOM   7724 C  "C5'" . DG  F  3  6   ? 21.793  22.137  211.146 1.00 38.56  ? 7   DG  T "C5'" 1 
ATOM   7725 C  "C4'" . DG  F  3  6   ? 22.138  21.882  212.592 1.00 40.01  ? 7   DG  T "C4'" 1 
ATOM   7726 O  "O4'" . DG  F  3  6   ? 20.995  21.302  213.261 1.00 41.45  ? 7   DG  T "O4'" 1 
ATOM   7727 C  "C3'" . DG  F  3  6   ? 23.305  20.927  212.839 1.00 39.57  ? 7   DG  T "C3'" 1 
ATOM   7728 O  "O3'" . DG  F  3  6   ? 24.069  21.455  213.925 1.00 43.82  ? 7   DG  T "O3'" 1 
ATOM   7729 C  "C2'" . DG  F  3  6   ? 22.620  19.601  213.101 1.00 39.95  ? 7   DG  T "C2'" 1 
ATOM   7730 C  "C1'" . DG  F  3  6   ? 21.303  20.016  213.748 1.00 40.25  ? 7   DG  T "C1'" 1 
ATOM   7731 N  N9    . DG  F  3  6   ? 20.148  19.161  213.493 1.00 43.42  ? 7   DG  T N9    1 
ATOM   7732 C  C8    . DG  F  3  6   ? 19.788  18.535  212.324 1.00 44.39  ? 7   DG  T C8    1 
ATOM   7733 N  N7    . DG  F  3  6   ? 18.677  17.856  212.428 1.00 41.01  ? 7   DG  T N7    1 
ATOM   7734 C  C5    . DG  F  3  6   ? 18.284  18.042  213.745 1.00 42.14  ? 7   DG  T C5    1 
ATOM   7735 C  C6    . DG  F  3  6   ? 17.162  17.531  214.457 1.00 42.88  ? 7   DG  T C6    1 
ATOM   7736 O  O6    . DG  F  3  6   ? 16.260  16.794  214.050 1.00 37.75  ? 7   DG  T O6    1 
ATOM   7737 N  N1    . DG  F  3  6   ? 17.142  17.985  215.772 1.00 47.05  ? 7   DG  T N1    1 
ATOM   7738 C  C2    . DG  F  3  6   ? 18.088  18.806  216.339 1.00 52.03  ? 7   DG  T C2    1 
ATOM   7739 N  N2    . DG  F  3  6   ? 17.903  19.131  217.629 1.00 54.28  ? 7   DG  T N2    1 
ATOM   7740 N  N3    . DG  F  3  6   ? 19.143  19.274  215.693 1.00 47.73  ? 7   DG  T N3    1 
ATOM   7741 C  C4    . DG  F  3  6   ? 19.177  18.855  214.412 1.00 45.88  ? 7   DG  T C4    1 
ATOM   7742 P  P     . DT  F  3  7   ? 25.306  20.651  214.502 1.00 48.71  ? 8   DT  T P     1 
ATOM   7743 O  OP1   . DT  F  3  7   ? 26.270  21.615  215.093 1.00 42.93  ? 8   DT  T OP1   1 
ATOM   7744 O  OP2   . DT  F  3  7   ? 25.731  19.671  213.482 1.00 54.92  ? 8   DT  T OP2   1 
ATOM   7745 O  "O5'" . DT  F  3  7   ? 24.685  19.871  215.742 1.00 52.27  ? 8   DT  T "O5'" 1 
ATOM   7746 C  "C5'" . DT  F  3  7   ? 24.154  20.604  216.865 1.00 50.11  ? 8   DT  T "C5'" 1 
ATOM   7747 C  "C4'" . DT  F  3  7   ? 23.685  19.652  217.940 1.00 48.51  ? 8   DT  T "C4'" 1 
ATOM   7748 O  "O4'" . DT  F  3  7   ? 22.461  19.007  217.513 1.00 47.20  ? 8   DT  T "O4'" 1 
ATOM   7749 C  "C3'" . DT  F  3  7   ? 24.678  18.537  218.287 1.00 48.73  ? 8   DT  T "C3'" 1 
ATOM   7750 O  "O3'" . DT  F  3  7   ? 25.133  18.708  219.642 1.00 48.91  ? 8   DT  T "O3'" 1 
ATOM   7751 C  "C2'" . DT  F  3  7   ? 23.923  17.251  217.974 1.00 47.91  ? 8   DT  T "C2'" 1 
ATOM   7752 C  "C1'" . DT  F  3  7   ? 22.461  17.677  217.955 1.00 45.69  ? 8   DT  T "C1'" 1 
ATOM   7753 N  N1    . DT  F  3  7   ? 21.562  16.897  217.069 1.00 45.02  ? 8   DT  T N1    1 
ATOM   7754 C  C2    . DT  F  3  7   ? 20.372  16.442  217.598 1.00 45.87  ? 8   DT  T C2    1 
ATOM   7755 O  O2    . DT  F  3  7   ? 20.021  16.663  218.744 1.00 44.96  ? 8   DT  T O2    1 
ATOM   7756 N  N3    . DT  F  3  7   ? 19.594  15.724  216.724 1.00 42.54  ? 8   DT  T N3    1 
ATOM   7757 C  C4    . DT  F  3  7   ? 19.885  15.410  215.409 1.00 42.18  ? 8   DT  T C4    1 
ATOM   7758 O  O4    . DT  F  3  7   ? 19.087  14.749  214.749 1.00 39.12  ? 8   DT  T O4    1 
ATOM   7759 C  C5    . DT  F  3  7   ? 21.147  15.921  214.916 1.00 41.80  ? 8   DT  T C5    1 
ATOM   7760 C  C7    . DT  F  3  7   ? 21.551  15.624  213.506 1.00 41.41  ? 8   DT  T C7    1 
ATOM   7761 C  C6    . DT  F  3  7   ? 21.915  16.623  215.762 1.00 43.86  ? 8   DT  T C6    1 
ATOM   7762 P  P     . DA  F  3  8   ? 26.047  17.591  220.352 1.00 53.31  ? 9   DA  T P     1 
ATOM   7763 O  OP1   . DA  F  3  8   ? 27.010  18.280  221.238 1.00 59.52  ? 9   DA  T OP1   1 
ATOM   7764 O  OP2   . DA  F  3  8   ? 26.565  16.651  219.339 1.00 52.02  ? 9   DA  T OP2   1 
ATOM   7765 O  "O5'" . DA  F  3  8   ? 24.995  16.782  221.239 1.00 51.66  ? 9   DA  T "O5'" 1 
ATOM   7766 C  "C5'" . DA  F  3  8   ? 23.904  17.445  221.907 1.00 47.53  ? 9   DA  T "C5'" 1 
ATOM   7767 C  "C4'" . DA  F  3  8   ? 22.986  16.421  222.531 1.00 46.27  ? 9   DA  T "C4'" 1 
ATOM   7768 O  "O4'" . DA  F  3  8   ? 22.076  15.912  221.523 1.00 44.13  ? 9   DA  T "O4'" 1 
ATOM   7769 C  "C3'" . DA  F  3  8   ? 23.699  15.207  223.137 1.00 46.93  ? 9   DA  T "C3'" 1 
ATOM   7770 O  "O3'" . DA  F  3  8   ? 23.255  15.064  224.493 1.00 51.25  ? 9   DA  T "O3'" 1 
ATOM   7771 C  "C2'" . DA  F  3  8   ? 23.345  14.069  222.191 1.00 46.64  ? 9   DA  T "C2'" 1 
ATOM   7772 C  "C1'" . DA  F  3  8   ? 21.997  14.505  221.633 1.00 45.70  ? 9   DA  T "C1'" 1 
ATOM   7773 N  N9    . DA  F  3  8   ? 21.681  13.955  220.312 1.00 42.93  ? 9   DA  T N9    1 
ATOM   7774 C  C8    . DA  F  3  8   ? 22.490  13.947  219.203 1.00 39.99  ? 9   DA  T C8    1 
ATOM   7775 N  N7    . DA  F  3  8   ? 21.960  13.343  218.168 1.00 39.21  ? 9   DA  T N7    1 
ATOM   7776 C  C5    . DA  F  3  8   ? 20.715  12.932  218.622 1.00 38.38  ? 9   DA  T C5    1 
ATOM   7777 C  C6    . DA  F  3  8   ? 19.664  12.226  218.002 1.00 38.66  ? 9   DA  T C6    1 
ATOM   7778 N  N6    . DA  F  3  8   ? 19.695  11.811  216.732 1.00 36.93  ? 9   DA  T N6    1 
ATOM   7779 N  N1    . DA  F  3  8   ? 18.562  11.965  218.740 1.00 38.87  ? 9   DA  T N1    1 
ATOM   7780 C  C2    . DA  F  3  8   ? 18.537  12.367  220.018 1.00 38.59  ? 9   DA  T C2    1 
ATOM   7781 N  N3    . DA  F  3  8   ? 19.461  13.028  220.711 1.00 40.19  ? 9   DA  T N3    1 
ATOM   7782 C  C4    . DA  F  3  8   ? 20.539  13.282  219.948 1.00 37.61  ? 9   DA  T C4    1 
ATOM   7783 P  P     . DT  F  3  9   ? 23.879  13.956  225.474 1.00 52.09  ? 10  DT  T P     1 
ATOM   7784 O  OP1   . DT  F  3  9   ? 23.671  14.420  226.863 1.00 56.06  ? 10  DT  T OP1   1 
ATOM   7785 O  OP2   . DT  F  3  9   ? 25.251  13.608  225.032 1.00 51.45  ? 10  DT  T OP2   1 
ATOM   7786 O  "O5'" . DT  F  3  9   ? 22.925  12.709  225.215 1.00 52.40  ? 10  DT  T "O5'" 1 
ATOM   7787 C  "C5'" . DT  F  3  9   ? 21.497  12.874  225.300 1.00 53.69  ? 10  DT  T "C5'" 1 
ATOM   7788 C  "C4'" . DT  F  3  9   ? 20.791  11.592  224.933 1.00 53.21  ? 10  DT  T "C4'" 1 
ATOM   7789 O  "O4'" . DT  F  3  9   ? 20.706  11.456  223.492 1.00 52.86  ? 10  DT  T "O4'" 1 
ATOM   7790 C  "C3'" . DT  F  3  9   ? 21.466  10.307  225.429 1.00 56.72  ? 10  DT  T "C3'" 1 
ATOM   7791 O  "O3'" . DT  F  3  9   ? 20.417  9.392   225.743 1.00 67.28  ? 10  DT  T "O3'" 1 
ATOM   7792 C  "C2'" . DT  F  3  9   ? 22.148  9.779   224.182 1.00 54.23  ? 10  DT  T "C2'" 1 
ATOM   7793 C  "C1'" . DT  F  3  9   ? 21.069  10.124  223.173 1.00 51.56  ? 10  DT  T "C1'" 1 
ATOM   7794 N  N1    . DT  F  3  9   ? 21.407  10.049  221.735 1.00 47.13  ? 10  DT  T N1    1 
ATOM   7795 C  C2    . DT  F  3  9   ? 20.453  9.529   220.885 1.00 45.89  ? 10  DT  T C2    1 
ATOM   7796 O  O2    . DT  F  3  9   ? 19.350  9.172   221.259 1.00 49.37  ? 10  DT  T O2    1 
ATOM   7797 N  N3    . DT  F  3  9   ? 20.835  9.458   219.571 1.00 44.67  ? 10  DT  T N3    1 
ATOM   7798 C  C4    . DT  F  3  9   ? 22.047  9.832   219.034 1.00 41.71  ? 10  DT  T C4    1 
ATOM   7799 O  O4    . DT  F  3  9   ? 22.243  9.703   217.835 1.00 41.55  ? 10  DT  T O4    1 
ATOM   7800 C  C5    . DT  F  3  9   ? 23.009  10.355  219.983 1.00 45.81  ? 10  DT  T C5    1 
ATOM   7801 C  C7    . DT  F  3  9   ? 24.355  10.790  219.492 1.00 46.77  ? 10  DT  T C7    1 
ATOM   7802 C  C6    . DT  F  3  9   ? 22.648  10.426  221.270 1.00 45.71  ? 10  DT  T C6    1 
ATOM   7803 P  P     . DG  F  3  10  ? 20.445  8.491   227.054 1.00 64.49  ? 11  DG  T P     1 
ATOM   7804 O  OP1   . DG  F  3  10  ? 20.040  9.348   228.195 1.00 65.25  ? 11  DG  T OP1   1 
ATOM   7805 O  OP2   . DG  F  3  10  ? 21.733  7.758   227.086 1.00 55.17  ? 11  DG  T OP2   1 
ATOM   7806 O  "O5'" . DG  F  3  10  ? 19.281  7.449   226.749 1.00 62.91  ? 11  DG  T "O5'" 1 
ATOM   7807 C  "C5'" . DG  F  3  10  ? 18.035  7.865   226.150 1.00 60.60  ? 11  DG  T "C5'" 1 
ATOM   7808 C  "C4'" . DG  F  3  10  ? 17.428  6.746   225.335 1.00 62.24  ? 11  DG  T "C4'" 1 
ATOM   7809 O  "O4'" . DG  F  3  10  ? 17.971  6.730   223.993 1.00 62.39  ? 11  DG  T "O4'" 1 
ATOM   7810 C  "C3'" . DG  F  3  10  ? 17.663  5.337   225.877 1.00 64.02  ? 11  DG  T "C3'" 1 
ATOM   7811 O  "O3'" . DG  F  3  10  ? 16.485  4.577   225.570 1.00 60.54  ? 11  DG  T "O3'" 1 
ATOM   7812 C  "C2'" . DG  F  3  10  ? 18.905  4.883   225.121 1.00 62.07  ? 11  DG  T "C2'" 1 
ATOM   7813 C  "C1'" . DG  F  3  10  ? 18.645  5.491   223.755 1.00 60.98  ? 11  DG  T "C1'" 1 
ATOM   7814 N  N9    . DG  F  3  10  ? 19.792  5.769   222.893 1.00 53.60  ? 11  DG  T N9    1 
ATOM   7815 C  C8    . DG  F  3  10  ? 20.919  6.504   223.174 1.00 52.57  ? 11  DG  T C8    1 
ATOM   7816 N  N7    . DG  F  3  10  ? 21.724  6.617   222.151 1.00 50.54  ? 11  DG  T N7    1 
ATOM   7817 C  C5    . DG  F  3  10  ? 21.076  5.936   221.129 1.00 43.48  ? 11  DG  T C5    1 
ATOM   7818 C  C6    . DG  F  3  10  ? 21.454  5.721   219.774 1.00 40.43  ? 11  DG  T C6    1 
ATOM   7819 O  O6    . DG  F  3  10  ? 22.459  6.132   219.176 1.00 37.19  ? 11  DG  T O6    1 
ATOM   7820 N  N1    . DG  F  3  10  ? 20.506  4.962   219.095 1.00 37.21  ? 11  DG  T N1    1 
ATOM   7821 C  C2    . DG  F  3  10  ? 19.338  4.479   219.646 1.00 38.72  ? 11  DG  T C2    1 
ATOM   7822 N  N2    . DG  F  3  10  ? 18.532  3.782   218.835 1.00 42.68  ? 11  DG  T N2    1 
ATOM   7823 N  N3    . DG  F  3  10  ? 18.969  4.692   220.892 1.00 39.39  ? 11  DG  T N3    1 
ATOM   7824 C  C4    . DG  F  3  10  ? 19.875  5.421   221.571 1.00 43.75  ? 11  DG  T C4    1 
ATOM   7825 P  P     . DT  F  3  11  ? 16.333  3.067   226.095 1.00 58.64  ? 12  DT  T P     1 
ATOM   7826 O  OP1   . DT  F  3  11  ? 14.892  2.852   226.446 1.00 53.41  ? 12  DT  T OP1   1 
ATOM   7827 O  OP2   . DT  F  3  11  ? 17.410  2.831   227.098 1.00 49.37  ? 12  DT  T OP2   1 
ATOM   7828 O  "O5'" . DT  F  3  11  ? 16.666  2.213   224.790 1.00 59.39  ? 12  DT  T "O5'" 1 
ATOM   7829 C  "C5'" . DT  F  3  11  ? 15.804  2.259   223.630 1.00 63.09  ? 12  DT  T "C5'" 1 
ATOM   7830 C  "C4'" . DT  F  3  11  ? 16.182  1.174   222.646 1.00 64.58  ? 12  DT  T "C4'" 1 
ATOM   7831 O  "O4'" . DT  F  3  11  ? 17.364  1.555   221.896 1.00 62.09  ? 12  DT  T "O4'" 1 
ATOM   7832 C  "C3'" . DT  F  3  11  ? 16.502  -0.187  223.271 1.00 64.67  ? 12  DT  T "C3'" 1 
ATOM   7833 O  "O3'" . DT  F  3  11  ? 15.871  -1.151  222.418 1.00 67.78  ? 12  DT  T "O3'" 1 
ATOM   7834 C  "C2'" . DT  F  3  11  ? 18.026  -0.204  223.311 1.00 61.37  ? 12  DT  T "C2'" 1 
ATOM   7835 C  "C1'" . DT  F  3  11  ? 18.369  0.553   222.032 1.00 59.74  ? 12  DT  T "C1'" 1 
ATOM   7836 N  N1    . DT  F  3  11  ? 19.698  1.218   221.901 1.00 51.49  ? 12  DT  T N1    1 
ATOM   7837 C  C2    . DT  F  3  11  ? 20.195  1.334   220.621 1.00 47.24  ? 12  DT  T C2    1 
ATOM   7838 O  O2    . DT  F  3  11  ? 19.613  0.907   219.637 1.00 45.28  ? 12  DT  T O2    1 
ATOM   7839 N  N3    . DT  F  3  11  ? 21.399  1.992   220.531 1.00 44.04  ? 12  DT  T N3    1 
ATOM   7840 C  C4    . DT  F  3  11  ? 22.134  2.537   221.562 1.00 44.63  ? 12  DT  T C4    1 
ATOM   7841 O  O4    . DT  F  3  11  ? 23.199  3.104   221.321 1.00 42.40  ? 12  DT  T O4    1 
ATOM   7842 C  C5    . DT  F  3  11  ? 21.560  2.372   222.880 1.00 45.39  ? 12  DT  T C5    1 
ATOM   7843 C  C7    . DT  F  3  11  ? 22.283  2.935   224.061 1.00 45.39  ? 12  DT  T C7    1 
ATOM   7844 C  C6    . DT  F  3  11  ? 20.383  1.736   222.982 1.00 49.17  ? 12  DT  T C6    1 
ATOM   7845 P  P     . DA  F  3  12  ? 15.806  -2.708  222.806 1.00 70.49  ? 13  DA  T P     1 
ATOM   7846 O  OP1   . DA  F  3  12  ? 14.548  -3.248  222.241 1.00 67.58  ? 13  DA  T OP1   1 
ATOM   7847 O  OP2   . DA  F  3  12  ? 16.102  -2.854  224.258 1.00 69.71  ? 13  DA  T OP2   1 
ATOM   7848 O  "O5'" . DA  F  3  12  ? 17.018  -3.330  221.978 1.00 68.83  ? 13  DA  T "O5'" 1 
ATOM   7849 C  "C5'" . DA  F  3  12  ? 17.074  -3.177  220.542 1.00 64.17  ? 13  DA  T "C5'" 1 
ATOM   7850 C  "C4'" . DA  F  3  12  ? 18.424  -3.596  220.003 1.00 61.89  ? 13  DA  T "C4'" 1 
ATOM   7851 O  "O4'" . DA  F  3  12  ? 19.413  -2.566  220.216 1.00 58.81  ? 13  DA  T "O4'" 1 
ATOM   7852 C  "C3'" . DA  F  3  12  ? 19.012  -4.875  220.613 1.00 60.15  ? 13  DA  T "C3'" 1 
ATOM   7853 O  "O3'" . DA  F  3  12  ? 18.722  -5.906  219.659 1.00 61.65  ? 13  DA  T "O3'" 1 
ATOM   7854 C  "C2'" . DA  F  3  12  ? 20.468  -4.519  220.901 1.00 57.78  ? 13  DA  T "C2'" 1 
ATOM   7855 C  "C1'" . DA  F  3  12  ? 20.662  -3.204  220.156 1.00 56.25  ? 13  DA  T "C1'" 1 
ATOM   7856 N  N9    . DA  F  3  12  ? 21.672  -2.296  220.700 1.00 50.91  ? 13  DA  T N9    1 
ATOM   7857 C  C8    . DA  F  3  12  ? 21.892  -1.932  222.006 1.00 52.05  ? 13  DA  T C8    1 
ATOM   7858 N  N7    . DA  F  3  12  ? 22.925  -1.140  222.168 1.00 51.06  ? 13  DA  T N7    1 
ATOM   7859 C  C5    . DA  F  3  12  ? 23.421  -0.972  220.882 1.00 46.95  ? 13  DA  T C5    1 
ATOM   7860 C  C6    . DA  F  3  12  ? 24.491  -0.215  220.368 1.00 40.80  ? 13  DA  T C6    1 
ATOM   7861 N  N6    . DA  F  3  12  ? 25.316  0.513   221.123 1.00 42.27  ? 13  DA  T N6    1 
ATOM   7862 N  N1    . DA  F  3  12  ? 24.714  -0.266  219.038 1.00 36.71  ? 13  DA  T N1    1 
ATOM   7863 C  C2    . DA  F  3  12  ? 23.900  -1.011  218.280 1.00 38.21  ? 13  DA  T C2    1 
ATOM   7864 N  N3    . DA  F  3  12  ? 22.845  -1.739  218.640 1.00 41.85  ? 13  DA  T N3    1 
ATOM   7865 C  C4    . DA  F  3  12  ? 22.656  -1.676  219.968 1.00 45.26  ? 13  DA  T C4    1 
ATOM   7866 P  P     . DT  F  3  13  ? 19.447  -7.330  219.723 1.00 59.96  ? 14  DT  T P     1 
ATOM   7867 O  OP1   . DT  F  3  13  ? 18.620  -8.284  218.952 1.00 68.39  ? 14  DT  T OP1   1 
ATOM   7868 O  OP2   . DT  F  3  13  ? 19.849  -7.609  221.126 1.00 57.06  ? 14  DT  T OP2   1 
ATOM   7869 O  "O5'" . DT  F  3  13  ? 20.774  -7.095  218.880 1.00 56.86  ? 14  DT  T "O5'" 1 
ATOM   7870 C  "C5'" . DT  F  3  13  ? 20.736  -6.409  217.620 1.00 49.37  ? 14  DT  T "C5'" 1 
ATOM   7871 C  "C4'" . DT  F  3  13  ? 22.151  -6.125  217.183 1.00 50.17  ? 14  DT  T "C4'" 1 
ATOM   7872 O  "O4'" . DT  F  3  13  ? 22.767  -5.158  218.062 1.00 50.25  ? 14  DT  T "O4'" 1 
ATOM   7873 C  "C3'" . DT  F  3  13  ? 23.063  -7.357  217.217 1.00 49.64  ? 14  DT  T "C3'" 1 
ATOM   7874 O  "O3'" . DT  F  3  13  ? 23.427  -7.696  215.880 1.00 48.24  ? 14  DT  T "O3'" 1 
ATOM   7875 C  "C2'" . DT  F  3  13  ? 24.252  -6.924  218.062 1.00 50.77  ? 14  DT  T "C2'" 1 
ATOM   7876 C  "C1'" . DT  F  3  13  ? 24.148  -5.412  218.008 1.00 48.58  ? 14  DT  T "C1'" 1 
ATOM   7877 N  N1    . DT  F  3  13  ? 24.790  -4.672  219.105 1.00 44.49  ? 14  DT  T N1    1 
ATOM   7878 C  C2    . DT  F  3  13  ? 25.798  -3.788  218.782 1.00 42.33  ? 14  DT  T C2    1 
ATOM   7879 O  O2    . DT  F  3  13  ? 26.178  -3.597  217.638 1.00 39.58  ? 14  DT  T O2    1 
ATOM   7880 N  N3    . DT  F  3  13  ? 26.333  -3.115  219.851 1.00 37.82  ? 14  DT  T N3    1 
ATOM   7881 C  C4    . DT  F  3  13  ? 25.982  -3.247  221.181 1.00 40.15  ? 14  DT  T C4    1 
ATOM   7882 O  O4    . DT  F  3  13  ? 26.564  -2.583  222.032 1.00 39.29  ? 14  DT  T O4    1 
ATOM   7883 C  C5    . DT  F  3  13  ? 24.930  -4.205  221.451 1.00 42.93  ? 14  DT  T C5    1 
ATOM   7884 C  C7    . DT  F  3  13  ? 24.479  -4.412  222.864 1.00 45.50  ? 14  DT  T C7    1 
ATOM   7885 C  C6    . DT  F  3  13  ? 24.384  -4.850  220.411 1.00 41.65  ? 14  DT  T C6    1 
HETATM 7886 MG MG    . MG  G  4  .   ? 21.643  28.207  179.580 1.00 19.46  ? 601 MG  A MG    1 
HETATM 7887 MG MG    . MG  H  4  .   ? 24.298  30.758  180.219 1.00 42.13  ? 602 MG  A MG    1 
HETATM 7888 C  C1    . PEG I  5  .   ? 10.922  22.038  177.693 1.00 26.42  ? 603 PEG A C1    1 
HETATM 7889 O  O1    . PEG I  5  .   ? 9.829   22.813  178.196 1.00 25.45  ? 603 PEG A O1    1 
HETATM 7890 C  C2    . PEG I  5  .   ? 12.215  22.834  177.830 1.00 24.82  ? 603 PEG A C2    1 
HETATM 7891 O  O2    . PEG I  5  .   ? 12.971  22.327  178.927 1.00 16.94  ? 603 PEG A O2    1 
HETATM 7892 C  C3    . PEG I  5  .   ? 14.364  22.591  178.777 1.00 27.07  ? 603 PEG A C3    1 
HETATM 7893 C  C4    . PEG I  5  .   ? 15.000  21.499  177.925 1.00 21.34  ? 603 PEG A C4    1 
HETATM 7894 O  O4    . PEG I  5  .   ? 15.026  21.917  176.555 1.00 28.63  ? 603 PEG A O4    1 
HETATM 7895 C  C1    . PEG J  5  .   ? 36.275  46.300  173.590 1.00 36.82  ? 604 PEG A C1    1 
HETATM 7896 O  O1    . PEG J  5  .   ? 36.803  47.582  173.232 1.00 31.03  ? 604 PEG A O1    1 
HETATM 7897 C  C2    . PEG J  5  .   ? 35.793  45.581  172.335 1.00 37.62  ? 604 PEG A C2    1 
HETATM 7898 O  O2    . PEG J  5  .   ? 35.559  44.207  172.636 1.00 37.72  ? 604 PEG A O2    1 
HETATM 7899 C  C3    . PEG J  5  .   ? 36.775  43.499  172.865 1.00 47.86  ? 604 PEG A C3    1 
HETATM 7900 C  C4    . PEG J  5  .   ? 37.548  43.380  171.557 1.00 48.67  ? 604 PEG A C4    1 
HETATM 7901 O  O4    . PEG J  5  .   ? 38.535  42.349  171.677 1.00 52.35  ? 604 PEG A O4    1 
HETATM 7902 C  C1    . PEG K  5  .   ? 19.082  67.395  165.893 1.00 62.69  ? 605 PEG A C1    1 
HETATM 7903 O  O1    . PEG K  5  .   ? 18.678  66.346  166.794 1.00 66.92  ? 605 PEG A O1    1 
HETATM 7904 C  C2    . PEG K  5  .   ? 20.562  67.716  166.076 1.00 61.73  ? 605 PEG A C2    1 
HETATM 7905 O  O2    . PEG K  5  .   ? 21.343  67.285  164.950 1.00 64.00  ? 605 PEG A O2    1 
HETATM 7906 C  C3    . PEG K  5  .   ? 22.763  67.464  165.069 1.00 57.35  ? 605 PEG A C3    1 
HETATM 7907 C  C4    . PEG K  5  .   ? 23.482  66.116  165.034 1.00 53.06  ? 605 PEG A C4    1 
HETATM 7908 O  O4    . PEG K  5  .   ? 24.225  65.931  163.822 1.00 56.66  ? 605 PEG A O4    1 
HETATM 7909 C  C1    . PEG L  5  .   ? 17.243  62.509  166.305 1.00 65.61  ? 606 PEG A C1    1 
HETATM 7910 O  O1    . PEG L  5  .   ? 18.013  63.406  167.116 1.00 65.69  ? 606 PEG A O1    1 
HETATM 7911 C  C2    . PEG L  5  .   ? 17.970  61.177  166.074 1.00 66.30  ? 606 PEG A C2    1 
HETATM 7912 O  O2    . PEG L  5  .   ? 19.328  61.351  165.635 1.00 69.71  ? 606 PEG A O2    1 
HETATM 7913 C  C3    . PEG L  5  .   ? 19.581  61.390  164.219 1.00 67.58  ? 606 PEG A C3    1 
HETATM 7914 C  C4    . PEG L  5  .   ? 21.035  61.001  163.904 1.00 68.05  ? 606 PEG A C4    1 
HETATM 7915 O  O4    . PEG L  5  .   ? 21.828  62.118  163.445 1.00 66.61  ? 606 PEG A O4    1 
HETATM 7916 I  I     . IOD M  6  .   ? 2.178   23.986  178.162 1.00 30.38  ? 607 IOD A I     1 
HETATM 7917 I  I     . IOD N  6  .   ? 0.712   35.580  174.052 1.00 37.70  ? 608 IOD A I     1 
HETATM 7918 I  I     . IOD O  6  .   ? 14.800  51.783  181.429 1.00 68.87  ? 609 IOD A I     1 
HETATM 7919 C  C1    . EDO P  7  .   ? 23.099  47.694  220.102 1.00 36.23  ? 610 EDO A C1    1 
HETATM 7920 O  O1    . EDO P  7  .   ? 24.210  46.865  219.624 1.00 39.06  ? 610 EDO A O1    1 
HETATM 7921 C  C2    . EDO P  7  .   ? 23.070  49.078  219.491 1.00 31.24  ? 610 EDO A C2    1 
HETATM 7922 O  O2    . EDO P  7  .   ? 21.781  49.648  219.343 1.00 29.17  ? 610 EDO A O2    1 
HETATM 7923 C  C1    . EDO Q  7  .   ? 27.315  31.153  150.195 1.00 54.50  ? 611 EDO A C1    1 
HETATM 7924 O  O1    . EDO Q  7  .   ? 27.221  29.843  150.738 1.00 55.99  ? 611 EDO A O1    1 
HETATM 7925 C  C2    . EDO Q  7  .   ? 26.965  32.162  151.275 1.00 54.57  ? 611 EDO A C2    1 
HETATM 7926 O  O2    . EDO Q  7  .   ? 26.504  33.379  150.669 1.00 58.56  ? 611 EDO A O2    1 
HETATM 7927 C  C1    . EDO R  7  .   ? 20.982  22.432  164.444 1.00 32.40  ? 612 EDO A C1    1 
HETATM 7928 O  O1    . EDO R  7  .   ? 20.227  23.255  165.280 1.00 33.39  ? 612 EDO A O1    1 
HETATM 7929 C  C2    . EDO R  7  .   ? 21.936  21.541  165.176 1.00 31.17  ? 612 EDO A C2    1 
HETATM 7930 O  O2    . EDO R  7  .   ? 21.432  20.282  165.547 1.00 38.08  ? 612 EDO A O2    1 
HETATM 7931 C  C1    . EDO S  7  .   ? 47.373  37.806  202.093 1.00 62.11  ? 613 EDO A C1    1 
HETATM 7932 O  O1    . EDO S  7  .   ? 46.621  38.204  200.938 1.00 59.49  ? 613 EDO A O1    1 
HETATM 7933 C  C2    . EDO S  7  .   ? 47.704  39.027  202.955 1.00 61.18  ? 613 EDO A C2    1 
HETATM 7934 O  O2    . EDO S  7  .   ? 48.403  40.038  202.211 1.00 62.12  ? 613 EDO A O2    1 
HETATM 7935 C  C1    . EDO T  7  .   ? 19.410  33.986  159.662 1.00 59.45  ? 614 EDO A C1    1 
HETATM 7936 O  O1    . EDO T  7  .   ? 18.829  32.677  159.776 1.00 63.50  ? 614 EDO A O1    1 
HETATM 7937 C  C2    . EDO T  7  .   ? 20.932  33.851  159.727 1.00 59.53  ? 614 EDO A C2    1 
HETATM 7938 O  O2    . EDO T  7  .   ? 21.525  34.923  160.480 1.00 59.73  ? 614 EDO A O2    1 
HETATM 7939 C  C1    . EDO U  7  .   ? 20.819  35.484  165.262 1.00 51.97  ? 615 EDO A C1    1 
HETATM 7940 O  O1    . EDO U  7  .   ? 20.349  35.843  166.575 1.00 52.86  ? 615 EDO A O1    1 
HETATM 7941 C  C2    . EDO U  7  .   ? 20.580  36.543  164.192 1.00 53.89  ? 615 EDO A C2    1 
HETATM 7942 O  O2    . EDO U  7  .   ? 21.431  36.406  163.028 1.00 59.48  ? 615 EDO A O2    1 
HETATM 7943 C  C1    . EDO V  7  .   ? 32.813  40.665  216.903 1.00 55.17  ? 616 EDO A C1    1 
