data_6CUS
# 
_entry.id   6CUS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.334 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CUS         
WWPDB D_1000233411 
BMRB  30404        
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB  . 6CE5  unspecified 
BMRB . 30404 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        6CUS 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-26 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Vlach, J.'  1 0000-0002-0874-2055 
'Saad, J.S.' 2 0000-0001-9503-6484 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            293 
_citation.language                  ? 
_citation.page_first                18828 
_citation.page_last                 18840 
_citation.title                     
'Structural basis for targeting avian sarcoma virus Gag polyprotein to the plasma membrane for virus assembly.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA118.003944 
_citation.pdbx_database_id_PubMed   30309983 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Vlach, J.'      1 ?                   
primary 'Eastep, G.N.'   2 ?                   
primary 'Ghanam, R.H.'   3 ?                   
primary 'Watanabe, S.M.' 4 ?                   
primary 'Carter, C.A.'   5 ?                   
primary 'Saad, J.S.'     6 0000-0001-9503-6484 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Matrix protein p19'        9209.771 1 ? M1S ? ? 
2 non-polymer syn 'INOSITOL HEXAKISPHOSPHATE' 660.035  1 ? ?   ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGA
LKAAREE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGA
LKAAREE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  GLU n 
1 3  ALA n 
1 4  VAL n 
1 5  ILE n 
1 6  LYS n 
1 7  VAL n 
1 8  ILE n 
1 9  SER n 
1 10 SER n 
1 11 ALA n 
1 12 CYS n 
1 13 LYS n 
1 14 THR n 
1 15 TYR n 
1 16 CYS n 
1 17 GLY n 
1 18 LYS n 
1 19 THR n 
1 20 SER n 
1 21 PRO n 
1 22 SER n 
1 23 LYS n 
1 24 LYS n 
1 25 GLU n 
1 26 ILE n 
1 27 GLY n 
1 28 ALA n 
1 29 MET n 
1 30 LEU n 
1 31 SER n 
1 32 LEU n 
1 33 LEU n 
1 34 GLN n 
1 35 LYS n 
1 36 GLU n 
1 37 GLY n 
1 38 LEU n 
1 39 LEU n 
1 40 MET n 
1 41 SER n 
1 42 PRO n 
1 43 SER n 
1 44 ASP n 
1 45 LEU n 
1 46 TYR n 
1 47 SER n 
1 48 PRO n 
1 49 GLY n 
1 50 SER n 
1 51 TRP n 
1 52 ASP n 
1 53 PRO n 
1 54 ILE n 
1 55 THR n 
1 56 ALA n 
1 57 ALA n 
1 58 LEU n 
1 59 SER n 
1 60 GLN n 
1 61 ARG n 
1 62 ALA n 
1 63 MET n 
1 64 ILE n 
1 65 LEU n 
1 66 GLY n 
1 67 LYS n 
1 68 SER n 
1 69 GLY n 
1 70 GLU n 
1 71 LEU n 
1 72 LYS n 
1 73 THR n 
1 74 TRP n 
1 75 GLY n 
1 76 LEU n 
1 77 VAL n 
1 78 LEU n 
1 79 GLY n 
1 80 ALA n 
1 81 LEU n 
1 82 LYS n 
1 83 ALA n 
1 84 ALA n 
1 85 ARG n 
1 86 GLU n 
1 87 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   87 
_entity_src_gen.gene_src_common_name               RSV-PrC 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 gag-pol 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'Prague C' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rous sarcoma virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11888 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    POL_RSVP 
_struct_ref.pdbx_db_accession          P03354 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGA
LKAAREE
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6CUS 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 87 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P03354 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  87 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       87 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             6CUS 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P03354 
_struct_ref_seq_dif.db_mon_id                    MET 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          1 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ?                                                                      
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                    ?                                                                      
'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ?                                                                      
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                    ?                                                                      
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ?                                                                      
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ?                                                                      
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                     ?                                                                      
'C2 H5 N O2'     75.067  
IHP non-polymer         . 'INOSITOL HEXAKISPHOSPHATE' 'MYO-INOSITOL HEXAKISPHOSPHATE; INOSITOL 1,2,3,4,5,6-HEXAKISPHOSPHATE' 
'C6 H18 O24 P6'  660.035 
ILE 'L-peptide linking' y ISOLEUCINE                  ?                                                                      
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                     ?                                                                      
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                      ?                                                                      
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                  ?                                                                      
'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE                     ?                                                                      
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                      ?                                                                      
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                   ?                                                                      
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ?                                                                      
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                    ?                                                                      
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                      ?                                                                      
'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1 1 1 '2D 1H-15N HSQC'                   1 isotropic 
2 1 2 '3D 13C-filtered/13C-edited NOESY' 1 isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            305 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     6 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         100 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  cond1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
_pdbx_nmr_sample_details.label 
_pdbx_nmr_sample_details.type 
_pdbx_nmr_sample_details.details 
1 '500 uM [U-98% 15N] Matrix protein, 50 mM sodium phosphate, 2 mM TCEP, 2 mM INOSITOL HEXAKISPHOSPHATE, 95% H2O/5% D2O' 
'95% H2O/5% D2O' s1 solution ? 
2 '0.5 mM [U-98% 13C] Matrix protein, 50 mM sodium phosphate, 2 mM TCEP, 2 mM INOSITOL HEXAKISPHOSPHATE, 100% D2O'       
'100% D2O'       s2 solution ? 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             'AVANCE II' 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    700 
_pdbx_nmr_spectrometer.details           ? 
# 
_pdbx_nmr_refine.entry_id           6CUS 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   4 
# 
_pdbx_nmr_ensemble.entry_id                                      6CUS 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             6CUS 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   medoid 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 processing              NMRPipe  ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
2 'data analysis'         Analysis ? CCPN                                                
3 'structure calculation' HADDOCK  ? Bonvin                                              
4 refinement              CNS      ? 'Brunger, Adams, Clore, Gros, Nilges and Read'      
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CUS 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6CUS 
_struct.title                        
'HADDOCK structure of the Rous sarcoma virus matrix protein (M-domain) in complex with myo-inositol hexakisphosphate' 
_struct.pdbx_descriptor              'Gag-Pol polyprotein (E.C.2.7.7.-,3.1.-.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CUS 
_struct_keywords.text            'RSV, ASV, Gag, IP6, VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLU A 2  ? CYS A 16 ? GLU A 2  CYS A 16 1 ? 15 
HELX_P HELX_P2 AA2 GLY A 17 ? SER A 20 ? GLY A 17 SER A 20 5 ? 4  
HELX_P HELX_P3 AA3 SER A 22 ? GLU A 36 ? SER A 22 GLU A 36 1 ? 15 
HELX_P HELX_P4 AA4 SER A 41 ? GLY A 49 ? SER A 41 GLY A 49 5 ? 9  
HELX_P HELX_P5 AA5 SER A 50 ? GLY A 66 ? SER A 50 GLY A 66 1 ? 17 
HELX_P HELX_P6 AA6 SER A 68 ? ARG A 85 ? SER A 68 ARG A 85 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    IHP 
_struct_site.pdbx_auth_seq_id     101 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'binding site for residue IHP A 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 LYS A 6  ? LYS A 6  . ? 1_555 ? 
2 AC1 5 LYS A 13 ? LYS A 13 . ? 1_555 ? 
3 AC1 5 SER A 22 ? SER A 22 . ? 1_555 ? 
4 AC1 5 LYS A 23 ? LYS A 23 . ? 1_555 ? 
5 AC1 5 LYS A 24 ? LYS A 24 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6CUS 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . SER A 1 1  ? 2.610   6.601   10.031  1.00 1.45 ? 1   SER A N    1  
ATOM   2     C CA   . SER A 1 1  ? 3.691   5.717   10.517  1.00 0.98 ? 1   SER A CA   1  
ATOM   3     C C    . SER A 1 1  ? 5.045   6.252   10.070  1.00 0.92 ? 1   SER A C    1  
ATOM   4     O O    . SER A 1 1  ? 5.124   7.327   9.472   1.00 1.21 ? 1   SER A O    1  
ATOM   5     C CB   . SER A 1 1  ? 3.479   4.302   9.985   1.00 1.66 ? 1   SER A CB   1  
ATOM   6     O OG   . SER A 1 1  ? 2.632   4.319   8.854   1.00 2.07 ? 1   SER A OG   1  
ATOM   7     H H1   . SER A 1 1  ? 2.831   7.590   10.260  1.00 1.90 ? 1   SER A H1   1  
ATOM   8     H H2   . SER A 1 1  ? 1.709   6.348   10.477  1.00 1.69 ? 1   SER A H2   1  
ATOM   9     H H3   . SER A 1 1  ? 2.510   6.508   9.000   1.00 1.94 ? 1   SER A H3   1  
ATOM   10    H HA   . SER A 1 1  ? 3.660   5.702   11.596  1.00 1.33 ? 1   SER A HA   1  
ATOM   11    H HB2  . SER A 1 1  ? 4.432   3.874   9.703   1.00 2.07 ? 1   SER A HB2  1  
ATOM   12    H HB3  . SER A 1 1  ? 3.025   3.696   10.755  1.00 2.12 ? 1   SER A HB3  1  
ATOM   13    H HG   . SER A 1 1  ? 1.728   4.108   9.124   1.00 2.51 ? 1   SER A HG   1  
ATOM   14    N N    . GLU A 1 2  ? 6.105   5.504   10.355  1.00 0.80 ? 2   GLU A N    1  
ATOM   15    C CA   . GLU A 1 2  ? 7.451   5.920   9.985   1.00 0.85 ? 2   GLU A CA   1  
ATOM   16    C C    . GLU A 1 2  ? 8.244   4.763   9.375   1.00 0.72 ? 2   GLU A C    1  
ATOM   17    O O    . GLU A 1 2  ? 8.555   4.771   8.182   1.00 0.72 ? 2   GLU A O    1  
ATOM   18    C CB   . GLU A 1 2  ? 8.192   6.464   11.210  1.00 1.13 ? 2   GLU A CB   1  
ATOM   19    C CG   . GLU A 1 2  ? 7.693   5.893   12.531  1.00 1.33 ? 2   GLU A CG   1  
ATOM   20    C CD   . GLU A 1 2  ? 8.684   6.061   13.662  1.00 1.48 ? 2   GLU A CD   1  
ATOM   21    O OE1  . GLU A 1 2  ? 9.347   5.066   14.027  1.00 1.99 ? 2   GLU A OE1  1  
ATOM   22    O OE2  . GLU A 1 2  ? 8.787   7.181   14.204  1.00 1.97 ? 2   GLU A OE2  1  
ATOM   23    H H    . GLU A 1 2  ? 5.981   4.656   10.830  1.00 0.89 ? 2   GLU A H    1  
ATOM   24    H HA   . GLU A 1 2  ? 7.364   6.704   9.249   1.00 0.92 ? 2   GLU A HA   1  
ATOM   25    H HB2  . GLU A 1 2  ? 9.240   6.227   11.114  1.00 1.41 ? 2   GLU A HB2  1  
ATOM   26    H HB3  . GLU A 1 2  ? 8.076   7.537   11.242  1.00 1.30 ? 2   GLU A HB3  1  
ATOM   27    H HG2  . GLU A 1 2  ? 6.778   6.397   12.801  1.00 1.76 ? 2   GLU A HG2  1  
ATOM   28    H HG3  . GLU A 1 2  ? 7.492   4.840   12.402  1.00 1.92 ? 2   GLU A HG3  1  
ATOM   29    N N    . ALA A 1 3  ? 8.526   3.756   10.200  1.00 0.74 ? 3   ALA A N    1  
ATOM   30    C CA   . ALA A 1 3  ? 9.307   2.594   9.778   1.00 0.73 ? 3   ALA A CA   1  
ATOM   31    C C    . ALA A 1 3  ? 8.632   1.808   8.659   1.00 0.59 ? 3   ALA A C    1  
ATOM   32    O O    . ALA A 1 3  ? 9.259   1.506   7.645   1.00 0.57 ? 3   ALA A O    1  
ATOM   33    C CB   . ALA A 1 3  ? 9.572   1.681   10.967  1.00 0.89 ? 3   ALA A CB   1  
ATOM   34    H H    . ALA A 1 3  ? 8.197   3.795   11.122  1.00 0.83 ? 3   ALA A H    1  
ATOM   35    H HA   . ALA A 1 3  ? 10.262  2.952   9.419   1.00 0.80 ? 3   ALA A HA   1  
ATOM   36    H HB1  . ALA A 1 3  ? 10.338  0.966   10.707  1.00 1.15 ? 3   ALA A HB1  1  
ATOM   37    H HB2  . ALA A 1 3  ? 8.664   1.156   11.223  1.00 1.06 ? 3   ALA A HB2  1  
ATOM   38    H HB3  . ALA A 1 3  ? 9.900   2.271   11.812  1.00 0.95 ? 3   ALA A HB3  1  
ATOM   39    N N    . VAL A 1 4  ? 7.348   1.505   8.836   1.00 0.56 ? 4   VAL A N    1  
ATOM   40    C CA   . VAL A 1 4  ? 6.590   0.728   7.851   1.00 0.50 ? 4   VAL A CA   1  
ATOM   41    C C    . VAL A 1 4  ? 6.694   1.324   6.449   1.00 0.45 ? 4   VAL A C    1  
ATOM   42    O O    . VAL A 1 4  ? 6.910   0.603   5.478   1.00 0.48 ? 4   VAL A O    1  
ATOM   43    C CB   . VAL A 1 4  ? 5.098   0.608   8.243   1.00 0.57 ? 4   VAL A CB   1  
ATOM   44    C CG1  . VAL A 1 4  ? 4.346   -0.266  7.247   1.00 0.82 ? 4   VAL A CG1  1  
ATOM   45    C CG2  . VAL A 1 4  ? 4.957   0.048   9.650   1.00 0.79 ? 4   VAL A CG2  1  
ATOM   46    H H    . VAL A 1 4  ? 6.898   1.807   9.654   1.00 0.63 ? 4   VAL A H    1  
ATOM   47    H HA   . VAL A 1 4  ? 7.008   -0.268  7.830   1.00 0.54 ? 4   VAL A HA   1  
ATOM   48    H HB   . VAL A 1 4  ? 4.661   1.595   8.223   1.00 0.63 ? 4   VAL A HB   1  
ATOM   49    H HG11 . VAL A 1 4  ? 4.818   -1.235  7.190   1.00 1.06 ? 4   VAL A HG11 1  
ATOM   50    H HG12 . VAL A 1 4  ? 4.366   0.199   6.271   1.00 0.99 ? 4   VAL A HG12 1  
ATOM   51    H HG13 . VAL A 1 4  ? 3.324   -0.382  7.570   1.00 1.13 ? 4   VAL A HG13 1  
ATOM   52    H HG21 . VAL A 1 4  ? 3.911   0.011   9.919   1.00 1.11 ? 4   VAL A HG21 1  
ATOM   53    H HG22 . VAL A 1 4  ? 5.485   0.681   10.346  1.00 1.16 ? 4   VAL A HG22 1  
ATOM   54    H HG23 . VAL A 1 4  ? 5.372   -0.949  9.685   1.00 1.27 ? 4   VAL A HG23 1  
ATOM   55    N N    . ILE A 1 5  ? 6.566   2.639   6.352   1.00 0.48 ? 5   ILE A N    1  
ATOM   56    C CA   . ILE A 1 5  ? 6.634   3.315   5.066   1.00 0.51 ? 5   ILE A CA   1  
ATOM   57    C C    . ILE A 1 5  ? 8.018   3.161   4.440   1.00 0.46 ? 5   ILE A C    1  
ATOM   58    O O    . ILE A 1 5  ? 8.141   2.823   3.262   1.00 0.47 ? 5   ILE A O    1  
ATOM   59    C CB   . ILE A 1 5  ? 6.291   4.813   5.195   1.00 0.65 ? 5   ILE A CB   1  
ATOM   60    C CG1  . ILE A 1 5  ? 4.983   4.998   5.967   1.00 0.81 ? 5   ILE A CG1  1  
ATOM   61    C CG2  . ILE A 1 5  ? 6.183   5.444   3.815   1.00 0.81 ? 5   ILE A CG2  1  
ATOM   62    C CD1  . ILE A 1 5  ? 4.629   6.445   6.229   1.00 0.98 ? 5   ILE A CD1  1  
ATOM   63    H H    . ILE A 1 5  ? 6.433   3.168   7.163   1.00 0.54 ? 5   ILE A H    1  
ATOM   64    H HA   . ILE A 1 5  ? 5.905   2.859   4.412   1.00 0.55 ? 5   ILE A HA   1  
ATOM   65    H HB   . ILE A 1 5  ? 7.091   5.302   5.728   1.00 0.71 ? 5   ILE A HB   1  
ATOM   66    H HG12 . ILE A 1 5  ? 4.178   4.558   5.399   1.00 0.91 ? 5   ILE A HG12 1  
ATOM   67    H HG13 . ILE A 1 5  ? 5.061   4.495   6.919   1.00 0.85 ? 5   ILE A HG13 1  
ATOM   68    H HG21 . ILE A 1 5  ? 5.934   6.489   3.916   1.00 1.02 ? 5   ILE A HG21 1  
ATOM   69    H HG22 . ILE A 1 5  ? 5.412   4.942   3.249   1.00 1.00 ? 5   ILE A HG22 1  
ATOM   70    H HG23 . ILE A 1 5  ? 7.128   5.346   3.302   1.00 1.04 ? 5   ILE A HG23 1  
ATOM   71    H HD11 . ILE A 1 5  ? 4.525   6.962   5.288   1.00 1.27 ? 5   ILE A HD11 1  
ATOM   72    H HD12 . ILE A 1 5  ? 5.413   6.907   6.811   1.00 1.29 ? 5   ILE A HD12 1  
ATOM   73    H HD13 . ILE A 1 5  ? 3.698   6.494   6.773   1.00 1.30 ? 5   ILE A HD13 1  
ATOM   74    N N    . LYS A 1 6  ? 9.056   3.387   5.240   1.00 0.49 ? 6   LYS A N    1  
ATOM   75    C CA   . LYS A 1 6  ? 10.434  3.279   4.765   1.00 0.50 ? 6   LYS A CA   1  
ATOM   76    C C    . LYS A 1 6  ? 10.730  1.866   4.262   1.00 0.46 ? 6   LYS A C    1  
ATOM   77    O O    . LYS A 1 6  ? 11.408  1.688   3.248   1.00 0.47 ? 6   LYS A O    1  
ATOM   78    C CB   . LYS A 1 6  ? 11.410  3.664   5.878   1.00 0.61 ? 6   LYS A CB   1  
ATOM   79    C CG   . LYS A 1 6  ? 12.303  4.845   5.528   1.00 0.85 ? 6   LYS A CG   1  
ATOM   80    C CD   . LYS A 1 6  ? 13.317  4.486   4.452   1.00 1.11 ? 6   LYS A CD   1  
ATOM   81    C CE   . LYS A 1 6  ? 14.297  5.622   4.201   1.00 1.11 ? 6   LYS A CE   1  
ATOM   82    N NZ   . LYS A 1 6  ? 13.668  6.749   3.462   1.00 1.12 ? 6   LYS A NZ   1  
ATOM   83    H H    . LYS A 1 6  ? 8.892   3.628   6.179   1.00 0.53 ? 6   LYS A H    1  
ATOM   84    H HA   . LYS A 1 6  ? 10.552  3.969   3.944   1.00 0.52 ? 6   LYS A HA   1  
ATOM   85    H HB2  . LYS A 1 6  ? 10.844  3.916   6.762   1.00 0.84 ? 6   LYS A HB2  1  
ATOM   86    H HB3  . LYS A 1 6  ? 12.041  2.815   6.097   1.00 0.80 ? 6   LYS A HB3  1  
ATOM   87    H HG2  . LYS A 1 6  ? 11.686  5.656   5.167   1.00 1.25 ? 6   LYS A HG2  1  
ATOM   88    H HG3  . LYS A 1 6  ? 12.830  5.163   6.416   1.00 1.02 ? 6   LYS A HG3  1  
ATOM   89    H HD2  . LYS A 1 6  ? 13.867  3.614   4.768   1.00 1.57 ? 6   LYS A HD2  1  
ATOM   90    H HD3  . LYS A 1 6  ? 12.790  4.269   3.533   1.00 1.65 ? 6   LYS A HD3  1  
ATOM   91    H HE2  . LYS A 1 6  ? 14.658  5.983   5.152   1.00 1.38 ? 6   LYS A HE2  1  
ATOM   92    H HE3  . LYS A 1 6  ? 15.128  5.240   3.622   1.00 1.51 ? 6   LYS A HE3  1  
ATOM   93    H HZ1  . LYS A 1 6  ? 14.060  7.657   3.785   1.00 1.52 ? 6   LYS A HZ1  1  
ATOM   94    H HZ2  . LYS A 1 6  ? 12.642  6.753   3.619   1.00 1.47 ? 6   LYS A HZ2  1  
ATOM   95    H HZ3  . LYS A 1 6  ? 13.850  6.653   2.443   1.00 1.48 ? 6   LYS A HZ3  1  
ATOM   96    N N    . VAL A 1 7  ? 10.210  0.868   4.974   1.00 0.46 ? 7   VAL A N    1  
ATOM   97    C CA   . VAL A 1 7  ? 10.402  -0.531  4.599   1.00 0.48 ? 7   VAL A CA   1  
ATOM   98    C C    . VAL A 1 7  ? 9.795   -0.808  3.223   1.00 0.44 ? 7   VAL A C    1  
ATOM   99    O O    . VAL A 1 7  ? 10.341  -1.579  2.430   1.00 0.54 ? 7   VAL A O    1  
ATOM   100   C CB   . VAL A 1 7  ? 9.769   -1.491  5.636   1.00 0.54 ? 7   VAL A CB   1  
ATOM   101   C CG1  . VAL A 1 7  ? 9.902   -2.942  5.198   1.00 0.60 ? 7   VAL A CG1  1  
ATOM   102   C CG2  . VAL A 1 7  ? 10.401  -1.296  7.005   1.00 0.61 ? 7   VAL A CG2  1  
ATOM   103   H H    . VAL A 1 7  ? 9.692   1.079   5.783   1.00 0.48 ? 7   VAL A H    1  
ATOM   104   H HA   . VAL A 1 7  ? 11.465  -0.724  4.559   1.00 0.53 ? 7   VAL A HA   1  
ATOM   105   H HB   . VAL A 1 7  ? 8.718   -1.256  5.713   1.00 0.55 ? 7   VAL A HB   1  
ATOM   106   H HG11 . VAL A 1 7  ? 10.948  -3.210  5.151   1.00 0.73 ? 7   VAL A HG11 1  
ATOM   107   H HG12 . VAL A 1 7  ? 9.456   -3.064  4.223   1.00 0.72 ? 7   VAL A HG12 1  
ATOM   108   H HG13 . VAL A 1 7  ? 9.397   -3.582  5.908   1.00 0.79 ? 7   VAL A HG13 1  
ATOM   109   H HG21 . VAL A 1 7  ? 10.357  -0.251  7.276   1.00 0.75 ? 7   VAL A HG21 1  
ATOM   110   H HG22 . VAL A 1 7  ? 11.431  -1.617  6.975   1.00 0.79 ? 7   VAL A HG22 1  
ATOM   111   H HG23 . VAL A 1 7  ? 9.862   -1.880  7.735   1.00 0.78 ? 7   VAL A HG23 1  
ATOM   112   N N    . ILE A 1 8  ? 8.671   -0.165  2.940   1.00 0.38 ? 8   ILE A N    1  
ATOM   113   C CA   . ILE A 1 8  ? 7.989   -0.345  1.666   1.00 0.40 ? 8   ILE A CA   1  
ATOM   114   C C    . ILE A 1 8  ? 8.751   0.349   0.539   1.00 0.37 ? 8   ILE A C    1  
ATOM   115   O O    . ILE A 1 8  ? 8.896   -0.206  -0.554  1.00 0.40 ? 8   ILE A O    1  
ATOM   116   C CB   . ILE A 1 8  ? 6.541   0.191   1.716   1.00 0.47 ? 8   ILE A CB   1  
ATOM   117   C CG1  . ILE A 1 8  ? 5.729   -0.545  2.788   1.00 0.52 ? 8   ILE A CG1  1  
ATOM   118   C CG2  . ILE A 1 8  ? 5.864   0.061   0.356   1.00 0.56 ? 8   ILE A CG2  1  
ATOM   119   C CD1  . ILE A 1 8  ? 5.704   -2.051  2.616   1.00 0.61 ? 8   ILE A CD1  1  
ATOM   120   H H    . ILE A 1 8  ? 8.291   0.449   3.606   1.00 0.39 ? 8   ILE A H    1  
ATOM   121   H HA   . ILE A 1 8  ? 7.948   -1.405  1.459   1.00 0.44 ? 8   ILE A HA   1  
ATOM   122   H HB   . ILE A 1 8  ? 6.584   1.240   1.968   1.00 0.50 ? 8   ILE A HB   1  
ATOM   123   H HG12 . ILE A 1 8  ? 6.148   -0.330  3.759   1.00 0.53 ? 8   ILE A HG12 1  
ATOM   124   H HG13 . ILE A 1 8  ? 4.708   -0.191  2.758   1.00 0.59 ? 8   ILE A HG13 1  
ATOM   125   H HG21 . ILE A 1 8  ? 4.881   0.509   0.396   1.00 0.96 ? 8   ILE A HG21 1  
ATOM   126   H HG22 . ILE A 1 8  ? 5.773   -0.984  0.101   1.00 1.01 ? 8   ILE A HG22 1  
ATOM   127   H HG23 . ILE A 1 8  ? 6.458   0.563   -0.392  1.00 1.00 ? 8   ILE A HG23 1  
ATOM   128   H HD11 . ILE A 1 8  ? 6.694   -2.450  2.783   1.00 0.96 ? 8   ILE A HD11 1  
ATOM   129   H HD12 . ILE A 1 8  ? 5.383   -2.292  1.615   1.00 0.94 ? 8   ILE A HD12 1  
ATOM   130   H HD13 . ILE A 1 8  ? 5.016   -2.484  3.329   1.00 0.97 ? 8   ILE A HD13 1  
ATOM   131   N N    . SER A 1 9  ? 9.242   1.550   0.813   1.00 0.37 ? 9   SER A N    1  
ATOM   132   C CA   . SER A 1 9  ? 9.983   2.326   -0.175  1.00 0.41 ? 9   SER A CA   1  
ATOM   133   C C    . SER A 1 9  ? 11.205  1.567   -0.690  1.00 0.40 ? 9   SER A C    1  
ATOM   134   O O    . SER A 1 9  ? 11.427  1.480   -1.900  1.00 0.46 ? 9   SER A O    1  
ATOM   135   C CB   . SER A 1 9  ? 10.413  3.662   0.424   1.00 0.49 ? 9   SER A CB   1  
ATOM   136   O OG   . SER A 1 9  ? 9.297   4.380   0.925   1.00 1.22 ? 9   SER A OG   1  
ATOM   137   H H    . SER A 1 9  ? 9.093   1.937   1.704   1.00 0.39 ? 9   SER A H    1  
ATOM   138   H HA   . SER A 1 9  ? 9.321   2.516   -1.005  1.00 0.45 ? 9   SER A HA   1  
ATOM   139   H HB2  . SER A 1 9  ? 11.104  3.483   1.236   1.00 1.05 ? 9   SER A HB2  1  
ATOM   140   H HB3  . SER A 1 9  ? 10.897  4.257   -0.336  1.00 1.19 ? 9   SER A HB3  1  
ATOM   141   H HG   . SER A 1 9  ? 9.604   5.061   1.534   1.00 1.36 ? 9   SER A HG   1  
ATOM   142   N N    . SER A 1 10 ? 11.975  0.988   0.227   1.00 0.39 ? 10  SER A N    1  
ATOM   143   C CA   . SER A 1 10 ? 13.178  0.252   -0.141  1.00 0.43 ? 10  SER A CA   1  
ATOM   144   C C    . SER A 1 10 ? 12.846  -1.094  -0.787  1.00 0.42 ? 10  SER A C    1  
ATOM   145   O O    . SER A 1 10 ? 13.724  -1.763  -1.327  1.00 0.56 ? 10  SER A O    1  
ATOM   146   C CB   . SER A 1 10 ? 14.056  0.036   1.091   1.00 0.52 ? 10  SER A CB   1  
ATOM   147   O OG   . SER A 1 10 ? 13.272  -0.322  2.216   1.00 1.17 ? 10  SER A OG   1  
ATOM   148   H H    . SER A 1 10 ? 11.731  1.057   1.177   1.00 0.41 ? 10  SER A H    1  
ATOM   149   H HA   . SER A 1 10 ? 13.724  0.850   -0.854  1.00 0.47 ? 10  SER A HA   1  
ATOM   150   H HB2  . SER A 1 10 ? 14.761  -0.758  0.890   1.00 0.93 ? 10  SER A HB2  1  
ATOM   151   H HB3  . SER A 1 10 ? 14.592  0.946   1.315   1.00 1.00 ? 10  SER A HB3  1  
ATOM   152   H HG   . SER A 1 10 ? 13.428  0.312   2.930   1.00 1.54 ? 10  SER A HG   1  
ATOM   153   N N    . ALA A 1 11 ? 11.578  -1.484  -0.731  1.00 0.37 ? 11  ALA A N    1  
ATOM   154   C CA   . ALA A 1 11 ? 11.148  -2.752  -1.302  1.00 0.41 ? 11  ALA A CA   1  
ATOM   155   C C    . ALA A 1 11 ? 10.542  -2.570  -2.693  1.00 0.37 ? 11  ALA A C    1  
ATOM   156   O O    . ALA A 1 11 ? 10.936  -3.250  -3.642  1.00 0.42 ? 11  ALA A O    1  
ATOM   157   C CB   . ALA A 1 11 ? 10.148  -3.434  -0.378  1.00 0.47 ? 11  ALA A CB   1  
ATOM   158   H H    . ALA A 1 11 ? 10.919  -0.904  -0.295  1.00 0.41 ? 11  ALA A H    1  
ATOM   159   H HA   . ALA A 1 11 ? 12.018  -3.389  -1.382  1.00 0.47 ? 11  ALA A HA   1  
ATOM   160   H HB1  . ALA A 1 11 ? 9.239   -2.852  -0.342  1.00 0.52 ? 11  ALA A HB1  1  
ATOM   161   H HB2  . ALA A 1 11 ? 10.568  -3.510  0.615   1.00 0.58 ? 11  ALA A HB2  1  
ATOM   162   H HB3  . ALA A 1 11 ? 9.927   -4.423  -0.751  1.00 0.58 ? 11  ALA A HB3  1  
ATOM   163   N N    . CYS A 1 12 ? 9.593   -1.647  -2.811  1.00 0.34 ? 12  CYS A N    1  
ATOM   164   C CA   . CYS A 1 12 ? 8.917   -1.396  -4.081  1.00 0.37 ? 12  CYS A CA   1  
ATOM   165   C C    . CYS A 1 12 ? 9.896   -0.948  -5.163  1.00 0.39 ? 12  CYS A C    1  
ATOM   166   O O    . CYS A 1 12 ? 9.795   -1.375  -6.314  1.00 0.44 ? 12  CYS A O    1  
ATOM   167   C CB   . CYS A 1 12 ? 7.806   -0.357  -3.908  1.00 0.42 ? 12  CYS A CB   1  
ATOM   168   S SG   . CYS A 1 12 ? 8.345   1.195   -3.153  1.00 0.66 ? 12  CYS A SG   1  
ATOM   169   H H    . CYS A 1 12 ? 9.340   -1.118  -2.022  1.00 0.35 ? 12  CYS A H    1  
ATOM   170   H HA   . CYS A 1 12 ? 8.468   -2.328  -4.395  1.00 0.43 ? 12  CYS A HA   1  
ATOM   171   H HB2  . CYS A 1 12 ? 7.391   -0.120  -4.877  1.00 0.63 ? 12  CYS A HB2  1  
ATOM   172   H HB3  . CYS A 1 12 ? 7.031   -0.773  -3.281  1.00 0.63 ? 12  CYS A HB3  1  
ATOM   173   H HG   . CYS A 1 12 ? 8.634   0.957   -1.879  1.00 1.11 ? 12  CYS A HG   1  
ATOM   174   N N    . LYS A 1 13 ? 10.866  -0.123  -4.784  1.00 0.41 ? 13  LYS A N    1  
ATOM   175   C CA   . LYS A 1 13 ? 11.857  0.382   -5.729  1.00 0.49 ? 13  LYS A CA   1  
ATOM   176   C C    . LYS A 1 13 ? 12.775  -0.727  -6.240  1.00 0.49 ? 13  LYS A C    1  
ATOM   177   O O    . LYS A 1 13 ? 13.505  -0.540  -7.210  1.00 0.58 ? 13  LYS A O    1  
ATOM   178   C CB   . LYS A 1 13 ? 12.670  1.503   -5.086  1.00 0.63 ? 13  LYS A CB   1  
ATOM   179   C CG   . LYS A 1 13 ? 11.982  2.853   -5.167  1.00 0.96 ? 13  LYS A CG   1  
ATOM   180   C CD   . LYS A 1 13 ? 12.698  3.897   -4.335  1.00 1.06 ? 13  LYS A CD   1  
ATOM   181   C CE   . LYS A 1 13 ? 12.038  5.256   -4.467  1.00 1.40 ? 13  LYS A CE   1  
ATOM   182   N NZ   . LYS A 1 13 ? 12.177  6.054   -3.226  1.00 1.34 ? 13  LYS A NZ   1  
ATOM   183   H H    . LYS A 1 13 ? 10.912  0.165   -3.847  1.00 0.43 ? 13  LYS A H    1  
ATOM   184   H HA   . LYS A 1 13 ? 11.318  0.790   -6.572  1.00 0.52 ? 13  LYS A HA   1  
ATOM   185   H HB2  . LYS A 1 13 ? 12.831  1.267   -4.043  1.00 0.79 ? 13  LYS A HB2  1  
ATOM   186   H HB3  . LYS A 1 13 ? 13.623  1.579   -5.586  1.00 0.85 ? 13  LYS A HB3  1  
ATOM   187   H HG2  . LYS A 1 13 ? 11.969  3.176   -6.197  1.00 1.66 ? 13  LYS A HG2  1  
ATOM   188   H HG3  . LYS A 1 13 ? 10.968  2.752   -4.807  1.00 1.57 ? 13  LYS A HG3  1  
ATOM   189   H HD2  . LYS A 1 13 ? 12.674  3.596   -3.300  1.00 1.45 ? 13  LYS A HD2  1  
ATOM   190   H HD3  . LYS A 1 13 ? 13.724  3.970   -4.669  1.00 1.68 ? 13  LYS A HD3  1  
ATOM   191   H HE2  . LYS A 1 13 ? 12.504  5.790   -5.280  1.00 1.92 ? 13  LYS A HE2  1  
ATOM   192   H HE3  . LYS A 1 13 ? 10.988  5.115   -4.683  1.00 1.72 ? 13  LYS A HE3  1  
ATOM   193   H HZ1  . LYS A 1 13 ? 13.181  6.192   -2.995  1.00 1.65 ? 13  LYS A HZ1  1  
ATOM   194   H HZ2  . LYS A 1 13 ? 11.717  5.570   -2.430  1.00 1.65 ? 13  LYS A HZ2  1  
ATOM   195   H HZ3  . LYS A 1 13 ? 11.737  6.983   -3.347  1.00 1.73 ? 13  LYS A HZ3  1  
ATOM   196   N N    . THR A 1 14 ? 12.725  -1.882  -5.593  1.00 0.49 ? 14  THR A N    1  
ATOM   197   C CA   . THR A 1 14 ? 13.537  -3.014  -6.000  1.00 0.56 ? 14  THR A CA   1  
ATOM   198   C C    . THR A 1 14 ? 12.798  -3.846  -7.050  1.00 0.54 ? 14  THR A C    1  
ATOM   199   O O    . THR A 1 14 ? 13.392  -4.679  -7.735  1.00 0.72 ? 14  THR A O    1  
ATOM   200   C CB   . THR A 1 14 ? 13.892  -3.894  -4.782  1.00 0.65 ? 14  THR A CB   1  
ATOM   201   O OG1  . THR A 1 14 ? 14.330  -3.060  -3.710  1.00 0.77 ? 14  THR A OG1  1  
ATOM   202   C CG2  . THR A 1 14 ? 14.988  -4.903  -5.113  1.00 0.83 ? 14  THR A CG2  1  
ATOM   203   H H    . THR A 1 14 ? 12.126  -1.976  -4.819  1.00 0.48 ? 14  THR A H    1  
ATOM   204   H HA   . THR A 1 14 ? 14.452  -2.633  -6.427  1.00 0.63 ? 14  THR A HA   1  
ATOM   205   H HB   . THR A 1 14 ? 13.006  -4.432  -4.473  1.00 0.82 ? 14  THR A HB   1  
ATOM   206   H HG1  . THR A 1 14 ? 14.366  -2.143  -4.011  1.00 0.99 ? 14  THR A HG1  1  
ATOM   207   H HG21 . THR A 1 14 ? 15.888  -4.379  -5.393  1.00 1.01 ? 14  THR A HG21 1  
ATOM   208   H HG22 . THR A 1 14 ? 14.665  -5.530  -5.932  1.00 1.11 ? 14  THR A HG22 1  
ATOM   209   H HG23 . THR A 1 14 ? 15.186  -5.518  -4.247  1.00 1.00 ? 14  THR A HG23 1  
ATOM   210   N N    . TYR A 1 15 ? 11.501  -3.601  -7.183  1.00 0.49 ? 15  TYR A N    1  
ATOM   211   C CA   . TYR A 1 15 ? 10.682  -4.328  -8.147  1.00 0.54 ? 15  TYR A CA   1  
ATOM   212   C C    . TYR A 1 15 ? 10.159  -3.392  -9.232  1.00 0.56 ? 15  TYR A C    1  
ATOM   213   O O    . TYR A 1 15 ? 10.367  -3.631  -10.423 1.00 0.72 ? 15  TYR A O    1  
ATOM   214   C CB   . TYR A 1 15 ? 9.515   -5.026  -7.440  1.00 0.55 ? 15  TYR A CB   1  
ATOM   215   C CG   . TYR A 1 15 ? 9.955   -6.073  -6.441  1.00 0.60 ? 15  TYR A CG   1  
ATOM   216   C CD1  . TYR A 1 15 ? 9.746   -5.893  -5.081  1.00 0.67 ? 15  TYR A CD1  1  
ATOM   217   C CD2  . TYR A 1 15 ? 10.596  -7.233  -6.859  1.00 0.80 ? 15  TYR A CD2  1  
ATOM   218   C CE1  . TYR A 1 15 ? 10.161  -6.840  -4.166  1.00 0.78 ? 15  TYR A CE1  1  
ATOM   219   C CE2  . TYR A 1 15 ? 11.009  -8.186  -5.950  1.00 0.91 ? 15  TYR A CE2  1  
ATOM   220   C CZ   . TYR A 1 15 ? 10.794  -7.984  -4.607  1.00 0.84 ? 15  TYR A CZ   1  
ATOM   221   O OH   . TYR A 1 15 ? 11.218  -8.927  -3.701  1.00 1.00 ? 15  TYR A OH   1  
ATOM   222   H H    . TYR A 1 15 ? 11.085  -2.912  -6.621  1.00 0.54 ? 15  TYR A H    1  
ATOM   223   H HA   . TYR A 1 15 ? 11.308  -5.077  -8.608  1.00 0.62 ? 15  TYR A HA   1  
ATOM   224   H HB2  . TYR A 1 15 ? 8.931   -4.288  -6.912  1.00 0.54 ? 15  TYR A HB2  1  
ATOM   225   H HB3  . TYR A 1 15 ? 8.893   -5.511  -8.178  1.00 0.63 ? 15  TYR A HB3  1  
ATOM   226   H HD1  . TYR A 1 15 ? 9.250   -4.998  -4.738  1.00 0.79 ? 15  TYR A HD1  1  
ATOM   227   H HD2  . TYR A 1 15 ? 10.766  -7.388  -7.913  1.00 0.96 ? 15  TYR A HD2  1  
ATOM   228   H HE1  . TYR A 1 15 ? 9.988   -6.682  -3.110  1.00 0.93 ? 15  TYR A HE1  1  
ATOM   229   H HE2  . TYR A 1 15 ? 11.504  -9.082  -6.294  1.00 1.14 ? 15  TYR A HE2  1  
ATOM   230   H HH   . TYR A 1 15 ? 12.120  -9.191  -3.925  1.00 1.22 ? 15  TYR A HH   1  
ATOM   231   N N    . CYS A 1 16 ? 9.492   -2.324  -8.818  1.00 0.50 ? 16  CYS A N    1  
ATOM   232   C CA   . CYS A 1 16 ? 8.941   -1.358  -9.757  1.00 0.55 ? 16  CYS A CA   1  
ATOM   233   C C    . CYS A 1 16 ? 10.022  -0.389  -10.235 1.00 0.57 ? 16  CYS A C    1  
ATOM   234   O O    . CYS A 1 16 ? 9.953   0.131   -11.349 1.00 0.88 ? 16  CYS A O    1  
ATOM   235   C CB   . CYS A 1 16 ? 7.794   -0.582  -9.107  1.00 0.54 ? 16  CYS A CB   1  
ATOM   236   S SG   . CYS A 1 16 ? 6.510   -1.627  -8.376  1.00 0.67 ? 16  CYS A SG   1  
ATOM   237   H H    . CYS A 1 16 ? 9.366   -2.179  -7.855  1.00 0.50 ? 16  CYS A H    1  
ATOM   238   H HA   . CYS A 1 16 ? 8.560   -1.903  -10.609 1.00 0.64 ? 16  CYS A HA   1  
ATOM   239   H HB2  . CYS A 1 16 ? 8.193   0.043   -8.322  1.00 0.56 ? 16  CYS A HB2  1  
ATOM   240   H HB3  . CYS A 1 16 ? 7.325   0.043   -9.853  1.00 0.63 ? 16  CYS A HB3  1  
ATOM   241   H HG   . CYS A 1 16 ? 5.542   -1.772  -9.274  1.00 1.15 ? 16  CYS A HG   1  
ATOM   242   N N    . GLY A 1 17 ? 11.019  -0.153  -9.391  1.00 0.49 ? 17  GLY A N    1  
ATOM   243   C CA   . GLY A 1 17 ? 12.095  0.750   -9.753  1.00 0.56 ? 17  GLY A CA   1  
ATOM   244   C C    . GLY A 1 17 ? 11.688  2.206   -9.614  1.00 0.52 ? 17  GLY A C    1  
ATOM   245   O O    . GLY A 1 17 ? 11.426  2.679   -8.508  1.00 0.66 ? 17  GLY A O    1  
ATOM   246   H H    . GLY A 1 17 ? 11.020  -0.585  -8.513  1.00 0.62 ? 17  GLY A H    1  
ATOM   247   H HA2  . GLY A 1 17 ? 12.945  0.560   -9.114  1.00 0.65 ? 17  GLY A HA2  1  
ATOM   248   H HA3  . GLY A 1 17 ? 12.377  0.565   -10.777 1.00 0.63 ? 17  GLY A HA3  1  
ATOM   249   N N    . LYS A 1 18 ? 11.603  2.909   -10.735 1.00 0.50 ? 18  LYS A N    1  
ATOM   250   C CA   . LYS A 1 18 ? 11.226  4.318   -10.722 1.00 0.56 ? 18  LYS A CA   1  
ATOM   251   C C    . LYS A 1 18 ? 9.712   4.482   -10.821 1.00 0.53 ? 18  LYS A C    1  
ATOM   252   O O    . LYS A 1 18 ? 9.182   5.575   -10.629 1.00 0.62 ? 18  LYS A O    1  
ATOM   253   C CB   . LYS A 1 18 ? 11.918  5.070   -11.862 1.00 0.70 ? 18  LYS A CB   1  
ATOM   254   C CG   . LYS A 1 18 ? 11.689  4.457   -13.236 1.00 0.81 ? 18  LYS A CG   1  
ATOM   255   C CD   . LYS A 1 18 ? 12.994  4.295   -13.999 1.00 1.11 ? 18  LYS A CD   1  
ATOM   256   C CE   . LYS A 1 18 ? 13.596  5.642   -14.365 1.00 1.46 ? 18  LYS A CE   1  
ATOM   257   N NZ   . LYS A 1 18 ? 15.024  5.524   -14.753 1.00 1.82 ? 18  LYS A NZ   1  
ATOM   258   H H    . LYS A 1 18 ? 11.800  2.472   -11.594 1.00 0.58 ? 18  LYS A H    1  
ATOM   259   H HA   . LYS A 1 18 ? 11.553  4.733   -9.783  1.00 0.60 ? 18  LYS A HA   1  
ATOM   260   H HB2  . LYS A 1 18 ? 11.549  6.085   -11.880 1.00 0.87 ? 18  LYS A HB2  1  
ATOM   261   H HB3  . LYS A 1 18 ? 12.983  5.089   -11.669 1.00 0.79 ? 18  LYS A HB3  1  
ATOM   262   H HG2  . LYS A 1 18 ? 11.231  3.486   -13.115 1.00 0.90 ? 18  LYS A HG2  1  
ATOM   263   H HG3  . LYS A 1 18 ? 11.028  5.101   -13.799 1.00 1.06 ? 18  LYS A HG3  1  
ATOM   264   H HD2  . LYS A 1 18 ? 13.696  3.754   -13.380 1.00 1.33 ? 18  LYS A HD2  1  
ATOM   265   H HD3  . LYS A 1 18 ? 12.805  3.737   -14.903 1.00 1.44 ? 18  LYS A HD3  1  
ATOM   266   H HE2  . LYS A 1 18 ? 13.042  6.058   -15.193 1.00 1.85 ? 18  LYS A HE2  1  
ATOM   267   H HE3  . LYS A 1 18 ? 13.516  6.302   -13.513 1.00 1.67 ? 18  LYS A HE3  1  
ATOM   268   H HZ1  . LYS A 1 18 ? 15.572  5.106   -13.974 1.00 2.13 ? 18  LYS A HZ1  1  
ATOM   269   H HZ2  . LYS A 1 18 ? 15.417  6.464   -14.970 1.00 2.19 ? 18  LYS A HZ2  1  
ATOM   270   H HZ3  . LYS A 1 18 ? 15.120  4.917   -15.592 1.00 2.14 ? 18  LYS A HZ3  1  
ATOM   271   N N    . THR A 1 19 ? 9.017   3.389   -11.105 1.00 0.49 ? 19  THR A N    1  
ATOM   272   C CA   . THR A 1 19 ? 7.565   3.410   -11.226 1.00 0.52 ? 19  THR A CA   1  
ATOM   273   C C    . THR A 1 19 ? 6.898   3.165   -9.873  1.00 0.48 ? 19  THR A C    1  
ATOM   274   O O    . THR A 1 19 ? 5.684   2.969   -9.790  1.00 0.62 ? 19  THR A O    1  
ATOM   275   C CB   . THR A 1 19 ? 7.091   2.346   -12.232 1.00 0.62 ? 19  THR A CB   1  
ATOM   276   O OG1  . THR A 1 19 ? 8.222   1.798   -12.923 1.00 0.83 ? 19  THR A OG1  1  
ATOM   277   C CG2  . THR A 1 19 ? 6.118   2.944   -13.237 1.00 0.91 ? 19  THR A CG2  1  
ATOM   278   H H    . THR A 1 19 ? 9.492   2.543   -11.248 1.00 0.49 ? 19  THR A H    1  
ATOM   279   H HA   . THR A 1 19 ? 7.275   4.384   -11.596 1.00 0.60 ? 19  THR A HA   1  
ATOM   280   H HB   . THR A 1 19 ? 6.589   1.557   -11.691 1.00 0.72 ? 19  THR A HB   1  
ATOM   281   H HG1  . THR A 1 19 ? 8.104   0.842   -13.022 1.00 1.10 ? 19  THR A HG1  1  
ATOM   282   H HG21 . THR A 1 19 ? 5.795   2.177   -13.927 1.00 1.10 ? 19  THR A HG21 1  
ATOM   283   H HG22 . THR A 1 19 ? 6.608   3.734   -13.784 1.00 1.23 ? 19  THR A HG22 1  
ATOM   284   H HG23 . THR A 1 19 ? 5.262   3.343   -12.716 1.00 1.17 ? 19  THR A HG23 1  
ATOM   285   N N    . SER A 1 20 ? 7.703   3.184   -8.820  1.00 0.42 ? 20  SER A N    1  
ATOM   286   C CA   . SER A 1 20 ? 7.222   2.961   -7.465  1.00 0.42 ? 20  SER A CA   1  
ATOM   287   C C    . SER A 1 20 ? 6.407   4.158   -6.964  1.00 0.41 ? 20  SER A C    1  
ATOM   288   O O    . SER A 1 20 ? 6.561   5.274   -7.463  1.00 0.46 ? 20  SER A O    1  
ATOM   289   C CB   . SER A 1 20 ? 8.420   2.705   -6.545  1.00 0.46 ? 20  SER A CB   1  
ATOM   290   O OG   . SER A 1 20 ? 9.316   1.780   -7.142  1.00 0.97 ? 20  SER A OG   1  
ATOM   291   H H    . SER A 1 20 ? 8.653   3.363   -8.957  1.00 0.49 ? 20  SER A H    1  
ATOM   292   H HA   . SER A 1 20 ? 6.591   2.085   -7.475  1.00 0.48 ? 20  SER A HA   1  
ATOM   293   H HB2  . SER A 1 20 ? 8.944   3.633   -6.371  1.00 0.70 ? 20  SER A HB2  1  
ATOM   294   H HB3  . SER A 1 20 ? 8.077   2.301   -5.605  1.00 0.81 ? 20  SER A HB3  1  
ATOM   295   H HG   . SER A 1 20 ? 10.113  2.244   -7.434  1.00 1.21 ? 20  SER A HG   1  
ATOM   296   N N    . PRO A 1 21 ? 5.517   3.936   -5.983  1.00 0.43 ? 21  PRO A N    1  
ATOM   297   C CA   . PRO A 1 21 ? 4.686   5.002   -5.420  1.00 0.49 ? 21  PRO A CA   1  
ATOM   298   C C    . PRO A 1 21 ? 5.495   5.948   -4.539  1.00 0.42 ? 21  PRO A C    1  
ATOM   299   O O    . PRO A 1 21 ? 6.502   5.552   -3.951  1.00 0.46 ? 21  PRO A O    1  
ATOM   300   C CB   . PRO A 1 21 ? 3.658   4.242   -4.580  1.00 0.62 ? 21  PRO A CB   1  
ATOM   301   C CG   . PRO A 1 21 ? 4.331   2.972   -4.202  1.00 0.63 ? 21  PRO A CG   1  
ATOM   302   C CD   . PRO A 1 21 ? 5.244   2.629   -5.348  1.00 0.50 ? 21  PRO A CD   1  
ATOM   303   H HA   . PRO A 1 21 ? 4.184   5.565   -6.192  1.00 0.57 ? 21  PRO A HA   1  
ATOM   304   H HB2  . PRO A 1 21 ? 3.398   4.821   -3.704  1.00 0.69 ? 21  PRO A HB2  1  
ATOM   305   H HB3  . PRO A 1 21 ? 2.779   4.035   -5.167  1.00 0.76 ? 21  PRO A HB3  1  
ATOM   306   H HG2  . PRO A 1 21 ? 4.900   3.117   -3.293  1.00 0.76 ? 21  PRO A HG2  1  
ATOM   307   H HG3  . PRO A 1 21 ? 3.598   2.190   -4.067  1.00 0.81 ? 21  PRO A HG3  1  
ATOM   308   H HD2  . PRO A 1 21 ? 6.155   2.179   -4.982  1.00 0.55 ? 21  PRO A HD2  1  
ATOM   309   H HD3  . PRO A 1 21 ? 4.748   1.966   -6.040  1.00 0.57 ? 21  PRO A HD3  1  
ATOM   310   N N    . SER A 1 22 ? 5.058   7.192   -4.449  1.00 0.43 ? 22  SER A N    1  
ATOM   311   C CA   . SER A 1 22 ? 5.750   8.178   -3.641  1.00 0.43 ? 22  SER A CA   1  
ATOM   312   C C    . SER A 1 22 ? 5.443   7.961   -2.162  1.00 0.38 ? 22  SER A C    1  
ATOM   313   O O    . SER A 1 22 ? 4.379   7.446   -1.810  1.00 0.39 ? 22  SER A O    1  
ATOM   314   C CB   . SER A 1 22 ? 5.334   9.583   -4.064  1.00 0.56 ? 22  SER A CB   1  
ATOM   315   O OG   . SER A 1 22 ? 5.334   9.706   -5.475  1.00 1.11 ? 22  SER A OG   1  
ATOM   316   H H    . SER A 1 22 ? 4.233   7.451   -4.927  1.00 0.53 ? 22  SER A H    1  
ATOM   317   H HA   . SER A 1 22 ? 6.812   8.061   -3.800  1.00 0.47 ? 22  SER A HA   1  
ATOM   318   H HB2  . SER A 1 22 ? 4.344   9.791   -3.694  1.00 0.96 ? 22  SER A HB2  1  
ATOM   319   H HB3  . SER A 1 22 ? 6.029   10.299  -3.654  1.00 0.81 ? 22  SER A HB3  1  
ATOM   320   H HG   . SER A 1 22 ? 5.996   9.107   -5.846  1.00 1.48 ? 22  SER A HG   1  
ATOM   321   N N    . LYS A 1 23 ? 6.371   8.361   -1.303  1.00 0.44 ? 23  LYS A N    1  
ATOM   322   C CA   . LYS A 1 23 ? 6.202   8.209   0.136   1.00 0.50 ? 23  LYS A CA   1  
ATOM   323   C C    . LYS A 1 23 ? 4.956   8.954   0.612   1.00 0.42 ? 23  LYS A C    1  
ATOM   324   O O    . LYS A 1 23 ? 4.249   8.496   1.512   1.00 0.42 ? 23  LYS A O    1  
ATOM   325   C CB   . LYS A 1 23 ? 7.445   8.735   0.845   1.00 0.69 ? 23  LYS A CB   1  
ATOM   326   C CG   . LYS A 1 23 ? 7.603   8.268   2.282   1.00 0.63 ? 23  LYS A CG   1  
ATOM   327   C CD   . LYS A 1 23 ? 7.051   9.277   3.285   1.00 1.12 ? 23  LYS A CD   1  
ATOM   328   C CE   . LYS A 1 23 ? 7.650   10.666  3.099   1.00 1.17 ? 23  LYS A CE   1  
ATOM   329   N NZ   . LYS A 1 23 ? 9.098   10.620  2.773   1.00 1.60 ? 23  LYS A NZ   1  
ATOM   330   H H    . LYS A 1 23 ? 7.201   8.767   -1.645  1.00 0.50 ? 23  LYS A H    1  
ATOM   331   H HA   . LYS A 1 23 ? 6.090   7.157   0.350   1.00 0.56 ? 23  LYS A HA   1  
ATOM   332   H HB2  . LYS A 1 23 ? 8.317   8.421   0.291   1.00 1.00 ? 23  LYS A HB2  1  
ATOM   333   H HB3  . LYS A 1 23 ? 7.403   9.812   0.846   1.00 1.02 ? 23  LYS A HB3  1  
ATOM   334   H HG2  . LYS A 1 23 ? 7.077   7.335   2.403   1.00 0.92 ? 23  LYS A HG2  1  
ATOM   335   H HG3  . LYS A 1 23 ? 8.654   8.116   2.482   1.00 0.87 ? 23  LYS A HG3  1  
ATOM   336   H HD2  . LYS A 1 23 ? 5.981   9.341   3.159   1.00 1.72 ? 23  LYS A HD2  1  
ATOM   337   H HD3  . LYS A 1 23 ? 7.274   8.931   4.284   1.00 1.84 ? 23  LYS A HD3  1  
ATOM   338   H HE2  . LYS A 1 23 ? 7.125   11.166  2.299   1.00 1.51 ? 23  LYS A HE2  1  
ATOM   339   H HE3  . LYS A 1 23 ? 7.516   11.223  4.013   1.00 1.35 ? 23  LYS A HE3  1  
ATOM   340   H HZ1  . LYS A 1 23 ? 9.241   10.729  1.745   1.00 2.03 ? 23  LYS A HZ1  1  
ATOM   341   H HZ2  . LYS A 1 23 ? 9.503   9.714   3.075   1.00 1.91 ? 23  LYS A HZ2  1  
ATOM   342   H HZ3  . LYS A 1 23 ? 9.603   11.389  3.262   1.00 2.03 ? 23  LYS A HZ3  1  
ATOM   343   N N    . LYS A 1 24 ? 4.686   10.095  -0.016  1.00 0.41 ? 24  LYS A N    1  
ATOM   344   C CA   . LYS A 1 24 ? 3.524   10.909  0.322   1.00 0.45 ? 24  LYS A CA   1  
ATOM   345   C C    . LYS A 1 24 ? 2.227   10.160  0.018   1.00 0.40 ? 24  LYS A C    1  
ATOM   346   O O    . LYS A 1 24 ? 1.208   10.370  0.674   1.00 0.48 ? 24  LYS A O    1  
ATOM   347   C CB   . LYS A 1 24 ? 3.551   12.232  -0.451  1.00 0.56 ? 24  LYS A CB   1  
ATOM   348   C CG   . LYS A 1 24 ? 4.331   13.346  0.238   1.00 0.83 ? 24  LYS A CG   1  
ATOM   349   C CD   . LYS A 1 24 ? 5.831   13.097  0.197   1.00 1.00 ? 24  LYS A CD   1  
ATOM   350   C CE   . LYS A 1 24 ? 6.609   14.313  0.673   1.00 1.56 ? 24  LYS A CE   1  
ATOM   351   N NZ   . LYS A 1 24 ? 8.080   14.092  0.636   1.00 2.04 ? 24  LYS A NZ   1  
ATOM   352   H H    . LYS A 1 24 ? 5.295   10.402  -0.719  1.00 0.44 ? 24  LYS A H    1  
ATOM   353   H HA   . LYS A 1 24 ? 3.565   11.118  1.381   1.00 0.51 ? 24  LYS A HA   1  
ATOM   354   H HB2  . LYS A 1 24 ? 4.000   12.058  -1.418  1.00 0.63 ? 24  LYS A HB2  1  
ATOM   355   H HB3  . LYS A 1 24 ? 2.534   12.569  -0.594  1.00 0.77 ? 24  LYS A HB3  1  
ATOM   356   H HG2  . LYS A 1 24 ? 4.119   14.279  -0.262  1.00 1.37 ? 24  LYS A HG2  1  
ATOM   357   H HG3  . LYS A 1 24 ? 4.014   13.410  1.268   1.00 1.33 ? 24  LYS A HG3  1  
ATOM   358   H HD2  . LYS A 1 24 ? 6.065   12.259  0.835   1.00 1.50 ? 24  LYS A HD2  1  
ATOM   359   H HD3  . LYS A 1 24 ? 6.120   12.871  -0.819  1.00 1.29 ? 24  LYS A HD3  1  
ATOM   360   H HE2  . LYS A 1 24 ? 6.365   15.148  0.034   1.00 1.84 ? 24  LYS A HE2  1  
ATOM   361   H HE3  . LYS A 1 24 ? 6.311   14.538  1.687   1.00 2.19 ? 24  LYS A HE3  1  
ATOM   362   H HZ1  . LYS A 1 24 ? 8.576   14.980  0.412   1.00 2.22 ? 24  LYS A HZ1  1  
ATOM   363   H HZ2  . LYS A 1 24 ? 8.322   13.384  -0.087  1.00 2.45 ? 24  LYS A HZ2  1  
ATOM   364   H HZ3  . LYS A 1 24 ? 8.419   13.750  1.558   1.00 2.55 ? 24  LYS A HZ3  1  
ATOM   365   N N    . GLU A 1 25 ? 2.273   9.284   -0.976  1.00 0.34 ? 25  GLU A N    1  
ATOM   366   C CA   . GLU A 1 25 ? 1.103   8.504   -1.351  1.00 0.37 ? 25  GLU A CA   1  
ATOM   367   C C    . GLU A 1 25 ? 0.891   7.386   -0.343  1.00 0.31 ? 25  GLU A C    1  
ATOM   368   O O    . GLU A 1 25 ? -0.225  7.153   0.119   1.00 0.34 ? 25  GLU A O    1  
ATOM   369   C CB   . GLU A 1 25 ? 1.273   7.917   -2.752  1.00 0.45 ? 25  GLU A CB   1  
ATOM   370   C CG   . GLU A 1 25 ? 1.543   8.963   -3.819  1.00 0.90 ? 25  GLU A CG   1  
ATOM   371   C CD   . GLU A 1 25 ? 1.631   8.371   -5.209  1.00 1.00 ? 25  GLU A CD   1  
ATOM   372   O OE1  . GLU A 1 25 ? 0.724   8.631   -6.025  1.00 1.30 ? 25  GLU A OE1  1  
ATOM   373   O OE2  . GLU A 1 25 ? 2.605   7.644   -5.495  1.00 1.58 ? 25  GLU A OE2  1  
ATOM   374   H H    . GLU A 1 25 ? 3.114   9.149   -1.460  1.00 0.36 ? 25  GLU A H    1  
ATOM   375   H HA   . GLU A 1 25 ? 0.245   9.160   -1.339  1.00 0.42 ? 25  GLU A HA   1  
ATOM   376   H HB2  . GLU A 1 25 ? 2.100   7.220   -2.740  1.00 0.97 ? 25  GLU A HB2  1  
ATOM   377   H HB3  . GLU A 1 25 ? 0.371   7.386   -3.017  1.00 0.87 ? 25  GLU A HB3  1  
ATOM   378   H HG2  . GLU A 1 25 ? 0.745   9.688   -3.803  1.00 1.42 ? 25  GLU A HG2  1  
ATOM   379   H HG3  . GLU A 1 25 ? 2.477   9.455   -3.595  1.00 1.47 ? 25  GLU A HG3  1  
ATOM   380   N N    . ILE A 1 26 ? 1.981   6.714   0.012   1.00 0.29 ? 26  ILE A N    1  
ATOM   381   C CA   . ILE A 1 26 ? 1.929   5.619   0.976   1.00 0.29 ? 26  ILE A CA   1  
ATOM   382   C C    . ILE A 1 26 ? 1.459   6.123   2.337   1.00 0.27 ? 26  ILE A C    1  
ATOM   383   O O    . ILE A 1 26 ? 0.541   5.560   2.934   1.00 0.28 ? 26  ILE A O    1  
ATOM   384   C CB   . ILE A 1 26 ? 3.309   4.940   1.133   1.00 0.33 ? 26  ILE A CB   1  
ATOM   385   C CG1  . ILE A 1 26 ? 3.871   4.544   -0.237  1.00 0.36 ? 26  ILE A CG1  1  
ATOM   386   C CG2  . ILE A 1 26 ? 3.203   3.717   2.039   1.00 0.41 ? 26  ILE A CG2  1  
ATOM   387   C CD1  . ILE A 1 26 ? 5.324   4.119   -0.199  1.00 0.45 ? 26  ILE A CD1  1  
ATOM   388   H H    . ILE A 1 26 ? 2.842   6.959   -0.392  1.00 0.30 ? 26  ILE A H    1  
ATOM   389   H HA   . ILE A 1 26 ? 1.224   4.883   0.612   1.00 0.32 ? 26  ILE A HA   1  
ATOM   390   H HB   . ILE A 1 26 ? 3.982   5.646   1.600   1.00 0.34 ? 26  ILE A HB   1  
ATOM   391   H HG12 . ILE A 1 26 ? 3.298   3.718   -0.627  1.00 0.44 ? 26  ILE A HG12 1  
ATOM   392   H HG13 . ILE A 1 26 ? 3.785   5.384   -0.909  1.00 0.35 ? 26  ILE A HG13 1  
ATOM   393   H HG21 . ILE A 1 26 ? 2.871   4.023   3.020   1.00 0.52 ? 26  ILE A HG21 1  
ATOM   394   H HG22 . ILE A 1 26 ? 4.172   3.245   2.118   1.00 0.53 ? 26  ILE A HG22 1  
ATOM   395   H HG23 . ILE A 1 26 ? 2.495   3.017   1.620   1.00 0.54 ? 26  ILE A HG23 1  
ATOM   396   H HD11 . ILE A 1 26 ? 5.642   3.832   -1.190  1.00 0.90 ? 26  ILE A HD11 1  
ATOM   397   H HD12 . ILE A 1 26 ? 5.435   3.279   0.471   1.00 0.91 ? 26  ILE A HD12 1  
ATOM   398   H HD13 . ILE A 1 26 ? 5.932   4.941   0.150   1.00 0.92 ? 26  ILE A HD13 1  
ATOM   399   N N    . GLY A 1 27 ? 2.075   7.205   2.804   1.00 0.27 ? 27  GLY A N    1  
ATOM   400   C CA   . GLY A 1 27 ? 1.724   7.780   4.092   1.00 0.29 ? 27  GLY A CA   1  
ATOM   401   C C    . GLY A 1 27 ? 0.267   8.201   4.180   1.00 0.28 ? 27  GLY A C    1  
ATOM   402   O O    . GLY A 1 27 ? -0.359  8.073   5.233   1.00 0.32 ? 27  GLY A O    1  
ATOM   403   H H    . GLY A 1 27 ? 2.787   7.620   2.265   1.00 0.28 ? 27  GLY A H    1  
ATOM   404   H HA2  . GLY A 1 27 ? 1.920   7.052   4.865   1.00 0.32 ? 27  GLY A HA2  1  
ATOM   405   H HA3  . GLY A 1 27 ? 2.346   8.645   4.264   1.00 0.33 ? 27  GLY A HA3  1  
ATOM   406   N N    . ALA A 1 28 ? -0.277  8.689   3.074   1.00 0.27 ? 28  ALA A N    1  
ATOM   407   C CA   . ALA A 1 28 ? -1.664  9.133   3.042   1.00 0.30 ? 28  ALA A CA   1  
ATOM   408   C C    . ALA A 1 28 ? -2.628  7.950   2.931   1.00 0.29 ? 28  ALA A C    1  
ATOM   409   O O    . ALA A 1 28 ? -3.690  7.940   3.559   1.00 0.32 ? 28  ALA A O    1  
ATOM   410   C CB   . ALA A 1 28 ? -1.886  10.105  1.890   1.00 0.35 ? 28  ALA A CB   1  
ATOM   411   H H    . ALA A 1 28 ? 0.268   8.757   2.263   1.00 0.27 ? 28  ALA A H    1  
ATOM   412   H HA   . ALA A 1 28 ? -1.864  9.659   3.964   1.00 0.34 ? 28  ALA A HA   1  
ATOM   413   H HB1  . ALA A 1 28 ? -1.174  10.916  1.959   1.00 0.47 ? 28  ALA A HB1  1  
ATOM   414   H HB2  . ALA A 1 28 ? -2.888  10.504  1.944   1.00 0.50 ? 28  ALA A HB2  1  
ATOM   415   H HB3  . ALA A 1 28 ? -1.754  9.590   0.950   1.00 0.45 ? 28  ALA A HB3  1  
ATOM   416   N N    . MET A 1 29 ? -2.255  6.958   2.131   1.00 0.27 ? 29  MET A N    1  
ATOM   417   C CA   . MET A 1 29 ? -3.090  5.777   1.928   1.00 0.30 ? 29  MET A CA   1  
ATOM   418   C C    . MET A 1 29 ? -3.189  4.937   3.198   1.00 0.28 ? 29  MET A C    1  
ATOM   419   O O    . MET A 1 29 ? -4.236  4.363   3.494   1.00 0.31 ? 29  MET A O    1  
ATOM   420   C CB   . MET A 1 29 ? -2.535  4.925   0.787   1.00 0.34 ? 29  MET A CB   1  
ATOM   421   C CG   . MET A 1 29 ? -3.346  3.669   0.530   1.00 0.40 ? 29  MET A CG   1  
ATOM   422   S SD   . MET A 1 29 ? -2.601  2.591   -0.707  1.00 0.49 ? 29  MET A SD   1  
ATOM   423   C CE   . MET A 1 29 ? -1.070  2.145   0.109   1.00 0.52 ? 29  MET A CE   1  
ATOM   424   H H    . MET A 1 29 ? -1.396  7.023   1.657   1.00 0.27 ? 29  MET A H    1  
ATOM   425   H HA   . MET A 1 29 ? -4.082  6.113   1.660   1.00 0.34 ? 29  MET A HA   1  
ATOM   426   H HB2  . MET A 1 29 ? -2.525  5.513   -0.117  1.00 0.38 ? 29  MET A HB2  1  
ATOM   427   H HB3  . MET A 1 29 ? -1.524  4.629   1.030   1.00 0.34 ? 29  MET A HB3  1  
ATOM   428   H HG2  . MET A 1 29 ? -3.434  3.122   1.457   1.00 0.40 ? 29  MET A HG2  1  
ATOM   429   H HG3  . MET A 1 29 ? -4.330  3.958   0.191   1.00 0.49 ? 29  MET A HG3  1  
ATOM   430   H HE1  . MET A 1 29 ? -0.447  3.020   0.213   1.00 0.81 ? 29  MET A HE1  1  
ATOM   431   H HE2  . MET A 1 29 ? -0.551  1.402   -0.479  1.00 0.89 ? 29  MET A HE2  1  
ATOM   432   H HE3  . MET A 1 29 ? -1.289  1.741   1.086   1.00 0.86 ? 29  MET A HE3  1  
ATOM   433   N N    . LEU A 1 30 ? -2.096  4.869   3.946   1.00 0.29 ? 30  LEU A N    1  
ATOM   434   C CA   . LEU A 1 30 ? -2.060  4.094   5.184   1.00 0.32 ? 30  LEU A CA   1  
ATOM   435   C C    . LEU A 1 30 ? -3.114  4.582   6.174   1.00 0.30 ? 30  LEU A C    1  
ATOM   436   O O    . LEU A 1 30 ? -3.794  3.780   6.814   1.00 0.33 ? 30  LEU A O    1  
ATOM   437   C CB   . LEU A 1 30 ? -0.669  4.166   5.816   1.00 0.39 ? 30  LEU A CB   1  
ATOM   438   C CG   . LEU A 1 30 ? 0.222   2.946   5.566   1.00 0.78 ? 30  LEU A CG   1  
ATOM   439   C CD1  . LEU A 1 30 ? 0.232   2.576   4.090   1.00 1.32 ? 30  LEU A CD1  1  
ATOM   440   C CD2  . LEU A 1 30 ? 1.637   3.216   6.051   1.00 1.04 ? 30  LEU A CD2  1  
ATOM   441   H H    . LEU A 1 30 ? -1.284  5.341   3.651   1.00 0.29 ? 30  LEU A H    1  
ATOM   442   H HA   . LEU A 1 30 ? -2.276  3.066   4.933   1.00 0.36 ? 30  LEU A HA   1  
ATOM   443   H HB2  . LEU A 1 30 ? -0.165  5.040   5.429   1.00 0.71 ? 30  LEU A HB2  1  
ATOM   444   H HB3  . LEU A 1 30 ? -0.788  4.283   6.883   1.00 0.65 ? 30  LEU A HB3  1  
ATOM   445   H HG   . LEU A 1 30 ? -0.166  2.104   6.121   1.00 1.11 ? 30  LEU A HG   1  
ATOM   446   H HD11 . LEU A 1 30 ? 0.554   3.428   3.508   1.00 1.67 ? 30  LEU A HD11 1  
ATOM   447   H HD12 . LEU A 1 30 ? -0.760  2.286   3.783   1.00 1.61 ? 30  LEU A HD12 1  
ATOM   448   H HD13 . LEU A 1 30 ? 0.912   1.755   3.931   1.00 1.72 ? 30  LEU A HD13 1  
ATOM   449   H HD21 . LEU A 1 30 ? 2.258   2.355   5.850   1.00 1.49 ? 30  LEU A HD21 1  
ATOM   450   H HD22 . LEU A 1 30 ? 1.625   3.410   7.112   1.00 1.30 ? 30  LEU A HD22 1  
ATOM   451   H HD23 . LEU A 1 30 ? 2.038   4.075   5.531   1.00 1.27 ? 30  LEU A HD23 1  
ATOM   452   N N    . SER A 1 31 ? -3.256  5.896   6.286   1.00 0.29 ? 31  SER A N    1  
ATOM   453   C CA   . SER A 1 31 ? -4.233  6.483   7.191   1.00 0.32 ? 31  SER A CA   1  
ATOM   454   C C    . SER A 1 31 ? -5.654  6.160   6.726   1.00 0.28 ? 31  SER A C    1  
ATOM   455   O O    . SER A 1 31 ? -6.575  6.024   7.535   1.00 0.29 ? 31  SER A O    1  
ATOM   456   C CB   . SER A 1 31 ? -4.010  7.992   7.265   1.00 0.40 ? 31  SER A CB   1  
ATOM   457   O OG   . SER A 1 31 ? -2.623  8.282   7.337   1.00 1.20 ? 31  SER A OG   1  
ATOM   458   H H    . SER A 1 31 ? -2.688  6.488   5.750   1.00 0.31 ? 31  SER A H    1  
ATOM   459   H HA   . SER A 1 31 ? -4.081  6.054   8.170   1.00 0.36 ? 31  SER A HA   1  
ATOM   460   H HB2  . SER A 1 31 ? -4.419  8.460   6.383   1.00 0.94 ? 31  SER A HB2  1  
ATOM   461   H HB3  . SER A 1 31 ? -4.494  8.387   8.146   1.00 1.08 ? 31  SER A HB3  1  
ATOM   462   H HG   . SER A 1 31 ? -2.261  7.909   8.148   1.00 1.76 ? 31  SER A HG   1  
ATOM   463   N N    . LEU A 1 32 ? -5.818  6.005   5.419   1.00 0.27 ? 32  LEU A N    1  
ATOM   464   C CA   . LEU A 1 32 ? -7.116  5.683   4.841   1.00 0.29 ? 32  LEU A CA   1  
ATOM   465   C C    . LEU A 1 32 ? -7.526  4.268   5.243   1.00 0.26 ? 32  LEU A C    1  
ATOM   466   O O    . LEU A 1 32 ? -8.684  4.013   5.565   1.00 0.29 ? 32  LEU A O    1  
ATOM   467   C CB   . LEU A 1 32 ? -7.062  5.811   3.314   1.00 0.35 ? 32  LEU A CB   1  
ATOM   468   C CG   . LEU A 1 32 ? -8.278  6.476   2.650   1.00 0.67 ? 32  LEU A CG   1  
ATOM   469   C CD1  . LEU A 1 32 ? -9.514  5.596   2.764   1.00 1.15 ? 32  LEU A CD1  1  
ATOM   470   C CD2  . LEU A 1 32 ? -8.541  7.848   3.253   1.00 1.17 ? 32  LEU A CD2  1  
ATOM   471   H H    . LEU A 1 32 ? -5.042  6.105   4.827   1.00 0.29 ? 32  LEU A H    1  
ATOM   472   H HA   . LEU A 1 32 ? -7.838  6.382   5.232   1.00 0.32 ? 32  LEU A HA   1  
ATOM   473   H HB2  . LEU A 1 32 ? -6.184  6.383   3.058   1.00 0.51 ? 32  LEU A HB2  1  
ATOM   474   H HB3  . LEU A 1 32 ? -6.955  4.820   2.900   1.00 0.56 ? 32  LEU A HB3  1  
ATOM   475   H HG   . LEU A 1 32 ? -8.068  6.612   1.599   1.00 0.58 ? 32  LEU A HG   1  
ATOM   476   H HD11 . LEU A 1 32 ? -9.302  4.621   2.349   1.00 1.26 ? 32  LEU A HD11 1  
ATOM   477   H HD12 . LEU A 1 32 ? -10.330 6.048   2.222   1.00 1.47 ? 32  LEU A HD12 1  
ATOM   478   H HD13 . LEU A 1 32 ? -9.788  5.493   3.804   1.00 1.37 ? 32  LEU A HD13 1  
ATOM   479   H HD21 . LEU A 1 32 ? -9.285  8.362   2.663   1.00 1.52 ? 32  LEU A HD21 1  
ATOM   480   H HD22 . LEU A 1 32 ? -7.626  8.421   3.259   1.00 1.23 ? 32  LEU A HD22 1  
ATOM   481   H HD23 . LEU A 1 32 ? -8.901  7.734   4.265   1.00 1.41 ? 32  LEU A HD23 1  
ATOM   482   N N    . LEU A 1 33 ? -6.554  3.361   5.242   1.00 0.27 ? 33  LEU A N    1  
ATOM   483   C CA   . LEU A 1 33 ? -6.793  1.969   5.607   1.00 0.31 ? 33  LEU A CA   1  
ATOM   484   C C    . LEU A 1 33 ? -7.285  1.858   7.046   1.00 0.27 ? 33  LEU A C    1  
ATOM   485   O O    . LEU A 1 33 ? -8.162  1.051   7.361   1.00 0.33 ? 33  LEU A O    1  
ATOM   486   C CB   . LEU A 1 33 ? -5.509  1.155   5.439   1.00 0.41 ? 33  LEU A CB   1  
ATOM   487   C CG   . LEU A 1 33 ? -5.129  0.830   3.995   1.00 0.49 ? 33  LEU A CG   1  
ATOM   488   C CD1  . LEU A 1 33 ? -3.656  0.452   3.896   1.00 0.61 ? 33  LEU A CD1  1  
ATOM   489   C CD2  . LEU A 1 33 ? -6.004  -0.296  3.464   1.00 0.68 ? 33  LEU A CD2  1  
ATOM   490   H H    . LEU A 1 33 ? -5.646  3.635   4.983   1.00 0.29 ? 33  LEU A H    1  
ATOM   491   H HA   . LEU A 1 33 ? -7.552  1.574   4.948   1.00 0.35 ? 33  LEU A HA   1  
ATOM   492   H HB2  . LEU A 1 33 ? -4.697  1.713   5.884   1.00 0.42 ? 33  LEU A HB2  1  
ATOM   493   H HB3  . LEU A 1 33 ? -5.624  0.229   5.976   1.00 0.50 ? 33  LEU A HB3  1  
ATOM   494   H HG   . LEU A 1 33 ? -5.292  1.702   3.378   1.00 0.46 ? 33  LEU A HG   1  
ATOM   495   H HD11 . LEU A 1 33 ? -3.407  0.223   2.870   1.00 1.08 ? 33  LEU A HD11 1  
ATOM   496   H HD12 . LEU A 1 33 ? -3.466  -0.416  4.512   1.00 1.05 ? 33  LEU A HD12 1  
ATOM   497   H HD13 . LEU A 1 33 ? -3.049  1.275   4.238   1.00 1.03 ? 33  LEU A HD13 1  
ATOM   498   H HD21 . LEU A 1 33 ? -5.907  -1.159  4.107   1.00 1.04 ? 33  LEU A HD21 1  
ATOM   499   H HD22 . LEU A 1 33 ? -5.691  -0.554  2.465   1.00 0.99 ? 33  LEU A HD22 1  
ATOM   500   H HD23 . LEU A 1 33 ? -7.034  0.026   3.445   1.00 0.89 ? 33  LEU A HD23 1  
ATOM   501   N N    . GLN A 1 34 ? -6.713  2.682   7.911   1.00 0.26 ? 34  GLN A N    1  
ATOM   502   C CA   . GLN A 1 34 ? -7.075  2.683   9.318   1.00 0.31 ? 34  GLN A CA   1  
ATOM   503   C C    . GLN A 1 34 ? -8.428  3.353   9.551   1.00 0.29 ? 34  GLN A C    1  
ATOM   504   O O    . GLN A 1 34 ? -9.269  2.821   10.277  1.00 0.38 ? 34  GLN A O    1  
ATOM   505   C CB   . GLN A 1 34 ? -5.994  3.390   10.132  1.00 0.42 ? 34  GLN A CB   1  
ATOM   506   C CG   . GLN A 1 34 ? -4.772  2.527   10.392  1.00 0.72 ? 34  GLN A CG   1  
ATOM   507   C CD   . GLN A 1 34 ? -3.590  3.328   10.896  1.00 1.04 ? 34  GLN A CD   1  
ATOM   508   O OE1  . GLN A 1 34 ? -3.378  4.473   10.493  1.00 1.62 ? 34  GLN A OE1  1  
ATOM   509   N NE2  . GLN A 1 34 ? -2.817  2.732   11.791  1.00 1.51 ? 34  GLN A NE2  1  
ATOM   510   H H    . GLN A 1 34 ? -6.026  3.304   7.592   1.00 0.29 ? 34  GLN A H    1  
ATOM   511   H HA   . GLN A 1 34 ? -7.137  1.655   9.642   1.00 0.36 ? 34  GLN A HA   1  
ATOM   512   H HB2  . GLN A 1 34 ? -5.677  4.273   9.597   1.00 0.67 ? 34  GLN A HB2  1  
ATOM   513   H HB3  . GLN A 1 34 ? -6.411  3.686   11.084  1.00 0.61 ? 34  GLN A HB3  1  
ATOM   514   H HG2  . GLN A 1 34 ? -5.024  1.785   11.134  1.00 1.27 ? 34  GLN A HG2  1  
ATOM   515   H HG3  . GLN A 1 34 ? -4.490  2.034   9.473   1.00 1.25 ? 34  GLN A HG3  1  
ATOM   516   H HE21 . GLN A 1 34 ? -3.053  1.820   12.077  1.00 1.73 ? 34  GLN A HE21 1  
ATOM   517   H HE22 . GLN A 1 34 ? -2.049  3.228   12.145  1.00 1.94 ? 34  GLN A HE22 1  
ATOM   518   N N    . LYS A 1 35 ? -8.644  4.508   8.926   1.00 0.29 ? 35  LYS A N    1  
ATOM   519   C CA   . LYS A 1 35 ? -9.900  5.239   9.094   1.00 0.37 ? 35  LYS A CA   1  
ATOM   520   C C    . LYS A 1 35 ? -11.091 4.433   8.570   1.00 0.32 ? 35  LYS A C    1  
ATOM   521   O O    . LYS A 1 35 ? -12.200 4.544   9.088   1.00 0.36 ? 35  LYS A O    1  
ATOM   522   C CB   . LYS A 1 35 ? -9.832  6.616   8.411   1.00 0.50 ? 35  LYS A CB   1  
ATOM   523   C CG   . LYS A 1 35 ? -10.175 6.607   6.927   1.00 0.67 ? 35  LYS A CG   1  
ATOM   524   C CD   . LYS A 1 35 ? -11.381 7.483   6.631   1.00 0.77 ? 35  LYS A CD   1  
ATOM   525   C CE   . LYS A 1 35 ? -11.843 7.341   5.190   1.00 1.00 ? 35  LYS A CE   1  
ATOM   526   N NZ   . LYS A 1 35 ? -12.946 8.282   4.867   1.00 1.37 ? 35  LYS A NZ   1  
ATOM   527   H H    . LYS A 1 35 ? -7.942  4.884   8.347   1.00 0.33 ? 35  LYS A H    1  
ATOM   528   H HA   . LYS A 1 35 ? -10.041 5.391   10.153  1.00 0.45 ? 35  LYS A HA   1  
ATOM   529   H HB2  . LYS A 1 35 ? -10.521 7.285   8.909   1.00 0.88 ? 35  LYS A HB2  1  
ATOM   530   H HB3  . LYS A 1 35 ? -8.831  7.004   8.521   1.00 1.00 ? 35  LYS A HB3  1  
ATOM   531   H HG2  . LYS A 1 35 ? -9.328  6.978   6.370   1.00 1.20 ? 35  LYS A HG2  1  
ATOM   532   H HG3  . LYS A 1 35 ? -10.392 5.592   6.626   1.00 1.10 ? 35  LYS A HG3  1  
ATOM   533   H HD2  . LYS A 1 35 ? -12.192 7.194   7.284   1.00 1.19 ? 35  LYS A HD2  1  
ATOM   534   H HD3  . LYS A 1 35 ? -11.118 8.514   6.818   1.00 1.15 ? 35  LYS A HD3  1  
ATOM   535   H HE2  . LYS A 1 35 ? -11.007 7.539   4.533   1.00 1.52 ? 35  LYS A HE2  1  
ATOM   536   H HE3  . LYS A 1 35 ? -12.189 6.330   5.035   1.00 1.60 ? 35  LYS A HE3  1  
ATOM   537   H HZ1  . LYS A 1 35 ? -13.735 8.152   5.532   1.00 1.85 ? 35  LYS A HZ1  1  
ATOM   538   H HZ2  . LYS A 1 35 ? -13.295 8.112   3.902   1.00 1.75 ? 35  LYS A HZ2  1  
ATOM   539   H HZ3  . LYS A 1 35 ? -12.612 9.264   4.932   1.00 1.76 ? 35  LYS A HZ3  1  
ATOM   540   N N    . GLU A 1 36 ? -10.855 3.601   7.563   1.00 0.29 ? 36  GLU A N    1  
ATOM   541   C CA   . GLU A 1 36 ? -11.914 2.781   6.989   1.00 0.31 ? 36  GLU A CA   1  
ATOM   542   C C    . GLU A 1 36 ? -12.123 1.508   7.797   1.00 0.29 ? 36  GLU A C    1  
ATOM   543   O O    . GLU A 1 36 ? -13.009 0.713   7.490   1.00 0.39 ? 36  GLU A O    1  
ATOM   544   C CB   . GLU A 1 36 ? -11.593 2.429   5.538   1.00 0.37 ? 36  GLU A CB   1  
ATOM   545   C CG   . GLU A 1 36 ? -11.943 3.535   4.559   1.00 0.43 ? 36  GLU A CG   1  
ATOM   546   C CD   . GLU A 1 36 ? -13.429 3.823   4.516   1.00 0.64 ? 36  GLU A CD   1  
ATOM   547   O OE1  . GLU A 1 36 ? -14.151 3.138   3.762   1.00 1.30 ? 36  GLU A OE1  1  
ATOM   548   O OE2  . GLU A 1 36 ? -13.885 4.738   5.234   1.00 1.21 ? 36  GLU A OE2  1  
ATOM   549   H H    . GLU A 1 36 ? -9.948  3.541   7.190   1.00 0.32 ? 36  GLU A H    1  
ATOM   550   H HA   . GLU A 1 36 ? -12.826 3.360   7.012   1.00 0.38 ? 36  GLU A HA   1  
ATOM   551   H HB2  . GLU A 1 36 ? -10.535 2.224   5.456   1.00 0.40 ? 36  GLU A HB2  1  
ATOM   552   H HB3  . GLU A 1 36 ? -12.146 1.542   5.264   1.00 0.47 ? 36  GLU A HB3  1  
ATOM   553   H HG2  . GLU A 1 36 ? -11.426 4.433   4.859   1.00 0.46 ? 36  GLU A HG2  1  
ATOM   554   H HG3  . GLU A 1 36 ? -11.615 3.245   3.573   1.00 0.50 ? 36  GLU A HG3  1  
ATOM   555   N N    . GLY A 1 37 ? -11.300 1.312   8.822   1.00 0.27 ? 37  GLY A N    1  
ATOM   556   C CA   . GLY A 1 37 ? -11.421 0.132   9.659   1.00 0.30 ? 37  GLY A CA   1  
ATOM   557   C C    . GLY A 1 37 ? -11.022 -1.138  8.936   1.00 0.29 ? 37  GLY A C    1  
ATOM   558   O O    . GLY A 1 37 ? -11.509 -2.225  9.256   1.00 0.41 ? 37  GLY A O    1  
ATOM   559   H H    . GLY A 1 37 ? -10.604 1.978   9.017   1.00 0.30 ? 37  GLY A H    1  
ATOM   560   H HA2  . GLY A 1 37 ? -10.785 0.251   10.524  1.00 0.33 ? 37  GLY A HA2  1  
ATOM   561   H HA3  . GLY A 1 37 ? -12.444 0.038   9.989   1.00 0.35 ? 37  GLY A HA3  1  
ATOM   562   N N    . LEU A 1 38 ? -10.144 -1.004  7.950   1.00 0.25 ? 38  LEU A N    1  
ATOM   563   C CA   . LEU A 1 38 ? -9.683  -2.151  7.186   1.00 0.28 ? 38  LEU A CA   1  
ATOM   564   C C    . LEU A 1 38 ? -8.532  -2.823  7.915   1.00 0.32 ? 38  LEU A C    1  
ATOM   565   O O    . LEU A 1 38 ? -8.449  -4.051  7.971   1.00 0.46 ? 38  LEU A O    1  
ATOM   566   C CB   . LEU A 1 38 ? -9.243  -1.731  5.782   1.00 0.31 ? 38  LEU A CB   1  
ATOM   567   C CG   . LEU A 1 38 ? -10.374 -1.265  4.863   1.00 0.40 ? 38  LEU A CG   1  
ATOM   568   C CD1  . LEU A 1 38 ? -9.809  -0.727  3.560   1.00 0.51 ? 38  LEU A CD1  1  
ATOM   569   C CD2  . LEU A 1 38 ? -11.350 -2.402  4.587   1.00 0.50 ? 38  LEU A CD2  1  
ATOM   570   H H    . LEU A 1 38 ? -9.793  -0.114  7.739   1.00 0.29 ? 38  LEU A H    1  
ATOM   571   H HA   . LEU A 1 38 ? -10.505 -2.849  7.105   1.00 0.34 ? 38  LEU A HA   1  
ATOM   572   H HB2  . LEU A 1 38 ? -8.528  -0.924  5.877   1.00 0.34 ? 38  LEU A HB2  1  
ATOM   573   H HB3  . LEU A 1 38 ? -8.752  -2.572  5.316   1.00 0.35 ? 38  LEU A HB3  1  
ATOM   574   H HG   . LEU A 1 38 ? -10.916 -0.466  5.349   1.00 0.47 ? 38  LEU A HG   1  
ATOM   575   H HD11 . LEU A 1 38 ? -9.176  -1.475  3.105   1.00 0.74 ? 38  LEU A HD11 1  
ATOM   576   H HD12 . LEU A 1 38 ? -9.232  0.163   3.757   1.00 0.78 ? 38  LEU A HD12 1  
ATOM   577   H HD13 . LEU A 1 38 ? -10.623 -0.488  2.890   1.00 0.79 ? 38  LEU A HD13 1  
ATOM   578   H HD21 . LEU A 1 38 ? -11.878 -2.650  5.496   1.00 0.77 ? 38  LEU A HD21 1  
ATOM   579   H HD22 . LEU A 1 38 ? -10.806 -3.267  4.241   1.00 0.67 ? 38  LEU A HD22 1  
ATOM   580   H HD23 . LEU A 1 38 ? -12.058 -2.095  3.832   1.00 0.68 ? 38  LEU A HD23 1  
ATOM   581   N N    . LEU A 1 39 ? -7.655  -2.005  8.481   1.00 0.31 ? 39  LEU A N    1  
ATOM   582   C CA   . LEU A 1 39 ? -6.501  -2.501  9.218   1.00 0.40 ? 39  LEU A CA   1  
ATOM   583   C C    . LEU A 1 39 ? -6.316  -1.704  10.500  1.00 0.39 ? 39  LEU A C    1  
ATOM   584   O O    . LEU A 1 39 ? -6.597  -0.503  10.539  1.00 0.57 ? 39  LEU A O    1  
ATOM   585   C CB   . LEU A 1 39 ? -5.230  -2.407  8.371   1.00 0.53 ? 39  LEU A CB   1  
ATOM   586   C CG   . LEU A 1 39 ? -5.168  -3.348  7.164   1.00 0.67 ? 39  LEU A CG   1  
ATOM   587   C CD1  . LEU A 1 39 ? -3.857  -3.162  6.421   1.00 0.86 ? 39  LEU A CD1  1  
ATOM   588   C CD2  . LEU A 1 39 ? -5.335  -4.797  7.600   1.00 0.75 ? 39  LEU A CD2  1  
ATOM   589   H H    . LEU A 1 39 ? -7.790  -1.034  8.408   1.00 0.31 ? 39  LEU A H    1  
ATOM   590   H HA   . LEU A 1 39 ? -6.686  -3.535  9.468   1.00 0.47 ? 39  LEU A HA   1  
ATOM   591   H HB2  . LEU A 1 39 ? -5.141  -1.393  8.010   1.00 0.56 ? 39  LEU A HB2  1  
ATOM   592   H HB3  . LEU A 1 39 ? -4.385  -2.620  9.010   1.00 0.63 ? 39  LEU A HB3  1  
ATOM   593   H HG   . LEU A 1 39 ? -5.975  -3.105  6.487   1.00 0.67 ? 39  LEU A HG   1  
ATOM   594   H HD11 . LEU A 1 39 ? -3.034  -3.285  7.107   1.00 1.10 ? 39  LEU A HD11 1  
ATOM   595   H HD12 . LEU A 1 39 ? -3.825  -2.172  5.991   1.00 1.10 ? 39  LEU A HD12 1  
ATOM   596   H HD13 . LEU A 1 39 ? -3.782  -3.899  5.634   1.00 1.09 ? 39  LEU A HD13 1  
ATOM   597   H HD21 . LEU A 1 39 ? -4.969  -5.449  6.823   1.00 1.19 ? 39  LEU A HD21 1  
ATOM   598   H HD22 . LEU A 1 39 ? -6.381  -5.000  7.777   1.00 1.13 ? 39  LEU A HD22 1  
ATOM   599   H HD23 . LEU A 1 39 ? -4.775  -4.969  8.508   1.00 1.12 ? 39  LEU A HD23 1  
ATOM   600   N N    . MET A 1 40 ? -5.848  -2.369  11.545  1.00 0.35 ? 40  MET A N    1  
ATOM   601   C CA   . MET A 1 40 ? -5.632  -1.714  12.824  1.00 0.41 ? 40  MET A CA   1  
ATOM   602   C C    . MET A 1 40 ? -4.300  -0.976  12.828  1.00 0.37 ? 40  MET A C    1  
ATOM   603   O O    . MET A 1 40 ? -4.225  0.186   13.226  1.00 0.53 ? 40  MET A O    1  
ATOM   604   C CB   . MET A 1 40 ? -5.670  -2.735  13.964  1.00 0.54 ? 40  MET A CB   1  
ATOM   605   C CG   . MET A 1 40 ? -5.687  -2.102  15.348  1.00 0.70 ? 40  MET A CG   1  
ATOM   606   S SD   . MET A 1 40 ? -5.453  -3.308  16.665  1.00 0.94 ? 40  MET A SD   1  
ATOM   607   C CE   . MET A 1 40 ? -3.697  -3.628  16.516  1.00 1.19 ? 40  MET A CE   1  
ATOM   608   H H    . MET A 1 40 ? -5.652  -3.328  11.454  1.00 0.44 ? 40  MET A H    1  
ATOM   609   H HA   . MET A 1 40 ? -6.425  -0.997  12.970  1.00 0.50 ? 40  MET A HA   1  
ATOM   610   H HB2  . MET A 1 40 ? -6.556  -3.344  13.860  1.00 0.62 ? 40  MET A HB2  1  
ATOM   611   H HB3  . MET A 1 40 ? -4.799  -3.369  13.894  1.00 0.55 ? 40  MET A HB3  1  
ATOM   612   H HG2  . MET A 1 40 ? -4.896  -1.372  15.406  1.00 0.73 ? 40  MET A HG2  1  
ATOM   613   H HG3  . MET A 1 40 ? -6.639  -1.616  15.495  1.00 0.78 ? 40  MET A HG3  1  
ATOM   614   H HE1  . MET A 1 40 ? -3.148  -2.734  16.766  1.00 1.40 ? 40  MET A HE1  1  
ATOM   615   H HE2  . MET A 1 40 ? -3.468  -3.921  15.503  1.00 1.50 ? 40  MET A HE2  1  
ATOM   616   H HE3  . MET A 1 40 ? -3.416  -4.423  17.191  1.00 1.50 ? 40  MET A HE3  1  
ATOM   617   N N    . SER A 1 41 ? -3.255  -1.646  12.365  1.00 0.33 ? 41  SER A N    1  
ATOM   618   C CA   . SER A 1 41 ? -1.933  -1.049  12.330  1.00 0.39 ? 41  SER A CA   1  
ATOM   619   C C    . SER A 1 41 ? -1.324  -1.164  10.931  1.00 0.34 ? 41  SER A C    1  
ATOM   620   O O    . SER A 1 41 ? -1.680  -2.061  10.168  1.00 0.31 ? 41  SER A O    1  
ATOM   621   C CB   . SER A 1 41 ? -1.030  -1.728  13.366  1.00 0.50 ? 41  SER A CB   1  
ATOM   622   O OG   . SER A 1 41 ? -1.185  -3.141  13.350  1.00 0.87 ? 41  SER A OG   1  
ATOM   623   H H    . SER A 1 41 ? -3.376  -2.564  12.030  1.00 0.38 ? 41  SER A H    1  
ATOM   624   H HA   . SER A 1 41 ? -2.036  -0.004  12.582  1.00 0.51 ? 41  SER A HA   1  
ATOM   625   H HB2  . SER A 1 41 ? 0.002   -1.494  13.150  1.00 0.83 ? 41  SER A HB2  1  
ATOM   626   H HB3  . SER A 1 41 ? -1.281  -1.365  14.352  1.00 0.81 ? 41  SER A HB3  1  
ATOM   627   H HG   . SER A 1 41 ? -1.884  -3.390  12.719  1.00 1.39 ? 41  SER A HG   1  
ATOM   628   N N    . PRO A 1 42 ? -0.401  -0.260  10.572  1.00 0.43 ? 42  PRO A N    1  
ATOM   629   C CA   . PRO A 1 42 ? 0.262   -0.288  9.259   1.00 0.47 ? 42  PRO A CA   1  
ATOM   630   C C    . PRO A 1 42 ? 1.082   -1.563  9.066   1.00 0.43 ? 42  PRO A C    1  
ATOM   631   O O    . PRO A 1 42 ? 1.308   -2.014  7.943   1.00 0.54 ? 42  PRO A O    1  
ATOM   632   C CB   . PRO A 1 42 ? 1.171   0.943   9.284   1.00 0.61 ? 42  PRO A CB   1  
ATOM   633   C CG   . PRO A 1 42 ? 1.336   1.282   10.725  1.00 0.65 ? 42  PRO A CG   1  
ATOM   634   C CD   . PRO A 1 42 ? 0.064   0.864   11.403  1.00 0.57 ? 42  PRO A CD   1  
ATOM   635   H HA   . PRO A 1 42 ? -0.450  -0.198  8.452   1.00 0.51 ? 42  PRO A HA   1  
ATOM   636   H HB2  . PRO A 1 42 ? 2.123   0.704   8.831   1.00 0.65 ? 42  PRO A HB2  1  
ATOM   637   H HB3  . PRO A 1 42 ? 0.704   1.761   8.762   1.00 0.73 ? 42  PRO A HB3  1  
ATOM   638   H HG2  . PRO A 1 42 ? 2.177   0.737   11.132  1.00 0.67 ? 42  PRO A HG2  1  
ATOM   639   H HG3  . PRO A 1 42 ? 1.484   2.345   10.839  1.00 0.81 ? 42  PRO A HG3  1  
ATOM   640   H HD2  . PRO A 1 42 ? 0.265   0.542   12.416  1.00 0.58 ? 42  PRO A HD2  1  
ATOM   641   H HD3  . PRO A 1 42 ? -0.654  1.672   11.400  1.00 0.68 ? 42  PRO A HD3  1  
ATOM   642   N N    . SER A 1 43 ? 1.502   -2.151  10.178  1.00 0.36 ? 43  SER A N    1  
ATOM   643   C CA   . SER A 1 43 ? 2.283   -3.377  10.160  1.00 0.41 ? 43  SER A CA   1  
ATOM   644   C C    . SER A 1 43 ? 1.426   -4.571  9.730   1.00 0.36 ? 43  SER A C    1  
ATOM   645   O O    . SER A 1 43 ? 1.943   -5.651  9.455   1.00 0.40 ? 43  SER A O    1  
ATOM   646   C CB   . SER A 1 43 ? 2.880   -3.623  11.544  1.00 0.54 ? 43  SER A CB   1  
ATOM   647   O OG   . SER A 1 43 ? 3.266   -2.394  12.142  1.00 0.69 ? 43  SER A OG   1  
ATOM   648   H H    . SER A 1 43 ? 1.290   -1.740  11.044  1.00 0.38 ? 43  SER A H    1  
ATOM   649   H HA   . SER A 1 43 ? 3.085   -3.250  9.449   1.00 0.49 ? 43  SER A HA   1  
ATOM   650   H HB2  . SER A 1 43 ? 2.145   -4.101  12.172  1.00 0.70 ? 43  SER A HB2  1  
ATOM   651   H HB3  . SER A 1 43 ? 3.750   -4.256  11.455  1.00 0.75 ? 43  SER A HB3  1  
ATOM   652   H HG   . SER A 1 43 ? 3.653   -2.569  13.009  1.00 1.10 ? 43  SER A HG   1  
ATOM   653   N N    . ASP A 1 44 ? 0.111   -4.364  9.649   1.00 0.32 ? 44  ASP A N    1  
ATOM   654   C CA   . ASP A 1 44 ? -0.810  -5.422  9.244   1.00 0.32 ? 44  ASP A CA   1  
ATOM   655   C C    . ASP A 1 44 ? -0.639  -5.745  7.764   1.00 0.29 ? 44  ASP A C    1  
ATOM   656   O O    . ASP A 1 44 ? -1.142  -6.758  7.274   1.00 0.31 ? 44  ASP A O    1  
ATOM   657   C CB   . ASP A 1 44 ? -2.262  -5.018  9.512   1.00 0.39 ? 44  ASP A CB   1  
ATOM   658   C CG   . ASP A 1 44 ? -2.716  -5.346  10.918  1.00 0.54 ? 44  ASP A CG   1  
ATOM   659   O OD1  . ASP A 1 44 ? -2.915  -6.547  11.216  1.00 0.87 ? 44  ASP A OD1  1  
ATOM   660   O OD2  . ASP A 1 44 ? -2.885  -4.407  11.731  1.00 0.69 ? 44  ASP A OD2  1  
ATOM   661   H H    . ASP A 1 44 ? -0.251  -3.478  9.868   1.00 0.35 ? 44  ASP A H    1  
ATOM   662   H HA   . ASP A 1 44 ? -0.576  -6.303  9.822   1.00 0.40 ? 44  ASP A HA   1  
ATOM   663   H HB2  . ASP A 1 44 ? -2.363  -3.954  9.362   1.00 0.46 ? 44  ASP A HB2  1  
ATOM   664   H HB3  . ASP A 1 44 ? -2.903  -5.538  8.816   1.00 0.52 ? 44  ASP A HB3  1  
ATOM   665   N N    . LEU A 1 45 ? 0.092   -4.884  7.064   1.00 0.31 ? 45  LEU A N    1  
ATOM   666   C CA   . LEU A 1 45 ? 0.348   -5.054  5.637   1.00 0.36 ? 45  LEU A CA   1  
ATOM   667   C C    . LEU A 1 45 ? 1.207   -6.289  5.373   1.00 0.34 ? 45  LEU A C    1  
ATOM   668   O O    . LEU A 1 45 ? 1.286   -6.766  4.242   1.00 0.38 ? 45  LEU A O    1  
ATOM   669   C CB   . LEU A 1 45 ? 1.036   -3.809  5.066   1.00 0.45 ? 45  LEU A CB   1  
ATOM   670   C CG   . LEU A 1 45 ? 0.266   -3.079  3.962   1.00 0.60 ? 45  LEU A CG   1  
ATOM   671   C CD1  . LEU A 1 45 ? 0.060   -3.982  2.756   1.00 0.96 ? 45  LEU A CD1  1  
ATOM   672   C CD2  . LEU A 1 45 ? -1.069  -2.580  4.485   1.00 0.98 ? 45  LEU A CD2  1  
ATOM   673   H H    . LEU A 1 45 ? 0.466   -4.103  7.521   1.00 0.35 ? 45  LEU A H    1  
ATOM   674   H HA   . LEU A 1 45 ? -0.603  -5.182  5.146   1.00 0.41 ? 45  LEU A HA   1  
ATOM   675   H HB2  . LEU A 1 45 ? 1.203   -3.114  5.876   1.00 0.60 ? 45  LEU A HB2  1  
ATOM   676   H HB3  . LEU A 1 45 ? 1.995   -4.105  4.668   1.00 0.54 ? 45  LEU A HB3  1  
ATOM   677   H HG   . LEU A 1 45 ? 0.838   -2.223  3.640   1.00 0.84 ? 45  LEU A HG   1  
ATOM   678   H HD11 . LEU A 1 45 ? 1.013   -4.364  2.426   1.00 1.37 ? 45  LEU A HD11 1  
ATOM   679   H HD12 . LEU A 1 45 ? -0.397  -3.416  1.959   1.00 1.34 ? 45  LEU A HD12 1  
ATOM   680   H HD13 . LEU A 1 45 ? -0.585  -4.805  3.029   1.00 1.38 ? 45  LEU A HD13 1  
ATOM   681   H HD21 . LEU A 1 45 ? -1.531  -1.943  3.745   1.00 1.28 ? 45  LEU A HD21 1  
ATOM   682   H HD22 . LEU A 1 45 ? -0.913  -2.020  5.394   1.00 1.36 ? 45  LEU A HD22 1  
ATOM   683   H HD23 . LEU A 1 45 ? -1.712  -3.423  4.686   1.00 1.37 ? 45  LEU A HD23 1  
ATOM   684   N N    . TYR A 1 46 ? 1.842   -6.813  6.419   1.00 0.32 ? 46  TYR A N    1  
ATOM   685   C CA   . TYR A 1 46 ? 2.686   -7.992  6.283   1.00 0.37 ? 46  TYR A CA   1  
ATOM   686   C C    . TYR A 1 46 ? 1.832   -9.257  6.191   1.00 0.34 ? 46  TYR A C    1  
ATOM   687   O O    . TYR A 1 46 ? 2.354   -10.358 5.998   1.00 0.44 ? 46  TYR A O    1  
ATOM   688   C CB   . TYR A 1 46 ? 3.664   -8.093  7.457   1.00 0.47 ? 46  TYR A CB   1  
ATOM   689   C CG   . TYR A 1 46 ? 4.580   -6.891  7.587   1.00 0.55 ? 46  TYR A CG   1  
ATOM   690   C CD1  . TYR A 1 46 ? 5.167   -6.314  6.466   1.00 0.87 ? 46  TYR A CD1  1  
ATOM   691   C CD2  . TYR A 1 46 ? 4.850   -6.328  8.829   1.00 0.64 ? 46  TYR A CD2  1  
ATOM   692   C CE1  . TYR A 1 46 ? 5.991   -5.215  6.577   1.00 1.01 ? 46  TYR A CE1  1  
ATOM   693   C CE2  . TYR A 1 46 ? 5.676   -5.227  8.947   1.00 0.76 ? 46  TYR A CE2  1  
ATOM   694   C CZ   . TYR A 1 46 ? 6.243   -4.672  7.820   1.00 0.86 ? 46  TYR A CZ   1  
ATOM   695   O OH   . TYR A 1 46 ? 7.066   -3.572  7.936   1.00 1.05 ? 46  TYR A OH   1  
ATOM   696   H H    . TYR A 1 46 ? 1.737   -6.396  7.300   1.00 0.33 ? 46  TYR A H    1  
ATOM   697   H HA   . TYR A 1 46 ? 3.248   -7.889  5.367   1.00 0.43 ? 46  TYR A HA   1  
ATOM   698   H HB2  . TYR A 1 46 ? 3.105   -8.184  8.376   1.00 0.46 ? 46  TYR A HB2  1  
ATOM   699   H HB3  . TYR A 1 46 ? 4.280   -8.972  7.328   1.00 0.61 ? 46  TYR A HB3  1  
ATOM   700   H HD1  . TYR A 1 46 ? 4.968   -6.737  5.493   1.00 1.12 ? 46  TYR A HD1  1  
ATOM   701   H HD2  . TYR A 1 46 ? 4.408   -6.764  9.712   1.00 0.84 ? 46  TYR A HD2  1  
ATOM   702   H HE1  . TYR A 1 46 ? 6.435   -4.787  5.693   1.00 1.34 ? 46  TYR A HE1  1  
ATOM   703   H HE2  . TYR A 1 46 ? 5.871   -4.803  9.920   1.00 0.97 ? 46  TYR A HE2  1  
ATOM   704   H HH   . TYR A 1 46 ? 6.941   -2.997  7.174   1.00 1.14 ? 46  TYR A HH   1  
ATOM   705   N N    . SER A 1 47 ? 0.518   -9.088  6.334   1.00 0.31 ? 47  SER A N    1  
ATOM   706   C CA   . SER A 1 47 ? -0.421  -10.197 6.248   1.00 0.29 ? 47  SER A CA   1  
ATOM   707   C C    . SER A 1 47 ? -0.966  -10.295 4.826   1.00 0.24 ? 47  SER A C    1  
ATOM   708   O O    . SER A 1 47 ? -1.795  -9.478  4.419   1.00 0.26 ? 47  SER A O    1  
ATOM   709   C CB   . SER A 1 47 ? -1.572  -9.997  7.240   1.00 0.36 ? 47  SER A CB   1  
ATOM   710   O OG   . SER A 1 47 ? -1.080  -9.657  8.526   1.00 0.53 ? 47  SER A OG   1  
ATOM   711   H H    . SER A 1 47 ? 0.170   -8.185  6.490   1.00 0.37 ? 47  SER A H    1  
ATOM   712   H HA   . SER A 1 47 ? 0.106   -11.104 6.489   1.00 0.33 ? 47  SER A HA   1  
ATOM   713   H HB2  . SER A 1 47 ? -2.209  -9.199  6.890   1.00 0.43 ? 47  SER A HB2  1  
ATOM   714   H HB3  . SER A 1 47 ? -2.144  -10.908 7.314   1.00 0.44 ? 47  SER A HB3  1  
ATOM   715   H HG   . SER A 1 47 ? -0.398  -8.980  8.438   1.00 1.10 ? 47  SER A HG   1  
ATOM   716   N N    . PRO A 1 48 ? -0.516  -11.300 4.053   1.00 0.24 ? 48  PRO A N    1  
ATOM   717   C CA   . PRO A 1 48 ? -0.943  -11.480 2.659   1.00 0.25 ? 48  PRO A CA   1  
ATOM   718   C C    . PRO A 1 48 ? -2.413  -11.864 2.524   1.00 0.26 ? 48  PRO A C    1  
ATOM   719   O O    . PRO A 1 48 ? -3.050  -11.570 1.511   1.00 0.32 ? 48  PRO A O    1  
ATOM   720   C CB   . PRO A 1 48 ? -0.040  -12.606 2.145   1.00 0.31 ? 48  PRO A CB   1  
ATOM   721   C CG   . PRO A 1 48 ? 0.404   -13.344 3.357   1.00 0.38 ? 48  PRO A CG   1  
ATOM   722   C CD   . PRO A 1 48 ? 0.439   -12.342 4.479   1.00 0.32 ? 48  PRO A CD   1  
ATOM   723   H HA   . PRO A 1 48 ? -0.764  -10.587 2.079   1.00 0.26 ? 48  PRO A HA   1  
ATOM   724   H HB2  . PRO A 1 48 ? -0.602  -13.254 1.481   1.00 0.38 ? 48  PRO A HB2  1  
ATOM   725   H HB3  . PRO A 1 48 ? 0.813   -12.191 1.631   1.00 0.38 ? 48  PRO A HB3  1  
ATOM   726   H HG2  . PRO A 1 48 ? -0.297  -14.136 3.581   1.00 0.50 ? 48  PRO A HG2  1  
ATOM   727   H HG3  . PRO A 1 48 ? 1.390   -13.750 3.198   1.00 0.52 ? 48  PRO A HG3  1  
ATOM   728   H HD2  . PRO A 1 48 ? 0.119   -12.802 5.401   1.00 0.38 ? 48  PRO A HD2  1  
ATOM   729   H HD3  . PRO A 1 48 ? 1.434   -11.933 4.584   1.00 0.38 ? 48  PRO A HD3  1  
ATOM   730   N N    . GLY A 1 49 ? -2.954  -12.505 3.550   1.00 0.28 ? 49  GLY A N    1  
ATOM   731   C CA   . GLY A 1 49 ? -4.342  -12.916 3.511   1.00 0.33 ? 49  GLY A CA   1  
ATOM   732   C C    . GLY A 1 49 ? -5.300  -11.745 3.630   1.00 0.32 ? 49  GLY A C    1  
ATOM   733   O O    . GLY A 1 49 ? -6.403  -11.777 3.081   1.00 0.50 ? 49  GLY A O    1  
ATOM   734   H H    . GLY A 1 49 ? -2.406  -12.700 4.341   1.00 0.30 ? 49  GLY A H    1  
ATOM   735   H HA2  . GLY A 1 49 ? -4.529  -13.425 2.578   1.00 0.35 ? 49  GLY A HA2  1  
ATOM   736   H HA3  . GLY A 1 49 ? -4.526  -13.602 4.325   1.00 0.38 ? 49  GLY A HA3  1  
ATOM   737   N N    . SER A 1 50 ? -4.868  -10.698 4.322   1.00 0.25 ? 50  SER A N    1  
ATOM   738   C CA   . SER A 1 50 ? -5.695  -9.516  4.524   1.00 0.27 ? 50  SER A CA   1  
ATOM   739   C C    . SER A 1 50 ? -5.716  -8.612  3.285   1.00 0.22 ? 50  SER A C    1  
ATOM   740   O O    . SER A 1 50 ? -6.482  -7.650  3.229   1.00 0.28 ? 50  SER A O    1  
ATOM   741   C CB   . SER A 1 50 ? -5.188  -8.729  5.736   1.00 0.35 ? 50  SER A CB   1  
ATOM   742   O OG   . SER A 1 50 ? -5.007  -9.580  6.862   1.00 0.47 ? 50  SER A OG   1  
ATOM   743   H H    . SER A 1 50 ? -3.972  -10.722 4.713   1.00 0.31 ? 50  SER A H    1  
ATOM   744   H HA   . SER A 1 50 ? -6.703  -9.850  4.725   1.00 0.32 ? 50  SER A HA   1  
ATOM   745   H HB2  . SER A 1 50 ? -4.241  -8.272  5.493   1.00 0.45 ? 50  SER A HB2  1  
ATOM   746   H HB3  . SER A 1 50 ? -5.903  -7.961  5.991   1.00 0.45 ? 50  SER A HB3  1  
ATOM   747   H HG   . SER A 1 50 ? -4.632  -9.069  7.592   1.00 0.93 ? 50  SER A HG   1  
ATOM   748   N N    . TRP A 1 51 ? -4.895  -8.932  2.288   1.00 0.20 ? 51  TRP A N    1  
ATOM   749   C CA   . TRP A 1 51 ? -4.827  -8.126  1.066   1.00 0.20 ? 51  TRP A CA   1  
ATOM   750   C C    . TRP A 1 51 ? -6.099  -8.261  0.235   1.00 0.19 ? 51  TRP A C    1  
ATOM   751   O O    . TRP A 1 51 ? -6.489  -7.330  -0.474  1.00 0.23 ? 51  TRP A O    1  
ATOM   752   C CB   . TRP A 1 51 ? -3.630  -8.540  0.204   1.00 0.23 ? 51  TRP A CB   1  
ATOM   753   C CG   . TRP A 1 51 ? -2.294  -8.272  0.823   1.00 0.24 ? 51  TRP A CG   1  
ATOM   754   C CD1  . TRP A 1 51 ? -2.010  -7.413  1.846   1.00 0.25 ? 51  TRP A CD1  1  
ATOM   755   C CD2  . TRP A 1 51 ? -1.048  -8.865  0.443   1.00 0.27 ? 51  TRP A CD2  1  
ATOM   756   N NE1  . TRP A 1 51 ? -0.666  -7.451  2.133   1.00 0.28 ? 51  TRP A NE1  1  
ATOM   757   C CE2  . TRP A 1 51 ? -0.055  -8.330  1.281   1.00 0.29 ? 51  TRP A CE2  1  
ATOM   758   C CE3  . TRP A 1 51 ? -0.677  -9.803  -0.527  1.00 0.30 ? 51  TRP A CE3  1  
ATOM   759   C CZ2  . TRP A 1 51 ? 1.284   -8.704  1.186   1.00 0.33 ? 51  TRP A CZ2  1  
ATOM   760   C CZ3  . TRP A 1 51 ? 0.651   -10.169 -0.627  1.00 0.34 ? 51  TRP A CZ3  1  
ATOM   761   C CH2  . TRP A 1 51 ? 1.619   -9.621  0.226   1.00 0.35 ? 51  TRP A CH2  1  
ATOM   762   H H    . TRP A 1 51 ? -4.327  -9.726  2.371   1.00 0.26 ? 51  TRP A H    1  
ATOM   763   H HA   . TRP A 1 51 ? -4.706  -7.093  1.358   1.00 0.22 ? 51  TRP A HA   1  
ATOM   764   H HB2  . TRP A 1 51 ? -3.692  -9.599  0.007   1.00 0.25 ? 51  TRP A HB2  1  
ATOM   765   H HB3  . TRP A 1 51 ? -3.676  -8.004  -0.732  1.00 0.27 ? 51  TRP A HB3  1  
ATOM   766   H HD1  . TRP A 1 51 ? -2.747  -6.806  2.353   1.00 0.26 ? 51  TRP A HD1  1  
ATOM   767   H HE1  . TRP A 1 51 ? -0.217  -6.928  2.834   1.00 0.31 ? 51  TRP A HE1  1  
ATOM   768   H HE3  . TRP A 1 51 ? -1.409  -10.236 -1.193  1.00 0.31 ? 51  TRP A HE3  1  
ATOM   769   H HZ2  . TRP A 1 51 ? 2.042   -8.289  1.833   1.00 0.35 ? 51  TRP A HZ2  1  
ATOM   770   H HZ3  . TRP A 1 51 ? 0.952   -10.892 -1.370  1.00 0.38 ? 51  TRP A HZ3  1  
ATOM   771   H HH2  . TRP A 1 51 ? 2.646   -9.935  0.115   1.00 0.39 ? 51  TRP A HH2  1  
ATOM   772   N N    . ASP A 1 52 ? -6.740  -9.424  0.328   1.00 0.23 ? 52  ASP A N    1  
ATOM   773   C CA   . ASP A 1 52 ? -7.957  -9.704  -0.437  1.00 0.27 ? 52  ASP A CA   1  
ATOM   774   C C    . ASP A 1 52 ? -9.078  -8.690  -0.152  1.00 0.24 ? 52  ASP A C    1  
ATOM   775   O O    . ASP A 1 52 ? -9.511  -7.988  -1.072  1.00 0.24 ? 52  ASP A O    1  
ATOM   776   C CB   . ASP A 1 52 ? -8.445  -11.141 -0.185  1.00 0.37 ? 52  ASP A CB   1  
ATOM   777   C CG   . ASP A 1 52 ? -9.731  -11.454 -0.926  1.00 0.85 ? 52  ASP A CG   1  
ATOM   778   O OD1  . ASP A 1 52 ? -10.731 -11.815 -0.273  1.00 1.49 ? 52  ASP A OD1  1  
ATOM   779   O OD2  . ASP A 1 52 ? -9.744  -11.343 -2.170  1.00 1.39 ? 52  ASP A OD2  1  
ATOM   780   H H    . ASP A 1 52 ? -6.382  -10.116 0.922   1.00 0.27 ? 52  ASP A H    1  
ATOM   781   H HA   . ASP A 1 52 ? -7.692  -9.618  -1.482  1.00 0.30 ? 52  ASP A HA   1  
ATOM   782   H HB2  . ASP A 1 52 ? -7.686  -11.835 -0.514  1.00 0.74 ? 52  ASP A HB2  1  
ATOM   783   H HB3  . ASP A 1 52 ? -8.618  -11.279 0.871   1.00 0.74 ? 52  ASP A HB3  1  
ATOM   784   N N    . PRO A 1 53 ? -9.565  -8.571  1.107   1.00 0.23 ? 53  PRO A N    1  
ATOM   785   C CA   . PRO A 1 53 ? -10.642 -7.632  1.439   1.00 0.24 ? 53  PRO A CA   1  
ATOM   786   C C    . PRO A 1 53 ? -10.281 -6.186  1.118   1.00 0.21 ? 53  PRO A C    1  
ATOM   787   O O    . PRO A 1 53 ? -11.126 -5.418  0.661   1.00 0.24 ? 53  PRO A O    1  
ATOM   788   C CB   . PRO A 1 53 ? -10.842 -7.808  2.948   1.00 0.29 ? 53  PRO A CB   1  
ATOM   789   C CG   . PRO A 1 53 ? -9.615  -8.491  3.436   1.00 0.33 ? 53  PRO A CG   1  
ATOM   790   C CD   . PRO A 1 53 ? -9.128  -9.331  2.294   1.00 0.28 ? 53  PRO A CD   1  
ATOM   791   H HA   . PRO A 1 53 ? -11.556 -7.889  0.924   1.00 0.27 ? 53  PRO A HA   1  
ATOM   792   H HB2  . PRO A 1 53 ? -10.959 -6.839  3.420   1.00 0.34 ? 53  PRO A HB2  1  
ATOM   793   H HB3  . PRO A 1 53 ? -11.710 -8.423  3.137   1.00 0.34 ? 53  PRO A HB3  1  
ATOM   794   H HG2  . PRO A 1 53 ? -8.872  -7.753  3.711   1.00 0.41 ? 53  PRO A HG2  1  
ATOM   795   H HG3  . PRO A 1 53 ? -9.853  -9.118  4.278   1.00 0.44 ? 53  PRO A HG3  1  
ATOM   796   H HD2  . PRO A 1 53 ? -8.052  -9.419  2.322   1.00 0.29 ? 53  PRO A HD2  1  
ATOM   797   H HD3  . PRO A 1 53 ? -9.592  -10.306 2.319   1.00 0.34 ? 53  PRO A HD3  1  
ATOM   798   N N    . ILE A 1 54 ? -9.022  -5.825  1.341   1.00 0.19 ? 54  ILE A N    1  
ATOM   799   C CA   . ILE A 1 54 ? -8.559  -4.470  1.078   1.00 0.19 ? 54  ILE A CA   1  
ATOM   800   C C    . ILE A 1 54 ? -8.652  -4.144  -0.410  1.00 0.16 ? 54  ILE A C    1  
ATOM   801   O O    . ILE A 1 54 ? -9.212  -3.115  -0.793  1.00 0.17 ? 54  ILE A O    1  
ATOM   802   C CB   . ILE A 1 54 ? -7.109  -4.267  1.556   1.00 0.22 ? 54  ILE A CB   1  
ATOM   803   C CG1  . ILE A 1 54 ? -7.024  -4.458  3.069   1.00 0.27 ? 54  ILE A CG1  1  
ATOM   804   C CG2  . ILE A 1 54 ? -6.606  -2.882  1.168   1.00 0.26 ? 54  ILE A CG2  1  
ATOM   805   C CD1  . ILE A 1 54 ? -5.606  -4.509  3.593   1.00 0.34 ? 54  ILE A CD1  1  
ATOM   806   H H    . ILE A 1 54 ? -8.385  -6.489  1.686   1.00 0.19 ? 54  ILE A H    1  
ATOM   807   H HA   . ILE A 1 54 ? -9.196  -3.790  1.626   1.00 0.23 ? 54  ILE A HA   1  
ATOM   808   H HB   . ILE A 1 54 ? -6.487  -5.002  1.072   1.00 0.21 ? 54  ILE A HB   1  
ATOM   809   H HG12 . ILE A 1 54 ? -7.524  -3.634  3.557   1.00 0.31 ? 54  ILE A HG12 1  
ATOM   810   H HG13 . ILE A 1 54 ? -7.514  -5.382  3.338   1.00 0.27 ? 54  ILE A HG13 1  
ATOM   811   H HG21 . ILE A 1 54 ? -5.593  -2.756  1.522   1.00 0.58 ? 54  ILE A HG21 1  
ATOM   812   H HG22 . ILE A 1 54 ? -7.239  -2.131  1.615   1.00 0.60 ? 54  ILE A HG22 1  
ATOM   813   H HG23 . ILE A 1 54 ? -6.625  -2.779  0.093   1.00 0.58 ? 54  ILE A HG23 1  
ATOM   814   H HD11 . ILE A 1 54 ? -5.624  -4.589  4.670   1.00 0.71 ? 54  ILE A HD11 1  
ATOM   815   H HD12 . ILE A 1 54 ? -5.081  -3.608  3.309   1.00 0.68 ? 54  ILE A HD12 1  
ATOM   816   H HD13 . ILE A 1 54 ? -5.099  -5.366  3.177   1.00 0.71 ? 54  ILE A HD13 1  
ATOM   817   N N    . THR A 1 55 ? -8.115  -5.032  -1.243  1.00 0.15 ? 55  THR A N    1  
ATOM   818   C CA   . THR A 1 55 ? -8.143  -4.836  -2.685  1.00 0.17 ? 55  THR A CA   1  
ATOM   819   C C    . THR A 1 55 ? -9.586  -4.740  -3.184  1.00 0.17 ? 55  THR A C    1  
ATOM   820   O O    . THR A 1 55 ? -9.915  -3.878  -4.000  1.00 0.19 ? 55  THR A O    1  
ATOM   821   C CB   . THR A 1 55 ? -7.407  -5.979  -3.420  1.00 0.20 ? 55  THR A CB   1  
ATOM   822   O OG1  . THR A 1 55 ? -6.099  -6.154  -2.858  1.00 0.20 ? 55  THR A OG1  1  
ATOM   823   C CG2  . THR A 1 55 ? -7.282  -5.689  -4.906  1.00 0.27 ? 55  THR A CG2  1  
ATOM   824   H H    . THR A 1 55 ? -7.694  -5.841  -0.878  1.00 0.16 ? 55  THR A H    1  
ATOM   825   H HA   . THR A 1 55 ? -7.634  -3.907  -2.904  1.00 0.19 ? 55  THR A HA   1  
ATOM   826   H HB   . THR A 1 55 ? -7.973  -6.892  -3.291  1.00 0.22 ? 55  THR A HB   1  
ATOM   827   H HG1  . THR A 1 55 ? -6.156  -6.729  -2.083  1.00 0.26 ? 55  THR A HG1  1  
ATOM   828   H HG21 . THR A 1 55 ? -6.894  -6.561  -5.412  1.00 0.49 ? 55  THR A HG21 1  
ATOM   829   H HG22 . THR A 1 55 ? -6.608  -4.858  -5.056  1.00 0.48 ? 55  THR A HG22 1  
ATOM   830   H HG23 . THR A 1 55 ? -8.253  -5.443  -5.307  1.00 0.46 ? 55  THR A HG23 1  
ATOM   831   N N    . ALA A 1 56 ? -10.448 -5.606  -2.660  1.00 0.18 ? 56  ALA A N    1  
