data_6CSU
# 
_entry.id   6CSU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.305 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CSU         
WWPDB D_1000233313 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6CSU 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lee, E.'    1 ? 
'Chen, Y.'   2 ? 
'Zhang, L.'  3 ? 
'Kim, T.S.'  4 ? 
'Ahn, J.I.'  5 ? 
'Park, J.E.' 6 ? 
'Lee, K.S.'  7 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                1151 
_citation.page_last                 1151 
_citation.title                     'Molecular architecture of a cylindrical self-assembly at human centrosomes.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-019-08838-2 
_citation.pdbx_database_id_PubMed   30858376 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kim, T.S.'     1  0000-0001-8592-3848 
primary 'Zhang, L.'     2  0000-0002-8338-784X 
primary 'Il Ahn, J.'    3  0000-0002-4600-3712 
primary 'Meng, L.'      4  ?                   
primary 'Chen, Y.'      5  ?                   
primary 'Lee, E.'       6  ?                   
primary 'Bang, J.K.'    7  0000-0001-5916-0912 
primary 'Lim, J.M.'     8  ?                   
primary 'Ghirlando, R.' 9  ?                   
primary 'Fan, L.'       10 ?                   
primary 'Wang, Y.X.'    11 ?                   
primary 'Kim, B.Y.'     12 0000-0003-1105-5480 
primary 'Park, J.E.'    13 0000-0001-9929-830X 
primary 'Lee, K.S.'     14 0000-0001-8326-7162 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6CSU 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     28.066 
_cell.length_a_esd                 ? 
_cell.length_b                     41.523 
_cell.length_b_esd                 ? 
_cell.length_c                     205.619 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6CSU 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Centrosomal protein of 152 kDa' 6456.716 2  ? ? ? ? 
2 polymer man 'Centrosomal protein of 63 kDa'  5331.049 2  ? ? ? ? 
3 water   nat water                            18.015   15 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 Cep152 
2 Cep63  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no MGALEELRGQYIKAVKKIKCDMLRYIQESKERAAEMVKAEVLRERQETARKMRK 
MGALEELRGQYIKAVKKIKCDMLRYIQESKERAAEMVKAEVLRERQETARKMRK B,D ? 
2 'polypeptide(L)' no no ACLNTRFLEEEELRSHHILERLDAHIEELKRESEKTVRQFTALK           ACLNTRFLEEEELRSHHILERLDAHIEELKRESEKTVRQFTALK C,A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLY n 
1 3  ALA n 
1 4  LEU n 
1 5  GLU n 
1 6  GLU n 
1 7  LEU n 
1 8  ARG n 
1 9  GLY n 
1 10 GLN n 
1 11 TYR n 
1 12 ILE n 
1 13 LYS n 
1 14 ALA n 
1 15 VAL n 
1 16 LYS n 
1 17 LYS n 
1 18 ILE n 
1 19 LYS n 
1 20 CYS n 
1 21 ASP n 
1 22 MET n 
1 23 LEU n 
1 24 ARG n 
1 25 TYR n 
1 26 ILE n 
1 27 GLN n 
1 28 GLU n 
1 29 SER n 
1 30 LYS n 
1 31 GLU n 
1 32 ARG n 
1 33 ALA n 
1 34 ALA n 
1 35 GLU n 
1 36 MET n 
1 37 VAL n 
1 38 LYS n 
1 39 ALA n 
1 40 GLU n 
1 41 VAL n 
1 42 LEU n 
1 43 ARG n 
1 44 GLU n 
1 45 ARG n 
1 46 GLN n 
1 47 GLU n 
1 48 THR n 
1 49 ALA n 
1 50 ARG n 
1 51 LYS n 
1 52 MET n 
1 53 ARG n 
1 54 LYS n 
2 1  ALA n 
2 2  CYS n 
2 3  LEU n 
2 4  ASN n 
2 5  THR n 
2 6  ARG n 
2 7  PHE n 
2 8  LEU n 
2 9  GLU n 
2 10 GLU n 
2 11 GLU n 
2 12 GLU n 
2 13 LEU n 
2 14 ARG n 
2 15 SER n 
2 16 HIS n 
2 17 HIS n 
2 18 ILE n 
2 19 LEU n 
2 20 GLU n 
2 21 ARG n 
2 22 LEU n 
2 23 ASP n 
2 24 ALA n 
2 25 HIS n 
2 26 ILE n 
2 27 GLU n 
2 28 GLU n 
2 29 LEU n 
2 30 LYS n 
2 31 ARG n 
2 32 GLU n 
2 33 SER n 
2 34 GLU n 
2 35 LYS n 
2 36 THR n 
2 37 VAL n 
2 38 ARG n 
2 39 GLN n 
2 40 PHE n 
2 41 THR n 
2 42 ALA n 
2 43 LEU n 
2 44 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 54 Human ? 'CEP152, KIAA0912' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 44 Human ? CEP63              ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CE152_HUMAN O94986 O94986-2 1 GALEELRGQYIKAVKKIKCDMLRYIQESKERAAEMVKAEVLRERQETARKMRK 1261 
2 UNP CEP63_HUMAN Q96MT8 ?        2 TRFLEEEELRSHHILERLDAHIEELKRESEKTVRQFTALK              664  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6CSU B 2 ? 54 ? O94986 1261 ? 1313 ? 1205 1257 
2 2 6CSU C 5 ? 44 ? Q96MT8 664  ? 703  ? 502  541  
3 1 6CSU D 2 ? 54 ? O94986 1261 ? 1313 ? 1205 1257 
4 2 6CSU A 5 ? 44 ? Q96MT8 664  ? 703  ? 502  541  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6CSU MET B 1 ? UNP O94986 ? ? 'initiating methionine' 1204 1  
2 6CSU ALA C 1 ? UNP Q96MT8 ? ? 'expression tag'        498  2  
2 6CSU CYS C 2 ? UNP Q96MT8 ? ? 'expression tag'        499  3  
2 6CSU LEU C 3 ? UNP Q96MT8 ? ? 'expression tag'        500  4  
2 6CSU ASN C 4 ? UNP Q96MT8 ? ? 'expression tag'        501  5  
3 6CSU MET D 1 ? UNP O94986 ? ? 'initiating methionine' 1204 6  
4 6CSU ALA A 1 ? UNP Q96MT8 ? ? 'expression tag'        498  7  
4 6CSU CYS A 2 ? UNP Q96MT8 ? ? 'expression tag'        499  8  
4 6CSU LEU A 3 ? UNP Q96MT8 ? ? 'expression tag'        500  9  
4 6CSU ASN A 4 ? UNP Q96MT8 ? ? 'expression tag'        501  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CSU 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.56 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         51.86 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M MES (pH 5.4), 23% PEG 3350 and 0.2 M ammonium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 R CdTe 300K' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-03-04 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9793 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9793 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6CSU 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.50 
_reflns.d_resolution_low                 19.87 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       8163 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             91.18 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.68 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.50 
_reflns_shell.d_res_low                   2.54 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6CSU 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.5 
_refine.ls_d_res_low                             19.870 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     8163 
_refine.ls_number_reflns_R_free                  817 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    90.78 
_refine.ls_percent_reflns_R_free                 10.01 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2535 
_refine.ls_R_factor_R_free                       0.2853 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2500 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.52 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               NONE 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 29.39 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.35 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1489 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             15 
_refine_hist.number_atoms_total               1504 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        19.870 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 1498 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.601  ? 1985 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 21.525 ? 966  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.031  ? 219  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.002  ? 255  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.4956 2.6516  . . 111 997  77.00 . . . 0.3358 . 0.2958 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6516 2.8558  . . 124 1115 85.00 . . . 0.3298 . 0.2782 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8558 3.1422  . . 138 1239 93.00 . . . 0.3038 . 0.2487 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1422 3.5945  . . 143 1287 97.00 . . . 0.2728 . 0.2562 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5945 4.5199  . . 145 1314 97.00 . . . 0.2358 . 0.2126 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5199 19.8705 . . 156 1394 96.00 . . . 0.3085 . 0.2617 . . . . . . . . . . 
# 
_struct.entry_id                     6CSU 
_struct.title                        'The structure of the Cep63-Cep152 heterotetrameric complex' 
_struct.pdbx_descriptor              'Centrosomal protein of 152 kDa, Centrosomal protein of 63 kDa' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CSU 
_struct_keywords.text            'Centrosome, Hydrophobic, CELL CYCLE' 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLY A 2  ? MET A 52 ? GLY B 1205 MET B 1255 1 ? 51 
HELX_P HELX_P2 AA2 CYS B 2  ? LEU B 43 ? CYS C 499  LEU C 540  1 ? 42 
HELX_P HELX_P3 AA3 GLY C 2  ? LEU C 42 ? GLY D 1205 LEU D 1245 1 ? 41 
HELX_P HELX_P4 AA4 ARG C 43 ? MET C 52 ? ARG D 1246 MET D 1255 1 ? 10 
HELX_P HELX_P5 AA5 CYS D 2  ? GLU D 32 ? CYS A 499  GLU A 529  1 ? 31 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    6CSU 
_atom_sites.fract_transf_matrix[1][1]   0.035630 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024083 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004863 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 2  ? 7.689   -3.316  -1.405  1.00 51.42  ? 1205 GLY B N   1 
ATOM   2    C CA  . GLY A 1 2  ? 8.878   -4.048  -1.015  1.00 20.79  ? 1205 GLY B CA  1 
ATOM   3    C C   . GLY A 1 2  ? 9.155   -5.228  -1.924  1.00 31.81  ? 1205 GLY B C   1 
ATOM   4    O O   . GLY A 1 2  ? 9.105   -5.094  -3.147  1.00 29.98  ? 1205 GLY B O   1 
ATOM   5    N N   . ALA A 1 3  ? 9.443   -6.389  -1.330  1.00 19.31  ? 1206 ALA B N   1 
ATOM   6    C CA  . ALA A 1 3  ? 9.776   -7.567  -2.127  1.00 27.67  ? 1206 ALA B CA  1 
ATOM   7    C C   . ALA A 1 3  ? 8.638   -7.943  -3.067  1.00 37.43  ? 1206 ALA B C   1 
ATOM   8    O O   . ALA A 1 3  ? 8.863   -8.285  -4.234  1.00 31.74  ? 1206 ALA B O   1 
ATOM   9    C CB  . ALA A 1 3  ? 10.126  -8.743  -1.217  1.00 19.53  ? 1206 ALA B CB  1 
ATOM   10   N N   . LEU A 1 4  ? 7.399   -7.883  -2.574  1.00 33.98  ? 1207 LEU B N   1 
ATOM   11   C CA  . LEU A 1 4  ? 6.271   -8.324  -3.385  1.00 25.89  ? 1207 LEU B CA  1 
ATOM   12   C C   . LEU A 1 4  ? 6.006   -7.362  -4.534  1.00 42.59  ? 1207 LEU B C   1 
ATOM   13   O O   . LEU A 1 4  ? 5.719   -7.796  -5.656  1.00 23.60  ? 1207 LEU B O   1 
ATOM   14   C CB  . LEU A 1 4  ? 5.027   -8.490  -2.515  1.00 20.11  ? 1207 LEU B CB  1 
ATOM   15   C CG  . LEU A 1 4  ? 5.104   -9.648  -1.518  1.00 33.05  ? 1207 LEU B CG  1 
ATOM   16   C CD1 . LEU A 1 4  ? 3.834   -9.765  -0.696  1.00 19.51  ? 1207 LEU B CD1 1 
ATOM   17   C CD2 . LEU A 1 4  ? 5.385   -10.948 -2.251  1.00 23.11  ? 1207 LEU B CD2 1 
ATOM   18   N N   . GLU A 1 5  ? 6.109   -6.056  -4.282  1.00 29.71  ? 1208 GLU B N   1 
ATOM   19   C CA  . GLU A 1 5  ? 5.903   -5.092  -5.357  1.00 26.55  ? 1208 GLU B CA  1 
ATOM   20   C C   . GLU A 1 5  ? 7.005   -5.193  -6.407  1.00 31.84  ? 1208 GLU B C   1 
ATOM   21   O O   . GLU A 1 5  ? 6.739   -5.074  -7.607  1.00 32.34  ? 1208 GLU B O   1 
ATOM   22   C CB  . GLU A 1 5  ? 5.819   -3.679  -4.784  1.00 23.83  ? 1208 GLU B CB  1 
ATOM   23   C CG  . GLU A 1 5  ? 5.491   -2.619  -5.818  1.00 41.17  ? 1208 GLU B CG  1 
ATOM   24   C CD  . GLU A 1 5  ? 4.287   -2.985  -6.674  1.00 48.69  ? 1208 GLU B CD  1 
ATOM   25   O OE1 . GLU A 1 5  ? 3.162   -3.081  -6.130  1.00 31.43  ? 1208 GLU B OE1 1 
ATOM   26   O OE2 . GLU A 1 5  ? 4.470   -3.187  -7.896  1.00 47.84  ? 1208 GLU B OE2 1 
ATOM   27   N N   . GLU A 1 6  ? 8.248   -5.419  -5.974  1.00 36.35  ? 1209 GLU B N   1 
ATOM   28   C CA  . GLU A 1 6  ? 9.340   -5.606  -6.924  1.00 33.89  ? 1209 GLU B CA  1 
ATOM   29   C C   . GLU A 1 6  ? 9.137   -6.871  -7.746  1.00 36.63  ? 1209 GLU B C   1 
ATOM   30   O O   . GLU A 1 6  ? 9.305   -6.860  -8.971  1.00 31.10  ? 1209 GLU B O   1 
ATOM   31   C CB  . GLU A 1 6  ? 10.682  -5.651  -6.191  1.00 32.55  ? 1209 GLU B CB  1 
ATOM   32   C CG  . GLU A 1 6  ? 11.180  -4.294  -5.723  1.00 39.63  ? 1209 GLU B CG  1 
ATOM   33   C CD  . GLU A 1 6  ? 12.390  -4.394  -4.810  1.00 48.56  ? 1209 GLU B CD  1 
ATOM   34   O OE1 . GLU A 1 6  ? 13.395  -5.019  -5.208  1.00 64.80  ? 1209 GLU B OE1 1 
ATOM   35   O OE2 . GLU A 1 6  ? 12.330  -3.852  -3.686  1.00 53.30  ? 1209 GLU B OE2 1 
ATOM   36   N N   . LEU A 1 7  ? 8.775   -7.975  -7.085  1.00 33.05  ? 1210 LEU B N   1 
ATOM   37   C CA  . LEU A 1 7  ? 8.481   -9.208  -7.809  1.00 22.31  ? 1210 LEU B CA  1 
ATOM   38   C C   . LEU A 1 7  ? 7.350   -8.998  -8.808  1.00 33.55  ? 1210 LEU B C   1 
ATOM   39   O O   . LEU A 1 7  ? 7.358   -9.579  -9.900  1.00 31.21  ? 1210 LEU B O   1 
ATOM   40   C CB  . LEU A 1 7  ? 8.129   -10.325 -6.827  1.00 22.33  ? 1210 LEU B CB  1 
ATOM   41   C CG  . LEU A 1 7  ? 7.960   -11.719 -7.434  1.00 33.62  ? 1210 LEU B CG  1 
ATOM   42   C CD1 . LEU A 1 7  ? 9.303   -12.251 -7.908  1.00 36.78  ? 1210 LEU B CD1 1 
ATOM   43   C CD2 . LEU A 1 7  ? 7.313   -12.684 -6.451  1.00 35.65  ? 1210 LEU B CD2 1 
ATOM   44   N N   . ARG A 1 8  ? 6.368   -8.170  -8.447  1.00 23.90  ? 1211 ARG B N   1 
ATOM   45   C CA  . ARG A 1 8  ? 5.302   -7.828  -9.379  1.00 23.43  ? 1211 ARG B CA  1 
ATOM   46   C C   . ARG A 1 8  ? 5.854   -7.068  -10.575 1.00 34.06  ? 1211 ARG B C   1 
ATOM   47   O O   . ARG A 1 8  ? 5.533   -7.380  -11.728 1.00 28.33  ? 1211 ARG B O   1 
ATOM   48   C CB  . ARG A 1 8  ? 4.232   -7.007  -8.662  1.00 21.42  ? 1211 ARG B CB  1 
ATOM   49   C CG  . ARG A 1 8  ? 3.165   -6.441  -9.579  1.00 30.43  ? 1211 ARG B CG  1 
ATOM   50   C CD  . ARG A 1 8  ? 2.196   -5.566  -8.812  1.00 29.22  ? 1211 ARG B CD  1 
ATOM   51   N NE  . ARG A 1 8  ? 1.175   -4.992  -9.680  1.00 25.10  ? 1211 ARG B NE  1 
ATOM   52   C CZ  . ARG A 1 8  ? 1.201   -3.745  -10.136 1.00 30.09  ? 1211 ARG B CZ  1 
ATOM   53   N NH1 . ARG A 1 8  ? 2.201   -2.943  -9.802  1.00 24.93  ? 1211 ARG B NH1 1 
ATOM   54   N NH2 . ARG A 1 8  ? 0.231   -3.300  -10.923 1.00 37.20  ? 1211 ARG B NH2 1 
ATOM   55   N N   . GLY A 1 9  ? 6.699   -6.068  -10.319 1.00 26.10  ? 1212 GLY B N   1 
ATOM   56   C CA  . GLY A 1 9  ? 7.277   -5.304  -11.411 1.00 27.04  ? 1212 GLY B CA  1 
ATOM   57   C C   . GLY A 1 9  ? 8.078   -6.166  -12.371 1.00 39.85  ? 1212 GLY B C   1 
ATOM   58   O O   . GLY A 1 9  ? 8.110   -5.901  -13.574 1.00 40.78  ? 1212 GLY B O   1 
ATOM   59   N N   . GLN A 1 10 ? 8.718   -7.215  -11.853 1.00 38.41  ? 1213 GLN B N   1 
ATOM   60   C CA  . GLN A 1 10 ? 9.523   -8.084  -12.707 1.00 43.23  ? 1213 GLN B CA  1 
ATOM   61   C C   . GLN A 1 10 ? 8.644   -8.920  -13.627 1.00 35.56  ? 1213 GLN B C   1 
ATOM   62   O O   . GLN A 1 10 ? 8.900   -9.013  -14.832 1.00 41.20  ? 1213 GLN B O   1 
ATOM   63   C CB  . GLN A 1 10 ? 10.422  -8.979  -11.854 1.00 32.80  ? 1213 GLN B CB  1 
ATOM   64   C CG  . GLN A 1 10 ? 11.604  -8.256  -11.252 1.00 45.04  ? 1213 GLN B CG  1 
ATOM   65   C CD  . GLN A 1 10 ? 12.603  -9.198  -10.616 1.00 47.82  ? 1213 GLN B CD  1 
ATOM   66   O OE1 . GLN A 1 10 ? 12.420  -10.416 -10.620 1.00 51.39  ? 1213 GLN B OE1 1 
ATOM   67   N NE2 . GLN A 1 10 ? 13.673  -8.636  -10.066 1.00 41.08  ? 1213 GLN B NE2 1 
ATOM   68   N N   . TYR A 1 11 ? 7.609   -9.552  -13.070 1.00 31.28  ? 1214 TYR B N   1 
ATOM   69   C CA  . TYR A 1 11 ? 6.663   -10.307 -13.884 1.00 35.90  ? 1214 TYR B CA  1 
ATOM   70   C C   . TYR A 1 11 ? 6.026   -9.423  -14.949 1.00 24.94  ? 1214 TYR B C   1 
ATOM   71   O O   . TYR A 1 11 ? 5.862   -9.838  -16.099 1.00 32.59  ? 1214 TYR B O   1 
ATOM   72   C CB  . TYR A 1 11 ? 5.586   -10.927 -12.995 1.00 30.23  ? 1214 TYR B CB  1 
ATOM   73   C CG  . TYR A 1 11 ? 6.047   -12.114 -12.182 1.00 39.65  ? 1214 TYR B CG  1 
ATOM   74   C CD1 . TYR A 1 11 ? 7.079   -12.929 -12.626 1.00 41.48  ? 1214 TYR B CD1 1 
ATOM   75   C CD2 . TYR A 1 11 ? 5.444   -12.421 -10.969 1.00 42.68  ? 1214 TYR B CD2 1 
ATOM   76   C CE1 . TYR A 1 11 ? 7.496   -14.016 -11.882 1.00 52.15  ? 1214 TYR B CE1 1 
ATOM   77   C CE2 . TYR A 1 11 ? 5.853   -13.503 -10.222 1.00 29.30  ? 1214 TYR B CE2 1 
ATOM   78   C CZ  . TYR A 1 11 ? 6.881   -14.295 -10.680 1.00 29.42  ? 1214 TYR B CZ  1 
ATOM   79   O OH  . TYR A 1 11 ? 7.292   -15.376 -9.939  1.00 37.71  ? 1214 TYR B OH  1 
ATOM   80   N N   . ILE A 1 12 ? 5.660   -8.197  -14.573 1.00 20.83  ? 1215 ILE B N   1 
ATOM   81   C CA  . ILE A 1 12 ? 5.086   -7.256  -15.529 1.00 30.41  ? 1215 ILE B CA  1 
ATOM   82   C C   . ILE A 1 12 ? 6.086   -6.945  -16.633 1.00 36.51  ? 1215 ILE B C   1 
ATOM   83   O O   . ILE A 1 12 ? 5.762   -7.008  -17.824 1.00 34.28  ? 1215 ILE B O   1 
ATOM   84   C CB  . ILE A 1 12 ? 4.631   -5.976  -14.806 1.00 28.87  ? 1215 ILE B CB  1 
ATOM   85   C CG1 . ILE A 1 12 ? 3.438   -6.272  -13.894 1.00 29.29  ? 1215 ILE B CG1 1 
ATOM   86   C CG2 . ILE A 1 12 ? 4.299   -4.880  -15.815 1.00 21.38  ? 1215 ILE B CG2 1 
ATOM   87   C CD1 . ILE A 1 12 ? 3.050   -5.109  -13.003 1.00 29.08  ? 1215 ILE B CD1 1 
ATOM   88   N N   . LYS A 1 13 ? 7.323   -6.608  -16.255 1.00 35.49  ? 1216 LYS B N   1 
ATOM   89   C CA  . LYS A 1 13 ? 8.336   -6.290  -17.254 1.00 40.02  ? 1216 LYS B CA  1 
ATOM   90   C C   . LYS A 1 13 ? 8.670   -7.499  -18.116 1.00 43.54  ? 1216 LYS B C   1 
ATOM   91   O O   . LYS A 1 13 ? 9.041   -7.342  -19.285 1.00 39.86  ? 1216 LYS B O   1 
ATOM   92   C CB  . LYS A 1 13 ? 9.599   -5.755  -16.575 1.00 35.82  ? 1216 LYS B CB  1 
ATOM   93   C CG  . LYS A 1 13 ? 10.785  -6.711  -16.630 1.00 53.51  ? 1216 LYS B CG  1 
ATOM   94   C CD  . LYS A 1 13 ? 11.541  -6.753  -15.310 1.00 58.83  ? 1216 LYS B CD  1 
ATOM   95   C CE  . LYS A 1 13 ? 12.597  -7.852  -15.318 1.00 74.81  ? 1216 LYS B CE  1 
ATOM   96   N NZ  . LYS A 1 13 ? 12.006  -9.222  -15.356 1.00 73.27  ? 1216 LYS B NZ  1 
ATOM   97   N N   . ALA A 1 14 ? 8.541   -8.708  -17.564 1.00 30.17  ? 1217 ALA B N   1 
ATOM   98   C CA  . ALA A 1 14 ? 8.846   -9.902  -18.343 1.00 27.78  ? 1217 ALA B CA  1 
ATOM   99   C C   . ALA A 1 14 ? 7.788   -10.146 -19.408 1.00 42.61  ? 1217 ALA B C   1 
ATOM   100  O O   . ALA A 1 14 ? 8.115   -10.483 -20.552 1.00 31.13  ? 1217 ALA B O   1 
ATOM   101  C CB  . ALA A 1 14 ? 8.974   -11.116 -17.426 1.00 23.81  ? 1217 ALA B CB  1 
ATOM   102  N N   . VAL A 1 15 ? 6.514   -9.982  -19.051 1.00 35.06  ? 1218 VAL B N   1 
ATOM   103  C CA  . VAL A 1 15 ? 5.445   -10.192 -20.019 1.00 36.50  ? 1218 VAL B CA  1 
ATOM   104  C C   . VAL A 1 15 ? 5.468   -9.104  -21.084 1.00 39.54  ? 1218 VAL B C   1 
ATOM   105  O O   . VAL A 1 15 ? 5.168   -9.359  -22.257 1.00 36.23  ? 1218 VAL B O   1 
ATOM   106  C CB  . VAL A 1 15 ? 4.081   -10.260 -19.309 1.00 42.90  ? 1218 VAL B CB  1 
ATOM   107  C CG1 . VAL A 1 15 ? 2.970   -10.483 -20.325 1.00 42.80  ? 1218 VAL B CG1 1 
ATOM   108  C CG2 . VAL A 1 15 ? 4.075   -11.368 -18.276 1.00 44.67  ? 1218 VAL B CG2 1 
ATOM   109  N N   . LYS A 1 16 ? 5.816   -7.874  -20.695 1.00 34.15  ? 1219 LYS B N   1 
ATOM   110  C CA  . LYS A 1 16 ? 5.896   -6.786  -21.664 1.00 35.56  ? 1219 LYS B CA  1 
ATOM   111  C C   . LYS A 1 16 ? 6.974   -7.056  -22.705 1.00 38.50  ? 1219 LYS B C   1 
ATOM   112  O O   . LYS A 1 16 ? 6.823   -6.682  -23.874 1.00 41.77  ? 1219 LYS B O   1 
ATOM   113  C CB  . LYS A 1 16 ? 6.164   -5.460  -20.955 1.00 25.69  ? 1219 LYS B CB  1 