HETATM 7944 O  O1    . EDO V  7  .   ? 32.637  42.071  216.906 1.00 58.09  ? 616 EDO A O1    1 
HETATM 7945 C  C2    . EDO V  7  .   ? 32.218  40.091  215.640 1.00 50.91  ? 616 EDO A C2    1 
HETATM 7946 O  O2    . EDO V  7  .   ? 33.154  39.258  214.964 1.00 55.04  ? 616 EDO A O2    1 
HETATM 7947 C  C1    . EDO W  7  .   ? 14.729  43.554  165.034 1.00 44.88  ? 617 EDO A C1    1 
HETATM 7948 O  O1    . EDO W  7  .   ? 14.633  43.763  166.454 1.00 56.07  ? 617 EDO A O1    1 
HETATM 7949 C  C2    . EDO W  7  .   ? 15.191  44.902  164.521 1.00 43.45  ? 617 EDO A C2    1 
HETATM 7950 O  O2    . EDO W  7  .   ? 16.171  44.850  163.520 1.00 49.40  ? 617 EDO A O2    1 
HETATM 7951 C  C1    . EDO X  7  .   ? 19.773  43.353  184.228 1.00 40.63  ? 618 EDO A C1    1 
HETATM 7952 O  O1    . EDO X  7  .   ? 19.122  44.313  185.066 1.00 51.53  ? 618 EDO A O1    1 
HETATM 7953 C  C2    . EDO X  7  .   ? 20.850  44.010  183.378 1.00 41.77  ? 618 EDO A C2    1 
HETATM 7954 O  O2    . EDO X  7  .   ? 20.782  45.434  183.205 1.00 49.40  ? 618 EDO A O2    1 
HETATM 7955 N  N1    . DZ4 Y  8  .   ? 18.956  34.985  188.813 1.00 24.66  ? 619 DZ4 A N1    1 
HETATM 7956 C  C2    . DZ4 Y  8  .   ? 19.394  33.832  189.331 1.00 24.52  ? 619 DZ4 A C2    1 
HETATM 7957 N  N3    . DZ4 Y  8  .   ? 19.840  32.755  188.671 1.00 24.70  ? 619 DZ4 A N3    1 
HETATM 7958 C  C4    . DZ4 Y  8  .   ? 19.788  32.925  187.328 1.00 23.34  ? 619 DZ4 A C4    1 
HETATM 7959 C  C5    . DZ4 Y  8  .   ? 19.341  34.053  186.676 1.00 23.79  ? 619 DZ4 A C5    1 
HETATM 7960 C  C6    . DZ4 Y  8  .   ? 18.887  35.120  187.470 1.00 23.60  ? 619 DZ4 A C6    1 
HETATM 7961 N  N6    . DZ4 Y  8  .   ? 18.396  36.271  186.961 1.00 24.05  ? 619 DZ4 A N6    1 
HETATM 7962 N  N7    . DZ4 Y  8  .   ? 19.451  33.856  185.305 1.00 22.43  ? 619 DZ4 A N7    1 
HETATM 7963 C  C8    . DZ4 Y  8  .   ? 19.907  32.625  185.197 1.00 23.65  ? 619 DZ4 A C8    1 
HETATM 7964 N  N9    . DZ4 Y  8  .   ? 20.203  32.046  186.371 1.00 24.56  ? 619 DZ4 A N9    1 
HETATM 7965 P  PA    . DZ4 Y  8  .   ? 21.019  30.910  181.412 1.00 24.68  ? 619 DZ4 A PA    1 
HETATM 7966 P  PB    . DZ4 Y  8  .   ? 18.931  28.821  181.137 1.00 22.20  ? 619 DZ4 A PB    1 
HETATM 7967 P  PG    . DZ4 Y  8  .   ? 18.662  29.006  178.258 1.00 24.30  ? 619 DZ4 A PG    1 
HETATM 7968 C  "C1'" . DZ4 Y  8  .   ? 20.637  30.649  186.599 1.00 23.07  ? 619 DZ4 A "C1'" 1 
HETATM 7969 O  O1A   . DZ4 Y  8  .   ? 21.063  32.317  181.025 1.00 23.53  ? 619 DZ4 A O1A   1 
HETATM 7970 O  O1B   . DZ4 Y  8  .   ? 20.013  27.843  181.071 1.00 19.64  ? 619 DZ4 A O1B   1 
HETATM 7971 O  O1G   . DZ4 Y  8  .   ? 18.026  30.288  177.786 1.00 22.26  ? 619 DZ4 A O1G   1 
HETATM 7972 C  "C2'" . DZ4 Y  8  .   ? 19.524  29.655  186.280 1.00 22.44  ? 619 DZ4 A "C2'" 1 
HETATM 7973 O  O2A   . DZ4 Y  8  .   ? 21.922  30.060  180.465 1.00 22.05  ? 619 DZ4 A O2A   1 
HETATM 7974 O  O2B   . DZ4 Y  8  .   ? 17.938  28.436  182.344 1.00 23.19  ? 619 DZ4 A O2B   1 
HETATM 7975 O  O2G   . DZ4 Y  8  .   ? 20.168  29.099  178.303 1.00 21.92  ? 619 DZ4 A O2G   1 
HETATM 7976 C  "C3'" . DZ4 Y  8  .   ? 19.787  29.248  184.843 1.00 22.38  ? 619 DZ4 A "C3'" 1 
HETATM 7977 O  "O3'" . DZ4 Y  8  .   ? 19.265  27.950  184.539 1.00 21.82  ? 619 DZ4 A "O3'" 1 
HETATM 7978 N  N3A   . DZ4 Y  8  .   ? 19.496  30.332  181.365 1.00 23.34  ? 619 DZ4 A N3A   1 
HETATM 7979 O  O3B   . DZ4 Y  8  .   ? 18.118  28.807  179.756 1.00 23.33  ? 619 DZ4 A O3B   1 
HETATM 7980 O  O3G   . DZ4 Y  8  .   ? 18.212  27.796  177.486 1.00 22.46  ? 619 DZ4 A O3G   1 
HETATM 7981 C  "C4'" . DZ4 Y  8  .   ? 21.308  29.282  184.825 1.00 21.51  ? 619 DZ4 A "C4'" 1 
HETATM 7982 O  "O4'" . DZ4 Y  8  .   ? 21.694  30.356  185.685 1.00 24.00  ? 619 DZ4 A "O4'" 1 
HETATM 7983 C  "C5'" . DZ4 Y  8  .   ? 21.901  29.485  183.444 1.00 22.89  ? 619 DZ4 A "C5'" 1 
HETATM 7984 O  "O5'" . DZ4 Y  8  .   ? 21.546  30.759  182.924 1.00 23.52  ? 619 DZ4 A "O5'" 1 
HETATM 7985 C  C1    . PGE Z  9  .   ? 13.872  21.611  168.705 1.00 60.86  ? 620 PGE A C1    1 
HETATM 7986 O  O1    . PGE Z  9  .   ? 14.888  20.918  169.434 1.00 63.59  ? 620 PGE A O1    1 
HETATM 7987 C  C2    . PGE Z  9  .   ? 13.259  22.674  169.613 1.00 62.84  ? 620 PGE A C2    1 
HETATM 7988 O  O2    . PGE Z  9  .   ? 12.133  23.310  168.988 1.00 62.04  ? 620 PGE A O2    1 
HETATM 7989 C  C3    . PGE Z  9  .   ? 12.114  24.739  168.970 1.00 61.63  ? 620 PGE A C3    1 
HETATM 7990 C  C4    . PGE Z  9  .   ? 12.748  25.233  167.676 1.00 66.71  ? 620 PGE A C4    1 
HETATM 7991 O  O4    . PGE Z  9  .   ? 15.964  26.276  165.880 1.00 63.09  ? 620 PGE A O4    1 
HETATM 7992 C  C6    . PGE Z  9  .   ? 15.303  27.070  166.864 1.00 63.49  ? 620 PGE A C6    1 
HETATM 7993 C  C5    . PGE Z  9  .   ? 13.805  27.074  166.630 1.00 65.70  ? 620 PGE A C5    1 
HETATM 7994 O  O3    . PGE Z  9  .   ? 13.133  26.603  167.792 1.00 65.61  ? 620 PGE A O3    1 
HETATM 7995 CL CL    . CL  AA 10 .   ? -0.014  53.123  190.768 1.00 53.22  ? 621 CL  A CL    1 
HETATM 7996 CL CL    . CL  BA 10 .   ? 19.047  53.249  204.258 1.00 28.96  ? 622 CL  A CL    1 
HETATM 7997 CL CL    . CL  CA 10 .   ? 21.102  20.352  196.817 1.00 23.15  ? 623 CL  A CL    1 
HETATM 7998 CL CL    . CL  DA 10 .   ? 5.030   27.564  195.151 1.00 50.39  ? 624 CL  A CL    1 
HETATM 7999 CL CL    . CL  EA 10 .   ? 8.164   41.014  185.977 1.00 23.60  ? 625 CL  A CL    1 
HETATM 8000 K  K     . K   FA 11 .   ? 12.155  54.095  203.826 1.00 34.62  ? 626 K   A K     1 
HETATM 8001 MG MG    . MG  GA 4  .   ? 8.118   28.838  221.488 1.00 28.36  ? 601 MG  B MG    1 
HETATM 8002 MG MG    . MG  HA 4  .   ? 10.811  26.371  222.559 1.00 55.98  ? 602 MG  B MG    1 
HETATM 8003 C  C1    . PEG IA 5  .   ? -1.918  34.816  216.761 1.00 35.44  ? 603 PEG B C1    1 
HETATM 8004 O  O1    . PEG IA 5  .   ? -2.418  34.362  215.532 1.00 39.78  ? 603 PEG B O1    1 
HETATM 8005 C  C2    . PEG IA 5  .   ? -0.480  35.232  216.573 1.00 35.13  ? 603 PEG B C2    1 
HETATM 8006 O  O2    . PEG IA 5  .   ? 0.431   34.449  217.282 1.00 22.70  ? 603 PEG B O2    1 
HETATM 8007 C  C3    . PEG IA 5  .   ? 1.541   35.171  217.599 1.00 29.49  ? 603 PEG B C3    1 
HETATM 8008 C  C4    . PEG IA 5  .   ? 1.303   35.904  218.920 1.00 35.76  ? 603 PEG B C4    1 
HETATM 8009 O  O4    . PEG IA 5  .   ? 1.896   35.158  219.960 1.00 40.34  ? 603 PEG B O4    1 
HETATM 8010 I  I     . IOD JA 6  .   ? 3.680   5.639   216.243 1.00 64.58  ? 604 IOD B I     1 
HETATM 8011 I  I     . IOD KA 6  .   ? 6.067   27.801  249.381 1.00 56.54  ? 605 IOD B I     1 
HETATM 8012 I  I     . IOD LA 6  .   ? -8.196  33.331  211.063 1.00 67.22  ? 606 IOD B I     1 
HETATM 8013 C  C1    . EDO MA 7  .   ? 32.795  8.552   189.206 1.00 30.38  ? 607 EDO B C1    1 
HETATM 8014 O  O1    . EDO MA 7  .   ? 31.692  7.648   189.310 1.00 26.02  ? 607 EDO B O1    1 
HETATM 8015 C  C2    . EDO MA 7  .   ? 32.809  9.581   190.300 1.00 33.80  ? 607 EDO B C2    1 
HETATM 8016 O  O2    . EDO MA 7  .   ? 33.810  10.611  190.242 1.00 36.84  ? 607 EDO B O2    1 
HETATM 8017 N  N1    . DZ4 NA 8  .   ? 11.393  22.246  212.347 1.00 27.64  ? 608 DZ4 B N1    1 
HETATM 8018 C  C2    . DZ4 NA 8  .   ? 12.060  23.398  212.204 1.00 28.28  ? 608 DZ4 B C2    1 
HETATM 8019 N  N3    . DZ4 NA 8  .   ? 12.025  24.486  212.983 1.00 29.05  ? 608 DZ4 B N3    1 
HETATM 8020 C  C4    . DZ4 NA 8  .   ? 11.161  24.343  214.014 1.00 31.63  ? 608 DZ4 B C4    1 
HETATM 8021 C  C5    . DZ4 NA 8  .   ? 10.414  23.209  214.257 1.00 31.09  ? 608 DZ4 B C5    1 
HETATM 8022 C  C6    . DZ4 NA 8  .   ? 10.537  22.114  213.378 1.00 29.04  ? 608 DZ4 B C6    1 
HETATM 8023 N  N6    . DZ4 NA 8  .   ? 9.867   20.941  213.516 1.00 29.61  ? 608 DZ4 B N6    1 
HETATM 8024 N  N7    . DZ4 NA 8  .   ? 9.645   23.432  215.389 1.00 30.47  ? 608 DZ4 B N7    1 
HETATM 8025 C  C8    . DZ4 NA 8  .   ? 9.950   24.651  215.764 1.00 31.04  ? 608 DZ4 B C8    1 
HETATM 8026 N  N9    . DZ4 NA 8  .   ? 10.882  25.247  215.011 1.00 30.28  ? 608 DZ4 B N9    1 
HETATM 8027 P  PA    . DZ4 NA 8  .   ? 8.677   26.241  219.574 1.00 34.22  ? 608 DZ4 B PA    1 
HETATM 8028 P  PB    . DZ4 NA 8  .   ? 6.810   28.301  218.629 1.00 31.60  ? 608 DZ4 B PB    1 
HETATM 8029 P  PG    . DZ4 NA 8  .   ? 4.867   28.166  220.763 1.00 33.35  ? 608 DZ4 B PG    1 
HETATM 8030 C  "C1'" . DZ4 NA 8  .   ? 11.355  26.654  215.099 1.00 30.23  ? 608 DZ4 B "C1'" 1 
HETATM 8031 O  O1A   . DZ4 NA 8  .   ? 8.574   24.817  219.880 1.00 32.02  ? 608 DZ4 B O1A   1 
HETATM 8032 O  O1B   . DZ4 NA 8  .   ? 7.643   29.257  219.353 1.00 31.13  ? 608 DZ4 B O1B   1 
HETATM 8033 O  O1G   . DZ4 NA 8  .   ? 4.024   26.913  220.839 1.00 30.23  ? 608 DZ4 B O1G   1 
HETATM 8034 C  "C2'" . DZ4 NA 8  .   ? 10.267  27.653  214.738 1.00 30.42  ? 608 DZ4 B "C2'" 1 
HETATM 8035 O  O2A   . DZ4 NA 8  .   ? 8.868   27.068  220.883 1.00 31.72  ? 608 DZ4 B O2A   1 
HETATM 8036 O  O2B   . DZ4 NA 8  .   ? 6.763   28.702  217.071 1.00 30.68  ? 608 DZ4 B O2B   1 
HETATM 8037 O  O2G   . DZ4 NA 8  .   ? 6.129   28.080  221.606 1.00 30.93  ? 608 DZ4 B O2G   1 
HETATM 8038 C  "C3'" . DZ4 NA 8  .   ? 9.644   27.994  216.080 1.00 30.22  ? 608 DZ4 B "C3'" 1 
HETATM 8039 O  "O3'" . DZ4 NA 8  .   ? 8.986   29.261  216.094 1.00 25.94  ? 608 DZ4 B "O3'" 1 
HETATM 8040 N  N3A   . DZ4 NA 8  .   ? 7.361   26.777  218.781 1.00 31.67  ? 608 DZ4 B N3A   1 
HETATM 8041 O  O3B   . DZ4 NA 8  .   ? 5.324   28.321  219.232 1.00 33.16  ? 608 DZ4 B O3B   1 
HETATM 8042 O  O3G   . DZ4 NA 8  .   ? 4.028   29.385  221.068 1.00 31.97  ? 608 DZ4 B O3G   1 
HETATM 8043 C  "C4'" . DZ4 NA 8  .   ? 10.876  27.990  216.964 1.00 31.29  ? 608 DZ4 B "C4'" 1 
HETATM 8044 O  "O4'" . DZ4 NA 8  .   ? 11.711  26.945  216.455 1.00 29.40  ? 608 DZ4 B "O4'" 1 
HETATM 8045 C  "C5'" . DZ4 NA 8  .   ? 10.515  27.779  218.425 1.00 32.76  ? 608 DZ4 B "C5'" 1 
HETATM 8046 O  "O5'" . DZ4 NA 8  .   ? 9.929   26.490  218.595 1.00 34.03  ? 608 DZ4 B "O5'" 1 
HETATM 8047 CL CL    . CL  OA 10 .   ? 1.097   16.368  208.324 1.00 39.22  ? 609 CL  B CL    1 
HETATM 8048 CL CL    . CL  PA 10 .   ? 23.266  37.660  216.564 1.00 54.79  ? 610 CL  B CL    1 
HETATM 8049 CL CL    . CL  QA 10 .   ? 4.002   29.741  199.033 1.00 45.53  ? 611 CL  B CL    1 
HETATM 8050 CL CL    . CL  RA 10 .   ? 20.757  29.326  221.040 1.00 59.90  ? 612 CL  B CL    1 
HETATM 8051 K  K     . K   SA 11 .   ? 20.447  4.018   199.880 1.00 29.81  ? 613 K   B K     1 
HETATM 8052 K  K     . K   TA 11 .   ? 14.632  3.151   196.256 1.00 39.78  ? 614 K   B K     1 
HETATM 8053 K  K     . K   UA 11 .   ? 6.825   43.067  195.945 1.00 34.92  ? 101 K   D K     1 
HETATM 8054 O  O     . HOH VA 12 .   ? 13.595  45.730  166.642 1.00 46.39  ? 701 HOH A O     1 
HETATM 8055 O  O     . HOH VA 12 .   ? 17.028  43.216  162.184 1.00 42.98  ? 702 HOH A O     1 
HETATM 8056 O  O     . HOH VA 12 .   ? 19.868  47.542  183.428 1.00 43.50  ? 703 HOH A O     1 
HETATM 8057 O  O     . HOH VA 12 .   ? 39.922  42.759  156.785 1.00 41.01  ? 704 HOH A O     1 
HETATM 8058 O  O     . HOH VA 12 .   ? 26.742  42.549  197.156 1.00 49.66  ? 705 HOH A O     1 
HETATM 8059 O  O     . HOH VA 12 .   ? 27.645  36.148  214.078 1.00 52.21  ? 706 HOH A O     1 
HETATM 8060 O  O     . HOH VA 12 .   ? 21.195  45.437  194.715 1.00 32.19  ? 707 HOH A O     1 
HETATM 8061 O  O     . HOH VA 12 .   ? 26.868  39.734  197.064 1.00 34.04  ? 708 HOH A O     1 
HETATM 8062 O  O     . HOH VA 12 .   ? -0.146  46.066  171.094 1.00 29.07  ? 709 HOH A O     1 
HETATM 8063 O  O     . HOH VA 12 .   ? 36.156  49.173  174.997 1.00 38.02  ? 710 HOH A O     1 
HETATM 8064 O  O     . HOH VA 12 .   ? 27.751  17.787  161.284 1.00 38.27  ? 711 HOH A O     1 
HETATM 8065 O  O     . HOH VA 12 .   ? 28.075  35.398  153.368 1.00 39.87  ? 712 HOH A O     1 
HETATM 8066 O  O     . HOH VA 12 .   ? 36.707  28.122  162.394 1.00 35.57  ? 713 HOH A O     1 
HETATM 8067 O  O     . HOH VA 12 .   ? 12.673  54.711  195.240 1.00 44.03  ? 714 HOH A O     1 
HETATM 8068 O  O     . HOH VA 12 .   ? 12.472  30.157  169.465 1.00 44.12  ? 715 HOH A O     1 
HETATM 8069 O  O     . HOH VA 12 .   ? 20.030  40.731  196.328 1.00 25.28  ? 716 HOH A O     1 
HETATM 8070 O  O     . HOH VA 12 .   ? 16.663  48.179  194.430 1.00 32.92  ? 717 HOH A O     1 
HETATM 8071 O  O     . HOH VA 12 .   ? 15.622  44.354  168.716 1.00 44.87  ? 718 HOH A O     1 
HETATM 8072 O  O     . HOH VA 12 .   ? -3.938  40.947  179.592 1.00 42.39  ? 719 HOH A O     1 
HETATM 8073 O  O     . HOH VA 12 .   ? 31.179  56.098  208.319 1.00 50.68  ? 720 HOH A O     1 
HETATM 8074 O  O     . HOH VA 12 .   ? 31.147  19.243  158.769 1.00 40.89  ? 721 HOH A O     1 
HETATM 8075 O  O     . HOH VA 12 .   ? 19.760  47.489  159.857 1.00 56.53  ? 722 HOH A O     1 
HETATM 8076 O  O     . HOH VA 12 .   ? 34.680  43.690  215.597 1.00 51.00  ? 723 HOH A O     1 
HETATM 8077 O  O     . HOH VA 12 .   ? 25.602  38.223  214.432 1.00 49.75  ? 724 HOH A O     1 
HETATM 8078 O  O     . HOH VA 12 .   ? 32.479  32.997  186.720 1.00 69.63  ? 725 HOH A O     1 
HETATM 8079 O  O     . HOH VA 12 .   ? 27.996  55.279  206.086 1.00 34.58  ? 726 HOH A O     1 
HETATM 8080 O  O     . HOH VA 12 .   ? 39.551  34.076  164.966 1.00 26.35  ? 727 HOH A O     1 
HETATM 8081 O  O     . HOH VA 12 .   ? 5.928   24.382  174.578 1.00 33.69  ? 728 HOH A O     1 
HETATM 8082 O  O     . HOH VA 12 .   ? 31.832  40.335  194.964 1.00 41.71  ? 729 HOH A O     1 
HETATM 8083 O  O     . HOH VA 12 .   ? 7.912   37.933  172.150 1.00 32.48  ? 730 HOH A O     1 
HETATM 8084 O  O     . HOH VA 12 .   ? 20.070  41.983  217.958 1.00 43.01  ? 731 HOH A O     1 
HETATM 8085 O  O     . HOH VA 12 .   ? 18.443  32.143  176.002 1.00 35.97  ? 732 HOH A O     1 
HETATM 8086 O  O     . HOH VA 12 .   ? 15.076  11.314  183.358 1.00 39.91  ? 733 HOH A O     1 
HETATM 8087 O  O     . HOH VA 12 .   ? 18.124  55.806  212.893 1.00 54.60  ? 734 HOH A O     1 
HETATM 8088 O  O     . HOH VA 12 .   ? 36.796  12.638  170.568 1.00 40.82  ? 735 HOH A O     1 
HETATM 8089 O  O     . HOH VA 12 .   ? 19.687  21.221  179.748 1.00 28.98  ? 736 HOH A O     1 
HETATM 8090 O  O     . HOH VA 12 .   ? 15.366  17.588  181.404 1.00 29.81  ? 737 HOH A O     1 
HETATM 8091 O  O     . HOH VA 12 .   ? 41.720  23.046  171.443 1.00 28.81  ? 738 HOH A O     1 
HETATM 8092 O  O     . HOH VA 12 .   ? 40.916  43.161  164.868 1.00 36.75  ? 739 HOH A O     1 
HETATM 8093 O  O     . HOH VA 12 .   ? 21.824  17.170  172.492 1.00 40.10  ? 740 HOH A O     1 
HETATM 8094 O  O     . HOH VA 12 .   ? 15.892  43.089  197.866 1.00 26.91  ? 741 HOH A O     1 
HETATM 8095 O  O     . HOH VA 12 .   ? 14.700  31.586  170.573 1.00 40.14  ? 742 HOH A O     1 
HETATM 8096 O  O     . HOH VA 12 .   ? 42.277  30.903  173.718 1.00 35.92  ? 743 HOH A O     1 
HETATM 8097 O  O     . HOH VA 12 .   ? 26.599  34.845  157.565 1.00 27.74  ? 744 HOH A O     1 
HETATM 8098 O  O     . HOH VA 12 .   ? 23.587  61.433  179.282 1.00 41.14  ? 745 HOH A O     1 
HETATM 8099 O  O     . HOH VA 12 .   ? 17.765  48.672  218.575 1.00 44.92  ? 746 HOH A O     1 
HETATM 8100 O  O     . HOH VA 12 .   ? 21.336  35.147  169.311 1.00 36.83  ? 747 HOH A O     1 
HETATM 8101 O  O     . HOH VA 12 .   ? 1.097   36.534  170.407 1.00 30.32  ? 748 HOH A O     1 
HETATM 8102 O  O     . HOH VA 12 .   ? 12.729  17.795  190.292 1.00 30.15  ? 749 HOH A O     1 
HETATM 8103 O  O     . HOH VA 12 .   ? 19.132  42.978  195.232 1.00 37.80  ? 750 HOH A O     1 
HETATM 8104 O  O     . HOH VA 12 .   ? 30.141  53.174  197.988 1.00 36.79  ? 751 HOH A O     1 
HETATM 8105 O  O     . HOH VA 12 .   ? 29.176  11.053  177.589 1.00 33.22  ? 752 HOH A O     1 
HETATM 8106 O  O     . HOH VA 12 .   ? 38.978  35.311  206.899 1.00 48.43  ? 753 HOH A O     1 
HETATM 8107 O  O     . HOH VA 12 .   ? 14.609  20.813  197.037 1.00 37.04  ? 754 HOH A O     1 
HETATM 8108 O  O     . HOH VA 12 .   ? 36.695  7.566   171.065 1.00 49.73  ? 755 HOH A O     1 
HETATM 8109 O  O     . HOH VA 12 .   ? 37.369  8.986   159.400 1.00 52.24  ? 756 HOH A O     1 
HETATM 8110 O  O     . HOH VA 12 .   ? 18.573  34.660  182.890 1.00 31.49  ? 757 HOH A O     1 
HETATM 8111 O  O     . HOH VA 12 .   ? 15.977  29.508  168.982 1.00 40.74  ? 758 HOH A O     1 
HETATM 8112 O  O     . HOH VA 12 .   ? 25.186  15.603  168.685 1.00 31.99  ? 759 HOH A O     1 
HETATM 8113 O  O     . HOH VA 12 .   ? 18.697  20.894  197.840 1.00 33.61  ? 760 HOH A O     1 
HETATM 8114 O  O     . HOH VA 12 .   ? 11.894  55.301  209.766 1.00 50.69  ? 761 HOH A O     1 
HETATM 8115 O  O     . HOH VA 12 .   ? 15.961  24.174  168.368 1.00 40.20  ? 762 HOH A O     1 
HETATM 8116 O  O     . HOH VA 12 .   ? 15.442  44.793  194.427 1.00 32.70  ? 763 HOH A O     1 
HETATM 8117 O  O     . HOH VA 12 .   ? 0.944   32.489  175.236 1.00 30.53  ? 764 HOH A O     1 
HETATM 8118 O  O     . HOH VA 12 .   ? 24.978  59.442  180.517 1.00 49.74  ? 765 HOH A O     1 
HETATM 8119 O  O     . HOH VA 12 .   ? 34.612  46.566  199.300 1.00 38.68  ? 766 HOH A O     1 
HETATM 8120 O  O     . HOH VA 12 .   ? 18.553  50.026  170.471 1.00 31.76  ? 767 HOH A O     1 
HETATM 8121 O  O     . HOH VA 12 .   ? 23.923  31.506  174.859 1.00 42.36  ? 768 HOH A O     1 
HETATM 8122 O  O     . HOH VA 12 .   ? 39.270  42.254  169.074 1.00 52.18  ? 769 HOH A O     1 
HETATM 8123 O  O     . HOH VA 12 .   ? 13.649  45.242  213.427 1.00 33.07  ? 770 HOH A O     1 
HETATM 8124 O  O     . HOH VA 12 .   ? 26.982  38.443  150.681 1.00 45.07  ? 771 HOH A O     1 
HETATM 8125 O  O     . HOH VA 12 .   ? 29.849  56.918  177.927 1.00 39.43  ? 772 HOH A O     1 
HETATM 8126 O  O     . HOH VA 12 .   ? 10.058  46.606  200.691 1.00 32.77  ? 773 HOH A O     1 
HETATM 8127 O  O     . HOH VA 12 .   ? 16.712  47.721  170.389 1.00 42.44  ? 774 HOH A O     1 
HETATM 8128 O  O     . HOH VA 12 .   ? 40.736  27.268  163.797 1.00 30.85  ? 775 HOH A O     1 
HETATM 8129 O  O     . HOH VA 12 .   ? 15.452  48.753  176.341 1.00 54.17  ? 776 HOH A O     1 
HETATM 8130 O  O     . HOH VA 12 .   ? 16.692  10.779  186.968 1.00 41.87  ? 777 HOH A O     1 
HETATM 8131 O  O     . HOH VA 12 .   ? 21.271  30.959  190.484 1.00 34.23  ? 778 HOH A O     1 
HETATM 8132 O  O     . HOH VA 12 .   ? 22.172  41.751  175.537 1.00 36.74  ? 779 HOH A O     1 
HETATM 8133 O  O     . HOH VA 12 .   ? 19.960  38.161  173.617 1.00 45.48  ? 780 HOH A O     1 
HETATM 8134 O  O     . HOH VA 12 .   ? 8.554   43.357  205.835 1.00 43.46  ? 781 HOH A O     1 
HETATM 8135 O  O     . HOH VA 12 .   ? 5.581   14.694  181.907 1.00 53.25  ? 782 HOH A O     1 
HETATM 8136 O  O     . HOH VA 12 .   ? 9.792   28.245  174.356 1.00 23.48  ? 783 HOH A O     1 
HETATM 8137 O  O     . HOH VA 12 .   ? 0.712   34.507  179.751 1.00 26.99  ? 784 HOH A O     1 
HETATM 8138 O  O     . HOH VA 12 .   ? 4.777   47.652  198.425 1.00 41.20  ? 785 HOH A O     1 
HETATM 8139 O  O     . HOH VA 12 .   ? 42.248  17.934  172.113 1.00 44.55  ? 786 HOH A O     1 
HETATM 8140 O  O     . HOH VA 12 .   ? 11.070  43.228  203.203 1.00 37.40  ? 787 HOH A O     1 
HETATM 8141 O  O     . HOH VA 12 .   ? 41.789  28.640  175.326 1.00 40.74  ? 788 HOH A O     1 
HETATM 8142 O  O     . HOH VA 12 .   ? 25.560  60.564  162.474 1.00 52.18  ? 789 HOH A O     1 
HETATM 8143 O  O     . HOH VA 12 .   ? 44.215  35.267  169.214 1.00 43.12  ? 790 HOH A O     1 
HETATM 8144 O  O     . HOH VA 12 .   ? 21.254  31.528  177.538 1.00 29.33  ? 791 HOH A O     1 
HETATM 8145 O  O     . HOH VA 12 .   ? 40.186  25.543  181.900 1.00 49.86  ? 792 HOH A O     1 
HETATM 8146 O  O     . HOH VA 12 .   ? 13.394  20.974  194.325 1.00 38.70  ? 793 HOH A O     1 
HETATM 8147 O  O     . HOH VA 12 .   ? 36.832  64.192  167.391 1.00 52.55  ? 794 HOH A O     1 
HETATM 8148 O  O     . HOH VA 12 .   ? 9.707   27.318  195.929 1.00 41.82  ? 795 HOH A O     1 
HETATM 8149 O  O     . HOH VA 12 .   ? 20.657  35.051  181.230 1.00 41.18  ? 796 HOH A O     1 
HETATM 8150 O  O     . HOH VA 12 .   ? 21.863  54.905  160.855 1.00 48.04  ? 797 HOH A O     1 
HETATM 8151 O  O     . HOH VA 12 .   ? 22.418  27.823  168.627 1.00 23.82  ? 798 HOH A O     1 
HETATM 8152 O  O     . HOH VA 12 .   ? 19.126  44.360  175.694 1.00 39.06  ? 799 HOH A O     1 
HETATM 8153 O  O     . HOH VA 12 .   ? 12.422  48.909  192.043 1.00 40.61  ? 800 HOH A O     1 
HETATM 8154 O  O     . HOH VA 12 .   ? 0.977   19.743  181.072 1.00 45.25  ? 801 HOH A O     1 
HETATM 8155 O  O     . HOH VA 12 .   ? 16.131  49.729  162.366 1.00 46.34  ? 802 HOH A O     1 
HETATM 8156 O  O     . HOH VA 12 .   ? 18.966  53.052  201.117 1.00 43.70  ? 803 HOH A O     1 
HETATM 8157 O  O     . HOH VA 12 .   ? 23.208  32.349  179.254 1.00 39.08  ? 804 HOH A O     1 
HETATM 8158 O  O     . HOH VA 12 .   ? -2.397  29.276  190.087 1.00 41.72  ? 805 HOH A O     1 
HETATM 8159 O  O     . HOH VA 12 .   ? 0.232   26.049  189.503 1.00 39.75  ? 806 HOH A O     1 
HETATM 8160 O  O     . HOH VA 12 .   ? -1.087  36.858  179.247 1.00 45.20  ? 807 HOH A O     1 
HETATM 8161 O  O     . HOH VA 12 .   ? 14.743  55.266  173.500 1.00 39.98  ? 808 HOH A O     1 
HETATM 8162 O  O     . HOH VA 12 .   ? 26.433  32.823  159.305 1.00 31.68  ? 809 HOH A O     1 
HETATM 8163 O  O     . HOH VA 12 .   ? 31.456  55.538  203.268 1.00 40.87  ? 810 HOH A O     1 
HETATM 8164 O  O     . HOH VA 12 .   ? 0.119   46.629  178.197 1.00 37.50  ? 811 HOH A O     1 