ATOM   832   C CA   . ALA A 1 56 ? -11.852 -5.618  -3.043  1.00 0.21 ? 56  ALA A CA   1  
ATOM   833   C C    . ALA A 1 56 ? -12.539 -4.308  -2.654  1.00 0.20 ? 56  ALA A C    1  
ATOM   834   O O    . ALA A 1 56 ? -13.247 -3.704  -3.463  1.00 0.24 ? 56  ALA A O    1  
ATOM   835   C CB   . ALA A 1 56 ? -12.565 -6.798  -2.404  1.00 0.25 ? 56  ALA A CB   1  
ATOM   836   H H    . ALA A 1 56 ? -10.125 -6.262  -2.002  1.00 0.18 ? 56  ALA A H    1  
ATOM   837   H HA   . ALA A 1 56 ? -11.904 -5.735  -4.117  1.00 0.23 ? 56  ALA A HA   1  
ATOM   838   H HB1  . ALA A 1 56 ? -12.578 -6.672  -1.332  1.00 0.42 ? 56  ALA A HB1  1  
ATOM   839   H HB2  . ALA A 1 56 ? -12.043 -7.711  -2.654  1.00 0.43 ? 56  ALA A HB2  1  
ATOM   840   H HB3  . ALA A 1 56 ? -13.580 -6.851  -2.772  1.00 0.43 ? 56  ALA A HB3  1  
ATOM   841   N N    . ALA A 1 57 ? -12.302 -3.872  -1.419  1.00 0.19 ? 57  ALA A N    1  
ATOM   842   C CA   . ALA A 1 57 ? -12.888 -2.638  -0.902  1.00 0.20 ? 57  ALA A CA   1  
ATOM   843   C C    . ALA A 1 57 ? -12.455 -1.432  -1.725  1.00 0.19 ? 57  ALA A C    1  
ATOM   844   O O    . ALA A 1 57 ? -13.270 -0.568  -2.053  1.00 0.22 ? 57  ALA A O    1  
ATOM   845   C CB   . ALA A 1 57 ? -12.509 -2.442  0.560   1.00 0.23 ? 57  ALA A CB   1  
ATOM   846   H H    . ALA A 1 57 ? -11.717 -4.402  -0.831  1.00 0.20 ? 57  ALA A H    1  
ATOM   847   H HA   . ALA A 1 57 ? -13.963 -2.731  -0.960  1.00 0.23 ? 57  ALA A HA   1  
ATOM   848   H HB1  . ALA A 1 57 ? -12.892 -3.265  1.147   1.00 0.41 ? 57  ALA A HB1  1  
ATOM   849   H HB2  . ALA A 1 57 ? -12.932 -1.516  0.921   1.00 0.39 ? 57  ALA A HB2  1  
ATOM   850   H HB3  . ALA A 1 57 ? -11.434 -2.405  0.654   1.00 0.38 ? 57  ALA A HB3  1  
ATOM   851   N N    . LEU A 1 58 ? -11.174 -1.388  -2.075  1.00 0.18 ? 58  LEU A N    1  
ATOM   852   C CA   . LEU A 1 58 ? -10.630 -0.284  -2.854  1.00 0.19 ? 58  LEU A CA   1  
ATOM   853   C C    . LEU A 1 58 ? -11.252 -0.223  -4.243  1.00 0.20 ? 58  LEU A C    1  
ATOM   854   O O    . LEU A 1 58 ? -11.699 0.836   -4.679  1.00 0.24 ? 58  LEU A O    1  
ATOM   855   C CB   . LEU A 1 58 ? -9.115  -0.407  -2.958  1.00 0.21 ? 58  LEU A CB   1  
ATOM   856   C CG   . LEU A 1 58 ? -8.360  0.028   -1.709  1.00 0.37 ? 58  LEU A CG   1  
ATOM   857   C CD1  . LEU A 1 58 ? -6.954  -0.529  -1.726  1.00 0.35 ? 58  LEU A CD1  1  
ATOM   858   C CD2  . LEU A 1 58 ? -8.332  1.544   -1.612  1.00 0.73 ? 58  LEU A CD2  1  
ATOM   859   H H    . LEU A 1 58 ? -10.576 -2.117  -1.795  1.00 0.19 ? 58  LEU A H    1  
ATOM   860   H HA   . LEU A 1 58 ? -10.868 0.631   -2.331  1.00 0.20 ? 58  LEU A HA   1  
ATOM   861   H HB2  . LEU A 1 58 ? -8.871  -1.440  -3.165  1.00 0.31 ? 58  LEU A HB2  1  
ATOM   862   H HB3  . LEU A 1 58 ? -8.778  0.200   -3.785  1.00 0.39 ? 58  LEU A HB3  1  
ATOM   863   H HG   . LEU A 1 58 ? -8.863  -0.358  -0.835  1.00 0.55 ? 58  LEU A HG   1  
ATOM   864   H HD11 . LEU A 1 58 ? -6.530  -0.458  -0.738  1.00 0.71 ? 58  LEU A HD11 1  
ATOM   865   H HD12 . LEU A 1 58 ? -6.351  0.038   -2.420  1.00 0.67 ? 58  LEU A HD12 1  
ATOM   866   H HD13 . LEU A 1 58 ? -6.981  -1.564  -2.033  1.00 0.64 ? 58  LEU A HD13 1  
ATOM   867   H HD21 . LEU A 1 58 ? -9.339  1.914   -1.495  1.00 1.19 ? 58  LEU A HD21 1  
ATOM   868   H HD22 . LEU A 1 58 ? -7.897  1.957   -2.509  1.00 1.00 ? 58  LEU A HD22 1  
ATOM   869   H HD23 . LEU A 1 58 ? -7.741  1.839   -0.757  1.00 1.19 ? 58  LEU A HD23 1  
ATOM   870   N N    . SER A 1 59 ? -11.291 -1.357  -4.928  1.00 0.20 ? 59  SER A N    1  
ATOM   871   C CA   . SER A 1 59 ? -11.871 -1.418  -6.260  1.00 0.23 ? 59  SER A CA   1  
ATOM   872   C C    . SER A 1 59 ? -13.350 -1.038  -6.211  1.00 0.23 ? 59  SER A C    1  
ATOM   873   O O    . SER A 1 59 ? -13.879 -0.427  -7.139  1.00 0.25 ? 59  SER A O    1  
ATOM   874   C CB   . SER A 1 59 ? -11.692 -2.820  -6.840  1.00 0.29 ? 59  SER A CB   1  
ATOM   875   O OG   . SER A 1 59 ? -10.327 -3.214  -6.799  1.00 0.85 ? 59  SER A OG   1  
ATOM   876   H H    . SER A 1 59 ? -10.916 -2.175  -4.533  1.00 0.21 ? 59  SER A H    1  
ATOM   877   H HA   . SER A 1 59 ? -11.350 -0.706  -6.885  1.00 0.25 ? 59  SER A HA   1  
ATOM   878   H HB2  . SER A 1 59 ? -12.273 -3.524  -6.265  1.00 0.65 ? 59  SER A HB2  1  
ATOM   879   H HB3  . SER A 1 59 ? -12.029 -2.829  -7.866  1.00 0.73 ? 59  SER A HB3  1  
ATOM   880   H HG   . SER A 1 59 ? -9.904  -2.980  -7.638  1.00 1.33 ? 59  SER A HG   1  
ATOM   881   N N    . GLN A 1 60 ? -13.999 -1.380  -5.107  1.00 0.24 ? 60  GLN A N    1  
ATOM   882   C CA   . GLN A 1 60 ? -15.411 -1.081  -4.922  1.00 0.28 ? 60  GLN A CA   1  
ATOM   883   C C    . GLN A 1 60 ? -15.640 0.429   -4.826  1.00 0.26 ? 60  GLN A C    1  
ATOM   884   O O    . GLN A 1 60 ? -16.422 0.996   -5.590  1.00 0.29 ? 60  GLN A O    1  
ATOM   885   C CB   . GLN A 1 60 ? -15.927 -1.785  -3.668  1.00 0.34 ? 60  GLN A CB   1  
ATOM   886   C CG   . GLN A 1 60 ? -17.422 -1.627  -3.438  1.00 0.50 ? 60  GLN A CG   1  
ATOM   887   C CD   . GLN A 1 60 ? -17.914 -2.390  -2.225  1.00 0.63 ? 60  GLN A CD   1  
ATOM   888   O OE1  . GLN A 1 60 ? -19.052 -2.853  -2.189  1.00 0.92 ? 60  GLN A OE1  1  
ATOM   889   N NE2  . GLN A 1 60 ? -17.066 -2.522  -1.215  1.00 0.77 ? 60  GLN A NE2  1  
ATOM   890   H H    . GLN A 1 60 ? -13.515 -1.855  -4.396  1.00 0.25 ? 60  GLN A H    1  
ATOM   891   H HA   . GLN A 1 60 ? -15.942 -1.458  -5.780  1.00 0.31 ? 60  GLN A HA   1  
ATOM   892   H HB2  . GLN A 1 60 ? -15.708 -2.839  -3.751  1.00 0.45 ? 60  GLN A HB2  1  
ATOM   893   H HB3  . GLN A 1 60 ? -15.408 -1.387  -2.807  1.00 0.42 ? 60  GLN A HB3  1  
ATOM   894   H HG2  . GLN A 1 60 ? -17.639 -0.578  -3.294  1.00 0.61 ? 60  GLN A HG2  1  
ATOM   895   H HG3  . GLN A 1 60 ? -17.946 -1.984  -4.311  1.00 0.63 ? 60  GLN A HG3  1  
ATOM   896   H HE21 . GLN A 1 60 ? -16.176 -2.123  -1.300  1.00 0.92 ? 60  GLN A HE21 1  
ATOM   897   H HE22 . GLN A 1 60 ? -17.362 -3.017  -0.422  1.00 0.90 ? 60  GLN A HE22 1  
ATOM   898   N N    . ARG A 1 61 ? -14.933 1.083   -3.911  1.00 0.29 ? 61  ARG A N    1  
ATOM   899   C CA   . ARG A 1 61 ? -15.075 2.525   -3.727  1.00 0.34 ? 61  ARG A CA   1  
ATOM   900   C C    . ARG A 1 61 ? -14.598 3.287   -4.963  1.00 0.30 ? 61  ARG A C    1  
ATOM   901   O O    . ARG A 1 61 ? -15.081 4.381   -5.252  1.00 0.34 ? 61  ARG A O    1  
ATOM   902   C CB   . ARG A 1 61 ? -14.317 2.995   -2.476  1.00 0.45 ? 61  ARG A CB   1  
ATOM   903   C CG   . ARG A 1 61 ? -12.811 2.795   -2.544  1.00 0.65 ? 61  ARG A CG   1  
ATOM   904   C CD   . ARG A 1 61 ? -12.150 3.071   -1.204  1.00 0.67 ? 61  ARG A CD   1  
ATOM   905   N NE   . ARG A 1 61 ? -11.411 4.339   -1.197  1.00 0.81 ? 61  ARG A NE   1  
ATOM   906   C CZ   . ARG A 1 61 ? -11.725 5.391   -0.436  1.00 1.09 ? 61  ARG A CZ   1  
ATOM   907   N NH1  . ARG A 1 61 ? -12.768 5.331   0.390   1.00 1.47 ? 61  ARG A NH1  1  
ATOM   908   N NH2  . ARG A 1 61 ? -10.985 6.492   -0.490  1.00 1.42 ? 61  ARG A NH2  1  
ATOM   909   H H    . ARG A 1 61 ? -14.305 0.584   -3.343  1.00 0.30 ? 61  ARG A H    1  
ATOM   910   H HA   . ARG A 1 61 ? -16.128 2.728   -3.588  1.00 0.40 ? 61  ARG A HA   1  
ATOM   911   H HB2  . ARG A 1 61 ? -14.508 4.048   -2.332  1.00 0.72 ? 61  ARG A HB2  1  
ATOM   912   H HB3  . ARG A 1 61 ? -14.694 2.452   -1.620  1.00 0.82 ? 61  ARG A HB3  1  
ATOM   913   H HG2  . ARG A 1 61 ? -12.605 1.775   -2.834  1.00 1.08 ? 61  ARG A HG2  1  
ATOM   914   H HG3  . ARG A 1 61 ? -12.402 3.470   -3.282  1.00 1.01 ? 61  ARG A HG3  1  
ATOM   915   H HD2  . ARG A 1 61 ? -12.915 3.104   -0.442  1.00 0.88 ? 61  ARG A HD2  1  
ATOM   916   H HD3  . ARG A 1 61 ? -11.465 2.266   -0.984  1.00 0.79 ? 61  ARG A HD3  1  
ATOM   917   H HE   . ARG A 1 61 ? -10.635 4.409   -1.794  1.00 1.11 ? 61  ARG A HE   1  
ATOM   918   H HH11 . ARG A 1 61 ? -13.006 6.118   0.965   1.00 1.93 ? 61  ARG A HH11 1  
ATOM   919   H HH12 . ARG A 1 61 ? -13.327 4.498   0.440   1.00 1.47 ? 61  ARG A HH12 1  
ATOM   920   H HH21 . ARG A 1 61 ? -10.181 6.533   -1.109  1.00 1.53 ? 61  ARG A HH21 1  
ATOM   921   H HH22 . ARG A 1 61 ? -11.215 7.288   0.080   1.00 1.76 ? 61  ARG A HH22 1  
ATOM   922   N N    . ALA A 1 62 ? -13.663 2.699   -5.699  1.00 0.27 ? 62  ALA A N    1  
ATOM   923   C CA   . ALA A 1 62 ? -13.130 3.328   -6.899  1.00 0.29 ? 62  ALA A CA   1  
ATOM   924   C C    . ALA A 1 62 ? -14.165 3.355   -8.020  1.00 0.30 ? 62  ALA A C    1  
ATOM   925   O O    . ALA A 1 62 ? -14.380 4.391   -8.647  1.00 0.41 ? 62  ALA A O    1  
ATOM   926   C CB   . ALA A 1 62 ? -11.868 2.612   -7.358  1.00 0.31 ? 62  ALA A CB   1  
ATOM   927   H H    . ALA A 1 62 ? -13.313 1.822   -5.420  1.00 0.26 ? 62  ALA A H    1  
ATOM   928   H HA   . ALA A 1 62 ? -12.866 4.344   -6.647  1.00 0.34 ? 62  ALA A HA   1  
ATOM   929   H HB1  . ALA A 1 62 ? -12.105 1.593   -7.626  1.00 0.40 ? 62  ALA A HB1  1  
ATOM   930   H HB2  . ALA A 1 62 ? -11.143 2.613   -6.558  1.00 0.44 ? 62  ALA A HB2  1  
ATOM   931   H HB3  . ALA A 1 62 ? -11.455 3.125   -8.216  1.00 0.46 ? 62  ALA A HB3  1  
ATOM   932   N N    . MET A 1 63 ? -14.819 2.222   -8.250  1.00 0.26 ? 63  MET A N    1  
ATOM   933   C CA   . MET A 1 63 ? -15.820 2.117   -9.311  1.00 0.32 ? 63  MET A CA   1  
ATOM   934   C C    . MET A 1 63 ? -17.131 2.800   -8.927  1.00 0.32 ? 63  MET A C    1  
ATOM   935   O O    . MET A 1 63 ? -17.954 3.095   -9.793  1.00 0.42 ? 63  MET A O    1  
ATOM   936   C CB   . MET A 1 63 ? -16.083 0.643   -9.660  1.00 0.37 ? 63  MET A CB   1  
ATOM   937   C CG   . MET A 1 63 ? -16.837 -0.119  -8.580  1.00 0.38 ? 63  MET A CG   1  
ATOM   938   S SD   . MET A 1 63 ? -17.170 -1.835  -9.031  1.00 0.50 ? 63  MET A SD   1  
ATOM   939   C CE   . MET A 1 63 ? -15.506 -2.487  -9.155  1.00 0.71 ? 63  MET A CE   1  
ATOM   940   H H    . MET A 1 63 ? -14.618 1.433   -7.700  1.00 0.27 ? 63  MET A H    1  
ATOM   941   H HA   . MET A 1 63 ? -15.419 2.612   -10.183 1.00 0.36 ? 63  MET A HA   1  
ATOM   942   H HB2  . MET A 1 63 ? -16.663 0.597   -10.571 1.00 0.43 ? 63  MET A HB2  1  
ATOM   943   H HB3  . MET A 1 63 ? -15.137 0.147   -9.822  1.00 0.42 ? 63  MET A HB3  1  
ATOM   944   H HG2  . MET A 1 63 ? -16.249 -0.109  -7.675  1.00 0.38 ? 63  MET A HG2  1  
ATOM   945   H HG3  . MET A 1 63 ? -17.778 0.380   -8.402  1.00 0.39 ? 63  MET A HG3  1  
ATOM   946   H HE1  . MET A 1 63 ? -14.962 -1.947  -9.916  1.00 0.96 ? 63  MET A HE1  1  
ATOM   947   H HE2  . MET A 1 63 ? -15.547 -3.534  -9.417  1.00 0.93 ? 63  MET A HE2  1  
ATOM   948   H HE3  . MET A 1 63 ? -15.005 -2.373  -8.206  1.00 0.95 ? 63  MET A HE3  1  
ATOM   949   N N    . ILE A 1 64 ? -17.327 3.062   -7.642  1.00 0.28 ? 64  ILE A N    1  
ATOM   950   C CA   . ILE A 1 64 ? -18.559 3.692   -7.182  1.00 0.31 ? 64  ILE A CA   1  
ATOM   951   C C    . ILE A 1 64 ? -18.406 5.203   -7.006  1.00 0.31 ? 64  ILE A C    1  
ATOM   952   O O    . ILE A 1 64 ? -19.246 5.975   -7.473  1.00 0.37 ? 64  ILE A O    1  
ATOM   953   C CB   . ILE A 1 64 ? -19.055 3.058   -5.859  1.00 0.35 ? 64  ILE A CB   1  
ATOM   954   C CG1  . ILE A 1 64 ? -19.511 1.616   -6.103  1.00 0.38 ? 64  ILE A CG1  1  
ATOM   955   C CG2  . ILE A 1 64 ? -20.191 3.878   -5.257  1.00 0.43 ? 64  ILE A CG2  1  
ATOM   956   C CD1  . ILE A 1 64 ? -19.828 0.855   -4.835  1.00 0.46 ? 64  ILE A CD1  1  
ATOM   957   H H    . ILE A 1 64 ? -16.637 2.815   -6.988  1.00 0.29 ? 64  ILE A H    1  
ATOM   958   H HA   . ILE A 1 64 ? -19.311 3.514   -7.935  1.00 0.35 ? 64  ILE A HA   1  
ATOM   959   H HB   . ILE A 1 64 ? -18.232 3.054   -5.157  1.00 0.34 ? 64  ILE A HB   1  
ATOM   960   H HG12 . ILE A 1 64 ? -20.402 1.628   -6.712  1.00 0.44 ? 64  ILE A HG12 1  
ATOM   961   H HG13 . ILE A 1 64 ? -18.731 1.081   -6.626  1.00 0.36 ? 64  ILE A HG13 1  
ATOM   962   H HG21 . ILE A 1 64 ? -20.488 3.446   -4.314  1.00 0.59 ? 64  ILE A HG21 1  
ATOM   963   H HG22 . ILE A 1 64 ? -21.033 3.878   -5.934  1.00 0.58 ? 64  ILE A HG22 1  
ATOM   964   H HG23 . ILE A 1 64 ? -19.856 4.894   -5.099  1.00 0.58 ? 64  ILE A HG23 1  
ATOM   965   H HD11 . ILE A 1 64 ? -20.206 -0.125  -5.085  1.00 0.62 ? 64  ILE A HD11 1  
ATOM   966   H HD12 . ILE A 1 64 ? -20.572 1.394   -4.268  1.00 0.57 ? 64  ILE A HD12 1  
ATOM   967   H HD13 . ILE A 1 64 ? -18.930 0.754   -4.245  1.00 0.59 ? 64  ILE A HD13 1  
ATOM   968   N N    . LEU A 1 65 ? -17.339 5.632   -6.345  1.00 0.29 ? 65  LEU A N    1  
ATOM   969   C CA   . LEU A 1 65 ? -17.125 7.058   -6.101  1.00 0.33 ? 65  LEU A CA   1  
ATOM   970   C C    . LEU A 1 65 ? -16.353 7.727   -7.235  1.00 0.34 ? 65  LEU A C    1  
ATOM   971   O O    . LEU A 1 65 ? -16.425 8.945   -7.411  1.00 0.47 ? 65  LEU A O    1  
ATOM   972   C CB   . LEU A 1 65 ? -16.387 7.270   -4.775  1.00 0.40 ? 65  LEU A CB   1  
ATOM   973   C CG   . LEU A 1 65 ? -17.244 7.132   -3.514  1.00 0.93 ? 65  LEU A CG   1  
ATOM   974   C CD1  . LEU A 1 65 ? -17.401 5.668   -3.116  1.00 1.61 ? 65  LEU A CD1  1  
ATOM   975   C CD2  . LEU A 1 65 ? -16.629 7.927   -2.380  1.00 0.99 ? 65  LEU A CD2  1  
ATOM   976   H H    . LEU A 1 65 ? -16.678 4.981   -6.014  1.00 0.30 ? 65  LEU A H    1  
ATOM   977   H HA   . LEU A 1 65 ? -18.098 7.520   -6.031  1.00 0.39 ? 65  LEU A HA   1  
ATOM   978   H HB2  . LEU A 1 65 ? -15.581 6.553   -4.715  1.00 0.77 ? 65  LEU A HB2  1  
ATOM   979   H HB3  . LEU A 1 65 ? -15.960 8.263   -4.781  1.00 0.73 ? 65  LEU A HB3  1  
ATOM   980   H HG   . LEU A 1 65 ? -18.226 7.533   -3.709  1.00 1.40 ? 65  LEU A HG   1  
ATOM   981   H HD11 . LEU A 1 65 ? -17.824 5.115   -3.941  1.00 1.79 ? 65  LEU A HD11 1  
ATOM   982   H HD12 . LEU A 1 65 ? -18.053 5.594   -2.258  1.00 1.94 ? 65  LEU A HD12 1  
ATOM   983   H HD13 . LEU A 1 65 ? -16.434 5.258   -2.867  1.00 2.09 ? 65  LEU A HD13 1  
ATOM   984   H HD21 . LEU A 1 65 ? -16.589 8.972   -2.652  1.00 1.31 ? 65  LEU A HD21 1  
ATOM   985   H HD22 . LEU A 1 65 ? -15.628 7.567   -2.189  1.00 1.14 ? 65  LEU A HD22 1  
ATOM   986   H HD23 . LEU A 1 65 ? -17.230 7.809   -1.490  1.00 1.50 ? 65  LEU A HD23 1  
ATOM   987   N N    . GLY A 1 66 ? -15.626 6.937   -8.005  1.00 0.30 ? 66  GLY A N    1  
ATOM   988   C CA   . GLY A 1 66 ? -14.855 7.489   -9.100  1.00 0.36 ? 66  GLY A CA   1  
ATOM   989   C C    . GLY A 1 66 ? -13.523 8.038   -8.633  1.00 0.43 ? 66  GLY A C    1  
ATOM   990   O O    . GLY A 1 66 ? -13.007 9.013   -9.185  1.00 0.81 ? 66  GLY A O    1  
ATOM   991   H H    . GLY A 1 66 ? -15.623 5.971   -7.841  1.00 0.33 ? 66  GLY A H    1  
ATOM   992   H HA2  . GLY A 1 66 ? -14.678 6.714   -9.829  1.00 0.40 ? 66  GLY A HA2  1  
ATOM   993   H HA3  . GLY A 1 66 ? -15.424 8.283   -9.562  1.00 0.41 ? 66  GLY A HA3  1  
ATOM   994   N N    . LYS A 1 67 ? -12.971 7.417   -7.600  1.00 0.43 ? 67  LYS A N    1  
ATOM   995   C CA   . LYS A 1 67 ? -11.693 7.831   -7.044  1.00 0.47 ? 67  LYS A CA   1  
ATOM   996   C C    . LYS A 1 67 ? -10.787 6.623   -6.856  1.00 0.35 ? 67  LYS A C    1  
ATOM   997   O O    . LYS A 1 67 ? -11.099 5.710   -6.092  1.00 0.44 ? 67  LYS A O    1  
ATOM   998   C CB   . LYS A 1 67 ? -11.888 8.566   -5.711  1.00 0.65 ? 67  LYS A CB   1  
ATOM   999   C CG   . LYS A 1 67 ? -12.778 7.831   -4.719  1.00 0.74 ? 67  LYS A CG   1  
ATOM   1000  C CD   . LYS A 1 67 ? -12.349 8.078   -3.277  1.00 1.10 ? 67  LYS A CD   1  
ATOM   1001  C CE   . LYS A 1 67 ? -12.827 9.429   -2.752  1.00 1.28 ? 67  LYS A CE   1  
ATOM   1002  N NZ   . LYS A 1 67 ? -12.025 10.562  -3.287  1.00 1.52 ? 67  LYS A NZ   1  
ATOM   1003  H H    . LYS A 1 67 ? -13.433 6.650   -7.206  1.00 0.69 ? 67  LYS A H    1  
ATOM   1004  H HA   . LYS A 1 67 ? -11.229 8.503   -7.752  1.00 0.55 ? 67  LYS A HA   1  
ATOM   1005  H HB2  . LYS A 1 67 ? -10.920 8.714   -5.252  1.00 0.82 ? 67  LYS A HB2  1  
ATOM   1006  H HB3  . LYS A 1 67 ? -12.331 9.531   -5.910  1.00 0.78 ? 67  LYS A HB3  1  
ATOM   1007  H HG2  . LYS A 1 67 ? -13.794 8.171   -4.843  1.00 0.86 ? 67  LYS A HG2  1  
ATOM   1008  H HG3  . LYS A 1 67 ? -12.725 6.771   -4.921  1.00 0.86 ? 67  LYS A HG3  1  
ATOM   1009  H HD2  . LYS A 1 67 ? -12.763 7.299   -2.653  1.00 1.44 ? 67  LYS A HD2  1  
ATOM   1010  H HD3  . LYS A 1 67 ? -11.269 8.043   -3.224  1.00 1.29 ? 67  LYS A HD3  1  
ATOM   1011  H HE2  . LYS A 1 67 ? -13.859 9.568   -3.036  1.00 1.52 ? 67  LYS A HE2  1  
ATOM   1012  H HE3  . LYS A 1 67 ? -12.751 9.424   -1.672  1.00 1.71 ? 67  LYS A HE3  1  
ATOM   1013  H HZ1  . LYS A 1 67 ? -12.245 11.434  -2.766  1.00 1.85 ? 67  LYS A HZ1  1  
ATOM   1014  H HZ2  . LYS A 1 67 ? -12.243 10.715  -4.292  1.00 1.82 ? 67  LYS A HZ2  1  
ATOM   1015  H HZ3  . LYS A 1 67 ? -11.008 10.363  -3.190  1.00 1.90 ? 67  LYS A HZ3  1  
ATOM   1016  N N    . SER A 1 68 ? -9.675  6.613   -7.567  1.00 0.30 ? 68  SER A N    1  
ATOM   1017  C CA   . SER A 1 68 ? -8.733  5.515   -7.486  1.00 0.32 ? 68  SER A CA   1  
ATOM   1018  C C    . SER A 1 68 ? -7.400  5.990   -6.911  1.00 0.28 ? 68  SER A C    1  
ATOM   1019  O O    . SER A 1 68 ? -6.358  5.376   -7.146  1.00 0.33 ? 68  SER A O    1  
ATOM   1020  C CB   . SER A 1 68 ? -8.535  4.909   -8.876  1.00 0.46 ? 68  SER A CB   1  
ATOM   1021  O OG   . SER A 1 68 ? -9.766  4.853   -9.581  1.00 0.91 ? 68  SER A OG   1  
ATOM   1022  H H    . SER A 1 68 ? -9.483  7.366   -8.170  1.00 0.38 ? 68  SER A H    1  
ATOM   1023  H HA   . SER A 1 68 ? -9.149  4.764   -6.829  1.00 0.38 ? 68  SER A HA   1  
ATOM   1024  H HB2  . SER A 1 68 ? -7.842  5.519   -9.434  1.00 0.76 ? 68  SER A HB2  1  
ATOM   1025  H HB3  . SER A 1 68 ? -8.142  3.909   -8.783  1.00 0.77 ? 68  SER A HB3  1  
ATOM   1026  H HG   . SER A 1 68 ? -10.246 5.678   -9.443  1.00 1.45 ? 68  SER A HG   1  
ATOM   1027  N N    . GLY A 1 69 ? -7.453  7.072   -6.137  1.00 0.29 ? 69  GLY A N    1  
ATOM   1028  C CA   . GLY A 1 69 ? -6.253  7.629   -5.532  1.00 0.35 ? 69  GLY A CA   1  
ATOM   1029  C C    . GLY A 1 69 ? -5.484  6.607   -4.719  1.00 0.32 ? 69  GLY A C    1  
ATOM   1030  O O    . GLY A 1 69 ? -4.290  6.401   -4.941  1.00 0.41 ? 69  GLY A O    1  
ATOM   1031  H H    . GLY A 1 69 ? -8.318  7.502   -5.979  1.00 0.33 ? 69  GLY A H    1  
ATOM   1032  H HA2  . GLY A 1 69 ? -5.612  8.004   -6.314  1.00 0.40 ? 69  GLY A HA2  1  
ATOM   1033  H HA3  . GLY A 1 69 ? -6.535  8.447   -4.887  1.00 0.42 ? 69  GLY A HA3  1  
ATOM   1034  N N    . GLU A 1 70 ? -6.172  5.960   -3.787  1.00 0.34 ? 70  GLU A N    1  
ATOM   1035  C CA   . GLU A 1 70 ? -5.551  4.946   -2.944  1.00 0.38 ? 70  GLU A CA   1  
ATOM   1036  C C    . GLU A 1 70 ? -5.330  3.655   -3.728  1.00 0.32 ? 70  GLU A C    1  
ATOM   1037  O O    . GLU A 1 70 ? -4.395  2.904   -3.461  1.00 0.39 ? 70  GLU A O    1  
ATOM   1038  C CB   . GLU A 1 70 ? -6.424  4.660   -1.717  1.00 0.52 ? 70  GLU A CB   1  
ATOM   1039  C CG   . GLU A 1 70 ? -6.621  5.857   -0.797  1.00 0.66 ? 70  GLU A CG   1  
ATOM   1040  C CD   . GLU A 1 70 ? -7.750  6.769   -1.246  1.00 0.70 ? 70  GLU A CD   1  
ATOM   1041  O OE1  . GLU A 1 70 ? -7.699  7.980   -0.940  1.00 1.24 ? 70  GLU A OE1  1  
ATOM   1042  O OE2  . GLU A 1 70 ? -8.696  6.278   -1.900  1.00 1.08 ? 70  GLU A OE2  1  
ATOM   1043  H H    . GLU A 1 70 ? -7.121  6.180   -3.652  1.00 0.40 ? 70  GLU A H    1  
ATOM   1044  H HA   . GLU A 1 70 ? -4.595  5.326   -2.618  1.00 0.42 ? 70  GLU A HA   1  
ATOM   1045  H HB2  . GLU A 1 70 ? -7.396  4.334   -2.055  1.00 0.52 ? 70  GLU A HB2  1  
ATOM   1046  H HB3  . GLU A 1 70 ? -5.969  3.864   -1.144  1.00 0.64 ? 70  GLU A HB3  1  
ATOM   1047  H HG2  . GLU A 1 70 ? -6.846  5.497   0.197   1.00 0.80 ? 70  GLU A HG2  1  
ATOM   1048  H HG3  . GLU A 1 70 ? -5.706  6.428   -0.774  1.00 0.82 ? 70  GLU A HG3  1  
ATOM   1049  N N    . LEU A 1 71 ? -6.193  3.419   -4.708  1.00 0.28 ? 71  LEU A N    1  
ATOM   1050  C CA   . LEU A 1 71 ? -6.122  2.220   -5.538  1.00 0.28 ? 71  LEU A CA   1  
ATOM   1051  C C    . LEU A 1 71 ? -4.819  2.162   -6.333  1.00 0.26 ? 71  LEU A C    1  
ATOM   1052  O O    . LEU A 1 71 ? -4.211  1.098   -6.470  1.00 0.30 ? 71  LEU A O    1  
ATOM   1053  C CB   . LEU A 1 71 ? -7.325  2.172   -6.487  1.00 0.34 ? 71  LEU A CB   1  
ATOM   1054  C CG   . LEU A 1 71 ? -7.378  0.966   -7.432  1.00 0.58 ? 71  LEU A CG   1  
ATOM   1055  C CD1  . LEU A 1 71 ? -8.770  0.350   -7.431  1.00 0.89 ? 71  LEU A CD1  1  
ATOM   1056  C CD2  . LEU A 1 71 ? -6.984  1.374   -8.846  1.00 1.43 ? 71  LEU A CD2  1  
ATOM   1057  H H    . LEU A 1 71 ? -6.898  4.075   -4.880  1.00 0.34 ? 71  LEU A H    1  
ATOM   1058  H HA   . LEU A 1 71 ? -6.163  1.365   -4.883  1.00 0.33 ? 71  LEU A HA   1  
ATOM   1059  H HB2  . LEU A 1 71 ? -8.227  2.175   -5.890  1.00 0.54 ? 71  LEU A HB2  1  
ATOM   1060  H HB3  . LEU A 1 71 ? -7.312  3.070   -7.088  1.00 0.61 ? 71  LEU A HB3  1  
ATOM   1061  H HG   . LEU A 1 71 ? -6.679  0.215   -7.091  1.00 1.35 ? 71  LEU A HG   1  
ATOM   1062  H HD11 . LEU A 1 71 ? -9.024  0.039   -6.427  1.00 1.64 ? 71  LEU A HD11 1  
ATOM   1063  H HD12 . LEU A 1 71 ? -8.784  -0.505  -8.087  1.00 1.06 ? 71  LEU A HD12 1  
ATOM   1064  H HD13 . LEU A 1 71 ? -9.489  1.080   -7.776  1.00 1.33 ? 71  LEU A HD13 1  
ATOM   1065  H HD21 . LEU A 1 71 ? -6.077  1.959   -8.814  1.00 2.09 ? 71  LEU A HD21 1  
ATOM   1066  H HD22 . LEU A 1 71 ? -7.776  1.964   -9.283  1.00 1.87 ? 71  LEU A HD22 1  
ATOM   1067  H HD23 . LEU A 1 71 ? -6.820  0.490   -9.442  1.00 1.71 ? 71  LEU A HD23 1  
ATOM   1068  N N    . LYS A 1 72 ? -4.392  3.304   -6.852  1.00 0.26 ? 72  LYS A N    1  
ATOM   1069  C CA   . LYS A 1 72 ? -3.168  3.370   -7.635  1.00 0.30 ? 72  LYS A CA   1  
ATOM   1070  C C    . LYS A 1 72 ? -1.949  3.045   -6.780  1.00 0.27 ? 72  LYS A C    1  
ATOM   1071  O O    . LYS A 1 72 ? -1.089  2.259   -7.181  1.00 0.33 ? 72  LYS A O    1  
ATOM   1072  C CB   . LYS A 1 72 ? -3.015  4.746   -8.277  1.00 0.39 ? 72  LYS A CB   1  
ATOM   1073  C CG   . LYS A 1 72 ? -4.079  5.044   -9.319  1.00 0.50 ? 72  LYS A CG   1  
ATOM   1074  C CD   . LYS A 1 72 ? -3.565  5.997   -10.383 1.00 0.74 ? 72  LYS A CD   1  
ATOM   1075  C CE   . LYS A 1 72 ? -3.285  7.386   -9.826  1.00 1.11 ? 72  LYS A CE   1  
ATOM   1076  N NZ   . LYS A 1 72 ? -2.572  8.244   -10.808 1.00 1.44 ? 72  LYS A NZ   1  
ATOM   1077  H H    . LYS A 1 72 ? -4.921  4.122   -6.713  1.00 0.28 ? 72  LYS A H    1  
ATOM   1078  H HA   . LYS A 1 72 ? -3.242  2.632   -8.415  1.00 0.35 ? 72  LYS A HA   1  
ATOM   1079  H HB2  . LYS A 1 72 ? -3.074  5.499   -7.506  1.00 0.45 ? 72  LYS A HB2  1  
ATOM   1080  H HB3  . LYS A 1 72 ? -2.049  4.802   -8.754  1.00 0.49 ? 72  LYS A HB3  1  
ATOM   1081  H HG2  . LYS A 1 72 ? -4.372  4.118   -9.791  1.00 0.76 ? 72  LYS A HG2  1  
ATOM   1082  H HG3  . LYS A 1 72 ? -4.936  5.489   -8.830  1.00 0.74 ? 72  LYS A HG3  1  
ATOM   1083  H HD2  . LYS A 1 72 ? -2.649  5.598   -10.795 1.00 0.98 ? 72  LYS A HD2  1  
ATOM   1084  H HD3  . LYS A 1 72 ? -4.305  6.075   -11.164 1.00 0.88 ? 72  LYS A HD3  1  
ATOM   1085  H HE2  . LYS A 1 72 ? -4.224  7.855   -9.570  1.00 1.39 ? 72  LYS A HE2  1  
ATOM   1086  H HE3  . LYS A 1 72 ? -2.678  7.287   -8.937  1.00 1.42 ? 72  LYS A HE3  1  
ATOM   1087  H HZ1  . LYS A 1 72 ? -2.289  9.141   -10.365 1.00 1.73 ? 72  LYS A HZ1  1  
ATOM   1088  H HZ2  . LYS A 1 72 ? -3.187  8.452   -11.620 1.00 1.79 ? 72  LYS A HZ2  1  
ATOM   1089  H HZ3  . LYS A 1 72 ? -1.718  7.760   -11.153 1.00 1.75 ? 72  LYS A HZ3  1  
ATOM   1090  N N    . THR A 1 73 ? -1.893  3.637   -5.598  1.00 0.23 ? 73  THR A N    1  
ATOM   1091  C CA   . THR A 1 73 ? -0.788  3.404   -4.689  1.00 0.24 ? 73  THR A CA   1  
ATOM   1092  C C    . THR A 1 73 ? -0.794  1.960   -4.186  1.00 0.21 ? 73  THR A C    1  
ATOM   1093  O O    . THR A 1 73 ? 0.249   1.299   -4.159  1.00 0.24 ? 73  THR A O    1  
ATOM   1094  C CB   . THR A 1 73 ? -0.845  4.387   -3.505  1.00 0.29 ? 73  THR A CB   1  
ATOM   1095  O OG1  . THR A 1 73 ? -0.992  5.724   -4.005  1.00 0.39 ? 73  THR A OG1  1  
ATOM   1096  C CG2  . THR A 1 73 ? 0.414   4.292   -2.657  1.00 0.35 ? 73  THR A CG2  1  
ATOM   1097  H H    . THR A 1 73 ? -2.609  4.250   -5.333  1.00 0.26 ? 73  THR A H    1  
ATOM   1098  H HA   . THR A 1 73 ? 0.129   3.581   -5.230  1.00 0.26 ? 73  THR A HA   1  
ATOM   1099  H HB   . THR A 1 73 ? -1.700  4.142   -2.892  1.00 0.32 ? 73  THR A HB   1  
ATOM   1100  H HG1  . THR A 1 73 ? -0.473  5.818   -4.816  1.00 0.74 ? 73  THR A HG1  1  
ATOM   1101  H HG21 . THR A 1 73 ? 1.282   4.432   -3.283  1.00 0.57 ? 73  THR A HG21 1  
ATOM   1102  H HG22 . THR A 1 73 ? 0.459   3.319   -2.193  1.00 0.56 ? 73  THR A HG22 1  
ATOM   1103  H HG23 . THR A 1 73 ? 0.393   5.056   -1.892  1.00 0.58 ? 73  THR A HG23 1  
ATOM   1104  N N    . TRP A 1 74 ? -1.976  1.469   -3.817  1.00 0.18 ? 74  TRP A N    1  
ATOM   1105  C CA   . TRP A 1 74 ? -2.121  0.104   -3.326  1.00 0.18 ? 74  TRP A CA   1  
ATOM   1106  C C    . TRP A 1 74 ? -1.665  -0.901  -4.371  1.00 0.17 ? 74  TRP A C    1  
ATOM   1107  O O    . TRP A 1 74 ? -0.923  -1.824  -4.061  1.00 0.19 ? 74  TRP A O    1  
ATOM   1108  C CB   . TRP A 1 74 ? -3.575  -0.180  -2.942  1.00 0.19 ? 74  TRP A CB   1  
ATOM   1109  C CG   . TRP A 1 74 ? -3.828  -1.612  -2.567  1.00 0.20 ? 74  TRP A CG   1  
ATOM   1110  C CD1  . TRP A 1 74 ? -4.426  -2.570  -3.339  1.00 0.23 ? 74  TRP A CD1  1  
ATOM   1111  C CD2  . TRP A 1 74 ? -3.496  -2.248  -1.326  1.00 0.27 ? 74  TRP A CD2  1  
ATOM   1112  N NE1  . TRP A 1 74 ? -4.482  -3.761  -2.651  1.00 0.25 ? 74  TRP A NE1  1  
ATOM   1113  C CE2  . TRP A 1 74 ? -3.916  -3.589  -1.418  1.00 0.27 ? 74  TRP A CE2  1  
ATOM   1114  C CE3  . TRP A 1 74 ? -2.883  -1.814  -0.148  1.00 0.38 ? 74  TRP A CE3  1  
ATOM   1115  C CZ2  . TRP A 1 74 ? -3.743  -4.497  -0.378  1.00 0.36 ? 74  TRP A CZ2  1  
ATOM   1116  C CZ3  . TRP A 1 74 ? -2.711  -2.717  0.882   1.00 0.48 ? 74  TRP A CZ3  1  
ATOM   1117  C CH2  . TRP A 1 74 ? -3.139  -4.045  0.762   1.00 0.46 ? 74  TRP A CH2  1  
ATOM   1118  H H    . TRP A 1 74 ? -2.771  2.046   -3.867  1.00 0.20 ? 74  TRP A H    1  
ATOM   1119  H HA   . TRP A 1 74 ? -1.501  -0.004  -2.449  1.00 0.20 ? 74  TRP A HA   1  
ATOM   1120  H HB2  . TRP A 1 74 ? -3.842  0.438   -2.097  1.00 0.22 ? 74  TRP A HB2  1  
ATOM   1121  H HB3  . TRP A 1 74 ? -4.214  0.066   -3.777  1.00 0.21 ? 74  TRP A HB3  1  
ATOM   1122  H HD1  . TRP A 1 74 ? -4.797  -2.402  -4.339  1.00 0.30 ? 74  TRP A HD1  1  
ATOM   1123  H HE1  . TRP A 1 74 ? -4.864  -4.605  -2.991  1.00 0.28 ? 74  TRP A HE1  1  
ATOM   1124  H HE3  . TRP A 1 74 ? -2.543  -0.796  -0.037  1.00 0.40 ? 74  TRP A HE3  1  
ATOM   1125  H HZ2  . TRP A 1 74 ? -4.066  -5.522  -0.456  1.00 0.36 ? 74  TRP A HZ2  1  
ATOM   1126  H HZ3  . TRP A 1 74 ? -2.239  -2.398  1.799   1.00 0.58 ? 74  TRP A HZ3  1  
ATOM   1127  H HH2  . TRP A 1 74 ? -2.985  -4.713  1.595   1.00 0.54 ? 74  TRP A HH2  1  
ATOM   1128  N N    . GLY A 1 75 ? -2.104  -0.701  -5.610  1.00 0.18 ? 75  GLY A N    1  
ATOM   1129  C CA   . GLY A 1 75 ? -1.747  -1.602  -6.690  1.00 0.21 ? 75  GLY A CA   1  
ATOM   1130  C C    . GLY A 1 75 ? -0.249  -1.803  -6.829  1.00 0.20 ? 75  GLY A C    1  
ATOM   1131  O O    . GLY A 1 75 ? 0.212   -2.918  -7.076  1.00 0.25 ? 75  GLY A O    1  
ATOM   1132  H H    . GLY A 1 75 ? -2.683  0.073   -5.794  1.00 0.20 ? 75  GLY A H    1  
ATOM   1133  H HA2  . GLY A 1 75 ? -2.209  -2.561  -6.509  1.00 0.24 ? 75  GLY A HA2  1  
ATOM   1134  H HA3  . GLY A 1 75 ? -2.132  -1.202  -7.617  1.00 0.24 ? 75  GLY A HA3  1  
ATOM   1135  N N    . LEU A 1 76 ? 0.513   -0.730  -6.659  1.00 0.20 ? 76  LEU A N    1  
ATOM   1136  C CA   . LEU A 1 76 ? 1.965   -0.798  -6.771  1.00 0.24 ? 76  LEU A CA   1  
ATOM   1137  C C    . LEU A 1 76 ? 2.564   -1.527  -5.574  1.00 0.23 ? 76  LEU A C    1  
ATOM   1138  O O    . LEU A 1 76 ? 3.383   -2.434  -5.732  1.00 0.28 ? 76  LEU A O    1  
ATOM   1139  C CB   . LEU A 1 76 ? 2.550   0.609   -6.878  1.00 0.30 ? 76  LEU A CB   1  
ATOM   1140  C CG   . LEU A 1 76 ? 2.088   1.411   -8.093  1.00 0.40 ? 76  LEU A CG   1  
ATOM   1141  C CD1  . LEU A 1 76 ? 2.483   2.867   -7.947  1.00 0.51 ? 76  LEU A CD1  1  
ATOM   1142  C CD2  . LEU A 1 76 ? 2.675   0.827   -9.369  1.00 0.56 ? 76  LEU A CD2  1  
ATOM   1143  H H    . LEU A 1 76 ? 0.088   0.132   -6.455  1.00 0.22 ? 76  LEU A H    1  
ATOM   1144  H HA   . LEU A 1 76 ? 2.203   -1.350  -7.669  1.00 0.27 ? 76  LEU A HA   1  
ATOM   1145  H HB2  . LEU A 1 76 ? 2.281   1.157   -5.986  1.00 0.34 ? 76  LEU A HB2  1  
ATOM   1146  H HB3  . LEU A 1 76 ? 3.624   0.525   -6.919  1.00 0.36 ? 76  LEU A HB3  1  
ATOM   1147  H HG   . LEU A 1 76 ? 1.013   1.363   -8.163  1.00 0.51 ? 76  LEU A HG   1  
ATOM   1148  H HD11 . LEU A 1 76 ? 2.004   3.283   -7.073  1.00 0.93 ? 76  LEU A HD11 1  
ATOM   1149  H HD12 . LEU A 1 76 ? 2.171   3.414   -8.824  1.00 0.87 ? 76  LEU A HD12 1  
ATOM   1150  H HD13 . LEU A 1 76 ? 3.554   2.938   -7.839  1.00 0.94 ? 76  LEU A HD13 1  
ATOM   1151  H HD21 . LEU A 1 76 ? 3.753   0.831   -9.303  1.00 0.97 ? 76  LEU A HD21 1  
ATOM   1152  H HD22 . LEU A 1 76 ? 2.364   1.424   -10.214 1.00 0.98 ? 76  LEU A HD22 1  
ATOM   1153  H HD23 . LEU A 1 76 ? 2.326   -0.186  -9.496  1.00 1.01 ? 76  LEU A HD23 1  
ATOM   1154  N N    . VAL A 1 77 ? 2.136   -1.135  -4.380  1.00 0.22 ? 77  VAL A N    1  
ATOM   1155  C CA   . VAL A 1 77 ? 2.623   -1.746  -3.151  1.00 0.25 ? 77  VAL A CA   1  
ATOM   1156  C C    . VAL A 1 77 ? 2.261   -3.227  -3.112  1.00 0.23 ? 77  VAL A C    1  
ATOM   1157  O O    . VAL A 1 77 ? 3.083   -4.070  -2.748  1.00 0.24 ? 77  VAL A O    1  
ATOM   1158  C CB   . VAL A 1 77 ? 2.049   -1.039  -1.900  1.00 0.29 ? 77  VAL A CB   1  
ATOM   1159  C CG1  . VAL A 1 77 ? 2.530   -1.717  -0.621  1.00 0.34 ? 77  VAL A CG1  1  
ATOM   1160  C CG2  . VAL A 1 77 ? 2.436   0.436   -1.893  1.00 0.35 ? 77  VAL A CG2  1  
ATOM   1161  H H    . VAL A 1 77 ? 1.468   -0.416  -4.325  1.00 0.22 ? 77  VAL A H    1  
ATOM   1162  H HA   . VAL A 1 77 ? 3.699   -1.648  -3.134  1.00 0.29 ? 77  VAL A HA   1  
ATOM   1163  H HB   . VAL A 1 77 ? 0.971   -1.107  -1.934  1.00 0.30 ? 77  VAL A HB   1  
ATOM   1164  H HG11 . VAL A 1 77 ? 2.161   -2.732  -0.592  1.00 0.46 ? 77  VAL A HG11 1  
ATOM   1165  H HG12 . VAL A 1 77 ? 2.161   -1.176  0.237   1.00 0.50 ? 77  VAL A HG12 1  
ATOM   1166  H HG13 . VAL A 1 77 ? 3.608   -1.727  -0.605  1.00 0.49 ? 77  VAL A HG13 1  
ATOM   1167  H HG21 . VAL A 1 77 ? 3.513   0.527   -1.893  1.00 0.59 ? 77  VAL A HG21 1  
ATOM   1168  H HG22 . VAL A 1 77 ? 2.034   0.909   -1.010  1.00 0.59 ? 77  VAL A HG22 1  
ATOM   1169  H HG23 . VAL A 1 77 ? 2.035   0.916   -2.773  1.00 0.55 ? 77  VAL A HG23 1  
ATOM   1170  N N    . LEU A 1 78 ? 1.033   -3.531  -3.515  1.00 0.21 ? 78  LEU A N    1  
ATOM   1171  C CA   . LEU A 1 78 ? 0.539   -4.900  -3.546  1.00 0.21 ? 78  LEU A CA   1  
ATOM   1172  C C    . LEU A 1 78 ? 1.398   -5.757  -4.466  1.00 0.20 ? 78  LEU A C    1  
ATOM   1173  O O    . LEU A 1 78 ? 1.825   -6.847  -4.089  1.00 0.22 ? 78  LEU A O    1  
ATOM   1174  C CB   . LEU A 1 78 ? -0.917  -4.925  -4.014  1.00 0.22 ? 78  LEU A CB   1  
ATOM   1175  C CG   . LEU A 1 78 ? -1.570  -6.310  -4.051  1.00 0.25 ? 78  LEU A CG   1  
ATOM   1176  C CD1  . LEU A 1 78 ? -1.778  -6.844  -2.643  1.00 0.35 ? 78  LEU A CD1  1  
ATOM   1177  C CD2  . LEU A 1 78 ? -2.891  -6.254  -4.804  1.00 0.34 ? 78  LEU A CD2  1  
ATOM   1178  H H    . LEU A 1 78 ? 0.430   -2.803  -3.798  1.00 0.20 ? 78  LEU A H    1  
ATOM   1179  H HA   . LEU A 1 78 ? 0.597   -5.296  -2.545  1.00 0.24 ? 78  LEU A HA   1  
ATOM   1180  H HB2  . LEU A 1 78 ? -1.493  -4.296  -3.354  1.00 0.26 ? 78  LEU A HB2  1  
ATOM   1181  H HB3  . LEU A 1 78 ? -0.959  -4.505  -5.008  1.00 0.23 ? 78  LEU A HB3  1  
ATOM   1182  H HG   . LEU A 1 78 ? -0.915  -6.993  -4.574  1.00 0.28 ? 78  LEU A HG   1  
ATOM   1183  H HD11 . LEU A 1 78 ? -2.378  -6.147  -2.080  1.00 0.67 ? 78  LEU A HD11 1  
ATOM   1184  H HD12 . LEU A 1 78 ? -0.819  -6.969  -2.159  1.00 0.70 ? 78  LEU A HD12 1  
ATOM   1185  H HD13 . LEU A 1 78 ? -2.281  -7.798  -2.692  1.00 0.68 ? 78  LEU A HD13 1  
ATOM   1186  H HD21 . LEU A 1 78 ? -3.559  -5.564  -4.309  1.00 0.67 ? 78  LEU A HD21 1  
ATOM   1187  H HD22 . LEU A 1 78 ? -3.337  -7.238  -4.819  1.00 0.68 ? 78  LEU A HD22 1  
ATOM   1188  H HD23 . LEU A 1 78 ? -2.716  -5.922  -5.817  1.00 0.71 ? 78  LEU A HD23 1  
ATOM   1189  N N    . GLY A 1 79 ? 1.658   -5.252  -5.665  1.00 0.20 ? 79  GLY A N    1  
ATOM   1190  C CA   . GLY A 1 79 ? 2.473   -5.980  -6.618  1.00 0.22 ? 79  GLY A CA   1  
ATOM   1191  C C    . GLY A 1 79 ? 3.865   -6.263  -6.088  1.00 0.21 ? 79  GLY A C    1  
ATOM   1192  O O    . GLY A 1 79 ? 4.381   -7.373  -6.237  1.00 0.27 ? 79  GLY A O    1  
ATOM   1193  H H    . GLY A 1 79 ? 1.292   -4.375  -5.906  1.00 0.20 ? 79  GLY A H    1  
ATOM   1194  H HA2  . GLY A 1 79 ? 1.988   -6.915  -6.848  1.00 0.24 ? 79  GLY A HA2  1  
ATOM   1195  H HA3  . GLY A 1 79 ? 2.555   -5.395  -7.526  1.00 0.24 ? 79  GLY A HA3  1  
ATOM   1196  N N    . ALA A 1 80 ? 4.466   -5.261  -5.457  1.00 0.19 ? 80  ALA A N    1  
ATOM   1197  C CA   . ALA A 1 80 ? 5.802   -5.397  -4.895  1.00 0.22 ? 80  ALA A CA   1  
ATOM   1198  C C    . ALA A 1 80 ? 5.825   -6.432  -3.776  1.00 0.21 ? 80  ALA A C    1  
ATOM   1199  O O    . ALA A 1 80 ? 6.709   -7.291  -3.728  1.00 0.25 ? 80  ALA A O    1  
ATOM   1200  C CB   . ALA A 1 80 ? 6.300   -4.052  -4.385  1.00 0.25 ? 80  ALA A CB   1  
ATOM   1201  H H    . ALA A 1 80 ? 3.999   -4.399  -5.374  1.00 0.21 ? 80  ALA A H    1  
ATOM   1202  H HA   . ALA A 1 80 ? 6.462   -5.723  -5.684  1.00 0.25 ? 80  ALA A HA   1  
ATOM   1203  H HB1  . ALA A 1 80 ? 5.621   -3.677  -3.632  1.00 0.41 ? 80  ALA A HB1  1  
ATOM   1204  H HB2  . ALA A 1 80 ? 6.346   -3.351  -5.205  1.00 0.39 ? 80  ALA A HB2  1  
ATOM   1205  H HB3  . ALA A 1 80 ? 7.284   -4.170  -3.957  1.00 0.43 ? 80  ALA A HB3  1  
ATOM   1206  N N    . LEU A 1 81 ? 4.841   -6.359  -2.888  1.00 0.21 ? 81  LEU A N    1  
ATOM   1207  C CA   . LEU A 1 81 ? 4.756   -7.287  -1.768  1.00 0.25 ? 81  LEU A CA   1  
ATOM   1208  C C    . LEU A 1 81 ? 4.432   -8.698  -2.249  1.00 0.22 ? 81  LEU A C    1  
ATOM   1209  O O    . LEU A 1 81 ? 4.945   -9.677  -1.706  1.00 0.23 ? 81  LEU A O    1  
ATOM   1210  C CB   . LEU A 1 81 ? 3.708   -6.820  -0.758  1.00 0.33 ? 81  LEU A CB   1  
ATOM   1211  C CG   . LEU A 1 81 ? 4.101   -5.592  0.065   1.00 0.50 ? 81  LEU A CG   1  
ATOM   1212  C CD1  . LEU A 1 81 ? 2.914   -5.082  0.863   1.00 0.60 ? 81  LEU A CD1  1  
ATOM   1213  C CD2  . LEU A 1 81 ? 5.263   -5.915  0.994   1.00 0.72 ? 81  LEU A CD2  1  
ATOM   1214  H H    . LEU A 1 81 ? 4.153   -5.663  -2.989  1.00 0.21 ? 81  LEU A H    1  
ATOM   1215  H HA   . LEU A 1 81 ? 5.721   -7.302  -1.286  1.00 0.30 ? 81  LEU A HA   1  
ATOM   1216  H HB2  . LEU A 1 81 ? 2.800   -6.590  -1.297  1.00 0.41 ? 81  LEU A HB2  1  
ATOM   1217  H HB3  . LEU A 1 81 ? 3.508   -7.635  -0.079  1.00 0.38 ? 81  LEU A HB3  1  
ATOM   1218  H HG   . LEU A 1 81 ? 4.414   -4.802  -0.604  1.00 0.60 ? 81  LEU A HG   1  
ATOM   1219  H HD11 . LEU A 1 81 ? 2.591   -5.844  1.553   1.00 0.98 ? 81  LEU A HD11 1  
ATOM   1220  H HD12 . LEU A 1 81 ? 2.106   -4.840  0.188   1.00 0.95 ? 81  LEU A HD12 1  
ATOM   1221  H HD13 . LEU A 1 81 ? 3.203   -4.197  1.412   1.00 1.12 ? 81  LEU A HD13 1  
ATOM   1222  H HD21 . LEU A 1 81 ? 6.116   -6.218  0.409   1.00 1.02 ? 81  LEU A HD21 1  
ATOM   1223  H HD22 . LEU A 1 81 ? 4.979   -6.717  1.659   1.00 1.04 ? 81  LEU A HD22 1  
ATOM   1224  H HD23 . LEU A 1 81 ? 5.514   -5.038  1.572   1.00 1.02 ? 81  LEU A HD23 1  
ATOM   1225  N N    . LYS A 1 82 ? 3.582   -8.795  -3.267  1.00 0.22 ? 82  LYS A N    1  
ATOM   1226  C CA   . LYS A 1 82 ? 3.206   -10.089 -3.827  1.00 0.24 ? 82  LYS A CA   1  
ATOM   1227  C C    . LYS A 1 82 ? 4.436   -10.799 -4.371  1.00 0.24 ? 82  LYS A C    1  
ATOM   1228  O O    . LYS A 1 82 ? 4.671   -11.969 -4.070  1.00 0.29 ? 82  LYS A O    1  
ATOM   1229  C CB   . LYS A 1 82 ? 2.158   -9.926  -4.935  1.00 0.31 ? 82  LYS A CB   1  
ATOM   1230  C CG   . LYS A 1 82 ? 0.729   -9.919  -4.423  1.00 0.52 ? 82  LYS A CG   1  
ATOM   1231  C CD   . LYS A 1 82 ? -0.273  -9.910  -5.564  1.00 0.61 ? 82  LYS A CD   1  
ATOM   1232  C CE   . LYS A 1 82 ? -1.672  -10.237 -5.070  1.00 0.90 ? 82  LYS A CE   1  
ATOM   1233  N NZ   . LYS A 1 82 ? -2.649  -10.341 -6.185  1.00 1.19 ? 82  LYS A NZ   1  
ATOM   1234  H H    . LYS A 1 82 ? 3.191   -7.977  -3.645  1.00 0.23 ? 82  LYS A H    1  
ATOM   1235  H HA   . LYS A 1 82 ? 2.785   -10.687 -3.030  1.00 0.26 ? 82  LYS A HA   1  
ATOM   1236  H HB2  . LYS A 1 82 ? 2.335   -8.993  -5.449  1.00 0.53 ? 82  LYS A HB2  1  
ATOM   1237  H HB3  . LYS A 1 82 ? 2.261   -10.740 -5.638  1.00 0.51 ? 82  LYS A HB3  1  
ATOM   1238  H HG2  . LYS A 1 82 ? 0.568   -10.800 -3.824  1.00 0.82 ? 82  LYS A HG2  1  
ATOM   1239  H HG3  . LYS A 1 82 ? 0.580   -9.037  -3.816  1.00 0.81 ? 82  LYS A HG3  1  
ATOM   1240  H HD2  . LYS A 1 82 ? -0.282  -8.930  -6.016  1.00 0.84 ? 82  LYS A HD2  1  
ATOM   1241  H HD3  . LYS A 1 82 ? 0.022   -10.647 -6.297  1.00 0.84 ? 82  LYS A HD3  1  
ATOM   1242  H HE2  . LYS A 1 82 ? -1.639  -11.178 -4.542  1.00 1.22 ? 82  LYS A HE2  1  
ATOM   1243  H HE3  . LYS A 1 82 ? -1.991  -9.457  -4.392  1.00 1.21 ? 82  LYS A HE3  1  
ATOM   1244  H HZ1  . LYS A 1 82 ? -2.172  -10.661 -7.051  1.00 1.48 ? 82  LYS A HZ1  1  
ATOM   1245  H HZ2  . LYS A 1 82 ? -3.094  -9.417  -6.367  1.00 1.54 ? 82  LYS A HZ2  1  
ATOM   1246  H HZ3  . LYS A 1 82 ? -3.395  -11.026 -5.943  1.00 1.55 ? 82  LYS A HZ3  1  
ATOM   1247  N N    . ALA A 1 83 ? 5.235   -10.073 -5.147  1.00 0.24 ? 83  ALA A N    1  
ATOM   1248  C CA   . ALA A 1 83 ? 6.451   -10.623 -5.727  1.00 0.28 ? 83  ALA A CA   1  
ATOM   1249  C C    . ALA A 1 83 ? 7.431   -11.032 -4.634  1.00 0.28 ? 83  ALA A C    1  
ATOM   1250  O O    . ALA A 1 83 ? 8.071   -12.079 -4.718  1.00 0.34 ? 83  ALA A O    1  
ATOM   1251  C CB   . ALA A 1 83 ? 7.093   -9.613  -6.668  1.00 0.35 ? 83  ALA A CB   1  
ATOM   1252  H H    . ALA A 1 83 ? 4.992   -9.139  -5.341  1.00 0.25 ? 83  ALA A H    1  
ATOM   1253  H HA   . ALA A 1 83 ? 6.180   -11.500 -6.301  1.00 0.32 ? 83  ALA A HA   1  
ATOM   1254  H HB1  . ALA A 1 83 ? 7.376   -8.732  -6.109  1.00 0.48 ? 83  ALA A HB1  1  
ATOM   1255  H HB2  . ALA A 1 83 ? 6.386   -9.337  -7.437  1.00 0.53 ? 83  ALA A HB2  1  
ATOM   1256  H HB3  . ALA A 1 83 ? 7.970   -10.048 -7.121  1.00 0.54 ? 83  ALA A HB3  1  
ATOM   1257  N N    . ALA A 1 84 ? 7.531   -10.202 -3.601  1.00 0.26 ? 84  ALA A N    1  
ATOM   1258  C CA   . ALA A 1 84 ? 8.423   -10.475 -2.483  1.00 0.31 ? 84  ALA A CA   1  
ATOM   1259  C C    . ALA A 1 84 ? 7.998   -11.735 -1.736  1.00 0.32 ? 84  ALA A C    1  
ATOM   1260  O O    . ALA A 1 84 ? 8.832   -12.538 -1.326  1.00 0.45 ? 84  ALA A O    1  
ATOM   1261  C CB   . ALA A 1 84 ? 8.454   -9.287  -1.534  1.00 0.35 ? 84  ALA A CB   1  
ATOM   1262  H H    . ALA A 1 84 ? 6.999   -9.379  -3.599  1.00 0.26 ? 84  ALA A H    1  
ATOM   1263  H HA   . ALA A 1 84 ? 9.421   -10.618 -2.878  1.00 0.36 ? 84  ALA A HA   1  
ATOM   1264  H HB1  . ALA A 1 84 ? 9.173   -9.472  -0.751  1.00 0.55 ? 84  ALA A HB1  1  
ATOM   1265  H HB2  . ALA A 1 84 ? 7.475   -9.146  -1.098  1.00 0.50 ? 84  ALA A HB2  1  
ATOM   1266  H HB3  . ALA A 1 84 ? 8.735   -8.398  -2.079  1.00 0.52 ? 84  ALA A HB3  1  
ATOM   1267  N N    . ARG A 1 85 ? 6.689   -11.904 -1.571  1.00 0.29 ? 85  ARG A N    1  
ATOM   1268  C CA   . ARG A 1 85 ? 6.150   -13.065 -0.873  1.00 0.35 ? 85  ARG A CA   1  
ATOM   1269  C C    . ARG A 1 85 ? 6.269   -14.331 -1.721  1.00 0.35 ? 85  ARG A C    1  
ATOM   1270  O O    . ARG A 1 85 ? 6.162   -15.440 -1.204  1.00 0.48 ? 85  ARG A O    1  
ATOM   1271  C CB   . ARG A 1 85 ? 4.688   -12.830 -0.489  1.00 0.42 ? 85  ARG A CB   1  
ATOM   1272  C CG   . ARG A 1 85 ? 4.501   -12.087 0.828   1.00 0.54 ? 85  ARG A CG   1  
ATOM   1273  C CD   . ARG A 1 85 ? 5.030   -12.895 2.000   1.00 0.74 ? 85  ARG A CD   1  
ATOM   1274  N NE   . ARG A 1 85 ? 4.582   -12.364 3.288   1.00 0.66 ? 85  ARG A NE   1  
ATOM   1275  C CZ   . ARG A 1 85 ? 4.711   -13.016 4.442   1.00 0.66 ? 85  ARG A CZ   1  
ATOM   1276  N NH1  . ARG A 1 85 ? 5.275   -14.219 4.470   1.00 0.83 ? 85  ARG A NH1  1  
ATOM   1277  N NH2  . ARG A 1 85 ? 4.254   -12.478 5.569   1.00 0.79 ? 85  ARG A NH2  1  
ATOM   1278  H H    . ARG A 1 85 ? 6.069   -11.226 -1.922  1.00 0.31 ? 85  ARG A H    1  
ATOM   1279  H HA   . ARG A 1 85 ? 6.730   -13.199 0.027   1.00 0.41 ? 85  ARG A HA   1  
ATOM   1280  H HB2  . ARG A 1 85 ? 4.212   -12.256 -1.271  1.00 0.47 ? 85  ARG A HB2  1  
ATOM   1281  H HB3  . ARG A 1 85 ? 4.194   -13.786 -0.410  1.00 0.49 ? 85  ARG A HB3  1  
ATOM   1282  H HG2  . ARG A 1 85 ? 5.035   -11.148 0.781   1.00 0.96 ? 85  ARG A HG2  1  
ATOM   1283  H HG3  . ARG A 1 85 ? 3.449   -11.896 0.977   1.00 1.03 ? 85  ARG A HG3  1  
ATOM   1284  H HD2  . ARG A 1 85 ? 4.683   -13.913 1.905   1.00 1.28 ? 85  ARG A HD2  1  
ATOM   1285  H HD3  . ARG A 1 85 ? 6.109   -12.880 1.975   1.00 1.22 ? 85  ARG A HD3  1  
ATOM   1286  H HE   . ARG A 1 85 ? 4.175   -11.471 3.290   1.00 0.81 ? 85  ARG A HE   1  
ATOM   1287  H HH11 . ARG A 1 85 ? 5.375   -14.711 5.338   1.00 1.01 ? 85  ARG A HH11 1  
ATOM   1288  H HH12 . ARG A 1 85 ? 5.604   -14.642 3.623   1.00 0.90 ? 85  ARG A HH12 1  
ATOM   1289  H HH21 . ARG A 1 85 ? 3.806   -11.579 5.556   1.00 0.90 ? 85  ARG A HH21 1  
ATOM   1290  H HH22 . ARG A 1 85 ? 4.355   -12.965 6.440   1.00 0.92 ? 85  ARG A HH22 1  
ATOM   1291  N N    . GLU A 1 86 ? 6.491   -14.160 -3.018  1.00 0.35 ? 86  GLU A N    1  
ATOM   1292  C CA   . GLU A 1 86 ? 6.624   -15.296 -3.927  1.00 0.40 ? 86  GLU A CA   1  
ATOM   1293  C C    . GLU A 1 86 ? 8.044   -15.847 -3.901  1.00 0.43 ? 86  GLU A C    1  
ATOM   1294  O O    . GLU A 1 86 ? 8.310   -16.932 -4.418  1.00 0.65 ? 86  GLU A O    1  
ATOM   1295  C CB   . GLU A 1 86 ? 6.266   -14.883 -5.354  1.00 0.50 ? 86  GLU A CB   1  
ATOM   1296  C CG   . GLU A 1 86 ? 4.774   -14.842 -5.628  1.00 0.68 ? 86  GLU A CG   1  
ATOM   1297  C CD   . GLU A 1 86 ? 4.468   -14.557 -7.083  1.00 0.87 ? 86  GLU A CD   1  
ATOM   1298  O OE1  . GLU A 1 86 ? 5.239   -15.018 -7.954  1.00 1.32 ? 86  GLU A OE1  1  
ATOM   1299  O OE2  . GLU A 1 86 ? 3.462   -13.875 -7.367  1.00 1.25 ? 86  GLU A OE2  1  
ATOM   1300  H H    . GLU A 1 86 ? 6.571   -13.250 -3.374  1.00 0.42 ? 86  GLU A H    1  
ATOM   1301  H HA   . GLU A 1 86 ? 5.943   -16.066 -3.601  1.00 0.47 ? 86  GLU A HA   1  
ATOM   1302  H HB2  . GLU A 1 86 ? 6.669   -13.899 -5.542  1.00 0.63 ? 86  GLU A HB2  1  
ATOM   1303  H HB3  . GLU A 1 86 ? 6.717   -15.583 -6.041  1.00 0.63 ? 86  GLU A HB3  1  
ATOM   1304  H HG2  . GLU A 1 86 ? 4.342   -15.796 -5.365  1.00 0.90 ? 86  GLU A HG2  1  
ATOM   1305  H HG3  . GLU A 1 86 ? 4.331   -14.066 -5.023  1.00 0.93 ? 86  GLU A HG3  1  
ATOM   1306  N N    . GLU A 1 87 ? 8.952   -15.096 -3.296  1.00 0.47 ? 87  GLU A N    1  
ATOM   1307  C CA   . GLU A 1 87 ? 10.343  -15.501 -3.208  1.00 0.58 ? 87  GLU A CA   1  
ATOM   1308  C C    . GLU A 1 87 ? 10.658  -16.045 -1.819  1.00 0.68 ? 87  GLU A C    1  
ATOM   1309  O O    . GLU A 1 87 ? 10.439  -17.251 -1.589  1.00 1.13 ? 87  GLU A O    1  
ATOM   1310  C CB   . GLU A 1 87 ? 11.254  -14.317 -3.532  1.00 0.77 ? 87  GLU A CB   1  
ATOM   1311  C CG   . GLU A 1 87 ? 11.014  -13.721 -4.908  1.00 1.10 ? 87  GLU A CG   1  
ATOM   1312  C CD   . GLU A 1 87 ? 12.146  -13.995 -5.873  1.00 1.15 ? 87  GLU A CD   1  
ATOM   1313  O OE1  . GLU A 1 87 ? 12.448  -15.180 -6.128  1.00 1.51 ? 87  GLU A OE1  1  
ATOM   1314  O OE2  . GLU A 1 87 ? 12.739  -13.022 -6.389  1.00 1.44 ? 87  GLU A OE2  1  
ATOM   1315  O OXT  . GLU A 1 87 ? 11.122  -15.265 -0.959  1.00 1.02 ? 87  GLU A OXT  1  
ATOM   1316  H H    . GLU A 1 87 ? 8.676   -14.248 -2.889  1.00 0.60 ? 87  GLU A H    1  
ATOM   1317  H HA   . GLU A 1 87 ? 10.510  -16.281 -3.935  1.00 0.71 ? 87  GLU A HA   1  
ATOM   1318  H HB2  . GLU A 1 87 ? 11.092  -13.544 -2.798  1.00 1.08 ? 87  GLU A HB2  1  
ATOM   1319  H HB3  . GLU A 1 87 ? 12.283  -14.645 -3.478  1.00 1.00 ? 87  GLU A HB3  1  
ATOM   1320  H HG2  . GLU A 1 87 ? 10.106  -14.142 -5.316  1.00 1.52 ? 87  GLU A HG2  1  
ATOM   1321  H HG3  . GLU A 1 87 ? 10.898  -12.651 -4.808  1.00 1.59 ? 87  GLU A HG3  1  
HETATM 1322  C C1   . IHP B 2 .  ? 14.119  9.992   1.597   1.00 0.87 ? 101 IHP A C1   1  
HETATM 1323  C C2   . IHP B 2 .  ? 12.935  10.659  2.301   1.00 0.83 ? 101 IHP A C2   1  
HETATM 1324  C C3   . IHP B 2 .  ? 12.229  11.600  1.324   1.00 0.67 ? 101 IHP A C3   1  
HETATM 1325  C C4   . IHP B 2 .  ? 11.723  10.802  0.120   1.00 0.52 ? 101 IHP A C4   1  
HETATM 1326  C C5   . IHP B 2 .  ? 12.908  10.137  -0.584  1.00 0.61 ? 101 IHP A C5   1  
HETATM 1327  C C6   . IHP B 2 .  ? 13.615  9.194   0.393   1.00 0.77 ? 101 IHP A C6   1  
HETATM 1328  O O11  . IHP B 2 .  ? 14.781  9.112   2.507   1.00 1.21 ? 101 IHP A O11  1  
HETATM 1329  P P1   . IHP B 2 .  ? 16.326  9.285   2.927   1.00 1.54 ? 101 IHP A P1   1  
HETATM 1330  O O21  . IHP B 2 .  ? 16.545  10.649  3.455   1.00 1.58 ? 101 IHP A O21  1  
HETATM 1331  O O31  . IHP B 2 .  ? 16.696  8.204   4.061   1.00 1.93 ? 101 IHP A O31  1  
HETATM 1332  O O41  . IHP B 2 .  ? 17.262  9.050   1.636   1.00 1.56 ? 101 IHP A O41  1  
HETATM 1333  O O12  . IHP B 2 .  ? 12.019  9.655   2.743   1.00 0.85 ? 101 IHP A O12  1  
HETATM 1334  P P2   . IHP B 2 .  ? 11.624  9.452   4.289   1.00 1.21 ? 101 IHP A P2   1  
HETATM 1335  O O22  . IHP B 2 .  ? 11.121  10.729  4.843   1.00 1.39 ? 101 IHP A O22  1  
HETATM 1336  O O32  . IHP B 2 .  ? 10.476  8.328   4.407   1.00 1.20 ? 101 IHP A O32  1  
HETATM 1337  O O42  . IHP B 2 .  ? 12.921  8.982   5.119   1.00 1.55 ? 101 IHP A O42  1  
HETATM 1338  O O13  . IHP B 2 .  ? 11.120  12.223  1.980   1.00 0.90 ? 101 IHP A O13  1  
HETATM 1339  P P3   . IHP B 2 .  ? 10.991  13.818  2.157   1.00 1.24 ? 101 IHP A P3   1  
HETATM 1340  O O23  . IHP B 2 .  ? 12.203  14.338  2.828   1.00 1.39 ? 101 IHP A O23  1  
HETATM 1341  O O33  . IHP B 2 .  ? 10.837  14.508  0.712   1.00 1.27 ? 101 IHP A O33  1  
HETATM 1342  O O43  . IHP B 2 .  ? 9.695   14.154  3.052   1.00 1.57 ? 101 IHP A O43  1  
HETATM 1343  O O14  . IHP B 2 .  ? 11.060  11.682  -0.791  1.00 0.74 ? 101 IHP A O14  1  
HETATM 1344  P P4   . IHP B 2 .  ? 9.516   11.512  -1.211  1.00 1.00 ? 101 IHP A P4   1  
HETATM 1345  O O24  . IHP B 2 .  ? 9.073   12.746  -2.143  1.00 1.39 ? 101 IHP A O24  1  
HETATM 1346  O O34  . IHP B 2 .  ? 9.329   10.132  -2.021  1.00 1.09 ? 101 IHP A O34  1  
HETATM 1347  O O44  . IHP B 2 .  ? 8.676   11.486  0.005   1.00 1.01 ? 101 IHP A O44  1  
HETATM 1348  O O15  . IHP B 2 .  ? 12.436  9.391   -1.707  1.00 0.86 ? 101 IHP A O15  1  
HETATM 1349  P P5   . IHP B 2 .  ? 12.908  9.691   -3.218  1.00 1.20 ? 101 IHP A P5   1  
HETATM 1350  O O25  . IHP B 2 .  ? 14.385  9.641   -3.293  1.00 1.28 ? 101 IHP A O25  1  
HETATM 1351  O O35  . IHP B 2 .  ? 12.282  8.582   -4.204  1.00 1.56 ? 101 IHP A O35  1  
HETATM 1352  O O45  . IHP B 2 .  ? 12.397  11.153  -3.661  1.00 1.25 ? 101 IHP A O45  1  
HETATM 1353  O O16  . IHP B 2 .  ? 14.721  8.573   -0.264  1.00 1.06 ? 101 IHP A O16  1  
HETATM 1354  P P6   . IHP B 2 .  ? 14.850  6.978   -0.442  1.00 1.40 ? 101 IHP A P6   1  
HETATM 1355  O O26  . IHP B 2 .  ? 13.640  6.454   -1.113  1.00 1.39 ? 101 IHP A O26  1  
HETATM 1356  O O36  . IHP B 2 .  ? 16.148  6.642   -1.337  1.00 1.74 ? 101 IHP A O36  1  
HETATM 1357  O O46  . IHP B 2 .  ? 15.004  6.287   1.004   1.00 1.56 ? 101 IHP A O46  1  
HETATM 1358  H H1   . IHP B 2 .  ? 14.811  10.771  1.253   1.00 0.89 ? 101 IHP A H1   1  
HETATM 1359  H H2   . IHP B 2 .  ? 13.294  11.222  3.163   1.00 1.08 ? 101 IHP A H2   1  
HETATM 1360  H H3   . IHP B 2 .  ? 12.945  12.358  1.004   1.00 0.73 ? 101 IHP A H3   1  
HETATM 1361  H H4   . IHP B 2 .  ? 11.021  10.028  0.459   1.00 0.51 ? 101 IHP A H4   1  
HETATM 1362  H H5   . IHP B 2 .  ? 13.599  10.913  -0.916  1.00 0.66 ? 101 IHP A H5   1  
HETATM 1363  H H6   . IHP B 2 .  ? 12.930  8.432   0.746   1.00 0.80 ? 101 IHP A H6   1  
ATOM   1364  N N    . SER A 1 1  ? 4.505   4.318   11.116  1.00 1.45 ? 1   SER A N    2  
ATOM   1365  C CA   . SER A 1 1  ? 4.937   5.643   11.605  1.00 0.98 ? 1   SER A CA   2  
ATOM   1366  C C    . SER A 1 1  ? 6.103   6.185   10.779  1.00 0.92 ? 1   SER A C    2  
ATOM   1367  O O    . SER A 1 1  ? 5.939   7.157   10.044  1.00 1.21 ? 1   SER A O    2  
ATOM   1368  C CB   . SER A 1 1  ? 5.322   5.543   13.075  1.00 1.66 ? 1   SER A CB   2  
ATOM   1369  O OG   . SER A 1 1  ? 4.357   4.799   13.794  1.00 2.07 ? 1   SER A OG   2  
ATOM   1370  H H1   . SER A 1 1  ? 4.290   4.362   10.099  1.00 1.90 ? 1   SER A H1   2  
ATOM   1371  H H2   . SER A 1 1  ? 3.650   4.019   11.627  1.00 1.69 ? 1   SER A H2   2  
ATOM   1372  H H3   . SER A 1 1  ? 5.252   3.616   11.275  1.00 1.94 ? 1   SER A H3   2  
ATOM   1373  H HA   . SER A 1 1  ? 4.102   6.322   11.508  1.00 1.33 ? 1   SER A HA   2  
ATOM   1374  H HB2  . SER A 1 1  ? 6.279   5.053   13.163  1.00 2.07 ? 1   SER A HB2  2  
ATOM   1375  H HB3  . SER A 1 1  ? 5.384   6.534   13.497  1.00 2.12 ? 1   SER A HB3  2  
ATOM   1376  H HG   . SER A 1 1  ? 3.649   5.393   14.081  1.00 2.51 ? 1   SER A HG   2  
ATOM   1377  N N    . GLU A 1 2  ? 7.284   5.571   10.899  1.00 0.80 ? 2   GLU A N    2  
ATOM   1378  C CA   . GLU A 1 2  ? 8.450   6.021   10.135  1.00 0.85 ? 2   GLU A CA   2  
ATOM   1379  C C    . GLU A 1 2  ? 9.230   4.834   9.579   1.00 0.72 ? 2   GLU A C    2  
ATOM   1380  O O    . GLU A 1 2  ? 9.372   4.688   8.366   1.00 0.72 ? 2   GLU A O    2  
ATOM   1381  C CB   . GLU A 1 2  ? 9.389   6.884   10.989  1.00 1.13 ? 2   GLU A CB   2  
ATOM   1382  C CG   . GLU A 1 2  ? 8.685   7.916   11.851  1.00 1.33 ? 2   GLU A CG   2  
ATOM   1383  C CD   . GLU A 1 2  ? 8.635   7.517   13.311  1.00 1.48 ? 2   GLU A CD   2  
ATOM   1384  O OE1  . GLU A 1 2  ? 9.709   7.291   13.908  1.00 1.99 ? 2   GLU A OE1  2  
ATOM   1385  O OE2  . GLU A 1 2  ? 7.525   7.421   13.868  1.00 1.97 ? 2   GLU A OE2  2  
ATOM   1386  H H    . GLU A 1 2  ? 7.375   4.809   11.514  1.00 0.89 ? 2   GLU A H    2  
ATOM   1387  H HA   . GLU A 1 2  ? 8.089   6.613   9.307   1.00 0.92 ? 2   GLU A HA   2  
ATOM   1388  H HB2  . GLU A 1 2  ? 9.960   6.239   11.635  1.00 1.41 ? 2   GLU A HB2  2  
ATOM   1389  H HB3  . GLU A 1 2  ? 10.069  7.405   10.330  1.00 1.30 ? 2   GLU A HB3  2  
ATOM   1390  H HG2  . GLU A 1 2  ? 9.209   8.853   11.767  1.00 1.76 ? 2   GLU A HG2  2  
ATOM   1391  H HG3  . GLU A 1 2  ? 7.674   8.035   11.491  1.00 1.92 ? 2   GLU A HG3  2  
ATOM   1392  N N    . ALA A 1 3  ? 9.720   3.982   10.476  1.00 0.74 ? 3   ALA A N    2  
ATOM   1393  C CA   . ALA A 1 3  ? 10.502  2.810   10.086  1.00 0.73 ? 3   ALA A CA   2  
ATOM   1394  C C    . ALA A 1 3  ? 9.753   1.936   9.085   1.00 0.59 ? 3   ALA A C    2  
ATOM   1395  O O    . ALA A 1 3  ? 10.282  1.607   8.023   1.00 0.57 ? 3   ALA A O    2  
ATOM   1396  C CB   . ALA A 1 3  ? 10.872  1.994   11.311  1.00 0.89 ? 3   ALA A CB   2  
ATOM   1397  H H    . ALA A 1 3  ? 9.563   4.151   11.433  1.00 0.83 ? 3   ALA A H    2  
ATOM   1398  H HA   . ALA A 1 3  ? 11.416  3.160   9.628   1.00 0.80 ? 3   ALA A HA   2  
ATOM   1399  H HB1  . ALA A 1 3  ? 11.412  2.616   12.009  1.00 1.15 ? 3   ALA A HB1  2  
ATOM   1400  H HB2  . ALA A 1 3  ? 11.492  1.163   11.014  1.00 1.06 ? 3   ALA A HB2  2  
ATOM   1401  H HB3  . ALA A 1 3  ? 9.972   1.623   11.780  1.00 0.95 ? 3   ALA A HB3  2  
ATOM   1402  N N    . VAL A 1 4  ? 8.518   1.573   9.420   1.00 0.56 ? 4   VAL A N    2  
ATOM   1403  C CA   . VAL A 1 4  ? 7.700   0.733   8.543   1.00 0.50 ? 4   VAL A CA   2  
ATOM   1404  C C    . VAL A 1 4  ? 7.531   1.385   7.169   1.00 0.45 ? 4   VAL A C    2  
ATOM   1405  O O    . VAL A 1 4  ? 7.452   0.699   6.149   1.00 0.48 ? 4   VAL A O    2  
ATOM   1406  C CB   . VAL A 1 4  ? 6.311   0.455   9.159   1.00 0.57 ? 4   VAL A CB   2  
ATOM   1407  C CG1  . VAL A 1 4  ? 5.507   -0.503  8.291   1.00 0.82 ? 4   VAL A CG1  2  
ATOM   1408  C CG2  . VAL A 1 4  ? 6.454   -0.104  10.565  1.00 0.79 ? 4   VAL A CG2  2  
ATOM   1409  H H    . VAL A 1 4  ? 8.149   1.872   10.278  1.00 0.63 ? 4   VAL A H    2  
ATOM   1410  H HA   . VAL A 1 4  ? 8.213   -0.211  8.418   1.00 0.54 ? 4   VAL A HA   2  
ATOM   1411  H HB   . VAL A 1 4  ? 5.774   1.388   9.217   1.00 0.63 ? 4   VAL A HB   2  
ATOM   1412  H HG11 . VAL A 1 4  ? 5.444   -0.114  7.286   1.00 1.06 ? 4   VAL A HG11 2  
ATOM   1413  H HG12 . VAL A 1 4  ? 4.513   -0.608  8.700   1.00 0.99 ? 4   VAL A HG12 2  
ATOM   1414  H HG13 . VAL A 1 4  ? 5.993   -1.466  8.274   1.00 1.13 ? 4   VAL A HG13 2  
ATOM   1415  H HG21 . VAL A 1 4  ? 7.000   0.596   11.176  1.00 1.11 ? 4   VAL A HG21 2  
ATOM   1416  H HG22 . VAL A 1 4  ? 6.988   -1.042  10.524  1.00 1.16 ? 4   VAL A HG22 2  
ATOM   1417  H HG23 . VAL A 1 4  ? 5.474   -0.267  10.989  1.00 1.27 ? 4   VAL A HG23 2  
ATOM   1418  N N    . ILE A 1 5  ? 7.490   2.713   7.150   1.00 0.48 ? 5   ILE A N    2  
ATOM   1419  C CA   . ILE A 1 5  ? 7.343   3.453   5.904   1.00 0.51 ? 5   ILE A CA   2  
ATOM   1420  C C    . ILE A 1 5  ? 8.559   3.243   5.006   1.00 0.46 ? 5   ILE A C    2  
ATOM   1421  O O    . ILE A 1 5  ? 8.421   2.824   3.856   1.00 0.47 ? 5   ILE A O    2  
ATOM   1422  C CB   . ILE A 1 5  ? 7.143   4.967   6.155   1.00 0.65 ? 5   ILE A CB   2  
ATOM   1423  C CG1  . ILE A 1 5  ? 5.772   5.224   6.787   1.00 0.81 ? 5   ILE A CG1  2  
ATOM   1424  C CG2  . ILE A 1 5  ? 7.290   5.752   4.856   1.00 0.81 ? 5   ILE A CG2  2  
ATOM   1425  C CD1  . ILE A 1 5  ? 5.409   6.690   6.896   1.00 0.98 ? 5   ILE A CD1  2  
ATOM   1426  H H    . ILE A 1 5  ? 7.565   3.206   7.991   1.00 0.54 ? 5   ILE A H    2  
ATOM   1427  H HA   . ILE A 1 5  ? 6.470   3.074   5.397   1.00 0.55 ? 5   ILE A HA   2  
ATOM   1428  H HB   . ILE A 1 5  ? 7.912   5.300   6.835   1.00 0.71 ? 5   ILE A HB   2  
ATOM   1429  H HG12 . ILE A 1 5  ? 5.014   4.743   6.189   1.00 0.91 ? 5   ILE A HG12 2  
ATOM   1430  H HG13 . ILE A 1 5  ? 5.761   4.805   7.783   1.00 0.85 ? 5   ILE A HG13 2  
ATOM   1431  H HG21 . ILE A 1 5  ? 6.513   5.456   4.167   1.00 1.02 ? 5   ILE A HG21 2  
ATOM   1432  H HG22 . ILE A 1 5  ? 8.255   5.545   4.418   1.00 1.00 ? 5   ILE A HG22 2  
ATOM   1433  H HG23 . ILE A 1 5  ? 7.208   6.809   5.063   1.00 1.04 ? 5   ILE A HG23 2  
ATOM   1434  H HD11 . ILE A 1 5  ? 5.399   7.133   5.911   1.00 1.27 ? 5   ILE A HD11 2  
ATOM   1435  H HD12 . ILE A 1 5  ? 6.139   7.197   7.511   1.00 1.29 ? 5   ILE A HD12 2  
ATOM   1436  H HD13 . ILE A 1 5  ? 4.431   6.785   7.344   1.00 1.30 ? 5   ILE A HD13 2  
ATOM   1437  N N    . LYS A 1 6  ? 9.743   3.514   5.548   1.00 0.49 ? 6   LYS A N    2  
ATOM   1438  C CA   . LYS A 1 6  ? 10.985  3.365   4.795   1.00 0.50 ? 6   LYS A CA   2  
ATOM   1439  C C    . LYS A 1 6  ? 11.149  1.933   4.295   1.00 0.46 ? 6   LYS A C    2  
ATOM   1440  O O    . LYS A 1 6  ? 11.533  1.720   3.150   1.00 0.47 ? 6   LYS A O    2  
ATOM   1441  C CB   . LYS A 1 6  ? 12.201  3.767   5.641   1.00 0.61 ? 6   LYS A CB   2  
ATOM   1442  C CG   . LYS A 1 6  ? 12.222  5.237   6.048   1.00 0.85 ? 6   LYS A CG   2  
ATOM   1443  C CD   . LYS A 1 6  ? 12.262  6.171   4.841   1.00 1.11 ? 6   LYS A CD   2  
ATOM   1444  C CE   . LYS A 1 6  ? 13.638  6.224   4.188   1.00 1.11 ? 6   LYS A CE   2  
ATOM   1445  N NZ   . LYS A 1 6  ? 13.692  7.230   3.087   1.00 1.12 ? 6   LYS A NZ   2  
ATOM   1446  H H    . LYS A 1 6  ? 9.781   3.821   6.479   1.00 0.53 ? 6   LYS A H    2  
ATOM   1447  H HA   . LYS A 1 6  ? 10.925  4.019   3.940   1.00 0.52 ? 6   LYS A HA   2  
ATOM   1448  H HB2  . LYS A 1 6  ? 12.211  3.169   6.541   1.00 0.84 ? 6   LYS A HB2  2  
ATOM   1449  H HB3  . LYS A 1 6  ? 13.098  3.562   5.077   1.00 0.80 ? 6   LYS A HB3  2  
ATOM   1450  H HG2  . LYS A 1 6  ? 11.334  5.450   6.621   1.00 1.25 ? 6   LYS A HG2  2  
ATOM   1451  H HG3  . LYS A 1 6  ? 13.096  5.416   6.658   1.00 1.02 ? 6   LYS A HG3  2  
ATOM   1452  H HD2  . LYS A 1 6  ? 11.550  5.828   4.112   1.00 1.57 ? 6   LYS A HD2  2  
ATOM   1453  H HD3  . LYS A 1 6  ? 11.993  7.164   5.166   1.00 1.65 ? 6   LYS A HD3  2  
ATOM   1454  H HE2  . LYS A 1 6  ? 14.369  6.484   4.939   1.00 1.38 ? 6   LYS A HE2  2  
ATOM   1455  H HE3  . LYS A 1 6  ? 13.870  5.249   3.786   1.00 1.51 ? 6   LYS A HE3  2  
ATOM   1456  H HZ1  . LYS A 1 6  ? 14.654  7.285   2.694   1.00 1.52 ? 6   LYS A HZ1  2  
ATOM   1457  H HZ2  . LYS A 1 6  ? 13.428  8.171   3.443   1.00 1.47 ? 6   LYS A HZ2  2  
ATOM   1458  H HZ3  . LYS A 1 6  ? 13.039  6.966   2.325   1.00 1.48 ? 6   LYS A HZ3  2  
ATOM   1459  N N    . VAL A 1 7  ? 10.840  0.958   5.153   1.00 0.46 ? 7   VAL A N    2  
ATOM   1460  C CA   . VAL A 1 7  ? 10.953  -0.456  4.786   1.00 0.48 ? 7   VAL A CA   2  
ATOM   1461  C C    . VAL A 1 7  ? 10.103  -0.769  3.554   1.00 0.44 ? 7   VAL A C    2  
ATOM   1462  O O    . VAL A 1 7  ? 10.588  -1.362  2.587   1.00 0.54 ? 7   VAL A O    2  
ATOM   1463  C CB   . VAL A 1 7  ? 10.536  -1.383  5.955   1.00 0.54 ? 7   VAL A CB   2  
ATOM   1464  C CG1  . VAL A 1 7  ? 10.497  -2.843  5.519   1.00 0.60 ? 7   VAL A CG1  2  
ATOM   1465  C CG2  . VAL A 1 7  ? 11.480  -1.208  7.134   1.00 0.61 ? 7   VAL A CG2  2  
ATOM   1466  H H    . VAL A 1 7  ? 10.537  1.196   6.058   1.00 0.48 ? 7   VAL A H    2  
ATOM   1467  H HA   . VAL A 1 7  ? 11.987  -0.653  4.552   1.00 0.53 ? 7   VAL A HA   2  
ATOM   1468  H HB   . VAL A 1 7  ? 9.542   -1.103  6.274   1.00 0.55 ? 7   VAL A HB   2  
ATOM   1469  H HG11 . VAL A 1 7  ? 11.466  -3.131  5.139   1.00 0.73 ? 7   VAL A HG11 2  
ATOM   1470  H HG12 . VAL A 1 7  ? 9.754   -2.970  4.745   1.00 0.72 ? 7   VAL A HG12 2  
ATOM   1471  H HG13 . VAL A 1 7  ? 10.243  -3.465  6.365   1.00 0.79 ? 7   VAL A HG13 2  
ATOM   1472  H HG21 . VAL A 1 7  ? 11.443  -0.184  7.476   1.00 0.75 ? 7   VAL A HG21 2  
ATOM   1473  H HG22 . VAL A 1 7  ? 12.487  -1.450  6.828   1.00 0.79 ? 7   VAL A HG22 2  
ATOM   1474  H HG23 . VAL A 1 7  ? 11.180  -1.867  7.937   1.00 0.78 ? 7   VAL A HG23 2  
ATOM   1475  N N    . ILE A 1 8  ? 8.843   -0.351  3.589   1.00 0.38 ? 8   ILE A N    2  
ATOM   1476  C CA   . ILE A 1 8  ? 7.934   -0.577  2.475   1.00 0.40 ? 8   ILE A CA   2  
ATOM   1477  C C    . ILE A 1 8  ? 8.433   0.145   1.226   1.00 0.37 ? 8   ILE A C    2  
ATOM   1478  O O    . ILE A 1 8  ? 8.439   -0.425  0.133   1.00 0.40 ? 8   ILE A O    2  
ATOM   1479  C CB   . ILE A 1 8  ? 6.497   -0.107  2.815   1.00 0.47 ? 8   ILE A CB   2  
ATOM   1480  C CG1  . ILE A 1 8  ? 5.860   -1.036  3.856   1.00 0.52 ? 8   ILE A CG1  2  
ATOM   1481  C CG2  . ILE A 1 8  ? 5.628   -0.033  1.562   1.00 0.56 ? 8   ILE A CG2  2  
ATOM   1482  C CD1  . ILE A 1 8  ? 5.792   -2.488  3.424   1.00 0.61 ? 8   ILE A CD1  2  
ATOM   1483  H H    . ILE A 1 8  ? 8.517   0.124   4.384   1.00 0.39 ? 8   ILE A H    2  
ATOM   1484  H HA   . ILE A 1 8  ? 7.909   -1.638  2.277   1.00 0.44 ? 8   ILE A HA   2  
ATOM   1485  H HB   . ILE A 1 8  ? 6.565   0.886   3.233   1.00 0.50 ? 8   ILE A HB   2  
ATOM   1486  H HG12 . ILE A 1 8  ? 6.433   -0.990  4.769   1.00 0.53 ? 8   ILE A HG12 2  
ATOM   1487  H HG13 . ILE A 1 8  ? 4.853   -0.704  4.053   1.00 0.59 ? 8   ILE A HG13 2  
ATOM   1488  H HG21 . ILE A 1 8  ? 4.659   0.371   1.819   1.00 0.96 ? 8   ILE A HG21 2  
ATOM   1489  H HG22 . ILE A 1 8  ? 5.506   -1.023  1.146   1.00 1.01 ? 8   ILE A HG22 2  
ATOM   1490  H HG23 . ILE A 1 8  ? 6.101   0.608   0.831   1.00 1.00 ? 8   ILE A HG23 2  
ATOM   1491  H HD11 . ILE A 1 8  ? 6.786   -2.909  3.410   1.00 0.96 ? 8   ILE A HD11 2  
ATOM   1492  H HD12 . ILE A 1 8  ? 5.363   -2.547  2.434   1.00 0.94 ? 8   ILE A HD12 2  
ATOM   1493  H HD13 . ILE A 1 8  ? 5.176   -3.042  4.116   1.00 0.97 ? 8   ILE A HD13 2  
ATOM   1494  N N    . SER A 1 9  ? 8.874   1.386   1.403   1.00 0.37 ? 9   SER A N    2  
ATOM   1495  C CA   . SER A 1 9  ? 9.377   2.186   0.298   1.00 0.41 ? 9   SER A CA   2  
ATOM   1496  C C    . SER A 1 9  ? 10.615  1.549   -0.333  1.00 0.40 ? 9   SER A C    2  
ATOM   1497  O O    . SER A 1 9  ? 10.671  1.365   -1.544  1.00 0.46 ? 9   SER A O    2  
ATOM   1498  C CB   . SER A 1 9  ? 9.703   3.600   0.776   1.00 0.49 ? 9   SER A CB   2  
ATOM   1499  O OG   . SER A 1 9  ? 8.573   4.207   1.376   1.00 1.22 ? 9   SER A OG   2  
ATOM   1500  H H    . SER A 1 9  ? 8.857   1.778   2.307   1.00 0.39 ? 9   SER A H    2  
ATOM   1501  H HA   . SER A 1 9  ? 8.597   2.243   -0.448  1.00 0.45 ? 9   SER A HA   2  
ATOM   1502  H HB2  . SER A 1 9  ? 10.501  3.557   1.501   1.00 1.05 ? 9   SER A HB2  2  
ATOM   1503  H HB3  . SER A 1 9  ? 10.015  4.197   -0.067  1.00 1.19 ? 9   SER A HB3  2  
ATOM   1504  H HG   . SER A 1 9  ? 8.859   4.965   1.904   1.00 1.36 ? 9   SER A HG   2  
ATOM   1505  N N    . SER A 1 10 ? 11.592  1.192   0.491   1.00 0.39 ? 10  SER A N    2  
ATOM   1506  C CA   . SER A 1 10 ? 12.820  0.579   0.002   1.00 0.43 ? 10  SER A CA   2  
ATOM   1507  C C    . SER A 1 10 ? 12.523  -0.716  -0.753  1.00 0.42 ? 10  SER A C    2  
ATOM   1508  O O    . SER A 1 10 ? 13.182  -1.037  -1.741  1.00 0.56 ? 10  SER A O    2  
ATOM   1509  C CB   . SER A 1 10 ? 13.767  0.294   1.166   1.00 0.52 ? 10  SER A CB   2  
ATOM   1510  O OG   . SER A 1 10 ? 14.123  1.487   1.848   1.00 1.17 ? 10  SER A OG   2  
ATOM   1511  H H    . SER A 1 10 ? 11.487  1.344   1.459   1.00 0.41 ? 10  SER A H    2  
ATOM   1512  H HA   . SER A 1 10 ? 13.294  1.276   -0.675  1.00 0.47 ? 10  SER A HA   2  
ATOM   1513  H HB2  . SER A 1 10 ? 13.283  -0.372  1.866   1.00 0.93 ? 10  SER A HB2  2  
ATOM   1514  H HB3  . SER A 1 10 ? 14.664  -0.172  0.791   1.00 1.00 ? 10  SER A HB3  2  
ATOM   1515  H HG   . SER A 1 10 ? 13.852  2.253   1.326   1.00 1.54 ? 10  SER A HG   2  
ATOM   1516  N N    . ALA A 1 11 ? 11.521  -1.448  -0.290  1.00 0.37 ? 11  ALA A N    2  
ATOM   1517  C CA   . ALA A 1 11 ? 11.140  -2.702  -0.918  1.00 0.41 ? 11  ALA A CA   2  
ATOM   1518  C C    . ALA A 1 11 ? 10.487  -2.471  -2.281  1.00 0.37 ? 11  ALA A C    2  
ATOM   1519  O O    . ALA A 1 11 ? 10.919  -3.039  -3.287  1.00 0.42 ? 11  ALA A O    2  
ATOM   1520  C CB   . ALA A 1 11 ? 10.207  -3.485  -0.008  1.00 0.47 ? 11  ALA A CB   2  
ATOM   1521  H H    . ALA A 1 11 ? 11.026  -1.138  0.501   1.00 0.41 ? 11  ALA A H    2  
ATOM   1522  H HA   . ALA A 1 11 ? 12.038  -3.286  -1.057  1.00 0.47 ? 11  ALA A HA   2  
ATOM   1523  H HB1  . ALA A 1 11 ? 9.301   -2.918  0.153   1.00 0.52 ? 11  ALA A HB1  2  
ATOM   1524  H HB2  . ALA A 1 11 ? 10.694  -3.661  0.939   1.00 0.58 ? 11  ALA A HB2  2  
ATOM   1525  H HB3  . ALA A 1 11 ? 9.963   -4.429  -0.470  1.00 0.58 ? 11  ALA A HB3  2  
ATOM   1526  N N    . CYS A 1 12 ? 9.472   -1.613  -2.324  1.00 0.34 ? 12  CYS A N    2  
ATOM   1527  C CA   . CYS A 1 12 ? 8.766   -1.346  -3.568  1.00 0.37 ? 12  CYS A CA   2  
ATOM   1528  C C    . CYS A 1 12 ? 9.666   -0.656  -4.587  1.00 0.39 ? 12  CYS A C    2  
ATOM   1529  O O    . CYS A 1 12 ? 9.620   -0.978  -5.771  1.00 0.44 ? 12  CYS A O    2  
ATOM   1530  C CB   . CYS A 1 12 ? 7.503   -0.517  -3.314  1.00 0.42 ? 12  CYS A CB   2  
ATOM   1531  S SG   . CYS A 1 12 ? 7.803   1.112   -2.587  1.00 0.66 ? 12  CYS A SG   2  
ATOM   1532  H H    . CYS A 1 12 ? 9.194   -1.149  -1.503  1.00 0.35 ? 12  CYS A H    2  
ATOM   1533  H HA   . CYS A 1 12 ? 8.472   -2.301  -3.978  1.00 0.43 ? 12  CYS A HA   2  
ATOM   1534  H HB2  . CYS A 1 12 ? 6.988   -0.366  -4.253  1.00 0.63 ? 12  CYS A HB2  2  
ATOM   1535  H HB3  . CYS A 1 12 ? 6.857   -1.063  -2.642  1.00 0.63 ? 12  CYS A HB3  2  
ATOM   1536  H HG   . CYS A 1 12 ? 6.981   1.971   -3.171  1.00 1.11 ? 12  CYS A HG   2  
ATOM   1537  N N    . LYS A 1 13 ? 10.526  0.248   -4.125  1.00 0.41 ? 13  LYS A N    2  
ATOM   1538  C CA   . LYS A 1 13 ? 11.426  0.970   -5.024  1.00 0.49 ? 13  LYS A CA   2  
ATOM   1539  C C    . LYS A 1 13 ? 12.498  0.047   -5.607  1.00 0.49 ? 13  LYS A C    2  
ATOM   1540  O O    . LYS A 1 13 ? 13.282  0.451   -6.466  1.00 0.58 ? 13  LYS A O    2  
ATOM   1541  C CB   . LYS A 1 13 ? 12.049  2.179   -4.317  1.00 0.63 ? 13  LYS A CB   2  
ATOM   1542  C CG   . LYS A 1 13 ? 11.012  3.216   -3.904  1.00 0.96 ? 13  LYS A CG   2  
ATOM   1543  C CD   . LYS A 1 13 ? 11.633  4.542   -3.502  1.00 1.06 ? 13  LYS A CD   2  
ATOM   1544  C CE   . LYS A 1 13 ? 10.570  5.526   -3.026  1.00 1.40 ? 13  LYS A CE   2  
ATOM   1545  N NZ   . LYS A 1 13 ? 11.110  6.903   -2.861  1.00 1.34 ? 13  LYS A NZ   2  
ATOM   1546  H H    . LYS A 1 13 ? 10.549  0.444   -3.158  1.00 0.43 ? 13  LYS A H    2  
ATOM   1547  H HA   . LYS A 1 13 ? 10.822  1.333   -5.842  1.00 0.52 ? 13  LYS A HA   2  
ATOM   1548  H HB2  . LYS A 1 13 ? 12.565  1.840   -3.430  1.00 0.79 ? 13  LYS A HB2  2  
ATOM   1549  H HB3  . LYS A 1 13 ? 12.758  2.652   -4.981  1.00 0.85 ? 13  LYS A HB3  2  
ATOM   1550  H HG2  . LYS A 1 13 ? 10.346  3.388   -4.735  1.00 1.66 ? 13  LYS A HG2  2  
ATOM   1551  H HG3  . LYS A 1 13 ? 10.449  2.825   -3.070  1.00 1.57 ? 13  LYS A HG3  2  
ATOM   1552  H HD2  . LYS A 1 13 ? 12.337  4.372   -2.704  1.00 1.45 ? 13  LYS A HD2  2  
ATOM   1553  H HD3  . LYS A 1 13 ? 12.147  4.962   -4.353  1.00 1.68 ? 13  LYS A HD3  2  
ATOM   1554  H HE2  . LYS A 1 13 ? 9.770   5.548   -3.751  1.00 1.92 ? 13  LYS A HE2  2  
ATOM   1555  H HE3  . LYS A 1 13 ? 10.182  5.184   -2.078  1.00 1.72 ? 13  LYS A HE3  2  
ATOM   1556  H HZ1  . LYS A 1 13 ? 11.868  6.912   -2.147  1.00 1.65 ? 13  LYS A HZ1  2  
ATOM   1557  H HZ2  . LYS A 1 13 ? 10.360  7.556   -2.560  1.00 1.65 ? 13  LYS A HZ2  2  
ATOM   1558  H HZ3  . LYS A 1 13 ? 11.499  7.243   -3.761  1.00 1.73 ? 13  LYS A HZ3  2  
ATOM   1559  N N    . THR A 1 14 ? 12.527  -1.195  -5.137  1.00 0.49 ? 14  THR A N    2  
ATOM   1560  C CA   . THR A 1 14 ? 13.466  -2.185  -5.642  1.00 0.56 ? 14  THR A CA   2  
ATOM   1561  C C    . THR A 1 14 ? 12.772  -3.083  -6.673  1.00 0.54 ? 14  THR A C    2  
ATOM   1562  O O    . THR A 1 14 ? 13.381  -3.525  -7.646  1.00 0.72 ? 14  THR A O    2  
ATOM   1563  C CB   . THR A 1 14 ? 14.040  -3.052  -4.501  1.00 0.65 ? 14  THR A CB   2  
ATOM   1564  O OG1  . THR A 1 14 ? 14.726  -2.218  -3.559  1.00 0.77 ? 14  THR A OG1  2  
ATOM   1565  C CG2  . THR A 1 14 ? 15.001  -4.108  -5.033  1.00 0.83 ? 14  THR A CG2  2  
ATOM   1566  H H    . THR A 1 14 ? 11.905  -1.449  -4.424  1.00 0.48 ? 14  THR A H    2  
ATOM   1567  H HA   . THR A 1 14 ? 14.283  -1.661  -6.122  1.00 0.63 ? 14  THR A HA   2  
ATOM   1568  H HB   . THR A 1 14 ? 13.222  -3.549  -4.001  1.00 0.82 ? 14  THR A HB   2  
ATOM   1569  H HG1  . THR A 1 14 ? 14.092  -1.624  -3.132  1.00 0.99 ? 14  THR A HG1  2  
ATOM   1570  H HG21 . THR A 1 14 ? 15.835  -3.623  -5.521  1.00 1.01 ? 14  THR A HG21 2  
ATOM   1571  H HG22 . THR A 1 14 ? 14.488  -4.738  -5.744  1.00 1.11 ? 14  THR A HG22 2  
ATOM   1572  H HG23 . THR A 1 14 ? 15.364  -4.712  -4.216  1.00 1.00 ? 14  THR A HG23 2  
ATOM   1573  N N    . TYR A 1 15 ? 11.482  -3.329  -6.460  1.00 0.49 ? 15  TYR A N    2  
ATOM   1574  C CA   . TYR A 1 15 ? 10.707  -4.175  -7.363  1.00 0.54 ? 15  TYR A CA   2  
ATOM   1575  C C    . TYR A 1 15 ? 10.090  -3.353  -8.494  1.00 0.56 ? 15  TYR A C    2  
ATOM   1576  O O    . TYR A 1 15 ? 10.058  -3.789  -9.645  1.00 0.72 ? 15  TYR A O    2  
ATOM   1577  C CB   . TYR A 1 15 ? 9.616   -4.922  -6.592  1.00 0.55 ? 15  TYR A CB   2  
ATOM   1578  C CG   . TYR A 1 15 ? 10.140  -6.106  -5.805  1.00 0.60 ? 15  TYR A CG   2  
ATOM   1579  C CD1  . TYR A 1 15 ? 10.473  -5.985  -4.460  1.00 0.67 ? 15  TYR A CD1  2  
ATOM   1580  C CD2  . TYR A 1 15 ? 10.307  -7.345  -6.411  1.00 0.80 ? 15  TYR A CD2  2  
ATOM   1581  C CE1  . TYR A 1 15 ? 10.965  -7.061  -3.746  1.00 0.78 ? 15  TYR A CE1  2  
ATOM   1582  C CE2  . TYR A 1 15 ? 10.795  -8.428  -5.702  1.00 0.91 ? 15  TYR A CE2  2  
ATOM   1583  C CZ   . TYR A 1 15 ? 11.119  -8.282  -4.371  1.00 0.84 ? 15  TYR A CZ   2  
ATOM   1584  O OH   . TYR A 1 15 ? 11.609  -9.357  -3.664  1.00 1.00 ? 15  TYR A OH   2  
ATOM   1585  H H    . TYR A 1 15 ? 11.040  -2.931  -5.680  1.00 0.54 ? 15  TYR A H    2  
ATOM   1586  H HA   . TYR A 1 15 ? 11.385  -4.898  -7.792  1.00 0.62 ? 15  TYR A HA   2  
ATOM   1587  H HB2  . TYR A 1 15 ? 9.143   -4.241  -5.898  1.00 0.54 ? 15  TYR A HB2  2  
ATOM   1588  H HB3  . TYR A 1 15 ? 8.879   -5.287  -7.291  1.00 0.63 ? 15  TYR A HB3  2  
ATOM   1589  H HD1  . TYR A 1 15 ? 10.348  -5.028  -3.972  1.00 0.79 ? 15  TYR A HD1  2  
ATOM   1590  H HD2  . TYR A 1 15 ? 10.051  -7.455  -7.455  1.00 0.96 ? 15  TYR A HD2  2  
ATOM   1591  H HE1  . TYR A 1 15 ? 11.218  -6.947  -2.703  1.00 0.93 ? 15  TYR A HE1  2  
ATOM   1592  H HE2  . TYR A 1 15 ? 10.915  -9.383  -6.191  1.00 1.14 ? 15  TYR A HE2  2  
ATOM   1593  H HH   . TYR A 1 15 ? 12.345  -9.752  -4.150  1.00 1.22 ? 15  TYR A HH   2  
ATOM   1594  N N    . CYS A 1 16 ? 9.592   -2.167  -8.164  1.00 0.50 ? 16  CYS A N    2  
ATOM   1595  C CA   . CYS A 1 16 ? 8.991   -1.288  -9.158  1.00 0.55 ? 16  CYS A CA   2  
ATOM   1596  C C    . CYS A 1 16 ? 10.067  -0.444  -9.831  1.00 0.57 ? 16  CYS A C    2  
ATOM   1597  O O    . CYS A 1 16 ? 9.864   0.097   -10.921 1.00 0.88 ? 16  CYS A O    2  
ATOM   1598  C CB   . CYS A 1 16 ? 7.930   -0.394  -8.511  1.00 0.54 ? 16  CYS A CB   2  
ATOM   1599  S SG   . CYS A 1 16 ? 6.717   -1.293  -7.518  1.00 0.67 ? 16  CYS A SG   2  
ATOM   1600  H H    . CYS A 1 16 ? 9.621   -1.875  -7.224  1.00 0.50 ? 16  CYS A H    2  
ATOM   1601  H HA   . CYS A 1 16 ? 8.520   -1.909  -9.906  1.00 0.64 ? 16  CYS A HA   2  
ATOM   1602  H HB2  . CYS A 1 16 ? 8.416   0.319   -7.863  1.00 0.56 ? 16  CYS A HB2  2  
ATOM   1603  H HB3  . CYS A 1 16 ? 7.394   0.135   -9.286  1.00 0.63 ? 16  CYS A HB3  2  
ATOM   1604  H HG   . CYS A 1 16 ? 6.369   -2.385  -8.185  1.00 1.15 ? 16  CYS A HG   2  
ATOM   1605  N N    . GLY A 1 17 ? 11.215  -0.342  -9.170  1.00 0.49 ? 17  GLY A N    2  
ATOM   1606  C CA   . GLY A 1 17 ? 12.333  0.412   -9.702  1.00 0.56 ? 17  GLY A CA   2  
ATOM   1607  C C    . GLY A 1 17 ? 12.071  1.902   -9.759  1.00 0.52 ? 17  GLY A C    2  
ATOM   1608  O O    . GLY A 1 17 ? 11.885  2.548   -8.729  1.00 0.66 ? 17  GLY A O    2  
ATOM   1609  H H    . GLY A 1 17 ? 11.302  -0.782  -8.301  1.00 0.62 ? 17  GLY A H    2  
ATOM   1610  H HA2  . GLY A 1 17 ? 13.196  0.237   -9.079  1.00 0.65 ? 17  GLY A HA2  2  
ATOM   1611  H HA3  . GLY A 1 17 ? 12.547  0.057   -10.698 1.00 0.63 ? 17  GLY A HA3  2  
ATOM   1612  N N    . LYS A 1 18 ? 12.031  2.442   -10.968 1.00 0.50 ? 18  LYS A N    2  
ATOM   1613  C CA   . LYS A 1 18 ? 11.810  3.868   -11.163 1.00 0.56 ? 18  LYS A CA   2  
ATOM   1614  C C    . LYS A 1 18 ? 10.323  4.187   -11.295 1.00 0.53 ? 18  LYS A C    2  
ATOM   1615  O O    . LYS A 1 18 ? 9.930   5.353   -11.320 1.00 0.62 ? 18  LYS A O    2  
ATOM   1616  C CB   . LYS A 1 18 ? 12.575  4.380   -12.396 1.00 0.70 ? 18  LYS A CB   2  
ATOM   1617  C CG   . LYS A 1 18 ? 12.774  3.339   -13.496 1.00 0.81 ? 18  LYS A CG   2  
ATOM   1618  C CD   . LYS A 1 18 ? 14.046  2.522   -13.288 1.00 1.11 ? 18  LYS A CD   2  
ATOM   1619  C CE   . LYS A 1 18 ? 15.295  3.338   -13.586 1.00 1.46 ? 18  LYS A CE   2  
ATOM   1620  N NZ   . LYS A 1 18 ? 16.520  2.710   -13.019 1.00 1.82 ? 18  LYS A NZ   2  
ATOM   1621  H H    . LYS A 1 18 ? 12.148  1.865   -11.753 1.00 0.58 ? 18  LYS A H    2  
ATOM   1622  H HA   . LYS A 1 18 ? 12.190  4.375   -10.288 1.00 0.60 ? 18  LYS A HA   2  
ATOM   1623  H HB2  . LYS A 1 18 ? 12.028  5.210   -12.817 1.00 0.87 ? 18  LYS A HB2  2  
ATOM   1624  H HB3  . LYS A 1 18 ? 13.546  4.729   -12.080 1.00 0.79 ? 18  LYS A HB3  2  
ATOM   1625  H HG2  . LYS A 1 18 ? 11.927  2.671   -13.499 1.00 0.90 ? 18  LYS A HG2  2  
ATOM   1626  H HG3  . LYS A 1 18 ? 12.837  3.847   -14.449 1.00 1.06 ? 18  LYS A HG3  2  
ATOM   1627  H HD2  . LYS A 1 18 ? 14.084  2.188   -12.262 1.00 1.33 ? 18  LYS A HD2  2  
ATOM   1628  H HD3  . LYS A 1 18 ? 14.024  1.663   -13.946 1.00 1.44 ? 18  LYS A HD3  2  
ATOM   1629  H HE2  . LYS A 1 18 ? 15.406  3.421   -14.657 1.00 1.85 ? 18  LYS A HE2  2  
ATOM   1630  H HE3  . LYS A 1 18 ? 15.178  4.322   -13.163 1.00 1.67 ? 18  LYS A HE3  2  
ATOM   1631  H HZ1  . LYS A 1 18 ? 17.365  3.242   -13.313 1.00 2.13 ? 18  LYS A HZ1  2  
ATOM   1632  H HZ2  . LYS A 1 18 ? 16.610  1.729   -13.352 1.00 2.19 ? 18  LYS A HZ2  2  
ATOM   1633  H HZ3  . LYS A 1 18 ? 16.475  2.706   -11.977 1.00 2.14 ? 18  LYS A HZ3  2  
ATOM   1634  N N    . THR A 1 19 ? 9.497   3.154   -11.381 1.00 0.49 ? 19  THR A N    2  
ATOM   1635  C CA   . THR A 1 19 ? 8.057   3.347   -11.494 1.00 0.52 ? 19  THR A CA   2  
ATOM   1636  C C    . THR A 1 19 ? 7.415   3.388   -10.110 1.00 0.48 ? 19  THR A C    2  
ATOM   1637  O O    . THR A 1 19 ? 6.189   3.374   -9.971  1.00 0.62 ? 19  THR A O    2  
ATOM   1638  C CB   . THR A 1 19 ? 7.405   2.230   -12.327 1.00 0.62 ? 19  THR A CB   2  
ATOM   1639  O OG1  . THR A 1 19 ? 8.401   1.570   -13.119 1.00 0.83 ? 19  THR A OG1  2  
ATOM   1640  C CG2  . THR A 1 19 ? 6.325   2.797   -13.239 1.00 0.91 ? 19  THR A CG2  2  
ATOM   1641  H H    . THR A 1 19 ? 9.857   2.243   -11.373 1.00 0.49 ? 19  THR A H    2  
ATOM   1642  H HA   . THR A 1 19 ? 7.883   4.291   -11.991 1.00 0.60 ? 19  THR A HA   2  
ATOM   1643  H HB   . THR A 1 19 ? 6.952   1.514   -11.657 1.00 0.72 ? 19  THR A HB   2  
ATOM   1644  H HG1  . THR A 1 19 ? 8.439   0.637   -12.867 1.00 1.10 ? 19  THR A HG1  2  
ATOM   1645  H HG21 . THR A 1 19 ? 5.905   2.002   -13.836 1.00 1.10 ? 19  THR A HG21 2  
ATOM   1646  H HG22 . THR A 1 19 ? 6.757   3.543   -13.887 1.00 1.23 ? 19  THR A HG22 2  
ATOM   1647  H HG23 . THR A 1 19 ? 5.548   3.248   -12.638 1.00 1.17 ? 19  THR A HG23 2  
ATOM   1648  N N    . SER A 1 20 ? 8.261   3.441   -9.092  1.00 0.42 ? 20  SER A N    2  
ATOM   1649  C CA   . SER A 1 20 ? 7.808   3.482   -7.715  1.00 0.42 ? 20  SER A CA   2  
ATOM   1650  C C    . SER A 1 20 ? 7.276   4.871   -7.367  1.00 0.41 ? 20  SER A C    2  
ATOM   1651  O O    . SER A 1 20 ? 7.840   5.882   -7.787  1.00 0.46 ? 20  SER A O    2  
ATOM   1652  C CB   . SER A 1 20 ? 8.960   3.106   -6.788  1.00 0.46 ? 20  SER A CB   2  
ATOM   1653  O OG   . SER A 1 20 ? 9.697   2.016   -7.319  1.00 0.97 ? 20  SER A OG   2  
ATOM   1654  H H    . SER A 1 20 ? 9.222   3.467   -9.274  1.00 0.49 ? 20  SER A H    2  
ATOM   1655  H HA   . SER A 1 20 ? 7.013   2.759   -7.601  1.00 0.48 ? 20  SER A HA   2  
ATOM   1656  H HB2  . SER A 1 20 ? 9.622   3.953   -6.675  1.00 0.70 ? 20  SER A HB2  2  
ATOM   1657  H HB3  . SER A 1 20 ? 8.567   2.824   -5.823  1.00 0.81 ? 20  SER A HB3  2  
ATOM   1658  H HG   . SER A 1 20 ? 10.544  2.336   -7.660  1.00 1.21 ? 20  SER A HG   2  
ATOM   1659  N N    . PRO A 1 21 ? 6.176   4.928   -6.608  1.00 0.43 ? 21  PRO A N    2  
ATOM   1660  C CA   . PRO A 1 21 ? 5.559   6.186   -6.201  1.00 0.49 ? 21  PRO A CA   2  
ATOM   1661  C C    . PRO A 1 21 ? 6.185   6.762   -4.937  1.00 0.42 ? 21  PRO A C    2  
ATOM   1662  O O    . PRO A 1 21 ? 6.949   6.086   -4.243  1.00 0.46 ? 21  PRO A O    2  
ATOM   1663  C CB   . PRO A 1 21 ? 4.121   5.766   -5.933  1.00 0.62 ? 21  PRO A CB   2  
ATOM   1664  C CG   . PRO A 1 21 ? 4.225   4.374   -5.422  1.00 0.63 ? 21  PRO A CG   2  
ATOM   1665  C CD   . PRO A 1 21 ? 5.435   3.763   -6.083  1.00 0.50 ? 21  PRO A CD   2  
ATOM   1666  H HA   . PRO A 1 21 ? 5.586   6.922   -6.990  1.00 0.57 ? 21  PRO A HA   2  
ATOM   1667  H HB2  . PRO A 1 21 ? 3.677   6.422   -5.194  1.00 0.69 ? 21  PRO A HB2  2  
ATOM   1668  H HB3  . PRO A 1 21 ? 3.550   5.784   -6.847  1.00 0.76 ? 21  PRO A HB3  2  
ATOM   1669  H HG2  . PRO A 1 21 ? 4.346   4.388   -4.348  1.00 0.76 ? 21  PRO A HG2  2  
ATOM   1670  H HG3  . PRO A 1 21 ? 3.340   3.819   -5.693  1.00 0.81 ? 21  PRO A HG3  2  
ATOM   1671  H HD2  . PRO A 1 21 ? 6.029   3.225   -5.359  1.00 0.55 ? 21  PRO A HD2  2  
ATOM   1672  H HD3  . PRO A 1 21 ? 5.132   3.105   -6.885  1.00 0.57 ? 21  PRO A HD3  2  
ATOM   1673  N N    . SER A 1 22 ? 5.861   8.010   -4.648  1.00 0.43 ? 22  SER A N    2  
ATOM   1674  C CA   . SER A 1 22 ? 6.371   8.676   -3.467  1.00 0.43 ? 22  SER A CA   2  
ATOM   1675  C C    . SER A 1 22 ? 5.702   8.110   -2.218  1.00 0.38 ? 22  SER A C    2  
ATOM   1676  O O    . SER A 1 22 ? 4.522   7.747   -2.247  1.00 0.39 ? 22  SER A O    2  
ATOM   1677  C CB   . SER A 1 22 ? 6.121   10.178  -3.577  1.00 0.56 ? 22  SER A CB   2  
ATOM   1678  O OG   . SER A 1 22 ? 6.742   10.706  -4.739  1.00 1.11 ? 22  SER A OG   2  
ATOM   1679  H H    . SER A 1 22 ? 5.258   8.497   -5.247  1.00 0.53 ? 22  SER A H    2  
ATOM   1680  H HA   . SER A 1 22 ? 7.431   8.495   -3.409  1.00 0.47 ? 22  SER A HA   2  
ATOM   1681  H HB2  . SER A 1 22 ? 5.057   10.363  -3.635  1.00 0.96 ? 22  SER A HB2  2  
ATOM   1682  H HB3  . SER A 1 22 ? 6.526   10.673  -2.708  1.00 0.81 ? 22  SER A HB3  2  
ATOM   1683  H HG   . SER A 1 22 ? 7.699   10.546  -4.683  1.00 1.48 ? 22  SER A HG   2  
ATOM   1684  N N    . LYS A 1 23 ? 6.440   8.047   -1.115  1.00 0.44 ? 23  LYS A N    2  
ATOM   1685  C CA   . LYS A 1 23 ? 5.894   7.499   0.123   1.00 0.50 ? 23  LYS A CA   2  
ATOM   1686  C C    . LYS A 1 23 ? 4.799   8.400   0.692   1.00 0.42 ? 23  LYS A C    2  
ATOM   1687  O O    . LYS A 1 23 ? 3.965   7.948   1.476   1.00 0.42 ? 23  LYS A O    2  
ATOM   1688  C CB   . LYS A 1 23 ? 7.001   7.247   1.157   1.00 0.69 ? 23  LYS A CB   2  
ATOM   1689  C CG   . LYS A 1 23 ? 7.068   8.268   2.279   1.00 0.63 ? 23  LYS A CG   2  
ATOM   1690  C CD   . LYS A 1 23 ? 7.897   9.467   1.879   1.00 1.12 ? 23  LYS A CD   2  
ATOM   1691  C CE   . LYS A 1 23 ? 7.810   10.567  2.914   1.00 1.17 ? 23  LYS A CE   2  
ATOM   1692  N NZ   . LYS A 1 23 ? 8.672   11.713  2.555   1.00 1.60 ? 23  LYS A NZ   2  
ATOM   1693  H H    . LYS A 1 23 ? 7.365   8.380   -1.133  1.00 0.50 ? 23  LYS A H    2  
ATOM   1694  H HA   . LYS A 1 23 ? 5.443   6.552   -0.127  1.00 0.56 ? 23  LYS A HA   2  
ATOM   1695  H HB2  . LYS A 1 23 ? 6.847   6.275   1.600   1.00 1.00 ? 23  LYS A HB2  2  
ATOM   1696  H HB3  . LYS A 1 23 ? 7.953   7.248   0.646   1.00 1.02 ? 23  LYS A HB3  2  
ATOM   1697  H HG2  . LYS A 1 23 ? 6.066   8.597   2.515   1.00 0.92 ? 23  LYS A HG2  2  
ATOM   1698  H HG3  . LYS A 1 23 ? 7.512   7.805   3.149   1.00 0.87 ? 23  LYS A HG3  2  
ATOM   1699  H HD2  . LYS A 1 23 ? 8.927   9.161   1.780   1.00 1.72 ? 23  LYS A HD2  2  
ATOM   1700  H HD3  . LYS A 1 23 ? 7.536   9.843   0.930   1.00 1.84 ? 23  LYS A HD3  2  
ATOM   1701  H HE2  . LYS A 1 23 ? 6.787   10.902  2.980   1.00 1.51 ? 23  LYS A HE2  2  
ATOM   1702  H HE3  . LYS A 1 23 ? 8.124   10.173  3.869   1.00 1.35 ? 23  LYS A HE3  2  
ATOM   1703  H HZ1  . LYS A 1 23 ? 8.710   11.824  1.518   1.00 2.03 ? 23  LYS A HZ1  2  
ATOM   1704  H HZ2  . LYS A 1 23 ? 9.640   11.557  2.906   1.00 1.91 ? 23  LYS A HZ2  2  
ATOM   1705  H HZ3  . LYS A 1 23 ? 8.304   12.590  2.973   1.00 2.03 ? 23  LYS A HZ3  2  
ATOM   1706  N N    . LYS A 1 24 ? 4.799   9.670   0.288   1.00 0.41 ? 24  LYS A N    2  
ATOM   1707  C CA   . LYS A 1 24 ? 3.785   10.614  0.748   1.00 0.45 ? 24  LYS A CA   2  
ATOM   1708  C C    . LYS A 1 24 ? 2.402   10.124  0.336   1.00 0.40 ? 24  LYS A C    2  
ATOM   1709  O O    . LYS A 1 24 ? 1.449   10.168  1.115   1.00 0.48 ? 24  LYS A O    2  
ATOM   1710  C CB   . LYS A 1 24 ? 4.034   12.010  0.169   1.00 0.56 ? 24  LYS A CB   2  
ATOM   1711  C CG   . LYS A 1 24 ? 5.387   12.600  0.540   1.00 0.83 ? 24  LYS A CG   2  
ATOM   1712  C CD   . LYS A 1 24 ? 5.354   14.123  0.531   1.00 1.00 ? 24  LYS A CD   2  
ATOM   1713  C CE   . LYS A 1 24 ? 6.300   14.712  -0.507  1.00 1.56 ? 24  LYS A CE   2  
ATOM   1714  N NZ   . LYS A 1 24 ? 7.714   14.341  -0.245  1.00 2.04 ? 24  LYS A NZ   2  
ATOM   1715  H H    . LYS A 1 24 ? 5.502   9.979   -0.320  1.00 0.44 ? 24  LYS A H    2  
ATOM   1716  H HA   . LYS A 1 24 ? 3.835   10.661  1.826   1.00 0.51 ? 24  LYS A HA   2  
ATOM   1717  H HB2  . LYS A 1 24 ? 3.973   11.956  -0.908  1.00 0.63 ? 24  LYS A HB2  2  
ATOM   1718  H HB3  . LYS A 1 24 ? 3.265   12.678  0.531   1.00 0.77 ? 24  LYS A HB3  2  
ATOM   1719  H HG2  . LYS A 1 24 ? 5.657   12.260  1.529   1.00 1.37 ? 24  LYS A HG2  2  
ATOM   1720  H HG3  . LYS A 1 24 ? 6.124   12.259  -0.173  1.00 1.33 ? 24  LYS A HG3  2  
ATOM   1721  H HD2  . LYS A 1 24 ? 4.350   14.448  0.310   1.00 1.50 ? 24  LYS A HD2  2  
ATOM   1722  H HD3  . LYS A 1 24 ? 5.640   14.482  1.508   1.00 1.29 ? 24  LYS A HD3  2  
ATOM   1723  H HE2  . LYS A 1 24 ? 6.017   14.349  -1.482  1.00 1.84 ? 24  LYS A HE2  2  
ATOM   1724  H HE3  . LYS A 1 24 ? 6.211   15.789  -0.484  1.00 2.19 ? 24  LYS A HE3  2  
ATOM   1725  H HZ1  . LYS A 1 24 ? 7.876   13.351  -0.503  1.00 2.22 ? 24  LYS A HZ1  2  
ATOM   1726  H HZ2  . LYS A 1 24 ? 7.942   14.464  0.761   1.00 2.45 ? 24  LYS A HZ2  2  
ATOM   1727  H HZ3  . LYS A 1 24 ? 8.357   14.939  -0.804  1.00 2.55 ? 24  LYS A HZ3  2  
ATOM   1728  N N    . GLU A 1 25 ? 2.319   9.620   -0.890  1.00 0.34 ? 25  GLU A N    2  
ATOM   1729  C CA   . GLU A 1 25 ? 1.073   9.105   -1.431  1.00 0.37 ? 25  GLU A CA   2  
ATOM   1730  C C    . GLU A 1 25 ? 0.694   7.814   -0.709  1.00 0.31 ? 25  GLU A C    2  
ATOM   1731  O O    . GLU A 1 25 ? -0.484  7.542   -0.465  1.00 0.34 ? 25  GLU A O    2  
ATOM   1732  C CB   . GLU A 1 25 ? 1.227   8.860   -2.934  1.00 0.45 ? 25  GLU A CB   2  
ATOM   1733  C CG   . GLU A 1 25 ? -0.059  9.021   -3.729  1.00 0.90 ? 25  GLU A CG   2  
ATOM   1734  C CD   . GLU A 1 25 ? 0.194   9.131   -5.220  1.00 1.00 ? 25  GLU A CD   2  
ATOM   1735  O OE1  . GLU A 1 25 ? -0.264  10.118  -5.837  1.00 1.30 ? 25  GLU A OE1  2  
ATOM   1736  O OE2  . GLU A 1 25 ? 0.856   8.233   -5.783  1.00 1.58 ? 25  GLU A OE2  2  
ATOM   1737  H H    . GLU A 1 25 ? 3.125   9.583   -1.443  1.00 0.36 ? 25  GLU A H    2  
ATOM   1738  H HA   . GLU A 1 25 ? 0.303   9.843   -1.264  1.00 0.42 ? 25  GLU A HA   2  
ATOM   1739  H HB2  . GLU A 1 25 ? 1.953   9.557   -3.327  1.00 0.97 ? 25  GLU A HB2  2  
ATOM   1740  H HB3  . GLU A 1 25 ? 1.591   7.855   -3.083  1.00 0.87 ? 25  GLU A HB3  2  
ATOM   1741  H HG2  . GLU A 1 25 ? -0.688  8.163   -3.548  1.00 1.42 ? 25  GLU A HG2  2  
ATOM   1742  H HG3  . GLU A 1 25 ? -0.565  9.917   -3.396  1.00 1.47 ? 25  GLU A HG3  2  
ATOM   1743  N N    . ILE A 1 26 ? 1.710   7.024   -0.362  1.00 0.29 ? 26  ILE A N    2  
ATOM   1744  C CA   . ILE A 1 26 ? 1.500   5.767   0.350   1.00 0.29 ? 26  ILE A CA   2  
ATOM   1745  C C    . ILE A 1 26 ? 0.948   6.042   1.747   1.00 0.27 ? 26  ILE A C    2  
ATOM   1746  O O    . ILE A 1 26 ? 0.040   5.351   2.217   1.00 0.28 ? 26  ILE A O    2  
ATOM   1747  C CB   . ILE A 1 26 ? 2.806   4.945   0.462   1.00 0.33 ? 26  ILE A CB   2  
ATOM   1748  C CG1  . ILE A 1 26 ? 3.383   4.666   -0.930  1.00 0.36 ? 26  ILE A CG1  2  
ATOM   1749  C CG2  . ILE A 1 26 ? 2.556   3.640   1.206   1.00 0.41 ? 26  ILE A CG2  2  
ATOM   1750  C CD1  . ILE A 1 26 ? 4.706   3.929   -0.907  1.00 0.45 ? 26  ILE A CD1  2  
ATOM   1751  H H    . ILE A 1 26 ? 2.623   7.293   -0.594  1.00 0.30 ? 26  ILE A H    2  
ATOM   1752  H HA   . ILE A 1 26 ? 0.776   5.187   -0.204  1.00 0.32 ? 26  ILE A HA   2  
ATOM   1753  H HB   . ILE A 1 26 ? 3.520   5.521   1.028   1.00 0.34 ? 26  ILE A HB   2  
ATOM   1754  H HG12 . ILE A 1 26 ? 2.683   4.066   -1.492  1.00 0.44 ? 26  ILE A HG12 2  
ATOM   1755  H HG13 . ILE A 1 26 ? 3.535   5.607   -1.440  1.00 0.35 ? 26  ILE A HG13 2  
ATOM   1756  H HG21 . ILE A 1 26 ? 2.253   3.856   2.220   1.00 0.52 ? 26  ILE A HG21 2  
ATOM   1757  H HG22 . ILE A 1 26 ? 3.463   3.054   1.219   1.00 0.53 ? 26  ILE A HG22 2  
ATOM   1758  H HG23 . ILE A 1 26 ? 1.774   3.085   0.708   1.00 0.54 ? 26  ILE A HG23 2  
ATOM   1759  H HD11 . ILE A 1 26 ? 4.921   3.547   -1.894  1.00 0.90 ? 26  ILE A HD11 2  
ATOM   1760  H HD12 . ILE A 1 26 ? 4.649   3.107   -0.208  1.00 0.91 ? 26  ILE A HD12 2  
ATOM   1761  H HD13 . ILE A 1 26 ? 5.493   4.604   -0.604  1.00 0.92 ? 26  ILE A HD13 2  
ATOM   1762  N N    . GLY A 1 27 ? 1.494   7.067   2.394   1.00 0.27 ? 27  GLY A N    2  
ATOM   1763  C CA   . GLY A 1 27 ? 1.049   7.441   3.723   1.00 0.29 ? 27  GLY A CA   2  
ATOM   1764  C C    . GLY A 1 27 ? -0.419  7.813   3.745   1.00 0.28 ? 27  GLY A C    2  
ATOM   1765  O O    . GLY A 1 27 ? -1.166  7.375   4.623   1.00 0.32 ? 27  GLY A O    2  
ATOM   1766  H H    . GLY A 1 27 ? 2.221   7.574   1.962   1.00 0.28 ? 27  GLY A H    2  
ATOM   1767  H HA2  . GLY A 1 27 ? 1.211   6.611   4.394   1.00 0.32 ? 27  GLY A HA2  2  