ATOM   114  C CG  . LYS A 1 16 ? 4.941   -4.794  -20.366 1.00 24.34  ? 1219 LYS B CG  1 
ATOM   115  C CD  . LYS A 1 16 ? 5.239   -3.338  -20.043 1.00 31.88  ? 1219 LYS B CD  1 
ATOM   116  C CE  . LYS A 1 16 ? 4.155   -2.730  -19.172 1.00 31.45  ? 1219 LYS B CE  1 
ATOM   117  N NZ  . LYS A 1 16 ? 4.610   -1.467  -18.522 1.00 56.69  ? 1219 LYS B NZ  1 
ATOM   118  N N   . LYS A 1 17 ? 8.077   -7.686  -22.288 1.00 34.61  ? 1220 LYS B N   1 
ATOM   119  C CA  . LYS A 1 17 ? 9.085   -8.164  -23.230 1.00 32.98  ? 1220 LYS B CA  1 
ATOM   120  C C   . LYS A 1 17 ? 8.471   -9.140  -24.223 1.00 41.56  ? 1220 LYS B C   1 
ATOM   121  O O   . LYS A 1 17 ? 8.656   -9.013  -25.436 1.00 35.75  ? 1220 LYS B O   1 
ATOM   122  C CB  . LYS A 1 17 ? 10.236  -8.836  -22.477 1.00 35.23  ? 1220 LYS B CB  1 
ATOM   123  C CG  . LYS A 1 17 ? 11.381  -7.927  -22.055 1.00 46.83  ? 1220 LYS B CG  1 
ATOM   124  C CD  . LYS A 1 17 ? 11.787  -8.225  -20.611 1.00 66.00  ? 1220 LYS B CD  1 
ATOM   125  C CE  . LYS A 1 17 ? 13.277  -8.132  -20.378 1.00 61.69  ? 1220 LYS B CE  1 
ATOM   126  N NZ  . LYS A 1 17 ? 13.616  -8.533  -18.979 1.00 78.67  ? 1220 LYS B NZ  1 
ATOM   127  N N   . ILE A 1 18 ? 7.744   -10.138 -23.706 1.00 35.44  ? 1221 ILE B N   1 
ATOM   128  C CA  . ILE A 1 18 ? 7.024   -11.075 -24.565 1.00 32.19  ? 1221 ILE B CA  1 
ATOM   129  C C   . ILE A 1 18 ? 6.167   -10.316 -25.566 1.00 43.84  ? 1221 ILE B C   1 
ATOM   130  O O   . ILE A 1 18 ? 6.116   -10.657 -26.752 1.00 45.50  ? 1221 ILE B O   1 
ATOM   131  C CB  . ILE A 1 18 ? 6.171   -12.035 -23.713 1.00 30.47  ? 1221 ILE B CB  1 
ATOM   132  C CG1 . ILE A 1 18 ? 7.045   -12.873 -22.774 1.00 39.67  ? 1221 ILE B CG1 1 
ATOM   133  C CG2 . ILE A 1 18 ? 5.315   -12.923 -24.612 1.00 43.89  ? 1221 ILE B CG2 1 
ATOM   134  C CD1 . ILE A 1 18 ? 7.728   -14.047 -23.437 1.00 33.27  ? 1221 ILE B CD1 1 
ATOM   135  N N   . LYS A 1 19 ? 5.498   -9.259  -25.101 1.00 35.78  ? 1222 LYS B N   1 
ATOM   136  C CA  . LYS A 1 19 ? 4.667   -8.449  -25.983 1.00 36.56  ? 1222 LYS B CA  1 
ATOM   137  C C   . LYS A 1 19 ? 5.500   -7.770  -27.062 1.00 44.02  ? 1222 LYS B C   1 
ATOM   138  O O   . LYS A 1 19 ? 5.078   -7.691  -28.220 1.00 40.83  ? 1222 LYS B O   1 
ATOM   139  C CB  . LYS A 1 19 ? 3.907   -7.411  -25.163 1.00 42.25  ? 1222 LYS B CB  1 
ATOM   140  C CG  . LYS A 1 19 ? 2.965   -6.553  -25.976 1.00 38.43  ? 1222 LYS B CG  1 
ATOM   141  C CD  . LYS A 1 19 ? 3.053   -5.109  -25.533 1.00 48.83  ? 1222 LYS B CD  1 
ATOM   142  C CE  . LYS A 1 19 ? 1.807   -4.349  -25.920 1.00 51.13  ? 1222 LYS B CE  1 
ATOM   143  N NZ  . LYS A 1 19 ? 1.742   -3.028  -25.239 1.00 52.93  ? 1222 LYS B NZ  1 
ATOM   144  N N   . CYS A 1 20 ? 6.683   -7.266  -26.698 1.00 35.99  ? 1223 CYS B N   1 
ATOM   145  C CA  . CYS A 1 20 ? 7.563   -6.645  -27.684 1.00 40.11  ? 1223 CYS B CA  1 
ATOM   146  C C   . CYS A 1 20 ? 7.944   -7.631  -28.777 1.00 42.26  ? 1223 CYS B C   1 
ATOM   147  O O   . CYS A 1 20 ? 7.919   -7.296  -29.966 1.00 53.82  ? 1223 CYS B O   1 
ATOM   148  C CB  . CYS A 1 20 ? 8.819   -6.100  -27.006 1.00 44.55  ? 1223 CYS B CB  1 
ATOM   149  S SG  . CYS A 1 20 ? 8.545   -4.686  -25.939 1.00 52.04  ? 1223 CYS B SG  1 
ATOM   150  N N   . ASP A 1 21 ? 8.313   -8.853  -28.387 1.00 35.11  ? 1224 ASP B N   1 
ATOM   151  C CA  . ASP A 1 21 ? 8.658   -9.874  -29.370 1.00 42.14  ? 1224 ASP B CA  1 
ATOM   152  C C   . ASP A 1 21 ? 7.494   -10.130 -30.321 1.00 43.30  ? 1224 ASP B C   1 
ATOM   153  O O   . ASP A 1 21 ? 7.680   -10.206 -31.542 1.00 30.00  ? 1224 ASP B O   1 
ATOM   154  C CB  . ASP A 1 21 ? 9.073   -11.167 -28.664 1.00 28.03  ? 1224 ASP B CB  1 
ATOM   155  C CG  . ASP A 1 21 ? 10.330  -11.002 -27.824 1.00 51.68  ? 1224 ASP B CG  1 
ATOM   156  O OD1 . ASP A 1 21 ? 11.124  -10.084 -28.118 1.00 52.64  ? 1224 ASP B OD1 1 
ATOM   157  O OD2 . ASP A 1 21 ? 10.524  -11.792 -26.870 1.00 52.79  ? 1224 ASP B OD2 1 
ATOM   158  N N   . MET A 1 22 ? 6.280   -10.254 -29.777 1.00 39.42  ? 1225 MET B N   1 
ATOM   159  C CA  . MET A 1 22 ? 5.112   -10.481 -30.622 1.00 37.15  ? 1225 MET B CA  1 
ATOM   160  C C   . MET A 1 22 ? 4.836   -9.278  -31.510 1.00 49.21  ? 1225 MET B C   1 
ATOM   161  O O   . MET A 1 22 ? 4.379   -9.429  -32.648 1.00 44.03  ? 1225 MET B O   1 
ATOM   162  C CB  . MET A 1 22 ? 3.890   -10.795 -29.759 1.00 33.82  ? 1225 MET B CB  1 
ATOM   163  C CG  . MET A 1 22 ? 4.083   -11.928 -28.768 1.00 51.10  ? 1225 MET B CG  1 
ATOM   164  S SD  . MET A 1 22 ? 4.520   -13.520 -29.498 1.00 74.14  ? 1225 MET B SD  1 
ATOM   165  C CE  . MET A 1 22 ? 6.295   -13.569 -29.253 1.00 51.81  ? 1225 MET B CE  1 
ATOM   166  N N   . LEU A 1 23 ? 5.101   -8.074  -31.003 1.00 47.64  ? 1226 LEU B N   1 
ATOM   167  C CA  . LEU A 1 23 ? 4.895   -6.865  -31.791 1.00 35.07  ? 1226 LEU B CA  1 
ATOM   168  C C   . LEU A 1 23 ? 5.825   -6.834  -32.992 1.00 47.07  ? 1226 LEU B C   1 
ATOM   169  O O   . LEU A 1 23 ? 5.378   -6.714  -34.138 1.00 44.18  ? 1226 LEU B O   1 
ATOM   170  C CB  . LEU A 1 23 ? 5.110   -5.630  -30.920 1.00 34.32  ? 1226 LEU B CB  1 
ATOM   171  C CG  . LEU A 1 23 ? 3.845   -4.836  -30.608 1.00 51.81  ? 1226 LEU B CG  1 
ATOM   172  C CD1 . LEU A 1 23 ? 2.962   -5.626  -29.667 1.00 67.31  ? 1226 LEU B CD1 1 
ATOM   173  C CD2 . LEU A 1 23 ? 4.197   -3.486  -30.013 1.00 62.78  ? 1226 LEU B CD2 1 
ATOM   174  N N   . ARG A 1 24 ? 7.136   -6.933  -32.740 1.00 42.56  ? 1227 ARG B N   1 
ATOM   175  C CA  . ARG A 1 24 ? 8.118   -6.979  -33.818 1.00 37.99  ? 1227 ARG B CA  1 
ATOM   176  C C   . ARG A 1 24 ? 7.738   -8.018  -34.860 1.00 50.04  ? 1227 ARG B C   1 
ATOM   177  O O   . ARG A 1 24 ? 7.867   -7.787  -36.066 1.00 52.37  ? 1227 ARG B O   1 
ATOM   178  C CB  . ARG A 1 24 ? 9.509   -7.283  -33.256 1.00 34.46  ? 1227 ARG B CB  1 
ATOM   179  C CG  . ARG A 1 24 ? 9.961   -6.367  -32.139 1.00 54.49  ? 1227 ARG B CG  1 
ATOM   180  C CD  . ARG A 1 24 ? 11.178  -5.559  -32.543 1.00 72.01  ? 1227 ARG B CD  1 
ATOM   181  N NE  . ARG A 1 24 ? 10.822  -4.438  -33.408 1.00 94.98  ? 1227 ARG B NE  1 
ATOM   182  C CZ  . ARG A 1 24 ? 11.690  -3.550  -33.881 1.00 94.23  ? 1227 ARG B CZ  1 
ATOM   183  N NH1 . ARG A 1 24 ? 12.979  -3.644  -33.576 1.00 92.92  ? 1227 ARG B NH1 1 
ATOM   184  N NH2 . ARG A 1 24 ? 11.265  -2.563  -34.659 1.00 90.88  ? 1227 ARG B NH2 1 
ATOM   185  N N   . TYR A 1 25 ? 7.257   -9.174  -34.404 1.00 38.94  ? 1228 TYR B N   1 
ATOM   186  C CA  . TYR A 1 25 ? 6.794   -10.203 -35.326 1.00 40.80  ? 1228 TYR B CA  1 
ATOM   187  C C   . TYR A 1 25 ? 5.648   -9.689  -36.189 1.00 41.69  ? 1228 TYR B C   1 
ATOM   188  O O   . TYR A 1 25 ? 5.676   -9.810  -37.419 1.00 51.20  ? 1228 TYR B O   1 
ATOM   189  C CB  . TYR A 1 25 ? 6.366   -11.438 -34.538 1.00 37.74  ? 1228 TYR B CB  1 
ATOM   190  C CG  . TYR A 1 25 ? 5.839   -12.559 -35.393 1.00 31.93  ? 1228 TYR B CG  1 
ATOM   191  C CD1 . TYR A 1 25 ? 6.705   -13.442 -36.012 1.00 35.93  ? 1228 TYR B CD1 1 
ATOM   192  C CD2 . TYR A 1 25 ? 4.473   -12.740 -35.573 1.00 30.11  ? 1228 TYR B CD2 1 
ATOM   193  C CE1 . TYR A 1 25 ? 6.234   -14.473 -36.789 1.00 40.10  ? 1228 TYR B CE1 1 
ATOM   194  C CE2 . TYR A 1 25 ? 3.990   -13.770 -36.347 1.00 27.37  ? 1228 TYR B CE2 1 
ATOM   195  C CZ  . TYR A 1 25 ? 4.876   -14.635 -36.954 1.00 38.38  ? 1228 TYR B CZ  1 
ATOM   196  O OH  . TYR A 1 25 ? 4.403   -15.665 -37.730 1.00 49.69  ? 1228 TYR B OH  1 
ATOM   197  N N   . ILE A 1 26 ? 4.630   -9.105  -35.554 1.00 38.04  ? 1229 ILE B N   1 
ATOM   198  C CA  . ILE A 1 26 ? 3.438   -8.663  -36.275 1.00 47.46  ? 1229 ILE B CA  1 
ATOM   199  C C   . ILE A 1 26 ? 3.783   -7.553  -37.260 1.00 51.62  ? 1229 ILE B C   1 
ATOM   200  O O   . ILE A 1 26 ? 3.253   -7.510  -38.379 1.00 53.63  ? 1229 ILE B O   1 
ATOM   201  C CB  . ILE A 1 26 ? 2.351   -8.224  -35.277 1.00 48.44  ? 1229 ILE B CB  1 
ATOM   202  C CG1 . ILE A 1 26 ? 1.705   -9.451  -34.632 1.00 42.20  ? 1229 ILE B CG1 1 
ATOM   203  C CG2 . ILE A 1 26 ? 1.300   -7.366  -35.961 1.00 42.05  ? 1229 ILE B CG2 1 
ATOM   204  C CD1 . ILE A 1 26 ? 1.071   -9.165  -33.287 1.00 42.35  ? 1229 ILE B CD1 1 
ATOM   205  N N   . GLN A 1 27 ? 4.663   -6.632  -36.860 1.00 42.19  ? 1230 GLN B N   1 
ATOM   206  C CA  . GLN A 1 27 ? 5.162   -5.632  -37.798 1.00 43.15  ? 1230 GLN B CA  1 
ATOM   207  C C   . GLN A 1 27 ? 5.835   -6.292  -38.991 1.00 48.76  ? 1230 GLN B C   1 
ATOM   208  O O   . GLN A 1 27 ? 5.665   -5.850  -40.132 1.00 50.28  ? 1230 GLN B O   1 
ATOM   209  C CB  . GLN A 1 27 ? 6.136   -4.691  -37.091 1.00 39.90  ? 1230 GLN B CB  1 
ATOM   210  C CG  . GLN A 1 27 ? 6.821   -3.693  -38.007 1.00 38.05  ? 1230 GLN B CG  1 
ATOM   211  C CD  . GLN A 1 27 ? 5.864   -2.645  -38.551 1.00 53.04  ? 1230 GLN B CD  1 
ATOM   212  O OE1 . GLN A 1 27 ? 4.831   -2.354  -37.942 1.00 50.14  ? 1230 GLN B OE1 1 
ATOM   213  N NE2 . GLN A 1 27 ? 6.202   -2.076  -39.705 1.00 50.86  ? 1230 GLN B NE2 1 
ATOM   214  N N   . GLU A 1 28 ? 6.608   -7.353  -38.746 1.00 44.70  ? 1231 GLU B N   1 
ATOM   215  C CA  . GLU A 1 28 ? 7.252   -8.057  -39.849 1.00 48.33  ? 1231 GLU B CA  1 
ATOM   216  C C   . GLU A 1 28 ? 6.223   -8.749  -40.731 1.00 54.54  ? 1231 GLU B C   1 
ATOM   217  O O   . GLU A 1 28 ? 6.424   -8.875  -41.945 1.00 42.29  ? 1231 GLU B O   1 
ATOM   218  C CB  . GLU A 1 28 ? 8.267   -9.068  -39.318 1.00 45.09  ? 1231 GLU B CB  1 
ATOM   219  C CG  . GLU A 1 28 ? 9.366   -9.381  -40.317 1.00 67.15  ? 1231 GLU B CG  1 
ATOM   220  C CD  . GLU A 1 28 ? 9.776   -10.836 -40.306 1.00 82.79  ? 1231 GLU B CD  1 
ATOM   221  O OE1 . GLU A 1 28 ? 10.546  -11.241 -41.204 1.00 90.58  ? 1231 GLU B OE1 1 
ATOM   222  O OE2 . GLU A 1 28 ? 9.325   -11.578 -39.408 1.00 81.21  ? 1231 GLU B OE2 1 
ATOM   223  N N   . SER A 1 29 ? 5.119   -9.211  -40.137 1.00 48.15  ? 1232 SER B N   1 
ATOM   224  C CA  . SER A 1 29 ? 4.010   -9.736  -40.923 1.00 40.99  ? 1232 SER B CA  1 
ATOM   225  C C   . SER A 1 29 ? 3.544   -8.712  -41.945 1.00 46.49  ? 1232 SER B C   1 
ATOM   226  O O   . SER A 1 29 ? 3.471   -8.995  -43.146 1.00 45.38  ? 1232 SER B O   1 
ATOM   227  C CB  . SER A 1 29 ? 2.846   -10.128 -40.009 1.00 49.34  ? 1232 SER B CB  1 
ATOM   228  O OG  . SER A 1 29 ? 3.111   -11.319 -39.297 1.00 55.38  ? 1232 SER B OG  1 
ATOM   229  N N   . LYS A 1 30 ? 3.232   -7.503  -41.474 1.00 42.86  ? 1233 LYS B N   1 
ATOM   230  C CA  . LYS A 1 30 ? 2.689   -6.476  -42.356 1.00 51.88  ? 1233 LYS B CA  1 
ATOM   231  C C   . LYS A 1 30 ? 3.676   -6.122  -43.458 1.00 45.98  ? 1233 LYS B C   1 
ATOM   232  O O   . LYS A 1 30 ? 3.288   -5.941  -44.616 1.00 48.41  ? 1233 LYS B O   1 
ATOM   233  C CB  . LYS A 1 30 ? 2.323   -5.229  -41.555 1.00 41.41  ? 1233 LYS B CB  1 
ATOM   234  C CG  . LYS A 1 30 ? 1.426   -5.487  -40.363 1.00 59.77  ? 1233 LYS B CG  1 
ATOM   235  C CD  . LYS A 1 30 ? 0.863   -4.180  -39.843 1.00 60.15  ? 1233 LYS B CD  1 
ATOM   236  C CE  . LYS A 1 30 ? 0.976   -4.090  -38.342 1.00 57.21  ? 1233 LYS B CE  1 
ATOM   237  N NZ  . LYS A 1 30 ? 1.397   -2.725  -37.931 1.00 58.70  ? 1233 LYS B NZ  1 
ATOM   238  N N   . GLU A 1 31 ? 4.960   -6.013  -43.111 1.00 37.99  ? 1234 GLU B N   1 
ATOM   239  C CA  . GLU A 1 31 ? 5.973   -5.710  -44.115 1.00 37.49  ? 1234 GLU B CA  1 
ATOM   240  C C   . GLU A 1 31 ? 6.026   -6.799  -45.176 1.00 51.24  ? 1234 GLU B C   1 
ATOM   241  O O   . GLU A 1 31 ? 6.113   -6.512  -46.376 1.00 54.81  ? 1234 GLU B O   1 
ATOM   242  C CB  . GLU A 1 31 ? 7.341   -5.538  -43.453 1.00 33.57  ? 1234 GLU B CB  1 
ATOM   243  C CG  . GLU A 1 31 ? 7.417   -4.397  -42.456 1.00 47.68  ? 1234 GLU B CG  1 
ATOM   244  C CD  . GLU A 1 31 ? 8.789   -4.266  -41.828 1.00 44.49  ? 1234 GLU B CD  1 
ATOM   245  O OE1 . GLU A 1 31 ? 9.768   -4.761  -42.423 1.00 56.01  ? 1234 GLU B OE1 1 
ATOM   246  O OE2 . GLU A 1 31 ? 8.886   -3.668  -40.737 1.00 63.66  ? 1234 GLU B OE2 1 
ATOM   247  N N   . ARG A 1 32 ? 5.971   -8.063  -44.749 1.00 47.12  ? 1235 ARG B N   1 
ATOM   248  C CA  . ARG A 1 32 ? 6.022   -9.167  -45.702 1.00 48.81  ? 1235 ARG B CA  1 
ATOM   249  C C   . ARG A 1 32 ? 4.817   -9.142  -46.632 1.00 45.55  ? 1235 ARG B C   1 
ATOM   250  O O   . ARG A 1 32 ? 4.960   -9.258  -47.854 1.00 48.22  ? 1235 ARG B O   1 
ATOM   251  C CB  . ARG A 1 32 ? 6.114   -10.503 -44.960 1.00 44.29  ? 1235 ARG B CB  1 
ATOM   252  C CG  . ARG A 1 32 ? 7.520   -10.819 -44.461 1.00 55.71  ? 1235 ARG B CG  1 
ATOM   253  C CD  . ARG A 1 32 ? 7.594   -12.118 -43.665 1.00 56.64  ? 1235 ARG B CD  1 
ATOM   254  N NE  . ARG A 1 32 ? 7.330   -13.301 -44.479 1.00 60.48  ? 1235 ARG B NE  1 
ATOM   255  C CZ  . ARG A 1 32 ? 6.192   -13.985 -44.444 1.00 63.85  ? 1235 ARG B CZ  1 
ATOM   256  N NH1 . ARG A 1 32 ? 5.218   -13.602 -43.631 1.00 57.81  ? 1235 ARG B NH1 1 
ATOM   257  N NH2 . ARG A 1 32 ? 6.030   -15.052 -45.213 1.00 55.51  ? 1235 ARG B NH2 1 
ATOM   258  N N   . ALA A 1 33 ? 3.615   -8.987  -46.071 1.00 36.90  ? 1236 ALA B N   1 
ATOM   259  C CA  . ALA A 1 33 ? 2.426   -8.915  -46.912 1.00 46.36  ? 1236 ALA B CA  1 
ATOM   260  C C   . ALA A 1 33 ? 2.459   -7.684  -47.806 1.00 61.52  ? 1236 ALA B C   1 
ATOM   261  O O   . ALA A 1 33 ? 1.917   -7.707  -48.918 1.00 51.11  ? 1236 ALA B O   1 
ATOM   262  C CB  . ALA A 1 33 ? 1.165   -8.918  -46.051 1.00 31.51  ? 1236 ALA B CB  1 
ATOM   263  N N   . ALA A 1 34 ? 3.091   -6.606  -47.339 1.00 49.48  ? 1237 ALA B N   1 
ATOM   264  C CA  . ALA A 1 34 ? 3.258   -5.428  -48.182 1.00 50.13  ? 1237 ALA B CA  1 
ATOM   265  C C   . ALA A 1 34 ? 4.272   -5.685  -49.287 1.00 51.19  ? 1237 ALA B C   1 
ATOM   266  O O   . ALA A 1 34 ? 4.093   -5.227  -50.420 1.00 47.99  ? 1237 ALA B O   1 
ATOM   267  C CB  . ALA A 1 34 ? 3.678   -4.231  -47.331 1.00 45.49  ? 1237 ALA B CB  1 
ATOM   268  N N   . GLU A 1 35 ? 5.349   -6.410  -48.974 1.00 45.21  ? 1238 GLU B N   1 
ATOM   269  C CA  . GLU A 1 35 ? 6.320   -6.779  -49.999 1.00 48.44  ? 1238 GLU B CA  1 
ATOM   270  C C   . GLU A 1 35 ? 5.686   -7.665  -51.061 1.00 53.39  ? 1238 GLU B C   1 
ATOM   271  O O   . GLU A 1 35 ? 6.057   -7.592  -52.241 1.00 46.82  ? 1238 GLU B O   1 
ATOM   272  C CB  . GLU A 1 35 ? 7.518   -7.474  -49.349 1.00 41.97  ? 1238 GLU B CB  1 
ATOM   273  C CG  . GLU A 1 35 ? 8.448   -8.189  -50.315 1.00 60.35  ? 1238 GLU B CG  1 
ATOM   274  C CD  . GLU A 1 35 ? 9.054   -7.256  -51.346 1.00 68.53  ? 1238 GLU B CD  1 
ATOM   275  O OE1 . GLU A 1 35 ? 9.283   -6.070  -51.020 1.00 60.49  ? 1238 GLU B OE1 1 
ATOM   276  O OE2 . GLU A 1 35 ? 9.295   -7.711  -52.484 1.00 50.29  ? 1238 GLU B OE2 1 
ATOM   277  N N   . MET A 1 36 ? 4.722   -8.495  -50.661 1.00 40.67  ? 1239 MET B N   1 
ATOM   278  C CA  . MET A 1 36 ? 3.956   -9.273  -51.624 1.00 48.11  ? 1239 MET B CA  1 
ATOM   279  C C   . MET A 1 36 ? 3.302   -8.374  -52.661 1.00 54.13  ? 1239 MET B C   1 
ATOM   280  O O   . MET A 1 36 ? 3.274   -8.696  -53.855 1.00 48.97  ? 1239 MET B O   1 
ATOM   281  C CB  . MET A 1 36 ? 2.899   -10.096 -50.895 1.00 33.44  ? 1239 MET B CB  1 
ATOM   282  C CG  . MET A 1 36 ? 3.453   -11.337 -50.264 1.00 51.72  ? 1239 MET B CG  1 
ATOM   283  S SD  . MET A 1 36 ? 4.180   -12.419 -51.507 1.00 59.90  ? 1239 MET B SD  1 
ATOM   284  C CE  . MET A 1 36 ? 2.862   -12.455 -52.718 1.00 51.56  ? 1239 MET B CE  1 
ATOM   285  N N   . VAL A 1 37 ? 2.773   -7.234  -52.214 1.00 47.68  ? 1240 VAL B N   1 
ATOM   286  C CA  . VAL A 1 37 ? 2.065   -6.320  -53.110 1.00 51.30  ? 1240 VAL B CA  1 
ATOM   287  C C   . VAL A 1 37 ? 2.983   -5.864  -54.237 1.00 46.49  ? 1240 VAL B C   1 
ATOM   288  O O   . VAL A 1 37 ? 2.615   -5.900  -55.417 1.00 49.69  ? 1240 VAL B O   1 
ATOM   289  C CB  . VAL A 1 37 ? 1.502   -5.125  -52.323 1.00 51.62  ? 1240 VAL B CB  1 
ATOM   290  C CG1 . VAL A 1 37 ? 1.215   -3.973  -53.259 1.00 42.38  ? 1240 VAL B CG1 1 
ATOM   291  C CG2 . VAL A 1 37 ? 0.237   -5.530  -51.591 1.00 48.97  ? 1240 VAL B CG2 1 
ATOM   292  N N   . LYS A 1 38 ? 4.199   -5.432  -53.888 1.00 43.36  ? 1241 LYS B N   1 
ATOM   293  C CA  . LYS A 1 38 ? 5.162   -5.040  -54.911 1.00 45.71  ? 1241 LYS B CA  1 
ATOM   294  C C   . LYS A 1 38 ? 5.505   -6.215  -55.814 1.00 50.87  ? 1241 LYS B C   1 
ATOM   295  O O   . LYS A 1 38 ? 5.659   -6.053  -57.030 1.00 55.28  ? 1241 LYS B O   1 
ATOM   296  C CB  . LYS A 1 38 ? 6.435   -4.487  -54.264 1.00 46.18  ? 1241 LYS B CB  1 
ATOM   297  C CG  . LYS A 1 38 ? 7.152   -3.432  -55.100 1.00 64.02  ? 1241 LYS B CG  1 
ATOM   298  C CD  . LYS A 1 38 ? 8.675   -3.577  -55.061 1.00 70.21  ? 1241 LYS B CD  1 
ATOM   299  C CE  . LYS A 1 38 ? 9.247   -3.314  -53.680 1.00 80.54  ? 1241 LYS B CE  1 
ATOM   300  N NZ  . LYS A 1 38 ? 10.670  -2.870  -53.722 1.00 89.07  ? 1241 LYS B NZ  1 
ATOM   301  N N   . ALA A 1 39 ? 5.625   -7.411  -55.233 1.00 50.83  ? 1242 ALA B N   1 
ATOM   302  C CA  . ALA A 1 39 ? 5.994   -8.582  -56.019 1.00 49.87  ? 1242 ALA B CA  1 
ATOM   303  C C   . ALA A 1 39 ? 4.928   -8.916  -57.055 1.00 47.00  ? 1242 ALA B C   1 
ATOM   304  O O   . ALA A 1 39 ? 5.250   -9.333  -58.172 1.00 38.58  ? 1242 ALA B O   1 
ATOM   305  C CB  . ALA A 1 39 ? 6.243   -9.775  -55.097 1.00 47.78  ? 1242 ALA B CB  1 
ATOM   306  N N   . GLU A 1 40 ? 3.654   -8.735  -56.706 1.00 42.53  ? 1243 GLU B N   1 
ATOM   307  C CA  . GLU A 1 40 ? 2.586   -9.006  -57.661 1.00 54.88  ? 1243 GLU B CA  1 
ATOM   308  C C   . GLU A 1 40 ? 2.530   -7.930  -58.739 1.00 59.68  ? 1243 GLU B C   1 
ATOM   309  O O   . GLU A 1 40 ? 2.250   -8.226  -59.907 1.00 67.46  ? 1243 GLU B O   1 
ATOM   310  C CB  . GLU A 1 40 ? 1.251   -9.112  -56.927 1.00 57.28  ? 1243 GLU B CB  1 
ATOM   311  C CG  . GLU A 1 40 ? 0.295   -10.154 -57.498 1.00 85.37  ? 1243 GLU B CG  1 
ATOM   312  C CD  . GLU A 1 40 ? -0.498  -9.640  -58.691 1.00 93.34  ? 1243 GLU B CD  1 
ATOM   313  O OE1 . GLU A 1 40 ? -0.216  -10.039 -59.832 1.00 94.46  ? 1243 GLU B OE1 1 
ATOM   314  O OE2 . GLU A 1 40 ? -1.413  -8.830  -58.494 1.00 92.25  ? 1243 GLU B OE2 1 
ATOM   315  N N   . VAL A 1 41 ? 2.792   -6.676  -58.364 1.00 46.67  ? 1244 VAL B N   1 
ATOM   316  C CA  . VAL A 1 41 ? 2.840   -5.603  -59.352 1.00 54.14  ? 1244 VAL B CA  1 
ATOM   317  C C   . VAL A 1 41 ? 3.940   -5.870  -60.369 1.00 52.61  ? 1244 VAL B C   1 
ATOM   318  O O   . VAL A 1 41 ? 3.799   -5.560  -61.558 1.00 58.99  ? 1244 VAL B O   1 
ATOM   319  C CB  . VAL A 1 41 ? 3.028   -4.241  -58.656 1.00 43.55  ? 1244 VAL B CB  1 
ATOM   320  C CG1 . VAL A 1 41 ? 3.217   -3.142  -59.681 1.00 52.61  ? 1244 VAL B CG1 1 
ATOM   321  C CG2 . VAL A 1 41 ? 1.831   -3.928  -57.793 1.00 36.94  ? 1244 VAL B CG2 1 
ATOM   322  N N   . LEU A 1 42 ? 5.043   -6.472  -59.921 1.00 45.03  ? 1245 LEU B N   1 
ATOM   323  C CA  . LEU A 1 42 ? 6.165   -6.720  -60.818 1.00 45.88  ? 1245 LEU B CA  1 
ATOM   324  C C   . LEU A 1 42 ? 5.882   -7.857  -61.788 1.00 57.59  ? 1245 LEU B C   1 
ATOM   325  O O   . LEU A 1 42 ? 6.452   -7.881  -62.885 1.00 69.80  ? 1245 LEU B O   1 
ATOM   326  C CB  . LEU A 1 42 ? 7.431   -7.018  -60.017 1.00 47.29  ? 1245 LEU B CB  1 
ATOM   327  C CG  . LEU A 1 42 ? 8.370   -5.825  -59.812 1.00 57.40  ? 1245 LEU B CG  1 