HETATM 8165 O  O     . HOH VA 12 .   ? 49.193  20.977  161.328 1.00 46.95  ? 812 HOH A O     1 
HETATM 8166 O  O     . HOH VA 12 .   ? 30.578  34.199  152.861 1.00 34.11  ? 813 HOH A O     1 
HETATM 8167 O  O     . HOH VA 12 .   ? 42.413  24.958  163.761 1.00 31.98  ? 814 HOH A O     1 
HETATM 8168 O  O     . HOH VA 12 .   ? 23.527  18.358  174.355 1.00 24.77  ? 815 HOH A O     1 
HETATM 8169 O  O     . HOH VA 12 .   ? 42.896  35.142  160.245 1.00 37.62  ? 816 HOH A O     1 
HETATM 8170 O  O     . HOH VA 12 .   ? 33.433  38.694  149.780 1.00 31.62  ? 817 HOH A O     1 
HETATM 8171 O  O     . HOH VA 12 .   ? 6.786   52.404  202.534 1.00 53.51  ? 818 HOH A O     1 
HETATM 8172 O  O     . HOH VA 12 .   ? 19.821  44.484  180.741 1.00 41.64  ? 819 HOH A O     1 
HETATM 8173 O  O     . HOH VA 12 .   ? -1.390  39.248  169.584 1.00 24.44  ? 820 HOH A O     1 
HETATM 8174 O  O     . HOH VA 12 .   ? 45.728  42.701  157.312 1.00 51.30  ? 821 HOH A O     1 
HETATM 8175 O  O     . HOH VA 12 .   ? 40.286  5.862   161.064 1.00 69.11  ? 822 HOH A O     1 
HETATM 8176 O  O     . HOH VA 12 .   ? 36.827  35.319  211.573 1.00 44.64  ? 823 HOH A O     1 
HETATM 8177 O  O     . HOH VA 12 .   ? 35.510  38.958  162.791 1.00 24.81  ? 824 HOH A O     1 
HETATM 8178 O  O     . HOH VA 12 .   ? 16.369  15.030  180.930 1.00 33.72  ? 825 HOH A O     1 
HETATM 8179 O  O     . HOH VA 12 .   ? 23.770  35.387  201.086 1.00 46.18  ? 826 HOH A O     1 
HETATM 8180 O  O     . HOH VA 12 .   ? 37.368  37.824  164.660 1.00 26.35  ? 827 HOH A O     1 
HETATM 8181 O  O     . HOH VA 12 .   ? 19.783  11.793  187.017 1.00 33.03  ? 828 HOH A O     1 
HETATM 8182 O  O     . HOH VA 12 .   ? 1.272   22.236  184.820 1.00 40.04  ? 829 HOH A O     1 
HETATM 8183 O  O     . HOH VA 12 .   ? 35.762  61.494  167.967 1.00 46.62  ? 830 HOH A O     1 
HETATM 8184 O  O     . HOH VA 12 .   ? 12.346  39.047  183.972 1.00 35.24  ? 831 HOH A O     1 
HETATM 8185 O  O     . HOH VA 12 .   ? 33.504  42.707  170.967 1.00 42.35  ? 832 HOH A O     1 
HETATM 8186 O  O     . HOH VA 12 .   ? 34.353  52.287  209.103 1.00 47.81  ? 833 HOH A O     1 
HETATM 8187 O  O     . HOH VA 12 .   ? 21.823  36.696  171.855 1.00 32.05  ? 834 HOH A O     1 
HETATM 8188 O  O     . HOH VA 12 .   ? 10.571  17.453  191.718 1.00 38.76  ? 835 HOH A O     1 
HETATM 8189 O  O     . HOH VA 12 .   ? 18.193  54.409  186.483 1.00 55.19  ? 836 HOH A O     1 
HETATM 8190 O  O     . HOH VA 12 .   ? 43.085  26.026  170.816 1.00 29.54  ? 837 HOH A O     1 
HETATM 8191 O  O     . HOH VA 12 .   ? 41.964  39.168  167.563 1.00 40.16  ? 838 HOH A O     1 
HETATM 8192 O  O     . HOH VA 12 .   ? 22.327  24.017  198.333 1.00 45.17  ? 839 HOH A O     1 
HETATM 8193 O  O     . HOH VA 12 .   ? 30.105  51.826  165.786 1.00 34.05  ? 840 HOH A O     1 
HETATM 8194 O  O     . HOH VA 12 .   ? 37.573  36.410  154.320 1.00 25.62  ? 841 HOH A O     1 
HETATM 8195 O  O     . HOH VA 12 .   ? 31.371  53.295  167.865 1.00 39.01  ? 842 HOH A O     1 
HETATM 8196 O  O     . HOH VA 12 .   ? -2.472  31.920  180.828 1.00 32.66  ? 843 HOH A O     1 
HETATM 8197 O  O     . HOH VA 12 .   ? 17.308  32.936  170.655 1.00 38.19  ? 844 HOH A O     1 
HETATM 8198 O  O     . HOH VA 12 .   ? 28.116  31.191  157.902 1.00 31.63  ? 845 HOH A O     1 
HETATM 8199 O  O     . HOH VA 12 .   ? 21.560  35.509  201.067 1.00 45.52  ? 846 HOH A O     1 
HETATM 8200 O  O     . HOH VA 12 .   ? 43.459  40.549  158.908 1.00 45.65  ? 847 HOH A O     1 
HETATM 8201 O  O     . HOH VA 12 .   ? -2.733  32.157  189.340 1.00 41.33  ? 848 HOH A O     1 
HETATM 8202 O  O     . HOH VA 12 .   ? 29.529  58.018  161.444 1.00 34.46  ? 849 HOH A O     1 
HETATM 8203 O  O     . HOH VA 12 .   ? 17.232  32.026  181.936 1.00 39.47  ? 850 HOH A O     1 
HETATM 8204 O  O     . HOH VA 12 .   ? 39.069  29.651  162.136 1.00 41.73  ? 851 HOH A O     1 
HETATM 8205 O  O     . HOH VA 12 .   ? 35.720  23.162  160.586 1.00 30.33  ? 852 HOH A O     1 
HETATM 8206 O  O     . HOH VA 12 .   ? 14.839  47.313  162.761 1.00 42.92  ? 853 HOH A O     1 
HETATM 8207 O  O     . HOH VA 12 .   ? 33.649  29.224  162.777 1.00 23.90  ? 854 HOH A O     1 
HETATM 8208 O  O     . HOH VA 12 .   ? 36.048  30.105  163.412 1.00 33.04  ? 855 HOH A O     1 
HETATM 8209 O  O     . HOH VA 12 .   ? 34.069  40.967  153.385 1.00 38.18  ? 856 HOH A O     1 
HETATM 8210 O  O     . HOH VA 12 .   ? 27.730  19.785  194.910 1.00 34.76  ? 857 HOH A O     1 
HETATM 8211 O  O     . HOH VA 12 .   ? 7.611   44.813  177.332 1.00 53.13  ? 858 HOH A O     1 
HETATM 8212 O  O     . HOH VA 12 .   ? 27.955  38.549  172.468 1.00 24.64  ? 859 HOH A O     1 
HETATM 8213 O  O     . HOH VA 12 .   ? 25.211  26.389  161.394 1.00 27.52  ? 860 HOH A O     1 
HETATM 8214 O  O     . HOH VA 12 .   ? 32.923  38.568  174.159 1.00 36.53  ? 861 HOH A O     1 
HETATM 8215 O  O     . HOH VA 12 .   ? 17.227  51.795  212.555 1.00 40.76  ? 862 HOH A O     1 
HETATM 8216 O  O     . HOH VA 12 .   ? 13.129  28.169  171.046 1.00 34.68  ? 863 HOH A O     1 
HETATM 8217 O  O     . HOH VA 12 .   ? 38.289  39.762  166.242 1.00 28.19  ? 864 HOH A O     1 
HETATM 8218 O  O     . HOH VA 12 .   ? 14.746  54.036  205.889 1.00 41.86  ? 865 HOH A O     1 
HETATM 8219 O  O     . HOH VA 12 .   ? 19.707  24.678  196.953 1.00 35.30  ? 866 HOH A O     1 
HETATM 8220 O  O     . HOH VA 12 .   ? 1.982   44.450  172.275 1.00 36.29  ? 867 HOH A O     1 
HETATM 8221 O  O     . HOH VA 12 .   ? 12.644  50.644  215.048 1.00 56.20  ? 868 HOH A O     1 
HETATM 8222 O  O     . HOH VA 12 .   ? 6.843   46.329  196.679 1.00 34.90  ? 869 HOH A O     1 
HETATM 8223 O  O     . HOH VA 12 .   ? 40.530  40.087  214.901 1.00 51.28  ? 870 HOH A O     1 
HETATM 8224 O  O     . HOH VA 12 .   ? 22.717  34.409  176.135 1.00 57.31  ? 871 HOH A O     1 
HETATM 8225 O  O     . HOH VA 12 .   ? 26.920  28.208  158.300 1.00 48.44  ? 872 HOH A O     1 
HETATM 8226 O  O     . HOH VA 12 .   ? 28.312  45.600  200.053 1.00 33.67  ? 873 HOH A O     1 
HETATM 8227 O  O     . HOH VA 12 .   ? 17.708  37.200  184.180 1.00 24.11  ? 874 HOH A O     1 
HETATM 8228 O  O     . HOH VA 12 .   ? 17.829  19.506  178.637 1.00 37.41  ? 875 HOH A O     1 
HETATM 8229 O  O     . HOH VA 12 .   ? -3.351  27.587  179.828 1.00 43.62  ? 876 HOH A O     1 
HETATM 8230 O  O     . HOH VA 12 .   ? 23.412  35.069  173.467 1.00 36.39  ? 877 HOH A O     1 
HETATM 8231 O  O     . HOH VA 12 .   ? 40.321  40.291  165.517 1.00 30.58  ? 878 HOH A O     1 
HETATM 8232 O  O     . HOH VA 12 .   ? 34.018  33.617  210.494 1.00 55.21  ? 879 HOH A O     1 
HETATM 8233 O  O     . HOH VA 12 .   ? 18.240  45.599  169.189 1.00 30.54  ? 880 HOH A O     1 
HETATM 8234 O  O     . HOH VA 12 .   ? 30.260  31.872  153.640 1.00 25.75  ? 881 HOH A O     1 
HETATM 8235 O  O     . HOH VA 12 .   ? 27.732  59.553  162.784 1.00 41.09  ? 882 HOH A O     1 
HETATM 8236 O  O     . HOH VA 12 .   ? 41.750  38.459  171.559 1.00 34.00  ? 883 HOH A O     1 
HETATM 8237 O  O     . HOH VA 12 .   ? -3.225  34.155  182.364 1.00 50.43  ? 884 HOH A O     1 
HETATM 8238 O  O     . HOH VA 12 .   ? 34.848  40.098  172.850 1.00 43.01  ? 885 HOH A O     1 
HETATM 8239 O  O     . HOH VA 12 .   ? 16.715  29.831  192.393 1.00 28.80  ? 886 HOH A O     1 
HETATM 8240 O  O     . HOH VA 12 .   ? 37.563  19.875  158.769 1.00 32.34  ? 887 HOH A O     1 
HETATM 8241 O  O     . HOH VA 12 .   ? 14.326  32.189  181.578 1.00 17.03  ? 888 HOH A O     1 
HETATM 8242 O  O     . HOH VA 12 .   ? 31.553  27.855  187.108 1.00 46.01  ? 889 HOH A O     1 
HETATM 8243 O  O     . HOH VA 12 .   ? 33.388  12.297  180.710 1.00 48.22  ? 890 HOH A O     1 
HETATM 8244 O  O     . HOH VA 12 .   ? 32.261  24.900  200.704 1.00 53.11  ? 891 HOH A O     1 
HETATM 8245 O  O     . HOH VA 12 .   ? 28.651  54.559  156.958 1.00 44.40  ? 892 HOH A O     1 
HETATM 8246 O  O     . HOH VA 12 .   ? 27.474  43.151  199.564 1.00 33.42  ? 893 HOH A O     1 
HETATM 8247 O  O     . HOH VA 12 .   ? 8.334   38.888  168.724 1.00 30.18  ? 894 HOH A O     1 
HETATM 8248 O  O     . HOH VA 12 .   ? 38.542  51.209  197.125 1.00 45.23  ? 895 HOH A O     1 
HETATM 8249 O  O     . HOH VA 12 .   ? 10.568  40.268  182.567 1.00 35.25  ? 896 HOH A O     1 
HETATM 8250 O  O     . HOH VA 12 .   ? 26.423  57.533  178.261 1.00 44.63  ? 897 HOH A O     1 
HETATM 8251 O  O     . HOH VA 12 .   ? 24.527  29.080  186.695 1.00 39.88  ? 898 HOH A O     1 
HETATM 8252 O  O     . HOH VA 12 .   ? 27.272  50.015  178.478 1.00 57.02  ? 899 HOH A O     1 
HETATM 8253 O  O     . HOH VA 12 .   ? 29.437  27.827  152.098 1.00 44.63  ? 900 HOH A O     1 
HETATM 8254 O  O     . HOH VA 12 .   ? 6.559   15.771  177.774 1.00 48.27  ? 901 HOH A O     1 
HETATM 8255 O  O     . HOH VA 12 .   ? 31.575  11.226  177.952 1.00 29.11  ? 902 HOH A O     1 
HETATM 8256 O  O     . HOH VA 12 .   ? -0.374  33.552  177.382 1.00 28.19  ? 903 HOH A O     1 
HETATM 8257 O  O     . HOH VA 12 .   ? 20.487  27.190  161.098 1.00 41.29  ? 904 HOH A O     1 
HETATM 8258 O  O     . HOH VA 12 .   ? 23.715  35.731  157.688 1.00 39.55  ? 905 HOH A O     1 
HETATM 8259 O  O     . HOH VA 12 .   ? 39.736  49.041  171.868 1.00 49.15  ? 906 HOH A O     1 
HETATM 8260 O  O     . HOH VA 12 .   ? 21.989  39.020  174.933 1.00 51.90  ? 907 HOH A O     1 
HETATM 8261 O  O     . HOH VA 12 .   ? 37.267  20.085  184.368 1.00 45.62  ? 908 HOH A O     1 
HETATM 8262 O  O     . HOH VA 12 .   ? 8.141   25.110  173.696 1.00 39.39  ? 909 HOH A O     1 
HETATM 8263 O  O     . HOH VA 12 .   ? 37.946  26.366  205.303 1.00 54.04  ? 910 HOH A O     1 
HETATM 8264 O  O     . HOH VA 12 .   ? 18.946  46.725  193.605 1.00 43.20  ? 911 HOH A O     1 
HETATM 8265 O  O     . HOH VA 12 .   ? 10.085  45.444  203.016 1.00 42.46  ? 912 HOH A O     1 
HETATM 8266 O  O     . HOH VA 12 .   ? 11.041  15.572  193.460 1.00 39.67  ? 913 HOH A O     1 
HETATM 8267 O  O     . HOH VA 12 .   ? 12.517  53.529  174.252 1.00 54.39  ? 914 HOH A O     1 
HETATM 8268 O  O     . HOH VA 12 .   ? 14.514  50.558  174.219 1.00 40.23  ? 915 HOH A O     1 
HETATM 8269 O  O     . HOH VA 12 .   ? 50.257  60.269  163.883 1.00 55.61  ? 916 HOH A O     1 
HETATM 8270 O  O     . HOH VA 12 .   ? 19.267  31.165  192.188 1.00 39.92  ? 917 HOH A O     1 
HETATM 8271 O  O     . HOH VA 12 .   ? 13.341  56.554  171.306 1.00 45.87  ? 918 HOH A O     1 
HETATM 8272 O  O     . HOH VA 12 .   ? 5.874   22.845  172.643 1.00 40.42  ? 919 HOH A O     1 
HETATM 8273 O  O     . HOH VA 12 .   ? 28.444  44.006  196.176 1.00 46.15  ? 920 HOH A O     1 
HETATM 8274 O  O     . HOH VA 12 .   ? 31.024  19.779  192.427 1.00 24.76  ? 921 HOH A O     1 
HETATM 8275 O  O     . HOH VA 12 .   ? 28.580  50.931  216.906 1.00 55.25  ? 922 HOH A O     1 
HETATM 8276 O  O     . HOH VA 12 .   ? 31.070  29.983  151.833 1.00 27.27  ? 923 HOH A O     1 
HETATM 8277 O  O     . HOH VA 12 .   ? 26.439  42.388  217.200 1.00 23.78  ? 924 HOH A O     1 
HETATM 8278 O  O     . HOH VA 12 .   ? -3.476  36.032  180.308 1.00 45.89  ? 925 HOH A O     1 
HETATM 8279 O  O     . HOH VA 12 .   ? 14.554  46.913  192.815 1.00 35.51  ? 926 HOH A O     1 
HETATM 8280 O  O     . HOH VA 12 .   ? 28.058  46.035  218.545 1.00 50.34  ? 927 HOH A O     1 
HETATM 8281 O  O     . HOH VA 12 .   ? 29.647  27.648  192.620 1.00 45.23  ? 928 HOH A O     1 
HETATM 8282 O  O     . HOH VA 12 .   ? 33.528  55.030  209.348 1.00 45.59  ? 929 HOH A O     1 
HETATM 8283 O  O     . HOH VA 12 .   ? 30.121  48.536  195.776 1.00 42.84  ? 930 HOH A O     1 
HETATM 8284 O  O     . HOH VA 12 .   ? -4.842  42.880  174.929 1.00 40.31  ? 931 HOH A O     1 
HETATM 8285 O  O     . HOH VA 12 .   ? 35.974  31.608  210.133 1.00 56.67  ? 932 HOH A O     1 
HETATM 8286 O  O     . HOH VA 12 .   ? 27.774  48.432  217.823 1.00 59.95  ? 933 HOH A O     1 
HETATM 8287 O  O     . HOH VA 12 .   ? 28.465  19.732  159.766 1.00 55.01  ? 934 HOH A O     1 
HETATM 8288 O  O     . HOH VA 12 .   ? 33.849  40.549  147.645 1.00 33.28  ? 935 HOH A O     1 
HETATM 8289 O  O     . HOH VA 12 .   ? 26.507  33.756  155.019 1.00 29.44  ? 936 HOH A O     1 
HETATM 8290 O  O     . HOH VA 12 .   ? 44.550  35.612  157.969 1.00 48.11  ? 937 HOH A O     1 
HETATM 8291 O  O     . HOH VA 12 .   ? 1.342   29.017  195.610 1.00 51.34  ? 938 HOH A O     1 
HETATM 8292 O  O     . HOH VA 12 .   ? 30.334  56.449  205.615 1.00 44.04  ? 939 HOH A O     1 
HETATM 8293 O  O     . HOH VA 12 .   ? 14.222  22.336  198.865 1.00 39.47  ? 940 HOH A O     1 
HETATM 8294 O  O     . HOH VA 12 .   ? 17.940  53.663  214.616 1.00 47.83  ? 941 HOH A O     1 
HETATM 8295 O  O     . HOH VA 12 .   ? 36.476  36.157  177.216 1.00 57.79  ? 942 HOH A O     1 
HETATM 8296 O  O     . HOH VA 12 .   ? 28.079  31.580  155.176 1.00 32.01  ? 943 HOH A O     1 
HETATM 8297 O  O     . HOH WA 12 .   ? 28.893  1.878   203.437 1.00 30.51  ? 701 HOH B O     1 
HETATM 8298 O  O     . HOH WA 12 .   ? 16.692  16.416  206.877 1.00 29.75  ? 702 HOH B O     1 
HETATM 8299 O  O     . HOH WA 12 .   ? 22.658  41.628  229.403 1.00 44.11  ? 703 HOH B O     1 
HETATM 8300 O  O     . HOH WA 12 .   ? 13.106  38.725  246.236 1.00 52.83  ? 704 HOH B O     1 
HETATM 8301 O  O     . HOH WA 12 .   ? 22.590  14.980  209.911 1.00 38.82  ? 705 HOH B O     1 
HETATM 8302 O  O     . HOH WA 12 .   ? 9.989   2.794   203.423 1.00 49.37  ? 706 HOH B O     1 
HETATM 8303 O  O     . HOH WA 12 .   ? 29.207  15.228  189.397 1.00 39.33  ? 707 HOH B O     1 
HETATM 8304 O  O     . HOH WA 12 .   ? 31.844  4.060   192.593 1.00 44.84  ? 708 HOH B O     1 
HETATM 8305 O  O     . HOH WA 12 .   ? 6.911   25.472  226.951 1.00 48.68  ? 709 HOH B O     1 
HETATM 8306 O  O     . HOH WA 12 .   ? 2.667   31.628  242.596 1.00 40.06  ? 710 HOH B O     1 
HETATM 8307 O  O     . HOH WA 12 .   ? 4.766   41.313  232.413 1.00 41.61  ? 711 HOH B O     1 
HETATM 8308 O  O     . HOH WA 12 .   ? 9.185   24.110  198.884 1.00 40.98  ? 712 HOH B O     1 
HETATM 8309 O  O     . HOH WA 12 .   ? 8.495   -11.216 230.895 1.00 46.73  ? 713 HOH B O     1 
HETATM 8310 O  O     . HOH WA 12 .   ? 9.413   -4.133  222.613 1.00 44.34  ? 714 HOH B O     1 
HETATM 8311 O  O     . HOH WA 12 .   ? 7.593   4.322   200.465 1.00 40.66  ? 715 HOH B O     1 
HETATM 8312 O  O     . HOH WA 12 .   ? 22.808  17.459  210.209 1.00 35.97  ? 716 HOH B O     1 
HETATM 8313 O  O     . HOH WA 12 .   ? 39.281  7.555   199.793 1.00 58.36  ? 717 HOH B O     1 
HETATM 8314 O  O     . HOH WA 12 .   ? 16.789  12.001  208.815 1.00 41.07  ? 718 HOH B O     1 
HETATM 8315 O  O     . HOH WA 12 .   ? 14.066  32.611  203.226 1.00 34.42  ? 719 HOH B O     1 
HETATM 8316 O  O     . HOH WA 12 .   ? 38.155  22.090  209.285 1.00 49.57  ? 720 HOH B O     1 
HETATM 8317 O  O     . HOH WA 12 .   ? 3.007   16.127  249.890 1.00 58.19  ? 721 HOH B O     1 
HETATM 8318 O  O     . HOH WA 12 .   ? 3.909   -9.435  243.569 1.00 41.83  ? 722 HOH B O     1 
HETATM 8319 O  O     . HOH WA 12 .   ? 43.935  17.911  203.731 1.00 62.66  ? 723 HOH B O     1 
HETATM 8320 O  O     . HOH WA 12 .   ? -0.059  22.255  242.379 1.00 48.07  ? 724 HOH B O     1 
HETATM 8321 O  O     . HOH WA 12 .   ? 24.814  1.136   192.255 1.00 48.45  ? 725 HOH B O     1 
HETATM 8322 O  O     . HOH WA 12 .   ? 0.683   7.349   227.249 1.00 42.84  ? 726 HOH B O     1 
HETATM 8323 O  O     . HOH WA 12 .   ? 24.612  32.096  230.528 1.00 46.73  ? 727 HOH B O     1 
HETATM 8324 O  O     . HOH WA 12 .   ? 12.766  36.715  203.149 1.00 37.60  ? 728 HOH B O     1 
HETATM 8325 O  O     . HOH WA 12 .   ? 6.477   15.453  225.144 1.00 39.51  ? 729 HOH B O     1 
HETATM 8326 O  O     . HOH WA 12 .   ? 20.328  40.316  240.429 1.00 63.47  ? 730 HOH B O     1 
HETATM 8327 O  O     . HOH WA 12 .   ? 12.821  9.240   206.476 1.00 35.98  ? 731 HOH B O     1 
HETATM 8328 O  O     . HOH WA 12 .   ? 13.373  14.160  196.180 1.00 37.56  ? 732 HOH B O     1 
HETATM 8329 O  O     . HOH WA 12 .   ? 4.807   -0.801  240.897 1.00 47.13  ? 733 HOH B O     1 
HETATM 8330 O  O     . HOH WA 12 .   ? -3.265  31.370  200.784 1.00 48.04  ? 734 HOH B O     1 
HETATM 8331 O  O     . HOH WA 12 .   ? 32.792  0.918   203.643 1.00 50.16  ? 735 HOH B O     1 
HETATM 8332 O  O     . HOH WA 12 .   ? 21.671  37.902  212.957 1.00 38.05  ? 736 HOH B O     1 
HETATM 8333 O  O     . HOH WA 12 .   ? 22.023  21.679  204.591 1.00 51.52  ? 737 HOH B O     1 
HETATM 8334 O  O     . HOH WA 12 .   ? 29.531  -3.108  198.754 1.00 45.26  ? 738 HOH B O     1 
HETATM 8335 O  O     . HOH WA 12 .   ? 8.341   46.534  212.462 1.00 43.24  ? 739 HOH B O     1 
HETATM 8336 O  O     . HOH WA 12 .   ? 16.549  32.573  206.426 1.00 42.39  ? 740 HOH B O     1 
HETATM 8337 O  O     . HOH WA 12 .   ? 10.420  36.234  204.330 1.00 40.96  ? 741 HOH B O     1 
HETATM 8338 O  O     . HOH WA 12 .   ? 1.586   13.443  199.781 1.00 45.77  ? 742 HOH B O     1 
HETATM 8339 O  O     . HOH WA 12 .   ? 32.391  13.727  191.411 1.00 41.91  ? 743 HOH B O     1 
HETATM 8340 O  O     . HOH WA 12 .   ? 12.108  3.152   207.173 1.00 40.74  ? 744 HOH B O     1 
HETATM 8341 O  O     . HOH WA 12 .   ? 4.032   39.721  216.345 1.00 36.39  ? 745 HOH B O     1 
HETATM 8342 O  O     . HOH WA 12 .   ? 14.525  4.557   207.570 1.00 36.53  ? 746 HOH B O     1 
HETATM 8343 O  O     . HOH WA 12 .   ? 6.956   12.480  219.184 1.00 47.03  ? 747 HOH B O     1 
HETATM 8344 O  O     . HOH WA 12 .   ? 19.845  34.512  239.842 1.00 37.93  ? 748 HOH B O     1 
HETATM 8345 O  O     . HOH WA 12 .   ? 7.394   20.885  251.126 1.00 48.31  ? 749 HOH B O     1 
HETATM 8346 O  O     . HOH WA 12 .   ? 7.210   39.539  207.508 1.00 31.53  ? 750 HOH B O     1 
HETATM 8347 O  O     . HOH WA 12 .   ? 30.249  1.567   207.754 1.00 40.92  ? 751 HOH B O     1 
HETATM 8348 O  O     . HOH WA 12 .   ? 14.885  23.468  243.775 1.00 42.66  ? 752 HOH B O     1 
HETATM 8349 O  O     . HOH WA 12 .   ? 16.069  14.034  244.282 1.00 50.24  ? 753 HOH B O     1 
HETATM 8350 O  O     . HOH WA 12 .   ? 43.113  4.780   210.994 1.00 60.95  ? 754 HOH B O     1 
HETATM 8351 O  O     . HOH WA 12 .   ? 15.410  14.212  207.324 1.00 32.35  ? 755 HOH B O     1 
HETATM 8352 O  O     . HOH WA 12 .   ? 7.768   22.533  217.179 1.00 40.12  ? 756 HOH B O     1 
HETATM 8353 O  O     . HOH WA 12 .   ? 21.092  38.439  238.739 1.00 61.85  ? 757 HOH B O     1 
HETATM 8354 O  O     . HOH WA 12 .   ? 1.924   21.962  230.197 1.00 51.11  ? 758 HOH B O     1 
HETATM 8355 O  O     . HOH WA 12 .   ? 30.286  10.716  212.802 1.00 36.42  ? 759 HOH B O     1 
HETATM 8356 O  O     . HOH WA 12 .   ? 16.367  36.402  204.863 1.00 38.48  ? 760 HOH B O     1 
HETATM 8357 O  O     . HOH WA 12 .   ? 6.678   36.156  220.320 1.00 43.77  ? 761 HOH B O     1 
HETATM 8358 O  O     . HOH WA 12 .   ? 41.088  10.941  205.653 1.00 44.49  ? 762 HOH B O     1 
HETATM 8359 O  O     . HOH WA 12 .   ? 10.971  45.536  214.201 1.00 39.78  ? 763 HOH B O     1 
HETATM 8360 O  O     . HOH WA 12 .   ? 21.432  12.006  189.278 1.00 29.28  ? 764 HOH B O     1 
HETATM 8361 O  O     . HOH WA 12 .   ? 20.643  31.838  241.077 1.00 40.84  ? 765 HOH B O     1 
HETATM 8362 O  O     . HOH WA 12 .   ? 4.274   -2.436  238.775 1.00 41.91  ? 766 HOH B O     1 
HETATM 8363 O  O     . HOH WA 12 .   ? -9.244  33.556  207.851 1.00 57.58  ? 767 HOH B O     1 
HETATM 8364 O  O     . HOH WA 12 .   ? 39.843  13.524  199.451 1.00 51.28  ? 768 HOH B O     1 
HETATM 8365 O  O     . HOH WA 12 .   ? 6.458   25.666  222.929 1.00 42.16  ? 769 HOH B O     1 
HETATM 8366 O  O     . HOH WA 12 .   ? 16.070  -4.455  247.291 1.00 64.67  ? 770 HOH B O     1 
HETATM 8367 O  O     . HOH WA 12 .   ? 6.427   38.781  226.910 1.00 34.73  ? 771 HOH B O     1 
HETATM 8368 O  O     . HOH WA 12 .   ? 7.802   19.958  215.474 1.00 30.35  ? 772 HOH B O     1 
HETATM 8369 O  O     . HOH WA 12 .   ? 14.078  26.330  212.374 1.00 36.59  ? 773 HOH B O     1 
HETATM 8370 O  O     . HOH WA 12 .   ? -2.308  -5.833  229.833 1.00 55.91  ? 774 HOH B O     1 
HETATM 8371 O  O     . HOH WA 12 .   ? 11.720  12.396  205.758 1.00 27.93  ? 775 HOH B O     1 
HETATM 8372 O  O     . HOH WA 12 .   ? 11.429  -0.326  225.083 1.00 49.75  ? 776 HOH B O     1 
HETATM 8373 O  O     . HOH WA 12 .   ? -1.988  22.787  198.494 1.00 46.55  ? 777 HOH B O     1 
HETATM 8374 O  O     . HOH WA 12 .   ? 8.777   27.809  242.163 1.00 42.00  ? 778 HOH B O     1 
HETATM 8375 O  O     . HOH WA 12 .   ? 1.872   26.271  243.090 1.00 44.85  ? 779 HOH B O     1 
HETATM 8376 O  O     . HOH WA 12 .   ? -6.609  32.812  217.278 1.00 55.28  ? 780 HOH B O     1 
HETATM 8377 O  O     . HOH WA 12 .   ? 8.266   29.943  201.144 1.00 42.54  ? 781 HOH B O     1 
HETATM 8378 O  O     . HOH WA 12 .   ? 3.540   -4.980  213.468 1.00 50.10  ? 782 HOH B O     1 
HETATM 8379 O  O     . HOH WA 12 .   ? 2.676   29.411  230.972 1.00 39.33  ? 783 HOH B O     1 
HETATM 8380 O  O     . HOH WA 12 .   ? 10.878  10.739  197.611 1.00 36.12  ? 784 HOH B O     1 
HETATM 8381 O  O     . HOH WA 12 .   ? 0.914   30.666  238.616 1.00 41.80  ? 785 HOH B O     1 
HETATM 8382 O  O     . HOH WA 12 .   ? 25.685  11.677  208.588 1.00 38.63  ? 786 HOH B O     1 
HETATM 8383 O  O     . HOH WA 12 .   ? 4.678   42.171  217.242 1.00 48.99  ? 787 HOH B O     1 
HETATM 8384 O  O     . HOH WA 12 .   ? 3.963   20.572  228.124 1.00 44.72  ? 788 HOH B O     1 