ATOM   1768  H HA3  . GLY A 1 27 ? 1.630   8.287   4.064   1.00 0.33 ? 27  GLY A HA3  2  
ATOM   1769  N N    . ALA A 1 28 ? -0.835  8.608   2.764   1.00 0.27 ? 28  ALA A N    2  
ATOM   1770  C CA   . ALA A 1 28 ? -2.224  9.029   2.660   1.00 0.30 ? 28  ALA A CA   2  
ATOM   1771  C C    . ALA A 1 28 ? -3.135  7.818   2.498   1.00 0.29 ? 28  ALA A C    2  
ATOM   1772  O O    . ALA A 1 28 ? -4.235  7.771   3.053   1.00 0.32 ? 28  ALA A O    2  
ATOM   1773  C CB   . ALA A 1 28 ? -2.400  9.986   1.494   1.00 0.35 ? 28  ALA A CB   2  
ATOM   1774  H H    . ALA A 1 28 ? -0.188  8.926   2.096   1.00 0.27 ? 28  ALA A H    2  
ATOM   1775  H HA   . ALA A 1 28 ? -2.486  9.548   3.571   1.00 0.34 ? 28  ALA A HA   2  
ATOM   1776  H HB1  . ALA A 1 28 ? -1.747  10.836  1.622   1.00 0.47 ? 28  ALA A HB1  2  
ATOM   1777  H HB2  . ALA A 1 28 ? -3.426  10.322  1.455   1.00 0.50 ? 28  ALA A HB2  2  
ATOM   1778  H HB3  . ALA A 1 28 ? -2.153  9.477   0.574   1.00 0.45 ? 28  ALA A HB3  2  
ATOM   1779  N N    . MET A 1 29 ? -2.664  6.836   1.739   1.00 0.27 ? 29  MET A N    2  
ATOM   1780  C CA   . MET A 1 29 ? -3.416  5.610   1.512   1.00 0.30 ? 29  MET A CA   2  
ATOM   1781  C C    . MET A 1 29 ? -3.493  4.793   2.798   1.00 0.28 ? 29  MET A C    2  
ATOM   1782  O O    . MET A 1 29 ? -4.555  4.300   3.169   1.00 0.31 ? 29  MET A O    2  
ATOM   1783  C CB   . MET A 1 29 ? -2.757  4.776   0.413   1.00 0.34 ? 29  MET A CB   2  
ATOM   1784  C CG   . MET A 1 29 ? -3.384  3.400   0.227   1.00 0.40 ? 29  MET A CG   2  
ATOM   1785  S SD   . MET A 1 29 ? -2.215  2.184   -0.416  1.00 0.49 ? 29  MET A SD   2  
ATOM   1786  C CE   . MET A 1 29 ? -1.134  1.955   0.996   1.00 0.52 ? 29  MET A CE   2  
ATOM   1787  H H    . MET A 1 29 ? -1.784  6.941   1.316   1.00 0.27 ? 29  MET A H    2  
ATOM   1788  H HA   . MET A 1 29 ? -4.417  5.879   1.204   1.00 0.34 ? 29  MET A HA   2  
ATOM   1789  H HB2  . MET A 1 29 ? -2.827  5.312   -0.520  1.00 0.38 ? 29  MET A HB2  2  
ATOM   1790  H HB3  . MET A 1 29 ? -1.714  4.641   0.660   1.00 0.34 ? 29  MET A HB3  2  
ATOM   1791  H HG2  . MET A 1 29 ? -3.750  3.053   1.182   1.00 0.40 ? 29  MET A HG2  2  
ATOM   1792  H HG3  . MET A 1 29 ? -4.209  3.485   -0.464  1.00 0.49 ? 29  MET A HG3  2  
ATOM   1793  H HE1  . MET A 1 29 ? -0.731  2.909   1.298   1.00 0.81 ? 29  MET A HE1  2  
ATOM   1794  H HE2  . MET A 1 29 ? -0.326  1.292   0.725   1.00 0.89 ? 29  MET A HE2  2  
ATOM   1795  H HE3  . MET A 1 29 ? -1.695  1.525   1.814   1.00 0.86 ? 29  MET A HE3  2  
ATOM   1796  N N    . LEU A 1 30 ? -2.357  4.670   3.479   1.00 0.29 ? 30  LEU A N    2  
ATOM   1797  C CA   . LEU A 1 30 ? -2.281  3.913   4.724   1.00 0.32 ? 30  LEU A CA   2  
ATOM   1798  C C    . LEU A 1 30 ? -3.239  4.486   5.766   1.00 0.30 ? 30  LEU A C    2  
ATOM   1799  O O    . LEU A 1 30 ? -3.966  3.744   6.425   1.00 0.33 ? 30  LEU A O    2  
ATOM   1800  C CB   . LEU A 1 30 ? -0.846  3.919   5.259   1.00 0.39 ? 30  LEU A CB   2  
ATOM   1801  C CG   . LEU A 1 30 ? -0.558  2.922   6.386   1.00 0.78 ? 30  LEU A CG   2  
ATOM   1802  C CD1  . LEU A 1 30 ? -0.731  1.489   5.898   1.00 1.32 ? 30  LEU A CD1  2  
ATOM   1803  C CD2  . LEU A 1 30 ? 0.846   3.132   6.926   1.00 1.04 ? 30  LEU A CD2  2  
ATOM   1804  H H    . LEU A 1 30 ? -1.542  5.098   3.131   1.00 0.29 ? 30  LEU A H    2  
ATOM   1805  H HA   . LEU A 1 30 ? -2.571  2.898   4.508   1.00 0.36 ? 30  LEU A HA   2  
ATOM   1806  H HB2  . LEU A 1 30 ? -0.179  3.702   4.435   1.00 0.71 ? 30  LEU A HB2  2  
ATOM   1807  H HB3  . LEU A 1 30 ? -0.625  4.912   5.623   1.00 0.65 ? 30  LEU A HB3  2  
ATOM   1808  H HG   . LEU A 1 30 ? -1.257  3.087   7.192   1.00 1.11 ? 30  LEU A HG   2  
ATOM   1809  H HD11 . LEU A 1 30 ? -0.108  1.327   5.030   1.00 1.67 ? 30  LEU A HD11 2  
ATOM   1810  H HD12 . LEU A 1 30 ? -1.765  1.319   5.636   1.00 1.61 ? 30  LEU A HD12 2  
ATOM   1811  H HD13 . LEU A 1 30 ? -0.441  0.804   6.681   1.00 1.72 ? 30  LEU A HD13 2  
ATOM   1812  H HD21 . LEU A 1 30 ? 1.086   2.342   7.622   1.00 1.49 ? 30  LEU A HD21 2  
ATOM   1813  H HD22 . LEU A 1 30 ? 0.898   4.085   7.431   1.00 1.30 ? 30  LEU A HD22 2  
ATOM   1814  H HD23 . LEU A 1 30 ? 1.552   3.119   6.109   1.00 1.27 ? 30  LEU A HD23 2  
ATOM   1815  N N    . SER A 1 31 ? -3.242  5.812   5.899   1.00 0.29 ? 31  SER A N    2  
ATOM   1816  C CA   . SER A 1 31 ? -4.122  6.487   6.847   1.00 0.32 ? 31  SER A CA   2  
ATOM   1817  C C    . SER A 1 31 ? -5.580  6.210   6.492   1.00 0.28 ? 31  SER A C    2  
ATOM   1818  O O    . SER A 1 31 ? -6.426  6.028   7.372   1.00 0.29 ? 31  SER A O    2  
ATOM   1819  C CB   . SER A 1 31 ? -3.847  7.997   6.842   1.00 0.40 ? 31  SER A CB   2  
ATOM   1820  O OG   . SER A 1 31 ? -4.279  8.613   8.048   1.00 1.20 ? 31  SER A OG   2  
ATOM   1821  H H    . SER A 1 31 ? -2.632  6.349   5.345   1.00 0.31 ? 31  SER A H    2  
ATOM   1822  H HA   . SER A 1 31 ? -3.922  6.093   7.833   1.00 0.36 ? 31  SER A HA   2  
ATOM   1823  H HB2  . SER A 1 31 ? -2.787  8.165   6.730   1.00 0.94 ? 31  SER A HB2  2  
ATOM   1824  H HB3  . SER A 1 31 ? -4.371  8.452   6.012   1.00 1.08 ? 31  SER A HB3  2  
ATOM   1825  H HG   . SER A 1 31 ? -5.233  8.764   8.005   1.00 1.76 ? 31  SER A HG   2  
ATOM   1826  N N    . LEU A 1 32 ? -5.864  6.163   5.194   1.00 0.27 ? 32  LEU A N    2  
ATOM   1827  C CA   . LEU A 1 32 ? -7.211  5.897   4.711   1.00 0.29 ? 32  LEU A CA   2  
ATOM   1828  C C    . LEU A 1 32 ? -7.646  4.490   5.115   1.00 0.26 ? 32  LEU A C    2  
ATOM   1829  O O    . LEU A 1 32 ? -8.759  4.284   5.593   1.00 0.29 ? 32  LEU A O    2  
ATOM   1830  C CB   . LEU A 1 32 ? -7.259  6.063   3.184   1.00 0.35 ? 32  LEU A CB   2  
ATOM   1831  C CG   . LEU A 1 32 ? -8.650  6.187   2.544   1.00 0.67 ? 32  LEU A CG   2  
ATOM   1832  C CD1  . LEU A 1 32 ? -9.237  4.820   2.238   1.00 1.15 ? 32  LEU A CD1  2  
ATOM   1833  C CD2  . LEU A 1 32 ? -9.591  6.986   3.431   1.00 1.17 ? 32  LEU A CD2  2  
ATOM   1834  H H    . LEU A 1 32 ? -5.144  6.312   4.542   1.00 0.29 ? 32  LEU A H    2  
ATOM   1835  H HA   . LEU A 1 32 ? -7.875  6.614   5.168   1.00 0.32 ? 32  LEU A HA   2  
ATOM   1836  H HB2  . LEU A 1 32 ? -6.697  6.949   2.929   1.00 0.51 ? 32  LEU A HB2  2  
ATOM   1837  H HB3  . LEU A 1 32 ? -6.764  5.211   2.743   1.00 0.56 ? 32  LEU A HB3  2  
ATOM   1838  H HG   . LEU A 1 32 ? -8.554  6.715   1.609   1.00 0.58 ? 32  LEU A HG   2  
ATOM   1839  H HD11 . LEU A 1 32 ? -8.609  4.311   1.522   1.00 1.26 ? 32  LEU A HD11 2  
ATOM   1840  H HD12 . LEU A 1 32 ? -10.229 4.940   1.827   1.00 1.47 ? 32  LEU A HD12 2  
ATOM   1841  H HD13 . LEU A 1 32 ? -9.292  4.239   3.147   1.00 1.37 ? 32  LEU A HD13 2  
ATOM   1842  H HD21 . LEU A 1 32 ? -10.514 7.167   2.901   1.00 1.52 ? 32  LEU A HD21 2  
ATOM   1843  H HD22 . LEU A 1 32 ? -9.131  7.930   3.687   1.00 1.23 ? 32  LEU A HD22 2  
ATOM   1844  H HD23 . LEU A 1 32 ? -9.797  6.428   4.332   1.00 1.41 ? 32  LEU A HD23 2  
ATOM   1845  N N    . LEU A 1 33 ? -6.750  3.533   4.939   1.00 0.27 ? 33  LEU A N    2  
ATOM   1846  C CA   . LEU A 1 33 ? -7.026  2.143   5.278   1.00 0.31 ? 33  LEU A CA   2  
ATOM   1847  C C    . LEU A 1 33 ? -7.271  1.987   6.778   1.00 0.27 ? 33  LEU A C    2  
ATOM   1848  O O    . LEU A 1 33 ? -8.102  1.178   7.207   1.00 0.33 ? 33  LEU A O    2  
ATOM   1849  C CB   . LEU A 1 33 ? -5.855  1.258   4.849   1.00 0.41 ? 33  LEU A CB   2  
ATOM   1850  C CG   . LEU A 1 33 ? -5.408  1.415   3.389   1.00 0.49 ? 33  LEU A CG   2  
ATOM   1851  C CD1  . LEU A 1 33 ? -4.231  0.499   3.082   1.00 0.61 ? 33  LEU A CD1  2  
ATOM   1852  C CD2  . LEU A 1 33 ? -6.562  1.141   2.435   1.00 0.68 ? 33  LEU A CD2  2  
ATOM   1853  H H    . LEU A 1 33 ? -5.871  3.767   4.564   1.00 0.29 ? 33  LEU A H    2  
ATOM   1854  H HA   . LEU A 1 33 ? -7.913  1.838   4.746   1.00 0.35 ? 33  LEU A HA   2  
ATOM   1855  H HB2  . LEU A 1 33 ? -5.013  1.486   5.486   1.00 0.42 ? 33  LEU A HB2  2  
ATOM   1856  H HB3  . LEU A 1 33 ? -6.134  0.229   5.008   1.00 0.50 ? 33  LEU A HB3  2  
ATOM   1857  H HG   . LEU A 1 33 ? -5.082  2.434   3.233   1.00 0.46 ? 33  LEU A HG   2  
ATOM   1858  H HD11 . LEU A 1 33 ? -3.391  0.768   3.706   1.00 1.08 ? 33  LEU A HD11 2  
ATOM   1859  H HD12 . LEU A 1 33 ? -3.955  0.605   2.043   1.00 1.05 ? 33  LEU A HD12 2  
ATOM   1860  H HD13 . LEU A 1 33 ? -4.510  -0.525  3.276   1.00 1.03 ? 33  LEU A HD13 2  
ATOM   1861  H HD21 . LEU A 1 33 ? -6.890  0.121   2.549   1.00 1.04 ? 33  LEU A HD21 2  
ATOM   1862  H HD22 . LEU A 1 33 ? -6.231  1.301   1.419   1.00 0.99 ? 33  LEU A HD22 2  
ATOM   1863  H HD23 . LEU A 1 33 ? -7.380  1.809   2.658   1.00 0.89 ? 33  LEU A HD23 2  
ATOM   1864  N N    . GLN A 1 34 ? -6.551  2.770   7.572   1.00 0.26 ? 34  GLN A N    2  
ATOM   1865  C CA   . GLN A 1 34 ? -6.680  2.720   9.022   1.00 0.31 ? 34  GLN A CA   2  
ATOM   1866  C C    . GLN A 1 34 ? -8.005  3.316   9.492   1.00 0.29 ? 34  GLN A C    2  
ATOM   1867  O O    . GLN A 1 34 ? -8.661  2.762   10.375  1.00 0.38 ? 34  GLN A O    2  
ATOM   1868  C CB   . GLN A 1 34 ? -5.523  3.463   9.687   1.00 0.42 ? 34  GLN A CB   2  
ATOM   1869  C CG   . GLN A 1 34 ? -4.194  2.734   9.593   1.00 0.72 ? 34  GLN A CG   2  
ATOM   1870  C CD   . GLN A 1 34 ? -3.086  3.435   10.355  1.00 1.04 ? 34  GLN A CD   2  
ATOM   1871  O OE1  . GLN A 1 34 ? -1.922  3.380   9.966   1.00 1.62 ? 34  GLN A OE1  2  
ATOM   1872  N NE2  . GLN A 1 34 ? -3.437  4.096   11.448  1.00 1.51 ? 34  GLN A NE2  2  
ATOM   1873  H H    . GLN A 1 34 ? -5.906  3.391   7.172   1.00 0.29 ? 34  GLN A H    2  
ATOM   1874  H HA   . GLN A 1 34 ? -6.644  1.683   9.318   1.00 0.36 ? 34  GLN A HA   2  
ATOM   1875  H HB2  . GLN A 1 34 ? -5.413  4.429   9.216   1.00 0.67 ? 34  GLN A HB2  2  
ATOM   1876  H HB3  . GLN A 1 34 ? -5.757  3.607   10.731  1.00 0.61 ? 34  GLN A HB3  2  
ATOM   1877  H HG2  . GLN A 1 34 ? -4.315  1.740   9.996   1.00 1.27 ? 34  GLN A HG2  2  
ATOM   1878  H HG3  . GLN A 1 34 ? -3.908  2.666   8.552   1.00 1.25 ? 34  GLN A HG3  2  
ATOM   1879  H HE21 . GLN A 1 34 ? -4.383  4.101   11.705  1.00 1.73 ? 34  GLN A HE21 2  
ATOM   1880  H HE22 . GLN A 1 34 ? -2.735  4.552   11.957  1.00 1.94 ? 34  GLN A HE22 2  
ATOM   1881  N N    . LYS A 1 35 ? -8.400  4.444   8.909   1.00 0.29 ? 35  LYS A N    2  
ATOM   1882  C CA   . LYS A 1 35 ? -9.644  5.102   9.308   1.00 0.37 ? 35  LYS A CA   2  
ATOM   1883  C C    . LYS A 1 35 ? -10.871 4.374   8.768   1.00 0.32 ? 35  LYS A C    2  
ATOM   1884  O O    . LYS A 1 35 ? -11.961 4.499   9.322   1.00 0.36 ? 35  LYS A O    2  
ATOM   1885  C CB   . LYS A 1 35 ? -9.667  6.568   8.861   1.00 0.50 ? 35  LYS A CB   2  
ATOM   1886  C CG   . LYS A 1 35 ? -9.592  6.755   7.357   1.00 0.67 ? 35  LYS A CG   2  
ATOM   1887  C CD   . LYS A 1 35 ? -10.244 8.054   6.920   1.00 0.77 ? 35  LYS A CD   2  
ATOM   1888  C CE   . LYS A 1 35 ? -11.760 7.936   6.894   1.00 1.00 ? 35  LYS A CE   2  
ATOM   1889  N NZ   . LYS A 1 35 ? -12.395 9.141   6.306   1.00 1.37 ? 35  LYS A NZ   2  
ATOM   1890  H H    . LYS A 1 35 ? -7.840  4.848   8.208   1.00 0.33 ? 35  LYS A H    2  
ATOM   1891  H HA   . LYS A 1 35 ? -9.686  5.075   10.385  1.00 0.45 ? 35  LYS A HA   2  
ATOM   1892  H HB2  . LYS A 1 35 ? -10.581 7.024   9.211   1.00 0.88 ? 35  LYS A HB2  2  
ATOM   1893  H HB3  . LYS A 1 35 ? -8.826  7.079   9.307   1.00 1.00 ? 35  LYS A HB3  2  
ATOM   1894  H HG2  . LYS A 1 35 ? -8.556  6.765   7.058   1.00 1.20 ? 35  LYS A HG2  2  
ATOM   1895  H HG3  . LYS A 1 35 ? -10.097 5.928   6.876   1.00 1.10 ? 35  LYS A HG3  2  
ATOM   1896  H HD2  . LYS A 1 35 ? -9.966  8.836   7.611   1.00 1.19 ? 35  LYS A HD2  2  
ATOM   1897  H HD3  . LYS A 1 35 ? -9.895  8.305   5.929   1.00 1.15 ? 35  LYS A HD3  2  
ATOM   1898  H HE2  . LYS A 1 35 ? -12.031 7.072   6.305   1.00 1.52 ? 35  LYS A HE2  2  
ATOM   1899  H HE3  . LYS A 1 35 ? -12.117 7.808   7.906   1.00 1.60 ? 35  LYS A HE3  2  
ATOM   1900  H HZ1  . LYS A 1 35 ? -12.004 10.000  6.743   1.00 1.85 ? 35  LYS A HZ1  2  
ATOM   1901  H HZ2  . LYS A 1 35 ? -13.420 9.120   6.468   1.00 1.75 ? 35  LYS A HZ2  2  
ATOM   1902  H HZ3  . LYS A 1 35 ? -12.218 9.177   5.281   1.00 1.76 ? 35  LYS A HZ3  2  
ATOM   1903  N N    . GLU A 1 36 ? -10.703 3.626   7.683   1.00 0.29 ? 36  GLU A N    2  
ATOM   1904  C CA   . GLU A 1 36 ? -11.817 2.882   7.103   1.00 0.31 ? 36  GLU A CA   2  
ATOM   1905  C C    . GLU A 1 36 ? -12.127 1.644   7.940   1.00 0.29 ? 36  GLU A C    2  
ATOM   1906  O O    . GLU A 1 36 ? -13.171 1.013   7.773   1.00 0.39 ? 36  GLU A O    2  
ATOM   1907  C CB   . GLU A 1 36 ? -11.512 2.478   5.660   1.00 0.37 ? 36  GLU A CB   2  
ATOM   1908  C CG   . GLU A 1 36 ? -11.782 3.581   4.646   1.00 0.43 ? 36  GLU A CG   2  
ATOM   1909  C CD   . GLU A 1 36 ? -13.228 4.039   4.647   1.00 0.64 ? 36  GLU A CD   2  
ATOM   1910  O OE1  . GLU A 1 36 ? -13.468 5.265   4.704   1.00 1.30 ? 36  GLU A OE1  2  
ATOM   1911  O OE2  . GLU A 1 36 ? -14.134 3.178   4.592   1.00 1.21 ? 36  GLU A OE2  2  
ATOM   1912  H H    . GLU A 1 36 ? -9.820  3.586   7.254   1.00 0.32 ? 36  GLU A H    2  
ATOM   1913  H HA   . GLU A 1 36 ? -12.681 3.532   7.109   1.00 0.38 ? 36  GLU A HA   2  
ATOM   1914  H HB2  . GLU A 1 36 ? -10.470 2.199   5.590   1.00 0.40 ? 36  GLU A HB2  2  
ATOM   1915  H HB3  . GLU A 1 36 ? -12.119 1.623   5.403   1.00 0.47 ? 36  GLU A HB3  2  
ATOM   1916  H HG2  . GLU A 1 36 ? -11.155 4.426   4.881   1.00 0.46 ? 36  GLU A HG2  2  
ATOM   1917  H HG3  . GLU A 1 36 ? -11.536 3.213   3.660   1.00 0.50 ? 36  GLU A HG3  2  
ATOM   1918  N N    . GLY A 1 37 ? -11.216 1.306   8.846   1.00 0.27 ? 37  GLY A N    2  
ATOM   1919  C CA   . GLY A 1 37 ? -11.412 0.151   9.701   1.00 0.30 ? 37  GLY A CA   2  
ATOM   1920  C C    . GLY A 1 37 ? -10.929 -1.129  9.060   1.00 0.29 ? 37  GLY A C    2  
ATOM   1921  O O    . GLY A 1 37 ? -11.280 -2.224  9.499   1.00 0.41 ? 37  GLY A O    2  
ATOM   1922  H H    . GLY A 1 37 ? -10.407 1.850   8.942   1.00 0.30 ? 37  GLY A H    2  
ATOM   1923  H HA2  . GLY A 1 37 ? -10.872 0.304   10.623  1.00 0.33 ? 37  GLY A HA2  2  
ATOM   1924  H HA3  . GLY A 1 37 ? -12.464 0.056   9.924   1.00 0.35 ? 37  GLY A HA3  2  
ATOM   1925  N N    . LEU A 1 38 ? -10.129 -0.998  8.014   1.00 0.25 ? 38  LEU A N    2  
ATOM   1926  C CA   . LEU A 1 38 ? -9.605  -2.159  7.314   1.00 0.28 ? 38  LEU A CA   2  
ATOM   1927  C C    . LEU A 1 38 ? -8.329  -2.659  7.984   1.00 0.32 ? 38  LEU A C    2  
ATOM   1928  O O    . LEU A 1 38 ? -8.150  -3.860  8.179   1.00 0.46 ? 38  LEU A O    2  
ATOM   1929  C CB   . LEU A 1 38 ? -9.344  -1.825  5.843   1.00 0.31 ? 38  LEU A CB   2  
ATOM   1930  C CG   . LEU A 1 38 ? -10.595 -1.508  5.016   1.00 0.40 ? 38  LEU A CG   2  
ATOM   1931  C CD1  . LEU A 1 38 ? -10.216 -0.896  3.675   1.00 0.51 ? 38  LEU A CD1  2  
ATOM   1932  C CD2  . LEU A 1 38 ? -11.431 -2.764  4.811   1.00 0.50 ? 38  LEU A CD2  2  
ATOM   1933  H H    . LEU A 1 38 ? -9.887  -0.099  7.703   1.00 0.29 ? 38  LEU A H    2  
ATOM   1934  H HA   . LEU A 1 38 ? -10.352 -2.937  7.369   1.00 0.34 ? 38  LEU A HA   2  
ATOM   1935  H HB2  . LEU A 1 38 ? -8.684  -0.971  5.799   1.00 0.34 ? 38  LEU A HB2  2  
ATOM   1936  H HB3  . LEU A 1 38 ? -8.846  -2.669  5.388   1.00 0.35 ? 38  LEU A HB3  2  
ATOM   1937  H HG   . LEU A 1 38 ? -11.198 -0.787  5.550   1.00 0.47 ? 38  LEU A HG   2  
ATOM   1938  H HD11 . LEU A 1 38 ? -9.672  -1.622  3.089   1.00 0.74 ? 38  LEU A HD11 2  
ATOM   1939  H HD12 . LEU A 1 38 ? -9.595  -0.028  3.838   1.00 0.78 ? 38  LEU A HD12 2  
ATOM   1940  H HD13 . LEU A 1 38 ? -11.112 -0.603  3.145   1.00 0.79 ? 38  LEU A HD13 2  
ATOM   1941  H HD21 . LEU A 1 38 ? -12.322 -2.518  4.250   1.00 0.77 ? 38  LEU A HD21 2  
ATOM   1942  H HD22 . LEU A 1 38 ? -11.712 -3.169  5.771   1.00 0.67 ? 38  LEU A HD22 2  
ATOM   1943  H HD23 . LEU A 1 38 ? -10.854 -3.498  4.267   1.00 0.68 ? 38  LEU A HD23 2  
ATOM   1944  N N    . LEU A 1 39 ? -7.451  -1.733  8.345   1.00 0.31 ? 39  LEU A N    2  
ATOM   1945  C CA   . LEU A 1 39 ? -6.197  -2.088  9.001   1.00 0.40 ? 39  LEU A CA   2  
ATOM   1946  C C    . LEU A 1 39 ? -6.109  -1.406  10.356  1.00 0.39 ? 39  LEU A C    2  
ATOM   1947  O O    . LEU A 1 39 ? -6.447  -0.229  10.485  1.00 0.57 ? 39  LEU A O    2  
ATOM   1948  C CB   . LEU A 1 39 ? -4.996  -1.691  8.139   1.00 0.53 ? 39  LEU A CB   2  
ATOM   1949  C CG   . LEU A 1 39 ? -4.937  -2.346  6.755   1.00 0.67 ? 39  LEU A CG   2  
ATOM   1950  C CD1  . LEU A 1 39 ? -3.660  -1.953  6.033   1.00 0.86 ? 39  LEU A CD1  2  
ATOM   1951  C CD2  . LEU A 1 39 ? -5.037  -3.860  6.868   1.00 0.75 ? 39  LEU A CD2  2  
ATOM   1952  H H    . LEU A 1 39 ? -7.652  -0.787  8.178   1.00 0.31 ? 39  LEU A H    2  
ATOM   1953  H HA   . LEU A 1 39 ? -6.189  -3.157  9.148   1.00 0.47 ? 39  LEU A HA   2  
ATOM   1954  H HB2  . LEU A 1 39 ? -5.014  -0.618  8.008   1.00 0.56 ? 39  LEU A HB2  2  
ATOM   1955  H HB3  . LEU A 1 39 ? -4.095  -1.955  8.674   1.00 0.63 ? 39  LEU A HB3  2  
ATOM   1956  H HG   . LEU A 1 39 ? -5.772  -1.999  6.167   1.00 0.67 ? 39  LEU A HG   2  
ATOM   1957  H HD11 . LEU A 1 39 ? -2.806  -2.265  6.617   1.00 1.10 ? 39  LEU A HD11 2  
ATOM   1958  H HD12 . LEU A 1 39 ? -3.634  -0.881  5.903   1.00 1.10 ? 39  LEU A HD12 2  
ATOM   1959  H HD13 . LEU A 1 39 ? -3.630  -2.434  5.067   1.00 1.09 ? 39  LEU A HD13 2  
ATOM   1960  H HD21 . LEU A 1 39 ? -6.046  -4.172  6.643   1.00 1.19 ? 39  LEU A HD21 2  
ATOM   1961  H HD22 . LEU A 1 39 ? -4.784  -4.163  7.874   1.00 1.13 ? 39  LEU A HD22 2  
ATOM   1962  H HD23 . LEU A 1 39 ? -4.354  -4.321  6.171   1.00 1.12 ? 39  LEU A HD23 2  
ATOM   1963  N N    . MET A 1 40 ? -5.656  -2.142  11.362  1.00 0.35 ? 40  MET A N    2  
ATOM   1964  C CA   . MET A 1 40 ? -5.533  -1.596  12.708  1.00 0.41 ? 40  MET A CA   2  
ATOM   1965  C C    . MET A 1 40 ? -4.135  -1.028  12.926  1.00 0.37 ? 40  MET A C    2  
ATOM   1966  O O    . MET A 1 40 ? -3.956  -0.030  13.625  1.00 0.53 ? 40  MET A O    2  
ATOM   1967  C CB   . MET A 1 40 ? -5.822  -2.673  13.757  1.00 0.54 ? 40  MET A CB   2  
ATOM   1968  C CG   . MET A 1 40 ? -5.989  -2.121  15.161  1.00 0.70 ? 40  MET A CG   2  
ATOM   1969  S SD   . MET A 1 40 ? -5.404  -3.269  16.422  1.00 0.94 ? 40  MET A SD   2  
ATOM   1970  C CE   . MET A 1 40 ? -3.631  -3.035  16.300  1.00 1.19 ? 40  MET A CE   2  
ATOM   1971  H H    . MET A 1 40 ? -5.384  -3.071  11.193  1.00 0.44 ? 40  MET A H    2  
ATOM   1972  H HA   . MET A 1 40 ? -6.255  -0.799  12.813  1.00 0.50 ? 40  MET A HA   2  
ATOM   1973  H HB2  . MET A 1 40 ? -6.731  -3.189  13.489  1.00 0.62 ? 40  MET A HB2  2  
ATOM   1974  H HB3  . MET A 1 40 ? -5.005  -3.380  13.769  1.00 0.55 ? 40  MET A HB3  2  
ATOM   1975  H HG2  . MET A 1 40 ? -5.428  -1.201  15.241  1.00 0.73 ? 40  MET A HG2  2  
ATOM   1976  H HG3  . MET A 1 40 ? -7.036  -1.920  15.333  1.00 0.78 ? 40  MET A HG3  2  
ATOM   1977  H HE1  . MET A 1 40 ? -3.380  -2.024  16.585  1.00 1.40 ? 40  MET A HE1  2  
ATOM   1978  H HE2  . MET A 1 40 ? -3.310  -3.212  15.284  1.00 1.50 ? 40  MET A HE2  2  
ATOM   1979  H HE3  . MET A 1 40 ? -3.134  -3.728  16.962  1.00 1.50 ? 40  MET A HE3  2  
ATOM   1980  N N    . SER A 1 41 ? -3.149  -1.672  12.319  1.00 0.33 ? 41  SER A N    2  
ATOM   1981  C CA   . SER A 1 41 ? -1.766  -1.250  12.440  1.00 0.39 ? 41  SER A CA   2  
ATOM   1982  C C    . SER A 1 41 ? -1.131  -1.096  11.060  1.00 0.34 ? 41  SER A C    2  
ATOM   1983  O O    . SER A 1 41 ? -1.526  -1.771  10.111  1.00 0.31 ? 41  SER A O    2  
ATOM   1984  C CB   . SER A 1 41 ? -0.990  -2.267  13.283  1.00 0.50 ? 41  SER A CB   2  
ATOM   1985  O OG   . SER A 1 41 ? -1.619  -3.542  13.270  1.00 0.87 ? 41  SER A OG   2  
ATOM   1986  H H    . SER A 1 41 ? -3.358  -2.465  11.769  1.00 0.38 ? 41  SER A H    2  
ATOM   1987  H HA   . SER A 1 41 ? -1.749  -0.294  12.938  1.00 0.51 ? 41  SER A HA   2  
ATOM   1988  H HB2  . SER A 1 41 ? 0.008   -2.371  12.889  1.00 0.83 ? 41  SER A HB2  2  
ATOM   1989  H HB3  . SER A 1 41 ? -0.938  -1.917  14.303  1.00 0.81 ? 41  SER A HB3  2  
ATOM   1990  H HG   . SER A 1 41 ? -2.169  -3.630  12.471  1.00 1.39 ? 41  SER A HG   2  
ATOM   1991  N N    . PRO A 1 42 ? -0.140  -0.204  10.924  1.00 0.43 ? 42  PRO A N    2  
ATOM   1992  C CA   . PRO A 1 42 ? 0.539   0.025   9.644   1.00 0.47 ? 42  PRO A CA   2  
ATOM   1993  C C    . PRO A 1 42 ? 1.282   -1.215  9.153   1.00 0.43 ? 42  PRO A C    2  
ATOM   1994  O O    . PRO A 1 42 ? 1.519   -1.376  7.955   1.00 0.54 ? 42  PRO A O    2  
ATOM   1995  C CB   . PRO A 1 42 ? 1.525   1.160   9.956   1.00 0.61 ? 42  PRO A CB   2  
ATOM   1996  C CG   . PRO A 1 42 ? 1.697   1.136   11.434  1.00 0.65 ? 42  PRO A CG   2  
ATOM   1997  C CD   . PRO A 1 42 ? 0.387   0.665   11.993  1.00 0.57 ? 42  PRO A CD   2  
ATOM   1998  H HA   . PRO A 1 42 ? -0.157  0.346   8.883   1.00 0.51 ? 42  PRO A HA   2  
ATOM   1999  H HB2  . PRO A 1 42 ? 2.467   0.981   9.452   1.00 0.65 ? 42  PRO A HB2  2  
ATOM   2000  H HB3  . PRO A 1 42 ? 1.107   2.104   9.646   1.00 0.73 ? 42  PRO A HB3  2  
ATOM   2001  H HG2  . PRO A 1 42 ? 2.490   0.451   11.699  1.00 0.67 ? 42  PRO A HG2  2  
ATOM   2002  H HG3  . PRO A 1 42 ? 1.916   2.128   11.798  1.00 0.81 ? 42  PRO A HG3  2  
ATOM   2003  H HD2  . PRO A 1 42 ? 0.543   0.108   12.905  1.00 0.58 ? 42  PRO A HD2  2  
ATOM   2004  H HD3  . PRO A 1 42 ? -0.273  1.502   12.165  1.00 0.68 ? 42  PRO A HD3  2  
ATOM   2005  N N    . SER A 1 43 ? 1.630   -2.094  10.084  1.00 0.36 ? 43  SER A N    2  
ATOM   2006  C CA   . SER A 1 43 ? 2.345   -3.315  9.758   1.00 0.41 ? 43  SER A CA   2  
ATOM   2007  C C    . SER A 1 43 ? 1.385   -4.443  9.376   1.00 0.36 ? 43  SER A C    2  
ATOM   2008  O O    . SER A 1 43 ? 1.801   -5.586  9.185   1.00 0.40 ? 43  SER A O    2  
ATOM   2009  C CB   . SER A 1 43 ? 3.207   -3.728  10.950  1.00 0.54 ? 43  SER A CB   2  
ATOM   2010  O OG   . SER A 1 43 ? 2.695   -3.178  12.157  1.00 0.69 ? 43  SER A OG   2  
ATOM   2011  H H    . SER A 1 43 ? 1.408   -1.910  11.022  1.00 0.38 ? 43  SER A H    2  
ATOM   2012  H HA   . SER A 1 43 ? 2.988   -3.104  8.917   1.00 0.49 ? 43  SER A HA   2  
ATOM   2013  H HB2  . SER A 1 43 ? 3.214   -4.805  11.033  1.00 0.70 ? 43  SER A HB2  2  
ATOM   2014  H HB3  . SER A 1 43 ? 4.215   -3.370  10.803  1.00 0.75 ? 43  SER A HB3  2  
ATOM   2015  H HG   . SER A 1 43 ? 2.229   -3.869  12.649  1.00 1.10 ? 43  SER A HG   2  
ATOM   2016  N N    . ASP A 1 44 ? 0.100   -4.121  9.244   1.00 0.32 ? 44  ASP A N    2  
ATOM   2017  C CA   . ASP A 1 44 ? -0.907  -5.118  8.877   1.00 0.32 ? 44  ASP A CA   2  
ATOM   2018  C C    . ASP A 1 44 ? -0.715  -5.584  7.439   1.00 0.29 ? 44  ASP A C    2  
ATOM   2019  O O    . ASP A 1 44 ? -1.333  -6.555  6.997   1.00 0.31 ? 44  ASP A O    2  
ATOM   2020  C CB   . ASP A 1 44 ? -2.313  -4.546  9.038   1.00 0.39 ? 44  ASP A CB   2  
ATOM   2021  C CG   . ASP A 1 44 ? -2.987  -4.983  10.322  1.00 0.54 ? 44  ASP A CG   2  
ATOM   2022  O OD1  . ASP A 1 44 ? -3.317  -6.182  10.449  1.00 0.87 ? 44  ASP A OD1  2  
ATOM   2023  O OD2  . ASP A 1 44 ? -3.206  -4.126  11.203  1.00 0.69 ? 44  ASP A OD2  2  
ATOM   2024  H H    . ASP A 1 44 ? -0.181  -3.191  9.401   1.00 0.35 ? 44  ASP A H    2  
ATOM   2025  H HA   . ASP A 1 44 ? -0.792  -5.963  9.537   1.00 0.40 ? 44  ASP A HA   2  
ATOM   2026  H HB2  . ASP A 1 44 ? -2.254  -3.468  9.037   1.00 0.46 ? 44  ASP A HB2  2  
ATOM   2027  H HB3  . ASP A 1 44 ? -2.919  -4.869  8.205   1.00 0.52 ? 44  ASP A HB3  2  
ATOM   2028  N N    . LEU A 1 45 ? 0.158   -4.889  6.720   1.00 0.31 ? 45  LEU A N    2  
ATOM   2029  C CA   . LEU A 1 45 ? 0.458   -5.205  5.329   1.00 0.36 ? 45  LEU A CA   2  
ATOM   2030  C C    . LEU A 1 45 ? 1.147   -6.566  5.202   1.00 0.34 ? 45  LEU A C    2  
ATOM   2031  O O    . LEU A 1 45 ? 1.207   -7.139  4.112   1.00 0.38 ? 45  LEU A O    2  
ATOM   2032  C CB   . LEU A 1 45 ? 1.350   -4.111  4.729   1.00 0.45 ? 45  LEU A CB   2  
ATOM   2033  C CG   . LEU A 1 45 ? 0.700   -3.236  3.653   1.00 0.60 ? 45  LEU A CG   2  
ATOM   2034  C CD1  . LEU A 1 45 ? 0.293   -4.075  2.455   1.00 0.96 ? 45  LEU A CD1  2  
ATOM   2035  C CD2  . LEU A 1 45 ? -0.501  -2.487  4.213   1.00 0.98 ? 45  LEU A CD2  2  
ATOM   2036  H H    . LEU A 1 45 ? 0.618   -4.134  7.140   1.00 0.35 ? 45  LEU A H    2  
ATOM   2037  H HA   . LEU A 1 45 ? -0.477  -5.233  4.786   1.00 0.41 ? 45  LEU A HA   2  
ATOM   2038  H HB2  . LEU A 1 45 ? 1.680   -3.468  5.531   1.00 0.60 ? 45  LEU A HB2  2  
ATOM   2039  H HB3  . LEU A 1 45 ? 2.218   -4.585  4.295   1.00 0.54 ? 45  LEU A HB3  2  
ATOM   2040  H HG   . LEU A 1 45 ? 1.418   -2.506  3.312   1.00 0.84 ? 45  LEU A HG   2  
ATOM   2041  H HD11 . LEU A 1 45 ? 1.117   -4.705  2.162   1.00 1.37 ? 45  LEU A HD11 2  
ATOM   2042  H HD12 . LEU A 1 45 ? 0.028   -3.425  1.635   1.00 1.34 ? 45  LEU A HD12 2  
ATOM   2043  H HD13 . LEU A 1 45 ? -0.556  -4.689  2.717   1.00 1.38 ? 45  LEU A HD13 2  
ATOM   2044  H HD21 . LEU A 1 45 ? -0.903  -1.832  3.454   1.00 1.28 ? 45  LEU A HD21 2  
ATOM   2045  H HD22 . LEU A 1 45 ? -0.194  -1.903  5.067   1.00 1.36 ? 45  LEU A HD22 2  
ATOM   2046  H HD23 . LEU A 1 45 ? -1.261  -3.194  4.514   1.00 1.37 ? 45  LEU A HD23 2  
ATOM   2047  N N    . TYR A 1 46 ? 1.649   -7.085  6.322   1.00 0.32 ? 46  TYR A N    2  
ATOM   2048  C CA   . TYR A 1 46 ? 2.337   -8.374  6.340   1.00 0.37 ? 46  TYR A CA   2  
ATOM   2049  C C    . TYR A 1 46 ? 1.349   -9.537  6.267   1.00 0.34 ? 46  TYR A C    2  
ATOM   2050  O O    . TYR A 1 46 ? 1.753   -10.700 6.217   1.00 0.44 ? 46  TYR A O    2  
ATOM   2051  C CB   . TYR A 1 46 ? 3.183   -8.507  7.609   1.00 0.47 ? 46  TYR A CB   2  
ATOM   2052  C CG   . TYR A 1 46 ? 4.437   -7.660  7.613   1.00 0.55 ? 46  TYR A CG   2  
ATOM   2053  C CD1  . TYR A 1 46 ? 5.433   -7.856  6.668   1.00 0.87 ? 46  TYR A CD1  2  
ATOM   2054  C CD2  . TYR A 1 46 ? 4.626   -6.671  8.570   1.00 0.64 ? 46  TYR A CD2  2  
ATOM   2055  C CE1  . TYR A 1 46 ? 6.582   -7.092  6.676   1.00 1.01 ? 46  TYR A CE1  2  
ATOM   2056  C CE2  . TYR A 1 46 ? 5.770   -5.901  8.583   1.00 0.76 ? 46  TYR A CE2  2  
ATOM   2057  C CZ   . TYR A 1 46 ? 6.746   -6.116  7.636   1.00 0.86 ? 46  TYR A CZ   2  
ATOM   2058  O OH   . TYR A 1 46 ? 7.895   -5.353  7.652   1.00 1.05 ? 46  TYR A OH   2  
ATOM   2059  H H    . TYR A 1 46 ? 1.554   -6.586  7.162   1.00 0.33 ? 46  TYR A H    2  
ATOM   2060  H HA   . TYR A 1 46 ? 2.988   -8.415  5.480   1.00 0.43 ? 46  TYR A HA   2  
ATOM   2061  H HB2  . TYR A 1 46 ? 2.587   -8.216  8.461   1.00 0.46 ? 46  TYR A HB2  2  
ATOM   2062  H HB3  . TYR A 1 46 ? 3.480   -9.538  7.724   1.00 0.61 ? 46  TYR A HB3  2  
ATOM   2063  H HD1  . TYR A 1 46 ? 5.303   -8.620  5.916   1.00 1.12 ? 46  TYR A HD1  2  
ATOM   2064  H HD2  . TYR A 1 46 ? 3.860   -6.504  9.311   1.00 0.84 ? 46  TYR A HD2  2  
ATOM   2065  H HE1  . TYR A 1 46 ? 7.344   -7.261  5.929   1.00 1.34 ? 46  TYR A HE1  2  
ATOM   2066  H HE2  . TYR A 1 46 ? 5.897   -5.139  9.335   1.00 0.97 ? 46  TYR A HE2  2  
ATOM   2067  H HH   . TYR A 1 46 ? 8.105   -5.118  8.564   1.00 1.14 ? 46  TYR A HH   2  
ATOM   2068  N N    . SER A 1 47 ? 0.059   -9.223  6.266   1.00 0.31 ? 47  SER A N    2  
ATOM   2069  C CA   . SER A 1 47 ? -0.974  -10.250 6.208   1.00 0.29 ? 47  SER A CA   2  
ATOM   2070  C C    . SER A 1 47 ? -1.525  -10.392 4.789   1.00 0.24 ? 47  SER A C    2  
ATOM   2071  O O    . SER A 1 47 ? -2.369  -9.602  4.365   1.00 0.26 ? 47  SER A O    2  
ATOM   2072  C CB   . SER A 1 47 ? -2.115  -9.909  7.173   1.00 0.36 ? 47  SER A CB   2  
ATOM   2073  O OG   . SER A 1 47 ? -1.684  -9.001  8.178   1.00 0.53 ? 47  SER A OG   2  
ATOM   2074  H H    . SER A 1 47 ? -0.206  -8.280  6.307   1.00 0.37 ? 47  SER A H    2  
ATOM   2075  H HA   . SER A 1 47 ? -0.528  -11.186 6.506   1.00 0.33 ? 47  SER A HA   2  
ATOM   2076  H HB2  . SER A 1 47 ? -2.929  -9.458  6.622   1.00 0.43 ? 47  SER A HB2  2  
ATOM   2077  H HB3  . SER A 1 47 ? -2.462  -10.814 7.647   1.00 0.44 ? 47  SER A HB3  2  
ATOM   2078  H HG   . SER A 1 47 ? -1.697  -8.099  7.821   1.00 1.10 ? 47  SER A HG   2  
ATOM   2079  N N    . PRO A 1 48 ? -1.071  -11.414 4.041   1.00 0.24 ? 48  PRO A N    2  
ATOM   2080  C CA   . PRO A 1 48 ? -1.514  -11.644 2.664   1.00 0.25 ? 48  PRO A CA   2  
ATOM   2081  C C    . PRO A 1 48 ? -2.973  -12.089 2.581   1.00 0.26 ? 48  PRO A C    2  
ATOM   2082  O O    . PRO A 1 48 ? -3.644  -11.864 1.572   1.00 0.32 ? 48  PRO A O    2  
ATOM   2083  C CB   . PRO A 1 48 ? -0.583  -12.753 2.168   1.00 0.31 ? 48  PRO A CB   2  
ATOM   2084  C CG   . PRO A 1 48 ? -0.131  -13.459 3.394   1.00 0.38 ? 48  PRO A CG   2  
ATOM   2085  C CD   . PRO A 1 48 ? -0.086  -12.422 4.482   1.00 0.32 ? 48  PRO A CD   2  
ATOM   2086  H HA   . PRO A 1 48 ? -1.378  -10.759 2.055   1.00 0.26 ? 48  PRO A HA   2  
ATOM   2087  H HB2  . PRO A 1 48 ? -1.129  -13.422 1.513   1.00 0.38 ? 48  PRO A HB2  2  
ATOM   2088  H HB3  . PRO A 1 48 ? 0.261   -12.328 1.651   1.00 0.38 ? 48  PRO A HB3  2  
ATOM   2089  H HG2  . PRO A 1 48 ? -0.833  -14.241 3.646   1.00 0.50 ? 48  PRO A HG2  2  
ATOM   2090  H HG3  . PRO A 1 48 ? 0.854   -13.869 3.240   1.00 0.52 ? 48  PRO A HG3  2  
ATOM   2091  H HD2  . PRO A 1 48 ? -0.376  -12.854 5.426   1.00 0.38 ? 48  PRO A HD2  2  
ATOM   2092  H HD3  . PRO A 1 48 ? 0.901   -11.990 4.552   1.00 0.38 ? 48  PRO A HD3  2  
ATOM   2093  N N    . GLY A 1 49 ? -3.461  -12.714 3.645   1.00 0.28 ? 49  GLY A N    2  
ATOM   2094  C CA   . GLY A 1 49 ? -4.837  -13.174 3.669   1.00 0.33 ? 49  GLY A CA   2  
ATOM   2095  C C    . GLY A 1 49 ? -5.820  -12.023 3.689   1.00 0.32 ? 49  GLY A C    2  
ATOM   2096  O O    . GLY A 1 49 ? -6.970  -12.172 3.279   1.00 0.50 ? 49  GLY A O    2  
ATOM   2097  H H    . GLY A 1 49 ? -2.881  -12.869 4.423   1.00 0.30 ? 49  GLY A H    2  
ATOM   2098  H HA2  . GLY A 1 49 ? -5.020  -13.776 2.790   1.00 0.35 ? 49  GLY A HA2  2  
ATOM   2099  H HA3  . GLY A 1 49 ? -4.990  -13.782 4.548   1.00 0.38 ? 49  GLY A HA3  2  
ATOM   2100  N N    . SER A 1 50 ? -5.358  -10.869 4.151   1.00 0.25 ? 50  SER A N    2  
ATOM   2101  C CA   . SER A 1 50 ? -6.198  -9.684  4.232   1.00 0.27 ? 50  SER A CA   2  
ATOM   2102  C C    . SER A 1 50 ? -6.064  -8.819  2.979   1.00 0.22 ? 50  SER A C    2  
ATOM   2103  O O    . SER A 1 50 ? -6.797  -7.847  2.813   1.00 0.28 ? 50  SER A O    2  
ATOM   2104  C CB   . SER A 1 50 ? -5.823  -8.874  5.471   1.00 0.35 ? 50  SER A CB   2  
ATOM   2105  O OG   . SER A 1 50 ? -5.603  -9.727  6.582   1.00 0.47 ? 50  SER A OG   2  
ATOM   2106  H H    . SER A 1 50 ? -4.427  -10.813 4.456   1.00 0.31 ? 50  SER A H    2  
ATOM   2107  H HA   . SER A 1 50 ? -7.224  -10.009 4.323   1.00 0.32 ? 50  SER A HA   2  
ATOM   2108  H HB2  . SER A 1 50 ? -4.919  -8.315  5.273   1.00 0.45 ? 50  SER A HB2  2  
ATOM   2109  H HB3  . SER A 1 50 ? -6.625  -8.191  5.709   1.00 0.45 ? 50  SER A HB3  2  
ATOM   2110  H HG   . SER A 1 50 ? -5.479  -9.192  7.378   1.00 0.93 ? 50  SER A HG   2  
ATOM   2111  N N    . TRP A 1 51 ? -5.146  -9.188  2.090   1.00 0.20 ? 51  TRP A N    2  
ATOM   2112  C CA   . TRP A 1 51 ? -4.918  -8.427  0.860   1.00 0.20 ? 51  TRP A CA   2  
ATOM   2113  C C    . TRP A 1 51 ? -6.157  -8.419  -0.030  1.00 0.19 ? 51  TRP A C    2  
ATOM   2114  O O    . TRP A 1 51 ? -6.489  -7.398  -0.632  1.00 0.23 ? 51  TRP A O    2  
ATOM   2115  C CB   . TRP A 1 51 ? -3.738  -8.999  0.067   1.00 0.23 ? 51  TRP A CB   2  
ATOM   2116  C CG   . TRP A 1 51 ? -2.389  -8.739  0.679   1.00 0.24 ? 51  TRP A CG   2  
ATOM   2117  C CD1  . TRP A 1 51 ? -2.099  -7.937  1.748   1.00 0.25 ? 51  TRP A CD1  2  
ATOM   2118  C CD2  . TRP A 1 51 ? -1.141  -9.289  0.243   1.00 0.27 ? 51  TRP A CD2  2  
ATOM   2119  N NE1  . TRP A 1 51 ? -0.746  -7.962  2.003   1.00 0.28 ? 51  TRP A NE1  2  
ATOM   2120  C CE2  . TRP A 1 51 ? -0.139  -8.788  1.093   1.00 0.29 ? 51  TRP A CE2  2  
ATOM   2121  C CE3  . TRP A 1 51 ? -0.778  -10.165 -0.782  1.00 0.30 ? 51  TRP A CE3  2  
ATOM   2122  C CZ2  . TRP A 1 51 ? 1.203   -9.132  0.946   1.00 0.33 ? 51  TRP A CZ2  2  
ATOM   2123  C CZ3  . TRP A 1 51 ? 0.552   -10.504 -0.928  1.00 0.34 ? 51  TRP A CZ3  2  
ATOM   2124  C CH2  . TRP A 1 51 ? 1.529   -9.991  -0.067  1.00 0.35 ? 51  TRP A CH2  2  
ATOM   2125  H H    . TRP A 1 51 ? -4.612  -9.992  2.260   1.00 0.26 ? 51  TRP A H    2  
ATOM   2126  H HA   . TRP A 1 51 ? -4.688  -7.413  1.143   1.00 0.22 ? 51  TRP A HA   2  
ATOM   2127  H HB2  . TRP A 1 51 ? -3.860  -10.068 -0.017  1.00 0.25 ? 51  TRP A HB2  2  
ATOM   2128  H HB3  . TRP A 1 51 ? -3.743  -8.566  -0.924  1.00 0.27 ? 51  TRP A HB3  2  
ATOM   2129  H HD1  . TRP A 1 51 ? -2.833  -7.373  2.302   1.00 0.26 ? 51  TRP A HD1  2  
ATOM   2130  H HE1  . TRP A 1 51 ? -0.288  -7.471  2.723   1.00 0.31 ? 51  TRP A HE1  2  
ATOM   2131  H HE3  . TRP A 1 51 ? -1.518  -10.571 -1.458  1.00 0.31 ? 51  TRP A HE3  2  
ATOM   2132  H HZ2  . TRP A 1 51 ? 1.967   -8.743  1.604   1.00 0.35 ? 51  TRP A HZ2  2  
ATOM   2133  H HZ3  . TRP A 1 51 ? 0.850   -11.179 -1.715  1.00 0.38 ? 51  TRP A HZ3  2  
ATOM   2134  H HH2  . TRP A 1 51 ? 2.557   -10.285 -0.219  1.00 0.39 ? 51  TRP A HH2  2  
ATOM   2135  N N    . ASP A 1 52 ? -6.837  -9.555  -0.103  1.00 0.23 ? 52  ASP A N    2  
ATOM   2136  C CA   . ASP A 1 52 ? -8.032  -9.686  -0.937  1.00 0.27 ? 52  ASP A CA   2  
ATOM   2137  C C    . ASP A 1 52 ? -9.136  -8.706  -0.517  1.00 0.24 ? 52  ASP A C    2  
ATOM   2138  O O    . ASP A 1 52 ? -9.583  -7.912  -1.347  1.00 0.24 ? 52  ASP A O    2  
ATOM   2139  C CB   . ASP A 1 52 ? -8.547  -11.130 -0.945  1.00 0.37 ? 52  ASP A CB   2  
ATOM   2140  C CG   . ASP A 1 52 ? -7.784  -12.002 -1.919  1.00 0.85 ? 52  ASP A CG   2  
ATOM   2141  O OD1  . ASP A 1 52 ? -8.177  -12.066 -3.105  1.00 1.49 ? 52  ASP A OD1  2  
ATOM   2142  O OD2  . ASP A 1 52 ? -6.782  -12.625 -1.506  1.00 1.39 ? 52  ASP A OD2  2  
ATOM   2143  H H    . ASP A 1 52 ? -6.534  -10.325 0.419   1.00 0.27 ? 52  ASP A H    2  
ATOM   2144  H HA   . ASP A 1 52 ? -7.734  -9.432  -1.944  1.00 0.30 ? 52  ASP A HA   2  
ATOM   2145  H HB2  . ASP A 1 52 ? -8.436  -11.552 0.041   1.00 0.74 ? 52  ASP A HB2  2  
ATOM   2146  H HB3  . ASP A 1 52 ? -9.591  -11.136 -1.223  1.00 0.74 ? 52  ASP A HB3  2  
ATOM   2147  N N    . PRO A 1 53 ? -9.600  -8.729  0.763   1.00 0.23 ? 53  PRO A N    2  
ATOM   2148  C CA   . PRO A 1 53 ? -10.642 -7.804  1.228   1.00 0.24 ? 53  PRO A CA   2  
ATOM   2149  C C    . PRO A 1 53 ? -10.274 -6.346  0.975   1.00 0.21 ? 53  PRO A C    2  
ATOM   2150  O O    . PRO A 1 53 ? -11.125 -5.542  0.599   1.00 0.24 ? 53  PRO A O    2  
ATOM   2151  C CB   . PRO A 1 53 ? -10.731 -8.076  2.733   1.00 0.29 ? 53  PRO A CB   2  
ATOM   2152  C CG   . PRO A 1 53 ? -10.222 -9.460  2.905   1.00 0.33 ? 53  PRO A CG   2  
ATOM   2153  C CD   . PRO A 1 53 ? -9.181  -9.657  1.840   1.00 0.28 ? 53  PRO A CD   2  
ATOM   2154  H HA   . PRO A 1 53 ? -11.592 -8.018  0.765   1.00 0.27 ? 53  PRO A HA   2  
ATOM   2155  H HB2  . PRO A 1 53 ? -10.116 -7.365  3.274   1.00 0.34 ? 53  PRO A HB2  2  
ATOM   2156  H HB3  . PRO A 1 53 ? -11.754 -8.012  3.064   1.00 0.34 ? 53  PRO A HB3  2  
ATOM   2157  H HG2  . PRO A 1 53 ? -9.785  -9.572  3.888   1.00 0.41 ? 53  PRO A HG2  2  
ATOM   2158  H HG3  . PRO A 1 53 ? -11.026 -10.166 2.767   1.00 0.44 ? 53  PRO A HG3  2  
ATOM   2159  H HD2  . PRO A 1 53 ? -8.203  -9.395  2.216   1.00 0.29 ? 53  PRO A HD2  2  
ATOM   2160  H HD3  . PRO A 1 53 ? -9.191  -10.677 1.493   1.00 0.34 ? 53  PRO A HD3  2  
ATOM   2161  N N    . ILE A 1 54 ? -9.001  -6.014  1.175   1.00 0.19 ? 54  ILE A N    2  
ATOM   2162  C CA   . ILE A 1 54 ? -8.519  -4.653  0.959   1.00 0.19 ? 54  ILE A CA   2  
ATOM   2163  C C    . ILE A 1 54 ? -8.690  -4.248  -0.500  1.00 0.16 ? 54  ILE A C    2  
ATOM   2164  O O    . ILE A 1 54 ? -9.265  -3.200  -0.800  1.00 0.17 ? 54  ILE A O    2  
ATOM   2165  C CB   . ILE A 1 54 ? -7.036  -4.505  1.359   1.00 0.22 ? 54  ILE A CB   2  
ATOM   2166  C CG1  . ILE A 1 54 ? -6.844  -4.847  2.840   1.00 0.27 ? 54  ILE A CG1  2  
ATOM   2167  C CG2  . ILE A 1 54 ? -6.545  -3.091  1.066   1.00 0.26 ? 54  ILE A CG2  2  
ATOM   2168  C CD1  . ILE A 1 54 ? -5.395  -4.879  3.276   1.00 0.34 ? 54  ILE A CD1  2  
ATOM   2169  H H    . ILE A 1 54 ? -8.371  -6.703  1.477   1.00 0.19 ? 54  ILE A H    2  
ATOM   2170  H HA   . ILE A 1 54 ? -9.106  -3.988  1.575   1.00 0.23 ? 54  ILE A HA   2  
ATOM   2171  H HB   . ILE A 1 54 ? -6.456  -5.190  0.760   1.00 0.21 ? 54  ILE A HB   2  
ATOM   2172  H HG12 . ILE A 1 54 ? -7.356  -4.112  3.443   1.00 0.31 ? 54  ILE A HG12 2  
ATOM   2173  H HG13 . ILE A 1 54 ? -7.269  -5.822  3.033   1.00 0.27 ? 54  ILE A HG13 2  
ATOM   2174  H HG21 . ILE A 1 54 ? -5.548  -2.968  1.460   1.00 0.58 ? 54  ILE A HG21 2  
ATOM   2175  H HG22 . ILE A 1 54 ? -7.208  -2.375  1.530   1.00 0.60 ? 54  ILE A HG22 2  
ATOM   2176  H HG23 . ILE A 1 54 ? -6.533  -2.929  -0.002  1.00 0.58 ? 54  ILE A HG23 2  
ATOM   2177  H HD11 . ILE A 1 54 ? -5.342  -5.046  4.343   1.00 0.71 ? 54  ILE A HD11 2  
ATOM   2178  H HD12 . ILE A 1 54 ? -4.928  -3.938  3.035   1.00 0.68 ? 54  ILE A HD12 2  
ATOM   2179  H HD13 . ILE A 1 54 ? -4.880  -5.678  2.762   1.00 0.71 ? 54  ILE A HD13 2  
ATOM   2180  N N    . THR A 1 55 ? -8.198  -5.089  -1.402  1.00 0.15 ? 55  THR A N    2  
ATOM   2181  C CA   . THR A 1 55 ? -8.299  -4.824  -2.831  1.00 0.17 ? 55  THR A CA   2  
ATOM   2182  C C    . THR A 1 55 ? -9.762  -4.681  -3.251  1.00 0.17 ? 55  THR A C    2  
ATOM   2183  O O    . THR A 1 55 ? -10.116 -3.783  -4.018  1.00 0.19 ? 55  THR A O    2  
ATOM   2184  C CB   . THR A 1 55 ? -7.636  -5.948  -3.650  1.00 0.20 ? 55  THR A CB   2  
ATOM   2185  O OG1  . THR A 1 55 ? -6.360  -6.282  -3.085  1.00 0.20 ? 55  THR A OG1  2  
ATOM   2186  C CG2  . THR A 1 55 ? -7.458  -5.536  -5.106  1.00 0.27 ? 55  THR A CG2  2  
ATOM   2187  H H    . THR A 1 55 ? -7.751  -5.911  -1.098  1.00 0.16 ? 55  THR A H    2  
ATOM   2188  H HA   . THR A 1 55 ? -7.780  -3.898  -3.040  1.00 0.19 ? 55  THR A HA   2  
ATOM   2189  H HB   . THR A 1 55 ? -8.273  -6.818  -3.613  1.00 0.22 ? 55  THR A HB   2  
ATOM   2190  H HG1  . THR A 1 55 ? -6.487  -6.891  -2.346  1.00 0.26 ? 55  THR A HG1  2  
ATOM   2191  H HG21 . THR A 1 55 ? -7.072  -6.371  -5.672  1.00 0.49 ? 55  THR A HG21 2  
ATOM   2192  H HG22 . THR A 1 55 ? -6.767  -4.709  -5.168  1.00 0.48 ? 55  THR A HG22 2  
ATOM   2193  H HG23 . THR A 1 55 ? -8.414  -5.235  -5.513  1.00 0.46 ? 55  THR A HG23 2  
ATOM   2194  N N    . ALA A 1 56 ? -10.608 -5.559  -2.722  1.00 0.18 ? 56  ALA A N    2  
ATOM   2195  C CA   . ALA A 1 56 ? -12.032 -5.534  -3.031  1.00 0.21 ? 56  ALA A CA   2  
ATOM   2196  C C    . ALA A 1 56 ? -12.672 -4.241  -2.542  1.00 0.20 ? 56  ALA A C    2  
ATOM   2197  O O    . ALA A 1 56 ? -13.399 -3.580  -3.282  1.00 0.24 ? 56  ALA A O    2  
ATOM   2198  C CB   . ALA A 1 56 ? -12.725 -6.736  -2.411  1.00 0.25 ? 56  ALA A CB   2  
ATOM   2199  H H    . ALA A 1 56 ? -10.261 -6.247  -2.110  1.00 0.18 ? 56  ALA A H    2  
ATOM   2200  H HA   . ALA A 1 56 ? -12.142 -5.595  -4.104  1.00 0.23 ? 56  ALA A HA   2  
ATOM   2201  H HB1  . ALA A 1 56 ? -12.617 -6.700  -1.338  1.00 0.42 ? 56  ALA A HB1  2  
ATOM   2202  H HB2  . ALA A 1 56 ? -12.278 -7.643  -2.790  1.00 0.43 ? 56  ALA A HB2  2  
ATOM   2203  H HB3  . ALA A 1 56 ? -13.774 -6.717  -2.666  1.00 0.43 ? 56  ALA A HB3  2  
ATOM   2204  N N    . ALA A 1 57 ? -12.376 -3.876  -1.300  1.00 0.19 ? 57  ALA A N    2  
ATOM   2205  C CA   . ALA A 1 57 ? -12.917 -2.664  -0.703  1.00 0.20 ? 57  ALA A CA   2  
ATOM   2206  C C    . ALA A 1 57 ? -12.490 -1.426  -1.480  1.00 0.19 ? 57  ALA A C    2  
ATOM   2207  O O    . ALA A 1 57 ? -13.313 -0.565  -1.791  1.00 0.22 ? 57  ALA A O    2  
ATOM   2208  C CB   . ALA A 1 57 ? -12.475 -2.552  0.747   1.00 0.23 ? 57  ALA A CB   2  
ATOM   2209  H H    . ALA A 1 57 ? -11.778 -4.445  -0.764  1.00 0.20 ? 57  ALA A H    2  
ATOM   2210  H HA   . ALA A 1 57 ? -13.996 -2.734  -0.723  1.00 0.23 ? 57  ALA A HA   2  
ATOM   2211  H HB1  . ALA A 1 57 ? -12.878 -3.380  1.310   1.00 0.41 ? 57  ALA A HB1  2  
ATOM   2212  H HB2  . ALA A 1 57 ? -12.835 -1.623  1.162   1.00 0.39 ? 57  ALA A HB2  2  
ATOM   2213  H HB3  . ALA A 1 57 ? -11.395 -2.574  0.796   1.00 0.38 ? 57  ALA A HB3  2  
ATOM   2214  N N    . LEU A 1 58 ? -11.204 -1.353  -1.802  1.00 0.18 ? 58  LEU A N    2  
ATOM   2215  C CA   . LEU A 1 58 ? -10.665 -0.218  -2.536  1.00 0.19 ? 58  LEU A CA   2  
ATOM   2216  C C    . LEU A 1 58 ? -11.251 -0.132  -3.939  1.00 0.20 ? 58  LEU A C    2  
ATOM   2217  O O    . LEU A 1 58 ? -11.682 0.938   -4.363  1.00 0.24 ? 58  LEU A O    2  
ATOM   2218  C CB   . LEU A 1 58 ? -9.140  -0.290  -2.589  1.00 0.21 ? 58  LEU A CB   2  
ATOM   2219  C CG   . LEU A 1 58 ? -8.445  -0.068  -1.244  1.00 0.37 ? 58  LEU A CG   2  
ATOM   2220  C CD1  . LEU A 1 58 ? -6.943  -0.201  -1.392  1.00 0.35 ? 58  LEU A CD1  2  
ATOM   2221  C CD2  . LEU A 1 58 ? -8.801  1.295   -0.668  1.00 0.73 ? 58  LEU A CD2  2  
ATOM   2222  H H    . LEU A 1 58 ? -10.598 -2.084  -1.533  1.00 0.19 ? 58  LEU A H    2  
ATOM   2223  H HA   . LEU A 1 58 ? -10.948 0.674   -1.999  1.00 0.20 ? 58  LEU A HA   2  
ATOM   2224  H HB2  . LEU A 1 58 ? -8.857  -1.266  -2.962  1.00 0.31 ? 58  LEU A HB2  2  
ATOM   2225  H HB3  . LEU A 1 58 ? -8.790  0.459   -3.281  1.00 0.39 ? 58  LEU A HB3  2  
ATOM   2226  H HG   . LEU A 1 58 ? -8.778  -0.824  -0.548  1.00 0.55 ? 58  LEU A HG   2  
ATOM   2227  H HD11 . LEU A 1 58 ? -6.472  -0.052  -0.433  1.00 0.71 ? 58  LEU A HD11 2  
ATOM   2228  H HD12 . LEU A 1 58 ? -6.583  0.540   -2.090  1.00 0.67 ? 58  LEU A HD12 2  
ATOM   2229  H HD13 . LEU A 1 58 ? -6.704  -1.188  -1.760  1.00 0.64 ? 58  LEU A HD13 2  
ATOM   2230  H HD21 . LEU A 1 58 ? -8.205  1.481   0.213   1.00 1.19 ? 58  LEU A HD21 2  
ATOM   2231  H HD22 . LEU A 1 58 ? -9.846  1.312   -0.403  1.00 1.00 ? 58  LEU A HD22 2  
ATOM   2232  H HD23 . LEU A 1 58 ? -8.604  2.060   -1.405  1.00 1.19 ? 58  LEU A HD23 2  
ATOM   2233  N N    . SER A 1 59 ? -11.281 -1.251  -4.653  1.00 0.20 ? 59  SER A N    2  
ATOM   2234  C CA   . SER A 1 59 ? -11.838 -1.271  -5.999  1.00 0.23 ? 59  SER A CA   2  
ATOM   2235  C C    . SER A 1 59 ? -13.322 -0.916  -5.965  1.00 0.23 ? 59  SER A C    2  
ATOM   2236  O O    . SER A 1 59 ? -13.833 -0.254  -6.869  1.00 0.25 ? 59  SER A O    2  
ATOM   2237  C CB   . SER A 1 59 ? -11.634 -2.641  -6.653  1.00 0.29 ? 59  SER A CB   2  
ATOM   2238  O OG   . SER A 1 59 ? -10.357 -2.730  -7.261  1.00 0.85 ? 59  SER A OG   2  
ATOM   2239  H H    . SER A 1 59 ? -10.917 -2.081  -4.268  1.00 0.21 ? 59  SER A H    2  
ATOM   2240  H HA   . SER A 1 59 ? -11.317 -0.524  -6.580  1.00 0.25 ? 59  SER A HA   2  
ATOM   2241  H HB2  . SER A 1 59 ? -11.716 -3.415  -5.902  1.00 0.65 ? 59  SER A HB2  2  
ATOM   2242  H HB3  . SER A 1 59 ? -12.389 -2.791  -7.409  1.00 0.73 ? 59  SER A HB3  2  
ATOM   2243  H HG   . SER A 1 59 ? -10.067 -3.650  -7.266  1.00 1.33 ? 59  SER A HG   2  
ATOM   2244  N N    . GLN A 1 60 ? -14.004 -1.348  -4.909  1.00 0.24 ? 60  GLN A N    2  
ATOM   2245  C CA   . GLN A 1 60 ? -15.423 -1.072  -4.745  1.00 0.28 ? 60  GLN A CA   2  
ATOM   2246  C C    . GLN A 1 60 ? -15.677 0.431   -4.688  1.00 0.26 ? 60  GLN A C    2  
ATOM   2247  O O    . GLN A 1 60 ? -16.364 0.985   -5.545  1.00 0.29 ? 60  GLN A O    2  
ATOM   2248  C CB   . GLN A 1 60 ? -15.953 -1.740  -3.476  1.00 0.34 ? 60  GLN A CB   2  
ATOM   2249  C CG   . GLN A 1 60 ? -17.458 -1.613  -3.301  1.00 0.50 ? 60  GLN A CG   2  
ATOM   2250  C CD   . GLN A 1 60 ? -17.942 -2.094  -1.946  1.00 0.63 ? 60  GLN A CD   2  
ATOM   2251  O OE1  . GLN A 1 60 ? -19.047 -2.627  -1.825  1.00 0.92 ? 60  GLN A OE1  2  
ATOM   2252  N NE2  . GLN A 1 60 ? -17.137 -1.890  -0.913  1.00 0.77 ? 60  GLN A NE2  2  
ATOM   2253  H H    . GLN A 1 60 ? -13.539 -1.879  -4.224  1.00 0.25 ? 60  GLN A H    2  
ATOM   2254  H HA   . GLN A 1 60 ? -15.941 -1.479  -5.601  1.00 0.31 ? 60  GLN A HA   2  
ATOM   2255  H HB2  . GLN A 1 60 ? -15.705 -2.791  -3.509  1.00 0.45 ? 60  GLN A HB2  2  
ATOM   2256  H HB3  . GLN A 1 60 ? -15.471 -1.292  -2.619  1.00 0.42 ? 60  GLN A HB3  2  
ATOM   2257  H HG2  . GLN A 1 60 ? -17.733 -0.575  -3.415  1.00 0.61 ? 60  GLN A HG2  2  
ATOM   2258  H HG3  . GLN A 1 60 ? -17.947 -2.198  -4.068  1.00 0.63 ? 60  GLN A HG3  2  
ATOM   2259  H HE21 . GLN A 1 60 ? -16.279 -1.444  -1.074  1.00 0.92 ? 60  GLN A HE21 2  
ATOM   2260  H HE22 . GLN A 1 60 ? -17.429 -2.200  -0.028  1.00 0.90 ? 60  GLN A HE22 2  
ATOM   2261  N N    . ARG A 1 61 ? -15.092 1.094   -3.695  1.00 0.29 ? 61  ARG A N    2  
ATOM   2262  C CA   . ARG A 1 61 ? -15.271 2.533   -3.534  1.00 0.34 ? 61  ARG A CA   2  
ATOM   2263  C C    . ARG A 1 61 ? -14.727 3.293   -4.739  1.00 0.30 ? 61  ARG A C    2  
ATOM   2264  O O    . ARG A 1 61 ? -15.279 4.317   -5.131  1.00 0.34 ? 61  ARG A O    2  
ATOM   2265  C CB   . ARG A 1 61 ? -14.601 3.032   -2.248  1.00 0.45 ? 61  ARG A CB   2  
ATOM   2266  C CG   . ARG A 1 61 ? -13.136 2.641   -2.117  1.00 0.65 ? 61  ARG A CG   2  
ATOM   2267  C CD   . ARG A 1 61 ? -12.571 3.028   -0.760  1.00 0.67 ? 61  ARG A CD   2  
ATOM   2268  N NE   . ARG A 1 61 ? -12.218 4.447   -0.688  1.00 0.81 ? 61  ARG A NE   2  
ATOM   2269  C CZ   . ARG A 1 61 ? -12.720 5.299   0.208   1.00 1.09 ? 61  ARG A CZ   2  
ATOM   2270  N NH1  . ARG A 1 61 ? -13.598 4.885   1.115   1.00 1.47 ? 61  ARG A NH1  2  
ATOM   2271  N NH2  . ARG A 1 61 ? -12.301 6.561   0.219   1.00 1.42 ? 61  ARG A NH2  2  
ATOM   2272  H H    . ARG A 1 61 ? -14.528 0.604   -3.055  1.00 0.30 ? 61  ARG A H    2  
ATOM   2273  H HA   . ARG A 1 61 ? -16.331 2.721   -3.464  1.00 0.40 ? 61  ARG A HA   2  
ATOM   2274  H HB2  . ARG A 1 61 ? -14.663 4.108   -2.220  1.00 0.72 ? 61  ARG A HB2  2  
ATOM   2275  H HB3  . ARG A 1 61 ? -15.135 2.630   -1.401  1.00 0.82 ? 61  ARG A HB3  2  
ATOM   2276  H HG2  . ARG A 1 61 ? -13.046 1.573   -2.241  1.00 1.08 ? 61  ARG A HG2  2  
ATOM   2277  H HG3  . ARG A 1 61 ? -12.571 3.141   -2.889  1.00 1.01 ? 61  ARG A HG3  2  
ATOM   2278  H HD2  . ARG A 1 61 ? -13.308 2.812   -0.004  1.00 0.88 ? 61  ARG A HD2  2  
ATOM   2279  H HD3  . ARG A 1 61 ? -11.683 2.439   -0.572  1.00 0.79 ? 61  ARG A HD3  2  
ATOM   2280  H HE   . ARG A 1 61 ? -11.579 4.787   -1.358  1.00 1.11 ? 61  ARG A HE   2  
ATOM   2281  H HH11 . ARG A 1 61 ? -13.973 5.530   1.786   1.00 1.93 ? 61  ARG A HH11 2  
ATOM   2282  H HH12 . ARG A 1 61 ? -13.891 3.929   1.133   1.00 1.47 ? 61  ARG A HH12 2  
ATOM   2283  H HH21 . ARG A 1 61 ? -11.605 6.871   -0.449  1.00 1.53 ? 61  ARG A HH21 2  
ATOM   2284  H HH22 . ARG A 1 61 ? -12.672 7.214   0.888   1.00 1.76 ? 61  ARG A HH22 2  
ATOM   2285  N N    . ALA A 1 62 ? -13.662 2.774   -5.337  1.00 0.27 ? 62  ALA A N    2  
ATOM   2286  C CA   . ALA A 1 62 ? -13.047 3.406   -6.497  1.00 0.29 ? 62  ALA A CA   2  
ATOM   2287  C C    . ALA A 1 62 ? -14.004 3.461   -7.682  1.00 0.30 ? 62  ALA A C    2  
ATOM   2288  O O    . ALA A 1 62 ? -14.168 4.510   -8.305  1.00 0.41 ? 62  ALA A O    2  
ATOM   2289  C CB   . ALA A 1 62 ? -11.767 2.685   -6.891  1.00 0.31 ? 62  ALA A CB   2  
ATOM   2290  H H    . ALA A 1 62 ? -13.271 1.944   -4.981  1.00 0.26 ? 62  ALA A H    2  
ATOM   2291  H HA   . ALA A 1 62 ? -12.785 4.416   -6.219  1.00 0.34 ? 62  ALA A HA   2  
ATOM   2292  H HB1  . ALA A 1 62 ? -12.003 1.683   -7.222  1.00 0.40 ? 62  ALA A HB1  2  
ATOM   2293  H HB2  . ALA A 1 62 ? -11.104 2.636   -6.039  1.00 0.44 ? 62  ALA A HB2  2  
ATOM   2294  H HB3  . ALA A 1 62 ? -11.283 3.223   -7.692  1.00 0.46 ? 62  ALA A HB3  2  
ATOM   2295  N N    . MET A 1 63 ? -14.645 2.338   -7.988  1.00 0.26 ? 63  MET A N    2  
ATOM   2296  C CA   . MET A 1 63 ? -15.572 2.279   -9.117  1.00 0.32 ? 63  MET A CA   2  
ATOM   2297  C C    . MET A 1 63 ? -16.904 2.959   -8.792  1.00 0.32 ? 63  MET A C    2  
ATOM   2298  O O    . MET A 1 63 ? -17.608 3.414   -9.692  1.00 0.42 ? 63  MET A O    2  
ATOM   2299  C CB   . MET A 1 63 ? -15.802 0.827   -9.569  1.00 0.37 ? 63  MET A CB   2  
ATOM   2300  C CG   . MET A 1 63 ? -16.653 -0.002  -8.620  1.00 0.38 ? 63  MET A CG   2  
ATOM   2301  S SD   . MET A 1 63 ? -16.891 -1.695  -9.202  1.00 0.50 ? 63  MET A SD   2  
ATOM   2302  C CE   . MET A 1 63 ? -15.237 -2.359  -9.024  1.00 0.71 ? 63  MET A CE   2  
ATOM   2303  H H    . MET A 1 63 ? -14.486 1.530   -7.448  1.00 0.27 ? 63  MET A H    2  
ATOM   2304  H HA   . MET A 1 63 ? -15.113 2.820   -9.930  1.00 0.36 ? 63  MET A HA   2  
ATOM   2305  H HB2  . MET A 1 63 ? -16.292 0.837   -10.531 1.00 0.43 ? 63  MET A HB2  2  
ATOM   2306  H HB3  . MET A 1 63 ? -14.843 0.341   -9.673  1.00 0.42 ? 63  MET A HB3  2  
ATOM   2307  H HG2  . MET A 1 63 ? -16.167 -0.034  -7.656  1.00 0.38 ? 63  MET A HG2  2  
ATOM   2308  H HG3  . MET A 1 63 ? -17.619 0.469   -8.519  1.00 0.39 ? 63  MET A HG3  2  
ATOM   2309  H HE1  . MET A 1 63 ? -14.558 -1.813  -9.662  1.00 0.96 ? 63  MET A HE1  2  
ATOM   2310  H HE2  . MET A 1 63 ? -15.238 -3.401  -9.305  1.00 0.93 ? 63  MET A HE2  2  
ATOM   2311  H HE3  . MET A 1 63 ? -14.920 -2.263  -7.996  1.00 0.95 ? 63  MET A HE3  2  
ATOM   2312  N N    . ILE A 1 64 ? -17.240 3.038   -7.509  1.00 0.28 ? 64  ILE A N    2  
ATOM   2313  C CA   . ILE A 1 64 ? -18.488 3.668   -7.087  1.00 0.31 ? 64  ILE A CA   2  
ATOM   2314  C C    . ILE A 1 64 ? -18.345 5.189   -7.035  1.00 0.31 ? 64  ILE A C    2  
ATOM   2315  O O    . ILE A 1 64 ? -19.179 5.920   -7.572  1.00 0.37 ? 64  ILE A O    2  
ATOM   2316  C CB   . ILE A 1 64 ? -18.951 3.147   -5.704  1.00 0.35 ? 64  ILE A CB   2  
ATOM   2317  C CG1  . ILE A 1 64 ? -19.357 1.675   -5.802  1.00 0.38 ? 64  ILE A CG1  2  
ATOM   2318  C CG2  . ILE A 1 64 ? -20.109 3.981   -5.167  1.00 0.43 ? 64  ILE A CG2  2  
ATOM   2319  C CD1  . ILE A 1 64 ? -19.714 1.055   -4.469  1.00 0.46 ? 64  ILE A CD1  2  
ATOM   2320  H H    . ILE A 1 64 ? -16.640 2.659   -6.832  1.00 0.29 ? 64  ILE A H    2  
ATOM   2321  H HA   . ILE A 1 64 ? -19.247 3.414   -7.814  1.00 0.35 ? 64  ILE A HA   2  
ATOM   2322  H HB   . ILE A 1 64 ? -18.124 3.239   -5.017  1.00 0.34 ? 64  ILE A HB   2  
ATOM   2323  H HG12 . ILE A 1 64 ? -20.218 1.587   -6.448  1.00 0.44 ? 64  ILE A HG12 2  
ATOM   2324  H HG13 . ILE A 1 64 ? -18.537 1.109   -6.221  1.00 0.36 ? 64  ILE A HG13 2  
ATOM   2325  H HG21 . ILE A 1 64 ? -20.446 3.563   -4.229  1.00 0.59 ? 64  ILE A HG21 2  
ATOM   2326  H HG22 . ILE A 1 64 ? -20.921 3.973   -5.879  1.00 0.58 ? 64  ILE A HG22 2  
ATOM   2327  H HG23 . ILE A 1 64 ? -19.780 4.997   -5.010  1.00 0.58 ? 64  ILE A HG23 2  
ATOM   2328  H HD11 . ILE A 1 64 ? -20.606 1.524   -4.079  1.00 0.62 ? 64  ILE A HD11 2  
ATOM   2329  H HD12 . ILE A 1 64 ? -18.899 1.198   -3.775  1.00 0.57 ? 64  ILE A HD12 2  
ATOM   2330  H HD13 . ILE A 1 64 ? -19.892 -0.003  -4.600  1.00 0.59 ? 64  ILE A HD13 2  
ATOM   2331  N N    . LEU A 1 65 ? -17.279 5.659   -6.394  1.00 0.29 ? 65  LEU A N    2  
ATOM   2332  C CA   . LEU A 1 65 ? -17.030 7.092   -6.261  1.00 0.33 ? 65  LEU A CA   2  
ATOM   2333  C C    . LEU A 1 65 ? -16.504 7.683   -7.561  1.00 0.34 ? 65  LEU A C    2  
ATOM   2334  O O    . LEU A 1 65 ? -16.804 8.831   -7.900  1.00 0.47 ? 65  LEU A O    2  
ATOM   2335  C CB   . LEU A 1 65 ? -16.038 7.367   -5.127  1.00 0.40 ? 65  LEU A CB   2  
ATOM   2336  C CG   . LEU A 1 65 ? -16.664 7.627   -3.754  1.00 0.93 ? 65  LEU A CG   2  
ATOM   2337  C CD1  . LEU A 1 65 ? -17.340 6.374   -3.220  1.00 1.61 ? 65  LEU A CD1  2  
ATOM   2338  C CD2  . LEU A 1 65 ? -15.607 8.117   -2.778  1.00 0.99 ? 65  LEU A CD2  2  
ATOM   2339  H H    . LEU A 1 65 ? -16.640 5.024   -5.993  1.00 0.30 ? 65  LEU A H    2  
ATOM   2340  H HA   . LEU A 1 65 ? -17.969 7.565   -6.024  1.00 0.39 ? 65  LEU A HA   2  
ATOM   2341  H HB2  . LEU A 1 65 ? -15.378 6.517   -5.043  1.00 0.77 ? 65  LEU A HB2  2  
ATOM   2342  H HB3  . LEU A 1 65 ? -15.447 8.231   -5.395  1.00 0.73 ? 65  LEU A HB3  2  
ATOM   2343  H HG   . LEU A 1 65 ? -17.415 8.397   -3.848  1.00 1.40 ? 65  LEU A HG   2  
ATOM   2344  H HD11 . LEU A 1 65 ? -16.599 5.604   -3.066  1.00 1.79 ? 65  LEU A HD11 2  
ATOM   2345  H HD12 . LEU A 1 65 ? -18.074 6.030   -3.933  1.00 1.94 ? 65  LEU A HD12 2  
ATOM   2346  H HD13 . LEU A 1 65 ? -17.826 6.600   -2.283  1.00 2.09 ? 65  LEU A HD13 2  
ATOM   2347  H HD21 . LEU A 1 65 ? -15.160 9.024   -3.158  1.00 1.31 ? 65  LEU A HD21 2  
ATOM   2348  H HD22 . LEU A 1 65 ? -14.845 7.360   -2.664  1.00 1.14 ? 65  LEU A HD22 2  
ATOM   2349  H HD23 . LEU A 1 65 ? -16.064 8.314   -1.821  1.00 1.50 ? 65  LEU A HD23 2  
ATOM   2350  N N    . GLY A 1 66 ? -15.718 6.900   -8.285  1.00 0.30 ? 66  GLY A N    2  
ATOM   2351  C CA   . GLY A 1 66 ? -15.170 7.365   -9.542  1.00 0.36 ? 66  GLY A CA   2  
ATOM   2352  C C    . GLY A 1 66 ? -13.742 7.856   -9.410  1.00 0.43 ? 66  GLY A C    2  
ATOM   2353  O O    . GLY A 1 66 ? -13.270 8.647   -10.227 1.00 0.81 ? 66  GLY A O    2  
ATOM   2354  H H    . GLY A 1 66 ? -15.516 5.993   -7.968  1.00 0.33 ? 66  GLY A H    2  
ATOM   2355  H HA2  . GLY A 1 66 ? -15.196 6.554   -10.255 1.00 0.40 ? 66  GLY A HA2  2  
ATOM   2356  H HA3  . GLY A 1 66 ? -15.784 8.173   -9.910  1.00 0.41 ? 66  GLY A HA3  2  
ATOM   2357  N N    . LYS A 1 67 ? -13.046 7.393   -8.381  1.00 0.43 ? 67  LYS A N    2  
ATOM   2358  C CA   . LYS A 1 67 ? -11.664 7.792   -8.164  1.00 0.47 ? 67  LYS A CA   2  
ATOM   2359  C C    . LYS A 1 67 ? -10.855 6.639   -7.580  1.00 0.35 ? 67  LYS A C    2  
ATOM   2360  O O    . LYS A 1 67 ? -11.262 6.009   -6.602  1.00 0.44 ? 67  LYS A O    2  
ATOM   2361  C CB   . LYS A 1 67 ? -11.583 9.033   -7.259  1.00 0.65 ? 67  LYS A CB   2  
ATOM   2362  C CG   . LYS A 1 67 ? -12.183 8.847   -5.871  1.00 0.74 ? 67  LYS A CG   2  
ATOM   2363  C CD   . LYS A 1 67 ? -11.109 8.878   -4.790  1.00 1.10 ? 67  LYS A CD   2  
ATOM   2364  C CE   . LYS A 1 67 ? -11.677 9.300   -3.444  1.00 1.28 ? 67  LYS A CE   2  
ATOM   2365  N NZ   . LYS A 1 67 ? -11.871 10.774  -3.359  1.00 1.52 ? 67  LYS A NZ   2  
ATOM   2366  H H    . LYS A 1 67 ? -13.464 6.755   -7.765  1.00 0.69 ? 67  LYS A H    2  
ATOM   2367  H HA   . LYS A 1 67 ? -11.250 8.041   -9.130  1.00 0.55 ? 67  LYS A HA   2  
ATOM   2368  H HB2  . LYS A 1 67 ? -10.545 9.305   -7.140  1.00 0.82 ? 67  LYS A HB2  2  
ATOM   2369  H HB3  . LYS A 1 67 ? -12.102 9.848   -7.743  1.00 0.78 ? 67  LYS A HB3  2  
ATOM   2370  H HG2  . LYS A 1 67 ? -12.892 9.639   -5.686  1.00 0.86 ? 67  LYS A HG2  2  
ATOM   2371  H HG3  . LYS A 1 67 ? -12.687 7.893   -5.835  1.00 0.86 ? 67  LYS A HG3  2  
ATOM   2372  H HD2  . LYS A 1 67 ? -10.679 7.892   -4.694  1.00 1.44 ? 67  LYS A HD2  2  
ATOM   2373  H HD3  . LYS A 1 67 ? -10.340 9.579   -5.080  1.00 1.29 ? 67  LYS A HD3  2  
ATOM   2374  H HE2  . LYS A 1 67 ? -12.630 8.814   -3.300  1.00 1.52 ? 67  LYS A HE2  2  
ATOM   2375  H HE3  . LYS A 1 67 ? -10.996 8.992   -2.665  1.00 1.71 ? 67  LYS A HE3  2  
ATOM   2376  H HZ1  . LYS A 1 67 ? -12.364 11.020  -2.478  1.00 1.85 ? 67  LYS A HZ1  2  
ATOM   2377  H HZ2  . LYS A 1 67 ? -12.435 11.108  -4.163  1.00 1.82 ? 67  LYS A HZ2  2  
ATOM   2378  H HZ3  . LYS A 1 67 ? -10.950 11.260  -3.374  1.00 1.90 ? 67  LYS A HZ3  2  
ATOM   2379  N N    . SER A 1 68 ? -9.713  6.366   -8.194  1.00 0.30 ? 68  SER A N    2  
ATOM   2380  C CA   . SER A 1 68 ? -8.835  5.289   -7.755  1.00 0.32 ? 68  SER A CA   2  
ATOM   2381  C C    . SER A 1 68 ? -7.651  5.841   -6.964  1.00 0.28 ? 68  SER A C    2  
ATOM   2382  O O    . SER A 1 68 ? -6.558  5.266   -6.978  1.00 0.33 ? 68  SER A O    2  
ATOM   2383  C CB   . SER A 1 68 ? -8.337  4.500   -8.968  1.00 0.46 ? 68  SER A CB   2  
ATOM   2384  O OG   . SER A 1 68 ? -9.291  4.520   -10.017 1.00 0.91 ? 68  SER A OG   2  
ATOM   2385  H H    . SER A 1 68 ? -9.449  6.906   -8.972  1.00 0.38 ? 68  SER A H    2  
ATOM   2386  H HA   . SER A 1 68 ? -9.405  4.631   -7.116  1.00 0.38 ? 68  SER A HA   2  
ATOM   2387  H HB2  . SER A 1 68 ? -7.419  4.936   -9.327  1.00 0.76 ? 68  SER A HB2  2  
ATOM   2388  H HB3  . SER A 1 68 ? -8.159  3.474   -8.679  1.00 0.77 ? 68  SER A HB3  2  
ATOM   2389  H HG   . SER A 1 68 ? -10.152 4.781   -9.664  1.00 1.45 ? 68  SER A HG   2  
ATOM   2390  N N    . GLY A 1 69 ? -7.887  6.939   -6.250  1.00 0.29 ? 69  GLY A N    2  
ATOM   2391  C CA   . GLY A 1 69 ? -6.839  7.570   -5.466  1.00 0.35 ? 69  GLY A CA   2  
ATOM   2392  C C    . GLY A 1 69 ? -6.212  6.637   -4.447  1.00 0.32 ? 69  GLY A C    2  
ATOM   2393  O O    . GLY A 1 69 ? -5.013  6.716   -4.184  1.00 0.41 ? 69  GLY A O    2  
ATOM   2394  H H    . GLY A 1 69 ? -8.787  7.326   -6.252  1.00 0.33 ? 69  GLY A H    2  
ATOM   2395  H HA2  . GLY A 1 69 ? -6.068  7.920   -6.136  1.00 0.40 ? 69  GLY A HA2  2  
ATOM   2396  H HA3  . GLY A 1 69 ? -7.260  8.420   -4.948  1.00 0.42 ? 69  GLY A HA3  2  
ATOM   2397  N N    . GLU A 1 70 ? -7.020  5.760   -3.869  1.00 0.34 ? 70  GLU A N    2  
ATOM   2398  C CA   . GLU A 1 70 ? -6.530  4.811   -2.879  1.00 0.38 ? 70  GLU A CA   2  
ATOM   2399  C C    . GLU A 1 70 ? -6.241  3.455   -3.518  1.00 0.32 ? 70  GLU A C    2  
ATOM   2400  O O    . GLU A 1 70 ? -5.669  2.567   -2.887  1.00 0.39 ? 70  GLU A O    2  
ATOM   2401  C CB   . GLU A 1 70 ? -7.557  4.642   -1.757  1.00 0.52 ? 70  GLU A CB   2  
ATOM   2402  C CG   . GLU A 1 70 ? -8.084  5.960   -1.207  1.00 0.66 ? 70  GLU A CG   2  
ATOM   2403  C CD   . GLU A 1 70 ? -9.392  6.390   -1.844  1.00 0.70 ? 70  GLU A CD   2  
ATOM   2404  O OE1  . GLU A 1 70 ? -10.133 7.170   -1.210  1.00 1.24 ? 70  GLU A OE1  2  
ATOM   2405  O OE2  . GLU A 1 70 ? -9.684  5.953   -2.979  1.00 1.08 ? 70  GLU A OE2  2  
ATOM   2406  H H    . GLU A 1 70 ? -7.981  5.764   -4.094  1.00 0.40 ? 70  GLU A H    2  
ATOM   2407  H HA   . GLU A 1 70 ? -5.614  5.206   -2.463  1.00 0.42 ? 70  GLU A HA   2  
ATOM   2408  H HB2  . GLU A 1 70 ? -8.395  4.076   -2.135  1.00 0.52 ? 70  GLU A HB2  2  
ATOM   2409  H HB3  . GLU A 1 70 ? -7.100  4.095   -0.946  1.00 0.64 ? 70  GLU A HB3  2  
ATOM   2410  H HG2  . GLU A 1 70 ? -8.239  5.852   -0.144  1.00 0.80 ? 70  GLU A HG2  2  
ATOM   2411  H HG3  . GLU A 1 70 ? -7.345  6.727   -1.384  1.00 0.82 ? 70  GLU A HG3  2  
ATOM   2412  N N    . LEU A 1 71 ? -6.619  3.312   -4.781  1.00 0.28 ? 71  LEU A N    2  
ATOM   2413  C CA   . LEU A 1 71 ? -6.424  2.055   -5.495  1.00 0.28 ? 71  LEU A CA   2  
ATOM   2414  C C    . LEU A 1 71 ? -5.033  1.970   -6.120  1.00 0.26 ? 71  LEU A C    2  
ATOM   2415  O O    . LEU A 1 71 ? -4.350  0.956   -5.977  1.00 0.30 ? 71  LEU A O    2  
ATOM   2416  C CB   . LEU A 1 71 ? -7.480  1.887   -6.586  1.00 0.34 ? 71  LEU A CB   2  
ATOM   2417  C CG   . LEU A 1 71 ? -8.234  0.550   -6.579  1.00 0.58 ? 71  LEU A CG   2  
ATOM   2418  C CD1  . LEU A 1 71 ? -9.030  0.387   -7.860  1.00 0.89 ? 71  LEU A CD1  2  
ATOM   2419  C CD2  . LEU A 1 71 ? -7.280  -0.626  -6.398  1.00 1.43 ? 71  LEU A CD2  2  
ATOM   2420  H H    . LEU A 1 71 ? -7.023  4.073   -5.248  1.00 0.34 ? 71  LEU A H    2  
ATOM   2421  H HA   . LEU A 1 71 ? -6.533  1.255   -4.780  1.00 0.33 ? 71  LEU A HA   2  
ATOM   2422  H HB2  . LEU A 1 71 ? -8.204  2.682   -6.481  1.00 0.54 ? 71  LEU A HB2  2  
ATOM   2423  H HB3  . LEU A 1 71 ? -6.991  1.995   -7.542  1.00 0.61 ? 71  LEU A HB3  2  
ATOM   2424  H HG   . LEU A 1 71 ? -8.929  0.546   -5.754  1.00 1.35 ? 71  LEU A HG   2  
ATOM   2425  H HD11 . LEU A 1 71 ? -9.773  1.170   -7.923  1.00 1.64 ? 71  LEU A HD11 2  
ATOM   2426  H HD12 . LEU A 1 71 ? -9.517  -0.575  -7.859  1.00 1.06 ? 71  LEU A HD12 2  
ATOM   2427  H HD13 . LEU A 1 71 ? -8.364  0.453   -8.707  1.00 1.33 ? 71  LEU A HD13 2  
ATOM   2428  H HD21 . LEU A 1 71 ? -6.897  -0.625  -5.388  1.00 2.09 ? 71  LEU A HD21 2  
ATOM   2429  H HD22 . LEU A 1 71 ? -6.459  -0.535  -7.094  1.00 1.87 ? 71  LEU A HD22 2  
ATOM   2430  H HD23 . LEU A 1 71 ? -7.809  -1.548  -6.583  1.00 1.71 ? 71  LEU A HD23 2  
ATOM   2431  N N    . LYS A 1 72 ? -4.627  3.034   -6.817  1.00 0.26 ? 72  LYS A N    2  
ATOM   2432  C CA   . LYS A 1 72 ? -3.315  3.078   -7.476  1.00 0.30 ? 72  LYS A CA   2  
ATOM   2433  C C    . LYS A 1 72 ? -2.198  2.791   -6.486  1.00 0.27 ? 72  LYS A C    2  
ATOM   2434  O O    . LYS A 1 72 ? -1.291  1.999   -6.758  1.00 0.33 ? 72  LYS A O    2  
ATOM   2435  C CB   . LYS A 1 72 ? -3.072  4.443   -8.123  1.00 0.39 ? 72  LYS A CB   2  
ATOM   2436  C CG   . LYS A 1 72 ? -3.948  4.720   -9.332  1.00 0.50 ? 72  LYS A CG   2  
ATOM   2437  C CD   . LYS A 1 72 ? -3.367  5.830   -10.193 1.00 0.74 ? 72  LYS A CD   2  
ATOM   2438  C CE   . LYS A 1 72 ? -3.300  7.147   -9.440  1.00 1.11 ? 72  LYS A CE   2  
ATOM   2439  N NZ   . LYS A 1 72 ? -2.271  8.057   -10.006 1.00 1.44 ? 72  LYS A NZ   2  
ATOM   2440  H H    . LYS A 1 72 ? -5.226  3.810   -6.891  1.00 0.28 ? 72  LYS A H    2  
ATOM   2441  H HA   . LYS A 1 72 ? -3.302  2.321   -8.244  1.00 0.35 ? 72  LYS A HA   2  
ATOM   2442  H HB2  . LYS A 1 72 ? -3.260  5.212   -7.390  1.00 0.45 ? 72  LYS A HB2  2  
ATOM   2443  H HB3  . LYS A 1 72 ? -2.040  4.501   -8.434  1.00 0.49 ? 72  LYS A HB3  2  
ATOM   2444  H HG2  . LYS A 1 72 ? -4.023  3.823   -9.924  1.00 0.76 ? 72  LYS A HG2  2  
ATOM   2445  H HG3  . LYS A 1 72 ? -4.930  5.017   -8.994  1.00 0.74 ? 72  LYS A HG3  2  
ATOM   2446  H HD2  . LYS A 1 72 ? -2.370  5.552   -10.501 1.00 0.98 ? 72  LYS A HD2  2  
ATOM   2447  H HD3  . LYS A 1 72 ? -3.992  5.956   -11.065 1.00 0.88 ? 72  LYS A HD3  2  
ATOM   2448  H HE2  . LYS A 1 72 ? -4.265  7.632   -9.493  1.00 1.39 ? 72  LYS A HE2  2  
ATOM   2449  H HE3  . LYS A 1 72 ? -3.060  6.941   -8.410  1.00 1.42 ? 72  LYS A HE3  2  
ATOM   2450  H HZ1  . LYS A 1 72 ? -2.475  8.250   -11.007 1.00 1.73 ? 72  LYS A HZ1  2  
ATOM   2451  H HZ2  . LYS A 1 72 ? -1.329  7.624   -9.935  1.00 1.79 ? 72  LYS A HZ2  2  
ATOM   2452  H HZ3  . LYS A 1 72 ? -2.262  8.958   -9.486  1.00 1.75 ? 72  LYS A HZ3  2  
ATOM   2453  N N    . THR A 1 73 ? -2.281  3.438   -5.336  1.00 0.23 ? 73  THR A N    2  
ATOM   2454  C CA   . THR A 1 73 ? -1.299  3.277   -4.286  1.00 0.24 ? 73  THR A CA   2  
ATOM   2455  C C    . THR A 1 73 ? -1.214  1.822   -3.832  1.00 0.21 ? 73  THR A C    2  
ATOM   2456  O O    . THR A 1 73 ? -0.123  1.266   -3.691  1.00 0.24 ? 73  THR A O    2  
ATOM   2457  C CB   . THR A 1 73 ? -1.658  4.171   -3.090  1.00 0.29 ? 73  THR A CB   2  
ATOM   2458  O OG1  . THR A 1 73 ? -2.620  5.154   -3.501  1.00 0.39 ? 73  THR A OG1  2  
ATOM   2459  C CG2  . THR A 1 73 ? -0.425  4.865   -2.535  1.00 0.35 ? 73  THR A CG2  2  
ATOM   2460  H H    . THR A 1 73 ? -3.031  4.051   -5.188  1.00 0.26 ? 73  THR A H    2  
ATOM   2461  H HA   . THR A 1 73 ? -0.340  3.585   -4.669  1.00 0.26 ? 73  THR A HA   2  
ATOM   2462  H HB   . THR A 1 73 ? -2.088  3.554   -2.312  1.00 0.32 ? 73  THR A HB   2  
ATOM   2463  H HG1  . THR A 1 73 ? -2.628  5.876   -2.865  1.00 0.74 ? 73  THR A HG1  2  
ATOM   2464  H HG21 . THR A 1 73 ? 0.027   5.469   -3.305  1.00 0.57 ? 73  THR A HG21 2  
ATOM   2465  H HG22 . THR A 1 73 ? 0.284   4.123   -2.195  1.00 0.56 ? 73  THR A HG22 2  
ATOM   2466  H HG23 . THR A 1 73 ? -0.712  5.495   -1.706  1.00 0.58 ? 73  THR A HG23 2  
ATOM   2467  N N    . TRP A 1 74 ? -2.375  1.210   -3.630  1.00 0.18 ? 74  TRP A N    2  
ATOM   2468  C CA   . TRP A 1 74 ? -2.451  -0.175  -3.195  1.00 0.18 ? 74  TRP A CA   2  
ATOM   2469  C C    . TRP A 1 74 ? -1.928  -1.118  -4.273  1.00 0.17 ? 74  TRP A C    2  
ATOM   2470  O O    . TRP A 1 74 ? -1.122  -1.999  -3.991  1.00 0.19 ? 74  TRP A O    2  
ATOM   2471  C CB   . TRP A 1 74 ? -3.896  -0.535  -2.848  1.00 0.19 ? 74  TRP A CB   2  
ATOM   2472  C CG   . TRP A 1 74 ? -4.096  -1.985  -2.540  1.00 0.20 ? 74  TRP A CG   2  
ATOM   2473  C CD1  . TRP A 1 74 ? -4.772  -2.899  -3.295  1.00 0.23 ? 74  TRP A CD1  2  
ATOM   2474  C CD2  . TRP A 1 74 ? -3.612  -2.691  -1.393  1.00 0.27 ? 74  TRP A CD2  2  
ATOM   2475  N NE1  . TRP A 1 74 ? -4.739  -4.128  -2.685  1.00 0.25 ? 74  TRP A NE1  2  
ATOM   2476  C CE2  . TRP A 1 74 ? -4.034  -4.026  -1.516  1.00 0.27 ? 74  TRP A CE2  2  
ATOM   2477  C CE3  . TRP A 1 74 ? -2.867  -2.321  -0.271  1.00 0.38 ? 74  TRP A CE3  2  
ATOM   2478  C CZ2  . TRP A 1 74 ? -3.731  -4.994  -0.562  1.00 0.36 ? 74  TRP A CZ2  2  
ATOM   2479  C CZ3  . TRP A 1 74 ? -2.568  -3.281  0.673   1.00 0.48 ? 74  TRP A CZ3  2  
ATOM   2480  C CH2  . TRP A 1 74 ? -3.001  -4.604  0.524   1.00 0.46 ? 74  TRP A CH2  2  
ATOM   2481  H H    . TRP A 1 74 ? -3.205  1.706   -3.777  1.00 0.20 ? 74  TRP A H    2  
ATOM   2482  H HA   . TRP A 1 74 ? -1.842  -0.281  -2.310  1.00 0.20 ? 74  TRP A HA   2  
ATOM   2483  H HB2  . TRP A 1 74 ? -4.204  0.034   -1.985  1.00 0.22 ? 74  TRP A HB2  2  
ATOM   2484  H HB3  . TRP A 1 74 ? -4.531  -0.281  -3.685  1.00 0.21 ? 74  TRP A HB3  2  
ATOM   2485  H HD1  . TRP A 1 74 ? -5.261  -2.673  -4.233  1.00 0.30 ? 74  TRP A HD1  2  
ATOM   2486  H HE1  . TRP A 1 74 ? -5.157  -4.952  -3.033  1.00 0.28 ? 74  TRP A HE1  2  
ATOM   2487  H HE3  . TRP A 1 74 ? -2.522  -1.307  -0.138  1.00 0.40 ? 74  TRP A HE3  2  
ATOM   2488  H HZ2  . TRP A 1 74 ? -4.057  -6.018  -0.664  1.00 0.36 ? 74  TRP A HZ2  2  
ATOM   2489  H HZ3  . TRP A 1 74 ? -1.995  -3.014  1.546   1.00 0.58 ? 74  TRP A HZ3  2  
ATOM   2490  H HH2  . TRP A 1 74 ? -2.747  -5.322  1.291   1.00 0.54 ? 74  TRP A HH2  2  
ATOM   2491  N N    . GLY A 1 75 ? -2.382  -0.914  -5.506  1.00 0.18 ? 75  GLY A N    2  
ATOM   2492  C CA   . GLY A 1 75 ? -1.972  -1.758  -6.617  1.00 0.21 ? 75  GLY A CA   2  
ATOM   2493  C C    . GLY A 1 75 ? -0.467  -1.855  -6.768  1.00 0.20 ? 75  GLY A C    2  
ATOM   2494  O O    . GLY A 1 75 ? 0.068   -2.932  -7.041  1.00 0.25 ? 75  GLY A O    2  
ATOM   2495  H H    . GLY A 1 75 ? -3.006  -0.170  -5.667  1.00 0.20 ? 75  GLY A H    2  
ATOM   2496  H HA2  . GLY A 1 75 ? -2.370  -2.750  -6.465  1.00 0.24 ? 75  GLY A HA2  2  
ATOM   2497  H HA3  . GLY A 1 75 ? -2.386  -1.353  -7.529  1.00 0.24 ? 75  GLY A HA3  2  
ATOM   2498  N N    . LEU A 1 76 ? 0.222   -0.737  -6.587  1.00 0.20 ? 76  LEU A N    2  
ATOM   2499  C CA   . LEU A 1 76 ? 1.672   -0.711  -6.714  1.00 0.24 ? 76  LEU A CA   2  
ATOM   2500  C C    . LEU A 1 76 ? 2.340   -1.482  -5.576  1.00 0.23 ? 76  LEU A C    2  
ATOM   2501  O O    . LEU A 1 76 ? 3.269   -2.259  -5.809  1.00 0.28 ? 76  LEU A O    2  
ATOM   2502  C CB   . LEU A 1 76 ? 2.177   0.733   -6.760  1.00 0.30 ? 76  LEU A CB   2  
ATOM   2503  C CG   . LEU A 1 76 ? 1.719   1.528   -7.988  1.00 0.40 ? 76  LEU A CG   2  
ATOM   2504  C CD1  . LEU A 1 76 ? 2.066   2.997   -7.840  1.00 0.51 ? 76  LEU A CD1  2  
ATOM   2505  C CD2  . LEU A 1 76 ? 2.338   0.960   -9.260  1.00 0.56 ? 76  LEU A CD2  2  
ATOM   2506  H H    . LEU A 1 76 ? -0.258  0.092   -6.369  1.00 0.22 ? 76  LEU A H    2  
ATOM   2507  H HA   . LEU A 1 76 ? 1.924   -1.195  -7.646  1.00 0.27 ? 76  LEU A HA   2  
ATOM   2508  H HB2  . LEU A 1 76 ? 1.830   1.242   -5.871  1.00 0.34 ? 76  LEU A HB2  2  
ATOM   2509  H HB3  . LEU A 1 76 ? 3.257   0.717   -6.749  1.00 0.36 ? 76  LEU A HB3  2  
ATOM   2510  H HG   . LEU A 1 76 ? 0.644   1.451   -8.076  1.00 0.51 ? 76  LEU A HG   2  
ATOM   2511  H HD11 . LEU A 1 76 ? 3.139   3.112   -7.787  1.00 0.93 ? 76  LEU A HD11 2  
ATOM   2512  H HD12 . LEU A 1 76 ? 1.618   3.383   -6.937  1.00 0.87 ? 76  LEU A HD12 2  
ATOM   2513  H HD13 . LEU A 1 76 ? 1.688   3.543   -8.691  1.00 0.94 ? 76  LEU A HD13 2  
ATOM   2514  H HD21 . LEU A 1 76 ? 3.414   0.969   -9.172  1.00 0.97 ? 76  LEU A HD21 2  
ATOM   2515  H HD22 . LEU A 1 76 ? 2.041   1.563   -10.105 1.00 0.98 ? 76  LEU A HD22 2  
ATOM   2516  H HD23 . LEU A 1 76 ? 1.995   -0.055  -9.409  1.00 1.01 ? 76  LEU A HD23 2  
ATOM   2517  N N    . VAL A 1 77 ? 1.856   -1.284  -4.354  1.00 0.22 ? 77  VAL A N    2  
ATOM   2518  C CA   . VAL A 1 77 ? 2.413   -1.973  -3.192  1.00 0.25 ? 77  VAL A CA   2  
ATOM   2519  C C    . VAL A 1 77 ? 2.071   -3.462  -3.236  1.00 0.23 ? 77  VAL A C    2  
ATOM   2520  O O    . VAL A 1 77 ? 2.917   -4.314  -2.957  1.00 0.24 ? 77  VAL A O    2  
ATOM   2521  C CB   . VAL A 1 77 ? 1.892   -1.373  -1.865  1.00 0.29 ? 77  VAL A CB   2  
ATOM   2522  C CG1  . VAL A 1 77 ? 2.452   -2.130  -0.668  1.00 0.34 ? 77  VAL A CG1  2  
ATOM   2523  C CG2  . VAL A 1 77 ? 2.241   0.103   -1.769  1.00 0.35 ? 77  VAL A CG2  2  
ATOM   2524  H H    . VAL A 1 77 ? 1.105   -0.664  -4.229  1.00 0.22 ? 77  VAL A H    2  
ATOM   2525  H HA   . VAL A 1 77 ? 3.486   -1.857  -3.222  1.00 0.29 ? 77  VAL A HA   2  
ATOM   2526  H HB   . VAL A 1 77 ? 0.816   -1.468  -1.849  1.00 0.30 ? 77  VAL A HB   2  
ATOM   2527  H HG11 . VAL A 1 77 ? 2.156   -3.167  -0.727  1.00 0.46 ? 77  VAL A HG11 2  
ATOM   2528  H HG12 . VAL A 1 77 ? 2.067   -1.696  0.244   1.00 0.50 ? 77  VAL A HG12 2  
ATOM   2529  H HG13 . VAL A 1 77 ? 3.528   -2.062  -0.671  1.00 0.49 ? 77  VAL A HG13 2  
ATOM   2530  H HG21 . VAL A 1 77 ? 3.311   0.225   -1.837  1.00 0.59 ? 77  VAL A HG21 2  
ATOM   2531  H HG22 . VAL A 1 77 ? 1.892   0.495   -0.825  1.00 0.59 ? 77  VAL A HG22 2  
ATOM   2532  H HG23 . VAL A 1 77 ? 1.765   0.637   -2.577  1.00 0.55 ? 77  VAL A HG23 2  
ATOM   2533  N N    . LEU A 1 78 ? 0.831   -3.759  -3.607  1.00 0.21 ? 78  LEU A N    2  
ATOM   2534  C CA   . LEU A 1 78 ? 0.351   -5.131  -3.697  1.00 0.21 ? 78  LEU A CA   2  
ATOM   2535  C C    . LEU A 1 78 ? 1.209   -5.944  -4.655  1.00 0.20 ? 78  LEU A C    2  
ATOM   2536  O O    . LEU A 1 78 ? 1.673   -7.026  -4.309  1.00 0.22 ? 78  LEU A O    2  
ATOM   2537  C CB   . LEU A 1 78 ? -1.110  -5.152  -4.155  1.00 0.22 ? 78  LEU A CB   2  
ATOM   2538  C CG   . LEU A 1 78 ? -1.737  -6.541  -4.288  1.00 0.25 ? 78  LEU A CG   2  
ATOM   2539  C CD1  . LEU A 1 78 ? -1.928  -7.174  -2.919  1.00 0.35 ? 78  LEU A CD1  2  
ATOM   2540  C CD2  . LEU A 1 78 ? -3.063  -6.454  -5.028  1.00 0.34 ? 78  LEU A CD2  2  
ATOM   2541  H H    . LEU A 1 78 ? 0.210   -3.026  -3.824  1.00 0.20 ? 78  LEU A H    2  
ATOM   2542  H HA   . LEU A 1 78 ? 0.415   -5.569  -2.715  1.00 0.24 ? 78  LEU A HA   2  
ATOM   2543  H HB2  . LEU A 1 78 ? -1.692  -4.586  -3.442  1.00 0.26 ? 78  LEU A HB2  2  
ATOM   2544  H HB3  . LEU A 1 78 ? -1.172  -4.660  -5.115  1.00 0.23 ? 78  LEU A HB3  2  
ATOM   2545  H HG   . LEU A 1 78 ? -1.074  -7.174  -4.859  1.00 0.28 ? 78  LEU A HG   2  
ATOM   2546  H HD11 . LEU A 1 78 ? -0.964  -7.331  -2.458  1.00 0.67 ? 78  LEU A HD11 2  
ATOM   2547  H HD12 . LEU A 1 78 ? -2.434  -8.121  -3.029  1.00 0.70 ? 78  LEU A HD12 2  
ATOM   2548  H HD13 . LEU A 1 78 ? -2.520  -6.517  -2.298  1.00 0.68 ? 78  LEU A HD13 2  
ATOM   2549  H HD21 . LEU A 1 78 ? -2.904  -6.005  -5.998  1.00 0.67 ? 78  LEU A HD21 2  
ATOM   2550  H HD22 . LEU A 1 78 ? -3.753  -5.850  -4.460  1.00 0.68 ? 78  LEU A HD22 2  
ATOM   2551  H HD23 . LEU A 1 78 ? -3.473  -7.446  -5.154  1.00 0.71 ? 78  LEU A HD23 2  
ATOM   2552  N N    . GLY A 1 79 ? 1.431   -5.406  -5.848  1.00 0.20 ? 79  GLY A N    2  
ATOM   2553  C CA   . GLY A 1 79 ? 2.232   -6.100  -6.840  1.00 0.22 ? 79  GLY A CA   2  
ATOM   2554  C C    . GLY A 1 79 ? 3.656   -6.351  -6.374  1.00 0.21 ? 79  GLY A C    2  
ATOM   2555  O O    . GLY A 1 79 ? 4.237   -7.400  -6.671  1.00 0.27 ? 79  GLY A O    2  
ATOM   2556  H H    . GLY A 1 79 ? 1.044   -4.529  -6.060  1.00 0.20 ? 79  GLY A H    2  
ATOM   2557  H HA2  . GLY A 1 79 ? 1.766   -7.050  -7.059  1.00 0.24 ? 79  GLY A HA2  2  
ATOM   2558  H HA3  . GLY A 1 79 ? 2.258   -5.509  -7.742  1.00 0.24 ? 79  GLY A HA3  2  
ATOM   2559  N N    . ALA A 1 80 ? 4.210   -5.398  -5.631  1.00 0.19 ? 80  ALA A N    2  
ATOM   2560  C CA   . ALA A 1 80 ? 5.573   -5.511  -5.127  1.00 0.22 ? 80  ALA A CA   2  
ATOM   2561  C C    . ALA A 1 80 ? 5.664   -6.557  -4.024  1.00 0.21 ? 80  ALA A C    2  
ATOM   2562  O O    . ALA A 1 80 ? 6.525   -7.439  -4.060  1.00 0.25 ? 80  ALA A O    2  
ATOM   2563  C CB   . ALA A 1 80 ? 6.068   -4.161  -4.621  1.00 0.25 ? 80  ALA A CB   2  
ATOM   2564  H H    . ALA A 1 80 ? 3.686   -4.597  -5.416  1.00 0.21 ? 80  ALA A H    2  
ATOM   2565  H HA   . ALA A 1 80 ? 6.206   -5.813  -5.949  1.00 0.25 ? 80  ALA A HA   2  
ATOM   2566  H HB1  . ALA A 1 80 ? 5.437   -3.827  -3.809  1.00 0.41 ? 80  ALA A HB1  2  
ATOM   2567  H HB2  . ALA A 1 80 ? 6.032   -3.440  -5.424  1.00 0.39 ? 80  ALA A HB2  2  
ATOM   2568  H HB3  . ALA A 1 80 ? 7.085   -4.256  -4.271  1.00 0.43 ? 80  ALA A HB3  2  
ATOM   2569  N N    . LEU A 1 81 ? 4.765   -6.467  -3.052  1.00 0.21 ? 81  LEU A N    2  
ATOM   2570  C CA   . LEU A 1 81 ? 4.753   -7.406  -1.940  1.00 0.25 ? 81  LEU A CA   2  
ATOM   2571  C C    . LEU A 1 81 ? 4.375   -8.803  -2.409  1.00 0.22 ? 81  LEU A C    2  
ATOM   2572  O O    . LEU A 1 81 ? 4.853   -9.796  -1.859  1.00 0.23 ? 81  LEU A O    2  
ATOM   2573  C CB   . LEU A 1 81 ? 3.806   -6.942  -0.832  1.00 0.33 ? 81  LEU A CB   2  
ATOM   2574  C CG   . LEU A 1 81 ? 4.325   -5.790  0.037   1.00 0.50 ? 81  LEU A CG   2  
ATOM   2575  C CD1  . LEU A 1 81 ? 3.520   -5.692  1.321   1.00 0.60 ? 81  LEU A CD1  2  
ATOM   2576  C CD2  . LEU A 1 81 ? 5.804   -5.967  0.351   1.00 0.72 ? 81  LEU A CD2  2  
ATOM   2577  H H    . LEU A 1 81 ? 4.093   -5.747  -3.082  1.00 0.21 ? 81  LEU A H    2  
ATOM   2578  H HA   . LEU A 1 81 ? 5.756   -7.445  -1.544  1.00 0.30 ? 81  LEU A HA   2  
ATOM   2579  H HB2  . LEU A 1 81 ? 2.879   -6.627  -1.289  1.00 0.41 ? 81  LEU A HB2  2  
ATOM   2580  H HB3  . LEU A 1 81 ? 3.602   -7.785  -0.188  1.00 0.38 ? 81  LEU A HB3  2  
ATOM   2581  H HG   . LEU A 1 81 ? 4.204   -4.860  -0.501  1.00 0.60 ? 81  LEU A HG   2  
ATOM   2582  H HD11 . LEU A 1 81 ? 3.718   -6.558  1.936   1.00 0.98 ? 81  LEU A HD11 2  
ATOM   2583  H HD12 . LEU A 1 81 ? 2.469   -5.656  1.079   1.00 0.95 ? 81  LEU A HD12 2  
ATOM   2584  H HD13 . LEU A 1 81 ? 3.798   -4.797  1.857   1.00 1.12 ? 81  LEU A HD13 2  
ATOM   2585  H HD21 . LEU A 1 81 ? 5.973   -6.960  0.740   1.00 1.02 ? 81  LEU A HD21 2  
ATOM   2586  H HD22 . LEU A 1 81 ? 6.107   -5.236  1.087   1.00 1.04 ? 81  LEU A HD22 2  
ATOM   2587  H HD23 . LEU A 1 81 ? 6.382   -5.830  -0.550  1.00 1.02 ? 81  LEU A HD23 2  
ATOM   2588  N N    . LYS A 1 82 ? 3.523   -8.885  -3.424  1.00 0.22 ? 82  LYS A N    2  
ATOM   2589  C CA   . LYS A 1 82 ? 3.122   -10.175 -3.964  1.00 0.24 ? 82  LYS A CA   2  
ATOM   2590  C C    . LYS A 1 82 ? 4.341   -10.897 -4.514  1.00 0.24 ? 82  LYS A C    2  
ATOM   2591  O O    . LYS A 1 82 ? 4.541   -12.079 -4.249  1.00 0.29 ? 82  LYS A O    2  
ATOM   2592  C CB   . LYS A 1 82 ? 2.063   -10.016 -5.056  1.00 0.31 ? 82  LYS A CB   2  
ATOM   2593  C CG   . LYS A 1 82 ? 0.638   -10.085 -4.532  1.00 0.52 ? 82  LYS A CG   2  
ATOM   2594  C CD   . LYS A 1 82 ? -0.369  -10.255 -5.659  1.00 0.61 ? 82  LYS A CD   2  
ATOM   2595  C CE   . LYS A 1 82 ? -1.781  -10.416 -5.117  1.00 0.90 ? 82  LYS A CE   2  
ATOM   2596  N NZ   . LYS A 1 82 ? -2.766  -10.723 -6.189  1.00 1.19 ? 82  LYS A NZ   2  
ATOM   2597  H H    . LYS A 1 82 ? 3.147   -8.061  -3.808  1.00 0.23 ? 82  LYS A H    2  
ATOM   2598  H HA   . LYS A 1 82 ? 2.712   -10.760 -3.153  1.00 0.26 ? 82  LYS A HA   2  
ATOM   2599  H HB2  . LYS A 1 82 ? 2.202   -9.062  -5.538  1.00 0.53 ? 82  LYS A HB2  2  
ATOM   2600  H HB3  . LYS A 1 82 ? 2.192   -10.801 -5.784  1.00 0.51 ? 82  LYS A HB3  2  
ATOM   2601  H HG2  . LYS A 1 82 ? 0.553   -10.925 -3.860  1.00 0.82 ? 82  LYS A HG2  2  
ATOM   2602  H HG3  . LYS A 1 82 ? 0.419   -9.171  -3.998  1.00 0.81 ? 82  LYS A HG3  2  
ATOM   2603  H HD2  . LYS A 1 82 ? -0.335  -9.384  -6.296  1.00 0.84 ? 82  LYS A HD2  2  
ATOM   2604  H HD3  . LYS A 1 82 ? -0.111  -11.134 -6.233  1.00 0.84 ? 82  LYS A HD3  2  
ATOM   2605  H HE2  . LYS A 1 82 ? -1.784  -11.220 -4.397  1.00 1.22 ? 82  LYS A HE2  2  
ATOM   2606  H HE3  . LYS A 1 82 ? -2.069  -9.498  -4.628  1.00 1.21 ? 82  LYS A HE3  2  
ATOM   2607  H HZ1  . LYS A 1 82 ? -2.435  -11.525 -6.762  1.00 1.48 ? 82  LYS A HZ1  2  
ATOM   2608  H HZ2  . LYS A 1 82 ? -2.894  -9.899  -6.810  1.00 1.54 ? 82  LYS A HZ2  2  
ATOM   2609  H HZ3  . LYS A 1 82 ? -3.686  -10.971 -5.768  1.00 1.55 ? 82  LYS A HZ3  2  
ATOM   2610  N N    . ALA A 1 83 ? 5.167   -10.165 -5.255  1.00 0.24 ? 83  ALA A N    2  
ATOM   2611  C CA   . ALA A 1 83 ? 6.381   -10.723 -5.833  1.00 0.28 ? 83  ALA A CA   2  
ATOM   2612  C C    . ALA A 1 83 ? 7.379   -11.085 -4.739  1.00 0.28 ? 83  ALA A C    2  
ATOM   2613  O O    . ALA A 1 83 ? 8.063   -12.106 -4.816  1.00 0.34 ? 83  ALA A O    2  
ATOM   2614  C CB   . ALA A 1 83 ? 6.998   -9.735  -6.810  1.00 0.35 ? 83  ALA A CB   2  
ATOM   2615  H H    . ALA A 1 83 ? 4.951   -9.222  -5.421  1.00 0.25 ? 83  ALA A H    2  
ATOM   2616  H HA   . ALA A 1 83 ? 6.114   -11.618 -6.375  1.00 0.32 ? 83  ALA A HA   2  
ATOM   2617  H HB1  . ALA A 1 83 ? 7.266   -8.831  -6.284  1.00 0.48 ? 83  ALA A HB1  2  
ATOM   2618  H HB2  . ALA A 1 83 ? 6.283   -9.501  -7.585  1.00 0.53 ? 83  ALA A HB2  2  
ATOM   2619  H HB3  . ALA A 1 83 ? 7.881   -10.168 -7.253  1.00 0.54 ? 83  ALA A HB3  2  
ATOM   2620  N N    . ALA A 1 84 ? 7.447   -10.242 -3.718  1.00 0.26 ? 84  ALA A N    2  
ATOM   2621  C CA   . ALA A 1 84 ? 8.349   -10.464 -2.596  1.00 0.31 ? 84  ALA A CA   2  
ATOM   2622  C C    . ALA A 1 84 ? 7.940   -11.697 -1.796  1.00 0.32 ? 84  ALA A C    2  
ATOM   2623  O O    . ALA A 1 84 ? 8.773   -12.348 -1.170  1.00 0.45 ? 84  ALA A O    2  
ATOM   2624  C CB   . ALA A 1 84 ? 8.382   -9.240  -1.699  1.00 0.35 ? 84  ALA A CB   2  
ATOM   2625  H H    . ALA A 1 84 ? 6.878   -9.441  -3.723  1.00 0.26 ? 84  ALA A H    2  
ATOM   2626  H HA   . ALA A 1 84 ? 9.343   -10.618 -2.992  1.00 0.36 ? 84  ALA A HA   2  
ATOM   2627  H HB1  . ALA A 1 84 ? 7.432   -9.139  -1.195  1.00 0.55 ? 84  ALA A HB1  2  
ATOM   2628  H HB2  . ALA A 1 84 ? 8.569   -8.360  -2.298  1.00 0.50 ? 84  ALA A HB2  2  
ATOM   2629  H HB3  . ALA A 1 84 ? 9.168   -9.352  -0.968  1.00 0.52 ? 84  ALA A HB3  2  
ATOM   2630  N N    . ARG A 1 85 ? 6.656   -12.021 -1.832  1.00 0.29 ? 85  ARG A N    2  
ATOM   2631  C CA   . ARG A 1 85 ? 6.140   -13.173 -1.109  1.00 0.35 ? 85  ARG A CA   2  
ATOM   2632  C C    . ARG A 1 85 ? 6.120   -14.418 -1.990  1.00 0.35 ? 85  ARG A C    2  
ATOM   2633  O O    . ARG A 1 85 ? 5.518   -15.431 -1.633  1.00 0.48 ? 85  ARG A O    2  
ATOM   2634  C CB   . ARG A 1 85 ? 4.735   -12.885 -0.578  1.00 0.42 ? 85  ARG A CB   2  
ATOM   2635  C CG   . ARG A 1 85 ? 4.725   -12.409 0.865   1.00 0.54 ? 85  ARG A CG   2  
ATOM   2636  C CD   . ARG A 1 85 ? 3.385   -12.666 1.529   1.00 0.74 ? 85  ARG A CD   2  
ATOM   2637  N NE   . ARG A 1 85 ? 3.484   -12.604 2.986   1.00 0.66 ? 85  ARG A NE   2  
ATOM   2638  C CZ   . ARG A 1 85 ? 3.455   -13.675 3.782   1.00 0.66 ? 85  ARG A CZ   2  
ATOM   2639  N NH1  . ARG A 1 85 ? 3.320   -14.892 3.269   1.00 0.83 ? 85  ARG A NH1  2  
ATOM   2640  N NH2  . ARG A 1 85 ? 3.568   -13.526 5.096   1.00 0.79 ? 85  ARG A NH2  2  
ATOM   2641  H H    . ARG A 1 85 ? 6.037   -11.466 -2.353  1.00 0.31 ? 85  ARG A H    2  
ATOM   2642  H HA   . ARG A 1 85 ? 6.797   -13.353 -0.273  1.00 0.41 ? 85  ARG A HA   2  
ATOM   2643  H HB2  . ARG A 1 85 ? 4.279   -12.121 -1.192  1.00 0.47 ? 85  ARG A HB2  2  
ATOM   2644  H HB3  . ARG A 1 85 ? 4.146   -13.787 -0.644  1.00 0.49 ? 85  ARG A HB3  2  
ATOM   2645  H HG2  . ARG A 1 85 ? 5.491   -12.937 1.413   1.00 0.96 ? 85  ARG A HG2  2  
ATOM   2646  H HG3  . ARG A 1 85 ? 4.931   -11.348 0.886   1.00 1.03 ? 85  ARG A HG3  2  
ATOM   2647  H HD2  . ARG A 1 85 ? 2.680   -11.920 1.194   1.00 1.28 ? 85  ARG A HD2  2  
ATOM   2648  H HD3  . ARG A 1 85 ? 3.036   -13.644 1.242   1.00 1.22 ? 85  ARG A HD3  2  
ATOM   2649  H HE   . ARG A 1 85 ? 3.584   -11.711 3.390   1.00 0.81 ? 85  ARG A HE   2  
ATOM   2650  H HH11 . ARG A 1 85 ? 3.301   -15.695 3.872   1.00 1.01 ? 85  ARG A HH11 2  
ATOM   2651  H HH12 . ARG A 1 85 ? 3.238   -15.019 2.279   1.00 0.90 ? 85  ARG A HH12 2  
ATOM   2652  H HH21 . ARG A 1 85 ? 3.682   -12.611 5.493   1.00 0.90 ? 85  ARG A HH21 2  
ATOM   2653  H HH22 . ARG A 1 85 ? 3.543   -14.329 5.700   1.00 0.92 ? 85  ARG A HH22 2  
ATOM   2654  N N    . GLU A 1 86 ? 6.772   -14.336 -3.141  1.00 0.35 ? 86  GLU A N    2  
ATOM   2655  C CA   . GLU A 1 86 ? 6.830   -15.462 -4.061  1.00 0.40 ? 86  GLU A CA   2  
ATOM   2656  C C    . GLU A 1 86 ? 8.239   -16.035 -4.123  1.00 0.43 ? 86  GLU A C    2  
ATOM   2657  O O    . GLU A 1 86 ? 8.498   -17.002 -4.845  1.00 0.65 ? 86  GLU A O    2  
ATOM   2658  C CB   . GLU A 1 86 ? 6.382   -15.035 -5.459  1.00 0.50 ? 86  GLU A CB   2  
ATOM   2659  C CG   . GLU A 1 86 ? 4.890   -14.783 -5.568  1.00 0.68 ? 86  GLU A CG   2  
ATOM   2660  C CD   . GLU A 1 86 ? 4.436   -14.584 -6.998  1.00 0.87 ? 86  GLU A CD   2  
ATOM   2661  O OE1  . GLU A 1 86 ? 4.789   -15.419 -7.858  1.00 1.32 ? 86  GLU A OE1  2  
ATOM   2662  O OE2  . GLU A 1 86 ? 3.709   -13.600 -7.270  1.00 1.25 ? 86  GLU A OE2  2  
ATOM   2663  H H    . GLU A 1 86 ? 7.220   -13.496 -3.380  1.00 0.42 ? 86  GLU A H    2  
ATOM   2664  H HA   . GLU A 1 86 ? 6.159   -16.225 -3.694  1.00 0.47 ? 86  GLU A HA   2  
ATOM   2665  H HB2  . GLU A 1 86 ? 6.899   -14.125 -5.727  1.00 0.63 ? 86  GLU A HB2  2  
ATOM   2666  H HB3  . GLU A 1 86 ? 6.647   -15.810 -6.162  1.00 0.63 ? 86  GLU A HB3  2  
ATOM   2667  H HG2  . GLU A 1 86 ? 4.361   -15.628 -5.151  1.00 0.90 ? 86  GLU A HG2  2  
ATOM   2668  H HG3  . GLU A 1 86 ? 4.647   -13.896 -5.002  1.00 0.93 ? 86  GLU A HG3  2  
ATOM   2669  N N    . GLU A 1 87 ? 9.149   -15.438 -3.365  1.00 0.47 ? 87  GLU A N    2  
ATOM   2670  C CA   . GLU A 1 87 ? 10.528  -15.889 -3.342  1.00 0.58 ? 87  GLU A CA   2  
ATOM   2671  C C    . GLU A 1 87 ? 11.200  -15.472 -2.042  1.00 0.68 ? 87  GLU A C    2  
ATOM   2672  O O    . GLU A 1 87 ? 11.537  -16.360 -1.231  1.00 1.13 ? 87  GLU A O    2  
ATOM   2673  C CB   . GLU A 1 87 ? 11.289  -15.310 -4.533  1.00 0.77 ? 87  GLU A CB   2  
ATOM   2674  C CG   . GLU A 1 87 ? 12.471  -16.158 -4.972  1.00 1.10 ? 87  GLU A CG   2  
ATOM   2675  C CD   . GLU A 1 87 ? 13.166  -15.595 -6.189  1.00 1.15 ? 87  GLU A CD   2  
ATOM   2676  O OE1  . GLU A 1 87 ? 14.281  -15.054 -6.044  1.00 1.51 ? 87  GLU A OE1  2  
ATOM   2677  O OE2  . GLU A 1 87 ? 12.601  -15.691 -7.300  1.00 1.44 ? 87  GLU A OE2  2  
ATOM   2678  O OXT  . GLU A 1 87 ? 11.381  -14.252 -1.833  1.00 1.02 ? 87  GLU A OXT  2  
ATOM   2679  H H    . GLU A 1 87 ? 8.888   -14.675 -2.806  1.00 0.60 ? 87  GLU A H    2  
ATOM   2680  H HA   . GLU A 1 87 ? 10.529  -16.965 -3.411  1.00 0.71 ? 87  GLU A HA   2  
ATOM   2681  H HB2  . GLU A 1 87 ? 10.607  -15.219 -5.365  1.00 1.08 ? 87  GLU A HB2  2  
ATOM   2682  H HB3  . GLU A 1 87 ? 11.655  -14.329 -4.269  1.00 1.00 ? 87  GLU A HB3  2  
ATOM   2683  H HG2  . GLU A 1 87 ? 13.182  -16.211 -4.162  1.00 1.52 ? 87  GLU A HG2  2  
ATOM   2684  H HG3  . GLU A 1 87 ? 12.118  -17.153 -5.205  1.00 1.59 ? 87  GLU A HG3  2  
HETATM 2685  C C1   . IHP B 2 .  ? 13.940  10.485  1.074   1.00 0.87 ? 101 IHP A C1   2  
HETATM 2686  C C2   . IHP B 2 .  ? 12.728  11.111  1.768   1.00 0.83 ? 101 IHP A C2   2  
HETATM 2687  C C3   . IHP B 2 .  ? 11.958  11.976  0.769   1.00 0.67 ? 101 IHP A C3   2  
HETATM 2688  C C4   . IHP B 2 .  ? 11.484  11.107  -0.398  1.00 0.52 ? 101 IHP A C4   2  
HETATM 2689  C C5   . IHP B 2 .  ? 12.697  10.483  -1.093  1.00 0.61 ? 101 IHP A C5   2  
HETATM 2690  C C6   . IHP B 2 .  ? 13.467  9.617   -0.093  1.00 0.77 ? 101 IHP A C6   2  
HETATM 2691  O O11  . IHP B 2 .  ? 14.660  9.677   2.006   1.00 1.21 ? 101 IHP A O11  2  
HETATM 2692  P P1   . IHP B 2 .  ? 16.197  9.949   2.398   1.00 1.54 ? 101 IHP A P1   2  
HETATM 2693  O O21  . IHP B 2 .  ? 16.348  11.343  2.874   1.00 1.58 ? 101 IHP A O21  2  
HETATM 2694  O O31  . IHP B 2 .  ? 16.641  8.933   3.566   1.00 1.93 ? 101 IHP A O31  2  
HETATM 2695  O O41  . IHP B 2 .  ? 17.129  9.720   1.104   1.00 1.56 ? 101 IHP A O41  2  
HETATM 2696  O O12  . IHP B 2 .  ? 11.875  10.075  2.260   1.00 0.85 ? 101 IHP A O12  2  
HETATM 2697  P P2   . IHP B 2 .  ? 11.510  9.907   3.819   1.00 1.21 ? 101 IHP A P2   2  
HETATM 2698  O O22  . IHP B 2 .  ? 10.943  11.174  4.332   1.00 1.39 ? 101 IHP A O22  2  
HETATM 2699  O O32  . IHP B 2 .  ? 10.429  8.726   3.992   1.00 1.20 ? 101 IHP A O32  2  
HETATM 2700  O O42  . IHP B 2 .  ? 12.840  9.541   4.647   1.00 1.55 ? 101 IHP A O42  2  
HETATM 2701  O O13  . IHP B 2 .  ? 10.826  12.560  1.418   1.00 0.90 ? 101 IHP A O13  2  
HETATM 2702  P P3   . IHP B 2 .  ? 10.609  14.149  1.540   1.00 1.24 ? 101 IHP A P3   2  
HETATM 2703  O O23  . IHP B 2 .  ? 11.799  14.762  2.175   1.00 1.39 ? 101 IHP A O23  2  