ATOM   328  C CD1 . LEU A 1 42 ? 7.672   -4.681  -59.089 1.00 65.61  ? 1245 LEU B CD1 1 
ATOM   329  C CD2 . LEU A 1 42 ? 9.633   -6.243  -59.067 1.00 66.99  ? 1245 LEU B CD2 1 
ATOM   330  N N   . ARG A 1 43 ? 5.031   -8.819  -61.420 1.00 57.13  ? 1246 ARG B N   1 
ATOM   331  C CA  . ARG A 1 43 ? 4.714   -9.848  -62.406 1.00 67.91  ? 1246 ARG B CA  1 
ATOM   332  C C   . ARG A 1 43 ? 3.664   -9.353  -63.391 1.00 70.85  ? 1246 ARG B C   1 
ATOM   333  O O   . ARG A 1 43 ? 3.512   -9.931  -64.474 1.00 68.43  ? 1246 ARG B O   1 
ATOM   334  C CB  . ARG A 1 43 ? 4.282   -11.163 -61.738 1.00 55.30  ? 1246 ARG B CB  1 
ATOM   335  C CG  . ARG A 1 43 ? 2.991   -11.167 -60.919 1.00 75.30  ? 1246 ARG B CG  1 
ATOM   336  C CD  . ARG A 1 43 ? 1.728   -10.993 -61.757 1.00 89.30  ? 1246 ARG B CD  1 
ATOM   337  N NE  . ARG A 1 43 ? 1.435   -12.117 -62.624 1.00 99.37  ? 1246 ARG B NE  1 
ATOM   338  C CZ  . ARG A 1 43 ? 0.506   -12.086 -63.570 1.00 104.96 ? 1246 ARG B CZ  1 
ATOM   339  N NH1 . ARG A 1 43 ? 0.279   -13.158 -64.305 1.00 101.46 ? 1246 ARG B NH1 1 
ATOM   340  N NH2 . ARG A 1 43 ? -0.193  -10.981 -63.786 1.00 100.52 ? 1246 ARG B NH2 1 
ATOM   341  N N   . GLU A 1 44 ? 2.903   -8.318  -63.016 1.00 69.06  ? 1247 GLU B N   1 
ATOM   342  C CA  . GLU A 1 44 ? 2.070   -7.636  -63.997 1.00 71.82  ? 1247 GLU B CA  1 
ATOM   343  C C   . GLU A 1 44 ? 2.933   -7.015  -65.079 1.00 70.16  ? 1247 GLU B C   1 
ATOM   344  O O   . GLU A 1 44 ? 2.488   -6.856  -66.220 1.00 55.03  ? 1247 GLU B O   1 
ATOM   345  C CB  . GLU A 1 44 ? 1.209   -6.560  -63.329 1.00 58.25  ? 1247 GLU B CB  1 
ATOM   346  C CG  . GLU A 1 44 ? -0.107  -7.054  -62.739 1.00 72.00  ? 1247 GLU B CG  1 
ATOM   347  C CD  . GLU A 1 44 ? -0.820  -5.985  -61.925 1.00 73.99  ? 1247 GLU B CD  1 
ATOM   348  O OE1 . GLU A 1 44 ? -1.439  -5.082  -62.527 1.00 69.73  ? 1247 GLU B OE1 1 
ATOM   349  O OE2 . GLU A 1 44 ? -0.754  -6.046  -60.679 1.00 68.47  ? 1247 GLU B OE2 1 
ATOM   350  N N   . ARG A 1 45 ? 4.175   -6.668  -64.733 1.00 70.67  ? 1248 ARG B N   1 
ATOM   351  C CA  . ARG A 1 45 ? 5.093   -6.105  -65.716 1.00 54.33  ? 1248 ARG B CA  1 
ATOM   352  C C   . ARG A 1 45 ? 5.363   -7.094  -66.843 1.00 65.37  ? 1248 ARG B C   1 
ATOM   353  O O   . ARG A 1 45 ? 5.490   -6.701  -68.008 1.00 64.50  ? 1248 ARG B O   1 
ATOM   354  C CB  . ARG A 1 45 ? 6.394   -5.683  -65.029 1.00 57.19  ? 1248 ARG B CB  1 
ATOM   355  C CG  . ARG A 1 45 ? 7.555   -5.405  -65.963 1.00 60.24  ? 1248 ARG B CG  1 
ATOM   356  C CD  . ARG A 1 45 ? 8.846   -5.147  -65.186 1.00 62.59  ? 1248 ARG B CD  1 
ATOM   357  N NE  . ARG A 1 45 ? 8.737   -3.995  -64.294 1.00 55.24  ? 1248 ARG B NE  1 
ATOM   358  C CZ  . ARG A 1 45 ? 9.774   -3.401  -63.710 1.00 63.05  ? 1248 ARG B CZ  1 
ATOM   359  N NH1 . ARG A 1 45 ? 9.588   -2.355  -62.919 1.00 65.10  ? 1248 ARG B NH1 1 
ATOM   360  N NH2 . ARG A 1 45 ? 11.003  -3.846  -63.922 1.00 65.34  ? 1248 ARG B NH2 1 
ATOM   361  N N   . GLN A 1 46 ? 5.434   -8.386  -66.522 1.00 79.35  ? 1249 GLN B N   1 
ATOM   362  C CA  . GLN A 1 46 ? 5.642   -9.383  -67.569 1.00 62.54  ? 1249 GLN B CA  1 
ATOM   363  C C   . GLN A 1 46 ? 4.465   -9.423  -68.537 1.00 73.87  ? 1249 GLN B C   1 
ATOM   364  O O   . GLN A 1 46 ? 4.655   -9.624  -69.743 1.00 76.32  ? 1249 GLN B O   1 
ATOM   365  C CB  . GLN A 1 46 ? 5.884   -10.759 -66.944 1.00 75.90  ? 1249 GLN B CB  1 
ATOM   366  C CG  . GLN A 1 46 ? 5.686   -11.935 -67.897 1.00 87.71  ? 1249 GLN B CG  1 
ATOM   367  C CD  . GLN A 1 46 ? 4.264   -12.469 -67.874 1.00 99.06  ? 1249 GLN B CD  1 
ATOM   368  O OE1 . GLN A 1 46 ? 3.526   -12.247 -66.915 1.00 96.06  ? 1249 GLN B OE1 1 
ATOM   369  N NE2 . GLN A 1 46 ? 3.871   -13.163 -68.938 1.00 108.35 ? 1249 GLN B NE2 1 
ATOM   370  N N   . GLU A 1 47 ? 3.244   -9.230  -68.035 1.00 77.84  ? 1250 GLU B N   1 
ATOM   371  C CA  . GLU A 1 47 ? 2.065   -9.299  -68.890 1.00 72.64  ? 1250 GLU B CA  1 
ATOM   372  C C   . GLU A 1 47 ? 1.818   -8.011  -69.665 1.00 72.52  ? 1250 GLU B C   1 
ATOM   373  O O   . GLU A 1 47 ? 1.144   -8.051  -70.699 1.00 70.25  ? 1250 GLU B O   1 
ATOM   374  C CB  . GLU A 1 47 ? 0.821   -9.642  -68.063 1.00 71.27  ? 1250 GLU B CB  1 
ATOM   375  C CG  . GLU A 1 47 ? 0.706   -11.105 -67.639 1.00 95.48  ? 1250 GLU B CG  1 
ATOM   376  C CD  . GLU A 1 47 ? 0.047   -11.986 -68.693 1.00 104.05 ? 1250 GLU B CD  1 
ATOM   377  O OE1 . GLU A 1 47 ? 0.295   -11.778 -69.899 1.00 103.09 ? 1250 GLU B OE1 1 
ATOM   378  O OE2 . GLU A 1 47 ? -0.728  -12.889 -68.310 1.00 101.49 ? 1250 GLU B OE2 1 
ATOM   379  N N   . THR A 1 48 ? 2.325   -6.870  -69.192 1.00 72.09  ? 1251 THR B N   1 
ATOM   380  C CA  . THR A 1 48 ? 2.175   -5.645  -69.970 1.00 64.83  ? 1251 THR B CA  1 
ATOM   381  C C   . THR A 1 48 ? 3.224   -5.551  -71.068 1.00 71.50  ? 1251 THR B C   1 
ATOM   382  O O   . THR A 1 48 ? 2.996   -4.878  -72.079 1.00 62.39  ? 1251 THR B O   1 
ATOM   383  C CB  . THR A 1 48 ? 2.240   -4.404  -69.073 1.00 66.34  ? 1251 THR B CB  1 
ATOM   384  O OG1 . THR A 1 48 ? 2.154   -3.227  -69.886 1.00 90.76  ? 1251 THR B OG1 1 
ATOM   385  C CG2 . THR A 1 48 ? 3.537   -4.352  -68.313 1.00 59.40  ? 1251 THR B CG2 1 
ATOM   386  N N   . ALA A 1 49 ? 4.373   -6.207  -70.888 1.00 71.38  ? 1252 ALA B N   1 
ATOM   387  C CA  . ALA A 1 49 ? 5.287   -6.388  -72.009 1.00 61.37  ? 1252 ALA B CA  1 
ATOM   388  C C   . ALA A 1 49 ? 4.641   -7.247  -73.082 1.00 78.37  ? 1252 ALA B C   1 
ATOM   389  O O   . ALA A 1 49 ? 4.807   -6.993  -74.282 1.00 71.97  ? 1252 ALA B O   1 
ATOM   390  C CB  . ALA A 1 49 ? 6.595   -7.019  -71.535 1.00 50.84  ? 1252 ALA B CB  1 
ATOM   391  N N   . ARG A 1 50 ? 3.895   -8.270  -72.664 1.00 79.62  ? 1253 ARG B N   1 
ATOM   392  C CA  . ARG A 1 50 ? 3.153   -9.104  -73.599 1.00 77.84  ? 1253 ARG B CA  1 
ATOM   393  C C   . ARG A 1 50 ? 2.195   -8.261  -74.430 1.00 68.46  ? 1253 ARG B C   1 
ATOM   394  O O   . ARG A 1 50 ? 2.179   -8.337  -75.664 1.00 83.19  ? 1253 ARG B O   1 
ATOM   395  C CB  . ARG A 1 50 ? 2.400   -10.183 -72.819 1.00 92.30  ? 1253 ARG B CB  1 
ATOM   396  C CG  . ARG A 1 50 ? 1.834   -11.302 -73.662 1.00 93.49  ? 1253 ARG B CG  1 
ATOM   397  C CD  . ARG A 1 50 ? 0.472   -11.718 -73.138 1.00 95.83  ? 1253 ARG B CD  1 
ATOM   398  N NE  . ARG A 1 50 ? -0.594  -11.339 -74.059 1.00 93.52  ? 1253 ARG B NE  1 
ATOM   399  C CZ  . ARG A 1 50 ? -1.813  -10.966 -73.682 1.00 91.27  ? 1253 ARG B CZ  1 
ATOM   400  N NH1 . ARG A 1 50 ? -2.125  -10.901 -72.393 1.00 95.61  ? 1253 ARG B NH1 1 
ATOM   401  N NH2 . ARG A 1 50 ? -2.717  -10.644 -74.596 1.00 92.04  ? 1253 ARG B NH2 1 
ATOM   402  N N   . LYS A 1 51 ? 1.411   -7.414  -73.758 1.00 65.84  ? 1254 LYS B N   1 
ATOM   403  C CA  . LYS A 1 51 ? 0.357   -6.651  -74.416 1.00 68.80  ? 1254 LYS B CA  1 
ATOM   404  C C   . LYS A 1 51 ? 0.895   -5.615  -75.398 1.00 74.47  ? 1254 LYS B C   1 
ATOM   405  O O   . LYS A 1 51 ? 0.155   -5.184  -76.289 1.00 76.05  ? 1254 LYS B O   1 
ATOM   406  C CB  . LYS A 1 51 ? -0.512  -5.970  -73.357 1.00 69.75  ? 1254 LYS B CB  1 
ATOM   407  C CG  . LYS A 1 51 ? -1.882  -5.539  -73.837 1.00 72.27  ? 1254 LYS B CG  1 
ATOM   408  C CD  . LYS A 1 51 ? -2.775  -5.159  -72.664 1.00 70.86  ? 1254 LYS B CD  1 
ATOM   409  C CE  . LYS A 1 51 ? -2.838  -6.288  -71.647 1.00 67.07  ? 1254 LYS B CE  1 
ATOM   410  N NZ  . LYS A 1 51 ? -3.915  -6.087  -70.642 1.00 67.28  ? 1254 LYS B NZ  1 
ATOM   411  N N   . MET A 1 52 ? 2.152   -5.204  -75.263 1.00 78.54  ? 1255 MET B N   1 
ATOM   412  C CA  . MET A 1 52 ? 2.715   -4.208  -76.175 1.00 75.42  ? 1255 MET B CA  1 
ATOM   413  C C   . MET A 1 52 ? 2.890   -4.758  -77.587 1.00 73.76  ? 1255 MET B C   1 
ATOM   414  O O   . MET A 1 52 ? 3.471   -5.824  -77.786 1.00 63.15  ? 1255 MET B O   1 
ATOM   415  C CB  . MET A 1 52 ? 4.055   -3.690  -75.647 1.00 74.57  ? 1255 MET B CB  1 
ATOM   416  C CG  . MET A 1 52 ? 3.912   -2.619  -74.583 1.00 69.89  ? 1255 MET B CG  1 
ATOM   417  S SD  . MET A 1 52 ? 5.408   -2.330  -73.628 1.00 76.58  ? 1255 MET B SD  1 
ATOM   418  C CE  . MET A 1 52 ? 4.685   -1.871  -72.058 1.00 67.87  ? 1255 MET B CE  1 
ATOM   419  N N   . ALA B 2 1  ? -1.952  -7.068  -57.485 1.00 101.83 ? 498  ALA C N   1 
ATOM   420  C CA  . ALA B 2 1  ? -3.273  -6.484  -57.682 1.00 92.76  ? 498  ALA C CA  1 
ATOM   421  C C   . ALA B 2 1  ? -4.100  -6.604  -56.410 1.00 85.33  ? 498  ALA C C   1 
ATOM   422  O O   . ALA B 2 1  ? -3.579  -6.441  -55.303 1.00 90.98  ? 498  ALA C O   1 
ATOM   423  C CB  . ALA B 2 1  ? -3.995  -7.144  -58.871 1.00 43.01  ? 498  ALA C CB  1 
ATOM   424  N N   . CYS B 2 2  ? -5.389  -6.904  -56.566 1.00 100.94 ? 499  CYS C N   1 
ATOM   425  C CA  . CYS B 2 2  ? -6.357  -6.622  -55.515 1.00 101.02 ? 499  CYS C CA  1 
ATOM   426  C C   . CYS B 2 2  ? -6.560  -7.780  -54.546 1.00 108.71 ? 499  CYS C C   1 
ATOM   427  O O   . CYS B 2 2  ? -7.153  -7.578  -53.485 1.00 117.73 ? 499  CYS C O   1 
ATOM   428  C CB  . CYS B 2 2  ? -7.687  -6.221  -56.152 1.00 63.97  ? 499  CYS C CB  1 
ATOM   429  S SG  . CYS B 2 2  ? -7.498  -4.844  -57.353 1.00 63.97  ? 499  CYS C SG  1 
ATOM   430  N N   . LEU B 2 3  ? -6.073  -8.981  -54.872 1.00 96.91  ? 500  LEU C N   1 
ATOM   431  C CA  . LEU B 2 3  ? -5.997  -10.046 -53.873 1.00 87.44  ? 500  LEU C CA  1 
ATOM   432  C C   . LEU B 2 3  ? -5.047  -9.665  -52.752 1.00 97.68  ? 500  LEU C C   1 
ATOM   433  O O   . LEU B 2 3  ? -5.372  -9.819  -51.572 1.00 92.54  ? 500  LEU C O   1 
ATOM   434  C CB  . LEU B 2 3  ? -5.537  -11.367 -54.506 1.00 52.36  ? 500  LEU C CB  1 
ATOM   435  C CG  . LEU B 2 3  ? -6.442  -12.286 -55.345 1.00 52.36  ? 500  LEU C CG  1 
ATOM   436  C CD1 . LEU B 2 3  ? -5.577  -13.299 -56.102 1.00 52.36  ? 500  LEU C CD1 1 
ATOM   437  C CD2 . LEU B 2 3  ? -7.551  -13.005 -54.545 1.00 52.36  ? 500  LEU C CD2 1 
ATOM   438  N N   . ASN B 2 4  ? -3.874  -9.128  -53.101 1.00 91.99  ? 501  ASN C N   1 
ATOM   439  C CA  . ASN B 2 4  ? -2.806  -8.954  -52.121 1.00 89.11  ? 501  ASN C CA  1 
ATOM   440  C C   . ASN B 2 4  ? -3.027  -7.702  -51.285 1.00 79.84  ? 501  ASN C C   1 
ATOM   441  O O   . ASN B 2 4  ? -2.728  -7.695  -50.082 1.00 85.76  ? 501  ASN C O   1 
ATOM   442  C CB  . ASN B 2 4  ? -1.450  -8.872  -52.826 1.00 50.86  ? 501  ASN C CB  1 
ATOM   443  C CG  . ASN B 2 4  ? -1.220  -10.003 -53.802 1.00 50.86  ? 501  ASN C CG  1 
ATOM   444  O OD1 . ASN B 2 4  ? -1.672  -9.950  -54.951 1.00 50.86  ? 501  ASN C OD1 1 
ATOM   445  N ND2 . ASN B 2 4  ? -0.497  -11.028 -53.362 1.00 50.86  ? 501  ASN C ND2 1 
ATOM   446  N N   . THR B 2 5  ? -3.505  -6.620  -51.902 1.00 54.78  ? 502  THR C N   1 
ATOM   447  C CA  . THR B 2 5  ? -3.838  -5.427  -51.134 1.00 66.50  ? 502  THR C CA  1 
ATOM   448  C C   . THR B 2 5  ? -4.941  -5.730  -50.133 1.00 63.19  ? 502  THR C C   1 
ATOM   449  O O   . THR B 2 5  ? -4.852  -5.341  -48.965 1.00 64.29  ? 502  THR C O   1 
ATOM   450  C CB  . THR B 2 5  ? -4.251  -4.293  -52.072 1.00 54.55  ? 502  THR C CB  1 
ATOM   451  O OG1 . THR B 2 5  ? -5.457  -4.646  -52.764 1.00 55.97  ? 502  THR C OG1 1 
ATOM   452  C CG2 . THR B 2 5  ? -3.173  -4.050  -53.088 1.00 53.80  ? 502  THR C CG2 1 
ATOM   453  N N   . ARG B 2 6  ? -5.986  -6.434  -50.566 1.00 62.17  ? 503  ARG C N   1 
ATOM   454  C CA  . ARG B 2 6  ? -7.047  -6.831  -49.648 1.00 57.17  ? 503  ARG C CA  1 
ATOM   455  C C   . ARG B 2 6  ? -6.531  -7.808  -48.601 1.00 65.64  ? 503  ARG C C   1 
ATOM   456  O O   . ARG B 2 6  ? -7.028  -7.822  -47.473 1.00 63.75  ? 503  ARG C O   1 
ATOM   457  C CB  . ARG B 2 6  ? -8.216  -7.456  -50.417 1.00 65.10  ? 503  ARG C CB  1 
ATOM   458  C CG  . ARG B 2 6  ? -9.471  -7.655  -49.585 1.00 85.30  ? 503  ARG C CG  1 
ATOM   459  C CD  . ARG B 2 6  ? -9.960  -9.102  -49.627 1.00 91.63  ? 503  ARG C CD  1 
ATOM   460  N NE  . ARG B 2 6  ? -10.722 -9.405  -50.838 1.00 98.68  ? 503  ARG C NE  1 
ATOM   461  C CZ  . ARG B 2 6  ? -11.015 -10.635 -51.249 1.00 100.50 ? 503  ARG C CZ  1 
ATOM   462  N NH1 . ARG B 2 6  ? -10.607 -11.686 -50.553 1.00 103.04 ? 503  ARG C NH1 1 
ATOM   463  N NH2 . ARG B 2 6  ? -11.714 -10.818 -52.361 1.00 90.82  ? 503  ARG C NH2 1 
ATOM   464  N N   . PHE B 2 7  ? -5.538  -8.628  -48.956 1.00 60.67  ? 504  PHE C N   1 
ATOM   465  C CA  . PHE B 2 7  ? -4.874  -9.471  -47.965 1.00 49.82  ? 504  PHE C CA  1 
ATOM   466  C C   . PHE B 2 7  ? -4.207  -8.612  -46.908 1.00 51.77  ? 504  PHE C C   1 
ATOM   467  O O   . PHE B 2 7  ? -4.343  -8.869  -45.709 1.00 49.61  ? 504  PHE C O   1 
ATOM   468  C CB  . PHE B 2 7  ? -3.847  -10.375 -48.655 1.00 38.42  ? 504  PHE C CB  1 
ATOM   469  C CG  . PHE B 2 7  ? -3.057  -11.260 -47.722 1.00 50.86  ? 504  PHE C CG  1 
ATOM   470  C CD1 . PHE B 2 7  ? -3.545  -12.503 -47.350 1.00 51.30  ? 504  PHE C CD1 1 
ATOM   471  C CD2 . PHE B 2 7  ? -1.817  -10.860 -47.234 1.00 51.75  ? 504  PHE C CD2 1 
ATOM   472  C CE1 . PHE B 2 7  ? -2.819  -13.327 -46.500 1.00 50.38  ? 504  PHE C CE1 1 
ATOM   473  C CE2 . PHE B 2 7  ? -1.087  -11.685 -46.382 1.00 49.91  ? 504  PHE C CE2 1 
ATOM   474  C CZ  . PHE B 2 7  ? -1.590  -12.917 -46.019 1.00 42.89  ? 504  PHE C CZ  1 
ATOM   475  N N   . LEU B 2 8  ? -3.500  -7.568  -47.344 1.00 50.40  ? 505  LEU C N   1 
ATOM   476  C CA  . LEU B 2 8  ? -2.786  -6.700  -46.416 1.00 45.68  ? 505  LEU C CA  1 
ATOM   477  C C   . LEU B 2 8  ? -3.754  -5.969  -45.498 1.00 55.96  ? 505  LEU C C   1 
ATOM   478  O O   . LEU B 2 8  ? -3.539  -5.896  -44.283 1.00 53.34  ? 505  LEU C O   1 
ATOM   479  C CB  . LEU B 2 8  ? -1.931  -5.704  -47.198 1.00 40.39  ? 505  LEU C CB  1 
ATOM   480  C CG  . LEU B 2 8  ? -1.040  -4.769  -46.383 1.00 51.56  ? 505  LEU C CG  1 
ATOM   481  C CD1 . LEU B 2 8  ? 0.142   -5.522  -45.811 1.00 59.72  ? 505  LEU C CD1 1 
ATOM   482  C CD2 . LEU B 2 8  ? -0.561  -3.603  -47.224 1.00 58.71  ? 505  LEU C CD2 1 
ATOM   483  N N   . GLU B 2 9  ? -4.824  -5.408  -46.071 1.00 39.49  ? 506  GLU C N   1 
ATOM   484  C CA  . GLU B 2 9  ? -5.836  -4.726  -45.271 1.00 49.57  ? 506  GLU C CA  1 
ATOM   485  C C   . GLU B 2 9  ? -6.392  -5.641  -44.192 1.00 49.59  ? 506  GLU C C   1 
ATOM   486  O O   . GLU B 2 9  ? -6.647  -5.205  -43.064 1.00 45.14  ? 506  GLU C O   1 
ATOM   487  C CB  . GLU B 2 9  ? -6.958  -4.222  -46.176 1.00 52.73  ? 506  GLU C CB  1 
ATOM   488  C CG  . GLU B 2 9  ? -6.503  -3.208  -47.205 1.00 59.94  ? 506  GLU C CG  1 
ATOM   489  C CD  . GLU B 2 9  ? -7.579  -2.899  -48.226 1.00 76.35  ? 506  GLU C CD  1 
ATOM   490  O OE1 . GLU B 2 9  ? -8.638  -3.561  -48.188 1.00 78.68  ? 506  GLU C OE1 1 
ATOM   491  O OE2 . GLU B 2 9  ? -7.366  -2.002  -49.069 1.00 66.59  ? 506  GLU C OE2 1 
ATOM   492  N N   . GLU B 2 10 ? -6.579  -6.920  -44.524 1.00 40.25  ? 507  GLU C N   1 
ATOM   493  C CA  . GLU B 2 10 ? -6.999  -7.895  -43.525 1.00 47.94  ? 507  GLU C CA  1 
ATOM   494  C C   . GLU B 2 10 ? -5.926  -8.080  -42.460 1.00 49.41  ? 507  GLU C C   1 
ATOM   495  O O   . GLU B 2 10 ? -6.225  -8.087  -41.262 1.00 44.25  ? 507  GLU C O   1 
ATOM   496  C CB  . GLU B 2 10 ? -7.326  -9.226  -44.200 1.00 44.31  ? 507  GLU C CB  1 
ATOM   497  C CG  . GLU B 2 10 ? -8.545  -9.193  -45.102 1.00 58.32  ? 507  GLU C CG  1 
ATOM   498  C CD  . GLU B 2 10 ? -8.623  -10.404 -46.014 1.00 68.99  ? 507  GLU C CD  1 
ATOM   499  O OE1 . GLU B 2 10 ? -7.674  -11.216 -46.005 1.00 61.14  ? 507  GLU C OE1 1 
ATOM   500  O OE2 . GLU B 2 10 ? -9.635  -10.542 -46.734 1.00 63.16  ? 507  GLU C OE2 1 
ATOM   501  N N   . GLU B 2 11 ? -4.667  -8.241  -42.885 1.00 46.58  ? 508  GLU C N   1 
ATOM   502  C CA  . GLU B 2 11 ? -3.560  -8.350  -41.938 1.00 46.68  ? 508  GLU C CA  1 
ATOM   503  C C   . GLU B 2 11 ? -3.579  -7.197  -40.945 1.00 39.61  ? 508  GLU C C   1 
ATOM   504  O O   . GLU B 2 11 ? -3.420  -7.395  -39.736 1.00 46.70  ? 508  GLU C O   1 
ATOM   505  C CB  . GLU B 2 11 ? -2.224  -8.375  -42.687 1.00 39.84  ? 508  GLU C CB  1 
ATOM   506  C CG  . GLU B 2 11 ? -1.748  -9.745  -43.143 1.00 50.89  ? 508  GLU C CG  1 
ATOM   507  C CD  . GLU B 2 11 ? -1.235  -10.607 -42.007 1.00 54.07  ? 508  GLU C CD  1 
ATOM   508  O OE1 . GLU B 2 11 ? -0.842  -10.045 -40.962 1.00 59.66  ? 508  GLU C OE1 1 
ATOM   509  O OE2 . GLU B 2 11 ? -1.226  -11.848 -42.159 1.00 65.15  ? 508  GLU C OE2 1 
ATOM   510  N N   . GLU B 2 12 ? -3.782  -5.977  -41.453 1.00 46.19  ? 509  GLU C N   1 
ATOM   511  C CA  . GLU B 2 12 ? -3.819  -4.793  -40.603 1.00 46.02  ? 509  GLU C CA  1 
ATOM   512  C C   . GLU B 2 12 ? -4.895  -4.914  -39.534 1.00 46.49  ? 509  GLU C C   1 
ATOM   513  O O   . GLU B 2 12 ? -4.674  -4.547  -38.374 1.00 40.07  ? 509  GLU C O   1 
ATOM   514  C CB  . GLU B 2 12 ? -4.069  -3.553  -41.459 1.00 42.23  ? 509  GLU C CB  1 
ATOM   515  C CG  . GLU B 2 12 ? -3.353  -2.309  -40.987 1.00 55.74  ? 509  GLU C CG  1 
ATOM   516  C CD  . GLU B 2 12 ? -1.991  -2.165  -41.623 1.00 50.32  ? 509  GLU C CD  1 
ATOM   517  O OE1 . GLU B 2 12 ? -1.878  -2.396  -42.846 1.00 63.57  ? 509  GLU C OE1 1 
ATOM   518  O OE2 . GLU B 2 12 ? -1.030  -1.831  -40.902 1.00 68.98  ? 509  GLU C OE2 1 
ATOM   519  N N   . LEU B 2 13 ? -6.071  -5.418  -39.912 1.00 40.53  ? 510  LEU C N   1 
ATOM   520  C CA  . LEU B 2 13 ? -7.165  -5.530  -38.955 1.00 45.97  ? 510  LEU C CA  1 
ATOM   521  C C   . LEU B 2 13 ? -6.861  -6.586  -37.902 1.00 56.21  ? 510  LEU C C   1 
ATOM   522  O O   . LEU B 2 13 ? -7.096  -6.367  -36.708 1.00 46.19  ? 510  LEU C O   1 
ATOM   523  C CB  . LEU B 2 13 ? -8.466  -5.856  -39.685 1.00 48.01  ? 510  LEU C CB  1 
ATOM   524  C CG  . LEU B 2 13 ? -9.733  -5.315  -39.026 1.00 57.48  ? 510  LEU C CG  1 
ATOM   525  C CD1 . LEU B 2 13 ? -9.674  -3.798  -38.961 1.00 54.11  ? 510  LEU C CD1 1 
ATOM   526  C CD2 . LEU B 2 13 ? -10.970 -5.778  -39.778 1.00 65.43  ? 510  LEU C CD2 1 
ATOM   527  N N   . ARG B 2 14 ? -6.335  -7.735  -38.329 1.00 43.81  ? 511  ARG C N   1 
ATOM   528  C CA  . ARG B 2 14 ? -5.957  -8.782  -37.391 1.00 46.88  ? 511  ARG C CA  1 
ATOM   529  C C   . ARG B 2 14 ? -4.797  -8.357  -36.508 1.00 44.81  ? 511  ARG C C   1 
ATOM   530  O O   . ARG B 2 14 ? -4.701  -8.823  -35.369 1.00 44.81  ? 511  ARG C O   1 
ATOM   531  C CB  . ARG B 2 14 ? -5.599  -10.061 -38.150 1.00 47.57  ? 511  ARG C CB  1 
ATOM   532  C CG  . ARG B 2 14 ? -6.667  -10.505 -39.135 1.00 54.69  ? 511  ARG C CG  1 
ATOM   533  C CD  . ARG B 2 14 ? -6.352  -11.850 -39.767 1.00 50.38  ? 511  ARG C CD  1 
ATOM   534  N NE  . ARG B 2 14 ? -4.926  -12.037 -40.004 1.00 55.97  ? 511  ARG C NE  1 
ATOM   535  C CZ  . ARG B 2 14 ? -4.192  -12.952 -39.384 1.00 51.98  ? 511  ARG C CZ  1 
ATOM   536  N NH1 . ARG B 2 14 ? -4.759  -13.762 -38.500 1.00 40.65  ? 511  ARG C NH1 1 
ATOM   537  N NH2 . ARG B 2 14 ? -2.898  -13.064 -39.650 1.00 47.56  ? 511  ARG C NH2 1 
ATOM   538  N N   . SER B 2 15 ? -3.921  -7.483  -37.010 1.00 40.13  ? 512  SER C N   1 
ATOM   539  C CA  . SER B 2 15 ? -2.812  -6.983  -36.204 1.00 40.16  ? 512  SER C CA  1 
ATOM   540  C C   . SER B 2 15 ? -3.313  -6.159  -35.027 1.00 57.15  ? 512  SER C C   1 
ATOM   541  O O   . SER B 2 15 ? -2.780  -6.259  -33.915 1.00 41.38  ? 512  SER C O   1 
ATOM   542  C CB  . SER B 2 15 ? -1.875  -6.148  -37.073 1.00 37.04  ? 512  SER C CB  1 