HETATM 8385 O  O     . HOH WA 12 .   ? 25.494  16.869  214.743 1.00 43.83  ? 789 HOH B O     1 
HETATM 8386 O  O     . HOH WA 12 .   ? 7.627   5.493   237.691 1.00 41.00  ? 790 HOH B O     1 
HETATM 8387 O  O     . HOH WA 12 .   ? 25.947  4.143   211.391 1.00 39.34  ? 791 HOH B O     1 
HETATM 8388 O  O     . HOH WA 12 .   ? 17.790  36.931  207.197 1.00 13.99  ? 792 HOH B O     1 
HETATM 8389 O  O     . HOH WA 12 .   ? 18.056  15.506  210.930 1.00 46.02  ? 793 HOH B O     1 
HETATM 8390 O  O     . HOH WA 12 .   ? 23.943  5.441   192.234 1.00 33.57  ? 794 HOH B O     1 
HETATM 8391 O  O     . HOH WA 12 .   ? 27.905  8.498   187.291 1.00 38.51  ? 795 HOH B O     1 
HETATM 8392 O  O     . HOH WA 12 .   ? 8.058   31.435  245.115 1.00 39.99  ? 796 HOH B O     1 
HETATM 8393 O  O     . HOH WA 12 .   ? 21.674  26.768  238.370 1.00 40.20  ? 797 HOH B O     1 
HETATM 8394 O  O     . HOH WA 12 .   ? -0.303  -14.692 231.764 1.00 46.75  ? 798 HOH B O     1 
HETATM 8395 O  O     . HOH WA 12 .   ? 9.604   -5.164  227.254 1.00 57.39  ? 799 HOH B O     1 
HETATM 8396 O  O     . HOH WA 12 .   ? 7.576   19.740  229.140 1.00 48.62  ? 800 HOH B O     1 
HETATM 8397 O  O     . HOH WA 12 .   ? 20.308  19.120  239.315 1.00 46.93  ? 801 HOH B O     1 
HETATM 8398 O  O     . HOH WA 12 .   ? 29.877  27.772  210.194 1.00 55.67  ? 802 HOH B O     1 
HETATM 8399 O  O     . HOH WA 12 .   ? 18.644  4.130   202.319 1.00 44.04  ? 803 HOH B O     1 
HETATM 8400 O  O     . HOH WA 12 .   ? 17.890  8.171   233.430 1.00 52.48  ? 804 HOH B O     1 
HETATM 8401 O  O     . HOH WA 12 .   ? -0.467  34.198  232.856 1.00 51.22  ? 805 HOH B O     1 
HETATM 8402 O  O     . HOH WA 12 .   ? 8.552   34.230  245.283 1.00 48.45  ? 806 HOH B O     1 
HETATM 8403 O  O     . HOH WA 12 .   ? 12.914  19.313  242.710 1.00 44.83  ? 807 HOH B O     1 
HETATM 8404 O  O     . HOH WA 12 .   ? 5.042   -15.748 241.487 1.00 44.40  ? 808 HOH B O     1 
HETATM 8405 O  O     . HOH WA 12 .   ? 22.465  28.974  236.584 1.00 46.94  ? 809 HOH B O     1 
HETATM 8406 O  O     . HOH WA 12 .   ? 18.366  10.389  184.105 1.00 43.70  ? 810 HOH B O     1 
HETATM 8407 O  O     . HOH WA 12 .   ? -6.185  39.199  215.150 1.00 67.42  ? 811 HOH B O     1 
HETATM 8408 O  O     . HOH WA 12 .   ? 8.159   8.636   206.124 1.00 37.49  ? 812 HOH B O     1 
HETATM 8409 O  O     . HOH WA 12 .   ? 11.438  27.392  208.095 1.00 29.94  ? 813 HOH B O     1 
HETATM 8410 O  O     . HOH WA 12 .   ? 3.227   -14.005 226.267 1.00 38.51  ? 814 HOH B O     1 
HETATM 8411 O  O     . HOH WA 12 .   ? 40.314  18.281  225.056 1.00 82.61  ? 815 HOH B O     1 
HETATM 8412 O  O     . HOH WA 12 .   ? 34.437  18.637  221.952 1.00 72.17  ? 816 HOH B O     1 
HETATM 8413 O  O     . HOH WA 12 .   ? 9.332   18.671  230.923 1.00 34.62  ? 817 HOH B O     1 
HETATM 8414 O  O     . HOH WA 12 .   ? 15.196  21.712  249.581 1.00 49.84  ? 818 HOH B O     1 
HETATM 8415 O  O     . HOH WA 12 .   ? 12.615  13.765  192.559 1.00 38.37  ? 819 HOH B O     1 
HETATM 8416 O  O     . HOH WA 12 .   ? 20.686  23.752  245.867 1.00 48.31  ? 820 HOH B O     1 
HETATM 8417 O  O     . HOH WA 12 .   ? 10.426  18.531  243.278 1.00 37.68  ? 821 HOH B O     1 
HETATM 8418 O  O     . HOH WA 12 .   ? 38.487  11.935  225.035 1.00 74.79  ? 822 HOH B O     1 
HETATM 8419 O  O     . HOH WA 12 .   ? 1.002   24.643  241.217 1.00 47.99  ? 823 HOH B O     1 
HETATM 8420 O  O     . HOH WA 12 .   ? 17.945  3.218   196.147 1.00 35.75  ? 824 HOH B O     1 
HETATM 8421 O  O     . HOH WA 12 .   ? 4.363   37.566  220.047 1.00 42.91  ? 825 HOH B O     1 
HETATM 8422 O  O     . HOH WA 12 .   ? 23.326  37.286  226.849 1.00 46.90  ? 826 HOH B O     1 
HETATM 8423 O  O     . HOH WA 12 .   ? 6.035   11.016  198.965 1.00 33.75  ? 827 HOH B O     1 
HETATM 8424 O  O     . HOH WA 12 .   ? 15.534  20.666  200.960 1.00 44.00  ? 828 HOH B O     1 
HETATM 8425 O  O     . HOH WA 12 .   ? 9.731   2.655   213.822 1.00 47.37  ? 829 HOH B O     1 
HETATM 8426 O  O     . HOH WA 12 .   ? 1.449   -9.726  242.155 1.00 51.17  ? 830 HOH B O     1 
HETATM 8427 O  O     . HOH WA 12 .   ? 17.437  27.124  217.667 1.00 48.04  ? 831 HOH B O     1 
HETATM 8428 O  O     . HOH WA 12 .   ? 16.969  10.071  235.364 1.00 51.23  ? 832 HOH B O     1 
HETATM 8429 O  O     . HOH WA 12 .   ? 6.002   25.090  216.581 1.00 52.07  ? 833 HOH B O     1 
HETATM 8430 O  O     . HOH WA 12 .   ? 18.082  17.925  242.574 1.00 58.46  ? 834 HOH B O     1 
HETATM 8431 O  O     . HOH WA 12 .   ? 36.422  10.932  193.439 1.00 56.10  ? 835 HOH B O     1 
HETATM 8432 O  O     . HOH WA 12 .   ? 18.679  2.813   198.897 1.00 42.71  ? 836 HOH B O     1 
HETATM 8433 O  O     . HOH WA 12 .   ? 12.810  -5.669  225.375 1.00 62.64  ? 837 HOH B O     1 
HETATM 8434 O  O     . HOH WA 12 .   ? 13.777  -5.901  229.627 1.00 68.75  ? 838 HOH B O     1 
HETATM 8435 O  O     . HOH WA 12 .   ? 34.168  14.940  193.710 1.00 28.49  ? 839 HOH B O     1 
HETATM 8436 O  O     . HOH WA 12 .   ? -10.665 22.369  213.386 1.00 68.27  ? 840 HOH B O     1 
HETATM 8437 O  O     . HOH WA 12 .   ? 3.331   24.959  215.558 1.00 25.55  ? 841 HOH B O     1 
HETATM 8438 O  O     . HOH WA 12 .   ? 38.161  17.375  198.686 1.00 46.50  ? 842 HOH B O     1 
HETATM 8439 O  O     . HOH WA 12 .   ? 15.213  17.333  242.345 1.00 35.92  ? 843 HOH B O     1 
HETATM 8440 O  O     . HOH WA 12 .   ? 9.317   -13.394 249.029 1.00 56.51  ? 844 HOH B O     1 
HETATM 8441 O  O     . HOH WA 12 .   ? 14.723  28.059  217.173 1.00 46.19  ? 845 HOH B O     1 
HETATM 8442 O  O     . HOH WA 12 .   ? 24.412  14.163  208.510 1.00 36.76  ? 846 HOH B O     1 
HETATM 8443 O  O     . HOH WA 12 .   ? 0.949   29.023  242.645 1.00 47.80  ? 847 HOH B O     1 
HETATM 8444 O  O     . HOH WA 12 .   ? 8.820   19.227  225.626 1.00 55.95  ? 848 HOH B O     1 
HETATM 8445 O  O     . HOH WA 12 .   ? 4.299   4.593   196.970 1.00 69.92  ? 849 HOH B O     1 
HETATM 8446 O  O     . HOH WA 12 .   ? 15.288  46.049  228.458 1.00 32.14  ? 850 HOH B O     1 
HETATM 8447 O  O     . HOH WA 12 .   ? 11.666  23.861  199.602 1.00 50.41  ? 851 HOH B O     1 
HETATM 8448 O  O     . HOH WA 12 .   ? 14.233  10.528  208.301 1.00 45.16  ? 852 HOH B O     1 
HETATM 8449 O  O     . HOH WA 12 .   ? 33.373  20.973  196.632 1.00 40.34  ? 853 HOH B O     1 
HETATM 8450 O  O     . HOH WA 12 .   ? 5.508   41.024  245.420 1.00 36.37  ? 854 HOH B O     1 
HETATM 8451 O  O     . HOH WA 12 .   ? 18.862  8.354   238.005 1.00 55.72  ? 855 HOH B O     1 
HETATM 8452 O  O     . HOH WA 12 .   ? 11.901  -15.786 239.683 1.00 52.95  ? 856 HOH B O     1 
HETATM 8453 O  O     . HOH WA 12 .   ? 15.710  12.594  235.165 1.00 45.48  ? 857 HOH B O     1 
HETATM 8454 O  O     . HOH WA 12 .   ? 11.086  -11.615 246.608 1.00 49.07  ? 858 HOH B O     1 
HETATM 8455 O  O     . HOH WA 12 .   ? 21.951  29.771  215.577 1.00 50.43  ? 859 HOH B O     1 
HETATM 8456 O  O     . HOH WA 12 .   ? -0.784  7.433   222.264 1.00 46.58  ? 860 HOH B O     1 
HETATM 8457 O  O     . HOH WA 12 .   ? 34.989  2.572   204.285 1.00 52.87  ? 861 HOH B O     1 
HETATM 8458 O  O     . HOH WA 12 .   ? 17.545  9.172   210.859 1.00 43.61  ? 862 HOH B O     1 
HETATM 8459 O  O     . HOH WA 12 .   ? 12.162  11.828  195.330 1.00 40.67  ? 863 HOH B O     1 
HETATM 8460 O  O     . HOH WA 12 .   ? 12.468  -13.689 240.811 1.00 42.34  ? 864 HOH B O     1 
HETATM 8461 O  O     . HOH WA 12 .   ? 10.087  -10.651 249.679 1.00 34.71  ? 865 HOH B O     1 
HETATM 8462 O  O     . HOH WA 12 .   ? -11.528 27.858  212.362 1.00 57.37  ? 866 HOH B O     1 
HETATM 8463 O  O     . HOH WA 12 .   ? 24.426  10.739  211.040 1.00 35.35  ? 867 HOH B O     1 
HETATM 8464 O  O     . HOH WA 12 .   ? 10.226  10.367  206.742 1.00 35.74  ? 868 HOH B O     1 
HETATM 8465 O  O     . HOH WA 12 .   ? 30.633  0.862   205.098 1.00 37.07  ? 869 HOH B O     1 
HETATM 8466 O  O     . HOH WA 12 .   ? 25.237  3.508   190.603 1.00 49.04  ? 870 HOH B O     1 
HETATM 8467 O  O     . HOH WA 12 .   ? -7.829  35.494  206.057 1.00 43.19  ? 871 HOH B O     1 
HETATM 8468 O  O     . HOH WA 12 .   ? -0.109  21.358  231.666 1.00 40.95  ? 872 HOH B O     1 
HETATM 8469 O  O     . HOH WA 12 .   ? 42.623  17.914  218.279 1.00 46.43  ? 873 HOH B O     1 
HETATM 8470 O  O     . HOH XA 12 .   ? 35.376  56.075  203.114 1.00 35.94  ? 101 HOH C O     1 
HETATM 8471 O  O     . HOH XA 12 .   ? 26.873  51.648  185.248 1.00 44.46  ? 102 HOH C O     1 
HETATM 8472 O  O     . HOH XA 12 .   ? 24.432  46.242  191.817 1.00 34.29  ? 103 HOH C O     1 
HETATM 8473 O  O     . HOH XA 12 .   ? 28.408  41.947  183.458 1.00 33.55  ? 104 HOH C O     1 
HETATM 8474 O  O     . HOH XA 12 .   ? 20.366  41.365  177.881 1.00 39.43  ? 105 HOH C O     1 
HETATM 8475 O  O     . HOH XA 12 .   ? 32.518  60.008  194.956 1.00 38.49  ? 106 HOH C O     1 
HETATM 8476 O  O     . HOH XA 12 .   ? 21.551  45.358  187.613 1.00 41.19  ? 107 HOH C O     1 
HETATM 8477 O  O     . HOH XA 12 .   ? 36.568  59.713  197.008 1.00 27.04  ? 108 HOH C O     1 
HETATM 8478 O  O     . HOH XA 12 .   ? 36.372  52.542  197.821 1.00 38.80  ? 109 HOH C O     1 
HETATM 8479 O  O     . HOH XA 12 .   ? 33.636  52.091  193.785 1.00 51.70  ? 110 HOH C O     1 
HETATM 8480 O  O     . HOH XA 12 .   ? 22.806  44.748  190.494 1.00 44.73  ? 111 HOH C O     1 
HETATM 8481 O  O     . HOH XA 12 .   ? 18.815  39.704  184.850 1.00 45.79  ? 112 HOH C O     1 
HETATM 8482 O  O     . HOH XA 12 .   ? 20.473  48.604  186.334 1.00 53.13  ? 113 HOH C O     1 
HETATM 8483 O  O     . HOH XA 12 .   ? 20.677  38.582  181.509 1.00 42.25  ? 114 HOH C O     1 
HETATM 8484 O  O     . HOH XA 12 .   ? 38.702  59.167  198.725 1.00 36.01  ? 115 HOH C O     1 
HETATM 8485 O  O     . HOH XA 12 .   ? 33.936  60.297  197.354 1.00 32.45  ? 116 HOH C O     1 
HETATM 8486 O  O     . HOH XA 12 .   ? 28.654  36.526  181.526 1.00 46.38  ? 117 HOH C O     1 
HETATM 8487 O  O     . HOH YA 12 .   ? 28.117  35.048  199.260 1.00 37.08  ? 201 HOH D O     1 
HETATM 8488 O  O     . HOH YA 12 .   ? 11.472  38.488  199.031 1.00 41.22  ? 202 HOH D O     1 
HETATM 8489 O  O     . HOH YA 12 .   ? 17.405  42.028  193.193 1.00 36.23  ? 203 HOH D O     1 
HETATM 8490 O  O     . HOH YA 12 .   ? 34.616  49.781  188.169 1.00 61.20  ? 204 HOH D O     1 
HETATM 8491 O  O     . HOH YA 12 .   ? 16.371  36.460  200.768 1.00 42.90  ? 205 HOH D O     1 
HETATM 8492 O  O     . HOH YA 12 .   ? 30.598  43.414  184.162 1.00 38.31  ? 206 HOH D O     1 
HETATM 8493 O  O     . HOH YA 12 .   ? 38.597  60.306  187.499 1.00 44.77  ? 207 HOH D O     1 
HETATM 8494 O  O     . HOH YA 12 .   ? 17.833  40.428  187.305 1.00 28.65  ? 208 HOH D O     1 
HETATM 8495 O  O     . HOH YA 12 .   ? 22.142  42.114  191.375 1.00 42.18  ? 209 HOH D O     1 
HETATM 8496 O  O     . HOH YA 12 .   ? 19.339  41.269  191.459 1.00 41.62  ? 210 HOH D O     1 
HETATM 8497 O  O     . HOH YA 12 .   ? 23.559  41.580  193.826 1.00 42.95  ? 211 HOH D O     1 
HETATM 8498 O  O     . HOH YA 12 .   ? -0.623  32.252  196.259 1.00 43.16  ? 212 HOH D O     1 
HETATM 8499 O  O     . HOH YA 12 .   ? 6.236   37.502  202.974 1.00 46.11  ? 213 HOH D O     1 
HETATM 8500 O  O     . HOH YA 12 .   ? 29.069  47.830  183.467 1.00 52.46  ? 214 HOH D O     1 
HETATM 8501 O  O     . HOH YA 12 .   ? 13.654  42.778  191.356 1.00 35.50  ? 215 HOH D O     1 
HETATM 8502 O  O     . HOH YA 12 .   ? 26.475  34.177  190.884 1.00 44.02  ? 216 HOH D O     1 
HETATM 8503 O  O     . HOH YA 12 .   ? 13.541  37.580  198.452 1.00 40.88  ? 217 HOH D O     1 
HETATM 8504 O  O     . HOH YA 12 .   ? 8.616   37.529  202.655 1.00 38.85  ? 218 HOH D O     1 
HETATM 8505 O  O     . HOH ZA 12 .   ? 8.916   10.183  217.643 1.00 45.71  ? 101 HOH P O     1 
HETATM 8506 O  O     . HOH ZA 12 .   ? 33.033  0.953   209.769 1.00 39.22  ? 102 HOH P O     1 
HETATM 8507 O  O     . HOH ZA 12 .   ? 9.267   17.546  215.655 1.00 41.76  ? 103 HOH P O     1 
HETATM 8508 O  O     . HOH ZA 12 .   ? 31.036  4.776   214.726 1.00 39.58  ? 104 HOH P O     1 
HETATM 8509 O  O     . HOH ZA 12 .   ? 26.444  -2.800  214.981 1.00 40.01  ? 105 HOH P O     1 
HETATM 8510 O  O     . HOH ZA 12 .   ? 12.850  11.754  214.913 1.00 41.54  ? 106 HOH P O     1 
HETATM 8511 O  O     . HOH ZA 12 .   ? 16.075  15.432  222.406 1.00 43.81  ? 107 HOH P O     1 
HETATM 8512 O  O     . HOH ZA 12 .   ? 17.155  10.920  212.877 1.00 45.64  ? 108 HOH P O     1 
HETATM 8513 O  O     . HOH ZA 12 .   ? 21.195  8.592   213.008 1.00 51.35  ? 109 HOH P O     1 
HETATM 8514 O  O     . HOH ZA 12 .   ? 16.462  21.922  219.275 1.00 61.62  ? 110 HOH P O     1 
HETATM 8515 O  O     . HOH ZA 12 .   ? 14.872  20.718  223.596 1.00 59.29  ? 111 HOH P O     1 
HETATM 8516 O  O     . HOH ZA 12 .   ? 10.152  12.675  217.779 1.00 47.03  ? 112 HOH P O     1 
HETATM 8517 O  O     . HOH AB 12 .   ? 6.537   15.591  207.596 1.00 41.32  ? 101 HOH T O     1 
HETATM 8518 O  O     . HOH AB 12 .   ? 11.153  18.762  199.238 1.00 42.80  ? 102 HOH T O     1 
HETATM 8519 O  O     . HOH AB 12 .   ? 19.894  2.667   227.255 1.00 59.70  ? 103 HOH T O     1 
HETATM 8520 O  O     . HOH AB 12 .   ? 1.532   13.846  205.836 1.00 41.90  ? 104 HOH T O     1 
HETATM 8521 O  O     . HOH AB 12 .   ? 25.050  22.162  209.444 1.00 40.53  ? 105 HOH T O     1 
HETATM 8522 O  O     . HOH AB 12 .   ? 14.225  14.231  203.159 1.00 28.04  ? 106 HOH T O     1 
HETATM 8523 O  O     . HOH AB 12 .   ? 9.620   16.809  212.762 1.00 36.77  ? 107 HOH T O     1 
HETATM 8524 O  O     . HOH AB 12 .   ? 12.967  14.991  207.931 1.00 40.38  ? 108 HOH T O     1 
HETATM 8525 O  O     . HOH AB 12 .   ? 18.761  -3.327  224.362 1.00 55.46  ? 109 HOH T O     1 
HETATM 8526 O  O     . HOH AB 12 .   ? 15.545  15.084  212.028 1.00 43.19  ? 110 HOH T O     1 
HETATM 8527 O  O     . HOH AB 12 .   ? 14.029  0.287   226.909 1.00 47.55  ? 111 HOH T O     1 
HETATM 8528 O  O     . HOH AB 12 .   ? 8.886   14.430  207.289 1.00 32.42  ? 112 HOH T O     1 
HETATM 8529 O  O     . HOH AB 12 .   ? 6.166   13.845  199.627 1.00 27.87  ? 113 HOH T O     1 
HETATM 8530 O  O     . HOH AB 12 .   ? 18.885  13.189  212.445 1.00 41.63  ? 114 HOH T O     1 
HETATM 8531 O  O     . HOH AB 12 .   ? 18.512  13.993  223.181 1.00 47.89  ? 115 HOH T O     1 
HETATM 8532 O  O     . HOH AB 12 .   ? 3.461   15.882  196.632 1.00 53.53  ? 116 HOH T O     1 
HETATM 8533 O  O     . HOH AB 12 .   ? 7.926   22.627  197.012 1.00 53.68  ? 117 HOH T O     1 
HETATM 8534 O  O     . HOH AB 12 .   ? 8.114   11.015  197.279 1.00 48.27  ? 118 HOH T O     1 
HETATM 8535 O  O     . HOH AB 12 .   ? 4.060   13.790  198.472 1.00 53.53  ? 119 HOH T O     1 
HETATM 8536 O  O     . HOH AB 12 .   ? 11.062  19.773  194.863 1.00 33.79  ? 120 HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -24 ?   ?   ?   A . n 
A 1 2   SER 2   -23 ?   ?   ?   A . n 
A 1 3   TYR 3   -22 ?   ?   ?   A . n 
A 1 4   TYR 4   -21 ?   ?   ?   A . n 
A 1 5   HIS 5   -20 ?   ?   ?   A . n 
A 1 6   HIS 6   -19 ?   ?   ?   A . n 
A 1 7   HIS 7   -18 ?   ?   ?   A . n 
A 1 8   HIS 8   -17 ?   ?   ?   A . n 
A 1 9   HIS 9   -16 ?   ?   ?   A . n 
A 1 10  HIS 10  -15 ?   ?   ?   A . n 
A 1 11  ASP 11  -14 ?   ?   ?   A . n 
A 1 12  TYR 12  -13 ?   ?   ?   A . n 
A 1 13  ASP 13  -12 ?   ?   ?   A . n 
A 1 14  ILE 14  -11 ?   ?   ?   A . n 
A 1 15  PRO 15  -10 ?   ?   ?   A . n 
A 1 16  THR 16  -9  ?   ?   ?   A . n 
A 1 17  THR 17  -8  ?   ?   ?   A . n 
A 1 18  GLU 18  -7  ?   ?   ?   A . n 
A 1 19  ASN 19  -6  ?   ?   ?   A . n 
A 1 20  LEU 20  -5  ?   ?   ?   A . n 
A 1 21  TYR 21  -4  ?   ?   ?   A . n 
A 1 22  PHE 22  -3  ?   ?   ?   A . n 
A 1 23  GLN 23  -2  ?   ?   ?   A . n 
A 1 24  GLY 24  -1  ?   ?   ?   A . n 
A 1 25  ALA 25  0   ?   ?   ?   A . n 
A 1 26  MET 26  1   ?   ?   ?   A . n 
A 1 27  ASP 27  2   ?   ?   ?   A . n 
A 1 28  SER 28  3   ?   ?   ?   A . n 
A 1 29  THR 29  4   ?   ?   ?   A . n 
A 1 30  LYS 30  5   ?   ?   ?   A . n 
A 1 31  GLU 31  6   ?   ?   ?   A . n 
A 1 32  LYS 32  7   ?   ?   ?   A . n 
A 1 33  CYS 33  8   ?   ?   ?   A . n 
A 1 34  ASP 34  9   ?   ?   ?   A . n 
A 1 35  SER 35  10  ?   ?   ?   A . n 
A 1 36  TYR 36  11  ?   ?   ?   A . n 
A 1 37  LYS 37  12  ?   ?   ?   A . n 
A 1 38  ASP 38  13  ?   ?   ?   A . n 
A 1 39  ASP 39  14  ?   ?   ?   A . n 
A 1 40  LEU 40  15  ?   ?   ?   A . n 
A 1 41  LEU 41  16  16  LEU LEU A . n 
A 1 42  LEU 42  17  17  LEU LEU A . n 
A 1 43  ARG 43  18  18  ARG ARG A . n 
A 1 44  MET 44  19  19  MET MET A . n 
A 1 45  GLY 45  20  20  GLY GLY A . n 
A 1 46  LEU 46  21  21  LEU LEU A . n 
A 1 47  ASN 47  22  22  ASN ASN A . n 
A 1 48  ASP 48  23  23  ASP ASP A . n 
A 1 49  ASN 49  24  24  ASN ASN A . n 
A 1 50  LYS 50  25  25  LYS LYS A . n 
A 1 51  ALA 51  26  26  ALA ALA A . n 
A 1 52  GLY 52  27  27  GLY GLY A . n 
A 1 53  MET 53  28  28  MET MET A . n 
A 1 54  GLU 54  29  29  GLU GLU A . n 
A 1 55  GLY 55  30  30  GLY GLY A . n 
A 1 56  LEU 56  31  31  LEU LEU A . n 
A 1 57  ASP 57  32  32  ASP ASP A . n 
A 1 58  LYS 58  33  33  LYS LYS A . n 
A 1 59  GLU 59  34  34  GLU GLU A . n 
A 1 60  LYS 60  35  35  LYS LYS A . n 
A 1 61  ILE 61  36  36  ILE ILE A . n 
A 1 62  ASN 62  37  37  ASN ASN A . n 
A 1 63  LYS 63  38  38  LYS LYS A . n 
A 1 64  ILE 64  39  39  ILE ILE A . n 
A 1 65  ILE 65  40  40  ILE ILE A . n 
A 1 66  MET 66  41  41  MET MET A . n 
A 1 67  GLU 67  42  42  GLU GLU A . n 
A 1 68  ALA 68  43  43  ALA ALA A . n 
A 1 69  THR 69  44  44  THR THR A . n 
A 1 70  LYS 70  45  45  LYS LYS A . n 
A 1 71  GLY 71  46  46  GLY GLY A . n 
A 1 72  SER 72  47  47  SER SER A . n 
A 1 73  ARG 73  48  48  ARG ARG A . n 
A 1 74  PHE 74  49  49  PHE PHE A . n 
A 1 75  TYR 75  50  50  TYR TYR A . n 
A 1 76  GLY 76  51  51  GLY GLY A . n 
A 1 77  ASN 77  52  52  ASN ASN A . n 
A 1 78  GLU 78  53  53  GLU GLU A . n 
A 1 79  LEU 79  54  54  LEU LEU A . n 
A 1 80  LYS 80  55  55  LYS LYS A . n 
A 1 81  LYS 81  56  56  LYS LYS A . n 
A 1 82  GLU 82  57  57  GLU GLU A . n 
A 1 83  LYS 83  58  58  LYS LYS A . n 
A 1 84  GLN 84  59  59  GLN GLN A . n 
A 1 85  VAL 85  60  60  VAL VAL A . n 
A 1 86  ASN 86  61  61  ASN ASN A . n 
A 1 87  GLN 87  62  62  GLN GLN A . n 
A 1 88  ARG 88  63  63  ARG ARG A . n 
A 1 89  ILE 89  64  64  ILE ILE A . n 
A 1 90  GLU 90  65  65  GLU GLU A . n 
A 1 91  ASN 91  66  66  ASN ASN A . n 
A 1 92  MET 92  67  67  MET MET A . n 
A 1 93  MET 93  68  68  MET MET A . n 
A 1 94  GLN 94  69  69  GLN GLN A . n 
A 1 95  GLN 95  70  70  GLN GLN A . n 
A 1 96  LYS 96  71  71  LYS LYS A . n 
A 1 97  ALA 97  72  72  ALA ALA A . n 
A 1 98  GLN 98  73  73  GLN GLN A . n 
A 1 99  ILE 99  74  74  ILE ILE A . n 
A 1 100 THR 100 75  75  THR THR A . n 
A 1 101 SER 101 76  76  SER SER A . n 
A 1 102 GLN 102 77  77  GLN GLN A . n 
A 1 103 GLN 103 78  78  GLN GLN A . n 
A 1 104 LEU 104 79  79  LEU LEU A . n 
A 1 105 ARG 105 80  80  ARG ARG A . n 
A 1 106 LYS 106 81  81  LYS LYS A . n 
A 1 107 ALA 107 82  82  ALA ALA A . n 
A 1 108 GLN 108 83  83  GLN GLN A . n 
A 1 109 LEU 109 84  84  LEU LEU A . n 
A 1 110 GLN 110 85  85  GLN GLN A . n 
A 1 111 VAL 111 86  86  VAL VAL A . n 
A 1 112 ASP 112 87  87  ASP ASP A . n 
A 1 113 ARG 113 88  88  ARG ARG A . n 
A 1 114 PHE 114 89  89  PHE PHE A . n 
A 1 115 ALA 115 90  90  ALA ALA A . n 
A 1 116 MET 116 91  91  MET MET A . n 
A 1 117 GLU 117 92  92  GLU GLU A . n 
A 1 118 LEU 118 93  93  LEU LEU A . n 
A 1 119 GLU 119 94  94  GLU GLU A . n 
A 1 120 GLN 120 95  95  GLN GLN A . n 
A 1 121 SER 121 96  96  SER SER A . n 
A 1 122 ARG 122 97  97  ARG ARG A . n 
A 1 123 ASN 123 98  98  ASN ASN A . n 
A 1 124 LEU 124 99  99  LEU LEU A . n 
A 1 125 SER 125 100 100 SER SER A . n 
A 1 126 ASN 126 101 101 ASN ASN A . n 
A 1 127 THR 127 102 102 THR THR A . n 
A 1 128 ILE 128 103 103 ILE ILE A . n 
A 1 129 VAL 129 104 104 VAL VAL A . n 
A 1 130 HIS 130 105 105 HIS HIS A . n 
A 1 131 ILE 131 106 106 ILE ILE A . n 
A 1 132 ASP 132 107 107 ASP ASP A . n 
A 1 133 MET 133 108 108 MET MET A . n 
A 1 134 ASP 134 109 109 ASP ASP A . n 
A 1 135 ALA 135 110 110 ALA ALA A . n 
A 1 136 PHE 136 111 111 PHE PHE A . n 
A 1 137 TYR 137 112 112 TYR TYR A . n 
A 1 138 ALA 138 113 113 ALA ALA A . n 
A 1 139 ALA 139 114 114 ALA ALA A . n 
A 1 140 VAL 140 115 115 VAL VAL A . n 
A 1 141 GLU 141 116 116 GLU GLU A . n 
A 1 142 MET 142 117 117 MET MET A . n 
A 1 143 ARG 143 118 118 ARG ARG A . n 
A 1 144 ASP 144 119 119 ASP ASP A . n 
A 1 145 ASN 145 120 120 ASN ASN A . n 
A 1 146 PRO 146 121 121 PRO PRO A . n 
A 1 147 GLU 147 122 122 GLU GLU A . n 
A 1 148 LEU 148 123 123 LEU LEU A . n 
A 1 149 LYS 149 124 124 LYS LYS A . n 
A 1 150 ASP 150 125 125 ASP ASP A . n 
A 1 151 LYS 151 126 126 LYS LYS A . n 
A 1 152 PRO 152 127 127 PRO PRO A . n 
A 1 153 ILE 153 128 128 ILE ILE A . n 
A 1 154 ALA 154 129 129 ALA ALA A . n 
A 1 155 VAL 155 130 130 VAL VAL A . n 
A 1 156 GLY 156 131 131 GLY GLY A . n 
A 1 157 SER 157 132 132 SER SER A . n 
A 1 158 MET 158 133 133 MET MET A . n 
A 1 159 SER 159 134 134 SER SER A . n 
A 1 160 MET 160 135 135 MET MET A . n 
A 1 161 LEU 161 136 136 LEU LEU A . n 
A 1 162 SER 162 137 137 SER SER A . n 
A 1 163 THR 163 138 138 THR THR A . n 
A 1 164 SER 164 139 139 SER SER A . n 
A 1 165 ASN 165 140 140 ASN ASN A . n 
A 1 166 TYR 166 141 141 TYR TYR A . n 
A 1 167 HIS 167 142 142 HIS HIS A . n 