HETATM 2704  O O33  . IHP B 2 .  ? 10.401  14.778  0.073   1.00 1.27 ? 101 IHP A O33  2  
HETATM 2705  O O43  . IHP B 2 .  ? 9.308   14.446  2.439   1.00 1.57 ? 101 IHP A O43  2  
HETATM 2706  O O14  . IHP B 2 .  ? 10.764  11.916  -1.332  1.00 0.74 ? 101 IHP A O14  2  
HETATM 2707  P P4   . IHP B 2 .  ? 9.226   11.644  -1.724  1.00 1.00 ? 101 IHP A P4   2  
HETATM 2708  O O24  . IHP B 2 .  ? 8.704   12.818  -2.693  1.00 1.39 ? 101 IHP A O24  2  
HETATM 2709  O O34  . IHP B 2 .  ? 9.107   10.228  -2.482  1.00 1.09 ? 101 IHP A O34  2  
HETATM 2710  O O44  . IHP B 2 .  ? 8.403   11.616  -0.495  1.00 1.01 ? 101 IHP A O44  2  
HETATM 2711  O O15  . IHP B 2 .  ? 12.254  9.672   -2.183  1.00 0.86 ? 101 IHP A O15  2  
HETATM 2712  P P5   . IHP B 2 .  ? 12.690  9.941   -3.709  1.00 1.20 ? 101 IHP A P5   2  
HETATM 2713  O O25  . IHP B 2 .  ? 14.167  9.970   -3.802  1.00 1.28 ? 101 IHP A O25  2  
HETATM 2714  O O35  . IHP B 2 .  ? 12.117  8.763   -4.647  1.00 1.56 ? 101 IHP A O35  2  
HETATM 2715  O O45  . IHP B 2 .  ? 12.093  11.354  -4.198  1.00 1.25 ? 101 IHP A O45  2  
HETATM 2716  O O16  . IHP B 2 .  ? 14.598  9.033   -0.742  1.00 1.06 ? 101 IHP A O16  2  
HETATM 2717  P P6   . IHP B 2 .  ? 14.814  7.442   -0.866  1.00 1.40 ? 101 IHP A P6   2  
HETATM 2718  O O26  . IHP B 2 .  ? 13.626  6.829   -1.499  1.00 1.39 ? 101 IHP A O26  2  
HETATM 2719  O O36  . IHP B 2 .  ? 16.117  7.146   -1.764  1.00 1.74 ? 101 IHP A O36  2  
HETATM 2720  O O46  . IHP B 2 .  ? 15.023  6.815   0.603   1.00 1.56 ? 101 IHP A O46  2  
HETATM 2721  H H1   . IHP B 2 .  ? 14.589  11.276  0.706   1.00 0.89 ? 101 IHP A H1   2  
HETATM 2722  H H2   . IHP B 2 .  ? 13.067  11.739  2.592   1.00 1.08 ? 101 IHP A H2   2  
HETATM 2723  H H3   . IHP B 2 .  ? 12.612  12.772  0.399   1.00 0.73 ? 101 IHP A H3   2  
HETATM 2724  H H4   . IHP B 2 .  ? 10.822  10.318  -0.039  1.00 0.51 ? 101 IHP A H4   2  
HETATM 2725  H H5   . IHP B 2 .  ? 13.339  11.280  -1.473  1.00 0.66 ? 101 IHP A H5   2  
HETATM 2726  H H6   . IHP B 2 .  ? 12.819  8.839   0.290   1.00 0.80 ? 101 IHP A H6   2  
ATOM   2727  N N    . SER A 1 1  ? 3.143   4.356   10.266  1.00 1.45 ? 1   SER A N    3  
ATOM   2728  C CA   . SER A 1 1  ? 3.304   5.756   10.707  1.00 0.98 ? 1   SER A CA   3  
ATOM   2729  C C    . SER A 1 1  ? 4.477   6.429   9.995   1.00 0.92 ? 1   SER A C    3  
ATOM   2730  O O    . SER A 1 1  ? 4.295   7.439   9.319   1.00 1.21 ? 1   SER A O    3  
ATOM   2731  C CB   . SER A 1 1  ? 3.508   5.794   12.217  1.00 1.66 ? 1   SER A CB   3  
ATOM   2732  O OG   . SER A 1 1  ? 2.657   4.859   12.855  1.00 2.07 ? 1   SER A OG   3  
ATOM   2733  H H1   . SER A 1 1  ? 2.961   4.324   9.247   1.00 1.90 ? 1   SER A H1   3  
ATOM   2734  H H2   . SER A 1 1  ? 2.338   3.922   10.766  1.00 1.69 ? 1   SER A H2   3  
ATOM   2735  H H3   . SER A 1 1  ? 4.000   3.811   10.477  1.00 1.94 ? 1   SER A H3   3  
ATOM   2736  H HA   . SER A 1 1  ? 2.398   6.292   10.463  1.00 1.33 ? 1   SER A HA   3  
ATOM   2737  H HB2  . SER A 1 1  ? 4.535   5.549   12.450  1.00 2.07 ? 1   SER A HB2  3  
ATOM   2738  H HB3  . SER A 1 1  ? 3.280   6.783   12.583  1.00 2.12 ? 1   SER A HB3  3  
ATOM   2739  H HG   . SER A 1 1  ? 2.343   5.234   13.690  1.00 2.51 ? 1   SER A HG   3  
ATOM   2740  N N    . GLU A 1 2  ? 5.679   5.874   10.146  1.00 0.80 ? 2   GLU A N    3  
ATOM   2741  C CA   . GLU A 1 2  ? 6.863   6.447   9.512   1.00 0.85 ? 2   GLU A CA   3  
ATOM   2742  C C    . GLU A 1 2  ? 7.865   5.368   9.093   1.00 0.72 ? 2   GLU A C    3  
ATOM   2743  O O    . GLU A 1 2  ? 8.161   5.218   7.910   1.00 0.72 ? 2   GLU A O    3  
ATOM   2744  C CB   . GLU A 1 2  ? 7.545   7.459   10.451  1.00 1.13 ? 2   GLU A CB   3  
ATOM   2745  C CG   . GLU A 1 2  ? 7.133   7.342   11.917  1.00 1.33 ? 2   GLU A CG   3  
ATOM   2746  C CD   . GLU A 1 2  ? 7.698   6.107   12.596  1.00 1.48 ? 2   GLU A CD   3  
ATOM   2747  O OE1  . GLU A 1 2  ? 7.096   5.017   12.455  1.00 1.99 ? 2   GLU A OE1  3  
ATOM   2748  O OE2  . GLU A 1 2  ? 8.747   6.214   13.262  1.00 1.97 ? 2   GLU A OE2  3  
ATOM   2749  H H    . GLU A 1 2  ? 5.778   5.081   10.712  1.00 0.89 ? 2   GLU A H    3  
ATOM   2750  H HA   . GLU A 1 2  ? 6.532   6.969   8.622   1.00 0.92 ? 2   GLU A HA   3  
ATOM   2751  H HB2  . GLU A 1 2  ? 8.614   7.316   10.392  1.00 1.41 ? 2   GLU A HB2  3  
ATOM   2752  H HB3  . GLU A 1 2  ? 7.309   8.458   10.114  1.00 1.30 ? 2   GLU A HB3  3  
ATOM   2753  H HG2  . GLU A 1 2  ? 7.482   8.214   12.446  1.00 1.76 ? 2   GLU A HG2  3  
ATOM   2754  H HG3  . GLU A 1 2  ? 6.053   7.301   11.970  1.00 1.92 ? 2   GLU A HG3  3  
ATOM   2755  N N    . ALA A 1 3  ? 8.357   4.610   10.069  1.00 0.74 ? 3   ALA A N    3  
ATOM   2756  C CA   . ALA A 1 3  ? 9.349   3.563   9.827   1.00 0.73 ? 3   ALA A CA   3  
ATOM   2757  C C    . ALA A 1 3  ? 8.871   2.532   8.810   1.00 0.59 ? 3   ALA A C    3  
ATOM   2758  O O    . ALA A 1 3  ? 9.554   2.260   7.822   1.00 0.57 ? 3   ALA A O    3  
ATOM   2759  C CB   . ALA A 1 3  ? 9.714   2.877   11.135  1.00 0.89 ? 3   ALA A CB   3  
ATOM   2760  H H    . ALA A 1 3  ? 8.043   4.759   10.992  1.00 0.83 ? 3   ALA A H    3  
ATOM   2761  H HA   . ALA A 1 3  ? 10.241  4.037   9.444   1.00 0.80 ? 3   ALA A HA   3  
ATOM   2762  H HB1  . ALA A 1 3  ? 8.850   2.360   11.522  1.00 1.15 ? 3   ALA A HB1  3  
ATOM   2763  H HB2  . ALA A 1 3  ? 10.041  3.618   11.850  1.00 1.06 ? 3   ALA A HB2  3  
ATOM   2764  H HB3  . ALA A 1 3  ? 10.510  2.169   10.960  1.00 0.95 ? 3   ALA A HB3  3  
ATOM   2765  N N    . VAL A 1 4  ? 7.692   1.966   9.044   1.00 0.56 ? 4   VAL A N    3  
ATOM   2766  C CA   . VAL A 1 4  ? 7.140   0.957   8.142   1.00 0.50 ? 4   VAL A CA   3  
ATOM   2767  C C    . VAL A 1 4  ? 6.985   1.511   6.726   1.00 0.45 ? 4   VAL A C    3  
ATOM   2768  O O    . VAL A 1 4  ? 7.189   0.795   5.747   1.00 0.48 ? 4   VAL A O    3  
ATOM   2769  C CB   . VAL A 1 4  ? 5.781   0.417   8.638   1.00 0.57 ? 4   VAL A CB   3  
ATOM   2770  C CG1  . VAL A 1 4  ? 5.294   -0.722  7.751   1.00 0.82 ? 4   VAL A CG1  3  
ATOM   2771  C CG2  . VAL A 1 4  ? 5.885   -0.047  10.080  1.00 0.79 ? 4   VAL A CG2  3  
ATOM   2772  H H    . VAL A 1 4  ? 7.189   2.221   9.846   1.00 0.63 ? 4   VAL A H    3  
ATOM   2773  H HA   . VAL A 1 4  ? 7.837   0.133   8.113   1.00 0.54 ? 4   VAL A HA   3  
ATOM   2774  H HB   . VAL A 1 4  ? 5.056   1.218   8.588   1.00 0.63 ? 4   VAL A HB   3  
ATOM   2775  H HG11 . VAL A 1 4  ? 5.279   -0.398  6.719   1.00 1.06 ? 4   VAL A HG11 3  
ATOM   2776  H HG12 . VAL A 1 4  ? 4.298   -1.009  8.051   1.00 0.99 ? 4   VAL A HG12 3  
ATOM   2777  H HG13 . VAL A 1 4  ? 5.958   -1.569  7.854   1.00 1.13 ? 4   VAL A HG13 3  
ATOM   2778  H HG21 . VAL A 1 4  ? 4.909   -0.349  10.432  1.00 1.11 ? 4   VAL A HG21 3  
ATOM   2779  H HG22 . VAL A 1 4  ? 6.257   0.758   10.694  1.00 1.16 ? 4   VAL A HG22 3  
ATOM   2780  H HG23 . VAL A 1 4  ? 6.562   -0.887  10.137  1.00 1.27 ? 4   VAL A HG23 3  
ATOM   2781  N N    . ILE A 1 5  ? 6.650   2.794   6.622   1.00 0.48 ? 5   ILE A N    3  
ATOM   2782  C CA   . ILE A 1 5  ? 6.482   3.431   5.322   1.00 0.51 ? 5   ILE A CA   3  
ATOM   2783  C C    . ILE A 1 5  ? 7.813   3.475   4.581   1.00 0.46 ? 5   ILE A C    3  
ATOM   2784  O O    . ILE A 1 5  ? 7.876   3.172   3.390   1.00 0.47 ? 5   ILE A O    3  
ATOM   2785  C CB   . ILE A 1 5  ? 5.913   4.860   5.451   1.00 0.65 ? 5   ILE A CB   3  
ATOM   2786  C CG1  . ILE A 1 5  ? 4.578   4.831   6.200   1.00 0.81 ? 5   ILE A CG1  3  
ATOM   2787  C CG2  . ILE A 1 5  ? 5.737   5.486   4.071   1.00 0.81 ? 5   ILE A CG2  3  
ATOM   2788  C CD1  . ILE A 1 5  ? 3.948   6.195   6.377   1.00 0.98 ? 5   ILE A CD1  3  
ATOM   2789  H H    . ILE A 1 5  ? 6.531   3.323   7.435   1.00 0.54 ? 5   ILE A H    3  
ATOM   2790  H HA   . ILE A 1 5  ? 5.783   2.836   4.748   1.00 0.55 ? 5   ILE A HA   3  
ATOM   2791  H HB   . ILE A 1 5  ? 6.619   5.458   6.008   1.00 0.71 ? 5   ILE A HB   3  
ATOM   2792  H HG12 . ILE A 1 5  ? 3.879   4.218   5.651   1.00 0.91 ? 5   ILE A HG12 3  
ATOM   2793  H HG13 . ILE A 1 5  ? 4.733   4.405   7.181   1.00 0.85 ? 5   ILE A HG13 3  
ATOM   2794  H HG21 . ILE A 1 5  ? 4.938   4.982   3.548   1.00 1.02 ? 5   ILE A HG21 3  
ATOM   2795  H HG22 . ILE A 1 5  ? 6.655   5.384   3.509   1.00 1.00 ? 5   ILE A HG22 3  
ATOM   2796  H HG23 . ILE A 1 5  ? 5.494   6.533   4.176   1.00 1.04 ? 5   ILE A HG23 3  
ATOM   2797  H HD11 . ILE A 1 5  ? 3.859   6.675   5.412   1.00 1.27 ? 5   ILE A HD11 3  
ATOM   2798  H HD12 . ILE A 1 5  ? 4.568   6.797   7.023   1.00 1.29 ? 5   ILE A HD12 3  
ATOM   2799  H HD13 . ILE A 1 5  ? 2.969   6.083   6.815   1.00 1.30 ? 5   ILE A HD13 3  
ATOM   2800  N N    . LYS A 1 6  ? 8.874   3.826   5.304   1.00 0.49 ? 6   LYS A N    3  
ATOM   2801  C CA   . LYS A 1 6  ? 10.211  3.892   4.726   1.00 0.50 ? 6   LYS A CA   3  
ATOM   2802  C C    . LYS A 1 6  ? 10.636  2.521   4.218   1.00 0.46 ? 6   LYS A C    3  
ATOM   2803  O O    . LYS A 1 6  ? 11.308  2.403   3.195   1.00 0.47 ? 6   LYS A O    3  
ATOM   2804  C CB   . LYS A 1 6  ? 11.225  4.396   5.761   1.00 0.61 ? 6   LYS A CB   3  
ATOM   2805  C CG   . LYS A 1 6  ? 11.020  5.845   6.175   1.00 0.85 ? 6   LYS A CG   3  
ATOM   2806  C CD   . LYS A 1 6  ? 11.323  6.804   5.033   1.00 1.11 ? 6   LYS A CD   3  
ATOM   2807  C CE   . LYS A 1 6  ? 12.821  6.958   4.797   1.00 1.11 ? 6   LYS A CE   3  
ATOM   2808  N NZ   . LYS A 1 6  ? 13.118  7.960   3.736   1.00 1.12 ? 6   LYS A NZ   3  
ATOM   2809  H H    . LYS A 1 6  ? 8.755   4.048   6.253   1.00 0.53 ? 6   LYS A H    3  
ATOM   2810  H HA   . LYS A 1 6  ? 10.180  4.578   3.894   1.00 0.52 ? 6   LYS A HA   3  
ATOM   2811  H HB2  . LYS A 1 6  ? 11.154  3.778   6.644   1.00 0.84 ? 6   LYS A HB2  3  
ATOM   2812  H HB3  . LYS A 1 6  ? 12.217  4.300   5.348   1.00 0.80 ? 6   LYS A HB3  3  
ATOM   2813  H HG2  . LYS A 1 6  ? 9.993   5.980   6.479   1.00 1.25 ? 6   LYS A HG2  3  
ATOM   2814  H HG3  . LYS A 1 6  ? 11.674  6.068   7.005   1.00 1.02 ? 6   LYS A HG3  3  
ATOM   2815  H HD2  . LYS A 1 6  ? 10.870  6.424   4.130   1.00 1.57 ? 6   LYS A HD2  3  
ATOM   2816  H HD3  . LYS A 1 6  ? 10.904  7.767   5.269   1.00 1.65 ? 6   LYS A HD3  3  
ATOM   2817  H HE2  . LYS A 1 6  ? 13.285  7.275   5.718   1.00 1.38 ? 6   LYS A HE2  3  
ATOM   2818  H HE3  . LYS A 1 6  ? 13.226  6.002   4.503   1.00 1.51 ? 6   LYS A HE3  3  
ATOM   2819  H HZ1  . LYS A 1 6  ? 12.456  7.852   2.942   1.00 1.52 ? 6   LYS A HZ1  3  
ATOM   2820  H HZ2  . LYS A 1 6  ? 14.086  7.830   3.380   1.00 1.47 ? 6   LYS A HZ2  3  
ATOM   2821  H HZ3  . LYS A 1 6  ? 13.032  8.924   4.116   1.00 1.48 ? 6   LYS A HZ3  3  
ATOM   2822  N N    . VAL A 1 7  ? 10.242  1.486   4.948   1.00 0.46 ? 7   VAL A N    3  
ATOM   2823  C CA   . VAL A 1 7  ? 10.562  0.125   4.561   1.00 0.48 ? 7   VAL A CA   3  
ATOM   2824  C C    . VAL A 1 7  ? 9.799   -0.251  3.293   1.00 0.44 ? 7   VAL A C    3  
ATOM   2825  O O    . VAL A 1 7  ? 10.361  -0.840  2.374   1.00 0.54 ? 7   VAL A O    3  
ATOM   2826  C CB   . VAL A 1 7  ? 10.228  -0.876  5.688   1.00 0.54 ? 7   VAL A CB   3  
ATOM   2827  C CG1  . VAL A 1 7  ? 10.525  -2.300  5.252   1.00 0.60 ? 7   VAL A CG1  3  
ATOM   2828  C CG2  . VAL A 1 7  ? 11.004  -0.536  6.954   1.00 0.61 ? 7   VAL A CG2  3  
ATOM   2829  H H    . VAL A 1 7  ? 9.730   1.645   5.769   1.00 0.48 ? 7   VAL A H    3  
ATOM   2830  H HA   . VAL A 1 7  ? 11.623  0.074   4.361   1.00 0.53 ? 7   VAL A HA   3  
ATOM   2831  H HB   . VAL A 1 7  ? 9.172   -0.802  5.909   1.00 0.55 ? 7   VAL A HB   3  
ATOM   2832  H HG11 . VAL A 1 7  ? 10.133  -2.459  4.259   1.00 0.73 ? 7   VAL A HG11 3  
ATOM   2833  H HG12 . VAL A 1 7  ? 10.056  -2.989  5.938   1.00 0.72 ? 7   VAL A HG12 3  
ATOM   2834  H HG13 . VAL A 1 7  ? 11.592  -2.465  5.250   1.00 0.79 ? 7   VAL A HG13 3  
ATOM   2835  H HG21 . VAL A 1 7  ? 10.668  0.414   7.341   1.00 0.75 ? 7   VAL A HG21 3  
ATOM   2836  H HG22 . VAL A 1 7  ? 12.058  -0.479  6.726   1.00 0.79 ? 7   VAL A HG22 3  
ATOM   2837  H HG23 . VAL A 1 7  ? 10.838  -1.305  7.695   1.00 0.78 ? 7   VAL A HG23 3  
ATOM   2838  N N    . ILE A 1 8  ? 8.527   0.127   3.238   1.00 0.38 ? 8   ILE A N    3  
ATOM   2839  C CA   . ILE A 1 8  ? 7.688   -0.171  2.083   1.00 0.40 ? 8   ILE A CA   3  
ATOM   2840  C C    . ILE A 1 8  ? 8.217   0.516   0.825   1.00 0.37 ? 8   ILE A C    3  
ATOM   2841  O O    . ILE A 1 8  ? 8.362   -0.125  -0.218  1.00 0.40 ? 8   ILE A O    3  
ATOM   2842  C CB   . ILE A 1 8  ? 6.217   0.248   2.320   1.00 0.47 ? 8   ILE A CB   3  
ATOM   2843  C CG1  . ILE A 1 8  ? 5.598   -0.551  3.472   1.00 0.52 ? 8   ILE A CG1  3  
ATOM   2844  C CG2  . ILE A 1 8  ? 5.389   0.065   1.054   1.00 0.56 ? 8   ILE A CG2  3  
ATOM   2845  C CD1  . ILE A 1 8  ? 5.721   -2.054  3.324   1.00 0.61 ? 8   ILE A CD1  3  
ATOM   2846  H H    . ILE A 1 8  ? 8.142   0.615   3.997   1.00 0.39 ? 8   ILE A H    3  
ATOM   2847  H HA   . ILE A 1 8  ? 7.711   -1.240  1.929   1.00 0.44 ? 8   ILE A HA   3  
ATOM   2848  H HB   . ILE A 1 8  ? 6.207   1.296   2.575   1.00 0.50 ? 8   ILE A HB   3  
ATOM   2849  H HG12 . ILE A 1 8  ? 6.080   -0.271  4.396   1.00 0.53 ? 8   ILE A HG12 3  
ATOM   2850  H HG13 . ILE A 1 8  ? 4.548   -0.312  3.536   1.00 0.59 ? 8   ILE A HG13 3  
ATOM   2851  H HG21 . ILE A 1 8  ? 4.376   0.389   1.239   1.00 0.96 ? 8   ILE A HG21 3  
ATOM   2852  H HG22 . ILE A 1 8  ? 5.387   -0.979  0.777   1.00 1.01 ? 8   ILE A HG22 3  
ATOM   2853  H HG23 . ILE A 1 8  ? 5.814   0.650   0.253   1.00 1.00 ? 8   ILE A HG23 3  
ATOM   2854  H HD11 . ILE A 1 8  ? 6.758   -2.341  3.407   1.00 0.96 ? 8   ILE A HD11 3  
ATOM   2855  H HD12 . ILE A 1 8  ? 5.340   -2.354  2.358   1.00 0.94 ? 8   ILE A HD12 3  
ATOM   2856  H HD13 . ILE A 1 8  ? 5.150   -2.539  4.102   1.00 0.97 ? 8   ILE A HD13 3  
ATOM   2857  N N    . SER A 1 9  ? 8.533   1.806   0.932   1.00 0.37 ? 9   SER A N    3  
ATOM   2858  C CA   . SER A 1 9  ? 9.036   2.562   -0.212  1.00 0.41 ? 9   SER A CA   3  
ATOM   2859  C C    . SER A 1 9  ? 10.385  2.011   -0.668  1.00 0.40 ? 9   SER A C    3  
ATOM   2860  O O    . SER A 1 9  ? 10.639  1.873   -1.866  1.00 0.46 ? 9   SER A O    3  
ATOM   2861  C CB   . SER A 1 9  ? 9.145   4.051   0.125   1.00 0.49 ? 9   SER A CB   3  
ATOM   2862  O OG   . SER A 1 9  ? 9.789   4.253   1.371   1.00 1.22 ? 9   SER A OG   3  
ATOM   2863  H H    . SER A 1 9  ? 8.441   2.258   1.803   1.00 0.39 ? 9   SER A H    3  
ATOM   2864  H HA   . SER A 1 9  ? 8.327   2.439   -1.018  1.00 0.45 ? 9   SER A HA   3  
ATOM   2865  H HB2  . SER A 1 9  ? 9.716   4.546   -0.645  1.00 1.05 ? 9   SER A HB2  3  
ATOM   2866  H HB3  . SER A 1 9  ? 8.155   4.483   0.171   1.00 1.19 ? 9   SER A HB3  3  
ATOM   2867  H HG   . SER A 1 9  ? 10.229  5.110   1.365   1.00 1.36 ? 9   SER A HG   3  
ATOM   2868  N N    . SER A 1 10 ? 11.242  1.678   0.289   1.00 0.39 ? 10  SER A N    3  
ATOM   2869  C CA   . SER A 1 10 ? 12.552  1.128   -0.024  1.00 0.43 ? 10  SER A CA   3  
ATOM   2870  C C    . SER A 1 10 ? 12.415  -0.258  -0.651  1.00 0.42 ? 10  SER A C    3  
ATOM   2871  O O    . SER A 1 10 ? 13.174  -0.620  -1.551  1.00 0.56 ? 10  SER A O    3  
ATOM   2872  C CB   . SER A 1 10 ? 13.419  1.057   1.238   1.00 0.52 ? 10  SER A CB   3  
ATOM   2873  O OG   . SER A 1 10 ? 14.789  0.869   0.916   1.00 1.17 ? 10  SER A OG   3  
ATOM   2874  H H    . SER A 1 10 ? 10.990  1.820   1.232   1.00 0.41 ? 10  SER A H    3  
ATOM   2875  H HA   . SER A 1 10 ? 13.027  1.784   -0.738  1.00 0.47 ? 10  SER A HA   3  
ATOM   2876  H HB2  . SER A 1 10 ? 13.317  1.978   1.792   1.00 0.93 ? 10  SER A HB2  3  
ATOM   2877  H HB3  . SER A 1 10 ? 13.092  0.231   1.851   1.00 1.00 ? 10  SER A HB3  3  
ATOM   2878  H HG   . SER A 1 10 ? 15.184  1.724   0.704   1.00 1.54 ? 10  SER A HG   3  
ATOM   2879  N N    . ALA A 1 11 ? 11.434  -1.020  -0.184  1.00 0.37 ? 11  ALA A N    3  
ATOM   2880  C CA   . ALA A 1 11 ? 11.196  -2.366  -0.688  1.00 0.41 ? 11  ALA A CA   3  
ATOM   2881  C C    . ALA A 1 11 ? 10.795  -2.349  -2.159  1.00 0.37 ? 11  ALA A C    3  
ATOM   2882  O O    . ALA A 1 11 ? 11.394  -3.050  -2.975  1.00 0.42 ? 11  ALA A O    3  
ATOM   2883  C CB   . ALA A 1 11 ? 10.130  -3.067  0.143   1.00 0.47 ? 11  ALA A CB   3  
ATOM   2884  H H    . ALA A 1 11 ? 10.858  -0.671  0.531   1.00 0.41 ? 11  ALA A H    3  
ATOM   2885  H HA   . ALA A 1 11 ? 12.116  -2.925  -0.586  1.00 0.47 ? 11  ALA A HA   3  
ATOM   2886  H HB1  . ALA A 1 11 ? 9.186   -2.558  0.018   1.00 0.52 ? 11  ALA A HB1  3  
ATOM   2887  H HB2  . ALA A 1 11 ? 10.414  -3.046  1.185   1.00 0.58 ? 11  ALA A HB2  3  
ATOM   2888  H HB3  . ALA A 1 11 ? 10.031  -4.092  -0.183  1.00 0.58 ? 11  ALA A HB3  3  
ATOM   2889  N N    . CYS A 1 12 ? 9.799   -1.534  -2.504  1.00 0.34 ? 12  CYS A N    3  
ATOM   2890  C CA   . CYS A 1 12 ? 9.326   -1.460  -3.885  1.00 0.37 ? 12  CYS A CA   3  
ATOM   2891  C C    . CYS A 1 12 ? 10.410  -0.938  -4.827  1.00 0.39 ? 12  CYS A C    3  
ATOM   2892  O O    . CYS A 1 12 ? 10.348  -1.157  -6.037  1.00 0.44 ? 12  CYS A O    3  
ATOM   2893  C CB   . CYS A 1 12 ? 8.060   -0.601  -3.989  1.00 0.42 ? 12  CYS A CB   3  
ATOM   2894  S SG   . CYS A 1 12 ? 8.146   0.984   -3.130  1.00 0.66 ? 12  CYS A SG   3  
ATOM   2895  H H    . CYS A 1 12 ? 9.370   -0.975  -1.815  1.00 0.35 ? 12  CYS A H    3  
ATOM   2896  H HA   . CYS A 1 12 ? 9.079   -2.466  -4.188  1.00 0.43 ? 12  CYS A HA   3  
ATOM   2897  H HB2  . CYS A 1 12 ? 7.861   -0.394  -5.031  1.00 0.63 ? 12  CYS A HB2  3  
ATOM   2898  H HB3  . CYS A 1 12 ? 7.229   -1.153  -3.576  1.00 0.63 ? 12  CYS A HB3  3  
ATOM   2899  H HG   . CYS A 1 12 ? 9.426   1.318   -3.001  1.00 1.11 ? 12  CYS A HG   3  
ATOM   2900  N N    . LYS A 1 13 ? 11.421  -0.276  -4.270  1.00 0.41 ? 13  LYS A N    3  
ATOM   2901  C CA   . LYS A 1 13 ? 12.516  0.261   -5.068  1.00 0.49 ? 13  LYS A CA   3  
ATOM   2902  C C    . LYS A 1 13 ? 13.307  -0.861  -5.735  1.00 0.49 ? 13  LYS A C    3  
ATOM   2903  O O    . LYS A 1 13 ? 13.860  -0.683  -6.816  1.00 0.58 ? 13  LYS A O    3  
ATOM   2904  C CB   . LYS A 1 13 ? 13.452  1.105   -4.203  1.00 0.63 ? 13  LYS A CB   3  
ATOM   2905  C CG   . LYS A 1 13 ? 12.941  2.513   -3.951  1.00 0.96 ? 13  LYS A CG   3  
ATOM   2906  C CD   . LYS A 1 13 ? 13.803  3.242   -2.931  1.00 1.06 ? 13  LYS A CD   3  
ATOM   2907  C CE   . LYS A 1 13 ? 14.246  4.602   -3.439  1.00 1.40 ? 13  LYS A CE   3  
ATOM   2908  N NZ   . LYS A 1 13 ? 13.836  5.689   -2.520  1.00 1.34 ? 13  LYS A NZ   3  
ATOM   2909  H H    . LYS A 1 13 ? 11.431  -0.151  -3.297  1.00 0.43 ? 13  LYS A H    3  
ATOM   2910  H HA   . LYS A 1 13 ? 12.089  0.886   -5.837  1.00 0.52 ? 13  LYS A HA   3  
ATOM   2911  H HB2  . LYS A 1 13 ? 13.582  0.614   -3.248  1.00 0.79 ? 13  LYS A HB2  3  
ATOM   2912  H HB3  . LYS A 1 13 ? 14.410  1.176   -4.695  1.00 0.85 ? 13  LYS A HB3  3  
ATOM   2913  H HG2  . LYS A 1 13 ? 12.954  3.062   -4.881  1.00 1.66 ? 13  LYS A HG2  3  
ATOM   2914  H HG3  . LYS A 1 13 ? 11.929  2.455   -3.577  1.00 1.57 ? 13  LYS A HG3  3  
ATOM   2915  H HD2  . LYS A 1 13 ? 13.232  3.381   -2.026  1.00 1.45 ? 13  LYS A HD2  3  
ATOM   2916  H HD3  . LYS A 1 13 ? 14.678  2.644   -2.717  1.00 1.68 ? 13  LYS A HD3  3  
ATOM   2917  H HE2  . LYS A 1 13 ? 15.321  4.605   -3.530  1.00 1.92 ? 13  LYS A HE2  3  
ATOM   2918  H HE3  . LYS A 1 13 ? 13.804  4.776   -4.408  1.00 1.72 ? 13  LYS A HE3  3  
ATOM   2919  H HZ1  . LYS A 1 13 ? 12.808  5.665   -2.366  1.00 1.65 ? 13  LYS A HZ1  3  
ATOM   2920  H HZ2  . LYS A 1 13 ? 14.082  6.615   -2.921  1.00 1.65 ? 13  LYS A HZ2  3  
ATOM   2921  H HZ3  . LYS A 1 13 ? 14.314  5.586   -1.602  1.00 1.73 ? 13  LYS A HZ3  3  
ATOM   2922  N N    . THR A 1 14 ? 13.344  -2.018  -5.096  1.00 0.49 ? 14  THR A N    3  
ATOM   2923  C CA   . THR A 1 14 ? 14.067  -3.156  -5.632  1.00 0.56 ? 14  THR A CA   3  
ATOM   2924  C C    . THR A 1 14 ? 13.150  -4.034  -6.490  1.00 0.54 ? 14  THR A C    3  
ATOM   2925  O O    . THR A 1 14 ? 13.565  -5.068  -7.009  1.00 0.72 ? 14  THR A O    3  
ATOM   2926  C CB   . THR A 1 14 ? 14.682  -3.993  -4.493  1.00 0.65 ? 14  THR A CB   3  
ATOM   2927  O OG1  . THR A 1 14 ? 14.919  -3.156  -3.349  1.00 0.77 ? 14  THR A OG1  3  
ATOM   2928  C CG2  . THR A 1 14 ? 15.990  -4.631  -4.936  1.00 0.83 ? 14  THR A CG2  3  
ATOM   2929  H H    . THR A 1 14 ? 12.882  -2.107  -4.235  1.00 0.48 ? 14  THR A H    3  
ATOM   2930  H HA   . THR A 1 14 ? 14.871  -2.780  -6.250  1.00 0.63 ? 14  THR A HA   3  
ATOM   2931  H HB   . THR A 1 14 ? 13.988  -4.776  -4.221  1.00 0.82 ? 14  THR A HB   3  
ATOM   2932  H HG1  . THR A 1 14 ? 15.750  -2.681  -3.466  1.00 0.99 ? 14  THR A HG1  3  
ATOM   2933  H HG21 . THR A 1 14 ? 16.649  -3.870  -5.329  1.00 1.01 ? 14  THR A HG21 3  
ATOM   2934  H HG22 . THR A 1 14 ? 15.791  -5.366  -5.702  1.00 1.11 ? 14  THR A HG22 3  
ATOM   2935  H HG23 . THR A 1 14 ? 16.460  -5.110  -4.091  1.00 1.00 ? 14  THR A HG23 3  
ATOM   2936  N N    . TYR A 1 15 ? 11.896  -3.615  -6.647  1.00 0.49 ? 15  TYR A N    3  
ATOM   2937  C CA   . TYR A 1 15 ? 10.940  -4.373  -7.446  1.00 0.54 ? 15  TYR A CA   3  
ATOM   2938  C C    . TYR A 1 15 ? 10.453  -3.556  -8.635  1.00 0.56 ? 15  TYR A C    3  
ATOM   2939  O O    . TYR A 1 15 ? 10.599  -3.966  -9.785  1.00 0.72 ? 15  TYR A O    3  
ATOM   2940  C CB   . TYR A 1 15 ? 9.746   -4.810  -6.592  1.00 0.55 ? 15  TYR A CB   3  
ATOM   2941  C CG   . TYR A 1 15 ? 10.111  -5.777  -5.484  1.00 0.60 ? 15  TYR A CG   3  
ATOM   2942  C CD1  . TYR A 1 15 ? 9.926   -5.435  -4.149  1.00 0.67 ? 15  TYR A CD1  3  
ATOM   2943  C CD2  . TYR A 1 15 ? 10.641  -7.030  -5.770  1.00 0.80 ? 15  TYR A CD2  3  
ATOM   2944  C CE1  . TYR A 1 15 ? 10.261  -6.309  -3.134  1.00 0.78 ? 15  TYR A CE1  3  
ATOM   2945  C CE2  . TYR A 1 15 ? 10.976  -7.912  -4.758  1.00 0.91 ? 15  TYR A CE2  3  
ATOM   2946  C CZ   . TYR A 1 15 ? 10.785  -7.546  -3.443  1.00 0.84 ? 15  TYR A CZ   3  
ATOM   2947  O OH   . TYR A 1 15 ? 11.120  -8.418  -2.431  1.00 1.00 ? 15  TYR A OH   3  
ATOM   2948  H H    . TYR A 1 15 ? 11.613  -2.778  -6.220  1.00 0.54 ? 15  TYR A H    3  
ATOM   2949  H HA   . TYR A 1 15 ? 11.444  -5.252  -7.815  1.00 0.62 ? 15  TYR A HA   3  
ATOM   2950  H HB2  . TYR A 1 15 ? 9.301   -3.938  -6.136  1.00 0.54 ? 15  TYR A HB2  3  
ATOM   2951  H HB3  . TYR A 1 15 ? 9.015   -5.291  -7.226  1.00 0.63 ? 15  TYR A HB3  3  
ATOM   2952  H HD1  . TYR A 1 15 ? 9.515   -4.466  -3.909  1.00 0.79 ? 15  TYR A HD1  3  
ATOM   2953  H HD2  . TYR A 1 15 ? 10.791  -7.314  -6.801  1.00 0.96 ? 15  TYR A HD2  3  
ATOM   2954  H HE1  . TYR A 1 15 ? 10.110  -6.024  -2.105  1.00 0.93 ? 15  TYR A HE1  3  
ATOM   2955  H HE2  . TYR A 1 15 ? 11.387  -8.881  -5.002  1.00 1.14 ? 15  TYR A HE2  3  
ATOM   2956  H HH   . TYR A 1 15 ? 11.896  -8.929  -2.690  1.00 1.22 ? 15  TYR A HH   3  
ATOM   2957  N N    . CYS A 1 16 ? 9.886   -2.394  -8.349  1.00 0.50 ? 16  CYS A N    3  
ATOM   2958  C CA   . CYS A 1 16 ? 9.371   -1.515  -9.388  1.00 0.55 ? 16  CYS A CA   3  
ATOM   2959  C C    . CYS A 1 16 ? 10.379  -0.413  -9.716  1.00 0.57 ? 16  CYS A C    3  
ATOM   2960  O O    . CYS A 1 16 ? 10.298  0.224   -10.769 1.00 0.88 ? 16  CYS A O    3  
ATOM   2961  C CB   . CYS A 1 16 ? 8.045   -0.907  -8.937  1.00 0.54 ? 16  CYS A CB   3  
ATOM   2962  S SG   . CYS A 1 16 ? 6.968   -2.077  -8.080  1.00 0.67 ? 16  CYS A SG   3  
ATOM   2963  H H    . CYS A 1 16 ? 9.805   -2.116  -7.410  1.00 0.50 ? 16  CYS A H    3  
ATOM   2964  H HA   . CYS A 1 16 ? 9.202   -2.111  -10.272 1.00 0.64 ? 16  CYS A HA   3  
ATOM   2965  H HB2  . CYS A 1 16 ? 8.244   -0.088  -8.261  1.00 0.56 ? 16  CYS A HB2  3  
ATOM   2966  H HB3  . CYS A 1 16 ? 7.510   -0.536  -9.799  1.00 0.63 ? 16  CYS A HB3  3  
ATOM   2967  H HG   . CYS A 1 16 ? 5.983   -2.405  -8.908  1.00 1.15 ? 16  CYS A HG   3  
ATOM   2968  N N    . GLY A 1 17 ? 11.313  -0.184  -8.800  1.00 0.49 ? 17  GLY A N    3  
ATOM   2969  C CA   . GLY A 1 17 ? 12.337  0.825   -9.007  1.00 0.56 ? 17  GLY A CA   3  
ATOM   2970  C C    . GLY A 1 17 ? 11.788  2.234   -8.996  1.00 0.52 ? 17  GLY A C    3  
ATOM   2971  O O    . GLY A 1 17 ? 11.353  2.734   -7.956  1.00 0.66 ? 17  GLY A O    3  
ATOM   2972  H H    . GLY A 1 17 ? 11.300  -0.697  -7.965  1.00 0.62 ? 17  GLY A H    3  
ATOM   2973  H HA2  . GLY A 1 17 ? 13.077  0.735   -8.227  1.00 0.65 ? 17  GLY A HA2  3  
ATOM   2974  H HA3  . GLY A 1 17 ? 12.813  0.645   -9.960  1.00 0.63 ? 17  GLY A HA3  3  
ATOM   2975  N N    . LYS A 1 18 ? 11.802  2.873   -10.157 1.00 0.50 ? 18  LYS A N    3  
ATOM   2976  C CA   . LYS A 1 18 ? 11.305  4.238   -10.285 1.00 0.56 ? 18  LYS A CA   3  
ATOM   2977  C C    . LYS A 1 18 ? 9.817   4.238   -10.613 1.00 0.53 ? 18  LYS A C    3  
ATOM   2978  O O    . LYS A 1 18 ? 9.185   5.291   -10.686 1.00 0.62 ? 18  LYS A O    3  
ATOM   2979  C CB   . LYS A 1 18 ? 12.095  5.001   -11.356 1.00 0.70 ? 18  LYS A CB   3  
ATOM   2980  C CG   . LYS A 1 18 ? 11.921  4.447   -12.762 1.00 0.81 ? 18  LYS A CG   3  
ATOM   2981  C CD   . LYS A 1 18 ? 13.187  4.607   -13.591 1.00 1.11 ? 18  LYS A CD   3  
ATOM   2982  C CE   . LYS A 1 18 ? 13.574  6.069   -13.765 1.00 1.46 ? 18  LYS A CE   3  
ATOM   2983  N NZ   . LYS A 1 18 ? 14.898  6.216   -14.427 1.00 1.82 ? 18  LYS A NZ   3  
ATOM   2984  H H    . LYS A 1 18 ? 12.162  2.417   -10.950 1.00 0.58 ? 18  LYS A H    3  
ATOM   2985  H HA   . LYS A 1 18 ? 11.444  4.728   -9.333  1.00 0.60 ? 18  LYS A HA   3  
ATOM   2986  H HB2  . LYS A 1 18 ? 11.771  6.031   -11.357 1.00 0.87 ? 18  LYS A HB2  3  
ATOM   2987  H HB3  . LYS A 1 18 ? 13.145  4.965   -11.105 1.00 0.79 ? 18  LYS A HB3  3  
ATOM   2988  H HG2  . LYS A 1 18 ? 11.677  3.398   -12.696 1.00 0.90 ? 18  LYS A HG2  3  
ATOM   2989  H HG3  . LYS A 1 18 ? 11.115  4.976   -13.246 1.00 1.06 ? 18  LYS A HG3  3  
ATOM   2990  H HD2  . LYS A 1 18 ? 13.994  4.090   -13.095 1.00 1.33 ? 18  LYS A HD2  3  
ATOM   2991  H HD3  . LYS A 1 18 ? 13.021  4.169   -14.567 1.00 1.44 ? 18  LYS A HD3  3  
ATOM   2992  H HE2  . LYS A 1 18 ? 12.827  6.558   -14.371 1.00 1.85 ? 18  LYS A HE2  3  
ATOM   2993  H HE3  . LYS A 1 18 ? 13.614  6.536   -12.790 1.00 1.67 ? 18  LYS A HE3  3  
ATOM   2994  H HZ1  . LYS A 1 18 ? 15.597  5.592   -13.974 1.00 2.13 ? 18  LYS A HZ1  3  
ATOM   2995  H HZ2  . LYS A 1 18 ? 15.229  7.198   -14.350 1.00 2.19 ? 18  LYS A HZ2  3  
ATOM   2996  H HZ3  . LYS A 1 18 ? 14.826  5.967   -15.431 1.00 2.14 ? 18  LYS A HZ3  3  
ATOM   2997  N N    . THR A 1 19 ? 9.259   3.053   -10.807 1.00 0.49 ? 19  THR A N    3  
ATOM   2998  C CA   . THR A 1 19 ? 7.845   2.926   -11.112 1.00 0.52 ? 19  THR A CA   3  
ATOM   2999  C C    . THR A 1 19 ? 7.029   2.870   -9.822  1.00 0.48 ? 19  THR A C    3  
ATOM   3000  O O    . THR A 1 19 ? 5.799   2.912   -9.848  1.00 0.62 ? 19  THR A O    3  
ATOM   3001  C CB   . THR A 1 19 ? 7.562   1.663   -11.949 1.00 0.62 ? 19  THR A CB   3  
ATOM   3002  O OG1  . THR A 1 19 ? 8.734   1.288   -12.688 1.00 0.83 ? 19  THR A OG1  3  
ATOM   3003  C CG2  . THR A 1 19 ? 6.414   1.902   -12.914 1.00 0.91 ? 19  THR A CG2  3  
ATOM   3004  H H    . THR A 1 19 ? 9.811   2.243   -10.752 1.00 0.49 ? 19  THR A H    3  
ATOM   3005  H HA   . THR A 1 19 ? 7.545   3.793   -11.684 1.00 0.60 ? 19  THR A HA   3  
ATOM   3006  H HB   . THR A 1 19 ? 7.290   0.858   -11.281 1.00 0.72 ? 19  THR A HB   3  
ATOM   3007  H HG1  . THR A 1 19 ? 9.255   0.659   -12.166 1.00 1.10 ? 19  THR A HG1  3  
ATOM   3008  H HG21 . THR A 1 19 ? 6.254   1.013   -13.507 1.00 1.10 ? 19  THR A HG21 3  
ATOM   3009  H HG22 . THR A 1 19 ? 6.656   2.730   -13.565 1.00 1.23 ? 19  THR A HG22 3  
ATOM   3010  H HG23 . THR A 1 19 ? 5.518   2.130   -12.358 1.00 1.17 ? 19  THR A HG23 3  
ATOM   3011  N N    . SER A 1 20 ? 7.727   2.768   -8.696  1.00 0.42 ? 20  SER A N    3  
ATOM   3012  C CA   . SER A 1 20 ? 7.092   2.709   -7.388  1.00 0.42 ? 20  SER A CA   3  
ATOM   3013  C C    . SER A 1 20 ? 6.432   4.046   -7.049  1.00 0.41 ? 20  SER A C    3  
ATOM   3014  O O    . SER A 1 20 ? 6.849   5.091   -7.547  1.00 0.46 ? 20  SER A O    3  
ATOM   3015  C CB   . SER A 1 20 ? 8.147   2.353   -6.339  1.00 0.46 ? 20  SER A CB   3  
ATOM   3016  O OG   . SER A 1 20 ? 9.154   1.530   -6.907  1.00 0.97 ? 20  SER A OG   3  
ATOM   3017  H H    . SER A 1 20 ? 8.702   2.732   -8.744  1.00 0.49 ? 20  SER A H    3  
ATOM   3018  H HA   . SER A 1 20 ? 6.336   1.937   -7.410  1.00 0.48 ? 20  SER A HA   3  
ATOM   3019  H HB2  . SER A 1 20 ? 8.604   3.257   -5.964  1.00 0.70 ? 20  SER A HB2  3  
ATOM   3020  H HB3  . SER A 1 20 ? 7.679   1.820   -5.524  1.00 0.81 ? 20  SER A HB3  3  
ATOM   3021  H HG   . SER A 1 20 ? 9.972   2.037   -6.982  1.00 1.21 ? 20  SER A HG   3  
ATOM   3022  N N    . PRO A 1 21 ? 5.387   4.030   -6.214  1.00 0.43 ? 21  PRO A N    3  
ATOM   3023  C CA   . PRO A 1 21 ? 4.680   5.247   -5.824  1.00 0.49 ? 21  PRO A CA   3  
ATOM   3024  C C    . PRO A 1 21 ? 5.483   6.089   -4.841  1.00 0.42 ? 21  PRO A C    3  
ATOM   3025  O O    . PRO A 1 21 ? 6.368   5.580   -4.152  1.00 0.46 ? 21  PRO A O    3  
ATOM   3026  C CB   . PRO A 1 21 ? 3.411   4.722   -5.161  1.00 0.62 ? 21  PRO A CB   3  
ATOM   3027  C CG   . PRO A 1 21 ? 3.775   3.377   -4.641  1.00 0.63 ? 21  PRO A CG   3  
ATOM   3028  C CD   . PRO A 1 21 ? 4.811   2.827   -5.584  1.00 0.50 ? 21  PRO A CD   3  
ATOM   3029  H HA   . PRO A 1 21 ? 4.425   5.846   -6.683  1.00 0.57 ? 21  PRO A HA   3  
ATOM   3030  H HB2  . PRO A 1 21 ? 3.118   5.386   -4.355  1.00 0.69 ? 21  PRO A HB2  3  
ATOM   3031  H HB3  . PRO A 1 21 ? 2.616   4.640   -5.885  1.00 0.76 ? 21  PRO A HB3  3  
ATOM   3032  H HG2  . PRO A 1 21 ? 4.181   3.468   -3.643  1.00 0.76 ? 21  PRO A HG2  3  
ATOM   3033  H HG3  . PRO A 1 21 ? 2.906   2.736   -4.637  1.00 0.81 ? 21  PRO A HG3  3  
ATOM   3034  H HD2  . PRO A 1 21 ? 5.565   2.281   -5.037  1.00 0.55 ? 21  PRO A HD2  3  
ATOM   3035  H HD3  . PRO A 1 21 ? 4.347   2.193   -6.323  1.00 0.57 ? 21  PRO A HD3  3  
ATOM   3036  N N    . SER A 1 22 ? 5.177   7.376   -4.787  1.00 0.43 ? 22  SER A N    3  
ATOM   3037  C CA   . SER A 1 22 ? 5.864   8.281   -3.883  1.00 0.43 ? 22  SER A CA   3  
ATOM   3038  C C    . SER A 1 22 ? 5.587   7.893   -2.434  1.00 0.38 ? 22  SER A C    3  
ATOM   3039  O O    . SER A 1 22 ? 4.494   7.416   -2.109  1.00 0.39 ? 22  SER A O    3  
ATOM   3040  C CB   . SER A 1 22 ? 5.410   9.714   -4.146  1.00 0.56 ? 22  SER A CB   3  
ATOM   3041  O OG   . SER A 1 22 ? 5.262   9.943   -5.538  1.00 1.11 ? 22  SER A OG   3  
ATOM   3042  H H    . SER A 1 22 ? 4.472   7.729   -5.372  1.00 0.53 ? 22  SER A H    3  
ATOM   3043  H HA   . SER A 1 22 ? 6.923   8.203   -4.073  1.00 0.47 ? 22  SER A HA   3  
ATOM   3044  H HB2  . SER A 1 22 ? 4.461   9.886   -3.660  1.00 0.96 ? 22  SER A HB2  3  
ATOM   3045  H HB3  . SER A 1 22 ? 6.147   10.401  -3.755  1.00 0.81 ? 22  SER A HB3  3  
ATOM   3046  H HG   . SER A 1 22 ? 6.088   9.717   -5.987  1.00 1.48 ? 22  SER A HG   3  
ATOM   3047  N N    . LYS A 1 23 ? 6.567   8.099   -1.567  1.00 0.44 ? 23  LYS A N    3  
ATOM   3048  C CA   . LYS A 1 23 ? 6.428   7.765   -0.158  1.00 0.50 ? 23  LYS A CA   3  
ATOM   3049  C C    . LYS A 1 23 ? 5.263   8.530   0.466   1.00 0.42 ? 23  LYS A C    3  
ATOM   3050  O O    . LYS A 1 23 ? 4.505   7.982   1.269   1.00 0.42 ? 23  LYS A O    3  
ATOM   3051  C CB   . LYS A 1 23 ? 7.731   8.077   0.572   1.00 0.69 ? 23  LYS A CB   3  
ATOM   3052  C CG   . LYS A 1 23 ? 7.656   7.907   2.076   1.00 0.63 ? 23  LYS A CG   3  
ATOM   3053  C CD   . LYS A 1 23 ? 8.552   8.912   2.776   1.00 1.12 ? 23  LYS A CD   3  
ATOM   3054  C CE   . LYS A 1 23 ? 7.993   10.323  2.669   1.00 1.17 ? 23  LYS A CE   3  
ATOM   3055  N NZ   . LYS A 1 23 ? 9.062   11.334  2.469   1.00 1.60 ? 23  LYS A NZ   3  
ATOM   3056  H H    . LYS A 1 23 ? 7.419   8.489   -1.882  1.00 0.50 ? 23  LYS A H    3  
ATOM   3057  H HA   . LYS A 1 23 ? 6.227   6.706   -0.086  1.00 0.56 ? 23  LYS A HA   3  
ATOM   3058  H HB2  . LYS A 1 23 ? 8.501   7.421   0.196   1.00 1.00 ? 23  LYS A HB2  3  
ATOM   3059  H HB3  . LYS A 1 23 ? 8.010   9.097   0.360   1.00 1.02 ? 23  LYS A HB3  3  
ATOM   3060  H HG2  . LYS A 1 23 ? 6.637   8.059   2.401   1.00 0.92 ? 23  LYS A HG2  3  
ATOM   3061  H HG3  . LYS A 1 23 ? 7.976   6.910   2.336   1.00 0.87 ? 23  LYS A HG3  3  
ATOM   3062  H HD2  . LYS A 1 23 ? 8.632   8.641   3.818   1.00 1.72 ? 23  LYS A HD2  3  
ATOM   3063  H HD3  . LYS A 1 23 ? 9.530   8.885   2.319   1.00 1.84 ? 23  LYS A HD3  3  
ATOM   3064  H HE2  . LYS A 1 23 ? 7.313   10.364  1.834   1.00 1.51 ? 23  LYS A HE2  3  
ATOM   3065  H HE3  . LYS A 1 23 ? 7.458   10.552  3.578   1.00 1.35 ? 23  LYS A HE3  3  
ATOM   3066  H HZ1  . LYS A 1 23 ? 9.207   11.508  1.453   1.00 2.03 ? 23  LYS A HZ1  3  
ATOM   3067  H HZ2  . LYS A 1 23 ? 9.955   10.998  2.875   1.00 1.91 ? 23  LYS A HZ2  3  
ATOM   3068  H HZ3  . LYS A 1 23 ? 8.802   12.228  2.926   1.00 2.03 ? 23  LYS A HZ3  3  
ATOM   3069  N N    . LYS A 1 24 ? 5.111   9.792   0.069   1.00 0.41 ? 24  LYS A N    3  
ATOM   3070  C CA   . LYS A 1 24 ? 4.033   10.639  0.579   1.00 0.45 ? 24  LYS A CA   3  
ATOM   3071  C C    . LYS A 1 24 ? 2.670   10.036  0.246   1.00 0.40 ? 24  LYS A C    3  
ATOM   3072  O O    . LYS A 1 24 ? 1.717   10.160  1.016   1.00 0.48 ? 24  LYS A O    3  
ATOM   3073  C CB   . LYS A 1 24 ? 4.118   12.052  -0.008  1.00 0.56 ? 24  LYS A CB   3  
ATOM   3074  C CG   . LYS A 1 24 ? 5.537   12.546  -0.243  1.00 0.83 ? 24  LYS A CG   3  
ATOM   3075  C CD   . LYS A 1 24 ? 5.573   14.055  -0.444  1.00 1.00 ? 24  LYS A CD   3  
ATOM   3076  C CE   . LYS A 1 24 ? 6.762   14.486  -1.291  1.00 1.56 ? 24  LYS A CE   3  
ATOM   3077  N NZ   . LYS A 1 24 ? 8.058   14.062  -0.702  1.00 2.04 ? 24  LYS A NZ   3  
ATOM   3078  H H    . LYS A 1 24 ? 5.752   10.167  -0.572  1.00 0.44 ? 24  LYS A H    3  
ATOM   3079  H HA   . LYS A 1 24 ? 4.136   10.698  1.652   1.00 0.51 ? 24  LYS A HA   3  
ATOM   3080  H HB2  . LYS A 1 24 ? 3.596   12.064  -0.952  1.00 0.63 ? 24  LYS A HB2  3  
ATOM   3081  H HB3  . LYS A 1 24 ? 3.631   12.738  0.670   1.00 0.77 ? 24  LYS A HB3  3  
ATOM   3082  H HG2  . LYS A 1 24 ? 6.142   12.292  0.615   1.00 1.37 ? 24  LYS A HG2  3  
ATOM   3083  H HG3  . LYS A 1 24 ? 5.937   12.065  -1.123  1.00 1.33 ? 24  LYS A HG3  3  
ATOM   3084  H HD2  . LYS A 1 24 ? 4.664   14.364  -0.936  1.00 1.50 ? 24  LYS A HD2  3  
ATOM   3085  H HD3  . LYS A 1 24 ? 5.639   14.535  0.521   1.00 1.29 ? 24  LYS A HD3  3  
ATOM   3086  H HE2  . LYS A 1 24 ? 6.665   14.045  -2.271  1.00 1.84 ? 24  LYS A HE2  3  
ATOM   3087  H HE3  . LYS A 1 24 ? 6.752   15.562  -1.380  1.00 2.19 ? 24  LYS A HE3  3  
ATOM   3088  H HZ1  . LYS A 1 24 ? 8.492   13.320  -1.288  1.00 2.22 ? 24  LYS A HZ1  3  
ATOM   3089  H HZ2  . LYS A 1 24 ? 7.914   13.681  0.253   1.00 2.45 ? 24  LYS A HZ2  3  
ATOM   3090  H HZ3  . LYS A 1 24 ? 8.715   14.869  -0.645  1.00 2.55 ? 24  LYS A HZ3  3  
ATOM   3091  N N    . GLU A 1 25 ? 2.594   9.383   -0.905  1.00 0.34 ? 25  GLU A N    3  
ATOM   3092  C CA   . GLU A 1 25 ? 1.363   8.753   -1.356  1.00 0.37 ? 25  GLU A CA   3  
ATOM   3093  C C    . GLU A 1 25 ? 1.042   7.534   -0.497  1.00 0.31 ? 25  GLU A C    3  
ATOM   3094  O O    . GLU A 1 25 ? -0.108  7.313   -0.114  1.00 0.34 ? 25  GLU A O    3  
ATOM   3095  C CB   . GLU A 1 25 ? 1.506   8.343   -2.821  1.00 0.45 ? 25  GLU A CB   3  
ATOM   3096  C CG   . GLU A 1 25 ? 0.209   8.392   -3.610  1.00 0.90 ? 25  GLU A CG   3  
ATOM   3097  C CD   . GLU A 1 25 ? 0.412   8.033   -5.065  1.00 1.00 ? 25  GLU A CD   3  
ATOM   3098  O OE1  . GLU A 1 25 ? 1.030   8.837   -5.798  1.00 1.30 ? 25  GLU A OE1  3  
ATOM   3099  O OE2  . GLU A 1 25 ? -0.043  6.947   -5.486  1.00 1.58 ? 25  GLU A OE2  3  
ATOM   3100  H H    . GLU A 1 25 ? 3.392   9.321   -1.469  1.00 0.36 ? 25  GLU A H    3  
ATOM   3101  H HA   . GLU A 1 25 ? 0.563   9.471   -1.263  1.00 0.42 ? 25  GLU A HA   3  
ATOM   3102  H HB2  . GLU A 1 25 ? 2.212   9.006   -3.297  1.00 0.97 ? 25  GLU A HB2  3  
ATOM   3103  H HB3  . GLU A 1 25 ? 1.890   7.335   -2.860  1.00 0.87 ? 25  GLU A HB3  3  
ATOM   3104  H HG2  . GLU A 1 25 ? -0.491  7.694   -3.175  1.00 1.42 ? 25  GLU A HG2  3  
ATOM   3105  H HG3  . GLU A 1 25 ? -0.195  9.391   -3.553  1.00 1.47 ? 25  GLU A HG3  3  
ATOM   3106  N N    . ILE A 1 26 ? 2.077   6.753   -0.190  1.00 0.29 ? 26  ILE A N    3  
ATOM   3107  C CA   . ILE A 1 26 ? 1.926   5.557   0.629   1.00 0.29 ? 26  ILE A CA   3  
ATOM   3108  C C    . ILE A 1 26 ? 1.437   5.933   2.026   1.00 0.27 ? 26  ILE A C    3  
ATOM   3109  O O    . ILE A 1 26 ? 0.598   5.244   2.611   1.00 0.28 ? 26  ILE A O    3  
ATOM   3110  C CB   . ILE A 1 26 ? 3.257   4.777   0.742   1.00 0.33 ? 26  ILE A CB   3  
ATOM   3111  C CG1  . ILE A 1 26 ? 3.802   4.440   -0.652  1.00 0.36 ? 26  ILE A CG1  3  
ATOM   3112  C CG2  . ILE A 1 26 ? 3.066   3.505   1.558   1.00 0.41 ? 26  ILE A CG2  3  
ATOM   3113  C CD1  . ILE A 1 26 ? 5.189   3.831   -0.636  1.00 0.45 ? 26  ILE A CD1  3  
ATOM   3114  H H    . ILE A 1 26 ? 2.968   6.991   -0.530  1.00 0.30 ? 26  ILE A H    3  
ATOM   3115  H HA   . ILE A 1 26 ? 1.191   4.918   0.160   1.00 0.32 ? 26  ILE A HA   3  
ATOM   3116  H HB   . ILE A 1 26 ? 3.970   5.402   1.259   1.00 0.34 ? 26  ILE A HB   3  
ATOM   3117  H HG12 . ILE A 1 26 ? 3.138   3.736   -1.130  1.00 0.44 ? 26  ILE A HG12 3  
ATOM   3118  H HG13 . ILE A 1 26 ? 3.845   5.344   -1.242  1.00 0.35 ? 26  ILE A HG13 3  
ATOM   3119  H HG21 . ILE A 1 26 ? 2.774   3.762   2.566   1.00 0.52 ? 26  ILE A HG21 3  
ATOM   3120  H HG22 . ILE A 1 26 ? 3.992   2.950   1.584   1.00 0.53 ? 26  ILE A HG22 3  
ATOM   3121  H HG23 . ILE A 1 26 ? 2.296   2.900   1.103   1.00 0.54 ? 26  ILE A HG23 3  
ATOM   3122  H HD11 . ILE A 1 26 ? 5.514   3.645   -1.649  1.00 0.90 ? 26  ILE A HD11 3  
ATOM   3123  H HD12 . ILE A 1 26 ? 5.169   2.899   -0.087  1.00 0.91 ? 26  ILE A HD12 3  
ATOM   3124  H HD13 . ILE A 1 26 ? 5.875   4.513   -0.158  1.00 0.92 ? 26  ILE A HD13 3  
ATOM   3125  N N    . GLY A 1 27 ? 1.956   7.047   2.538   1.00 0.27 ? 27  GLY A N    3  
ATOM   3126  C CA   . GLY A 1 27 ? 1.570   7.516   3.856   1.00 0.29 ? 27  GLY A CA   3  
ATOM   3127  C C    . GLY A 1 27 ? 0.086   7.814   3.947   1.00 0.28 ? 27  GLY A C    3  
ATOM   3128  O O    . GLY A 1 27 ? -0.558  7.501   4.949   1.00 0.32 ? 27  GLY A O    3  
ATOM   3129  H H    . GLY A 1 27 ? 2.617   7.553   2.015   1.00 0.28 ? 27  GLY A H    3  
ATOM   3130  H HA2  . GLY A 1 27 ? 1.820   6.757   4.584   1.00 0.32 ? 27  GLY A HA2  3  
ATOM   3131  H HA3  . GLY A 1 27 ? 2.123   8.414   4.084   1.00 0.33 ? 27  GLY A HA3  3  
ATOM   3132  N N    . ALA A 1 28 ? -0.460  8.404   2.890   1.00 0.27 ? 28  ALA A N    3  
ATOM   3133  C CA   . ALA A 1 28 ? -1.876  8.738   2.847   1.00 0.30 ? 28  ALA A CA   3  
ATOM   3134  C C    . ALA A 1 28 ? -2.722  7.471   2.757   1.00 0.29 ? 28  ALA A C    3  
ATOM   3135  O O    . ALA A 1 28 ? -3.740  7.340   3.439   1.00 0.32 ? 28  ALA A O    3  
ATOM   3136  C CB   . ALA A 1 28 ? -2.166  9.656   1.667   1.00 0.35 ? 28  ALA A CB   3  
ATOM   3137  H H    . ALA A 1 28 ? 0.106   8.625   2.120   1.00 0.27 ? 28  ALA A H    3  
ATOM   3138  H HA   . ALA A 1 28 ? -2.124  9.264   3.757   1.00 0.34 ? 28  ALA A HA   3  
ATOM   3139  H HB1  . ALA A 1 28 ? -1.513  10.516  1.709   1.00 0.47 ? 28  ALA A HB1  3  
ATOM   3140  H HB2  . ALA A 1 28 ? -3.194  9.981   1.707   1.00 0.50 ? 28  ALA A HB2  3  
ATOM   3141  H HB3  . ALA A 1 28 ? -1.993  9.118   0.747   1.00 0.45 ? 28  ALA A HB3  3  
ATOM   3142  N N    . MET A 1 29 ? -2.280  6.540   1.913   1.00 0.27 ? 29  MET A N    3  
ATOM   3143  C CA   . MET A 1 29 ? -2.972  5.269   1.721   1.00 0.30 ? 29  MET A CA   3  
ATOM   3144  C C    . MET A 1 29 ? -3.070  4.506   3.038   1.00 0.28 ? 29  MET A C    3  
ATOM   3145  O O    . MET A 1 29 ? -4.106  3.917   3.354   1.00 0.31 ? 29  MET A O    3  
ATOM   3146  C CB   . MET A 1 29 ? -2.231  4.422   0.684   1.00 0.34 ? 29  MET A CB   3  
ATOM   3147  C CG   . MET A 1 29 ? -2.860  3.062   0.445   1.00 0.40 ? 29  MET A CG   3  
ATOM   3148  S SD   . MET A 1 29 ? -1.683  1.867   -0.213  1.00 0.49 ? 29  MET A SD   3  
ATOM   3149  C CE   . MET A 1 29 ? -0.674  1.546   1.233   1.00 0.52 ? 29  MET A CE   3  
ATOM   3150  H H    . MET A 1 29 ? -1.461  6.718   1.399   1.00 0.27 ? 29  MET A H    3  
ATOM   3151  H HA   . MET A 1 29 ? -3.968  5.477   1.361   1.00 0.34 ? 29  MET A HA   3  
ATOM   3152  H HB2  . MET A 1 29 ? -2.216  4.956   -0.255  1.00 0.38 ? 29  MET A HB2  3  
ATOM   3153  H HB3  . MET A 1 29 ? -1.213  4.272   1.017   1.00 0.34 ? 29  MET A HB3  3  
ATOM   3154  H HG2  . MET A 1 29 ? -3.244  2.688   1.384   1.00 0.40 ? 29  MET A HG2  3  
ATOM   3155  H HG3  . MET A 1 29 ? -3.672  3.173   -0.258  1.00 0.49 ? 29  MET A HG3  3  
ATOM   3156  H HE1  . MET A 1 29 ? -0.174  2.454   1.532   1.00 0.81 ? 29  MET A HE1  3  
ATOM   3157  H HE2  . MET A 1 29 ? 0.063   0.791   0.997   1.00 0.89 ? 29  MET A HE2  3  
ATOM   3158  H HE3  . MET A 1 29 ? -1.302  1.199   2.041   1.00 0.86 ? 29  MET A HE3  3  
ATOM   3159  N N    . LEU A 1 30 ? -1.988  4.539   3.805   1.00 0.29 ? 30  LEU A N    3  
ATOM   3160  C CA   . LEU A 1 30 ? -1.922  3.857   5.090   1.00 0.32 ? 30  LEU A CA   3  
ATOM   3161  C C    . LEU A 1 30 ? -3.019  4.360   6.023   1.00 0.30 ? 30  LEU A C    3  
ATOM   3162  O O    . LEU A 1 30 ? -3.753  3.570   6.619   1.00 0.33 ? 30  LEU A O    3  
ATOM   3163  C CB   . LEU A 1 30 ? -0.549  4.081   5.723   1.00 0.39 ? 30  LEU A CB   3  
ATOM   3164  C CG   . LEU A 1 30 ? -0.048  2.951   6.629   1.00 0.78 ? 30  LEU A CG   3  
ATOM   3165  C CD1  . LEU A 1 30 ? 0.182   1.679   5.825   1.00 1.32 ? 30  LEU A CD1  3  
ATOM   3166  C CD2  . LEU A 1 30 ? 1.229   3.371   7.341   1.00 1.04 ? 30  LEU A CD2  3  
ATOM   3167  H H    . LEU A 1 30 ? -1.201  5.038   3.491   1.00 0.29 ? 30  LEU A H    3  
ATOM   3168  H HA   . LEU A 1 30 ? -2.066  2.803   4.918   1.00 0.36 ? 30  LEU A HA   3  
ATOM   3169  H HB2  . LEU A 1 30 ? 0.167   4.222   4.928   1.00 0.71 ? 30  LEU A HB2  3  
ATOM   3170  H HB3  . LEU A 1 30 ? -0.594  4.988   6.310   1.00 0.65 ? 30  LEU A HB3  3  
ATOM   3171  H HG   . LEU A 1 30 ? -0.797  2.740   7.379   1.00 1.11 ? 30  LEU A HG   3  
ATOM   3172  H HD11 . LEU A 1 30 ? 0.813   1.899   4.977   1.00 1.67 ? 30  LEU A HD11 3  
ATOM   3173  H HD12 . LEU A 1 30 ? -0.766  1.294   5.479   1.00 1.61 ? 30  LEU A HD12 3  
ATOM   3174  H HD13 . LEU A 1 30 ? 0.661   0.939   6.450   1.00 1.72 ? 30  LEU A HD13 3  
ATOM   3175  H HD21 . LEU A 1 30 ? 1.565   2.573   7.987   1.00 1.49 ? 30  LEU A HD21 3  
ATOM   3176  H HD22 . LEU A 1 30 ? 1.038   4.253   7.932   1.00 1.30 ? 30  LEU A HD22 3  
ATOM   3177  H HD23 . LEU A 1 30 ? 1.994   3.587   6.610   1.00 1.27 ? 30  LEU A HD23 3  
ATOM   3178  N N    . SER A 1 31 ? -3.130  5.678   6.136   1.00 0.29 ? 31  SER A N    3  
ATOM   3179  C CA   . SER A 1 31 ? -4.141  6.292   6.987   1.00 0.32 ? 31  SER A CA   3  
ATOM   3180  C C    . SER A 1 31 ? -5.549  5.962   6.494   1.00 0.28 ? 31  SER A C    3  
ATOM   3181  O O    . SER A 1 31 ? -6.448  5.682   7.291   1.00 0.29 ? 31  SER A O    3  
ATOM   3182  C CB   . SER A 1 31 ? -3.941  7.807   7.015   1.00 0.40 ? 31  SER A CB   3  
ATOM   3183  O OG   . SER A 1 31 ? -2.604  8.139   7.351   1.00 1.20 ? 31  SER A OG   3  
ATOM   3184  H H    . SER A 1 31 ? -2.510  6.256   5.639   1.00 0.31 ? 31  SER A H    3  
ATOM   3185  H HA   . SER A 1 31 ? -4.019  5.900   7.986   1.00 0.36 ? 31  SER A HA   3  
ATOM   3186  H HB2  . SER A 1 31 ? -4.167  8.214   6.040   1.00 0.94 ? 31  SER A HB2  3  
ATOM   3187  H HB3  . SER A 1 31 ? -4.602  8.242   7.748   1.00 1.08 ? 31  SER A HB3  3  
ATOM   3188  H HG   . SER A 1 31 ? -2.497  8.085   8.309   1.00 1.76 ? 31  SER A HG   3  
ATOM   3189  N N    . LEU A 1 32 ? -5.728  5.981   5.176   1.00 0.27 ? 32  LEU A N    3  
ATOM   3190  C CA   . LEU A 1 32 ? -7.021  5.692   4.567   1.00 0.29 ? 32  LEU A CA   3  
ATOM   3191  C C    . LEU A 1 32 ? -7.492  4.285   4.914   1.00 0.26 ? 32  LEU A C    3  
ATOM   3192  O O    . LEU A 1 32 ? -8.624  4.093   5.351   1.00 0.29 ? 32  LEU A O    3  
ATOM   3193  C CB   . LEU A 1 32 ? -6.940  5.856   3.047   1.00 0.35 ? 32  LEU A CB   3  
ATOM   3194  C CG   . LEU A 1 32 ? -7.690  7.062   2.477   1.00 0.67 ? 32  LEU A CG   3  
ATOM   3195  C CD1  . LEU A 1 32 ? -9.185  6.935   2.722   1.00 1.15 ? 32  LEU A CD1  3  
ATOM   3196  C CD2  . LEU A 1 32 ? -7.152  8.352   3.074   1.00 1.17 ? 32  LEU A CD2  3  
ATOM   3197  H H    . LEU A 1 32 ? -4.967  6.200   4.596   1.00 0.29 ? 32  LEU A H    3  
ATOM   3198  H HA   . LEU A 1 32 ? -7.736  6.400   4.957   1.00 0.32 ? 32  LEU A HA   3  
ATOM   3199  H HB2  . LEU A 1 32 ? -5.899  5.943   2.772   1.00 0.51 ? 32  LEU A HB2  3  
ATOM   3200  H HB3  . LEU A 1 32 ? -7.342  4.965   2.589   1.00 0.56 ? 32  LEU A HB3  3  
ATOM   3201  H HG   . LEU A 1 32 ? -7.533  7.100   1.412   1.00 0.58 ? 32  LEU A HG   3  
ATOM   3202  H HD11 . LEU A 1 32 ? -9.546  6.014   2.289   1.00 1.26 ? 32  LEU A HD11 3  
ATOM   3203  H HD12 . LEU A 1 32 ? -9.697  7.771   2.265   1.00 1.47 ? 32  LEU A HD12 3  
ATOM   3204  H HD13 . LEU A 1 32 ? -9.378  6.932   3.784   1.00 1.37 ? 32  LEU A HD13 3  
ATOM   3205  H HD21 . LEU A 1 32 ? -7.762  9.182   2.747   1.00 1.52 ? 32  LEU A HD21 3  
ATOM   3206  H HD22 . LEU A 1 32 ? -6.134  8.503   2.747   1.00 1.23 ? 32  LEU A HD22 3  
ATOM   3207  H HD23 . LEU A 1 32 ? -7.177  8.291   4.152   1.00 1.41 ? 32  LEU A HD23 3  
ATOM   3208  N N    . LEU A 1 33 ? -6.610  3.309   4.744   1.00 0.27 ? 33  LEU A N    3  
ATOM   3209  C CA   . LEU A 1 33 ? -6.941  1.917   5.031   1.00 0.31 ? 33  LEU A CA   3  
ATOM   3210  C C    . LEU A 1 33 ? -7.227  1.710   6.516   1.00 0.27 ? 33  LEU A C    3  
ATOM   3211  O O    . LEU A 1 33 ? -8.065  0.892   6.889   1.00 0.33 ? 33  LEU A O    3  
ATOM   3212  C CB   . LEU A 1 33 ? -5.807  0.999   4.572   1.00 0.41 ? 33  LEU A CB   3  
ATOM   3213  C CG   . LEU A 1 33 ? -5.482  1.064   3.079   1.00 0.49 ? 33  LEU A CG   3  
ATOM   3214  C CD1  . LEU A 1 33 ? -4.347  0.113   2.741   1.00 0.61 ? 33  LEU A CD1  3  
ATOM   3215  C CD2  . LEU A 1 33 ? -6.713  0.744   2.245   1.00 0.68 ? 33  LEU A CD2  3  
ATOM   3216  H H    . LEU A 1 33 ? -5.709  3.529   4.415   1.00 0.29 ? 33  LEU A H    3  
ATOM   3217  H HA   . LEU A 1 33 ? -7.833  1.671   4.472   1.00 0.35 ? 33  LEU A HA   3  
ATOM   3218  H HB2  . LEU A 1 33 ? -4.914  1.261   5.124   1.00 0.42 ? 33  LEU A HB2  3  
ATOM   3219  H HB3  . LEU A 1 33 ? -6.075  -0.018  4.815   1.00 0.50 ? 33  LEU A HB3  3  
ATOM   3220  H HG   . LEU A 1 33 ? -5.163  2.067   2.833   1.00 0.46 ? 33  LEU A HG   3  
ATOM   3221  H HD11 . LEU A 1 33 ? -4.145  0.157   1.681   1.00 1.08 ? 33  LEU A HD11 3  
ATOM   3222  H HD12 . LEU A 1 33 ? -4.627  -0.895  3.013   1.00 1.05 ? 33  LEU A HD12 3  
ATOM   3223  H HD13 . LEU A 1 33 ? -3.462  0.401   3.289   1.00 1.03 ? 33  LEU A HD13 3  
ATOM   3224  H HD21 . LEU A 1 33 ? -7.433  1.541   2.351   1.00 1.04 ? 33  LEU A HD21 3  
ATOM   3225  H HD22 . LEU A 1 33 ? -7.148  -0.181  2.591   1.00 0.99 ? 33  LEU A HD22 3  
ATOM   3226  H HD23 . LEU A 1 33 ? -6.433  0.646   1.206   1.00 0.89 ? 33  LEU A HD23 3  
ATOM   3227  N N    . GLN A 1 34 ? -6.537  2.461   7.360   1.00 0.26 ? 34  GLN A N    3  
ATOM   3228  C CA   . GLN A 1 34 ? -6.726  2.353   8.797   1.00 0.31 ? 34  GLN A CA   3  
ATOM   3229  C C    . GLN A 1 34 ? -8.050  2.977   9.230   1.00 0.29 ? 34  GLN A C    3  
ATOM   3230  O O    . GLN A 1 34 ? -8.803  2.376   9.994   1.00 0.38 ? 34  GLN A O    3  
ATOM   3231  C CB   . GLN A 1 34 ? -5.570  3.016   9.540   1.00 0.42 ? 34  GLN A CB   3  
ATOM   3232  C CG   . GLN A 1 34 ? -4.441  2.058   9.876   1.00 0.72 ? 34  GLN A CG   3  
ATOM   3233  C CD   . GLN A 1 34 ? -3.312  2.726   10.632  1.00 1.04 ? 34  GLN A CD   3  
ATOM   3234  O OE1  . GLN A 1 34 ? -2.348  3.206   10.039  1.00 1.62 ? 34  GLN A OE1  3  
ATOM   3235  N NE2  . GLN A 1 34 ? -3.422  2.762   11.949  1.00 1.51 ? 34  GLN A NE2  3  
ATOM   3236  H H    . GLN A 1 34 ? -5.880  3.100   7.008   1.00 0.29 ? 34  GLN A H    3  
ATOM   3237  H HA   . GLN A 1 34 ? -6.744  1.303   9.047   1.00 0.36 ? 34  GLN A HA   3  
ATOM   3238  H HB2  . GLN A 1 34 ? -5.170  3.808   8.924   1.00 0.67 ? 34  GLN A HB2  3  
ATOM   3239  H HB3  . GLN A 1 34 ? -5.943  3.439   10.460  1.00 0.61 ? 34  GLN A HB3  3  
ATOM   3240  H HG2  . GLN A 1 34 ? -4.837  1.258   10.483  1.00 1.27 ? 34  GLN A HG2  3  
ATOM   3241  H HG3  . GLN A 1 34 ? -4.049  1.651   8.955   1.00 1.25 ? 34  GLN A HG3  3  
ATOM   3242  H HE21 . GLN A 1 34 ? -4.215  2.359   12.360  1.00 1.73 ? 34  GLN A HE21 3  
ATOM   3243  H HE22 . GLN A 1 34 ? -2.705  3.190   12.465  1.00 1.94 ? 34  GLN A HE22 3  
ATOM   3244  N N    . LYS A 1 35 ? -8.341  4.173   8.728   1.00 0.29 ? 35  LYS A N    3  
ATOM   3245  C CA   . LYS A 1 35 ? -9.571  4.870   9.086   1.00 0.37 ? 35  LYS A CA   3  
ATOM   3246  C C    . LYS A 1 35 ? -10.803 4.156   8.524   1.00 0.32 ? 35  LYS A C    3  
ATOM   3247  O O    . LYS A 1 35 ? -11.903 4.290   9.057   1.00 0.36 ? 35  LYS A O    3  
ATOM   3248  C CB   . LYS A 1 35 ? -9.526  6.328   8.610   1.00 0.50 ? 35  LYS A CB   3  
ATOM   3249  C CG   . LYS A 1 35 ? -9.920  6.528   7.154   1.00 0.67 ? 35  LYS A CG   3  
ATOM   3250  C CD   . LYS A 1 35 ? -9.936  8.004   6.780   1.00 0.77 ? 35  LYS A CD   3  
ATOM   3251  C CE   . LYS A 1 35 ? -10.837 8.270   5.581   1.00 1.00 ? 35  LYS A CE   3  
ATOM   3252  N NZ   . LYS A 1 35 ? -11.972 9.164   5.933   1.00 1.37 ? 35  LYS A NZ   3  
ATOM   3253  H H    . LYS A 1 35 ? -7.709  4.603   8.105   1.00 0.33 ? 35  LYS A H    3  
ATOM   3254  H HA   . LYS A 1 35 ? -9.639  4.862   10.162  1.00 0.45 ? 35  LYS A HA   3  
ATOM   3255  H HB2  . LYS A 1 35 ? -10.198 6.912   9.222   1.00 0.88 ? 35  LYS A HB2  3  
ATOM   3256  H HB3  . LYS A 1 35 ? -8.520  6.704   8.740   1.00 1.00 ? 35  LYS A HB3  3  
ATOM   3257  H HG2  . LYS A 1 35 ? -9.205  6.015   6.527   1.00 1.20 ? 35  LYS A HG2  3  
ATOM   3258  H HG3  . LYS A 1 35 ? -10.905 6.113   6.998   1.00 1.10 ? 35  LYS A HG3  3  
ATOM   3259  H HD2  . LYS A 1 35 ? -10.299 8.576   7.622   1.00 1.19 ? 35  LYS A HD2  3  
ATOM   3260  H HD3  . LYS A 1 35 ? -8.929  8.317   6.539   1.00 1.15 ? 35  LYS A HD3  3  
ATOM   3261  H HE2  . LYS A 1 35 ? -10.252 8.736   4.802   1.00 1.52 ? 35  LYS A HE2  3  
ATOM   3262  H HE3  . LYS A 1 35 ? -11.228 7.328   5.222   1.00 1.60 ? 35  LYS A HE3  3  
ATOM   3263  H HZ1  . LYS A 1 35 ? -12.511 8.762   6.727   1.00 1.85 ? 35  LYS A HZ1  3  
ATOM   3264  H HZ2  . LYS A 1 35 ? -12.607 9.275   5.118   1.00 1.75 ? 35  LYS A HZ2  3  
ATOM   3265  H HZ3  . LYS A 1 35 ? -11.617 10.104  6.208   1.00 1.76 ? 35  LYS A HZ3  3  
ATOM   3266  N N    . GLU A 1 36 ? -10.615 3.395   7.450   1.00 0.29 ? 36  GLU A N    3  
ATOM   3267  C CA   . GLU A 1 36 ? -11.717 2.666   6.839   1.00 0.31 ? 36  GLU A CA   3  
ATOM   3268  C C    . GLU A 1 36 ? -12.032 1.389   7.612   1.00 0.29 ? 36  GLU A C    3  
ATOM   3269  O O    . GLU A 1 36 ? -13.032 0.718   7.346   1.00 0.39 ? 36  GLU A O    3  
ATOM   3270  C CB   . GLU A 1 36 ? -11.400 2.336   5.381   1.00 0.37 ? 36  GLU A CB   3  
ATOM   3271  C CG   . GLU A 1 36 ? -12.140 3.222   4.392   1.00 0.43 ? 36  GLU A CG   3  
ATOM   3272  C CD   . GLU A 1 36 ? -13.642 3.196   4.609   1.00 0.64 ? 36  GLU A CD   3  
ATOM   3273  O OE1  . GLU A 1 36 ? -14.160 4.064   5.347   1.00 1.30 ? 36  GLU A OE1  3  
ATOM   3274  O OE2  . GLU A 1 36 ? -14.313 2.300   4.052   1.00 1.21 ? 36  GLU A OE2  3  
ATOM   3275  H H    . GLU A 1 36 ? -9.722  3.338   7.049   1.00 0.32 ? 36  GLU A H    3  
ATOM   3276  H HA   . GLU A 1 36 ? -12.587 3.305   6.867   1.00 0.38 ? 36  GLU A HA   3  
ATOM   3277  H HB2  . GLU A 1 36 ? -10.337 2.456   5.217   1.00 0.40 ? 36  GLU A HB2  3  
ATOM   3278  H HB3  . GLU A 1 36 ? -11.671 1.309   5.185   1.00 0.47 ? 36  GLU A HB3  3  
ATOM   3279  H HG2  . GLU A 1 36 ? -11.791 4.237   4.503   1.00 0.46 ? 36  GLU A HG2  3  
ATOM   3280  H HG3  . GLU A 1 36 ? -11.928 2.877   3.390   1.00 0.50 ? 36  GLU A HG3  3  
ATOM   3281  N N    . GLY A 1 37 ? -11.185 1.063   8.577   1.00 0.27 ? 37  GLY A N    3  
ATOM   3282  C CA   . GLY A 1 37 ? -11.397 -0.131  9.371   1.00 0.30 ? 37  GLY A CA   3  
ATOM   3283  C C    . GLY A 1 37 ? -10.856 -1.376  8.705   1.00 0.29 ? 37  GLY A C    3  
ATOM   3284  O O    . GLY A 1 37 ? -11.132 -2.493  9.144   1.00 0.41 ? 37  GLY A O    3  
ATOM   3285  H H    . GLY A 1 37 ? -10.416 1.644   8.764   1.00 0.30 ? 37  GLY A H    3  
ATOM   3286  H HA2  . GLY A 1 37 ? -10.908 -0.005  10.325  1.00 0.33 ? 37  GLY A HA2  3  
ATOM   3287  H HA3  . GLY A 1 37 ? -12.457 -0.256  9.537   1.00 0.35 ? 37  GLY A HA3  3  
ATOM   3288  N N    . LEU A 1 38 ? -10.088 -1.187  7.642   1.00 0.25 ? 38  LEU A N    3  
ATOM   3289  C CA   . LEU A 1 38 ? -9.505  -2.306  6.917   1.00 0.28 ? 38  LEU A CA   3  
ATOM   3290  C C    . LEU A 1 38 ? -8.257  -2.797  7.635   1.00 0.32 ? 38  LEU A C    3  
ATOM   3291  O O    . LEU A 1 38 ? -8.009  -3.998  7.723   1.00 0.46 ? 38  LEU A O    3  
ATOM   3292  C CB   . LEU A 1 38 ? -9.173  -1.901  5.479   1.00 0.31 ? 38  LEU A CB   3  
ATOM   3293  C CG   . LEU A 1 38 ? -10.383 -1.665  4.573   1.00 0.40 ? 38  LEU A CG   3  
ATOM   3294  C CD1  . LEU A 1 38 ? -9.943  -1.080  3.245   1.00 0.51 ? 38  LEU A CD1  3  
ATOM   3295  C CD2  . LEU A 1 38 ? -11.151 -2.963  4.355   1.00 0.50 ? 38  LEU A CD2  3  
ATOM   3296  H H    . LEU A 1 38 ? -9.907  -0.274  7.337   1.00 0.29 ? 38  LEU A H    3  
ATOM   3297  H HA   . LEU A 1 38 ? -10.233 -3.104  6.900   1.00 0.34 ? 38  LEU A HA   3  
ATOM   3298  H HB2  . LEU A 1 38 ? -8.591  -0.992  5.510   1.00 0.34 ? 38  LEU A HB2  3  
ATOM   3299  H HB3  . LEU A 1 38 ? -8.570  -2.679  5.037   1.00 0.35 ? 38  LEU A HB3  3  
ATOM   3300  H HG   . LEU A 1 38 ? -11.048 -0.959  5.046   1.00 0.47 ? 38  LEU A HG   3  
ATOM   3301  H HD11 . LEU A 1 38 ? -9.260  -1.763  2.763   1.00 0.74 ? 38  LEU A HD11 3  
ATOM   3302  H HD12 . LEU A 1 38 ? -9.449  -0.135  3.414   1.00 0.78 ? 38  LEU A HD12 3  
ATOM   3303  H HD13 . LEU A 1 38 ? -10.806 -0.929  2.613   1.00 0.79 ? 38  LEU A HD13 3  
ATOM   3304  H HD21 . LEU A 1 38 ? -11.952 -2.793  3.653   1.00 0.77 ? 38  LEU A HD21 3  
ATOM   3305  H HD22 . LEU A 1 38 ? -11.563 -3.300  5.296   1.00 0.67 ? 38  LEU A HD22 3  
ATOM   3306  H HD23 . LEU A 1 38 ? -10.482 -3.716  3.965   1.00 0.68 ? 38  LEU A HD23 3  
ATOM   3307  N N    . LEU A 1 39 ? -7.481  -1.859  8.162   1.00 0.31 ? 39  LEU A N    3  
ATOM   3308  C CA   . LEU A 1 39 ? -6.260  -2.189  8.882   1.00 0.40 ? 39  LEU A CA   3  
ATOM   3309  C C    . LEU A 1 39 ? -6.276  -1.547  10.264  1.00 0.39 ? 39  LEU A C    3  
ATOM   3310  O O    . LEU A 1 39 ? -6.965  -0.547  10.484  1.00 0.57 ? 39  LEU A O    3  
ATOM   3311  C CB   . LEU A 1 39 ? -5.033  -1.722  8.094   1.00 0.53 ? 39  LEU A CB   3  
ATOM   3312  C CG   . LEU A 1 39 ? -4.862  -2.373  6.723   1.00 0.67 ? 39  LEU A CG   3  
ATOM   3313  C CD1  . LEU A 1 39 ? -3.757  -1.686  5.947   1.00 0.86 ? 39  LEU A CD1  3  
ATOM   3314  C CD2  . LEU A 1 39 ? -4.574  -3.857  6.865   1.00 0.75 ? 39  LEU A CD2  3  
ATOM   3315  H H    . LEU A 1 39 ? -7.737  -0.914  8.066   1.00 0.31 ? 39  LEU A H    3  
ATOM   3316  H HA   . LEU A 1 39 ? -6.221  -3.265  8.996   1.00 0.47 ? 39  LEU A HA   3  
ATOM   3317  H HB2  . LEU A 1 39 ? -5.106  -0.653  7.956   1.00 0.56 ? 39  LEU A HB2  3  
ATOM   3318  H HB3  . LEU A 1 39 ? -4.148  -1.930  8.679   1.00 0.63 ? 39  LEU A HB3  3  
ATOM   3319  H HG   . LEU A 1 39 ? -5.775  -2.261  6.163   1.00 0.67 ? 39  LEU A HG   3  
ATOM   3320  H HD11 . LEU A 1 39 ? -2.851  -1.678  6.535   1.00 1.10 ? 39  LEU A HD11 3  
ATOM   3321  H HD12 . LEU A 1 39 ? -4.051  -0.671  5.726   1.00 1.10 ? 39  LEU A HD12 3  
ATOM   3322  H HD13 . LEU A 1 39 ? -3.583  -2.218  5.024   1.00 1.09 ? 39  LEU A HD13 3  
ATOM   3323  H HD21 . LEU A 1 39 ? -4.295  -4.262  5.905   1.00 1.19 ? 39  LEU A HD21 3  
ATOM   3324  H HD22 . LEU A 1 39 ? -5.459  -4.359  7.226   1.00 1.13 ? 39  LEU A HD22 3  
ATOM   3325  H HD23 . LEU A 1 39 ? -3.768  -4.001  7.566   1.00 1.12 ? 39  LEU A HD23 3  
ATOM   3326  N N    . MET A 1 40 ? -5.524  -2.121  11.189  1.00 0.35 ? 40  MET A N    3  
ATOM   3327  C CA   . MET A 1 40 ? -5.455  -1.607  12.551  1.00 0.41 ? 40  MET A CA   3  
ATOM   3328  C C    . MET A 1 40 ? -4.062  -1.058  12.843  1.00 0.37 ? 40  MET A C    3  
ATOM   3329  O O    . MET A 1 40 ? -3.907  0.026   13.407  1.00 0.53 ? 40  MET A O    3  
ATOM   3330  C CB   . MET A 1 40 ? -5.811  -2.718  13.544  1.00 0.54 ? 40  MET A CB   3  
ATOM   3331  C CG   . MET A 1 40 ? -6.028  -2.230  14.964  1.00 0.70 ? 40  MET A CG   3  
ATOM   3332  S SD   . MET A 1 40 ? -6.725  -3.506  16.036  1.00 0.94 ? 40  MET A SD   3  
ATOM   3333  C CE   . MET A 1 40 ? -5.387  -4.700  16.070  1.00 1.19 ? 40  MET A CE   3  
ATOM   3334  H H    . MET A 1 40 ? -4.991  -2.918  10.953  1.00 0.44 ? 40  MET A H    3  
ATOM   3335  H HA   . MET A 1 40 ? -6.174  -0.807  12.647  1.00 0.50 ? 40  MET A HA   3  
ATOM   3336  H HB2  . MET A 1 40 ? -6.719  -3.203  13.213  1.00 0.62 ? 40  MET A HB2  3  
ATOM   3337  H HB3  . MET A 1 40 ? -5.010  -3.444  13.556  1.00 0.55 ? 40  MET A HB3  3  
ATOM   3338  H HG2  . MET A 1 40 ? -5.077  -1.914  15.369  1.00 0.73 ? 40  MET A HG2  3  
ATOM   3339  H HG3  . MET A 1 40 ? -6.703  -1.387  14.939  1.00 0.78 ? 40  MET A HG3  3  
ATOM   3340  H HE1  . MET A 1 40 ? -4.497  -4.235  16.472  1.00 1.40 ? 40  MET A HE1  3  
ATOM   3341  H HE2  . MET A 1 40 ? -5.186  -5.047  15.066  1.00 1.50 ? 40  MET A HE2  3  
ATOM   3342  H HE3  . MET A 1 40 ? -5.670  -5.534  16.692  1.00 1.50 ? 40  MET A HE3  3  
ATOM   3343  N N    . SER A 1 41 ? -3.052  -1.809  12.440  1.00 0.33 ? 41  SER A N    3  
ATOM   3344  C CA   . SER A 1 41 ? -1.667  -1.417  12.652  1.00 0.39 ? 41  SER A CA   3  
ATOM   3345  C C    . SER A 1 41 ? -0.958  -1.231  11.311  1.00 0.34 ? 41  SER A C    3  
ATOM   3346  O O    . SER A 1 41 ? -1.414  -1.746  10.295  1.00 0.31 ? 41  SER A O    3  
ATOM   3347  C CB   . SER A 1 41 ? -0.955  -2.488  13.486  1.00 0.50 ? 41  SER A CB   3  
ATOM   3348  O OG   . SER A 1 41 ? -1.861  -3.510  13.877  1.00 0.87 ? 41  SER A OG   3  
ATOM   3349  H H    . SER A 1 41 ? -3.243  -2.662  11.981  1.00 0.38 ? 41  SER A H    3  
ATOM   3350  H HA   . SER A 1 41 ? -1.659  -0.483  13.190  1.00 0.51 ? 41  SER A HA   3  
ATOM   3351  H HB2  . SER A 1 41 ? -0.163  -2.932  12.901  1.00 0.83 ? 41  SER A HB2  3  
ATOM   3352  H HB3  . SER A 1 41 ? -0.538  -2.036  14.372  1.00 0.81 ? 41  SER A HB3  3  
ATOM   3353  H HG   . SER A 1 41 ? -1.926  -4.170  13.166  1.00 1.39 ? 41  SER A HG   3  
ATOM   3354  N N    . PRO A 1 42 ? 0.154   -0.476  11.281  1.00 0.43 ? 42  PRO A N    3  
ATOM   3355  C CA   . PRO A 1 42 ? 0.916   -0.255  10.048  1.00 0.47 ? 42  PRO A CA   3  
ATOM   3356  C C    . PRO A 1 42 ? 1.700   -1.499  9.633   1.00 0.43 ? 42  PRO A C    3  
ATOM   3357  O O    . PRO A 1 42 ? 2.231   -1.577  8.528   1.00 0.54 ? 42  PRO A O    3  
ATOM   3358  C CB   . PRO A 1 42 ? 1.873   0.879   10.418  1.00 0.61 ? 42  PRO A CB   3  
ATOM   3359  C CG   . PRO A 1 42 ? 2.033   0.784   11.896  1.00 0.65 ? 42  PRO A CG   3  
ATOM   3360  C CD   . PRO A 1 42 ? 0.734   0.252   12.430  1.00 0.57 ? 42  PRO A CD   3  
ATOM   3361  H HA   . PRO A 1 42 ? 0.276   0.057   9.236   1.00 0.51 ? 42  PRO A HA   3  
ATOM   3362  H HB2  . PRO A 1 42 ? 2.822   0.739   9.915   1.00 0.65 ? 42  PRO A HB2  3  
ATOM   3363  H HB3  . PRO A 1 42 ? 1.444   1.831   10.151  1.00 0.73 ? 42  PRO A HB3  3  
ATOM   3364  H HG2  . PRO A 1 42 ? 2.842   0.107   12.133  1.00 0.67 ? 42  PRO A HG2  3  
ATOM   3365  H HG3  . PRO A 1 42 ? 2.225   1.761   12.310  1.00 0.81 ? 42  PRO A HG3  3  
ATOM   3366  H HD2  . PRO A 1 42 ? 0.916   -0.417  13.258  1.00 0.58 ? 42  PRO A HD2  3  
ATOM   3367  H HD3  . PRO A 1 42 ? 0.092   1.065   12.736  1.00 0.68 ? 42  PRO A HD3  3  
ATOM   3368  N N    . SER A 1 43 ? 1.760   -2.469  10.536  1.00 0.36 ? 43  SER A N    3  
ATOM   3369  C CA   . SER A 1 43 ? 2.465   -3.717  10.287  1.00 0.41 ? 43  SER A CA   3  
ATOM   3370  C C    . SER A 1 43 ? 1.511   -4.774  9.735   1.00 0.36 ? 43  SER A C    3  
ATOM   3371  O O    . SER A 1 43 ? 1.920   -5.893  9.424   1.00 0.40 ? 43  SER A O    3  
ATOM   3372  C CB   . SER A 1 43 ? 3.111   -4.206  11.583  1.00 0.54 ? 43  SER A CB   3  
ATOM   3373  O OG   . SER A 1 43 ? 3.391   -3.113  12.450  1.00 0.69 ? 43  SER A OG   3  
ATOM   3374  H H    . SER A 1 43 ? 1.329   -2.335  11.404  1.00 0.38 ? 43  SER A H    3  
ATOM   3375  H HA   . SER A 1 43 ? 3.237   -3.523  9.559   1.00 0.49 ? 43  SER A HA   3  
ATOM   3376  H HB2  . SER A 1 43 ? 2.439   -4.886  12.086  1.00 0.70 ? 43  SER A HB2  3  
ATOM   3377  H HB3  . SER A 1 43 ? 4.036   -4.713  11.353  1.00 0.75 ? 43  SER A HB3  3  
ATOM   3378  H HG   . SER A 1 43 ? 3.466   -3.435  13.359  1.00 1.10 ? 43  SER A HG   3  
ATOM   3379  N N    . ASP A 1 44 ? 0.244   -4.404  9.588   1.00 0.32 ? 44  ASP A N    3  
ATOM   3380  C CA   . ASP A 1 44 ? -0.770  -5.320  9.071   1.00 0.32 ? 44  ASP A CA   3  
ATOM   3381  C C    . ASP A 1 44 ? -0.567  -5.539  7.578   1.00 0.29 ? 44  ASP A C    3  
ATOM   3382  O O    . ASP A 1 44 ? -1.086  -6.493  6.997   1.00 0.31 ? 44  ASP A O    3  
ATOM   3383  C CB   . ASP A 1 44 ? -2.182  -4.777  9.321   1.00 0.39 ? 44  ASP A CB   3  
ATOM   3384  C CG   . ASP A 1 44 ? -2.548  -4.675  10.791  1.00 0.54 ? 44  ASP A CG   3  
ATOM   3385  O OD1  . ASP A 1 44 ? -1.760  -5.129  11.651  1.00 0.87 ? 44  ASP A OD1  3  
ATOM   3386  O OD2  . ASP A 1 44 ? -3.632  -4.130  11.098  1.00 0.69 ? 44  ASP A OD2  3  
ATOM   3387  H H    . ASP A 1 44 ? -0.018  -3.489  9.827   1.00 0.35 ? 44  ASP A H    3  
ATOM   3388  H HA   . ASP A 1 44 ? -0.658  -6.266  9.581   1.00 0.40 ? 44  ASP A HA   3  
ATOM   3389  H HB2  . ASP A 1 44 ? -2.256  -3.791  8.891   1.00 0.46 ? 44  ASP A HB2  3  
ATOM   3390  H HB3  . ASP A 1 44 ? -2.895  -5.429  8.837   1.00 0.52 ? 44  ASP A HB3  3  
ATOM   3391  N N    . LEU A 1 45 ? 0.198   -4.644  6.962   1.00 0.31 ? 45  LEU A N    3  
ATOM   3392  C CA   . LEU A 1 45 ? 0.496   -4.712  5.536   1.00 0.36 ? 45  LEU A CA   3  
ATOM   3393  C C    . LEU A 1 45 ? 1.234   -6.007  5.186   1.00 0.34 ? 45  LEU A C    3  
ATOM   3394  O O    . LEU A 1 45 ? 1.198   -6.464  4.045   1.00 0.38 ? 45  LEU A O    3  
ATOM   3395  C CB   . LEU A 1 45 ? 1.350   -3.503  5.140   1.00 0.45 ? 45  LEU A CB   3  
ATOM   3396  C CG   . LEU A 1 45 ? 0.812   -2.641  3.988   1.00 0.60 ? 45  LEU A CG   3  
ATOM   3397  C CD1  . LEU A 1 45 ? 0.725   -3.445  2.703   1.00 0.96 ? 45  LEU A CD1  3  
ATOM   3398  C CD2  . LEU A 1 45 ? -0.545  -2.049  4.336   1.00 0.98 ? 45  LEU A CD2  3  
ATOM   3399  H H    . LEU A 1 45 ? 0.557   -3.891  7.484   1.00 0.35 ? 45  LEU A H    3  
ATOM   3400  H HA   . LEU A 1 45 ? -0.439  -4.680  4.995   1.00 0.41 ? 45  LEU A HA   3  
ATOM   3401  H HB2  . LEU A 1 45 ? 1.453   -2.872  6.010   1.00 0.60 ? 45  LEU A HB2  3  
ATOM   3402  H HB3  . LEU A 1 45 ? 2.330   -3.861  4.863   1.00 0.54 ? 45  LEU A HB3  3  
ATOM   3403  H HG   . LEU A 1 45 ? 1.496   -1.824  3.819   1.00 0.84 ? 45  LEU A HG   3  
ATOM   3404  H HD11 . LEU A 1 45 ? 1.675   -3.924  2.511   1.00 1.37 ? 45  LEU A HD11 3  
ATOM   3405  H HD12 . LEU A 1 45 ? 0.485   -2.784  1.884   1.00 1.34 ? 45  LEU A HD12 3  
ATOM   3406  H HD13 . LEU A 1 45 ? -0.044  -4.195  2.797   1.00 1.38 ? 45  LEU A HD13 3  
ATOM   3407  H HD21 . LEU A 1 45 ? -0.930  -1.506  3.486   1.00 1.28 ? 45  LEU A HD21 3  
ATOM   3408  H HD22 . LEU A 1 45 ? -0.440  -1.377  5.174   1.00 1.36 ? 45  LEU A HD22 3  
ATOM   3409  H HD23 . LEU A 1 45 ? -1.228  -2.844  4.594   1.00 1.37 ? 45  LEU A HD23 3  
ATOM   3410  N N    . TYR A 1 46 ? 1.880   -6.606  6.180   1.00 0.32 ? 46  TYR A N    3  
ATOM   3411  C CA   . TYR A 1 46 ? 2.635   -7.836  5.976   1.00 0.37 ? 46  TYR A CA   3  
ATOM   3412  C C    . TYR A 1 46 ? 1.731   -9.071  6.034   1.00 0.34 ? 46  TYR A C    3  
ATOM   3413  O O    . TYR A 1 46 ? 2.214   -10.202 5.984   1.00 0.44 ? 46  TYR A O    3  
ATOM   3414  C CB   . TYR A 1 46 ? 3.755   -7.955  7.017   1.00 0.47 ? 46  TYR A CB   3  
ATOM   3415  C CG   . TYR A 1 46 ? 4.787   -6.851  6.942   1.00 0.55 ? 46  TYR A CG   3  
ATOM   3416  C CD1  . TYR A 1 46 ? 5.502   -6.617  5.772   1.00 0.87 ? 46  TYR A CD1  3  
ATOM   3417  C CD2  . TYR A 1 46 ? 5.053   -6.048  8.045   1.00 0.64 ? 46  TYR A CD2  3  
ATOM   3418  C CE1  . TYR A 1 46 ? 6.448   -5.613  5.704   1.00 1.01 ? 46  TYR A CE1  3  
ATOM   3419  C CE2  . TYR A 1 46 ? 5.998   -5.042  7.984   1.00 0.76 ? 46  TYR A CE2  3  
ATOM   3420  C CZ   . TYR A 1 46 ? 6.692   -4.829  6.812   1.00 0.86 ? 46  TYR A CZ   3  
ATOM   3421  O OH   . TYR A 1 46 ? 7.636   -3.831  6.749   1.00 1.05 ? 46  TYR A OH   3  
ATOM   3422  H H    . TYR A 1 46 ? 1.844   -6.210  7.077   1.00 0.33 ? 46  TYR A H    3  
ATOM   3423  H HA   . TYR A 1 46 ? 3.080   -7.785  4.994   1.00 0.43 ? 46  TYR A HA   3  
ATOM   3424  H HB2  . TYR A 1 46 ? 3.322   -7.930  8.004   1.00 0.46 ? 46  TYR A HB2  3  
ATOM   3425  H HB3  . TYR A 1 46 ? 4.265   -8.897  6.878   1.00 0.61 ? 46  TYR A HB3  3  
ATOM   3426  H HD1  . TYR A 1 46 ? 5.306   -7.231  4.906   1.00 1.12 ? 46  TYR A HD1  3  
ATOM   3427  H HD2  . TYR A 1 46 ? 4.508   -6.218  8.963   1.00 0.84 ? 46  TYR A HD2  3  
ATOM   3428  H HE1  . TYR A 1 46 ? 6.993   -5.447  4.785   1.00 1.34 ? 46  TYR A HE1  3  
ATOM   3429  H HE2  . TYR A 1 46 ? 6.190   -4.426  8.850   1.00 0.97 ? 46  TYR A HE2  3  
ATOM   3430  H HH   . TYR A 1 46 ? 8.380   -4.065  7.316   1.00 1.14 ? 46  TYR A HH   3  
ATOM   3431  N N    . SER A 1 47 ? 0.425   -8.858  6.158   1.00 0.31 ? 47  SER A N    3  
ATOM   3432  C CA   . SER A 1 47 ? -0.523  -9.967  6.199   1.00 0.29 ? 47  SER A CA   3  
ATOM   3433  C C    . SER A 1 47 ? -1.137  -10.179 4.812   1.00 0.24 ? 47  SER A C    3  
ATOM   3434  O O    . SER A 1 47 ? -1.984  -9.394  4.378   1.00 0.26 ? 47  SER A O    3  
ATOM   3435  C CB   . SER A 1 47 ? -1.617  -9.692  7.233   1.00 0.36 ? 47  SER A CB   3  
ATOM   3436  O OG   . SER A 1 47 ? -1.050  -9.365  8.492   1.00 0.53 ? 47  SER A OG   3  
ATOM   3437  H H    . SER A 1 47 ? 0.089   -7.937  6.225   1.00 0.37 ? 47  SER A H    3  
ATOM   3438  H HA   . SER A 1 47 ? 0.020   -10.855 6.482   1.00 0.33 ? 47  SER A HA   3  
ATOM   3439  H HB2  . SER A 1 47 ? -2.226  -8.864  6.897   1.00 0.43 ? 47  SER A HB2  3  
ATOM   3440  H HB3  . SER A 1 47 ? -2.234  -10.572 7.346   1.00 0.44 ? 47  SER A HB3  3  
ATOM   3441  H HG   . SER A 1 47 ? -0.117  -9.141  8.375   1.00 1.10 ? 47  SER A HG   3  
ATOM   3442  N N    . PRO A 1 48 ? -0.720  -11.248 4.101   1.00 0.24 ? 48  PRO A N    3  
ATOM   3443  C CA   . PRO A 1 48 ? -1.206  -11.542 2.745   1.00 0.25 ? 48  PRO A CA   3  
ATOM   3444  C C    . PRO A 1 48 ? -2.689  -11.900 2.686   1.00 0.26 ? 48  PRO A C    3  
ATOM   3445  O O    . PRO A 1 48 ? -3.377  -11.559 1.721   1.00 0.32 ? 48  PRO A O    3  
ATOM   3446  C CB   . PRO A 1 48 ? -0.349  -12.728 2.294   1.00 0.31 ? 48  PRO A CB   3  
ATOM   3447  C CG   . PRO A 1 48 ? 0.178   -13.346 3.539   1.00 0.38 ? 48  PRO A CG   3  
ATOM   3448  C CD   . PRO A 1 48 ? 0.258   -12.250 4.569   1.00 0.32 ? 48  PRO A CD   3  
ATOM   3449  H HA   . PRO A 1 48 ? -1.026  -10.707 2.083   1.00 0.26 ? 48  PRO A HA   3  
ATOM   3450  H HB2  . PRO A 1 48 ? -0.958  -13.430 1.741   1.00 0.38 ? 48  PRO A HB2  3  
ATOM   3451  H HB3  . PRO A 1 48 ? 0.467   -12.380 1.682   1.00 0.38 ? 48  PRO A HB3  3  
ATOM   3452  H HG2  . PRO A 1 48 ? -0.496  -14.125 3.870   1.00 0.50 ? 48  PRO A HG2  3  
ATOM   3453  H HG3  . PRO A 1 48 ? 1.161   -13.753 3.359   1.00 0.52 ? 48  PRO A HG3  3  
ATOM   3454  H HD2  . PRO A 1 48 ? -0.016  -12.629 5.542   1.00 0.38 ? 48  PRO A HD2  3  
ATOM   3455  H HD3  . PRO A 1 48 ? 1.254   -11.833 4.593   1.00 0.38 ? 48  PRO A HD3  3  
ATOM   3456  N N    . GLY A 1 49 ? -3.186  -12.571 3.716   1.00 0.28 ? 49  GLY A N    3  
ATOM   3457  C CA   . GLY A 1 49 ? -4.586  -12.963 3.740   1.00 0.33 ? 49  GLY A CA   3  
ATOM   3458  C C    . GLY A 1 49 ? -5.527  -11.775 3.803   1.00 0.32 ? 49  GLY A C    3  
ATOM   3459  O O    . GLY A 1 49 ? -6.680  -11.858 3.376   1.00 0.50 ? 49  GLY A O    3  
ATOM   3460  H H    . GLY A 1 49 ? -2.598  -12.806 4.469   1.00 0.30 ? 49  GLY A H    3  
ATOM   3461  H HA2  . GLY A 1 49 ? -4.805  -13.532 2.849   1.00 0.35 ? 49  GLY A HA2  3  
ATOM   3462  H HA3  . GLY A 1 49 ? -4.754  -13.590 4.602   1.00 0.38 ? 49  GLY A HA3  3  
ATOM   3463  N N    . SER A 1 50 ? -5.029  -10.661 4.314   1.00 0.25 ? 50  SER A N    3  
ATOM   3464  C CA   . SER A 1 50 ? -5.831  -9.458  4.447   1.00 0.27 ? 50  SER A CA   3  
ATOM   3465  C C    . SER A 1 50 ? -5.772  -8.597  3.181   1.00 0.22 ? 50  SER A C    3  
ATOM   3466  O O    . SER A 1 50 ? -6.517  -7.626  3.056   1.00 0.28 ? 50  SER A O    3  
ATOM   3467  C CB   . SER A 1 50 ? -5.346  -8.658  5.658   1.00 0.35 ? 50  SER A CB   3  
ATOM   3468  O OG   . SER A 1 50 ? -5.037  -9.518  6.750   1.00 0.47 ? 50  SER A OG   3  
ATOM   3469  H H    . SER A 1 50 ? -4.099  -10.651 4.626   1.00 0.31 ? 50  SER A H    3  
ATOM   3470  H HA   . SER A 1 50 ? -6.855  -9.759  4.614   1.00 0.32 ? 50  SER A HA   3  
ATOM   3471  H HB2  . SER A 1 50 ? -4.458  -8.107  5.389   1.00 0.45 ? 50  SER A HB2  3  
ATOM   3472  H HB3  . SER A 1 50 ? -6.119  -7.969  5.966   1.00 0.45 ? 50  SER A HB3  3  
ATOM   3473  H HG   . SER A 1 50 ? -5.022  -9.004  7.569   1.00 0.93 ? 50  SER A HG   3  
ATOM   3474  N N    . TRP A 1 51 ? -4.908  -8.961  2.233   1.00 0.20 ? 51  TRP A N    3  
ATOM   3475  C CA   . TRP A 1 51 ? -4.764  -8.195  0.995   1.00 0.20 ? 51  TRP A CA   3  
ATOM   3476  C C    . TRP A 1 51 ? -6.033  -8.247  0.142   1.00 0.19 ? 51  TRP A C    3  
ATOM   3477  O O    . TRP A 1 51 ? -6.399  -7.261  -0.501  1.00 0.23 ? 51  TRP A O    3  
ATOM   3478  C CB   . TRP A 1 51 ? -3.586  -8.716  0.161   1.00 0.23 ? 51  TRP A CB   3  
ATOM   3479  C CG   . TRP A 1 51 ? -2.239  -8.460  0.768   1.00 0.24 ? 51  TRP A CG   3  
ATOM   3480  C CD1  . TRP A 1 51 ? -1.924  -7.546  1.730   1.00 0.25 ? 51  TRP A CD1  3  
ATOM   3481  C CD2  . TRP A 1 51 ? -1.018  -9.128  0.434   1.00 0.27 ? 51  TRP A CD2  3  
ATOM   3482  N NE1  . TRP A 1 51 ? -0.585  -7.619  2.028   1.00 0.28 ? 51  TRP A NE1  3  
ATOM   3483  C CE2  . TRP A 1 51 ? -0.008  -8.579  1.240   1.00 0.29 ? 51  TRP A CE2  3  
ATOM   3484  C CE3  . TRP A 1 51 ? -0.684  -10.145 -0.467  1.00 0.30 ? 51  TRP A CE3  3  
ATOM   3485  C CZ2  . TRP A 1 51 ? 1.311   -9.013  1.184   1.00 0.33 ? 51  TRP A CZ2  3  
ATOM   3486  C CZ3  . TRP A 1 51 ? 0.631   -10.568 -0.533  1.00 0.34 ? 51  TRP A CZ3  3  
ATOM   3487  C CH2  . TRP A 1 51 ? 1.613   -10.003 0.290   1.00 0.35 ? 51  TRP A CH2  3  
ATOM   3488  H H    . TRP A 1 51 ? -4.356  -9.762  2.368   1.00 0.26 ? 51  TRP A H    3  
ATOM   3489  H HA   . TRP A 1 51 ? -4.571  -7.170  1.262   1.00 0.22 ? 51  TRP A HA   3  
ATOM   3490  H HB2  . TRP A 1 51 ? -3.691  -9.784  0.035   1.00 0.25 ? 51  TRP A HB2  3  
ATOM   3491  H HB3  . TRP A 1 51 ? -3.608  -8.245  -0.809  1.00 0.27 ? 51  TRP A HB3  3  
ATOM   3492  H HD1  . TRP A 1 51 ? -2.637  -6.876  2.185   1.00 0.26 ? 51  TRP A HD1  3  
ATOM   3493  H HE1  . TRP A 1 51 ? -0.116  -7.068  2.697   1.00 0.31 ? 51  TRP A HE1  3  
ATOM   3494  H HE3  . TRP A 1 51 ? -1.430  -10.590 -1.108  1.00 0.31 ? 51  TRP A HE3  3  
ATOM   3495  H HZ2  . TRP A 1 51 ? 2.081   -8.584  1.810   1.00 0.35 ? 51  TRP A HZ2  3  
ATOM   3496  H HZ3  . TRP A 1 51 ? 0.910   -11.349 -1.223  1.00 0.38 ? 51  TRP A HZ3  3  
ATOM   3497  H HH2  . TRP A 1 51 ? 2.626   -10.365 0.208   1.00 0.39 ? 51  TRP A HH2  3  
ATOM   3498  N N    . ASP A 1 52 ? -6.698  -9.399  0.140   1.00 0.23 ? 52  ASP A N    3  
ATOM   3499  C CA   . ASP A 1 52 ? -7.911  -9.587  -0.662  1.00 0.27 ? 52  ASP A CA   3  
ATOM   3500  C C    . ASP A 1 52 ? -9.038  -8.620  -0.259  1.00 0.24 ? 52  ASP A C    3  
ATOM   3501  O O    . ASP A 1 52 ? -9.495  -7.844  -1.099  1.00 0.24 ? 52  ASP A O    3  
ATOM   3502  C CB   . ASP A 1 52 ? -8.391  -11.044 -0.600  1.00 0.37 ? 52  ASP A CB   3  
ATOM   3503  C CG   . ASP A 1 52 ? -9.569  -11.304 -1.519  1.00 0.85 ? 52  ASP A CG   3  
ATOM   3504  O OD1  . ASP A 1 52 ? -10.601 -11.814 -1.040  1.00 1.49 ? 52  ASP A OD1  3  
ATOM   3505  O OD2  . ASP A 1 52 ? -9.468  -11.000 -2.728  1.00 1.39 ? 52  ASP A OD2  3  
ATOM   3506  H H    . ASP A 1 52 ? -6.374  -10.139 0.695   1.00 0.27 ? 52  ASP A H    3  
ATOM   3507  H HA   . ASP A 1 52 ? -7.641  -9.367  -1.684  1.00 0.30 ? 52  ASP A HA   3  
ATOM   3508  H HB2  . ASP A 1 52 ? -7.581  -11.698 -0.890  1.00 0.74 ? 52  ASP A HB2  3  
ATOM   3509  H HB3  . ASP A 1 52 ? -8.689  -11.277 0.412   1.00 0.74 ? 52  ASP A HB3  3  
ATOM   3510  N N    . PRO A 1 53 ? -9.505  -8.633  1.016   1.00 0.23 ? 53  PRO A N    3  
ATOM   3511  C CA   . PRO A 1 53 ? -10.579 -7.733  1.462   1.00 0.24 ? 53  PRO A CA   3  
ATOM   3512  C C    . PRO A 1 53 ? -10.257 -6.260  1.195   1.00 0.21 ? 53  PRO A C    3  
ATOM   3513  O O    . PRO A 1 53 ? -11.132 -5.491  0.797   1.00 0.24 ? 53  PRO A O    3  
ATOM   3514  C CB   . PRO A 1 53 ? -10.692 -7.993  2.969   1.00 0.29 ? 53  PRO A CB   3  
ATOM   3515  C CG   . PRO A 1 53 ? -9.479  -8.774  3.342   1.00 0.33 ? 53  PRO A CG   3  
ATOM   3516  C CD   . PRO A 1 53 ? -9.064  -9.520  2.109   1.00 0.28 ? 53  PRO A CD   3  
ATOM   3517  H HA   . PRO A 1 53 ? -11.515 -7.980  0.984   1.00 0.27 ? 53  PRO A HA   3  
ATOM   3518  H HB2  . PRO A 1 53 ? -10.722 -7.051  3.501   1.00 0.34 ? 53  PRO A HB2  3  
ATOM   3519  H HB3  . PRO A 1 53 ? -11.580 -8.567  3.180   1.00 0.34 ? 53  PRO A HB3  3  
ATOM   3520  H HG2  . PRO A 1 53 ? -8.692  -8.100  3.658   1.00 0.41 ? 53  PRO A HG2  3  
ATOM   3521  H HG3  . PRO A 1 53 ? -9.718  -9.471  4.130   1.00 0.44 ? 53  PRO A HG3  3  
ATOM   3522  H HD2  . PRO A 1 53 ? -7.992  -9.651  2.088   1.00 0.29 ? 53  PRO A HD2  3  
ATOM   3523  H HD3  . PRO A 1 53 ? -9.565  -10.475 2.059   1.00 0.34 ? 53  PRO A HD3  3  
ATOM   3524  N N    . ILE A 1 54 ? -8.995  -5.881  1.400   1.00 0.19 ? 54  ILE A N    3  
ATOM   3525  C CA   . ILE A 1 54 ? -8.564  -4.506  1.175   1.00 0.19 ? 54  ILE A CA   3  
ATOM   3526  C C    . ILE A 1 54 ? -8.735  -4.131  -0.291  1.00 0.16 ? 54  ILE A C    3  
ATOM   3527  O O    . ILE A 1 54 ? -9.343  -3.111  -0.616  1.00 0.17 ? 54  ILE A O    3  
ATOM   3528  C CB   . ILE A 1 54 ? -7.090  -4.294  1.581   1.00 0.22 ? 54  ILE A CB   3  
ATOM   3529  C CG1  . ILE A 1 54 ? -6.906  -4.557  3.073   1.00 0.27 ? 54  ILE A CG1  3  
ATOM   3530  C CG2  . ILE A 1 54 ? -6.634  -2.883  1.234   1.00 0.26 ? 54  ILE A CG2  3  
ATOM   3531  C CD1  . ILE A 1 54 ? -5.458  -4.607  3.504   1.00 0.34 ? 54  ILE A CD1  3  
ATOM   3532  H H    . ILE A 1 54 ? -8.342  -6.543  1.707   1.00 0.19 ? 54  ILE A H    3  
ATOM   3533  H HA   . ILE A 1 54 ? -9.183  -3.858  1.779   1.00 0.23 ? 54  ILE A HA   3  
ATOM   3534  H HB   . ILE A 1 54 ? -6.483  -4.990  1.022   1.00 0.21 ? 54  ILE A HB   3  
ATOM   3535  H HG12 . ILE A 1 54 ? -7.387  -3.769  3.628   1.00 0.31 ? 54  ILE A HG12 3  
ATOM   3536  H HG13 . ILE A 1 54 ? -7.364  -5.503  3.328   1.00 0.27 ? 54  ILE A HG13 3  
ATOM   3537  H HG21 . ILE A 1 54 ? -5.629  -2.729  1.596   1.00 0.58 ? 54  ILE A HG21 3  
ATOM   3538  H HG22 . ILE A 1 54 ? -7.298  -2.166  1.695   1.00 0.60 ? 54  ILE A HG22 3  
ATOM   3539  H HG23 . ILE A 1 54 ? -6.655  -2.754  0.161   1.00 0.58 ? 54  ILE A HG23 3  
ATOM   3540  H HD11 . ILE A 1 54 ? -5.388  -5.073  4.474   1.00 0.71 ? 54  ILE A HD11 3  
ATOM   3541  H HD12 . ILE A 1 54 ? -5.061  -3.602  3.558   1.00 0.68 ? 54  ILE A HD12 3  
ATOM   3542  H HD13 . ILE A 1 54 ? -4.890  -5.180  2.786   1.00 0.71 ? 54  ILE A HD13 3  
ATOM   3543  N N    . THR A 1 55 ? -8.212  -4.975  -1.172  1.00 0.15 ? 55  THR A N    3  
ATOM   3544  C CA   . THR A 1 55 ? -8.307  -4.740  -2.606  1.00 0.17 ? 55  THR A CA   3  
ATOM   3545  C C    . THR A 1 55 ? -9.766  -4.697  -3.053  1.00 0.17 ? 55  THR A C    3  
ATOM   3546  O O    . THR A 1 55 ? -10.150 -3.858  -3.872  1.00 0.19 ? 55  THR A O    3  
ATOM   3547  C CB   . THR A 1 55 ? -7.549  -5.824  -3.404  1.00 0.20 ? 55  THR A CB   3  
ATOM   3548  O OG1  . THR A 1 55 ? -6.225  -5.974  -2.874  1.00 0.20 ? 55  THR A OG1  3  
ATOM   3549  C CG2  . THR A 1 55 ? -7.463  -5.460  -4.879  1.00 0.27 ? 55  THR A CG2  3  
ATOM   3550  H H    . THR A 1 55 ? -7.742  -5.775  -0.848  1.00 0.16 ? 55  THR A H    3  
ATOM   3551  H HA   . THR A 1 55 ? -7.852  -3.784  -2.814  1.00 0.19 ? 55  THR A HA   3  
ATOM   3552  H HB   . THR A 1 55 ? -8.080  -6.760  -3.306  1.00 0.22 ? 55  THR A HB   3  
ATOM   3553  H HG1  . THR A 1 55 ? -6.257  -6.523  -2.075  1.00 0.26 ? 55  THR A HG1  3  
ATOM   3554  H HG21 . THR A 1 55 ? -6.946  -6.242  -5.417  1.00 0.49 ? 55  THR A HG21 3  
ATOM   3555  H HG22 . THR A 1 55 ? -6.924  -4.531  -4.992  1.00 0.48 ? 55  THR A HG22 3  
ATOM   3556  H HG23 . THR A 1 55 ? -8.460  -5.346  -5.280  1.00 0.46 ? 55  THR A HG23 3  
ATOM   3557  N N    . ALA A 1 56 ? -10.580 -5.589  -2.494  1.00 0.18 ? 56  ALA A N    3  
ATOM   3558  C CA   . ALA A 1 56 ? -11.997 -5.653  -2.828  1.00 0.21 ? 56  ALA A CA   3  
ATOM   3559  C C    . ALA A 1 56 ? -12.710 -4.359  -2.453  1.00 0.20 ? 56  ALA A C    3  
ATOM   3560  O O    . ALA A 1 56 ? -13.386 -3.750  -3.282  1.00 0.24 ? 56  ALA A O    3  
ATOM   3561  C CB   . ALA A 1 56 ? -12.649 -6.832  -2.127  1.00 0.25 ? 56  ALA A CB   3  
ATOM   3562  H H    . ALA A 1 56 ? -10.212 -6.228  -1.841  1.00 0.18 ? 56  ALA A H    3  
ATOM   3563  H HA   . ALA A 1 56 ? -12.082 -5.805  -3.894  1.00 0.23 ? 56  ALA A HA   3  
ATOM   3564  H HB1  . ALA A 1 56 ? -12.779 -6.597  -1.081  1.00 0.42 ? 56  ALA A HB1  3  
ATOM   3565  H HB2  . ALA A 1 56 ? -12.019 -7.701  -2.226  1.00 0.43 ? 56  ALA A HB2  3  
ATOM   3566  H HB3  . ALA A 1 56 ? -13.611 -7.029  -2.574  1.00 0.43 ? 56  ALA A HB3  3  
ATOM   3567  N N    . ALA A 1 57 ? -12.540 -3.937  -1.205  1.00 0.19 ? 57  ALA A N    3  
ATOM   3568  C CA   . ALA A 1 57 ? -13.172 -2.716  -0.718  1.00 0.20 ? 57  ALA A CA   3  
ATOM   3569  C C    . ALA A 1 57 ? -12.658 -1.491  -1.472  1.00 0.19 ? 57  ALA A C    3  
ATOM   3570  O O    . ALA A 1 57 ? -13.434 -0.612  -1.849  1.00 0.22 ? 57  ALA A O    3  
ATOM   3571  C CB   . ALA A 1 57 ? -12.935 -2.560  0.775   1.00 0.23 ? 57  ALA A CB   3  
ATOM   3572  H H    . ALA A 1 57 ? -11.975 -4.463  -0.592  1.00 0.20 ? 57  ALA A H    3  
ATOM   3573  H HA   . ALA A 1 57 ? -14.237 -2.805  -0.880  1.00 0.23 ? 57  ALA A HA   3  
ATOM   3574  H HB1  . ALA A 1 57 ? -13.234 -3.466  1.282   1.00 0.41 ? 57  ALA A HB1  3  
ATOM   3575  H HB2  . ALA A 1 57 ? -13.514 -1.731  1.146   1.00 0.39 ? 57  ALA A HB2  3  
ATOM   3576  H HB3  . ALA A 1 57 ? -11.886 -2.376  0.953   1.00 0.38 ? 57  ALA A HB3  3  
ATOM   3577  N N    . LEU A 1 58 ? -11.350 -1.452  -1.712  1.00 0.18 ? 58  LEU A N    3  
ATOM   3578  C CA   . LEU A 1 58 ? -10.738 -0.334  -2.421  1.00 0.19 ? 58  LEU A CA   3  
ATOM   3579  C C    . LEU A 1 58 ? -11.278 -0.221  -3.842  1.00 0.20 ? 58  LEU A C    3  
ATOM   3580  O O    . LEU A 1 58 ? -11.621 0.869   -4.294  1.00 0.24 ? 58  LEU A O    3  
ATOM   3581  C CB   . LEU A 1 58 ? -9.215  -0.475  -2.448  1.00 0.21 ? 58  LEU A CB   3  
ATOM   3582  C CG   . LEU A 1 58 ? -8.464  0.497   -1.538  1.00 0.37 ? 58  LEU A CG   3  
ATOM   3583  C CD1  . LEU A 1 58 ? -6.975  0.222   -1.588  1.00 0.35 ? 58  LEU A CD1  3  
ATOM   3584  C CD2  . LEU A 1 58 ? -8.751  1.936   -1.938  1.00 0.73 ? 58  LEU A CD2  3  
ATOM   3585  H H    . LEU A 1 58 ? -10.780 -2.189  -1.395  1.00 0.19 ? 58  LEU A H    3  
ATOM   3586  H HA   . LEU A 1 58 ? -10.991 0.568   -1.886  1.00 0.20 ? 58  LEU A HA   3  
ATOM   3587  H HB2  . LEU A 1 58 ? -8.965  -1.483  -2.153  1.00 0.31 ? 58  LEU A HB2  3  
ATOM   3588  H HB3  . LEU A 1 58 ? -8.876  -0.319  -3.460  1.00 0.39 ? 58  LEU A HB3  3  
ATOM   3589  H HG   . LEU A 1 58 ? -8.797  0.358   -0.519  1.00 0.55 ? 58  LEU A HG   3  
ATOM   3590  H HD11 . LEU A 1 58 ? -6.457  0.932   -0.964  1.00 0.71 ? 58  LEU A HD11 3  
ATOM   3591  H HD12 . LEU A 1 58 ? -6.626  0.314   -2.607  1.00 0.67 ? 58  LEU A HD12 3  
ATOM   3592  H HD13 . LEU A 1 58 ? -6.782  -0.781  -1.233  1.00 0.64 ? 58  LEU A HD13 3  
ATOM   3593  H HD21 . LEU A 1 58 ? -8.483  2.084   -2.975  1.00 1.19 ? 58  LEU A HD21 3  
ATOM   3594  H HD22 . LEU A 1 58 ? -8.173  2.607   -1.319  1.00 1.00 ? 58  LEU A HD22 3  
ATOM   3595  H HD23 . LEU A 1 58 ? -9.801  2.144   -1.806  1.00 1.19 ? 58  LEU A HD23 3  
ATOM   3596  N N    . SER A 1 59 ? -11.366 -1.348  -4.539  1.00 0.20 ? 59  SER A N    3  
ATOM   3597  C CA   . SER A 1 59 ? -11.875 -1.354  -5.906  1.00 0.23 ? 59  SER A CA   3  
ATOM   3598  C C    . SER A 1 59 ? -13.345 -0.941  -5.930  1.00 0.23 ? 59  SER A C    3  
ATOM   3599  O O    . SER A 1 59 ? -13.808 -0.312  -6.883  1.00 0.25 ? 59  SER A O    3  
ATOM   3600  C CB   . SER A 1 59 ? -11.708 -2.738  -6.545  1.00 0.29 ? 59  SER A CB   3  
ATOM   3601  O OG   . SER A 1 59 ? -10.373 -3.208  -6.428  1.00 0.85 ? 59  SER A OG   3  
ATOM   3602  H H    . SER A 1 59 ? -11.086 -2.193  -4.124  1.00 0.21 ? 59  SER A H    3  
ATOM   3603  H HA   . SER A 1 59 ? -11.304 -0.633  -6.475  1.00 0.25 ? 59  SER A HA   3  
ATOM   3604  H HB2  . SER A 1 59 ? -12.366 -3.441  -6.057  1.00 0.65 ? 59  SER A HB2  3  
ATOM   3605  H HB3  . SER A 1 59 ? -11.964 -2.679  -7.593  1.00 0.73 ? 59  SER A HB3  3  
ATOM   3606  H HG   . SER A 1 59 ? -10.175 -3.366  -5.496  1.00 1.33 ? 59  SER A HG   3  
ATOM   3607  N N    . GLN A 1 60 ? -14.067 -1.286  -4.865  1.00 0.24 ? 60  GLN A N    3  
ATOM   3608  C CA   . GLN A 1 60 ? -15.482 -0.963  -4.756  1.00 0.28 ? 60  GLN A CA   3  
ATOM   3609  C C    . GLN A 1 60 ? -15.694 0.548   -4.696  1.00 0.26 ? 60  GLN A C    3  
ATOM   3610  O O    . GLN A 1 60 ? -16.387 1.116   -5.540  1.00 0.29 ? 60  GLN A O    3  
ATOM   3611  C CB   . GLN A 1 60 ? -16.090 -1.632  -3.523  1.00 0.34 ? 60  GLN A CB   3  
ATOM   3612  C CG   . GLN A 1 60 ? -17.598 -1.474  -3.437  1.00 0.50 ? 60  GLN A CG   3  
ATOM   3613  C CD   . GLN A 1 60 ? -18.198 -2.175  -2.234  1.00 0.63 ? 60  GLN A CD   3  
ATOM   3614  O OE1  . GLN A 1 60 ? -19.311 -2.692  -2.297  1.00 0.92 ? 60  GLN A OE1  3  
ATOM   3615  N NE2  . GLN A 1 60 ? -17.483 -2.173  -1.123  1.00 0.77 ? 60  GLN A NE2  3  
ATOM   3616  H H    . GLN A 1 60 ? -13.631 -1.773  -4.134  1.00 0.25 ? 60  GLN A H    3  
ATOM   3617  H HA   . GLN A 1 60 ? -15.973 -1.344  -5.639  1.00 0.31 ? 60  GLN A HA   3  
ATOM   3618  H HB2  . GLN A 1 60 ? -15.859 -2.687  -3.547  1.00 0.45 ? 60  GLN A HB2  3  
ATOM   3619  H HB3  . GLN A 1 60 ? -15.652 -1.196  -2.638  1.00 0.42 ? 60  GLN A HB3  3  
ATOM   3620  H HG2  . GLN A 1 60 ? -17.833 -0.422  -3.372  1.00 0.61 ? 60  GLN A HG2  3  
ATOM   3621  H HG3  . GLN A 1 60 ? -18.040 -1.885  -4.332  1.00 0.63 ? 60  GLN A HG3  3  
ATOM   3622  H HE21 . GLN A 1 60 ? -16.612 -1.715  -1.128  1.00 0.92 ? 60  GLN A HE21 3  
ATOM   3623  H HE22 . GLN A 1 60 ? -17.847 -2.634  -0.335  1.00 0.90 ? 60  GLN A HE22 3  
ATOM   3624  N N    . ARG A 1 61 ? -15.082 1.204   -3.716  1.00 0.29 ? 61  ARG A N    3  
ATOM   3625  C CA   . ARG A 1 61 ? -15.228 2.650   -3.571  1.00 0.34 ? 61  ARG A CA   3  
ATOM   3626  C C    . ARG A 1 61 ? -14.624 3.386   -4.769  1.00 0.30 ? 61  ARG A C    3  
ATOM   3627  O O    . ARG A 1 61 ? -15.052 4.488   -5.109  1.00 0.34 ? 61  ARG A O    3  
ATOM   3628  C CB   . ARG A 1 61 ? -14.597 3.153   -2.263  1.00 0.45 ? 61  ARG A CB   3  
ATOM   3629  C CG   . ARG A 1 61 ? -13.168 2.684   -2.031  1.00 0.65 ? 61  ARG A CG   3  
ATOM   3630  C CD   . ARG A 1 61 ? -12.658 3.111   -0.662  1.00 0.67 ? 61  ARG A CD   3  
ATOM   3631  N NE   . ARG A 1 61 ? -11.943 4.387   -0.708  1.00 0.81 ? 61  ARG A NE   3  
ATOM   3632  C CZ   . ARG A 1 61 ? -12.437 5.550   -0.285  1.00 1.09 ? 61  ARG A CZ   3  
ATOM   3633  N NH1  . ARG A 1 61 ? -13.663 5.621   0.230   1.00 1.47 ? 61  ARG A NH1  3  
ATOM   3634  N NH2  . ARG A 1 61 ? -11.685 6.641   -0.360  1.00 1.42 ? 61  ARG A NH2  3  
ATOM   3635  H H    . ARG A 1 61 ? -14.530 0.704   -3.071  1.00 0.30 ? 61  ARG A H    3  
ATOM   3636  H HA   . ARG A 1 61 ? -16.287 2.864   -3.543  1.00 0.40 ? 61  ARG A HA   3  
ATOM   3637  H HB2  . ARG A 1 61 ? -14.593 4.231   -2.277  1.00 0.72 ? 61  ARG A HB2  3  
ATOM   3638  H HB3  . ARG A 1 61 ? -15.202 2.815   -1.432  1.00 0.82 ? 61  ARG A HB3  3  
ATOM   3639  H HG2  . ARG A 1 61 ? -13.138 1.607   -2.094  1.00 1.08 ? 61  ARG A HG2  3  