ATOM   543  O OG  . SER B 2 15 ? -1.375  -6.914  -38.155 1.00 67.25  ? 512  SER C OG  1 
ATOM   544  N N   . HIS B 2 16 ? -4.332  -5.331  -35.258 1.00 56.31  ? 513  HIS C N   1 
ATOM   545  C CA  . HIS B 2 16 ? -4.887  -4.510  -34.191 1.00 53.57  ? 513  HIS C CA  1 
ATOM   546  C C   . HIS B 2 16 ? -5.602  -5.367  -33.154 1.00 49.31  ? 513  HIS C C   1 
ATOM   547  O O   . HIS B 2 16 ? -5.533  -5.086  -31.952 1.00 45.69  ? 513  HIS C O   1 
ATOM   548  C CB  . HIS B 2 16 ? -5.838  -3.474  -34.788 1.00 51.21  ? 513  HIS C CB  1 
ATOM   549  C CG  . HIS B 2 16 ? -6.540  -2.632  -33.768 1.00 73.15  ? 513  HIS C CG  1 
ATOM   550  N ND1 . HIS B 2 16 ? -5.881  -1.715  -32.982 1.00 77.64  ? 513  HIS C ND1 1 
ATOM   551  C CD2 . HIS B 2 16 ? -7.848  -2.556  -33.425 1.00 75.32  ? 513  HIS C CD2 1 
ATOM   552  C CE1 . HIS B 2 16 ? -6.751  -1.118  -32.182 1.00 75.01  ? 513  HIS C CE1 1 
ATOM   553  N NE2 . HIS B 2 16 ? -7.949  -1.610  -32.432 1.00 71.88  ? 513  HIS C NE2 1 
ATOM   554  N N   . HIS B 2 17 ? -6.278  -6.425  -33.599 1.00 45.33  ? 514  HIS C N   1 
ATOM   555  C CA  . HIS B 2 17 ? -7.082  -7.225  -32.682 1.00 50.27  ? 514  HIS C CA  1 
ATOM   556  C C   . HIS B 2 17 ? -6.202  -8.072  -31.771 1.00 52.91  ? 514  HIS C C   1 
ATOM   557  O O   . HIS B 2 17 ? -6.374  -8.062  -30.546 1.00 40.35  ? 514  HIS C O   1 
ATOM   558  C CB  . HIS B 2 17 ? -8.052  -8.099  -33.472 1.00 39.04  ? 514  HIS C CB  1 
ATOM   559  C CG  . HIS B 2 17 ? -9.043  -7.322  -34.284 1.00 73.24  ? 514  HIS C CG  1 
ATOM   560  N ND1 . HIS B 2 17 ? -10.091 -7.922  -34.946 1.00 81.83  ? 514  HIS C ND1 1 
ATOM   561  C CD2 . HIS B 2 17 ? -9.146  -5.996  -34.534 1.00 70.10  ? 514  HIS C CD2 1 
ATOM   562  C CE1 . HIS B 2 17 ? -10.798 -6.998  -35.574 1.00 74.26  ? 514  HIS C CE1 1 
ATOM   563  N NE2 . HIS B 2 17 ? -10.245 -5.821  -35.342 1.00 75.70  ? 514  HIS C NE2 1 
ATOM   564  N N   . ILE B 2 18 ? -5.250  -8.811  -32.349 1.00 48.86  ? 515  ILE C N   1 
ATOM   565  C CA  . ILE B 2 18 ? -4.306  -9.576  -31.540 1.00 44.50  ? 515  ILE C CA  1 
ATOM   566  C C   . ILE B 2 18 ? -3.559  -8.651  -30.589 1.00 53.34  ? 515  ILE C C   1 
ATOM   567  O O   . ILE B 2 18 ? -3.212  -9.042  -29.468 1.00 43.80  ? 515  ILE C O   1 
ATOM   568  C CB  . ILE B 2 18 ? -3.347  -10.368 -32.456 1.00 35.47  ? 515  ILE C CB  1 
ATOM   569  C CG1 . ILE B 2 18 ? -2.408  -11.259 -31.647 1.00 39.01  ? 515  ILE C CG1 1 
ATOM   570  C CG2 . ILE B 2 18 ? -2.534  -9.437  -33.326 1.00 47.28  ? 515  ILE C CG2 1 
ATOM   571  C CD1 . ILE B 2 18 ? -3.084  -12.456 -31.055 1.00 57.17  ? 515  ILE C CD1 1 
ATOM   572  N N   . LEU B 2 19 ? -3.328  -7.402  -31.007 1.00 46.30  ? 516  LEU C N   1 
ATOM   573  C CA  . LEU B 2 19 ? -2.690  -6.422  -30.136 1.00 44.52  ? 516  LEU C CA  1 
ATOM   574  C C   . LEU B 2 19 ? -3.552  -6.124  -28.917 1.00 47.72  ? 516  LEU C C   1 
ATOM   575  O O   . LEU B 2 19 ? -3.047  -6.088  -27.788 1.00 38.67  ? 516  LEU C O   1 
ATOM   576  C CB  . LEU B 2 19 ? -2.414  -5.140  -30.920 1.00 44.37  ? 516  LEU C CB  1 
ATOM   577  C CG  . LEU B 2 19 ? -1.729  -3.989  -30.182 1.00 68.18  ? 516  LEU C CG  1 
ATOM   578  C CD1 . LEU B 2 19 ? -0.228  -4.098  -30.351 1.00 68.85  ? 516  LEU C CD1 1 
ATOM   579  C CD2 . LEU B 2 19 ? -2.234  -2.642  -30.676 1.00 70.97  ? 516  LEU C CD2 1 
ATOM   580  N N   . GLU B 2 20 ? -4.852  -5.896  -29.128 1.00 38.47  ? 517  GLU C N   1 
ATOM   581  C CA  . GLU B 2 20 ? -5.764  -5.687  -28.009 1.00 44.19  ? 517  GLU C CA  1 
ATOM   582  C C   . GLU B 2 20 ? -5.694  -6.843  -27.026 1.00 38.84  ? 517  GLU C C   1 
ATOM   583  O O   . GLU B 2 20 ? -5.554  -6.632  -25.816 1.00 40.95  ? 517  GLU C O   1 
ATOM   584  C CB  . GLU B 2 20 ? -7.198  -5.522  -28.513 1.00 39.99  ? 517  GLU C CB  1 
ATOM   585  C CG  . GLU B 2 20 ? -7.523  -4.156  -29.091 1.00 59.58  ? 517  GLU C CG  1 
ATOM   586  C CD  . GLU B 2 20 ? -8.850  -4.146  -29.832 1.00 72.17  ? 517  GLU C CD  1 
ATOM   587  O OE1 . GLU B 2 20 ? -9.890  -4.475  -29.222 1.00 76.21  ? 517  GLU C OE1 1 
ATOM   588  O OE2 . GLU B 2 20 ? -8.851  -3.823  -31.036 1.00 72.09  ? 517  GLU C OE2 1 
ATOM   589  N N   . ARG B 2 21 ? -5.772  -8.074  -27.535 1.00 44.26  ? 518  ARG C N   1 
ATOM   590  C CA  . ARG B 2 21 ? -5.808  -9.245  -26.669 1.00 40.84  ? 518  ARG C CA  1 
ATOM   591  C C   . ARG B 2 21 ? -4.551  -9.356  -25.823 1.00 43.01  ? 518  ARG C C   1 
ATOM   592  O O   . ARG B 2 21 ? -4.608  -9.854  -24.693 1.00 37.69  ? 518  ARG C O   1 
ATOM   593  C CB  . ARG B 2 21 ? -6.005  -10.507 -27.509 1.00 41.15  ? 518  ARG C CB  1 
ATOM   594  C CG  . ARG B 2 21 ? -7.385  -11.130 -27.364 1.00 56.74  ? 518  ARG C CG  1 
ATOM   595  C CD  . ARG B 2 21 ? -7.751  -11.975 -28.571 1.00 66.56  ? 518  ARG C CD  1 
ATOM   596  N NE  . ARG B 2 21 ? -7.977  -11.162 -29.764 1.00 76.60  ? 518  ARG C NE  1 
ATOM   597  C CZ  . ARG B 2 21 ? -8.596  -11.595 -30.858 1.00 76.72  ? 518  ARG C CZ  1 
ATOM   598  N NH1 . ARG B 2 21 ? -9.062  -12.836 -30.909 1.00 79.50  ? 518  ARG C NH1 1 
ATOM   599  N NH2 . ARG B 2 21 ? -8.758  -10.788 -31.898 1.00 59.69  ? 518  ARG C NH2 1 
ATOM   600  N N   . LEU B 2 22 ? -3.414  -8.887  -26.342 1.00 29.38  ? 519  LEU C N   1 
ATOM   601  C CA  . LEU B 2 22 ? -2.185  -8.911  -25.557 1.00 35.57  ? 519  LEU C CA  1 
ATOM   602  C C   . LEU B 2 22 ? -2.224  -7.859  -24.458 1.00 46.27  ? 519  LEU C C   1 
ATOM   603  O O   . LEU B 2 22 ? -1.856  -8.131  -23.310 1.00 46.64  ? 519  LEU C O   1 
ATOM   604  C CB  . LEU B 2 22 ? -0.971  -8.697  -26.461 1.00 38.29  ? 519  LEU C CB  1 
ATOM   605  C CG  . LEU B 2 22 ? -0.663  -9.727  -27.553 1.00 44.21  ? 519  LEU C CG  1 
ATOM   606  C CD1 . LEU B 2 22 ? 0.845   -9.914  -27.683 1.00 33.42  ? 519  LEU C CD1 1 
ATOM   607  C CD2 . LEU B 2 22 ? -1.359  -11.061 -27.307 1.00 44.71  ? 519  LEU C CD2 1 
ATOM   608  N N   . ASP B 2 23 ? -2.668  -6.645  -24.796 1.00 36.92  ? 520  ASP C N   1 
ATOM   609  C CA  . ASP B 2 23 ? -2.837  -5.612  -23.781 1.00 38.58  ? 520  ASP C CA  1 
ATOM   610  C C   . ASP B 2 23 ? -3.800  -6.054  -22.690 1.00 46.02  ? 520  ASP C C   1 
ATOM   611  O O   . ASP B 2 23 ? -3.619  -5.696  -21.520 1.00 41.58  ? 520  ASP C O   1 
ATOM   612  C CB  . ASP B 2 23 ? -3.334  -4.315  -24.418 1.00 31.24  ? 520  ASP C CB  1 
ATOM   613  C CG  . ASP B 2 23 ? -2.227  -3.521  -25.070 1.00 42.30  ? 520  ASP C CG  1 
ATOM   614  O OD1 . ASP B 2 23 ? -1.053  -3.926  -24.953 1.00 33.42  ? 520  ASP C OD1 1 
ATOM   615  O OD2 . ASP B 2 23 ? -2.531  -2.480  -25.689 1.00 47.07  ? 520  ASP C OD2 1 
ATOM   616  N N   . ALA B 2 24 ? -4.827  -6.825  -23.054 1.00 37.10  ? 521  ALA C N   1 
ATOM   617  C CA  . ALA B 2 24 ? -5.790  -7.309  -22.072 1.00 36.76  ? 521  ALA C CA  1 
ATOM   618  C C   . ALA B 2 24 ? -5.123  -8.235  -21.064 1.00 35.00  ? 521  ALA C C   1 
ATOM   619  O O   . ALA B 2 24 ? -5.217  -8.027  -19.849 1.00 45.90  ? 521  ALA C O   1 
ATOM   620  C CB  . ALA B 2 24 ? -6.943  -8.021  -22.781 1.00 25.75  ? 521  ALA C CB  1 
ATOM   621  N N   . HIS B 2 25 ? -4.444  -9.274  -21.560 1.00 25.01  ? 522  HIS C N   1 
ATOM   622  C CA  . HIS B 2 25 ? -3.779  -10.225 -20.679 1.00 34.74  ? 522  HIS C CA  1 
ATOM   623  C C   . HIS B 2 25 ? -2.763  -9.536  -19.779 1.00 34.03  ? 522  HIS C C   1 
ATOM   624  O O   . HIS B 2 25 ? -2.515  -9.988  -18.655 1.00 34.89  ? 522  HIS C O   1 
ATOM   625  C CB  . HIS B 2 25 ? -3.101  -11.316 -21.508 1.00 29.16  ? 522  HIS C CB  1 
ATOM   626  C CG  . HIS B 2 25 ? -3.998  -11.952 -22.525 1.00 44.14  ? 522  HIS C CG  1 
ATOM   627  N ND1 . HIS B 2 25 ? -5.363  -12.053 -22.361 1.00 50.80  ? 522  HIS C ND1 1 
ATOM   628  C CD2 . HIS B 2 25 ? -3.721  -12.516 -23.725 1.00 36.96  ? 522  HIS C CD2 1 
ATOM   629  C CE1 . HIS B 2 25 ? -5.887  -12.653 -23.414 1.00 39.46  ? 522  HIS C CE1 1 
ATOM   630  N NE2 . HIS B 2 25 ? -4.913  -12.944 -24.257 1.00 35.13  ? 522  HIS C NE2 1 
ATOM   631  N N   . ILE B 2 26 ? -2.176  -8.435  -20.247 1.00 31.36  ? 523  ILE C N   1 
ATOM   632  C CA  . ILE B 2 26 ? -1.244  -7.674  -19.424 1.00 28.44  ? 523  ILE C CA  1 
ATOM   633  C C   . ILE B 2 26 ? -1.989  -6.884  -18.358 1.00 40.96  ? 523  ILE C C   1 
ATOM   634  O O   . ILE B 2 26 ? -1.632  -6.925  -17.175 1.00 30.50  ? 523  ILE C O   1 
ATOM   635  C CB  . ILE B 2 26 ? -0.382  -6.755  -20.307 1.00 30.98  ? 523  ILE C CB  1 
ATOM   636  C CG1 . ILE B 2 26 ? 0.525   -7.580  -21.225 1.00 36.38  ? 523  ILE C CG1 1 
ATOM   637  C CG2 . ILE B 2 26 ? 0.438   -5.805  -19.449 1.00 32.23  ? 523  ILE C CG2 1 
ATOM   638  C CD1 . ILE B 2 26 ? 1.269   -6.739  -22.247 1.00 32.87  ? 523  ILE C CD1 1 
ATOM   639  N N   . GLU B 2 27 ? -3.040  -6.162  -18.759 1.00 35.48  ? 524  GLU C N   1 
ATOM   640  C CA  . GLU B 2 27 ? -3.803  -5.360  -17.808 1.00 36.39  ? 524  GLU C CA  1 
ATOM   641  C C   . GLU B 2 27 ? -4.440  -6.229  -16.732 1.00 36.02  ? 524  GLU C C   1 
ATOM   642  O O   . GLU B 2 27 ? -4.505  -5.839  -15.560 1.00 34.18  ? 524  GLU C O   1 
ATOM   643  C CB  . GLU B 2 27 ? -4.874  -4.554  -18.544 1.00 30.50  ? 524  GLU C CB  1 
ATOM   644  C CG  . GLU B 2 27 ? -5.190  -3.218  -17.901 1.00 49.67  ? 524  GLU C CG  1 
ATOM   645  C CD  . GLU B 2 27 ? -4.028  -2.235  -17.986 1.00 57.09  ? 524  GLU C CD  1 
ATOM   646  O OE1 . GLU B 2 27 ? -3.225  -2.328  -18.941 1.00 54.43  ? 524  GLU C OE1 1 
ATOM   647  O OE2 . GLU B 2 27 ? -3.922  -1.364  -17.098 1.00 59.02  ? 524  GLU C OE2 1 
ATOM   648  N N   . GLU B 2 28 ? -4.922  -7.415  -17.113 1.00 31.69  ? 525  GLU C N   1 
ATOM   649  C CA  . GLU B 2 28 ? -5.448  -8.342  -16.120 1.00 35.83  ? 525  GLU C CA  1 
ATOM   650  C C   . GLU B 2 28 ? -4.360  -8.764  -15.142 1.00 41.48  ? 525  GLU C C   1 
ATOM   651  O O   . GLU B 2 28 ? -4.608  -8.866  -13.935 1.00 31.35  ? 525  GLU C O   1 
ATOM   652  C CB  . GLU B 2 28 ? -6.052  -9.566  -16.804 1.00 36.30  ? 525  GLU C CB  1 
ATOM   653  C CG  . GLU B 2 28 ? -6.680  -10.546 -15.835 1.00 45.05  ? 525  GLU C CG  1 
ATOM   654  C CD  . GLU B 2 28 ? -7.034  -11.874 -16.479 1.00 53.98  ? 525  GLU C CD  1 
ATOM   655  O OE1 . GLU B 2 28 ? -6.358  -12.272 -17.453 1.00 51.54  ? 525  GLU C OE1 1 
ATOM   656  O OE2 . GLU B 2 28 ? -7.991  -12.522 -16.004 1.00 56.90  ? 525  GLU C OE2 1 
ATOM   657  N N   . LEU B 2 29 ? -3.149  -9.010  -15.650 1.00 27.94  ? 526  LEU C N   1 
ATOM   658  C CA  . LEU B 2 29 ? -2.040  -9.348  -14.765 1.00 29.99  ? 526  LEU C CA  1 
ATOM   659  C C   . LEU B 2 29 ? -1.748  -8.205  -13.806 1.00 35.78  ? 526  LEU C C   1 
ATOM   660  O O   . LEU B 2 29 ? -1.493  -8.431  -12.617 1.00 21.30  ? 526  LEU C O   1 
ATOM   661  C CB  . LEU B 2 29 ? -0.795  -9.690  -15.583 1.00 20.86  ? 526  LEU C CB  1 
ATOM   662  C CG  . LEU B 2 29 ? 0.495   -9.934  -14.793 1.00 27.00  ? 526  LEU C CG  1 
ATOM   663  C CD1 . LEU B 2 29 ? 0.388   -11.221 -13.994 1.00 42.21  ? 526  LEU C CD1 1 
ATOM   664  C CD2 . LEU B 2 29 ? 1.711   -9.970  -15.717 1.00 25.94  ? 526  LEU C CD2 1 
ATOM   665  N N   . LYS B 2 30 ? -1.798  -6.969  -14.302 1.00 26.04  ? 527  LYS C N   1 
ATOM   666  C CA  . LYS B 2 30 ? -1.517  -5.827  -13.445 1.00 28.67  ? 527  LYS C CA  1 
ATOM   667  C C   . LYS B 2 30 ? -2.558  -5.705  -12.343 1.00 32.31  ? 527  LYS C C   1 
ATOM   668  O O   . LYS B 2 30 ? -2.225  -5.383  -11.198 1.00 30.14  ? 527  LYS C O   1 
ATOM   669  C CB  . LYS B 2 30 ? -1.445  -4.549  -14.282 1.00 26.40  ? 527  LYS C CB  1 
ATOM   670  C CG  . LYS B 2 30 ? -0.395  -4.601  -15.384 1.00 38.34  ? 527  LYS C CG  1 
ATOM   671  C CD  . LYS B 2 30 ? 0.327   -3.275  -15.545 1.00 34.61  ? 527  LYS C CD  1 
ATOM   672  C CE  . LYS B 2 30 ? -0.079  -2.556  -16.819 1.00 51.80  ? 527  LYS C CE  1 
ATOM   673  N NZ  . LYS B 2 30 ? -0.846  -1.314  -16.525 1.00 62.27  ? 527  LYS C NZ  1 
ATOM   674  N N   . ARG B 2 31 ? -3.824  -5.990  -12.657 1.00 28.49  ? 528  ARG C N   1 
ATOM   675  C CA  . ARG B 2 31 ? -4.872  -5.888  -11.648 1.00 31.85  ? 528  ARG C CA  1 
ATOM   676  C C   . ARG B 2 31 ? -4.800  -7.036  -10.651 1.00 30.81  ? 528  ARG C C   1 
ATOM   677  O O   . ARG B 2 31 ? -4.924  -6.822  -9.439  1.00 32.69  ? 528  ARG C O   1 
ATOM   678  C CB  . ARG B 2 31 ? -6.245  -5.842  -12.320 1.00 35.99  ? 528  ARG C CB  1 
ATOM   679  C CG  . ARG B 2 31 ? -6.751  -4.429  -12.567 1.00 50.38  ? 528  ARG C CG  1 
ATOM   680  C CD  . ARG B 2 31 ? -8.070  -4.395  -13.333 1.00 66.04  ? 528  ARG C CD  1 
ATOM   681  N NE  . ARG B 2 31 ? -7.902  -4.698  -14.752 1.00 91.26  ? 528  ARG C NE  1 
ATOM   682  C CZ  . ARG B 2 31 ? -8.318  -5.822  -15.324 1.00 88.83  ? 528  ARG C CZ  1 
ATOM   683  N NH1 . ARG B 2 31 ? -8.932  -6.743  -14.595 1.00 96.05  ? 528  ARG C NH1 1 
ATOM   684  N NH2 . ARG B 2 31 ? -8.128  -6.023  -16.621 1.00 76.10  ? 528  ARG C NH2 1 
ATOM   685  N N   . GLU B 2 32 ? -4.605  -8.263  -11.141 1.00 29.76  ? 529  GLU C N   1 
ATOM   686  C CA  . GLU B 2 32 ? -4.517  -9.409  -10.244 1.00 28.16  ? 529  GLU C CA  1 
ATOM   687  C C   . GLU B 2 32 ? -3.319  -9.293  -9.312  1.00 36.70  ? 529  GLU C C   1 
ATOM   688  O O   . GLU B 2 32 ? -3.430  -9.571  -8.113  1.00 26.81  ? 529  GLU C O   1 
ATOM   689  C CB  . GLU B 2 32 ? -4.435  -10.704 -11.049 1.00 23.72  ? 529  GLU C CB  1 
ATOM   690  C CG  . GLU B 2 32 ? -5.702  -11.066 -11.798 1.00 45.68  ? 529  GLU C CG  1 
ATOM   691  C CD  . GLU B 2 32 ? -5.540  -12.329 -12.625 1.00 50.11  ? 529  GLU C CD  1 
ATOM   692  O OE1 . GLU B 2 32 ? -4.430  -12.562 -13.148 1.00 39.85  ? 529  GLU C OE1 1 
ATOM   693  O OE2 . GLU B 2 32 ? -6.520  -13.091 -12.741 1.00 59.44  ? 529  GLU C OE2 1 
ATOM   694  N N   . SER B 2 33 ? -2.167  -8.884  -9.844  1.00 34.70  ? 530  SER C N   1 
ATOM   695  C CA  . SER B 2 33 ? -0.959  -8.817  -9.031  1.00 28.44  ? 530  SER C CA  1 
ATOM   696  C C   . SER B 2 33 ? -1.015  -7.666  -8.035  1.00 36.88  ? 530  SER C C   1 
ATOM   697  O O   . SER B 2 33 ? -0.592  -7.822  -6.883  1.00 28.04  ? 530  SER C O   1 
ATOM   698  C CB  . SER B 2 33 ? 0.272   -8.689  -9.928  1.00 23.14  ? 530  SER C CB  1 
ATOM   699  O OG  . SER B 2 33 ? 0.261   -7.455  -10.620 1.00 28.61  ? 530  SER C OG  1 
ATOM   700  N N   . GLU B 2 34 ? -1.527  -6.509  -8.463  1.00 27.16  ? 531  GLU C N   1 
ATOM   701  C CA  . GLU B 2 34 ? -1.692  -5.384  -7.548  1.00 27.41  ? 531  GLU C CA  1 
ATOM   702  C C   . GLU B 2 34 ? -2.542  -5.775  -6.346  1.00 42.82  ? 531  GLU C C   1 
ATOM   703  O O   . GLU B 2 34 ? -2.260  -5.368  -5.212  1.00 32.66  ? 531  GLU C O   1 
ATOM   704  C CB  . GLU B 2 34 ? -2.313  -4.200  -8.291  1.00 26.47  ? 531  GLU C CB  1 
ATOM   705  C CG  . GLU B 2 34 ? -2.635  -2.989  -7.429  1.00 43.15  ? 531  GLU C CG  1 
ATOM   706  C CD  . GLU B 2 34 ? -3.048  -1.774  -8.255  1.00 65.87  ? 531  GLU C CD  1 
ATOM   707  O OE1 . GLU B 2 34 ? -4.244  -1.655  -8.604  1.00 69.26  ? 531  GLU C OE1 1 
ATOM   708  O OE2 . GLU B 2 34 ? -2.168  -0.942  -8.565  1.00 64.35  ? 531  GLU C OE2 1 
ATOM   709  N N   . LYS B 2 35 ? -3.578  -6.586  -6.570  1.00 29.83  ? 532  LYS C N   1 
ATOM   710  C CA  . LYS B 2 35 ? -4.439  -6.989  -5.466  1.00 27.81  ? 532  LYS C CA  1 
ATOM   711  C C   . LYS B 2 35 ? -3.724  -7.960  -4.539  1.00 33.16  ? 532  LYS C C   1 
ATOM   712  O O   . LYS B 2 35 ? -3.827  -7.845  -3.311  1.00 42.41  ? 532  LYS C O   1 
ATOM   713  C CB  . LYS B 2 35 ? -5.730  -7.611  -5.992  1.00 34.74  ? 532  LYS C CB  1 
ATOM   714  C CG  . LYS B 2 35 ? -6.730  -7.927  -4.889  1.00 37.67  ? 532  LYS C CG  1 
ATOM   715  C CD  . LYS B 2 35 ? -7.529  -9.182  -5.187  1.00 39.13  ? 532  LYS C CD  1 
ATOM   716  C CE  . LYS B 2 35 ? -8.812  -8.861  -5.930  1.00 42.66  ? 532  LYS C CE  1 
ATOM   717  N NZ  . LYS B 2 35 ? -9.425  -10.088 -6.516  1.00 73.99  ? 532  LYS C NZ  1 
ATOM   718  N N   . THR B 2 36 ? -2.998  -8.925  -5.109  1.00 24.65  ? 533  THR C N   1 
ATOM   719  C CA  . THR B 2 36 ? -2.212  -9.846  -4.293  1.00 35.30  ? 533  THR C CA  1 
ATOM   720  C C   . THR B 2 36 ? -1.232  -9.088  -3.407  1.00 34.69  ? 533  THR C C   1 
ATOM   721  O O   . THR B 2 36 ? -1.117  -9.365  -2.207  1.00 33.03  ? 533  THR C O   1 
ATOM   722  C CB  . THR B 2 36 ? -1.473  -10.839 -5.192  1.00 31.16  ? 533  THR C CB  1 
ATOM   723  O OG1 . THR B 2 36 ? -2.413  -11.737 -5.791  1.00 33.21  ? 533  THR C OG1 1 
ATOM   724  C CG2 . THR B 2 36 ? -0.474  -11.638 -4.386  1.00 26.59  ? 533  THR C CG2 1 
ATOM   725  N N   . VAL B 2 37 ? -0.529  -8.110  -3.980  1.00 24.82  ? 534  VAL C N   1 
ATOM   726  C CA  . VAL B 2 37 ? 0.440   -7.328  -3.218  1.00 25.73  ? 534  VAL C CA  1 
ATOM   727  C C   . VAL B 2 37 ? -0.256  -6.577  -2.087  1.00 25.31  ? 534  VAL C C   1 
ATOM   728  O O   . VAL B 2 37 ? 0.118   -6.698  -0.917  1.00 32.02  ? 534  VAL C O   1 
ATOM   729  C CB  . VAL B 2 37 ? 1.197   -6.361  -4.141  1.00 23.72  ? 534  VAL C CB  1 
ATOM   730  C CG1 . VAL B 2 37 ? 2.067   -5.431  -3.319  1.00 24.56  ? 534  VAL C CG1 1 
ATOM   731  C CG2 . VAL B 2 37 ? 2.034   -7.138  -5.148  1.00 24.12  ? 534  VAL C CG2 1 
ATOM   732  N N   . ARG B 2 38 ? -1.276  -5.793  -2.436  1.00 23.96  ? 535  ARG C N   1 
ATOM   733  C CA  . ARG B 2 38 ? -1.986  -4.971  -1.459  1.00 23.17  ? 535  ARG C CA  1 
ATOM   734  C C   . ARG B 2 38 ? -2.458  -5.796  -0.270  1.00 32.94  ? 535  ARG C C   1 
ATOM   735  O O   . ARG B 2 38 ? -2.278  -5.400  0.889   1.00 28.22  ? 535  ARG C O   1 
ATOM   736  C CB  . ARG B 2 38 ? -3.178  -4.293  -2.135  1.00 26.15  ? 535  ARG C CB  1 
ATOM   737  C CG  . ARG B 2 38 ? -4.071  -3.506  -1.196  1.00 37.45  ? 535  ARG C CG  1 
ATOM   738  C CD  . ARG B 2 38 ? -5.451  -3.256  -1.797  1.00 31.14  ? 535  ARG C CD  1 
ATOM   739  N NE  . ARG B 2 38 ? -5.407  -3.047  -3.243  1.00 58.76  ? 535  ARG C NE  1 
ATOM   740  C CZ  . ARG B 2 38 ? -6.021  -3.820  -4.136  1.00 45.66  ? 535  ARG C CZ  1 
ATOM   741  N NH1 . ARG B 2 38 ? -6.750  -4.856  -3.744  1.00 42.80  ? 535  ARG C NH1 1 
ATOM   742  N NH2 . ARG B 2 38 ? -5.919  -3.543  -5.427  1.00 58.43  ? 535  ARG C NH2 1 
ATOM   743  N N   . GLN B 2 39 ? -3.050  -6.960  -0.541  1.00 25.57  ? 536  GLN C N   1 
ATOM   744  C CA  . GLN B 2 39 ? -3.708  -7.726  0.511   1.00 31.33  ? 536  GLN C CA  1 
ATOM   745  C C   . GLN B 2 39 ? -2.699  -8.489  1.364   1.00 36.54  ? 536  GLN C C   1 
ATOM   746  O O   . GLN B 2 39 ? -2.815  -8.523  2.594   1.00 31.01  ? 536  GLN C O   1 
ATOM   747  C CB  . GLN B 2 39 ? -4.744  -8.665  -0.111  1.00 17.85  ? 536  GLN C CB  1 
ATOM   748  C CG  . GLN B 2 39 ? -5.897  -7.920  -0.771  1.00 20.87  ? 536  GLN C CG  1 
ATOM   749  C CD  . GLN B 2 39 ? -7.053  -8.822  -1.155  1.00 28.80  ? 536  GLN C CD  1 
ATOM   750  O OE1 . GLN B 2 39 ? -6.884  -10.028 -1.347  1.00 28.77  ? 536  GLN C OE1 1 
ATOM   751  N NE2 . GLN B 2 39 ? -8.241  -8.235  -1.277  1.00 34.86  ? 536  GLN C NE2 1 
ATOM   752  N N   . PHE B 2 40 ? -1.694  -9.103  0.732   1.00 31.29  ? 537  PHE C N   1 
ATOM   753  C CA  . PHE B 2 40 ? -0.635  -9.756  1.496   1.00 34.86  ? 537  PHE C CA  1 
ATOM   754  C C   . PHE B 2 40 ? 0.232   -8.750  2.247   1.00 36.44  ? 537  PHE C C   1 
ATOM   755  O O   . PHE B 2 40 ? 0.763   -9.079  3.312   1.00 33.26  ? 537  PHE C O   1 
ATOM   756  C CB  . PHE B 2 40 ? 0.231   -10.622 0.575   1.00 36.31  ? 537  PHE C CB  1 