A 1 168 ALA 168 143 143 ALA ALA A . n 
A 1 169 ARG 169 144 144 ARG ARG A . n 
A 1 170 ARG 170 145 145 ARG ARG A . n 
A 1 171 PHE 171 146 146 PHE PHE A . n 
A 1 172 GLY 172 147 147 GLY GLY A . n 
A 1 173 VAL 173 148 148 VAL VAL A . n 
A 1 174 ARG 174 149 149 ARG ARG A . n 
A 1 175 ALA 175 150 150 ALA ALA A . n 
A 1 176 ALA 176 151 151 ALA ALA A . n 
A 1 177 MET 177 152 152 MET MET A . n 
A 1 178 PRO 178 153 153 PRO PRO A . n 
A 1 179 GLY 179 154 154 GLY GLY A . n 
A 1 180 PHE 180 155 155 PHE PHE A . n 
A 1 181 ILE 181 156 156 ILE ILE A . n 
A 1 182 ALA 182 157 157 ALA ALA A . n 
A 1 183 LYS 183 158 158 LYS LYS A . n 
A 1 184 ARG 184 159 159 ARG ARG A . n 
A 1 185 LEU 185 160 160 LEU LEU A . n 
A 1 186 CYS 186 161 161 CYS CYS A . n 
A 1 187 PRO 187 162 162 PRO PRO A . n 
A 1 188 GLN 188 163 163 GLN GLN A . n 
A 1 189 LEU 189 164 164 LEU LEU A . n 
A 1 190 ILE 190 165 165 ILE ILE A . n 
A 1 191 ILE 191 166 166 ILE ILE A . n 
A 1 192 VAL 192 167 167 VAL VAL A . n 
A 1 193 PRO 193 168 168 PRO PRO A . n 
A 1 194 PRO 194 169 169 PRO PRO A . n 
A 1 195 ASN 195 170 170 ASN ASN A . n 
A 1 196 PHE 196 171 171 PHE PHE A . n 
A 1 197 ASP 197 172 172 ASP ASP A . n 
A 1 198 LYS 198 173 173 LYS LYS A . n 
A 1 199 TYR 199 174 174 TYR TYR A . n 
A 1 200 ARG 200 175 175 ARG ARG A . n 
A 1 201 ALA 201 176 176 ALA ALA A . n 
A 1 202 VAL 202 177 177 VAL VAL A . n 
A 1 203 SER 203 178 178 SER SER A . n 
A 1 204 LYS 204 179 179 LYS LYS A . n 
A 1 205 GLU 205 180 180 GLU GLU A . n 
A 1 206 VAL 206 181 181 VAL VAL A . n 
A 1 207 LYS 207 182 182 LYS LYS A . n 
A 1 208 GLU 208 183 183 GLU GLU A . n 
A 1 209 ILE 209 184 184 ILE ILE A . n 
A 1 210 LEU 210 185 185 LEU LEU A . n 
A 1 211 ALA 211 186 186 ALA ALA A . n 
A 1 212 ASP 212 187 187 ASP ASP A . n 
A 1 213 TYR 213 188 188 TYR TYR A . n 
A 1 214 ASP 214 189 189 ASP ASP A . n 
A 1 215 PRO 215 190 190 PRO PRO A . n 
A 1 216 ASN 216 191 191 ASN ASN A . n 
A 1 217 PHE 217 192 192 PHE PHE A . n 
A 1 218 MET 218 193 193 MET MET A . n 
A 1 219 ALA 219 194 194 ALA ALA A . n 
A 1 220 MET 220 195 195 MET MET A . n 
A 1 221 SER 221 196 196 SER SER A . n 
A 1 222 LEU 222 197 197 LEU LEU A . n 
A 1 223 ASP 223 198 198 ASP ASP A . n 
A 1 224 GLU 224 199 199 GLU GLU A . n 
A 1 225 ALA 225 200 200 ALA ALA A . n 
A 1 226 TYR 226 201 201 TYR TYR A . n 
A 1 227 LEU 227 202 202 LEU LEU A . n 
A 1 228 ASN 228 203 203 ASN ASN A . n 
A 1 229 ILE 229 204 204 ILE ILE A . n 
A 1 230 THR 230 205 205 THR THR A . n 
A 1 231 LYS 231 206 206 LYS LYS A . n 
A 1 232 HIS 232 207 207 HIS HIS A . n 
A 1 233 LEU 233 208 208 LEU LEU A . n 
A 1 234 GLU 234 209 209 GLU GLU A . n 
A 1 235 GLU 235 210 210 GLU GLU A . n 
A 1 236 ARG 236 211 211 ARG ARG A . n 
A 1 237 GLN 237 212 212 GLN GLN A . n 
A 1 238 ASN 238 213 213 ASN ASN A . n 
A 1 239 TRP 239 214 214 TRP TRP A . n 
A 1 240 PRO 240 215 215 PRO PRO A . n 
A 1 241 GLU 241 216 216 GLU GLU A . n 
A 1 242 ASP 242 217 217 ASP ASP A . n 
A 1 243 LYS 243 218 218 LYS LYS A . n 
A 1 244 ARG 244 219 219 ARG ARG A . n 
A 1 245 ARG 245 220 220 ARG ARG A . n 
A 1 246 TYR 246 221 221 TYR TYR A . n 
A 1 247 PHE 247 222 222 PHE PHE A . n 
A 1 248 ILE 248 223 223 ILE ILE A . n 
A 1 249 LYS 249 224 224 LYS LYS A . n 
A 1 250 MET 250 225 ?   ?   ?   A . n 
A 1 251 GLY 251 226 ?   ?   ?   A . n 
A 1 252 SER 252 227 ?   ?   ?   A . n 
A 1 253 SER 253 228 ?   ?   ?   A . n 
A 1 254 VAL 254 229 ?   ?   ?   A . n 
A 1 255 GLU 255 230 ?   ?   ?   A . n 
A 1 256 ASN 256 231 ?   ?   ?   A . n 
A 1 257 ASP 257 232 ?   ?   ?   A . n 
A 1 258 ASN 258 233 ?   ?   ?   A . n 
A 1 259 PRO 259 234 ?   ?   ?   A . n 
A 1 260 GLY 260 235 ?   ?   ?   A . n 
A 1 261 LYS 261 236 ?   ?   ?   A . n 
A 1 262 GLU 262 237 ?   ?   ?   A . n 
A 1 263 VAL 263 238 ?   ?   ?   A . n 
A 1 264 ASN 264 239 ?   ?   ?   A . n 
A 1 265 LYS 265 240 ?   ?   ?   A . n 
A 1 266 LEU 266 241 ?   ?   ?   A . n 
A 1 267 SER 267 242 ?   ?   ?   A . n 
A 1 268 GLU 268 243 ?   ?   ?   A . n 
A 1 269 HIS 269 244 ?   ?   ?   A . n 
A 1 270 GLU 270 245 ?   ?   ?   A . n 
A 1 271 ARG 271 246 ?   ?   ?   A . n 
A 1 272 SER 272 247 ?   ?   ?   A . n 
A 1 273 ILE 273 248 ?   ?   ?   A . n 
A 1 274 SER 274 249 ?   ?   ?   A . n 
A 1 275 PRO 275 250 ?   ?   ?   A . n 
A 1 276 LEU 276 251 ?   ?   ?   A . n 
A 1 277 LEU 277 252 ?   ?   ?   A . n 
A 1 278 PHE 278 253 ?   ?   ?   A . n 
A 1 279 GLU 279 254 ?   ?   ?   A . n 
A 1 280 GLU 280 255 ?   ?   ?   A . n 
A 1 281 SER 281 256 ?   ?   ?   A . n 
A 1 282 PRO 282 257 ?   ?   ?   A . n 
A 1 283 SER 283 258 ?   ?   ?   A . n 
A 1 284 ASP 284 259 ?   ?   ?   A . n 
A 1 285 VAL 285 260 ?   ?   ?   A . n 
A 1 286 GLN 286 261 ?   ?   ?   A . n 
A 1 287 PRO 287 262 ?   ?   ?   A . n 
A 1 288 PRO 288 263 ?   ?   ?   A . n 
A 1 289 GLY 289 264 ?   ?   ?   A . n 
A 1 290 ASP 290 265 ?   ?   ?   A . n 
A 1 291 PRO 291 266 ?   ?   ?   A . n 
A 1 292 PHE 292 267 ?   ?   ?   A . n 
A 1 293 GLN 293 268 ?   ?   ?   A . n 
A 1 294 VAL 294 269 ?   ?   ?   A . n 
A 1 295 ASN 295 270 ?   ?   ?   A . n 
A 1 296 PHE 296 271 ?   ?   ?   A . n 
A 1 297 GLU 297 272 ?   ?   ?   A . n 
A 1 298 GLU 298 273 ?   ?   ?   A . n 
A 1 299 GLN 299 274 ?   ?   ?   A . n 
A 1 300 ASN 300 275 ?   ?   ?   A . n 
A 1 301 ASN 301 276 ?   ?   ?   A . n 
A 1 302 PRO 302 277 ?   ?   ?   A . n 
A 1 303 GLN 303 278 ?   ?   ?   A . n 
A 1 304 ILE 304 279 ?   ?   ?   A . n 
A 1 305 LEU 305 280 ?   ?   ?   A . n 
A 1 306 GLN 306 281 ?   ?   ?   A . n 
A 1 307 ASN 307 282 282 ASN ASN A . n 
A 1 308 SER 308 283 283 SER SER A . n 
A 1 309 VAL 309 284 284 VAL VAL A . n 
A 1 310 VAL 310 285 285 VAL VAL A . n 
A 1 311 PHE 311 286 286 PHE PHE A . n 
A 1 312 GLY 312 287 287 GLY GLY A . n 
A 1 313 THR 313 288 288 THR THR A . n 
A 1 314 SER 314 289 289 SER SER A . n 
A 1 315 ALA 315 290 290 ALA ALA A . n 
A 1 316 GLN 316 291 291 GLN GLN A . n 
A 1 317 GLU 317 292 292 GLU GLU A . n 
A 1 318 VAL 318 293 293 VAL VAL A . n 
A 1 319 VAL 319 294 294 VAL VAL A . n 
A 1 320 LYS 320 295 295 LYS LYS A . n 
A 1 321 GLU 321 296 296 GLU GLU A . n 
A 1 322 ILE 322 297 297 ILE ILE A . n 
A 1 323 ARG 323 298 298 ARG ARG A . n 
A 1 324 PHE 324 299 299 PHE PHE A . n 
A 1 325 ARG 325 300 300 ARG ARG A . n 
A 1 326 ILE 326 301 301 ILE ILE A . n 
A 1 327 GLU 327 302 302 GLU GLU A . n 
A 1 328 GLN 328 303 303 GLN GLN A . n 
A 1 329 LYS 329 304 304 LYS LYS A . n 
A 1 330 THR 330 305 305 THR THR A . n 
A 1 331 THR 331 306 306 THR THR A . n 
A 1 332 LEU 332 307 307 LEU LEU A . n 
A 1 333 THR 333 308 308 THR THR A . n 
A 1 334 ALA 334 309 309 ALA ALA A . n 
A 1 335 SER 335 310 310 SER SER A . n 
A 1 336 ALA 336 311 311 ALA ALA A . n 
A 1 337 GLY 337 312 312 GLY GLY A . n 
A 1 338 ILE 338 313 313 ILE ILE A . n 
A 1 339 ALA 339 314 314 ALA ALA A . n 
A 1 340 PRO 340 315 315 PRO PRO A . n 
A 1 341 ASN 341 316 316 ASN ASN A . n 
A 1 342 THR 342 317 317 THR THR A . n 
A 1 343 MET 343 318 318 MET MET A . n 
A 1 344 LEU 344 319 319 LEU LEU A . n 
A 1 345 ALA 345 320 320 ALA ALA A . n 
A 1 346 LYS 346 321 321 LYS LYS A . n 
A 1 347 VAL 347 322 322 VAL VAL A . n 
A 1 348 CYS 348 323 323 CYS CYS A . n 
A 1 349 SER 349 324 324 SER SER A . n 
A 1 350 ASP 350 325 325 ASP ASP A . n 
A 1 351 LYS 351 326 326 LYS LYS A . n 
A 1 352 ASN 352 327 327 ASN ASN A . n 
A 1 353 LYS 353 328 328 LYS LYS A . n 
A 1 354 PRO 354 329 329 PRO PRO A . n 
A 1 355 ASN 355 330 330 ASN ASN A . n 
A 1 356 GLY 356 331 331 GLY GLY A . n 
A 1 357 GLN 357 332 332 GLN GLN A . n 
A 1 358 TYR 358 333 333 TYR TYR A . n 
A 1 359 GLN 359 334 334 GLN GLN A . n 
A 1 360 ILE 360 335 335 ILE ILE A . n 
A 1 361 LEU 361 336 336 LEU LEU A . n 
A 1 362 PRO 362 337 337 PRO PRO A . n 
A 1 363 ASN 363 338 338 ASN ASN A . n 
A 1 364 ARG 364 339 339 ARG ARG A . n 
A 1 365 GLN 365 340 340 GLN GLN A . n 
A 1 366 ALA 366 341 341 ALA ALA A . n 
A 1 367 VAL 367 342 342 VAL VAL A . n 
A 1 368 MET 368 343 343 MET MET A . n 
A 1 369 ASP 369 344 344 ASP ASP A . n 
A 1 370 PHE 370 345 345 PHE PHE A . n 
A 1 371 ILE 371 346 346 ILE ILE A . n 
A 1 372 LYS 372 347 347 LYS LYS A . n 
A 1 373 ASP 373 348 348 ASP ASP A . n 
A 1 374 LEU 374 349 349 LEU LEU A . n 
A 1 375 PRO 375 350 350 PRO PRO A . n 
A 1 376 ILE 376 351 351 ILE ILE A . n 
A 1 377 ARG 377 352 352 ARG ARG A . n 
A 1 378 LYS 378 353 353 LYS LYS A . n 
A 1 379 VAL 379 354 354 VAL VAL A . n 
A 1 380 SER 380 355 355 SER SER A . n 
A 1 381 GLY 381 356 356 GLY GLY A . n 
A 1 382 ILE 382 357 357 ILE ILE A . n 
A 1 383 GLY 383 358 358 GLY GLY A . n 
A 1 384 LYS 384 359 359 LYS LYS A . n 
A 1 385 VAL 385 360 360 VAL VAL A . n 
A 1 386 THR 386 361 361 THR THR A . n 
A 1 387 GLU 387 362 362 GLU GLU A . n 
A 1 388 LYS 388 363 363 LYS LYS A . n 
A 1 389 MET 389 364 364 MET MET A . n 
A 1 390 LEU 390 365 365 LEU LEU A . n 
A 1 391 LYS 391 366 366 LYS LYS A . n 
A 1 392 ALA 392 367 367 ALA ALA A . n 
A 1 393 LEU 393 368 368 LEU LEU A . n 
A 1 394 GLY 394 369 369 GLY GLY A . n 
A 1 395 ILE 395 370 370 ILE ILE A . n 
A 1 396 ILE 396 371 371 ILE ILE A . n 
A 1 397 THR 397 372 372 THR THR A . n 
A 1 398 CYS 398 373 373 CYS CYS A . n 
A 1 399 THR 399 374 374 THR THR A . n 
A 1 400 GLU 400 375 375 GLU GLU A . n 
A 1 401 LEU 401 376 376 LEU LEU A . n 
A 1 402 TYR 402 377 377 TYR TYR A . n 
A 1 403 GLN 403 378 378 GLN GLN A . n 
A 1 404 GLN 404 379 379 GLN GLN A . n 
A 1 405 ARG 405 380 380 ARG ARG A . n 
A 1 406 ALA 406 381 381 ALA ALA A . n 
A 1 407 LEU 407 382 382 LEU LEU A . n 
A 1 408 LEU 408 383 383 LEU LEU A . n 
A 1 409 SER 409 384 384 SER SER A . n 
A 1 410 LEU 410 385 385 LEU LEU A . n 
A 1 411 LEU 411 386 386 LEU LEU A . n 
A 1 412 PHE 412 387 387 PHE PHE A . n 
A 1 413 SER 413 388 388 SER SER A . n 
A 1 414 GLU 414 389 389 GLU GLU A . n 
A 1 415 THR 415 390 390 THR THR A . n 
A 1 416 SER 416 391 391 SER SER A . n 
A 1 417 TRP 417 392 392 TRP TRP A . n 
A 1 418 HIS 418 393 393 HIS HIS A . n 
A 1 419 TYR 419 394 394 TYR TYR A . n 
A 1 420 PHE 420 395 395 PHE PHE A . n 
A 1 421 LEU 421 396 396 LEU LEU A . n 
A 1 422 HIS 422 397 397 HIS HIS A . n 
A 1 423 ILE 423 398 398 ILE ILE A . n 
A 1 424 SER 424 399 399 SER SER A . n 
A 1 425 LEU 425 400 400 LEU LEU A . n 
A 1 426 GLY 426 401 401 GLY GLY A . n 
A 1 427 LEU 427 402 402 LEU LEU A . n 
A 1 428 GLY 428 403 403 GLY GLY A . n 
A 1 429 SER 429 404 404 SER SER A . n 
A 1 430 THR 430 405 405 THR THR A . n 
A 1 431 HIS 431 406 406 HIS HIS A . n 
A 1 432 LEU 432 407 407 LEU LEU A . n 
A 1 433 THR 433 408 408 THR THR A . n 
A 1 434 ARG 434 409 409 ARG ARG A . n 
A 1 435 ASP 435 410 410 ASP ASP A . n 
A 1 436 GLY 436 411 411 GLY GLY A . n 
A 1 437 GLU 437 412 412 GLU GLU A . n 
A 1 438 ARG 438 413 413 ARG ARG A . n 
A 1 439 LYS 439 414 414 LYS LYS A . n 
A 1 440 SER 440 415 415 SER SER A . n 
A 1 441 MET 441 416 416 MET MET A . n 
A 1 442 SER 442 417 417 SER SER A . n 
A 1 443 VAL 443 418 418 VAL VAL A . n 
A 1 444 GLU 444 419 419 GLU GLU A . n 
A 1 445 ARG 445 420 420 ARG ARG A . n 
A 1 446 THR 446 421 421 THR THR A . n 
A 1 447 PHE 447 422 422 PHE PHE A . n 
A 1 448 SER 448 423 423 SER SER A . n 
A 1 449 GLU 449 424 424 GLU GLU A . n 
A 1 450 ILE 450 425 425 ILE ILE A . n 
A 1 451 ASN 451 426 426 ASN ASN A . n 
A 1 452 LYS 452 427 427 LYS LYS A . n 
A 1 453 ALA 453 428 428 ALA ALA A . n 
A 1 454 GLU 454 429 429 GLU GLU A . n 
A 1 455 GLU 455 430 430 GLU GLU A . n 
A 1 456 GLN 456 431 431 GLN GLN A . n 
A 1 457 TYR 457 432 432 TYR TYR A . n 
A 1 458 SER 458 433 433 SER SER A . n 
A 1 459 LEU 459 434 434 LEU LEU A . n 
A 1 460 CYS 460 435 435 CYS CYS A . n 
A 1 461 GLN 461 436 436 GLN GLN A . n 
A 1 462 GLU 462 437 437 GLU GLU A . n 
A 1 463 LEU 463 438 438 LEU LEU A . n 
A 1 464 CYS 464 439 439 CYS CYS A . n 
A 1 465 SER 465 440 440 SER SER A . n 
A 1 466 GLU 466 441 441 GLU GLU A . n 
A 1 467 LEU 467 442 442 LEU LEU A . n 
A 1 468 ALA 468 443 443 ALA ALA A . n 
A 1 469 GLN 469 444 444 GLN GLN A . n 
A 1 470 ASP 470 445 445 ASP ASP A . n 
A 1 471 LEU 471 446 446 LEU LEU A . n 
A 1 472 GLN 472 447 447 GLN GLN A . n 
A 1 473 LYS 473 448 448 LYS LYS A . n 
A 1 474 GLU 474 449 449 GLU GLU A . n 
A 1 475 ARG 475 450 450 ARG ARG A . n 
A 1 476 LEU 476 451 451 LEU LEU A . n 
A 1 477 LYS 477 452 452 LYS LYS A . n 
A 1 478 GLY 478 453 453 GLY GLY A . n 
A 1 479 ARG 479 454 454 ARG ARG A . n 
A 1 480 THR 480 455 455 THR THR A . n 
A 1 481 VAL 481 456 456 VAL VAL A . n 
A 1 482 THR 482 457 457 THR THR A . n 
A 1 483 ILE 483 458 458 ILE ILE A . n 
A 1 484 LYS 484 459 459 LYS LYS A . n 
A 1 485 LEU 485 460 460 LEU LEU A . n 
A 1 486 LYS 486 461 461 LYS LYS A . n 
A 1 487 ASN 487 462 462 ASN ASN A . n 
A 1 488 VAL 488 463 463 VAL VAL A . n 
A 1 489 ASN 489 464 464 ASN ASN A . n 
A 1 490 PHE 490 465 465 PHE PHE A . n 
A 1 491 GLU 491 466 466 GLU GLU A . n 
A 1 492 VAL 492 467 467 VAL VAL A . n 
A 1 493 LYS 493 468 468 LYS LYS A . n 
A 1 494 THR 494 469 469 THR THR A . n 
A 1 495 ARG 495 470 470 ARG ARG A . n 
A 1 496 ALA 496 471 471 ALA ALA A . n 
A 1 497 SER 497 472 472 SER SER A . n 
A 1 498 THR 498 473 473 THR THR A . n 
A 1 499 VAL 499 474 474 VAL VAL A . n 
A 1 500 SER 500 475 475 SER SER A . n 
A 1 501 SER 501 476 476 SER SER A . n 
A 1 502 VAL 502 477 477 VAL VAL A . n 
A 1 503 VAL 503 478 478 VAL VAL A . n 
A 1 504 SER 504 479 479 SER SER A . n 
A 1 505 THR 505 480 480 THR THR A . n 
A 1 506 ALA 506 481 481 ALA ALA A . n 
A 1 507 GLU 507 482 482 GLU GLU A . n 
A 1 508 GLU 508 483 483 GLU GLU A . n 
A 1 509 ILE 509 484 484 ILE ILE A . n 
A 1 510 PHE 510 485 485 PHE PHE A . n 
A 1 511 ALA 511 486 486 ALA ALA A . n 
A 1 512 ILE 512 487 487 ILE ILE A . n 
A 1 513 ALA 513 488 488 ALA ALA A . n 
A 1 514 LYS 514 489 489 LYS LYS A . n 
A 1 515 GLU 515 490 490 GLU GLU A . n 
A 1 516 LEU 516 491 491 LEU LEU A . n 
A 1 517 LEU 517 492 492 LEU LEU A . n 
A 1 518 LYS 518 493 493 LYS LYS A . n 
A 1 519 THR 519 494 494 THR THR A . n 
A 1 520 GLU 520 495 495 GLU GLU A . n 
A 1 521 ILE 521 496 496 ILE ILE A . n 
A 1 522 ASP 522 497 497 ASP ASP A . n 
A 1 523 ALA 523 498 498 ALA ALA A . n 
A 1 524 ASP 524 499 499 ASP ASP A . n 
A 1 525 PHE 525 500 500 PHE PHE A . n 
A 1 526 PRO 526 501 501 PRO PRO A . n 
A 1 527 HIS 527 502 502 HIS HIS A . n 
A 1 528 PRO 528 503 503 PRO PRO A . n 
A 1 529 LEU 529 504 504 LEU LEU A . n 
A 1 530 ARG 530 505 505 ARG ARG A . n 
A 1 531 LEU 531 506 506 LEU LEU A . n 
A 1 532 ARG 532 507 507 ARG ARG A . n 
A 1 533 LEU 533 508 508 LEU LEU A . n 
A 1 534 MET 534 509 509 MET MET A . n 
A 1 535 GLY 535 510 510 GLY GLY A . n 
A 1 536 VAL 536 511 511 VAL VAL A . n 
A 1 537 ARG 537 512 512 ARG ARG A . n 
A 1 538 ILE 538 513 513 ILE ILE A . n 
A 1 539 SER 539 514 514 SER SER A . n 
A 1 540 SER 540 515 515 SER SER A . n 
A 1 541 PHE 541 516 516 PHE PHE A . n 
A 1 542 PRO 542 517 517 PRO PRO A . n 
A 1 543 ASN 543 518 518 ASN ASN A . n 
A 1 544 GLU 544 519 ?   ?   ?   A . n 
A 1 545 GLU 545 520 ?   ?   ?   A . n 
A 1 546 ASP 546 521 ?   ?   ?   A . n 
A 1 547 ARG 547 522 ?   ?   ?   A . n 
A 1 548 LYS 548 523 ?   ?   ?   A . n 
A 1 549 HIS 549 524 ?   ?   ?   A . n 
A 1 550 GLN 550 525 ?   ?   ?   A . n 
A 1 551 GLN 551 526 ?   ?   ?   A . n 
B 1 1   MET 1   -24 ?   ?   ?   B . n 
B 1 2   SER 2   -23 ?   ?   ?   B . n 
B 1 3   TYR 3   -22 ?   ?   ?   B . n 
B 1 4   TYR 4   -21 ?   ?   ?   B . n 
B 1 5   HIS 5   -20 ?   ?   ?   B . n 
B 1 6   HIS 6   -19 ?   ?   ?   B . n 
B 1 7   HIS 7   -18 ?   ?   ?   B . n 
B 1 8   HIS 8   -17 ?   ?   ?   B . n 
B 1 9   HIS 9   -16 ?   ?   ?   B . n 
B 1 10  HIS 10  -15 ?   ?   ?   B . n 
B 1 11  ASP 11  -14 ?   ?   ?   B . n 
B 1 12  TYR 12  -13 ?   ?   ?   B . n 
B 1 13  ASP 13  -12 ?   ?   ?   B . n 
B 1 14  ILE 14  -11 ?   ?   ?   B . n 
B 1 15  PRO 15  -10 ?   ?   ?   B . n 
B 1 16  THR 16  -9  ?   ?   ?   B . n 
B 1 17  THR 17  -8  ?   ?   ?   B . n 
B 1 18  GLU 18  -7  ?   ?   ?   B . n 
B 1 19  ASN 19  -6  ?   ?   ?   B . n 
B 1 20  LEU 20  -5  ?   ?   ?   B . n 
B 1 21  TYR 21  -4  ?   ?   ?   B . n 
B 1 22  PHE 22  -3  ?   ?   ?   B . n 
B 1 23  GLN 23  -2  ?   ?   ?   B . n 
B 1 24  GLY 24  -1  ?   ?   ?   B . n 
B 1 25  ALA 25  0   ?   ?   ?   B . n 
B 1 26  MET 26  1   ?   ?   ?   B . n 
B 1 27  ASP 27  2   ?   ?   ?   B . n 
B 1 28  SER 28  3   ?   ?   ?   B . n 
B 1 29  THR 29  4   ?   ?   ?   B . n 
B 1 30  LYS 30  5   ?   ?   ?   B . n 
B 1 31  GLU 31  6   ?   ?   ?   B . n 
B 1 32  LYS 32  7   ?   ?   ?   B . n 
B 1 33  CYS 33  8   ?   ?   ?   B . n 
B 1 34  ASP 34  9   ?   ?   ?   B . n 
B 1 35  SER 35  10  ?   ?   ?   B . n 
B 1 36  TYR 36  11  ?   ?   ?   B . n 
B 1 37  LYS 37  12  ?   ?   ?   B . n 
B 1 38  ASP 38  13  ?   ?   ?   B . n 
B 1 39  ASP 39  14  ?   ?   ?   B . n 
B 1 40  LEU 40  15  ?   ?   ?   B . n 
B 1 41  LEU 41  16  ?   ?   ?   B . n 
B 1 42  LEU 42  17  ?   ?   ?   B . n 
B 1 43  ARG 43  18  ?   ?   ?   B . n 
B 1 44  MET 44  19  ?   ?   ?   B . n 
B 1 45  GLY 45  20  20  GLY GLY B . n 
B 1 46  LEU 46  21  21  LEU LEU B . n 
B 1 47  ASN 47  22  22  ASN ASN B . n 
B 1 48  ASP 48  23  23  ASP ASP B . n 
B 1 49  ASN 49  24  24  ASN ASN B . n 
B 1 50  LYS 50  25  25  LYS LYS B . n 
B 1 51  ALA 51  26  26  ALA ALA B . n 
B 1 52  GLY 52  27  27  GLY GLY B . n 
B 1 53  MET 53  28  28  MET MET B . n 
B 1 54  GLU 54  29  29  GLU GLU B . n 
B 1 55  GLY 55  30  30  GLY GLY B . n 
B 1 56  LEU 56  31  31  LEU LEU B . n 
B 1 57  ASP 57  32  32  ASP ASP B . n 
B 1 58  LYS 58  33  33  LYS LYS B . n 
B 1 59  GLU 59  34  34  GLU GLU B . n 
B 1 60  LYS 60  35  35  LYS LYS B . n 
B 1 61  ILE 61  36  36  ILE ILE B . n 
B 1 62  ASN 62  37  37  ASN ASN B . n 
B 1 63  LYS 63  38  38  LYS LYS B . n 
B 1 64  ILE 64  39  39  ILE ILE B . n 
B 1 65  ILE 65  40  40  ILE ILE B . n 
B 1 66  MET 66  41  41  MET MET B . n 
B 1 67  GLU 67  42  42  GLU GLU B . n 
B 1 68  ALA 68  43  43  ALA ALA B . n 
B 1 69  THR 69  44  44  THR THR B . n 
B 1 70  LYS 70  45  45  LYS LYS B . n 
B 1 71  GLY 71  46  46  GLY GLY B . n 
B 1 72  SER 72  47  47  SER SER B . n 
B 1 73  ARG 73  48  48  ARG ARG B . n 
B 1 74  PHE 74  49  49  PHE PHE B . n 
B 1 75  TYR 75  50  50  TYR TYR B . n 
B 1 76  GLY 76  51  51  GLY GLY B . n 
B 1 77  ASN 77  52  52  ASN ASN B . n 
B 1 78  GLU 78  53  53  GLU GLU B . n 
B 1 79  LEU 79  54  54  LEU LEU B . n 
B 1 80  LYS 80  55  55  LYS LYS B . n 
B 1 81  LYS 81  56  56  LYS LYS B . n 
B 1 82  GLU 82  57  57  GLU GLU B . n 
B 1 83  LYS 83  58  58  LYS LYS B . n 
B 1 84  GLN 84  59  59  GLN GLN B . n 
B 1 85  VAL 85  60  60  VAL VAL B . n 
B 1 86  ASN 86  61  61  ASN ASN B . n 
B 1 87  GLN 87  62  62  GLN GLN B . n 
B 1 88  ARG 88  63  63  ARG ARG B . n 
B 1 89  ILE 89  64  64  ILE ILE B . n 
B 1 90  GLU 90  65  65  GLU GLU B . n 
B 1 91  ASN 91  66  66  ASN ASN B . n 
B 1 92  MET 92  67  67  MET MET B . n 
B 1 93  MET 93  68  68  MET MET B . n 
B 1 94  GLN 94  69  69  GLN GLN B . n 
B 1 95  GLN 95  70  70  GLN GLN B . n 
B 1 96  LYS 96  71  71  LYS LYS B . n 
B 1 97  ALA 97  72  72  ALA ALA B . n 
B 1 98  GLN 98  73  73  GLN GLN B . n 
B 1 99  ILE 99  74  74  ILE ILE B . n 
B 1 100 THR 100 75  75  THR THR B . n 
B 1 101 SER 101 76  76  SER SER B . n 
B 1 102 GLN 102 77  77  GLN GLN B . n 
B 1 103 GLN 103 78  78  GLN GLN B . n 
B 1 104 LEU 104 79  79  LEU LEU B . n 
B 1 105 ARG 105 80  80  ARG ARG B . n 
B 1 106 LYS 106 81  81  LYS LYS B . n 
B 1 107 ALA 107 82  82  ALA ALA B . n 
B 1 108 GLN 108 83  83  GLN GLN B . n 
B 1 109 LEU 109 84  84  LEU LEU B . n 
B 1 110 GLN 110 85  85  GLN GLN B . n 
B 1 111 VAL 111 86  86  VAL VAL B . n 
B 1 112 ASP 112 87  87  ASP ASP B . n 
B 1 113 ARG 113 88  88  ARG ARG B . n 
B 1 114 PHE 114 89  89  PHE PHE B . n 
B 1 115 ALA 115 90  90  ALA ALA B . n 
B 1 116 MET 116 91  91  MET MET B . n 
B 1 117 GLU 117 92  92  GLU GLU B . n 
B 1 118 LEU 118 93  93  LEU LEU B . n 
B 1 119 GLU 119 94  94  GLU GLU B . n 
B 1 120 GLN 120 95  95  GLN GLN B . n 
B 1 121 SER 121 96  96  SER SER B . n 
B 1 122 ARG 122 97  97  ARG ARG B . n 
B 1 123 ASN 123 98  98  ASN ASN B . n 
B 1 124 LEU 124 99  99  LEU LEU B . n 
B 1 125 SER 125 100 100 SER SER B . n 
B 1 126 ASN 126 101 101 ASN ASN B . n 
B 1 127 THR 127 102 102 THR THR B . n 
B 1 128 ILE 128 103 103 ILE ILE B . n 
B 1 129 VAL 129 104 104 VAL VAL B . n 
B 1 130 HIS 130 105 105 HIS HIS B . n 
B 1 131 ILE 131 106 106 ILE ILE B . n 
B 1 132 ASP 132 107 107 ASP ASP B . n 
B 1 133 MET 133 108 108 MET MET B . n 
B 1 134 ASP 134 109 109 ASP ASP B . n 
B 1 135 ALA 135 110 110 ALA ALA B . n 
B 1 136 PHE 136 111 111 PHE PHE B . n 
B 1 137 TYR 137 112 112 TYR TYR B . n 
B 1 138 ALA 138 113 113 ALA ALA B . n 
B 1 139 ALA 139 114 114 ALA ALA B . n 
B 1 140 VAL 140 115 115 VAL VAL B . n 
B 1 141 GLU 141 116 116 GLU GLU B . n 
B 1 142 MET 142 117 117 MET MET B . n 
B 1 143 ARG 143 118 118 ARG ARG B . n 
B 1 144 ASP 144 119 119 ASP ASP B . n 
B 1 145 ASN 145 120 120 ASN ASN B . n 
B 1 146 PRO 146 121 121 PRO PRO B . n 
B 1 147 GLU 147 122 122 GLU GLU B . n 
B 1 148 LEU 148 123 123 LEU LEU B . n 
B 1 149 LYS 149 124 124 LYS LYS B . n 
B 1 150 ASP 150 125 125 ASP ASP B . n 
B 1 151 LYS 151 126 126 LYS LYS B . n 
B 1 152 PRO 152 127 127 PRO PRO B . n 
B 1 153 ILE 153 128 128 ILE ILE B . n 
B 1 154 ALA 154 129 129 ALA ALA B . n 
B 1 155 VAL 155 130 130 VAL VAL B . n 
B 1 156 GLY 156 131 131 GLY GLY B . n 
B 1 157 SER 157 132 132 SER SER B . n 
B 1 158 MET 158 133 133 MET MET B . n 