ATOM   3640  H HG3  . ARG A 1 61 ? -12.530 3.111   -2.796  1.00 1.01 ? 61  ARG A HG3  3  
ATOM   3641  H HD2  . ARG A 1 61 ? -13.498 3.205   0.008   1.00 0.88 ? 61  ARG A HD2  3  
ATOM   3642  H HD3  . ARG A 1 61 ? -11.989 2.349   -0.291  1.00 0.79 ? 61  ARG A HD3  3  
ATOM   3643  H HE   . ARG A 1 61 ? -11.022 4.371   -1.064  1.00 1.11 ? 61  ARG A HE   3  
ATOM   3644  H HH11 . ARG A 1 61 ? -14.027 6.501   0.545   1.00 1.93 ? 61  ARG A HH11 3  
ATOM   3645  H HH12 . ARG A 1 61 ? -14.227 4.796   0.310   1.00 1.47 ? 61  ARG A HH12 3  
ATOM   3646  H HH21 . ARG A 1 61 ? -10.743 6.577   -0.734  1.00 1.53 ? 61  ARG A HH21 3  
ATOM   3647  H HH22 . ARG A 1 61 ? -12.039 7.525   -0.047  1.00 1.76 ? 61  ARG A HH22 3  
ATOM   3648  N N    . ALA A 1 62 ? -13.642 2.766   -5.412  1.00 0.27 ? 62  ALA A N    3  
ATOM   3649  C CA   . ALA A 1 62 ? -12.993 3.363   -6.573  1.00 0.29 ? 62  ALA A CA   3  
ATOM   3650  C C    . ALA A 1 62 ? -13.933 3.414   -7.773  1.00 0.30 ? 62  ALA A C    3  
ATOM   3651  O O    . ALA A 1 62 ? -13.895 4.355   -8.566  1.00 0.41 ? 62  ALA A O    3  
ATOM   3652  C CB   . ALA A 1 62 ? -11.729 2.595   -6.929  1.00 0.31 ? 62  ALA A CB   3  
ATOM   3653  H H    . ALA A 1 62 ? -13.336 1.890   -5.091  1.00 0.26 ? 62  ALA A H    3  
ATOM   3654  H HA   . ALA A 1 62 ? -12.709 4.371   -6.312  1.00 0.34 ? 62  ALA A HA   3  
ATOM   3655  H HB1  . ALA A 1 62 ? -11.993 1.600   -7.259  1.00 0.40 ? 62  ALA A HB1  3  
ATOM   3656  H HB2  . ALA A 1 62 ? -11.092 2.527   -6.060  1.00 0.44 ? 62  ALA A HB2  3  
ATOM   3657  H HB3  . ALA A 1 62 ? -11.206 3.111   -7.721  1.00 0.46 ? 62  ALA A HB3  3  
ATOM   3658  N N    . MET A 1 63 ? -14.785 2.406   -7.895  1.00 0.26 ? 63  MET A N    3  
ATOM   3659  C CA   . MET A 1 63 ? -15.724 2.331   -9.009  1.00 0.32 ? 63  MET A CA   3  
ATOM   3660  C C    . MET A 1 63 ? -17.039 3.044   -8.689  1.00 0.32 ? 63  MET A C    3  
ATOM   3661  O O    . MET A 1 63 ? -17.758 3.461   -9.596  1.00 0.42 ? 63  MET A O    3  
ATOM   3662  C CB   . MET A 1 63 ? -15.995 0.868   -9.383  1.00 0.37 ? 63  MET A CB   3  
ATOM   3663  C CG   . MET A 1 63 ? -16.971 0.166   -8.449  1.00 0.38 ? 63  MET A CG   3  
ATOM   3664  S SD   . MET A 1 63 ? -17.321 -1.531  -8.940  1.00 0.50 ? 63  MET A SD   3  
ATOM   3665  C CE   . MET A 1 63 ? -15.774 -2.327  -8.520  1.00 0.71 ? 63  MET A CE   3  
ATOM   3666  H H    . MET A 1 63 ? -14.773 1.685   -7.227  1.00 0.27 ? 63  MET A H    3  
ATOM   3667  H HA   . MET A 1 63 ? -15.266 2.826   -9.852  1.00 0.36 ? 63  MET A HA   3  
ATOM   3668  H HB2  . MET A 1 63 ? -16.399 0.832   -10.384 1.00 0.43 ? 63  MET A HB2  3  
ATOM   3669  H HB3  . MET A 1 63 ? -15.061 0.328   -9.363  1.00 0.42 ? 63  MET A HB3  3  
ATOM   3670  H HG2  . MET A 1 63 ? -16.552 0.157   -7.454  1.00 0.38 ? 63  MET A HG2  3  
ATOM   3671  H HG3  . MET A 1 63 ? -17.898 0.722   -8.439  1.00 0.39 ? 63  MET A HG3  3  
ATOM   3672  H HE1  . MET A 1 63 ? -15.884 -3.396  -8.604  1.00 0.96 ? 63  MET A HE1  3  
ATOM   3673  H HE2  . MET A 1 63 ? -15.501 -2.073  -7.508  1.00 0.93 ? 63  MET A HE2  3  
ATOM   3674  H HE3  . MET A 1 63 ? -15.000 -1.990  -9.197  1.00 0.95 ? 63  MET A HE3  3  
ATOM   3675  N N    . ILE A 1 64 ? -17.355 3.179   -7.406  1.00 0.28 ? 64  ILE A N    3  
ATOM   3676  C CA   . ILE A 1 64 ? -18.596 3.829   -6.994  1.00 0.31 ? 64  ILE A CA   3  
ATOM   3677  C C    . ILE A 1 64 ? -18.407 5.336   -6.826  1.00 0.31 ? 64  ILE A C    3  
ATOM   3678  O O    . ILE A 1 64 ? -19.158 6.133   -7.394  1.00 0.37 ? 64  ILE A O    3  
ATOM   3679  C CB   . ILE A 1 64 ? -19.143 3.221   -5.682  1.00 0.35 ? 64  ILE A CB   3  
ATOM   3680  C CG1  . ILE A 1 64 ? -19.482 1.738   -5.883  1.00 0.38 ? 64  ILE A CG1  3  
ATOM   3681  C CG2  . ILE A 1 64 ? -20.369 3.986   -5.202  1.00 0.43 ? 64  ILE A CG2  3  
ATOM   3682  C CD1  . ILE A 1 64 ? -20.035 1.067   -4.645  1.00 0.46 ? 64  ILE A CD1  3  
ATOM   3683  H H    . ILE A 1 64 ? -16.748 2.822   -6.721  1.00 0.29 ? 64  ILE A H    3  
ATOM   3684  H HA   . ILE A 1 64 ? -19.325 3.659   -7.771  1.00 0.35 ? 64  ILE A HA   3  
ATOM   3685  H HB   . ILE A 1 64 ? -18.377 3.306   -4.926  1.00 0.34 ? 64  ILE A HB   3  
ATOM   3686  H HG12 . ILE A 1 64 ? -20.218 1.645   -6.668  1.00 0.44 ? 64  ILE A HG12 3  
ATOM   3687  H HG13 . ILE A 1 64 ? -18.586 1.209   -6.174  1.00 0.36 ? 64  ILE A HG13 3  
ATOM   3688  H HG21 . ILE A 1 64 ? -20.730 3.545   -4.284  1.00 0.59 ? 64  ILE A HG21 3  
ATOM   3689  H HG22 . ILE A 1 64 ? -21.142 3.936   -5.954  1.00 0.58 ? 64  ILE A HG22 3  
ATOM   3690  H HG23 . ILE A 1 64 ? -20.103 5.018   -5.026  1.00 0.58 ? 64  ILE A HG23 3  
ATOM   3691  H HD11 . ILE A 1 64 ? -20.958 1.548   -4.356  1.00 0.62 ? 64  ILE A HD11 3  
ATOM   3692  H HD12 . ILE A 1 64 ? -19.319 1.149   -3.840  1.00 0.57 ? 64  ILE A HD12 3  
ATOM   3693  H HD13 . ILE A 1 64 ? -20.223 0.024   -4.855  1.00 0.59 ? 64  ILE A HD13 3  
ATOM   3694  N N    . LEU A 1 65 ? -17.399 5.727   -6.058  1.00 0.29 ? 65  LEU A N    3  
ATOM   3695  C CA   . LEU A 1 65 ? -17.137 7.140   -5.818  1.00 0.33 ? 65  LEU A CA   3  
ATOM   3696  C C    . LEU A 1 65 ? -16.412 7.769   -7.002  1.00 0.34 ? 65  LEU A C    3  
ATOM   3697  O O    . LEU A 1 65 ? -16.417 8.987   -7.171  1.00 0.47 ? 65  LEU A O    3  
ATOM   3698  C CB   . LEU A 1 65 ? -16.318 7.335   -4.538  1.00 0.40 ? 65  LEU A CB   3  
ATOM   3699  C CG   . LEU A 1 65 ? -17.117 7.285   -3.230  1.00 0.93 ? 65  LEU A CG   3  
ATOM   3700  C CD1  . LEU A 1 65 ? -17.440 5.850   -2.844  1.00 1.61 ? 65  LEU A CD1  3  
ATOM   3701  C CD2  . LEU A 1 65 ? -16.350 7.980   -2.113  1.00 0.99 ? 65  LEU A CD2  3  
ATOM   3702  H H    . LEU A 1 65 ? -16.815 5.054   -5.645  1.00 0.30 ? 65  LEU A H    3  
ATOM   3703  H HA   . LEU A 1 65 ? -18.091 7.630   -5.700  1.00 0.39 ? 65  LEU A HA   3  
ATOM   3704  H HB2  . LEU A 1 65 ? -15.562 6.564   -4.501  1.00 0.77 ? 65  LEU A HB2  3  
ATOM   3705  H HB3  . LEU A 1 65 ? -15.827 8.294   -4.596  1.00 0.73 ? 65  LEU A HB3  3  
ATOM   3706  H HG   . LEU A 1 65 ? -18.051 7.809   -3.369  1.00 1.40 ? 65  LEU A HG   3  
ATOM   3707  H HD11 . LEU A 1 65 ? -16.527 5.277   -2.787  1.00 1.79 ? 65  LEU A HD11 3  
ATOM   3708  H HD12 . LEU A 1 65 ? -18.094 5.416   -3.585  1.00 1.94 ? 65  LEU A HD12 3  
ATOM   3709  H HD13 . LEU A 1 65 ? -17.929 5.843   -1.883  1.00 2.09 ? 65  LEU A HD13 3  
ATOM   3710  H HD21 . LEU A 1 65 ? -16.153 9.003   -2.395  1.00 1.31 ? 65  LEU A HD21 3  
ATOM   3711  H HD22 . LEU A 1 65 ? -15.414 7.467   -1.940  1.00 1.14 ? 65  LEU A HD22 3  
ATOM   3712  H HD23 . LEU A 1 65 ? -16.941 7.964   -1.212  1.00 1.50 ? 65  LEU A HD23 3  
ATOM   3713  N N    . GLY A 1 66 ? -15.790 6.931   -7.820  1.00 0.30 ? 66  GLY A N    3  
ATOM   3714  C CA   . GLY A 1 66 ? -15.070 7.426   -8.979  1.00 0.36 ? 66  GLY A CA   3  
ATOM   3715  C C    . GLY A 1 66 ? -13.733 8.036   -8.608  1.00 0.43 ? 66  GLY A C    3  
ATOM   3716  O O    . GLY A 1 66 ? -13.375 9.117   -9.086  1.00 0.81 ? 66  GLY A O    3  
ATOM   3717  H H    . GLY A 1 66 ? -15.817 5.970   -7.635  1.00 0.33 ? 66  GLY A H    3  
ATOM   3718  H HA2  . GLY A 1 66 ? -14.906 6.605   -9.663  1.00 0.40 ? 66  GLY A HA2  3  
ATOM   3719  H HA3  . GLY A 1 66 ? -15.672 8.175   -9.472  1.00 0.41 ? 66  GLY A HA3  3  
ATOM   3720  N N    . LYS A 1 67 ? -13.001 7.346   -7.744  1.00 0.43 ? 67  LYS A N    3  
ATOM   3721  C CA   . LYS A 1 67 ? -11.696 7.809   -7.295  1.00 0.47 ? 67  LYS A CA   3  
ATOM   3722  C C    . LYS A 1 67 ? -10.757 6.628   -7.108  1.00 0.35 ? 67  LYS A C    3  
ATOM   3723  O O    . LYS A 1 67 ? -11.057 5.696   -6.367  1.00 0.44 ? 67  LYS A O    3  
ATOM   3724  C CB   . LYS A 1 67 ? -11.812 8.600   -5.987  1.00 0.65 ? 67  LYS A CB   3  
ATOM   3725  C CG   . LYS A 1 67 ? -12.590 7.886   -4.893  1.00 0.74 ? 67  LYS A CG   3  
ATOM   3726  C CD   . LYS A 1 67 ? -12.147 8.323   -3.501  1.00 1.10 ? 67  LYS A CD   3  
ATOM   3727  C CE   . LYS A 1 67 ? -12.468 9.787   -3.236  1.00 1.28 ? 67  LYS A CE   3  
ATOM   3728  N NZ   . LYS A 1 67 ? -11.338 10.688  -3.588  1.00 1.52 ? 67  LYS A NZ   3  
ATOM   3729  H H    . LYS A 1 67 ? -13.345 6.493   -7.406  1.00 0.69 ? 67  LYS A H    3  
ATOM   3730  H HA   . LYS A 1 67 ? -11.295 8.454   -8.062  1.00 0.55 ? 67  LYS A HA   3  
ATOM   3731  H HB2  . LYS A 1 67 ? -10.819 8.803   -5.613  1.00 0.82 ? 67  LYS A HB2  3  
ATOM   3732  H HB3  . LYS A 1 67 ? -12.305 9.539   -6.191  1.00 0.78 ? 67  LYS A HB3  3  
ATOM   3733  H HG2  . LYS A 1 67 ? -13.640 8.109   -5.007  1.00 0.86 ? 67  LYS A HG2  3  
ATOM   3734  H HG3  . LYS A 1 67 ? -12.433 6.821   -4.993  1.00 0.86 ? 67  LYS A HG3  3  
ATOM   3735  H HD2  . LYS A 1 67 ? -12.659 7.717   -2.769  1.00 1.44 ? 67  LYS A HD2  3  
ATOM   3736  H HD3  . LYS A 1 67 ? -11.081 8.175   -3.410  1.00 1.29 ? 67  LYS A HD3  3  
ATOM   3737  H HE2  . LYS A 1 67 ? -13.332 10.062  -3.823  1.00 1.52 ? 67  LYS A HE2  3  
ATOM   3738  H HE3  . LYS A 1 67 ? -12.696 9.905   -2.187  1.00 1.71 ? 67  LYS A HE3  3  
ATOM   3739  H HZ1  . LYS A 1 67 ? -11.175 10.680  -4.613  1.00 1.85 ? 67  LYS A HZ1  3  
ATOM   3740  H HZ2  . LYS A 1 67 ? -10.470 10.376  -3.109  1.00 1.82 ? 67  LYS A HZ2  3  
ATOM   3741  H HZ3  . LYS A 1 67 ? -11.549 11.663  -3.291  1.00 1.90 ? 67  LYS A HZ3  3  
ATOM   3742  N N    . SER A 1 68 ? -9.621  6.668   -7.777  1.00 0.30 ? 68  SER A N    3  
ATOM   3743  C CA   . SER A 1 68 ? -8.650  5.594   -7.679  1.00 0.32 ? 68  SER A CA   3  
ATOM   3744  C C    . SER A 1 68 ? -7.343  6.098   -7.074  1.00 0.28 ? 68  SER A C    3  
ATOM   3745  O O    . SER A 1 68 ? -6.274  5.556   -7.349  1.00 0.33 ? 68  SER A O    3  
ATOM   3746  C CB   . SER A 1 68 ? -8.405  4.983   -9.061  1.00 0.46 ? 68  SER A CB   3  
ATOM   3747  O OG   . SER A 1 68 ? -8.452  5.969   -10.083 1.00 0.91 ? 68  SER A OG   3  
ATOM   3748  H H    . SER A 1 68 ? -9.430  7.439   -8.355  1.00 0.38 ? 68  SER A H    3  
ATOM   3749  H HA   . SER A 1 68 ? -9.060  4.835   -7.031  1.00 0.38 ? 68  SER A HA   3  
ATOM   3750  H HB2  . SER A 1 68 ? -7.431  4.518   -9.077  1.00 0.76 ? 68  SER A HB2  3  
ATOM   3751  H HB3  . SER A 1 68 ? -9.164  4.240   -9.260  1.00 0.77 ? 68  SER A HB3  3  
ATOM   3752  H HG   . SER A 1 68 ? -7.550  6.188   -10.361 1.00 1.45 ? 68  SER A HG   3  
ATOM   3753  N N    . GLY A 1 69 ? -7.446  7.127   -6.236  1.00 0.29 ? 69  GLY A N    3  
ATOM   3754  C CA   . GLY A 1 69 ? -6.271  7.700   -5.603  1.00 0.35 ? 69  GLY A CA   3  
ATOM   3755  C C    . GLY A 1 69 ? -5.479  6.681   -4.811  1.00 0.32 ? 69  GLY A C    3  
ATOM   3756  O O    . GLY A 1 69 ? -4.312  6.430   -5.104  1.00 0.41 ? 69  GLY A O    3  
ATOM   3757  H H    . GLY A 1 69 ? -8.330  7.498   -6.039  1.00 0.33 ? 69  GLY A H    3  
ATOM   3758  H HA2  . GLY A 1 69 ? -5.635  8.122   -6.366  1.00 0.40 ? 69  GLY A HA2  3  
ATOM   3759  H HA3  . GLY A 1 69 ? -6.586  8.489   -4.937  1.00 0.42 ? 69  GLY A HA3  3  
ATOM   3760  N N    . GLU A 1 70 ? -6.114  6.093   -3.812  1.00 0.34 ? 70  GLU A N    3  
ATOM   3761  C CA   . GLU A 1 70 ? -5.465  5.089   -2.982  1.00 0.38 ? 70  GLU A CA   3  
ATOM   3762  C C    . GLU A 1 70 ? -5.319  3.778   -3.747  1.00 0.32 ? 70  GLU A C    3  
ATOM   3763  O O    . GLU A 1 70 ? -4.414  2.993   -3.481  1.00 0.39 ? 70  GLU A O    3  
ATOM   3764  C CB   . GLU A 1 70 ? -6.263  4.846   -1.699  1.00 0.52 ? 70  GLU A CB   3  
ATOM   3765  C CG   . GLU A 1 70 ? -6.912  6.093   -1.123  1.00 0.66 ? 70  GLU A CG   3  
ATOM   3766  C CD   . GLU A 1 70 ? -8.304  6.330   -1.676  1.00 0.70 ? 70  GLU A CD   3  
ATOM   3767  O OE1  . GLU A 1 70 ? -8.422  6.966   -2.745  1.00 1.24 ? 70  GLU A OE1  3  
ATOM   3768  O OE2  . GLU A 1 70 ? -9.278  5.869   -1.050  1.00 1.08 ? 70  GLU A OE2  3  
ATOM   3769  H H    . GLU A 1 70 ? -7.044  6.357   -3.608  1.00 0.40 ? 70  GLU A H    3  
ATOM   3770  H HA   . GLU A 1 70 ? -4.482  5.455   -2.724  1.00 0.42 ? 70  GLU A HA   3  
ATOM   3771  H HB2  . GLU A 1 70 ? -7.043  4.130   -1.908  1.00 0.52 ? 70  GLU A HB2  3  
ATOM   3772  H HB3  . GLU A 1 70 ? -5.602  4.434   -0.952  1.00 0.64 ? 70  GLU A HB3  3  
ATOM   3773  H HG2  . GLU A 1 70 ? -6.982  5.983   -0.053  1.00 0.80 ? 70  GLU A HG2  3  
ATOM   3774  H HG3  . GLU A 1 70 ? -6.296  6.950   -1.358  1.00 0.82 ? 70  GLU A HG3  3  
ATOM   3775  N N    . LEU A 1 71 ? -6.218  3.552   -4.700  1.00 0.28 ? 71  LEU A N    3  
ATOM   3776  C CA   . LEU A 1 71 ? -6.190  2.335   -5.504  1.00 0.28 ? 71  LEU A CA   3  
ATOM   3777  C C    . LEU A 1 71 ? -4.906  2.273   -6.325  1.00 0.26 ? 71  LEU A C    3  
ATOM   3778  O O    . LEU A 1 71 ? -4.338  1.197   -6.530  1.00 0.30 ? 71  LEU A O    3  
ATOM   3779  C CB   . LEU A 1 71 ? -7.410  2.276   -6.427  1.00 0.34 ? 71  LEU A CB   3  
ATOM   3780  C CG   . LEU A 1 71 ? -7.527  0.999   -7.261  1.00 0.58 ? 71  LEU A CG   3  
ATOM   3781  C CD1  . LEU A 1 71 ? -7.900  -0.187  -6.380  1.00 0.89 ? 71  LEU A CD1  3  
ATOM   3782  C CD2  . LEU A 1 71 ? -8.545  1.184   -8.375  1.00 1.43 ? 71  LEU A CD2  3  
ATOM   3783  H H    . LEU A 1 71 ? -6.914  4.221   -4.867  1.00 0.34 ? 71  LEU A H    3  
ATOM   3784  H HA   . LEU A 1 71 ? -6.215  1.492   -4.829  1.00 0.33 ? 71  LEU A HA   3  
ATOM   3785  H HB2  . LEU A 1 71 ? -8.300  2.369   -5.821  1.00 0.54 ? 71  LEU A HB2  3  
ATOM   3786  H HB3  . LEU A 1 71 ? -7.366  3.116   -7.103  1.00 0.61 ? 71  LEU A HB3  3  
ATOM   3787  H HG   . LEU A 1 71 ? -6.570  0.790   -7.714  1.00 1.35 ? 71  LEU A HG   3  
ATOM   3788  H HD11 . LEU A 1 71 ? -7.132  -0.337  -5.637  1.00 1.64 ? 71  LEU A HD11 3  
ATOM   3789  H HD12 . LEU A 1 71 ? -7.992  -1.074  -6.988  1.00 1.06 ? 71  LEU A HD12 3  
ATOM   3790  H HD13 . LEU A 1 71 ? -8.840  0.013   -5.890  1.00 1.33 ? 71  LEU A HD13 3  
ATOM   3791  H HD21 . LEU A 1 71 ? -8.573  0.296   -8.990  1.00 2.09 ? 71  LEU A HD21 3  
ATOM   3792  H HD22 . LEU A 1 71 ? -8.261  2.030   -8.982  1.00 1.87 ? 71  LEU A HD22 3  
ATOM   3793  H HD23 . LEU A 1 71 ? -9.523  1.358   -7.949  1.00 1.71 ? 71  LEU A HD23 3  
ATOM   3794  N N    . LYS A 1 72 ? -4.452  3.434   -6.790  1.00 0.26 ? 72  LYS A N    3  
ATOM   3795  C CA   . LYS A 1 72 ? -3.223  3.523   -7.569  1.00 0.30 ? 72  LYS A CA   3  
ATOM   3796  C C    . LYS A 1 72 ? -2.039  3.098   -6.714  1.00 0.27 ? 72  LYS A C    3  
ATOM   3797  O O    . LYS A 1 72 ? -1.254  2.232   -7.102  1.00 0.33 ? 72  LYS A O    3  
ATOM   3798  C CB   . LYS A 1 72 ? -3.005  4.954   -8.065  1.00 0.39 ? 72  LYS A CB   3  
ATOM   3799  C CG   . LYS A 1 72 ? -3.683  5.266   -9.391  1.00 0.50 ? 72  LYS A CG   3  
ATOM   3800  C CD   . LYS A 1 72 ? -2.854  4.796   -10.578 1.00 0.74 ? 72  LYS A CD   3  
ATOM   3801  C CE   . LYS A 1 72 ? -1.530  5.547   -10.691 1.00 1.11 ? 72  LYS A CE   3  
ATOM   3802  N NZ   . LYS A 1 72 ? -1.718  7.022   -10.717 1.00 1.44 ? 72  LYS A NZ   3  
ATOM   3803  H H    . LYS A 1 72 ? -4.961  4.256   -6.606  1.00 0.28 ? 72  LYS A H    3  
ATOM   3804  H HA   . LYS A 1 72 ? -3.309  2.857   -8.415  1.00 0.35 ? 72  LYS A HA   3  
ATOM   3805  H HB2  . LYS A 1 72 ? -3.386  5.639   -7.322  1.00 0.45 ? 72  LYS A HB2  3  
ATOM   3806  H HB3  . LYS A 1 72 ? -1.947  5.119   -8.180  1.00 0.49 ? 72  LYS A HB3  3  
ATOM   3807  H HG2  . LYS A 1 72 ? -4.643  4.769   -9.420  1.00 0.76 ? 72  LYS A HG2  3  
ATOM   3808  H HG3  . LYS A 1 72 ? -3.827  6.332   -9.466  1.00 0.74 ? 72  LYS A HG3  3  
ATOM   3809  H HD2  . LYS A 1 72 ? -2.648  3.743   -10.465 1.00 0.98 ? 72  LYS A HD2  3  
ATOM   3810  H HD3  . LYS A 1 72 ? -3.425  4.956   -11.481 1.00 0.88 ? 72  LYS A HD3  3  
ATOM   3811  H HE2  . LYS A 1 72 ? -0.914  5.291   -9.844  1.00 1.39 ? 72  LYS A HE2  3  
ATOM   3812  H HE3  . LYS A 1 72 ? -1.032  5.240   -11.600 1.00 1.42 ? 72  LYS A HE3  3  
ATOM   3813  H HZ1  . LYS A 1 72 ? -1.999  7.366   -9.776  1.00 1.73 ? 72  LYS A HZ1  3  
ATOM   3814  H HZ2  . LYS A 1 72 ? -2.456  7.278   -11.398 1.00 1.79 ? 72  LYS A HZ2  3  
ATOM   3815  H HZ3  . LYS A 1 72 ? -0.831  7.492   -10.994 1.00 1.75 ? 72  LYS A HZ3  3  
ATOM   3816  N N    . THR A 1 73 ? -1.941  3.707   -5.542  1.00 0.23 ? 73  THR A N    3  
ATOM   3817  C CA   . THR A 1 73 ? -0.874  3.421   -4.600  1.00 0.24 ? 73  THR A CA   3  
ATOM   3818  C C    . THR A 1 73 ? -0.896  1.958   -4.160  1.00 0.21 ? 73  THR A C    3  
ATOM   3819  O O    . THR A 1 73 ? 0.115   1.259   -4.251  1.00 0.24 ? 73  THR A O    3  
ATOM   3820  C CB   . THR A 1 73 ? -1.009  4.326   -3.366  1.00 0.29 ? 73  THR A CB   3  
ATOM   3821  O OG1  . THR A 1 73 ? -1.551  5.596   -3.761  1.00 0.39 ? 73  THR A OG1  3  
ATOM   3822  C CG2  . THR A 1 73 ? 0.336   4.526   -2.688  1.00 0.35 ? 73  THR A CG2  3  
ATOM   3823  H H    . THR A 1 73 ? -2.610  4.384   -5.298  1.00 0.26 ? 73  THR A H    3  
ATOM   3824  H HA   . THR A 1 73 ? 0.069   3.634   -5.080  1.00 0.26 ? 73  THR A HA   3  
ATOM   3825  H HB   . THR A 1 73 ? -1.686  3.856   -2.666  1.00 0.32 ? 73  THR A HB   3  
ATOM   3826  H HG1  . THR A 1 73 ? -0.961  6.012   -4.416  1.00 0.74 ? 73  THR A HG1  3  
ATOM   3827  H HG21 . THR A 1 73 ? 1.022   4.991   -3.379  1.00 0.57 ? 73  THR A HG21 3  
ATOM   3828  H HG22 . THR A 1 73 ? 0.726   3.568   -2.378  1.00 0.56 ? 73  THR A HG22 3  
ATOM   3829  H HG23 . THR A 1 73 ? 0.213   5.160   -1.824  1.00 0.58 ? 73  THR A HG23 3  
ATOM   3830  N N    . TRP A 1 74 ? -2.061  1.500   -3.711  1.00 0.18 ? 74  TRP A N    3  
ATOM   3831  C CA   . TRP A 1 74 ? -2.225  0.128   -3.246  1.00 0.18 ? 74  TRP A CA   3  
ATOM   3832  C C    . TRP A 1 74 ? -1.849  -0.871  -4.329  1.00 0.17 ? 74  TRP A C    3  
ATOM   3833  O O    . TRP A 1 74 ? -1.094  -1.806  -4.078  1.00 0.19 ? 74  TRP A O    3  
ATOM   3834  C CB   . TRP A 1 74 ? -3.666  -0.113  -2.792  1.00 0.19 ? 74  TRP A CB   3  
ATOM   3835  C CG   . TRP A 1 74 ? -3.945  -1.543  -2.420  1.00 0.20 ? 74  TRP A CG   3  
ATOM   3836  C CD1  . TRP A 1 74 ? -4.731  -2.430  -3.104  1.00 0.23 ? 74  TRP A CD1  3  
ATOM   3837  C CD2  . TRP A 1 74 ? -3.441  -2.252  -1.281  1.00 0.27 ? 74  TRP A CD2  3  
ATOM   3838  N NE1  . TRP A 1 74 ? -4.743  -3.643  -2.461  1.00 0.25 ? 74  TRP A NE1  3  
ATOM   3839  C CE2  . TRP A 1 74 ? -3.960  -3.561  -1.341  1.00 0.27 ? 74  TRP A CE2  3  
ATOM   3840  C CE3  . TRP A 1 74 ? -2.599  -1.909  -0.219  1.00 0.38 ? 74  TRP A CE3  3  
ATOM   3841  C CZ2  . TRP A 1 74 ? -3.667  -4.524  -0.379  1.00 0.36 ? 74  TRP A CZ2  3  
ATOM   3842  C CZ3  . TRP A 1 74 ? -2.309  -2.866  0.735   1.00 0.48 ? 74  TRP A CZ3  3  
ATOM   3843  C CH2  . TRP A 1 74 ? -2.840  -4.162  0.648   1.00 0.46 ? 74  TRP A CH2  3  
ATOM   3844  H H    . TRP A 1 74 ? -2.836  2.108   -3.685  1.00 0.20 ? 74  TRP A H    3  
ATOM   3845  H HA   . TRP A 1 74 ? -1.567  -0.016  -2.399  1.00 0.20 ? 74  TRP A HA   3  
ATOM   3846  H HB2  . TRP A 1 74 ? -3.872  0.503   -1.930  1.00 0.22 ? 74  TRP A HB2  3  
ATOM   3847  H HB3  . TRP A 1 74 ? -4.339  0.162   -3.592  1.00 0.21 ? 74  TRP A HB3  3  
ATOM   3848  H HD1  . TRP A 1 74 ? -5.262  -2.199  -4.015  1.00 0.30 ? 74  TRP A HD1  3  
ATOM   3849  H HE1  . TRP A 1 74 ? -5.235  -4.446  -2.756  1.00 0.28 ? 74  TRP A HE1  3  
ATOM   3850  H HE3  . TRP A 1 74 ? -2.179  -0.916  -0.137  1.00 0.40 ? 74  TRP A HE3  3  
ATOM   3851  H HZ2  . TRP A 1 74 ? -4.067  -5.525  -0.436  1.00 0.36 ? 74  TRP A HZ2  3  
ATOM   3852  H HZ3  . TRP A 1 74 ? -1.660  -2.617  1.563   1.00 0.58 ? 74  TRP A HZ3  3  
ATOM   3853  H HH2  . TRP A 1 74 ? -2.583  -4.879  1.418   1.00 0.54 ? 74  TRP A HH2  3  
ATOM   3854  N N    . GLY A 1 75 ? -2.371  -0.662  -5.532  1.00 0.18 ? 75  GLY A N    3  
ATOM   3855  C CA   . GLY A 1 75 ? -2.082  -1.557  -6.634  1.00 0.21 ? 75  GLY A CA   3  
ATOM   3856  C C    . GLY A 1 75 ? -0.596  -1.698  -6.892  1.00 0.20 ? 75  GLY A C    3  
ATOM   3857  O O    . GLY A 1 75 ? -0.101  -2.802  -7.121  1.00 0.25 ? 75  GLY A O    3  
ATOM   3858  H H    . GLY A 1 75 ? -2.964  0.109   -5.670  1.00 0.20 ? 75  GLY A H    3  
ATOM   3859  H HA2  . GLY A 1 75 ? -2.488  -2.531  -6.409  1.00 0.24 ? 75  GLY A HA2  3  
ATOM   3860  H HA3  . GLY A 1 75 ? -2.559  -1.178  -7.526  1.00 0.24 ? 75  GLY A HA3  3  
ATOM   3861  N N    . LEU A 1 76 ? 0.122   -0.587  -6.831  1.00 0.20 ? 76  LEU A N    3  
ATOM   3862  C CA   . LEU A 1 76 ? 1.559   -0.592  -7.068  1.00 0.24 ? 76  LEU A CA   3  
ATOM   3863  C C    . LEU A 1 76 ? 2.294   -1.346  -5.964  1.00 0.23 ? 76  LEU A C    3  
ATOM   3864  O O    . LEU A 1 76 ? 3.169   -2.169  -6.240  1.00 0.28 ? 76  LEU A O    3  
ATOM   3865  C CB   . LEU A 1 76 ? 2.083   0.840   -7.162  1.00 0.30 ? 76  LEU A CB   3  
ATOM   3866  C CG   . LEU A 1 76 ? 1.590   1.633   -8.377  1.00 0.40 ? 76  LEU A CG   3  
ATOM   3867  C CD1  . LEU A 1 76 ? 1.892   3.117   -8.218  1.00 0.51 ? 76  LEU A CD1  3  
ATOM   3868  C CD2  . LEU A 1 76 ? 2.217   1.101   -9.656  1.00 0.56 ? 76  LEU A CD2  3  
ATOM   3869  H H    . LEU A 1 76 ? -0.327  0.262   -6.619  1.00 0.22 ? 76  LEU A H    3  
ATOM   3870  H HA   . LEU A 1 76 ? 1.737   -1.091  -8.010  1.00 0.27 ? 76  LEU A HA   3  
ATOM   3871  H HB2  . LEU A 1 76 ? 1.785   1.366   -6.267  1.00 0.34 ? 76  LEU A HB2  3  
ATOM   3872  H HB3  . LEU A 1 76 ? 3.160   0.804   -7.197  1.00 0.36 ? 76  LEU A HB3  3  
ATOM   3873  H HG   . LEU A 1 76 ? 0.519   1.523   -8.458  1.00 0.51 ? 76  LEU A HG   3  
ATOM   3874  H HD11 . LEU A 1 76 ? 2.947   3.253   -8.037  1.00 0.93 ? 76  LEU A HD11 3  
ATOM   3875  H HD12 . LEU A 1 76 ? 1.329   3.509   -7.384  1.00 0.87 ? 76  LEU A HD12 3  
ATOM   3876  H HD13 . LEU A 1 76 ? 1.611   3.640   -9.120  1.00 0.94 ? 76  LEU A HD13 3  
ATOM   3877  H HD21 . LEU A 1 76 ? 1.823   1.646   -10.499 1.00 0.97 ? 76  LEU A HD21 3  
ATOM   3878  H HD22 . LEU A 1 76 ? 1.983   0.052   -9.765  1.00 0.98 ? 76  LEU A HD22 3  
ATOM   3879  H HD23 . LEU A 1 76 ? 3.288   1.230   -9.612  1.00 1.01 ? 76  LEU A HD23 3  
ATOM   3880  N N    . VAL A 1 77 ? 1.927   -1.073  -4.716  1.00 0.22 ? 77  VAL A N    3  
ATOM   3881  C CA   . VAL A 1 77 ? 2.562   -1.720  -3.571  1.00 0.25 ? 77  VAL A CA   3  
ATOM   3882  C C    . VAL A 1 77 ? 2.214   -3.206  -3.524  1.00 0.23 ? 77  VAL A C    3  
ATOM   3883  O O    . VAL A 1 77 ? 3.080   -4.044  -3.273  1.00 0.24 ? 77  VAL A O    3  
ATOM   3884  C CB   . VAL A 1 77 ? 2.146   -1.051  -2.240  1.00 0.29 ? 77  VAL A CB   3  
ATOM   3885  C CG1  . VAL A 1 77 ? 2.817   -1.729  -1.055  1.00 0.34 ? 77  VAL A CG1  3  
ATOM   3886  C CG2  . VAL A 1 77 ? 2.482   0.430   -2.262  1.00 0.35 ? 77  VAL A CG2  3  
ATOM   3887  H H    . VAL A 1 77 ? 1.210   -0.416  -4.561  1.00 0.22 ? 77  VAL A H    3  
ATOM   3888  H HA   . VAL A 1 77 ? 3.632   -1.614  -3.681  1.00 0.29 ? 77  VAL A HA   3  
ATOM   3889  H HB   . VAL A 1 77 ? 1.077   -1.154  -2.127  1.00 0.30 ? 77  VAL A HB   3  
ATOM   3890  H HG11 . VAL A 1 77 ? 2.547   -2.773  -1.036  1.00 0.46 ? 77  VAL A HG11 3  
ATOM   3891  H HG12 . VAL A 1 77 ? 2.493   -1.256  -0.139  1.00 0.50 ? 77  VAL A HG12 3  
ATOM   3892  H HG13 . VAL A 1 77 ? 3.889   -1.635  -1.148  1.00 0.49 ? 77  VAL A HG13 3  
ATOM   3893  H HG21 . VAL A 1 77 ? 3.530   0.556   -2.491  1.00 0.59 ? 77  VAL A HG21 3  
ATOM   3894  H HG22 . VAL A 1 77 ? 2.268   0.862   -1.296  1.00 0.59 ? 77  VAL A HG22 3  
ATOM   3895  H HG23 . VAL A 1 77 ? 1.888   0.922   -3.016  1.00 0.55 ? 77  VAL A HG23 3  
ATOM   3896  N N    . LEU A 1 78 ? 0.949   -3.518  -3.789  1.00 0.21 ? 78  LEU A N    3  
ATOM   3897  C CA   . LEU A 1 78 ? 0.462   -4.895  -3.783  1.00 0.21 ? 78  LEU A CA   3  
ATOM   3898  C C    . LEU A 1 78 ? 1.266   -5.768  -4.739  1.00 0.20 ? 78  LEU A C    3  
ATOM   3899  O O    . LEU A 1 78 ? 1.612   -6.906  -4.413  1.00 0.22 ? 78  LEU A O    3  
ATOM   3900  C CB   . LEU A 1 78 ? -1.018  -4.928  -4.169  1.00 0.22 ? 78  LEU A CB   3  
ATOM   3901  C CG   . LEU A 1 78 ? -1.672  -6.307  -4.133  1.00 0.25 ? 78  LEU A CG   3  
ATOM   3902  C CD1  . LEU A 1 78 ? -1.692  -6.851  -2.711  1.00 0.35 ? 78  LEU A CD1  3  
ATOM   3903  C CD2  . LEU A 1 78 ? -3.084  -6.237  -4.696  1.00 0.34 ? 78  LEU A CD2  3  
ATOM   3904  H H    . LEU A 1 78 ? 0.311   -2.791  -3.987  1.00 0.20 ? 78  LEU A H    3  
ATOM   3905  H HA   . LEU A 1 78 ? 0.572   -5.284  -2.782  1.00 0.24 ? 78  LEU A HA   3  
ATOM   3906  H HB2  . LEU A 1 78 ? -1.555  -4.281  -3.492  1.00 0.26 ? 78  LEU A HB2  3  
ATOM   3907  H HB3  . LEU A 1 78 ? -1.117  -4.532  -5.171  1.00 0.23 ? 78  LEU A HB3  3  
ATOM   3908  H HG   . LEU A 1 78 ? -1.096  -6.987  -4.746  1.00 0.28 ? 78  LEU A HG   3  
ATOM   3909  H HD11 . LEU A 1 78 ? -2.209  -6.156  -2.068  1.00 0.67 ? 78  LEU A HD11 3  
ATOM   3910  H HD12 . LEU A 1 78 ? -0.679  -6.981  -2.359  1.00 0.70 ? 78  LEU A HD12 3  
ATOM   3911  H HD13 . LEU A 1 78 ? -2.202  -7.803  -2.696  1.00 0.68 ? 78  LEU A HD13 3  
ATOM   3912  H HD21 . LEU A 1 78 ? -3.046  -5.881  -5.715  1.00 0.67 ? 78  LEU A HD21 3  
ATOM   3913  H HD22 . LEU A 1 78 ? -3.678  -5.560  -4.099  1.00 0.68 ? 78  LEU A HD22 3  
ATOM   3914  H HD23 . LEU A 1 78 ? -3.529  -7.221  -4.676  1.00 0.71 ? 78  LEU A HD23 3  
ATOM   3915  N N    . GLY A 1 79 ? 1.558   -5.225  -5.916  1.00 0.20 ? 79  GLY A N    3  
ATOM   3916  C CA   . GLY A 1 79 ? 2.325   -5.955  -6.906  1.00 0.22 ? 79  GLY A CA   3  
ATOM   3917  C C    . GLY A 1 79 ? 3.690   -6.369  -6.391  1.00 0.21 ? 79  GLY A C    3  
ATOM   3918  O O    . GLY A 1 79 ? 4.156   -7.477  -6.662  1.00 0.27 ? 79  GLY A O    3  
ATOM   3919  H H    . GLY A 1 79 ? 1.232   -4.321  -6.121  1.00 0.20 ? 79  GLY A H    3  
ATOM   3920  H HA2  . GLY A 1 79 ? 1.775   -6.841  -7.190  1.00 0.24 ? 79  GLY A HA2  3  
ATOM   3921  H HA3  . GLY A 1 79 ? 2.456   -5.330  -7.776  1.00 0.24 ? 79  GLY A HA3  3  
ATOM   3922  N N    . ALA A 1 80 ? 4.321   -5.483  -5.632  1.00 0.19 ? 80  ALA A N    3  
ATOM   3923  C CA   . ALA A 1 80 ? 5.634   -5.756  -5.067  1.00 0.22 ? 80  ALA A CA   3  
ATOM   3924  C C    . ALA A 1 80 ? 5.533   -6.772  -3.936  1.00 0.21 ? 80  ALA A C    3  
ATOM   3925  O O    . ALA A 1 80 ? 6.336   -7.702  -3.848  1.00 0.25 ? 80  ALA A O    3  
ATOM   3926  C CB   . ALA A 1 80 ? 6.276   -4.465  -4.574  1.00 0.25 ? 80  ALA A CB   3  
ATOM   3927  H H    . ALA A 1 80 ? 3.890   -4.624  -5.444  1.00 0.21 ? 80  ALA A H    3  
ATOM   3928  H HA   . ALA A 1 80 ? 6.255   -6.168  -5.850  1.00 0.25 ? 80  ALA A HA   3  
ATOM   3929  H HB1  . ALA A 1 80 ? 5.658   -4.031  -3.800  1.00 0.41 ? 80  ALA A HB1  3  
ATOM   3930  H HB2  . ALA A 1 80 ? 6.367   -3.769  -5.394  1.00 0.39 ? 80  ALA A HB2  3  
ATOM   3931  H HB3  . ALA A 1 80 ? 7.255   -4.679  -4.173  1.00 0.43 ? 80  ALA A HB3  3  
ATOM   3932  N N    . LEU A 1 81 ? 4.523   -6.600  -3.089  1.00 0.21 ? 81  LEU A N    3  
ATOM   3933  C CA   . LEU A 1 81 ? 4.302   -7.490  -1.954  1.00 0.25 ? 81  LEU A CA   3  
ATOM   3934  C C    . LEU A 1 81 ? 4.085   -8.928  -2.414  1.00 0.22 ? 81  LEU A C    3  
ATOM   3935  O O    . LEU A 1 81 ? 4.704   -9.857  -1.893  1.00 0.23 ? 81  LEU A O    3  
ATOM   3936  C CB   . LEU A 1 81 ? 3.088   -7.033  -1.147  1.00 0.33 ? 81  LEU A CB   3  
ATOM   3937  C CG   . LEU A 1 81 ? 3.196   -5.651  -0.509  1.00 0.50 ? 81  LEU A CG   3  
ATOM   3938  C CD1  . LEU A 1 81 ? 1.827   -5.179  -0.048  1.00 0.60 ? 81  LEU A CD1  3  
ATOM   3939  C CD2  . LEU A 1 81 ? 4.171   -5.675  0.659   1.00 0.72 ? 81  LEU A CD2  3  
ATOM   3940  H H    . LEU A 1 81 ? 3.908   -5.847  -3.230  1.00 0.21 ? 81  LEU A H    3  
ATOM   3941  H HA   . LEU A 1 81 ? 5.180   -7.451  -1.326  1.00 0.30 ? 81  LEU A HA   3  
ATOM   3942  H HB2  . LEU A 1 81 ? 2.231   -7.035  -1.802  1.00 0.41 ? 81  LEU A HB2  3  
ATOM   3943  H HB3  . LEU A 1 81 ? 2.922   -7.754  -0.360  1.00 0.38 ? 81  LEU A HB3  3  
ATOM   3944  H HG   . LEU A 1 81 ? 3.564   -4.946  -1.243  1.00 0.60 ? 81  LEU A HG   3  
ATOM   3945  H HD11 . LEU A 1 81 ? 1.456   -5.842  0.718   1.00 0.98 ? 81  LEU A HD11 3  
ATOM   3946  H HD12 . LEU A 1 81 ? 1.146   -5.179  -0.884  1.00 0.95 ? 81  LEU A HD12 3  
ATOM   3947  H HD13 . LEU A 1 81 ? 1.906   -4.178  0.350   1.00 1.12 ? 81  LEU A HD13 3  
ATOM   3948  H HD21 . LEU A 1 81 ? 3.808   -6.351  1.417   1.00 1.02 ? 81  LEU A HD21 3  
ATOM   3949  H HD22 . LEU A 1 81 ? 4.259   -4.682  1.076   1.00 1.04 ? 81  LEU A HD22 3  
ATOM   3950  H HD23 . LEU A 1 81 ? 5.139   -6.007  0.314   1.00 1.02 ? 81  LEU A HD23 3  
ATOM   3951  N N    . LYS A 1 82 ? 3.206   -9.101  -3.395  1.00 0.22 ? 82  LYS A N    3  
ATOM   3952  C CA   . LYS A 1 82 ? 2.901   -10.423 -3.930  1.00 0.24 ? 82  LYS A CA   3  
ATOM   3953  C C    . LYS A 1 82 ? 4.153   -11.086 -4.493  1.00 0.24 ? 82  LYS A C    3  
ATOM   3954  O O    . LYS A 1 82 ? 4.406   -12.265 -4.243  1.00 0.29 ? 82  LYS A O    3  
ATOM   3955  C CB   . LYS A 1 82 ? 1.834   -10.327 -5.018  1.00 0.31 ? 82  LYS A CB   3  
ATOM   3956  C CG   . LYS A 1 82 ? 0.437   -10.062 -4.487  1.00 0.52 ? 82  LYS A CG   3  
ATOM   3957  C CD   . LYS A 1 82 ? -0.585  -10.091 -5.610  1.00 0.61 ? 82  LYS A CD   3  
ATOM   3958  C CE   . LYS A 1 82 ? -2.004  -9.958  -5.087  1.00 0.90 ? 82  LYS A CE   3  
ATOM   3959  N NZ   . LYS A 1 82 ? -3.006  -10.073 -6.180  1.00 1.19 ? 82  LYS A NZ   3  
ATOM   3960  H H    . LYS A 1 82 ? 2.749   -8.316  -3.772  1.00 0.23 ? 82  LYS A H    3  
ATOM   3961  H HA   . LYS A 1 82 ? 2.524   -11.027 -3.120  1.00 0.26 ? 82  LYS A HA   3  
ATOM   3962  H HB2  . LYS A 1 82 ? 2.095   -9.525  -5.693  1.00 0.53 ? 82  LYS A HB2  3  
ATOM   3963  H HB3  . LYS A 1 82 ? 1.816   -11.256 -5.566  1.00 0.51 ? 82  LYS A HB3  3  
ATOM   3964  H HG2  . LYS A 1 82 ? 0.187   -10.821 -3.760  1.00 0.82 ? 82  LYS A HG2  3  
ATOM   3965  H HG3  . LYS A 1 82 ? 0.418   -9.089  -4.017  1.00 0.81 ? 82  LYS A HG3  3  
ATOM   3966  H HD2  . LYS A 1 82 ? -0.387  -9.273  -6.283  1.00 0.84 ? 82  LYS A HD2  3  
ATOM   3967  H HD3  . LYS A 1 82 ? -0.494  -11.028 -6.143  1.00 0.84 ? 82  LYS A HD3  3  
ATOM   3968  H HE2  . LYS A 1 82 ? -2.183  -10.743 -4.365  1.00 1.22 ? 82  LYS A HE2  3  
ATOM   3969  H HE3  . LYS A 1 82 ? -2.111  -8.997  -4.607  1.00 1.21 ? 82  LYS A HE3  3  
ATOM   3970  H HZ1  . LYS A 1 82 ? -3.026  -11.047 -6.546  1.00 1.48 ? 82  LYS A HZ1  3  
ATOM   3971  H HZ2  . LYS A 1 82 ? -2.762  -9.430  -6.960  1.00 1.54 ? 82  LYS A HZ2  3  
ATOM   3972  H HZ3  . LYS A 1 82 ? -3.953  -9.829  -5.829  1.00 1.55 ? 82  LYS A HZ3  3  
ATOM   3973  N N    . ALA A 1 83 ? 4.943   -10.312 -5.233  1.00 0.24 ? 83  ALA A N    3  
ATOM   3974  C CA   . ALA A 1 83 ? 6.168   -10.819 -5.835  1.00 0.28 ? 83  ALA A CA   3  
ATOM   3975  C C    . ALA A 1 83 ? 7.173   -11.226 -4.763  1.00 0.28 ? 83  ALA A C    3  
ATOM   3976  O O    . ALA A 1 83 ? 7.863   -12.240 -4.894  1.00 0.34 ? 83  ALA A O    3  
ATOM   3977  C CB   . ALA A 1 83 ? 6.771   -9.772  -6.756  1.00 0.35 ? 83  ALA A CB   3  
ATOM   3978  H H    . ALA A 1 83 ? 4.698   -9.373  -5.374  1.00 0.25 ? 83  ALA A H    3  
ATOM   3979  H HA   . ALA A 1 83 ? 5.914   -11.685 -6.428  1.00 0.32 ? 83  ALA A HA   3  
ATOM   3980  H HB1  . ALA A 1 83 ? 7.053   -8.905  -6.177  1.00 0.48 ? 83  ALA A HB1  3  
ATOM   3981  H HB2  . ALA A 1 83 ? 6.044   -9.487  -7.503  1.00 0.53 ? 83  ALA A HB2  3  
ATOM   3982  H HB3  . ALA A 1 83 ? 7.644   -10.180 -7.243  1.00 0.54 ? 83  ALA A HB3  3  
ATOM   3983  N N    . ALA A 1 84 ? 7.246   -10.431 -3.701  1.00 0.26 ? 84  ALA A N    3  
ATOM   3984  C CA   . ALA A 1 84 ? 8.157   -10.704 -2.597  1.00 0.31 ? 84  ALA A CA   3  
ATOM   3985  C C    . ALA A 1 84 ? 7.782   -12.002 -1.892  1.00 0.32 ? 84  ALA A C    3  
ATOM   3986  O O    . ALA A 1 84 ? 8.646   -12.732 -1.414  1.00 0.45 ? 84  ALA A O    3  
ATOM   3987  C CB   . ALA A 1 84 ? 8.147   -9.548  -1.611  1.00 0.35 ? 84  ALA A CB   3  
ATOM   3988  H H    . ALA A 1 84 ? 6.674   -9.630  -3.662  1.00 0.26 ? 84  ALA A H    3  
ATOM   3989  H HA   . ALA A 1 84 ? 9.155   -10.799 -3.002  1.00 0.36 ? 84  ALA A HA   3  
ATOM   3990  H HB1  . ALA A 1 84 ? 8.855   -9.745  -0.820  1.00 0.55 ? 84  ALA A HB1  3  
ATOM   3991  H HB2  . ALA A 1 84 ? 7.158   -9.441  -1.193  1.00 0.50 ? 84  ALA A HB2  3  
ATOM   3992  H HB3  . ALA A 1 84 ? 8.423   -8.637  -2.121  1.00 0.52 ? 84  ALA A HB3  3  
ATOM   3993  N N    . ARG A 1 85 ? 6.487   -12.290 -1.852  1.00 0.29 ? 85  ARG A N    3  
ATOM   3994  C CA   . ARG A 1 85 ? 5.987   -13.493 -1.204  1.00 0.35 ? 85  ARG A CA   3  
ATOM   3995  C C    . ARG A 1 85 ? 6.071   -14.704 -2.131  1.00 0.35 ? 85  ARG A C    3  
ATOM   3996  O O    . ARG A 1 85 ? 5.739   -15.820 -1.736  1.00 0.48 ? 85  ARG A O    3  
ATOM   3997  C CB   . ARG A 1 85 ? 4.541   -13.288 -0.740  1.00 0.42 ? 85  ARG A CB   3  
ATOM   3998  C CG   . ARG A 1 85 ? 4.431   -12.655 0.640   1.00 0.54 ? 85  ARG A CG   3  
ATOM   3999  C CD   . ARG A 1 85 ? 4.709   -13.665 1.745   1.00 0.74 ? 85  ARG A CD   3  
ATOM   4000  N NE   . ARG A 1 85 ? 4.884   -13.019 3.047   1.00 0.66 ? 85  ARG A NE   3  
ATOM   4001  C CZ   . ARG A 1 85 ? 4.726   -13.640 4.219   1.00 0.66 ? 85  ARG A CZ   3  
ATOM   4002  N NH1  . ARG A 1 85 ? 4.377   -14.921 4.255   1.00 0.83 ? 85  ARG A NH1  3  
ATOM   4003  N NH2  . ARG A 1 85 ? 4.903   -12.969 5.352   1.00 0.79 ? 85  ARG A NH2  3  
ATOM   4004  H H    . ARG A 1 85 ? 5.849   -11.669 -2.268  1.00 0.31 ? 85  ARG A H    3  
ATOM   4005  H HA   . ARG A 1 85 ? 6.604   -13.677 -0.337  1.00 0.41 ? 85  ARG A HA   3  
ATOM   4006  H HB2  . ARG A 1 85 ? 4.035   -12.649 -1.449  1.00 0.47 ? 85  ARG A HB2  3  
ATOM   4007  H HB3  . ARG A 1 85 ? 4.045   -14.245 -0.713  1.00 0.49 ? 85  ARG A HB3  3  
ATOM   4008  H HG2  . ARG A 1 85 ? 5.151   -11.854 0.713   1.00 0.96 ? 85  ARG A HG2  3  
ATOM   4009  H HG3  . ARG A 1 85 ? 3.433   -12.258 0.768   1.00 1.03 ? 85  ARG A HG3  3  
ATOM   4010  H HD2  . ARG A 1 85 ? 3.881   -14.354 1.803   1.00 1.28 ? 85  ARG A HD2  3  
ATOM   4011  H HD3  . ARG A 1 85 ? 5.610   -14.208 1.499   1.00 1.22 ? 85  ARG A HD3  3  
ATOM   4012  H HE   . ARG A 1 85 ? 5.148   -12.070 3.047   1.00 0.81 ? 85  ARG A HE   3  
ATOM   4013  H HH11 . ARG A 1 85 ? 4.264   -15.394 5.137   1.00 1.01 ? 85  ARG A HH11 3  
ATOM   4014  H HH12 . ARG A 1 85 ? 4.225   -15.429 3.401   1.00 0.90 ? 85  ARG A HH12 3  
ATOM   4015  H HH21 . ARG A 1 85 ? 5.156   -11.993 5.332   1.00 0.90 ? 85  ARG A HH21 3  
ATOM   4016  H HH22 . ARG A 1 85 ? 4.794   -13.433 6.236   1.00 0.92 ? 85  ARG A HH22 3  
ATOM   4017  N N    . GLU A 1 86 ? 6.507   -14.487 -3.364  1.00 0.35 ? 86  GLU A N    3  
ATOM   4018  C CA   . GLU A 1 86 ? 6.627   -15.575 -4.323  1.00 0.40 ? 86  GLU A CA   3  
ATOM   4019  C C    . GLU A 1 86 ? 7.998   -16.234 -4.225  1.00 0.43 ? 86  GLU A C    3  
ATOM   4020  O O    . GLU A 1 86 ? 8.130   -17.444 -4.411  1.00 0.65 ? 86  GLU A O    3  
ATOM   4021  C CB   . GLU A 1 86 ? 6.398   -15.073 -5.747  1.00 0.50 ? 86  GLU A CB   3  
ATOM   4022  C CG   . GLU A 1 86 ? 4.952   -14.731 -6.056  1.00 0.68 ? 86  GLU A CG   3  
ATOM   4023  C CD   . GLU A 1 86 ? 4.744   -14.445 -7.524  1.00 0.87 ? 86  GLU A CD   3  
ATOM   4024  O OE1  . GLU A 1 86 ? 4.199   -15.314 -8.234  1.00 1.32 ? 86  GLU A OE1  3  
ATOM   4025  O OE2  . GLU A 1 86 ? 5.148   -13.356 -7.982  1.00 1.25 ? 86  GLU A OE2  3  
ATOM   4026  H H    . GLU A 1 86 ? 6.750   -13.576 -3.636  1.00 0.42 ? 86  GLU A H    3  
ATOM   4027  H HA   . GLU A 1 86 ? 5.871   -16.309 -4.084  1.00 0.47 ? 86  GLU A HA   3  
ATOM   4028  H HB2  . GLU A 1 86 ? 6.995   -14.187 -5.902  1.00 0.63 ? 86  GLU A HB2  3  
ATOM   4029  H HB3  . GLU A 1 86 ? 6.720   -15.837 -6.442  1.00 0.63 ? 86  GLU A HB3  3  
ATOM   4030  H HG2  . GLU A 1 86 ? 4.322   -15.562 -5.770  1.00 0.90 ? 86  GLU A HG2  3  
ATOM   4031  H HG3  . GLU A 1 86 ? 4.673   -13.854 -5.491  1.00 0.93 ? 86  GLU A HG3  3  
ATOM   4032  N N    . GLU A 1 87 ? 9.013   -15.438 -3.933  1.00 0.47 ? 87  GLU A N    3  
ATOM   4033  C CA   . GLU A 1 87 ? 10.369  -15.946 -3.821  1.00 0.58 ? 87  GLU A CA   3  
ATOM   4034  C C    . GLU A 1 87 ? 10.751  -16.125 -2.360  1.00 0.68 ? 87  GLU A C    3  
ATOM   4035  O O    . GLU A 1 87 ? 10.836  -17.284 -1.908  1.00 1.13 ? 87  GLU A O    3  
ATOM   4036  C CB   . GLU A 1 87 ? 11.354  -15.009 -4.521  1.00 0.77 ? 87  GLU A CB   3  
ATOM   4037  C CG   . GLU A 1 87 ? 11.062  -14.825 -6.001  1.00 1.10 ? 87  GLU A CG   3  
ATOM   4038  C CD   . GLU A 1 87 ? 12.163  -14.082 -6.725  1.00 1.15 ? 87  GLU A CD   3  
ATOM   4039  O OE1  . GLU A 1 87 ? 12.980  -14.739 -7.401  1.00 1.51 ? 87  GLU A OE1  3  
ATOM   4040  O OE2  . GLU A 1 87 ? 12.213  -12.836 -6.627  1.00 1.44 ? 87  GLU A OE2  3  
ATOM   4041  O OXT  . GLU A 1 87 ? 10.942  -15.109 -1.661  1.00 1.02 ? 87  GLU A OXT  3  
ATOM   4042  H H    . GLU A 1 87 ? 8.847   -14.485 -3.779  1.00 0.60 ? 87  GLU A H    3  
ATOM   4043  H HA   . GLU A 1 87 ? 10.400  -16.912 -4.306  1.00 0.71 ? 87  GLU A HA   3  
ATOM   4044  H HB2  . GLU A 1 87 ? 11.313  -14.041 -4.042  1.00 1.08 ? 87  GLU A HB2  3  
ATOM   4045  H HB3  . GLU A 1 87 ? 12.351  -15.411 -4.418  1.00 1.00 ? 87  GLU A HB3  3  
ATOM   4046  H HG2  . GLU A 1 87 ? 10.951  -15.797 -6.454  1.00 1.52 ? 87  GLU A HG2  3  
ATOM   4047  H HG3  . GLU A 1 87 ? 10.141  -14.270 -6.109  1.00 1.59 ? 87  GLU A HG3  3  
HETATM 4048  C C1   . IHP B 2 .  ? 14.137  10.549  1.448   1.00 0.87 ? 101 IHP A C1   3  
HETATM 4049  C C2   . IHP B 2 .  ? 12.979  11.415  1.949   1.00 0.83 ? 101 IHP A C2   3  
HETATM 4050  C C3   . IHP B 2 .  ? 12.228  12.001  0.752   1.00 0.67 ? 101 IHP A C3   3  
HETATM 4051  C C4   . IHP B 2 .  ? 11.677  10.866  -0.113  1.00 0.52 ? 101 IHP A C4   3  
HETATM 4052  C C5   . IHP B 2 .  ? 12.835  10.000  -0.613  1.00 0.61 ? 101 IHP A C5   3  
HETATM 4053  C C6   . IHP B 2 .  ? 13.588  9.412   0.584   1.00 0.77 ? 101 IHP A C6   3  
HETATM 4054  O O11  . IHP B 2 .  ? 14.838  10.000  2.565   1.00 1.21 ? 101 IHP A O11  3  
HETATM 4055  P P1   . IHP B 2 .  ? 16.399  10.286  2.844   1.00 1.54 ? 101 IHP A P1   3  
HETATM 4056  O O21  . IHP B 2 .  ? 16.633  11.745  2.900   1.00 1.58 ? 101 IHP A O21  3  
HETATM 4057  O O31  . IHP B 2 .  ? 16.820  9.620   4.249   1.00 1.93 ? 101 IHP A O31  3  
HETATM 4058  O O41  . IHP B 2 .  ? 17.281  9.643   1.661   1.00 1.56 ? 101 IHP A O41  3  
HETATM 4059  O O12  . IHP B 2 .  ? 12.086  10.613  2.726   1.00 0.85 ? 101 IHP A O12  3  
HETATM 4060  P P2   . IHP B 2 .  ? 11.756  10.919  4.270   1.00 1.21 ? 101 IHP A P2   3  
HETATM 4061  O O22  . IHP B 2 .  ? 11.268  12.310  4.407   1.00 1.39 ? 101 IHP A O22  3  
HETATM 4062  O O32  . IHP B 2 .  ? 10.619  9.901   4.787   1.00 1.20 ? 101 IHP A O32  3  
HETATM 4063  O O42  . IHP B 2 .  ? 13.087  10.728  5.154   1.00 1.55 ? 101 IHP A O42  3  
HETATM 4064  O O13  . IHP B 2 .  ? 11.145  12.810  1.219   1.00 0.90 ? 101 IHP A O13  3  
HETATM 4065  P P3   . IHP B 2 .  ? 11.014  14.379  0.883   1.00 1.24 ? 101 IHP A P3   3  
HETATM 4066  O O23  . IHP B 2 .  ? 12.251  15.077  1.302   1.00 1.39 ? 101 IHP A O23  3  
HETATM 4067  O O33  . IHP B 2 .  ? 10.799  14.572  -0.700  1.00 1.27 ? 101 IHP A O33  3  
HETATM 4068  O O43  . IHP B 2 .  ? 9.754   14.994  1.673   1.00 1.57 ? 101 IHP A O43  3  
HETATM 4069  O O14  . IHP B 2 .  ? 10.974  11.414  -1.231  1.00 0.74 ? 101 IHP A O14  3  
HETATM 4070  P P4   . IHP B 2 .  ? 9.415   11.130  -1.511  1.00 1.00 ? 101 IHP A P4   3  
HETATM 4071  O O24  . IHP B 2 .  ? 8.928   12.006  -2.771  1.00 1.39 ? 101 IHP A O24  3  
HETATM 4072  O O34  . IHP B 2 .  ? 9.201   9.565   -1.830  1.00 1.09 ? 101 IHP A O34  3  
HETATM 4073  O O44  . IHP B 2 .  ? 8.623   11.500  -0.317  1.00 1.01 ? 101 IHP A O44  3  
HETATM 4074  O O15  . IHP B 2 .  ? 12.323  8.938   -1.420  1.00 0.86 ? 101 IHP A O15  3  
HETATM 4075  P P5   . IHP B 2 .  ? 12.731  8.736   -2.964  1.00 1.20 ? 101 IHP A P5   3  
HETATM 4076  O O25  . IHP B 2 .  ? 14.204  8.652   -3.078  1.00 1.28 ? 101 IHP A O25  3  
HETATM 4077  O O35  . IHP B 2 .  ? 12.071  7.375   -3.519  1.00 1.56 ? 101 IHP A O35  3  
HETATM 4078  O O45  . IHP B 2 .  ? 12.195  9.982   -3.831  1.00 1.25 ? 101 IHP A O45  3  
HETATM 4079  O O16  . IHP B 2 .  ? 14.669  8.604   0.117   1.00 1.06 ? 101 IHP A O16  3  
HETATM 4080  P P6   . IHP B 2 .  ? 14.799  7.035   0.453   1.00 1.40 ? 101 IHP A P6   3  
HETATM 4081  O O26  . IHP B 2 .  ? 13.565  6.336   0.033   1.00 1.39 ? 101 IHP A O26  3  
HETATM 4082  O O36  . IHP B 2 .  ? 16.061  6.420   -0.340  1.00 1.74 ? 101 IHP A O36  3  
HETATM 4083  O O46  . IHP B 2 .  ? 15.014  6.842   2.036   1.00 1.56 ? 101 IHP A O46  3  
HETATM 4084  H H1   . IHP B 2 .  ? 14.824  11.163  0.861   1.00 0.89 ? 101 IHP A H1   3  
HETATM 4085  H H2   . IHP B 2 .  ? 13.360  12.239  2.552   1.00 1.08 ? 101 IHP A H2   3  
HETATM 4086  H H3   . IHP B 2 .  ? 12.910  12.614  0.164   1.00 0.73 ? 101 IHP A H3   3  
HETATM 4087  H H4   . IHP B 2 .  ? 10.986  10.250  0.473   1.00 0.51 ? 101 IHP A H4   3  
HETATM 4088  H H5   . IHP B 2 .  ? 13.520  10.611  -1.214  1.00 0.66 ? 101 IHP A H5   3  
HETATM 4089  H H6   . IHP B 2 .  ? 12.913  8.804   1.180   1.00 0.80 ? 101 IHP A H6   3  
ATOM   4090  N N    . SER A 1 1  ? 4.386   4.631   11.332  1.00 1.45 ? 1   SER A N    4  
ATOM   4091  C CA   . SER A 1 1  ? 4.919   5.961   11.686  1.00 0.98 ? 1   SER A CA   4  
ATOM   4092  C C    . SER A 1 1  ? 6.086   6.345   10.777  1.00 0.92 ? 1   SER A C    4  
ATOM   4093  O O    . SER A 1 1  ? 5.944   7.203   9.904   1.00 1.21 ? 1   SER A O    4  
ATOM   4094  C CB   . SER A 1 1  ? 5.363   5.956   13.147  1.00 1.66 ? 1   SER A CB   4  
ATOM   4095  O OG   . SER A 1 1  ? 4.672   4.952   13.875  1.00 2.07 ? 1   SER A OG   4  
ATOM   4096  H H1   . SER A 1 1  ? 3.991   4.649   10.372  1.00 1.90 ? 1   SER A H1   4  
ATOM   4097  H H2   . SER A 1 1  ? 3.635   4.364   12.000  1.00 1.69 ? 1   SER A H2   4  
ATOM   4098  H H3   . SER A 1 1  ? 5.138   3.922   11.377  1.00 1.94 ? 1   SER A H3   4  
ATOM   4099  H HA   . SER A 1 1  ? 4.128   6.688   11.561  1.00 1.33 ? 1   SER A HA   4  
ATOM   4100  H HB2  . SER A 1 1  ? 6.424   5.758   13.200  1.00 2.07 ? 1   SER A HB2  4  
ATOM   4101  H HB3  . SER A 1 1  ? 5.152   6.917   13.591  1.00 2.12 ? 1   SER A HB3  4  
ATOM   4102  H HG   . SER A 1 1  ? 4.290   5.340   14.672  1.00 2.51 ? 1   SER A HG   4  
ATOM   4103  N N    . GLU A 1 2  ? 7.235   5.697   10.968  1.00 0.80 ? 2   GLU A N    4  
ATOM   4104  C CA   . GLU A 1 2  ? 8.420   5.999   10.171  1.00 0.85 ? 2   GLU A CA   4  
ATOM   4105  C C    . GLU A 1 2  ? 9.054   4.729   9.604   1.00 0.72 ? 2   GLU A C    4  
ATOM   4106  O O    . GLU A 1 2  ? 9.089   4.533   8.390   1.00 0.72 ? 2   GLU A O    4  
ATOM   4107  C CB   . GLU A 1 2  ? 9.450   6.746   11.026  1.00 1.13 ? 2   GLU A CB   4  
ATOM   4108  C CG   . GLU A 1 2  ? 8.850   7.853   11.880  1.00 1.33 ? 2   GLU A CG   4  
ATOM   4109  C CD   . GLU A 1 2  ? 9.230   7.735   13.341  1.00 1.48 ? 2   GLU A CD   4  
ATOM   4110  O OE1  . GLU A 1 2  ? 10.009  8.584   13.833  1.00 1.99 ? 2   GLU A OE1  4  
ATOM   4111  O OE2  . GLU A 1 2  ? 8.756   6.789   14.008  1.00 1.97 ? 2   GLU A OE2  4  
ATOM   4112  H H    . GLU A 1 2  ? 7.291   5.005   11.662  1.00 0.89 ? 2   GLU A H    4  
ATOM   4113  H HA   . GLU A 1 2  ? 8.116   6.637   9.355   1.00 0.92 ? 2   GLU A HA   4  
ATOM   4114  H HB2  . GLU A 1 2  ? 9.937   6.040   11.681  1.00 1.41 ? 2   GLU A HB2  4  
ATOM   4115  H HB3  . GLU A 1 2  ? 10.190  7.188   10.372  1.00 1.30 ? 2   GLU A HB3  4  
ATOM   4116  H HG2  . GLU A 1 2  ? 9.196   8.805   11.506  1.00 1.76 ? 2   GLU A HG2  4  
ATOM   4117  H HG3  . GLU A 1 2  ? 7.773   7.806   11.798  1.00 1.92 ? 2   GLU A HG3  4  
ATOM   4118  N N    . ALA A 1 3  ? 9.537   3.865   10.496  1.00 0.74 ? 3   ALA A N    4  
ATOM   4119  C CA   . ALA A 1 3  ? 10.210  2.620   10.114  1.00 0.73 ? 3   ALA A CA   4  
ATOM   4120  C C    . ALA A 1 3  ? 9.403   1.777   9.128   1.00 0.59 ? 3   ALA A C    4  
ATOM   4121  O O    . ALA A 1 3  ? 9.938   1.326   8.116   1.00 0.57 ? 3   ALA A O    4  
ATOM   4122  C CB   . ALA A 1 3  ? 10.533  1.809   11.358  1.00 0.89 ? 3   ALA A CB   4  
ATOM   4123  H H    . ALA A 1 3  ? 9.443   4.075   11.451  1.00 0.83 ? 3   ALA A H    4  
ATOM   4124  H HA   . ALA A 1 3  ? 11.145  2.886   9.647   1.00 0.80 ? 3   ALA A HA   4  
ATOM   4125  H HB1  . ALA A 1 3  ? 11.048  2.434   12.072  1.00 1.15 ? 3   ALA A HB1  4  
ATOM   4126  H HB2  . ALA A 1 3  ? 11.164  0.974   11.090  1.00 1.06 ? 3   ALA A HB2  4  
ATOM   4127  H HB3  . ALA A 1 3  ? 9.616   1.440   11.795  1.00 0.95 ? 3   ALA A HB3  4  
ATOM   4128  N N    . VAL A 1 4  ? 8.122   1.573   9.414   1.00 0.56 ? 4   VAL A N    4  
ATOM   4129  C CA   . VAL A 1 4  ? 7.260   0.765   8.552   1.00 0.50 ? 4   VAL A CA   4  
ATOM   4130  C C    . VAL A 1 4  ? 7.237   1.300   7.118   1.00 0.45 ? 4   VAL A C    4  
ATOM   4131  O O    . VAL A 1 4  ? 7.250   0.527   6.159   1.00 0.48 ? 4   VAL A O    4  
ATOM   4132  C CB   . VAL A 1 4  ? 5.814   0.711   9.098   1.00 0.57 ? 4   VAL A CB   4  
ATOM   4133  C CG1  . VAL A 1 4  ? 4.873   0.049   8.101   1.00 0.82 ? 4   VAL A CG1  4  
ATOM   4134  C CG2  . VAL A 1 4  ? 5.769   -0.019  10.431  1.00 0.79 ? 4   VAL A CG2  4  
ATOM   4135  H H    . VAL A 1 4  ? 7.747   1.975   10.224  1.00 0.63 ? 4   VAL A H    4  
ATOM   4136  H HA   . VAL A 1 4  ? 7.655   -0.241  8.542   1.00 0.54 ? 4   VAL A HA   4  
ATOM   4137  H HB   . VAL A 1 4  ? 5.475   1.724   9.258   1.00 0.63 ? 4   VAL A HB   4  
ATOM   4138  H HG11 . VAL A 1 4  ? 3.880   -0.005  8.520   1.00 1.06 ? 4   VAL A HG11 4  
ATOM   4139  H HG12 . VAL A 1 4  ? 5.225   -0.947  7.877   1.00 0.99 ? 4   VAL A HG12 4  
ATOM   4140  H HG13 . VAL A 1 4  ? 4.848   0.633   7.192   1.00 1.13 ? 4   VAL A HG13 4  
ATOM   4141  H HG21 . VAL A 1 4  ? 6.039   -1.055  10.283  1.00 1.11 ? 4   VAL A HG21 4  
ATOM   4142  H HG22 . VAL A 1 4  ? 4.772   0.040   10.838  1.00 1.16 ? 4   VAL A HG22 4  
ATOM   4143  H HG23 . VAL A 1 4  ? 6.466   0.440   11.115  1.00 1.27 ? 4   VAL A HG23 4  
ATOM   4144  N N    . ILE A 1 5  ? 7.232   2.620   6.979   1.00 0.48 ? 5   ILE A N    4  
ATOM   4145  C CA   . ILE A 1 5  ? 7.197   3.242   5.665   1.00 0.51 ? 5   ILE A CA   4  
ATOM   4146  C C    . ILE A 1 5  ? 8.452   2.900   4.869   1.00 0.46 ? 5   ILE A C    4  
ATOM   4147  O O    . ILE A 1 5  ? 8.372   2.576   3.684   1.00 0.47 ? 5   ILE A O    4  
ATOM   4148  C CB   . ILE A 1 5  ? 7.050   4.775   5.768   1.00 0.65 ? 5   ILE A CB   4  
ATOM   4149  C CG1  . ILE A 1 5  ? 5.797   5.130   6.573   1.00 0.81 ? 5   ILE A CG1  4  
ATOM   4150  C CG2  . ILE A 1 5  ? 6.992   5.398   4.378   1.00 0.81 ? 5   ILE A CG2  4  
ATOM   4151  C CD1  . ILE A 1 5  ? 5.545   6.618   6.690   1.00 0.98 ? 5   ILE A CD1  4  
ATOM   4152  H H    . ILE A 1 5  ? 7.273   3.187   7.774   1.00 0.54 ? 5   ILE A H    4  
ATOM   4153  H HA   . ILE A 1 5  ? 6.336   2.855   5.140   1.00 0.55 ? 5   ILE A HA   4  
ATOM   4154  H HB   . ILE A 1 5  ? 7.921   5.164   6.276   1.00 0.71 ? 5   ILE A HB   4  
ATOM   4155  H HG12 . ILE A 1 5  ? 4.937   4.686   6.099   1.00 0.91 ? 5   ILE A HG12 4  
ATOM   4156  H HG13 . ILE A 1 5  ? 5.896   4.731   7.572   1.00 0.85 ? 5   ILE A HG13 4  
ATOM   4157  H HG21 . ILE A 1 5  ? 6.187   4.947   3.817   1.00 1.02 ? 5   ILE A HG21 4  
ATOM   4158  H HG22 . ILE A 1 5  ? 7.927   5.227   3.866   1.00 1.00 ? 5   ILE A HG22 4  
ATOM   4159  H HG23 . ILE A 1 5  ? 6.819   6.460   4.468   1.00 1.04 ? 5   ILE A HG23 4  
ATOM   4160  H HD11 . ILE A 1 5  ? 5.646   7.080   5.718   1.00 1.27 ? 5   ILE A HD11 4  
ATOM   4161  H HD12 . ILE A 1 5  ? 6.261   7.050   7.372   1.00 1.29 ? 5   ILE A HD12 4  
ATOM   4162  H HD13 . ILE A 1 5  ? 4.547   6.785   7.065   1.00 1.30 ? 5   ILE A HD13 4  
ATOM   4163  N N    . LYS A 1 6  ? 9.601   2.933   5.538   1.00 0.49 ? 6   LYS A N    4  
ATOM   4164  C CA   . LYS A 1 6  ? 10.874  2.626   4.891   1.00 0.50 ? 6   LYS A CA   4  
ATOM   4165  C C    . LYS A 1 6  ? 10.858  1.219   4.317   1.00 0.46 ? 6   LYS A C    4  
ATOM   4166  O O    . LYS A 1 6  ? 11.309  0.990   3.196   1.00 0.47 ? 6   LYS A O    4  
ATOM   4167  C CB   . LYS A 1 6  ? 12.040  2.766   5.876   1.00 0.61 ? 6   LYS A CB   4  
ATOM   4168  C CG   . LYS A 1 6  ? 12.235  4.175   6.419   1.00 0.85 ? 6   LYS A CG   4  
ATOM   4169  C CD   . LYS A 1 6  ? 12.131  5.233   5.329   1.00 1.11 ? 6   LYS A CD   4  
ATOM   4170  C CE   . LYS A 1 6  ? 13.245  5.111   4.296   1.00 1.11 ? 6   LYS A CE   4  
ATOM   4171  N NZ   . LYS A 1 6  ? 13.061  6.063   3.168   1.00 1.12 ? 6   LYS A NZ   4  
ATOM   4172  H H    . LYS A 1 6  ? 9.593   3.170   6.490   1.00 0.53 ? 6   LYS A H    4  
ATOM   4173  H HA   . LYS A 1 6  ? 11.011  3.328   4.083   1.00 0.52 ? 6   LYS A HA   4  
ATOM   4174  H HB2  . LYS A 1 6  ? 11.865  2.104   6.713   1.00 0.84 ? 6   LYS A HB2  4  
ATOM   4175  H HB3  . LYS A 1 6  ? 12.949  2.466   5.380   1.00 0.80 ? 6   LYS A HB3  4  
ATOM   4176  H HG2  . LYS A 1 6  ? 11.480  4.368   7.164   1.00 1.25 ? 6   LYS A HG2  4  
ATOM   4177  H HG3  . LYS A 1 6  ? 13.214  4.238   6.874   1.00 1.02 ? 6   LYS A HG3  4  
ATOM   4178  H HD2  . LYS A 1 6  ? 11.180  5.131   4.832   1.00 1.57 ? 6   LYS A HD2  4  
ATOM   4179  H HD3  . LYS A 1 6  ? 12.191  6.204   5.791   1.00 1.65 ? 6   LYS A HD3  4  
ATOM   4180  H HE2  . LYS A 1 6  ? 14.188  5.318   4.777   1.00 1.38 ? 6   LYS A HE2  4  
ATOM   4181  H HE3  . LYS A 1 6  ? 13.253  4.104   3.906   1.00 1.51 ? 6   LYS A HE3  4  
ATOM   4182  H HZ1  . LYS A 1 6  ? 12.231  5.800   2.604   1.00 1.52 ? 6   LYS A HZ1  4  
ATOM   4183  H HZ2  . LYS A 1 6  ? 13.899  6.058   2.550   1.00 1.47 ? 6   LYS A HZ2  4  
ATOM   4184  H HZ3  . LYS A 1 6  ? 12.924  7.029   3.532   1.00 1.48 ? 6   LYS A HZ3  4  
ATOM   4185  N N    . VAL A 1 7  ? 10.304  0.286   5.080   1.00 0.46 ? 7   VAL A N    4  
ATOM   4186  C CA   . VAL A 1 7  ? 10.221  -1.105  4.652   1.00 0.48 ? 7   VAL A CA   4  
ATOM   4187  C C    . VAL A 1 7  ? 9.392   -1.239  3.376   1.00 0.44 ? 7   VAL A C    4  
ATOM   4188  O O    . VAL A 1 7  ? 9.603   -2.150  2.586   1.00 0.54 ? 7   VAL A O    4  
ATOM   4189  C CB   . VAL A 1 7  ? 9.610   -2.003  5.753   1.00 0.54 ? 7   VAL A CB   4  
ATOM   4190  C CG1  . VAL A 1 7  ? 9.702   -3.475  5.373   1.00 0.60 ? 7   VAL A CG1  4  
ATOM   4191  C CG2  . VAL A 1 7  ? 10.298  -1.752  7.087   1.00 0.61 ? 7   VAL A CG2  4  
ATOM   4192  H H    . VAL A 1 7  ? 9.942   0.542   5.956   1.00 0.48 ? 7   VAL A H    4  
ATOM   4193  H HA   . VAL A 1 7  ? 11.225  -1.450  4.453   1.00 0.53 ? 7   VAL A HA   4  
ATOM   4194  H HB   . VAL A 1 7  ? 8.568   -1.746  5.859   1.00 0.55 ? 7   VAL A HB   4  
ATOM   4195  H HG11 . VAL A 1 7  ? 9.146   -3.647  4.463   1.00 0.73 ? 7   VAL A HG11 4  
ATOM   4196  H HG12 . VAL A 1 7  ? 9.286   -4.078  6.166   1.00 0.72 ? 7   VAL A HG12 4  
ATOM   4197  H HG13 . VAL A 1 7  ? 10.737  -3.744  5.221   1.00 0.79 ? 7   VAL A HG13 4  
ATOM   4198  H HG21 . VAL A 1 7  ? 10.154  -0.722  7.378   1.00 0.75 ? 7   VAL A HG21 4  
ATOM   4199  H HG22 . VAL A 1 7  ? 11.355  -1.951  6.990   1.00 0.79 ? 7   VAL A HG22 4  
ATOM   4200  H HG23 . VAL A 1 7  ? 9.875   -2.401  7.840   1.00 0.78 ? 7   VAL A HG23 4  
ATOM   4201  N N    . ILE A 1 8  ? 8.474   -0.308  3.165   1.00 0.38 ? 8   ILE A N    4  
ATOM   4202  C CA   . ILE A 1 8  ? 7.616   -0.335  1.990   1.00 0.40 ? 8   ILE A CA   4  
ATOM   4203  C C    . ILE A 1 8  ? 8.283   0.337   0.787   1.00 0.37 ? 8   ILE A C    4  
ATOM   4204  O O    . ILE A 1 8  ? 8.477   -0.295  -0.256  1.00 0.40 ? 8   ILE A O    4  
ATOM   4205  C CB   . ILE A 1 8  ? 6.258   0.344   2.273   1.00 0.47 ? 8   ILE A CB   4  
ATOM   4206  C CG1  . ILE A 1 8  ? 5.549   -0.347  3.444   1.00 0.52 ? 8   ILE A CG1  4  
ATOM   4207  C CG2  . ILE A 1 8  ? 5.373   0.327   1.033   1.00 0.56 ? 8   ILE A CG2  4  
ATOM   4208  C CD1  . ILE A 1 8  ? 5.298   -1.829  3.225   1.00 0.61 ? 8   ILE A CD1  4  
ATOM   4209  H H    . ILE A 1 8  ? 8.375   0.418   3.816   1.00 0.39 ? 8   ILE A H    4  
ATOM   4210  H HA   . ILE A 1 8  ? 7.429   -1.370  1.745   1.00 0.44 ? 8   ILE A HA   4  
ATOM   4211  H HB   . ILE A 1 8  ? 6.445   1.375   2.535   1.00 0.50 ? 8   ILE A HB   4  
ATOM   4212  H HG12 . ILE A 1 8  ? 6.154   -0.242  4.334   1.00 0.53 ? 8   ILE A HG12 4  
ATOM   4213  H HG13 . ILE A 1 8  ? 4.595   0.133   3.607   1.00 0.59 ? 8   ILE A HG13 4  
ATOM   4214  H HG21 . ILE A 1 8  ? 5.126   -0.694  0.784   1.00 0.96 ? 8   ILE A HG21 4  
ATOM   4215  H HG22 . ILE A 1 8  ? 5.902   0.780   0.206   1.00 1.01 ? 8   ILE A HG22 4  
ATOM   4216  H HG23 . ILE A 1 8  ? 4.468   0.881   1.229   1.00 1.00 ? 8   ILE A HG23 4  
ATOM   4217  H HD11 . ILE A 1 8  ? 6.241   -2.352  3.171   1.00 0.96 ? 8   ILE A HD11 4  
ATOM   4218  H HD12 . ILE A 1 8  ? 4.754   -1.971  2.301   1.00 0.94 ? 8   ILE A HD12 4  
ATOM   4219  H HD13 . ILE A 1 8  ? 4.716   -2.221  4.045   1.00 0.97 ? 8   ILE A HD13 4  
ATOM   4220  N N    . SER A 1 9  ? 8.650   1.603   0.943   1.00 0.37 ? 9   SER A N    4  
ATOM   4221  C CA   . SER A 1 9  ? 9.268   2.370   -0.135  1.00 0.41 ? 9   SER A CA   4  
ATOM   4222  C C    . SER A 1 9  ? 10.597  1.767   -0.597  1.00 0.40 ? 9   SER A C    4  
ATOM   4223  O O    . SER A 1 9  ? 10.796  1.535   -1.792  1.00 0.46 ? 9   SER A O    4  
ATOM   4224  C CB   . SER A 1 9  ? 9.476   3.814   0.319   1.00 0.49 ? 9   SER A CB   4  
ATOM   4225  O OG   . SER A 1 9  ? 8.475   4.199   1.246   1.00 1.22 ? 9   SER A OG   4  
ATOM   4226  H H    . SER A 1 9  ? 8.494   2.048   1.809   1.00 0.39 ? 9   SER A H    4  
ATOM   4227  H HA   . SER A 1 9  ? 8.584   2.368   -0.970  1.00 0.45 ? 9   SER A HA   4  
ATOM   4228  H HB2  . SER A 1 9  ? 10.444  3.906   0.791   1.00 1.05 ? 9   SER A HB2  4  
ATOM   4229  H HB3  . SER A 1 9  ? 9.429   4.470   -0.539  1.00 1.19 ? 9   SER A HB3  4  
ATOM   4230  H HG   . SER A 1 9  ? 8.746   5.019   1.678   1.00 1.36 ? 9   SER A HG   4  
ATOM   4231  N N    . SER A 1 10 ? 11.489  1.482   0.345   1.00 0.39 ? 10  SER A N    4  
ATOM   4232  C CA   . SER A 1 10 ? 12.795  0.926   0.012   1.00 0.43 ? 10  SER A CA   4  
ATOM   4233  C C    . SER A 1 10 ? 12.674  -0.443  -0.655  1.00 0.42 ? 10  SER A C    4  
ATOM   4234  O O    . SER A 1 10 ? 13.545  -0.841  -1.428  1.00 0.56 ? 10  SER A O    4  
ATOM   4235  C CB   . SER A 1 10 ? 13.666  0.837   1.265   1.00 0.52 ? 10  SER A CB   4  
ATOM   4236  O OG   . SER A 1 10 ? 13.790  2.109   1.885   1.00 1.17 ? 10  SER A OG   4  
ATOM   4237  H H    . SER A 1 10 ? 11.265  1.649   1.289   1.00 0.41 ? 10  SER A H    4  
ATOM   4238  H HA   . SER A 1 10 ? 13.264  1.601   -0.685  1.00 0.47 ? 10  SER A HA   4  
ATOM   4239  H HB2  . SER A 1 10 ? 13.216  0.150   1.965   1.00 0.93 ? 10  SER A HB2  4  
ATOM   4240  H HB3  . SER A 1 10 ? 14.649  0.482   0.995   1.00 1.00 ? 10  SER A HB3  4  
ATOM   4241  H HG   . SER A 1 10 ? 14.079  2.759   1.229   1.00 1.54 ? 10  SER A HG   4  
ATOM   4242  N N    . ALA A 1 11 ? 11.588  -1.150  -0.373  1.00 0.37 ? 11  ALA A N    4  
ATOM   4243  C CA   . ALA A 1 11 ? 11.372  -2.466  -0.955  1.00 0.41 ? 11  ALA A CA   4  
ATOM   4244  C C    . ALA A 1 11 ? 10.846  -2.354  -2.379  1.00 0.37 ? 11  ALA A C    4  
ATOM   4245  O O    . ALA A 1 11 ? 11.394  -2.965  -3.297  1.00 0.42 ? 11  ALA A O    4  
ATOM   4246  C CB   . ALA A 1 11 ? 10.410  -3.279  -0.109  1.00 0.47 ? 11  ALA A CB   4  
ATOM   4247  H H    . ALA A 1 11 ? 10.915  -0.778  0.238   1.00 0.41 ? 11  ALA A H    4  
ATOM   4248  H HA   . ALA A 1 11 ? 12.320  -2.982  -0.974  1.00 0.47 ? 11  ALA A HA   4  
ATOM   4249  H HB1  . ALA A 1 11 ? 9.442   -2.802  -0.107  1.00 0.52 ? 11  ALA A HB1  4  
ATOM   4250  H HB2  . ALA A 1 11 ? 10.781  -3.339  0.903   1.00 0.58 ? 11  ALA A HB2  4  
ATOM   4251  H HB3  . ALA A 1 11 ? 10.321  -4.273  -0.521  1.00 0.58 ? 11  ALA A HB3  4  
ATOM   4252  N N    . CYS A 1 12 ? 9.801   -1.554  -2.569  1.00 0.34 ? 12  CYS A N    4  
ATOM   4253  C CA   . CYS A 1 12 ? 9.207   -1.382  -3.891  1.00 0.37 ? 12  CYS A CA   4  
ATOM   4254  C C    . CYS A 1 12 ? 10.213  -0.790  -4.872  1.00 0.39 ? 12  CYS A C    4  
ATOM   4255  O O    . CYS A 1 12 ? 10.113  -1.004  -6.074  1.00 0.44 ? 12  CYS A O    4  
ATOM   4256  C CB   . CYS A 1 12 ? 7.954   -0.505  -3.822  1.00 0.42 ? 12  CYS A CB   4  
ATOM   4257  S SG   . CYS A 1 12 ? 8.269   1.233   -3.435  1.00 0.66 ? 12  CYS A SG   4  
ATOM   4258  H H    . CYS A 1 12 ? 9.415   -1.074  -1.801  1.00 0.35 ? 12  CYS A H    4  
ATOM   4259  H HA   . CYS A 1 12 ? 8.924   -2.360  -4.246  1.00 0.43 ? 12  CYS A HA   4  
ATOM   4260  H HB2  . CYS A 1 12 ? 7.451   -0.541  -4.776  1.00 0.63 ? 12  CYS A HB2  4  
ATOM   4261  H HB3  . CYS A 1 12 ? 7.296   -0.898  -3.061  1.00 0.63 ? 12  CYS A HB3  4  
ATOM   4262  H HG   . CYS A 1 12 ? 9.351   1.297   -2.668  1.00 1.11 ? 12  CYS A HG   4  
ATOM   4263  N N    . LYS A 1 13 ? 11.199  -0.069  -4.352  1.00 0.41 ? 13  LYS A N    4  
ATOM   4264  C CA   . LYS A 1 13 ? 12.224  0.542   -5.189  1.00 0.49 ? 13  LYS A CA   4  
ATOM   4265  C C    . LYS A 1 13 ? 13.105  -0.526  -5.831  1.00 0.49 ? 13  LYS A C    4  
ATOM   4266  O O    . LYS A 1 13 ? 13.708  -0.299  -6.876  1.00 0.58 ? 13  LYS A O    4  
ATOM   4267  C CB   . LYS A 1 13 ? 13.073  1.499   -4.356  1.00 0.63 ? 13  LYS A CB   4  
ATOM   4268  C CG   . LYS A 1 13 ? 13.473  2.758   -5.104  1.00 0.96 ? 13  LYS A CG   4  
ATOM   4269  C CD   . LYS A 1 13 ? 13.852  3.867   -4.142  1.00 1.06 ? 13  LYS A CD   4  
ATOM   4270  C CE   . LYS A 1 13 ? 14.025  5.195   -4.859  1.00 1.40 ? 13  LYS A CE   4  
ATOM   4271  N NZ   . LYS A 1 13 ? 13.984  6.331   -3.908  1.00 1.34 ? 13  LYS A NZ   4  
ATOM   4272  H H    . LYS A 1 13 ? 11.231  0.069   -3.381  1.00 0.43 ? 13  LYS A H    4  
ATOM   4273  H HA   . LYS A 1 13 ? 11.728  1.100   -5.969  1.00 0.52 ? 13  LYS A HA   4  
ATOM   4274  H HB2  . LYS A 1 13 ? 12.511  1.788   -3.480  1.00 0.79 ? 13  LYS A HB2  4  
ATOM   4275  H HB3  . LYS A 1 13 ? 13.972  0.990   -4.044  1.00 0.85 ? 13  LYS A HB3  4  
ATOM   4276  H HG2  . LYS A 1 13 ? 14.320  2.539   -5.737  1.00 1.66 ? 13  LYS A HG2  4  
ATOM   4277  H HG3  . LYS A 1 13 ? 12.641  3.087   -5.711  1.00 1.57 ? 13  LYS A HG3  4  
ATOM   4278  H HD2  . LYS A 1 13 ? 13.073  3.970   -3.402  1.00 1.45 ? 13  LYS A HD2  4  
ATOM   4279  H HD3  . LYS A 1 13 ? 14.780  3.606   -3.654  1.00 1.68 ? 13  LYS A HD3  4  
ATOM   4280  H HE2  . LYS A 1 13 ? 14.979  5.198   -5.367  1.00 1.92 ? 13  LYS A HE2  4  
ATOM   4281  H HE3  . LYS A 1 13 ? 13.232  5.311   -5.582  1.00 1.72 ? 13  LYS A HE3  4  
ATOM   4282  H HZ1  . LYS A 1 13 ? 14.102  7.235   -4.409  1.00 1.65 ? 13  LYS A HZ1  4  
ATOM   4283  H HZ2  . LYS A 1 13 ? 14.742  6.237   -3.204  1.00 1.65 ? 13  LYS A HZ2  4  
ATOM   4284  H HZ3  . LYS A 1 13 ? 13.072  6.350   -3.402  1.00 1.73 ? 13  LYS A HZ3  4  
ATOM   4285  N N    . THR A 1 14 ? 13.163  -1.695  -5.210  1.00 0.49 ? 14  THR A N    4  
ATOM   4286  C CA   . THR A 1 14 ? 13.963  -2.794  -5.727  1.00 0.56 ? 14  THR A CA   4  
ATOM   4287  C C    . THR A 1 14 ? 13.176  -3.603  -6.767  1.00 0.54 ? 14  THR A C    4  
ATOM   4288  O O    . THR A 1 14 ? 13.753  -4.372  -7.540  1.00 0.72 ? 14  THR A O    4  
ATOM   4289  C CB   . THR A 1 14 ? 14.417  -3.724  -4.581  1.00 0.65 ? 14  THR A CB   4  
ATOM   4290  O OG1  . THR A 1 14 ? 14.759  -2.941  -3.425  1.00 0.77 ? 14  THR A OG1  4  
ATOM   4291  C CG2  . THR A 1 14 ? 15.616  -4.564  -4.995  1.00 0.83 ? 14  THR A CG2  4  
ATOM   4292  H H    . THR A 1 14 ? 12.661  -1.824  -4.374  1.00 0.48 ? 14  THR A H    4  
ATOM   4293  H HA   . THR A 1 14 ? 14.841  -2.375  -6.198  1.00 0.63 ? 14  THR A HA   4  
ATOM   4294  H HB   . THR A 1 14 ? 13.601  -4.384  -4.331  1.00 0.82 ? 14  THR A HB   4  
ATOM   4295  H HG1  . THR A 1 14 ? 15.419  -2.278  -3.670  1.00 0.99 ? 14  THR A HG1  4  
ATOM   4296  H HG21 . THR A 1 14 ? 16.448  -3.916  -5.227  1.00 1.01 ? 14  THR A HG21 4  
ATOM   4297  H HG22 . THR A 1 14 ? 15.360  -5.148  -5.866  1.00 1.11 ? 14  THR A HG22 4  
ATOM   4298  H HG23 . THR A 1 14 ? 15.886  -5.225  -4.184  1.00 1.00 ? 14  THR A HG23 4  
ATOM   4299  N N    . TYR A 1 15 ? 11.861  -3.416  -6.797  1.00 0.49 ? 15  TYR A N    4  
ATOM   4300  C CA   . TYR A 1 15 ? 11.009  -4.142  -7.735  1.00 0.54 ? 15  TYR A CA   4  
ATOM   4301  C C    . TYR A 1 15 ? 10.536  -3.236  -8.872  1.00 0.56 ? 15  TYR A C    4  
ATOM   4302  O O    . TYR A 1 15 ? 10.590  -3.612  -10.042 1.00 0.72 ? 15  TYR A O    4  
ATOM   4303  C CB   . TYR A 1 15 ? 9.808   -4.751  -7.001  1.00 0.55 ? 15  TYR A CB   4  
ATOM   4304  C CG   . TYR A 1 15 ? 10.193  -5.820  -5.999  1.00 0.60 ? 15  TYR A CG   4  
ATOM   4305  C CD1  . TYR A 1 15 ? 10.533  -5.485  -4.694  1.00 0.67 ? 15  TYR A CD1  4  
ATOM   4306  C CD2  . TYR A 1 15 ? 10.223  -7.160  -6.359  1.00 0.80 ? 15  TYR A CD2  4  
ATOM   4307  C CE1  . TYR A 1 15 ? 10.899  -6.452  -3.778  1.00 0.78 ? 15  TYR A CE1  4  
ATOM   4308  C CE2  . TYR A 1 15 ? 10.585  -8.134  -5.446  1.00 0.91 ? 15  TYR A CE2  4  
ATOM   4309  C CZ   . TYR A 1 15 ? 10.923  -7.775  -4.159  1.00 0.84 ? 15  TYR A CZ   4  
ATOM   4310  O OH   . TYR A 1 15 ? 11.292  -8.739  -3.250  1.00 1.00 ? 15  TYR A OH   4  
ATOM   4311  H H    . TYR A 1 15 ? 11.455  -2.775  -6.176  1.00 0.54 ? 15  TYR A H    4  
ATOM   4312  H HA   . TYR A 1 15 ? 11.598  -4.942  -8.160  1.00 0.62 ? 15  TYR A HA   4  
ATOM   4313  H HB2  . TYR A 1 15 ? 9.287   -3.970  -6.468  1.00 0.54 ? 15  TYR A HB2  4  
ATOM   4314  H HB3  . TYR A 1 15 ? 9.138   -5.195  -7.723  1.00 0.63 ? 15  TYR A HB3  4  
ATOM   4315  H HD1  . TYR A 1 15 ? 10.513  -4.445  -4.398  1.00 0.79 ? 15  TYR A HD1  4  
ATOM   4316  H HD2  . TYR A 1 15 ? 9.958   -7.440  -7.366  1.00 0.96 ? 15  TYR A HD2  4  
ATOM   4317  H HE1  . TYR A 1 15 ? 11.161  -6.170  -2.769  1.00 0.93 ? 15  TYR A HE1  4  
ATOM   4318  H HE2  . TYR A 1 15 ? 10.604  -9.173  -5.745  1.00 1.14 ? 15  TYR A HE2  4  
ATOM   4319  H HH   . TYR A 1 15 ? 11.834  -9.406  -3.693  1.00 1.22 ? 15  TYR A HH   4  
ATOM   4320  N N    . CYS A 1 16 ? 10.081  -2.040  -8.524  1.00 0.50 ? 16  CYS A N    4  
ATOM   4321  C CA   . CYS A 1 16 ? 9.600   -1.084  -9.513  1.00 0.55 ? 16  CYS A CA   4  
ATOM   4322  C C    . CYS A 1 16 ? 10.758  -0.289  -10.104 1.00 0.57 ? 16  CYS A C    4  
ATOM   4323  O O    . CYS A 1 16 ? 10.792  -0.012  -11.304 1.00 0.88 ? 16  CYS A O    4  
ATOM   4324  C CB   . CYS A 1 16 ? 8.585   -0.136  -8.871  1.00 0.54 ? 16  CYS A CB   4  
ATOM   4325  S SG   . CYS A 1 16 ? 7.290   -0.972  -7.922  1.00 0.67 ? 16  CYS A SG   4  
ATOM   4326  H H    . CYS A 1 16 ? 10.060  -1.792  -7.572  1.00 0.50 ? 16  CYS A H    4  
ATOM   4327  H HA   . CYS A 1 16 ? 9.117   -1.635  -10.304 1.00 0.64 ? 16  CYS A HA   4  
ATOM   4328  H HB2  . CYS A 1 16 ? 9.102   0.533   -8.199  1.00 0.56 ? 16  CYS A HB2  4  
ATOM   4329  H HB3  . CYS A 1 16 ? 8.104   0.443   -9.646  1.00 0.63 ? 16  CYS A HB3  4  
ATOM   4330  H HG   . CYS A 1 16 ? 6.540   -1.659  -8.775  1.00 1.15 ? 16  CYS A HG   4  
ATOM   4331  N N    . GLY A 1 17 ? 11.709  0.076   -9.258  1.00 0.49 ? 17  GLY A N    4  
ATOM   4332  C CA   . GLY A 1 17 ? 12.853  0.831   -9.719  1.00 0.56 ? 17  GLY A CA   4  
ATOM   4333  C C    . GLY A 1 17 ? 12.584  2.320   -9.762  1.00 0.52 ? 17  GLY A C    4  
ATOM   4334  O O    . GLY A 1 17 ? 12.822  3.029   -8.786  1.00 0.66 ? 17  GLY A O    4  
ATOM   4335  H H    . GLY A 1 17 ? 11.634  -0.174  -8.312  1.00 0.62 ? 17  GLY A H    4  
ATOM   4336  H HA2  . GLY A 1 17 ? 13.681  0.647   -9.053  1.00 0.65 ? 17  GLY A HA2  4  
ATOM   4337  H HA3  . GLY A 1 17 ? 13.119  0.495   -10.711 1.00 0.63 ? 17  GLY A HA3  4  
ATOM   4338  N N    . LYS A 1 18 ? 12.081  2.795   -10.890 1.00 0.50 ? 18  LYS A N    4  
ATOM   4339  C CA   . LYS A 1 18 ? 11.783  4.213   -11.053 1.00 0.56 ? 18  LYS A CA   4  
ATOM   4340  C C    . LYS A 1 18 ? 10.281  4.444   -11.133 1.00 0.53 ? 18  LYS A C    4  
ATOM   4341  O O    . LYS A 1 18 ? 9.823   5.575   -11.286 1.00 0.62 ? 18  LYS A O    4  
ATOM   4342  C CB   . LYS A 1 18 ? 12.474  4.782   -12.304 1.00 0.70 ? 18  LYS A CB   4  
ATOM   4343  C CG   . LYS A 1 18 ? 12.526  3.821   -13.488 1.00 0.81 ? 18  LYS A CG   4  
ATOM   4344  C CD   . LYS A 1 18 ? 13.771  2.940   -13.447 1.00 1.11 ? 18  LYS A CD   4  
ATOM   4345  C CE   . LYS A 1 18 ? 15.026  3.713   -13.813 1.00 1.46 ? 18  LYS A CE   4  
ATOM   4346  N NZ   . LYS A 1 18 ? 16.241  3.143   -13.167 1.00 1.82 ? 18  LYS A NZ   4  
ATOM   4347  H H    . LYS A 1 18 ? 11.902  2.179   -11.634 1.00 0.58 ? 18  LYS A H    4  
ATOM   4348  H HA   . LYS A 1 18 ? 12.165  4.726   -10.183 1.00 0.60 ? 18  LYS A HA   4  
ATOM   4349  H HB2  . LYS A 1 18 ? 11.947  5.670   -12.615 1.00 0.87 ? 18  LYS A HB2  4  
ATOM   4350  H HB3  . LYS A 1 18 ? 13.486  5.052   -12.044 1.00 0.79 ? 18  LYS A HB3  4  
ATOM   4351  H HG2  . LYS A 1 18 ? 11.650  3.190   -13.464 1.00 0.90 ? 18  LYS A HG2  4  
ATOM   4352  H HG3  . LYS A 1 18 ? 12.534  4.395   -14.404 1.00 1.06 ? 18  LYS A HG3  4  
ATOM   4353  H HD2  . LYS A 1 18 ? 13.884  2.540   -12.451 1.00 1.33 ? 18  LYS A HD2  4  
ATOM   4354  H HD3  . LYS A 1 18 ? 13.644  2.127   -14.150 1.00 1.44 ? 18  LYS A HD3  4  
ATOM   4355  H HE2  . LYS A 1 18 ? 15.153  3.681   -14.885 1.00 1.85 ? 18  LYS A HE2  4  
ATOM   4356  H HE3  . LYS A 1 18 ? 14.907  4.739   -13.497 1.00 1.67 ? 18  LYS A HE3  4  
ATOM   4357  H HZ1  . LYS A 1 18 ? 16.204  3.296   -12.138 1.00 2.13 ? 18  LYS A HZ1  4  
ATOM   4358  H HZ2  . LYS A 1 18 ? 17.093  3.605   -13.542 1.00 2.19 ? 18  LYS A HZ2  4  
ATOM   4359  H HZ3  . LYS A 1 18 ? 16.305  2.120   -13.354 1.00 2.14 ? 18  LYS A HZ3  4  
ATOM   4360  N N    . THR A 1 19 ? 9.515   3.369   -11.045 1.00 0.49 ? 19  THR A N    4  
ATOM   4361  C CA   . THR A 1 19 ? 8.066   3.466   -11.098 1.00 0.52 ? 19  THR A CA   4  
ATOM   4362  C C    . THR A 1 19 ? 7.467   3.277   -9.712  1.00 0.48 ? 19  THR A C    4  
ATOM   4363  O O    . THR A 1 19 ? 6.273   3.005   -9.563  1.00 0.62 ? 19  THR A O    4  
ATOM   4364  C CB   . THR A 1 19 ? 7.477   2.423   -12.065 1.00 0.62 ? 19  THR A CB   4  
ATOM   4365  O OG1  . THR A 1 19 ? 8.163   1.175   -11.905 1.00 0.83 ? 19  THR A OG1  4  
ATOM   4366  C CG2  . THR A 1 19 ? 7.596   2.888   -13.509 1.00 0.91 ? 19  THR A CG2  4  
ATOM   4367  H H    . THR A 1 19 ? 9.931   2.487   -10.956 1.00 0.49 ? 19  THR A H    4  
ATOM   4368  H HA   . THR A 1 19 ? 7.810   4.452   -11.462 1.00 0.60 ? 19  THR A HA   4  
ATOM   4369  H HB   . THR A 1 19 ? 6.431   2.285   -11.828 1.00 0.72 ? 19  THR A HB   4  
ATOM   4370  H HG1  . THR A 1 19 ? 8.246   0.740   -12.763 1.00 1.10 ? 19  THR A HG1  4  
ATOM   4371  H HG21 . THR A 1 19 ? 7.151   2.150   -14.159 1.00 1.10 ? 19  THR A HG21 4  
ATOM   4372  H HG22 . THR A 1 19 ? 8.637   3.009   -13.761 1.00 1.23 ? 19  THR A HG22 4  
ATOM   4373  H HG23 . THR A 1 19 ? 7.084   3.831   -13.628 1.00 1.17 ? 19  THR A HG23 4  
ATOM   4374  N N    . SER A 1 20 ? 8.306   3.431   -8.701  1.00 0.42 ? 20  SER A N    4  
ATOM   4375  C CA   . SER A 1 20 ? 7.890   3.278   -7.319  1.00 0.42 ? 20  SER A CA   4  
ATOM   4376  C C    . SER A 1 20 ? 7.083   4.487   -6.850  1.00 0.41 ? 20  SER A C    4  
ATOM   4377  O O    . SER A 1 20 ? 7.364   5.622   -7.236  1.00 0.46 ? 20  SER A O    4  
ATOM   4378  C CB   . SER A 1 20 ? 9.121   3.096   -6.434  1.00 0.46 ? 20  SER A CB   4  
ATOM   4379  O OG   . SER A 1 20 ? 10.303  3.049   -7.220  1.00 0.97 ? 20  SER A OG   4  
ATOM   4380  H H    . SER A 1 20 ? 9.241   3.656   -8.887  1.00 0.49 ? 20  SER A H    4  
ATOM   4381  H HA   . SER A 1 20 ? 7.273   2.397   -7.252  1.00 0.48 ? 20  SER A HA   4  
ATOM   4382  H HB2  . SER A 1 20 ? 9.193   3.925   -5.746  1.00 0.70 ? 20  SER A HB2  4  
ATOM   4383  H HB3  . SER A 1 20 ? 9.032   2.173   -5.880  1.00 0.81 ? 20  SER A HB3  4  
ATOM   4384  H HG   . SER A 1 20 ? 10.849  3.817   -7.022  1.00 1.21 ? 20  SER A HG   4  
ATOM   4385  N N    . PRO A 1 21 ? 6.062   4.251   -6.018  1.00 0.43 ? 21  PRO A N    4  
ATOM   4386  C CA   . PRO A 1 21 ? 5.214   5.317   -5.484  1.00 0.49 ? 21  PRO A CA   4  
ATOM   4387  C C    . PRO A 1 21 ? 5.928   6.134   -4.414  1.00 0.42 ? 21  PRO A C    4  
ATOM   4388  O O    . PRO A 1 21 ? 6.732   5.601   -3.650  1.00 0.46 ? 21  PRO A O    4  
ATOM   4389  C CB   . PRO A 1 21 ? 4.041   4.557   -4.868  1.00 0.62 ? 21  PRO A CB   4  
ATOM   4390  C CG   . PRO A 1 21 ? 4.594   3.222   -4.510  1.00 0.63 ? 21  PRO A CG   4  
ATOM   4391  C CD   . PRO A 1 21 ? 5.655   2.919   -5.530  1.00 0.50 ? 21  PRO A CD   4  
ATOM   4392  H HA   . PRO A 1 21 ? 4.857   5.974   -6.264  1.00 0.57 ? 21  PRO A HA   4  
ATOM   4393  H HB2  . PRO A 1 21 ? 3.687   5.080   -3.988  1.00 0.69 ? 21  PRO A HB2  4  
ATOM   4394  H HB3  . PRO A 1 21 ? 3.248   4.449   -5.589  1.00 0.76 ? 21  PRO A HB3  4  
ATOM   4395  H HG2  . PRO A 1 21 ? 5.023   3.256   -3.517  1.00 0.76 ? 21  PRO A HG2  4  
ATOM   4396  H HG3  . PRO A 1 21 ? 3.818   2.477   -4.561  1.00 0.81 ? 21  PRO A HG3  4  
ATOM   4397  H HD2  . PRO A 1 21 ? 6.488   2.408   -5.068  1.00 0.55 ? 21  PRO A HD2  4  
ATOM   4398  H HD3  . PRO A 1 21 ? 5.244   2.324   -6.332  1.00 0.57 ? 21  PRO A HD3  4  
ATOM   4399  N N    . SER A 1 22 ? 5.639   7.425   -4.369  1.00 0.43 ? 22  SER A N    4  
ATOM   4400  C CA   . SER A 1 22 ? 6.244   8.307   -3.387  1.00 0.43 ? 22  SER A CA   4  
ATOM   4401  C C    . SER A 1 22 ? 5.635   8.059   -2.016  1.00 0.38 ? 22  SER A C    4  
ATOM   4402  O O    . SER A 1 22 ? 4.462   7.683   -1.912  1.00 0.39 ? 22  SER A O    4  
ATOM   4403  C CB   . SER A 1 22 ? 6.037   9.764   -3.803  1.00 0.56 ? 22  SER A CB   4  
ATOM   4404  O OG   . SER A 1 22 ? 4.855   9.908   -4.579  1.00 1.11 ? 22  SER A OG   4  
ATOM   4405  H H    . SER A 1 22 ? 4.999   7.798   -5.011  1.00 0.53 ? 22  SER A H    4  
ATOM   4406  H HA   . SER A 1 22 ? 7.300   8.094   -3.347  1.00 0.47 ? 22  SER A HA   4  
ATOM   4407  H HB2  . SER A 1 22 ? 5.951   10.380  -2.922  1.00 0.96 ? 22  SER A HB2  4  
ATOM   4408  H HB3  . SER A 1 22 ? 6.881   10.092  -4.391  1.00 0.81 ? 22  SER A HB3  4  
ATOM   4409  H HG   . SER A 1 22 ? 5.075   9.813   -5.512  1.00 1.48 ? 22  SER A HG   4  
ATOM   4410  N N    . LYS A 1 23 ? 6.424   8.268   -0.967  1.00 0.44 ? 23  LYS A N    4  
ATOM   4411  C CA   . LYS A 1 23 ? 5.954   8.070   0.399   1.00 0.50 ? 23  LYS A CA   4  
ATOM   4412  C C    . LYS A 1 23 ? 4.704   8.902   0.667   1.00 0.42 ? 23  LYS A C    4  
ATOM   4413  O O    . LYS A 1 23 ? 3.830   8.490   1.430   1.00 0.42 ? 23  LYS A O    4  
ATOM   4414  C CB   . LYS A 1 23 ? 7.067   8.422   1.392   1.00 0.69 ? 23  LYS A CB   4  
ATOM   4415  C CG   . LYS A 1 23 ? 6.593   8.668   2.822   1.00 0.63 ? 23  LYS A CG   4  
ATOM   4416  C CD   . LYS A 1 23 ? 6.342   10.146  3.094   1.00 1.12 ? 23  LYS A CD   4  
ATOM   4417  C CE   . LYS A 1 23 ? 7.618   10.876  3.491   1.00 1.17 ? 23  LYS A CE   4  
ATOM   4418  N NZ   . LYS A 1 23 ? 8.747   10.582  2.573   1.00 1.60 ? 23  LYS A NZ   4  
ATOM   4419  H H    . LYS A 1 23 ? 7.358   8.553   -1.118  1.00 0.50 ? 23  LYS A H    4  
ATOM   4420  H HA   . LYS A 1 23 ? 5.703   7.026   0.510   1.00 0.56 ? 23  LYS A HA   4  
ATOM   4421  H HB2  . LYS A 1 23 ? 7.779   7.610   1.415   1.00 1.00 ? 23  LYS A HB2  4  
ATOM   4422  H HB3  . LYS A 1 23 ? 7.567   9.314   1.044   1.00 1.02 ? 23  LYS A HB3  4  
ATOM   4423  H HG2  . LYS A 1 23 ? 5.674   8.123   2.987   1.00 0.92 ? 23  LYS A HG2  4  
ATOM   4424  H HG3  . LYS A 1 23 ? 7.350   8.313   3.502   1.00 0.87 ? 23  LYS A HG3  4  
ATOM   4425  H HD2  . LYS A 1 23 ? 5.941   10.601  2.198   1.00 1.72 ? 23  LYS A HD2  4  
ATOM   4426  H HD3  . LYS A 1 23 ? 5.620   10.236  3.894   1.00 1.84 ? 23  LYS A HD3  4  
ATOM   4427  H HE2  . LYS A 1 23 ? 7.428   11.939  3.477   1.00 1.51 ? 23  LYS A HE2  4  
ATOM   4428  H HE3  . LYS A 1 23 ? 7.891   10.576  4.491   1.00 1.35 ? 23  LYS A HE3  4  
ATOM   4429  H HZ1  . LYS A 1 23 ? 9.612   11.049  2.920   1.00 2.03 ? 23  LYS A HZ1  4  
ATOM   4430  H HZ2  . LYS A 1 23 ? 8.545   10.924  1.612   1.00 1.91 ? 23  LYS A HZ2  4  
ATOM   4431  H HZ3  . LYS A 1 23 ? 8.922   9.556   2.535   1.00 2.03 ? 23  LYS A HZ3  4  
ATOM   4432  N N    . LYS A 1 24 ? 4.624   10.069  0.028   1.00 0.41 ? 24  LYS A N    4  
ATOM   4433  C CA   . LYS A 1 24 ? 3.481   10.965  0.185   1.00 0.45 ? 24  LYS A CA   4  
ATOM   4434  C C    . LYS A 1 24 ? 2.171   10.229  -0.090  1.00 0.40 ? 24  LYS A C    4  
ATOM   4435  O O    . LYS A 1 24 ? 1.199   10.366  0.656   1.00 0.48 ? 24  LYS A O    4  
ATOM   4436  C CB   . LYS A 1 24 ? 3.607   12.170  -0.755  1.00 0.56 ? 24  LYS A CB   4  
ATOM   4437  C CG   . LYS A 1 24 ? 4.465   13.305  -0.204  1.00 0.83 ? 24  LYS A CG   4  
ATOM   4438  C CD   . LYS A 1 24 ? 5.949   13.003  -0.332  1.00 1.00 ? 24  LYS A CD   4  
ATOM   4439  C CE   . LYS A 1 24 ? 6.800   14.164  0.161   1.00 1.56 ? 24  LYS A CE   4  
ATOM   4440  N NZ   . LYS A 1 24 ? 8.242   13.949  -0.114  1.00 2.04 ? 24  LYS A NZ   4  
ATOM   4441  H H    . LYS A 1 24 ? 5.360   10.334  -0.565  1.00 0.44 ? 24  LYS A H    4  
ATOM   4442  H HA   . LYS A 1 24 ? 3.475   11.317  1.205   1.00 0.51 ? 24  LYS A HA   4  
ATOM   4443  H HB2  . LYS A 1 24 ? 4.046   11.839  -1.685  1.00 0.63 ? 24  LYS A HB2  4  
ATOM   4444  H HB3  . LYS A 1 24 ? 2.619   12.560  -0.955  1.00 0.77 ? 24  LYS A HB3  4  
ATOM   4445  H HG2  . LYS A 1 24 ? 4.248   14.212  -0.751  1.00 1.37 ? 24  LYS A HG2  4  
ATOM   4446  H HG3  . LYS A 1 24 ? 4.224   13.448  0.839   1.00 1.33 ? 24  LYS A HG3  4  
ATOM   4447  H HD2  . LYS A 1 24 ? 6.178   12.127  0.255   1.00 1.50 ? 24  LYS A HD2  4  
ATOM   4448  H HD3  . LYS A 1 24 ? 6.180   12.813  -1.370  1.00 1.29 ? 24  LYS A HD3  4  
ATOM   4449  H HE2  . LYS A 1 24 ? 6.480   15.065  -0.335  1.00 1.84 ? 24  LYS A HE2  4  
ATOM   4450  H HE3  . LYS A 1 24 ? 6.659   14.269  1.226   1.00 2.19 ? 24  LYS A HE3  4  
ATOM   4451  H HZ1  . LYS A 1 24 ? 8.569   13.075  0.345   1.00 2.22 ? 24  LYS A HZ1  4  
ATOM   4452  H HZ2  . LYS A 1 24 ? 8.802   14.744  0.249   1.00 2.45 ? 24  LYS A HZ2  4  
ATOM   4453  H HZ3  . LYS A 1 24 ? 8.407   13.865  -1.139  1.00 2.55 ? 24  LYS A HZ3  4  
ATOM   4454  N N    . GLU A 1 25 ? 2.164   9.427   -1.147  1.00 0.34 ? 25  GLU A N    4  
ATOM   4455  C CA   . GLU A 1 25 ? 0.979   8.668   -1.523  1.00 0.37 ? 25  GLU A CA   4  
ATOM   4456  C C    . GLU A 1 25 ? 0.761   7.495   -0.576  1.00 0.31 ? 25  GLU A C    4  
ATOM   4457  O O    . GLU A 1 25 ? -0.367  7.221   -0.162  1.00 0.34 ? 25  GLU A O    4  
ATOM   4458  C CB   . GLU A 1 25 ? 1.109   8.160   -2.957  1.00 0.45 ? 25  GLU A CB   4  
ATOM   4459  C CG   . GLU A 1 25 ? 1.276   9.266   -3.984  1.00 0.90 ? 25  GLU A CG   4  
ATOM   4460  C CD   . GLU A 1 25 ? 0.591   8.938   -5.289  1.00 1.00 ? 25  GLU A CD   4  
ATOM   4461  O OE1  . GLU A 1 25 ? 1.280   8.555   -6.257  1.00 1.30 ? 25  GLU A OE1  4  
ATOM   4462  O OE2  . GLU A 1 25 ? -0.647  9.057   -5.356  1.00 1.58 ? 25  GLU A OE2  4  
ATOM   4463  H H    . GLU A 1 25 ? 2.977   9.342   -1.688  1.00 0.36 ? 25  GLU A H    4  
ATOM   4464  H HA   . GLU A 1 25 ? 0.128   9.330   -1.459  1.00 0.42 ? 25  GLU A HA   4  
ATOM   4465  H HB2  . GLU A 1 25 ? 1.968   7.508   -3.018  1.00 0.97 ? 25  GLU A HB2  4  
ATOM   4466  H HB3  . GLU A 1 25 ? 0.221   7.597   -3.206  1.00 0.87 ? 25  GLU A HB3  4  
ATOM   4467  H HG2  . GLU A 1 25 ? 0.852   10.178  -3.591  1.00 1.42 ? 25  GLU A HG2  4  
ATOM   4468  H HG3  . GLU A 1 25 ? 2.332   9.411   -4.173  1.00 1.47 ? 25  GLU A HG3  4  
ATOM   4469  N N    . ILE A 1 26 ? 1.846   6.808   -0.236  1.00 0.29 ? 26  ILE A N    4  
ATOM   4470  C CA   . ILE A 1 26 ? 1.775   5.656   0.656   1.00 0.29 ? 26  ILE A CA   4  
ATOM   4471  C C    . ILE A 1 26 ? 1.221   6.062   2.020   1.00 0.27 ? 26  ILE A C    4  
ATOM   4472  O O    . ILE A 1 26 ? 0.385   5.364   2.592   1.00 0.28 ? 26  ILE A O    4  
ATOM   4473  C CB   . ILE A 1 26 ? 3.156   4.986   0.838   1.00 0.33 ? 26  ILE A CB   4  
ATOM   4474  C CG1  . ILE A 1 26 ? 3.854   4.811   -0.516  1.00 0.36 ? 26  ILE A CG1  4  
ATOM   4475  C CG2  . ILE A 1 26 ? 2.997   3.636   1.525   1.00 0.41 ? 26  ILE A CG2  4  
ATOM   4476  C CD1  . ILE A 1 26 ? 5.250   4.234   -0.411  1.00 0.45 ? 26  ILE A CD1  4  
ATOM   4477  H H    . ILE A 1 26 ? 2.718   7.084   -0.594  1.00 0.30 ? 26  ILE A H    4  
ATOM   4478  H HA   . ILE A 1 26 ? 1.105   4.934   0.210   1.00 0.32 ? 26  ILE A HA   4  
ATOM   4479  H HB   . ILE A 1 26 ? 3.759   5.620   1.471   1.00 0.34 ? 26  ILE A HB   4  
ATOM   4480  H HG12 . ILE A 1 26 ? 3.267   4.146   -1.134  1.00 0.44 ? 26  ILE A HG12 4  
ATOM   4481  H HG13 . ILE A 1 26 ? 3.929   5.773   -1.004  1.00 0.35 ? 26  ILE A HG13 4  
ATOM   4482  H HG21 . ILE A 1 26 ? 2.348   3.740   2.382   1.00 0.52 ? 26  ILE A HG21 4  
ATOM   4483  H HG22 . ILE A 1 26 ? 3.965   3.279   1.846   1.00 0.53 ? 26  ILE A HG22 4  
ATOM   4484  H HG23 . ILE A 1 26 ? 2.566   2.930   0.830   1.00 0.54 ? 26  ILE A HG23 4  
ATOM   4485  H HD11 . ILE A 1 26 ? 5.694   4.187   -1.395  1.00 0.90 ? 26  ILE A HD11 4  
ATOM   4486  H HD12 . ILE A 1 26 ? 5.195   3.239   0.006   1.00 0.91 ? 26  ILE A HD12 4  
ATOM   4487  H HD13 . ILE A 1 26 ? 5.856   4.859   0.229   1.00 0.92 ? 26  ILE A HD13 4  
ATOM   4488  N N    . GLY A 1 27 ? 1.678   7.201   2.527   1.00 0.27 ? 27  GLY A N    4  
ATOM   4489  C CA   . GLY A 1 27 ? 1.210   7.685   3.815   1.00 0.29 ? 27  GLY A CA   4  
ATOM   4490  C C    . GLY A 1 27 ? -0.271  8.019   3.800   1.00 0.28 ? 27  GLY A C    4  
ATOM   4491  O O    . GLY A 1 27 ? -1.007  7.680   4.731   1.00 0.32 ? 27  GLY A O    4  
ATOM   4492  H H    . GLY A 1 27 ? 2.349   7.719   2.022   1.00 0.28 ? 27  GLY A H    4  
ATOM   4493  H HA2  . GLY A 1 27 ? 1.391   6.925   4.561   1.00 0.32 ? 27  GLY A HA2  4  
ATOM   4494  H HA3  . GLY A 1 27 ? 1.764   8.573   4.078   1.00 0.33 ? 27  GLY A HA3  4  
ATOM   4495  N N    . ALA A 1 28 ? -0.712  8.675   2.730   1.00 0.27 ? 28  ALA A N    4  
ATOM   4496  C CA   . ALA A 1 28 ? -2.115  9.044   2.579   1.00 0.30 ? 28  ALA A CA   4  
ATOM   4497  C C    . ALA A 1 28 ? -2.983  7.793   2.496   1.00 0.29 ? 28  ALA A C    4  
ATOM   4498  O O    . ALA A 1 28 ? -4.042  7.710   3.120   1.00 0.32 ? 28  ALA A O    4  
ATOM   4499  C CB   . ALA A 1 28 ? -2.305  9.908   1.341   1.00 0.35 ? 28  ALA A CB   4  
ATOM   4500  H H    . ALA A 1 28 ? -0.075  8.916   2.024   1.00 0.27 ? 28  ALA A H    4  
ATOM   4501  H HA   . ALA A 1 28 ? -2.408  9.622   3.445   1.00 0.34 ? 28  ALA A HA   4  
ATOM   4502  H HB1  . ALA A 1 28 ? -1.589  10.718  1.350   1.00 0.47 ? 28  ALA A HB1  4  
ATOM   4503  H HB2  . ALA A 1 28 ? -3.306  10.315  1.335   1.00 0.50 ? 28  ALA A HB2  4  
ATOM   4504  H HB3  . ALA A 1 28 ? -2.157  9.306   0.458   1.00 0.45 ? 28  ALA A HB3  4  
ATOM   4505  N N    . MET A 1 29 ? -2.505  6.812   1.736   1.00 0.27 ? 29  MET A N    4  
ATOM   4506  C CA   . MET A 1 29 ? -3.212  5.549   1.560   1.00 0.30 ? 29  MET A CA   4  
ATOM   4507  C C    . MET A 1 29 ? -3.302  4.794   2.884   1.00 0.28 ? 29  MET A C    4  
ATOM   4508  O O    . MET A 1 29 ? -4.350  4.252   3.234   1.00 0.31 ? 29  MET A O    4  
ATOM   4509  C CB   . MET A 1 29 ? -2.488  4.695   0.516   1.00 0.34 ? 29  MET A CB   4  
ATOM   4510  C CG   . MET A 1 29 ? -3.072  3.304   0.338   1.00 0.40 ? 29  MET A CG   4  
ATOM   4511  S SD   . MET A 1 29 ? -1.849  2.113   -0.248  1.00 0.49 ? 29  MET A SD   4  
ATOM   4512  C CE   . MET A 1 29 ? -0.795  1.970   1.196   1.00 0.52 ? 29  MET A CE   4  
ATOM   4513  H H    . MET A 1 29 ? -1.648  6.945   1.270   1.00 0.27 ? 29  MET A H    4  
ATOM   4514  H HA   . MET A 1 29 ? -4.209  5.769   1.212   1.00 0.34 ? 29  MET A HA   4  
ATOM   4515  H HB2  . MET A 1 29 ? -2.529  5.203   -0.436  1.00 0.38 ? 29  MET A HB2  4  
ATOM   4516  H HB3  . MET A 1 29 ? -1.454  4.593   0.811   1.00 0.34 ? 29  MET A HB3  4  
ATOM   4517  H HG2  . MET A 1 29 ? -3.459  2.965   1.287   1.00 0.40 ? 29  MET A HG2  4  
ATOM   4518  H HG3  . MET A 1 29 ? -3.877  3.356   -0.380  1.00 0.49 ? 29  MET A HG3  4  
ATOM   4519  H HE1  . MET A 1 29 ? -0.248  2.891   1.339   1.00 0.81 ? 29  MET A HE1  4  
ATOM   4520  H HE2  . MET A 1 29 ? -0.098  1.158   1.053   1.00 0.89 ? 29  MET A HE2  4  
ATOM   4521  H HE3  . MET A 1 29 ? -1.401  1.773   2.068   1.00 0.86 ? 29  MET A HE3  4  
ATOM   4522  N N    . LEU A 1 30 ? -2.193  4.772   3.616   1.00 0.29 ? 30  LEU A N    4  
ATOM   4523  C CA   . LEU A 1 30 ? -2.123  4.093   4.906   1.00 0.32 ? 30  LEU A CA   4  
ATOM   4524  C C    . LEU A 1 30 ? -3.167  4.647   5.874   1.00 0.30 ? 30  LEU A C    4  
ATOM   4525  O O    . LEU A 1 30 ? -3.877  3.893   6.539   1.00 0.33 ? 30  LEU A O    4  
ATOM   4526  C CB   . LEU A 1 30 ? -0.724  4.258   5.500   1.00 0.39 ? 30  LEU A CB   4  
ATOM   4527  C CG   . LEU A 1 30 ? -0.478  3.520   6.816   1.00 0.78 ? 30  LEU A CG   4  
ATOM   4528  C CD1  . LEU A 1 30 ? -0.455  2.016   6.589   1.00 1.32 ? 30  LEU A CD1  4  
ATOM   4529  C CD2  . LEU A 1 30 ? 0.822   3.989   7.451   1.00 1.04 ? 30  LEU A CD2  4  
ATOM   4530  H H    . LEU A 1 30 ? -1.389  5.223   3.272   1.00 0.29 ? 30  LEU A H    4  
ATOM   4531  H HA   . LEU A 1 30 ? -2.316  3.044   4.743   1.00 0.36 ? 30  LEU A HA   4  
ATOM   4532  H HB2  . LEU A 1 30 ? -0.007  3.905   4.775   1.00 0.71 ? 30  LEU A HB2  4  
ATOM   4533  H HB3  . LEU A 1 30 ? -0.551  5.311   5.669   1.00 0.65 ? 30  LEU A HB3  4  
ATOM   4534  H HG   . LEU A 1 30 ? -1.284  3.740   7.501   1.00 1.11 ? 30  LEU A HG   4  
ATOM   4535  H HD11 . LEU A 1 30 ? -1.466  1.652   6.478   1.00 1.67 ? 30  LEU A HD11 4  
ATOM   4536  H HD12 . LEU A 1 30 ? 0.014   1.530   7.431   1.00 1.61 ? 30  LEU A HD12 4  
ATOM   4537  H HD13 . LEU A 1 30 ? 0.105   1.797   5.691   1.00 1.72 ? 30  LEU A HD13 4  
ATOM   4538  H HD21 . LEU A 1 30 ? 1.654   3.488   6.980   1.00 1.49 ? 30  LEU A HD21 4  
ATOM   4539  H HD22 . LEU A 1 30 ? 0.812   3.759   8.505   1.00 1.30 ? 30  LEU A HD22 4  
ATOM   4540  H HD23 . LEU A 1 30 ? 0.923   5.056   7.319   1.00 1.27 ? 30  LEU A HD23 4  
ATOM   4541  N N    . SER A 1 31 ? -3.262  5.970   5.932   1.00 0.29 ? 31  SER A N    4  
ATOM   4542  C CA   . SER A 1 31 ? -4.215  6.634   6.812   1.00 0.32 ? 31  SER A CA   4  
ATOM   4543  C C    . SER A 1 31 ? -5.653  6.263   6.440   1.00 0.28 ? 31  SER A C    4  
ATOM   4544  O O    . SER A 1 31 ? -6.513  6.109   7.308   1.00 0.29 ? 31  SER A O    4  
ATOM   4545  C CB   . SER A 1 31 ? -4.017  8.148   6.732   1.00 0.40 ? 31  SER A CB   4  
ATOM   4546  O OG   . SER A 1 31 ? -2.641  8.486   6.826   1.00 1.20 ? 31  SER A OG   4  
ATOM   4547  H H    . SER A 1 31 ? -2.669  6.515   5.373   1.00 0.31 ? 31  SER A H    4  
ATOM   4548  H HA   . SER A 1 31 ? -4.018  6.306   7.820   1.00 0.36 ? 31  SER A HA   4  
ATOM   4549  H HB2  . SER A 1 31 ? -4.401  8.513   5.792   1.00 0.94 ? 31  SER A HB2  4  
ATOM   4550  H HB3  . SER A 1 31 ? -4.547  8.619   7.544   1.00 1.08 ? 31  SER A HB3  4  
ATOM   4551  H HG   . SER A 1 31 ? -2.252  8.506   5.939   1.00 1.76 ? 31  SER A HG   4  
ATOM   4552  N N    . LEU A 1 32 ? -5.892  6.107   5.142   1.00 0.27 ? 32  LEU A N    4  
ATOM   4553  C CA   . LEU A 1 32 ? -7.207  5.747   4.629   1.00 0.29 ? 32  LEU A CA   4  
ATOM   4554  C C    . LEU A 1 32 ? -7.600  4.350   5.106   1.00 0.26 ? 32  LEU A C    4  
ATOM   4555  O O    . LEU A 1 32 ? -8.729  4.125   5.549   1.00 0.29 ? 32  LEU A O    4  
ATOM   4556  C CB   . LEU A 1 32 ? -7.199  5.817   3.091   1.00 0.35 ? 32  LEU A CB   4  
ATOM   4557  C CG   . LEU A 1 32 ? -8.572  5.826   2.399   1.00 0.67 ? 32  LEU A CG   4  
ATOM   4558  C CD1  . LEU A 1 32 ? -9.076  4.407   2.169   1.00 1.15 ? 32  LEU A CD1  4  
ATOM   4559  C CD2  . LEU A 1 32 ? -9.589  6.628   3.204   1.00 1.17 ? 32  LEU A CD2  4  
ATOM   4560  H H    . LEU A 1 32 ? -5.157  6.242   4.508   1.00 0.29 ? 32  LEU A H    4  
ATOM   4561  H HA   . LEU A 1 32 ? -7.920  6.459   5.011   1.00 0.32 ? 32  LEU A HA   4  
ATOM   4562  H HB2  . LEU A 1 32 ? -6.674  6.717   2.802   1.00 0.51 ? 32  LEU A HB2  4  
ATOM   4563  H HB3  . LEU A 1 32 ? -6.642  4.969   2.719   1.00 0.56 ? 32  LEU A HB3  4  
ATOM   4564  H HG   . LEU A 1 32 ? -8.469  6.298   1.432   1.00 0.58 ? 32  LEU A HG   4  
ATOM   4565  H HD11 . LEU A 1 32 ? -8.389  3.883   1.522   1.00 1.26 ? 32  LEU A HD11 4  
ATOM   4566  H HD12 . LEU A 1 32 ? -10.051 4.441   1.707   1.00 1.47 ? 32  LEU A HD12 4  
ATOM   4567  H HD13 . LEU A 1 32 ? -9.144  3.889   3.115   1.00 1.37 ? 32  LEU A HD13 4  
ATOM   4568  H HD21 . LEU A 1 32 ? -10.511 6.701   2.646   1.00 1.52 ? 32  LEU A HD21 4  
ATOM   4569  H HD22 . LEU A 1 32 ? -9.202  7.619   3.393   1.00 1.23 ? 32  LEU A HD22 4  
ATOM   4570  H HD23 . LEU A 1 32 ? -9.778  6.130   4.143   1.00 1.41 ? 32  LEU A HD23 4  
ATOM   4571  N N    . LEU A 1 33 ? -6.652  3.427   5.041   1.00 0.27 ? 33  LEU A N    4  
ATOM   4572  C CA   . LEU A 1 33 ? -6.889  2.048   5.450   1.00 0.31 ? 33  LEU A CA   4  
ATOM   4573  C C    . LEU A 1 33 ? -7.240  1.953   6.932   1.00 0.27 ? 33  LEU A C    4  
ATOM   4574  O O    . LEU A 1 33 ? -8.155  1.219   7.319   1.00 0.33 ? 33  LEU A O    4  
ATOM   4575  C CB   . LEU A 1 33 ? -5.657  1.187   5.163   1.00 0.41 ? 33  LEU A CB   4  