ATOM   757  C CG  . PHE B 2 40 ? -0.361  -11.980 0.273   1.00 34.86  ? 537  PHE C CG  1 
ATOM   758  C CD1 . PHE B 2 40 ? -0.246  -13.013 1.189   1.00 29.46  ? 537  PHE C CD1 1 
ATOM   759  C CD2 . PHE B 2 40 ? -1.023  -12.223 -0.927  1.00 20.04  ? 537  PHE C CD2 1 
ATOM   760  C CE1 . PHE B 2 40 ? -0.782  -14.261 0.924   1.00 32.13  ? 537  PHE C CE1 1 
ATOM   761  C CE2 . PHE B 2 40 ? -1.562  -13.473 -1.200  1.00 25.41  ? 537  PHE C CE2 1 
ATOM   762  C CZ  . PHE B 2 40 ? -1.441  -14.492 -0.268  1.00 31.45  ? 537  PHE C CZ  1 
ATOM   763  N N   . THR B 2 41 ? 0.379   -7.533  1.720   1.00 36.71  ? 538  THR C N   1 
ATOM   764  C CA  . THR B 2 41 ? 1.089   -6.471  2.422   1.00 24.38  ? 538  THR C CA  1 
ATOM   765  C C   . THR B 2 41 ? 0.352   -6.027  3.679   1.00 37.31  ? 538  THR C C   1 
ATOM   766  O O   . THR B 2 41 ? 0.993   -5.581  4.637   1.00 43.34  ? 538  THR C O   1 
ATOM   767  C CB  . THR B 2 41 ? 1.320   -5.293  1.461   1.00 26.42  ? 538  THR C CB  1 
ATOM   768  O OG1 . THR B 2 41 ? 2.502   -5.538  0.692   1.00 45.26  ? 538  THR C OG1 1 
ATOM   769  C CG2 . THR B 2 41 ? 1.453   -3.963  2.184   1.00 49.99  ? 538  THR C CG2 1 
ATOM   770  N N   . ALA B 2 42 ? -0.974  -6.170  3.710   1.00 40.75  ? 539  ALA C N   1 
ATOM   771  C CA  . ALA B 2 42 ? -1.715  -5.898  4.935   1.00 40.31  ? 539  ALA C CA  1 
ATOM   772  C C   . ALA B 2 42 ? -1.284  -6.829  6.061   1.00 49.47  ? 539  ALA C C   1 
ATOM   773  O O   . ALA B 2 42 ? -1.294  -6.429  7.230   1.00 43.47  ? 539  ALA C O   1 
ATOM   774  C CB  . ALA B 2 42 ? -3.218  -6.023  4.682   1.00 29.04  ? 539  ALA C CB  1 
ATOM   775  N N   . LEU B 2 43 ? -0.895  -8.060  5.734   1.00 45.35  ? 540  LEU C N   1 
ATOM   776  C CA  . LEU B 2 43 ? -0.390  -8.999  6.735   1.00 39.99  ? 540  LEU C CA  1 
ATOM   777  C C   . LEU B 2 43 ? 0.838   -8.430  7.439   1.00 46.14  ? 540  LEU C C   1 
ATOM   778  O O   . LEU B 2 43 ? 0.936   -8.479  8.663   1.00 49.07  ? 540  LEU C O   1 
ATOM   779  C CB  . LEU B 2 43 ? -0.049  -10.348 6.097   1.00 33.72  ? 540  LEU C CB  1 
ATOM   780  C CG  . LEU B 2 43 ? -1.201  -11.184 5.546   1.00 41.63  ? 540  LEU C CG  1 
ATOM   781  C CD1 . LEU B 2 43 ? -0.684  -12.467 4.916   1.00 41.78  ? 540  LEU C CD1 1 
ATOM   782  C CD2 . LEU B 2 43 ? -2.173  -11.507 6.652   1.00 39.68  ? 540  LEU C CD2 1 
ATOM   783  N N   . MET C 1 1  ? 4.849   -16.464 1.122   1.00 19.25  ? 1204 MET D N   1 
ATOM   784  C CA  . MET C 1 1  ? 4.908   -17.785 0.510   1.00 46.50  ? 1204 MET D CA  1 
ATOM   785  C C   . MET C 1 1  ? 3.745   -17.957 -0.460  1.00 58.25  ? 1204 MET D C   1 
ATOM   786  O O   . MET C 1 1  ? 3.943   -18.241 -1.640  1.00 41.17  ? 1204 MET D O   1 
ATOM   787  C CB  . MET C 1 1  ? 4.874   -18.891 1.573   1.00 53.76  ? 1204 MET D CB  1 
ATOM   788  C CG  . MET C 1 1  ? 5.143   -18.417 2.995   1.00 78.97  ? 1204 MET D CG  1 
ATOM   789  S SD  . MET C 1 1  ? 5.101   -19.724 4.240   1.00 138.82 ? 1204 MET D SD  1 
ATOM   790  C CE  . MET C 1 1  ? 6.504   -20.705 3.730   1.00 68.66  ? 1204 MET D CE  1 
ATOM   791  N N   . GLY C 1 2  ? 2.524   -17.792 0.055   1.00 75.32  ? 1205 GLY D N   1 
ATOM   792  C CA  . GLY C 1 2  ? 1.351   -17.869 -0.799  1.00 34.23  ? 1205 GLY D CA  1 
ATOM   793  C C   . GLY C 1 2  ? 1.275   -16.741 -1.809  1.00 42.44  ? 1205 GLY D C   1 
ATOM   794  O O   . GLY C 1 2  ? 0.798   -16.939 -2.931  1.00 41.96  ? 1205 GLY D O   1 
ATOM   795  N N   . ALA C 1 3  ? 1.733   -15.545 -1.428  1.00 27.32  ? 1206 ALA D N   1 
ATOM   796  C CA  . ALA C 1 3  ? 1.814   -14.448 -2.385  1.00 29.78  ? 1206 ALA D CA  1 
ATOM   797  C C   . ALA C 1 3  ? 2.753   -14.796 -3.531  1.00 32.89  ? 1206 ALA D C   1 
ATOM   798  O O   . ALA C 1 3  ? 2.475   -14.473 -4.690  1.00 29.70  ? 1206 ALA D O   1 
ATOM   799  C CB  . ALA C 1 3  ? 2.274   -13.168 -1.688  1.00 26.68  ? 1206 ALA D CB  1 
ATOM   800  N N   . LEU C 1 4  ? 3.868   -15.462 -3.223  1.00 31.89  ? 1207 LEU D N   1 
ATOM   801  C CA  . LEU C 1 4  ? 4.820   -15.858 -4.258  1.00 27.62  ? 1207 LEU D CA  1 
ATOM   802  C C   . LEU C 1 4  ? 4.186   -16.833 -5.243  1.00 33.20  ? 1207 LEU D C   1 
ATOM   803  O O   . LEU C 1 4  ? 4.371   -16.715 -6.460  1.00 28.08  ? 1207 LEU D O   1 
ATOM   804  C CB  . LEU C 1 4  ? 6.065   -16.473 -3.611  1.00 30.29  ? 1207 LEU D CB  1 
ATOM   805  C CG  . LEU C 1 4  ? 7.250   -15.591 -3.189  1.00 26.52  ? 1207 LEU D CG  1 
ATOM   806  C CD1 . LEU C 1 4  ? 6.810   -14.267 -2.595  1.00 30.64  ? 1207 LEU D CD1 1 
ATOM   807  C CD2 . LEU C 1 4  ? 8.123   -16.340 -2.199  1.00 23.85  ? 1207 LEU D CD2 1 
ATOM   808  N N   . GLU C 1 5  ? 3.428   -17.806 -4.731  1.00 28.78  ? 1208 GLU D N   1 
ATOM   809  C CA  . GLU C 1 5  ? 2.752   -18.763 -5.602  1.00 29.64  ? 1208 GLU D CA  1 
ATOM   810  C C   . GLU C 1 5  ? 1.682   -18.074 -6.439  1.00 30.17  ? 1208 GLU D C   1 
ATOM   811  O O   . GLU C 1 5  ? 1.536   -18.353 -7.635  1.00 32.03  ? 1208 GLU D O   1 
ATOM   812  C CB  . GLU C 1 5  ? 2.149   -19.893 -4.762  1.00 24.22  ? 1208 GLU D CB  1 
ATOM   813  C CG  . GLU C 1 5  ? 1.565   -21.064 -5.542  1.00 61.76  ? 1208 GLU D CG  1 
ATOM   814  C CD  . GLU C 1 5  ? 0.186   -20.778 -6.107  1.00 93.54  ? 1208 GLU D CD  1 
ATOM   815  O OE1 . GLU C 1 5  ? -0.110  -21.274 -7.215  1.00 98.87  ? 1208 GLU D OE1 1 
ATOM   816  O OE2 . GLU C 1 5  ? -0.593  -20.053 -5.451  1.00 92.66  ? 1208 GLU D OE2 1 
ATOM   817  N N   . GLU C 1 6  ? 0.913   -17.174 -5.821  1.00 32.91  ? 1209 GLU D N   1 
ATOM   818  C CA  . GLU C 1 6  ? -0.106  -16.430 -6.553  1.00 29.73  ? 1209 GLU D CA  1 
ATOM   819  C C   . GLU C 1 6  ? 0.513   -15.633 -7.691  1.00 33.03  ? 1209 GLU D C   1 
ATOM   820  O O   . GLU C 1 6  ? 0.087   -15.737 -8.846  1.00 30.26  ? 1209 GLU D O   1 
ATOM   821  C CB  . GLU C 1 6  ? -0.862  -15.495 -5.608  1.00 26.19  ? 1209 GLU D CB  1 
ATOM   822  C CG  . GLU C 1 6  ? -2.064  -16.111 -4.922  1.00 29.19  ? 1209 GLU D CG  1 
ATOM   823  C CD  . GLU C 1 6  ? -2.861  -15.085 -4.133  1.00 35.22  ? 1209 GLU D CD  1 
ATOM   824  O OE1 . GLU C 1 6  ? -3.435  -15.450 -3.084  1.00 46.34  ? 1209 GLU D OE1 1 
ATOM   825  O OE2 . GLU C 1 6  ? -2.906  -13.909 -4.559  1.00 25.70  ? 1209 GLU D OE2 1 
ATOM   826  N N   . LEU C 1 7  ? 1.519   -14.814 -7.370  1.00 25.14  ? 1210 LEU D N   1 
ATOM   827  C CA  . LEU C 1 7  ? 2.152   -13.989 -8.391  1.00 32.92  ? 1210 LEU D CA  1 
ATOM   828  C C   . LEU C 1 7  ? 2.745   -14.849 -9.495  1.00 32.93  ? 1210 LEU D C   1 
ATOM   829  O O   . LEU C 1 7  ? 2.627   -14.519 -10.681 1.00 29.15  ? 1210 LEU D O   1 
ATOM   830  C CB  . LEU C 1 7  ? 3.231   -13.109 -7.763  1.00 24.21  ? 1210 LEU D CB  1 
ATOM   831  C CG  . LEU C 1 7  ? 2.765   -11.973 -6.850  1.00 31.01  ? 1210 LEU D CG  1 
ATOM   832  C CD1 . LEU C 1 7  ? 3.957   -11.156 -6.358  1.00 22.06  ? 1210 LEU D CD1 1 
ATOM   833  C CD2 . LEU C 1 7  ? 1.759   -11.090 -7.567  1.00 15.75  ? 1210 LEU D CD2 1 
ATOM   834  N N   . ARG C 1 8  ? 3.384   -15.958 -9.121  1.00 31.29  ? 1211 ARG D N   1 
ATOM   835  C CA  . ARG C 1 8  ? 3.889   -16.898 -10.112 1.00 28.15  ? 1211 ARG D CA  1 
ATOM   836  C C   . ARG C 1 8  ? 2.754   -17.461 -10.950 1.00 30.44  ? 1211 ARG D C   1 
ATOM   837  O O   . ARG C 1 8  ? 2.891   -17.622 -12.167 1.00 29.37  ? 1211 ARG D O   1 
ATOM   838  C CB  . ARG C 1 8  ? 4.646   -18.024 -9.412  1.00 38.02  ? 1211 ARG D CB  1 
ATOM   839  C CG  . ARG C 1 8  ? 5.437   -18.938 -10.319 1.00 41.09  ? 1211 ARG D CG  1 
ATOM   840  C CD  . ARG C 1 8  ? 5.877   -20.174 -9.552  1.00 56.57  ? 1211 ARG D CD  1 
ATOM   841  N NE  . ARG C 1 8  ? 5.080   -21.342 -9.914  1.00 74.51  ? 1211 ARG D NE  1 
ATOM   842  C CZ  . ARG C 1 8  ? 5.432   -22.220 -10.848 1.00 73.24  ? 1211 ARG D CZ  1 
ATOM   843  N NH1 . ARG C 1 8  ? 6.573   -22.063 -11.509 1.00 68.56  ? 1211 ARG D NH1 1 
ATOM   844  N NH2 . ARG C 1 8  ? 4.648   -23.254 -11.118 1.00 74.19  ? 1211 ARG D NH2 1 
ATOM   845  N N   . GLY C 1 9  ? 1.621   -17.761 -10.315 1.00 28.74  ? 1212 GLY D N   1 
ATOM   846  C CA  . GLY C 1 9  ? 0.496   -18.300 -11.053 1.00 17.28  ? 1212 GLY D CA  1 
ATOM   847  C C   . GLY C 1 9  ? -0.085  -17.296 -12.031 1.00 31.77  ? 1212 GLY D C   1 
ATOM   848  O O   . GLY C 1 9  ? -0.506  -17.657 -13.131 1.00 41.89  ? 1212 GLY D O   1 
ATOM   849  N N   . GLN C 1 10 ? -0.096  -16.020 -11.642 1.00 20.70  ? 1213 GLN D N   1 
ATOM   850  C CA  . GLN C 1 10 ? -0.649  -14.986 -12.508 1.00 22.41  ? 1213 GLN D CA  1 
ATOM   851  C C   . GLN C 1 10 ? 0.251   -14.733 -13.707 1.00 31.73  ? 1213 GLN D C   1 
ATOM   852  O O   . GLN C 1 10 ? -0.239  -14.510 -14.820 1.00 38.47  ? 1213 GLN D O   1 
ATOM   853  C CB  . GLN C 1 10 ? -0.857  -13.698 -11.715 1.00 25.43  ? 1213 GLN D CB  1 
ATOM   854  C CG  . GLN C 1 10 ? -1.876  -13.804 -10.597 1.00 28.21  ? 1213 GLN D CG  1 
ATOM   855  C CD  . GLN C 1 10 ? -1.705  -12.715 -9.560  1.00 26.16  ? 1213 GLN D CD  1 
ATOM   856  O OE1 . GLN C 1 10 ? -0.742  -11.949 -9.604  1.00 27.04  ? 1213 GLN D OE1 1 
ATOM   857  N NE2 . GLN C 1 10 ? -2.638  -12.641 -8.615  1.00 31.46  ? 1213 GLN D NE2 1 
ATOM   858  N N   . TYR C 1 11 ? 1.569   -14.749 -13.501 1.00 25.93  ? 1214 TYR D N   1 
ATOM   859  C CA  . TYR C 1 11 ? 2.482   -14.614 -14.629 1.00 31.12  ? 1214 TYR D CA  1 
ATOM   860  C C   . TYR C 1 11 ? 2.278   -15.746 -15.626 1.00 40.18  ? 1214 TYR D C   1 
ATOM   861  O O   . TYR C 1 11 ? 2.134   -15.512 -16.832 1.00 30.43  ? 1214 TYR D O   1 
ATOM   862  C CB  . TYR C 1 11 ? 3.931   -14.591 -14.144 1.00 28.77  ? 1214 TYR D CB  1 
ATOM   863  C CG  . TYR C 1 11 ? 4.928   -14.693 -15.280 1.00 50.58  ? 1214 TYR D CG  1 
ATOM   864  C CD1 . TYR C 1 11 ? 5.400   -15.928 -15.715 1.00 47.46  ? 1214 TYR D CD1 1 
ATOM   865  C CD2 . TYR C 1 11 ? 5.389   -13.556 -15.926 1.00 46.80  ? 1214 TYR D CD2 1 
ATOM   866  C CE1 . TYR C 1 11 ? 6.302   -16.024 -16.756 1.00 54.20  ? 1214 TYR D CE1 1 
ATOM   867  C CE2 . TYR C 1 11 ? 6.296   -13.643 -16.966 1.00 54.76  ? 1214 TYR D CE2 1 
ATOM   868  C CZ  . TYR C 1 11 ? 6.746   -14.880 -17.378 1.00 52.06  ? 1214 TYR D CZ  1 
ATOM   869  O OH  . TYR C 1 11 ? 7.648   -14.974 -18.413 1.00 67.00  ? 1214 TYR D OH  1 
ATOM   870  N N   . ILE C 1 12 ? 2.268   -16.987 -15.130 1.00 36.42  ? 1215 ILE D N   1 
ATOM   871  C CA  . ILE C 1 12 ? 2.130   -18.154 -15.998 1.00 33.81  ? 1215 ILE D CA  1 
ATOM   872  C C   . ILE C 1 12 ? 0.838   -18.074 -16.794 1.00 40.17  ? 1215 ILE D C   1 
ATOM   873  O O   . ILE C 1 12 ? 0.808   -18.367 -17.996 1.00 38.27  ? 1215 ILE D O   1 
ATOM   874  C CB  . ILE C 1 12 ? 2.199   -19.447 -15.163 1.00 34.97  ? 1215 ILE D CB  1 
ATOM   875  C CG1 . ILE C 1 12 ? 3.588   -19.620 -14.543 1.00 38.72  ? 1215 ILE D CG1 1 
ATOM   876  C CG2 . ILE C 1 12 ? 1.820   -20.660 -16.003 1.00 31.60  ? 1215 ILE D CG2 1 
ATOM   877  C CD1 . ILE C 1 12 ? 4.701   -19.766 -15.554 1.00 55.57  ? 1215 ILE D CD1 1 
ATOM   878  N N   . LYS C 1 13 ? -0.251  -17.669 -16.138 1.00 31.11  ? 1216 LYS D N   1 
ATOM   879  C CA  . LYS C 1 13 ? -1.529  -17.558 -16.831 1.00 37.62  ? 1216 LYS D CA  1 
ATOM   880  C C   . LYS C 1 13 ? -1.474  -16.496 -17.920 1.00 43.80  ? 1216 LYS D C   1 
ATOM   881  O O   . LYS C 1 13 ? -2.002  -16.700 -19.021 1.00 36.38  ? 1216 LYS D O   1 
ATOM   882  C CB  . LYS C 1 13 ? -2.647  -17.245 -15.835 1.00 24.90  ? 1216 LYS D CB  1 
ATOM   883  C CG  . LYS C 1 13 ? -3.972  -16.912 -16.504 1.00 44.02  ? 1216 LYS D CG  1 
ATOM   884  C CD  . LYS C 1 13 ? -4.853  -16.031 -15.643 1.00 45.80  ? 1216 LYS D CD  1 
ATOM   885  C CE  . LYS C 1 13 ? -5.464  -16.809 -14.502 1.00 58.04  ? 1216 LYS D CE  1 
ATOM   886  N NZ  . LYS C 1 13 ? -6.552  -16.032 -13.846 1.00 80.30  ? 1216 LYS D NZ  1 
ATOM   887  N N   . ALA C 1 14 ? -0.835  -15.359 -17.633 1.00 27.41  ? 1217 ALA D N   1 
ATOM   888  C CA  . ALA C 1 14 ? -0.729  -14.296 -18.627 1.00 33.97  ? 1217 ALA D CA  1 
ATOM   889  C C   . ALA C 1 14 ? -0.017  -14.788 -19.878 1.00 43.78  ? 1217 ALA D C   1 
ATOM   890  O O   . ALA C 1 14 ? -0.509  -14.607 -20.994 1.00 28.73  ? 1217 ALA D O   1 
ATOM   891  C CB  . ALA C 1 14 ? -0.002  -13.087 -18.037 1.00 24.78  ? 1217 ALA D CB  1 
ATOM   892  N N   . VAL C 1 15 ? 1.139   -15.435 -19.706 1.00 37.68  ? 1218 VAL D N   1 
ATOM   893  C CA  . VAL C 1 15 ? 1.930   -15.851 -20.860 1.00 34.89  ? 1218 VAL D CA  1 
ATOM   894  C C   . VAL C 1 15 ? 1.267   -17.016 -21.587 1.00 44.77  ? 1218 VAL D C   1 
ATOM   895  O O   . VAL C 1 15 ? 1.370   -17.125 -22.815 1.00 32.03  ? 1218 VAL D O   1 
ATOM   896  C CB  . VAL C 1 15 ? 3.373   -16.192 -20.435 1.00 35.88  ? 1218 VAL D CB  1 
ATOM   897  C CG1 . VAL C 1 15 ? 3.972   -15.064 -19.607 1.00 42.62  ? 1218 VAL D CG1 1 
ATOM   898  C CG2 . VAL C 1 15 ? 3.421   -17.499 -19.664 1.00 59.99  ? 1218 VAL D CG2 1 
ATOM   899  N N   . LYS C 1 16 ? 0.571   -17.896 -20.859 1.00 38.74  ? 1219 LYS D N   1 
ATOM   900  C CA  . LYS C 1 16 ? -0.105  -19.008 -21.518 1.00 40.01  ? 1219 LYS D CA  1 
ATOM   901  C C   . LYS C 1 16 ? -1.286  -18.526 -22.346 1.00 42.40  ? 1219 LYS D C   1 
ATOM   902  O O   . LYS C 1 16 ? -1.679  -19.193 -23.307 1.00 41.63  ? 1219 LYS D O   1 
ATOM   903  C CB  . LYS C 1 16 ? -0.555  -20.046 -20.487 1.00 36.23  ? 1219 LYS D CB  1 
ATOM   904  C CG  . LYS C 1 16 ? 0.473   -21.139 -20.223 1.00 47.27  ? 1219 LYS D CG  1 
ATOM   905  C CD  . LYS C 1 16 ? 0.141   -21.943 -18.970 1.00 52.63  ? 1219 LYS D CD  1 
ATOM   906  C CE  . LYS C 1 16 ? -1.161  -22.717 -19.109 1.00 63.05  ? 1219 LYS D CE  1 
ATOM   907  N NZ  . LYS C 1 16 ? -1.560  -23.354 -17.819 1.00 79.84  ? 1219 LYS D NZ  1 
ATOM   908  N N   . LYS C 1 17 ? -1.861  -17.376 -21.991 1.00 31.20  ? 1220 LYS D N   1 
ATOM   909  C CA  . LYS C 1 17 ? -2.893  -16.775 -22.827 1.00 32.86  ? 1220 LYS D CA  1 
ATOM   910  C C   . LYS C 1 17 ? -2.289  -16.105 -24.051 1.00 38.60  ? 1220 LYS D C   1 
ATOM   911  O O   . LYS C 1 17 ? -2.884  -16.129 -25.133 1.00 41.23  ? 1220 LYS D O   1 
ATOM   912  C CB  . LYS C 1 17 ? -3.706  -15.760 -22.026 1.00 27.18  ? 1220 LYS D CB  1 
ATOM   913  C CG  . LYS C 1 17 ? -4.737  -16.382 -21.113 1.00 35.64  ? 1220 LYS D CG  1 
ATOM   914  C CD  . LYS C 1 17 ? -5.538  -15.320 -20.383 1.00 41.72  ? 1220 LYS D CD  1 
ATOM   915  C CE  . LYS C 1 17 ? -6.547  -15.961 -19.447 1.00 42.06  ? 1220 LYS D CE  1 
ATOM   916  N NZ  . LYS C 1 17 ? -7.319  -14.954 -18.671 1.00 57.34  ? 1220 LYS D NZ  1 
ATOM   917  N N   . ILE C 1 18 ? -1.117  -15.489 -23.891 1.00 33.87  ? 1221 ILE D N   1 
ATOM   918  C CA  . ILE C 1 18 ? -0.436  -14.875 -25.026 1.00 33.24  ? 1221 ILE D CA  1 
ATOM   919  C C   . ILE C 1 18 ? -0.057  -15.937 -26.047 1.00 34.74  ? 1221 ILE D C   1 
ATOM   920  O O   . ILE C 1 18 ? -0.189  -15.734 -27.259 1.00 40.32  ? 1221 ILE D O   1 
ATOM   921  C CB  . ILE C 1 18 ? 0.790   -14.081 -24.536 1.00 28.39  ? 1221 ILE D CB  1 
ATOM   922  C CG1 . ILE C 1 18 ? 0.344   -12.836 -23.763 1.00 37.39  ? 1221 ILE D CG1 1 
ATOM   923  C CG2 . ILE C 1 18 ? 1.702   -13.701 -25.693 1.00 24.02  ? 1221 ILE D CG2 1 
ATOM   924  C CD1 . ILE C 1 18 ? 1.496   -12.002 -23.268 1.00 26.24  ? 1221 ILE D CD1 1 
ATOM   925  N N   . LYS C 1 19 ? 0.395   -17.097 -25.571 1.00 35.13  ? 1222 LYS D N   1 
ATOM   926  C CA  . LYS C 1 19 ? 0.736   -18.191 -26.471 1.00 33.27  ? 1222 LYS D CA  1 
ATOM   927  C C   . LYS C 1 19 ? -0.501  -18.726 -27.181 1.00 44.21  ? 1222 LYS D C   1 
ATOM   928  O O   . LYS C 1 19 ? -0.460  -19.006 -28.384 1.00 41.48  ? 1222 LYS D O   1 
ATOM   929  C CB  . LYS C 1 19 ? 1.435   -19.300 -25.688 1.00 34.87  ? 1222 LYS D CB  1 
ATOM   930  C CG  . LYS C 1 19 ? 1.678   -20.576 -26.463 1.00 38.08  ? 1222 LYS D CG  1 
ATOM   931  C CD  . LYS C 1 19 ? 2.273   -21.640 -25.549 1.00 41.11  ? 1222 LYS D CD  1 
ATOM   932  C CE  . LYS C 1 19 ? 2.503   -22.948 -26.283 1.00 64.89  ? 1222 LYS D CE  1 
ATOM   933  N NZ  . LYS C 1 19 ? 3.095   -23.980 -25.388 1.00 57.23  ? 1222 LYS D NZ  1 
ATOM   934  N N   . CYS C 1 20 ? -1.612  -18.871 -26.454 1.00 39.25  ? 1223 CYS D N   1 
ATOM   935  C CA  . CYS C 1 20 ? -2.847  -19.321 -27.089 1.00 39.15  ? 1223 CYS D CA  1 
ATOM   936  C C   . CYS C 1 20 ? -3.298  -18.343 -28.163 1.00 35.22  ? 1223 CYS D C   1 
ATOM   937  O O   . CYS C 1 20 ? -3.782  -18.755 -29.224 1.00 44.93  ? 1223 CYS D O   1 
ATOM   938  C CB  . CYS C 1 20 ? -3.945  -19.507 -26.043 1.00 23.66  ? 1223 CYS D CB  1 
ATOM   939  S SG  . CYS C 1 20 ? -3.747  -20.981 -25.019 1.00 54.28  ? 1223 CYS D SG  1 
ATOM   940  N N   . ASP C 1 21 ? -3.149  -17.042 -27.906 1.00 39.69  ? 1224 ASP D N   1 
ATOM   941  C CA  . ASP C 1 21 ? -3.535  -16.046 -28.897 1.00 36.49  ? 1224 ASP D CA  1 
ATOM   942  C C   . ASP C 1 21 ? -2.632  -16.109 -30.123 1.00 42.44  ? 1224 ASP D C   1 
ATOM   943  O O   . ASP C 1 21 ? -3.116  -16.043 -31.258 1.00 43.48  ? 1224 ASP D O   1 
ATOM   944  C CB  . ASP C 1 21 ? -3.513  -14.647 -28.278 1.00 35.78  ? 1224 ASP D CB  1 
ATOM   945  C CG  . ASP C 1 21 ? -4.738  -14.364 -27.425 1.00 50.92  ? 1224 ASP D CG  1 
ATOM   946  O OD1 . ASP C 1 21 ? -5.687  -15.177 -27.454 1.00 42.88  ? 1224 ASP D OD1 1 
ATOM   947  O OD2 . ASP C 1 21 ? -4.759  -13.321 -26.739 1.00 58.89  ? 1224 ASP D OD2 1 
ATOM   948  N N   . MET C 1 22 ? -1.320  -16.252 -29.915 1.00 33.47  ? 1225 MET D N   1 
ATOM   949  C CA  . MET C 1 22 ? -0.396  -16.320 -31.043 1.00 34.48  ? 1225 MET D CA  1 
ATOM   950  C C   . MET C 1 22 ? -0.577  -17.607 -31.836 1.00 51.23  ? 1225 MET D C   1 
ATOM   951  O O   . MET C 1 22 ? -0.470  -17.603 -33.068 1.00 45.27  ? 1225 MET D O   1 
ATOM   952  C CB  . MET C 1 22 ? 1.043   -16.200 -30.552 1.00 32.08  ? 1225 MET D CB  1 
ATOM   953  C CG  . MET C 1 22 ? 1.368   -14.853 -29.957 1.00 49.05  ? 1225 MET D CG  1 
ATOM   954  S SD  . MET C 1 22 ? 1.054   -13.484 -31.093 1.00 51.34  ? 1225 MET D SD  1 
ATOM   955  C CE  . MET C 1 22 ? 2.166   -13.879 -32.443 1.00 46.70  ? 1225 MET D CE  1 
ATOM   956  N N   . LEU C 1 23 ? -0.836  -18.719 -31.143 1.00 39.14  ? 1226 LEU D N   1 
ATOM   957  C CA  . LEU C 1 23 ? -1.094  -19.985 -31.822 1.00 46.57  ? 1226 LEU D CA  1 
ATOM   958  C C   . LEU C 1 23 ? -2.266  -19.865 -32.787 1.00 49.40  ? 1226 LEU D C   1 
ATOM   959  O O   . LEU C 1 23 ? -2.208  -20.352 -33.921 1.00 48.70  ? 1226 LEU D O   1 
ATOM   960  C CB  . LEU C 1 23 ? -1.365  -21.083 -30.792 1.00 36.20  ? 1226 LEU D CB  1 
ATOM   961  C CG  . LEU C 1 23 ? -0.149  -21.690 -30.095 1.00 44.21  ? 1226 LEU D CG  1 
ATOM   962  C CD1 . LEU C 1 23 ? -0.561  -22.693 -29.022 1.00 49.76  ? 1226 LEU D CD1 1 
ATOM   963  C CD2 . LEU C 1 23 ? 0.728   -22.346 -31.130 1.00 43.18  ? 1226 LEU D CD2 1 
ATOM   964  N N   . ARG C 1 24 ? -3.348  -19.220 -32.345 1.00 36.73  ? 1227 ARG D N   1 
ATOM   965  C CA  . ARG C 1 24 ? -4.517  -19.064 -33.203 1.00 43.66  ? 1227 ARG D CA  1 
ATOM   966  C C   . ARG C 1 24 ? -4.272  -18.024 -34.288 1.00 52.55  ? 1227 ARG D C   1 
ATOM   967  O O   . ARG C 1 24 ? -4.713  -18.195 -35.430 1.00 33.08  ? 1227 ARG D O   1 
ATOM   968  C CB  . ARG C 1 24 ? -5.736  -18.685 -32.364 1.00 32.44  ? 1227 ARG D CB  1 
ATOM   969  C CG  . ARG C 1 24 ? -6.614  -19.860 -31.959 1.00 60.71  ? 1227 ARG D CG  1 
ATOM   970  C CD  . ARG C 1 24 ? -7.304  -20.502 -33.163 1.00 89.50  ? 1227 ARG D CD  1 