B 1 159 SER 159 134 134 SER SER B . n 
B 1 160 MET 160 135 135 MET MET B . n 
B 1 161 LEU 161 136 136 LEU LEU B . n 
B 1 162 SER 162 137 137 SER SER B . n 
B 1 163 THR 163 138 138 THR THR B . n 
B 1 164 SER 164 139 139 SER SER B . n 
B 1 165 ASN 165 140 140 ASN ASN B . n 
B 1 166 TYR 166 141 141 TYR TYR B . n 
B 1 167 HIS 167 142 142 HIS HIS B . n 
B 1 168 ALA 168 143 143 ALA ALA B . n 
B 1 169 ARG 169 144 144 ARG ARG B . n 
B 1 170 ARG 170 145 145 ARG ARG B . n 
B 1 171 PHE 171 146 146 PHE PHE B . n 
B 1 172 GLY 172 147 147 GLY GLY B . n 
B 1 173 VAL 173 148 148 VAL VAL B . n 
B 1 174 ARG 174 149 149 ARG ARG B . n 
B 1 175 ALA 175 150 150 ALA ALA B . n 
B 1 176 ALA 176 151 151 ALA ALA B . n 
B 1 177 MET 177 152 152 MET MET B . n 
B 1 178 PRO 178 153 153 PRO PRO B . n 
B 1 179 GLY 179 154 154 GLY GLY B . n 
B 1 180 PHE 180 155 155 PHE PHE B . n 
B 1 181 ILE 181 156 156 ILE ILE B . n 
B 1 182 ALA 182 157 157 ALA ALA B . n 
B 1 183 LYS 183 158 158 LYS LYS B . n 
B 1 184 ARG 184 159 159 ARG ARG B . n 
B 1 185 LEU 185 160 160 LEU LEU B . n 
B 1 186 CYS 186 161 161 CYS CYS B . n 
B 1 187 PRO 187 162 162 PRO PRO B . n 
B 1 188 GLN 188 163 163 GLN GLN B . n 
B 1 189 LEU 189 164 164 LEU LEU B . n 
B 1 190 ILE 190 165 165 ILE ILE B . n 
B 1 191 ILE 191 166 166 ILE ILE B . n 
B 1 192 VAL 192 167 167 VAL VAL B . n 
B 1 193 PRO 193 168 168 PRO PRO B . n 
B 1 194 PRO 194 169 169 PRO PRO B . n 
B 1 195 ASN 195 170 170 ASN ASN B . n 
B 1 196 PHE 196 171 171 PHE PHE B . n 
B 1 197 ASP 197 172 172 ASP ASP B . n 
B 1 198 LYS 198 173 173 LYS LYS B . n 
B 1 199 TYR 199 174 174 TYR TYR B . n 
B 1 200 ARG 200 175 175 ARG ARG B . n 
B 1 201 ALA 201 176 176 ALA ALA B . n 
B 1 202 VAL 202 177 177 VAL VAL B . n 
B 1 203 SER 203 178 178 SER SER B . n 
B 1 204 LYS 204 179 179 LYS LYS B . n 
B 1 205 GLU 205 180 180 GLU GLU B . n 
B 1 206 VAL 206 181 181 VAL VAL B . n 
B 1 207 LYS 207 182 182 LYS LYS B . n 
B 1 208 GLU 208 183 183 GLU GLU B . n 
B 1 209 ILE 209 184 184 ILE ILE B . n 
B 1 210 LEU 210 185 185 LEU LEU B . n 
B 1 211 ALA 211 186 186 ALA ALA B . n 
B 1 212 ASP 212 187 187 ASP ASP B . n 
B 1 213 TYR 213 188 188 TYR TYR B . n 
B 1 214 ASP 214 189 189 ASP ASP B . n 
B 1 215 PRO 215 190 190 PRO PRO B . n 
B 1 216 ASN 216 191 191 ASN ASN B . n 
B 1 217 PHE 217 192 192 PHE PHE B . n 
B 1 218 MET 218 193 193 MET MET B . n 
B 1 219 ALA 219 194 194 ALA ALA B . n 
B 1 220 MET 220 195 195 MET MET B . n 
B 1 221 SER 221 196 196 SER SER B . n 
B 1 222 LEU 222 197 197 LEU LEU B . n 
B 1 223 ASP 223 198 198 ASP ASP B . n 
B 1 224 GLU 224 199 199 GLU GLU B . n 
B 1 225 ALA 225 200 200 ALA ALA B . n 
B 1 226 TYR 226 201 201 TYR TYR B . n 
B 1 227 LEU 227 202 202 LEU LEU B . n 
B 1 228 ASN 228 203 203 ASN ASN B . n 
B 1 229 ILE 229 204 204 ILE ILE B . n 
B 1 230 THR 230 205 205 THR THR B . n 
B 1 231 LYS 231 206 206 LYS LYS B . n 
B 1 232 HIS 232 207 207 HIS HIS B . n 
B 1 233 LEU 233 208 208 LEU LEU B . n 
B 1 234 GLU 234 209 209 GLU GLU B . n 
B 1 235 GLU 235 210 210 GLU GLU B . n 
B 1 236 ARG 236 211 211 ARG ARG B . n 
B 1 237 GLN 237 212 212 GLN GLN B . n 
B 1 238 ASN 238 213 213 ASN ASN B . n 
B 1 239 TRP 239 214 214 TRP TRP B . n 
B 1 240 PRO 240 215 215 PRO PRO B . n 
B 1 241 GLU 241 216 216 GLU GLU B . n 
B 1 242 ASP 242 217 217 ASP ASP B . n 
B 1 243 LYS 243 218 218 LYS LYS B . n 
B 1 244 ARG 244 219 219 ARG ARG B . n 
B 1 245 ARG 245 220 220 ARG ARG B . n 
B 1 246 TYR 246 221 221 TYR TYR B . n 
B 1 247 PHE 247 222 222 PHE PHE B . n 
B 1 248 ILE 248 223 223 ILE ILE B . n 
B 1 249 LYS 249 224 224 LYS LYS B . n 
B 1 250 MET 250 225 ?   ?   ?   B . n 
B 1 251 GLY 251 226 ?   ?   ?   B . n 
B 1 252 SER 252 227 ?   ?   ?   B . n 
B 1 253 SER 253 228 ?   ?   ?   B . n 
B 1 254 VAL 254 229 ?   ?   ?   B . n 
B 1 255 GLU 255 230 ?   ?   ?   B . n 
B 1 256 ASN 256 231 ?   ?   ?   B . n 
B 1 257 ASP 257 232 ?   ?   ?   B . n 
B 1 258 ASN 258 233 ?   ?   ?   B . n 
B 1 259 PRO 259 234 ?   ?   ?   B . n 
B 1 260 GLY 260 235 ?   ?   ?   B . n 
B 1 261 LYS 261 236 ?   ?   ?   B . n 
B 1 262 GLU 262 237 ?   ?   ?   B . n 
B 1 263 VAL 263 238 ?   ?   ?   B . n 
B 1 264 ASN 264 239 ?   ?   ?   B . n 
B 1 265 LYS 265 240 ?   ?   ?   B . n 
B 1 266 LEU 266 241 ?   ?   ?   B . n 
B 1 267 SER 267 242 ?   ?   ?   B . n 
B 1 268 GLU 268 243 ?   ?   ?   B . n 
B 1 269 HIS 269 244 ?   ?   ?   B . n 
B 1 270 GLU 270 245 ?   ?   ?   B . n 
B 1 271 ARG 271 246 ?   ?   ?   B . n 
B 1 272 SER 272 247 ?   ?   ?   B . n 
B 1 273 ILE 273 248 ?   ?   ?   B . n 
B 1 274 SER 274 249 ?   ?   ?   B . n 
B 1 275 PRO 275 250 ?   ?   ?   B . n 
B 1 276 LEU 276 251 ?   ?   ?   B . n 
B 1 277 LEU 277 252 ?   ?   ?   B . n 
B 1 278 PHE 278 253 ?   ?   ?   B . n 
B 1 279 GLU 279 254 ?   ?   ?   B . n 
B 1 280 GLU 280 255 ?   ?   ?   B . n 
B 1 281 SER 281 256 ?   ?   ?   B . n 
B 1 282 PRO 282 257 ?   ?   ?   B . n 
B 1 283 SER 283 258 ?   ?   ?   B . n 
B 1 284 ASP 284 259 ?   ?   ?   B . n 
B 1 285 VAL 285 260 ?   ?   ?   B . n 
B 1 286 GLN 286 261 ?   ?   ?   B . n 
B 1 287 PRO 287 262 ?   ?   ?   B . n 
B 1 288 PRO 288 263 ?   ?   ?   B . n 
B 1 289 GLY 289 264 ?   ?   ?   B . n 
B 1 290 ASP 290 265 ?   ?   ?   B . n 
B 1 291 PRO 291 266 ?   ?   ?   B . n 
B 1 292 PHE 292 267 ?   ?   ?   B . n 
B 1 293 GLN 293 268 ?   ?   ?   B . n 
B 1 294 VAL 294 269 ?   ?   ?   B . n 
B 1 295 ASN 295 270 ?   ?   ?   B . n 
B 1 296 PHE 296 271 ?   ?   ?   B . n 
B 1 297 GLU 297 272 ?   ?   ?   B . n 
B 1 298 GLU 298 273 ?   ?   ?   B . n 
B 1 299 GLN 299 274 ?   ?   ?   B . n 
B 1 300 ASN 300 275 ?   ?   ?   B . n 
B 1 301 ASN 301 276 ?   ?   ?   B . n 
B 1 302 PRO 302 277 ?   ?   ?   B . n 
B 1 303 GLN 303 278 ?   ?   ?   B . n 
B 1 304 ILE 304 279 ?   ?   ?   B . n 
B 1 305 LEU 305 280 ?   ?   ?   B . n 
B 1 306 GLN 306 281 ?   ?   ?   B . n 
B 1 307 ASN 307 282 282 ASN ASN B . n 
B 1 308 SER 308 283 283 SER SER B . n 
B 1 309 VAL 309 284 284 VAL VAL B . n 
B 1 310 VAL 310 285 285 VAL VAL B . n 
B 1 311 PHE 311 286 286 PHE PHE B . n 
B 1 312 GLY 312 287 287 GLY GLY B . n 
B 1 313 THR 313 288 288 THR THR B . n 
B 1 314 SER 314 289 289 SER SER B . n 
B 1 315 ALA 315 290 290 ALA ALA B . n 
B 1 316 GLN 316 291 291 GLN GLN B . n 
B 1 317 GLU 317 292 292 GLU GLU B . n 
B 1 318 VAL 318 293 293 VAL VAL B . n 
B 1 319 VAL 319 294 294 VAL VAL B . n 
B 1 320 LYS 320 295 295 LYS LYS B . n 
B 1 321 GLU 321 296 296 GLU GLU B . n 
B 1 322 ILE 322 297 297 ILE ILE B . n 
B 1 323 ARG 323 298 298 ARG ARG B . n 
B 1 324 PHE 324 299 299 PHE PHE B . n 
B 1 325 ARG 325 300 300 ARG ARG B . n 
B 1 326 ILE 326 301 301 ILE ILE B . n 
B 1 327 GLU 327 302 302 GLU GLU B . n 
B 1 328 GLN 328 303 303 GLN GLN B . n 
B 1 329 LYS 329 304 304 LYS LYS B . n 
B 1 330 THR 330 305 305 THR THR B . n 
B 1 331 THR 331 306 306 THR THR B . n 
B 1 332 LEU 332 307 307 LEU LEU B . n 
B 1 333 THR 333 308 308 THR THR B . n 
B 1 334 ALA 334 309 309 ALA ALA B . n 
B 1 335 SER 335 310 310 SER SER B . n 
B 1 336 ALA 336 311 311 ALA ALA B . n 
B 1 337 GLY 337 312 312 GLY GLY B . n 
B 1 338 ILE 338 313 313 ILE ILE B . n 
B 1 339 ALA 339 314 314 ALA ALA B . n 
B 1 340 PRO 340 315 315 PRO PRO B . n 
B 1 341 ASN 341 316 316 ASN ASN B . n 
B 1 342 THR 342 317 317 THR THR B . n 
B 1 343 MET 343 318 318 MET MET B . n 
B 1 344 LEU 344 319 319 LEU LEU B . n 
B 1 345 ALA 345 320 320 ALA ALA B . n 
B 1 346 LYS 346 321 321 LYS LYS B . n 
B 1 347 VAL 347 322 322 VAL VAL B . n 
B 1 348 CYS 348 323 323 CYS CYS B . n 
B 1 349 SER 349 324 324 SER SER B . n 
B 1 350 ASP 350 325 325 ASP ASP B . n 
B 1 351 LYS 351 326 326 LYS LYS B . n 
B 1 352 ASN 352 327 327 ASN ASN B . n 
B 1 353 LYS 353 328 328 LYS LYS B . n 
B 1 354 PRO 354 329 329 PRO PRO B . n 
B 1 355 ASN 355 330 330 ASN ASN B . n 
B 1 356 GLY 356 331 331 GLY GLY B . n 
B 1 357 GLN 357 332 332 GLN GLN B . n 
B 1 358 TYR 358 333 333 TYR TYR B . n 
B 1 359 GLN 359 334 334 GLN GLN B . n 
B 1 360 ILE 360 335 335 ILE ILE B . n 
B 1 361 LEU 361 336 336 LEU LEU B . n 
B 1 362 PRO 362 337 337 PRO PRO B . n 
B 1 363 ASN 363 338 338 ASN ASN B . n 
B 1 364 ARG 364 339 339 ARG ARG B . n 
B 1 365 GLN 365 340 340 GLN GLN B . n 
B 1 366 ALA 366 341 341 ALA ALA B . n 
B 1 367 VAL 367 342 342 VAL VAL B . n 
B 1 368 MET 368 343 343 MET MET B . n 
B 1 369 ASP 369 344 344 ASP ASP B . n 
B 1 370 PHE 370 345 345 PHE PHE B . n 
B 1 371 ILE 371 346 346 ILE ILE B . n 
B 1 372 LYS 372 347 347 LYS LYS B . n 
B 1 373 ASP 373 348 348 ASP ASP B . n 
B 1 374 LEU 374 349 349 LEU LEU B . n 
B 1 375 PRO 375 350 350 PRO PRO B . n 
B 1 376 ILE 376 351 351 ILE ILE B . n 
B 1 377 ARG 377 352 352 ARG ARG B . n 
B 1 378 LYS 378 353 353 LYS LYS B . n 
B 1 379 VAL 379 354 354 VAL VAL B . n 
B 1 380 SER 380 355 355 SER SER B . n 
B 1 381 GLY 381 356 356 GLY GLY B . n 
B 1 382 ILE 382 357 357 ILE ILE B . n 
B 1 383 GLY 383 358 358 GLY GLY B . n 
B 1 384 LYS 384 359 359 LYS LYS B . n 
B 1 385 VAL 385 360 360 VAL VAL B . n 
B 1 386 THR 386 361 361 THR THR B . n 
B 1 387 GLU 387 362 362 GLU GLU B . n 
B 1 388 LYS 388 363 363 LYS LYS B . n 
B 1 389 MET 389 364 364 MET MET B . n 
B 1 390 LEU 390 365 365 LEU LEU B . n 
B 1 391 LYS 391 366 366 LYS LYS B . n 
B 1 392 ALA 392 367 367 ALA ALA B . n 
B 1 393 LEU 393 368 368 LEU LEU B . n 
B 1 394 GLY 394 369 369 GLY GLY B . n 
B 1 395 ILE 395 370 370 ILE ILE B . n 
B 1 396 ILE 396 371 371 ILE ILE B . n 
B 1 397 THR 397 372 372 THR THR B . n 
B 1 398 CYS 398 373 373 CYS CYS B . n 
B 1 399 THR 399 374 374 THR THR B . n 
B 1 400 GLU 400 375 375 GLU GLU B . n 
B 1 401 LEU 401 376 376 LEU LEU B . n 
B 1 402 TYR 402 377 377 TYR TYR B . n 
B 1 403 GLN 403 378 378 GLN GLN B . n 
B 1 404 GLN 404 379 379 GLN GLN B . n 
B 1 405 ARG 405 380 380 ARG ARG B . n 
B 1 406 ALA 406 381 381 ALA ALA B . n 
B 1 407 LEU 407 382 382 LEU LEU B . n 
B 1 408 LEU 408 383 383 LEU LEU B . n 
B 1 409 SER 409 384 384 SER SER B . n 
B 1 410 LEU 410 385 385 LEU LEU B . n 
B 1 411 LEU 411 386 386 LEU LEU B . n 
B 1 412 PHE 412 387 387 PHE PHE B . n 
B 1 413 SER 413 388 388 SER SER B . n 
B 1 414 GLU 414 389 389 GLU GLU B . n 
B 1 415 THR 415 390 390 THR THR B . n 
B 1 416 SER 416 391 391 SER SER B . n 
B 1 417 TRP 417 392 392 TRP TRP B . n 
B 1 418 HIS 418 393 393 HIS HIS B . n 
B 1 419 TYR 419 394 394 TYR TYR B . n 
B 1 420 PHE 420 395 395 PHE PHE B . n 
B 1 421 LEU 421 396 396 LEU LEU B . n 
B 1 422 HIS 422 397 397 HIS HIS B . n 
B 1 423 ILE 423 398 398 ILE ILE B . n 
B 1 424 SER 424 399 399 SER SER B . n 
B 1 425 LEU 425 400 400 LEU LEU B . n 
B 1 426 GLY 426 401 401 GLY GLY B . n 
B 1 427 LEU 427 402 402 LEU LEU B . n 
B 1 428 GLY 428 403 403 GLY GLY B . n 
B 1 429 SER 429 404 404 SER SER B . n 
B 1 430 THR 430 405 405 THR THR B . n 
B 1 431 HIS 431 406 406 HIS HIS B . n 
B 1 432 LEU 432 407 407 LEU LEU B . n 
B 1 433 THR 433 408 408 THR THR B . n 
B 1 434 ARG 434 409 409 ARG ARG B . n 
B 1 435 ASP 435 410 410 ASP ASP B . n 
B 1 436 GLY 436 411 411 GLY GLY B . n 
B 1 437 GLU 437 412 412 GLU GLU B . n 
B 1 438 ARG 438 413 413 ARG ARG B . n 
B 1 439 LYS 439 414 414 LYS LYS B . n 
B 1 440 SER 440 415 415 SER SER B . n 
B 1 441 MET 441 416 416 MET MET B . n 
B 1 442 SER 442 417 417 SER SER B . n 
B 1 443 VAL 443 418 418 VAL VAL B . n 
B 1 444 GLU 444 419 419 GLU GLU B . n 
B 1 445 ARG 445 420 420 ARG ARG B . n 
B 1 446 THR 446 421 421 THR THR B . n 
B 1 447 PHE 447 422 422 PHE PHE B . n 
B 1 448 SER 448 423 423 SER SER B . n 
B 1 449 GLU 449 424 424 GLU GLU B . n 
B 1 450 ILE 450 425 425 ILE ILE B . n 
B 1 451 ASN 451 426 426 ASN ASN B . n 
B 1 452 LYS 452 427 427 LYS LYS B . n 
B 1 453 ALA 453 428 428 ALA ALA B . n 
B 1 454 GLU 454 429 429 GLU GLU B . n 
B 1 455 GLU 455 430 430 GLU GLU B . n 
B 1 456 GLN 456 431 431 GLN GLN B . n 
B 1 457 TYR 457 432 432 TYR TYR B . n 
B 1 458 SER 458 433 433 SER SER B . n 
B 1 459 LEU 459 434 434 LEU LEU B . n 
B 1 460 CYS 460 435 435 CYS CYS B . n 
B 1 461 GLN 461 436 436 GLN GLN B . n 
B 1 462 GLU 462 437 437 GLU GLU B . n 
B 1 463 LEU 463 438 438 LEU LEU B . n 
B 1 464 CYS 464 439 439 CYS CYS B . n 
B 1 465 SER 465 440 440 SER SER B . n 
B 1 466 GLU 466 441 441 GLU GLU B . n 
B 1 467 LEU 467 442 442 LEU LEU B . n 
B 1 468 ALA 468 443 443 ALA ALA B . n 
B 1 469 GLN 469 444 444 GLN GLN B . n 
B 1 470 ASP 470 445 445 ASP ASP B . n 
B 1 471 LEU 471 446 446 LEU LEU B . n 
B 1 472 GLN 472 447 447 GLN GLN B . n 
B 1 473 LYS 473 448 448 LYS LYS B . n 
B 1 474 GLU 474 449 449 GLU GLU B . n 
B 1 475 ARG 475 450 450 ARG ARG B . n 
B 1 476 LEU 476 451 451 LEU LEU B . n 
B 1 477 LYS 477 452 452 LYS LYS B . n 
B 1 478 GLY 478 453 453 GLY GLY B . n 
B 1 479 ARG 479 454 454 ARG ARG B . n 
B 1 480 THR 480 455 455 THR THR B . n 
B 1 481 VAL 481 456 456 VAL VAL B . n 
B 1 482 THR 482 457 457 THR THR B . n 
B 1 483 ILE 483 458 458 ILE ILE B . n 
B 1 484 LYS 484 459 459 LYS LYS B . n 
B 1 485 LEU 485 460 460 LEU LEU B . n 
B 1 486 LYS 486 461 461 LYS LYS B . n 
B 1 487 ASN 487 462 462 ASN ASN B . n 
B 1 488 VAL 488 463 463 VAL VAL B . n 
B 1 489 ASN 489 464 464 ASN ASN B . n 
B 1 490 PHE 490 465 465 PHE PHE B . n 
B 1 491 GLU 491 466 466 GLU GLU B . n 
B 1 492 VAL 492 467 467 VAL VAL B . n 
B 1 493 LYS 493 468 468 LYS LYS B . n 
B 1 494 THR 494 469 469 THR THR B . n 
B 1 495 ARG 495 470 470 ARG ARG B . n 
B 1 496 ALA 496 471 471 ALA ALA B . n 
B 1 497 SER 497 472 472 SER SER B . n 
B 1 498 THR 498 473 473 THR THR B . n 
B 1 499 VAL 499 474 474 VAL VAL B . n 
B 1 500 SER 500 475 475 SER SER B . n 
B 1 501 SER 501 476 476 SER SER B . n 
B 1 502 VAL 502 477 477 VAL VAL B . n 
B 1 503 VAL 503 478 478 VAL VAL B . n 
B 1 504 SER 504 479 479 SER SER B . n 
B 1 505 THR 505 480 480 THR THR B . n 
B 1 506 ALA 506 481 481 ALA ALA B . n 
B 1 507 GLU 507 482 482 GLU GLU B . n 
B 1 508 GLU 508 483 483 GLU GLU B . n 
B 1 509 ILE 509 484 484 ILE ILE B . n 
B 1 510 PHE 510 485 485 PHE PHE B . n 
B 1 511 ALA 511 486 486 ALA ALA B . n 
B 1 512 ILE 512 487 487 ILE ILE B . n 
B 1 513 ALA 513 488 488 ALA ALA B . n 
B 1 514 LYS 514 489 489 LYS LYS B . n 
B 1 515 GLU 515 490 490 GLU GLU B . n 
B 1 516 LEU 516 491 491 LEU LEU B . n 
B 1 517 LEU 517 492 492 LEU LEU B . n 
B 1 518 LYS 518 493 493 LYS LYS B . n 
B 1 519 THR 519 494 494 THR THR B . n 
B 1 520 GLU 520 495 495 GLU GLU B . n 
B 1 521 ILE 521 496 496 ILE ILE B . n 
B 1 522 ASP 522 497 497 ASP ASP B . n 
B 1 523 ALA 523 498 498 ALA ALA B . n 
B 1 524 ASP 524 499 499 ASP ASP B . n 
B 1 525 PHE 525 500 500 PHE PHE B . n 
B 1 526 PRO 526 501 501 PRO PRO B . n 
B 1 527 HIS 527 502 502 HIS HIS B . n 
B 1 528 PRO 528 503 503 PRO PRO B . n 
B 1 529 LEU 529 504 504 LEU LEU B . n 
B 1 530 ARG 530 505 505 ARG ARG B . n 
B 1 531 LEU 531 506 506 LEU LEU B . n 
B 1 532 ARG 532 507 507 ARG ARG B . n 
B 1 533 LEU 533 508 508 LEU LEU B . n 
B 1 534 MET 534 509 509 MET MET B . n 
B 1 535 GLY 535 510 510 GLY GLY B . n 
B 1 536 VAL 536 511 511 VAL VAL B . n 
B 1 537 ARG 537 512 512 ARG ARG B . n 
B 1 538 ILE 538 513 513 ILE ILE B . n 
B 1 539 SER 539 514 514 SER SER B . n 
B 1 540 SER 540 515 515 SER SER B . n 
B 1 541 PHE 541 516 516 PHE PHE B . n 
B 1 542 PRO 542 517 517 PRO PRO B . n 
B 1 543 ASN 543 518 518 ASN ASN B . n 
B 1 544 GLU 544 519 ?   ?   ?   B . n 
B 1 545 GLU 545 520 ?   ?   ?   B . n 
B 1 546 ASP 546 521 ?   ?   ?   B . n 
B 1 547 ARG 547 522 ?   ?   ?   B . n 
B 1 548 LYS 548 523 ?   ?   ?   B . n 
B 1 549 HIS 549 524 ?   ?   ?   B . n 
B 1 550 GLN 550 525 ?   ?   ?   B . n 
B 1 551 GLN 551 526 ?   ?   ?   B . n 
C 2 1   DA  1   5   5   DA  DA  C . n 
C 2 2   DT  2   6   6   DT  DT  C . n 
C 2 3   DA  3   7   7   DA  DA  C . n 
C 2 4   DC  4   8   8   DC  DC  C . n 
C 2 5   DA  5   9   9   DA  DA  C . n 
C 2 6   DT  6   10  10  DT  DT  C . n 
C 2 7   DA  7   11  11  DA  DA  C . n 
C 2 8   DC  8   12  12  DC  DC  C . n 
C 2 9   DC  9   13  13  DC  DC  C . n 
D 3 1   DT  1   2   2   DT  DT  D . n 
D 3 2   DA  2   3   3   DA  DA  D . n 
D 3 3   DC  3   4   4   DC  DC  D . n 
D 3 4   DT  4   5   5   DT  DT  D . n 
D 3 5   DG  5   6   6   DG  DG  D . n 
D 3 6   DG  6   7   7   DG  DG  D . n 
D 3 7   DT  7   8   8   DT  DT  D . n 
D 3 8   DA  8   9   9   DA  DA  D . n 
D 3 9   DT  9   10  10  DT  DT  D . n 
D 3 10  DG  10  11  11  DG  DG  D . n 
D 3 11  DT  11  12  12  DT  DT  D . n 
D 3 12  DA  12  13  13  DA  DA  D . n 
D 3 13  DT  13  14  14  DT  DT  D . n 
E 2 1   DA  1   5   5   DA  DA  P . n 
E 2 2   DT  2   6   6   DT  DT  P . n 
E 2 3   DA  3   7   7   DA  DA  P . n 
E 2 4   DC  4   8   8   DC  DC  P . n 
E 2 5   DA  5   9   9   DA  DA  P . n 
E 2 6   DT  6   10  10  DT  DT  P . n 
E 2 7   DA  7   11  11  DA  DA  P . n 
E 2 8   DC  8   12  12  DC  DC  P . n 
E 2 9   DC  9   13  13  DC  DC  P . n 
F 3 1   DT  1   2   2   DT  DT  T . n 
F 3 2   DA  2   3   3   DA  DA  T . n 
F 3 3   DC  3   4   4   DC  DC  T . n 
F 3 4   DT  4   5   5   DT  DT  T . n 
F 3 5   DG  5   6   6   DG  DG  T . n 
F 3 6   DG  6   7   7   DG  DG  T . n 
F 3 7   DT  7   8   8   DT  DT  T . n 
F 3 8   DA  8   9   9   DA  DA  T . n 
F 3 9   DT  9   10  10  DT  DT  T . n 
F 3 10  DG  10  11  11  DG  DG  T . n 
F 3 11  DT  11  12  12  DT  DT  T . n 
F 3 12  DA  12  13  13  DA  DA  T . n 
F 3 13  DT  13  14  14  DT  DT  T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G  4  MG  1   601 1   MG  MG  A . 
H  4  MG  1   602 2   MG  MG  A . 
I  5  PEG 1   603 1   PEG PEG A . 
J  5  PEG 1   604 3   PEG PEG A . 
K  5  PEG 1   605 4   PEG PEG A . 
L  5  PEG 1   606 5   PEG PEG A . 
M  6  IOD 1   607 1   IOD IOD A . 
N  6  IOD 1   608 2   IOD IOD A . 
O  6  IOD 1   609 6   IOD IOD A . 
P  7  EDO 1   610 2   EDO EDO A . 
Q  7  EDO 1   611 3   EDO EDO A . 
R  7  EDO 1   612 4   EDO EDO A . 
S  7  EDO 1   613 5   EDO EDO A . 
T  7  EDO 1   614 6   EDO EDO A . 
U  7  EDO 1   615 7   EDO EDO A . 
V  7  EDO 1   616 8   EDO EDO A . 
W  7  EDO 1   617 9   EDO EDO A . 
X  7  EDO 1   618 10  EDO EDO A . 
Y  8  DZ4 1   619 1   DZ4 DZ4 A . 
Z  9  PGE 1   620 1   PGE PGE A . 
AA 10 CL  1   621 1   CL  CL  A . 
BA 10 CL  1   622 3   CL  CL  A . 
CA 10 CL  1   623 4   CL  CL  A . 
DA 10 CL  1   624 8   CL  CL  A . 
EA 10 CL  1   625 10  CL  CL  A . 
FA 11 K   1   626 4   K   K   A . 
GA 4  MG  1   601 3   MG  MG  B . 
HA 4  MG  1   602 4   MG  MG  B . 
IA 5  PEG 1   603 2   PEG PEG B . 
JA 6  IOD 1   604 4   IOD IOD B . 
KA 6  IOD 1   605 7   IOD IOD B . 
LA 6  IOD 1   606 8   IOD IOD B . 
MA 7  EDO 1   607 1   EDO EDO B . 
NA 8  DZ4 1   608 1   DZ4 DZ4 B . 
OA 10 CL  1   609 5   CL  CL  B . 
PA 10 CL  1   610 6   CL  CL  B . 
QA 10 CL  1   611 7   CL  CL  B . 
RA 10 CL  1   612 9   CL  CL  B . 
SA 11 K   1   613 1   K   K   B . 
TA 11 K   1   614 2   K   K   B . 
UA 11 K   1   101 3   K   K   D . 
VA 12 HOH 1   701 343 HOH HOH A . 
VA 12 HOH 2   702 424 HOH HOH A . 
VA 12 HOH 3   703 281 HOH HOH A . 
VA 12 HOH 4   704 438 HOH HOH A . 
VA 12 HOH 5   705 285 HOH HOH A . 
VA 12 HOH 6   706 479 HOH HOH A . 
VA 12 HOH 7   707 232 HOH HOH A . 
VA 12 HOH 8   708 286 HOH HOH A . 
VA 12 HOH 9   709 1   HOH HOH A . 
VA 12 HOH 10  710 253 HOH HOH A . 
VA 12 HOH 11  711 167 HOH HOH A . 
VA 12 HOH 12  712 264 HOH HOH A . 
VA 12 HOH 13  713 307 HOH HOH A . 
VA 12 HOH 14  714 327 HOH HOH A . 
VA 12 HOH 15  715 338 HOH HOH A . 
VA 12 HOH 16  716 233 HOH HOH A . 
VA 12 HOH 17  717 340 HOH HOH A . 
VA 12 HOH 18  718 400 HOH HOH A . 
VA 12 HOH 19  719 373 HOH HOH A . 
VA 12 HOH 20  720 355 HOH HOH A . 
VA 12 HOH 21  721 102 HOH HOH A . 
VA 12 HOH 22  722 101 HOH HOH A . 
VA 12 HOH 23  723 421 HOH HOH A . 
VA 12 HOH 24  724 480 HOH HOH A . 
VA 12 HOH 25  725 435 HOH HOH A . 
VA 12 HOH 26  726 294 HOH HOH A . 
VA 12 HOH 27  727 3   HOH HOH A . 
VA 12 HOH 28  728 271 HOH HOH A . 
VA 12 HOH 29  729 312 HOH HOH A . 
VA 12 HOH 30  730 302 HOH HOH A . 
VA 12 HOH 31  731 206 HOH HOH A . 
VA 12 HOH 32  732 274 HOH HOH A . 
VA 12 HOH 33  733 117 HOH HOH A . 
VA 12 HOH 34  734 391 HOH HOH A . 
VA 12 HOH 35  735 46  HOH HOH A . 
VA 12 HOH 36  736 30  HOH HOH A . 
VA 12 HOH 37  737 67  HOH HOH A . 
VA 12 HOH 38  738 40  HOH HOH A . 
VA 12 HOH 39  739 71  HOH HOH A . 
VA 12 HOH 40  740 115 HOH HOH A . 
VA 12 HOH 41  741 234 HOH HOH A . 
VA 12 HOH 42  742 273 HOH HOH A . 
VA 12 HOH 43  743 276 HOH HOH A . 
VA 12 HOH 44  744 123 HOH HOH A . 
VA 12 HOH 45  745 242 HOH HOH A . 
VA 12 HOH 46  746 207 HOH HOH A . 
VA 12 HOH 47  747 198 HOH HOH A . 
VA 12 HOH 48  748 142 HOH HOH A . 
VA 12 HOH 49  749 23  HOH HOH A . 
VA 12 HOH 50  750 288 HOH HOH A . 
VA 12 HOH 51  751 255 HOH HOH A . 
VA 12 HOH 52  752 291 HOH HOH A . 
VA 12 HOH 53  753 323 HOH HOH A . 
VA 12 HOH 54  754 88  HOH HOH A . 
VA 12 HOH 55  755 155 HOH HOH A . 
VA 12 HOH 56  756 428 HOH HOH A . 
VA 12 HOH 57  757 228 HOH HOH A . 
VA 12 HOH 58  758 47  HOH HOH A . 
VA 12 HOH 59  759 81  HOH HOH A . 
VA 12 HOH 60  760 311 HOH HOH A . 
VA 12 HOH 61  761 303 HOH HOH A . 
VA 12 HOH 62  762 41  HOH HOH A . 
VA 12 HOH 63  763 231 HOH HOH A . 
VA 12 HOH 64  764 32  HOH HOH A . 
VA 12 HOH 65  765 478 HOH HOH A . 
VA 12 HOH 66  766 256 HOH HOH A . 
VA 12 HOH 67  767 277 HOH HOH A . 
VA 12 HOH 68  768 336 HOH HOH A . 
VA 12 HOH 69  769 252 HOH HOH A . 
VA 12 HOH 70  770 243 HOH HOH A . 
VA 12 HOH 71  771 141 HOH HOH A . 
VA 12 HOH 72  772 370 HOH HOH A . 
VA 12 HOH 73  773 248 HOH HOH A . 
VA 12 HOH 74  774 362 HOH HOH A . 
VA 12 HOH 75  775 76  HOH HOH A . 