ATOM   4576  C CG   . LEU A 1 33 ? -5.224  1.124   3.696   1.00 0.49 ? 33  LEU A CG   4  
ATOM   4577  C CD1  . LEU A 1 33 ? -3.994  0.242   3.538   1.00 0.61 ? 33  LEU A CD1  4  
ATOM   4578  C CD2  . LEU A 1 33 ? -6.367  0.610   2.833   1.00 0.68 ? 33  LEU A CD2  4  
ATOM   4579  H H    . LEU A 1 33 ? -5.763  3.680   4.705   1.00 0.29 ? 33  LEU A H    4  
ATOM   4580  H HA   . LEU A 1 33 ? -7.719  1.672   4.873   1.00 0.35 ? 33  LEU A HA   4  
ATOM   4581  H HB2  . LEU A 1 33 ? -4.832  1.573   5.744   1.00 0.42 ? 33  LEU A HB2  4  
ATOM   4582  H HB3  . LEU A 1 33 ? -5.864  0.180   5.496   1.00 0.50 ? 33  LEU A HB3  4  
ATOM   4583  H HG   . LEU A 1 33 ? -4.968  2.119   3.359   1.00 0.46 ? 33  LEU A HG   4  
ATOM   4584  H HD11 . LEU A 1 33 ? -3.678  0.248   2.507   1.00 1.08 ? 33  LEU A HD11 4  
ATOM   4585  H HD12 . LEU A 1 33 ? -4.236  -0.768  3.835   1.00 1.05 ? 33  LEU A HD12 4  
ATOM   4586  H HD13 . LEU A 1 33 ? -3.197  0.619   4.162   1.00 1.03 ? 33  LEU A HD13 4  
ATOM   4587  H HD21 . LEU A 1 33 ? -6.695  -0.349  3.205   1.00 1.04 ? 33  LEU A HD21 4  
ATOM   4588  H HD22 . LEU A 1 33 ? -6.031  0.505   1.815   1.00 0.99 ? 33  LEU A HD22 4  
ATOM   4589  H HD23 . LEU A 1 33 ? -7.189  1.311   2.871   1.00 0.89 ? 33  LEU A HD23 4  
ATOM   4590  N N    . GLN A 1 34 ? -6.514  2.695   7.755   1.00 0.26 ? 34  GLN A N    4  
ATOM   4591  C CA   . GLN A 1 34 ? -6.732  2.678   9.193   1.00 0.31 ? 34  GLN A CA   4  
ATOM   4592  C C    . GLN A 1 34 ? -8.046  3.359   9.574   1.00 0.29 ? 34  GLN A C    4  
ATOM   4593  O O    . GLN A 1 34 ? -8.791  2.853   10.415  1.00 0.38 ? 34  GLN A O    4  
ATOM   4594  C CB   . GLN A 1 34 ? -5.563  3.348   9.915   1.00 0.42 ? 34  GLN A CB   4  
ATOM   4595  C CG   . GLN A 1 34 ? -5.441  2.941   11.377  1.00 0.72 ? 34  GLN A CG   4  
ATOM   4596  C CD   . GLN A 1 34 ? -4.272  3.605   12.082  1.00 1.04 ? 34  GLN A CD   4  
ATOM   4597  O OE1  . GLN A 1 34 ? -3.241  3.895   11.473  1.00 1.62 ? 34  GLN A OE1  4  
ATOM   4598  N NE2  . GLN A 1 34 ? -4.420  3.848   13.375  1.00 1.51 ? 34  GLN A NE2  4  
ATOM   4599  H H    . GLN A 1 34 ? -5.803  3.265   7.385   1.00 0.29 ? 34  GLN A H    4  
ATOM   4600  H HA   . GLN A 1 34 ? -6.781  1.645   9.504   1.00 0.36 ? 34  GLN A HA   4  
ATOM   4601  H HB2  . GLN A 1 34 ? -4.646  3.085   9.408   1.00 0.67 ? 34  GLN A HB2  4  
ATOM   4602  H HB3  . GLN A 1 34 ? -5.696  4.418   9.871   1.00 0.61 ? 34  GLN A HB3  4  
ATOM   4603  H HG2  . GLN A 1 34 ? -6.353  3.212   11.890  1.00 1.27 ? 34  GLN A HG2  4  
ATOM   4604  H HG3  . GLN A 1 34 ? -5.310  1.870   11.427  1.00 1.25 ? 34  GLN A HG3  4  
ATOM   4605  H HE21 . GLN A 1 34 ? -5.265  3.589   13.803  1.00 1.73 ? 34  GLN A HE21 4  
ATOM   4606  H HE22 . GLN A 1 34 ? -3.684  4.284   13.853  1.00 1.94 ? 34  GLN A HE22 4  
ATOM   4607  N N    . LYS A 1 35 ? -8.344  4.490   8.942   1.00 0.29 ? 35  LYS A N    4  
ATOM   4608  C CA   . LYS A 1 35 ? -9.565  5.231   9.250   1.00 0.37 ? 35  LYS A CA   4  
ATOM   4609  C C    . LYS A 1 35 ? -10.814 4.452   8.836   1.00 0.32 ? 35  LYS A C    4  
ATOM   4610  O O    . LYS A 1 35 ? -11.863 4.560   9.476   1.00 0.36 ? 35  LYS A O    4  
ATOM   4611  C CB   . LYS A 1 35 ? -9.549  6.621   8.595   1.00 0.50 ? 35  LYS A CB   4  
ATOM   4612  C CG   . LYS A 1 35 ? -10.140 6.674   7.192   1.00 0.67 ? 35  LYS A CG   4  
ATOM   4613  C CD   . LYS A 1 35 ? -11.309 7.646   7.119   1.00 0.77 ? 35  LYS A CD   4  
ATOM   4614  C CE   . LYS A 1 35 ? -11.917 7.688   5.723   1.00 1.00 ? 35  LYS A CE   4  
ATOM   4615  N NZ   . LYS A 1 35 ? -13.004 8.697   5.615   1.00 1.37 ? 35  LYS A NZ   4  
ATOM   4616  H H    . LYS A 1 35 ? -7.726  4.841   8.264   1.00 0.33 ? 35  LYS A H    4  
ATOM   4617  H HA   . LYS A 1 35 ? -9.592  5.360   10.323  1.00 0.45 ? 35  LYS A HA   4  
ATOM   4618  H HB2  . LYS A 1 35 ? -10.111 7.300   9.217   1.00 0.88 ? 35  LYS A HB2  4  
ATOM   4619  H HB3  . LYS A 1 35 ? -8.527  6.965   8.543   1.00 1.00 ? 35  LYS A HB3  4  
ATOM   4620  H HG2  . LYS A 1 35 ? -9.373  6.996   6.503   1.00 1.20 ? 35  LYS A HG2  4  
ATOM   4621  H HG3  . LYS A 1 35 ? -10.482 5.687   6.917   1.00 1.10 ? 35  LYS A HG3  4  
ATOM   4622  H HD2  . LYS A 1 35 ? -12.068 7.334   7.821   1.00 1.19 ? 35  LYS A HD2  4  
ATOM   4623  H HD3  . LYS A 1 35 ? -10.960 8.636   7.379   1.00 1.15 ? 35  LYS A HD3  4  
ATOM   4624  H HE2  . LYS A 1 35 ? -11.140 7.933   5.013   1.00 1.52 ? 35  LYS A HE2  4  
ATOM   4625  H HE3  . LYS A 1 35 ? -12.320 6.712   5.489   1.00 1.60 ? 35  LYS A HE3  4  
ATOM   4626  H HZ1  . LYS A 1 35 ? -13.800 8.436   6.231   1.00 1.85 ? 35  LYS A HZ1  4  
ATOM   4627  H HZ2  . LYS A 1 35 ? -13.345 8.756   4.633   1.00 1.75 ? 35  LYS A HZ2  4  
ATOM   4628  H HZ3  . LYS A 1 35 ? -12.654 9.633   5.904   1.00 1.76 ? 35  LYS A HZ3  4  
ATOM   4629  N N    . GLU A 1 36 ? -10.700 3.660   7.775   1.00 0.29 ? 36  GLU A N    4  
ATOM   4630  C CA   . GLU A 1 36 ? -11.828 2.871   7.291   1.00 0.31 ? 36  GLU A CA   4  
ATOM   4631  C C    . GLU A 1 36 ? -11.996 1.591   8.102   1.00 0.29 ? 36  GLU A C    4  
ATOM   4632  O O    . GLU A 1 36 ? -12.968 0.858   7.928   1.00 0.39 ? 36  GLU A O    4  
ATOM   4633  C CB   . GLU A 1 36 ? -11.664 2.546   5.804   1.00 0.37 ? 36  GLU A CB   4  
ATOM   4634  C CG   . GLU A 1 36 ? -11.965 3.730   4.895   1.00 0.43 ? 36  GLU A CG   4  
ATOM   4635  C CD   . GLU A 1 36 ? -13.393 4.229   5.027   1.00 0.64 ? 36  GLU A CD   4  
ATOM   4636  O OE1  . GLU A 1 36 ? -13.706 4.910   6.028   1.00 1.30 ? 36  GLU A OE1  4  
ATOM   4637  O OE2  . GLU A 1 36 ? -14.208 3.942   4.126   1.00 1.21 ? 36  GLU A OE2  4  
ATOM   4638  H H    . GLU A 1 36 ? -9.840  3.613   7.300   1.00 0.32 ? 36  GLU A H    4  
ATOM   4639  H HA   . GLU A 1 36 ? -12.717 3.468   7.412   1.00 0.38 ? 36  GLU A HA   4  
ATOM   4640  H HB2  . GLU A 1 36 ? -10.647 2.230   5.625   1.00 0.40 ? 36  GLU A HB2  4  
ATOM   4641  H HB3  . GLU A 1 36 ? -12.335 1.741   5.547   1.00 0.47 ? 36  GLU A HB3  4  
ATOM   4642  H HG2  . GLU A 1 36 ? -11.297 4.537   5.151   1.00 0.46 ? 36  GLU A HG2  4  
ATOM   4643  H HG3  . GLU A 1 36 ? -11.796 3.433   3.870   1.00 0.50 ? 36  GLU A HG3  4  
ATOM   4644  N N    . GLY A 1 37 ? -11.042 1.325   8.986   1.00 0.27 ? 37  GLY A N    4  
ATOM   4645  C CA   . GLY A 1 37 ? -11.114 0.141   9.821   1.00 0.30 ? 37  GLY A CA   4  
ATOM   4646  C C    . GLY A 1 37 ? -10.684 -1.122  9.105   1.00 0.29 ? 37  GLY A C    4  
ATOM   4647  O O    . GLY A 1 37 ? -10.931 -2.227  9.588   1.00 0.41 ? 37  GLY A O    4  
ATOM   4648  H H    . GLY A 1 37 ? -10.287 1.943   9.079   1.00 0.30 ? 37  GLY A H    4  
ATOM   4649  H HA2  . GLY A 1 37 ? -10.478 0.288   10.682  1.00 0.33 ? 37  GLY A HA2  4  
ATOM   4650  H HA3  . GLY A 1 37 ? -12.132 0.017   10.158  1.00 0.35 ? 37  GLY A HA3  4  
ATOM   4651  N N    . LEU A 1 38 ? -10.040 -0.965  7.956   1.00 0.25 ? 38  LEU A N    4  
ATOM   4652  C CA   . LEU A 1 38 ? -9.572  -2.108  7.182   1.00 0.28 ? 38  LEU A CA   4  
ATOM   4653  C C    . LEU A 1 38 ? -8.420  -2.784  7.908   1.00 0.32 ? 38  LEU A C    4  
ATOM   4654  O O    . LEU A 1 38 ? -8.343  -4.013  7.970   1.00 0.46 ? 38  LEU A O    4  
ATOM   4655  C CB   . LEU A 1 38 ? -9.135  -1.667  5.785   1.00 0.31 ? 38  LEU A CB   4  
ATOM   4656  C CG   . LEU A 1 38 ? -10.269 -1.197  4.873   1.00 0.40 ? 38  LEU A CG   4  
ATOM   4657  C CD1  . LEU A 1 38 ? -9.715  -0.418  3.695   1.00 0.51 ? 38  LEU A CD1  4  
ATOM   4658  C CD2  . LEU A 1 38 ? -11.086 -2.384  4.385   1.00 0.50 ? 38  LEU A CD2  4  
ATOM   4659  H H    . LEU A 1 38 ? -9.871  -0.057  7.624   1.00 0.29 ? 38  LEU A H    4  
ATOM   4660  H HA   . LEU A 1 38 ? -10.391 -2.807  7.093   1.00 0.34 ? 38  LEU A HA   4  
ATOM   4661  H HB2  . LEU A 1 38 ? -8.425  -0.860  5.891   1.00 0.34 ? 38  LEU A HB2  4  
ATOM   4662  H HB3  . LEU A 1 38 ? -8.641  -2.498  5.306   1.00 0.35 ? 38  LEU A HB3  4  
ATOM   4663  H HG   . LEU A 1 38 ? -10.925 -0.543  5.429   1.00 0.47 ? 38  LEU A HG   4  
ATOM   4664  H HD11 . LEU A 1 38 ? -9.174  -1.089  3.041   1.00 0.74 ? 38  LEU A HD11 4  
ATOM   4665  H HD12 . LEU A 1 38 ? -9.047  0.350   4.052   1.00 0.78 ? 38  LEU A HD12 4  
ATOM   4666  H HD13 . LEU A 1 38 ? -10.527 0.038   3.150   1.00 0.79 ? 38  LEU A HD13 4  
ATOM   4667  H HD21 . LEU A 1 38 ? -11.868 -2.038  3.724   1.00 0.77 ? 38  LEU A HD21 4  
ATOM   4668  H HD22 . LEU A 1 38 ? -11.529 -2.889  5.230   1.00 0.67 ? 38  LEU A HD22 4  
ATOM   4669  H HD23 . LEU A 1 38 ? -10.443 -3.071  3.854   1.00 0.68 ? 38  LEU A HD23 4  
ATOM   4670  N N    . LEU A 1 39 ? -7.542  -1.966  8.472   1.00 0.31 ? 39  LEU A N    4  
ATOM   4671  C CA   . LEU A 1 39 ? -6.393  -2.452  9.222   1.00 0.40 ? 39  LEU A CA   4  
ATOM   4672  C C    . LEU A 1 39 ? -6.245  -1.630  10.494  1.00 0.39 ? 39  LEU A C    4  
ATOM   4673  O O    . LEU A 1 39 ? -6.680  -0.476  10.543  1.00 0.57 ? 39  LEU A O    4  
ATOM   4674  C CB   . LEU A 1 39 ? -5.114  -2.362  8.384   1.00 0.53 ? 39  LEU A CB   4  
ATOM   4675  C CG   . LEU A 1 39 ? -5.074  -3.257  7.142   1.00 0.67 ? 39  LEU A CG   4  
ATOM   4676  C CD1  . LEU A 1 39 ? -3.788  -3.025  6.370   1.00 0.86 ? 39  LEU A CD1  4  
ATOM   4677  C CD2  . LEU A 1 39 ? -5.209  -4.724  7.525   1.00 0.75 ? 39  LEU A CD2  4  
ATOM   4678  H H    . LEU A 1 39 ? -7.681  -0.997  8.396   1.00 0.31 ? 39  LEU A H    4  
ATOM   4679  H HA   . LEU A 1 39 ? -6.577  -3.483  9.485   1.00 0.47 ? 39  LEU A HA   4  
ATOM   4680  H HB2  . LEU A 1 39 ? -4.993  -1.337  8.065   1.00 0.56 ? 39  LEU A HB2  4  
ATOM   4681  H HB3  . LEU A 1 39 ? -4.277  -2.624  9.014   1.00 0.63 ? 39  LEU A HB3  4  
ATOM   4682  H HG   . LEU A 1 39 ? -5.904  -3.003  6.496   1.00 0.67 ? 39  LEU A HG   4  
ATOM   4683  H HD11 . LEU A 1 39 ? -2.943  -3.179  7.024   1.00 1.10 ? 39  LEU A HD11 4  
ATOM   4684  H HD12 . LEU A 1 39 ? -3.772  -2.012  5.992   1.00 1.10 ? 39  LEU A HD12 4  
ATOM   4685  H HD13 . LEU A 1 39 ? -3.733  -3.718  5.544   1.00 1.09 ? 39  LEU A HD13 4  
ATOM   4686  H HD21 . LEU A 1 39 ? -5.082  -5.337  6.646   1.00 1.19 ? 39  LEU A HD21 4  
ATOM   4687  H HD22 . LEU A 1 39 ? -6.189  -4.895  7.946   1.00 1.13 ? 39  LEU A HD22 4  
ATOM   4688  H HD23 . LEU A 1 39 ? -4.454  -4.978  8.253   1.00 1.12 ? 39  LEU A HD23 4  
ATOM   4689  N N    . MET A 1 40 ? -5.649  -2.216  11.519  1.00 0.35 ? 40  MET A N    4  
ATOM   4690  C CA   . MET A 1 40 ? -5.466  -1.520  12.785  1.00 0.41 ? 40  MET A CA   4  
ATOM   4691  C C    . MET A 1 40 ? -4.060  -0.941  12.893  1.00 0.37 ? 40  MET A C    4  
ATOM   4692  O O    . MET A 1 40 ? -3.876  0.200   13.317  1.00 0.53 ? 40  MET A O    4  
ATOM   4693  C CB   . MET A 1 40 ? -5.725  -2.471  13.957  1.00 0.54 ? 40  MET A CB   4  
ATOM   4694  C CG   . MET A 1 40 ? -5.610  -1.803  15.316  1.00 0.70 ? 40  MET A CG   4  
ATOM   4695  S SD   . MET A 1 40 ? -5.535  -2.995  16.672  1.00 0.94 ? 40  MET A SD   4  
ATOM   4696  C CE   . MET A 1 40 ? -3.926  -3.737  16.388  1.00 1.19 ? 40  MET A CE   4  
ATOM   4697  H H    . MET A 1 40 ? -5.321  -3.136  11.425  1.00 0.44 ? 40  MET A H    4  
ATOM   4698  H HA   . MET A 1 40 ? -6.180  -0.712  12.823  1.00 0.50 ? 40  MET A HA   4  
ATOM   4699  H HB2  . MET A 1 40 ? -6.721  -2.877  13.864  1.00 0.62 ? 40  MET A HB2  4  
ATOM   4700  H HB3  . MET A 1 40 ? -5.010  -3.280  13.914  1.00 0.55 ? 40  MET A HB3  4  
ATOM   4701  H HG2  . MET A 1 40 ? -4.711  -1.206  15.330  1.00 0.73 ? 40  MET A HG2  4  
ATOM   4702  H HG3  . MET A 1 40 ? -6.467  -1.162  15.461  1.00 0.78 ? 40  MET A HG3  4  
ATOM   4703  H HE1  . MET A 1 40 ? -3.171  -2.966  16.366  1.00 1.40 ? 40  MET A HE1  4  
ATOM   4704  H HE2  . MET A 1 40 ? -3.927  -4.263  15.443  1.00 1.50 ? 40  MET A HE2  4  
ATOM   4705  H HE3  . MET A 1 40 ? -3.710  -4.431  17.186  1.00 1.50 ? 40  MET A HE3  4  
ATOM   4706  N N    . SER A 1 41 ? -3.075  -1.733  12.507  1.00 0.33 ? 41  SER A N    4  
ATOM   4707  C CA   . SER A 1 41 ? -1.689  -1.312  12.571  1.00 0.39 ? 41  SER A CA   4  
ATOM   4708  C C    . SER A 1 41 ? -1.106  -1.153  11.169  1.00 0.34 ? 41  SER A C    4  
ATOM   4709  O O    . SER A 1 41 ? -1.496  -1.861  10.239  1.00 0.31 ? 41  SER A O    4  
ATOM   4710  C CB   . SER A 1 41 ? -0.877  -2.328  13.381  1.00 0.50 ? 41  SER A CB   4  
ATOM   4711  O OG   . SER A 1 41 ? -1.690  -3.415  13.804  1.00 0.87 ? 41  SER A OG   4  
ATOM   4712  H H    . SER A 1 41 ? -3.284  -2.630  12.156  1.00 0.38 ? 41  SER A H    4  
ATOM   4713  H HA   . SER A 1 41 ? -1.656  -0.356  13.070  1.00 0.51 ? 41  SER A HA   4  
ATOM   4714  H HB2  . SER A 1 41 ? -0.072  -2.712  12.771  1.00 0.83 ? 41  SER A HB2  4  
ATOM   4715  H HB3  . SER A 1 41 ? -0.464  -1.842  14.255  1.00 0.81 ? 41  SER A HB3  4  
ATOM   4716  H HG   . SER A 1 41 ? -2.175  -3.774  13.042  1.00 1.39 ? 41  SER A HG   4  
ATOM   4717  N N    . PRO A 1 42 ? -0.162  -0.217  10.999  1.00 0.43 ? 42  PRO A N    4  
ATOM   4718  C CA   . PRO A 1 42 ? 0.476   0.033   9.703   1.00 0.47 ? 42  PRO A CA   4  
ATOM   4719  C C    . PRO A 1 42 ? 1.315   -1.150  9.226   1.00 0.43 ? 42  PRO A C    4  
ATOM   4720  O O    . PRO A 1 42 ? 1.598   -1.283  8.037   1.00 0.54 ? 42  PRO A O    4  
ATOM   4721  C CB   . PRO A 1 42 ? 1.367   1.248   9.971   1.00 0.61 ? 42  PRO A CB   4  
ATOM   4722  C CG   . PRO A 1 42 ? 1.588   1.263   11.442  1.00 0.65 ? 42  PRO A CG   4  
ATOM   4723  C CD   . PRO A 1 42 ? 0.343   0.687   12.050  1.00 0.57 ? 42  PRO A CD   4  
ATOM   4724  H HA   . PRO A 1 42 ? -0.252  0.280   8.948   1.00 0.51 ? 42  PRO A HA   4  
ATOM   4725  H HB2  . PRO A 1 42 ? 2.304   1.138   9.440   1.00 0.65 ? 42  PRO A HB2  4  
ATOM   4726  H HB3  . PRO A 1 42 ? 0.864   2.149   9.662   1.00 0.73 ? 42  PRO A HB3  4  
ATOM   4727  H HG2  . PRO A 1 42 ? 2.449   0.657   11.691  1.00 0.67 ? 42  PRO A HG2  4  
ATOM   4728  H HG3  . PRO A 1 42 ? 1.729   2.276   11.782  1.00 0.81 ? 42  PRO A HG3  4  
ATOM   4729  H HD2  . PRO A 1 42 ? 0.583   0.137   12.947  1.00 0.58 ? 42  PRO A HD2  4  
ATOM   4730  H HD3  . PRO A 1 42 ? -0.372  1.468   12.263  1.00 0.68 ? 42  PRO A HD3  4  
ATOM   4731  N N    . SER A 1 43 ? 1.697   -2.014  10.155  1.00 0.36 ? 43  SER A N    4  
ATOM   4732  C CA   . SER A 1 43 ? 2.504   -3.179  9.834   1.00 0.41 ? 43  SER A CA   4  
ATOM   4733  C C    . SER A 1 43 ? 1.626   -4.398  9.532   1.00 0.36 ? 43  SER A C    4  
ATOM   4734  O O    . SER A 1 43 ? 2.124   -5.515  9.383   1.00 0.40 ? 43  SER A O    4  
ATOM   4735  C CB   . SER A 1 43 ? 3.448   -3.474  11.000  1.00 0.54 ? 43  SER A CB   4  
ATOM   4736  O OG   . SER A 1 43 ? 2.941   -2.925  12.207  1.00 0.69 ? 43  SER A OG   4  
ATOM   4737  H H    . SER A 1 43 ? 1.434   -1.861  11.089  1.00 0.38 ? 43  SER A H    4  
ATOM   4738  H HA   . SER A 1 43 ? 3.089   -2.946  8.959   1.00 0.49 ? 43  SER A HA   4  
ATOM   4739  H HB2  . SER A 1 43 ? 3.548   -4.542  11.117  1.00 0.70 ? 43  SER A HB2  4  
ATOM   4740  H HB3  . SER A 1 43 ? 4.415   -3.040  10.798  1.00 0.75 ? 43  SER A HB3  4  
ATOM   4741  H HG   . SER A 1 43 ? 2.450   -3.610  12.684  1.00 1.10 ? 43  SER A HG   4  
ATOM   4742  N N    . ASP A 1 44 ? 0.318   -4.185  9.419   1.00 0.32 ? 44  ASP A N    4  
ATOM   4743  C CA   . ASP A 1 44 ? -0.610  -5.282  9.143   1.00 0.32 ? 44  ASP A CA   4  
ATOM   4744  C C    . ASP A 1 44 ? -0.612  -5.641  7.661   1.00 0.29 ? 44  ASP A C    4  
ATOM   4745  O O    . ASP A 1 44 ? -1.328  -6.546  7.231   1.00 0.31 ? 44  ASP A O    4  
ATOM   4746  C CB   . ASP A 1 44 ? -2.030  -4.919  9.587   1.00 0.39 ? 44  ASP A CB   4  
ATOM   4747  C CG   . ASP A 1 44 ? -2.213  -4.973  11.093  1.00 0.54 ? 44  ASP A CG   4  
ATOM   4748  O OD1  . ASP A 1 44 ? -1.462  -5.704  11.772  1.00 0.87 ? 44  ASP A OD1  4  
ATOM   4749  O OD2  . ASP A 1 44 ? -3.122  -4.287  11.613  1.00 0.69 ? 44  ASP A OD2  4  
ATOM   4750  H H    . ASP A 1 44 ? -0.033  -3.273  9.522   1.00 0.35 ? 44  ASP A H    4  
ATOM   4751  H HA   . ASP A 1 44 ? -0.276  -6.141  9.708   1.00 0.40 ? 44  ASP A HA   4  
ATOM   4752  H HB2  . ASP A 1 44 ? -2.256  -3.917  9.253   1.00 0.46 ? 44  ASP A HB2  4  
ATOM   4753  H HB3  . ASP A 1 44 ? -2.728  -5.609  9.134   1.00 0.52 ? 44  ASP A HB3  4  
ATOM   4754  N N    . LEU A 1 45 ? 0.203   -4.938  6.884   1.00 0.31 ? 45  LEU A N    4  
ATOM   4755  C CA   . LEU A 1 45 ? 0.293   -5.181  5.447   1.00 0.36 ? 45  LEU A CA   4  
ATOM   4756  C C    . LEU A 1 45 ? 1.112   -6.435  5.157   1.00 0.34 ? 45  LEU A C    4  
ATOM   4757  O O    . LEU A 1 45 ? 1.109   -6.940  4.036   1.00 0.38 ? 45  LEU A O    4  
ATOM   4758  C CB   . LEU A 1 45 ? 0.921   -3.976  4.728   1.00 0.45 ? 45  LEU A CB   4  
ATOM   4759  C CG   . LEU A 1 45 ? -0.040  -2.842  4.348   1.00 0.60 ? 45  LEU A CG   4  
ATOM   4760  C CD1  . LEU A 1 45 ? -1.254  -3.380  3.608   1.00 0.96 ? 45  LEU A CD1  4  
ATOM   4761  C CD2  . LEU A 1 45 ? -0.464  -2.055  5.578   1.00 0.98 ? 45  LEU A CD2  4  
ATOM   4762  H H    . LEU A 1 45 ? 0.760   -4.239  7.284   1.00 0.35 ? 45  LEU A H    4  
ATOM   4763  H HA   . LEU A 1 45 ? -0.709  -5.329  5.074   1.00 0.41 ? 45  LEU A HA   4  
ATOM   4764  H HB2  . LEU A 1 45 ? 1.686   -3.564  5.366   1.00 0.60 ? 45  LEU A HB2  4  
ATOM   4765  H HB3  . LEU A 1 45 ? 1.389   -4.333  3.823   1.00 0.54 ? 45  LEU A HB3  4  
ATOM   4766  H HG   . LEU A 1 45 ? 0.472   -2.161  3.681   1.00 0.84 ? 45  LEU A HG   4  
ATOM   4767  H HD11 . LEU A 1 45 ? -0.929  -4.039  2.817   1.00 1.37 ? 45  LEU A HD11 4  
ATOM   4768  H HD12 . LEU A 1 45 ? -1.811  -2.558  3.182   1.00 1.34 ? 45  LEU A HD12 4  
ATOM   4769  H HD13 . LEU A 1 45 ? -1.886  -3.923  4.293   1.00 1.38 ? 45  LEU A HD13 4  
ATOM   4770  H HD21 . LEU A 1 45 ? -1.176  -1.295  5.291   1.00 1.28 ? 45  LEU A HD21 4  
ATOM   4771  H HD22 . LEU A 1 45 ? 0.401   -1.587  6.023   1.00 1.36 ? 45  LEU A HD22 4  
ATOM   4772  H HD23 . LEU A 1 45 ? -0.921  -2.722  6.294   1.00 1.37 ? 45  LEU A HD23 4  
ATOM   4773  N N    . TYR A 1 46 ? 1.806   -6.937  6.172   1.00 0.32 ? 46  TYR A N    4  
ATOM   4774  C CA   . TYR A 1 46 ? 2.630   -8.133  6.022   1.00 0.37 ? 46  TYR A CA   4  
ATOM   4775  C C    . TYR A 1 46 ? 1.775   -9.381  5.812   1.00 0.34 ? 46  TYR A C    4  
ATOM   4776  O O    . TYR A 1 46 ? 2.226   -10.357 5.204   1.00 0.44 ? 46  TYR A O    4  
ATOM   4777  C CB   . TYR A 1 46 ? 3.521   -8.332  7.251   1.00 0.47 ? 46  TYR A CB   4  
ATOM   4778  C CG   . TYR A 1 46 ? 4.620   -7.301  7.403   1.00 0.55 ? 46  TYR A CG   4  
ATOM   4779  C CD1  . TYR A 1 46 ? 5.402   -6.918  6.317   1.00 0.87 ? 46  TYR A CD1  4  
ATOM   4780  C CD2  . TYR A 1 46 ? 4.882   -6.717  8.633   1.00 0.64 ? 46  TYR A CD2  4  
ATOM   4781  C CE1  . TYR A 1 46 ? 6.416   -5.989  6.460   1.00 1.01 ? 46  TYR A CE1  4  
ATOM   4782  C CE2  . TYR A 1 46 ? 5.889   -5.786  8.782   1.00 0.76 ? 46  TYR A CE2  4  
ATOM   4783  C CZ   . TYR A 1 46 ? 6.653   -5.424  7.693   1.00 0.86 ? 46  TYR A CZ   4  
ATOM   4784  O OH   . TYR A 1 46 ? 7.665   -4.502  7.842   1.00 1.05 ? 46  TYR A OH   4  
ATOM   4785  H H    . TYR A 1 46 ? 1.767   -6.490  7.044   1.00 0.33 ? 46  TYR A H    4  
ATOM   4786  H HA   . TYR A 1 46 ? 3.258   -7.993  5.156   1.00 0.43 ? 46  TYR A HA   4  
ATOM   4787  H HB2  . TYR A 1 46 ? 2.907   -8.295  8.139   1.00 0.46 ? 46  TYR A HB2  4  
ATOM   4788  H HB3  . TYR A 1 46 ? 3.988   -9.306  7.190   1.00 0.61 ? 46  TYR A HB3  4  
ATOM   4789  H HD1  . TYR A 1 46 ? 5.215   -7.360  5.352   1.00 1.12 ? 46  TYR A HD1  4  
ATOM   4790  H HD2  . TYR A 1 46 ? 4.281   -6.998  9.486   1.00 0.84 ? 46  TYR A HD2  4  
ATOM   4791  H HE1  . TYR A 1 46 ? 7.013   -5.705  5.606   1.00 1.34 ? 46  TYR A HE1  4  
ATOM   4792  H HE2  . TYR A 1 46 ? 6.075   -5.345  9.749   1.00 0.97 ? 46  TYR A HE2  4  
ATOM   4793  H HH   . TYR A 1 46 ? 8.519   -4.960  7.824   1.00 1.14 ? 46  TYR A HH   4  
ATOM   4794  N N    . SER A 1 47 ? 0.549   -9.348  6.320   1.00 0.31 ? 47  SER A N    4  
ATOM   4795  C CA   . SER A 1 47 ? -0.361  -10.478 6.201   1.00 0.29 ? 47  SER A CA   4  
ATOM   4796  C C    . SER A 1 47 ? -1.048  -10.486 4.835   1.00 0.24 ? 47  SER A C    4  
ATOM   4797  O O    . SER A 1 47 ? -1.818  -9.582  4.514   1.00 0.26 ? 47  SER A O    4  
ATOM   4798  C CB   . SER A 1 47 ? -1.399  -10.410 7.318   1.00 0.36 ? 47  SER A CB   4  
ATOM   4799  O OG   . SER A 1 47 ? -0.816  -9.903  8.508   1.00 0.53 ? 47  SER A OG   4  
ATOM   4800  H H    . SER A 1 47 ? 0.243   -8.538  6.781   1.00 0.37 ? 47  SER A H    4  
ATOM   4801  H HA   . SER A 1 47 ? 0.217   -11.383 6.308   1.00 0.33 ? 47  SER A HA   4  
ATOM   4802  H HB2  . SER A 1 47 ? -2.208  -9.758  7.020   1.00 0.43 ? 47  SER A HB2  4  
ATOM   4803  H HB3  . SER A 1 47 ? -1.785  -11.398 7.512   1.00 0.44 ? 47  SER A HB3  4  
ATOM   4804  H HG   . SER A 1 47 ? 0.002   -10.379 8.691   1.00 1.10 ? 47  SER A HG   4  
ATOM   4805  N N    . PRO A 1 48 ? -0.798  -11.530 4.024   1.00 0.24 ? 48  PRO A N    4  
ATOM   4806  C CA   . PRO A 1 48 ? -1.376  -11.647 2.681   1.00 0.25 ? 48  PRO A CA   4  
ATOM   4807  C C    . PRO A 1 48 ? -2.887  -11.869 2.704   1.00 0.26 ? 48  PRO A C    4  
ATOM   4808  O O    . PRO A 1 48 ? -3.584  -11.549 1.741   1.00 0.32 ? 48  PRO A O    4  
ATOM   4809  C CB   . PRO A 1 48 ? -0.659  -12.862 2.086   1.00 0.31 ? 48  PRO A CB   4  
ATOM   4810  C CG   . PRO A 1 48 ? -0.203  -13.664 3.254   1.00 0.38 ? 48  PRO A CG   4  
ATOM   4811  C CD   . PRO A 1 48 ? 0.063   -12.684 4.361   1.00 0.32 ? 48  PRO A CD   4  
ATOM   4812  H HA   . PRO A 1 48 ? -1.156  -10.774 2.084   1.00 0.26 ? 48  PRO A HA   4  
ATOM   4813  H HB2  . PRO A 1 48 ? -1.346  -13.430 1.470   1.00 0.38 ? 48  PRO A HB2  4  
ATOM   4814  H HB3  . PRO A 1 48 ? 0.189   -12.544 1.503   1.00 0.38 ? 48  PRO A HB3  4  
ATOM   4815  H HG2  . PRO A 1 48 ? -0.979  -14.359 3.542   1.00 0.50 ? 48  PRO A HG2  4  
ATOM   4816  H HG3  . PRO A 1 48 ? 0.704   -14.196 3.006   1.00 0.52 ? 48  PRO A HG3  4  
ATOM   4817  H HD2  . PRO A 1 48 ? -0.218  -13.109 5.313   1.00 0.38 ? 48  PRO A HD2  4  
ATOM   4818  H HD3  . PRO A 1 48 ? 1.105   -12.398 4.369   1.00 0.38 ? 48  PRO A HD3  4  
ATOM   4819  N N    . GLY A 1 49 ? -3.388  -12.407 3.813   1.00 0.28 ? 49  GLY A N    4  
ATOM   4820  C CA   . GLY A 1 49 ? -4.812  -12.661 3.939   1.00 0.33 ? 49  GLY A CA   4  
ATOM   4821  C C    . GLY A 1 49 ? -5.636  -11.385 3.981   1.00 0.32 ? 49  GLY A C    4  
ATOM   4822  O O    . GLY A 1 49 ? -6.807  -11.380 3.601   1.00 0.50 ? 49  GLY A O    4  
ATOM   4823  H H    . GLY A 1 49 ? -2.783  -12.642 4.548   1.00 0.30 ? 49  GLY A H    4  
ATOM   4824  H HA2  . GLY A 1 49 ? -5.136  -13.259 3.101   1.00 0.35 ? 49  GLY A HA2  4  
ATOM   4825  H HA3  . GLY A 1 49 ? -4.986  -13.217 4.849   1.00 0.38 ? 49  GLY A HA3  4  
ATOM   4826  N N    . SER A 1 50 ? -5.016  -10.296 4.422   1.00 0.25 ? 50  SER A N    4  
ATOM   4827  C CA   . SER A 1 50 ? -5.699  -9.013  4.531   1.00 0.27 ? 50  SER A CA   4  
ATOM   4828  C C    . SER A 1 50 ? -5.610  -8.208  3.235   1.00 0.22 ? 50  SER A C    4  
ATOM   4829  O O    . SER A 1 50 ? -6.151  -7.109  3.144   1.00 0.28 ? 50  SER A O    4  
ATOM   4830  C CB   . SER A 1 50 ? -5.097  -8.203  5.684   1.00 0.35 ? 50  SER A CB   4  
ATOM   4831  O OG   . SER A 1 50 ? -4.644  -9.052  6.731   1.00 0.47 ? 50  SER A OG   4  
ATOM   4832  H H    . SER A 1 50 ? -4.074  -10.355 4.687   1.00 0.31 ? 50  SER A H    4  
ATOM   4833  H HA   . SER A 1 50 ? -6.737  -9.207  4.748   1.00 0.32 ? 50  SER A HA   4  
ATOM   4834  H HB2  . SER A 1 50 ? -4.259  -7.629  5.317   1.00 0.45 ? 50  SER A HB2  4  
ATOM   4835  H HB3  . SER A 1 50 ? -5.846  -7.533  6.079   1.00 0.45 ? 50  SER A HB3  4  
ATOM   4836  H HG   . SER A 1 50 ? -3.846  -8.678  7.123   1.00 0.93 ? 50  SER A HG   4  
ATOM   4837  N N    . TRP A 1 51 ? -4.948  -8.760  2.230   1.00 0.20 ? 51  TRP A N    4  
ATOM   4838  C CA   . TRP A 1 51 ? -4.790  -8.067  0.958   1.00 0.20 ? 51  TRP A CA   4  
ATOM   4839  C C    . TRP A 1 51 ? -6.080  -8.099  0.144   1.00 0.19 ? 51  TRP A C    4  
ATOM   4840  O O    . TRP A 1 51 ? -6.440  -7.117  -0.506  1.00 0.23 ? 51  TRP A O    4  
ATOM   4841  C CB   . TRP A 1 51 ? -3.654  -8.690  0.142   1.00 0.23 ? 51  TRP A CB   4  
ATOM   4842  C CG   . TRP A 1 51 ? -2.292  -8.510  0.753   1.00 0.24 ? 51  TRP A CG   4  
ATOM   4843  C CD1  . TRP A 1 51 ? -1.951  -7.693  1.797   1.00 0.25 ? 51  TRP A CD1  4  
ATOM   4844  C CD2  . TRP A 1 51 ? -1.080  -9.162  0.348   1.00 0.27 ? 51  TRP A CD2  4  
ATOM   4845  N NE1  . TRP A 1 51 ? -0.605  -7.805  2.063   1.00 0.28 ? 51  TRP A NE1  4  
ATOM   4846  C CE2  . TRP A 1 51 ? -0.052  -8.696  1.187   1.00 0.29 ? 51  TRP A CE2  4  
ATOM   4847  C CE3  . TRP A 1 51 ? -0.767  -10.092 -0.646  1.00 0.30 ? 51  TRP A CE3  4  
ATOM   4848  C CZ2  . TRP A 1 51 ? 1.264   -9.136  1.068   1.00 0.33 ? 51  TRP A CZ2  4  
ATOM   4849  C CZ3  . TRP A 1 51 ? 0.539   -10.525 -0.763  1.00 0.34 ? 51  TRP A CZ3  4  
ATOM   4850  C CH2  . TRP A 1 51 ? 1.541   -10.046 0.089   1.00 0.35 ? 51  TRP A CH2  4  
ATOM   4851  H H    . TRP A 1 51 ? -4.555  -9.651  2.343   1.00 0.26 ? 51  TRP A H    4  
ATOM   4852  H HA   . TRP A 1 51 ? -4.541  -7.038  1.171   1.00 0.22 ? 51  TRP A HA   4  
ATOM   4853  H HB2  . TRP A 1 51 ? -3.838  -9.749  0.045   1.00 0.25 ? 51  TRP A HB2  4  
ATOM   4854  H HB3  . TRP A 1 51 ? -3.642  -8.242  -0.840  1.00 0.27 ? 51  TRP A HB3  4  
ATOM   4855  H HD1  . TRP A 1 51 ? -2.646  -7.058  2.326   1.00 0.26 ? 51  TRP A HD1  4  
ATOM   4856  H HE1  . TRP A 1 51 ? -0.118  -7.322  2.773   1.00 0.31 ? 51  TRP A HE1  4  
ATOM   4857  H HE3  . TRP A 1 51 ? -1.526  -10.473 -1.312  1.00 0.31 ? 51  TRP A HE3  4  
ATOM   4858  H HZ2  . TRP A 1 51 ? 2.050   -8.777  1.716   1.00 0.35 ? 51  TRP A HZ2  4  
ATOM   4859  H HZ3  . TRP A 1 51 ? 0.800   -11.245 -1.525  1.00 0.38 ? 51  TRP A HZ3  4  
ATOM   4860  H HH2  . TRP A 1 51 ? 2.549   -10.411 -0.041  1.00 0.39 ? 51  TRP A HH2  4  
ATOM   4861  N N    . ASP A 1 52 ? -6.782  -9.222  0.198   1.00 0.23 ? 52  ASP A N    4  
ATOM   4862  C CA   . ASP A 1 52 ? -8.018  -9.385  -0.559  1.00 0.27 ? 52  ASP A CA   4  
ATOM   4863  C C    . ASP A 1 52 ? -9.101  -8.374  -0.160  1.00 0.24 ? 52  ASP A C    4  
ATOM   4864  O O    . ASP A 1 52 ? -9.601  -7.650  -1.024  1.00 0.24 ? 52  ASP A O    4  
ATOM   4865  C CB   . ASP A 1 52 ? -8.553  -10.806 -0.423  1.00 0.37 ? 52  ASP A CB   4  
ATOM   4866  C CG   . ASP A 1 52 ? -9.790  -11.027 -1.268  1.00 0.85 ? 52  ASP A CG   4  
ATOM   4867  O OD1  . ASP A 1 52 ? -10.900 -11.126 -0.700  1.00 1.49 ? 52  ASP A OD1  4  
ATOM   4868  O OD2  . ASP A 1 52 ? -9.659  -11.107 -2.508  1.00 1.39 ? 52  ASP A OD2  4  
ATOM   4869  H H    . ASP A 1 52 ? -6.464  -9.959  0.760   1.00 0.27 ? 52  ASP A H    4  
ATOM   4870  H HA   . ASP A 1 52 ? -7.775  -9.217  -1.598  1.00 0.30 ? 52  ASP A HA   4  
ATOM   4871  H HB2  . ASP A 1 52 ? -7.789  -11.503 -0.737  1.00 0.74 ? 52  ASP A HB2  4  
ATOM   4872  H HB3  . ASP A 1 52 ? -8.803  -10.994 0.610   1.00 0.74 ? 52  ASP A HB3  4  
ATOM   4873  N N    . PRO A 1 53 ? -9.484  -8.290  1.139   1.00 0.23 ? 53  PRO A N    4  
ATOM   4874  C CA   . PRO A 1 53 ? -10.520 -7.350  1.593   1.00 0.24 ? 53  PRO A CA   4  
ATOM   4875  C C    . PRO A 1 53 ? -10.221 -5.908  1.184   1.00 0.21 ? 53  PRO A C    4  
ATOM   4876  O O    . PRO A 1 53 ? -11.122 -5.168  0.786   1.00 0.24 ? 53  PRO A O    4  
ATOM   4877  C CB   . PRO A 1 53 ? -10.504 -7.484  3.122   1.00 0.29 ? 53  PRO A CB   4  
ATOM   4878  C CG   . PRO A 1 53 ? -9.263  -8.233  3.453   1.00 0.33 ? 53  PRO A CG   4  
ATOM   4879  C CD   . PRO A 1 53 ? -8.968  -9.093  2.261   1.00 0.28 ? 53  PRO A CD   4  
ATOM   4880  H HA   . PRO A 1 53 ? -11.496 -7.630  1.217   1.00 0.27 ? 53  PRO A HA   4  
ATOM   4881  H HB2  . PRO A 1 53 ? -10.492 -6.500  3.574   1.00 0.34 ? 53  PRO A HB2  4  
ATOM   4882  H HB3  . PRO A 1 53 ? -11.368 -8.036  3.455   1.00 0.34 ? 53  PRO A HB3  4  
ATOM   4883  H HG2  . PRO A 1 53 ? -8.452  -7.540  3.628   1.00 0.41 ? 53  PRO A HG2  4  
ATOM   4884  H HG3  . PRO A 1 53 ? -9.425  -8.851  4.323   1.00 0.44 ? 53  PRO A HG3  4  
ATOM   4885  H HD2  . PRO A 1 53 ? -7.905  -9.257  2.164   1.00 0.29 ? 53  PRO A HD2  4  
ATOM   4886  H HD3  . PRO A 1 53 ? -9.492  -10.034 2.336   1.00 0.34 ? 53  PRO A HD3  4  
ATOM   4887  N N    . ILE A 1 54 ? -8.953  -5.518  1.278   1.00 0.19 ? 54  ILE A N    4  
ATOM   4888  C CA   . ILE A 1 54 ? -8.541  -4.168  0.907   1.00 0.19 ? 54  ILE A CA   4  
ATOM   4889  C C    . ILE A 1 54 ? -8.739  -3.941  -0.589  1.00 0.16 ? 54  ILE A C    4  
ATOM   4890  O O    . ILE A 1 54 ? -9.340  -2.946  -1.000  1.00 0.17 ? 54  ILE A O    4  
ATOM   4891  C CB   . ILE A 1 54 ? -7.065  -3.903  1.282   1.00 0.22 ? 54  ILE A CB   4  
ATOM   4892  C CG1  . ILE A 1 54 ? -6.873  -4.029  2.795   1.00 0.27 ? 54  ILE A CG1  4  
ATOM   4893  C CG2  . ILE A 1 54 ? -6.626  -2.530  0.797   1.00 0.26 ? 54  ILE A CG2  4  
ATOM   4894  C CD1  . ILE A 1 54 ? -5.428  -3.920  3.229   1.00 0.34 ? 54  ILE A CD1  4  
ATOM   4895  H H    . ILE A 1 54 ? -8.280  -6.154  1.607   1.00 0.19 ? 54  ILE A H    4  
ATOM   4896  H HA   . ILE A 1 54 ? -9.161  -3.470  1.448   1.00 0.23 ? 54  ILE A HA   4  
ATOM   4897  H HB   . ILE A 1 54 ? -6.451  -4.644  0.787   1.00 0.21 ? 54  ILE A HB   4  
ATOM   4898  H HG12 . ILE A 1 54 ? -7.428  -3.247  3.289   1.00 0.31 ? 54  ILE A HG12 4  
ATOM   4899  H HG13 . ILE A 1 54 ? -7.245  -4.991  3.119   1.00 0.27 ? 54  ILE A HG13 4  
ATOM   4900  H HG21 . ILE A 1 54 ? -5.597  -2.360  1.078   1.00 0.58 ? 54  ILE A HG21 4  
ATOM   4901  H HG22 . ILE A 1 54 ? -7.250  -1.771  1.244   1.00 0.60 ? 54  ILE A HG22 4  
ATOM   4902  H HG23 . ILE A 1 54 ? -6.719  -2.484  -0.277  1.00 0.58 ? 54  ILE A HG23 4  
ATOM   4903  H HD11 . ILE A 1 54 ? -5.366  -4.029  4.301   1.00 0.71 ? 54  ILE A HD11 4  
ATOM   4904  H HD12 . ILE A 1 54 ? -5.035  -2.957  2.940   1.00 0.68 ? 54  ILE A HD12 4  
ATOM   4905  H HD13 . ILE A 1 54 ? -4.852  -4.701  2.754   1.00 0.71 ? 54  ILE A HD13 4  
ATOM   4906  N N    . THR A 1 55 ? -8.253  -4.877  -1.394  1.00 0.15 ? 55  THR A N    4  
ATOM   4907  C CA   . THR A 1 55 ? -8.380  -4.786  -2.843  1.00 0.17 ? 55  THR A CA   4  
ATOM   4908  C C    . THR A 1 55 ? -9.847  -4.739  -3.257  1.00 0.17 ? 55  THR A C    4  
ATOM   4909  O O    . THR A 1 55 ? -10.238 -3.934  -4.105  1.00 0.19 ? 55  THR A O    4  
ATOM   4910  C CB   . THR A 1 55 ? -7.691  -5.981  -3.530  1.00 0.20 ? 55  THR A CB   4  
ATOM   4911  O OG1  . THR A 1 55 ? -6.380  -6.166  -2.979  1.00 0.20 ? 55  THR A OG1  4  
ATOM   4912  C CG2  . THR A 1 55 ? -7.580  -5.762  -5.030  1.00 0.27 ? 55  THR A CG2  4  
ATOM   4913  H H    . THR A 1 55 ? -7.794  -5.652  -1.005  1.00 0.16 ? 55  THR A H    4  
ATOM   4914  H HA   . THR A 1 55 ? -7.894  -3.878  -3.167  1.00 0.19 ? 55  THR A HA   4  
ATOM   4915  H HB   . THR A 1 55 ? -8.281  -6.870  -3.353  1.00 0.22 ? 55  THR A HB   4  
ATOM   4916  H HG1  . THR A 1 55 ? -6.427  -6.763  -2.219  1.00 0.26 ? 55  THR A HG1  4  
ATOM   4917  H HG21 . THR A 1 55 ? -7.124  -6.627  -5.485  1.00 0.49 ? 55  THR A HG21 4  
ATOM   4918  H HG22 . THR A 1 55 ? -6.972  -4.889  -5.221  1.00 0.48 ? 55  THR A HG22 4  
ATOM   4919  H HG23 . THR A 1 55 ? -8.565  -5.612  -5.443  1.00 0.46 ? 55  THR A HG23 4  
ATOM   4920  N N    . ALA A 1 56 ? -10.657 -5.585  -2.631  1.00 0.18 ? 56  ALA A N    4  
ATOM   4921  C CA   . ALA A 1 56 ? -12.080 -5.650  -2.926  1.00 0.21 ? 56  ALA A CA   4  
ATOM   4922  C C    . ALA A 1 56 ? -12.775 -4.338  -2.583  1.00 0.20 ? 56  ALA A C    4  
ATOM   4923  O O    . ALA A 1 56 ? -13.463 -3.752  -3.416  1.00 0.24 ? 56  ALA A O    4  
ATOM   4924  C CB   . ALA A 1 56 ? -12.720 -6.801  -2.169  1.00 0.25 ? 56  ALA A CB   4  
ATOM   4925  H H    . ALA A 1 56 ? -10.283 -6.188  -1.952  1.00 0.18 ? 56  ALA A H    4  
ATOM   4926  H HA   . ALA A 1 56 ? -12.191 -5.840  -3.984  1.00 0.23 ? 56  ALA A HA   4  
ATOM   4927  H HB1  . ALA A 1 56 ? -12.658 -6.611  -1.108  1.00 0.42 ? 56  ALA A HB1  4  
ATOM   4928  H HB2  . ALA A 1 56 ? -12.200 -7.718  -2.400  1.00 0.43 ? 56  ALA A HB2  4  
ATOM   4929  H HB3  . ALA A 1 56 ? -13.757 -6.891  -2.459  1.00 0.43 ? 56  ALA A HB3  4  
ATOM   4930  N N    . ALA A 1 57 ? -12.567 -3.871  -1.357  1.00 0.19 ? 57  ALA A N    4  
ATOM   4931  C CA   . ALA A 1 57 ? -13.179 -2.632  -0.890  1.00 0.20 ? 57  ALA A CA   4  
ATOM   4932  C C    . ALA A 1 57 ? -12.746 -1.440  -1.737  1.00 0.19 ? 57  ALA A C    4  
ATOM   4933  O O    . ALA A 1 57 ? -13.571 -0.609  -2.121  1.00 0.22 ? 57  ALA A O    4  
ATOM   4934  C CB   . ALA A 1 57 ? -12.828 -2.393  0.570   1.00 0.23 ? 57  ALA A CB   4  
ATOM   4935  H H    . ALA A 1 57 ? -11.986 -4.380  -0.744  1.00 0.20 ? 57  ALA A H    4  
ATOM   4936  H HA   . ALA A 1 57 ? -14.251 -2.743  -0.960  1.00 0.23 ? 57  ALA A HA   4  
ATOM   4937  H HB1  . ALA A 1 57 ? -13.122 -3.250  1.159   1.00 0.41 ? 57  ALA A HB1  4  
ATOM   4938  H HB2  . ALA A 1 57 ? -13.348 -1.516  0.927   1.00 0.39 ? 57  ALA A HB2  4  
ATOM   4939  H HB3  . ALA A 1 57 ? -11.764 -2.244  0.661   1.00 0.38 ? 57  ALA A HB3  4  
ATOM   4940  N N    . LEU A 1 58 ? -11.454 -1.371  -2.039  1.00 0.18 ? 58  LEU A N    4  
ATOM   4941  C CA   . LEU A 1 58 ? -10.907 -0.277  -2.833  1.00 0.19 ? 58  LEU A CA   4  
ATOM   4942  C C    . LEU A 1 58 ? -11.487 -0.261  -4.239  1.00 0.20 ? 58  LEU A C    4  
ATOM   4943  O O    . LEU A 1 58 ? -11.870 0.791   -4.744  1.00 0.24 ? 58  LEU A O    4  
ATOM   4944  C CB   . LEU A 1 58 ? -9.383  -0.357  -2.893  1.00 0.21 ? 58  LEU A CB   4  
ATOM   4945  C CG   . LEU A 1 58 ? -8.656  0.386   -1.774  1.00 0.37 ? 58  LEU A CG   4  
ATOM   4946  C CD1  . LEU A 1 58 ? -7.159  0.192   -1.897  1.00 0.35 ? 58  LEU A CD1  4  
ATOM   4947  C CD2  . LEU A 1 58 ? -8.998  1.866   -1.800  1.00 0.73 ? 58  LEU A CD2  4  
ATOM   4948  H H    . LEU A 1 58 ? -10.851 -2.082  -1.721  1.00 0.19 ? 58  LEU A H    4  
ATOM   4949  H HA   . LEU A 1 58 ? -11.183 0.644   -2.344  1.00 0.20 ? 58  LEU A HA   4  
ATOM   4950  H HB2  . LEU A 1 58 ? -9.096  -1.398  -2.855  1.00 0.31 ? 58  LEU A HB2  4  
ATOM   4951  H HB3  . LEU A 1 58 ? -9.058  0.055   -3.835  1.00 0.39 ? 58  LEU A HB3  4  
ATOM   4952  H HG   . LEU A 1 58 ? -8.968  -0.015  -0.821  1.00 0.55 ? 58  LEU A HG   4  
ATOM   4953  H HD11 . LEU A 1 58 ? -6.658  0.790   -1.151  1.00 0.71 ? 58  LEU A HD11 4  
ATOM   4954  H HD12 . LEU A 1 58 ? -6.835  0.499   -2.880  1.00 0.67 ? 58  LEU A HD12 4  
ATOM   4955  H HD13 . LEU A 1 58 ? -6.917  -0.849  -1.745  1.00 0.64 ? 58  LEU A HD13 4  
ATOM   4956  H HD21 . LEU A 1 58 ? -8.326  2.400   -1.147  1.00 1.19 ? 58  LEU A HD21 4  
ATOM   4957  H HD22 . LEU A 1 58 ? -10.013 2.006   -1.460  1.00 1.00 ? 58  LEU A HD22 4  
ATOM   4958  H HD23 . LEU A 1 58 ? -8.899  2.241   -2.808  1.00 1.19 ? 58  LEU A HD23 4  
ATOM   4959  N N    . SER A 1 59 ? -11.556 -1.422  -4.871  1.00 0.20 ? 59  SER A N    4  
ATOM   4960  C CA   . SER A 1 59 ? -12.102 -1.507  -6.219  1.00 0.23 ? 59  SER A CA   4  
ATOM   4961  C C    . SER A 1 59 ? -13.592 -1.176  -6.211  1.00 0.23 ? 59  SER A C    4  
ATOM   4962  O O    . SER A 1 59 ? -14.110 -0.560  -7.148  1.00 0.25 ? 59  SER A O    4  
ATOM   4963  C CB   . SER A 1 59 ? -11.866 -2.899  -6.804  1.00 0.29 ? 59  SER A CB   4  
ATOM   4964  O OG   . SER A 1 59 ? -10.493 -3.243  -6.746  1.00 0.85 ? 59  SER A OG   4  
ATOM   4965  H H    . SER A 1 59 ? -11.233 -2.237  -4.428  1.00 0.21 ? 59  SER A H    4  
ATOM   4966  H HA   . SER A 1 59 ? -11.589 -0.778  -6.829  1.00 0.25 ? 59  SER A HA   4  
ATOM   4967  H HB2  . SER A 1 59 ? -12.432 -3.624  -6.239  1.00 0.65 ? 59  SER A HB2  4  
ATOM   4968  H HB3  . SER A 1 59 ? -12.186 -2.915  -7.834  1.00 0.73 ? 59  SER A HB3  4  
ATOM   4969  H HG   . SER A 1 59 ? -10.313 -3.678  -5.901  1.00 1.33 ? 59  SER A HG   4  
ATOM   4970  N N    . GLN A 1 60 ? -14.268 -1.568  -5.136  1.00 0.24 ? 60  GLN A N    4  
ATOM   4971  C CA   . GLN A 1 60 ? -15.691 -1.315  -4.987  1.00 0.28 ? 60  GLN A CA   4  
ATOM   4972  C C    . GLN A 1 60 ? -15.967 0.182   -4.911  1.00 0.26 ? 60  GLN A C    4  
ATOM   4973  O O    . GLN A 1 60 ? -16.757 0.714   -5.688  1.00 0.29 ? 60  GLN A O    4  
ATOM   4974  C CB   . GLN A 1 60 ? -16.223 -2.006  -3.730  1.00 0.34 ? 60  GLN A CB   4  
ATOM   4975  C CG   . GLN A 1 60 ? -17.731 -2.196  -3.734  1.00 0.50 ? 60  GLN A CG   4  
ATOM   4976  C CD   . GLN A 1 60 ? -18.250 -2.810  -2.448  1.00 0.63 ? 60  GLN A CD   4  
ATOM   4977  O OE1  . GLN A 1 60 ? -19.154 -3.644  -2.470  1.00 0.92 ? 60  GLN A OE1  4  
ATOM   4978  N NE2  . GLN A 1 60 ? -17.701 -2.390  -1.319  1.00 0.77 ? 60  GLN A NE2  4  
ATOM   4979  H H    . GLN A 1 60 ? -13.794 -2.054  -4.424  1.00 0.25 ? 60  GLN A H    4  
ATOM   4980  H HA   . GLN A 1 60 ? -16.196 -1.721  -5.852  1.00 0.31 ? 60  GLN A HA   4  
ATOM   4981  H HB2  . GLN A 1 60 ? -15.759 -2.978  -3.643  1.00 0.45 ? 60  GLN A HB2  4  
ATOM   4982  H HB3  . GLN A 1 60 ? -15.960 -1.412  -2.868  1.00 0.42 ? 60  GLN A HB3  4  
ATOM   4983  H HG2  . GLN A 1 60 ? -18.200 -1.234  -3.869  1.00 0.61 ? 60  GLN A HG2  4  
ATOM   4984  H HG3  . GLN A 1 60 ? -17.997 -2.844  -4.558  1.00 0.63 ? 60  GLN A HG3  4  
ATOM   4985  H HE21 . GLN A 1 60 ? -16.996 -1.708  -1.366  1.00 0.92 ? 60  GLN A HE21 4  
ATOM   4986  H HE22 . GLN A 1 60 ? -18.020 -2.781  -0.477  1.00 0.90 ? 60  GLN A HE22 4  
ATOM   4987  N N    . ARG A 1 61 ? -15.294 0.866   -3.993  1.00 0.29 ? 61  ARG A N    4  
ATOM   4988  C CA   . ARG A 1 61 ? -15.492 2.303   -3.825  1.00 0.34 ? 61  ARG A CA   4  
ATOM   4989  C C    . ARG A 1 61 ? -15.017 3.079   -5.051  1.00 0.30 ? 61  ARG A C    4  
ATOM   4990  O O    . ARG A 1 61 ? -15.593 4.107   -5.399  1.00 0.34 ? 61  ARG A O    4  
ATOM   4991  C CB   . ARG A 1 61 ? -14.790 2.811   -2.562  1.00 0.45 ? 61  ARG A CB   4  
ATOM   4992  C CG   . ARG A 1 61 ? -13.308 2.495   -2.510  1.00 0.65 ? 61  ARG A CG   4  
ATOM   4993  C CD   . ARG A 1 61 ? -12.742 2.731   -1.124  1.00 0.67 ? 61  ARG A CD   4  
ATOM   4994  N NE   . ARG A 1 61 ? -12.165 4.062   -0.983  1.00 0.81 ? 61  ARG A NE   4  
ATOM   4995  C CZ   . ARG A 1 61 ? -12.274 4.802   0.118   1.00 1.09 ? 61  ARG A CZ   4  
ATOM   4996  N NH1  . ARG A 1 61 ? -12.957 4.350   1.166   1.00 1.47 ? 61  ARG A NH1  4  
ATOM   4997  N NH2  . ARG A 1 61 ? -11.687 5.987   0.179   1.00 1.42 ? 61  ARG A NH2  4  
ATOM   4998  H H    . ARG A 1 61 ? -14.652 0.391   -3.412  1.00 0.30 ? 61  ARG A H    4  
ATOM   4999  H HA   . ARG A 1 61 ? -16.553 2.469   -3.715  1.00 0.40 ? 61  ARG A HA   4  
ATOM   5000  H HB2  . ARG A 1 61 ? -14.908 3.884   -2.506  1.00 0.72 ? 61  ARG A HB2  4  
ATOM   5001  H HB3  . ARG A 1 61 ? -15.261 2.365   -1.699  1.00 0.82 ? 61  ARG A HB3  4  
ATOM   5002  H HG2  . ARG A 1 61 ? -13.162 1.458   -2.777  1.00 1.08 ? 61  ARG A HG2  4  
ATOM   5003  H HG3  . ARG A 1 61 ? -12.790 3.126   -3.214  1.00 1.01 ? 61  ARG A HG3  4  
ATOM   5004  H HD2  . ARG A 1 61 ? -13.537 2.618   -0.404  1.00 0.88 ? 61  ARG A HD2  4  
ATOM   5005  H HD3  . ARG A 1 61 ? -11.979 1.995   -0.933  1.00 0.79 ? 61  ARG A HD3  4  
ATOM   5006  H HE   . ARG A 1 61 ? -11.675 4.426   -1.759  1.00 1.11 ? 61  ARG A HE   4  
ATOM   5007  H HH11 . ARG A 1 61 ? -13.040 4.905   1.994   1.00 1.93 ? 61  ARG A HH11 4  
ATOM   5008  H HH12 . ARG A 1 61 ? -13.396 3.448   1.131   1.00 1.47 ? 61  ARG A HH12 4  
ATOM   5009  H HH21 . ARG A 1 61 ? -11.150 6.331   -0.605  1.00 1.53 ? 61  ARG A HH21 4  
ATOM   5010  H HH22 . ARG A 1 61 ? -11.770 6.545   1.002   1.00 1.76 ? 61  ARG A HH22 4  
ATOM   5011  N N    . ALA A 1 62 ? -13.982 2.581   -5.714  1.00 0.27 ? 62  ALA A N    4  
ATOM   5012  C CA   . ALA A 1 62 ? -13.456 3.243   -6.898  1.00 0.29 ? 62  ALA A CA   4  
ATOM   5013  C C    . ALA A 1 62 ? -14.461 3.207   -8.046  1.00 0.30 ? 62  ALA A C    4  
ATOM   5014  O O    . ALA A 1 62 ? -14.632 4.191   -8.764  1.00 0.41 ? 62  ALA A O    4  
ATOM   5015  C CB   . ALA A 1 62 ? -12.148 2.602   -7.328  1.00 0.31 ? 62  ALA A CB   4  
ATOM   5016  H H    . ALA A 1 62 ? -13.552 1.757   -5.393  1.00 0.26 ? 62  ALA A H    4  
ATOM   5017  H HA   . ALA A 1 62 ? -13.256 4.272   -6.641  1.00 0.34 ? 62  ALA A HA   4  
ATOM   5018  H HB1  . ALA A 1 62 ? -12.307 1.548   -7.505  1.00 0.40 ? 62  ALA A HB1  4  
ATOM   5019  H HB2  . ALA A 1 62 ? -11.411 2.727   -6.548  1.00 0.44 ? 62  ALA A HB2  4  
ATOM   5020  H HB3  . ALA A 1 62 ? -11.798 3.071   -8.236  1.00 0.46 ? 62  ALA A HB3  4  
ATOM   5021  N N    . MET A 1 63 ? -15.141 2.078   -8.199  1.00 0.26 ? 63  MET A N    4  
ATOM   5022  C CA   . MET A 1 63 ? -16.121 1.915   -9.273  1.00 0.32 ? 63  MET A CA   4  
ATOM   5023  C C    . MET A 1 63 ? -17.453 2.585   -8.931  1.00 0.32 ? 63  MET A C    4  
ATOM   5024  O O    . MET A 1 63 ? -18.304 2.778   -9.801  1.00 0.42 ? 63  MET A O    4  
ATOM   5025  C CB   . MET A 1 63 ? -16.342 0.426   -9.578  1.00 0.37 ? 63  MET A CB   4  
ATOM   5026  C CG   . MET A 1 63 ? -17.265 -0.282  -8.596  1.00 0.38 ? 63  MET A CG   4  
ATOM   5027  S SD   . MET A 1 63 ? -17.681 -1.962  -9.111  1.00 0.50 ? 63  MET A SD   4  
ATOM   5028  C CE   . MET A 1 63 ? -16.190 -2.848  -8.658  1.00 0.71 ? 63  MET A CE   4  
ATOM   5029  H H    . MET A 1 63 ? -14.976 1.330   -7.582  1.00 0.27 ? 63  MET A H    4  
ATOM   5030  H HA   . MET A 1 63 ? -15.716 2.393   -10.153 1.00 0.36 ? 63  MET A HA   4  
ATOM   5031  H HB2  . MET A 1 63 ? -16.772 0.337   -10.562 1.00 0.43 ? 63  MET A HB2  4  
ATOM   5032  H HB3  . MET A 1 63 ? -15.386 -0.075  -9.566  1.00 0.42 ? 63  MET A HB3  4  
ATOM   5033  H HG2  . MET A 1 63 ? -16.777 -0.325  -7.634  1.00 0.38 ? 63  MET A HG2  4  
ATOM   5034  H HG3  . MET A 1 63 ? -18.178 0.289   -8.508  1.00 0.39 ? 63  MET A HG3  4  
ATOM   5035  H HE1  . MET A 1 63 ? -16.082 -2.846  -7.584  1.00 0.96 ? 63  MET A HE1  4  
ATOM   5036  H HE2  . MET A 1 63 ? -15.333 -2.367  -9.107  1.00 0.93 ? 63  MET A HE2  4  
ATOM   5037  H HE3  . MET A 1 63 ? -16.254 -3.868  -9.011  1.00 0.95 ? 63  MET A HE3  4  
ATOM   5038  N N    . ILE A 1 64 ? -17.634 2.935   -7.665  1.00 0.28 ? 64  ILE A N    4  
ATOM   5039  C CA   . ILE A 1 64 ? -18.868 3.571   -7.223  1.00 0.31 ? 64  ILE A CA   4  
ATOM   5040  C C    . ILE A 1 64 ? -18.698 5.084   -7.088  1.00 0.31 ? 64  ILE A C    4  
ATOM   5041  O O    . ILE A 1 64 ? -19.472 5.856   -7.650  1.00 0.37 ? 64  ILE A O    4  
ATOM   5042  C CB   . ILE A 1 64 ? -19.342 2.986   -5.872  1.00 0.35 ? 64  ILE A CB   4  
ATOM   5043  C CG1  . ILE A 1 64 ? -19.747 1.520   -6.040  1.00 0.38 ? 64  ILE A CG1  4  
ATOM   5044  C CG2  . ILE A 1 64 ? -20.503 3.792   -5.308  1.00 0.43 ? 64  ILE A CG2  4  
ATOM   5045  C CD1  . ILE A 1 64 ? -20.021 0.815   -4.731  1.00 0.46 ? 64  ILE A CD1  4  
ATOM   5046  H H    . ILE A 1 64 ? -16.925 2.758   -7.011  1.00 0.29 ? 64  ILE A H    4  
ATOM   5047  H HA   . ILE A 1 64 ? -19.629 3.369   -7.965  1.00 0.35 ? 64  ILE A HA   4  
ATOM   5048  H HB   . ILE A 1 64 ? -18.521 3.046   -5.174  1.00 0.34 ? 64  ILE A HB   4  
ATOM   5049  H HG12 . ILE A 1 64 ? -20.646 1.469   -6.636  1.00 0.44 ? 64  ILE A HG12 4  
ATOM   5050  H HG13 . ILE A 1 64 ? -18.955 0.988   -6.547  1.00 0.36 ? 64  ILE A HG13 4  
ATOM   5051  H HG21 . ILE A 1 64 ? -20.780 3.395   -4.342  1.00 0.59 ? 64  ILE A HG21 4  
ATOM   5052  H HG22 . ILE A 1 64 ? -21.347 3.726   -5.979  1.00 0.58 ? 64  ILE A HG22 4  
ATOM   5053  H HG23 . ILE A 1 64 ? -20.209 4.825   -5.202  1.00 0.58 ? 64  ILE A HG23 4  
ATOM   5054  H HD11 . ILE A 1 64 ? -20.840 1.301   -4.225  1.00 0.62 ? 64  ILE A HD11 4  
ATOM   5055  H HD12 . ILE A 1 64 ? -19.138 0.855   -4.109  1.00 0.57 ? 64  ILE A HD12 4  
ATOM   5056  H HD13 . ILE A 1 64 ? -20.278 -0.216  -4.925  1.00 0.59 ? 64  ILE A HD13 4  
ATOM   5057  N N    . LEU A 1 65 ? -17.681 5.502   -6.350  1.00 0.29 ? 65  LEU A N    4  
ATOM   5058  C CA   . LEU A 1 65 ? -17.426 6.920   -6.129  1.00 0.33 ? 65  LEU A CA   4  
ATOM   5059  C C    . LEU A 1 65 ? -16.811 7.572   -7.360  1.00 0.34 ? 65  LEU A C    4  
ATOM   5060  O O    . LEU A 1 65 ? -17.142 8.708   -7.696  1.00 0.47 ? 65  LEU A O    4  
ATOM   5061  C CB   . LEU A 1 65 ? -16.505 7.110   -4.923  1.00 0.40 ? 65  LEU A CB   4  
ATOM   5062  C CG   . LEU A 1 65 ? -17.079 7.967   -3.792  1.00 0.93 ? 65  LEU A CG   4  
ATOM   5063  C CD1  . LEU A 1 65 ? -18.381 7.374   -3.276  1.00 1.61 ? 65  LEU A CD1  4  
ATOM   5064  C CD2  . LEU A 1 65 ? -16.071 8.093   -2.663  1.00 0.99 ? 65  LEU A CD2  4  
ATOM   5065  H H    . LEU A 1 65 ? -17.078 4.840   -5.944  1.00 0.30 ? 65  LEU A H    4  
ATOM   5066  H HA   . LEU A 1 65 ? -18.372 7.394   -5.924  1.00 0.39 ? 65  LEU A HA   4  
ATOM   5067  H HB2  . LEU A 1 65 ? -16.269 6.135   -4.523  1.00 0.77 ? 65  LEU A HB2  4  
ATOM   5068  H HB3  . LEU A 1 65 ? -15.593 7.571   -5.265  1.00 0.73 ? 65  LEU A HB3  4  
ATOM   5069  H HG   . LEU A 1 65 ? -17.285 8.956   -4.170  1.00 1.40 ? 65  LEU A HG   4  
ATOM   5070  H HD11 . LEU A 1 65 ? -18.218 6.345   -2.991  1.00 1.79 ? 65  LEU A HD11 4  
ATOM   5071  H HD12 . LEU A 1 65 ? -19.130 7.420   -4.051  1.00 1.94 ? 65  LEU A HD12 4  
ATOM   5072  H HD13 . LEU A 1 65 ? -18.714 7.934   -2.417  1.00 2.09 ? 65  LEU A HD13 4  
ATOM   5073  H HD21 . LEU A 1 65 ? -15.205 8.640   -3.008  1.00 1.31 ? 65  LEU A HD21 4  
ATOM   5074  H HD22 . LEU A 1 65 ? -15.768 7.109   -2.336  1.00 1.14 ? 65  LEU A HD22 4  
ATOM   5075  H HD23 . LEU A 1 65 ? -16.523 8.622   -1.838  1.00 1.50 ? 65  LEU A HD23 4  
ATOM   5076  N N    . GLY A 1 66 ? -15.909 6.860   -8.023  1.00 0.30 ? 66  GLY A N    4  
ATOM   5077  C CA   . GLY A 1 66 ? -15.276 7.397   -9.211  1.00 0.36 ? 66  GLY A CA   4  
ATOM   5078  C C    . GLY A 1 66 ? -13.803 7.680   -9.008  1.00 0.43 ? 66  GLY A C    4  
ATOM   5079  O O    . GLY A 1 66 ? -13.046 7.778   -9.974  1.00 0.81 ? 66  GLY A O    4  
ATOM   5080  H H    . GLY A 1 66 ? -15.671 5.963   -7.705  1.00 0.33 ? 66  GLY A H    4  
ATOM   5081  H HA2  . GLY A 1 66 ? -15.387 6.687   -10.019 1.00 0.40 ? 66  GLY A HA2  4  
ATOM   5082  H HA3  . GLY A 1 66 ? -15.770 8.317   -9.483  1.00 0.41 ? 66  GLY A HA3  4  
ATOM   5083  N N    . LYS A 1 67 ? -13.393 7.818   -7.755  1.00 0.43 ? 67  LYS A N    4  
ATOM   5084  C CA   . LYS A 1 67 ? -11.996 8.089   -7.439  1.00 0.47 ? 67  LYS A CA   4  
ATOM   5085  C C    . LYS A 1 67 ? -11.235 6.792   -7.184  1.00 0.35 ? 67  LYS A C    4  
ATOM   5086  O O    . LYS A 1 67 ? -11.619 5.987   -6.333  1.00 0.44 ? 67  LYS A O    4  
ATOM   5087  C CB   . LYS A 1 67 ? -11.876 9.028   -6.232  1.00 0.65 ? 67  LYS A CB   4  
ATOM   5088  C CG   . LYS A 1 67 ? -12.712 8.613   -5.026  1.00 0.74 ? 67  LYS A CG   4  
ATOM   5089  C CD   . LYS A 1 67 ? -12.408 9.471   -3.802  1.00 1.10 ? 67  LYS A CD   4  
ATOM   5090  C CE   . LYS A 1 67 ? -13.180 10.792  -3.812  1.00 1.28 ? 67  LYS A CE   4  
ATOM   5091  N NZ   . LYS A 1 67 ? -12.730 11.715  -4.891  1.00 1.52 ? 67  LYS A NZ   4  
ATOM   5092  H H    . LYS A 1 67 ? -14.043 7.732   -7.028  1.00 0.69 ? 67  LYS A H    4  
ATOM   5093  H HA   . LYS A 1 67 ? -11.558 8.572   -8.300  1.00 0.55 ? 67  LYS A HA   4  
ATOM   5094  H HB2  . LYS A 1 67 ? -10.841 9.068   -5.926  1.00 0.82 ? 67  LYS A HB2  4  
ATOM   5095  H HB3  . LYS A 1 67 ? -12.187 10.017  -6.534  1.00 0.78 ? 67  LYS A HB3  4  
ATOM   5096  H HG2  . LYS A 1 67 ? -13.757 8.719   -5.274  1.00 0.86 ? 67  LYS A HG2  4  
ATOM   5097  H HG3  . LYS A 1 67 ? -12.501 7.580   -4.794  1.00 0.86 ? 67  LYS A HG3  4  
ATOM   5098  H HD2  . LYS A 1 67 ? -12.678 8.920   -2.913  1.00 1.44 ? 67  LYS A HD2  4  
ATOM   5099  H HD3  . LYS A 1 67 ? -11.351 9.685   -3.782  1.00 1.29 ? 67  LYS A HD3  4  
ATOM   5100  H HE2  . LYS A 1 67 ? -14.228 10.580  -3.954  1.00 1.52 ? 67  LYS A HE2  4  
ATOM   5101  H HE3  . LYS A 1 67 ? -13.041 11.276  -2.857  1.00 1.71 ? 67  LYS A HE3  4  
ATOM   5102  H HZ1  . LYS A 1 67 ? -13.016 12.692  -4.672  1.00 1.85 ? 67  LYS A HZ1  4  
ATOM   5103  H HZ2  . LYS A 1 67 ? -13.162 11.444  -5.797  1.00 1.82 ? 67  LYS A HZ2  4  
ATOM   5104  H HZ3  . LYS A 1 67 ? -11.694 11.685  -4.989  1.00 1.90 ? 67  LYS A HZ3  4  
ATOM   5105  N N    . SER A 1 68 ? -10.162 6.591   -7.935  1.00 0.30 ? 68  SER A N    4  
ATOM   5106  C CA   . SER A 1 68 ? -9.342  5.398   -7.801  1.00 0.32 ? 68  SER A CA   4  
ATOM   5107  C C    . SER A 1 68 ? -7.929  5.761   -7.350  1.00 0.28 ? 68  SER A C    4  
ATOM   5108  O O    . SER A 1 68 ? -6.989  4.988   -7.538  1.00 0.33 ? 68  SER A O    4  
ATOM   5109  C CB   . SER A 1 68 ? -9.304  4.656   -9.140  1.00 0.46 ? 68  SER A CB   4  
ATOM   5110  O OG   . SER A 1 68 ? -9.563  5.550   -10.214 1.00 0.91 ? 68  SER A OG   4  
ATOM   5111  H H    . SER A 1 68 ? -9.921  7.255   -8.616  1.00 0.38 ? 68  SER A H    4  
ATOM   5112  H HA   . SER A 1 68 ? -9.797  4.762   -7.058  1.00 0.38 ? 68  SER A HA   4  
ATOM   5113  H HB2  . SER A 1 68 ? -8.329  4.214   -9.282  1.00 0.76 ? 68  SER A HB2  4  
ATOM   5114  H HB3  . SER A 1 68 ? -10.055 3.880   -9.145  1.00 0.77 ? 68  SER A HB3  4  
ATOM   5115  H HG   . SER A 1 68 ? -8.879  5.452   -10.886 1.00 1.45 ? 68  SER A HG   4  
ATOM   5116  N N    . GLY A 1 69 ? -7.792  6.934   -6.734  1.00 0.29 ? 69  GLY A N    4  
ATOM   5117  C CA   . GLY A 1 69 ? -6.492  7.396   -6.272  1.00 0.35 ? 69  GLY A CA   4  
ATOM   5118  C C    . GLY A 1 69 ? -5.839  6.439   -5.293  1.00 0.32 ? 69  GLY A C    4  
ATOM   5119  O O    . GLY A 1 69 ? -4.640  6.171   -5.381  1.00 0.41 ? 69  GLY A O    4  
ATOM   5120  H H    . GLY A 1 69 ? -8.585  7.492   -6.586  1.00 0.33 ? 69  GLY A H    4  
ATOM   5121  H HA2  . GLY A 1 69 ? -5.843  7.514   -7.126  1.00 0.40 ? 69  GLY A HA2  4  
ATOM   5122  H HA3  . GLY A 1 69 ? -6.612  8.357   -5.792  1.00 0.42 ? 69  GLY A HA3  4  
ATOM   5123  N N    . GLU A 1 70 ? -6.626  5.921   -4.362  1.00 0.34 ? 70  GLU A N    4  
ATOM   5124  C CA   . GLU A 1 70 ? -6.123  4.984   -3.366  1.00 0.38 ? 70  GLU A CA   4  
ATOM   5125  C C    . GLU A 1 70 ? -5.807  3.639   -4.016  1.00 0.32 ? 70  GLU A C    4  
ATOM   5126  O O    . GLU A 1 70 ? -4.890  2.934   -3.597  1.00 0.39 ? 70  GLU A O    4  
ATOM   5127  C CB   . GLU A 1 70 ? -7.143  4.804   -2.237  1.00 0.52 ? 70  GLU A CB   4  
ATOM   5128  C CG   . GLU A 1 70 ? -7.581  6.108   -1.583  1.00 0.66 ? 70  GLU A CG   4  
ATOM   5129  C CD   . GLU A 1 70 ? -8.878  6.647   -2.156  1.00 0.70 ? 70  GLU A CD   4  
ATOM   5130  O OE1  . GLU A 1 70 ? -9.734  7.105   -1.369  1.00 1.24 ? 70  GLU A OE1  4  
ATOM   5131  O OE2  . GLU A 1 70 ? -9.046  6.616   -3.395  1.00 1.08 ? 70  GLU A OE2  4  
ATOM   5132  H H    . GLU A 1 70 ? -7.578  6.187   -4.331  1.00 0.40 ? 70  GLU A H    4  
ATOM   5133  H HA   . GLU A 1 70 ? -5.213  5.393   -2.955  1.00 0.42 ? 70  GLU A HA   4  
ATOM   5134  H HB2  . GLU A 1 70 ? -8.018  4.318   -2.637  1.00 0.52 ? 70  GLU A HB2  4  
ATOM   5135  H HB3  . GLU A 1 70 ? -6.708  4.172   -1.474  1.00 0.64 ? 70  GLU A HB3  4  
ATOM   5136  H HG2  . GLU A 1 70 ? -7.718  5.937   -0.525  1.00 0.80 ? 70  GLU A HG2  4  
ATOM   5137  H HG3  . GLU A 1 70 ? -6.806  6.846   -1.729  1.00 0.82 ? 70  GLU A HG3  4  
ATOM   5138  N N    . LEU A 1 71 ? -6.553  3.306   -5.063  1.00 0.28 ? 71  LEU A N    4  
ATOM   5139  C CA   . LEU A 1 71 ? -6.364  2.045   -5.773  1.00 0.28 ? 71  LEU A CA   4  
ATOM   5140  C C    . LEU A 1 71 ? -5.015  2.029   -6.484  1.00 0.26 ? 71  LEU A C    4  
ATOM   5141  O O    . LEU A 1 71 ? -4.308  1.017   -6.470  1.00 0.30 ? 71  LEU A O    4  
ATOM   5142  C CB   . LEU A 1 71 ? -7.488  1.821   -6.790  1.00 0.34 ? 71  LEU A CB   4  
ATOM   5143  C CG   . LEU A 1 71 ? -8.219  0.475   -6.686  1.00 0.58 ? 71  LEU A CG   4  
ATOM   5144  C CD1  . LEU A 1 71 ? -9.215  0.324   -7.822  1.00 0.89 ? 71  LEU A CD1  4  
ATOM   5145  C CD2  . LEU A 1 71 ? -7.235  -0.686  -6.687  1.00 1.43 ? 71  LEU A CD2  4  
ATOM   5146  H H    . LEU A 1 71 ? -7.241  3.929   -5.372  1.00 0.34 ? 71  LEU A H    4  
ATOM   5147  H HA   . LEU A 1 71 ? -6.381  1.249   -5.044  1.00 0.33 ? 71  LEU A HA   4  
ATOM   5148  H HB2  . LEU A 1 71 ? -8.215  2.611   -6.668  1.00 0.54 ? 71  LEU A HB2  4  
ATOM   5149  H HB3  . LEU A 1 71 ? -7.067  1.897   -7.780  1.00 0.61 ? 71  LEU A HB3  4  
ATOM   5150  H HG   . LEU A 1 71 ? -8.769  0.446   -5.759  1.00 1.35 ? 71  LEU A HG   4  
ATOM   5151  H HD11 . LEU A 1 71 ? -9.978  1.084   -7.734  1.00 1.64 ? 71  LEU A HD11 4  
ATOM   5152  H HD12 . LEU A 1 71 ? -9.670  -0.653  -7.773  1.00 1.06 ? 71  LEU A HD12 4  
ATOM   5153  H HD13 . LEU A 1 71 ? -8.704  0.437   -8.766  1.00 1.33 ? 71  LEU A HD13 4  
ATOM   5154  H HD21 . LEU A 1 71 ? -6.595  -0.619  -5.820  1.00 2.09 ? 71  LEU A HD21 4  
ATOM   5155  H HD22 . LEU A 1 71 ? -6.633  -0.644  -7.582  1.00 1.87 ? 71  LEU A HD22 4  
ATOM   5156  H HD23 . LEU A 1 71 ? -7.780  -1.618  -6.662  1.00 1.71 ? 71  LEU A HD23 4  
ATOM   5157  N N    . LYS A 1 72 ? -4.661  3.157   -7.098  1.00 0.26 ? 72  LYS A N    4  
ATOM   5158  C CA   . LYS A 1 72 ? -3.391  3.276   -7.810  1.00 0.30 ? 72  LYS A CA   4  
ATOM   5159  C C    . LYS A 1 72 ? -2.227  3.025   -6.861  1.00 0.27 ? 72  LYS A C    4  
ATOM   5160  O O    . LYS A 1 72 ? -1.259  2.338   -7.200  1.00 0.33 ? 72  LYS A O    4  
ATOM   5161  C CB   . LYS A 1 72 ? -3.246  4.667   -8.434  1.00 0.39 ? 72  LYS A CB   4  
ATOM   5162  C CG   . LYS A 1 72 ? -4.330  5.012   -9.447  1.00 0.50 ? 72  LYS A CG   4  
ATOM   5163  C CD   . LYS A 1 72 ? -3.845  6.048   -10.450 1.00 0.74 ? 72  LYS A CD   4  
ATOM   5164  C CE   . LYS A 1 72 ? -3.465  7.356   -9.772  1.00 1.11 ? 72  LYS A CE   4  
ATOM   5165  N NZ   . LYS A 1 72 ? -2.252  7.965   -10.382 1.00 1.44 ? 72  LYS A NZ   4  
ATOM   5166  H H    . LYS A 1 72 ? -5.273  3.925   -7.078  1.00 0.28 ? 72  LYS A H    4  
ATOM   5167  H HA   . LYS A 1 72 ? -3.377  2.532   -8.593  1.00 0.35 ? 72  LYS A HA   4  
ATOM   5168  H HB2  . LYS A 1 72 ? -3.276  5.401   -7.643  1.00 0.45 ? 72  LYS A HB2  4  
ATOM   5169  H HB3  . LYS A 1 72 ? -2.286  4.725   -8.930  1.00 0.49 ? 72  LYS A HB3  4  
ATOM   5170  H HG2  . LYS A 1 72 ? -4.611  4.118   -9.979  1.00 0.76 ? 72  LYS A HG2  4  
ATOM   5171  H HG3  . LYS A 1 72 ? -5.189  5.409   -8.921  1.00 0.74 ? 72  LYS A HG3  4  
ATOM   5172  H HD2  . LYS A 1 72 ? -2.979  5.657   -10.964 1.00 0.98 ? 72  LYS A HD2  4  
ATOM   5173  H HD3  . LYS A 1 72 ? -4.631  6.238   -11.166 1.00 0.88 ? 72  LYS A HD3  4  
ATOM   5174  H HE2  . LYS A 1 72 ? -4.288  8.049   -9.864  1.00 1.39 ? 72  LYS A HE2  4  
ATOM   5175  H HE3  . LYS A 1 72 ? -3.274  7.163   -8.726  1.00 1.42 ? 72  LYS A HE3  4  
ATOM   5176  H HZ1  . LYS A 1 72 ? -2.393  8.111   -11.401 1.00 1.73 ? 72  LYS A HZ1  4  
ATOM   5177  H HZ2  . LYS A 1 72 ? -1.433  7.340   -10.244 1.00 1.79 ? 72  LYS A HZ2  4  
ATOM   5178  H HZ3  . LYS A 1 72 ? -2.045  8.883   -9.938  1.00 1.75 ? 72  LYS A HZ3  4  
ATOM   5179  N N    . THR A 1 73 ? -2.339  3.587   -5.667  1.00 0.23 ? 73  THR A N    4  
ATOM   5180  C CA   . THR A 1 73 ? -1.318  3.441   -4.646  1.00 0.24 ? 73  THR A CA   4  
ATOM   5181  C C    . THR A 1 73 ? -1.274  2.002   -4.125  1.00 0.21 ? 73  THR A C    4  
ATOM   5182  O O    . THR A 1 73 ? -0.194  1.444   -3.907  1.00 0.24 ? 73  THR A O    4  
ATOM   5183  C CB   . THR A 1 73 ? -1.579  4.423   -3.487  1.00 0.29 ? 73  THR A CB   4  
ATOM   5184  O OG1  . THR A 1 73 ? -1.951  5.702   -4.020  1.00 0.39 ? 73  THR A OG1  4  
ATOM   5185  C CG2  . THR A 1 73 ? -0.345  4.582   -2.613  1.00 0.35 ? 73  THR A CG2  4  
ATOM   5186  H H    . THR A 1 73 ? -3.134  4.127   -5.468  1.00 0.26 ? 73  THR A H    4  
ATOM   5187  H HA   . THR A 1 73 ? -0.364  3.682   -5.089  1.00 0.26 ? 73  THR A HA   4  
ATOM   5188  H HB   . THR A 1 73 ? -2.389  4.040   -2.881  1.00 0.32 ? 73  THR A HB   4  
ATOM   5189  H HG1  . THR A 1 73 ? -1.362  5.923   -4.753  1.00 0.74 ? 73  THR A HG1  4  
ATOM   5190  H HG21 . THR A 1 73 ? 0.498   4.861   -3.227  1.00 0.57 ? 73  THR A HG21 4  
ATOM   5191  H HG22 . THR A 1 73 ? -0.136  3.647   -2.116  1.00 0.56 ? 73  THR A HG22 4  
ATOM   5192  H HG23 . THR A 1 73 ? -0.523  5.352   -1.877  1.00 0.58 ? 73  THR A HG23 4  
ATOM   5193  N N    . TRP A 1 74 ? -2.447  1.402   -3.954  1.00 0.18 ? 74  TRP A N    4  
ATOM   5194  C CA   . TRP A 1 74 ? -2.551  0.032   -3.465  1.00 0.18 ? 74  TRP A CA   4  
ATOM   5195  C C    . TRP A 1 74 ? -1.951  -0.958  -4.458  1.00 0.17 ? 74  TRP A C    4  
ATOM   5196  O O    . TRP A 1 74 ? -1.229  -1.878  -4.068  1.00 0.19 ? 74  TRP A O    4  
ATOM   5197  C CB   . TRP A 1 74 ? -4.013  -0.329  -3.197  1.00 0.19 ? 74  TRP A CB   4  
ATOM   5198  C CG   . TRP A 1 74 ? -4.220  -1.765  -2.812  1.00 0.20 ? 74  TRP A CG   4  
ATOM   5199  C CD1  . TRP A 1 74 ? -5.015  -2.673  -3.448  1.00 0.23 ? 74  TRP A CD1  4  
ATOM   5200  C CD2  . TRP A 1 74 ? -3.622  -2.459  -1.709  1.00 0.27 ? 74  TRP A CD2  4  
ATOM   5201  N NE1  . TRP A 1 74 ? -4.956  -3.883  -2.804  1.00 0.25 ? 74  TRP A NE1  4  
ATOM   5202  C CE2  . TRP A 1 74 ? -4.107  -3.780  -1.737  1.00 0.27 ? 74  TRP A CE2  4  
ATOM   5203  C CE3  . TRP A 1 74 ? -2.727  -2.092  -0.700  1.00 0.38 ? 74  TRP A CE3  4  
ATOM   5204  C CZ2  . TRP A 1 74 ? -3.725  -4.735  -0.799  1.00 0.36 ? 74  TRP A CZ2  4  
ATOM   5205  C CZ3  . TRP A 1 74 ? -2.346  -3.039  0.232   1.00 0.48 ? 74  TRP A CZ3  4  
ATOM   5206  C CH2  . TRP A 1 74 ? -2.847  -4.347  0.177   1.00 0.46 ? 74  TRP A CH2  4  
ATOM   5207  H H    . TRP A 1 74 ? -3.268  1.900   -4.156  1.00 0.20 ? 74  TRP A H    4  
ATOM   5208  H HA   . TRP A 1 74 ? -2.000  -0.030  -2.541  1.00 0.20 ? 74  TRP A HA   4  
ATOM   5209  H HB2  . TRP A 1 74 ? -4.385  0.287   -2.394  1.00 0.22 ? 74  TRP A HB2  4  
ATOM   5210  H HB3  . TRP A 1 74 ? -4.593  -0.136  -4.088  1.00 0.21 ? 74  TRP A HB3  4  
ATOM   5211  H HD1  . TRP A 1 74 ? -5.605  -2.454  -4.327  1.00 0.30 ? 74  TRP A HD1  4  
ATOM   5212  H HE1  . TRP A 1 74 ? -5.447  -4.701  -3.070  1.00 0.28 ? 74  TRP A HE1  4  
ATOM   5213  H HE3  . TRP A 1 74 ? -2.334  -1.087  -0.642  1.00 0.40 ? 74  TRP A HE3  4  
ATOM   5214  H HZ2  . TRP A 1 74 ? -4.101  -5.749  -0.829  1.00 0.36 ? 74  TRP A HZ2  4  
ATOM   5215  H HZ3  . TRP A 1 74 ? -1.655  -2.776  1.017   1.00 0.58 ? 74  TRP A HZ3  4  
ATOM   5216  H HH2  . TRP A 1 74 ? -2.523  -5.054  0.927   1.00 0.54 ? 74  TRP A HH2  4  
ATOM   5217  N N    . GLY A 1 75 ? -2.244  -0.757  -5.738  1.00 0.18 ? 75  GLY A N    4  
ATOM   5218  C CA   . GLY A 1 75 ? -1.733  -1.639  -6.772  1.00 0.21 ? 75  GLY A CA   4  
ATOM   5219  C C    . GLY A 1 75 ? -0.222  -1.738  -6.754  1.00 0.20 ? 75  GLY A C    4  
ATOM   5220  O O    . GLY A 1 75 ? 0.340   -2.807  -6.987  1.00 0.25 ? 75  GLY A O    4  
ATOM   5221  H H    . GLY A 1 75 ? -2.824  -0.001  -5.985  1.00 0.20 ? 75  GLY A H    4  
ATOM   5222  H HA2  . GLY A 1 75 ? -2.147  -2.626  -6.626  1.00 0.24 ? 75  GLY A HA2  4  
ATOM   5223  H HA3  . GLY A 1 75 ? -2.046  -1.266  -7.734  1.00 0.24 ? 75  GLY A HA3  4  
ATOM   5224  N N    . LEU A 1 76 ? 0.435   -0.625  -6.453  1.00 0.20 ? 76  LEU A N    4  
ATOM   5225  C CA   . LEU A 1 76 ? 1.889   -0.591  -6.401  1.00 0.24 ? 76  LEU A CA   4  
ATOM   5226  C C    . LEU A 1 76 ? 2.414   -1.324  -5.166  1.00 0.23 ? 76  LEU A C    4  
ATOM   5227  O O    . LEU A 1 76 ? 3.525   -1.851  -5.177  1.00 0.28 ? 76  LEU A O    4  
ATOM   5228  C CB   . LEU A 1 76 ? 2.384   0.857   -6.430  1.00 0.30 ? 76  LEU A CB   4  
ATOM   5229  C CG   . LEU A 1 76 ? 2.306   1.531   -7.805  1.00 0.40 ? 76  LEU A CG   4  
ATOM   5230  C CD1  . LEU A 1 76 ? 2.475   3.035   -7.681  1.00 0.51 ? 76  LEU A CD1  4  
ATOM   5231  C CD2  . LEU A 1 76 ? 3.361   0.955   -8.737  1.00 0.56 ? 76  LEU A CD2  4  
ATOM   5232  H H    . LEU A 1 76 ? -0.072  0.193   -6.267  1.00 0.22 ? 76  LEU A H    4  
ATOM   5233  H HA   . LEU A 1 76 ? 2.255   -1.099  -7.280  1.00 0.27 ? 76  LEU A HA   4  
ATOM   5234  H HB2  . LEU A 1 76 ? 1.795   1.435   -5.731  1.00 0.34 ? 76  LEU A HB2  4  
ATOM   5235  H HB3  . LEU A 1 76 ? 3.413   0.871   -6.105  1.00 0.36 ? 76  LEU A HB3  4  
ATOM   5236  H HG   . LEU A 1 76 ? 1.336   1.338   -8.238  1.00 0.51 ? 76  LEU A HG   4  
ATOM   5237  H HD11 . LEU A 1 76 ? 1.720   3.429   -7.018  1.00 0.93 ? 76  LEU A HD11 4  
ATOM   5238  H HD12 . LEU A 1 76 ? 2.371   3.490   -8.655  1.00 0.87 ? 76  LEU A HD12 4  
ATOM   5239  H HD13 . LEU A 1 76 ? 3.455   3.256   -7.284  1.00 0.94 ? 76  LEU A HD13 4  
ATOM   5240  H HD21 . LEU A 1 76 ? 4.330   1.021   -8.268  1.00 0.97 ? 76  LEU A HD21 4  
ATOM   5241  H HD22 . LEU A 1 76 ? 3.371   1.516   -9.659  1.00 0.98 ? 76  LEU A HD22 4  
ATOM   5242  H HD23 . LEU A 1 76 ? 3.129   -0.080  -8.948  1.00 1.01 ? 76  LEU A HD23 4  
ATOM   5243  N N    . VAL A 1 77 ? 1.610   -1.361  -4.108  1.00 0.22 ? 77  VAL A N    4  
ATOM   5244  C CA   . VAL A 1 77 ? 1.995   -2.057  -2.884  1.00 0.25 ? 77  VAL A CA   4  
ATOM   5245  C C    . VAL A 1 77 ? 1.793   -3.551  -3.066  1.00 0.23 ? 77  VAL A C    4  
ATOM   5246  O O    . VAL A 1 77 ? 2.697   -4.348  -2.819  1.00 0.24 ? 77  VAL A O    4  
ATOM   5247  C CB   . VAL A 1 77 ? 1.177   -1.594  -1.660  1.00 0.29 ? 77  VAL A CB   4  
ATOM   5248  C CG1  . VAL A 1 77 ? 1.654   -2.293  -0.397  1.00 0.34 ? 77  VAL A CG1  4  
ATOM   5249  C CG2  . VAL A 1 77 ? 1.257   -0.090  -1.493  1.00 0.35 ? 77  VAL A CG2  4  
ATOM   5250  H H    . VAL A 1 77 ? 0.736   -0.917  -4.152  1.00 0.22 ? 77  VAL A H    4  
ATOM   5251  H HA   . VAL A 1 77 ? 3.039   -1.862  -2.696  1.00 0.29 ? 77  VAL A HA   4  
ATOM   5252  H HB   . VAL A 1 77 ? 0.144   -1.862  -1.822  1.00 0.30 ? 77  VAL A HB   4  
ATOM   5253  H HG11 . VAL A 1 77 ? 1.688   -3.357  -0.567  1.00 0.46 ? 77  VAL A HG11 4  
ATOM   5254  H HG12 . VAL A 1 77 ? 0.973   -2.078  0.413   1.00 0.50 ? 77  VAL A HG12 4  
ATOM   5255  H HG13 . VAL A 1 77 ? 2.642   -1.940  -0.140  1.00 0.49 ? 77  VAL A HG13 4  
ATOM   5256  H HG21 . VAL A 1 77 ? 2.293   0.212   -1.451  1.00 0.59 ? 77  VAL A HG21 4  
ATOM   5257  H HG22 . VAL A 1 77 ? 0.760   0.197   -0.578  1.00 0.59 ? 77  VAL A HG22 4  
ATOM   5258  H HG23 . VAL A 1 77 ? 0.776   0.388   -2.332  1.00 0.55 ? 77  VAL A HG23 4  
ATOM   5259  N N    . LEU A 1 78 ? 0.600   -3.911  -3.525  1.00 0.21 ? 78  LEU A N    4  
ATOM   5260  C CA   . LEU A 1 78 ? 0.245   -5.303  -3.751  1.00 0.21 ? 78  LEU A CA   4  
ATOM   5261  C C    . LEU A 1 78 ? 1.200   -5.953  -4.743  1.00 0.20 ? 78  LEU A C    4  
ATOM   5262  O O    . LEU A 1 78 ? 1.665   -7.069  -4.526  1.00 0.22 ? 78  LEU A O    4  
ATOM   5263  C CB   . LEU A 1 78 ? -1.193  -5.395  -4.263  1.00 0.22 ? 78  LEU A CB   4  
ATOM   5264  C CG   . LEU A 1 78 ? -1.746  -6.815  -4.415  1.00 0.25 ? 78  LEU A CG   4  
ATOM   5265  C CD1  . LEU A 1 78 ? -1.830  -7.508  -3.062  1.00 0.35 ? 78  LEU A CD1  4  
ATOM   5266  C CD2  . LEU A 1 78 ? -3.114  -6.777  -5.079  1.00 0.34 ? 78  LEU A CD2  4  
ATOM   5267  H H    . LEU A 1 78 ? -0.069  -3.213  -3.714  1.00 0.20 ? 78  LEU A H    4  
ATOM   5268  H HA   . LEU A 1 78 ? 0.317   -5.822  -2.810  1.00 0.24 ? 78  LEU A HA   4  
ATOM   5269  H HB2  . LEU A 1 78 ? -1.830  -4.854  -3.579  1.00 0.26 ? 78  LEU A HB2  4  
ATOM   5270  H HB3  . LEU A 1 78 ? -1.239  -4.912  -5.228  1.00 0.23 ? 78  LEU A HB3  4  
ATOM   5271  H HG   . LEU A 1 78 ? -1.083  -7.389  -5.044  1.00 0.28 ? 78  LEU A HG   4  
ATOM   5272  H HD11 . LEU A 1 78 ? -0.836  -7.629  -2.658  1.00 0.67 ? 78  LEU A HD11 4  
ATOM   5273  H HD12 . LEU A 1 78 ? -2.287  -8.478  -3.183  1.00 0.70 ? 78  LEU A HD12 4  
ATOM   5274  H HD13 . LEU A 1 78 ? -2.423  -6.910  -2.386  1.00 0.68 ? 78  LEU A HD13 4  
ATOM   5275  H HD21 . LEU A 1 78 ? -3.019  -6.382  -6.080  1.00 0.67 ? 78  LEU A HD21 4  
ATOM   5276  H HD22 . LEU A 1 78 ? -3.776  -6.146  -4.505  1.00 0.68 ? 78  LEU A HD22 4  
ATOM   5277  H HD23 . LEU A 1 78 ? -3.519  -7.776  -5.122  1.00 0.71 ? 78  LEU A HD23 4  
ATOM   5278  N N    . GLY A 1 79 ? 1.508   -5.234  -5.816  1.00 0.20 ? 79  GLY A N    4  
ATOM   5279  C CA   . GLY A 1 79 ? 2.407   -5.751  -6.829  1.00 0.22 ? 79  GLY A CA   4  
ATOM   5280  C C    . GLY A 1 79 ? 3.816   -5.975  -6.311  1.00 0.21 ? 79  GLY A C    4  
ATOM   5281  O O    . GLY A 1 79 ? 4.531   -6.849  -6.804  1.00 0.27 ? 79  GLY A O    4  
ATOM   5282  H H    . GLY A 1 79 ? 1.115   -4.340  -5.925  1.00 0.20 ? 79  GLY A H    4  
ATOM   5283  H HA2  . GLY A 1 79 ? 2.017   -6.689  -7.197  1.00 0.24 ? 79  GLY A HA2  4  
ATOM   5284  H HA3  . GLY A 1 79 ? 2.447   -5.048  -7.645  1.00 0.24 ? 79  GLY A HA3  4  
ATOM   5285  N N    . ALA A 1 80 ? 4.219   -5.190  -5.320  1.00 0.19 ? 80  ALA A N    4  
ATOM   5286  C CA   . ALA A 1 80 ? 5.553   -5.315  -4.748  1.00 0.22 ? 80  ALA A CA   4  
ATOM   5287  C C    . ALA A 1 80 ? 5.585   -6.371  -3.647  1.00 0.21 ? 80  ALA A C    4  
ATOM   5288  O O    . ALA A 1 80 ? 6.457   -7.241  -3.635  1.00 0.25 ? 80  ALA A O    4  
ATOM   5289  C CB   . ALA A 1 80 ? 6.027   -3.972  -4.213  1.00 0.25 ? 80  ALA A CB   4  
ATOM   5290  H H    . ALA A 1 80 ? 3.604   -4.515  -4.962  1.00 0.21 ? 80  ALA A H    4  
ATOM   5291  H HA   . ALA A 1 80 ? 6.225   -5.618  -5.538  1.00 0.25 ? 80  ALA A HA   4  
ATOM   5292  H HB1  . ALA A 1 80 ? 5.365   -3.643  -3.426  1.00 0.41 ? 80  ALA A HB1  4  
ATOM   5293  H HB2  . ALA A 1 80 ? 6.023   -3.246  -5.012  1.00 0.39 ? 80  ALA A HB2  4  
ATOM   5294  H HB3  . ALA A 1 80 ? 7.030   -4.074  -3.824  1.00 0.43 ? 80  ALA A HB3  4  
ATOM   5295  N N    . LEU A 1 81 ? 4.622   -6.299  -2.736  1.00 0.21 ? 81  LEU A N    4  
ATOM   5296  C CA   . LEU A 1 81 ? 4.543   -7.241  -1.627  1.00 0.25 ? 81  LEU A CA   4  
ATOM   5297  C C    . LEU A 1 81 ? 4.300   -8.664  -2.118  1.00 0.22 ? 81  LEU A C    4  
ATOM   5298  O O    . LEU A 1 81 ? 4.886   -9.613  -1.596  1.00 0.23 ? 81  LEU A O    4  
ATOM   5299  C CB   . LEU A 1 81 ? 3.445   -6.826  -0.645  1.00 0.33 ? 81  LEU A CB   4  
ATOM   5300  C CG   . LEU A 1 81 ? 3.921   -5.999  0.555   1.00 0.50 ? 81  LEU A CG   4  
ATOM   5301  C CD1  . LEU A 1 81 ? 2.735   -5.496  1.365   1.00 0.60 ? 81  LEU A CD1  4  
ATOM   5302  C CD2  . LEU A 1 81 ? 4.850   -6.822  1.434   1.00 0.72 ? 81  LEU A CD2  4  
ATOM   5303  H H    . LEU A 1 81 ? 3.944   -5.589  -2.810  1.00 0.21 ? 81  LEU A H    4  
ATOM   5304  H HA   . LEU A 1 81 ? 5.492   -7.215  -1.115  1.00 0.30 ? 81  LEU A HA   4  
ATOM   5305  H HB2  . LEU A 1 81 ? 2.709   -6.248  -1.186  1.00 0.41 ? 81  LEU A HB2  4  
ATOM   5306  H HB3  . LEU A 1 81 ? 2.972   -7.721  -0.271  1.00 0.38 ? 81  LEU A HB3  4  
ATOM   5307  H HG   . LEU A 1 81 ? 4.469   -5.140  0.196   1.00 0.60 ? 81  LEU A HG   4  
ATOM   5308  H HD11 . LEU A 1 81 ? 2.140   -6.334  1.692   1.00 0.98 ? 81  LEU A HD11 4  
ATOM   5309  H HD12 . LEU A 1 81 ? 2.131   -4.843  0.753   1.00 0.95 ? 81  LEU A HD12 4  
ATOM   5310  H HD13 . LEU A 1 81 ? 3.095   -4.953  2.226   1.00 1.12 ? 81  LEU A HD13 4  
ATOM   5311  H HD21 . LEU A 1 81 ? 4.358   -7.743  1.713   1.00 1.02 ? 81  LEU A HD21 4  
ATOM   5312  H HD22 . LEU A 1 81 ? 5.093   -6.262  2.323   1.00 1.04 ? 81  LEU A HD22 4  
ATOM   5313  H HD23 . LEU A 1 81 ? 5.756   -7.046  0.891   1.00 1.02 ? 81  LEU A HD23 4  
ATOM   5314  N N    . LYS A 1 82 ? 3.447   -8.819  -3.128  1.00 0.22 ? 82  LYS A N    4  
ATOM   5315  C CA   . LYS A 1 82 ? 3.162   -10.140 -3.673  1.00 0.24 ? 82  LYS A CA   4  
ATOM   5316  C C    . LYS A 1 82 ? 4.416   -10.735 -4.288  1.00 0.24 ? 82  LYS A C    4  
ATOM   5317  O O    . LYS A 1 82 ? 4.732   -11.901 -4.063  1.00 0.29 ? 82  LYS A O    4  
ATOM   5318  C CB   . LYS A 1 82 ? 2.053   -10.073 -4.720  1.00 0.31 ? 82  LYS A CB   4  
ATOM   5319  C CG   . LYS A 1 82 ? 0.714   -10.580 -4.219  1.00 0.52 ? 82  LYS A CG   4  
ATOM   5320  C CD   . LYS A 1 82 ? -0.277  -10.735 -5.357  1.00 0.61 ? 82  LYS A CD   4  
ATOM   5321  C CE   . LYS A 1 82 ? -1.562  -11.399 -4.894  1.00 0.90 ? 82  LYS A CE   4  
ATOM   5322  N NZ   . LYS A 1 82 ? -2.433  -11.765 -6.040  1.00 1.19 ? 82  LYS A NZ   4  
ATOM   5323  H H    . LYS A 1 82 ? 2.999   -8.030  -3.509  1.00 0.23 ? 82  LYS A H    4  
ATOM   5324  H HA   . LYS A 1 82 ? 2.844   -10.771 -2.858  1.00 0.26 ? 82  LYS A HA   4  
ATOM   5325  H HB2  . LYS A 1 82 ? 1.931   -9.045  -5.029  1.00 0.53 ? 82  LYS A HB2  4  
ATOM   5326  H HB3  . LYS A 1 82 ? 2.343   -10.664 -5.575  1.00 0.51 ? 82  LYS A HB3  4  
ATOM   5327  H HG2  . LYS A 1 82 ? 0.857   -11.537 -3.745  1.00 0.82 ? 82  LYS A HG2  4  
ATOM   5328  H HG3  . LYS A 1 82 ? 0.318   -9.874  -3.501  1.00 0.81 ? 82  LYS A HG3  4  
ATOM   5329  H HD2  . LYS A 1 82 ? -0.510  -9.758  -5.753  1.00 0.84 ? 82  LYS A HD2  4  
ATOM   5330  H HD3  . LYS A 1 82 ? 0.171   -11.341 -6.132  1.00 0.84 ? 82  LYS A HD3  4  
ATOM   5331  H HE2  . LYS A 1 82 ? -1.314  -12.292 -4.341  1.00 1.22 ? 82  LYS A HE2  4  
ATOM   5332  H HE3  . LYS A 1 82 ? -2.095  -10.713 -4.251  1.00 1.21 ? 82  LYS A HE3  4  
ATOM   5333  H HZ1  . LYS A 1 82 ? -1.951  -12.450 -6.653  1.00 1.48 ? 82  LYS A HZ1  4  
ATOM   5334  H HZ2  . LYS A 1 82 ? -2.664  -10.921 -6.602  1.00 1.54 ? 82  LYS A HZ2  4  
ATOM   5335  H HZ3  . LYS A 1 82 ? -3.321  -12.190 -5.697  1.00 1.55 ? 82  LYS A HZ3  4  
ATOM   5336  N N    . ALA A 1 83 ? 5.138   -9.917  -5.045  1.00 0.24 ? 83  ALA A N    4  
ATOM   5337  C CA   . ALA A 1 83 ? 6.366   -10.354 -5.691  1.00 0.28 ? 83  ALA A CA   4  
ATOM   5338  C C    . ALA A 1 83 ? 7.403   -10.767 -4.654  1.00 0.28 ? 83  ALA A C    4  
ATOM   5339  O O    . ALA A 1 83 ? 8.115   -11.756 -4.828  1.00 0.34 ? 83  ALA A O    4  
ATOM   5340  C CB   . ALA A 1 83 ? 6.915   -9.255  -6.582  1.00 0.35 ? 83  ALA A CB   4  
ATOM   5341  H H    . ALA A 1 83 ? 4.835   -8.991  -5.172  1.00 0.25 ? 83  ALA A H    4  
ATOM   5342  H HA   . ALA A 1 83 ? 6.132   -11.207 -6.311  1.00 0.32 ? 83  ALA A HA   4  
ATOM   5343  H HB1  . ALA A 1 83 ? 7.133   -8.382  -5.983  1.00 0.48 ? 83  ALA A HB1  4  
ATOM   5344  H HB2  . ALA A 1 83 ? 6.184   -9.004  -7.334  1.00 0.53 ? 83  ALA A HB2  4  
ATOM   5345  H HB3  . ALA A 1 83 ? 7.819   -9.600  -7.060  1.00 0.54 ? 83  ALA A HB3  4  
ATOM   5346  N N    . ALA A 1 84 ? 7.469   -10.012 -3.566  1.00 0.26 ? 84  ALA A N    4  
ATOM   5347  C CA   . ALA A 1 84 ? 8.406   -10.296 -2.490  1.00 0.31 ? 84  ALA A CA   4  
ATOM   5348  C C    . ALA A 1 84 ? 8.031   -11.589 -1.770  1.00 0.32 ? 84  ALA A C    4  
ATOM   5349  O O    . ALA A 1 84 ? 8.873   -12.224 -1.134  1.00 0.45 ? 84  ALA A O    4  
ATOM   5350  C CB   . ALA A 1 84 ? 8.443   -9.137  -1.508  1.00 0.35 ? 84  ALA A CB   4  
ATOM   5351  H H    . ALA A 1 84 ? 6.874   -9.232  -3.487  1.00 0.26 ? 84  ALA A H    4  
ATOM   5352  H HA   . ALA A 1 84 ? 9.391   -10.406 -2.922  1.00 0.36 ? 84  ALA A HA   4  
ATOM   5353  H HB1  . ALA A 1 84 ? 9.203   -9.321  -0.764  1.00 0.55 ? 84  ALA A HB1  4  
ATOM   5354  H HB2  . ALA A 1 84 ? 7.482   -9.045  -1.026  1.00 0.50 ? 84  ALA A HB2  4  
ATOM   5355  H HB3  . ALA A 1 84 ? 8.670   -8.222  -2.036  1.00 0.52 ? 84  ALA A HB3  4  
ATOM   5356  N N    . ARG A 1 85 ? 6.763   -11.974 -1.875  1.00 0.29 ? 85  ARG A N    4  
ATOM   5357  C CA   . ARG A 1 85 ? 6.275   -13.190 -1.237  1.00 0.35 ? 85  ARG A CA   4  
ATOM   5358  C C    . ARG A 1 85 ? 6.299   -14.369 -2.205  1.00 0.35 ? 85  ARG A C    4  
ATOM   5359  O O    . ARG A 1 85 ? 5.917   -15.482 -1.847  1.00 0.48 ? 85  ARG A O    4  
ATOM   5360  C CB   . ARG A 1 85 ? 4.856   -12.991 -0.698  1.00 0.42 ? 85  ARG A CB   4  
ATOM   5361  C CG   . ARG A 1 85 ? 4.814   -12.448 0.722   1.00 0.54 ? 85  ARG A CG   4  
ATOM   5362  C CD   . ARG A 1 85 ? 3.499   -12.778 1.407   1.00 0.74 ? 85  ARG A CD   4  
ATOM   5363  N NE   . ARG A 1 85 ? 3.480   -12.359 2.811   1.00 0.66 ? 85  ARG A NE   4  
ATOM   5364  C CZ   . ARG A 1 85 ? 3.876   -13.129 3.829   1.00 0.66 ? 85  ARG A CZ   4  
ATOM   5365  N NH1  . ARG A 1 85 ? 4.322   -14.361 3.605   1.00 0.83 ? 85  ARG A NH1  4  
ATOM   5366  N NH2  . ARG A 1 85 ? 3.803   -12.678 5.074   1.00 0.79 ? 85  ARG A NH2  4  
ATOM   5367  H H    . ARG A 1 85 ? 6.138   -11.423 -2.394  1.00 0.31 ? 85  ARG A H    4  
ATOM   5368  H HA   . ARG A 1 85 ? 6.932   -13.407 -0.410  1.00 0.41 ? 85  ARG A HA   4  
ATOM   5369  H HB2  . ARG A 1 85 ? 4.333   -12.298 -1.340  1.00 0.47 ? 85  ARG A HB2  4  
ATOM   5370  H HB3  . ARG A 1 85 ? 4.339   -13.940 -0.713  1.00 0.49 ? 85  ARG A HB3  4  
ATOM   5371  H HG2  . ARG A 1 85 ? 5.623   -12.887 1.288   1.00 0.96 ? 85  ARG A HG2  4  
ATOM   5372  H HG3  . ARG A 1 85 ? 4.936   -11.376 0.689   1.00 1.03 ? 85  ARG A HG3  4  
ATOM   5373  H HD2  . ARG A 1 85 ? 2.699   -12.276 0.882   1.00 1.28 ? 85  ARG A HD2  4  
ATOM   5374  H HD3  . ARG A 1 85 ? 3.342   -13.847 1.360   1.00 1.22 ? 85  ARG A HD3  4  
ATOM   5375  H HE   . ARG A 1 85 ? 3.166   -11.445 3.002   1.00 0.81 ? 85  ARG A HE   4  
ATOM   5376  H HH11 . ARG A 1 85 ? 4.620   -14.939 4.372   1.00 1.01 ? 85  ARG A HH11 4  
ATOM   5377  H HH12 . ARG A 1 85 ? 4.371   -14.722 2.669   1.00 0.90 ? 85  ARG A HH12 4  
ATOM   5378  H HH21 . ARG A 1 85 ? 3.453   -11.752 5.258   1.00 0.90 ? 85  ARG A HH21 4  
ATOM   5379  H HH22 . ARG A 1 85 ? 4.096   -13.260 5.842   1.00 0.92 ? 85  ARG A HH22 4  
ATOM   5380  N N    . GLU A 1 86 ? 6.730   -14.120 -3.435  1.00 0.35 ? 86  GLU A N    4  
ATOM   5381  C CA   . GLU A 1 86 ? 6.808   -15.175 -4.442  1.00 0.40 ? 86  GLU A CA   4  
ATOM   5382  C C    . GLU A 1 86 ? 8.111   -15.945 -4.292  1.00 0.43 ? 86  GLU A C    4  
ATOM   5383  O O    . GLU A 1 86 ? 8.178   -17.138 -4.580  1.00 0.65 ? 86  GLU A O    4  
ATOM   5384  C CB   . GLU A 1 86 ? 6.708   -14.600 -5.858  1.00 0.50 ? 86  GLU A CB   4  
ATOM   5385  C CG   . GLU A 1 86 ? 5.341   -14.029 -6.199  1.00 0.68 ? 86  GLU A CG   4  
ATOM   5386  C CD   . GLU A 1 86 ? 4.211   -15.012 -5.959  1.00 0.87 ? 86  GLU A CD   4  
ATOM   5387  O OE1  . GLU A 1 86 ? 4.398   -16.222 -6.216  1.00 1.32 ? 86  GLU A OE1  4  
ATOM   5388  O OE2  . GLU A 1 86 ? 3.121   -14.578 -5.526  1.00 1.25 ? 86  GLU A OE2  4  
ATOM   5389  H H    . GLU A 1 86 ? 7.002   -13.208 -3.673  1.00 0.42 ? 86  GLU A H    4  
ATOM   5390  H HA   . GLU A 1 86 ? 5.985   -15.853 -4.276  1.00 0.47 ? 86  GLU A HA   4  
ATOM   5391  H HB2  . GLU A 1 86 ? 7.440   -13.813 -5.962  1.00 0.63 ? 86  GLU A HB2  4  
ATOM   5392  H HB3  . GLU A 1 86 ? 6.934   -15.381 -6.569  1.00 0.63 ? 86  GLU A HB3  4  
ATOM   5393  H HG2  . GLU A 1 86 ? 5.169   -13.154 -5.589  1.00 0.90 ? 86  GLU A HG2  4  
ATOM   5394  H HG3  . GLU A 1 86 ? 5.335   -13.746 -7.241  1.00 0.93 ? 86  GLU A HG3  4  
ATOM   5395  N N    . GLU A 1 87 ? 9.140   -15.253 -3.834  1.00 0.47 ? 87  GLU A N    4  
ATOM   5396  C CA   . GLU A 1 87 ? 10.444  -15.860 -3.641  1.00 0.58 ? 87  GLU A CA   4  
ATOM   5397  C C    . GLU A 1 87 ? 10.565  -16.441 -2.239  1.00 0.68 ? 87  GLU A C    4  
ATOM   5398  O O    . GLU A 1 87 ? 10.977  -17.617 -2.117  1.00 1.13 ? 87  GLU A O    4  
ATOM   5399  C CB   . GLU A 1 87 ? 11.548  -14.835 -3.880  1.00 0.77 ? 87  GLU A CB   4  
ATOM   5400  C CG   . GLU A 1 87 ? 11.785  -14.529 -5.347  1.00 1.10 ? 87  GLU A CG   4  
ATOM   5401  C CD   . GLU A 1 87 ? 13.014  -13.675 -5.559  1.00 1.15 ? 87  GLU A CD   4  
ATOM   5402  O OE1  . GLU A 1 87 ? 14.135  -14.171 -5.315  1.00 1.51 ? 87  GLU A OE1  4  
ATOM   5403  O OE2  . GLU A 1 87 ? 12.867  -12.503 -5.968  1.00 1.44 ? 87  GLU A OE2  4  
ATOM   5404  O OXT  . GLU A 1 87 ? 10.233  -15.727 -1.268  1.00 1.02 ? 87  GLU A OXT  4  
ATOM   5405  H H    . GLU A 1 87 ? 9.017   -14.310 -3.612  1.00 0.60 ? 87  GLU A H    4  
ATOM   5406  H HA   . GLU A 1 87 ? 10.547  -16.659 -4.359  1.00 0.71 ? 87  GLU A HA   4  
ATOM   5407  H HB2  . GLU A 1 87 ? 11.280  -13.917 -3.383  1.00 1.08 ? 87  GLU A HB2  4  
ATOM   5408  H HB3  . GLU A 1 87 ? 12.467  -15.207 -3.458  1.00 1.00 ? 87  GLU A HB3  4  
ATOM   5409  H HG2  . GLU A 1 87 ? 11.909  -15.458 -5.882  1.00 1.52 ? 87  GLU A HG2  4  
ATOM   5410  H HG3  . GLU A 1 87 ? 10.927  -14.002 -5.735  1.00 1.59 ? 87  GLU A HG3  4  
HETATM 5411  C C1   . IHP B 2 .  ? 13.748  9.308   1.444   1.00 0.87 ? 101 IHP A C1   4  
HETATM 5412  C C2   . IHP B 2 .  ? 12.568  10.043  2.085   1.00 0.83 ? 101 IHP A C2   4  
HETATM 5413  C C3   . IHP B 2 .  ? 12.020  11.081  1.103   1.00 0.67 ? 101 IHP A C3   4  
HETATM 5414  C C4   . IHP B 2 .  ? 11.552  10.379  -0.174  1.00 0.52 ? 101 IHP A C4   4  
HETATM 5415  C C5   . IHP B 2 .  ? 12.733  9.647   -0.814  1.00 0.61 ? 101 IHP A C5   4  
HETATM 5416  C C6   . IHP B 2 .  ? 13.282  8.607   0.167   1.00 0.77 ? 101 IHP A C6   4  
HETATM 5417  O O11  . IHP B 2 .  ? 14.259  8.338   2.359   1.00 1.21 ? 101 IHP A O11  4  
HETATM 5418  P P1   . IHP B 2 .  ? 15.774  8.363   2.906   1.00 1.54 ? 101 IHP A P1   4  
HETATM 5419  O O21  . IHP B 2 .  ? 16.059  9.680   3.515   1.00 1.58 ? 101 IHP A O21  4  
HETATM 5420  O O31  . IHP B 2 .  ? 15.962  7.207   4.012   1.00 1.93 ? 101 IHP A O31  4  
HETATM 5421  O O41  . IHP B 2 .  ? 16.789  8.104   1.682   1.00 1.56 ? 101 IHP A O41  4  
HETATM 5422  O O12  . IHP B 2 .  ? 11.541  9.102   2.406   1.00 0.85 ? 101 IHP A O12  4  
HETATM 5423  P P2   . IHP B 2 .  ? 11.006  8.868   3.904   1.00 1.21 ? 101 IHP A P2   4  
HETATM 5424  O O22  . IHP B 2 .  ? 10.563  10.157  4.479   1.00 1.39 ? 101 IHP A O22  4  
HETATM 5425  O O32  . IHP B 2 .  ? 9.766   7.840   3.879   1.00 1.20 ? 101 IHP A O32  4  
HETATM 5426  O O42  . IHP B 2 .  ? 12.188  8.257   4.809   1.00 1.55 ? 101 IHP A O42  4  
HETATM 5427  O O13  . IHP B 2 .  ? 10.917  11.766  1.701   1.00 0.90 ? 101 IHP A O13  4  
HETATM 5428  P P3   . IHP B 2 .  ? 10.901  13.356  1.946   1.00 1.24 ? 101 IHP A P3   4  
HETATM 5429  O O23  . IHP B 2 .  ? 12.094  13.746  2.733   1.00 1.39 ? 101 IHP A O23  4  
HETATM 5430  O O33  . IHP B 2 .  ? 10.923  14.119  0.528   1.00 1.27 ? 101 IHP A O33  4  
HETATM 5431  O O43  . IHP B 2 .  ? 9.569   13.763  2.752   1.00 1.57 ? 101 IHP A O43  4  
HETATM 5432  O O14  . IHP B 2 .  ? 11.040  11.350  -1.091  1.00 0.74 ? 101 IHP A O14  4  
HETATM 5433  P P4   . IHP B 2 .  ? 9.526   11.327  -1.636  1.00 1.00 ? 101 IHP A P4   4  
HETATM 5434  O O24  . IHP B 2 .  ? 9.261   12.633  -2.538  1.00 1.39 ? 101 IHP A O24  4  
HETATM 5435  O O34  . IHP B 2 .  ? 9.295   10.004  -2.525  1.00 1.09 ? 101 IHP A O34  4  
HETATM 5436  O O44  . IHP B 2 .  ? 8.589   11.320  -0.491  1.00 1.01 ? 101 IHP A O44  4  
HETATM 5437  O O15  . IHP B 2 .  ? 12.297  8.992   -2.006  1.00 0.86 ? 101 IHP A O15  4  
HETATM 5438  P P5   . IHP B 2 .  ? 12.912  9.314   -3.459  1.00 1.20 ? 101 IHP A P5   4  
HETATM 5439  O O25  . IHP B 2 .  ? 14.381  9.142   -3.421  1.00 1.28 ? 101 IHP A O25  4  
HETATM 5440  O O35  . IHP B 2 .  ? 12.283  8.303   -4.544  1.00 1.56 ? 101 IHP A O35  4  
HETATM 5441  O O45  . IHP B 2 .  ? 12.559  10.830  -3.869  1.00 1.25 ? 101 IHP A O45  4  
HETATM 5442  O O16  . IHP B 2 .  ? 14.382  7.923   -0.431  1.00 1.06 ? 101 IHP A O16  4  
HETATM 5443  P P6   . IHP B 2 .  ? 14.397  6.331   -0.676  1.00 1.40 ? 101 IHP A P6   4  
HETATM 5444  O O26  . IHP B 2 .  ? 13.208  5.941   -1.464  1.00 1.39 ? 101 IHP A O26  4  
HETATM 5445  O O36  . IHP B 2 .  ? 15.732  5.926   -1.483  1.00 1.74 ? 101 IHP A O36  4  
HETATM 5446  O O46  . IHP B 2 .  ? 14.376  5.571   0.742   1.00 1.56 ? 101 IHP A O46  4  
HETATM 5447  H H1   . IHP B 2 .  ? 14.536  10.027  1.199   1.00 0.89 ? 101 IHP A H1   4  
HETATM 5448  H H2   . IHP B 2 .  ? 12.895  10.537  2.993   1.00 1.08 ? 101 IHP A H2   4  
HETATM 5449  H H3   . IHP B 2 .  ? 12.811  11.799  0.875   1.00 0.73 ? 101 IHP A H3   4  
HETATM 5450  H H4   . IHP B 2 .  ? 10.753  9.676   0.094   1.00 0.51 ? 101 IHP A H4   4  
HETATM 5451  H H5   . IHP B 2 .  ? 13.507  10.377  -1.067  1.00 0.66 ? 101 IHP A H5   4  
HETATM 5452  H H6   . IHP B 2 .  ? 12.498  7.882   0.410   1.00 0.80 ? 101 IHP A H6   4  
ATOM   5453  N N    . SER A 1 1  ? 4.182   4.320   10.677  1.00 1.45 ? 1   SER A N    5  
ATOM   5454  C CA   . SER A 1 1  ? 4.664   5.515   11.398  1.00 0.98 ? 1   SER A CA   5  
ATOM   5455  C C    . SER A 1 1  ? 5.938   6.073   10.765  1.00 0.92 ? 1   SER A C    5  
ATOM   5456  O O    . SER A 1 1  ? 5.940   7.195   10.268  1.00 1.21 ? 1   SER A O    5  
ATOM   5457  C CB   . SER A 1 1  ? 4.904   5.168   12.863  1.00 1.66 ? 1   SER A CB   5  
ATOM   5458  O OG   . SER A 1 1  ? 3.861   4.345   13.361  1.00 2.07 ? 1   SER A OG   5  
ATOM   5459  H H1   . SER A 1 1  ? 3.904   4.575   9.707   1.00 1.90 ? 1   SER A H1   5  
ATOM   5460  H H2   . SER A 1 1  ? 3.355   3.923   11.167  1.00 1.69 ? 1   SER A H2   5  
ATOM   5461  H H3   . SER A 1 1  ? 4.926   3.599   10.638  1.00 1.94 ? 1   SER A H3   5  
ATOM   5462  H HA   . SER A 1 1  ? 3.895   6.272   11.341  1.00 1.33 ? 1   SER A HA   5  
ATOM   5463  H HB2  . SER A 1 1  ? 5.840   4.641   12.960  1.00 2.07 ? 1   SER A HB2  5  
ATOM   5464  H HB3  . SER A 1 1  ? 4.941   6.076   13.445  1.00 2.12 ? 1   SER A HB3  5  
ATOM   5465  H HG   . SER A 1 1  ? 4.210   3.768   14.054  1.00 2.51 ? 1   SER A HG   5  
ATOM   5466  N N    . GLU A 1 2  ? 7.021   5.295   10.777  1.00 0.80 ? 2   GLU A N    5  
ATOM   5467  C CA   . GLU A 1 2  ? 8.283   5.755   10.202  1.00 0.85 ? 2   GLU A CA   5  
ATOM   5468  C C    . GLU A 1 2  ? 9.086   4.604   9.592   1.00 0.72 ? 2   GLU A C    5  
ATOM   5469  O O    . GLU A 1 2  ? 9.203   4.511   8.371   1.00 0.72 ? 2   GLU A O    5  
ATOM   5470  C CB   . GLU A 1 2  ? 9.113   6.491   11.259  1.00 1.13 ? 2   GLU A CB   5  
ATOM   5471  C CG   . GLU A 1 2  ? 8.907   5.974   12.671  1.00 1.33 ? 2   GLU A CG   5  
ATOM   5472  C CD   . GLU A 1 2  ? 9.622   6.814   13.703  1.00 1.48 ? 2   GLU A CD   5  
ATOM   5473  O OE1  . GLU A 1 2  ? 10.835  7.058   13.536  1.00 1.99 ? 2   GLU A OE1  5  
ATOM   5474  O OE2  . GLU A 1 2  ? 8.977   7.222   14.692  1.00 1.97 ? 2   GLU A OE2  5  
ATOM   5475  H H    . GLU A 1 2  ? 6.974   4.405   11.185  1.00 0.89 ? 2   GLU A H    5  
ATOM   5476  H HA   . GLU A 1 2  ? 8.040   6.452   9.414   1.00 0.92 ? 2   GLU A HA   5  
ATOM   5477  H HB2  . GLU A 1 2  ? 10.159  6.388   11.014  1.00 1.41 ? 2   GLU A HB2  5  
ATOM   5478  H HB3  . GLU A 1 2  ? 8.851   7.540   11.243  1.00 1.30 ? 2   GLU A HB3  5  
ATOM   5479  H HG2  . GLU A 1 2  ? 7.848   5.979   12.894  1.00 1.76 ? 2   GLU A HG2  5  
ATOM   5480  H HG3  . GLU A 1 2  ? 9.280   4.964   12.731  1.00 1.92 ? 2   GLU A HG3  5  
ATOM   5481  N N    . ALA A 1 3  ? 9.620   3.723   10.440  1.00 0.74 ? 3   ALA A N    5  
ATOM   5482  C CA   . ALA A 1 3  ? 10.426  2.591   9.976   1.00 0.73 ? 3   ALA A CA   5  
ATOM   5483  C C    . ALA A 1 3  ? 9.675   1.740   8.955   1.00 0.59 ? 3   ALA A C    5  
ATOM   5484  O O    . ALA A 1 3  ? 10.216  1.398   7.902   1.00 0.57 ? 3   ALA A O    5  
ATOM   5485  C CB   . ALA A 1 3  ? 10.865  1.735   11.154  1.00 0.89 ? 3   ALA A CB   5  
ATOM   5486  H H    . ALA A 1 3  ? 9.485   3.842   11.402  1.00 0.83 ? 3   ALA A H    5  
ATOM   5487  H HA   . ALA A 1 3  ? 11.312  2.989   9.506   1.00 0.80 ? 3   ALA A HA   5  
ATOM   5488  H HB1  . ALA A 1 3  ? 11.337  2.359   11.898  1.00 1.15 ? 3   ALA A HB1  5  
ATOM   5489  H HB2  . ALA A 1 3  ? 11.565  0.986   10.817  1.00 1.06 ? 3   ALA A HB2  5  
ATOM   5490  H HB3  . ALA A 1 3  ? 10.003  1.250   11.586  1.00 0.95 ? 3   ALA A HB3  5  
ATOM   5491  N N    . VAL A 1 4  ? 8.424   1.417   9.267   1.00 0.56 ? 4   VAL A N    5  
ATOM   5492  C CA   . VAL A 1 4  ? 7.593   0.609   8.379   1.00 0.50 ? 4   VAL A CA   5  
ATOM   5493  C C    . VAL A 1 4  ? 7.488   1.251   6.993   1.00 0.45 ? 4   VAL A C    5  
ATOM   5494  O O    . VAL A 1 4  ? 7.568   0.564   5.973   1.00 0.48 ? 4   VAL A O    5  
ATOM   5495  C CB   . VAL A 1 4  ? 6.177   0.405   8.965   1.00 0.57 ? 4   VAL A CB   5  
ATOM   5496  C CG1  . VAL A 1 4  ? 5.283   -0.327  7.978   1.00 0.82 ? 4   VAL A CG1  5  
ATOM   5497  C CG2  . VAL A 1 4  ? 6.249   -0.362  10.276  1.00 0.79 ? 4   VAL A CG2  5  
ATOM   5498  H H    . VAL A 1 4  ? 8.051   1.726   10.116  1.00 0.63 ? 4   VAL A H    5  
ATOM   5499  H HA   . VAL A 1 4  ? 8.060   -0.360  8.280   1.00 0.54 ? 4   VAL A HA   5  
ATOM   5500  H HB   . VAL A 1 4  ? 5.746   1.374   9.163   1.00 0.63 ? 4   VAL A HB   5  
ATOM   5501  H HG11 . VAL A 1 4  ? 5.250   0.221   7.047   1.00 1.06 ? 4   VAL A HG11 5  
ATOM   5502  H HG12 . VAL A 1 4  ? 4.285   -0.409  8.384   1.00 0.99 ? 4   VAL A HG12 5  
ATOM   5503  H HG13 . VAL A 1 4  ? 5.681   -1.315  7.798   1.00 1.13 ? 4   VAL A HG13 5  
ATOM   5504  H HG21 . VAL A 1 4  ? 5.276   -0.366  10.746  1.00 1.11 ? 4   VAL A HG21 5  
ATOM   5505  H HG22 . VAL A 1 4  ? 6.965   0.108   10.932  1.00 1.16 ? 4   VAL A HG22 5  
ATOM   5506  H HG23 . VAL A 1 4  ? 6.554   -1.379  10.079  1.00 1.27 ? 4   VAL A HG23 5  
ATOM   5507  N N    . ILE A 1 5  ? 7.338   2.574   6.965   1.00 0.48 ? 5   ILE A N    5  
ATOM   5508  C CA   . ILE A 1 5  ? 7.229   3.308   5.706   1.00 0.51 ? 5   ILE A CA   5  
ATOM   5509  C C    . ILE A 1 5  ? 8.488   3.124   4.868   1.00 0.46 ? 5   ILE A C    5  
ATOM   5510  O O    . ILE A 1 5  ? 8.415   2.802   3.682   1.00 0.47 ? 5   ILE A O    5  
ATOM   5511  C CB   . ILE A 1 5  ? 6.998   4.820   5.939   1.00 0.65 ? 5   ILE A CB   5  