ATOM   971  N NE  . ARG C 1 24 ? -6.730  -21.800 -33.515 1.00 92.18  ? 1227 ARG D NE  1 
ATOM   972  C CZ  . ARG C 1 24 ? -7.256  -22.632 -34.409 1.00 80.80  ? 1227 ARG D CZ  1 
ATOM   973  N NH1 . ARG C 1 24 ? -8.375  -22.305 -35.041 1.00 73.90  ? 1227 ARG D NH1 1 
ATOM   974  N NH2 . ARG C 1 24 ? -6.665  -23.790 -34.670 1.00 74.62  ? 1227 ARG D NH2 1 
ATOM   975  N N   . TYR C 1 25 ? -3.583  -16.933 -33.946 1.00 46.24  ? 1228 TYR D N   1 
ATOM   976  C CA  . TYR C 1 25 ? -3.242  -15.924 -34.945 1.00 44.04  ? 1228 TYR D CA  1 
ATOM   977  C C   . TYR C 1 25 ? -2.392  -16.521 -36.059 1.00 46.53  ? 1228 TYR D C   1 
ATOM   978  O O   . TYR C 1 25 ? -2.595  -16.216 -37.239 1.00 45.42  ? 1228 TYR D O   1 
ATOM   979  C CB  . TYR C 1 25 ? -2.517  -14.758 -34.270 1.00 39.50  ? 1228 TYR D CB  1 
ATOM   980  C CG  . TYR C 1 25 ? -1.793  -13.801 -35.200 1.00 43.77  ? 1228 TYR D CG  1 
ATOM   981  C CD1 . TYR C 1 25 ? -2.464  -12.747 -35.810 1.00 48.38  ? 1228 TYR D CD1 1 
ATOM   982  C CD2 . TYR C 1 25 ? -0.427  -13.932 -35.439 1.00 51.83  ? 1228 TYR D CD2 1 
ATOM   983  C CE1 . TYR C 1 25 ? -1.798  -11.862 -36.650 1.00 46.19  ? 1228 TYR D CE1 1 
ATOM   984  C CE2 . TYR C 1 25 ? 0.246   -13.052 -36.280 1.00 42.59  ? 1228 TYR D CE2 1 
ATOM   985  C CZ  . TYR C 1 25 ? -0.443  -12.018 -36.882 1.00 43.76  ? 1228 TYR D CZ  1 
ATOM   986  O OH  . TYR C 1 25 ? 0.221   -11.141 -37.717 1.00 46.71  ? 1228 TYR D OH  1 
ATOM   987  N N   . ILE C 1 26 ? -1.447  -17.390 -35.699 1.00 43.12  ? 1229 ILE D N   1 
ATOM   988  C CA  . ILE C 1 26 ? -0.550  -17.983 -36.685 1.00 46.44  ? 1229 ILE D CA  1 
ATOM   989  C C   . ILE C 1 26 ? -1.301  -18.971 -37.571 1.00 46.48  ? 1229 ILE D C   1 
ATOM   990  O O   . ILE C 1 26 ? -1.202  -18.923 -38.804 1.00 39.43  ? 1229 ILE D O   1 
ATOM   991  C CB  . ILE C 1 26 ? 0.642   -18.653 -35.978 1.00 42.91  ? 1229 ILE D CB  1 
ATOM   992  C CG1 . ILE C 1 26 ? 1.647   -17.596 -35.514 1.00 37.77  ? 1229 ILE D CG1 1 
ATOM   993  C CG2 . ILE C 1 26 ? 1.297   -19.684 -36.885 1.00 52.23  ? 1229 ILE D CG2 1 
ATOM   994  C CD1 . ILE C 1 26 ? 2.759   -18.152 -34.659 1.00 46.06  ? 1229 ILE D CD1 1 
ATOM   995  N N   . GLN C 1 27 ? -2.046  -19.894 -36.954 1.00 47.66  ? 1230 GLN D N   1 
ATOM   996  C CA  . GLN C 1 27 ? -2.837  -20.846 -37.725 1.00 45.52  ? 1230 GLN D CA  1 
ATOM   997  C C   . GLN C 1 27 ? -3.771  -20.123 -38.684 1.00 45.31  ? 1230 GLN D C   1 
ATOM   998  O O   . GLN C 1 27 ? -3.911  -20.521 -39.846 1.00 52.36  ? 1230 GLN D O   1 
ATOM   999  C CB  . GLN C 1 27 ? -3.630  -21.756 -36.784 1.00 43.01  ? 1230 GLN D CB  1 
ATOM   1000 C CG  . GLN C 1 27 ? -4.600  -22.694 -37.489 1.00 50.52  ? 1230 GLN D CG  1 
ATOM   1001 C CD  . GLN C 1 27 ? -3.897  -23.749 -38.325 1.00 57.30  ? 1230 GLN D CD  1 
ATOM   1002 O OE1 . GLN C 1 27 ? -2.766  -24.138 -38.032 1.00 55.61  ? 1230 GLN D OE1 1 
ATOM   1003 N NE2 . GLN C 1 27 ? -4.566  -24.215 -39.377 1.00 62.77  ? 1230 GLN D NE2 1 
ATOM   1004 N N   . GLU C 1 28 ? -4.401  -19.043 -38.218 1.00 47.81  ? 1231 GLU D N   1 
ATOM   1005 C CA  . GLU C 1 28 ? -5.248  -18.243 -39.095 1.00 53.82  ? 1231 GLU D CA  1 
ATOM   1006 C C   . GLU C 1 28 ? -4.435  -17.613 -40.218 1.00 52.35  ? 1231 GLU D C   1 
ATOM   1007 O O   . GLU C 1 28 ? -4.878  -17.579 -41.371 1.00 53.62  ? 1231 GLU D O   1 
ATOM   1008 C CB  . GLU C 1 28 ? -5.971  -17.168 -38.281 1.00 49.01  ? 1231 GLU D CB  1 
ATOM   1009 C CG  . GLU C 1 28 ? -6.888  -16.263 -39.094 1.00 60.01  ? 1231 GLU D CG  1 
ATOM   1010 C CD  . GLU C 1 28 ? -8.095  -17.000 -39.644 1.00 77.54  ? 1231 GLU D CD  1 
ATOM   1011 O OE1 . GLU C 1 28 ? -8.504  -18.010 -39.032 1.00 78.53  ? 1231 GLU D OE1 1 
ATOM   1012 O OE2 . GLU C 1 28 ? -8.631  -16.574 -40.691 1.00 72.30  ? 1231 GLU D OE2 1 
ATOM   1013 N N   . SER C 1 29 ? -3.233  -17.123 -39.905 1.00 51.83  ? 1232 SER D N   1 
ATOM   1014 C CA  . SER C 1 29 ? -2.434  -16.446 -40.921 1.00 47.40  ? 1232 SER D CA  1 
ATOM   1015 C C   . SER C 1 29 ? -1.988  -17.415 -42.009 1.00 48.38  ? 1232 SER D C   1 
ATOM   1016 O O   . SER C 1 29 ? -1.934  -17.048 -43.189 1.00 50.31  ? 1232 SER D O   1 
ATOM   1017 C CB  . SER C 1 29 ? -1.226  -15.766 -40.275 1.00 50.59  ? 1232 SER D CB  1 
ATOM   1018 O OG  . SER C 1 29 ? -0.674  -14.778 -41.132 1.00 66.20  ? 1232 SER D OG  1 
ATOM   1019 N N   . LYS C 1 30 ? -1.677  -18.658 -41.637 1.00 40.86  ? 1233 LYS D N   1 
ATOM   1020 C CA  . LYS C 1 30 ? -1.231  -19.629 -42.630 1.00 45.83  ? 1233 LYS D CA  1 
ATOM   1021 C C   . LYS C 1 30 ? -2.386  -20.093 -43.510 1.00 58.70  ? 1233 LYS D C   1 
ATOM   1022 O O   . LYS C 1 30 ? -2.193  -20.361 -44.702 1.00 42.84  ? 1233 LYS D O   1 
ATOM   1023 C CB  . LYS C 1 30 ? -0.559  -20.813 -41.939 1.00 38.57  ? 1233 LYS D CB  1 
ATOM   1024 C CG  . LYS C 1 30 ? 0.823   -20.499 -41.385 1.00 61.16  ? 1233 LYS D CG  1 
ATOM   1025 C CD  . LYS C 1 30 ? 1.129   -21.333 -40.152 1.00 58.07  ? 1233 LYS D CD  1 
ATOM   1026 C CE  . LYS C 1 30 ? 0.863   -22.803 -40.403 1.00 54.27  ? 1233 LYS D CE  1 
ATOM   1027 N NZ  . LYS C 1 30 ? 1.155   -23.636 -39.201 1.00 69.02  ? 1233 LYS D NZ  1 
ATOM   1028 N N   . GLU C 1 31 ? -3.592  -20.197 -42.944 1.00 44.73  ? 1234 GLU D N   1 
ATOM   1029 C CA  . GLU C 1 31 ? -4.758  -20.535 -43.755 1.00 45.23  ? 1234 GLU D CA  1 
ATOM   1030 C C   . GLU C 1 31 ? -5.060  -19.422 -44.749 1.00 51.56  ? 1234 GLU D C   1 
ATOM   1031 O O   . GLU C 1 31 ? -5.395  -19.681 -45.912 1.00 59.10  ? 1234 GLU D O   1 
ATOM   1032 C CB  . GLU C 1 31 ? -5.973  -20.803 -42.860 1.00 38.75  ? 1234 GLU D CB  1 
ATOM   1033 C CG  . GLU C 1 31 ? -5.802  -21.963 -41.883 1.00 46.76  ? 1234 GLU D CG  1 
ATOM   1034 C CD  . GLU C 1 31 ? -7.034  -22.227 -41.032 1.00 51.06  ? 1234 GLU D CD  1 
ATOM   1035 O OE1 . GLU C 1 31 ? -8.041  -21.501 -41.176 1.00 55.71  ? 1234 GLU D OE1 1 
ATOM   1036 O OE2 . GLU C 1 31 ? -7.001  -23.174 -40.214 1.00 49.43  ? 1234 GLU D OE2 1 
ATOM   1037 N N   . ARG C 1 32 ? -4.940  -18.169 -44.305 1.00 42.25  ? 1235 ARG D N   1 
ATOM   1038 C CA  . ARG C 1 32 ? -5.145  -17.043 -45.208 1.00 52.82  ? 1235 ARG D CA  1 
ATOM   1039 C C   . ARG C 1 32 ? -4.076  -17.011 -46.292 1.00 47.89  ? 1235 ARG D C   1 
ATOM   1040 O O   . ARG C 1 32 ? -4.356  -16.642 -47.438 1.00 45.52  ? 1235 ARG D O   1 
ATOM   1041 C CB  . ARG C 1 32 ? -5.169  -15.734 -44.416 1.00 48.94  ? 1235 ARG D CB  1 
ATOM   1042 C CG  . ARG C 1 32 ? -6.317  -15.663 -43.415 1.00 56.47  ? 1235 ARG D CG  1 
ATOM   1043 C CD  . ARG C 1 32 ? -6.358  -14.370 -42.603 1.00 51.70  ? 1235 ARG D CD  1 
ATOM   1044 N NE  . ARG C 1 32 ? -5.173  -13.533 -42.764 1.00 52.01  ? 1235 ARG D NE  1 
ATOM   1045 C CZ  . ARG C 1 32 ? -5.101  -12.509 -43.606 1.00 60.09  ? 1235 ARG D CZ  1 
ATOM   1046 N NH1 . ARG C 1 32 ? -6.139  -12.211 -44.373 1.00 56.36  ? 1235 ARG D NH1 1 
ATOM   1047 N NH2 . ARG C 1 32 ? -3.991  -11.795 -43.693 1.00 44.40  ? 1235 ARG D NH2 1 
ATOM   1048 N N   . ALA C 1 33 ? -2.844  -17.403 -45.953 1.00 38.44  ? 1236 ALA D N   1 
ATOM   1049 C CA  . ALA C 1 33 ? -1.800  -17.506 -46.967 1.00 40.45  ? 1236 ALA D CA  1 
ATOM   1050 C C   . ALA C 1 33 ? -2.087  -18.647 -47.933 1.00 57.45  ? 1236 ALA D C   1 
ATOM   1051 O O   . ALA C 1 33 ? -1.880  -18.511 -49.145 1.00 44.75  ? 1236 ALA D O   1 
ATOM   1052 C CB  . ALA C 1 33 ? -0.435  -17.698 -46.309 1.00 28.48  ? 1236 ALA D CB  1 
ATOM   1053 N N   . ALA C 1 34 ? -2.554  -19.783 -47.412 1.00 48.76  ? 1237 ALA D N   1 
ATOM   1054 C CA  . ALA C 1 34 ? -2.905  -20.898 -48.281 1.00 41.46  ? 1237 ALA D CA  1 
ATOM   1055 C C   . ALA C 1 34 ? -4.078  -20.539 -49.180 1.00 51.92  ? 1237 ALA D C   1 
ATOM   1056 O O   . ALA C 1 34 ? -4.099  -20.902 -50.363 1.00 50.19  ? 1237 ALA D O   1 
ATOM   1057 C CB  . ALA C 1 34 ? -3.223  -22.137 -47.448 1.00 36.89  ? 1237 ALA D CB  1 
ATOM   1058 N N   . GLU C 1 35 ? -5.063  -19.817 -48.638 1.00 48.62  ? 1238 GLU D N   1 
ATOM   1059 C CA  . GLU C 1 35 ? -6.163  -19.350 -49.473 1.00 54.07  ? 1238 GLU D CA  1 
ATOM   1060 C C   . GLU C 1 35 ? -5.662  -18.469 -50.607 1.00 58.13  ? 1238 GLU D C   1 
ATOM   1061 O O   . GLU C 1 35 ? -6.228  -18.492 -51.705 1.00 38.98  ? 1238 GLU D O   1 
ATOM   1062 C CB  . GLU C 1 35 ? -7.194  -18.599 -48.631 1.00 49.48  ? 1238 GLU D CB  1 
ATOM   1063 C CG  . GLU C 1 35 ? -8.483  -19.375 -48.398 1.00 66.60  ? 1238 GLU D CG  1 
ATOM   1064 C CD  . GLU C 1 35 ? -9.150  -19.798 -49.693 1.00 74.84  ? 1238 GLU D CD  1 
ATOM   1065 O OE1 . GLU C 1 35 ? -9.074  -19.038 -50.683 1.00 78.79  ? 1238 GLU D OE1 1 
ATOM   1066 O OE2 . GLU C 1 35 ? -9.745  -20.896 -49.725 1.00 82.63  ? 1238 GLU D OE2 1 
ATOM   1067 N N   . MET C 1 36 ? -4.597  -17.699 -50.369 1.00 59.93  ? 1239 MET D N   1 
ATOM   1068 C CA  . MET C 1 36 ? -4.028  -16.872 -51.426 1.00 57.95  ? 1239 MET D CA  1 
ATOM   1069 C C   . MET C 1 36 ? -3.327  -17.705 -52.486 1.00 56.44  ? 1239 MET D C   1 
ATOM   1070 O O   . MET C 1 36 ? -3.135  -17.226 -53.608 1.00 59.35  ? 1239 MET D O   1 
ATOM   1071 C CB  . MET C 1 36 ? -3.054  -15.851 -50.832 1.00 54.43  ? 1239 MET D CB  1 
ATOM   1072 C CG  . MET C 1 36 ? -2.947  -14.562 -51.622 1.00 53.21  ? 1239 MET D CG  1 
ATOM   1073 S SD  . MET C 1 36 ? -3.914  -13.233 -50.884 1.00 57.28  ? 1239 MET D SD  1 
ATOM   1074 C CE  . MET C 1 36 ? -5.599  -13.803 -51.113 1.00 44.94  ? 1239 MET D CE  1 
ATOM   1075 N N   . VAL C 1 37 ? -2.937  -18.935 -52.154 1.00 50.22  ? 1240 VAL D N   1 
ATOM   1076 C CA  . VAL C 1 37 ? -2.350  -19.821 -53.151 1.00 50.53  ? 1240 VAL D CA  1 
ATOM   1077 C C   . VAL C 1 37 ? -3.428  -20.350 -54.088 1.00 50.95  ? 1240 VAL D C   1 
ATOM   1078 O O   . VAL C 1 37 ? -3.262  -20.350 -55.313 1.00 43.01  ? 1240 VAL D O   1 
ATOM   1079 C CB  . VAL C 1 37 ? -1.588  -20.965 -52.463 1.00 51.55  ? 1240 VAL D CB  1 
ATOM   1080 C CG1 . VAL C 1 37 ? -0.970  -21.880 -53.502 1.00 45.07  ? 1240 VAL D CG1 1 
ATOM   1081 C CG2 . VAL C 1 37 ? -0.530  -20.401 -51.523 1.00 49.25  ? 1240 VAL D CG2 1 
ATOM   1082 N N   . LYS C 1 38 ? -4.549  -20.807 -53.525 1.00 40.48  ? 1241 LYS D N   1 
ATOM   1083 C CA  . LYS C 1 38 ? -5.663  -21.279 -54.341 1.00 38.63  ? 1241 LYS D CA  1 
ATOM   1084 C C   . LYS C 1 38 ? -6.178  -20.181 -55.260 1.00 45.75  ? 1241 LYS D C   1 
ATOM   1085 O O   . LYS C 1 38 ? -6.287  -20.369 -56.477 1.00 61.00  ? 1241 LYS D O   1 
ATOM   1086 C CB  . LYS C 1 38 ? -6.798  -21.788 -53.451 1.00 42.97  ? 1241 LYS D CB  1 
ATOM   1087 C CG  . LYS C 1 38 ? -6.632  -23.216 -52.993 1.00 59.13  ? 1241 LYS D CG  1 
ATOM   1088 C CD  . LYS C 1 38 ? -7.872  -23.723 -52.265 1.00 73.37  ? 1241 LYS D CD  1 
ATOM   1089 C CE  . LYS C 1 38 ? -9.067  -23.927 -53.199 1.00 83.78  ? 1241 LYS D CE  1 
ATOM   1090 N NZ  . LYS C 1 38 ? -10.206 -24.604 -52.496 1.00 77.45  ? 1241 LYS D NZ  1 
ATOM   1091 N N   . ALA C 1 39 ? -6.500  -19.018 -54.680 1.00 38.27  ? 1242 ALA D N   1 
ATOM   1092 C CA  . ALA C 1 39 ? -7.129  -17.939 -55.436 1.00 47.02  ? 1242 ALA D CA  1 
ATOM   1093 C C   . ALA C 1 39 ? -6.339  -17.564 -56.680 1.00 52.31  ? 1242 ALA D C   1 
ATOM   1094 O O   . ALA C 1 39 ? -6.916  -17.062 -57.652 1.00 46.66  ? 1242 ALA D O   1 
ATOM   1095 C CB  . ALA C 1 39 ? -7.303  -16.705 -54.550 1.00 33.37  ? 1242 ALA D CB  1 
ATOM   1096 N N   . GLU C 1 40 ? -5.028  -17.797 -56.674 1.00 47.04  ? 1243 GLU D N   1 
ATOM   1097 C CA  . GLU C 1 40 ? -4.178  -17.393 -57.784 1.00 49.85  ? 1243 GLU D CA  1 
ATOM   1098 C C   . GLU C 1 40 ? -3.964  -18.496 -58.811 1.00 61.49  ? 1243 GLU D C   1 
ATOM   1099 O O   . GLU C 1 40 ? -3.849  -18.201 -60.005 1.00 62.12  ? 1243 GLU D O   1 
ATOM   1100 C CB  . GLU C 1 40 ? -2.823  -16.907 -57.271 1.00 33.84  ? 1243 GLU D CB  1 
ATOM   1101 C CG  . GLU C 1 40 ? -2.121  -15.988 -58.263 1.00 81.14  ? 1243 GLU D CG  1 
ATOM   1102 C CD  . GLU C 1 40 ? -0.614  -16.056 -58.155 1.00 91.44  ? 1243 GLU D CD  1 
ATOM   1103 O OE1 . GLU C 1 40 ? -0.125  -16.524 -57.105 1.00 81.78  ? 1243 GLU D OE1 1 
ATOM   1104 O OE2 . GLU C 1 40 ? 0.079   -15.680 -59.128 1.00 104.98 ? 1243 GLU D OE2 1 
ATOM   1105 N N   . VAL C 1 41 ? -3.895  -19.760 -58.385 1.00 41.99  ? 1244 VAL D N   1 
ATOM   1106 C CA  . VAL C 1 41 ? -3.968  -20.858 -59.347 1.00 49.79  ? 1244 VAL D CA  1 
ATOM   1107 C C   . VAL C 1 41 ? -5.235  -20.724 -60.178 1.00 50.91  ? 1244 VAL D C   1 
ATOM   1108 O O   . VAL C 1 41 ? -5.253  -21.021 -61.380 1.00 62.68  ? 1244 VAL D O   1 
ATOM   1109 C CB  . VAL C 1 41 ? -3.898  -22.217 -58.624 1.00 48.14  ? 1244 VAL D CB  1 
ATOM   1110 C CG1 . VAL C 1 41 ? -4.448  -23.322 -59.507 1.00 51.03  ? 1244 VAL D CG1 1 
ATOM   1111 C CG2 . VAL C 1 41 ? -2.469  -22.528 -58.239 1.00 44.91  ? 1244 VAL D CG2 1 
ATOM   1112 N N   . LEU C 1 42 ? -6.308  -20.237 -59.551 1.00 35.39  ? 1245 LEU D N   1 
ATOM   1113 C CA  . LEU C 1 42 ? -7.545  -19.963 -60.269 1.00 46.32  ? 1245 LEU D CA  1 
ATOM   1114 C C   . LEU C 1 42 ? -7.405  -18.786 -61.225 1.00 59.09  ? 1245 LEU D C   1 
ATOM   1115 O O   . LEU C 1 42 ? -8.129  -18.716 -62.225 1.00 65.58  ? 1245 LEU D O   1 
ATOM   1116 C CB  . LEU C 1 42 ? -8.673  -19.704 -59.276 1.00 48.88  ? 1245 LEU D CB  1 
ATOM   1117 C CG  . LEU C 1 42 ? -9.550  -20.916 -58.976 1.00 47.19  ? 1245 LEU D CG  1 
ATOM   1118 C CD1 . LEU C 1 42 ? -8.713  -22.120 -58.573 1.00 56.10  ? 1245 LEU D CD1 1 
ATOM   1119 C CD2 . LEU C 1 42 ? -10.547 -20.569 -57.891 1.00 49.24  ? 1245 LEU D CD2 1 
ATOM   1120 N N   . ARG C 1 43 ? -6.494  -17.852 -60.941 1.00 51.72  ? 1246 ARG D N   1 
ATOM   1121 C CA  . ARG C 1 43 ? -6.262  -16.750 -61.867 1.00 66.62  ? 1246 ARG D CA  1 
ATOM   1122 C C   . ARG C 1 43 ? -5.459  -17.164 -63.096 1.00 69.44  ? 1246 ARG D C   1 
ATOM   1123 O O   . ARG C 1 43 ? -5.434  -16.409 -64.076 1.00 81.41  ? 1246 ARG D O   1 
ATOM   1124 C CB  . ARG C 1 43 ? -5.568  -15.585 -61.154 1.00 68.50  ? 1246 ARG D CB  1 
ATOM   1125 C CG  . ARG C 1 43 ? -6.503  -14.767 -60.264 1.00 90.37  ? 1246 ARG D CG  1 
ATOM   1126 C CD  . ARG C 1 43 ? -6.034  -13.322 -60.097 1.00 95.28  ? 1246 ARG D CD  1 
ATOM   1127 N NE  . ARG C 1 43 ? -4.649  -13.235 -59.643 1.00 98.57  ? 1246 ARG D NE  1 
ATOM   1128 C CZ  . ARG C 1 43 ? -3.621  -12.947 -60.435 1.00 90.00  ? 1246 ARG D CZ  1 
ATOM   1129 N NH1 . ARG C 1 43 ? -3.821  -12.710 -61.724 1.00 84.27  ? 1246 ARG D NH1 1 
ATOM   1130 N NH2 . ARG C 1 43 ? -2.394  -12.893 -59.937 1.00 87.95  ? 1246 ARG D NH2 1 
ATOM   1131 N N   . GLU C 1 44 ? -4.808  -18.334 -63.072 1.00 54.84  ? 1247 GLU D N   1 
ATOM   1132 C CA  . GLU C 1 44 ? -4.207  -18.882 -64.282 1.00 62.56  ? 1247 GLU D CA  1 
ATOM   1133 C C   . GLU C 1 44 ? -5.239  -19.415 -65.253 1.00 60.28  ? 1247 GLU D C   1 
ATOM   1134 O O   . GLU C 1 44 ? -4.914  -19.613 -66.427 1.00 67.10  ? 1247 GLU D O   1 
ATOM   1135 C CB  . GLU C 1 44 ? -3.262  -20.035 -63.979 1.00 49.60  ? 1247 GLU D CB  1 
ATOM   1136 C CG  . GLU C 1 44 ? -2.384  -19.870 -62.789 1.00 55.07  ? 1247 GLU D CG  1 
ATOM   1137 C CD  . GLU C 1 44 ? -1.645  -21.150 -62.522 1.00 59.77  ? 1247 GLU D CD  1 
ATOM   1138 O OE1 . GLU C 1 44 ? -1.167  -21.758 -63.503 1.00 72.17  ? 1247 GLU D OE1 1 
ATOM   1139 O OE2 . GLU C 1 44 ? -1.559  -21.559 -61.347 1.00 66.20  ? 1247 GLU D OE2 1 
ATOM   1140 N N   . ARG C 1 45 ? -6.446  -19.720 -64.776 1.00 60.11  ? 1248 ARG D N   1 
ATOM   1141 C CA  . ARG C 1 45 ? -7.526  -20.067 -65.688 1.00 56.37  ? 1248 ARG D CA  1 
ATOM   1142 C C   . ARG C 1 45 ? -7.669  -18.996 -66.756 1.00 72.02  ? 1248 ARG D C   1 
ATOM   1143 O O   . ARG C 1 45 ? -7.828  -19.297 -67.943 1.00 68.85  ? 1248 ARG D O   1 
ATOM   1144 C CB  . ARG C 1 45 ? -8.832  -20.243 -64.916 1.00 47.94  ? 1248 ARG D CB  1 
ATOM   1145 C CG  . ARG C 1 45 ? -8.981  -21.586 -64.233 1.00 66.84  ? 1248 ARG D CG  1 
ATOM   1146 C CD  . ARG C 1 45 ? -10.019 -21.486 -63.139 1.00 58.45  ? 1248 ARG D CD  1 
ATOM   1147 N NE  . ARG C 1 45 ? -10.664 -22.761 -62.855 1.00 59.35  ? 1248 ARG D NE  1 
ATOM   1148 C CZ  . ARG C 1 45 ? -11.870 -22.865 -62.309 1.00 61.74  ? 1248 ARG D CZ  1 
ATOM   1149 N NH1 . ARG C 1 45 ? -12.549 -21.769 -62.005 1.00 60.07  ? 1248 ARG D NH1 1 
ATOM   1150 N NH2 . ARG C 1 45 ? -12.399 -24.057 -62.074 1.00 61.54  ? 1248 ARG D NH2 1 
ATOM   1151 N N   . GLN C 1 46 ? -7.581  -17.729 -66.344 1.00 70.23  ? 1249 GLN D N   1 
ATOM   1152 C CA  . GLN C 1 46 ? -7.590  -16.630 -67.301 1.00 67.48  ? 1249 GLN D CA  1 
ATOM   1153 C C   . GLN C 1 46 ? -6.422  -16.734 -68.276 1.00 72.97  ? 1249 GLN D C   1 
ATOM   1154 O O   . GLN C 1 46 ? -6.572  -16.444 -69.468 1.00 85.77  ? 1249 GLN D O   1 
ATOM   1155 C CB  . GLN C 1 46 ? -7.562  -15.296 -66.553 1.00 73.20  ? 1249 GLN D CB  1 
ATOM   1156 C CG  . GLN C 1 46 ? -8.870  -14.971 -65.841 1.00 88.20  ? 1249 GLN D CG  1 
ATOM   1157 C CD  . GLN C 1 46 ? -8.699  -13.982 -64.700 1.00 85.50  ? 1249 GLN D CD  1 
ATOM   1158 O OE1 . GLN C 1 46 ? -7.606  -13.461 -64.467 1.00 76.95  ? 1249 GLN D OE1 1 
ATOM   1159 N NE2 . GLN C 1 46 ? -9.784  -13.726 -63.976 1.00 71.41  ? 1249 GLN D NE2 1 
ATOM   1160 N N   . GLU C 1 47 ? -5.254  -17.164 -67.791 1.00 64.78  ? 1250 GLU D N   1 
ATOM   1161 C CA  . GLU C 1 47 ? -4.097  -17.318 -68.669 1.00 69.90  ? 1250 GLU D CA  1 
ATOM   1162 C C   . GLU C 1 47 ? -4.260  -18.524 -69.586 1.00 70.68  ? 1250 GLU D C   1 
ATOM   1163 O O   . GLU C 1 47 ? -4.051  -18.424 -70.802 1.00 66.11  ? 1250 GLU D O   1 
ATOM   1164 C CB  . GLU C 1 47 ? -2.818  -17.443 -67.840 1.00 73.87  ? 1250 GLU D CB  1 
ATOM   1165 C CG  . GLU C 1 47 ? -1.591  -17.881 -68.634 1.00 68.87  ? 1250 GLU D CG  1 
ATOM   1166 C CD  . GLU C 1 47 ? -0.750  -16.714 -69.114 1.00 88.58  ? 1250 GLU D CD  1 
ATOM   1167 O OE1 . GLU C 1 47 ? -1.165  -15.553 -68.911 1.00 96.89  ? 1250 GLU D OE1 1 
ATOM   1168 O OE2 . GLU C 1 47 ? 0.334   -16.956 -69.687 1.00 98.00  ? 1250 GLU D OE2 1 
ATOM   1169 N N   . THR C 1 48 ? -4.631  -19.677 -69.019 1.00 59.75  ? 1251 THR D N   1 
ATOM   1170 C CA  . THR C 1 48 ? -4.833  -20.869 -69.837 1.00 72.81  ? 1251 THR D CA  1 
ATOM   1171 C C   . THR C 1 48 ? -5.970  -20.679 -70.832 1.00 75.88  ? 1251 THR D C   1 
ATOM   1172 O O   . THR C 1 48 ? -5.936  -21.251 -71.928 1.00 68.25  ? 1251 THR D O   1 
ATOM   1173 C CB  . THR C 1 48 ? -5.107  -22.087 -68.951 1.00 60.44  ? 1251 THR D CB  1 
ATOM   1174 O OG1 . THR C 1 48 ? -6.296  -21.866 -68.184 1.00 61.12  ? 1251 THR D OG1 1 
ATOM   1175 C CG2 . THR C 1 48 ? -3.935  -22.345 -68.013 1.00 43.07  ? 1251 THR D CG2 1 
ATOM   1176 N N   . ALA C 1 49 ? -6.984  -19.889 -70.470 1.00 76.13  ? 1252 ALA D N   1 
ATOM   1177 C CA  . ALA C 1 49 ? -8.034  -19.552 -71.425 1.00 67.12  ? 1252 ALA D CA  1 
ATOM   1178 C C   . ALA C 1 49 ? -7.470  -18.730 -72.575 1.00 83.55  ? 1252 ALA D C   1 
ATOM   1179 O O   . ALA C 1 49 ? -7.773  -18.985 -73.746 1.00 67.00  ? 1252 ALA D O   1 
ATOM   1180 C CB  . ALA C 1 49 ? -9.166  -18.799 -70.727 1.00 71.06  ? 1252 ALA D CB  1 
ATOM   1181 N N   . ARG C 1 50 ? -6.638  -17.735 -72.254 1.00 83.29  ? 1253 ARG D N   1 
ATOM   1182 C CA  . ARG C 1 50 ? -5.979  -16.952 -73.291 1.00 81.99  ? 1253 ARG D CA  1 
ATOM   1183 C C   . ARG C 1 50 ? -5.129  -17.831 -74.199 1.00 71.94  ? 1253 ARG D C   1 
ATOM   1184 O O   . ARG C 1 50 ? -4.977  -17.536 -75.389 1.00 82.16  ? 1253 ARG D O   1 
ATOM   1185 C CB  . ARG C 1 50 ? -5.117  -15.861 -72.652 1.00 81.12  ? 1253 ARG D CB  1 