VA 12 HOH 76  776 407 HOH HOH A . 
VA 12 HOH 77  777 91  HOH HOH A . 
VA 12 HOH 78  778 17  HOH HOH A . 
VA 12 HOH 79  779 2   HOH HOH A . 
VA 12 HOH 80  780 329 HOH HOH A . 
VA 12 HOH 81  781 381 HOH HOH A . 
VA 12 HOH 82  782 341 HOH HOH A . 
VA 12 HOH 83  783 5   HOH HOH A . 
VA 12 HOH 84  784 265 HOH HOH A . 
VA 12 HOH 85  785 267 HOH HOH A . 
VA 12 HOH 86  786 182 HOH HOH A . 
VA 12 HOH 87  787 246 HOH HOH A . 
VA 12 HOH 88  788 351 HOH HOH A . 
VA 12 HOH 89  789 420 HOH HOH A . 
VA 12 HOH 90  790 249 HOH HOH A . 
VA 12 HOH 91  791 43  HOH HOH A . 
VA 12 HOH 92  792 173 HOH HOH A . 
VA 12 HOH 93  793 132 HOH HOH A . 
VA 12 HOH 94  794 353 HOH HOH A . 
VA 12 HOH 95  795 380 HOH HOH A . 
VA 12 HOH 96  796 257 HOH HOH A . 
VA 12 HOH 97  797 83  HOH HOH A . 
VA 12 HOH 98  798 8   HOH HOH A . 
VA 12 HOH 99  799 195 HOH HOH A . 
VA 12 HOH 100 800 316 HOH HOH A . 
VA 12 HOH 101 801 409 HOH HOH A . 
VA 12 HOH 102 802 113 HOH HOH A . 
VA 12 HOH 103 803 408 HOH HOH A . 
VA 12 HOH 104 804 226 HOH HOH A . 
VA 12 HOH 105 805 319 HOH HOH A . 
VA 12 HOH 106 806 85  HOH HOH A . 
VA 12 HOH 107 807 394 HOH HOH A . 
VA 12 HOH 108 808 349 HOH HOH A . 
VA 12 HOH 109 809 175 HOH HOH A . 
VA 12 HOH 110 810 296 HOH HOH A . 
VA 12 HOH 111 811 335 HOH HOH A . 
VA 12 HOH 112 812 127 HOH HOH A . 
VA 12 HOH 113 813 75  HOH HOH A . 
VA 12 HOH 114 814 72  HOH HOH A . 
VA 12 HOH 115 815 16  HOH HOH A . 
VA 12 HOH 116 816 74  HOH HOH A . 
VA 12 HOH 117 817 37  HOH HOH A . 
VA 12 HOH 118 818 268 HOH HOH A . 
VA 12 HOH 119 819 366 HOH HOH A . 
VA 12 HOH 120 820 24  HOH HOH A . 
VA 12 HOH 121 821 181 HOH HOH A . 
VA 12 HOH 122 822 171 HOH HOH A . 
VA 12 HOH 123 823 411 HOH HOH A . 
VA 12 HOH 124 824 52  HOH HOH A . 
VA 12 HOH 125 825 53  HOH HOH A . 
VA 12 HOH 126 826 310 HOH HOH A . 
VA 12 HOH 127 827 474 HOH HOH A . 
VA 12 HOH 128 828 86  HOH HOH A . 
VA 12 HOH 129 829 92  HOH HOH A . 
VA 12 HOH 130 830 413 HOH HOH A . 
VA 12 HOH 131 831 259 HOH HOH A . 
VA 12 HOH 132 832 251 HOH HOH A . 
VA 12 HOH 133 833 342 HOH HOH A . 
VA 12 HOH 134 834 197 HOH HOH A . 
VA 12 HOH 135 835 143 HOH HOH A . 
VA 12 HOH 136 836 300 HOH HOH A . 
VA 12 HOH 137 837 63  HOH HOH A . 
VA 12 HOH 138 838 325 HOH HOH A . 
VA 12 HOH 139 839 431 HOH HOH A . 
VA 12 HOH 140 840 278 HOH HOH A . 
VA 12 HOH 141 841 14  HOH HOH A . 
VA 12 HOH 142 842 279 HOH HOH A . 
VA 12 HOH 143 843 31  HOH HOH A . 
VA 12 HOH 144 844 371 HOH HOH A . 
VA 12 HOH 145 845 36  HOH HOH A . 
VA 12 HOH 146 846 412 HOH HOH A . 
VA 12 HOH 147 847 352 HOH HOH A . 
VA 12 HOH 148 848 318 HOH HOH A . 
VA 12 HOH 149 849 111 HOH HOH A . 
VA 12 HOH 150 850 301 HOH HOH A . 
VA 12 HOH 151 851 306 HOH HOH A . 
VA 12 HOH 152 852 51  HOH HOH A . 
VA 12 HOH 153 853 179 HOH HOH A . 
VA 12 HOH 154 854 13  HOH HOH A . 
VA 12 HOH 155 855 136 HOH HOH A . 
VA 12 HOH 156 856 49  HOH HOH A . 
VA 12 HOH 157 857 21  HOH HOH A . 
VA 12 HOH 158 858 290 HOH HOH A . 
VA 12 HOH 159 859 200 HOH HOH A . 
VA 12 HOH 160 860 57  HOH HOH A . 
VA 12 HOH 161 861 326 HOH HOH A . 
VA 12 HOH 162 862 345 HOH HOH A . 
VA 12 HOH 163 863 270 HOH HOH A . 
VA 12 HOH 164 864 475 HOH HOH A . 
VA 12 HOH 165 865 372 HOH HOH A . 
VA 12 HOH 166 866 60  HOH HOH A . 
VA 12 HOH 167 867 97  HOH HOH A . 
VA 12 HOH 168 868 334 HOH HOH A . 
VA 12 HOH 169 869 266 HOH HOH A . 
VA 12 HOH 170 870 481 HOH HOH A . 
VA 12 HOH 171 871 437 HOH HOH A . 
VA 12 HOH 172 872 163 HOH HOH A . 
VA 12 HOH 173 873 283 HOH HOH A . 
VA 12 HOH 174 874 227 HOH HOH A . 
VA 12 HOH 175 875 122 HOH HOH A . 
VA 12 HOH 176 876 39  HOH HOH A . 
VA 12 HOH 177 877 199 HOH HOH A . 
VA 12 HOH 178 878 476 HOH HOH A . 
VA 12 HOH 179 879 483 HOH HOH A . 
VA 12 HOH 180 880 196 HOH HOH A . 
VA 12 HOH 181 881 28  HOH HOH A . 
VA 12 HOH 182 882 419 HOH HOH A . 
VA 12 HOH 183 883 308 HOH HOH A . 
VA 12 HOH 184 884 392 HOH HOH A . 
VA 12 HOH 185 885 250 HOH HOH A . 
VA 12 HOH 186 886 452 HOH HOH A . 
VA 12 HOH 187 887 65  HOH HOH A . 
VA 12 HOH 188 888 10  HOH HOH A . 
VA 12 HOH 189 889 38  HOH HOH A . 
VA 12 HOH 190 890 293 HOH HOH A . 
VA 12 HOH 191 891 128 HOH HOH A . 
VA 12 HOH 192 892 309 HOH HOH A . 
VA 12 HOH 193 893 284 HOH HOH A . 
VA 12 HOH 194 894 458 HOH HOH A . 
VA 12 HOH 195 895 347 HOH HOH A . 
VA 12 HOH 196 896 258 HOH HOH A . 
VA 12 HOH 197 897 432 HOH HOH A . 
VA 12 HOH 198 898 77  HOH HOH A . 
VA 12 HOH 199 899 269 HOH HOH A . 
VA 12 HOH 200 900 395 HOH HOH A . 
VA 12 HOH 201 901 87  HOH HOH A . 
VA 12 HOH 202 902 292 HOH HOH A . 
VA 12 HOH 203 903 397 HOH HOH A . 
VA 12 HOH 204 904 305 HOH HOH A . 
VA 12 HOH 205 905 429 HOH HOH A . 
VA 12 HOH 206 906 304 HOH HOH A . 
VA 12 HOH 207 907 436 HOH HOH A . 
VA 12 HOH 208 908 473 HOH HOH A . 
VA 12 HOH 209 909 272 HOH HOH A . 
VA 12 HOH 210 910 482 HOH HOH A . 
VA 12 HOH 211 911 367 HOH HOH A . 
VA 12 HOH 212 912 247 HOH HOH A . 
VA 12 HOH 213 913 192 HOH HOH A . 
VA 12 HOH 214 914 369 HOH HOH A . 
VA 12 HOH 215 915 416 HOH HOH A . 
VA 12 HOH 216 916 193 HOH HOH A . 
VA 12 HOH 217 917 177 HOH HOH A . 
VA 12 HOH 218 918 389 HOH HOH A . 
VA 12 HOH 219 919 471 HOH HOH A . 
VA 12 HOH 220 920 439 HOH HOH A . 
VA 12 HOH 221 921 94  HOH HOH A . 
VA 12 HOH 222 922 457 HOH HOH A . 
VA 12 HOH 223 923 29  HOH HOH A . 
VA 12 HOH 224 924 454 HOH HOH A . 
VA 12 HOH 225 925 393 HOH HOH A . 
VA 12 HOH 226 926 317 HOH HOH A . 
VA 12 HOH 227 927 455 HOH HOH A . 
VA 12 HOH 228 928 468 HOH HOH A . 
VA 12 HOH 229 929 354 HOH HOH A . 
VA 12 HOH 230 930 477 HOH HOH A . 
VA 12 HOH 231 931 470 HOH HOH A . 
VA 12 HOH 232 932 484 HOH HOH A . 
VA 12 HOH 233 933 456 HOH HOH A . 
VA 12 HOH 234 934 164 HOH HOH A . 
VA 12 HOH 235 935 96  HOH HOH A . 
VA 12 HOH 236 936 98  HOH HOH A . 
VA 12 HOH 237 937 275 HOH HOH A . 
VA 12 HOH 238 938 441 HOH HOH A . 
VA 12 HOH 239 939 356 HOH HOH A . 
VA 12 HOH 240 940 388 HOH HOH A . 
VA 12 HOH 241 941 390 HOH HOH A . 
VA 12 HOH 242 942 453 HOH HOH A . 
VA 12 HOH 243 943 95  HOH HOH A . 
WA 12 HOH 1   701 289 HOH HOH B . 
WA 12 HOH 2   702 19  HOH HOH B . 
WA 12 HOH 3   703 208 HOH HOH B . 
WA 12 HOH 4   704 218 HOH HOH B . 
WA 12 HOH 5   705 485 HOH HOH B . 
WA 12 HOH 6   706 116 HOH HOH B . 
WA 12 HOH 7   707 15  HOH HOH B . 
WA 12 HOH 8   708 133 HOH HOH B . 
WA 12 HOH 9   709 176 HOH HOH B . 
WA 12 HOH 10  710 125 HOH HOH B . 
WA 12 HOH 11  711 209 HOH HOH B . 
WA 12 HOH 12  712 186 HOH HOH B . 
WA 12 HOH 13  713 145 HOH HOH B . 
WA 12 HOH 14  714 44  HOH HOH B . 
WA 12 HOH 15  715 406 HOH HOH B . 
WA 12 HOH 16  716 417 HOH HOH B . 
WA 12 HOH 17  717 156 HOH HOH B . 
WA 12 HOH 18  718 48  HOH HOH B . 
WA 12 HOH 19  719 203 HOH HOH B . 
WA 12 HOH 20  720 178 HOH HOH B . 
WA 12 HOH 21  721 170 HOH HOH B . 
WA 12 HOH 22  722 138 HOH HOH B . 
WA 12 HOH 23  723 148 HOH HOH B . 
WA 12 HOH 24  724 185 HOH HOH B . 
WA 12 HOH 25  725 425 HOH HOH B . 
WA 12 HOH 26  726 442 HOH HOH B . 
WA 12 HOH 27  727 114 HOH HOH B . 
WA 12 HOH 28  728 204 HOH HOH B . 
WA 12 HOH 29  729 152 HOH HOH B . 
WA 12 HOH 30  730 384 HOH HOH B . 
WA 12 HOH 31  731 313 HOH HOH B . 
WA 12 HOH 32  732 225 HOH HOH B . 
WA 12 HOH 33  733 112 HOH HOH B . 
WA 12 HOH 34  734 324 HOH HOH B . 
WA 12 HOH 35  735 360 HOH HOH B . 
WA 12 HOH 36  736 205 HOH HOH B . 
WA 12 HOH 37  737 121 HOH HOH B . 
WA 12 HOH 38  738 320 HOH HOH B . 
WA 12 HOH 39  739 245 HOH HOH B . 
WA 12 HOH 40  740 487 HOH HOH B . 
WA 12 HOH 41  741 322 HOH HOH B . 
WA 12 HOH 42  742 333 HOH HOH B . 
WA 12 HOH 43  743 357 HOH HOH B . 
WA 12 HOH 44  744 153 HOH HOH B . 
WA 12 HOH 45  745 213 HOH HOH B . 
WA 12 HOH 46  746 35  HOH HOH B . 
WA 12 HOH 47  747 134 HOH HOH B . 
WA 12 HOH 48  748 219 HOH HOH B . 
WA 12 HOH 49  749 298 HOH HOH B . 
WA 12 HOH 50  750 214 HOH HOH B . 
WA 12 HOH 51  751 137 HOH HOH B . 
WA 12 HOH 52  752 22  HOH HOH B . 
WA 12 HOH 53  753 126 HOH HOH B . 
WA 12 HOH 54  754 106 HOH HOH B . 
WA 12 HOH 55  755 124 HOH HOH B . 
WA 12 HOH 56  756 223 HOH HOH B . 
WA 12 HOH 57  757 383 HOH HOH B . 
WA 12 HOH 58  758 444 HOH HOH B . 
WA 12 HOH 59  759 18  HOH HOH B . 
WA 12 HOH 60  760 261 HOH HOH B . 
WA 12 HOH 61  761 212 HOH HOH B . 
WA 12 HOH 62  762 337 HOH HOH B . 
WA 12 HOH 63  763 244 HOH HOH B . 
WA 12 HOH 64  764 27  HOH HOH B . 
WA 12 HOH 65  765 220 HOH HOH B . 
WA 12 HOH 66  766 26  HOH HOH B . 
WA 12 HOH 67  767 440 HOH HOH B . 
WA 12 HOH 68  768 165 HOH HOH B . 
WA 12 HOH 69  769 147 HOH HOH B . 
WA 12 HOH 70  770 172 HOH HOH B . 
WA 12 HOH 71  771 210 HOH HOH B . 
WA 12 HOH 72  772 59  HOH HOH B . 
WA 12 HOH 73  773 45  HOH HOH B . 
WA 12 HOH 74  774 297 HOH HOH B . 
WA 12 HOH 75  775 20  HOH HOH B . 
WA 12 HOH 76  776 423 HOH HOH B . 
WA 12 HOH 77  777 108 HOH HOH B . 
WA 12 HOH 78  778 100 HOH HOH B . 
WA 12 HOH 79  779 184 HOH HOH B . 
WA 12 HOH 80  780 464 HOH HOH B . 
WA 12 HOH 81  781 365 HOH HOH B . 
WA 12 HOH 82  782 161 HOH HOH B . 
WA 12 HOH 83  783 6   HOH HOH B . 
WA 12 HOH 84  784 166 HOH HOH B . 
WA 12 HOH 85  785 130 HOH HOH B . 
WA 12 HOH 86  786 42  HOH HOH B . 
WA 12 HOH 87  787 348 HOH HOH B . 
WA 12 HOH 88  788 377 HOH HOH B . 
WA 12 HOH 89  789 140 HOH HOH B . 
WA 12 HOH 90  790 11  HOH HOH B . 
WA 12 HOH 91  791 66  HOH HOH B . 
WA 12 HOH 92  792 260 HOH HOH B . 
WA 12 HOH 93  793 339 HOH HOH B . 
WA 12 HOH 94  794 119 HOH HOH B . 
WA 12 HOH 95  795 157 HOH HOH B . 
WA 12 HOH 96  796 217 HOH HOH B . 
WA 12 HOH 97  797 144 HOH HOH B . 
WA 12 HOH 98  798 364 HOH HOH B . 
WA 12 HOH 99  799 410 HOH HOH B . 
WA 12 HOH 100 800 374 HOH HOH B . 
WA 12 HOH 101 801 110 HOH HOH B . 
WA 12 HOH 102 802 378 HOH HOH B . 
WA 12 HOH 103 803 150 HOH HOH B . 
WA 12 HOH 104 804 426 HOH HOH B . 
WA 12 HOH 105 805 331 HOH HOH B . 
WA 12 HOH 106 806 99  HOH HOH B . 
WA 12 HOH 107 807 422 HOH HOH B . 
WA 12 HOH 108 808 62  HOH HOH B . 
WA 12 HOH 109 809 68  HOH HOH B . 
WA 12 HOH 110 810 118 HOH HOH B . 
WA 12 HOH 111 811 215 HOH HOH B . 
WA 12 HOH 112 812 33  HOH HOH B . 
WA 12 HOH 113 813 222 HOH HOH B . 
WA 12 HOH 114 814 107 HOH HOH B . 
WA 12 HOH 115 815 89  HOH HOH B . 
WA 12 HOH 116 816 169 HOH HOH B . 
WA 12 HOH 117 817 80  HOH HOH B . 
WA 12 HOH 118 818 131 HOH HOH B . 
WA 12 HOH 119 819 149 HOH HOH B . 
WA 12 HOH 120 820 375 HOH HOH B . 
WA 12 HOH 121 821 104 HOH HOH B . 
WA 12 HOH 122 822 103 HOH HOH B . 
WA 12 HOH 123 823 376 HOH HOH B . 
WA 12 HOH 124 824 78  HOH HOH B . 
WA 12 HOH 125 825 211 HOH HOH B . 
WA 12 HOH 126 826 396 HOH HOH B . 
WA 12 HOH 127 827 50  HOH HOH B . 
WA 12 HOH 128 828 84  HOH HOH B . 
WA 12 HOH 129 829 180 HOH HOH B . 
WA 12 HOH 130 830 120 HOH HOH B . 
WA 12 HOH 131 831 358 HOH HOH B . 
WA 12 HOH 132 832 70  HOH HOH B . 
WA 12 HOH 133 833 447 HOH HOH B . 
WA 12 HOH 134 834 158 HOH HOH B . 
WA 12 HOH 135 835 58  HOH HOH B . 
WA 12 HOH 136 836 332 HOH HOH B . 
WA 12 HOH 137 837 221 HOH HOH B . 
WA 12 HOH 138 838 146 HOH HOH B . 
WA 12 HOH 139 839 463 HOH HOH B . 
WA 12 HOH 140 840 129 HOH HOH B . 
WA 12 HOH 141 841 446 HOH HOH B . 
WA 12 HOH 142 842 467 HOH HOH B . 
WA 12 HOH 143 843 459 HOH HOH B . 
WA 12 HOH 144 844 462 HOH HOH B . 
WA 12 HOH 145 845 54  HOH HOH B . 
WA 12 HOH 146 846 315 HOH HOH B . 
WA 12 HOH 147 847 216 HOH HOH B . 
WA 12 HOH 148 848 160 HOH HOH B . 
WA 12 HOH 149 849 168 HOH HOH B . 
WA 12 HOH 150 850 465 HOH HOH B . 
WA 12 HOH 151 851 486 HOH HOH B . 
WA 12 HOH 152 852 314 HOH HOH B . 
WA 12 HOH 153 853 386 HOH HOH B . 
WA 12 HOH 154 854 466 HOH HOH B . 
WA 12 HOH 155 855 489 HOH HOH B . 
WA 12 HOH 156 856 492 HOH HOH B . 
WA 12 HOH 157 857 299 HOH HOH B . 
WA 12 HOH 158 858 461 HOH HOH B . 
WA 12 HOH 159 859 493 HOH HOH B . 
WA 12 HOH 160 860 488 HOH HOH B . 
WA 12 HOH 161 861 350 HOH HOH B . 
WA 12 HOH 162 862 361 HOH HOH B . 
WA 12 HOH 163 863 191 HOH HOH B . 
WA 12 HOH 164 864 491 HOH HOH B . 
WA 12 HOH 165 865 460 HOH HOH B . 
WA 12 HOH 166 866 490 HOH HOH B . 
WA 12 HOH 167 867 194 HOH HOH B . 
WA 12 HOH 168 868 82  HOH HOH B . 
WA 12 HOH 169 869 174 HOH HOH B . 
WA 12 HOH 170 870 427 HOH HOH B . 
WA 12 HOH 171 871 387 HOH HOH B . 
WA 12 HOH 172 872 445 HOH HOH B . 
WA 12 HOH 173 873 469 HOH HOH B . 
XA 12 HOH 1   101 295 HOH HOH C . 
XA 12 HOH 2   102 254 HOH HOH C . 
XA 12 HOH 3   103 321 HOH HOH C . 
XA 12 HOH 4   104 202 HOH HOH C . 
XA 12 HOH 5   105 241 HOH HOH C . 
XA 12 HOH 6   106 109 HOH HOH C . 
XA 12 HOH 7   107 238 HOH HOH C . 
XA 12 HOH 8   108 61  HOH HOH C . 
XA 12 HOH 9   109 346 HOH HOH C . 
XA 12 HOH 10  110 359 HOH HOH C . 
XA 12 HOH 11  111 237 HOH HOH C . 
XA 12 HOH 12  112 328 HOH HOH C . 
XA 12 HOH 13  113 282 HOH HOH C . 
XA 12 HOH 14  114 201 HOH HOH C . 
XA 12 HOH 15  115 385 HOH HOH C . 
XA 12 HOH 16  116 79  HOH HOH C . 
XA 12 HOH 17  117 434 HOH HOH C . 
YA 12 HOH 1   201 418 HOH HOH D . 
YA 12 HOH 2   202 430 HOH HOH D . 
YA 12 HOH 3   203 287 HOH HOH D . 
YA 12 HOH 4   204 398 HOH HOH D . 
YA 12 HOH 5   205 262 HOH HOH D . 
YA 12 HOH 6   206 330 HOH HOH D . 
YA 12 HOH 7   207 399 HOH HOH D . 
YA 12 HOH 8   208 229 HOH HOH D . 
YA 12 HOH 9   209 239 HOH HOH D . 
YA 12 HOH 10  210 235 HOH HOH D . 
YA 12 HOH 11  211 236 HOH HOH D . 
YA 12 HOH 12  212 379 HOH HOH D . 
YA 12 HOH 13  213 401 HOH HOH D . 
YA 12 HOH 14  214 240 HOH HOH D . 
YA 12 HOH 15  215 230 HOH HOH D . 
YA 12 HOH 16  216 433 HOH HOH D . 
YA 12 HOH 17  217 263 HOH HOH D . 
YA 12 HOH 18  218 402 HOH HOH D . 
ZA 12 HOH 1   101 368 HOH HOH P . 
ZA 12 HOH 2   102 56  HOH HOH P . 
ZA 12 HOH 3   103 280 HOH HOH P . 
ZA 12 HOH 4   104 69  HOH HOH P . 
ZA 12 HOH 5   105 451 HOH HOH P . 
ZA 12 HOH 6   106 183 HOH HOH P . 
ZA 12 HOH 7   107 154 HOH HOH P . 
ZA 12 HOH 8   108 344 HOH HOH P . 
ZA 12 HOH 9   109 414 HOH HOH P . 
ZA 12 HOH 10  110 105 HOH HOH P . 
ZA 12 HOH 11  111 448 HOH HOH P . 
ZA 12 HOH 12  112 443 HOH HOH P . 
AB 12 HOH 1   101 224 HOH HOH T . 
AB 12 HOH 2   102 472 HOH HOH T . 
AB 12 HOH 3   103 449 HOH HOH T . 
AB 12 HOH 4   104 188 HOH HOH T . 
AB 12 HOH 5   105 34  HOH HOH T . 
AB 12 HOH 6   106 64  HOH HOH T . 
AB 12 HOH 7   107 139 HOH HOH T . 
AB 12 HOH 8   108 135 HOH HOH T . 
AB 12 HOH 9   109 450 HOH HOH T . 
AB 12 HOH 10  110 363 HOH HOH T . 
AB 12 HOH 11  111 159 HOH HOH T . 
AB 12 HOH 12  112 55  HOH HOH T . 
AB 12 HOH 13  113 7   HOH HOH T . 
AB 12 HOH 14  114 382 HOH HOH T . 
AB 12 HOH 15  115 415 HOH HOH T . 
AB 12 HOH 16  116 403 HOH HOH T . 
AB 12 HOH 17  117 187 HOH HOH T . 
AB 12 HOH 18  118 405 HOH HOH T . 
AB 12 HOH 19  119 404 HOH HOH T . 
AB 12 HOH 20  120 162 HOH HOH T . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      
;A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA,RA,SA,TA,UA,VA,WA,XA,YA,ZA,AB
;
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A  ASP 132 ? A ASP 107 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 O   ? A  MET 133 ? A MET 108 ? 1_555 87.7  ? 
2  OD1 ? A  ASP 132 ? A ASP 107 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 OD2 ? A  ASP 223 ? A ASP 198 ? 1_555 92.3  ? 
3  O   ? A  MET 133 ? A MET 108 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 OD2 ? A  ASP 223 ? A ASP 198 ? 1_555 87.3  ? 
4  OD1 ? A  ASP 132 ? A ASP 107 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 O1B ? Y  DZ4 .   ? A DZ4 619 ? 1_555 172.5 ? 
5  O   ? A  MET 133 ? A MET 108 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 O1B ? Y  DZ4 .   ? A DZ4 619 ? 1_555 86.2  ? 
6  OD2 ? A  ASP 223 ? A ASP 198 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 O1B ? Y  DZ4 .   ? A DZ4 619 ? 1_555 91.8  ? 
7  OD1 ? A  ASP 132 ? A ASP 107 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 O2G ? Y  DZ4 .   ? A DZ4 619 ? 1_555 88.2  ? 
8  O   ? A  MET 133 ? A MET 108 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 O2G ? Y  DZ4 .   ? A DZ4 619 ? 1_555 94.3  ? 
9  OD2 ? A  ASP 223 ? A ASP 198 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 O2G ? Y  DZ4 .   ? A DZ4 619 ? 1_555 178.3 ? 
10 O1B ? Y  DZ4 .   ? A DZ4 619 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 O2G ? Y  DZ4 .   ? A DZ4 619 ? 1_555 87.9  ? 
11 OD1 ? A  ASP 132 ? A ASP 107 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 O2A ? Y  DZ4 .   ? A DZ4 619 ? 1_555 98.6  ? 
12 O   ? A  MET 133 ? A MET 108 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 O2A ? Y  DZ4 .   ? A DZ4 619 ? 1_555 173.1 ? 
13 OD2 ? A  ASP 223 ? A ASP 198 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 O2A ? Y  DZ4 .   ? A DZ4 619 ? 1_555 89.7  ? 
14 O1B ? Y  DZ4 .   ? A DZ4 619 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 O2A ? Y  DZ4 .   ? A DZ4 619 ? 1_555 87.6  ? 
15 O2G ? Y  DZ4 .   ? A DZ4 619 ? 1_555 MG ? G  MG . ? A MG 601 ? 1_555 O2A ? Y  DZ4 .   ? A DZ4 619 ? 1_555 88.6  ? 
16 OD2 ? A  ASP 132 ? A ASP 107 ? 1_555 MG ? H  MG . ? A MG 602 ? 1_555 OD1 ? A  ASP 223 ? A ASP 198 ? 1_555 111.2 ? 
17 OD2 ? A  ASP 132 ? A ASP 107 ? 1_555 MG ? H  MG . ? A MG 602 ? 1_555 OE1 ? A  GLU 224 ? A GLU 199 ? 1_555 80.8  ? 
18 OD1 ? A  ASP 223 ? A ASP 198 ? 1_555 MG ? H  MG . ? A MG 602 ? 1_555 OE1 ? A  GLU 224 ? A GLU 199 ? 1_555 118.8 ? 
19 OD2 ? A  ASP 132 ? A ASP 107 ? 1_555 MG ? H  MG . ? A MG 602 ? 1_555 O2A ? Y  DZ4 .   ? A DZ4 619 ? 1_555 88.0  ? 
20 OD1 ? A  ASP 223 ? A ASP 198 ? 1_555 MG ? H  MG . ? A MG 602 ? 1_555 O2A ? Y  DZ4 .   ? A DZ4 619 ? 1_555 81.3  ? 
21 OE1 ? A  GLU 224 ? A GLU 199 ? 1_555 MG ? H  MG . ? A MG 602 ? 1_555 O2A ? Y  DZ4 .   ? A DZ4 619 ? 1_555 159.5 ? 
22 OD2 ? A  ASP 132 ? A ASP 107 ? 1_555 MG ? H  MG . ? A MG 602 ? 1_555 O   ? VA HOH .   ? A HOH 804 ? 1_555 72.4  ? 
23 OD1 ? A  ASP 223 ? A ASP 198 ? 1_555 MG ? H  MG . ? A MG 602 ? 1_555 O   ? VA HOH .   ? A HOH 804 ? 1_555 157.5 ? 
24 OE1 ? A  GLU 224 ? A GLU 199 ? 1_555 MG ? H  MG . ? A MG 602 ? 1_555 O   ? VA HOH .   ? A HOH 804 ? 1_555 83.6  ? 
25 O2A ? Y  DZ4 .   ? A DZ4 619 ? 1_555 MG ? H  MG . ? A MG 602 ? 1_555 O   ? VA HOH .   ? A HOH 804 ? 1_555 76.6  ? 
26 OD1 ? B  ASP 132 ? B ASP 107 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 O   ? B  MET 133 ? B MET 108 ? 1_555 83.5  ? 
27 OD1 ? B  ASP 132 ? B ASP 107 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 OD2 ? B  ASP 223 ? B ASP 198 ? 1_555 91.8  ? 
28 O   ? B  MET 133 ? B MET 108 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 OD2 ? B  ASP 223 ? B ASP 198 ? 1_555 86.4  ? 
29 OD1 ? B  ASP 132 ? B ASP 107 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 O1B ? NA DZ4 .   ? B DZ4 608 ? 1_555 171.4 ? 
30 O   ? B  MET 133 ? B MET 108 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 O1B ? NA DZ4 .   ? B DZ4 608 ? 1_555 88.4  ? 
31 OD2 ? B  ASP 223 ? B ASP 198 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 O1B ? NA DZ4 .   ? B DZ4 608 ? 1_555 90.7  ? 
32 OD1 ? B  ASP 132 ? B ASP 107 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 O2A ? NA DZ4 .   ? B DZ4 608 ? 1_555 100.8 ? 
33 O   ? B  MET 133 ? B MET 108 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 O2A ? NA DZ4 .   ? B DZ4 608 ? 1_555 172.5 ? 
34 OD2 ? B  ASP 223 ? B ASP 198 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 O2A ? NA DZ4 .   ? B DZ4 608 ? 1_555 87.4  ? 
35 O1B ? NA DZ4 .   ? B DZ4 608 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 O2A ? NA DZ4 .   ? B DZ4 608 ? 1_555 87.5  ? 
36 OD1 ? B  ASP 132 ? B ASP 107 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 O2G ? NA DZ4 .   ? B DZ4 608 ? 1_555 91.9  ? 
37 O   ? B  MET 133 ? B MET 108 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 O2G ? NA DZ4 .   ? B DZ4 608 ? 1_555 93.0  ? 
38 OD2 ? B  ASP 223 ? B ASP 198 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 O2G ? NA DZ4 .   ? B DZ4 608 ? 1_555 176.1 ? 
39 O1B ? NA DZ4 .   ? B DZ4 608 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 O2G ? NA DZ4 .   ? B DZ4 608 ? 1_555 85.5  ? 