ATOM   5512  C CG1  . ILE A 1 5  ? 5.756   5.047   6.803   1.00 0.81 ? 5   ILE A CG1  5  
ATOM   5513  C CG2  . ILE A 1 5  ? 6.866   5.552   4.606   1.00 0.81 ? 5   ILE A CG2  5  
ATOM   5514  C CD1  . ILE A 1 5  ? 5.471   6.507   7.083   1.00 0.98 ? 5   ILE A CD1  5  
ATOM   5515  H H    . ILE A 1 5  ? 7.312   3.068   7.808   1.00 0.54 ? 5   ILE A H    5  
ATOM   5516  H HA   . ILE A 1 5  ? 6.382   2.914   5.159   1.00 0.55 ? 5   ILE A HA   5  
ATOM   5517  H HB   . ILE A 1 5  ? 7.861   5.217   6.452   1.00 0.71 ? 5   ILE A HB   5  
ATOM   5518  H HG12 . ILE A 1 5  ? 4.895   4.633   6.303   1.00 0.91 ? 5   ILE A HG12 5  
ATOM   5519  H HG13 . ILE A 1 5  ? 5.891   4.548   7.753   1.00 0.85 ? 5   ILE A HG13 5  
ATOM   5520  H HG21 . ILE A 1 5  ? 6.024   5.152   4.060   1.00 1.02 ? 5   ILE A HG21 5  
ATOM   5521  H HG22 . ILE A 1 5  ? 7.769   5.417   4.028   1.00 1.00 ? 5   ILE A HG22 5  
ATOM   5522  H HG23 . ILE A 1 5  ? 6.709   6.604   4.789   1.00 1.04 ? 5   ILE A HG23 5  
ATOM   5523  H HD11 . ILE A 1 5  ? 5.289   7.023   6.152   1.00 1.27 ? 5   ILE A HD11 5  
ATOM   5524  H HD12 . ILE A 1 5  ? 6.321   6.950   7.579   1.00 1.29 ? 5   ILE A HD12 5  
ATOM   5525  H HD13 . ILE A 1 5  ? 4.602   6.591   7.717   1.00 1.30 ? 5   ILE A HD13 5  
ATOM   5526  N N    . LYS A 1 6  ? 9.637   3.309   5.503   1.00 0.49 ? 6   LYS A N    5  
ATOM   5527  C CA   . LYS A 1 6  ? 10.921  3.179   4.826   1.00 0.50 ? 6   LYS A CA   5  
ATOM   5528  C C    . LYS A 1 6  ? 11.115  1.769   4.287   1.00 0.46 ? 6   LYS A C    5  
ATOM   5529  O O    . LYS A 1 6  ? 11.543  1.589   3.147   1.00 0.47 ? 6   LYS A O    5  
ATOM   5530  C CB   . LYS A 1 6  ? 12.070  3.540   5.768   1.00 0.61 ? 6   LYS A CB   5  
ATOM   5531  C CG   . LYS A 1 6  ? 11.985  4.952   6.330   1.00 0.85 ? 6   LYS A CG   5  
ATOM   5532  C CD   . LYS A 1 6  ? 11.828  5.997   5.230   1.00 1.11 ? 6   LYS A CD   5  
ATOM   5533  C CE   . LYS A 1 6  ? 13.000  5.979   4.258   1.00 1.11 ? 6   LYS A CE   5  
ATOM   5534  N NZ   . LYS A 1 6  ? 12.935  7.098   3.285   1.00 1.12 ? 6   LYS A NZ   5  
ATOM   5535  H H    . LYS A 1 6  ? 9.622   3.542   6.457   1.00 0.53 ? 6   LYS A H    5  
ATOM   5536  H HA   . LYS A 1 6  ? 10.925  3.867   3.993   1.00 0.52 ? 6   LYS A HA   5  
ATOM   5537  H HB2  . LYS A 1 6  ? 12.074  2.847   6.598   1.00 0.84 ? 6   LYS A HB2  5  
ATOM   5538  H HB3  . LYS A 1 6  ? 13.003  3.446   5.232   1.00 0.80 ? 6   LYS A HB3  5  
ATOM   5539  H HG2  . LYS A 1 6  ? 11.134  5.012   6.993   1.00 1.25 ? 6   LYS A HG2  5  
ATOM   5540  H HG3  . LYS A 1 6  ? 12.888  5.159   6.886   1.00 1.02 ? 6   LYS A HG3  5  
ATOM   5541  H HD2  . LYS A 1 6  ? 10.919  5.800   4.683   1.00 1.57 ? 6   LYS A HD2  5  
ATOM   5542  H HD3  . LYS A 1 6  ? 11.767  6.974   5.688   1.00 1.65 ? 6   LYS A HD3  5  
ATOM   5543  H HE2  . LYS A 1 6  ? 13.917  6.056   4.821   1.00 1.38 ? 6   LYS A HE2  5  
ATOM   5544  H HE3  . LYS A 1 6  ? 12.990  5.044   3.717   1.00 1.51 ? 6   LYS A HE3  5  
ATOM   5545  H HZ1  . LYS A 1 6  ? 13.778  7.094   2.675   1.00 1.52 ? 6   LYS A HZ1  5  
ATOM   5546  H HZ2  . LYS A 1 6  ? 12.893  8.007   3.786   1.00 1.47 ? 6   LYS A HZ2  5  
ATOM   5547  H HZ3  . LYS A 1 6  ? 12.091  7.008   2.689   1.00 1.48 ? 6   LYS A HZ3  5  
ATOM   5548  N N    . VAL A 1 7  ? 10.788  0.772   5.105   1.00 0.46 ? 7   VAL A N    5  
ATOM   5549  C CA   . VAL A 1 7  ? 10.927  -0.623  4.699   1.00 0.48 ? 7   VAL A CA   5  
ATOM   5550  C C    . VAL A 1 7  ? 10.092  -0.902  3.453   1.00 0.44 ? 7   VAL A C    5  
ATOM   5551  O O    . VAL A 1 7  ? 10.577  -1.506  2.497   1.00 0.54 ? 7   VAL A O    5  
ATOM   5552  C CB   . VAL A 1 7  ? 10.516  -1.602  5.823   1.00 0.54 ? 7   VAL A CB   5  
ATOM   5553  C CG1  . VAL A 1 7  ? 10.618  -3.046  5.349   1.00 0.60 ? 7   VAL A CG1  5  
ATOM   5554  C CG2  . VAL A 1 7  ? 11.378  -1.396  7.059   1.00 0.61 ? 7   VAL A CG2  5  
ATOM   5555  H H    . VAL A 1 7  ? 10.455  0.981   6.007   1.00 0.48 ? 7   VAL A H    5  
ATOM   5556  H HA   . VAL A 1 7  ? 11.969  -0.795  4.463   1.00 0.53 ? 7   VAL A HA   5  
ATOM   5557  H HB   . VAL A 1 7  ? 9.489   -1.404  6.091   1.00 0.55 ? 7   VAL A HB   5  
ATOM   5558  H HG11 . VAL A 1 7  ? 11.635  -3.261  5.059   1.00 0.73 ? 7   VAL A HG11 5  
ATOM   5559  H HG12 . VAL A 1 7  ? 9.964   -3.196  4.504   1.00 0.72 ? 7   VAL A HG12 5  
ATOM   5560  H HG13 . VAL A 1 7  ? 10.327  -3.709  6.150   1.00 0.79 ? 7   VAL A HG13 5  
ATOM   5561  H HG21 . VAL A 1 7  ? 11.251  -0.385  7.423   1.00 0.75 ? 7   VAL A HG21 5  
ATOM   5562  H HG22 . VAL A 1 7  ? 12.417  -1.559  6.805   1.00 0.79 ? 7   VAL A HG22 5  
ATOM   5563  H HG23 . VAL A 1 7  ? 11.081  -2.097  7.826   1.00 0.78 ? 7   VAL A HG23 5  
ATOM   5564  N N    . ILE A 1 8  ? 8.846   -0.444  3.467   1.00 0.38 ? 8   ILE A N    5  
ATOM   5565  C CA   . ILE A 1 8  ? 7.944   -0.637  2.340   1.00 0.40 ? 8   ILE A CA   5  
ATOM   5566  C C    . ILE A 1 8  ? 8.443   0.116   1.106   1.00 0.37 ? 8   ILE A C    5  
ATOM   5567  O O    . ILE A 1 8  ? 8.512   -0.450  0.012   1.00 0.40 ? 8   ILE A O    5  
ATOM   5568  C CB   . ILE A 1 8  ? 6.508   -0.180  2.689   1.00 0.47 ? 8   ILE A CB   5  
ATOM   5569  C CG1  . ILE A 1 8  ? 5.915   -1.072  3.789   1.00 0.52 ? 8   ILE A CG1  5  
ATOM   5570  C CG2  . ILE A 1 8  ? 5.614   -0.192  1.456   1.00 0.56 ? 8   ILE A CG2  5  
ATOM   5571  C CD1  . ILE A 1 8  ? 5.849   -2.544  3.424   1.00 0.61 ? 8   ILE A CD1  5  
ATOM   5572  H H    . ILE A 1 8  ? 8.521   0.034   4.262   1.00 0.39 ? 8   ILE A H    5  
ATOM   5573  H HA   . ILE A 1 8  ? 7.917   -1.693  2.115   1.00 0.44 ? 8   ILE A HA   5  
ATOM   5574  H HB   . ILE A 1 8  ? 6.560   0.836   3.052   1.00 0.50 ? 8   ILE A HB   5  
ATOM   5575  H HG12 . ILE A 1 8  ? 6.517   -0.979  4.684   1.00 0.53 ? 8   ILE A HG12 5  
ATOM   5576  H HG13 . ILE A 1 8  ? 4.910   -0.741  4.005   1.00 0.59 ? 8   ILE A HG13 5  
ATOM   5577  H HG21 . ILE A 1 8  ? 4.617   0.127   1.730   1.00 0.96 ? 8   ILE A HG21 5  
ATOM   5578  H HG22 . ILE A 1 8  ? 5.571   -1.192  1.055   1.00 1.01 ? 8   ILE A HG22 5  
ATOM   5579  H HG23 . ILE A 1 8  ? 6.016   0.478   0.711   1.00 1.00 ? 8   ILE A HG23 5  
ATOM   5580  H HD11 . ILE A 1 8  ? 6.846   -2.962  3.428   1.00 0.96 ? 8   ILE A HD11 5  
ATOM   5581  H HD12 . ILE A 1 8  ? 5.420   -2.650  2.438   1.00 0.94 ? 8   ILE A HD12 5  
ATOM   5582  H HD13 . ILE A 1 8  ? 5.235   -3.066  4.143   1.00 0.97 ? 8   ILE A HD13 5  
ATOM   5583  N N    . SER A 1 9  ? 8.814   1.378   1.301   1.00 0.37 ? 9   SER A N    5  
ATOM   5584  C CA   . SER A 1 9  ? 9.303   2.222   0.218   1.00 0.41 ? 9   SER A CA   5  
ATOM   5585  C C    . SER A 1 9  ? 10.549  1.614   -0.428  1.00 0.40 ? 9   SER A C    5  
ATOM   5586  O O    . SER A 1 9  ? 10.620  1.466   -1.647  1.00 0.46 ? 9   SER A O    5  
ATOM   5587  C CB   . SER A 1 9  ? 9.608   3.627   0.751   1.00 0.49 ? 9   SER A CB   5  
ATOM   5588  O OG   . SER A 1 9  ? 9.790   4.560   -0.300  1.00 1.22 ? 9   SER A OG   5  
ATOM   5589  H H    . SER A 1 9  ? 8.756   1.759   2.207   1.00 0.39 ? 9   SER A H    5  
ATOM   5590  H HA   . SER A 1 9  ? 8.523   2.293   -0.526  1.00 0.45 ? 9   SER A HA   5  
ATOM   5591  H HB2  . SER A 1 9  ? 8.786   3.961   1.367   1.00 1.05 ? 9   SER A HB2  5  
ATOM   5592  H HB3  . SER A 1 9  ? 10.509  3.590   1.347   1.00 1.19 ? 9   SER A HB3  5  
ATOM   5593  H HG   . SER A 1 9  ? 9.791   5.451   0.065   1.00 1.36 ? 9   SER A HG   5  
ATOM   5594  N N    . SER A 1 10 ? 11.522  1.235   0.390   1.00 0.39 ? 10  SER A N    5  
ATOM   5595  C CA   . SER A 1 10 ? 12.752  0.651   -0.119  1.00 0.43 ? 10  SER A CA   5  
ATOM   5596  C C    . SER A 1 10 ? 12.489  -0.715  -0.765  1.00 0.42 ? 10  SER A C    5  
ATOM   5597  O O    . SER A 1 10 ? 13.225  -1.140  -1.651  1.00 0.56 ? 10  SER A O    5  
ATOM   5598  C CB   . SER A 1 10 ? 13.782  0.530   1.007   1.00 0.52 ? 10  SER A CB   5  
ATOM   5599  O OG   . SER A 1 10 ? 14.104  1.806   1.543   1.00 1.17 ? 10  SER A OG   5  
ATOM   5600  H H    . SER A 1 10 ? 11.414  1.358   1.361   1.00 0.41 ? 10  SER A H    5  
ATOM   5601  H HA   . SER A 1 10 ? 13.139  1.318   -0.874  1.00 0.47 ? 10  SER A HA   5  
ATOM   5602  H HB2  . SER A 1 10 ? 13.377  -0.084  1.795   1.00 0.93 ? 10  SER A HB2  5  
ATOM   5603  H HB3  . SER A 1 10 ? 14.682  0.075   0.621   1.00 1.00 ? 10  SER A HB3  5  
ATOM   5604  H HG   . SER A 1 10 ? 13.498  2.469   1.180   1.00 1.54 ? 10  SER A HG   5  
ATOM   5605  N N    . ALA A 1 11 ? 11.424  -1.386  -0.339  1.00 0.37 ? 11  ALA A N    5  
ATOM   5606  C CA   . ALA A 1 11 ? 11.081  -2.695  -0.881  1.00 0.41 ? 11  ALA A CA   5  
ATOM   5607  C C    . ALA A 1 11 ? 10.488  -2.583  -2.282  1.00 0.37 ? 11  ALA A C    5  
ATOM   5608  O O    . ALA A 1 11 ? 10.969  -3.224  -3.217  1.00 0.42 ? 11  ALA A O    5  
ATOM   5609  C CB   . ALA A 1 11 ? 10.115  -3.419  0.045   1.00 0.47 ? 11  ALA A CB   5  
ATOM   5610  H H    . ALA A 1 11 ? 10.854  -0.992  0.357   1.00 0.41 ? 11  ALA A H    5  
ATOM   5611  H HA   . ALA A 1 11 ? 11.988  -3.278  -0.935  1.00 0.47 ? 11  ALA A HA   5  
ATOM   5612  H HB1  . ALA A 1 11 ? 9.208   -2.841  0.145   1.00 0.52 ? 11  ALA A HB1  5  
ATOM   5613  H HB2  . ALA A 1 11 ? 10.573  -3.543  1.015   1.00 0.58 ? 11  ALA A HB2  5  
ATOM   5614  H HB3  . ALA A 1 11 ? 9.880   -4.387  -0.369  1.00 0.58 ? 11  ALA A HB3  5  
ATOM   5615  N N    . CYS A 1 12 ? 9.462   -1.751  -2.433  1.00 0.34 ? 12  CYS A N    5  
ATOM   5616  C CA   . CYS A 1 12 ? 8.805   -1.588  -3.724  1.00 0.37 ? 12  CYS A CA   5  
ATOM   5617  C C    . CYS A 1 12 ? 9.752   -0.987  -4.755  1.00 0.39 ? 12  CYS A C    5  
ATOM   5618  O O    . CYS A 1 12 ? 9.763   -1.407  -5.914  1.00 0.44 ? 12  CYS A O    5  
ATOM   5619  C CB   . CYS A 1 12 ? 7.546   -0.726  -3.589  1.00 0.42 ? 12  CYS A CB   5  
ATOM   5620  S SG   . CYS A 1 12 ? 7.811   0.869   -2.784  1.00 0.66 ? 12  CYS A SG   5  
ATOM   5621  H H    . CYS A 1 12 ? 9.145   -1.227  -1.661  1.00 0.35 ? 12  CYS A H    5  
ATOM   5622  H HA   . CYS A 1 12 ? 8.513   -2.571  -4.063  1.00 0.43 ? 12  CYS A HA   5  
ATOM   5623  H HB2  . CYS A 1 12 ? 7.148   -0.530  -4.574  1.00 0.63 ? 12  CYS A HB2  5  
ATOM   5624  H HB3  . CYS A 1 12 ? 6.813   -1.268  -3.013  1.00 0.63 ? 12  CYS A HB3  5  
ATOM   5625  H HG   . CYS A 1 12 ? 6.654   1.518   -2.776  1.00 1.11 ? 12  CYS A HG   5  
ATOM   5626  N N    . LYS A 1 13 ? 10.577  -0.038  -4.321  1.00 0.41 ? 13  LYS A N    5  
ATOM   5627  C CA   . LYS A 1 13 ? 11.526  0.621   -5.212  1.00 0.49 ? 13  LYS A CA   5  
ATOM   5628  C C    . LYS A 1 13 ? 12.624  -0.329  -5.683  1.00 0.49 ? 13  LYS A C    5  
ATOM   5629  O O    . LYS A 1 13 ? 13.376  -0.006  -6.599  1.00 0.58 ? 13  LYS A O    5  
ATOM   5630  C CB   . LYS A 1 13 ? 12.135  1.847   -4.533  1.00 0.63 ? 13  LYS A CB   5  
ATOM   5631  C CG   . LYS A 1 13 ? 11.134  2.974   -4.339  1.00 0.96 ? 13  LYS A CG   5  
ATOM   5632  C CD   . LYS A 1 13 ? 11.738  4.160   -3.607  1.00 1.06 ? 13  LYS A CD   5  
ATOM   5633  C CE   . LYS A 1 13 ? 10.691  5.230   -3.338  1.00 1.40 ? 13  LYS A CE   5  
ATOM   5634  N NZ   . LYS A 1 13 ? 11.294  6.469   -2.790  1.00 1.34 ? 13  LYS A NZ   5  
ATOM   5635  H H    . LYS A 1 13 ? 10.537  0.235   -3.376  1.00 0.43 ? 13  LYS A H    5  
ATOM   5636  H HA   . LYS A 1 13 ? 10.972  0.952   -6.081  1.00 0.52 ? 13  LYS A HA   5  
ATOM   5637  H HB2  . LYS A 1 13 ? 12.517  1.556   -3.566  1.00 0.79 ? 13  LYS A HB2  5  
ATOM   5638  H HB3  . LYS A 1 13 ? 12.951  2.214   -5.139  1.00 0.85 ? 13  LYS A HB3  5  
ATOM   5639  H HG2  . LYS A 1 13 ? 10.789  3.305   -5.307  1.00 1.66 ? 13  LYS A HG2  5  
ATOM   5640  H HG3  . LYS A 1 13 ? 10.297  2.600   -3.768  1.00 1.57 ? 13  LYS A HG3  5  
ATOM   5641  H HD2  . LYS A 1 13 ? 12.145  3.826   -2.664  1.00 1.45 ? 13  LYS A HD2  5  
ATOM   5642  H HD3  . LYS A 1 13 ? 12.525  4.585   -4.211  1.00 1.68 ? 13  LYS A HD3  5  
ATOM   5643  H HE2  . LYS A 1 13 ? 10.189  5.467   -4.262  1.00 1.92 ? 13  LYS A HE2  5  
ATOM   5644  H HE3  . LYS A 1 13 ? 9.974   4.843   -2.627  1.00 1.72 ? 13  LYS A HE3  5  
ATOM   5645  H HZ1  . LYS A 1 13 ? 11.981  6.857   -3.461  1.00 1.65 ? 13  LYS A HZ1  5  
ATOM   5646  H HZ2  . LYS A 1 13 ? 11.786  6.271   -1.896  1.00 1.65 ? 13  LYS A HZ2  5  
ATOM   5647  H HZ3  . LYS A 1 13 ? 10.558  7.180   -2.619  1.00 1.73 ? 13  LYS A HZ3  5  
ATOM   5648  N N    . THR A 1 14 ? 12.725  -1.493  -5.057  1.00 0.49 ? 14  THR A N    5  
ATOM   5649  C CA   . THR A 1 14 ? 13.722  -2.476  -5.454  1.00 0.56 ? 14  THR A CA   5  
ATOM   5650  C C    . THR A 1 14 ? 13.150  -3.388  -6.548  1.00 0.54 ? 14  THR A C    5  
ATOM   5651  O O    . THR A 1 14 ? 13.885  -4.042  -7.289  1.00 0.72 ? 14  THR A O    5  
ATOM   5652  C CB   . THR A 1 14 ? 14.195  -3.317  -4.242  1.00 0.65 ? 14  THR A CB   5  
ATOM   5653  O OG1  . THR A 1 14 ? 14.763  -2.456  -3.244  1.00 0.77 ? 14  THR A OG1  5  
ATOM   5654  C CG2  . THR A 1 14 ? 15.229  -4.355  -4.654  1.00 0.83 ? 14  THR A CG2  5  
ATOM   5655  H H    . THR A 1 14 ? 12.122  -1.693  -4.308  1.00 0.48 ? 14  THR A H    5  
ATOM   5656  H HA   . THR A 1 14 ? 14.573  -1.943  -5.856  1.00 0.63 ? 14  THR A HA   5  
ATOM   5657  H HB   . THR A 1 14 ? 13.343  -3.829  -3.823  1.00 0.82 ? 14  THR A HB   5  
ATOM   5658  H HG1  . THR A 1 14 ? 14.053  -2.057  -2.718  1.00 0.99 ? 14  THR A HG1  5  
ATOM   5659  H HG21 . THR A 1 14 ? 16.092  -3.859  -5.071  1.00 1.01 ? 14  THR A HG21 5  
ATOM   5660  H HG22 . THR A 1 14 ? 14.800  -5.015  -5.393  1.00 1.11 ? 14  THR A HG22 5  
ATOM   5661  H HG23 . THR A 1 14 ? 15.527  -4.929  -3.788  1.00 1.00 ? 14  THR A HG23 5  
ATOM   5662  N N    . TYR A 1 15 ? 11.829  -3.398  -6.667  1.00 0.49 ? 15  TYR A N    5  
ATOM   5663  C CA   . TYR A 1 15 ? 11.168  -4.222  -7.666  1.00 0.54 ? 15  TYR A CA   5  
ATOM   5664  C C    . TYR A 1 15 ? 10.645  -3.368  -8.817  1.00 0.56 ? 15  TYR A C    5  
ATOM   5665  O O    . TYR A 1 15 ? 10.978  -3.602  -9.978  1.00 0.72 ? 15  TYR A O    5  
ATOM   5666  C CB   . TYR A 1 15 ? 10.022  -5.019  -7.037  1.00 0.55 ? 15  TYR A CB   5  
ATOM   5667  C CG   . TYR A 1 15 ? 10.452  -6.364  -6.494  1.00 0.60 ? 15  TYR A CG   5  
ATOM   5668  C CD1  . TYR A 1 15 ? 10.534  -6.596  -5.126  1.00 0.67 ? 15  TYR A CD1  5  
ATOM   5669  C CD2  . TYR A 1 15 ? 10.784  -7.401  -7.355  1.00 0.80 ? 15  TYR A CD2  5  
ATOM   5670  C CE1  . TYR A 1 15 ? 10.935  -7.826  -4.634  1.00 0.78 ? 15  TYR A CE1  5  
ATOM   5671  C CE2  . TYR A 1 15 ? 11.184  -8.631  -6.873  1.00 0.91 ? 15  TYR A CE2  5  
ATOM   5672  C CZ   . TYR A 1 15 ? 11.260  -8.840  -5.512  1.00 0.84 ? 15  TYR A CZ   5  
ATOM   5673  O OH   . TYR A 1 15 ? 11.665  -10.067 -5.027  1.00 1.00 ? 15  TYR A OH   5  
ATOM   5674  H H    . TYR A 1 15 ? 11.288  -2.833  -6.076  1.00 0.54 ? 15  TYR A H    5  
ATOM   5675  H HA   . TYR A 1 15 ? 11.901  -4.916  -8.056  1.00 0.62 ? 15  TYR A HA   5  
ATOM   5676  H HB2  . TYR A 1 15 ? 9.603   -4.450  -6.220  1.00 0.54 ? 15  TYR A HB2  5  
ATOM   5677  H HB3  . TYR A 1 15 ? 9.257   -5.189  -7.782  1.00 0.63 ? 15  TYR A HB3  5  
ATOM   5678  H HD1  . TYR A 1 15 ? 10.280  -5.801  -4.443  1.00 0.79 ? 15  TYR A HD1  5  
ATOM   5679  H HD2  . TYR A 1 15 ? 10.723  -7.237  -8.422  1.00 0.96 ? 15  TYR A HD2  5  
ATOM   5680  H HE1  . TYR A 1 15 ? 10.991  -7.987  -3.568  1.00 0.93 ? 15  TYR A HE1  5  
ATOM   5681  H HE2  . TYR A 1 15 ? 11.439  -9.423  -7.562  1.00 1.14 ? 15  TYR A HE2  5  
ATOM   5682  H HH   . TYR A 1 15 ? 12.535  -10.287 -5.389  1.00 1.22 ? 15  TYR A HH   5  
ATOM   5683  N N    . CYS A 1 16 ? 9.841   -2.363  -8.488  1.00 0.50 ? 16  CYS A N    5  
ATOM   5684  C CA   . CYS A 1 16 ? 9.261   -1.483  -9.498  1.00 0.55 ? 16  CYS A CA   5  
ATOM   5685  C C    . CYS A 1 16 ? 10.215  -0.346  -9.869  1.00 0.57 ? 16  CYS A C    5  
ATOM   5686  O O    . CYS A 1 16 ? 9.970   0.401   -10.819 1.00 0.88 ? 16  CYS A O    5  
ATOM   5687  C CB   . CYS A 1 16 ? 7.928   -0.922  -8.993  1.00 0.54 ? 16  CYS A CB   5  
ATOM   5688  S SG   . CYS A 1 16 ? 6.807   -2.174  -8.323  1.00 0.67 ? 16  CYS A SG   5  
ATOM   5689  H H    . CYS A 1 16 ? 9.627   -2.207  -7.538  1.00 0.50 ? 16  CYS A H    5  
ATOM   5690  H HA   . CYS A 1 16 ? 9.077   -2.076  -10.380 1.00 0.64 ? 16  CYS A HA   5  
ATOM   5691  H HB2  . CYS A 1 16 ? 8.122   -0.201  -8.211  1.00 0.56 ? 16  CYS A HB2  5  
ATOM   5692  H HB3  . CYS A 1 16 ? 7.419   -0.429  -9.810  1.00 0.63 ? 16  CYS A HB3  5  
ATOM   5693  H HG   . CYS A 1 16 ? 6.750   -3.184  -9.183  1.00 1.15 ? 16  CYS A HG   5  
ATOM   5694  N N    . GLY A 1 17 ? 11.302  -0.227  -9.120  1.00 0.49 ? 17  GLY A N    5  
ATOM   5695  C CA   . GLY A 1 17 ? 12.283  0.806   -9.379  1.00 0.56 ? 17  GLY A CA   5  
ATOM   5696  C C    . GLY A 1 17 ? 11.742  2.199   -9.130  1.00 0.52 ? 17  GLY A C    5  
ATOM   5697  O O    . GLY A 1 17 ? 11.147  2.465   -8.085  1.00 0.66 ? 17  GLY A O    5  
ATOM   5698  H H    . GLY A 1 17 ? 11.439  -0.848  -8.379  1.00 0.62 ? 17  GLY A H    5  
ATOM   5699  H HA2  . GLY A 1 17 ? 13.136  0.641   -8.737  1.00 0.65 ? 17  GLY A HA2  5  
ATOM   5700  H HA3  . GLY A 1 17 ? 12.603  0.735   -10.409 1.00 0.63 ? 17  GLY A HA3  5  
ATOM   5701  N N    . LYS A 1 18 ? 11.922  3.077   -10.107 1.00 0.50 ? 18  LYS A N    5  
ATOM   5702  C CA   . LYS A 1 18 ? 11.458  4.456   -10.001 1.00 0.56 ? 18  LYS A CA   5  
ATOM   5703  C C    . LYS A 1 18 ? 9.980   4.562   -10.376 1.00 0.53 ? 18  LYS A C    5  
ATOM   5704  O O    . LYS A 1 18 ? 9.393   5.647   -10.350 1.00 0.62 ? 18  LYS A O    5  
ATOM   5705  C CB   . LYS A 1 18 ? 12.305  5.376   -10.892 1.00 0.70 ? 18  LYS A CB   5  
ATOM   5706  C CG   . LYS A 1 18 ? 12.277  5.008   -12.368 1.00 0.81 ? 18  LYS A CG   5  
ATOM   5707  C CD   . LYS A 1 18 ? 13.646  5.160   -13.015 1.00 1.11 ? 18  LYS A CD   5  
ATOM   5708  C CE   . LYS A 1 18 ? 14.133  6.597   -12.966 1.00 1.46 ? 18  LYS A CE   5  
ATOM   5709  N NZ   . LYS A 1 18 ? 15.563  6.713   -13.351 1.00 1.82 ? 18  LYS A NZ   5  
ATOM   5710  H H    . LYS A 1 18 ? 12.386  2.790   -10.925 1.00 0.58 ? 18  LYS A H    5  
ATOM   5711  H HA   . LYS A 1 18 ? 11.575  4.763   -8.971  1.00 0.60 ? 18  LYS A HA   5  
ATOM   5712  H HB2  . LYS A 1 18 ? 11.939  6.386   -10.792 1.00 0.87 ? 18  LYS A HB2  5  
ATOM   5713  H HB3  . LYS A 1 18 ? 13.329  5.338   -10.554 1.00 0.79 ? 18  LYS A HB3  5  
ATOM   5714  H HG2  . LYS A 1 18 ? 11.956  3.983   -12.468 1.00 0.90 ? 18  LYS A HG2  5  
ATOM   5715  H HG3  . LYS A 1 18 ? 11.576  5.656   -12.873 1.00 1.06 ? 18  LYS A HG3  5  
ATOM   5716  H HD2  . LYS A 1 18 ? 14.352  4.531   -12.496 1.00 1.33 ? 18  LYS A HD2  5  
ATOM   5717  H HD3  . LYS A 1 18 ? 13.577  4.849   -14.047 1.00 1.44 ? 18  LYS A HD3  5  
ATOM   5718  H HE2  . LYS A 1 18 ? 13.539  7.189   -13.645 1.00 1.85 ? 18  LYS A HE2  5  
ATOM   5719  H HE3  . LYS A 1 18 ? 14.010  6.972   -11.959 1.00 1.67 ? 18  LYS A HE3  5  
ATOM   5720  H HZ1  . LYS A 1 18 ? 16.157  6.192   -12.676 1.00 2.13 ? 18  LYS A HZ1  5  
ATOM   5721  H HZ2  . LYS A 1 18 ? 15.851  7.712   -13.346 1.00 2.19 ? 18  LYS A HZ2  5  
ATOM   5722  H HZ3  . LYS A 1 18 ? 15.712  6.325   -14.303 1.00 2.14 ? 18  LYS A HZ3  5  
ATOM   5723  N N    . THR A 1 19 ? 9.386   3.428   -10.716 1.00 0.49 ? 19  THR A N    5  
ATOM   5724  C CA   . THR A 1 19 ? 7.978   3.380   -11.086 1.00 0.52 ? 19  THR A CA   5  
ATOM   5725  C C    . THR A 1 19 ? 7.106   3.165   -9.852  1.00 0.48 ? 19  THR A C    5  
ATOM   5726  O O    . THR A 1 19 ? 5.878   3.140   -9.938  1.00 0.62 ? 19  THR A O    5  
ATOM   5727  C CB   . THR A 1 19 ? 7.714   2.253   -12.104 1.00 0.62 ? 19  THR A CB   5  
ATOM   5728  O OG1  . THR A 1 19 ? 8.936   1.909   -12.776 1.00 0.83 ? 19  THR A OG1  5  
ATOM   5729  C CG2  . THR A 1 19 ? 6.670   2.680   -13.126 1.00 0.91 ? 19  THR A CG2  5  
ATOM   5730  H H    . THR A 1 19 ? 9.907   2.598   -10.719 1.00 0.49 ? 19  THR A H    5  
ATOM   5731  H HA   . THR A 1 19 ? 7.719   4.323   -11.544 1.00 0.60 ? 19  THR A HA   5  
ATOM   5732  H HB   . THR A 1 19 ? 7.348   1.388   -11.576 1.00 0.72 ? 19  THR A HB   5  
ATOM   5733  H HG1  . THR A 1 19 ? 9.412   1.245   -12.252 1.00 1.10 ? 19  THR A HG1  5  
ATOM   5734  H HG21 . THR A 1 19 ? 6.461   1.859   -13.794 1.00 1.10 ? 19  THR A HG21 5  
ATOM   5735  H HG22 . THR A 1 19 ? 7.043   3.521   -13.694 1.00 1.23 ? 19  THR A HG22 5  
ATOM   5736  H HG23 . THR A 1 19 ? 5.765   2.967   -12.614 1.00 1.17 ? 19  THR A HG23 5  
ATOM   5737  N N    . SER A 1 20 ? 7.757   3.012   -8.707  1.00 0.42 ? 20  SER A N    5  
ATOM   5738  C CA   . SER A 1 20 ? 7.065   2.799   -7.446  1.00 0.42 ? 20  SER A CA   5  
ATOM   5739  C C    . SER A 1 20 ? 6.452   4.108   -6.939  1.00 0.41 ? 20  SER A C    5  
ATOM   5740  O O    . SER A 1 20 ? 6.883   5.193   -7.332  1.00 0.46 ? 20  SER A O    5  
ATOM   5741  C CB   . SER A 1 20 ? 8.047   2.229   -6.421  1.00 0.46 ? 20  SER A CB   5  
ATOM   5742  O OG   . SER A 1 20 ? 8.972   1.352   -7.048  1.00 0.97 ? 20  SER A OG   5  
ATOM   5743  H H    . SER A 1 20 ? 8.735   3.045   -8.710  1.00 0.49 ? 20  SER A H    5  
ATOM   5744  H HA   . SER A 1 20 ? 6.274   2.085   -7.616  1.00 0.48 ? 20  SER A HA   5  
ATOM   5745  H HB2  . SER A 1 20 ? 8.594   3.036   -5.954  1.00 0.70 ? 20  SER A HB2  5  
ATOM   5746  H HB3  . SER A 1 20 ? 7.502   1.680   -5.669  1.00 0.81 ? 20  SER A HB3  5  
ATOM   5747  H HG   . SER A 1 20 ? 9.794   1.829   -7.227  1.00 1.21 ? 20  SER A HG   5  
ATOM   5748  N N    . PRO A 1 21 ? 5.422   4.023   -6.081  1.00 0.43 ? 21  PRO A N    5  
ATOM   5749  C CA   . PRO A 1 21 ? 4.756   5.208   -5.534  1.00 0.49 ? 21  PRO A CA   5  
ATOM   5750  C C    . PRO A 1 21 ? 5.621   5.947   -4.520  1.00 0.42 ? 21  PRO A C    5  
ATOM   5751  O O    . PRO A 1 21 ? 6.429   5.342   -3.816  1.00 0.46 ? 21  PRO A O    5  
ATOM   5752  C CB   . PRO A 1 21 ? 3.509   4.637   -4.858  1.00 0.62 ? 21  PRO A CB   5  
ATOM   5753  C CG   . PRO A 1 21 ? 3.860   3.232   -4.518  1.00 0.63 ? 21  PRO A CG   5  
ATOM   5754  C CD   . PRO A 1 21 ? 4.820   2.772   -5.580  1.00 0.50 ? 21  PRO A CD   5  
ATOM   5755  H HA   . PRO A 1 21 ? 4.463   5.891   -6.316  1.00 0.57 ? 21  PRO A HA   5  
ATOM   5756  H HB2  . PRO A 1 21 ? 3.279   5.209   -3.966  1.00 0.69 ? 21  PRO A HB2  5  
ATOM   5757  H HB3  . PRO A 1 21 ? 2.676   4.656   -5.540  1.00 0.76 ? 21  PRO A HB3  5  
ATOM   5758  H HG2  . PRO A 1 21 ? 4.327   3.196   -3.542  1.00 0.76 ? 21  PRO A HG2  5  
ATOM   5759  H HG3  . PRO A 1 21 ? 2.973   2.617   -4.534  1.00 0.81 ? 21  PRO A HG3  5  
ATOM   5760  H HD2  . PRO A 1 21 ? 5.572   2.127   -5.155  1.00 0.55 ? 21  PRO A HD2  5  
ATOM   5761  H HD3  . PRO A 1 21 ? 4.288   2.263   -6.370  1.00 0.57 ? 21  PRO A HD3  5  
ATOM   5762  N N    . SER A 1 22 ? 5.446   7.256   -4.457  1.00 0.43 ? 22  SER A N    5  
ATOM   5763  C CA   . SER A 1 22 ? 6.196   8.085   -3.535  1.00 0.43 ? 22  SER A CA   5  
ATOM   5764  C C    . SER A 1 22 ? 5.614   7.971   -2.129  1.00 0.38 ? 22  SER A C    5  
ATOM   5765  O O    . SER A 1 22 ? 4.449   7.591   -1.963  1.00 0.39 ? 22  SER A O    5  
ATOM   5766  C CB   . SER A 1 22 ? 6.155   9.533   -4.015  1.00 0.56 ? 22  SER A CB   5  
ATOM   5767  O OG   . SER A 1 22 ? 6.235   9.591   -5.431  1.00 1.11 ? 22  SER A OG   5  
ATOM   5768  H H    . SER A 1 22 ? 4.790   7.681   -5.049  1.00 0.53 ? 22  SER A H    5  
ATOM   5769  H HA   . SER A 1 22 ? 7.220   7.741   -3.526  1.00 0.47 ? 22  SER A HA   5  
ATOM   5770  H HB2  . SER A 1 22 ? 5.230   9.987   -3.700  1.00 0.96 ? 22  SER A HB2  5  
ATOM   5771  H HB3  . SER A 1 22 ? 6.988   10.077  -3.596  1.00 0.81 ? 22  SER A HB3  5  
ATOM   5772  H HG   . SER A 1 22 ? 7.029   9.125   -5.722  1.00 1.48 ? 22  SER A HG   5  
ATOM   5773  N N    . LYS A 1 23 ? 6.415   8.305   -1.121  1.00 0.44 ? 23  LYS A N    5  
ATOM   5774  C CA   . LYS A 1 23 ? 5.971   8.240   0.270   1.00 0.50 ? 23  LYS A CA   5  
ATOM   5775  C C    . LYS A 1 23 ? 4.725   9.097   0.472   1.00 0.42 ? 23  LYS A C    5  
ATOM   5776  O O    . LYS A 1 23 ? 3.836   8.745   1.247   1.00 0.42 ? 23  LYS A O    5  
ATOM   5777  C CB   . LYS A 1 23 ? 7.100   8.694   1.209   1.00 0.69 ? 23  LYS A CB   5  
ATOM   5778  C CG   . LYS A 1 23 ? 6.673   8.908   2.661   1.00 0.63 ? 23  LYS A CG   5  
ATOM   5779  C CD   . LYS A 1 23 ? 6.198   10.335  2.913   1.00 1.12 ? 23  LYS A CD   5  
ATOM   5780  C CE   . LYS A 1 23 ? 7.331   11.252  3.347   1.00 1.17 ? 23  LYS A CE   5  
ATOM   5781  N NZ   . LYS A 1 23 ? 8.501   11.166  2.438   1.00 1.60 ? 23  LYS A NZ   5  
ATOM   5782  H H    . LYS A 1 23 ? 7.331   8.609   -1.317  1.00 0.50 ? 23  LYS A H    5  
ATOM   5783  H HA   . LYS A 1 23 ? 5.721   7.213   0.488   1.00 0.56 ? 23  LYS A HA   5  
ATOM   5784  H HB2  . LYS A 1 23 ? 7.878   7.947   1.197   1.00 1.00 ? 23  LYS A HB2  5  
ATOM   5785  H HB3  . LYS A 1 23 ? 7.504   9.623   0.837   1.00 1.02 ? 23  LYS A HB3  5  
ATOM   5786  H HG2  . LYS A 1 23 ? 5.866   8.229   2.890   1.00 0.92 ? 23  LYS A HG2  5  
ATOM   5787  H HG3  . LYS A 1 23 ? 7.512   8.701   3.307   1.00 0.87 ? 23  LYS A HG3  5  
ATOM   5788  H HD2  . LYS A 1 23 ? 5.766   10.724  2.003   1.00 1.72 ? 23  LYS A HD2  5  
ATOM   5789  H HD3  . LYS A 1 23 ? 5.445   10.317  3.687   1.00 1.84 ? 23  LYS A HD3  5  
ATOM   5790  H HE2  . LYS A 1 23 ? 6.970   12.270  3.359   1.00 1.51 ? 23  LYS A HE2  5  
ATOM   5791  H HE3  . LYS A 1 23 ? 7.641   10.970  4.343   1.00 1.35 ? 23  LYS A HE3  5  
ATOM   5792  H HZ1  . LYS A 1 23 ? 8.247   11.482  1.479   1.00 2.03 ? 23  LYS A HZ1  5  
ATOM   5793  H HZ2  . LYS A 1 23 ? 8.848   10.189  2.390   1.00 1.91 ? 23  LYS A HZ2  5  
ATOM   5794  H HZ3  . LYS A 1 23 ? 9.272   11.769  2.795   1.00 2.03 ? 23  LYS A HZ3  5  
ATOM   5795  N N    . LYS A 1 24 ? 4.674   10.212  -0.250  1.00 0.41 ? 24  LYS A N    5  
ATOM   5796  C CA   . LYS A 1 24 ? 3.556   11.147  -0.175  1.00 0.45 ? 24  LYS A CA   5  
ATOM   5797  C C    . LYS A 1 24 ? 2.220   10.432  -0.396  1.00 0.40 ? 24  LYS A C    5  
ATOM   5798  O O    . LYS A 1 24 ? 1.229   10.728  0.271   1.00 0.48 ? 24  LYS A O    5  
ATOM   5799  C CB   . LYS A 1 24 ? 3.720   12.252  -1.225  1.00 0.56 ? 24  LYS A CB   5  
ATOM   5800  C CG   . LYS A 1 24 ? 5.103   12.883  -1.269  1.00 0.83 ? 24  LYS A CG   5  
ATOM   5801  C CD   . LYS A 1 24 ? 5.337   13.803  -0.083  1.00 1.00 ? 24  LYS A CD   5  
ATOM   5802  C CE   . LYS A 1 24 ? 6.432   14.820  -0.371  1.00 1.56 ? 24  LYS A CE   5  
ATOM   5803  N NZ   . LYS A 1 24 ? 7.769   14.188  -0.513  1.00 2.04 ? 24  LYS A NZ   5  
ATOM   5804  H H    . LYS A 1 24 ? 5.420   10.413  -0.855  1.00 0.44 ? 24  LYS A H    5  
ATOM   5805  H HA   . LYS A 1 24 ? 3.556   11.592  0.809   1.00 0.51 ? 24  LYS A HA   5  
ATOM   5806  H HB2  . LYS A 1 24 ? 3.513   11.836  -2.198  1.00 0.63 ? 24  LYS A HB2  5  
ATOM   5807  H HB3  . LYS A 1 24 ? 3.001   13.032  -1.021  1.00 0.77 ? 24  LYS A HB3  5  
ATOM   5808  H HG2  . LYS A 1 24 ? 5.847   12.100  -1.255  1.00 1.37 ? 24  LYS A HG2  5  
ATOM   5809  H HG3  . LYS A 1 24 ? 5.199   13.454  -2.182  1.00 1.33 ? 24  LYS A HG3  5  
ATOM   5810  H HD2  . LYS A 1 24 ? 4.419   14.330  0.137   1.00 1.50 ? 24  LYS A HD2  5  
ATOM   5811  H HD3  . LYS A 1 24 ? 5.626   13.206  0.769   1.00 1.29 ? 24  LYS A HD3  5  
ATOM   5812  H HE2  . LYS A 1 24 ? 6.195   15.337  -1.286  1.00 1.84 ? 24  LYS A HE2  5  
ATOM   5813  H HE3  . LYS A 1 24 ? 6.466   15.532  0.441   1.00 2.19 ? 24  LYS A HE3  5  
ATOM   5814  H HZ1  . LYS A 1 24 ? 7.694   13.289  -1.031  1.00 2.22 ? 24  LYS A HZ1  5  
ATOM   5815  H HZ2  . LYS A 1 24 ? 8.181   14.001  0.422   1.00 2.45 ? 24  LYS A HZ2  5  
ATOM   5816  H HZ3  . LYS A 1 24 ? 8.410   14.819  -1.035  1.00 2.55 ? 24  LYS A HZ3  5  
ATOM   5817  N N    . GLU A 1 25 ? 2.209   9.483   -1.329  1.00 0.34 ? 25  GLU A N    5  
ATOM   5818  C CA   . GLU A 1 25 ? 0.999   8.734   -1.645  1.00 0.37 ? 25  GLU A CA   5  
ATOM   5819  C C    . GLU A 1 25 ? 0.812   7.562   -0.688  1.00 0.31 ? 25  GLU A C    5  
ATOM   5820  O O    . GLU A 1 25 ? -0.313  7.227   -0.317  1.00 0.34 ? 25  GLU A O    5  
ATOM   5821  C CB   . GLU A 1 25 ? 1.056   8.223   -3.088  1.00 0.45 ? 25  GLU A CB   5  
ATOM   5822  C CG   . GLU A 1 25 ? 1.221   9.331   -4.118  1.00 0.90 ? 25  GLU A CG   5  
ATOM   5823  C CD   . GLU A 1 25 ? 1.211   8.824   -5.546  1.00 1.00 ? 25  GLU A CD   5  
ATOM   5824  O OE1  . GLU A 1 25 ? 0.110   8.658   -6.120  1.00 1.30 ? 25  GLU A OE1  5  
ATOM   5825  O OE2  . GLU A 1 25 ? 2.305   8.604   -6.109  1.00 1.58 ? 25  GLU A OE2  5  
ATOM   5826  H H    . GLU A 1 25 ? 3.034   9.283   -1.818  1.00 0.36 ? 25  GLU A H    5  
ATOM   5827  H HA   . GLU A 1 25 ? 0.161   9.405   -1.542  1.00 0.42 ? 25  GLU A HA   5  
ATOM   5828  H HB2  . GLU A 1 25 ? 1.892   7.544   -3.183  1.00 0.97 ? 25  GLU A HB2  5  
ATOM   5829  H HB3  . GLU A 1 25 ? 0.143   7.689   -3.307  1.00 0.87 ? 25  GLU A HB3  5  
ATOM   5830  H HG2  . GLU A 1 25 ? 0.414   10.039  -4.000  1.00 1.42 ? 25  GLU A HG2  5  
ATOM   5831  H HG3  . GLU A 1 25 ? 2.162   9.829   -3.937  1.00 1.47 ? 25  GLU A HG3  5  
ATOM   5832  N N    . ILE A 1 26 ? 1.920   6.944   -0.290  1.00 0.29 ? 26  ILE A N    5  
ATOM   5833  C CA   . ILE A 1 26 ? 1.880   5.801   0.621   1.00 0.29 ? 26  ILE A CA   5  
ATOM   5834  C C    . ILE A 1 26 ? 1.259   6.186   1.963   1.00 0.27 ? 26  ILE A C    5  
ATOM   5835  O O    . ILE A 1 26 ? 0.369   5.495   2.465   1.00 0.28 ? 26  ILE A O    5  
ATOM   5836  C CB   . ILE A 1 26 ? 3.291   5.215   0.859   1.00 0.33 ? 26  ILE A CB   5  
ATOM   5837  C CG1  . ILE A 1 26 ? 3.892   4.731   -0.464  1.00 0.36 ? 26  ILE A CG1  5  
ATOM   5838  C CG2  . ILE A 1 26 ? 3.237   4.069   1.866   1.00 0.41 ? 26  ILE A CG2  5  
ATOM   5839  C CD1  . ILE A 1 26 ? 5.342   4.307   -0.360  1.00 0.45 ? 26  ILE A CD1  5  
ATOM   5840  H H    . ILE A 1 26 ? 2.790   7.266   -0.616  1.00 0.30 ? 26  ILE A H    5  
ATOM   5841  H HA   . ILE A 1 26 ? 1.271   5.035   0.161   1.00 0.32 ? 26  ILE A HA   5  
ATOM   5842  H HB   . ILE A 1 26 ? 3.916   5.993   1.268   1.00 0.34 ? 26  ILE A HB   5  
ATOM   5843  H HG12 . ILE A 1 26 ? 3.325   3.884   -0.821  1.00 0.44 ? 26  ILE A HG12 5  
ATOM   5844  H HG13 . ILE A 1 26 ? 3.832   5.528   -1.190  1.00 0.35 ? 26  ILE A HG13 5  
ATOM   5845  H HG21 . ILE A 1 26 ? 2.797   4.419   2.789   1.00 0.52 ? 26  ILE A HG21 5  
ATOM   5846  H HG22 . ILE A 1 26 ? 4.237   3.710   2.057   1.00 0.53 ? 26  ILE A HG22 5  
ATOM   5847  H HG23 . ILE A 1 26 ? 2.638   3.267   1.461   1.00 0.54 ? 26  ILE A HG23 5  
ATOM   5848  H HD11 . ILE A 1 26 ? 5.663   3.888   -1.303  1.00 0.90 ? 26  ILE A HD11 5  
ATOM   5849  H HD12 . ILE A 1 26 ? 5.446   3.564   0.417   1.00 0.91 ? 26  ILE A HD12 5  
ATOM   5850  H HD13 . ILE A 1 26 ? 5.952   5.164   -0.122  1.00 0.92 ? 26  ILE A HD13 5  
ATOM   5851  N N    . GLY A 1 27 ? 1.719   7.297   2.527   1.00 0.27 ? 27  GLY A N    5  
ATOM   5852  C CA   . GLY A 1 27 ? 1.204   7.758   3.803   1.00 0.29 ? 27  GLY A CA   5  
ATOM   5853  C C    . GLY A 1 27 ? -0.288  8.032   3.762   1.00 0.28 ? 27  GLY A C    5  
ATOM   5854  O O    . GLY A 1 27 ? -1.032  7.614   4.653   1.00 0.32 ? 27  GLY A O    5  
ATOM   5855  H H    . GLY A 1 27 ? 2.422   7.813   2.069   1.00 0.28 ? 27  GLY A H    5  
ATOM   5856  H HA2  . GLY A 1 27 ? 1.403   7.006   4.554   1.00 0.32 ? 27  GLY A HA2  5  
ATOM   5857  H HA3  . GLY A 1 27 ? 1.718   8.668   4.075   1.00 0.33 ? 27  GLY A HA3  5  
ATOM   5858  N N    . ALA A 1 28 ? -0.726  8.721   2.715   1.00 0.27 ? 28  ALA A N    5  
ATOM   5859  C CA   . ALA A 1 28 ? -2.132  9.059   2.545   1.00 0.30 ? 28  ALA A CA   5  
ATOM   5860  C C    . ALA A 1 28 ? -2.984  7.801   2.409   1.00 0.29 ? 28  ALA A C    5  
ATOM   5861  O O    . ALA A 1 28 ? -4.066  7.702   2.992   1.00 0.32 ? 28  ALA A O    5  
ATOM   5862  C CB   . ALA A 1 28 ? -2.314  9.957   1.326   1.00 0.35 ? 28  ALA A CB   5  
ATOM   5863  H H    . ALA A 1 28 ? -0.080  9.023   2.042   1.00 0.27 ? 28  ALA A H    5  
ATOM   5864  H HA   . ALA A 1 28 ? -2.452  9.606   3.419   1.00 0.34 ? 28  ALA A HA   5  
ATOM   5865  H HB1  . ALA A 1 28 ? -1.690  10.833  1.429   1.00 0.47 ? 28  ALA A HB1  5  
ATOM   5866  H HB2  . ALA A 1 28 ? -3.348  10.260  1.249   1.00 0.50 ? 28  ALA A HB2  5  
ATOM   5867  H HB3  . ALA A 1 28 ? -2.030  9.417   0.434   1.00 0.45 ? 28  ALA A HB3  5  
ATOM   5868  N N    . MET A 1 29 ? -2.477  6.839   1.651   1.00 0.27 ? 29  MET A N    5  
ATOM   5869  C CA   . MET A 1 29 ? -3.181  5.582   1.424   1.00 0.30 ? 29  MET A CA   5  
ATOM   5870  C C    . MET A 1 29 ? -3.314  4.780   2.717   1.00 0.28 ? 29  MET A C    5  
ATOM   5871  O O    . MET A 1 29 ? -4.398  4.302   3.050   1.00 0.31 ? 29  MET A O    5  
ATOM   5872  C CB   . MET A 1 29 ? -2.443  4.750   0.374   1.00 0.34 ? 29  MET A CB   5  
ATOM   5873  C CG   . MET A 1 29 ? -3.093  3.406   0.084   1.00 0.40 ? 29  MET A CG   5  
ATOM   5874  S SD   . MET A 1 29 ? -1.936  2.210   -0.608  1.00 0.49 ? 29  MET A SD   5  
ATOM   5875  C CE   . MET A 1 29 ? -0.919  1.845   0.819   1.00 0.52 ? 29  MET A CE   5  
ATOM   5876  H H    . MET A 1 29 ? -1.603  6.983   1.223   1.00 0.27 ? 29  MET A H    5  
ATOM   5877  H HA   . MET A 1 29 ? -4.170  5.815   1.056   1.00 0.34 ? 29  MET A HA   5  
ATOM   5878  H HB2  . MET A 1 29 ? -2.403  5.313   -0.548  1.00 0.38 ? 29  MET A HB2  5  
ATOM   5879  H HB3  . MET A 1 29 ? -1.436  4.573   0.719   1.00 0.34 ? 29  MET A HB3  5  
ATOM   5880  H HG2  . MET A 1 29 ? -3.490  3.006   1.005   1.00 0.40 ? 29  MET A HG2  5  
ATOM   5881  H HG3  . MET A 1 29 ? -3.900  3.556   -0.617  1.00 0.49 ? 29  MET A HG3  5  
ATOM   5882  H HE1  . MET A 1 29 ? -0.426  2.746   1.149   1.00 0.81 ? 29  MET A HE1  5  
ATOM   5883  H HE2  . MET A 1 29 ? -0.179  1.106   0.550   1.00 0.89 ? 29  MET A HE2  5  
ATOM   5884  H HE3  . MET A 1 29 ? -1.538  1.461   1.616   1.00 0.86 ? 29  MET A HE3  5  
ATOM   5885  N N    . LEU A 1 30 ? -2.210  4.652   3.445   1.00 0.29 ? 30  LEU A N    5  
ATOM   5886  C CA   . LEU A 1 30 ? -2.194  3.899   4.694   1.00 0.32 ? 30  LEU A CA   5  
ATOM   5887  C C    . LEU A 1 30 ? -3.179  4.476   5.707   1.00 0.30 ? 30  LEU A C    5  
ATOM   5888  O O    . LEU A 1 30 ? -3.979  3.744   6.292   1.00 0.33 ? 30  LEU A O    5  
ATOM   5889  C CB   . LEU A 1 30 ? -0.784  3.888   5.285   1.00 0.39 ? 30  LEU A CB   5  
ATOM   5890  C CG   . LEU A 1 30 ? -0.609  3.012   6.525   1.00 0.78 ? 30  LEU A CG   5  
ATOM   5891  C CD1  . LEU A 1 30 ? -0.577  1.540   6.143   1.00 1.32 ? 30  LEU A CD1  5  
ATOM   5892  C CD2  . LEU A 1 30 ? 0.655   3.402   7.271   1.00 1.04 ? 30  LEU A CD2  5  
ATOM   5893  H H    . LEU A 1 30 ? -1.379  5.078   3.134   1.00 0.29 ? 30  LEU A H    5  
ATOM   5894  H HA   . LEU A 1 30 ? -2.486  2.884   4.469   1.00 0.36 ? 30  LEU A HA   5  
ATOM   5895  H HB2  . LEU A 1 30 ? -0.101  3.541   4.524   1.00 0.71 ? 30  LEU A HB2  5  
ATOM   5896  H HB3  . LEU A 1 30 ? -0.517  4.901   5.549   1.00 0.65 ? 30  LEU A HB3  5  
ATOM   5897  H HG   . LEU A 1 30 ? -1.450  3.165   7.186   1.00 1.11 ? 30  LEU A HG   5  
ATOM   5898  H HD11 . LEU A 1 30 ? 0.246   1.359   5.469   1.00 1.67 ? 30  LEU A HD11 5  
ATOM   5899  H HD12 . LEU A 1 30 ? -1.505  1.272   5.658   1.00 1.61 ? 30  LEU A HD12 5  
ATOM   5900  H HD13 . LEU A 1 30 ? -0.450  0.940   7.032   1.00 1.72 ? 30  LEU A HD13 5  
ATOM   5901  H HD21 . LEU A 1 30 ? 0.744   2.803   8.164   1.00 1.49 ? 30  LEU A HD21 5  
ATOM   5902  H HD22 . LEU A 1 30 ? 0.605   4.448   7.541   1.00 1.30 ? 30  LEU A HD22 5  
ATOM   5903  H HD23 . LEU A 1 30 ? 1.513   3.235   6.635   1.00 1.27 ? 30  LEU A HD23 5  
ATOM   5904  N N    . SER A 1 31 ? -3.124  5.788   5.897   1.00 0.29 ? 31  SER A N    5  
ATOM   5905  C CA   . SER A 1 31 ? -4.008  6.464   6.839   1.00 0.32 ? 31  SER A CA   5  
ATOM   5906  C C    . SER A 1 31 ? -5.475  6.251   6.457   1.00 0.28 ? 31  SER A C    5  
ATOM   5907  O O    . SER A 1 31 ? -6.338  6.101   7.325   1.00 0.29 ? 31  SER A O    5  
ATOM   5908  C CB   . SER A 1 31 ? -3.677  7.957   6.880   1.00 0.40 ? 31  SER A CB   5  
ATOM   5909  O OG   . SER A 1 31 ? -4.336  8.608   7.956   1.00 1.20 ? 31  SER A OG   5  
ATOM   5910  H H    . SER A 1 31 ? -2.467  6.317   5.394   1.00 0.31 ? 31  SER A H    5  
ATOM   5911  H HA   . SER A 1 31 ? -3.838  6.037   7.816   1.00 0.36 ? 31  SER A HA   5  
ATOM   5912  H HB2  . SER A 1 31 ? -2.613  8.082   7.000   1.00 0.94 ? 31  SER A HB2  5  
ATOM   5913  H HB3  . SER A 1 31 ? -3.991  8.414   5.953   1.00 1.08 ? 31  SER A HB3  5  
ATOM   5914  H HG   . SER A 1 31 ? -5.039  9.171   7.605   1.00 1.76 ? 31  SER A HG   5  
ATOM   5915  N N    . LEU A 1 32 ? -5.744  6.220   5.157   1.00 0.27 ? 32  LEU A N    5  
ATOM   5916  C CA   . LEU A 1 32 ? -7.094  6.023   4.652   1.00 0.29 ? 32  LEU A CA   5  
ATOM   5917  C C    . LEU A 1 32 ? -7.613  4.641   5.053   1.00 0.26 ? 32  LEU A C    5  
ATOM   5918  O O    . LEU A 1 32 ? -8.705  4.513   5.603   1.00 0.29 ? 32  LEU A O    5  
ATOM   5919  C CB   . LEU A 1 32 ? -7.105  6.180   3.125   1.00 0.35 ? 32  LEU A CB   5  
ATOM   5920  C CG   . LEU A 1 32 ? -8.450  6.560   2.489   1.00 0.67 ? 32  LEU A CG   5  
ATOM   5921  C CD1  . LEU A 1 32 ? -9.332  5.333   2.297   1.00 1.15 ? 32  LEU A CD1  5  
ATOM   5922  C CD2  . LEU A 1 32 ? -9.167  7.616   3.325   1.00 1.17 ? 32  LEU A CD2  5  
ATOM   5923  H H    . LEU A 1 32 ? -5.009  6.328   4.518   1.00 0.29 ? 32  LEU A H    5  
ATOM   5924  H HA   . LEU A 1 32 ? -7.729  6.778   5.089   1.00 0.32 ? 32  LEU A HA   5  
ATOM   5925  H HB2  . LEU A 1 32 ? -6.383  6.940   2.863   1.00 0.51 ? 32  LEU A HB2  5  
ATOM   5926  H HB3  . LEU A 1 32 ? -6.782  5.244   2.693   1.00 0.56 ? 32  LEU A HB3  5  
ATOM   5927  H HG   . LEU A 1 32 ? -8.264  6.984   1.513   1.00 0.58 ? 32  LEU A HG   5  
ATOM   5928  H HD11 . LEU A 1 32 ? -8.798  4.590   1.722   1.00 1.26 ? 32  LEU A HD11 5  
ATOM   5929  H HD12 . LEU A 1 32 ? -10.233 5.615   1.770   1.00 1.47 ? 32  LEU A HD12 5  
ATOM   5930  H HD13 . LEU A 1 32 ? -9.592  4.921   3.262   1.00 1.37 ? 32  LEU A HD13 5  
ATOM   5931  H HD21 . LEU A 1 32 ? -9.971  8.047   2.747   1.00 1.52 ? 32  LEU A HD21 5  
ATOM   5932  H HD22 . LEU A 1 32 ? -8.469  8.391   3.606   1.00 1.23 ? 32  LEU A HD22 5  
ATOM   5933  H HD23 . LEU A 1 32 ? -9.571  7.157   4.216   1.00 1.41 ? 32  LEU A HD23 5  
ATOM   5934  N N    . LEU A 1 33 ? -6.803  3.620   4.800   1.00 0.27 ? 33  LEU A N    5  
ATOM   5935  C CA   . LEU A 1 33 ? -7.164  2.239   5.119   1.00 0.31 ? 33  LEU A CA   5  
ATOM   5936  C C    . LEU A 1 33 ? -7.400  2.057   6.616   1.00 0.27 ? 33  LEU A C    5  
ATOM   5937  O O    . LEU A 1 33 ? -8.329  1.360   7.032   1.00 0.33 ? 33  LEU A O    5  
ATOM   5938  C CB   . LEU A 1 33 ? -6.059  1.284   4.656   1.00 0.41 ? 33  LEU A CB   5  
ATOM   5939  C CG   . LEU A 1 33 ? -5.612  1.450   3.203   1.00 0.49 ? 33  LEU A CG   5  
ATOM   5940  C CD1  . LEU A 1 33 ? -4.439  0.535   2.898   1.00 0.61 ? 33  LEU A CD1  5  
ATOM   5941  C CD2  . LEU A 1 33 ? -6.767  1.170   2.254   1.00 0.68 ? 33  LEU A CD2  5  
ATOM   5942  H H    . LEU A 1 33 ? -5.933  3.798   4.378   1.00 0.29 ? 33  LEU A H    5  
ATOM   5943  H HA   . LEU A 1 33 ? -8.075  2.004   4.591   1.00 0.35 ? 33  LEU A HA   5  
ATOM   5944  H HB2  . LEU A 1 33 ? -5.200  1.428   5.294   1.00 0.42 ? 33  LEU A HB2  5  
ATOM   5945  H HB3  . LEU A 1 33 ? -6.412  0.271   4.785   1.00 0.50 ? 33  LEU A HB3  5  
ATOM   5946  H HG   . LEU A 1 33 ? -5.289  2.469   3.044   1.00 0.46 ? 33  LEU A HG   5  
ATOM   5947  H HD11 . LEU A 1 33 ? -4.728  -0.490  3.077   1.00 1.08 ? 33  LEU A HD11 5  
ATOM   5948  H HD12 . LEU A 1 33 ? -3.608  0.792   3.540   1.00 1.05 ? 33  LEU A HD12 5  
ATOM   5949  H HD13 . LEU A 1 33 ? -4.149  0.653   1.866   1.00 1.03 ? 33  LEU A HD13 5  
ATOM   5950  H HD21 . LEU A 1 33 ? -7.113  0.158   2.401   1.00 1.04 ? 33  LEU A HD21 5  
ATOM   5951  H HD22 . LEU A 1 33 ? -6.432  1.292   1.234   1.00 0.99 ? 33  LEU A HD22 5  
ATOM   5952  H HD23 . LEU A 1 33 ? -7.573  1.859   2.456   1.00 0.89 ? 33  LEU A HD23 5  
ATOM   5953  N N    . GLN A 1 34 ? -6.560  2.688   7.420   1.00 0.26 ? 34  GLN A N    5  
ATOM   5954  C CA   . GLN A 1 34 ? -6.661  2.589   8.867   1.00 0.31 ? 34  GLN A CA   5  
ATOM   5955  C C    . GLN A 1 34 ? -7.934  3.242   9.401   1.00 0.29 ? 34  GLN A C    5  
ATOM   5956  O O    . GLN A 1 34 ? -8.686  2.622   10.159  1.00 0.38 ? 34  GLN A O    5  
ATOM   5957  C CB   . GLN A 1 34 ? -5.437  3.229   9.522   1.00 0.42 ? 34  GLN A CB   5  
ATOM   5958  C CG   . GLN A 1 34 ? -4.199  2.348   9.508   1.00 0.72 ? 34  GLN A CG   5  
ATOM   5959  C CD   . GLN A 1 34 ? -2.985  3.027   10.123  1.00 1.04 ? 34  GLN A CD   5  
ATOM   5960  O OE1  . GLN A 1 34 ? -2.791  4.238   9.988   1.00 1.62 ? 34  GLN A OE1  5  
ATOM   5961  N NE2  . GLN A 1 34 ? -2.164  2.253   10.813  1.00 1.51 ? 34  GLN A NE2  5  
ATOM   5962  H H    . GLN A 1 34 ? -5.843  3.233   7.027   1.00 0.29 ? 34  GLN A H    5  
ATOM   5963  H HA   . GLN A 1 34 ? -6.683  1.541   9.121   1.00 0.36 ? 34  GLN A HA   5  
ATOM   5964  H HB2  . GLN A 1 34 ? -5.206  4.145   9.000   1.00 0.67 ? 34  GLN A HB2  5  
ATOM   5965  H HB3  . GLN A 1 34 ? -5.676  3.462   10.548  1.00 0.61 ? 34  GLN A HB3  5  
ATOM   5966  H HG2  . GLN A 1 34 ? -4.412  1.449   10.067  1.00 1.27 ? 34  GLN A HG2  5  
ATOM   5967  H HG3  . GLN A 1 34 ? -3.971  2.087   8.485   1.00 1.25 ? 34  GLN A HG3  5  
ATOM   5968  H HE21 . GLN A 1 34 ? -2.382  1.301   10.889  1.00 1.73 ? 34  GLN A HE21 5  
ATOM   5969  H HE22 . GLN A 1 34 ? -1.375  2.665   11.226  1.00 1.94 ? 34  GLN A HE22 5  
ATOM   5970  N N    . LYS A 1 35 ? -8.192  4.479   8.991   1.00 0.29 ? 35  LYS A N    5  
ATOM   5971  C CA   . LYS A 1 35 ? -9.360  5.214   9.470   1.00 0.37 ? 35  LYS A CA   5  
ATOM   5972  C C    . LYS A 1 35 ? -10.672 4.634   8.940   1.00 0.32 ? 35  LYS A C    5  
ATOM   5973  O O    . LYS A 1 35 ? -11.732 4.848   9.530   1.00 0.36 ? 35  LYS A O    5  
ATOM   5974  C CB   . LYS A 1 35 ? -9.248  6.698   9.106   1.00 0.50 ? 35  LYS A CB   5  
ATOM   5975  C CG   . LYS A 1 35 ? -9.708  7.034   7.694   1.00 0.67 ? 35  LYS A CG   5  
ATOM   5976  C CD   . LYS A 1 35 ? -9.702  8.533   7.453   1.00 0.77 ? 35  LYS A CD   5  
ATOM   5977  C CE   . LYS A 1 35 ? -10.773 8.940   6.450   1.00 1.00 ? 35  LYS A CE   5  
ATOM   5978  N NZ   . LYS A 1 35 ? -12.148 8.659   6.949   1.00 1.37 ? 35  LYS A NZ   5  
ATOM   5979  H H    . LYS A 1 35 ? -7.576  4.918   8.356   1.00 0.33 ? 35  LYS A H    5  
ATOM   5980  H HA   . LYS A 1 35 ? -9.369  5.129   10.546  1.00 0.45 ? 35  LYS A HA   5  
ATOM   5981  H HB2  . LYS A 1 35 ? -9.845  7.270   9.799   1.00 0.88 ? 35  LYS A HB2  5  
ATOM   5982  H HB3  . LYS A 1 35 ? -8.215  7.001   9.204   1.00 1.00 ? 35  LYS A HB3  5  
ATOM   5983  H HG2  . LYS A 1 35 ? -9.043  6.562   6.986   1.00 1.20 ? 35  LYS A HG2  5  
ATOM   5984  H HG3  . LYS A 1 35 ? -10.710 6.658   7.554   1.00 1.10 ? 35  LYS A HG3  5  
ATOM   5985  H HD2  . LYS A 1 35 ? -9.888  9.038   8.388   1.00 1.19 ? 35  LYS A HD2  5  
ATOM   5986  H HD3  . LYS A 1 35 ? -8.733  8.823   7.071   1.00 1.15 ? 35  LYS A HD3  5  
ATOM   5987  H HE2  . LYS A 1 35 ? -10.681 9.997   6.254   1.00 1.52 ? 35  LYS A HE2  5  
ATOM   5988  H HE3  . LYS A 1 35 ? -10.613 8.391   5.535   1.00 1.60 ? 35  LYS A HE3  5  
ATOM   5989  H HZ1  . LYS A 1 35 ? -12.367 7.640   6.848   1.00 1.85 ? 35  LYS A HZ1  5  
ATOM   5990  H HZ2  . LYS A 1 35 ? -12.844 9.207   6.406   1.00 1.75 ? 35  LYS A HZ2  5  
ATOM   5991  H HZ3  . LYS A 1 35 ? -12.227 8.920   7.953   1.00 1.76 ? 35  LYS A HZ3  5  
ATOM   5992  N N    . GLU A 1 36 ? -10.610 3.898   7.840   1.00 0.29 ? 36  GLU A N    5  
ATOM   5993  C CA   . GLU A 1 36 ? -11.818 3.311   7.263   1.00 0.31 ? 36  GLU A CA   5  
ATOM   5994  C C    . GLU A 1 36 ? -12.118 1.946   7.875   1.00 0.29 ? 36  GLU A C    5  
ATOM   5995  O O    . GLU A 1 36 ? -13.046 1.256   7.453   1.00 0.39 ? 36  GLU A O    5  
ATOM   5996  C CB   . GLU A 1 36 ? -11.704 3.203   5.743   1.00 0.37 ? 36  GLU A CB   5  
ATOM   5997  C CG   . GLU A 1 36 ? -11.779 4.549   5.034   1.00 0.43 ? 36  GLU A CG   5  
ATOM   5998  C CD   . GLU A 1 36 ? -12.913 5.418   5.542   1.00 0.64 ? 36  GLU A CD   5  
ATOM   5999  O OE1  . GLU A 1 36 ? -14.004 5.400   4.937   1.00 1.30 ? 36  GLU A OE1  5  
ATOM   6000  O OE2  . GLU A 1 36 ? -12.719 6.134   6.547   1.00 1.21 ? 36  GLU A OE2  5  
ATOM   6001  H H    . GLU A 1 36 ? -9.743  3.757   7.399   1.00 0.32 ? 36  GLU A H    5  
ATOM   6002  H HA   . GLU A 1 36 ? -12.637 3.972   7.501   1.00 0.38 ? 36  GLU A HA   5  
ATOM   6003  H HB2  . GLU A 1 36 ? -10.763 2.737   5.493   1.00 0.40 ? 36  GLU A HB2  5  
ATOM   6004  H HB3  . GLU A 1 36 ? -12.510 2.584   5.378   1.00 0.47 ? 36  GLU A HB3  5  
ATOM   6005  H HG2  . GLU A 1 36 ? -10.849 5.075   5.187   1.00 0.46 ? 36  GLU A HG2  5  
ATOM   6006  H HG3  . GLU A 1 36 ? -11.924 4.378   3.977   1.00 0.50 ? 36  GLU A HG3  5  
ATOM   6007  N N    . GLY A 1 37 ? -11.316 1.557   8.859   1.00 0.27 ? 37  GLY A N    5  
ATOM   6008  C CA   . GLY A 1 37 ? -11.524 0.293   9.538   1.00 0.30 ? 37  GLY A CA   5  
ATOM   6009  C C    . GLY A 1 37 ? -11.053 -0.904  8.736   1.00 0.29 ? 37  GLY A C    5  
ATOM   6010  O O    . GLY A 1 37 ? -11.316 -2.046  9.110   1.00 0.41 ? 37  GLY A O    5  
ATOM   6011  H H    . GLY A 1 37 ? -10.575 2.139   9.133   1.00 0.30 ? 37  GLY A H    5  
ATOM   6012  H HA2  . GLY A 1 37 ? -10.989 0.313   10.475  1.00 0.33 ? 37  GLY A HA2  5  
ATOM   6013  H HA3  . GLY A 1 37 ? -12.577 0.182   9.743   1.00 0.35 ? 37  GLY A HA3  5  
ATOM   6014  N N    . LEU A 1 38 ? -10.356 -0.651  7.637   1.00 0.25 ? 38  LEU A N    5  
ATOM   6015  C CA   . LEU A 1 38 ? -9.850  -1.729  6.797   1.00 0.28 ? 38  LEU A CA   5  
ATOM   6016  C C    . LEU A 1 38 ? -8.608  -2.340  7.422   1.00 0.32 ? 38  LEU A C    5  
ATOM   6017  O O    . LEU A 1 38 ? -8.385  -3.548  7.338   1.00 0.46 ? 38  LEU A O    5  
ATOM   6018  C CB   . LEU A 1 38 ? -9.538  -1.220  5.388   1.00 0.31 ? 38  LEU A CB   5  
ATOM   6019  C CG   . LEU A 1 38 ? -10.761 -0.867  4.540   1.00 0.40 ? 38  LEU A CG   5  
ATOM   6020  C CD1  . LEU A 1 38 ? -10.334 -0.203  3.240   1.00 0.51 ? 38  LEU A CD1  5  
ATOM   6021  C CD2  . LEU A 1 38 ? -11.591 -2.112  4.256   1.00 0.50 ? 38  LEU A CD2  5  
ATOM   6022  H H    . LEU A 1 38 ? -10.174 0.281   7.388   1.00 0.29 ? 38  LEU A H    5  
ATOM   6023  H HA   . LEU A 1 38 ? -10.615 -2.489  6.736   1.00 0.34 ? 38  LEU A HA   5  
ATOM   6024  H HB2  . LEU A 1 38 ? -8.919  -0.339  5.476   1.00 0.34 ? 38  LEU A HB2  5  
ATOM   6025  H HB3  . LEU A 1 38 ? -8.977  -1.982  4.869   1.00 0.35 ? 38  LEU A HB3  5  
ATOM   6026  H HG   . LEU A 1 38 ? -11.381 -0.167  5.084   1.00 0.47 ? 38  LEU A HG   5  
ATOM   6027  H HD11 . LEU A 1 38 ? -9.672  -0.866  2.701   1.00 0.74 ? 38  LEU A HD11 5  
ATOM   6028  H HD12 . LEU A 1 38 ? -9.817  0.721   3.462   1.00 0.78 ? 38  LEU A HD12 5  
ATOM   6029  H HD13 . LEU A 1 38 ? -11.206 0.006   2.638   1.00 0.79 ? 38  LEU A HD13 5  
ATOM   6030  H HD21 . LEU A 1 38 ? -12.414 -1.855  3.605   1.00 0.77 ? 38  LEU A HD21 5  
ATOM   6031  H HD22 . LEU A 1 38 ? -11.976 -2.511  5.183   1.00 0.67 ? 38  LEU A HD22 5  
ATOM   6032  H HD23 . LEU A 1 38 ? -10.971 -2.856  3.775   1.00 0.68 ? 38  LEU A HD23 5  
ATOM   6033  N N    . LEU A 1 39 ? -7.810  -1.500  8.062   1.00 0.31 ? 39  LEU A N    5  
ATOM   6034  C CA   . LEU A 1 39 ? -6.590  -1.951  8.714   1.00 0.40 ? 39  LEU A CA   5  
ATOM   6035  C C    . LEU A 1 39 ? -6.502  -1.402  10.131  1.00 0.39 ? 39  LEU A C    5  
ATOM   6036  O O    . LEU A 1 39 ? -7.191  -0.440  10.478  1.00 0.57 ? 39  LEU A O    5  
ATOM   6037  C CB   . LEU A 1 39 ? -5.361  -1.515  7.913   1.00 0.53 ? 39  LEU A CB   5  
ATOM   6038  C CG   . LEU A 1 39 ? -5.081  -2.333  6.654   1.00 0.67 ? 39  LEU A CG   5  
ATOM   6039  C CD1  . LEU A 1 39 ? -3.832  -1.823  5.954   1.00 0.86 ? 39  LEU A CD1  5  
ATOM   6040  C CD2  . LEU A 1 39 ? -4.940  -3.804  7.002   1.00 0.75 ? 39  LEU A CD2  5  
ATOM   6041  H H    . LEU A 1 39 ? -8.045  -0.548  8.096   1.00 0.31 ? 39  LEU A H    5  
ATOM   6042  H HA   . LEU A 1 39 ? -6.618  -3.029  8.760   1.00 0.47 ? 39  LEU A HA   5  
ATOM   6043  H HB2  . LEU A 1 39 ? -5.494  -0.482  7.620   1.00 0.56 ? 39  LEU A HB2  5  
ATOM   6044  H HB3  . LEU A 1 39 ? -4.497  -1.580  8.557   1.00 0.63 ? 39  LEU A HB3  5  
ATOM   6045  H HG   . LEU A 1 39 ? -5.911  -2.229  5.971   1.00 0.67 ? 39  LEU A HG   5  
ATOM   6046  H HD11 . LEU A 1 39 ? -2.988  -1.894  6.624   1.00 1.10 ? 39  LEU A HD11 5  
ATOM   6047  H HD12 . LEU A 1 39 ? -3.978  -0.793  5.668   1.00 1.10 ? 39  LEU A HD12 5  
ATOM   6048  H HD13 . LEU A 1 39 ? -3.644  -2.419  5.074   1.00 1.09 ? 39  LEU A HD13 5  
ATOM   6049  H HD21 . LEU A 1 39 ? -4.410  -4.310  6.210   1.00 1.19 ? 39  LEU A HD21 5  
ATOM   6050  H HD22 . LEU A 1 39 ? -5.921  -4.240  7.114   1.00 1.13 ? 39  LEU A HD22 5  
ATOM   6051  H HD23 . LEU A 1 39 ? -4.393  -3.906  7.928   1.00 1.12 ? 39  LEU A HD23 5  
ATOM   6052  N N    . MET A 1 40 ? -5.652  -2.014  10.941  1.00 0.35 ? 40  MET A N    5  
ATOM   6053  C CA   . MET A 1 40 ? -5.468  -1.589  12.317  1.00 0.41 ? 40  MET A CA   5  
ATOM   6054  C C    . MET A 1 40 ? -4.057  -1.052  12.513  1.00 0.37 ? 40  MET A C    5  
ATOM   6055  O O    . MET A 1 40 ? -3.862  0.123   12.833  1.00 0.53 ? 40  MET A O    5  
ATOM   6056  C CB   . MET A 1 40 ? -5.731  -2.758  13.276  1.00 0.54 ? 40  MET A CB   5  
ATOM   6057  C CG   . MET A 1 40 ? -5.580  -2.396  14.745  1.00 0.70 ? 40  MET A CG   5  
ATOM   6058  S SD   . MET A 1 40 ? -5.700  -3.829  15.836  1.00 0.94 ? 40  MET A SD   5  
ATOM   6059  C CE   . MET A 1 40 ? -4.207  -4.717  15.391  1.00 1.19 ? 40  MET A CE   5  
ATOM   6060  H H    . MET A 1 40 ? -5.127  -2.775  10.603  1.00 0.44 ? 40  MET A H    5  
ATOM   6061  H HA   . MET A 1 40 ? -6.173  -0.798  12.521  1.00 0.50 ? 40  MET A HA   5  
ATOM   6062  H HB2  . MET A 1 40 ? -6.738  -3.115  13.118  1.00 0.62 ? 40  MET A HB2  5  
ATOM   6063  H HB3  . MET A 1 40 ? -5.036  -3.555  13.050  1.00 0.55 ? 40  MET A HB3  5  
ATOM   6064  H HG2  . MET A 1 40 ? -4.616  -1.934  14.891  1.00 0.73 ? 40  MET A HG2  5  
ATOM   6065  H HG3  . MET A 1 40 ? -6.358  -1.696  15.011  1.00 0.78 ? 40  MET A HG3  5  
ATOM   6066  H HE1  . MET A 1 40 ? -3.352  -4.066  15.509  1.00 1.40 ? 40  MET A HE1  5  
ATOM   6067  H HE2  . MET A 1 40 ? -4.273  -5.041  14.365  1.00 1.50 ? 40  MET A HE2  5  
ATOM   6068  H HE3  . MET A 1 40 ? -4.095  -5.577  16.032  1.00 1.50 ? 40  MET A HE3  5  
ATOM   6069  N N    . SER A 1 41 ? -3.076  -1.906  12.278  1.00 0.33 ? 41  SER A N    5  
ATOM   6070  C CA   . SER A 1 41 ? -1.684  -1.530  12.441  1.00 0.39 ? 41  SER A CA   5  
ATOM   6071  C C    . SER A 1 41 ? -1.013  -1.332  11.084  1.00 0.34 ? 41  SER A C    5  
ATOM   6072  O O    . SER A 1 41 ? -1.438  -1.909  10.084  1.00 0.31 ? 41  SER A O    5  
ATOM   6073  C CB   . SER A 1 41 ? -0.956  -2.606  13.247  1.00 0.50 ? 41  SER A CB   5  
ATOM   6074  O OG   . SER A 1 41 ? -1.649  -2.884  14.449  1.00 0.87 ? 41  SER A OG   5  
ATOM   6075  H H    . SER A 1 41 ? -3.292  -2.820  11.973  1.00 0.38 ? 41  SER A H    5  
ATOM   6076  H HA   . SER A 1 41 ? -1.654  -0.598  12.984  1.00 0.51 ? 41  SER A HA   5  
ATOM   6077  H HB2  . SER A 1 41 ? -0.895  -3.513  12.664  1.00 0.83 ? 41  SER A HB2  5  
ATOM   6078  H HB3  . SER A 1 41 ? 0.040   -2.264  13.487  1.00 0.81 ? 41  SER A HB3  5  
ATOM   6079  H HG   . SER A 1 41 ? -2.127  -2.095  14.735  1.00 1.39 ? 41  SER A HG   5  
ATOM   6080  N N    . PRO A 1 42 ? 0.038   -0.498  11.027  1.00 0.43 ? 42  PRO A N    5  
ATOM   6081  C CA   . PRO A 1 42 ? 0.768   -0.237  9.778   1.00 0.47 ? 42  PRO A CA   5  
ATOM   6082  C C    . PRO A 1 42 ? 1.505   -1.476  9.272   1.00 0.43 ? 42  PRO A C    5  
ATOM   6083  O O    . PRO A 1 42 ? 1.788   -1.608  8.083   1.00 0.54 ? 42  PRO A O    5  
ATOM   6084  C CB   . PRO A 1 42 ? 1.771   0.853   10.171  1.00 0.61 ? 42  PRO A CB   5  
ATOM   6085  C CG   . PRO A 1 42 ? 1.921   0.735   11.650  1.00 0.65 ? 42  PRO A CG   5  
ATOM   6086  C CD   . PRO A 1 42 ? 0.589   0.272   12.163  1.00 0.57 ? 42  PRO A CD   5  
ATOM   6087  H HA   . PRO A 1 42 ? 0.111   0.133   9.004   1.00 0.51 ? 42  PRO A HA   5  
ATOM   6088  H HB2  . PRO A 1 42 ? 2.715   0.679   9.671   1.00 0.65 ? 42  PRO A HB2  5  
ATOM   6089  H HB3  . PRO A 1 42 ? 1.384   1.825   9.913   1.00 0.73 ? 42  PRO A HB3  5  
ATOM   6090  H HG2  . PRO A 1 42 ? 2.692   0.012   11.883  1.00 0.67 ? 42  PRO A HG2  5  
ATOM   6091  H HG3  . PRO A 1 42 ? 2.164   1.696   12.075  1.00 0.81 ? 42  PRO A HG3  5  
ATOM   6092  H HD2  . PRO A 1 42 ? 0.717   -0.357  13.029  1.00 0.58 ? 42  PRO A HD2  5  
ATOM   6093  H HD3  . PRO A 1 42 ? -0.039  1.120   12.397  1.00 0.68 ? 42  PRO A HD3  5  
ATOM   6094  N N    . SER A 1 43 ? 1.801   -2.385  10.190  1.00 0.36 ? 43  SER A N    5  
ATOM   6095  C CA   . SER A 1 43 ? 2.507   -3.615  9.864   1.00 0.41 ? 43  SER A CA   5  
ATOM   6096  C C    . SER A 1 43 ? 1.537   -4.709  9.417   1.00 0.36 ? 43  SER A C    5  
ATOM   6097  O O    . SER A 1 43 ? 1.929   -5.860  9.229   1.00 0.40 ? 43  SER A O    5  
ATOM   6098  C CB   . SER A 1 43 ? 3.301   -4.075  11.086  1.00 0.54 ? 43  SER A CB   5  
ATOM   6099  O OG   . SER A 1 43 ? 3.719   -2.957  11.857  1.00 0.69 ? 43  SER A OG   5  
ATOM   6100  H H    . SER A 1 43 ? 1.553   -2.217  11.121  1.00 0.38 ? 43  SER A H    5  
ATOM   6101  H HA   . SER A 1 43 ? 3.193   -3.402  9.058   1.00 0.49 ? 43  SER A HA   5  
ATOM   6102  H HB2  . SER A 1 43 ? 2.681   -4.711  11.700  1.00 0.70 ? 43  SER A HB2  5  
ATOM   6103  H HB3  . SER A 1 43 ? 4.174   -4.622  10.762  1.00 0.75 ? 43  SER A HB3  5  
ATOM   6104  H HG   . SER A 1 43 ? 3.846   -3.229  12.773  1.00 1.10 ? 43  SER A HG   5  
ATOM   6105  N N    . ASP A 1 44 ? 0.272   -4.339  9.225   1.00 0.32 ? 44  ASP A N    5  
ATOM   6106  C CA   . ASP A 1 44 ? -0.751  -5.291  8.795   1.00 0.32 ? 44  ASP A CA   5  
ATOM   6107  C C    . ASP A 1 44 ? -0.577  -5.652  7.323   1.00 0.29 ? 44  ASP A C    5  
ATOM   6108  O O    . ASP A 1 44 ? -1.178  -6.605  6.829   1.00 0.31 ? 44  ASP A O    5  
ATOM   6109  C CB   . ASP A 1 44 ? -2.155  -4.719  9.014   1.00 0.39 ? 44  ASP A CB   5  
ATOM   6110  C CG   . ASP A 1 44 ? -2.766  -5.131  10.339  1.00 0.54 ? 44  ASP A CG   5  
ATOM   6111  O OD1  . ASP A 1 44 ? -2.481  -6.258  10.808  1.00 0.87 ? 44  ASP A OD1  5  
ATOM   6112  O OD2  . ASP A 1 44 ? -3.555  -4.339  10.906  1.00 0.69 ? 44  ASP A OD2  5  
ATOM   6113  H H    . ASP A 1 44 ? 0.019   -3.403  9.379   1.00 0.35 ? 44  ASP A H    5  
ATOM   6114  H HA   . ASP A 1 44 ? -0.639  -6.186  9.388   1.00 0.40 ? 44  ASP A HA   5  
ATOM   6115  H HB2  . ASP A 1 44 ? -2.103  -3.641  8.988   1.00 0.46 ? 44  ASP A HB2  5  
ATOM   6116  H HB3  . ASP A 1 44 ? -2.799  -5.061  8.218   1.00 0.52 ? 44  ASP A HB3  5  
ATOM   6117  N N    . LEU A 1 45 ? 0.258   -4.885  6.627   1.00 0.31 ? 45  LEU A N    5  
ATOM   6118  C CA   . LEU A 1 45 ? 0.515   -5.114  5.208   1.00 0.36 ? 45  LEU A CA   5  
ATOM   6119  C C    . LEU A 1 45 ? 1.294   -6.407  4.993   1.00 0.34 ? 45  LEU A C    5  
ATOM   6120  O O    . LEU A 1 45 ? 1.342   -6.932  3.883   1.00 0.38 ? 45  LEU A O    5  
ATOM   6121  C CB   . LEU A 1 45 ? 1.293   -3.940  4.604   1.00 0.45 ? 45  LEU A CB   5  
ATOM   6122  C CG   . LEU A 1 45 ? 0.464   -2.937  3.800   1.00 0.60 ? 45  LEU A CG   5  
ATOM   6123  C CD1  . LEU A 1 45 ? -0.344  -3.644  2.726   1.00 0.96 ? 45  LEU A CD1  5  
ATOM   6124  C CD2  . LEU A 1 45 ? -0.447  -2.136  4.719   1.00 0.98 ? 45  LEU A CD2  5  
ATOM   6125  H H    . LEU A 1 45 ? 0.717   -4.146  7.082   1.00 0.35 ? 45  LEU A H    5  
ATOM   6126  H HA   . LEU A 1 45 ? -0.438  -5.197  4.709   1.00 0.41 ? 45  LEU A HA   5  
ATOM   6127  H HB2  . LEU A 1 45 ? 1.771   -3.407  5.408   1.00 0.60 ? 45  LEU A HB2  5  
ATOM   6128  H HB3  . LEU A 1 45 ? 2.056   -4.339  3.955   1.00 0.54 ? 45  LEU A HB3  5  
ATOM   6129  H HG   . LEU A 1 45 ? 1.131   -2.242  3.308   1.00 0.84 ? 45  LEU A HG   5  
ATOM   6130  H HD11 . LEU A 1 45 ? -1.218  -4.096  3.171   1.00 1.37 ? 45  LEU A HD11 5  
ATOM   6131  H HD12 . LEU A 1 45 ? 0.264   -4.411  2.266   1.00 1.34 ? 45  LEU A HD12 5  
ATOM   6132  H HD13 . LEU A 1 45 ? -0.648  -2.928  1.978   1.00 1.38 ? 45  LEU A HD13 5  
ATOM   6133  H HD21 . LEU A 1 45 ? -1.108  -1.526  4.123   1.00 1.28 ? 45  LEU A HD21 5  
ATOM   6134  H HD22 . LEU A 1 45 ? 0.152   -1.504  5.356   1.00 1.36 ? 45  LEU A HD22 5  
ATOM   6135  H HD23 . LEU A 1 45 ? -1.029  -2.812  5.328   1.00 1.37 ? 45  LEU A HD23 5  
ATOM   6136  N N    . TYR A 1 46 ? 1.892   -6.919  6.064   1.00 0.32 ? 46  TYR A N    5  
ATOM   6137  C CA   . TYR A 1 46 ? 2.678   -8.147  5.993   1.00 0.37 ? 46  TYR A CA   5  
ATOM   6138  C C    . TYR A 1 46 ? 1.782   -9.382  5.996   1.00 0.34 ? 46  TYR A C    5  
ATOM   6139  O O    . TYR A 1 46 ? 2.266   -10.511 5.930   1.00 0.44 ? 46  TYR A O    5  
ATOM   6140  C CB   . TYR A 1 46 ? 3.671   -8.208  7.159   1.00 0.47 ? 46  TYR A CB   5  
ATOM   6141  C CG   . TYR A 1 46 ? 4.868   -7.310  6.972   1.00 0.55 ? 46  TYR A CG   5  
ATOM   6142  C CD1  . TYR A 1 46 ? 5.937   -7.716  6.190   1.00 0.87 ? 46  TYR A CD1  5  
ATOM   6143  C CD2  . TYR A 1 46 ? 4.925   -6.059  7.569   1.00 0.64 ? 46  TYR A CD2  5  
ATOM   6144  C CE1  . TYR A 1 46 ? 7.035   -6.902  6.008   1.00 1.01 ? 46  TYR A CE1  5  
ATOM   6145  C CE2  . TYR A 1 46 ? 6.020   -5.237  7.392   1.00 0.76 ? 46  TYR A CE2  5  
ATOM   6146  C CZ   . TYR A 1 46 ? 7.071   -5.665  6.610   1.00 0.86 ? 46  TYR A CZ   5  
ATOM   6147  O OH   . TYR A 1 46 ? 8.165   -4.855  6.427   1.00 1.05 ? 46  TYR A OH   5  
ATOM   6148  H H    . TYR A 1 46 ? 1.799   -6.461  6.925   1.00 0.33 ? 46  TYR A H    5  
ATOM   6149  H HA   . TYR A 1 46 ? 3.230   -8.129  5.067   1.00 0.43 ? 46  TYR A HA   5  
ATOM   6150  H HB2  . TYR A 1 46 ? 3.172   -7.907  8.067   1.00 0.46 ? 46  TYR A HB2  5  
ATOM   6151  H HB3  . TYR A 1 46 ? 4.030   -9.221  7.267   1.00 0.61 ? 46  TYR A HB3  5  
ATOM   6152  H HD1  . TYR A 1 46 ? 5.904   -8.687  5.720   1.00 1.12 ? 46  TYR A HD1  5  
ATOM   6153  H HD2  . TYR A 1 46 ? 4.099   -5.730  8.181   1.00 0.84 ? 46  TYR A HD2  5  
ATOM   6154  H HE1  . TYR A 1 46 ? 7.858   -7.236  5.396   1.00 1.34 ? 46  TYR A HE1  5  
ATOM   6155  H HE2  . TYR A 1 46 ? 6.049   -4.267  7.867   1.00 0.97 ? 46  TYR A HE2  5  
ATOM   6156  H HH   . TYR A 1 46 ? 8.504   -4.979  5.530   1.00 1.14 ? 46  TYR A HH   5  
ATOM   6157  N N    . SER A 1 47 ? 0.477   -9.161  6.076   1.00 0.31 ? 47  SER A N    5  
ATOM   6158  C CA   . SER A 1 47 ? -0.483  -10.248 6.075   1.00 0.29 ? 47  SER A CA   5  
ATOM   6159  C C    . SER A 1 47 ? -1.083  -10.422 4.677   1.00 0.24 ? 47  SER A C    5  
ATOM   6160  O O    . SER A 1 47 ? -1.959  -9.661  4.268   1.00 0.26 ? 47  SER A O    5  
ATOM   6161  C CB   . SER A 1 47 ? -1.576  -9.975  7.107   1.00 0.36 ? 47  SER A CB   5  
ATOM   6162  O OG   . SER A 1 47 ? -1.029  -9.911  8.417   1.00 0.53 ? 47  SER A OG   5  
ATOM   6163  H H    . SER A 1 47 ? 0.150   -8.238  6.132   1.00 0.37 ? 47  SER A H    5  
ATOM   6164  H HA   . SER A 1 47 ? 0.040   -11.152 6.345   1.00 0.33 ? 47  SER A HA   5  
ATOM   6165  H HB2  . SER A 1 47 ? -2.053  -9.031  6.884   1.00 0.43 ? 47  SER A HB2  5  
ATOM   6166  H HB3  . SER A 1 47 ? -2.309  -10.766 7.073   1.00 0.44 ? 47  SER A HB3  5  
ATOM   6167  H HG   . SER A 1 47 ? -0.479  -10.690 8.569   1.00 1.10 ? 47  SER A HG   5  
ATOM   6168  N N    . PRO A 1 48 ? -0.622  -11.442 3.932   1.00 0.24 ? 48  PRO A N    5  
ATOM   6169  C CA   . PRO A 1 48 ? -1.092  -11.703 2.567   1.00 0.25 ? 48  PRO A CA   5  
ATOM   6170  C C    . PRO A 1 48 ? -2.519  -12.238 2.524   1.00 0.26 ? 48  PRO A C    5  
ATOM   6171  O O    . PRO A 1 48 ? -3.126  -12.320 1.456   1.00 0.32 ? 48  PRO A O    5  
ATOM   6172  C CB   . PRO A 1 48 ? -0.105  -12.749 2.051   1.00 0.31 ? 48  PRO A CB   5  
ATOM   6173  C CG   . PRO A 1 48 ? 0.391   -13.447 3.266   1.00 0.38 ? 48  PRO A CG   5  
ATOM   6174  C CD   . PRO A 1 48 ? 0.389   -12.425 4.367   1.00 0.32 ? 48  PRO A CD   5  
ATOM   6175  H HA   . PRO A 1 48 ? -1.030  -10.815 1.955   1.00 0.26 ? 48  PRO A HA   5  
ATOM   6176  H HB2  . PRO A 1 48 ? -0.614  -13.435 1.385   1.00 0.38 ? 48  PRO A HB2  5  
ATOM   6177  H HB3  . PRO A 1 48 ? 0.713   -12.267 1.540   1.00 0.38 ? 48  PRO A HB3  5  
ATOM   6178  H HG2  . PRO A 1 48 ? -0.268  -14.267 3.511   1.00 0.50 ? 48  PRO A HG2  5  
ATOM   6179  H HG3  . PRO A 1 48 ? 1.394   -13.805 3.101   1.00 0.52 ? 48  PRO A HG3  5  
ATOM   6180  H HD2  . PRO A 1 48 ? 0.105   -12.881 5.304   1.00 0.38 ? 48  PRO A HD2  5  
ATOM   6181  H HD3  . PRO A 1 48 ? 1.363   -11.963 4.453   1.00 0.38 ? 48  PRO A HD3  5  
ATOM   6182  N N    . GLY A 1 49 ? -3.047  -12.599 3.682   1.00 0.28 ? 49  GLY A N    5  
ATOM   6183  C CA   . GLY A 1 49 ? -4.401  -13.110 3.753   1.00 0.33 ? 49  GLY A CA   5  
ATOM   6184  C C    . GLY A 1 49 ? -5.405  -12.032 4.098   1.00 0.32 ? 49  GLY A C    5  
ATOM   6185  O O    . GLY A 1 49 ? -6.573  -12.319 4.360   1.00 0.50 ? 49  GLY A O    5  
ATOM   6186  H H    . GLY A 1 49 ? -2.508  -12.531 4.501   1.00 0.30 ? 49  GLY A H    5  
ATOM   6187  H HA2  . GLY A 1 49 ? -4.663  -13.538 2.797   1.00 0.35 ? 49  GLY A HA2  5  
ATOM   6188  H HA3  . GLY A 1 49 ? -4.444  -13.882 4.505   1.00 0.38 ? 49  GLY A HA3  5  
ATOM   6189  N N    . SER A 1 50 ? -4.950  -10.787 4.104   1.00 0.25 ? 50  SER A N    5  
ATOM   6190  C CA   . SER A 1 50 ? -5.815  -9.663  4.419   1.00 0.27 ? 50  SER A CA   5  
ATOM   6191  C C    . SER A 1 50 ? -5.784  -8.624  3.299   1.00 0.22 ? 50  SER A C    5  
ATOM   6192  O O    . SER A 1 50 ? -6.307  -7.522  3.448   1.00 0.28 ? 50  SER A O    5  
ATOM   6193  C CB   . SER A 1 50 ? -5.382  -9.029  5.741   1.00 0.35 ? 50  SER A CB   5  
ATOM   6194  O OG   . SER A 1 50 ? -5.303  -10.003 6.774   1.00 0.47 ? 50  SER A OG   5  
ATOM   6195  H H    . SER A 1 50 ? -4.007  -10.622 3.899   1.00 0.31 ? 50  SER A H    5  
ATOM   6196  H HA   . SER A 1 50 ? -6.822  -10.040 4.522   1.00 0.32 ? 50  SER A HA   5  
ATOM   6197  H HB2  . SER A 1 50 ? -4.408  -8.579  5.617   1.00 0.45 ? 50  SER A HB2  5  
ATOM   6198  H HB3  . SER A 1 50 ? -6.096  -8.271  6.030   1.00 0.45 ? 50  SER A HB3  5  
ATOM   6199  H HG   . SER A 1 50 ? -6.079  -9.927  7.345   1.00 0.93 ? 50  SER A HG   5  
ATOM   6200  N N    . TRP A 1 51 ? -5.185  -8.993  2.173   1.00 0.20 ? 51  TRP A N    5  
ATOM   6201  C CA   . TRP A 1 51 ? -5.073  -8.090  1.034   1.00 0.20 ? 51  TRP A CA   5  
ATOM   6202  C C    . TRP A 1 51 ? -6.376  -8.049  0.241   1.00 0.19 ? 51  TRP A C    5  
ATOM   6203  O O    . TRP A 1 51 ? -6.787  -6.994  -0.248  1.00 0.23 ? 51  TRP A O    5  
ATOM   6204  C CB   . TRP A 1 51 ? -3.928  -8.527  0.114   1.00 0.23 ? 51  TRP A CB   5  
ATOM   6205  C CG   . TRP A 1 51 ? -2.561  -8.350  0.705   1.00 0.24 ? 51  TRP A CG   5  
ATOM   6206  C CD1  . TRP A 1 51 ? -2.205  -7.529  1.738   1.00 0.25 ? 51  TRP A CD1  5  
ATOM   6207  C CD2  . TRP A 1 51 ? -1.358  -9.002  0.281   1.00 0.27 ? 51  TRP A CD2  5  
ATOM   6208  N NE1  . TRP A 1 51 ? -0.857  -7.638  1.984   1.00 0.28 ? 51  TRP A NE1  5  
ATOM   6209  C CE2  . TRP A 1 51 ? -0.317  -8.533  1.103   1.00 0.29 ? 51  TRP A CE2  5  
ATOM   6210  C CE3  . TRP A 1 51 ? -1.060  -9.940  -0.712  1.00 0.30 ? 51  TRP A CE3  5  
ATOM   6211  C CZ2  . TRP A 1 51 ? 0.995   -8.967  0.963   1.00 0.33 ? 51  TRP A CZ2  5  
ATOM   6212  C CZ3  . TRP A 1 51 ? 0.246   -10.368 -0.851  1.00 0.34 ? 51  TRP A CZ3  5  
ATOM   6213  C CH2  . TRP A 1 51 ? 1.258   -9.885  -0.016  1.00 0.35 ? 51  TRP A CH2  5  
ATOM   6214  H H    . TRP A 1 51 ? -4.817  -9.899  2.103   1.00 0.26 ? 51  TRP A H    5  
ATOM   6215  H HA   . TRP A 1 51 ? -4.863  -7.102  1.412   1.00 0.22 ? 51  TRP A HA   5  
ATOM   6216  H HB2  . TRP A 1 51 ? -4.049  -9.572  -0.127  1.00 0.25 ? 51  TRP A HB2  5  
ATOM   6217  H HB3  . TRP A 1 51 ? -3.972  -7.949  -0.798  1.00 0.27 ? 51  TRP A HB3  5  
ATOM   6218  H HD1  . TRP A 1 51 ? -2.893  -6.897  2.276   1.00 0.26 ? 51  TRP A HD1  5  
ATOM   6219  H HE1  . TRP A 1 51 ? -0.360  -7.151  2.681   1.00 0.31 ? 51  TRP A HE1  5  
ATOM   6220  H HE3  . TRP A 1 51 ? -1.830  -10.326 -1.367  1.00 0.31 ? 51  TRP A HE3  5  
ATOM   6221  H HZ2  . TRP A 1 51 ? 1.788   -8.601  1.601   1.00 0.35 ? 51  TRP A HZ2  5  
ATOM   6222  H HZ3  . TRP A 1 51 ? 0.497   -11.091 -1.612  1.00 0.38 ? 51  TRP A HZ3  5  
ATOM   6223  H HH2  . TRP A 1 51 ? 2.264   -10.246 -0.165  1.00 0.39 ? 51  TRP A HH2  5  
ATOM   6224  N N    . ASP A 1 52 ? -7.025  -9.200  0.136   1.00 0.23 ? 52  ASP A N    5  
ATOM   6225  C CA   . ASP A 1 52 ? -8.273  -9.336  -0.618  1.00 0.27 ? 52  ASP A CA   5  
ATOM   6226  C C    . ASP A 1 52 ? -9.357  -8.357  -0.157  1.00 0.24 ? 52  ASP A C    5  
ATOM   6227  O O    . ASP A 1 52 ? -9.849  -7.571  -0.971  1.00 0.24 ? 52  ASP A O    5  
ATOM   6228  C CB   . ASP A 1 52 ? -8.796  -10.776 -0.542  1.00 0.37 ? 52  ASP A CB   5  
ATOM   6229  C CG   . ASP A 1 52 ? -8.118  -11.692 -1.535  1.00 0.85 ? 52  ASP A CG   5  
ATOM   6230  O OD1  . ASP A 1 52 ? -8.467  -11.638 -2.735  1.00 1.49 ? 52  ASP A OD1  5  
ATOM   6231  O OD2  . ASP A 1 52 ? -7.236  -12.477 -1.119  1.00 1.39 ? 52  ASP A OD2  5  
ATOM   6232  H H    . ASP A 1 52 ? -6.654  -9.992  0.582   1.00 0.27 ? 52  ASP A H    5  
ATOM   6233  H HA   . ASP A 1 52 ? -8.044  -9.115  -1.652  1.00 0.30 ? 52  ASP A HA   5  
ATOM   6234  H HB2  . ASP A 1 52 ? -8.621  -11.162 0.451   1.00 0.74 ? 52  ASP A HB2  5  
ATOM   6235  H HB3  . ASP A 1 52 ? -9.857  -10.780 -0.741  1.00 0.74 ? 52  ASP A HB3  5  
ATOM   6236  N N    . PRO A 1 53 ? -9.747  -8.368  1.140   1.00 0.23 ? 53  PRO A N    5  
ATOM   6237  C CA   . PRO A 1 53 ? -10.790 -7.468  1.652   1.00 0.24 ? 53  PRO A CA   5  
ATOM   6238  C C    . PRO A 1 53 ? -10.498 -5.995  1.371   1.00 0.21 ? 53  PRO A C    5  
ATOM   6239  O O    . PRO A 1 53 ? -11.412 -5.212  1.122   1.00 0.24 ? 53  PRO A O    5  
ATOM   6240  C CB   . PRO A 1 53 ? -10.801 -7.731  3.165   1.00 0.29 ? 53  PRO A CB   5  
ATOM   6241  C CG   . PRO A 1 53 ? -9.549  -8.482  3.456   1.00 0.33 ? 53  PRO A CG   5  
ATOM   6242  C CD   . PRO A 1 53 ? -9.223  -9.244  2.208   1.00 0.28 ? 53  PRO A CD   5  
ATOM   6243  H HA   . PRO A 1 53 ? -11.755 -7.719  1.238   1.00 0.27 ? 53  PRO A HA   5  
ATOM   6244  H HB2  . PRO A 1 53 ? -10.819 -6.789  3.699   1.00 0.34 ? 53  PRO A HB2  5  
ATOM   6245  H HB3  . PRO A 1 53 ? -11.659 -8.326  3.429   1.00 0.34 ? 53  PRO A HB3  5  
ATOM   6246  H HG2  . PRO A 1 53 ? -8.756  -7.788  3.696   1.00 0.41 ? 53  PRO A HG2  5  
ATOM   6247  H HG3  . PRO A 1 53 ? -9.710  -9.167  4.273   1.00 0.44 ? 53  PRO A HG3  5  
ATOM   6248  H HD2  . PRO A 1 53 ? -8.155  -9.376  2.115   1.00 0.29 ? 53  PRO A HD2  5  
ATOM   6249  H HD3  . PRO A 1 53 ? -9.726  -10.200 2.204   1.00 0.34 ? 53  PRO A HD3  5  
ATOM   6250  N N    . ILE A 1 54 ? -9.225  -5.625  1.400   1.00 0.19 ? 54  ILE A N    5  
ATOM   6251  C CA   . ILE A 1 54 ? -8.829  -4.246  1.151   1.00 0.19 ? 54  ILE A CA   5  
ATOM   6252  C C    . ILE A 1 54 ? -8.915  -3.925  -0.337  1.00 0.16 ? 54  ILE A C    5  
ATOM   6253  O O    . ILE A 1 54 ? -9.493  -2.909  -0.728  1.00 0.17 ? 54  ILE A O    5  
ATOM   6254  C CB   . ILE A 1 54 ? -7.400  -3.969  1.655   1.00 0.22 ? 54  ILE A CB   5  
ATOM   6255  C CG1  . ILE A 1 54 ? -7.278  -4.349  3.131   1.00 0.27 ? 54  ILE A CG1  5  
ATOM   6256  C CG2  . ILE A 1 54 ? -7.041  -2.505  1.452   1.00 0.26 ? 54  ILE A CG2  5  
ATOM   6257  C CD1  . ILE A 1 54 ? -5.854  -4.336  3.645   1.00 0.34 ? 54  ILE A CD1  5  
ATOM   6258  H H    . ILE A 1 54 ? -8.534  -6.295  1.585   1.00 0.19 ? 54  ILE A H    5  
ATOM   6259  H HA   . ILE A 1 54 ? -9.510  -3.600  1.690   1.00 0.23 ? 54  ILE A HA   5  
ATOM   6260  H HB   . ILE A 1 54 ? -6.713  -4.569  1.076   1.00 0.21 ? 54  ILE A HB   5  
ATOM   6261  H HG12 . ILE A 1 54 ? -7.850  -3.650  3.725   1.00 0.31 ? 54  ILE A HG12 5  
ATOM   6262  H HG13 . ILE A 1 54 ? -7.675  -5.343  3.274   1.00 0.27 ? 54  ILE A HG13 5  
ATOM   6263  H HG21 . ILE A 1 54 ? -6.108  -2.290  1.951   1.00 0.58 ? 54  ILE A HG21 5  
ATOM   6264  H HG22 . ILE A 1 54 ? -7.823  -1.884  1.861   1.00 0.60 ? 54  ILE A HG22 5  
ATOM   6265  H HG23 . ILE A 1 54 ? -6.938  -2.306  0.396   1.00 0.58 ? 54  ILE A HG23 5  
ATOM   6266  H HD11 . ILE A 1 54 ? -5.846  -4.619  4.688   1.00 0.71 ? 54  ILE A HD11 5  
ATOM   6267  H HD12 . ILE A 1 54 ? -5.440  -3.343  3.539   1.00 0.68 ? 54  ILE A HD12 5  
ATOM   6268  H HD13 . ILE A 1 54 ? -5.261  -5.037  3.078   1.00 0.71 ? 54  ILE A HD13 5  
ATOM   6269  N N    . THR A 1 55 ? -8.351  -4.804  -1.162  1.00 0.15 ? 55  THR A N    5  
ATOM   6270  C CA   . THR A 1 55 ? -8.365  -4.621  -2.609  1.00 0.17 ? 55  THR A CA   5  
ATOM   6271  C C    . THR A 1 55 ? -9.797  -4.484  -3.120  1.00 0.17 ? 55  THR A C    5  
ATOM   6272  O O    . THR A 1 55 ? -10.105 -3.590  -3.908  1.00 0.19 ? 55  THR A O    5  
ATOM   6273  C CB   . THR A 1 55 ? -7.672  -5.800  -3.328  1.00 0.20 ? 55  THR A CB   5  
ATOM   6274  O OG1  . THR A 1 55 ? -6.401  -6.068  -2.714  1.00 0.20 ? 55  THR A OG1  5  
ATOM   6275  C CG2  . THR A 1 55 ? -7.464  -5.494  -4.805  1.00 0.27 ? 55  THR A CG2  5  
ATOM   6276  H H    . THR A 1 55 ? -7.909  -5.597  -0.784  1.00 0.16 ? 55  THR A H    5  
ATOM   6277  H HA   . THR A 1 55 ? -7.824  -3.716  -2.838  1.00 0.19 ? 55  THR A HA   5  
ATOM   6278  H HB   . THR A 1 55 ? -8.302  -6.676  -3.240  1.00 0.22 ? 55  THR A HB   5  
ATOM   6279  H HG1  . THR A 1 55 ? -6.542  -6.534  -1.880  1.00 0.26 ? 55  THR A HG1  5  
ATOM   6280  H HG21 . THR A 1 55 ? -7.038  -6.357  -5.293  1.00 0.49 ? 55  THR A HG21 5  
ATOM   6281  H HG22 . THR A 1 55 ? -6.793  -4.654  -4.905  1.00 0.48 ? 55  THR A HG22 5  
ATOM   6282  H HG23 . THR A 1 55 ? -8.413  -5.253  -5.261  1.00 0.46 ? 55  THR A HG23 5  
ATOM   6283  N N    . ALA A 1 56 ? -10.671 -5.361  -2.639  1.00 0.18 ? 56  ALA A N    5  
ATOM   6284  C CA   . ALA A 1 56 ? -12.070 -5.346  -3.037  1.00 0.21 ? 56  ALA A CA   5  
ATOM   6285  C C    . ALA A 1 56 ? -12.751 -4.046  -2.617  1.00 0.20 ? 56  ALA A C    5  
ATOM   6286  O O    . ALA A 1 56 ? -13.450 -3.418  -3.413  1.00 0.24 ? 56  ALA A O    5  
ATOM   6287  C CB   . ALA A 1 56 ? -12.796 -6.540  -2.438  1.00 0.25 ? 56  ALA A CB   5  
ATOM   6288  H H    . ALA A 1 56 ? -10.362 -6.047  -1.999  1.00 0.18 ? 56  ALA A H    5  
ATOM   6289  H HA   . ALA A 1 56 ? -12.111 -5.432  -4.114  1.00 0.23 ? 56  ALA A HA   5  
ATOM   6290  H HB1  . ALA A 1 56 ? -12.734 -6.495  -1.360  1.00 0.42 ? 56  ALA A HB1  5  
ATOM   6291  H HB2  . ALA A 1 56 ? -12.339 -7.455  -2.788  1.00 0.43 ? 56  ALA A HB2  5  
ATOM   6292  H HB3  . ALA A 1 56 ? -13.833 -6.518  -2.737  1.00 0.43 ? 56  ALA A HB3  5  
ATOM   6293  N N    . ALA A 1 57 ? -12.524 -3.635  -1.371  1.00 0.19 ? 57  ALA A N    5  
ATOM   6294  C CA   . ALA A 1 57 ? -13.123 -2.414  -0.843  1.00 0.20 ? 57  ALA A CA   5  
ATOM   6295  C C    . ALA A 1 57 ? -12.659 -1.188  -1.626  1.00 0.19 ? 57  ALA A C    5  
ATOM   6296  O O    . ALA A 1 57 ? -13.459 -0.303  -1.946  1.00 0.22 ? 57  ALA A O    5  
ATOM   6297  C CB   . ALA A 1 57 ? -12.786 -2.255  0.632   1.00 0.23 ? 57  ALA A CB   5  
ATOM   6298  H H    . ALA A 1 57 ? -11.936 -4.168  -0.792  1.00 0.20 ? 57  ALA A H    5  
ATOM   6299  H HA   . ALA A 1 57 ? -14.198 -2.503  -0.935  1.00 0.23 ? 57  ALA A HA   5  
ATOM   6300  H HB1  . ALA A 1 57 ? -13.112 -3.131  1.173   1.00 0.41 ? 57  ALA A HB1  5  
ATOM   6301  H HB2  . ALA A 1 57 ? -13.286 -1.382  1.023   1.00 0.39 ? 57  ALA A HB2  5  
ATOM   6302  H HB3  . ALA A 1 57 ? -11.718 -2.139  0.744   1.00 0.38 ? 57  ALA A HB3  5  
ATOM   6303  N N    . LEU A 1 58 ? -11.367 -1.142  -1.938  1.00 0.18 ? 58  LEU A N    5  
ATOM   6304  C CA   . LEU A 1 58 ? -10.803 -0.025  -2.687  1.00 0.19 ? 58  LEU A CA   5  
ATOM   6305  C C    . LEU A 1 58 ? -11.328 -0.025  -4.114  1.00 0.20 ? 58  LEU A C    5  
ATOM   6306  O O    . LEU A 1 58 ? -11.690 1.020   -4.651  1.00 0.24 ? 58  LEU A O    5  
ATOM   6307  C CB   . LEU A 1 58 ? -9.274  -0.083  -2.686  1.00 0.21 ? 58  LEU A CB   5  
ATOM   6308  C CG   . LEU A 1 58 ? -8.615  0.174   -1.329  1.00 0.37 ? 58  LEU A CG   5  
ATOM   6309  C CD1  . LEU A 1 58 ? -7.107  0.179   -1.471  1.00 0.35 ? 58  LEU A CD1  5  
ATOM   6310  C CD2  . LEU A 1 58 ? -9.098  1.488   -0.729  1.00 0.73 ? 58  LEU A CD2  5  
ATOM   6311  H H    . LEU A 1 58 ? -10.776 -1.876  -1.651  1.00 0.19 ? 58  LEU A H    5  
ATOM   6312  H HA   . LEU A 1 58 ? -11.116 0.888   -2.203  1.00 0.20 ? 58  LEU A HA   5  
ATOM   6313  H HB2  . LEU A 1 58 ? -8.970  -1.062  -3.033  1.00 0.31 ? 58  LEU A HB2  5  
ATOM   6314  H HB3  . LEU A 1 58 ? -8.905  0.655   -3.384  1.00 0.39 ? 58  LEU A HB3  5  
ATOM   6315  H HG   . LEU A 1 58 ? -8.882  -0.621  -0.650  1.00 0.55 ? 58  LEU A HG   5  
ATOM   6316  H HD11 . LEU A 1 58 ? -6.655  0.216   -0.493  1.00 0.71 ? 58  LEU A HD11 5  
ATOM   6317  H HD12 . LEU A 1 58 ? -6.803  1.044   -2.041  1.00 0.67 ? 58  LEU A HD12 5  
ATOM   6318  H HD13 . LEU A 1 58 ? -6.792  -0.717  -1.980  1.00 0.64 ? 58  LEU A HD13 5  
ATOM   6319  H HD21 . LEU A 1 58 ? -10.124 1.382   -0.407  1.00 1.19 ? 58  LEU A HD21 5  
ATOM   6320  H HD22 . LEU A 1 58 ? -9.032  2.269   -1.470  1.00 1.00 ? 58  LEU A HD22 5  
ATOM   6321  H HD23 . LEU A 1 58 ? -8.479  1.745   0.120   1.00 1.19 ? 58  LEU A HD23 5  
ATOM   6322  N N    . SER A 1 59 ? -11.381 -1.207  -4.714  1.00 0.20 ? 59  SER A N    5  
ATOM   6323  C CA   . SER A 1 59 ? -11.877 -1.361  -6.073  1.00 0.23 ? 59  SER A CA   5  
ATOM   6324  C C    . SER A 1 59 ? -13.338 -0.917  -6.145  1.00 0.23 ? 59  SER A C    5  
ATOM   6325  O O    . SER A 1 59 ? -13.759 -0.260  -7.103  1.00 0.25 ? 59  SER A O    5  
ATOM   6326  C CB   . SER A 1 59 ? -11.733 -2.823  -6.516  1.00 0.29 ? 59  SER A CB   5  
ATOM   6327  O OG   . SER A 1 59 ? -12.102 -3.004  -7.874  1.00 0.85 ? 59  SER A OG   5  
ATOM   6328  H H    . SER A 1 59 ? -11.073 -2.004  -4.226  1.00 0.21 ? 59  SER A H    5  
ATOM   6329  H HA   . SER A 1 59 ? -11.285 -0.732  -6.721  1.00 0.25 ? 59  SER A HA   5  
ATOM   6330  H HB2  . SER A 1 59 ? -10.706 -3.133  -6.397  1.00 0.65 ? 59  SER A HB2  5  
ATOM   6331  H HB3  . SER A 1 59 ? -12.368 -3.442  -5.901  1.00 0.73 ? 59  SER A HB3  5  
ATOM   6332  H HG   . SER A 1 59 ? -12.511 -3.874  -7.976  1.00 1.33 ? 59  SER A HG   5  
ATOM   6333  N N    . GLN A 1 60 ? -14.098 -1.256  -5.109  1.00 0.24 ? 60  GLN A N    5  
ATOM   6334  C CA   . GLN A 1 60 ? -15.507 -0.901  -5.032  1.00 0.28 ? 60  GLN A CA   5  
ATOM   6335  C C    . GLN A 1 60 ? -15.694 0.617   -5.017  1.00 0.26 ? 60  GLN A C    5  
ATOM   6336  O O    . GLN A 1 60 ? -16.472 1.159   -5.801  1.00 0.29 ? 60  GLN A O    5  
ATOM   6337  C CB   . GLN A 1 60 ? -16.141 -1.523  -3.788  1.00 0.34 ? 60  GLN A CB   5  
ATOM   6338  C CG   . GLN A 1 60 ? -17.640 -1.301  -3.699  1.00 0.50 ? 60  GLN A CG   5  
ATOM   6339  C CD   . GLN A 1 60 ? -18.277 -2.037  -2.539  1.00 0.63 ? 60  GLN A CD   5  
ATOM   6340  O OE1  . GLN A 1 60 ? -19.426 -2.472  -2.623  1.00 0.92 ? 60  GLN A OE1  5  
ATOM   6341  N NE2  . GLN A 1 60 ? -17.551 -2.164  -1.442  1.00 0.77 ? 60  GLN A NE2  5  
ATOM   6342  H H    . GLN A 1 60 ? -13.697 -1.773  -4.374  1.00 0.25 ? 60  GLN A H    5  
ATOM   6343  H HA   . GLN A 1 60 ? -15.997 -1.300  -5.907  1.00 0.31 ? 60  GLN A HA   5  
ATOM   6344  H HB2  . GLN A 1 60 ? -15.955 -2.586  -3.796  1.00 0.45 ? 60  GLN A HB2  5  
ATOM   6345  H HB3  . GLN A 1 60 ? -15.682 -1.093  -2.912  1.00 0.42 ? 60  GLN A HB3  5  
ATOM   6346  H HG2  . GLN A 1 60 ? -17.827 -0.245  -3.580  1.00 0.61 ? 60  GLN A HG2  5  
ATOM   6347  H HG3  . GLN A 1 60 ? -18.096 -1.645  -4.614  1.00 0.63 ? 60  GLN A HG3  5  
ATOM   6348  H HE21 . GLN A 1 60 ? -16.648 -1.781  -1.435  1.00 0.92 ? 60  GLN A HE21 5  
ATOM   6349  H HE22 . GLN A 1 60 ? -17.943 -2.639  -0.679  1.00 0.90 ? 60  GLN A HE22 5  
ATOM   6350  N N    . ARG A 1 61 ? -14.960 1.306   -4.151  1.00 0.29 ? 61  ARG A N    5  
ATOM   6351  C CA   . ARG A 1 61 ? -15.071 2.759   -4.054  1.00 0.34 ? 61  ARG A CA   5  
ATOM   6352  C C    . ARG A 1 61 ? -14.496 3.434   -5.298  1.00 0.30 ? 61  ARG A C    5  
ATOM   6353  O O    . ARG A 1 61 ? -14.852 4.565   -5.624  1.00 0.34 ? 61  ARG A O    5  
ATOM   6354  C CB   . ARG A 1 61 ? -14.382 3.278   -2.786  1.00 0.45 ? 61  ARG A CB   5  
ATOM   6355  C CG   . ARG A 1 61 ? -12.861 3.272   -2.848  1.00 0.65 ? 61  ARG A CG   5  
ATOM   6356  C CD   . ARG A 1 61 ? -12.252 3.593   -1.492  1.00 0.67 ? 61  ARG A CD   5  
ATOM   6357  N NE   . ARG A 1 61 ? -11.493 4.846   -1.508  1.00 0.81 ? 61  ARG A NE   5  
ATOM   6358  C CZ   . ARG A 1 61 ? -11.883 5.967   -0.901  1.00 1.09 ? 61  ARG A CZ   5  
ATOM   6359  N NH1  . ARG A 1 61 ? -13.025 6.008   -0.227  1.00 1.47 ? 61  ARG A NH1  5  
ATOM   6360  N NH2  . ARG A 1 61 ? -11.110 7.046   -0.947  1.00 1.42 ? 61  ARG A NH2  5  
ATOM   6361  H H    . ARG A 1 61 ? -14.336 0.830   -3.562  1.00 0.30 ? 61  ARG A H    5  
ATOM   6362  H HA   . ARG A 1 61 ? -16.122 3.001   -3.996  1.00 0.40 ? 61  ARG A HA   5  
ATOM   6363  H HB2  . ARG A 1 61 ? -14.706 4.292   -2.607  1.00 0.72 ? 61  ARG A HB2  5  
ATOM   6364  H HB3  . ARG A 1 61 ? -14.687 2.660   -1.951  1.00 0.82 ? 61  ARG A HB3  5  
ATOM   6365  H HG2  . ARG A 1 61 ? -12.526 2.296   -3.162  1.00 1.08 ? 61  ARG A HG2  5  
ATOM   6366  H HG3  . ARG A 1 61 ? -12.538 4.016   -3.563  1.00 1.01 ? 61  ARG A HG3  5  
ATOM   6367  H HD2  . ARG A 1 61 ? -13.046 3.674   -0.768  1.00 0.88 ? 61  ARG A HD2  5  
ATOM   6368  H HD3  . ARG A 1 61 ? -11.590 2.787   -1.210  1.00 0.79 ? 61  ARG A HD3  5  
ATOM   6369  H HE   . ARG A 1 61 ? -10.640 4.851   -2.001  1.00 1.11 ? 61  ARG A HE   5  
ATOM   6370  H HH11 . ARG A 1 61 ? -13.313 6.857   0.227   1.00 1.93 ? 61  ARG A HH11 5  
ATOM   6371  H HH12 . ARG A 1 61 ? -13.604 5.194   -0.160  1.00 1.47 ? 61  ARG A HH12 5  
ATOM   6372  H HH21 . ARG A 1 61 ? -10.225 7.015   -1.439  1.00 1.53 ? 61  ARG A HH21 5  
ATOM   6373  H HH22 . ARG A 1 61 ? -11.397 7.893   -0.493  1.00 1.76 ? 61  ARG A HH22 5  
ATOM   6374  N N    . ALA A 1 62 ? -13.626 2.727   -6.000  1.00 0.27 ? 62  ALA A N    5  
ATOM   6375  C CA   . ALA A 1 62 ? -13.011 3.260   -7.205  1.00 0.29 ? 62  ALA A CA   5  
ATOM   6376  C C    . ALA A 1 62 ? -13.978 3.228   -8.379  1.00 0.30 ? 62  ALA A C    5  
ATOM   6377  O O    . ALA A 1 62 ? -13.981 4.133   -9.215  1.00 0.41 ? 62  ALA A O    5  
ATOM   6378  C CB   . ALA A 1 62 ? -11.756 2.480   -7.538  1.00 0.31 ? 62  ALA A CB   5  
ATOM   6379  H H    . ALA A 1 62 ? -13.376 1.830   -5.693  1.00 0.26 ? 62  ALA A H    5  
ATOM   6380  H HA   . ALA A 1 62 ? -12.730 4.284   -7.009  1.00 0.34 ? 62  ALA A HA   5  
ATOM   6381  H HB1  . ALA A 1 62 ? -12.028 1.550   -8.014  1.00 0.40 ? 62  ALA A HB1  5  
ATOM   6382  H HB2  . ALA A 1 62 ? -11.208 2.273   -6.629  1.00 0.44 ? 62  ALA A HB2  5  
ATOM   6383  H HB3  . ALA A 1 62 ? -11.136 3.061   -8.208  1.00 0.46 ? 62  ALA A HB3  5  
ATOM   6384  N N    . MET A 1 63 ? -14.804 2.191   -8.436  1.00 0.26 ? 63  MET A N    5  
ATOM   6385  C CA   . MET A 1 63 ? -15.763 2.045   -9.524  1.00 0.32 ? 63  MET A CA   5  
ATOM   6386  C C    . MET A 1 63 ? -17.107 2.702   -9.198  1.00 0.32 ? 63  MET A C    5  
ATOM   6387  O O    . MET A 1 63 ? -17.756 3.263   -10.077 1.00 0.42 ? 63  MET A O    5  
ATOM   6388  C CB   . MET A 1 63 ? -15.958 0.563   -9.875  1.00 0.37 ? 63  MET A CB   5  
ATOM   6389  C CG   . MET A 1 63 ? -16.598 -0.267  -8.773  1.00 0.38 ? 63  MET A CG   5  
ATOM   6390  S SD   . MET A 1 63 ? -16.804 -2.002  -9.229  1.00 0.50 ? 63  MET A SD   5  
ATOM   6391  C CE   . MET A 1 63 ? -15.098 -2.520  -9.404  1.00 0.71 ? 63  MET A CE   5  
ATOM   6392  H H    . MET A 1 63 ? -14.755 1.499   -7.739  1.00 0.27 ? 63  MET A H    5  
ATOM   6393  H HA   . MET A 1 63 ? -15.345 2.544   -10.386 1.00 0.36 ? 63  MET A HA   5  
ATOM   6394  H HB2  . MET A 1 63 ? -16.583 0.493   -10.751 1.00 0.43 ? 63  MET A HB2  5  
ATOM   6395  H HB3  . MET A 1 63 ? -14.992 0.135   -10.101 1.00 0.42 ? 63  MET A HB3  5  
ATOM   6396  H HG2  . MET A 1 63 ? -15.974 -0.213  -7.894  1.00 0.38 ? 63  MET A HG2  5  
ATOM   6397  H HG3  . MET A 1 63 ? -17.568 0.148   -8.550  1.00 0.39 ? 63  MET A HG3  5  
ATOM   6398  H HE1  . MET A 1 63 ? -14.638 -1.978  -10.216 1.00 0.96 ? 63  MET A HE1  5  
ATOM   6399  H HE2  . MET A 1 63 ? -15.063 -3.577  -9.612  1.00 0.93 ? 63  MET A HE2  5  
ATOM   6400  H HE3  . MET A 1 63 ? -14.564 -2.318  -8.487  1.00 0.95 ? 63  MET A HE3  5  
ATOM   6401  N N    . ILE A 1 64 ? -17.517 2.653   -7.934  1.00 0.28 ? 64  ILE A N    5  
ATOM   6402  C CA   . ILE A 1 64 ? -18.796 3.233   -7.533  1.00 0.31 ? 64  ILE A CA   5  
ATOM   6403  C C    . ILE A 1 64 ? -18.672 4.725   -7.233  1.00 0.31 ? 64  ILE A C    5  
ATOM   6404  O O    . ILE A 1 64 ? -19.337 5.545   -7.866  1.00 0.37 ? 64  ILE A O    5  
ATOM   6405  C CB   . ILE A 1 64 ? -19.389 2.504   -6.303  1.00 0.35 ? 64  ILE A CB   5  
ATOM   6406  C CG1  . ILE A 1 64 ? -19.712 1.051   -6.661  1.00 0.38 ? 64  ILE A CG1  5  
ATOM   6407  C CG2  . ILE A 1 64 ? -20.638 3.221   -5.803  1.00 0.43 ? 64  ILE A CG2  5  
ATOM   6408  C CD1  . ILE A 1 64 ? -20.336 0.266   -5.527  1.00 0.46 ? 64  ILE A CD1  5  
ATOM   6409  H H    . ILE A 1 64 ? -16.951 2.217   -7.258  1.00 0.29 ? 64  ILE A H    5  
ATOM   6410  H HA   . ILE A 1 64 ? -19.481 3.105   -8.358  1.00 0.35 ? 64  ILE A HA   5  
ATOM   6411  H HB   . ILE A 1 64 ? -18.656 2.518   -5.512  1.00 0.34 ? 64  ILE A HB   5  
ATOM   6412  H HG12 . ILE A 1 64 ? -20.403 1.035   -7.488  1.00 0.44 ? 64  ILE A HG12 5  
ATOM   6413  H HG13 . ILE A 1 64 ? -18.802 0.549   -6.948  1.00 0.36 ? 64  ILE A HG13 5  
ATOM   6414  H HG21 . ILE A 1 64 ? -21.037 2.701   -4.945  1.00 0.59 ? 64  ILE A HG21 5  
ATOM   6415  H HG22 . ILE A 1 64 ? -21.377 3.239   -6.590  1.00 0.58 ? 64  ILE A HG22 5  
ATOM   6416  H HG23 . ILE A 1 64 ? -20.384 4.235   -5.525  1.00 0.58 ? 64  ILE A HG23 5  
ATOM   6417  H HD11 . ILE A 1 64 ? -21.261 0.735   -5.229  1.00 0.62 ? 64  ILE A HD11 5  
ATOM   6418  H HD12 . ILE A 1 64 ? -19.656 0.245   -4.688  1.00 0.57 ? 64  ILE A HD12 5  
ATOM   6419  H HD13 . ILE A 1 64 ? -20.535 -0.743  -5.853  1.00 0.59 ? 64  ILE A HD13 5  
ATOM   6420  N N    . LEU A 1 65 ? -17.820 5.077   -6.276  1.00 0.29 ? 65  LEU A N    5  
ATOM   6421  C CA   . LEU A 1 65 ? -17.639 6.477   -5.896  1.00 0.33 ? 65  LEU A CA   5  
ATOM   6422  C C    . LEU A 1 65 ? -16.715 7.194   -6.876  1.00 0.34 ? 65  LEU A C    5  
ATOM   6423  O O    . LEU A 1 65 ? -16.705 8.423   -6.962  1.00 0.47 ? 65  LEU A O    5  
ATOM   6424  C CB   . LEU A 1 65 ? -17.083 6.570   -4.473  1.00 0.40 ? 65  LEU A CB   5  
ATOM   6425  C CG   . LEU A 1 65 ? -17.268 7.923   -3.780  1.00 0.93 ? 65  LEU A CG   5  
ATOM   6426  C CD1  . LEU A 1 65 ? -18.745 8.211   -3.555  1.00 1.61 ? 65  LEU A CD1  5  
ATOM   6427  C CD2  . LEU A 1 65 ? -16.514 7.948   -2.460  1.00 0.99 ? 65  LEU A CD2  5  
ATOM   6428  H H    . LEU A 1 65 ? -17.302 4.385   -5.816  1.00 0.30 ? 65  LEU A H    5  
ATOM   6429  H HA   . LEU A 1 65 ? -18.608 6.952   -5.926  1.00 0.39 ? 65  LEU A HA   5  
ATOM   6430  H HB2  . LEU A 1 65 ? -17.569 5.816   -3.874  1.00 0.77 ? 65  LEU A HB2  5  
ATOM   6431  H HB3  . LEU A 1 65 ? -16.026 6.352   -4.507  1.00 0.73 ? 65  LEU A HB3  5  
ATOM   6432  H HG   . LEU A 1 65 ? -16.867 8.702   -4.412  1.00 1.40 ? 65  LEU A HG   5  
ATOM   6433  H HD11 . LEU A 1 65 ? -19.191 7.393   -3.010  1.00 1.79 ? 65  LEU A HD11 5  
ATOM   6434  H HD12 . LEU A 1 65 ? -19.240 8.319   -4.510  1.00 1.94 ? 65  LEU A HD12 5  
ATOM   6435  H HD13 . LEU A 1 65 ? -18.853 9.123   -2.988  1.00 2.09 ? 65  LEU A HD13 5  
ATOM   6436  H HD21 . LEU A 1 65 ? -15.468 7.749   -2.638  1.00 1.31 ? 65  LEU A HD21 5  
ATOM   6437  H HD22 . LEU A 1 65 ? -16.917 7.192   -1.801  1.00 1.14 ? 65  LEU A HD22 5  
ATOM   6438  H HD23 . LEU A 1 65 ? -16.624 8.920   -2.001  1.00 1.50 ? 65  LEU A HD23 5  
ATOM   6439  N N    . GLY A 1 66 ? -15.936 6.417   -7.613  1.00 0.30 ? 66  GLY A N    5  
ATOM   6440  C CA   . GLY A 1 66 ? -15.027 6.986   -8.585  1.00 0.36 ? 66  GLY A CA   5  
ATOM   6441  C C    . GLY A 1 66 ? -13.740 7.485   -7.959  1.00 0.43 ? 66  GLY A C    5  
ATOM   6442  O O    . GLY A 1 66 ? -13.104 8.404   -8.478  1.00 0.81 ? 66  GLY A O    5  
ATOM   6443  H H    . GLY A 1 66 ? -15.979 5.447   -7.494  1.00 0.33 ? 66  GLY A H    5  
ATOM   6444  H HA2  . GLY A 1 66 ? -14.786 6.230   -9.320  1.00 0.40 ? 66  GLY A HA2  5  
ATOM   6445  H HA3  . GLY A 1 66 ? -15.516 7.811   -9.080  1.00 0.41 ? 66  GLY A HA3  5  
ATOM   6446  N N    . LYS A 1 67 ? -13.354 6.886   -6.841  1.00 0.43 ? 67  LYS A N    5  
ATOM   6447  C CA   . LYS A 1 67 ? -12.127 7.271   -6.155  1.00 0.47 ? 67  LYS A CA   5  