ATOM   1186 C CG  . ARG C 1 50 ? -4.845  -14.676 -73.556 1.00 96.34  ? 1253 ARG D CG  1 
ATOM   1187 C CD  . ARG C 1 50 ? -6.116  -13.887 -73.803 1.00 106.46 ? 1253 ARG D CD  1 
ATOM   1188 N NE  . ARG C 1 50 ? -5.915  -12.830 -74.787 1.00 101.67 ? 1253 ARG D NE  1 
ATOM   1189 C CZ  . ARG C 1 50 ? -6.031  -13.004 -76.099 1.00 99.66  ? 1253 ARG D CZ  1 
ATOM   1190 N NH1 . ARG C 1 50 ? -6.348  -14.198 -76.586 1.00 79.86  ? 1253 ARG D NH1 1 
ATOM   1191 N NH2 . ARG C 1 50 ? -5.829  -11.986 -76.924 1.00 93.38  ? 1253 ARG D NH2 1 
ATOM   1192 N N   . LYS C 1 51 ? -4.576  -18.917 -73.656 1.00 72.29  ? 1254 LYS D N   1 
ATOM   1193 C CA  . LYS C 1 51 ? -3.748  -19.828 -74.436 1.00 77.71  ? 1254 LYS D CA  1 
ATOM   1194 C C   . LYS C 1 51 ? -4.587  -20.738 -75.328 1.00 69.27  ? 1254 LYS D C   1 
ATOM   1195 O O   . LYS C 1 51 ? -4.137  -21.127 -76.412 1.00 52.10  ? 1254 LYS D O   1 
ATOM   1196 C CB  . LYS C 1 51 ? -2.876  -20.653 -73.487 1.00 64.64  ? 1254 LYS D CB  1 
ATOM   1197 C CG  . LYS C 1 51 ? -1.474  -20.933 -73.994 1.00 74.75  ? 1254 LYS D CG  1 
ATOM   1198 C CD  . LYS C 1 51 ? -1.347  -22.355 -74.515 1.00 75.07  ? 1254 LYS D CD  1 
ATOM   1199 C CE  . LYS C 1 51 ? 0.010   -22.600 -75.162 1.00 79.65  ? 1254 LYS D CE  1 
ATOM   1200 N NZ  . LYS C 1 51 ? 0.174   -21.823 -76.421 1.00 73.46  ? 1254 LYS D NZ  1 
ATOM   1201 N N   . MET C 1 52 ? -5.794  -21.086 -74.892 1.00 78.18  ? 1255 MET D N   1 
ATOM   1202 C CA  . MET C 1 52 ? -6.729  -21.831 -75.727 1.00 65.77  ? 1255 MET D CA  1 
ATOM   1203 C C   . MET C 1 52 ? -7.127  -20.996 -76.941 1.00 66.60  ? 1255 MET D C   1 
ATOM   1204 O O   . MET C 1 52 ? -7.549  -21.532 -77.966 1.00 61.53  ? 1255 MET D O   1 
ATOM   1205 C CB  . MET C 1 52 ? -7.973  -22.231 -74.927 1.00 64.66  ? 1255 MET D CB  1 
ATOM   1206 C CG  . MET C 1 52 ? -7.790  -23.444 -74.024 1.00 70.15  ? 1255 MET D CG  1 
ATOM   1207 S SD  . MET C 1 52 ? -9.273  -23.811 -73.060 1.00 76.49  ? 1255 MET D SD  1 
ATOM   1208 C CE  . MET C 1 52 ? -8.854  -23.072 -71.484 1.00 79.60  ? 1255 MET D CE  1 
ATOM   1209 N N   . ALA D 2 1  ? 1.785   -17.979 -57.999 1.00 106.63 ? 498  ALA A N   1 
ATOM   1210 C CA  . ALA D 2 1  ? 1.743   -19.182 -57.183 1.00 95.63  ? 498  ALA A CA  1 
ATOM   1211 C C   . ALA D 2 1  ? 3.060   -19.349 -56.484 1.00 102.55 ? 498  ALA A C   1 
ATOM   1212 O O   . ALA D 2 1  ? 3.118   -19.231 -55.267 1.00 105.55 ? 498  ALA A O   1 
ATOM   1213 C CB  . ALA D 2 1  ? 1.455   -20.363 -57.997 1.00 40.11  ? 498  ALA A CB  1 
ATOM   1214 N N   . CYS D 2 2  ? 4.117   -19.616 -57.262 1.00 111.63 ? 499  CYS A N   1 
ATOM   1215 C CA  . CYS D 2 2  ? 5.466   -19.697 -56.711 1.00 112.68 ? 499  CYS A CA  1 
ATOM   1216 C C   . CYS D 2 2  ? 5.822   -18.461 -55.889 1.00 115.64 ? 499  CYS A C   1 
ATOM   1217 O O   . CYS D 2 2  ? 6.706   -18.527 -55.032 1.00 117.13 ? 499  CYS A O   1 
ATOM   1218 C CB  . CYS D 2 2  ? 6.477   -19.912 -57.843 1.00 64.88  ? 499  CYS A CB  1 
ATOM   1219 S SG  . CYS D 2 2  ? 6.164   -21.434 -58.848 1.00 64.88  ? 499  CYS A SG  1 
ATOM   1220 N N   . LEU D 2 3  ? 5.143   -17.336 -56.122 1.00 100.74 ? 500  LEU A N   1 
ATOM   1221 C CA  . LEU D 2 3  ? 5.177   -16.227 -55.176 1.00 100.49 ? 500  LEU A CA  1 
ATOM   1222 C C   . LEU D 2 3  ? 4.504   -16.630 -53.866 1.00 91.18  ? 500  LEU A C   1 
ATOM   1223 O O   . LEU D 2 3  ? 5.132   -16.635 -52.805 1.00 102.75 ? 500  LEU A O   1 
ATOM   1224 C CB  . LEU D 2 3  ? 4.487   -14.986 -55.773 1.00 53.25  ? 500  LEU A CB  1 
ATOM   1225 C CG  . LEU D 2 3  ? 5.134   -14.116 -56.876 1.00 53.25  ? 500  LEU A CG  1 
ATOM   1226 C CD1 . LEU D 2 3  ? 4.392   -12.773 -57.100 1.00 53.25  ? 500  LEU A CD1 1 
ATOM   1227 C CD2 . LEU D 2 3  ? 6.626   -13.844 -56.626 1.00 53.25  ? 500  LEU A CD2 1 
ATOM   1228 N N   . ASN D 2 4  ? 3.240   -17.033 -53.929 1.00 76.03  ? 501  ASN A N   1 
ATOM   1229 C CA  . ASN D 2 4  ? 2.464   -17.259 -52.716 1.00 97.47  ? 501  ASN A CA  1 
ATOM   1230 C C   . ASN D 2 4  ? 2.834   -18.554 -52.010 1.00 89.50  ? 501  ASN A C   1 
ATOM   1231 O O   . ASN D 2 4  ? 2.605   -18.669 -50.806 1.00 91.70  ? 501  ASN A O   1 
ATOM   1232 C CB  . ASN D 2 4  ? 0.965   -17.265 -53.038 1.00 51.77  ? 501  ASN A CB  1 
ATOM   1233 C CG  . ASN D 2 4  ? 0.437   -15.886 -53.451 1.00 51.77  ? 501  ASN A CG  1 
ATOM   1234 O OD1 . ASN D 2 4  ? 0.525   -14.912 -52.690 1.00 51.77  ? 501  ASN A OD1 1 
ATOM   1235 N ND2 . ASN D 2 4  ? -0.144  -15.810 -54.644 1.00 51.77  ? 501  ASN A ND2 1 
ATOM   1236 N N   . THR D 2 5  ? 3.369   -19.539 -52.730 1.00 51.43  ? 502  THR A N   1 
ATOM   1237 C CA  . THR D 2 5  ? 3.905   -20.728 -52.079 1.00 66.78  ? 502  THR A CA  1 
ATOM   1238 C C   . THR D 2 5  ? 5.206   -20.408 -51.364 1.00 57.08  ? 502  THR A C   1 
ATOM   1239 O O   . THR D 2 5  ? 5.426   -20.883 -50.248 1.00 67.49  ? 502  THR A O   1 
ATOM   1240 C CB  . THR D 2 5  ? 4.118   -21.858 -53.100 1.00 54.12  ? 502  THR A CB  1 
ATOM   1241 O OG1 . THR D 2 5  ? 5.168   -21.506 -54.014 1.00 66.43  ? 502  THR A OG1 1 
ATOM   1242 C CG2 . THR D 2 5  ? 2.843   -22.107 -53.878 1.00 50.96  ? 502  THR A CG2 1 
ATOM   1243 N N   . ARG D 2 6  ? 6.067   -19.603 -51.993 1.00 46.03  ? 503  ARG A N   1 
ATOM   1244 C CA  . ARG D 2 6  ? 7.235   -19.068 -51.306 1.00 52.35  ? 503  ARG A CA  1 
ATOM   1245 C C   . ARG D 2 6  ? 6.811   -18.316 -50.057 1.00 66.79  ? 503  ARG A C   1 
ATOM   1246 O O   . ARG D 2 6  ? 7.479   -18.391 -49.022 1.00 47.93  ? 503  ARG A O   1 
ATOM   1247 C CB  . ARG D 2 6  ? 8.034   -18.166 -52.257 1.00 52.08  ? 503  ARG A CB  1 
ATOM   1248 C CG  . ARG D 2 6  ? 9.217   -17.425 -51.630 1.00 74.90  ? 503  ARG A CG  1 
ATOM   1249 C CD  . ARG D 2 6  ? 9.141   -15.923 -51.938 1.00 84.53  ? 503  ARG A CD  1 
ATOM   1250 N NE  . ARG D 2 6  ? 8.104   -15.271 -51.140 1.00 96.61  ? 503  ARG A NE  1 
ATOM   1251 C CZ  . ARG D 2 6  ? 8.316   -14.283 -50.272 1.00 102.18 ? 503  ARG A CZ  1 
ATOM   1252 N NH1 . ARG D 2 6  ? 7.299   -13.781 -49.586 1.00 106.38 ? 503  ARG A NH1 1 
ATOM   1253 N NH2 . ARG D 2 6  ? 9.533   -13.787 -50.089 1.00 84.88  ? 503  ARG A NH2 1 
ATOM   1254 N N   . PHE D 2 7  ? 5.677   -17.617 -50.125 1.00 57.00  ? 504  PHE A N   1 
ATOM   1255 C CA  . PHE D 2 7  ? 5.204   -16.855 -48.973 1.00 53.72  ? 504  PHE A CA  1 
ATOM   1256 C C   . PHE D 2 7  ? 4.800   -17.787 -47.841 1.00 61.35  ? 504  PHE A C   1 
ATOM   1257 O O   . PHE D 2 7  ? 5.207   -17.588 -46.690 1.00 56.98  ? 504  PHE A O   1 
ATOM   1258 C CB  . PHE D 2 7  ? 4.029   -15.965 -49.387 1.00 53.91  ? 504  PHE A CB  1 
ATOM   1259 C CG  . PHE D 2 7  ? 3.657   -14.901 -48.381 1.00 52.53  ? 504  PHE A CG  1 
ATOM   1260 C CD1 . PHE D 2 7  ? 4.493   -13.817 -48.157 1.00 48.16  ? 504  PHE A CD1 1 
ATOM   1261 C CD2 . PHE D 2 7  ? 2.453   -14.968 -47.689 1.00 55.97  ? 504  PHE A CD2 1 
ATOM   1262 C CE1 . PHE D 2 7  ? 4.153   -12.820 -47.239 1.00 54.59  ? 504  PHE A CE1 1 
ATOM   1263 C CE2 . PHE D 2 7  ? 2.103   -13.977 -46.769 1.00 46.61  ? 504  PHE A CE2 1 
ATOM   1264 C CZ  . PHE D 2 7  ? 2.955   -12.903 -46.546 1.00 44.36  ? 504  PHE A CZ  1 
ATOM   1265 N N   . LEU D 2 8  ? 4.025   -18.829 -48.154 1.00 51.27  ? 505  LEU A N   1 
ATOM   1266 C CA  . LEU D 2 8  ? 3.543   -19.736 -47.120 1.00 49.40  ? 505  LEU A CA  1 
ATOM   1267 C C   . LEU D 2 8  ? 4.693   -20.498 -46.484 1.00 60.78  ? 505  LEU A C   1 
ATOM   1268 O O   . LEU D 2 8  ? 4.678   -20.749 -45.274 1.00 60.99  ? 505  LEU A O   1 
ATOM   1269 C CB  . LEU D 2 8  ? 2.514   -20.703 -47.704 1.00 36.38  ? 505  LEU A CB  1 
ATOM   1270 C CG  . LEU D 2 8  ? 1.872   -21.709 -46.732 1.00 49.12  ? 505  LEU A CG  1 
ATOM   1271 C CD1 . LEU D 2 8  ? 1.136   -20.992 -45.619 1.00 43.99  ? 505  LEU A CD1 1 
ATOM   1272 C CD2 . LEU D 2 8  ? 0.920   -22.632 -47.468 1.00 44.13  ? 505  LEU A CD2 1 
ATOM   1273 N N   . GLU D 2 9  ? 5.695   -20.874 -47.281 1.00 48.84  ? 506  GLU A N   1 
ATOM   1274 C CA  . GLU D 2 9  ? 6.876   -21.536 -46.740 1.00 52.38  ? 506  GLU A CA  1 
ATOM   1275 C C   . GLU D 2 9  ? 7.510   -20.695 -45.641 1.00 50.44  ? 506  GLU A C   1 
ATOM   1276 O O   . GLU D 2 9  ? 7.689   -21.153 -44.508 1.00 62.63  ? 506  GLU A O   1 
ATOM   1277 C CB  . GLU D 2 9  ? 7.888   -21.803 -47.857 1.00 55.19  ? 506  GLU A CB  1 
ATOM   1278 C CG  . GLU D 2 9  ? 7.504   -22.914 -48.820 1.00 66.82  ? 506  GLU A CG  1 
ATOM   1279 C CD  . GLU D 2 9  ? 8.694   -23.412 -49.622 1.00 69.74  ? 506  GLU A CD  1 
ATOM   1280 O OE1 . GLU D 2 9  ? 9.751   -22.744 -49.594 1.00 69.84  ? 506  GLU A OE1 1 
ATOM   1281 O OE2 . GLU D 2 9  ? 8.577   -24.472 -50.272 1.00 66.83  ? 506  GLU A OE2 1 
ATOM   1282 N N   . GLU D 2 10 ? 7.826   -19.438 -45.963 1.00 47.00  ? 507  GLU A N   1 
ATOM   1283 C CA  . GLU D 2 10 ? 8.559   -18.583 -45.036 1.00 56.79  ? 507  GLU A CA  1 
ATOM   1284 C C   . GLU D 2 10 ? 7.764   -18.318 -43.764 1.00 59.77  ? 507  GLU A C   1 
ATOM   1285 O O   . GLU D 2 10 ? 8.330   -18.323 -42.665 1.00 51.77  ? 507  GLU A O   1 
ATOM   1286 C CB  . GLU D 2 10 ? 8.934   -17.276 -45.734 1.00 48.36  ? 507  GLU A CB  1 
ATOM   1287 C CG  . GLU D 2 10 ? 9.921   -17.473 -46.877 1.00 58.68  ? 507  GLU A CG  1 
ATOM   1288 C CD  . GLU D 2 10 ? 9.939   -16.312 -47.854 1.00 69.49  ? 507  GLU A CD  1 
ATOM   1289 O OE1 . GLU D 2 10 ? 9.151   -15.362 -47.660 1.00 66.73  ? 507  GLU A OE1 1 
ATOM   1290 O OE2 . GLU D 2 10 ? 10.737  -16.352 -48.817 1.00 73.93  ? 507  GLU A OE2 1 
ATOM   1291 N N   . GLU D 2 11 ? 6.454   -18.087 -43.885 1.00 51.71  ? 508  GLU A N   1 
ATOM   1292 C CA  . GLU D 2 11 ? 5.638   -17.882 -42.693 1.00 52.66  ? 508  GLU A CA  1 
ATOM   1293 C C   . GLU D 2 11 ? 5.620   -19.125 -41.814 1.00 53.97  ? 508  GLU A C   1 
ATOM   1294 O O   . GLU D 2 11 ? 5.548   -19.016 -40.587 1.00 50.15  ? 508  GLU A O   1 
ATOM   1295 C CB  . GLU D 2 11 ? 4.215   -17.478 -43.085 1.00 54.88  ? 508  GLU A CB  1 
ATOM   1296 C CG  . GLU D 2 11 ? 3.325   -17.117 -41.900 1.00 71.75  ? 508  GLU A CG  1 
ATOM   1297 C CD  . GLU D 2 11 ? 2.580   -15.806 -42.099 1.00 83.38  ? 508  GLU A CD  1 
ATOM   1298 O OE1 . GLU D 2 11 ? 1.969   -15.621 -43.173 1.00 80.73  ? 508  GLU A OE1 1 
ATOM   1299 O OE2 . GLU D 2 11 ? 2.622   -14.953 -41.183 1.00 89.88  ? 508  GLU A OE2 1 
ATOM   1300 N N   . GLU D 2 12 ? 5.696   -20.312 -42.419 1.00 58.57  ? 509  GLU A N   1 
ATOM   1301 C CA  . GLU D 2 12 ? 5.827   -21.534 -41.634 1.00 50.34  ? 509  GLU A CA  1 
ATOM   1302 C C   . GLU D 2 12 ? 7.111   -21.521 -40.814 1.00 45.74  ? 509  GLU A C   1 
ATOM   1303 O O   . GLU D 2 12 ? 7.100   -21.823 -39.617 1.00 48.54  ? 509  GLU A O   1 
ATOM   1304 C CB  . GLU D 2 12 ? 5.788   -22.752 -42.556 1.00 46.58  ? 509  GLU A CB  1 
ATOM   1305 C CG  . GLU D 2 12 ? 4.414   -23.084 -43.106 1.00 53.72  ? 509  GLU A CG  1 
ATOM   1306 C CD  . GLU D 2 12 ? 3.627   -23.974 -42.176 1.00 61.09  ? 509  GLU A CD  1 
ATOM   1307 O OE1 . GLU D 2 12 ? 4.044   -24.123 -41.009 1.00 76.38  ? 509  GLU A OE1 1 
ATOM   1308 O OE2 . GLU D 2 12 ? 2.598   -24.529 -42.612 1.00 62.84  ? 509  GLU A OE2 1 
ATOM   1309 N N   . LEU D 2 13 ? 8.232   -21.170 -41.449 1.00 47.54  ? 510  LEU A N   1 
ATOM   1310 C CA  . LEU D 2 13 ? 9.507   -21.120 -40.740 1.00 42.90  ? 510  LEU A CA  1 
ATOM   1311 C C   . LEU D 2 13 ? 9.485   -20.065 -39.644 1.00 50.17  ? 510  LEU A C   1 
ATOM   1312 O O   . LEU D 2 13 ? 9.830   -20.344 -38.490 1.00 62.95  ? 510  LEU A O   1 
ATOM   1313 C CB  . LEU D 2 13 ? 10.650  -20.838 -41.717 1.00 49.94  ? 510  LEU A CB  1 
ATOM   1314 C CG  . LEU D 2 13 ? 11.267  -21.988 -42.522 1.00 55.90  ? 510  LEU A CG  1 
ATOM   1315 C CD1 . LEU D 2 13 ? 11.555  -23.195 -41.641 1.00 70.01  ? 510  LEU A CD1 1 
ATOM   1316 C CD2 . LEU D 2 13 ? 10.403  -22.379 -43.710 1.00 61.02  ? 510  LEU A CD2 1 
ATOM   1317 N N   . ARG D 2 14 ? 9.081   -18.841 -39.986 1.00 49.43  ? 511  ARG A N   1 
ATOM   1318 C CA  . ARG D 2 14 ? 9.204   -17.750 -39.027 1.00 45.56  ? 511  ARG A CA  1 
ATOM   1319 C C   . ARG D 2 14 ? 8.148   -17.835 -37.932 1.00 55.51  ? 511  ARG A C   1 
ATOM   1320 O O   . ARG D 2 14 ? 8.365   -17.320 -36.830 1.00 56.19  ? 511  ARG A O   1 
ATOM   1321 C CB  . ARG D 2 14 ? 9.137   -16.403 -39.748 1.00 45.30  ? 511  ARG A CB  1 
ATOM   1322 C CG  . ARG D 2 14 ? 7.802   -15.703 -39.649 1.00 54.52  ? 511  ARG A CG  1 
ATOM   1323 C CD  . ARG D 2 14 ? 7.825   -14.367 -40.368 1.00 58.56  ? 511  ARG A CD  1 
ATOM   1324 N NE  . ARG D 2 14 ? 6.805   -13.460 -39.856 1.00 55.78  ? 511  ARG A NE  1 
ATOM   1325 C CZ  . ARG D 2 14 ? 5.504   -13.584 -40.092 1.00 64.16  ? 511  ARG A CZ  1 
ATOM   1326 N NH1 . ARG D 2 14 ? 4.659   -12.707 -39.579 1.00 43.87  ? 511  ARG A NH1 1 
ATOM   1327 N NH2 . ARG D 2 14 ? 5.046   -14.584 -40.829 1.00 65.23  ? 511  ARG A NH2 1 
ATOM   1328 N N   . SER D 2 15 ? 7.011   -18.481 -38.198 1.00 51.57  ? 512  SER A N   1 
ATOM   1329 C CA  . SER D 2 15 ? 6.037   -18.686 -37.131 1.00 43.54  ? 512  SER A CA  1 
ATOM   1330 C C   . SER D 2 15 ? 6.489   -19.798 -36.199 1.00 53.86  ? 512  SER A C   1 
ATOM   1331 O O   . SER D 2 15 ? 6.248   -19.740 -34.989 1.00 59.79  ? 512  SER A O   1 
ATOM   1332 C CB  . SER D 2 15 ? 4.659   -19.007 -37.704 1.00 39.75  ? 512  SER A CB  1 
ATOM   1333 O OG  . SER D 2 15 ? 4.504   -20.400 -37.912 1.00 49.94  ? 512  SER A OG  1 
ATOM   1334 N N   . HIS D 2 16 ? 7.138   -20.827 -36.744 1.00 49.90  ? 513  HIS A N   1 
ATOM   1335 C CA  . HIS D 2 16 ? 7.689   -21.868 -35.888 1.00 57.08  ? 513  HIS A CA  1 
ATOM   1336 C C   . HIS D 2 16 ? 8.793   -21.309 -35.005 1.00 58.90  ? 513  HIS A C   1 
ATOM   1337 O O   . HIS D 2 16 ? 8.916   -21.686 -33.835 1.00 60.96  ? 513  HIS A O   1 
ATOM   1338 C CB  . HIS D 2 16 ? 8.214   -23.023 -36.737 1.00 61.70  ? 513  HIS A CB  1 
ATOM   1339 C CG  . HIS D 2 16 ? 8.696   -24.190 -35.935 1.00 72.66  ? 513  HIS A CG  1 
ATOM   1340 N ND1 . HIS D 2 16 ? 10.032  -24.498 -35.798 1.00 72.51  ? 513  HIS A ND1 1 
ATOM   1341 C CD2 . HIS D 2 16 ? 8.018   -25.124 -35.228 1.00 75.80  ? 513  HIS A CD2 1 
ATOM   1342 C CE1 . HIS D 2 16 ? 10.156  -25.576 -35.044 1.00 84.73  ? 513  HIS A CE1 1 
ATOM   1343 N NE2 . HIS D 2 16 ? 8.950   -25.974 -34.683 1.00 85.68  ? 513  HIS A NE2 1 
ATOM   1344 N N   . HIS D 2 17 ? 9.597   -20.395 -35.547 1.00 53.03  ? 514  HIS A N   1 
ATOM   1345 C CA  . HIS D 2 17 ? 10.651  -19.772 -34.756 1.00 59.81  ? 514  HIS A CA  1 
ATOM   1346 C C   . HIS D 2 17 ? 10.068  -18.990 -33.586 1.00 70.65  ? 514  HIS A C   1 
ATOM   1347 O O   . HIS D 2 17 ? 10.553  -19.092 -32.453 1.00 71.81  ? 514  HIS A O   1 
ATOM   1348 C CB  . HIS D 2 17 ? 11.499  -18.866 -35.649 1.00 56.23  ? 514  HIS A CB  1 
ATOM   1349 C CG  . HIS D 2 17 ? 12.220  -17.785 -34.904 1.00 78.22  ? 514  HIS A CG  1 
ATOM   1350 N ND1 . HIS D 2 17 ? 11.637  -16.575 -34.601 1.00 83.61  ? 514  HIS A ND1 1 
ATOM   1351 C CD2 . HIS D 2 17 ? 13.479  -17.734 -34.408 1.00 90.36  ? 514  HIS A CD2 1 
ATOM   1352 C CE1 . HIS D 2 17 ? 12.505  -15.822 -33.947 1.00 88.14  ? 514  HIS A CE1 1 
ATOM   1353 N NE2 . HIS D 2 17 ? 13.629  -16.502 -33.817 1.00 92.15  ? 514  HIS A NE2 1 
ATOM   1354 N N   . ILE D 2 18 ? 9.016   -18.207 -33.840 1.00 67.64  ? 515  ILE A N   1 
ATOM   1355 C CA  . ILE D 2 18 ? 8.461   -17.349 -32.795 1.00 54.74  ? 515  ILE A CA  1 
ATOM   1356 C C   . ILE D 2 18 ? 7.873   -18.192 -31.671 1.00 60.69  ? 515  ILE A C   1 
ATOM   1357 O O   . ILE D 2 18 ? 7.938   -17.816 -30.494 1.00 72.26  ? 515  ILE A O   1 
ATOM   1358 C CB  . ILE D 2 18 ? 7.425   -16.370 -33.392 1.00 48.21  ? 515  ILE A CB  1 
ATOM   1359 C CG1 . ILE D 2 18 ? 7.227   -15.164 -32.475 1.00 51.19  ? 515  ILE A CG1 1 
ATOM   1360 C CG2 . ILE D 2 18 ? 6.077   -17.032 -33.609 1.00 50.11  ? 515  ILE A CG2 1 
ATOM   1361 C CD1 . ILE D 2 18 ? 8.409   -14.233 -32.430 1.00 50.00  ? 515  ILE A CD1 1 
ATOM   1362 N N   . LEU D 2 19 ? 7.319   -19.358 -32.007 1.00 60.43  ? 516  LEU A N   1 
ATOM   1363 C CA  . LEU D 2 19 ? 6.728   -20.216 -30.988 1.00 58.82  ? 516  LEU A CA  1 
ATOM   1364 C C   . LEU D 2 19 ? 7.808   -20.916 -30.178 1.00 65.17  ? 516  LEU A C   1 
ATOM   1365 O O   . LEU D 2 19 ? 7.706   -21.026 -28.950 1.00 73.43  ? 516  LEU A O   1 
ATOM   1366 C CB  . LEU D 2 19 ? 5.791   -21.231 -31.641 1.00 54.84  ? 516  LEU A CB  1 
ATOM   1367 C CG  . LEU D 2 19 ? 4.498   -20.633 -32.190 1.00 62.32  ? 516  LEU A CG  1 
ATOM   1368 C CD1 . LEU D 2 19 ? 3.721   -21.671 -32.967 1.00 57.09  ? 516  LEU A CD1 1 
ATOM   1369 C CD2 . LEU D 2 19 ? 3.656   -20.082 -31.052 1.00 45.48  ? 516  LEU A CD2 1 
ATOM   1370 N N   . GLU D 2 20 ? 8.849   -21.400 -30.859 1.00 60.65  ? 517  GLU A N   1 
ATOM   1371 C CA  . GLU D 2 20 ? 10.028  -21.980 -30.230 1.00 67.83  ? 517  GLU A CA  1 
ATOM   1372 C C   . GLU D 2 20 ? 10.557  -21.084 -29.122 1.00 71.26  ? 517  GLU A C   1 
ATOM   1373 O O   . GLU D 2 20 ? 10.524  -21.447 -27.941 1.00 64.93  ? 517  GLU A O   1 
ATOM   1374 C CB  . GLU D 2 20 ? 11.133  -22.194 -31.266 1.00 66.13  ? 517  GLU A CB  1 
ATOM   1375 C CG  . GLU D 2 20 ? 11.184  -23.563 -31.908 1.00 67.40  ? 517  GLU A CG  1 
ATOM   1376 C CD  . GLU D 2 20 ? 12.461  -23.757 -32.706 1.00 89.61  ? 517  GLU A CD  1 
ATOM   1377 O OE1 . GLU D 2 20 ? 13.406  -22.964 -32.509 1.00 92.59  ? 517  GLU A OE1 1 
ATOM   1378 O OE2 . GLU D 2 20 ? 12.523  -24.692 -33.530 1.00 103.43 ? 517  GLU A OE2 1 
ATOM   1379 N N   . ARG D 2 21 ? 11.040  -19.903 -29.512 1.00 67.43  ? 518  ARG A N   1 
ATOM   1380 C CA  . ARG D 2 21 ? 11.671  -18.989 -28.567 1.00 76.25  ? 518  ARG A CA  1 
ATOM   1381 C C   . ARG D 2 21 ? 10.717  -18.563 -27.461 1.00 79.38  ? 518  ARG A C   1 
ATOM   1382 O O   . ARG D 2 21 ? 11.159  -18.244 -26.353 1.00 81.10  ? 518  ARG A O   1 
ATOM   1383 C CB  . ARG D 2 21 ? 12.206  -17.769 -29.314 1.00 70.67  ? 518  ARG A CB  1 
ATOM   1384 C CG  . ARG D 2 21 ? 13.376  -18.077 -30.234 1.00 76.45  ? 518  ARG A CG  1 
ATOM   1385 C CD  . ARG D 2 21 ? 14.693  -17.992 -29.481 1.00 82.66  ? 518  ARG A CD  1 
ATOM   1386 N NE  . ARG D 2 21 ? 15.053  -16.607 -29.185 1.00 93.09  ? 518  ARG A NE  1 
ATOM   1387 C CZ  . ARG D 2 21 ? 16.052  -16.245 -28.387 1.00 85.23  ? 518  ARG A CZ  1 
ATOM   1388 N NH1 . ARG D 2 21 ? 16.306  -14.959 -28.183 1.00 72.54  ? 518  ARG A NH1 1 
ATOM   1389 N NH2 . ARG D 2 21 ? 16.794  -17.167 -27.787 1.00 79.31  ? 518  ARG A NH2 1 
ATOM   1390 N N   . LEU D 2 22 ? 9.413   -18.550 -27.735 1.00 76.50  ? 519  LEU A N   1 
ATOM   1391 C CA  . LEU D 2 22 ? 8.440   -18.256 -26.691 1.00 70.32  ? 519  LEU A CA  1 
ATOM   1392 C C   . LEU D 2 22 ? 8.315   -19.418 -25.713 1.00 64.19  ? 519  LEU A C   1 
ATOM   1393 O O   . LEU D 2 22 ? 8.312   -19.213 -24.495 1.00 68.99  ? 519  LEU A O   1 
ATOM   1394 C CB  . LEU D 2 22 ? 7.085   -17.926 -27.316 1.00 65.11  ? 519  LEU A CB  1 
ATOM   1395 C CG  . LEU D 2 22 ? 5.880   -17.833 -26.377 1.00 60.19  ? 519  LEU A CG  1 
ATOM   1396 C CD1 . LEU D 2 22 ? 6.139   -16.854 -25.246 1.00 60.76  ? 519  LEU A CD1 1 
ATOM   1397 C CD2 . LEU D 2 22 ? 4.636   -17.431 -27.157 1.00 50.13  ? 519  LEU A CD2 1 
ATOM   1398 N N   . ASP D 2 23 ? 8.204   -20.647 -26.230 1.00 68.82  ? 520  ASP A N   1 
ATOM   1399 C CA  . ASP D 2 23 ? 8.224   -21.813 -25.353 1.00 73.34  ? 520  ASP A CA  1 