40 O2A ? NA DZ4 .   ? B DZ4 608 ? 1_555 MG ? GA MG . ? B MG 601 ? 1_555 O2G ? NA DZ4 .   ? B DZ4 608 ? 1_555 93.0  ? 
41 OD1 ? B  ASP 223 ? B ASP 198 ? 1_555 MG ? HA MG . ? B MG 602 ? 1_555 OE2 ? B  GLU 224 ? B GLU 199 ? 1_555 117.4 ? 
42 OD1 ? B  ASP 223 ? B ASP 198 ? 1_555 MG ? HA MG . ? B MG 602 ? 1_555 O2A ? NA DZ4 .   ? B DZ4 608 ? 1_555 81.2  ? 
43 OE2 ? B  GLU 224 ? B GLU 199 ? 1_555 MG ? HA MG . ? B MG 602 ? 1_555 O2A ? NA DZ4 .   ? B DZ4 608 ? 1_555 159.9 ? 
44 OP2 ? D  DC  3   ? D DC  4   ? 1_555 K  ? UA K  . ? D K  101 ? 1_555 O   ? VA HOH .   ? A HOH 869 ? 1_555 106.4 ? 
45 O   ? WA HOH .   ? B HOH 836 ? 1_555 K  ? SA K  . ? B K  613 ? 1_555 O   ? WA HOH .   ? B HOH 803 ? 1_555 84.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-01-30 
2 'Structure model' 1 1 2020-01-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Author supporting evidence' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            pdbx_audit_support 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    2 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_audit_support.funding_organization' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC  ? ? ? 5.8.0135 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA   ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 "O3'" D DT 14 ? ? 1_555 P     P DA 5  ? ? 3_657 1.67 
2 1 P     C DA 5  ? ? 1_555 "O3'" T DT 14 ? ? 3_657 2.04 
3 1 OP1   C DA 5  ? ? 1_555 "O3'" T DT 14 ? ? 3_657 2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 17  ? ? 80.90   -107.38 
2 1 ASP A 410 ? ? -53.95  109.52  
3 1 SER A 479 ? ? -147.61 -27.17  
4 1 ALA B 151 ? ? 80.21   -2.98   
5 1 ASN B 191 ? ? -98.91  32.12   
6 1 ARG B 450 ? ? 36.34   55.01   
7 1 SER B 479 ? ? -159.65 -20.72  
8 1 PRO B 517 ? ? -64.68  3.30    
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LEU 17  ? CG  ? A LEU 42  CG  
2   1 Y 1 A LEU 17  ? CD1 ? A LEU 42  CD1 
3   1 Y 1 A LEU 17  ? CD2 ? A LEU 42  CD2 
4   1 Y 1 A LYS 45  ? CG  ? A LYS 70  CG  
5   1 Y 1 A LYS 45  ? CD  ? A LYS 70  CD  
6   1 Y 1 A LYS 45  ? CE  ? A LYS 70  CE  
7   1 Y 1 A LYS 45  ? NZ  ? A LYS 70  NZ  
8   1 Y 1 A MET 91  ? CG  ? A MET 116 CG  
9   1 Y 1 A MET 91  ? SD  ? A MET 116 SD  
10  1 Y 1 A MET 91  ? CE  ? A MET 116 CE  
11  1 Y 1 A GLU 92  ? CG  ? A GLU 117 CG  
12  1 Y 1 A GLU 92  ? CD  ? A GLU 117 CD  
13  1 Y 1 A GLU 92  ? OE1 ? A GLU 117 OE1 
14  1 Y 1 A GLU 92  ? OE2 ? A GLU 117 OE2 
15  1 Y 1 A ASP 217 ? CG  ? A ASP 242 CG  
16  1 Y 1 A ASP 217 ? OD1 ? A ASP 242 OD1 
17  1 Y 1 A ASP 217 ? OD2 ? A ASP 242 OD2 
18  1 Y 1 A LYS 224 ? CG  ? A LYS 249 CG  
19  1 Y 1 A LYS 224 ? CD  ? A LYS 249 CD  
20  1 Y 1 A LYS 224 ? CE  ? A LYS 249 CE  
21  1 Y 1 A LYS 224 ? NZ  ? A LYS 249 NZ  
22  1 Y 1 A ASN 282 ? CG  ? A ASN 307 CG  
23  1 Y 1 A ASN 282 ? OD1 ? A ASN 307 OD1 
24  1 Y 1 A ASN 282 ? ND2 ? A ASN 307 ND2 
25  1 Y 1 A LYS 347 ? CE  ? A LYS 372 CE  
26  1 Y 1 A LYS 347 ? NZ  ? A LYS 372 NZ  
27  1 Y 1 A LYS 359 ? CG  ? A LYS 384 CG  
28  1 Y 1 A LYS 359 ? CD  ? A LYS 384 CD  
29  1 Y 1 A LYS 359 ? CE  ? A LYS 384 CE  
30  1 Y 1 A LYS 359 ? NZ  ? A LYS 384 NZ  
31  1 Y 1 A ARG 409 ? CG  ? A ARG 434 CG  
32  1 Y 1 A ARG 409 ? CD  ? A ARG 434 CD  
33  1 Y 1 A ARG 409 ? NE  ? A ARG 434 NE  
34  1 Y 1 A ARG 409 ? CZ  ? A ARG 434 CZ  
35  1 Y 1 A ARG 409 ? NH1 ? A ARG 434 NH1 
36  1 Y 1 A ARG 409 ? NH2 ? A ARG 434 NH2 
37  1 Y 1 A ASP 410 ? CG  ? A ASP 435 CG  
38  1 Y 1 A ASP 410 ? OD1 ? A ASP 435 OD1 
39  1 Y 1 A ASP 410 ? OD2 ? A ASP 435 OD2 
40  1 Y 1 A GLU 412 ? CG  ? A GLU 437 CG  
41  1 Y 1 A GLU 412 ? CD  ? A GLU 437 CD  
42  1 Y 1 A GLU 412 ? OE1 ? A GLU 437 OE1 
43  1 Y 1 A GLU 412 ? OE2 ? A GLU 437 OE2 
44  1 Y 1 A GLN 444 ? CG  ? A GLN 469 CG  
45  1 Y 1 A GLN 444 ? CD  ? A GLN 469 CD  
46  1 Y 1 A GLN 444 ? OE1 ? A GLN 469 OE1 
47  1 Y 1 A GLN 444 ? NE2 ? A GLN 469 NE2 
48  1 Y 1 A SER 476 ? OG  ? A SER 501 OG  
49  1 Y 1 A ASN 518 ? CG  ? A ASN 543 CG  
50  1 Y 1 A ASN 518 ? OD1 ? A ASN 543 OD1 
51  1 Y 1 A ASN 518 ? ND2 ? A ASN 543 ND2 
52  1 Y 1 B LEU 21  ? CG  ? B LEU 46  CG  
53  1 Y 1 B LEU 21  ? CD1 ? B LEU 46  CD1 
54  1 Y 1 B LEU 21  ? CD2 ? B LEU 46  CD2 
55  1 Y 1 B ASN 22  ? CG  ? B ASN 47  CG  
56  1 Y 1 B ASN 22  ? OD1 ? B ASN 47  OD1 
57  1 Y 1 B ASN 22  ? ND2 ? B ASN 47  ND2 
58  1 Y 1 B LYS 25  ? CG  ? B LYS 50  CG  
59  1 Y 1 B LYS 25  ? CD  ? B LYS 50  CD  
60  1 Y 1 B LYS 25  ? CE  ? B LYS 50  CE  
61  1 Y 1 B LYS 25  ? NZ  ? B LYS 50  NZ  
62  1 Y 1 B GLU 34  ? CG  ? B GLU 59  CG  
63  1 Y 1 B GLU 34  ? CD  ? B GLU 59  CD  
64  1 Y 1 B GLU 34  ? OE1 ? B GLU 59  OE1 
65  1 Y 1 B GLU 34  ? OE2 ? B GLU 59  OE2 
66  1 Y 1 B LYS 38  ? CG  ? B LYS 63  CG  
67  1 Y 1 B LYS 38  ? CD  ? B LYS 63  CD  
68  1 Y 1 B LYS 38  ? CE  ? B LYS 63  CE  
69  1 Y 1 B LYS 38  ? NZ  ? B LYS 63  NZ  
70  1 Y 1 B GLU 42  ? CG  ? B GLU 67  CG  
71  1 Y 1 B GLU 42  ? CD  ? B GLU 67  CD  
72  1 Y 1 B GLU 42  ? OE1 ? B GLU 67  OE1 
73  1 Y 1 B GLU 42  ? OE2 ? B GLU 67  OE2 
74  1 Y 1 B LYS 45  ? CG  ? B LYS 70  CG  
75  1 Y 1 B LYS 45  ? CD  ? B LYS 70  CD  
76  1 Y 1 B LYS 45  ? CE  ? B LYS 70  CE  
77  1 Y 1 B LYS 45  ? NZ  ? B LYS 70  NZ  
78  1 Y 1 B ARG 88  ? CG  ? B ARG 113 CG  
79  1 Y 1 B ARG 88  ? CD  ? B ARG 113 CD  
80  1 Y 1 B ARG 88  ? NE  ? B ARG 113 NE  
81  1 Y 1 B ARG 88  ? CZ  ? B ARG 113 CZ  
82  1 Y 1 B ARG 88  ? NH1 ? B ARG 113 NH1 
83  1 Y 1 B ARG 88  ? NH2 ? B ARG 113 NH2 
84  1 Y 1 B GLN 95  ? CG  ? B GLN 120 CG  
85  1 Y 1 B GLN 95  ? CD  ? B GLN 120 CD  
86  1 Y 1 B GLN 95  ? OE1 ? B GLN 120 OE1 
87  1 Y 1 B GLN 95  ? NE2 ? B GLN 120 NE2 
88  1 Y 1 B LYS 206 ? CG  ? B LYS 231 CG  
89  1 Y 1 B LYS 206 ? CD  ? B LYS 231 CD  
90  1 Y 1 B LYS 206 ? CE  ? B LYS 231 CE  
91  1 Y 1 B LYS 206 ? NZ  ? B LYS 231 NZ  
92  1 Y 1 B LYS 224 ? CG  ? B LYS 249 CG  
93  1 Y 1 B LYS 224 ? CD  ? B LYS 249 CD  
94  1 Y 1 B LYS 224 ? CE  ? B LYS 249 CE  
95  1 Y 1 B LYS 224 ? NZ  ? B LYS 249 NZ  
96  1 Y 1 B ASN 282 ? CG  ? B ASN 307 CG  
97  1 Y 1 B ASN 282 ? OD1 ? B ASN 307 OD1 
98  1 Y 1 B ASN 282 ? ND2 ? B ASN 307 ND2 
99  1 Y 1 B SER 283 ? OG  ? B SER 308 OG  
100 1 Y 1 B ARG 409 ? CG  ? B ARG 434 CG  
101 1 Y 1 B ARG 409 ? CD  ? B ARG 434 CD  
102 1 Y 1 B ARG 409 ? NE  ? B ARG 434 NE  
103 1 Y 1 B ARG 409 ? CZ  ? B ARG 434 CZ  
104 1 Y 1 B ARG 409 ? NH1 ? B ARG 434 NH1 
105 1 Y 1 B ARG 409 ? NH2 ? B ARG 434 NH2 
106 1 Y 1 B ASP 410 ? CG  ? B ASP 435 CG  
107 1 Y 1 B ASP 410 ? OD1 ? B ASP 435 OD1 
108 1 Y 1 B ASP 410 ? OD2 ? B ASP 435 OD2 
109 1 Y 1 B GLU 412 ? CG  ? B GLU 437 CG  
110 1 Y 1 B GLU 412 ? CD  ? B GLU 437 CD  
111 1 Y 1 B GLU 412 ? OE1 ? B GLU 437 OE1 
112 1 Y 1 B GLU 412 ? OE2 ? B GLU 437 OE2 
113 1 Y 1 B LYS 414 ? CG  ? B LYS 439 CG  
114 1 Y 1 B LYS 414 ? CD  ? B LYS 439 CD  
115 1 Y 1 B LYS 414 ? CE  ? B LYS 439 CE  
116 1 Y 1 B LYS 414 ? NZ  ? B LYS 439 NZ  
117 1 Y 1 B LYS 448 ? CE  ? B LYS 473 CE  
118 1 Y 1 B LYS 448 ? NZ  ? B LYS 473 NZ  
119 1 Y 1 B SER 476 ? OG  ? B SER 501 OG  
120 1 Y 1 B ASN 518 ? CG  ? B ASN 543 CG  
121 1 Y 1 B ASN 518 ? OD1 ? B ASN 543 OD1 
122 1 Y 1 B ASN 518 ? ND2 ? B ASN 543 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET -24 ? A MET 1   
2   1 Y 1 A SER -23 ? A SER 2   
3   1 Y 1 A TYR -22 ? A TYR 3   
4   1 Y 1 A TYR -21 ? A TYR 4   
5   1 Y 1 A HIS -20 ? A HIS 5   
6   1 Y 1 A HIS -19 ? A HIS 6   
7   1 Y 1 A HIS -18 ? A HIS 7   
8   1 Y 1 A HIS -17 ? A HIS 8   
9   1 Y 1 A HIS -16 ? A HIS 9   
10  1 Y 1 A HIS -15 ? A HIS 10  
11  1 Y 1 A ASP -14 ? A ASP 11  
12  1 Y 1 A TYR -13 ? A TYR 12  
13  1 Y 1 A ASP -12 ? A ASP 13  
14  1 Y 1 A ILE -11 ? A ILE 14  
15  1 Y 1 A PRO -10 ? A PRO 15  
16  1 Y 1 A THR -9  ? A THR 16  
17  1 Y 1 A THR -8  ? A THR 17  
18  1 Y 1 A GLU -7  ? A GLU 18  
19  1 Y 1 A ASN -6  ? A ASN 19  
20  1 Y 1 A LEU -5  ? A LEU 20  
21  1 Y 1 A TYR -4  ? A TYR 21  
22  1 Y 1 A PHE -3  ? A PHE 22  
23  1 Y 1 A GLN -2  ? A GLN 23  
24  1 Y 1 A GLY -1  ? A GLY 24  
25  1 Y 1 A ALA 0   ? A ALA 25  
26  1 Y 1 A MET 1   ? A MET 26  
27  1 Y 1 A ASP 2   ? A ASP 27  
28  1 Y 1 A SER 3   ? A SER 28  
29  1 Y 1 A THR 4   ? A THR 29  
30  1 Y 1 A LYS 5   ? A LYS 30  
31  1 Y 1 A GLU 6   ? A GLU 31  
32  1 Y 1 A LYS 7   ? A LYS 32  
33  1 Y 1 A CYS 8   ? A CYS 33  
34  1 Y 1 A ASP 9   ? A ASP 34  
35  1 Y 1 A SER 10  ? A SER 35  
36  1 Y 1 A TYR 11  ? A TYR 36  
37  1 Y 1 A LYS 12  ? A LYS 37  
38  1 Y 1 A ASP 13  ? A ASP 38  
39  1 Y 1 A ASP 14  ? A ASP 39  
40  1 Y 1 A LEU 15  ? A LEU 40  
41  1 Y 1 A MET 225 ? A MET 250 
42  1 Y 1 A GLY 226 ? A GLY 251 
43  1 Y 1 A SER 227 ? A SER 252 
44  1 Y 1 A SER 228 ? A SER 253 
45  1 Y 1 A VAL 229 ? A VAL 254 
46  1 Y 1 A GLU 230 ? A GLU 255 
47  1 Y 1 A ASN 231 ? A ASN 256 
48  1 Y 1 A ASP 232 ? A ASP 257 
49  1 Y 1 A ASN 233 ? A ASN 258 
50  1 Y 1 A PRO 234 ? A PRO 259 
51  1 Y 1 A GLY 235 ? A GLY 260 
52  1 Y 1 A LYS 236 ? A LYS 261 
53  1 Y 1 A GLU 237 ? A GLU 262 
54  1 Y 1 A VAL 238 ? A VAL 263 
55  1 Y 1 A ASN 239 ? A ASN 264 
56  1 Y 1 A LYS 240 ? A LYS 265 
57  1 Y 1 A LEU 241 ? A LEU 266 
58  1 Y 1 A SER 242 ? A SER 267 
59  1 Y 1 A GLU 243 ? A GLU 268 
60  1 Y 1 A HIS 244 ? A HIS 269 
61  1 Y 1 A GLU 245 ? A GLU 270 
62  1 Y 1 A ARG 246 ? A ARG 271 
63  1 Y 1 A SER 247 ? A SER 272 
64  1 Y 1 A ILE 248 ? A ILE 273 
65  1 Y 1 A SER 249 ? A SER 274 
66  1 Y 1 A PRO 250 ? A PRO 275 
67  1 Y 1 A LEU 251 ? A LEU 276 
68  1 Y 1 A LEU 252 ? A LEU 277 
69  1 Y 1 A PHE 253 ? A PHE 278 
70  1 Y 1 A GLU 254 ? A GLU 279 
71  1 Y 1 A GLU 255 ? A GLU 280 
72  1 Y 1 A SER 256 ? A SER 281 
73  1 Y 1 A PRO 257 ? A PRO 282 
74  1 Y 1 A SER 258 ? A SER 283 
75  1 Y 1 A ASP 259 ? A ASP 284 
76  1 Y 1 A VAL 260 ? A VAL 285 
77  1 Y 1 A GLN 261 ? A GLN 286 
78  1 Y 1 A PRO 262 ? A PRO 287 
79  1 Y 1 A PRO 263 ? A PRO 288 
80  1 Y 1 A GLY 264 ? A GLY 289 
81  1 Y 1 A ASP 265 ? A ASP 290 
82  1 Y 1 A PRO 266 ? A PRO 291 
83  1 Y 1 A PHE 267 ? A PHE 292 
84  1 Y 1 A GLN 268 ? A GLN 293 
85  1 Y 1 A VAL 269 ? A VAL 294 
86  1 Y 1 A ASN 270 ? A ASN 295 
87  1 Y 1 A PHE 271 ? A PHE 296 
88  1 Y 1 A GLU 272 ? A GLU 297 
89  1 Y 1 A GLU 273 ? A GLU 298 
90  1 Y 1 A GLN 274 ? A GLN 299 
91  1 Y 1 A ASN 275 ? A ASN 300 
92  1 Y 1 A ASN 276 ? A ASN 301 
93  1 Y 1 A PRO 277 ? A PRO 302 
94  1 Y 1 A GLN 278 ? A GLN 303 
95  1 Y 1 A ILE 279 ? A ILE 304 
96  1 Y 1 A LEU 280 ? A LEU 305 
97  1 Y 1 A GLN 281 ? A GLN 306 
98  1 Y 1 A GLU 519 ? A GLU 544 
99  1 Y 1 A GLU 520 ? A GLU 545 
100 1 Y 1 A ASP 521 ? A ASP 546 
101 1 Y 1 A ARG 522 ? A ARG 547 
102 1 Y 1 A LYS 523 ? A LYS 548 
103 1 Y 1 A HIS 524 ? A HIS 549 
104 1 Y 1 A GLN 525 ? A GLN 550 
105 1 Y 1 A GLN 526 ? A GLN 551 
106 1 Y 1 B MET -24 ? B MET 1   
107 1 Y 1 B SER -23 ? B SER 2   
108 1 Y 1 B TYR -22 ? B TYR 3   
109 1 Y 1 B TYR -21 ? B TYR 4   
110 1 Y 1 B HIS -20 ? B HIS 5   
111 1 Y 1 B HIS -19 ? B HIS 6   
112 1 Y 1 B HIS -18 ? B HIS 7   
113 1 Y 1 B HIS -17 ? B HIS 8   
114 1 Y 1 B HIS -16 ? B HIS 9   
115 1 Y 1 B HIS -15 ? B HIS 10  
116 1 Y 1 B ASP -14 ? B ASP 11  
117 1 Y 1 B TYR -13 ? B TYR 12  
118 1 Y 1 B ASP -12 ? B ASP 13  
119 1 Y 1 B ILE -11 ? B ILE 14  
120 1 Y 1 B PRO -10 ? B PRO 15  
121 1 Y 1 B THR -9  ? B THR 16  
122 1 Y 1 B THR -8  ? B THR 17  
123 1 Y 1 B GLU -7  ? B GLU 18  
124 1 Y 1 B ASN -6  ? B ASN 19  
125 1 Y 1 B LEU -5  ? B LEU 20  
126 1 Y 1 B TYR -4  ? B TYR 21  
127 1 Y 1 B PHE -3  ? B PHE 22  
128 1 Y 1 B GLN -2  ? B GLN 23  
129 1 Y 1 B GLY -1  ? B GLY 24  
130 1 Y 1 B ALA 0   ? B ALA 25  
131 1 Y 1 B MET 1   ? B MET 26  
132 1 Y 1 B ASP 2   ? B ASP 27  
133 1 Y 1 B SER 3   ? B SER 28  
134 1 Y 1 B THR 4   ? B THR 29  
135 1 Y 1 B LYS 5   ? B LYS 30  
136 1 Y 1 B GLU 6   ? B GLU 31  
137 1 Y 1 B LYS 7   ? B LYS 32  
138 1 Y 1 B CYS 8   ? B CYS 33  
139 1 Y 1 B ASP 9   ? B ASP 34  
140 1 Y 1 B SER 10  ? B SER 35  
141 1 Y 1 B TYR 11  ? B TYR 36  
142 1 Y 1 B LYS 12  ? B LYS 37  
143 1 Y 1 B ASP 13  ? B ASP 38  
144 1 Y 1 B ASP 14  ? B ASP 39  
145 1 Y 1 B LEU 15  ? B LEU 40  
146 1 Y 1 B LEU 16  ? B LEU 41  
147 1 Y 1 B LEU 17  ? B LEU 42  
148 1 Y 1 B ARG 18  ? B ARG 43  
149 1 Y 1 B MET 19  ? B MET 44  
150 1 Y 1 B MET 225 ? B MET 250 
151 1 Y 1 B GLY 226 ? B GLY 251 
152 1 Y 1 B SER 227 ? B SER 252 
153 1 Y 1 B SER 228 ? B SER 253 
154 1 Y 1 B VAL 229 ? B VAL 254 
155 1 Y 1 B GLU 230 ? B GLU 255 
156 1 Y 1 B ASN 231 ? B ASN 256 
157 1 Y 1 B ASP 232 ? B ASP 257 
158 1 Y 1 B ASN 233 ? B ASN 258 
159 1 Y 1 B PRO 234 ? B PRO 259 
160 1 Y 1 B GLY 235 ? B GLY 260 
161 1 Y 1 B LYS 236 ? B LYS 261 
162 1 Y 1 B GLU 237 ? B GLU 262 
163 1 Y 1 B VAL 238 ? B VAL 263 
164 1 Y 1 B ASN 239 ? B ASN 264 
165 1 Y 1 B LYS 240 ? B LYS 265 
166 1 Y 1 B LEU 241 ? B LEU 266 
167 1 Y 1 B SER 242 ? B SER 267 
168 1 Y 1 B GLU 243 ? B GLU 268 
169 1 Y 1 B HIS 244 ? B HIS 269 
170 1 Y 1 B GLU 245 ? B GLU 270 
171 1 Y 1 B ARG 246 ? B ARG 271 
172 1 Y 1 B SER 247 ? B SER 272 
173 1 Y 1 B ILE 248 ? B ILE 273 
174 1 Y 1 B SER 249 ? B SER 274 
175 1 Y 1 B PRO 250 ? B PRO 275 
176 1 Y 1 B LEU 251 ? B LEU 276 
177 1 Y 1 B LEU 252 ? B LEU 277 
178 1 Y 1 B PHE 253 ? B PHE 278 
179 1 Y 1 B GLU 254 ? B GLU 279 
180 1 Y 1 B GLU 255 ? B GLU 280 
181 1 Y 1 B SER 256 ? B SER 281 
182 1 Y 1 B PRO 257 ? B PRO 282 
183 1 Y 1 B SER 258 ? B SER 283 
184 1 Y 1 B ASP 259 ? B ASP 284 
185 1 Y 1 B VAL 260 ? B VAL 285 
186 1 Y 1 B GLN 261 ? B GLN 286 
187 1 Y 1 B PRO 262 ? B PRO 287 
188 1 Y 1 B PRO 263 ? B PRO 288 
189 1 Y 1 B GLY 264 ? B GLY 289 
190 1 Y 1 B ASP 265 ? B ASP 290 
191 1 Y 1 B PRO 266 ? B PRO 291 
192 1 Y 1 B PHE 267 ? B PHE 292 
193 1 Y 1 B GLN 268 ? B GLN 293 
194 1 Y 1 B VAL 269 ? B VAL 294 
195 1 Y 1 B ASN 270 ? B ASN 295 
196 1 Y 1 B PHE 271 ? B PHE 296 
197 1 Y 1 B GLU 272 ? B GLU 297 
198 1 Y 1 B GLU 273 ? B GLU 298 
199 1 Y 1 B GLN 274 ? B GLN 299 
200 1 Y 1 B ASN 275 ? B ASN 300 
201 1 Y 1 B ASN 276 ? B ASN 301 
202 1 Y 1 B PRO 277 ? B PRO 302 
203 1 Y 1 B GLN 278 ? B GLN 303 
204 1 Y 1 B ILE 279 ? B ILE 304 
205 1 Y 1 B LEU 280 ? B LEU 305 
206 1 Y 1 B GLN 281 ? B GLN 306 
207 1 Y 1 B GLU 519 ? B GLU 544 
208 1 Y 1 B GLU 520 ? B GLU 545 
209 1 Y 1 B ASP 521 ? B ASP 546 
210 1 Y 1 B ARG 522 ? B ARG 547 
211 1 Y 1 B LYS 523 ? B LYS 548 
212 1 Y 1 B HIS 524 ? B HIS 549 
213 1 Y 1 B GLN 525 ? B GLN 550 
214 1 Y 1 B GLN 526 ? B GLN 551 
# 
_ndb_struct_conf_na.entry_id   6CST 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DA 1 1_555 D DT 13 1_555 0.110  -0.057 0.078  -6.842  -8.927  2.173  1  C_DA5:DT14_D C 5  ? D 14 ? 20 1 
1 C DT 2 1_555 D DA 12 1_555 0.050  -0.082 0.294  -3.732  -11.626 2.784  2  C_DT6:DA13_D C 6  ? D 13 ? 20 1 
1 C DA 3 1_555 D DT 11 1_555 -0.005 -0.091 0.182  0.905   -9.331  6.032  3  C_DA7:DT12_D C 7  ? D 12 ? 20 1 
1 C DC 4 1_555 D DG 10 1_555 0.475  -0.151 -0.207 9.772   -10.633 3.728  4  C_DC8:DG11_D C 8  ? D 11 ? 19 1 
1 C DA 5 1_555 D DT 9  1_555 0.262  -0.171 -0.326 -11.870 -11.494 4.920  5  C_DA9:DT10_D C 9  ? D 10 ? 20 1 
1 C DT 6 1_555 D DA 8  1_555 0.011  -0.105 -0.124 -4.662  -7.123  2.245  6  C_DT10:DA9_D C 10 ? D 9  ? 20 1 
1 C DA 7 1_555 D DT 7  1_555 0.114  -0.136 -0.068 -3.094  -0.428  -1.571 7  C_DA11:DT8_D C 11 ? D 8  ? 20 1 
1 C DC 8 1_555 D DG 6  1_555 0.303  -0.070 -0.354 9.941   -3.399  0.990  8  C_DC12:DG7_D C 12 ? D 7  ? 19 1 
1 C DC 9 1_555 D DG 5  1_555 0.161  -0.092 -0.069 -1.902  -6.293  1.160  9  C_DC13:DG6_D C 13 ? D 6  ? 19 1 
1 E DA 1 1_555 F DT 13 1_555 0.242  -0.093 0.053  -7.442  -10.096 1.023  10 P_DA5:DT14_T P 5  ? T 14 ? 20 1 
1 E DT 2 1_555 F DA 12 1_555 -0.010 -0.074 0.271  -4.013  -13.582 4.129  11 P_DT6:DA13_T P 6  ? T 13 ? 20 1 
1 E DA 3 1_555 F DT 11 1_555 -0.017 -0.111 -0.103 -3.358  -9.116  5.837  12 P_DA7:DT12_T P 7  ? T 12 ? 20 1 
1 E DC 4 1_555 F DG 10 1_555 0.202  -0.081 -0.042 7.028   -10.937 4.426  13 P_DC8:DG11_T P 8  ? T 11 ? 19 1 
1 E DA 5 1_555 F DT 9  1_555 0.236  -0.045 -0.269 -13.356 -9.907  6.004  14 P_DA9:DT10_T P 9  ? T 10 ? 20 1 
1 E DT 6 1_555 F DA 8  1_555 0.035  -0.058 -0.170 -3.727  -8.032  1.216  15 P_DT10:DA9_T P 10 ? T 9  ? 20 1 
1 E DA 7 1_555 F DT 7  1_555 0.112  -0.118 -0.069 -1.697  -1.485  -0.036 16 P_DA11:DT8_T P 11 ? T 8  ? 20 1 
1 E DC 8 1_555 F DG 6  1_555 0.389  -0.030 -0.352 13.201  -4.742  3.170  17 P_DC12:DG7_T P 12 ? T 7  ? 19 1 
1 E DC 9 1_555 F DG 5  1_555 0.357  -0.171 0.065  -8.164  -2.484  1.717  18 P_DC13:DG6_T P 13 ? T 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DA 1 1_555 D DT 13 1_555 C DT 2 1_555 D DA 12 1_555 -0.460 -0.972 3.189 -1.488 -2.864 30.304 -1.282 0.580  3.283 -5.459 2.835  
30.472 1  CC_DA5DT6:DA13DT14_DD C 5  ? D 14 ? C 6  ? D 13 ? 
1 C DT 2 1_555 D DA 12 1_555 C DA 3 1_555 D DT 11 1_555 -0.430 -0.412 3.103 -1.349 4.076  32.469 -1.395 0.544  3.045 7.249  2.399  
32.744 2  CC_DT6DA7:DT12DA13_DD C 6  ? D 13 ? C 7  ? D 12 ? 
1 C DA 3 1_555 D DT 11 1_555 C DC 4 1_555 D DG 10 1_555 0.345  -0.394 3.094 2.755  -0.701 32.292 -0.589 -0.156 3.120 -1.257 -4.941 
32.414 3  CC_DA7DC8:DG11DT12_DD C 7  ? D 12 ? C 8  ? D 11 ? 
1 C DC 4 1_555 D DG 10 1_555 C DA 5 1_555 D DT 9  1_555 0.571  -0.168 3.841 4.925  4.886  40.007 -0.886 -0.174 3.836 7.077  -7.133 
40.580 4  CC_DC8DA9:DT10DG11_DD C 8  ? D 11 ? C 9  ? D 10 ? 
1 C DA 5 1_555 D DT 9  1_555 C DT 6 1_555 D DA 8  1_555 -0.520 -0.679 3.132 -1.781 1.601  28.931 -1.692 0.662  3.116 3.199  3.558  
29.027 5  CC_DA9DT10:DA9DT10_DD C 9  ? D 10 ? C 10 ? D 9  ? 
1 C DT 6 1_555 D DA 8  1_555 C DA 7 1_555 D DT 7  1_555 0.161  -0.725 3.276 0.538  3.592  29.564 -2.153 -0.202 3.170 7.006  -1.050 
29.781 6  CC_DT10DA11:DT8DA9_DD C 10 ? D 9  ? C 11 ? D 8  ? 
1 C DA 7 1_555 D DT 7  1_555 C DC 8 1_555 D DG 6  1_555 0.318  -0.436 3.144 3.827  0.834  29.901 -1.003 0.141  3.146 1.608  -7.376 
30.150 7  CC_DA11DC12:DG7DT8_DD C 11 ? D 8  ? C 12 ? D 7  ? 
1 C DC 8 1_555 D DG 6  1_555 C DC 9 1_555 D DG 5  1_555 0.773  0.061  3.999 4.719  22.246 31.187 -3.396 -0.434 3.393 35.999 -7.637 
38.431 8  CC_DC12DC13:DG6DG7_DD C 12 ? D 7  ? C 13 ? D 6  ? 
1 E DA 1 1_555 F DT 13 1_555 E DT 2 1_555 F DA 12 1_555 -0.381 -0.963 3.241 -1.217 -1.797 29.903 -1.490 0.484  3.304 -3.477 2.354  
29.980 9  PP_DA5DT6:DA13DT14_TT P 5  ? T 14 ? P 6  ? T 13 ? 
1 E DT 2 1_555 F DA 12 1_555 E DA 3 1_555 F DT 11 1_555 -0.624 -0.500 3.248 -1.076 7.758  30.548 -2.335 0.952  3.051 14.429 2.001  
31.513 10 PP_DT6DA7:DT12DA13_TT P 6  ? T 13 ? P 7  ? T 12 ? 
1 E DA 3 1_555 F DT 11 1_555 E DC 4 1_555 F DG 10 1_555 0.327  -0.354 3.063 -1.427 -1.844 33.112 -0.330 -0.797 3.062 -3.230 2.500  
33.191 11 PP_DA7DC8:DG11DT12_TT P 7  ? T 12 ? P 8  ? T 11 ? 
1 E DC 4 1_555 F DG 10 1_555 E DA 5 1_555 F DT 9  1_555 0.515  -0.114 3.799 3.746  3.605  40.608 -0.624 -0.259 3.806 5.169  -5.371 
40.925 12 PP_DC8DA9:DT10DG11_TT P 8  ? T 11 ? P 9  ? T 10 ? 
1 E DA 5 1_555 F DT 9  1_555 E DT 6 1_555 F DA 8  1_555 -0.790 -0.726 3.089 -0.633 3.791  28.035 -2.304 1.480  2.984 7.778  1.298  
28.292 13 PP_DA9DT10:DA9DT10_TT P 9  ? T 10 ? P 10 ? T 9  ? 
1 E DT 6 1_555 F DA 8  1_555 E DA 7 1_555 F DT 7  1_555 0.103  -0.662 3.325 -0.753 2.857  30.101 -1.851 -0.351 3.246 5.484  1.445  
30.243 14 PP_DT10DA11:DT8DA9_TT P 10 ? T 9  ? P 11 ? T 8  ? 
1 E DA 7 1_555 F DT 7  1_555 E DC 8 1_555 F DG 6  1_555 0.319  -0.376 3.075 3.219  1.459  29.301 -1.031 0.019  3.070 2.871  -6.335 
29.509 15 PP_DA11DC12:DG7DT8_TT P 11 ? T 8  ? P 12 ? T 7  ? 
1 E DC 8 1_555 F DG 6  1_555 E DC 9 1_555 F DG 5  1_555 0.576  -0.085 4.324 2.370  24.895 30.907 -4.038 -0.478 3.386 39.590 -3.769 
39.564 16 PP_DC12DC13:DG6DG7_TT P 12 ? T 7  ? P 13 ? T 6  ? 
# 
_pdbx_audit_support.funding_organization   'Canadian Institutes of Health Research (CIHR)' 
_pdbx_audit_support.country                Canada 
_pdbx_audit_support.grant_number           MOP-94590 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4  'MAGNESIUM ION'                                                                              MG  
5  'DI(HYDROXYETHYL)ETHER'                                                                      PEG 
6  'IODIDE ION'                                                                                 IOD 
7  1,2-ETHANEDIOL                                                                               EDO 
8  "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]adenosine" DZ4 
9  'TRIETHYLENE GLYCOL'                                                                         PGE 
10 'CHLORIDE ION'                                                                               CL  
11 'POTASSIUM ION'                                                                              K   
12 water                                                                                        HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'native gel electrophoresis' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#