ATOM   1400 C C   . ASP D 2 23 ? 9.516   -21.871 -24.552 1.00 80.45  ? 520  ASP A C   1 
ATOM   1401 O O   . ASP D 2 23 ? 9.512   -22.304 -23.396 1.00 79.60  ? 520  ASP A O   1 
ATOM   1402 C CB  . ASP D 2 23 ? 8.041   -23.100 -26.161 1.00 66.78  ? 520  ASP A CB  1 
ATOM   1403 C CG  . ASP D 2 23 ? 6.587   -23.530 -26.258 1.00 63.02  ? 520  ASP A CG  1 
ATOM   1404 O OD1 . ASP D 2 23 ? 5.819   -23.259 -25.312 1.00 68.80  ? 520  ASP A OD1 1 
ATOM   1405 O OD2 . ASP D 2 23 ? 6.213   -24.145 -27.279 1.00 61.43  ? 520  ASP A OD2 1 
ATOM   1406 N N   . ALA D 2 24 ? 10.626  -21.428 -25.141 1.00 84.41  ? 521  ALA A N   1 
ATOM   1407 C CA  . ALA D 2 24 ? 11.864  -21.316 -24.381 1.00 75.90  ? 521  ALA A CA  1 
ATOM   1408 C C   . ALA D 2 24 ? 11.696  -20.349 -23.217 1.00 86.99  ? 521  ALA A C   1 
ATOM   1409 O O   . ALA D 2 24 ? 12.036  -20.671 -22.071 1.00 90.75  ? 521  ALA A O   1 
ATOM   1410 C CB  . ALA D 2 24 ? 13.002  -20.867 -25.298 1.00 74.69  ? 521  ALA A CB  1 
ATOM   1411 N N   . HIS D 2 25 ? 11.139  -19.165 -23.489 1.00 81.34  ? 522  HIS A N   1 
ATOM   1412 C CA  . HIS D 2 25 ? 11.050  -18.124 -22.473 1.00 85.44  ? 522  HIS A CA  1 
ATOM   1413 C C   . HIS D 2 25 ? 10.042  -18.452 -21.381 1.00 77.84  ? 522  HIS A C   1 
ATOM   1414 O O   . HIS D 2 25 ? 10.175  -17.938 -20.267 1.00 81.80  ? 522  HIS A O   1 
ATOM   1415 C CB  . HIS D 2 25 ? 10.702  -16.781 -23.117 1.00 75.14  ? 522  HIS A CB  1 
ATOM   1416 C CG  . HIS D 2 25 ? 11.731  -16.301 -24.097 1.00 88.80  ? 522  HIS A CG  1 
ATOM   1417 N ND1 . HIS D 2 25 ? 12.852  -17.032 -24.418 1.00 88.62  ? 522  HIS A ND1 1 
ATOM   1418 C CD2 . HIS D 2 25 ? 11.802  -15.161 -24.827 1.00 87.35  ? 522  HIS A CD2 1 
ATOM   1419 C CE1 . HIS D 2 25 ? 13.573  -16.367 -25.304 1.00 85.91  ? 522  HIS A CE1 1 
ATOM   1420 N NE2 . HIS D 2 25 ? 12.960  -15.229 -25.567 1.00 90.18  ? 522  HIS A NE2 1 
ATOM   1421 N N   . ILE D 2 26 ? 9.039   -19.286 -21.658 1.00 77.55  ? 523  ILE A N   1 
ATOM   1422 C CA  . ILE D 2 26 ? 8.176   -19.746 -20.575 1.00 80.30  ? 523  ILE A CA  1 
ATOM   1423 C C   . ILE D 2 26 ? 8.922   -20.755 -19.709 1.00 96.06  ? 523  ILE A C   1 
ATOM   1424 O O   . ILE D 2 26 ? 8.920   -20.656 -18.477 1.00 105.08 ? 523  ILE A O   1 
ATOM   1425 C CB  . ILE D 2 26 ? 6.845   -20.310 -21.115 1.00 85.67  ? 523  ILE A CB  1 
ATOM   1426 C CG1 . ILE D 2 26 ? 6.999   -21.695 -21.753 1.00 84.07  ? 523  ILE A CG1 1 
ATOM   1427 C CG2 . ILE D 2 26 ? 6.209   -19.338 -22.103 1.00 90.07  ? 523  ILE A CG2 1 
ATOM   1428 C CD1 . ILE D 2 26 ? 5.691   -22.420 -21.967 1.00 77.69  ? 523  ILE A CD1 1 
ATOM   1429 N N   . GLU D 2 27 ? 9.619   -21.705 -20.344 1.00 94.39  ? 524  GLU A N   1 
ATOM   1430 C CA  . GLU D 2 27 ? 10.459  -22.634 -19.600 1.00 92.68  ? 524  GLU A CA  1 
ATOM   1431 C C   . GLU D 2 27 ? 11.525  -21.888 -18.814 1.00 89.60  ? 524  GLU A C   1 
ATOM   1432 O O   . GLU D 2 27 ? 11.994  -22.373 -17.780 1.00 90.60  ? 524  GLU A O   1 
ATOM   1433 C CB  . GLU D 2 27 ? 11.105  -23.640 -20.557 1.00 96.68  ? 524  GLU A CB  1 
ATOM   1434 C CG  . GLU D 2 27 ? 10.487  -25.031 -20.529 1.00 98.18  ? 524  GLU A CG  1 
ATOM   1435 C CD  . GLU D 2 27 ? 9.064   -25.064 -21.056 1.00 100.58 ? 524  GLU A CD  1 
ATOM   1436 O OE1 . GLU D 2 27 ? 8.832   -24.624 -22.200 1.00 100.42 ? 524  GLU A OE1 1 
ATOM   1437 O OE2 . GLU D 2 27 ? 8.172   -25.533 -20.319 1.00 99.19  ? 524  GLU A OE2 1 
ATOM   1438 N N   . GLU D 2 28 ? 11.896  -20.692 -19.278 1.00 96.07  ? 525  GLU A N   1 
ATOM   1439 C CA  . GLU D 2 28 ? 12.941  -19.916 -18.622 1.00 97.12  ? 525  GLU A CA  1 
ATOM   1440 C C   . GLU D 2 28 ? 12.483  -19.403 -17.263 1.00 105.44 ? 525  GLU A C   1 
ATOM   1441 O O   . GLU D 2 28 ? 13.104  -19.694 -16.235 1.00 104.80 ? 525  GLU A O   1 
ATOM   1442 C CB  . GLU D 2 28 ? 13.364  -18.752 -19.515 1.00 93.26  ? 525  GLU A CB  1 
ATOM   1443 C CG  . GLU D 2 28 ? 14.271  -17.765 -18.816 1.00 98.80  ? 525  GLU A CG  1 
ATOM   1444 C CD  . GLU D 2 28 ? 15.048  -16.920 -19.794 1.00 108.22 ? 525  GLU A CD  1 
ATOM   1445 O OE1 . GLU D 2 28 ? 14.506  -16.633 -20.882 1.00 106.56 ? 525  GLU A OE1 1 
ATOM   1446 O OE2 . GLU D 2 28 ? 16.201  -16.553 -19.483 1.00 103.28 ? 525  GLU A OE2 1 
ATOM   1447 N N   . LEU D 2 29 ? 11.397  -18.627 -17.239 1.00 95.00  ? 526  LEU A N   1 
ATOM   1448 C CA  . LEU D 2 29 ? 10.974  -17.995 -15.996 1.00 99.10  ? 526  LEU A CA  1 
ATOM   1449 C C   . LEU D 2 29 ? 10.267  -18.959 -15.050 1.00 111.34 ? 526  LEU A C   1 
ATOM   1450 O O   . LEU D 2 29 ? 10.175  -18.669 -13.855 1.00 113.80 ? 526  LEU A O   1 
ATOM   1451 C CB  . LEU D 2 29 ? 10.074  -16.791 -16.293 1.00 92.93  ? 526  LEU A CB  1 
ATOM   1452 C CG  . LEU D 2 29 ? 9.825   -15.778 -15.166 1.00 86.05  ? 526  LEU A CG  1 
ATOM   1453 C CD1 . LEU D 2 29 ? 10.972  -15.717 -14.175 1.00 77.18  ? 526  LEU A CD1 1 
ATOM   1454 C CD2 . LEU D 2 29 ? 9.590   -14.395 -15.742 1.00 65.52  ? 526  LEU A CD2 1 
ATOM   1455 N N   . LYS D 2 30 ? 9.766   -20.094 -15.540 1.00 109.11 ? 527  LYS A N   1 
ATOM   1456 C CA  . LYS D 2 30 ? 9.217   -21.076 -14.610 1.00 110.96 ? 527  LYS A CA  1 
ATOM   1457 C C   . LYS D 2 30 ? 10.331  -21.812 -13.871 1.00 121.63 ? 527  LYS A C   1 
ATOM   1458 O O   . LYS D 2 30 ? 10.225  -22.051 -12.662 1.00 113.77 ? 527  LYS A O   1 
ATOM   1459 C CB  . LYS D 2 30 ? 8.285   -22.052 -15.341 1.00 96.08  ? 527  LYS A CB  1 
ATOM   1460 C CG  . LYS D 2 30 ? 8.938   -22.996 -16.341 1.00 97.41  ? 527  LYS A CG  1 
ATOM   1461 C CD  . LYS D 2 30 ? 7.906   -23.878 -17.057 1.00 103.11 ? 527  LYS A CD  1 
ATOM   1462 C CE  . LYS D 2 30 ? 7.012   -23.097 -18.021 1.00 99.65  ? 527  LYS A CE  1 
ATOM   1463 N NZ  . LYS D 2 30 ? 6.268   -23.999 -18.961 1.00 102.00 ? 527  LYS A NZ  1 
ATOM   1464 N N   . ARG D 2 31 ? 11.412  -22.163 -14.575 1.00 147.14 ? 528  ARG A N   1 
ATOM   1465 C CA  . ARG D 2 31 ? 12.612  -22.659 -13.910 1.00 146.81 ? 528  ARG A CA  1 
ATOM   1466 C C   . ARG D 2 31 ? 13.281  -21.578 -13.076 1.00 141.54 ? 528  ARG A C   1 
ATOM   1467 O O   . ARG D 2 31 ? 14.051  -21.899 -12.165 1.00 134.87 ? 528  ARG A O   1 
ATOM   1468 C CB  . ARG D 2 31 ? 13.607  -23.207 -14.936 1.00 101.67 ? 528  ARG A CB  1 
ATOM   1469 C CG  . ARG D 2 31 ? 13.610  -24.721 -15.081 1.00 98.90  ? 528  ARG A CG  1 
ATOM   1470 C CD  . ARG D 2 31 ? 12.239  -25.238 -15.468 1.00 89.21  ? 528  ARG A CD  1 
ATOM   1471 N NE  . ARG D 2 31 ? 12.314  -26.445 -16.285 1.00 86.60  ? 528  ARG A NE  1 
ATOM   1472 C CZ  . ARG D 2 31 ? 11.289  -26.935 -16.974 1.00 90.25  ? 528  ARG A CZ  1 
ATOM   1473 N NH1 . ARG D 2 31 ? 10.116  -26.317 -16.943 1.00 82.24  ? 528  ARG A NH1 1 
ATOM   1474 N NH2 . ARG D 2 31 ? 11.435  -28.036 -17.700 1.00 82.49  ? 528  ARG A NH2 1 
ATOM   1475 N N   . GLU D 2 32 ? 13.024  -20.308 -13.381 1.00 138.59 ? 529  GLU A N   1 
ATOM   1476 C CA  . GLU D 2 32 ? 13.440  -19.224 -12.505 1.00 134.27 ? 529  GLU A CA  1 
ATOM   1477 C C   . GLU D 2 32 ? 12.495  -19.026 -11.334 1.00 136.32 ? 529  GLU A C   1 
ATOM   1478 O O   . GLU D 2 32 ? 12.828  -18.280 -10.408 1.00 131.51 ? 529  GLU A O   1 
ATOM   1479 C CB  . GLU D 2 32 ? 13.535  -17.914 -13.280 1.00 89.97  ? 529  GLU A CB  1 
ATOM   1480 C CG  . GLU D 2 32 ? 14.863  -17.653 -13.933 1.00 87.99  ? 529  GLU A CG  1 
ATOM   1481 C CD  . GLU D 2 32 ? 15.096  -16.174 -14.136 1.00 85.50  ? 529  GLU A CD  1 
ATOM   1482 O OE1 . GLU D 2 32 ? 14.114  -15.450 -14.406 1.00 80.90  ? 529  GLU A OE1 1 
ATOM   1483 O OE2 . GLU D 2 32 ? 16.254  -15.730 -14.002 1.00 76.68  ? 529  GLU A OE2 1 
ATOM   1484 N N   . SER D 2 33 ? 11.334  -19.666 -11.355 1.00 119.28 ? 530  SER A N   1 
ATOM   1485 C CA  . SER D 2 33 ? 10.318  -19.436 -10.343 1.00 110.99 ? 530  SER A CA  1 
ATOM   1486 C C   . SER D 2 33 ? 10.307  -20.545 -9.300  1.00 106.37 ? 530  SER A C   1 
ATOM   1487 O O   . SER D 2 33 ? 9.713   -21.601 -9.514  1.00 104.09 ? 530  SER A O   1 
ATOM   1488 C CB  . SER D 2 33 ? 8.945   -19.313 -11.003 1.00 99.35  ? 530  SER A CB  1 
ATOM   1489 O OG  . SER D 2 33 ? 8.980   -18.397 -12.087 1.00 93.51  ? 530  SER A OG  1 
HETATM 1490 O O   . HOH E 3 .  ? 6.677   -5.157  -69.094 1.00 54.01  ? 1301 HOH B O   1 
HETATM 1491 O O   . HOH E 3 .  ? 10.631  -5.273  -10.020 1.00 54.01  ? 1302 HOH B O   1 
HETATM 1492 O O   . HOH E 3 .  ? 0.749   -3.023  -6.374  1.00 54.01  ? 1303 HOH B O   1 
HETATM 1493 O O   . HOH F 3 .  ? -5.262  -10.957 -2.285  1.00 54.01  ? 601  HOH C O   1 
HETATM 1494 O O   . HOH F 3 .  ? -1.421  -0.925  -19.238 1.00 54.01  ? 602  HOH C O   1 
HETATM 1495 O O   . HOH F 3 .  ? -3.063  -10.755 -56.693 1.00 54.01  ? 603  HOH C O   1 
HETATM 1496 O O   . HOH F 3 .  ? -8.667  -11.848 -2.542  1.00 54.01  ? 604  HOH C O   1 
HETATM 1497 O O   . HOH F 3 .  ? -8.914  -8.488  -12.268 1.00 54.01  ? 605  HOH C O   1 
HETATM 1498 O O   . HOH F 3 .  ? -4.701  -2.220  -13.768 1.00 54.01  ? 606  HOH C O   1 
HETATM 1499 O O   . HOH F 3 .  ? -3.082  -1.715  -12.493 1.00 54.01  ? 607  HOH C O   1 
HETATM 1500 O O   . HOH G 3 .  ? 0.209   -20.089 -60.724 1.00 54.01  ? 1301 HOH D O   1 
HETATM 1501 O O   . HOH G 3 .  ? 1.766   -21.457 -9.062  1.00 54.01  ? 1302 HOH D O   1 
HETATM 1502 O O   . HOH G 3 .  ? -5.214  -13.953 -1.665  1.00 54.01  ? 1303 HOH D O   1 
HETATM 1503 O O   . HOH H 3 .  ? 4.213   -25.709 -27.167 1.00 54.01  ? 601  HOH A O   1 
HETATM 1504 O O   . HOH H 3 .  ? -0.752  -13.115 -56.103 1.00 54.01  ? 602  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1204 ?    ?   ?   B . n 
A 1 2  GLY 2  1205 1205 GLY GLY B . n 
A 1 3  ALA 3  1206 1206 ALA ALA B . n 
A 1 4  LEU 4  1207 1207 LEU LEU B . n 
A 1 5  GLU 5  1208 1208 GLU GLU B . n 
A 1 6  GLU 6  1209 1209 GLU GLU B . n 
A 1 7  LEU 7  1210 1210 LEU LEU B . n 
A 1 8  ARG 8  1211 1211 ARG ARG B . n 
A 1 9  GLY 9  1212 1212 GLY GLY B . n 
A 1 10 GLN 10 1213 1213 GLN GLN B . n 
A 1 11 TYR 11 1214 1214 TYR TYR B . n 
A 1 12 ILE 12 1215 1215 ILE ILE B . n 
A 1 13 LYS 13 1216 1216 LYS LYS B . n 
A 1 14 ALA 14 1217 1217 ALA ALA B . n 
A 1 15 VAL 15 1218 1218 VAL VAL B . n 
A 1 16 LYS 16 1219 1219 LYS LYS B . n 
A 1 17 LYS 17 1220 1220 LYS LYS B . n 
A 1 18 ILE 18 1221 1221 ILE ILE B . n 
A 1 19 LYS 19 1222 1222 LYS LYS B . n 
A 1 20 CYS 20 1223 1223 CYS CYS B . n 
A 1 21 ASP 21 1224 1224 ASP ASP B . n 
A 1 22 MET 22 1225 1225 MET MET B . n 
A 1 23 LEU 23 1226 1226 LEU LEU B . n 
A 1 24 ARG 24 1227 1227 ARG ARG B . n 
A 1 25 TYR 25 1228 1228 TYR TYR B . n 
A 1 26 ILE 26 1229 1229 ILE ILE B . n 
A 1 27 GLN 27 1230 1230 GLN GLN B . n 
A 1 28 GLU 28 1231 1231 GLU GLU B . n 
A 1 29 SER 29 1232 1232 SER SER B . n 
A 1 30 LYS 30 1233 1233 LYS LYS B . n 
A 1 31 GLU 31 1234 1234 GLU GLU B . n 
A 1 32 ARG 32 1235 1235 ARG ARG B . n 
A 1 33 ALA 33 1236 1236 ALA ALA B . n 
A 1 34 ALA 34 1237 1237 ALA ALA B . n 
A 1 35 GLU 35 1238 1238 GLU GLU B . n 
A 1 36 MET 36 1239 1239 MET MET B . n 
A 1 37 VAL 37 1240 1240 VAL VAL B . n 
A 1 38 LYS 38 1241 1241 LYS LYS B . n 
A 1 39 ALA 39 1242 1242 ALA ALA B . n 
A 1 40 GLU 40 1243 1243 GLU GLU B . n 
A 1 41 VAL 41 1244 1244 VAL VAL B . n 
A 1 42 LEU 42 1245 1245 LEU LEU B . n 
A 1 43 ARG 43 1246 1246 ARG ARG B . n 
A 1 44 GLU 44 1247 1247 GLU GLU B . n 
A 1 45 ARG 45 1248 1248 ARG ARG B . n 
A 1 46 GLN 46 1249 1249 GLN GLN B . n 
A 1 47 GLU 47 1250 1250 GLU GLU B . n 
A 1 48 THR 48 1251 1251 THR THR B . n 
A 1 49 ALA 49 1252 1252 ALA ALA B . n 
A 1 50 ARG 50 1253 1253 ARG ARG B . n 
A 1 51 LYS 51 1254 1254 LYS LYS B . n 
A 1 52 MET 52 1255 1255 MET MET B . n 
A 1 53 ARG 53 1256 ?    ?   ?   B . n 
A 1 54 LYS 54 1257 ?    ?   ?   B . n 
B 2 1  ALA 1  498  498  ALA ALA C . n 
B 2 2  CYS 2  499  499  CYS CYS C . n 
B 2 3  LEU 3  500  500  LEU LEU C . n 
B 2 4  ASN 4  501  501  ASN ASN C . n 
B 2 5  THR 5  502  502  THR THR C . n 
B 2 6  ARG 6  503  503  ARG ARG C . n 
B 2 7  PHE 7  504  504  PHE PHE C . n 
B 2 8  LEU 8  505  505  LEU LEU C . n 
B 2 9  GLU 9  506  506  GLU GLU C . n 
B 2 10 GLU 10 507  507  GLU GLU C . n 
B 2 11 GLU 11 508  508  GLU GLU C . n 
B 2 12 GLU 12 509  509  GLU GLU C . n 
B 2 13 LEU 13 510  510  LEU LEU C . n 
B 2 14 ARG 14 511  511  ARG ARG C . n 
B 2 15 SER 15 512  512  SER SER C . n 
B 2 16 HIS 16 513  513  HIS HIS C . n 
B 2 17 HIS 17 514  514  HIS HIS C . n 
B 2 18 ILE 18 515  515  ILE ILE C . n 
B 2 19 LEU 19 516  516  LEU LEU C . n 
B 2 20 GLU 20 517  517  GLU GLU C . n 
B 2 21 ARG 21 518  518  ARG ARG C . n 
B 2 22 LEU 22 519  519  LEU LEU C . n 
B 2 23 ASP 23 520  520  ASP ASP C . n 
B 2 24 ALA 24 521  521  ALA ALA C . n 
B 2 25 HIS 25 522  522  HIS HIS C . n 
B 2 26 ILE 26 523  523  ILE ILE C . n 
B 2 27 GLU 27 524  524  GLU GLU C . n 
B 2 28 GLU 28 525  525  GLU GLU C . n 
B 2 29 LEU 29 526  526  LEU LEU C . n 
B 2 30 LYS 30 527  527  LYS LYS C . n 
B 2 31 ARG 31 528  528  ARG ARG C . n 
B 2 32 GLU 32 529  529  GLU GLU C . n 
B 2 33 SER 33 530  530  SER SER C . n 
B 2 34 GLU 34 531  531  GLU GLU C . n 
B 2 35 LYS 35 532  532  LYS LYS C . n 
B 2 36 THR 36 533  533  THR THR C . n 
B 2 37 VAL 37 534  534  VAL VAL C . n 
B 2 38 ARG 38 535  535  ARG ARG C . n 
B 2 39 GLN 39 536  536  GLN GLN C . n 
B 2 40 PHE 40 537  537  PHE PHE C . n 
B 2 41 THR 41 538  538  THR THR C . n 
B 2 42 ALA 42 539  539  ALA ALA C . n 
B 2 43 LEU 43 540  540  LEU LEU C . n 
B 2 44 LYS 44 541  ?    ?   ?   C . n 
C 1 1  MET 1  1204 1204 MET MET D . n 
C 1 2  GLY 2  1205 1205 GLY GLY D . n 
C 1 3  ALA 3  1206 1206 ALA ALA D . n 
C 1 4  LEU 4  1207 1207 LEU LEU D . n 
C 1 5  GLU 5  1208 1208 GLU GLU D . n 
C 1 6  GLU 6  1209 1209 GLU GLU D . n 
C 1 7  LEU 7  1210 1210 LEU LEU D . n 
C 1 8  ARG 8  1211 1211 ARG ARG D . n 
C 1 9  GLY 9  1212 1212 GLY GLY D . n 
C 1 10 GLN 10 1213 1213 GLN GLN D . n 
C 1 11 TYR 11 1214 1214 TYR TYR D . n 
C 1 12 ILE 12 1215 1215 ILE ILE D . n 
C 1 13 LYS 13 1216 1216 LYS LYS D . n 
C 1 14 ALA 14 1217 1217 ALA ALA D . n 
C 1 15 VAL 15 1218 1218 VAL VAL D . n 
C 1 16 LYS 16 1219 1219 LYS LYS D . n 
C 1 17 LYS 17 1220 1220 LYS LYS D . n 
C 1 18 ILE 18 1221 1221 ILE ILE D . n 
C 1 19 LYS 19 1222 1222 LYS LYS D . n 
C 1 20 CYS 20 1223 1223 CYS CYS D . n 
C 1 21 ASP 21 1224 1224 ASP ASP D . n 
C 1 22 MET 22 1225 1225 MET MET D . n 
C 1 23 LEU 23 1226 1226 LEU LEU D . n 
C 1 24 ARG 24 1227 1227 ARG ARG D . n 
C 1 25 TYR 25 1228 1228 TYR TYR D . n 
C 1 26 ILE 26 1229 1229 ILE ILE D . n 
C 1 27 GLN 27 1230 1230 GLN GLN D . n 
C 1 28 GLU 28 1231 1231 GLU GLU D . n 
C 1 29 SER 29 1232 1232 SER SER D . n 
C 1 30 LYS 30 1233 1233 LYS LYS D . n 
C 1 31 GLU 31 1234 1234 GLU GLU D . n 
C 1 32 ARG 32 1235 1235 ARG ARG D . n 
C 1 33 ALA 33 1236 1236 ALA ALA D . n 
C 1 34 ALA 34 1237 1237 ALA ALA D . n 
C 1 35 GLU 35 1238 1238 GLU GLU D . n 
C 1 36 MET 36 1239 1239 MET MET D . n 
C 1 37 VAL 37 1240 1240 VAL VAL D . n 
C 1 38 LYS 38 1241 1241 LYS LYS D . n 
C 1 39 ALA 39 1242 1242 ALA ALA D . n 
C 1 40 GLU 40 1243 1243 GLU GLU D . n 
C 1 41 VAL 41 1244 1244 VAL VAL D . n 
C 1 42 LEU 42 1245 1245 LEU LEU D . n 
C 1 43 ARG 43 1246 1246 ARG ARG D . n 
C 1 44 GLU 44 1247 1247 GLU GLU D . n 
C 1 45 ARG 45 1248 1248 ARG ARG D . n 
C 1 46 GLN 46 1249 1249 GLN GLN D . n 
C 1 47 GLU 47 1250 1250 GLU GLU D . n 
C 1 48 THR 48 1251 1251 THR THR D . n 
C 1 49 ALA 49 1252 1252 ALA ALA D . n 
C 1 50 ARG 50 1253 1253 ARG ARG D . n 
C 1 51 LYS 51 1254 1254 LYS LYS D . n 
C 1 52 MET 52 1255 1255 MET MET D . n 
C 1 53 ARG 53 1256 ?    ?   ?   D . n 
C 1 54 LYS 54 1257 ?    ?   ?   D . n 
D 2 1  ALA 1  498  498  ALA ALA A . n 
D 2 2  CYS 2  499  499  CYS CYS A . n 
D 2 3  LEU 3  500  500  LEU LEU A . n 
D 2 4  ASN 4  501  501  ASN ASN A . n 
D 2 5  THR 5  502  502  THR THR A . n 
D 2 6  ARG 6  503  503  ARG ARG A . n 
D 2 7  PHE 7  504  504  PHE PHE A . n 
D 2 8  LEU 8  505  505  LEU LEU A . n 
D 2 9  GLU 9  506  506  GLU GLU A . n 
D 2 10 GLU 10 507  507  GLU GLU A . n 
D 2 11 GLU 11 508  508  GLU GLU A . n 
D 2 12 GLU 12 509  509  GLU GLU A . n 
D 2 13 LEU 13 510  510  LEU LEU A . n 
D 2 14 ARG 14 511  511  ARG ARG A . n 
D 2 15 SER 15 512  512  SER SER A . n 
D 2 16 HIS 16 513  513  HIS HIS A . n 
D 2 17 HIS 17 514  514  HIS HIS A . n 
D 2 18 ILE 18 515  515  ILE ILE A . n 
D 2 19 LEU 19 516  516  LEU LEU A . n 
D 2 20 GLU 20 517  517  GLU GLU A . n 
D 2 21 ARG 21 518  518  ARG ARG A . n 
D 2 22 LEU 22 519  519  LEU LEU A . n 
D 2 23 ASP 23 520  520  ASP ASP A . n 
D 2 24 ALA 24 521  521  ALA ALA A . n 
D 2 25 HIS 25 522  522  HIS HIS A . n 
D 2 26 ILE 26 523  523  ILE ILE A . n 
D 2 27 GLU 27 524  524  GLU GLU A . n 
D 2 28 GLU 28 525  525  GLU GLU A . n 
D 2 29 LEU 29 526  526  LEU LEU A . n 
D 2 30 LYS 30 527  527  LYS LYS A . n 
D 2 31 ARG 31 528  528  ARG ARG A . n 
D 2 32 GLU 32 529  529  GLU GLU A . n 
D 2 33 SER 33 530  530  SER SER A . n 
D 2 34 GLU 34 531  ?    ?   ?   A . n 
D 2 35 LYS 35 532  ?    ?   ?   A . n 
D 2 36 THR 36 533  ?    ?   ?   A . n 
D 2 37 VAL 37 534  ?    ?   ?   A . n 
D 2 38 ARG 38 535  ?    ?   ?   A . n 
D 2 39 GLN 39 536  ?    ?   ?   A . n 
D 2 40 PHE 40 537  ?    ?   ?   A . n 
D 2 41 THR 41 538  ?    ?   ?   A . n 
D 2 42 ALA 42 539  ?    ?   ?   A . n 
D 2 43 LEU 43 540  ?    ?   ?   A . n 
D 2 44 LYS 44 541  ?    ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1 1301 14 HOH HOH B . 
E 3 HOH 2 1302 3  HOH HOH B . 
E 3 HOH 3 1303 1  HOH HOH B . 
F 3 HOH 1 601  12 HOH HOH C . 
F 3 HOH 2 602  9  HOH HOH C . 
F 3 HOH 3 603  7  HOH HOH C . 
F 3 HOH 4 604  5  HOH HOH C . 
F 3 HOH 5 605  11 HOH HOH C . 
F 3 HOH 6 606  15 HOH HOH C . 
F 3 HOH 7 607  13 HOH HOH C . 
G 3 HOH 1 1301 10 HOH HOH D . 
G 3 HOH 2 1302 2  HOH HOH D . 
G 3 HOH 3 1303 6  HOH HOH D . 
H 3 HOH 1 601  4  HOH HOH A . 
H 3 HOH 2 602  8  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7250  ? 
1 MORE         -54   ? 
1 'SSA (A^2)'  11330 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2019-03-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(1.10_2155: ???)' 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                  2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                  3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                  4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? .                  5 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot     ? ? ? .                  6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 C GLN 536  ? ? O   C HOH 601 ? ? 2.09 
2 1 OG  B SER 1232 ? ? NH1 A ARG 511 ? ? 2.10 
3 1 OE2 B GLU 1243 ? ? N   C ALA 498 ? ? 2.10 
4 1 O   C HOH 606  ? ? O   C HOH 607 ? ? 2.12 
5 1 O   A LEU 526  ? ? OG  A SER 530 ? ? 2.15 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B MET 1204 ? A MET 1  
2  1 Y 1 B ARG 1256 ? A ARG 53 
3  1 Y 1 B LYS 1257 ? A LYS 54 
4  1 Y 1 C LYS 541  ? B LYS 44 
5  1 Y 1 D ARG 1256 ? C ARG 53 
6  1 Y 1 D LYS 1257 ? C LYS 54 
7  1 Y 1 A GLU 531  ? D GLU 34 
8  1 Y 1 A LYS 532  ? D LYS 35 
9  1 Y 1 A THR 533  ? D THR 36 
10 1 Y 1 A VAL 534  ? D VAL 37 
11 1 Y 1 A ARG 535  ? D ARG 38 
12 1 Y 1 A GLN 536  ? D GLN 39 
13 1 Y 1 A PHE 537  ? D PHE 40 
14 1 Y 1 A THR 538  ? D THR 41 
15 1 Y 1 A ALA 539  ? D ALA 42 
16 1 Y 1 A LEU 540  ? D LEU 43 
17 1 Y 1 A LYS 541  ? D LYS 44 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'light scattering' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#