ATOM   6448  C C    . LYS A 1 67 ? -11.065 6.193   -6.315  1.00 0.35 ? 67  LYS A C    5  
ATOM   6449  O O    . LYS A 1 67 ? -11.064 5.196   -5.592  1.00 0.44 ? 67  LYS A O    5  
ATOM   6450  C CB   . LYS A 1 67 ? -12.397 7.533   -4.672  1.00 0.65 ? 67  LYS A CB   5  
ATOM   6451  C CG   . LYS A 1 67 ? -13.045 8.882   -4.411  1.00 0.74 ? 67  LYS A CG   5  
ATOM   6452  C CD   . LYS A 1 67 ? -12.969 9.265   -2.942  1.00 1.10 ? 67  LYS A CD   5  
ATOM   6453  C CE   . LYS A 1 67 ? -13.459 10.685  -2.712  1.00 1.28 ? 67  LYS A CE   5  
ATOM   6454  N NZ   . LYS A 1 67 ? -12.608 11.687  -3.409  1.00 1.52 ? 67  LYS A NZ   5  
ATOM   6455  H H    . LYS A 1 67 ? -13.904 6.161   -6.468  1.00 0.69 ? 67  LYS A H    5  
ATOM   6456  H HA   . LYS A 1 67 ? -11.768 8.179   -6.613  1.00 0.55 ? 67  LYS A HA   5  
ATOM   6457  H HB2  . LYS A 1 67 ? -13.052 6.762   -4.295  1.00 0.82 ? 67  LYS A HB2  5  
ATOM   6458  H HB3  . LYS A 1 67 ? -11.462 7.495   -4.133  1.00 0.78 ? 67  LYS A HB3  5  
ATOM   6459  H HG2  . LYS A 1 67 ? -12.533 9.634   -4.995  1.00 0.86 ? 67  LYS A HG2  5  
ATOM   6460  H HG3  . LYS A 1 67 ? -14.082 8.836   -4.711  1.00 0.86 ? 67  LYS A HG3  5  
ATOM   6461  H HD2  . LYS A 1 67 ? -13.580 8.584   -2.370  1.00 1.44 ? 67  LYS A HD2  5  
ATOM   6462  H HD3  . LYS A 1 67 ? -11.942 9.191   -2.615  1.00 1.29 ? 67  LYS A HD3  5  
ATOM   6463  H HE2  . LYS A 1 67 ? -14.471 10.767  -3.080  1.00 1.52 ? 67  LYS A HE2  5  
ATOM   6464  H HE3  . LYS A 1 67 ? -13.446 10.889  -1.653  1.00 1.71 ? 67  LYS A HE3  5  
ATOM   6465  H HZ1  . LYS A 1 67 ? -13.039 12.631  -3.343  1.00 1.85 ? 67  LYS A HZ1  5  
ATOM   6466  H HZ2  . LYS A 1 67 ? -12.499 11.437  -4.411  1.00 1.82 ? 67  LYS A HZ2  5  
ATOM   6467  H HZ3  . LYS A 1 67 ? -11.663 11.721  -2.970  1.00 1.90 ? 67  LYS A HZ3  5  
ATOM   6468  N N    . SER A 1 68 ? -10.168 6.391   -7.271  1.00 0.30 ? 68  SER A N    5  
ATOM   6469  C CA   . SER A 1 68 ? -9.113  5.427   -7.533  1.00 0.32 ? 68  SER A CA   5  
ATOM   6470  C C    . SER A 1 68 ? -7.760  5.949   -7.057  1.00 0.28 ? 68  SER A C    5  
ATOM   6471  O O    . SER A 1 68 ? -6.718  5.387   -7.392  1.00 0.33 ? 68  SER A O    5  
ATOM   6472  C CB   . SER A 1 68 ? -9.061  5.099   -9.028  1.00 0.46 ? 68  SER A CB   5  
ATOM   6473  O OG   . SER A 1 68 ? -10.348 4.760   -9.521  1.00 0.91 ? 68  SER A OG   5  
ATOM   6474  H H    . SER A 1 68 ? -10.211 7.210   -7.810  1.00 0.38 ? 68  SER A H    5  
ATOM   6475  H HA   . SER A 1 68 ? -9.350  4.526   -6.986  1.00 0.38 ? 68  SER A HA   5  
ATOM   6476  H HB2  . SER A 1 68 ? -8.699  5.960   -9.569  1.00 0.76 ? 68  SER A HB2  5  
ATOM   6477  H HB3  . SER A 1 68 ? -8.394  4.265   -9.190  1.00 0.77 ? 68  SER A HB3  5  
ATOM   6478  H HG   . SER A 1 68 ? -10.894 5.554   -9.555  1.00 1.45 ? 68  SER A HG   5  
ATOM   6479  N N    . GLY A 1 69 ? -7.782  7.017   -6.264  1.00 0.29 ? 69  GLY A N    5  
ATOM   6480  C CA   . GLY A 1 69 ? -6.549  7.593   -5.753  1.00 0.35 ? 69  GLY A CA   5  
ATOM   6481  C C    . GLY A 1 69 ? -5.744  6.596   -4.940  1.00 0.32 ? 69  GLY A C    5  
ATOM   6482  O O    . GLY A 1 69 ? -4.587  6.311   -5.258  1.00 0.41 ? 69  GLY A O    5  
ATOM   6483  H H    . GLY A 1 69 ? -8.644  7.422   -6.023  1.00 0.33 ? 69  GLY A H    5  
ATOM   6484  H HA2  . GLY A 1 69 ? -5.949  7.929   -6.586  1.00 0.40 ? 69  GLY A HA2  5  
ATOM   6485  H HA3  . GLY A 1 69 ? -6.791  8.440   -5.128  1.00 0.42 ? 69  GLY A HA3  5  
ATOM   6486  N N    . GLU A 1 70 ? -6.366  6.047   -3.903  1.00 0.34 ? 70  GLU A N    5  
ATOM   6487  C CA   . GLU A 1 70 ? -5.705  5.071   -3.044  1.00 0.38 ? 70  GLU A CA   5  
ATOM   6488  C C    . GLU A 1 70 ? -5.529  3.742   -3.774  1.00 0.32 ? 70  GLU A C    5  
ATOM   6489  O O    . GLU A 1 70 ? -4.658  2.943   -3.430  1.00 0.39 ? 70  GLU A O    5  
ATOM   6490  C CB   . GLU A 1 70 ? -6.508  4.847   -1.756  1.00 0.52 ? 70  GLU A CB   5  
ATOM   6491  C CG   . GLU A 1 70 ? -6.634  6.084   -0.876  1.00 0.66 ? 70  GLU A CG   5  
ATOM   6492  C CD   . GLU A 1 70 ? -7.746  7.017   -1.321  1.00 0.70 ? 70  GLU A CD   5  
ATOM   6493  O OE1  . GLU A 1 70 ? -7.689  8.219   -0.980  1.00 1.24 ? 70  GLU A OE1  5  
ATOM   6494  O OE2  . GLU A 1 70 ? -8.680  6.555   -2.014  1.00 1.08 ? 70  GLU A OE2  5  
ATOM   6495  H H    . GLU A 1 70 ? -7.290  6.314   -3.700  1.00 0.40 ? 70  GLU A H    5  
ATOM   6496  H HA   . GLU A 1 70 ? -4.731  5.459   -2.789  1.00 0.42 ? 70  GLU A HA   5  
ATOM   6497  H HB2  . GLU A 1 70 ? -7.501  4.518   -2.022  1.00 0.52 ? 70  GLU A HB2  5  
ATOM   6498  H HB3  . GLU A 1 70 ? -6.026  4.070   -1.180  1.00 0.64 ? 70  GLU A HB3  5  
ATOM   6499  H HG2  . GLU A 1 70 ? -6.836  5.768   0.136   1.00 0.80 ? 70  GLU A HG2  5  
ATOM   6500  H HG3  . GLU A 1 70 ? -5.699  6.626   -0.901  1.00 0.82 ? 70  GLU A HG3  5  
ATOM   6501  N N    . LEU A 1 71 ? -6.354  3.521   -4.793  1.00 0.28 ? 71  LEU A N    5  
ATOM   6502  C CA   . LEU A 1 71 ? -6.304  2.290   -5.573  1.00 0.28 ? 71  LEU A CA   5  
ATOM   6503  C C    . LEU A 1 71 ? -4.991  2.189   -6.347  1.00 0.26 ? 71  LEU A C    5  
ATOM   6504  O O    . LEU A 1 71 ? -4.420  1.104   -6.477  1.00 0.30 ? 71  LEU A O    5  
ATOM   6505  C CB   . LEU A 1 71 ? -7.490  2.221   -6.540  1.00 0.34 ? 71  LEU A CB   5  
ATOM   6506  C CG   . LEU A 1 71 ? -7.604  0.920   -7.336  1.00 0.58 ? 71  LEU A CG   5  
ATOM   6507  C CD1  . LEU A 1 71 ? -8.137  -0.202  -6.456  1.00 0.89 ? 71  LEU A CD1  5  
ATOM   6508  C CD2  . LEU A 1 71 ? -8.496  1.116   -8.551  1.00 1.43 ? 71  LEU A CD2  5  
ATOM   6509  H H    . LEU A 1 71 ? -7.007  4.211   -5.031  1.00 0.34 ? 71  LEU A H    5  
ATOM   6510  H HA   . LEU A 1 71 ? -6.363  1.462   -4.884  1.00 0.33 ? 71  LEU A HA   5  
ATOM   6511  H HB2  . LEU A 1 71 ? -8.400  2.352   -5.971  1.00 0.54 ? 71  LEU A HB2  5  
ATOM   6512  H HB3  . LEU A 1 71 ? -7.403  3.038   -7.240  1.00 0.61 ? 71  LEU A HB3  5  
ATOM   6513  H HG   . LEU A 1 71 ? -6.622  0.632   -7.682  1.00 1.35 ? 71  LEU A HG   5  
ATOM   6514  H HD11 . LEU A 1 71 ? -7.469  -0.352  -5.620  1.00 1.64 ? 71  LEU A HD11 5  
ATOM   6515  H HD12 . LEU A 1 71 ? -8.201  -1.113  -7.033  1.00 1.06 ? 71  LEU A HD12 5  
ATOM   6516  H HD13 . LEU A 1 71 ? -9.119  0.063   -6.090  1.00 1.33 ? 71  LEU A HD13 5  
ATOM   6517  H HD21 . LEU A 1 71 ? -9.513  1.289   -8.230  1.00 2.09 ? 71  LEU A HD21 5  
ATOM   6518  H HD22 . LEU A 1 71 ? -8.460  0.231   -9.168  1.00 1.87 ? 71  LEU A HD22 5  
ATOM   6519  H HD23 . LEU A 1 71 ? -8.148  1.966   -9.120  1.00 1.71 ? 71  LEU A HD23 5  
ATOM   6520  N N    . LYS A 1 72 ? -4.518  3.322   -6.865  1.00 0.26 ? 72  LYS A N    5  
ATOM   6521  C CA   . LYS A 1 72 ? -3.267  3.351   -7.615  1.00 0.30 ? 72  LYS A CA   5  
ATOM   6522  C C    . LYS A 1 72 ? -2.111  2.923   -6.724  1.00 0.27 ? 72  LYS A C    5  
ATOM   6523  O O    . LYS A 1 72 ? -1.334  2.032   -7.072  1.00 0.33 ? 72  LYS A O    5  
ATOM   6524  C CB   . LYS A 1 72 ? -2.986  4.753   -8.160  1.00 0.39 ? 72  LYS A CB   5  
ATOM   6525  C CG   . LYS A 1 72 ? -3.981  5.226   -9.206  1.00 0.50 ? 72  LYS A CG   5  
ATOM   6526  C CD   . LYS A 1 72 ? -3.386  6.328   -10.073 1.00 0.74 ? 72  LYS A CD   5  
ATOM   6527  C CE   . LYS A 1 72 ? -2.783  7.443   -9.230  1.00 1.11 ? 72  LYS A CE   5  
ATOM   6528  N NZ   . LYS A 1 72 ? -1.966  8.377   -10.050 1.00 1.44 ? 72  LYS A NZ   5  
ATOM   6529  H H    . LYS A 1 72 ? -5.024  4.155   -6.741  1.00 0.28 ? 72  LYS A H    5  
ATOM   6530  H HA   . LYS A 1 72 ? -3.352  2.658   -8.439  1.00 0.35 ? 72  LYS A HA   5  
ATOM   6531  H HB2  . LYS A 1 72 ? -3.004  5.452   -7.337  1.00 0.45 ? 72  LYS A HB2  5  
ATOM   6532  H HB3  . LYS A 1 72 ? -1.999  4.762   -8.603  1.00 0.49 ? 72  LYS A HB3  5  
ATOM   6533  H HG2  . LYS A 1 72 ? -4.247  4.392   -9.835  1.00 0.76 ? 72  LYS A HG2  5  
ATOM   6534  H HG3  . LYS A 1 72 ? -4.864  5.604   -8.711  1.00 0.74 ? 72  LYS A HG3  5  
ATOM   6535  H HD2  . LYS A 1 72 ? -2.612  5.904   -10.692 1.00 0.98 ? 72  LYS A HD2  5  
ATOM   6536  H HD3  . LYS A 1 72 ? -4.164  6.741   -10.697 1.00 0.88 ? 72  LYS A HD3  5  
ATOM   6537  H HE2  . LYS A 1 72 ? -3.584  7.992   -8.761  1.00 1.39 ? 72  LYS A HE2  5  
ATOM   6538  H HE3  . LYS A 1 72 ? -2.155  7.004   -8.470  1.00 1.42 ? 72  LYS A HE3  5  
ATOM   6539  H HZ1  . LYS A 1 72 ? -2.582  8.975   -10.634 1.00 1.73 ? 72  LYS A HZ1  5  
ATOM   6540  H HZ2  . LYS A 1 72 ? -1.330  7.842   -10.675 1.00 1.79 ? 72  LYS A HZ2  5  
ATOM   6541  H HZ3  . LYS A 1 72 ? -1.392  8.986   -9.432  1.00 1.75 ? 72  LYS A HZ3  5  
ATOM   6542  N N    . THR A 1 73 ? -2.021  3.566   -5.568  1.00 0.23 ? 73  THR A N    5  
ATOM   6543  C CA   . THR A 1 73 ? -0.975  3.280   -4.605  1.00 0.24 ? 73  THR A CA   5  
ATOM   6544  C C    . THR A 1 73 ? -1.039  1.829   -4.134  1.00 0.21 ? 73  THR A C    5  
ATOM   6545  O O    . THR A 1 73 ? -0.018  1.136   -4.092  1.00 0.24 ? 73  THR A O    5  
ATOM   6546  C CB   . THR A 1 73 ? -1.094  4.219   -3.395  1.00 0.29 ? 73  THR A CB   5  
ATOM   6547  O OG1  . THR A 1 73 ? -1.747  5.435   -3.792  1.00 0.39 ? 73  THR A OG1  5  
ATOM   6548  C CG2  . THR A 1 73 ? 0.276   4.543   -2.821  1.00 0.35 ? 73  THR A CG2  5  
ATOM   6549  H H    . THR A 1 73 ? -2.678  4.261   -5.355  1.00 0.26 ? 73  THR A H    5  
ATOM   6550  H HA   . THR A 1 73 ? -0.021  3.455   -5.080  1.00 0.26 ? 73  THR A HA   5  
ATOM   6551  H HB   . THR A 1 73 ? -1.685  3.732   -2.631  1.00 0.32 ? 73  THR A HB   5  
ATOM   6552  H HG1  . THR A 1 73 ? -1.842  6.010   -3.026  1.00 0.74 ? 73  THR A HG1  5  
ATOM   6553  H HG21 . THR A 1 73 ? 0.871   5.040   -3.572  1.00 0.57 ? 73  THR A HG21 5  
ATOM   6554  H HG22 . THR A 1 73 ? 0.767   3.628   -2.521  1.00 0.56 ? 73  THR A HG22 5  
ATOM   6555  H HG23 . THR A 1 73 ? 0.165   5.192   -1.966  1.00 0.58 ? 73  THR A HG23 5  
ATOM   6556  N N    . TRP A 1 74 ? -2.245  1.374   -3.802  1.00 0.18 ? 74  TRP A N    5  
ATOM   6557  C CA   . TRP A 1 74 ? -2.453  0.010   -3.329  1.00 0.18 ? 74  TRP A CA   5  
ATOM   6558  C C    . TRP A 1 74 ? -1.970  -1.009  -4.353  1.00 0.17 ? 74  TRP A C    5  
ATOM   6559  O O    . TRP A 1 74 ? -1.186  -1.897  -4.022  1.00 0.19 ? 74  TRP A O    5  
ATOM   6560  C CB   . TRP A 1 74 ? -3.933  -0.235  -3.016  1.00 0.19 ? 74  TRP A CB   5  
ATOM   6561  C CG   . TRP A 1 74 ? -4.219  -1.634  -2.554  1.00 0.20 ? 74  TRP A CG   5  
ATOM   6562  C CD1  . TRP A 1 74 ? -4.827  -2.626  -3.267  1.00 0.23 ? 74  TRP A CD1  5  
ATOM   6563  C CD2  . TRP A 1 74 ? -3.897  -2.197  -1.279  1.00 0.27 ? 74  TRP A CD2  5  
ATOM   6564  N NE1  . TRP A 1 74 ? -4.903  -3.771  -2.511  1.00 0.25 ? 74  TRP A NE1  5  
ATOM   6565  C CE2  . TRP A 1 74 ? -4.342  -3.532  -1.287  1.00 0.27 ? 74  TRP A CE2  5  
ATOM   6566  C CE3  . TRP A 1 74 ? -3.284  -1.700  -0.126  1.00 0.38 ? 74  TRP A CE3  5  
ATOM   6567  C CZ2  . TRP A 1 74 ? -4.178  -4.378  -0.194  1.00 0.36 ? 74  TRP A CZ2  5  
ATOM   6568  C CZ3  . TRP A 1 74 ? -3.124  -2.541  0.957   1.00 0.48 ? 74  TRP A CZ3  5  
ATOM   6569  C CH2  . TRP A 1 74 ? -3.575  -3.865  0.918   1.00 0.46 ? 74  TRP A CH2  5  
ATOM   6570  H H    . TRP A 1 74 ? -3.017  1.977   -3.866  1.00 0.20 ? 74  TRP A H    5  
ATOM   6571  H HA   . TRP A 1 74 ? -1.881  -0.115  -2.422  1.00 0.20 ? 74  TRP A HA   5  
ATOM   6572  H HB2  . TRP A 1 74 ? -4.246  0.445   -2.240  1.00 0.22 ? 74  TRP A HB2  5  
ATOM   6573  H HB3  . TRP A 1 74 ? -4.517  -0.052  -3.908  1.00 0.21 ? 74  TRP A HB3  5  
ATOM   6574  H HD1  . TRP A 1 74 ? -5.193  -2.513  -4.276  1.00 0.30 ? 74  TRP A HD1  5  
ATOM   6575  H HE1  . TRP A 1 74 ? -5.298  -4.628  -2.805  1.00 0.28 ? 74  TRP A HE1  5  
ATOM   6576  H HE3  . TRP A 1 74 ? -2.930  -0.681  -0.076  1.00 0.40 ? 74  TRP A HE3  5  
ATOM   6577  H HZ2  . TRP A 1 74 ? -4.520  -5.401  -0.208  1.00 0.36 ? 74  TRP A HZ2  5  
ATOM   6578  H HZ3  . TRP A 1 74 ? -2.651  -2.175  1.855   1.00 0.58 ? 74  TRP A HZ3  5  
ATOM   6579  H HH2  . TRP A 1 74 ? -3.430  -4.486  1.790   1.00 0.54 ? 74  TRP A HH2  5  
ATOM   6580  N N    . GLY A 1 75 ? -2.442  -0.874  -5.588  1.00 0.18 ? 75  GLY A N    5  
ATOM   6581  C CA   . GLY A 1 75 ? -2.057  -1.794  -6.644  1.00 0.21 ? 75  GLY A CA   5  
ATOM   6582  C C    . GLY A 1 75 ? -0.556  -1.853  -6.857  1.00 0.20 ? 75  GLY A C    5  
ATOM   6583  O O    . GLY A 1 75 ? 0.011   -2.935  -7.018  1.00 0.25 ? 75  GLY A O    5  
ATOM   6584  H H    . GLY A 1 75 ? -3.068  -0.141  -5.784  1.00 0.20 ? 75  GLY A H    5  
ATOM   6585  H HA2  . GLY A 1 75 ? -2.409  -2.781  -6.386  1.00 0.24 ? 75  GLY A HA2  5  
ATOM   6586  H HA3  . GLY A 1 75 ? -2.528  -1.486  -7.566  1.00 0.24 ? 75  GLY A HA3  5  
ATOM   6587  N N    . LEU A 1 76 ? 0.091   -0.697  -6.833  1.00 0.20 ? 76  LEU A N    5  
ATOM   6588  C CA   . LEU A 1 76 ? 1.532   -0.627  -7.028  1.00 0.24 ? 76  LEU A CA   5  
ATOM   6589  C C    . LEU A 1 76 ? 2.277   -1.330  -5.897  1.00 0.23 ? 76  LEU A C    5  
ATOM   6590  O O    . LEU A 1 76 ? 3.178   -2.133  -6.141  1.00 0.28 ? 76  LEU A O    5  
ATOM   6591  C CB   . LEU A 1 76 ? 1.981   0.830   -7.127  1.00 0.30 ? 76  LEU A CB   5  
ATOM   6592  C CG   . LEU A 1 76 ? 1.699   1.513   -8.469  1.00 0.40 ? 76  LEU A CG   5  
ATOM   6593  C CD1  . LEU A 1 76 ? 1.933   3.012   -8.362  1.00 0.51 ? 76  LEU A CD1  5  
ATOM   6594  C CD2  . LEU A 1 76 ? 2.572   0.914   -9.563  1.00 0.56 ? 76  LEU A CD2  5  
ATOM   6595  H H    . LEU A 1 76 ? -0.413  0.133   -6.674  1.00 0.22 ? 76  LEU A H    5  
ATOM   6596  H HA   . LEU A 1 76 ? 1.764   -1.126  -7.955  1.00 0.27 ? 76  LEU A HA   5  
ATOM   6597  H HB2  . LEU A 1 76 ? 1.485   1.390   -6.347  1.00 0.34 ? 76  LEU A HB2  5  
ATOM   6598  H HB3  . LEU A 1 76 ? 3.043   0.863   -6.950  1.00 0.36 ? 76  LEU A HB3  5  
ATOM   6599  H HG   . LEU A 1 76 ? 0.663   1.357   -8.739  1.00 0.51 ? 76  LEU A HG   5  
ATOM   6600  H HD11 . LEU A 1 76 ? 1.241   3.436   -7.650  1.00 0.93 ? 76  LEU A HD11 5  
ATOM   6601  H HD12 . LEU A 1 76 ? 1.784   3.472   -9.328  1.00 0.87 ? 76  LEU A HD12 5  
ATOM   6602  H HD13 . LEU A 1 76 ? 2.945   3.194   -8.030  1.00 0.94 ? 76  LEU A HD13 5  
ATOM   6603  H HD21 . LEU A 1 76 ? 2.284   -0.112  -9.733  1.00 0.97 ? 76  LEU A HD21 5  
ATOM   6604  H HD22 . LEU A 1 76 ? 3.606   0.949   -9.254  1.00 0.98 ? 76  LEU A HD22 5  
ATOM   6605  H HD23 . LEU A 1 76 ? 2.452   1.479   -10.476 1.00 1.01 ? 76  LEU A HD23 5  
ATOM   6606  N N    . VAL A 1 77 ? 1.891   -1.034  -4.661  1.00 0.22 ? 77  VAL A N    5  
ATOM   6607  C CA   . VAL A 1 77 ? 2.525   -1.643  -3.498  1.00 0.25 ? 77  VAL A CA   5  
ATOM   6608  C C    . VAL A 1 77 ? 2.218   -3.140  -3.445  1.00 0.23 ? 77  VAL A C    5  
ATOM   6609  O O    . VAL A 1 77 ? 3.088   -3.956  -3.132  1.00 0.24 ? 77  VAL A O    5  
ATOM   6610  C CB   . VAL A 1 77 ? 2.061   -0.972  -2.183  1.00 0.29 ? 77  VAL A CB   5  
ATOM   6611  C CG1  . VAL A 1 77 ? 2.685   -1.647  -0.971  1.00 0.34 ? 77  VAL A CG1  5  
ATOM   6612  C CG2  . VAL A 1 77 ? 2.401   0.511   -2.194  1.00 0.35 ? 77  VAL A CG2  5  
ATOM   6613  H H    . VAL A 1 77 ? 1.156   -0.392  -4.528  1.00 0.22 ? 77  VAL A H    5  
ATOM   6614  H HA   . VAL A 1 77 ? 3.593   -1.509  -3.592  1.00 0.29 ? 77  VAL A HA   5  
ATOM   6615  H HB   . VAL A 1 77 ? 0.988   -1.071  -2.111  1.00 0.30 ? 77  VAL A HB   5  
ATOM   6616  H HG11 . VAL A 1 77 ? 2.431   -2.697  -0.976  1.00 0.46 ? 77  VAL A HG11 5  
ATOM   6617  H HG12 . VAL A 1 77 ? 2.305   -1.187  -0.069  1.00 0.50 ? 77  VAL A HG12 5  
ATOM   6618  H HG13 . VAL A 1 77 ? 3.759   -1.534  -1.008  1.00 0.49 ? 77  VAL A HG13 5  
ATOM   6619  H HG21 . VAL A 1 77 ? 3.474   0.636   -2.237  1.00 0.59 ? 77  VAL A HG21 5  
ATOM   6620  H HG22 . VAL A 1 77 ? 2.020   0.974   -1.296  1.00 0.59 ? 77  VAL A HG22 5  
ATOM   6621  H HG23 . VAL A 1 77 ? 1.949   0.977   -3.058  1.00 0.55 ? 77  VAL A HG23 5  
ATOM   6622  N N    . LEU A 1 78 ? 0.985   -3.487  -3.793  1.00 0.21 ? 78  LEU A N    5  
ATOM   6623  C CA   . LEU A 1 78 ? 0.533   -4.872  -3.791  1.00 0.21 ? 78  LEU A CA   5  
ATOM   6624  C C    . LEU A 1 78 ? 1.383   -5.727  -4.718  1.00 0.20 ? 78  LEU A C    5  
ATOM   6625  O O    . LEU A 1 78 ? 1.783   -6.833  -4.356  1.00 0.22 ? 78  LEU A O    5  
ATOM   6626  C CB   . LEU A 1 78 ? -0.937  -4.947  -4.215  1.00 0.22 ? 78  LEU A CB   5  
ATOM   6627  C CG   . LEU A 1 78 ? -1.586  -6.328  -4.093  1.00 0.25 ? 78  LEU A CG   5  
ATOM   6628  C CD1  . LEU A 1 78 ? -1.763  -6.707  -2.629  1.00 0.35 ? 78  LEU A CD1  5  
ATOM   6629  C CD2  . LEU A 1 78 ? -2.924  -6.348  -4.818  1.00 0.34 ? 78  LEU A CD2  5  
ATOM   6630  H H    . LEU A 1 78 ? 0.349   -2.784  -4.056  1.00 0.20 ? 78  LEU A H    5  
ATOM   6631  H HA   . LEU A 1 78 ? 0.629   -5.248  -2.787  1.00 0.24 ? 78  LEU A HA   5  
ATOM   6632  H HB2  . LEU A 1 78 ? -1.497  -4.257  -3.603  1.00 0.26 ? 78  LEU A HB2  5  
ATOM   6633  H HB3  . LEU A 1 78 ? -1.010  -4.630  -5.244  1.00 0.23 ? 78  LEU A HB3  5  
ATOM   6634  H HG   . LEU A 1 78 ? -0.942  -7.065  -4.553  1.00 0.28 ? 78  LEU A HG   5  
ATOM   6635  H HD11 . LEU A 1 78 ? -2.446  -6.015  -2.158  1.00 0.67 ? 78  LEU A HD11 5  
ATOM   6636  H HD12 . LEU A 1 78 ? -0.807  -6.666  -2.127  1.00 0.70 ? 78  LEU A HD12 5  
ATOM   6637  H HD13 . LEU A 1 78 ? -2.161  -7.708  -2.562  1.00 0.68 ? 78  LEU A HD13 5  
ATOM   6638  H HD21 . LEU A 1 78 ? -2.765  -6.158  -5.871  1.00 0.67 ? 78  LEU A HD21 5  
ATOM   6639  H HD22 . LEU A 1 78 ? -3.567  -5.583  -4.407  1.00 0.68 ? 78  LEU A HD22 5  
ATOM   6640  H HD23 . LEU A 1 78 ? -3.389  -7.315  -4.692  1.00 0.71 ? 78  LEU A HD23 5  
ATOM   6641  N N    . GLY A 1 79 ? 1.661   -5.204  -5.906  1.00 0.20 ? 79  GLY A N    5  
ATOM   6642  C CA   . GLY A 1 79 ? 2.465   -5.929  -6.870  1.00 0.22 ? 79  GLY A CA   5  
ATOM   6643  C C    . GLY A 1 79 ? 3.841   -6.271  -6.334  1.00 0.21 ? 79  GLY A C    5  
ATOM   6644  O O    . GLY A 1 79 ? 4.342   -7.378  -6.549  1.00 0.27 ? 79  GLY A O    5  
ATOM   6645  H H    . GLY A 1 79 ? 1.310   -4.313  -6.134  1.00 0.20 ? 79  GLY A H    5  
ATOM   6646  H HA2  . GLY A 1 79 ? 1.956   -6.846  -7.127  1.00 0.24 ? 79  GLY A HA2  5  
ATOM   6647  H HA3  . GLY A 1 79 ? 2.574   -5.327  -7.759  1.00 0.24 ? 79  GLY A HA3  5  
ATOM   6648  N N    . ALA A 1 80 ? 4.444   -5.325  -5.622  1.00 0.19 ? 80  ALA A N    5  
ATOM   6649  C CA   . ALA A 1 80 ? 5.764   -5.528  -5.046  1.00 0.22 ? 80  ALA A CA   5  
ATOM   6650  C C    . ALA A 1 80 ? 5.692   -6.498  -3.870  1.00 0.21 ? 80  ALA A C    5  
ATOM   6651  O O    . ALA A 1 80 ? 6.555   -7.363  -3.713  1.00 0.25 ? 80  ALA A O    5  
ATOM   6652  C CB   . ALA A 1 80 ? 6.358   -4.197  -4.610  1.00 0.25 ? 80  ALA A CB   5  
ATOM   6653  H H    . ALA A 1 80 ? 3.987   -4.469  -5.478  1.00 0.21 ? 80  ALA A H    5  
ATOM   6654  H HA   . ALA A 1 80 ? 6.401   -5.951  -5.810  1.00 0.25 ? 80  ALA A HA   5  
ATOM   6655  H HB1  . ALA A 1 80 ? 5.776   -3.792  -3.795  1.00 0.41 ? 80  ALA A HB1  5  
ATOM   6656  H HB2  . ALA A 1 80 ? 6.341   -3.507  -5.440  1.00 0.39 ? 80  ALA A HB2  5  
ATOM   6657  H HB3  . ALA A 1 80 ? 7.378   -4.344  -4.286  1.00 0.43 ? 80  ALA A HB3  5  
ATOM   6658  N N    . LEU A 1 81 ? 4.653   -6.354  -3.057  1.00 0.21 ? 81  LEU A N    5  
ATOM   6659  C CA   . LEU A 1 81 ? 4.462   -7.220  -1.902  1.00 0.25 ? 81  LEU A CA   5  
ATOM   6660  C C    . LEU A 1 81 ? 4.259   -8.666  -2.335  1.00 0.22 ? 81  LEU A C    5  
ATOM   6661  O O    . LEU A 1 81 ? 4.818   -9.586  -1.739  1.00 0.23 ? 81  LEU A O    5  
ATOM   6662  C CB   . LEU A 1 81 ? 3.264   -6.753  -1.070  1.00 0.33 ? 81  LEU A CB   5  
ATOM   6663  C CG   . LEU A 1 81 ? 3.515   -5.533  -0.181  1.00 0.50 ? 81  LEU A CG   5  
ATOM   6664  C CD1  . LEU A 1 81 ? 2.249   -5.161  0.572   1.00 0.60 ? 81  LEU A CD1  5  
ATOM   6665  C CD2  . LEU A 1 81 ? 4.652   -5.805  0.791   1.00 0.72 ? 81  LEU A CD2  5  
ATOM   6666  H H    . LEU A 1 81 ? 3.999   -5.638  -3.237  1.00 0.21 ? 81  LEU A H    5  
ATOM   6667  H HA   . LEU A 1 81 ? 5.354   -7.163  -1.295  1.00 0.30 ? 81  LEU A HA   5  
ATOM   6668  H HB2  . LEU A 1 81 ? 2.455   -6.518  -1.746  1.00 0.41 ? 81  LEU A HB2  5  
ATOM   6669  H HB3  . LEU A 1 81 ? 2.952   -7.571  -0.435  1.00 0.38 ? 81  LEU A HB3  5  
ATOM   6670  H HG   . LEU A 1 81 ? 3.795   -4.694  -0.800  1.00 0.60 ? 81  LEU A HG   5  
ATOM   6671  H HD11 . LEU A 1 81 ? 1.441   -5.014  -0.129  1.00 0.98 ? 81  LEU A HD11 5  
ATOM   6672  H HD12 . LEU A 1 81 ? 2.416   -4.248  1.127   1.00 0.95 ? 81  LEU A HD12 5  
ATOM   6673  H HD13 . LEU A 1 81 ? 1.990   -5.956  1.256   1.00 1.12 ? 81  LEU A HD13 5  
ATOM   6674  H HD21 . LEU A 1 81 ? 5.590   -5.816  0.257   1.00 1.02 ? 81  LEU A HD21 5  
ATOM   6675  H HD22 . LEU A 1 81 ? 4.497   -6.762  1.267   1.00 1.04 ? 81  LEU A HD22 5  
ATOM   6676  H HD23 . LEU A 1 81 ? 4.676   -5.029  1.542   1.00 1.02 ? 81  LEU A HD23 5  
ATOM   6677  N N    . LYS A 1 82 ? 3.469   -8.862  -3.387  1.00 0.22 ? 82  LYS A N    5  
ATOM   6678  C CA   . LYS A 1 82 ? 3.203   -10.198 -3.901  1.00 0.24 ? 82  LYS A CA   5  
ATOM   6679  C C    . LYS A 1 82 ? 4.484   -10.828 -4.434  1.00 0.24 ? 82  LYS A C    5  
ATOM   6680  O O    . LYS A 1 82 ? 4.744   -12.007 -4.199  1.00 0.29 ? 82  LYS A O    5  
ATOM   6681  C CB   . LYS A 1 82 ? 2.139   -10.158 -5.000  1.00 0.31 ? 82  LYS A CB   5  
ATOM   6682  C CG   . LYS A 1 82 ? 0.736   -9.904  -4.476  1.00 0.52 ? 82  LYS A CG   5  
ATOM   6683  C CD   . LYS A 1 82 ? -0.308  -10.082 -5.564  1.00 0.61 ? 82  LYS A CD   5  
ATOM   6684  C CE   . LYS A 1 82 ? -1.715  -10.063 -4.991  1.00 0.90 ? 82  LYS A CE   5  
ATOM   6685  N NZ   . LYS A 1 82 ? -2.729  -10.530 -5.974  1.00 1.19 ? 82  LYS A NZ   5  
ATOM   6686  H H    . LYS A 1 82 ? 3.049   -8.085  -3.824  1.00 0.23 ? 82  LYS A H    5  
ATOM   6687  H HA   . LYS A 1 82 ? 2.838   -10.798 -3.081  1.00 0.26 ? 82  LYS A HA   5  
ATOM   6688  H HB2  . LYS A 1 82 ? 2.389   -9.372  -5.698  1.00 0.53 ? 82  LYS A HB2  5  
ATOM   6689  H HB3  . LYS A 1 82 ? 2.138   -11.103 -5.524  1.00 0.51 ? 82  LYS A HB3  5  
ATOM   6690  H HG2  . LYS A 1 82 ? 0.528   -10.598 -3.676  1.00 0.82 ? 82  LYS A HG2  5  
ATOM   6691  H HG3  . LYS A 1 82 ? 0.683   -8.892  -4.100  1.00 0.81 ? 82  LYS A HG3  5  
ATOM   6692  H HD2  . LYS A 1 82 ? -0.211  -9.278  -6.278  1.00 0.84 ? 82  LYS A HD2  5  
ATOM   6693  H HD3  . LYS A 1 82 ? -0.139  -11.026 -6.057  1.00 0.84 ? 82  LYS A HD3  5  
ATOM   6694  H HE2  . LYS A 1 82 ? -1.744  -10.708 -4.126  1.00 1.22 ? 82  LYS A HE2  5  
ATOM   6695  H HE3  . LYS A 1 82 ? -1.953  -9.054  -4.691  1.00 1.21 ? 82  LYS A HE3  5  
ATOM   6696  H HZ1  . LYS A 1 82 ? -2.525  -11.505 -6.266  1.00 1.48 ? 82  LYS A HZ1  5  
ATOM   6697  H HZ2  . LYS A 1 82 ? -2.719  -9.922  -6.818  1.00 1.54 ? 82  LYS A HZ2  5  
ATOM   6698  H HZ3  . LYS A 1 82 ? -3.678  -10.499 -5.548  1.00 1.55 ? 82  LYS A HZ3  5  
ATOM   6699  N N    . ALA A 1 83 ? 5.290   -10.025 -5.123  1.00 0.24 ? 83  ALA A N    5  
ATOM   6700  C CA   . ALA A 1 83 ? 6.552   -10.499 -5.681  1.00 0.28 ? 83  ALA A CA   5  
ATOM   6701  C C    . ALA A 1 83 ? 7.516   -10.904 -4.572  1.00 0.28 ? 83  ALA A C    5  
ATOM   6702  O O    . ALA A 1 83 ? 8.236   -11.895 -4.684  1.00 0.34 ? 83  ALA A O    5  
ATOM   6703  C CB   . ALA A 1 83 ? 7.177   -9.427  -6.564  1.00 0.35 ? 83  ALA A CB   5  
ATOM   6704  H H    . ALA A 1 83 ? 5.027   -9.089  -5.264  1.00 0.25 ? 83  ALA A H    5  
ATOM   6705  H HA   . ALA A 1 83 ? 6.341   -11.363 -6.296  1.00 0.32 ? 83  ALA A HA   5  
ATOM   6706  H HB1  . ALA A 1 83 ? 7.425   -8.566  -5.962  1.00 0.48 ? 83  ALA A HB1  5  
ATOM   6707  H HB2  . ALA A 1 83 ? 6.475   -9.138  -7.333  1.00 0.53 ? 83  ALA A HB2  5  
ATOM   6708  H HB3  . ALA A 1 83 ? 8.074   -9.817  -7.024  1.00 0.54 ? 83  ALA A HB3  5  
ATOM   6709  N N    . ALA A 1 84 ? 7.501   -10.142 -3.486  1.00 0.26 ? 84  ALA A N    5  
ATOM   6710  C CA   . ALA A 1 84 ? 8.367   -10.413 -2.346  1.00 0.31 ? 84  ALA A CA   5  
ATOM   6711  C C    . ALA A 1 84 ? 7.863   -11.609 -1.542  1.00 0.32 ? 84  ALA A C    5  
ATOM   6712  O O    . ALA A 1 84 ? 8.510   -12.049 -0.591  1.00 0.45 ? 84  ALA A O    5  
ATOM   6713  C CB   . ALA A 1 84 ? 8.468   -9.182  -1.461  1.00 0.35 ? 84  ALA A CB   5  
ATOM   6714  H H    . ALA A 1 84 ? 6.893   -9.370  -3.452  1.00 0.26 ? 84  ALA A H    5  
ATOM   6715  H HA   . ALA A 1 84 ? 9.353   -10.639 -2.724  1.00 0.36 ? 84  ALA A HA   5  
ATOM   6716  H HB1  . ALA A 1 84 ? 9.134   -9.386  -0.637  1.00 0.55 ? 84  ALA A HB1  5  
ATOM   6717  H HB2  . ALA A 1 84 ? 7.490   -8.929  -1.079  1.00 0.50 ? 84  ALA A HB2  5  
ATOM   6718  H HB3  . ALA A 1 84 ? 8.854   -8.353  -2.038  1.00 0.52 ? 84  ALA A HB3  5  
ATOM   6719  N N    . ARG A 1 85 ? 6.707   -12.130 -1.930  1.00 0.29 ? 85  ARG A N    5  
ATOM   6720  C CA   . ARG A 1 85 ? 6.114   -13.275 -1.254  1.00 0.35 ? 85  ARG A CA   5  
ATOM   6721  C C    . ARG A 1 85 ? 6.249   -14.533 -2.102  1.00 0.35 ? 85  ARG A C    5  
ATOM   6722  O O    . ARG A 1 85 ? 5.838   -15.618 -1.689  1.00 0.48 ? 85  ARG A O    5  
ATOM   6723  C CB   . ARG A 1 85 ? 4.634   -13.011 -0.961  1.00 0.42 ? 85  ARG A CB   5  
ATOM   6724  C CG   . ARG A 1 85 ? 4.375   -12.389 0.400   1.00 0.54 ? 85  ARG A CG   5  
ATOM   6725  C CD   . ARG A 1 85 ? 4.526   -13.407 1.517   1.00 0.74 ? 85  ARG A CD   5  
ATOM   6726  N NE   . ARG A 1 85 ? 4.296   -12.806 2.832   1.00 0.66 ? 85  ARG A NE   5  
ATOM   6727  C CZ   . ARG A 1 85 ? 4.115   -13.502 3.956   1.00 0.66 ? 85  ARG A CZ   5  
ATOM   6728  N NH1  . ARG A 1 85 ? 4.129   -14.826 3.938   1.00 0.83 ? 85  ARG A NH1  5  
ATOM   6729  N NH2  . ARG A 1 85 ? 3.909   -12.865 5.100   1.00 0.79 ? 85  ARG A NH2  5  
ATOM   6730  H H    . ARG A 1 85 ? 6.235   -11.730 -2.693  1.00 0.31 ? 85  ARG A H    5  
ATOM   6731  H HA   . ARG A 1 85 ? 6.639   -13.419 -0.321  1.00 0.41 ? 85  ARG A HA   5  
ATOM   6732  H HB2  . ARG A 1 85 ? 4.245   -12.342 -1.714  1.00 0.47 ? 85  ARG A HB2  5  
ATOM   6733  H HB3  . ARG A 1 85 ? 4.096   -13.947 -1.012  1.00 0.49 ? 85  ARG A HB3  5  
ATOM   6734  H HG2  . ARG A 1 85 ? 5.083   -11.590 0.560   1.00 0.96 ? 85  ARG A HG2  5  
ATOM   6735  H HG3  . ARG A 1 85 ? 3.372   -11.992 0.419   1.00 1.03 ? 85  ARG A HG3  5  
ATOM   6736  H HD2  . ARG A 1 85 ? 3.812   -14.199 1.366   1.00 1.28 ? 85  ARG A HD2  5  
ATOM   6737  H HD3  . ARG A 1 85 ? 5.526   -13.814 1.484   1.00 1.22 ? 85  ARG A HD3  5  
ATOM   6738  H HE   . ARG A 1 85 ? 4.275   -11.819 2.879   1.00 0.81 ? 85  ARG A HE   5  
ATOM   6739  H HH11 . ARG A 1 85 ? 3.993   -15.344 4.789   1.00 1.01 ? 85  ARG A HH11 5  
ATOM   6740  H HH12 . ARG A 1 85 ? 4.273   -15.319 3.075   1.00 0.90 ? 85  ARG A HH12 5  
ATOM   6741  H HH21 . ARG A 1 85 ? 3.884   -11.860 5.121   1.00 0.90 ? 85  ARG A HH21 5  
ATOM   6742  H HH22 . ARG A 1 85 ? 3.782   -13.383 5.951   1.00 0.92 ? 85  ARG A HH22 5  
ATOM   6743  N N    . GLU A 1 86 ? 6.821   -14.384 -3.290  1.00 0.35 ? 86  GLU A N    5  
ATOM   6744  C CA   . GLU A 1 86 ? 6.999   -15.510 -4.198  1.00 0.40 ? 86  GLU A CA   5  
ATOM   6745  C C    . GLU A 1 86 ? 8.310   -16.232 -3.924  1.00 0.43 ? 86  GLU A C    5  
ATOM   6746  O O    . GLU A 1 86 ? 8.499   -17.375 -4.338  1.00 0.65 ? 86  GLU A O    5  
ATOM   6747  C CB   . GLU A 1 86 ? 6.970   -15.033 -5.649  1.00 0.50 ? 86  GLU A CB   5  
ATOM   6748  C CG   . GLU A 1 86 ? 5.661   -14.379 -6.048  1.00 0.68 ? 86  GLU A CG   5  
ATOM   6749  C CD   . GLU A 1 86 ? 5.656   -13.910 -7.484  1.00 0.87 ? 86  GLU A CD   5  
ATOM   6750  O OE1  . GLU A 1 86 ? 5.136   -14.643 -8.348  1.00 1.32 ? 86  GLU A OE1  5  
ATOM   6751  O OE2  . GLU A 1 86 ? 6.165   -12.804 -7.759  1.00 1.25 ? 86  GLU A OE2  5  
ATOM   6752  H H    . GLU A 1 86 ? 7.129   -13.494 -3.565  1.00 0.42 ? 86  GLU A H    5  
ATOM   6753  H HA   . GLU A 1 86 ? 6.183   -16.195 -4.036  1.00 0.47 ? 86  GLU A HA   5  
ATOM   6754  H HB2  . GLU A 1 86 ? 7.763   -14.316 -5.796  1.00 0.63 ? 86  GLU A HB2  5  
ATOM   6755  H HB3  . GLU A 1 86 ? 7.138   -15.880 -6.298  1.00 0.63 ? 86  GLU A HB3  5  
ATOM   6756  H HG2  . GLU A 1 86 ? 4.862   -15.093 -5.917  1.00 0.90 ? 86  GLU A HG2  5  
ATOM   6757  H HG3  . GLU A 1 86 ? 5.489   -13.526 -5.406  1.00 0.93 ? 86  GLU A HG3  5  
ATOM   6758  N N    . GLU A 1 87 ? 9.214   -15.560 -3.230  1.00 0.47 ? 87  GLU A N    5  
ATOM   6759  C CA   . GLU A 1 87 ? 10.511  -16.131 -2.907  1.00 0.58 ? 87  GLU A CA   5  
ATOM   6760  C C    . GLU A 1 87 ? 10.776  -16.011 -1.417  1.00 0.68 ? 87  GLU A C    5  
ATOM   6761  O O    . GLU A 1 87 ? 11.748  -16.622 -0.929  1.00 1.13 ? 87  GLU A O    5  
ATOM   6762  C CB   . GLU A 1 87 ? 11.614  -15.425 -3.699  1.00 0.77 ? 87  GLU A CB   5  
ATOM   6763  C CG   . GLU A 1 87 ? 11.469  -15.574 -5.205  1.00 1.10 ? 87  GLU A CG   5  
ATOM   6764  C CD   . GLU A 1 87 ? 12.527  -14.813 -5.972  1.00 1.15 ? 87  GLU A CD   5  
ATOM   6765  O OE1  . GLU A 1 87 ? 13.329  -15.453 -6.687  1.00 1.51 ? 87  GLU A OE1  5  
ATOM   6766  O OE2  . GLU A 1 87 ? 12.567  -13.573 -5.869  1.00 1.44 ? 87  GLU A OE2  5  
ATOM   6767  O OXT  . GLU A 1 87 ? 10.005  -15.301 -0.737  1.00 1.02 ? 87  GLU A OXT  5  
ATOM   6768  H H    . GLU A 1 87 ? 8.999   -14.659 -2.911  1.00 0.60 ? 87  GLU A H    5  
ATOM   6769  H HA   . GLU A 1 87 ? 10.494  -17.177 -3.179  1.00 0.71 ? 87  GLU A HA   5  
ATOM   6770  H HB2  . GLU A 1 87 ? 11.594  -14.371 -3.461  1.00 1.08 ? 87  GLU A HB2  5  
ATOM   6771  H HB3  . GLU A 1 87 ? 12.570  -15.833 -3.407  1.00 1.00 ? 87  GLU A HB3  5  
ATOM   6772  H HG2  . GLU A 1 87 ? 11.544  -16.620 -5.459  1.00 1.52 ? 87  GLU A HG2  5  
ATOM   6773  H HG3  . GLU A 1 87 ? 10.497  -15.203 -5.497  1.00 1.59 ? 87  GLU A HG3  5  
HETATM 6774  C C1   . IHP B 2 .  ? 13.673  10.231  1.482   1.00 0.87 ? 101 IHP A C1   5  
HETATM 6775  C C2   . IHP B 2 .  ? 12.414  10.891  2.049   1.00 0.83 ? 101 IHP A C2   5  
HETATM 6776  C C3   . IHP B 2 .  ? 11.767  11.764  0.972   1.00 0.67 ? 101 IHP A C3   5  
HETATM 6777  C C4   . IHP B 2 .  ? 11.389  10.895  -0.231  1.00 0.52 ? 101 IHP A C4   5  
HETATM 6778  C C5   . IHP B 2 .  ? 12.648  10.235  -0.797  1.00 0.61 ? 101 IHP A C5   5  
HETATM 6779  C C6   . IHP B 2 .  ? 13.296  9.363   0.281   1.00 0.77 ? 101 IHP A C6   5  
HETATM 6780  O O11  . IHP B 2 .  ? 14.278  9.416   2.487   1.00 1.21 ? 101 IHP A O11  5  
HETATM 6781  P P1   . IHP B 2 .  ? 15.776  9.658   3.026   1.00 1.54 ? 101 IHP A P1   5  
HETATM 6782  O O21  . IHP B 2 .  ? 15.911  11.050  3.503   1.00 1.58 ? 101 IHP A O21  5  
HETATM 6783  O O31  . IHP B 2 .  ? 16.078  8.642   4.239   1.00 1.93 ? 101 IHP A O31  5  
HETATM 6784  O O41  . IHP B 2 .  ? 16.825  9.392   1.832   1.00 1.56 ? 101 IHP A O41  5  
HETATM 6785  O O12  . IHP B 2 .  ? 11.493  9.881   2.462   1.00 0.85 ? 101 IHP A O12  5  
HETATM 6786  P P2   . IHP B 2 .  ? 10.971  9.737   3.978   1.00 1.21 ? 101 IHP A P2   5  
HETATM 6787  O O22  . IHP B 2 .  ? 10.386  11.021  4.424   1.00 1.39 ? 101 IHP A O22  5  
HETATM 6788  O O32  . IHP B 2 .  ? 9.850   8.582   4.054   1.00 1.20 ? 101 IHP A O32  5  
HETATM 6789  O O42  . IHP B 2 .  ? 12.206  9.348   4.935   1.00 1.55 ? 101 IHP A O42  5  
HETATM 6790  O O13  . IHP B 2 .  ? 10.590  12.381  1.502   1.00 0.90 ? 101 IHP A O13  5  
HETATM 6791  P P3   . IHP B 2 .  ? 10.402  13.976  1.590   1.00 1.24 ? 101 IHP A P3   5  
HETATM 6792  O O23  . IHP B 2 .  ? 11.538  14.566  2.333   1.00 1.39 ? 101 IHP A O23  5  
HETATM 6793  O O33  . IHP B 2 .  ? 10.353  14.594  0.105   1.00 1.27 ? 101 IHP A O33  5  
HETATM 6794  O O43  . IHP B 2 .  ? 9.025   14.312  2.354   1.00 1.57 ? 101 IHP A O43  5  
HETATM 6795  O O14  . IHP B 2 .  ? 10.783  11.711  -1.236  1.00 0.74 ? 101 IHP A O14  5  
HETATM 6796  P P4   . IHP B 2 .  ? 9.286   11.470  -1.775  1.00 1.00 ? 101 IHP A P4   5  
HETATM 6797  O O24  . IHP B 2 .  ? 8.890   12.647  -2.801  1.00 1.39 ? 101 IHP A O24  5  
HETATM 6798  O O34  . IHP B 2 .  ? 9.208   10.050  -2.530  1.00 1.09 ? 101 IHP A O34  5  
HETATM 6799  O O44  . IHP B 2 .  ? 8.345   11.473  -0.633  1.00 1.01 ? 101 IHP A O44  5  
HETATM 6800  O O15  . IHP B 2 .  ? 12.296  9.424   -1.919  1.00 0.86 ? 101 IHP A O15  5  
HETATM 6801  P P5   . IHP B 2 .  ? 12.886  9.669   -3.397  1.00 1.20 ? 101 IHP A P5   5  
HETATM 6802  O O25  . IHP B 2 .  ? 14.365  9.662   -3.345  1.00 1.28 ? 101 IHP A O25  5  
HETATM 6803  O O35  . IHP B 2 .  ? 12.379  8.495   -4.378  1.00 1.56 ? 101 IHP A O35  5  
HETATM 6804  O O45  . IHP B 2 .  ? 12.375  11.091  -3.953  1.00 1.25 ? 101 IHP A O45  5  
HETATM 6805  O O16  . IHP B 2 .  ? 14.471  8.747   -0.250  1.00 1.06 ? 101 IHP A O16  5  
HETATM 6806  P P6   . IHP B 2 .  ? 14.659  7.150   -0.339  1.00 1.40 ? 101 IHP A P6   5  
HETATM 6807  O O26  . IHP B 2 .  ? 13.525  6.558   -1.083  1.00 1.39 ? 101 IHP A O26  5  
HETATM 6808  O O36  . IHP B 2 .  ? 16.037  6.815   -1.104  1.00 1.74 ? 101 IHP A O36  5  
HETATM 6809  O O46  . IHP B 2 .  ? 14.708  6.533   1.147   1.00 1.56 ? 101 IHP A O46  5  
HETATM 6810  H H1   . IHP B 2 .  ? 14.370  10.995  1.158   1.00 0.89 ? 101 IHP A H1   5  
HETATM 6811  H H2   . IHP B 2 .  ? 12.676  11.504  2.914   1.00 1.08 ? 101 IHP A H2   5  
HETATM 6812  H H3   . IHP B 2 .  ? 12.483  12.532  0.672   1.00 0.73 ? 101 IHP A H3   5  
HETATM 6813  H H4   . IHP B 2 .  ? 10.672  10.149  0.103   1.00 0.51 ? 101 IHP A H4   5  
HETATM 6814  H H5   . IHP B 2 .  ? 13.338  11.017  -1.108  1.00 0.66 ? 101 IHP A H5   5  
HETATM 6815  H H6   . IHP B 2 .  ? 12.594  8.578   0.590   1.00 0.80 ? 101 IHP A H6   5  
ATOM   6816  N N    . SER A 1 1  ? 4.898   3.923   11.371  1.00 1.45 ? 1   SER A N    6  
ATOM   6817  C CA   . SER A 1 1  ? 4.974   5.381   11.155  1.00 0.98 ? 1   SER A CA   6  
ATOM   6818  C C    . SER A 1 1  ? 6.267   5.776   10.445  1.00 0.92 ? 1   SER A C    6  
ATOM   6819  O O    . SER A 1 1  ? 6.258   6.644   9.575   1.00 1.21 ? 1   SER A O    6  
ATOM   6820  C CB   . SER A 1 1  ? 4.866   6.093   12.500  1.00 1.66 ? 1   SER A CB   6  
ATOM   6821  O OG   . SER A 1 1  ? 3.889   5.467   13.315  1.00 2.07 ? 1   SER A OG   6  
ATOM   6822  H H1   . SER A 1 1  ? 4.940   3.423   10.464  1.00 1.90 ? 1   SER A H1   6  
ATOM   6823  H H2   . SER A 1 1  ? 4.003   3.686   11.847  1.00 1.69 ? 1   SER A H2   6  
ATOM   6824  H H3   . SER A 1 1  ? 5.683   3.606   11.968  1.00 1.94 ? 1   SER A H3   6  
ATOM   6825  H HA   . SER A 1 1  ? 4.139   5.676   10.539  1.00 1.33 ? 1   SER A HA   6  
ATOM   6826  H HB2  . SER A 1 1  ? 5.820   6.057   13.005  1.00 2.07 ? 1   SER A HB2  6  
ATOM   6827  H HB3  . SER A 1 1  ? 4.579   7.122   12.340  1.00 2.12 ? 1   SER A HB3  6  
ATOM   6828  H HG   . SER A 1 1  ? 3.530   6.111   13.940  1.00 2.51 ? 1   SER A HG   6  
ATOM   6829  N N    . GLU A 1 2  ? 7.371   5.122   10.801  1.00 0.80 ? 2   GLU A N    6  
ATOM   6830  C CA   . GLU A 1 2  ? 8.666   5.437   10.206  1.00 0.85 ? 2   GLU A CA   6  
ATOM   6831  C C    . GLU A 1 2  ? 9.281   4.232   9.494   1.00 0.72 ? 2   GLU A C    6  
ATOM   6832  O O    . GLU A 1 2  ? 9.226   4.132   8.268   1.00 0.72 ? 2   GLU A O    6  
ATOM   6833  C CB   . GLU A 1 2  ? 9.628   5.957   11.285  1.00 1.13 ? 2   GLU A CB   6  
ATOM   6834  C CG   . GLU A 1 2  ? 9.176   5.646   12.706  1.00 1.33 ? 2   GLU A CG   6  
ATOM   6835  C CD   . GLU A 1 2  ? 10.190  6.039   13.761  1.00 1.48 ? 2   GLU A CD   6  
ATOM   6836  O OE1  . GLU A 1 2  ? 10.812  7.117   13.635  1.00 1.99 ? 2   GLU A OE1  6  
ATOM   6837  O OE2  . GLU A 1 2  ? 10.357  5.274   14.732  1.00 1.97 ? 2   GLU A OE2  6  
ATOM   6838  H H    . GLU A 1 2  ? 7.317   4.414   11.478  1.00 0.89 ? 2   GLU A H    6  
ATOM   6839  H HA   . GLU A 1 2  ? 8.508   6.218   9.479   1.00 0.92 ? 2   GLU A HA   6  
ATOM   6840  H HB2  . GLU A 1 2  ? 10.597  5.507   11.132  1.00 1.41 ? 2   GLU A HB2  6  
ATOM   6841  H HB3  . GLU A 1 2  ? 9.716   7.029   11.183  1.00 1.30 ? 2   GLU A HB3  6  
ATOM   6842  H HG2  . GLU A 1 2  ? 8.260   6.180   12.901  1.00 1.76 ? 2   GLU A HG2  6  
ATOM   6843  H HG3  . GLU A 1 2  ? 8.991   4.583   12.784  1.00 1.92 ? 2   GLU A HG3  6  
ATOM   6844  N N    . ALA A 1 3  ? 9.840   3.308   10.274  1.00 0.74 ? 3   ALA A N    6  
ATOM   6845  C CA   . ALA A 1 3  ? 10.495  2.116   9.734   1.00 0.73 ? 3   ALA A CA   6  
ATOM   6846  C C    . ALA A 1 3  ? 9.572   1.312   8.820   1.00 0.59 ? 3   ALA A C    6  
ATOM   6847  O O    . ALA A 1 3  ? 10.019  0.767   7.813   1.00 0.57 ? 3   ALA A O    6  
ATOM   6848  C CB   . ALA A 1 3  ? 11.008  1.243   10.869  1.00 0.89 ? 3   ALA A CB   6  
ATOM   6849  H H    . ALA A 1 3  ? 9.817   3.434   11.247  1.00 0.83 ? 3   ALA A H    6  
ATOM   6850  H HA   . ALA A 1 3  ? 11.347  2.445   9.159   1.00 0.80 ? 3   ALA A HA   6  
ATOM   6851  H HB1  . ALA A 1 3  ? 11.701  1.809   11.471  1.00 1.15 ? 3   ALA A HB1  6  
ATOM   6852  H HB2  . ALA A 1 3  ? 11.507  0.378   10.460  1.00 1.06 ? 3   ALA A HB2  6  
ATOM   6853  H HB3  . ALA A 1 3  ? 10.177  0.925   11.480  1.00 0.95 ? 3   ALA A HB3  6  
ATOM   6854  N N    . VAL A 1 4  ? 8.289   1.253   9.167   1.00 0.56 ? 4   VAL A N    6  
ATOM   6855  C CA   . VAL A 1 4  ? 7.314   0.513   8.366   1.00 0.50 ? 4   VAL A CA   6  
ATOM   6856  C C    . VAL A 1 4  ? 7.294   1.009   6.917   1.00 0.45 ? 4   VAL A C    6  
ATOM   6857  O O    . VAL A 1 4  ? 7.258   0.207   5.983   1.00 0.48 ? 4   VAL A O    6  
ATOM   6858  C CB   . VAL A 1 4  ? 5.891   0.609   8.966   1.00 0.57 ? 4   VAL A CB   6  
ATOM   6859  C CG1  . VAL A 1 4  ? 4.845   0.085   7.991   1.00 0.82 ? 4   VAL A CG1  6  
ATOM   6860  C CG2  . VAL A 1 4  ? 5.811   -0.155  10.276  1.00 0.79 ? 4   VAL A CG2  6  
ATOM   6861  H H    . VAL A 1 4  ? 7.995   1.710   9.983   1.00 0.63 ? 4   VAL A H    6  
ATOM   6862  H HA   . VAL A 1 4  ? 7.612   -0.526  8.370   1.00 0.54 ? 4   VAL A HA   6  
ATOM   6863  H HB   . VAL A 1 4  ? 5.676   1.647   9.167   1.00 0.63 ? 4   VAL A HB   6  
ATOM   6864  H HG11 . VAL A 1 4  ? 4.812   0.723   7.120   1.00 1.06 ? 4   VAL A HG11 6  
ATOM   6865  H HG12 . VAL A 1 4  ? 3.878   0.077   8.468   1.00 0.99 ? 4   VAL A HG12 6  
ATOM   6866  H HG13 . VAL A 1 4  ? 5.106   -0.920  7.689   1.00 1.13 ? 4   VAL A HG13 6  
ATOM   6867  H HG21 . VAL A 1 4  ? 6.497   0.278   10.985  1.00 1.11 ? 4   VAL A HG21 6  
ATOM   6868  H HG22 . VAL A 1 4  ? 6.073   -1.188  10.107  1.00 1.16 ? 4   VAL A HG22 6  
ATOM   6869  H HG23 . VAL A 1 4  ? 4.806   -0.097  10.665  1.00 1.27 ? 4   VAL A HG23 6  
ATOM   6870  N N    . ILE A 1 5  ? 7.344   2.325   6.735   1.00 0.48 ? 5   ILE A N    6  
ATOM   6871  C CA   . ILE A 1 5  ? 7.328   2.904   5.398   1.00 0.51 ? 5   ILE A CA   6  
ATOM   6872  C C    . ILE A 1 5  ? 8.627   2.593   4.666   1.00 0.46 ? 5   ILE A C    6  
ATOM   6873  O O    . ILE A 1 5  ? 8.615   2.250   3.485   1.00 0.47 ? 5   ILE A O    6  
ATOM   6874  C CB   . ILE A 1 5  ? 7.121   4.435   5.423   1.00 0.65 ? 5   ILE A CB   6  
ATOM   6875  C CG1  . ILE A 1 5  ? 5.878   4.795   6.244   1.00 0.81 ? 5   ILE A CG1  6  
ATOM   6876  C CG2  . ILE A 1 5  ? 6.997   4.974   4.003   1.00 0.81 ? 5   ILE A CG2  6  
ATOM   6877  C CD1  . ILE A 1 5  ? 5.569   6.278   6.265   1.00 0.98 ? 5   ILE A CD1  6  
ATOM   6878  H H    . ILE A 1 5  ? 7.404   2.917   7.513   1.00 0.54 ? 5   ILE A H    6  
ATOM   6879  H HA   . ILE A 1 5  ? 6.510   2.460   4.856   1.00 0.55 ? 5   ILE A HA   6  
ATOM   6880  H HB   . ILE A 1 5  ? 7.990   4.886   5.881   1.00 0.71 ? 5   ILE A HB   6  
ATOM   6881  H HG12 . ILE A 1 5  ? 5.021   4.286   5.830   1.00 0.91 ? 5   ILE A HG12 6  
ATOM   6882  H HG13 . ILE A 1 5  ? 6.026   4.472   7.265   1.00 0.85 ? 5   ILE A HG13 6  
ATOM   6883  H HG21 . ILE A 1 5  ? 6.138   4.531   3.522   1.00 1.02 ? 5   ILE A HG21 6  
ATOM   6884  H HG22 . ILE A 1 5  ? 7.889   4.728   3.445   1.00 1.00 ? 5   ILE A HG22 6  
ATOM   6885  H HG23 . ILE A 1 5  ? 6.878   6.046   4.035   1.00 1.04 ? 5   ILE A HG23 6  
ATOM   6886  H HD11 . ILE A 1 5  ? 5.349   6.612   5.262   1.00 1.27 ? 5   ILE A HD11 6  
ATOM   6887  H HD12 . ILE A 1 5  ? 6.423   6.816   6.645   1.00 1.29 ? 5   ILE A HD12 6  
ATOM   6888  H HD13 . ILE A 1 5  ? 4.715   6.460   6.900   1.00 1.30 ? 5   ILE A HD13 6  
ATOM   6889  N N    . LYS A 1 6  ? 9.742   2.688   5.382   1.00 0.49 ? 6   LYS A N    6  
ATOM   6890  C CA   . LYS A 1 6  ? 11.052  2.420   4.800   1.00 0.50 ? 6   LYS A CA   6  
ATOM   6891  C C    . LYS A 1 6  ? 11.116  1.013   4.222   1.00 0.46 ? 6   LYS A C    6  
ATOM   6892  O O    . LYS A 1 6  ? 11.613  0.815   3.116   1.00 0.47 ? 6   LYS A O    6  
ATOM   6893  C CB   . LYS A 1 6  ? 12.160  2.607   5.840   1.00 0.61 ? 6   LYS A CB   6  
ATOM   6894  C CG   . LYS A 1 6  ? 12.200  3.999   6.460   1.00 0.85 ? 6   LYS A CG   6  
ATOM   6895  C CD   . LYS A 1 6  ? 12.141  5.102   5.409   1.00 1.11 ? 6   LYS A CD   6  
ATOM   6896  C CE   . LYS A 1 6  ? 13.360  5.093   4.498   1.00 1.11 ? 6   LYS A CE   6  
ATOM   6897  N NZ   . LYS A 1 6  ? 13.268  6.132   3.439   1.00 1.12 ? 6   LYS A NZ   6  
ATOM   6898  H H    . LYS A 1 6  ? 9.682   2.951   6.325   1.00 0.53 ? 6   LYS A H    6  
ATOM   6899  H HA   . LYS A 1 6  ? 11.203  3.126   3.998   1.00 0.52 ? 6   LYS A HA   6  
ATOM   6900  H HB2  . LYS A 1 6  ? 12.013  1.891   6.633   1.00 0.84 ? 6   LYS A HB2  6  
ATOM   6901  H HB3  . LYS A 1 6  ? 13.113  2.418   5.368   1.00 0.80 ? 6   LYS A HB3  6  
ATOM   6902  H HG2  . LYS A 1 6  ? 11.358  4.107   7.126   1.00 1.25 ? 6   LYS A HG2  6  
ATOM   6903  H HG3  . LYS A 1 6  ? 13.114  4.104   7.024   1.00 1.02 ? 6   LYS A HG3  6  
ATOM   6904  H HD2  . LYS A 1 6  ? 11.256  4.965   4.807   1.00 1.57 ? 6   LYS A HD2  6  
ATOM   6905  H HD3  . LYS A 1 6  ? 12.089  6.056   5.914   1.00 1.65 ? 6   LYS A HD3  6  
ATOM   6906  H HE2  . LYS A 1 6  ? 14.242  5.272   5.093   1.00 1.38 ? 6   LYS A HE2  6  
ATOM   6907  H HE3  . LYS A 1 6  ? 13.431  4.125   4.031   1.00 1.51 ? 6   LYS A HE3  6  
ATOM   6908  H HZ1  . LYS A 1 6  ? 13.086  7.065   3.864   1.00 1.52 ? 6   LYS A HZ1  6  
ATOM   6909  H HZ2  . LYS A 1 6  ? 12.497  5.909   2.782   1.00 1.47 ? 6   LYS A HZ2  6  
ATOM   6910  H HZ3  . LYS A 1 6  ? 14.158  6.181   2.902   1.00 1.48 ? 6   LYS A HZ3  6  
ATOM   6911  N N    . VAL A 1 7  ? 10.597  0.040   4.959   1.00 0.46 ? 7   VAL A N    6  
ATOM   6912  C CA   . VAL A 1 7  ? 10.600  -1.344  4.499   1.00 0.48 ? 7   VAL A CA   6  
ATOM   6913  C C    . VAL A 1 7  ? 9.736   -1.491  3.241   1.00 0.44 ? 7   VAL A C    6  
ATOM   6914  O O    . VAL A 1 7  ? 10.021  -2.318  2.370   1.00 0.54 ? 7   VAL A O    6  
ATOM   6915  C CB   . VAL A 1 7  ? 10.094  -2.310  5.593   1.00 0.54 ? 7   VAL A CB   6  
ATOM   6916  C CG1  . VAL A 1 7  ? 10.148  -3.752  5.111   1.00 0.60 ? 7   VAL A CG1  6  
ATOM   6917  C CG2  . VAL A 1 7  ? 10.908  -2.147  6.868   1.00 0.61 ? 7   VAL A CG2  6  
ATOM   6918  H H    . VAL A 1 7  ? 10.207  0.255   5.837   1.00 0.48 ? 7   VAL A H    6  
ATOM   6919  H HA   . VAL A 1 7  ? 11.619  -1.609  4.255   1.00 0.53 ? 7   VAL A HA   6  
ATOM   6920  H HB   . VAL A 1 7  ? 9.066   -2.065  5.816   1.00 0.55 ? 7   VAL A HB   6  
ATOM   6921  H HG11 . VAL A 1 7  ? 11.159  -3.997  4.818   1.00 0.73 ? 7   VAL A HG11 6  
ATOM   6922  H HG12 . VAL A 1 7  ? 9.489   -3.876  4.264   1.00 0.72 ? 7   VAL A HG12 6  
ATOM   6923  H HG13 . VAL A 1 7  ? 9.836   -4.407  5.910   1.00 0.79 ? 7   VAL A HG13 6  
ATOM   6924  H HG21 . VAL A 1 7  ? 10.852  -1.124  7.204   1.00 0.75 ? 7   VAL A HG21 6  
ATOM   6925  H HG22 . VAL A 1 7  ? 11.938  -2.406  6.672   1.00 0.79 ? 7   VAL A HG22 6  
ATOM   6926  H HG23 . VAL A 1 7  ? 10.512  -2.801  7.632   1.00 0.78 ? 7   VAL A HG23 6  
ATOM   6927  N N    . ILE A 1 8  ? 8.690   -0.676  3.151   1.00 0.38 ? 8   ILE A N    6  
ATOM   6928  C CA   . ILE A 1 8  ? 7.795   -0.695  2.002   1.00 0.40 ? 8   ILE A CA   6  
ATOM   6929  C C    . ILE A 1 8  ? 8.493   -0.088  0.784   1.00 0.37 ? 8   ILE A C    6  
ATOM   6930  O O    . ILE A 1 8  ? 8.630   -0.742  -0.252  1.00 0.40 ? 8   ILE A O    6  
ATOM   6931  C CB   . ILE A 1 8  ? 6.481   0.079   2.286   1.00 0.47 ? 8   ILE A CB   6  
ATOM   6932  C CG1  . ILE A 1 8  ? 5.597   -0.700  3.269   1.00 0.52 ? 8   ILE A CG1  6  
ATOM   6933  C CG2  . ILE A 1 8  ? 5.721   0.356   0.992   1.00 0.56 ? 8   ILE A CG2  6  
ATOM   6934  C CD1  . ILE A 1 8  ? 4.999   -1.970  2.691   1.00 0.61 ? 8   ILE A CD1  6  
ATOM   6935  H H    . ILE A 1 8  ? 8.518   -0.038  3.877   1.00 0.39 ? 8   ILE A H    6  
ATOM   6936  H HA   . ILE A 1 8  ? 7.546   -1.723  1.788   1.00 0.44 ? 8   ILE A HA   6  
ATOM   6937  H HB   . ILE A 1 8  ? 6.739   1.031   2.727   1.00 0.50 ? 8   ILE A HB   6  
ATOM   6938  H HG12 . ILE A 1 8  ? 6.188   -0.977  4.130   1.00 0.53 ? 8   ILE A HG12 6  
ATOM   6939  H HG13 . ILE A 1 8  ? 4.783   -0.065  3.592   1.00 0.59 ? 8   ILE A HG13 6  
ATOM   6940  H HG21 . ILE A 1 8  ? 4.760   0.790   1.221   1.00 0.96 ? 8   ILE A HG21 6  
ATOM   6941  H HG22 . ILE A 1 8  ? 5.579   -0.570  0.454   1.00 1.01 ? 8   ILE A HG22 6  
ATOM   6942  H HG23 . ILE A 1 8  ? 6.291   1.042   0.380   1.00 1.00 ? 8   ILE A HG23 6  
ATOM   6943  H HD11 . ILE A 1 8  ? 5.792   -2.645  2.408   1.00 0.96 ? 8   ILE A HD11 6  
ATOM   6944  H HD12 . ILE A 1 8  ? 4.408   -1.725  1.823   1.00 0.94 ? 8   ILE A HD12 6  
ATOM   6945  H HD13 . ILE A 1 8  ? 4.371   -2.441  3.433   1.00 0.97 ? 8   ILE A HD13 6  
ATOM   6946  N N    . SER A 1 9  ? 8.967   1.149   0.942   1.00 0.37 ? 9   SER A N    6  
ATOM   6947  C CA   . SER A 1 9  ? 9.640   1.871   -0.132  1.00 0.41 ? 9   SER A CA   6  
ATOM   6948  C C    . SER A 1 9  ? 10.899  1.147   -0.607  1.00 0.40 ? 9   SER A C    6  
ATOM   6949  O O    . SER A 1 9  ? 11.145  1.042   -1.809  1.00 0.46 ? 9   SER A O    6  
ATOM   6950  C CB   . SER A 1 9  ? 9.984   3.284   0.333   1.00 0.49 ? 9   SER A CB   6  
ATOM   6951  O OG   . SER A 1 9  ? 8.852   3.910   0.909   1.00 1.22 ? 9   SER A OG   6  
ATOM   6952  H H    . SER A 1 9  ? 8.853   1.596   1.811   1.00 0.39 ? 9   SER A H    6  
ATOM   6953  H HA   . SER A 1 9  ? 8.951   1.938   -0.961  1.00 0.45 ? 9   SER A HA   6  
ATOM   6954  H HB2  . SER A 1 9  ? 10.770  3.237   1.073   1.00 1.05 ? 9   SER A HB2  6  
ATOM   6955  H HB3  . SER A 1 9  ? 10.318  3.871   -0.511  1.00 1.19 ? 9   SER A HB3  6  
ATOM   6956  H HG   . SER A 1 9  ? 9.139   4.673   1.423   1.00 1.36 ? 9   SER A HG   6  
ATOM   6957  N N    . SER A 1 10 ? 11.680  0.623   0.333   1.00 0.39 ? 10  SER A N    6  
ATOM   6958  C CA   . SER A 1 10 ? 12.913  -0.088  0.003   1.00 0.43 ? 10  SER A CA   6  
ATOM   6959  C C    . SER A 1 10 ? 12.630  -1.333  -0.837  1.00 0.42 ? 10  SER A C    6  
ATOM   6960  O O    . SER A 1 10 ? 13.529  -1.877  -1.475  1.00 0.56 ? 10  SER A O    6  
ATOM   6961  C CB   . SER A 1 10 ? 13.671  -0.469  1.282   1.00 0.52 ? 10  SER A CB   6  
ATOM   6962  O OG   . SER A 1 10 ? 15.075  -0.395  1.094   1.00 1.17 ? 10  SER A OG   6  
ATOM   6963  H H    . SER A 1 10 ? 11.428  0.724   1.281   1.00 0.41 ? 10  SER A H    6  
ATOM   6964  H HA   . SER A 1 10 ? 13.528  0.582   -0.577  1.00 0.47 ? 10  SER A HA   6  
ATOM   6965  H HB2  . SER A 1 10 ? 13.391  0.210   2.076   1.00 0.93 ? 10  SER A HB2  6  
ATOM   6966  H HB3  . SER A 1 10 ? 13.411  -1.479  1.565   1.00 1.00 ? 10  SER A HB3  6  
ATOM   6967  H HG   . SER A 1 10 ? 15.482  -0.042  1.895   1.00 1.54 ? 10  SER A HG   6  
ATOM   6968  N N    . ALA A 1 11 ? 11.376  -1.766  -0.853  1.00 0.37 ? 11  ALA A N    6  
ATOM   6969  C CA   . ALA A 1 11 ? 10.993  -2.939  -1.618  1.00 0.41 ? 11  ALA A CA   6  
ATOM   6970  C C    . ALA A 1 11 ? 10.522  -2.555  -3.016  1.00 0.37 ? 11  ALA A C    6  
ATOM   6971  O O    . ALA A 1 11 ? 11.022  -3.082  -4.012  1.00 0.42 ? 11  ALA A O    6  
ATOM   6972  C CB   . ALA A 1 11 ? 9.915   -3.716  -0.889  1.00 0.47 ? 11  ALA A CB   6  
ATOM   6973  H H    . ALA A 1 11 ? 10.693  -1.278  -0.343  1.00 0.41 ? 11  ALA A H    6  
ATOM   6974  H HA   . ALA A 1 11 ? 11.860  -3.576  -1.705  1.00 0.47 ? 11  ALA A HA   6  
ATOM   6975  H HB1  . ALA A 1 11 ? 9.044   -3.092  -0.771  1.00 0.52 ? 11  ALA A HB1  6  
ATOM   6976  H HB2  . ALA A 1 11 ? 10.281  -4.013  0.083   1.00 0.58 ? 11  ALA A HB2  6  
ATOM   6977  H HB3  . ALA A 1 11 ? 9.653   -4.594  -1.460  1.00 0.58 ? 11  ALA A HB3  6  
ATOM   6978  N N    . CYS A 1 12 ? 9.578   -1.621  -3.102  1.00 0.34 ? 12  CYS A N    6  
ATOM   6979  C CA   . CYS A 1 12 ? 9.058   -1.196  -4.399  1.00 0.37 ? 12  CYS A CA   6  
ATOM   6980  C C    . CYS A 1 12 ? 10.167  -0.613  -5.267  1.00 0.39 ? 12  CYS A C    6  
ATOM   6981  O O    . CYS A 1 12 ? 10.138  -0.743  -6.487  1.00 0.44 ? 12  CYS A O    6  
ATOM   6982  C CB   . CYS A 1 12 ? 7.917   -0.187  -4.237  1.00 0.42 ? 12  CYS A CB   6  
ATOM   6983  S SG   . CYS A 1 12 ? 8.097   0.919   -2.822  1.00 0.66 ? 12  CYS A SG   6  
ATOM   6984  H H    . CYS A 1 12 ? 9.228   -1.207  -2.282  1.00 0.35 ? 12  CYS A H    6  
ATOM   6985  H HA   . CYS A 1 12 ? 8.675   -2.074  -4.891  1.00 0.43 ? 12  CYS A HA   6  
ATOM   6986  H HB2  . CYS A 1 12 ? 7.864   0.425   -5.123  1.00 0.63 ? 12  CYS A HB2  6  
ATOM   6987  H HB3  . CYS A 1 12 ? 6.985   -0.724  -4.117  1.00 0.63 ? 12  CYS A HB3  6  
ATOM   6988  H HG   . CYS A 1 12 ? 8.284   2.153   -3.279  1.00 1.11 ? 12  CYS A HG   6  
ATOM   6989  N N    . LYS A 1 13 ? 11.161  -0.001  -4.633  1.00 0.41 ? 13  LYS A N    6  
ATOM   6990  C CA   . LYS A 1 13 ? 12.287  0.581   -5.360  1.00 0.49 ? 13  LYS A CA   6  
ATOM   6991  C C    . LYS A 1 13 ? 13.111  -0.507  -6.056  1.00 0.49 ? 13  LYS A C    6  
ATOM   6992  O O    . LYS A 1 13 ? 13.846  -0.231  -7.002  1.00 0.58 ? 13  LYS A O    6  
ATOM   6993  C CB   . LYS A 1 13 ? 13.177  1.390   -4.413  1.00 0.63 ? 13  LYS A CB   6  
ATOM   6994  C CG   . LYS A 1 13 ? 12.531  2.672   -3.906  1.00 0.96 ? 13  LYS A CG   6  
ATOM   6995  C CD   . LYS A 1 13 ? 12.508  3.752   -4.975  1.00 1.06 ? 13  LYS A CD   6  
ATOM   6996  C CE   . LYS A 1 13 ? 11.719  4.968   -4.517  1.00 1.40 ? 13  LYS A CE   6  
ATOM   6997  N NZ   . LYS A 1 13 ? 12.394  5.706   -3.415  1.00 1.34 ? 13  LYS A NZ   6  
ATOM   6998  H H    . LYS A 1 13 ? 11.133  0.071   -3.654  1.00 0.43 ? 13  LYS A H    6  
ATOM   6999  H HA   . LYS A 1 13 ? 11.886  1.243   -6.113  1.00 0.52 ? 13  LYS A HA   6  
ATOM   7000  H HB2  . LYS A 1 13 ? 13.424  0.776   -3.559  1.00 0.79 ? 13  LYS A HB2  6  
ATOM   7001  H HB3  . LYS A 1 13 ? 14.086  1.652   -4.931  1.00 0.85 ? 13  LYS A HB3  6  
ATOM   7002  H HG2  . LYS A 1 13 ? 11.517  2.455   -3.606  1.00 1.66 ? 13  LYS A HG2  6  
ATOM   7003  H HG3  . LYS A 1 13 ? 13.090  3.032   -3.054  1.00 1.57 ? 13  LYS A HG3  6  
ATOM   7004  H HD2  . LYS A 1 13 ? 13.522  4.053   -5.190  1.00 1.45 ? 13  LYS A HD2  6  
ATOM   7005  H HD3  . LYS A 1 13 ? 12.051  3.353   -5.868  1.00 1.68 ? 13  LYS A HD3  6  
ATOM   7006  H HE2  . LYS A 1 13 ? 11.591  5.635   -5.356  1.00 1.92 ? 13  LYS A HE2  6  
ATOM   7007  H HE3  . LYS A 1 13 ? 10.750  4.638   -4.175  1.00 1.72 ? 13  LYS A HE3  6  
ATOM   7008  H HZ1  . LYS A 1 13 ? 11.688  6.188   -2.819  1.00 1.65 ? 13  LYS A HZ1  6  
ATOM   7009  H HZ2  . LYS A 1 13 ? 13.033  6.426   -3.803  1.00 1.65 ? 13  LYS A HZ2  6  
ATOM   7010  H HZ3  . LYS A 1 13 ? 12.945  5.059   -2.818  1.00 1.73 ? 13  LYS A HZ3  6  
ATOM   7011  N N    . THR A 1 14 ? 12.985  -1.744  -5.587  1.00 0.49 ? 14  THR A N    6  
ATOM   7012  C CA   . THR A 1 14 ? 13.717  -2.854  -6.179  1.00 0.56 ? 14  THR A CA   6  
ATOM   7013  C C    . THR A 1 14 ? 12.870  -3.585  -7.222  1.00 0.54 ? 14  THR A C    6  
ATOM   7014  O O    . THR A 1 14 ? 13.379  -4.030  -8.248  1.00 0.72 ? 14  THR A O    6  
ATOM   7015  C CB   . THR A 1 14 ? 14.164  -3.871  -5.109  1.00 0.65 ? 14  THR A CB   6  
ATOM   7016  O OG1  . THR A 1 14 ? 14.265  -3.235  -3.828  1.00 0.77 ? 14  THR A OG1  6  
ATOM   7017  C CG2  . THR A 1 14 ? 15.506  -4.491  -5.478  1.00 0.83 ? 14  THR A CG2  6  
ATOM   7018  H H    . THR A 1 14 ? 12.389  -1.913  -4.823  1.00 0.48 ? 14  THR A H    6  
ATOM   7019  H HA   . THR A 1 14 ? 14.599  -2.455  -6.659  1.00 0.63 ? 14  THR A HA   6  
ATOM   7020  H HB   . THR A 1 14 ? 13.426  -4.656  -5.052  1.00 0.82 ? 14  THR A HB   6  
ATOM   7021  H HG1  . THR A 1 14 ? 14.599  -2.334  -3.939  1.00 0.99 ? 14  THR A HG1  6  
ATOM   7022  H HG21 . THR A 1 14 ? 16.254  -3.718  -5.550  1.00 1.01 ? 14  THR A HG21 6  
ATOM   7023  H HG22 . THR A 1 14 ? 15.419  -4.999  -6.428  1.00 1.11 ? 14  THR A HG22 6  
ATOM   7024  H HG23 . THR A 1 14 ? 15.793  -5.201  -4.715  1.00 1.00 ? 14  THR A HG23 6  
ATOM   7025  N N    . TYR A 1 15 ? 11.575  -3.710  -6.953  1.00 0.49 ? 15  TYR A N    6  
ATOM   7026  C CA   . TYR A 1 15 ? 10.673  -4.408  -7.867  1.00 0.54 ? 15  TYR A CA   6  
ATOM   7027  C C    . TYR A 1 15 ? 10.178  -3.490  -8.983  1.00 0.56 ? 15  TYR A C    6  
ATOM   7028  O O    . TYR A 1 15 ? 10.270  -3.831  -10.163 1.00 0.72 ? 15  TYR A O    6  
ATOM   7029  C CB   . TYR A 1 15 ? 9.489   -5.005  -7.094  1.00 0.55 ? 15  TYR A CB   6  
ATOM   7030  C CG   . TYR A 1 15 ? 9.903   -6.017  -6.046  1.00 0.60 ? 15  TYR A CG   6  
ATOM   7031  C CD1  . TYR A 1 15 ? 9.813   -5.724  -4.691  1.00 0.67 ? 15  TYR A CD1  6  
ATOM   7032  C CD2  . TYR A 1 15 ? 10.399  -7.262  -6.413  1.00 0.80 ? 15  TYR A CD2  6  
ATOM   7033  C CE1  . TYR A 1 15 ? 10.206  -6.640  -3.735  1.00 0.78 ? 15  TYR A CE1  6  
ATOM   7034  C CE2  . TYR A 1 15 ? 10.790  -8.186  -5.461  1.00 0.91 ? 15  TYR A CE2  6  
ATOM   7035  C CZ   . TYR A 1 15 ? 10.693  -7.868  -4.123  1.00 0.84 ? 15  TYR A CZ   6  
ATOM   7036  O OH   . TYR A 1 15 ? 11.088  -8.781  -3.166  1.00 1.00 ? 15  TYR A OH   6  
ATOM   7037  H H    . TYR A 1 15 ? 11.220  -3.337  -6.120  1.00 0.54 ? 15  TYR A H    6  
ATOM   7038  H HA   . TYR A 1 15 ? 11.230  -5.215  -8.317  1.00 0.62 ? 15  TYR A HA   6  
ATOM   7039  H HB2  . TYR A 1 15 ? 8.956   -4.209  -6.595  1.00 0.54 ? 15  TYR A HB2  6  
ATOM   7040  H HB3  . TYR A 1 15 ? 8.823   -5.499  -7.789  1.00 0.63 ? 15  TYR A HB3  6  
ATOM   7041  H HD1  . TYR A 1 15 ? 9.432   -4.760  -4.386  1.00 0.79 ? 15  TYR A HD1  6  
ATOM   7042  H HD2  . TYR A 1 15 ? 10.473  -7.507  -7.463  1.00 0.96 ? 15  TYR A HD2  6  
ATOM   7043  H HE1  . TYR A 1 15 ? 10.127  -6.392  -2.687  1.00 0.93 ? 15  TYR A HE1  6  
ATOM   7044  H HE2  . TYR A 1 15 ? 11.172  -9.148  -5.766  1.00 1.14 ? 15  TYR A HE2  6  
ATOM   7045  H HH   . TYR A 1 15 ? 11.723  -9.401  -3.550  1.00 1.22 ? 15  TYR A HH   6  
ATOM   7046  N N    . CYS A 1 16 ? 9.663   -2.329  -8.614  1.00 0.50 ? 16  CYS A N    6  
ATOM   7047  C CA   . CYS A 1 16 ? 9.156   -1.378  -9.593  1.00 0.55 ? 16  CYS A CA   6  
ATOM   7048  C C    . CYS A 1 16 ? 10.270  -0.442  -10.048 1.00 0.57 ? 16  CYS A C    6  
ATOM   7049  O O    . CYS A 1 16 ? 10.475  -0.229  -11.242 1.00 0.88 ? 16  CYS A O    6  
ATOM   7050  C CB   . CYS A 1 16 ? 7.995   -0.575  -8.999  1.00 0.54 ? 16  CYS A CB   6  
ATOM   7051  S SG   . CYS A 1 16 ? 6.899   -1.544  -7.938  1.00 0.67 ? 16  CYS A SG   6  
ATOM   7052  H H    . CYS A 1 16 ? 9.627   -2.101  -7.660  1.00 0.50 ? 16  CYS A H    6  
ATOM   7053  H HA   . CYS A 1 16 ? 8.799   -1.939  -10.443 1.00 0.64 ? 16  CYS A HA   6  
ATOM   7054  H HB2  . CYS A 1 16 ? 8.393   0.236   -8.407  1.00 0.56 ? 16  CYS A HB2  6  
ATOM   7055  H HB3  . CYS A 1 16 ? 7.400   -0.167  -9.804  1.00 0.63 ? 16  CYS A HB3  6  
ATOM   7056  H HG   . CYS A 1 16 ? 6.160   -2.322  -8.720  1.00 1.15 ? 16  CYS A HG   6  
ATOM   7057  N N    . GLY A 1 17 ? 10.996  0.110   -9.086  1.00 0.49 ? 17  GLY A N    6  
ATOM   7058  C CA   . GLY A 1 17 ? 12.086  1.010   -9.399  1.00 0.56 ? 17  GLY A CA   6  
ATOM   7059  C C    . GLY A 1 17 ? 11.674  2.464   -9.276  1.00 0.52 ? 17  GLY A C    6  
ATOM   7060  O O    . GLY A 1 17 ? 11.254  2.910   -8.207  1.00 0.66 ? 17  GLY A O    6  
ATOM   7061  H H    . GLY A 1 17 ? 10.782  -0.095  -8.146  1.00 0.62 ? 17  GLY A H    6  
ATOM   7062  H HA2  . GLY A 1 17 ? 12.907  0.816   -8.720  1.00 0.65 ? 17  GLY A HA2  6  
ATOM   7063  H HA3  . GLY A 1 17 ? 12.416  0.823   -10.408 1.00 0.63 ? 17  GLY A HA3  6  
ATOM   7064  N N    . LYS A 1 18 ? 11.767  3.199   -10.374 1.00 0.50 ? 18  LYS A N    6  
ATOM   7065  C CA   . LYS A 1 18 ? 11.405  4.616   -10.383 1.00 0.56 ? 18  LYS A CA   6  
ATOM   7066  C C    . LYS A 1 18 ? 9.912   4.796   -10.632 1.00 0.53 ? 18  LYS A C    6  
ATOM   7067  O O    . LYS A 1 18 ? 9.403   5.917   -10.664 1.00 0.62 ? 18  LYS A O    6  
ATOM   7068  C CB   . LYS A 1 18 ? 12.217  5.386   -11.430 1.00 0.70 ? 18  LYS A CB   6  
ATOM   7069  C CG   . LYS A 1 18 ? 12.525  4.589   -12.693 1.00 0.81 ? 18  LYS A CG   6  
ATOM   7070  C CD   . LYS A 1 18 ? 13.919  3.980   -12.641 1.00 1.11 ? 18  LYS A CD   6  
ATOM   7071  C CE   . LYS A 1 18 ? 15.003  5.032   -12.828 1.00 1.46 ? 18  LYS A CE   6  
ATOM   7072  N NZ   . LYS A 1 18 ? 16.359  4.484   -12.553 1.00 1.82 ? 18  LYS A NZ   6  
ATOM   7073  H H    . LYS A 1 18 ? 12.085  2.782   -11.202 1.00 0.58 ? 18  LYS A H    6  
ATOM   7074  H HA   . LYS A 1 18 ? 11.637  5.013   -9.406  1.00 0.60 ? 18  LYS A HA   6  
ATOM   7075  H HB2  . LYS A 1 18 ? 11.667  6.270   -11.715 1.00 0.87 ? 18  LYS A HB2  6  
ATOM   7076  H HB3  . LYS A 1 18 ? 13.151  5.686   -10.985 1.00 0.79 ? 18  LYS A HB3  6  
ATOM   7077  H HG2  . LYS A 1 18 ? 11.800  3.796   -12.791 1.00 0.90 ? 18  LYS A HG2  6  
ATOM   7078  H HG3  . LYS A 1 18 ? 12.462  5.243   -13.550 1.00 1.06 ? 18  LYS A HG3  6  
ATOM   7079  H HD2  . LYS A 1 18 ? 14.057  3.505   -11.682 1.00 1.33 ? 18  LYS A HD2  6  
ATOM   7080  H HD3  . LYS A 1 18 ? 14.007  3.245   -13.425 1.00 1.44 ? 18  LYS A HD3  6  
ATOM   7081  H HE2  . LYS A 1 18 ? 14.969  5.388   -13.845 1.00 1.85 ? 18  LYS A HE2  6  
ATOM   7082  H HE3  . LYS A 1 18 ? 14.812  5.853   -12.153 1.00 1.67 ? 18  LYS A HE3  6  
ATOM   7083  H HZ1  . LYS A 1 18 ? 17.082  5.212   -12.722 1.00 2.13 ? 18  LYS A HZ1  6  
ATOM   7084  H HZ2  . LYS A 1 18 ? 16.550  3.669   -13.174 1.00 2.19 ? 18  LYS A HZ2  6  
ATOM   7085  H HZ3  . LYS A 1 18 ? 16.422  4.172   -11.562 1.00 2.14 ? 18  LYS A HZ3  6  
ATOM   7086  N N    . THR A 1 19 ? 9.215   3.684   -10.814 1.00 0.49 ? 19  THR A N    6  
ATOM   7087  C CA   . THR A 1 19 ? 7.779   3.703   -11.041 1.00 0.52 ? 19  THR A CA   6  
ATOM   7088  C C    . THR A 1 19 ? 7.035   3.519   -9.720  1.00 0.48 ? 19  THR A C    6  
ATOM   7089  O O    . THR A 1 19 ? 5.824   3.300   -9.693  1.00 0.62 ? 19  THR A O    6  
ATOM   7090  C CB   . THR A 1 19 ? 7.370   2.585   -12.019 1.00 0.62 ? 19  THR A CB   6  
ATOM   7091  O OG1  . THR A 1 19 ? 8.539   1.866   -12.441 1.00 0.83 ? 19  THR A OG1  6  
ATOM   7092  C CG2  . THR A 1 19 ? 6.647   3.155   -13.231 1.00 0.91 ? 19  THR A CG2  6  
ATOM   7093  H H    . THR A 1 19 ? 9.680   2.824   -10.811 1.00 0.49 ? 19  THR A H    6  
ATOM   7094  H HA   . THR A 1 19 ? 7.514   4.656   -11.474 1.00 0.60 ? 19  THR A HA   6  
ATOM   7095  H HB   . THR A 1 19 ? 6.703   1.905   -11.508 1.00 0.72 ? 19  THR A HB   6  
ATOM   7096  H HG1  . THR A 1 19 ? 8.301   0.954   -12.652 1.00 1.10 ? 19  THR A HG1  6  
ATOM   7097  H HG21 . THR A 1 19 ? 6.343   2.349   -13.882 1.00 1.10 ? 19  THR A HG21 6  
ATOM   7098  H HG22 . THR A 1 19 ? 7.311   3.820   -13.767 1.00 1.23 ? 19  THR A HG22 6  
ATOM   7099  H HG23 . THR A 1 19 ? 5.776   3.700   -12.904 1.00 1.17 ? 19  THR A HG23 6  
ATOM   7100  N N    . SER A 1 20 ? 7.780   3.604   -8.625  1.00 0.42 ? 20  SER A N    6  
ATOM   7101  C CA   . SER A 1 20 ? 7.222   3.448   -7.292  1.00 0.42 ? 20  SER A CA   6  
ATOM   7102  C C    . SER A 1 20 ? 6.568   4.743   -6.819  1.00 0.41 ? 20  SER A C    6  
ATOM   7103  O O    . SER A 1 20 ? 7.007   5.838   -7.177  1.00 0.46 ? 20  SER A O    6  
ATOM   7104  C CB   . SER A 1 20 ? 8.327   3.035   -6.320  1.00 0.46 ? 20  SER A CB   6  
ATOM   7105  O OG   . SER A 1 20 ? 9.128   2.011   -6.879  1.00 0.97 ? 20  SER A OG   6  
ATOM   7106  H H    . SER A 1 20 ? 8.736   3.785   -8.718  1.00 0.49 ? 20  SER A H    6  
ATOM   7107  H HA   . SER A 1 20 ? 6.473   2.670   -7.331  1.00 0.48 ? 20  SER A HA   6  
ATOM   7108  H HB2  . SER A 1 20 ? 8.954   3.888   -6.104  1.00 0.70 ? 20  SER A HB2  6  
ATOM   7109  H HB3  . SER A 1 20 ? 7.885   2.672   -5.403  1.00 0.81 ? 20  SER A HB3  6  
ATOM   7110  H HG   . SER A 1 20 ? 9.927   2.400   -7.258  1.00 1.21 ? 20  SER A HG   6  
ATOM   7111  N N    . PRO A 1 21 ? 5.503   4.636   -6.012  1.00 0.43 ? 21  PRO A N    6  
ATOM   7112  C CA   . PRO A 1 21 ? 4.797   5.804   -5.488  1.00 0.49 ? 21  PRO A CA   6  
ATOM   7113  C C    . PRO A 1 21 ? 5.581   6.486   -4.373  1.00 0.42 ? 21  PRO A C    6  
ATOM   7114  O O    . PRO A 1 21 ? 6.199   5.818   -3.543  1.00 0.46 ? 21  PRO A O    6  
ATOM   7115  C CB   . PRO A 1 21 ? 3.502   5.205   -4.942  1.00 0.62 ? 21  PRO A CB   6  
ATOM   7116  C CG   . PRO A 1 21 ? 3.861   3.814   -4.554  1.00 0.63 ? 21  PRO A CG   6  
ATOM   7117  C CD   . PRO A 1 21 ? 4.907   3.368   -5.540  1.00 0.50 ? 21  PRO A CD   6  
ATOM   7118  H HA   . PRO A 1 21 ? 4.572   6.520   -6.265  1.00 0.57 ? 21  PRO A HA   6  
ATOM   7119  H HB2  . PRO A 1 21 ? 3.163   5.774   -4.085  1.00 0.69 ? 21  PRO A HB2  6  
ATOM   7120  H HB3  . PRO A 1 21 ? 2.744   5.191   -5.707  1.00 0.76 ? 21  PRO A HB3  6  
ATOM   7121  H HG2  . PRO A 1 21 ? 4.261   3.809   -3.548  1.00 0.76 ? 21  PRO A HG2  6  
ATOM   7122  H HG3  . PRO A 1 21 ? 2.996   3.174   -4.621  1.00 0.81 ? 21  PRO A HG3  6  
ATOM   7123  H HD2  . PRO A 1 21 ? 5.648   2.753   -5.050  1.00 0.55 ? 21  PRO A HD2  6  
ATOM   7124  H HD3  . PRO A 1 21 ? 4.450   2.830   -6.358  1.00 0.57 ? 21  PRO A HD3  6  
ATOM   7125  N N    . SER A 1 22 ? 5.567   7.813   -4.359  1.00 0.43 ? 22  SER A N    6  
ATOM   7126  C CA   . SER A 1 22 ? 6.266   8.572   -3.333  1.00 0.43 ? 22  SER A CA   6  
ATOM   7127  C C    . SER A 1 22 ? 5.647   8.297   -1.967  1.00 0.38 ? 22  SER A C    6  
ATOM   7128  O O    . SER A 1 22 ? 4.469   7.935   -1.875  1.00 0.39 ? 22  SER A O    6  
ATOM   7129  C CB   . SER A 1 22 ? 6.194   10.066  -3.648  1.00 0.56 ? 22  SER A CB   6  
ATOM   7130  O OG   . SER A 1 22 ? 6.536   10.314  -5.001  1.00 1.11 ? 22  SER A OG   6  
ATOM   7131  H H    . SER A 1 22 ? 5.083   8.294   -5.059  1.00 0.53 ? 22  SER A H    6  
ATOM   7132  H HA   . SER A 1 22 ? 7.299   8.257   -3.323  1.00 0.47 ? 22  SER A HA   6  
ATOM   7133  H HB2  . SER A 1 22 ? 5.190   10.420  -3.476  1.00 0.96 ? 22  SER A HB2  6  
ATOM   7134  H HB3  . SER A 1 22 ? 6.881   10.601  -3.011  1.00 0.81 ? 22  SER A HB3  6  
ATOM   7135  H HG   . SER A 1 22 ? 7.495   10.421  -5.067  1.00 1.48 ? 22  SER A HG   6  
ATOM   7136  N N    . LYS A 1 23 ? 6.427   8.485   -0.912  1.00 0.44 ? 23  LYS A N    6  
ATOM   7137  C CA   . LYS A 1 23 ? 5.954   8.239   0.446   1.00 0.50 ? 23  LYS A CA   6  
ATOM   7138  C C    . LYS A 1 23 ? 4.709   9.070   0.751   1.00 0.42 ? 23  LYS A C    6  
ATOM   7139  O O    . LYS A 1 23 ? 3.846   8.639   1.512   1.00 0.42 ? 23  LYS A O    6  
ATOM   7140  C CB   . LYS A 1 23 ? 7.066   8.542   1.454   1.00 0.69 ? 23  LYS A CB   6  
ATOM   7141  C CG   . LYS A 1 23 ? 6.616   8.526   2.908   1.00 0.63 ? 23  LYS A CG   6  
ATOM   7142  C CD   . LYS A 1 23 ? 6.302   9.930   3.421   1.00 1.12 ? 23  LYS A CD   6  
ATOM   7143  C CE   . LYS A 1 23 ? 7.544   10.637  3.937   1.00 1.17 ? 23  LYS A CE   6  
ATOM   7144  N NZ   . LYS A 1 23 ? 8.657   10.615  2.950   1.00 1.60 ? 23  LYS A NZ   6  
ATOM   7145  H H    . LYS A 1 23 ? 7.353   8.799   -1.048  1.00 0.50 ? 23  LYS A H    6  
ATOM   7146  H HA   . LYS A 1 23 ? 5.695   7.193   0.517   1.00 0.56 ? 23  LYS A HA   6  
ATOM   7147  H HB2  . LYS A 1 23 ? 7.847   7.807   1.337   1.00 1.00 ? 23  LYS A HB2  6  
ATOM   7148  H HB3  . LYS A 1 23 ? 7.470   9.519   1.236   1.00 1.02 ? 23  LYS A HB3  6  
ATOM   7149  H HG2  . LYS A 1 23 ? 5.728   7.918   2.991   1.00 0.92 ? 23  LYS A HG2  6  
ATOM   7150  H HG3  . LYS A 1 23 ? 7.406   8.099   3.511   1.00 0.87 ? 23  LYS A HG3  6  
ATOM   7151  H HD2  . LYS A 1 23 ? 5.881   10.515  2.614   1.00 1.72 ? 23  LYS A HD2  6  
ATOM   7152  H HD3  . LYS A 1 23 ? 5.583   9.854   4.224   1.00 1.84 ? 23  LYS A HD3  6  
ATOM   7153  H HE2  . LYS A 1 23 ? 7.291   11.662  4.156   1.00 1.51 ? 23  LYS A HE2  6  
ATOM   7154  H HE3  . LYS A 1 23 ? 7.870   10.147  4.845   1.00 1.35 ? 23  LYS A HE3  6  
ATOM   7155  H HZ1  . LYS A 1 23 ? 8.348   10.987  2.029   1.00 2.03 ? 23  LYS A HZ1  6  
ATOM   7156  H HZ2  . LYS A 1 23 ? 8.999   9.641   2.823   1.00 1.91 ? 23  LYS A HZ2  6  
ATOM   7157  H HZ3  . LYS A 1 23 ? 9.448   11.196  3.296   1.00 2.03 ? 23  LYS A HZ3  6  
ATOM   7158  N N    . LYS A 1 24 ? 4.617   10.251  0.145   1.00 0.41 ? 24  LYS A N    6  
ATOM   7159  C CA   . LYS A 1 24 ? 3.472   11.138  0.354   1.00 0.45 ? 24  LYS A CA   6  
ATOM   7160  C C    . LYS A 1 24 ? 2.163   10.433  0.010   1.00 0.40 ? 24  LYS A C    6  
ATOM   7161  O O    . LYS A 1 24 ? 1.176   10.549  0.737   1.00 0.48 ? 24  LYS A O    6  
ATOM   7162  C CB   . LYS A 1 24 ? 3.608   12.408  -0.489  1.00 0.56 ? 24  LYS A CB   6  
ATOM   7163  C CG   . LYS A 1 24 ? 4.565   13.434  0.090   1.00 0.83 ? 24  LYS A CG   6  
ATOM   7164  C CD   . LYS A 1 24 ? 6.012   13.052  -0.162  1.00 1.00 ? 24  LYS A CD   6  
ATOM   7165  C CE   . LYS A 1 24 ? 6.939   14.232  0.054   1.00 1.56 ? 24  LYS A CE   6  
ATOM   7166  N NZ   . LYS A 1 24 ? 8.354   13.868  -0.186  1.00 2.04 ? 24  LYS A NZ   6  
ATOM   7167  H H    . LYS A 1 24 ? 5.337   10.533  -0.456  1.00 0.44 ? 24  LYS A H    6  
ATOM   7168  H HA   . LYS A 1 24 ? 3.454   11.413  1.399   1.00 0.51 ? 24  LYS A HA   6  
ATOM   7169  H HB2  . LYS A 1 24 ? 3.964   12.133  -1.470  1.00 0.63 ? 24  LYS A HB2  6  
ATOM   7170  H HB3  . LYS A 1 24 ? 2.635   12.869  -0.586  1.00 0.77 ? 24  LYS A HB3  6  
ATOM   7171  H HG2  . LYS A 1 24 ? 4.372   14.394  -0.364  1.00 1.37 ? 24  LYS A HG2  6  
ATOM   7172  H HG3  . LYS A 1 24 ? 4.402   13.502  1.154   1.00 1.33 ? 24  LYS A HG3  6  
ATOM   7173  H HD2  . LYS A 1 24 ? 6.287   12.259  0.518   1.00 1.50 ? 24  LYS A HD2  6  
ATOM   7174  H HD3  . LYS A 1 24 ? 6.113   12.706  -1.181  1.00 1.29 ? 24  LYS A HD3  6  
ATOM   7175  H HE2  . LYS A 1 24 ? 6.660   15.023  -0.625  1.00 1.84 ? 24  LYS A HE2  6  
ATOM   7176  H HE3  . LYS A 1 24 ? 6.831   14.574  1.071   1.00 2.19 ? 24  LYS A HE3  6  
ATOM   7177  H HZ1  . LYS A 1 24 ? 8.987   14.597  0.200   1.00 2.22 ? 24  LYS A HZ1  6  
ATOM   7178  H HZ2  . LYS A 1 24 ? 8.533   13.776  -1.205  1.00 2.45 ? 24  LYS A HZ2  6  
ATOM   7179  H HZ3  . LYS A 1 24 ? 8.578   12.959  0.268   1.00 2.55 ? 24  LYS A HZ3  6  
ATOM   7180  N N    . GLU A 1 25 ? 2.167   9.698   -1.096  1.00 0.34 ? 25  GLU A N    6  
ATOM   7181  C CA   . GLU A 1 25 ? 0.982   8.975   -1.534  1.00 0.37 ? 25  GLU A CA   6  
ATOM   7182  C C    . GLU A 1 25 ? 0.725   7.785   -0.617  1.00 0.31 ? 25  GLU A C    6  
ATOM   7183  O O    . GLU A 1 25 ? -0.416  7.504   -0.246  1.00 0.34 ? 25  GLU A O    6  
ATOM   7184  C CB   . GLU A 1 25 ? 1.152   8.503   -2.978  1.00 0.45 ? 25  GLU A CB   6  
ATOM   7185  C CG   . GLU A 1 25 ? -0.011  8.879   -3.880  1.00 0.90 ? 25  GLU A CG   6  
ATOM   7186  C CD   . GLU A 1 25 ? 0.092   8.258   -5.256  1.00 1.00 ? 25  GLU A CD   6  
ATOM   7187  O OE1  . GLU A 1 25 ? 0.748   8.855   -6.136  1.00 1.30 ? 25  GLU A OE1  6  
ATOM   7188  O OE2  . GLU A 1 25 ? -0.490  7.175   -5.468  1.00 1.58 ? 25  GLU A OE2  6  
ATOM   7189  H H    . GLU A 1 25 ? 2.988   9.636   -1.628  1.00 0.36 ? 25  GLU A H    6  
ATOM   7190  H HA   . GLU A 1 25 ? 0.140   9.650   -1.477  1.00 0.42 ? 25  GLU A HA   6  
ATOM   7191  H HB2  . GLU A 1 25 ? 2.051   8.941   -3.385  1.00 0.97 ? 25  GLU A HB2  6  
ATOM   7192  H HB3  . GLU A 1 25 ? 1.252   7.427   -2.983  1.00 0.87 ? 25  GLU A HB3  6  
ATOM   7193  H HG2  . GLU A 1 25 ? -0.929  8.547   -3.419  1.00 1.42 ? 25  GLU A HG2  6  
ATOM   7194  H HG3  . GLU A 1 25 ? -0.032  9.955   -3.989  1.00 1.47 ? 25  GLU A HG3  6  
ATOM   7195  N N    . ILE A 1 26 ? 1.802   7.101   -0.245  1.00 0.29 ? 26  ILE A N    6  
ATOM   7196  C CA   . ILE A 1 26 ? 1.716   5.939   0.633   1.00 0.29 ? 26  ILE A CA   6  
ATOM   7197  C C    . ILE A 1 26 ? 1.145   6.336   1.992   1.00 0.27 ? 26  ILE A C    6  
ATOM   7198  O O    . ILE A 1 26 ? 0.274   5.656   2.532   1.00 0.28 ? 26  ILE A O    6  
ATOM   7199  C CB   . ILE A 1 26 ? 3.100   5.275   0.824   1.00 0.33 ? 26  ILE A CB   6  
ATOM   7200  C CG1  . ILE A 1 26 ? 3.694   4.884   -0.533  1.00 0.36 ? 26  ILE A CG1  6  
ATOM   7201  C CG2  . ILE A 1 26 ? 2.989   4.054   1.728   1.00 0.41 ? 26  ILE A CG2  6  
ATOM   7202  C CD1  . ILE A 1 26 ? 5.126   4.399   -0.452  1.00 0.45 ? 26  ILE A CD1  6  
ATOM   7203  H H    . ILE A 1 26 ? 2.683   7.382   -0.576  1.00 0.30 ? 26  ILE A H    6  
ATOM   7204  H HA   . ILE A 1 26 ? 1.053   5.219   0.169   1.00 0.32 ? 26  ILE A HA   6  
ATOM   7205  H HB   . ILE A 1 26 ? 3.753   5.985   1.302   1.00 0.34 ? 26  ILE A HB   6  
ATOM   7206  H HG12 . ILE A 1 26 ? 3.101   4.088   -0.960  1.00 0.44 ? 26  ILE A HG12 6  
ATOM   7207  H HG13 . ILE A 1 26 ? 3.667   5.739   -1.193  1.00 0.35 ? 26  ILE A HG13 6  
ATOM   7208  H HG21 . ILE A 1 26 ? 2.633   4.359   2.702   1.00 0.52 ? 26  ILE A HG21 6  
ATOM   7209  H HG22 . ILE A 1 26 ? 3.959   3.589   1.828   1.00 0.53 ? 26  ILE A HG22 6  
ATOM   7210  H HG23 . ILE A 1 26 ? 2.296   3.347   1.297   1.00 0.54 ? 26  ILE A HG23 6  
ATOM   7211  H HD11 . ILE A 1 26 ? 5.416   3.970   -1.400  1.00 0.90 ? 26  ILE A HD11 6  
ATOM   7212  H HD12 . ILE A 1 26 ? 5.210   3.650   0.324   1.00 0.91 ? 26  ILE A HD12 6  
ATOM   7213  H HD13 . ILE A 1 26 ? 5.775   5.231   -0.221  1.00 0.92 ? 26  ILE A HD13 6  
ATOM   7214  N N    . GLY A 1 27 ? 1.629   7.451   2.528   1.00 0.27 ? 27  GLY A N    6  
ATOM   7215  C CA   . GLY A 1 27 ? 1.163   7.934   3.817   1.00 0.29 ? 27  GLY A CA   6  
ATOM   7216  C C    . GLY A 1 27 ? -0.322  8.241   3.815   1.00 0.28 ? 27  GLY A C    6  
ATOM   7217  O O    . GLY A 1 27 ? -1.027  7.930   4.778   1.00 0.32 ? 27  GLY A O    6  
ATOM   7218  H H    . GLY A 1 27 ? 2.320   7.955   2.041   1.00 0.28 ? 27  GLY A H    6  
ATOM   7219  H HA2  . GLY A 1 27 ? 1.364   7.181   4.564   1.00 0.32 ? 27  GLY A HA2  6  
ATOM   7220  H HA3  . GLY A 1 27 ? 1.707   8.831   4.069   1.00 0.33 ? 27  GLY A HA3  6  
ATOM   7221  N N    . ALA A 1 28 ? -0.796  8.841   2.730   1.00 0.27 ? 28  ALA A N    6  
ATOM   7222  C CA   . ALA A 1 28 ? -2.205  9.182   2.594   1.00 0.30 ? 28  ALA A CA   6  
ATOM   7223  C C    . ALA A 1 28 ? -3.052  7.919   2.552   1.00 0.29 ? 28  ALA A C    6  
ATOM   7224  O O    . ALA A 1 28 ? -4.072  7.814   3.236   1.00 0.32 ? 28  ALA A O    6  
ATOM   7225  C CB   . ALA A 1 28 ? -2.426  10.017  1.342   1.00 0.35 ? 28  ALA A CB   6  
ATOM   7226  H H    . ALA A 1 28 ? -0.178  9.063   2.003   1.00 0.27 ? 28  ALA A H    6  
ATOM   7227  H HA   . ALA A 1 28 ? -2.493  9.771   3.452   1.00 0.34 ? 28  ALA A HA   6  
ATOM   7228  H HB1  . ALA A 1 28 ? -1.769  10.873  1.359   1.00 0.47 ? 28  ALA A HB1  6  
ATOM   7229  H HB2  . ALA A 1 28 ? -3.453  10.351  1.307   1.00 0.50 ? 28  ALA A HB2  6  
ATOM   7230  H HB3  . ALA A 1 28 ? -2.214  9.419   0.468   1.00 0.45 ? 28  ALA A HB3  6  
ATOM   7231  N N    . MET A 1 29 ? -2.612  6.950   1.757   1.00 0.27 ? 29  MET A N    6  
ATOM   7232  C CA   . MET A 1 29 ? -3.321  5.681   1.633   1.00 0.30 ? 29  MET A CA   6  
ATOM   7233  C C    . MET A 1 29 ? -3.342  4.953   2.974   1.00 0.28 ? 29  MET A C    6  
ATOM   7234  O O    . MET A 1 29 ? -4.339  4.330   3.339   1.00 0.31 ? 29  MET A O    6  
ATOM   7235  C CB   . MET A 1 29 ? -2.658  4.799   0.574   1.00 0.34 ? 29  MET A CB   6  
ATOM   7236  C CG   . MET A 1 29 ? -3.359  3.464   0.362   1.00 0.40 ? 29  MET A CG   6  
ATOM   7237  S SD   . MET A 1 29 ? -2.370  2.299   -0.597  1.00 0.49 ? 29  MET A SD   6  
ATOM   7238  C CE   . MET A 1 29 ? -1.054  1.933   0.561   1.00 0.52 ? 29  MET A CE   6  
ATOM   7239  H H    . MET A 1 29 ? -1.792  7.095   1.234   1.00 0.27 ? 29  MET A H    6  
ATOM   7240  H HA   . MET A 1 29 ? -4.336  5.895   1.335   1.00 0.34 ? 29  MET A HA   6  
ATOM   7241  H HB2  . MET A 1 29 ? -2.649  5.332   -0.366  1.00 0.38 ? 29  MET A HB2  6  
ATOM   7242  H HB3  . MET A 1 29 ? -1.639  4.604   0.876   1.00 0.34 ? 29  MET A HB3  6  
ATOM   7243  H HG2  . MET A 1 29 ? -3.568  3.027   1.329   1.00 0.40 ? 29  MET A HG2  6  
ATOM   7244  H HG3  . MET A 1 29 ? -4.291  3.640   -0.158  1.00 0.49 ? 29  MET A HG3  6  
ATOM   7245  H HE1  . MET A 1 29 ? -1.478  1.584   1.491   1.00 0.81 ? 29  MET A HE1  6  
ATOM   7246  H HE2  . MET A 1 29 ? -0.475  2.827   0.744   1.00 0.89 ? 29  MET A HE2  6  
ATOM   7247  H HE3  . MET A 1 29 ? -0.413  1.167   0.147   1.00 0.86 ? 29  MET A HE3  6  
ATOM   7248  N N    . LEU A 1 30 ? -2.236  5.048   3.705   1.00 0.29 ? 30  LEU A N    6  
ATOM   7249  C CA   . LEU A 1 30 ? -2.110  4.411   5.010   1.00 0.32 ? 30  LEU A CA   6  
ATOM   7250  C C    . LEU A 1 30 ? -3.204  4.895   5.955   1.00 0.30 ? 30  LEU A C    6  
ATOM   7251  O O    . LEU A 1 30 ? -3.838  4.094   6.643   1.00 0.33 ? 30  LEU A O    6  
ATOM   7252  C CB   . LEU A 1 30 ? -0.728  4.697   5.607   1.00 0.39 ? 30  LEU A CB   6  
ATOM   7253  C CG   . LEU A 1 30 ? 0.227   3.501   5.656   1.00 0.78 ? 30  LEU A CG   6  
ATOM   7254  C CD1  . LEU A 1 30 ? 0.359   2.850   4.290   1.00 1.32 ? 30  LEU A CD1  6  
ATOM   7255  C CD2  . LEU A 1 30 ? 1.589   3.939   6.168   1.00 1.04 ? 30  LEU A CD2  6  
ATOM   7256  H H    . LEU A 1 30 ? -1.476  5.558   3.349   1.00 0.29 ? 30  LEU A H    6  
ATOM   7257  H HA   . LEU A 1 30 ? -2.219  3.347   4.870   1.00 0.36 ? 30  LEU A HA   6  
ATOM   7258  H HB2  . LEU A 1 30 ? -0.263  5.479   5.023   1.00 0.71 ? 30  LEU A HB2  6  
ATOM   7259  H HB3  . LEU A 1 30 ? -0.863  5.061   6.616   1.00 0.65 ? 30  LEU A HB3  6  
ATOM   7260  H HG   . LEU A 1 30 ? -0.166  2.765   6.341   1.00 1.11 ? 30  LEU A HG   6  
ATOM   7261  H HD11 . LEU A 1 30 ? 0.674   3.587   3.565   1.00 1.67 ? 30  LEU A HD11 6  
ATOM   7262  H HD12 . LEU A 1 30 ? -0.595  2.438   3.994   1.00 1.61 ? 30  LEU A HD12 6  
ATOM   7263  H HD13 . LEU A 1 30 ? 1.092   2.059   4.342   1.00 1.72 ? 30  LEU A HD13 6  
ATOM   7264  H HD21 . LEU A 1 30 ? 2.263   3.095   6.170   1.00 1.49 ? 30  LEU A HD21 6  
ATOM   7265  H HD22 . LEU A 1 30 ? 1.490   4.320   7.173   1.00 1.30 ? 30  LEU A HD22 6  
ATOM   7266  H HD23 . LEU A 1 30 ? 1.985   4.712   5.527   1.00 1.27 ? 30  LEU A HD23 6  
ATOM   7267  N N    . SER A 1 31 ? -3.430  6.203   5.973   1.00 0.29 ? 31  SER A N    6  
ATOM   7268  C CA   . SER A 1 31 ? -4.454  6.789   6.825   1.00 0.32 ? 31  SER A CA   6  
ATOM   7269  C C    . SER A 1 31 ? -5.844  6.342   6.372   1.00 0.28 ? 31  SER A C    6  
ATOM   7270  O O    . SER A 1 31 ? -6.728  6.094   7.192   1.00 0.29 ? 31  SER A O    6  
ATOM   7271  C CB   . SER A 1 31 ? -4.350  8.313   6.799   1.00 0.40 ? 31  SER A CB   6  
ATOM   7272  O OG   . SER A 1 31 ? -3.057  8.742   7.197   1.00 1.20 ? 31  SER A OG   6  
ATOM   7273  H H    . SER A 1 31 ? -2.892  6.791   5.397   1.00 0.31 ? 31  SER A H    6  
ATOM   7274  H HA   . SER A 1 31 ? -4.285  6.440   7.831   1.00 0.36 ? 31  SER A HA   6  
ATOM   7275  H HB2  . SER A 1 31 ? -4.540  8.666   5.797   1.00 0.94 ? 31  SER A HB2  6  
ATOM   7276  H HB3  . SER A 1 31 ? -5.080  8.732   7.476   1.00 1.08 ? 31  SER A HB3  6  
ATOM   7277  H HG   . SER A 1 31 ? -2.835  8.338   8.046   1.00 1.76 ? 31  SER A HG   6  
ATOM   7278  N N    . LEU A 1 32 ? -6.023  6.220   5.061   1.00 0.27 ? 32  LEU A N    6  
ATOM   7279  C CA   . LEU A 1 32 ? -7.297  5.790   4.494   1.00 0.29 ? 32  LEU A CA   6  
ATOM   7280  C C    . LEU A 1 32 ? -7.645  4.382   4.961   1.00 0.26 ? 32  LEU A C    6  
ATOM   7281  O O    . LEU A 1 32 ? -8.762  4.125   5.406   1.00 0.29 ? 32  LEU A O    6  
ATOM   7282  C CB   . LEU A 1 32 ? -7.241  5.836   2.964   1.00 0.35 ? 32  LEU A CB   6  
ATOM   7283  C CG   . LEU A 1 32 ? -7.980  7.011   2.314   1.00 0.67 ? 32  LEU A CG   6  
ATOM   7284  C CD1  . LEU A 1 32 ? -9.480  6.899   2.545   1.00 1.15 ? 32  LEU A CD1  6  
ATOM   7285  C CD2  . LEU A 1 32 ? -7.453  8.340   2.840   1.00 1.17 ? 32  LEU A CD2  6  
ATOM   7286  H H    . LEU A 1 32 ? -5.280  6.438   4.455   1.00 0.29 ? 32  LEU A H    6  
ATOM   7287  H HA   . LEU A 1 32 ? -8.058  6.470   4.840   1.00 0.32 ? 32  LEU A HA   6  
ATOM   7288  H HB2  . LEU A 1 32 ? -6.203  5.881   2.665   1.00 0.51 ? 32  LEU A HB2  6  
ATOM   7289  H HB3  . LEU A 1 32 ? -7.666  4.918   2.582   1.00 0.56 ? 32  LEU A HB3  6  
ATOM   7290  H HG   . LEU A 1 32 ? -7.809  6.985   1.248   1.00 0.58 ? 32  LEU A HG   6  
ATOM   7291  H HD11 . LEU A 1 32 ? -9.865  6.046   2.005   1.00 1.26 ? 32  LEU A HD11 6  
ATOM   7292  H HD12 . LEU A 1 32 ? -9.965  7.796   2.192   1.00 1.47 ? 32  LEU A HD12 6  
ATOM   7293  H HD13 . LEU A 1 32 ? -9.676  6.777   3.599   1.00 1.37 ? 32  LEU A HD13 6  
ATOM   7294  H HD21 . LEU A 1 32 ? -7.986  9.149   2.365   1.00 1.52 ? 32  LEU A HD21 6  
ATOM   7295  H HD22 . LEU A 1 32 ? -6.398  8.425   2.614   1.00 1.23 ? 32  LEU A HD22 6  
ATOM   7296  H HD23 . LEU A 1 32 ? -7.596  8.390   3.910   1.00 1.41 ? 32  LEU A HD23 6  
ATOM   7297  N N    . LEU A 1 33 ? -6.673  3.480   4.882   1.00 0.27 ? 33  LEU A N    6  
ATOM   7298  C CA   . LEU A 1 33 ? -6.874  2.094   5.294   1.00 0.31 ? 33  LEU A CA   6  
ATOM   7299  C C    . LEU A 1 33 ? -7.204  2.002   6.782   1.00 0.27 ? 33  LEU A C    6  
ATOM   7300  O O    . LEU A 1 33 ? -7.977  1.140   7.204   1.00 0.33 ? 33  LEU A O    6  
ATOM   7301  C CB   . LEU A 1 33 ? -5.626  1.253   4.992   1.00 0.41 ? 33  LEU A CB   6  
ATOM   7302  C CG   . LEU A 1 33 ? -5.102  1.336   3.555   1.00 0.49 ? 33  LEU A CG   6  
ATOM   7303  C CD1  . LEU A 1 33 ? -3.829  0.514   3.402   1.00 0.61 ? 33  LEU A CD1  6  
ATOM   7304  C CD2  . LEU A 1 33 ? -6.159  0.864   2.568   1.00 0.68 ? 33  LEU A CD2  6  
ATOM   7305  H H    . LEU A 1 33 ? -5.796  3.755   4.528   1.00 0.29 ? 33  LEU A H    6  
ATOM   7306  H HA   . LEU A 1 33 ? -7.706  1.702   4.728   1.00 0.35 ? 33  LEU A HA   6  
ATOM   7307  H HB2  . LEU A 1 33 ? -4.837  1.574   5.657   1.00 0.42 ? 33  LEU A HB2  6  
ATOM   7308  H HB3  . LEU A 1 33 ? -5.855  0.221   5.208   1.00 0.50 ? 33  LEU A HB3  6  
ATOM   7309  H HG   . LEU A 1 33 ? -4.863  2.365   3.327   1.00 0.46 ? 33  LEU A HG   6  
ATOM   7310  H HD11 . LEU A 1 33 ? -3.464  0.601   2.391   1.00 1.08 ? 33  LEU A HD11 6  
ATOM   7311  H HD12 . LEU A 1 33 ? -4.044  -0.522  3.620   1.00 1.05 ? 33  LEU A HD12 6  
ATOM   7312  H HD13 . LEU A 1 33 ? -3.078  0.879   4.088   1.00 1.03 ? 33  LEU A HD13 6  
ATOM   7313  H HD21 . LEU A 1 33 ? -6.465  -0.142  2.820   1.00 1.04 ? 33  LEU A HD21 6  
ATOM   7314  H HD22 . LEU A 1 33 ? -5.749  0.875   1.571   1.00 0.99 ? 33  LEU A HD22 6  
ATOM   7315  H HD23 . LEU A 1 33 ? -7.016  1.523   2.613   1.00 0.89 ? 33  LEU A HD23 6  
ATOM   7316  N N    . GLN A 1 34 ? -6.626  2.900   7.567   1.00 0.26 ? 34  GLN A N    6  
ATOM   7317  C CA   . GLN A 1 34 ? -6.844  2.913   9.006   1.00 0.31 ? 34  GLN A CA   6  
ATOM   7318  C C    . GLN A 1 34 ? -8.205  3.503   9.368   1.00 0.29 ? 34  GLN A C    6  
ATOM   7319  O O    . GLN A 1 34 ? -8.931  2.939   10.184  1.00 0.38 ? 34  GLN A O    6  
ATOM   7320  C CB   . GLN A 1 34 ? -5.737  3.709   9.704   1.00 0.42 ? 34  GLN A CB   6  
ATOM   7321  C CG   . GLN A 1 34 ? -4.397  2.995   9.743   1.00 0.72 ? 34  GLN A CG   6  
ATOM   7322  C CD   . GLN A 1 34 ? -3.281  3.865   10.297  1.00 1.04 ? 34  GLN A CD   6  
ATOM   7323  O OE1  . GLN A 1 34 ? -3.506  4.732   11.144  1.00 1.62 ? 34  GLN A OE1  6  
ATOM   7324  N NE2  . GLN A 1 34 ? -2.067  3.645   9.813   1.00 1.51 ? 34  GLN A NE2  6  
ATOM   7325  H H    . GLN A 1 34 ? -6.037  3.574   7.168   1.00 0.29 ? 34  GLN A H    6  
ATOM   7326  H HA   . GLN A 1 34 ? -6.808  1.895   9.354   1.00 0.36 ? 34  GLN A HA   6  
ATOM   7327  H HB2  . GLN A 1 34 ? -5.604  4.647   9.186   1.00 0.67 ? 34  GLN A HB2  6  
ATOM   7328  H HB3  . GLN A 1 34 ? -6.044  3.912   10.719  1.00 0.61 ? 34  GLN A HB3  6  
ATOM   7329  H HG2  . GLN A 1 34 ? -4.489  2.120   10.370  1.00 1.27 ? 34  GLN A HG2  6  
ATOM   7330  H HG3  . GLN A 1 34 ? -4.136  2.692   8.742   1.00 1.25 ? 34  GLN A HG3  6  
ATOM   7331  H HE21 . GLN A 1 34 ? -1.956  2.937   9.138   1.00 1.73 ? 34  GLN A HE21 6  
ATOM   7332  H HE22 . GLN A 1 34 ? -1.327  4.192   10.151  1.00 1.94 ? 34  GLN A HE22 6  
ATOM   7333  N N    . LYS A 1 35 ? -8.560  4.620   8.741   1.00 0.29 ? 35  LYS A N    6  
ATOM   7334  C CA   . LYS A 1 35 ? -9.825  5.290   9.037   1.00 0.37 ? 35  LYS A CA   6  
ATOM   7335  C C    . LYS A 1 35 ? -11.034 4.523   8.492   1.00 0.32 ? 35  LYS A C    6  
ATOM   7336  O O    . LYS A 1 35 ? -12.146 4.674   9.004   1.00 0.36 ? 35  LYS A O    6  
ATOM   7337  C CB   . LYS A 1 35 ? -9.816  6.731   8.508   1.00 0.50 ? 35  LYS A CB   6  
ATOM   7338  C CG   . LYS A 1 35 ? -10.266 6.878   7.062   1.00 0.67 ? 35  LYS A CG   6  
ATOM   7339  C CD   . LYS A 1 35 ? -10.415 8.342   6.684   1.00 0.77 ? 35  LYS A CD   6  
ATOM   7340  C CE   . LYS A 1 35 ? -11.309 8.524   5.468   1.00 1.00 ? 35  LYS A CE   6  
ATOM   7341  N NZ   . LYS A 1 35 ? -12.702 8.074   5.727   1.00 1.37 ? 35  LYS A NZ   6  
ATOM   7342  H H    . LYS A 1 35 ? -7.955  5.007   8.068   1.00 0.33 ? 35  LYS A H    6  
ATOM   7343  H HA   . LYS A 1 35 ? -9.915  5.329   10.112  1.00 0.45 ? 35  LYS A HA   6  
ATOM   7344  H HB2  . LYS A 1 35 ? -10.473 7.325   9.124   1.00 0.88 ? 35  LYS A HB2  6  
ATOM   7345  H HB3  . LYS A 1 35 ? -8.814  7.122   8.591   1.00 1.00 ? 35  LYS A HB3  6  
ATOM   7346  H HG2  . LYS A 1 35 ? -9.528  6.421   6.418   1.00 1.20 ? 35  LYS A HG2  6  
ATOM   7347  H HG3  . LYS A 1 35 ? -11.215 6.381   6.935   1.00 1.10 ? 35  LYS A HG3  6  
ATOM   7348  H HD2  . LYS A 1 35 ? -10.846 8.877   7.518   1.00 1.19 ? 35  LYS A HD2  6  
ATOM   7349  H HD3  . LYS A 1 35 ? -9.437  8.743   6.462   1.00 1.15 ? 35  LYS A HD3  6  
ATOM   7350  H HE2  . LYS A 1 35 ? -11.324 9.571   5.204   1.00 1.52 ? 35  LYS A HE2  6  
ATOM   7351  H HE3  . LYS A 1 35 ? -10.902 7.953   4.650   1.00 1.60 ? 35  LYS A HE3  6  
ATOM   7352  H HZ1  . LYS A 1 35 ? -12.814 7.069   5.453   1.00 1.85 ? 35  LYS A HZ1  6  
ATOM   7353  H HZ2  . LYS A 1 35 ? -13.369 8.646   5.174   1.00 1.75 ? 35  LYS A HZ2  6  
ATOM   7354  H HZ3  . LYS A 1 35 ? -12.932 8.173   6.736   1.00 1.76 ? 35  LYS A HZ3  6  
ATOM   7355  N N    . GLU A 1 36 ? -10.822 3.710   7.460   1.00 0.29 ? 36  GLU A N    6  
ATOM   7356  C CA   . GLU A 1 36 ? -11.908 2.925   6.873   1.00 0.31 ? 36  GLU A CA   6  
ATOM   7357  C C    . GLU A 1 36 ? -12.121 1.627   7.644   1.00 0.29 ? 36  GLU A C    6  
ATOM   7358  O O    . GLU A 1 36 ? -13.083 0.897   7.403   1.00 0.39 ? 36  GLU A O    6  
ATOM   7359  C CB   . GLU A 1 36 ? -11.622 2.610   5.399   1.00 0.37 ? 36  GLU A CB   6  
ATOM   7360  C CG   . GLU A 1 36 ? -11.801 3.801   4.470   1.00 0.43 ? 36  GLU A CG   6  
ATOM   7361  C CD   . GLU A 1 36 ? -13.162 4.452   4.614   1.00 0.64 ? 36  GLU A CD   6  
ATOM   7362  O OE1  . GLU A 1 36 ? -14.183 3.728   4.596   1.00 1.30 ? 36  GLU A OE1  6  
ATOM   7363  O OE2  . GLU A 1 36 ? -13.219 5.693   4.737   1.00 1.21 ? 36  GLU A OE2  6  
ATOM   7364  H H    . GLU A 1 36 ? -9.921  3.645   7.074   1.00 0.32 ? 36  GLU A H    6  
ATOM   7365  H HA   . GLU A 1 36 ? -12.809 3.516   6.934   1.00 0.38 ? 36  GLU A HA   6  
ATOM   7366  H HB2  . GLU A 1 36 ? -10.604 2.260   5.306   1.00 0.40 ? 36  GLU A HB2  6  
ATOM   7367  H HB3  . GLU A 1 36 ? -12.293 1.825   5.074   1.00 0.47 ? 36  GLU A HB3  6  
ATOM   7368  H HG2  . GLU A 1 36 ? -11.043 4.536   4.701   1.00 0.46 ? 36  GLU A HG2  6  
ATOM   7369  H HG3  . GLU A 1 36 ? -11.680 3.470   3.449   1.00 0.50 ? 36  GLU A HG3  6  
ATOM   7370  N N    . GLY A 1 37 ? -11.218 1.344   8.572   1.00 0.27 ? 37  GLY A N    6  
ATOM   7371  C CA   . GLY A 1 37 ? -11.324 0.136   9.361   1.00 0.30 ? 37  GLY A CA   6  
ATOM   7372  C C    . GLY A 1 37 ? -10.931 -1.096  8.573   1.00 0.29 ? 37  GLY A C    6  
ATOM   7373  O O    . GLY A 1 37 ? -11.357 -2.208  8.890   1.00 0.41 ? 37  GLY A O    6  
ATOM   7374  H H    . GLY A 1 37 ? -10.475 1.965   8.726   1.00 0.30 ? 37  GLY A H    6  
ATOM   7375  H HA2  . GLY A 1 37 ? -10.680 0.223   10.226  1.00 0.33 ? 37  GLY A HA2  6  
ATOM   7376  H HA3  . GLY A 1 37 ? -12.345 0.023   9.697   1.00 0.35 ? 37  GLY A HA3  6  
ATOM   7377  N N    . LEU A 1 38 ? -10.114 -0.896  7.545   1.00 0.25 ? 38  LEU A N    6  
ATOM   7378  C CA   . LEU A 1 38 ? -9.659  -1.997  6.705   1.00 0.28 ? 38  LEU A CA   6  
ATOM   7379  C C    . LEU A 1 38 ? -8.546  -2.767  7.404   1.00 0.32 ? 38  LEU A C    6  
ATOM   7380  O O    . LEU A 1 38 ? -8.364  -3.965  7.178   1.00 0.46 ? 38  LEU A O    6  
ATOM   7381  C CB   . LEU A 1 38 ? -9.169  -1.471  5.356   1.00 0.31 ? 38  LEU A CB   6  
ATOM   7382  C CG   . LEU A 1 38 ? -10.260 -0.899  4.450   1.00 0.40 ? 38  LEU A CG   6  
ATOM   7383  C CD1  . LEU A 1 38 ? -9.647  -0.244  3.224   1.00 0.51 ? 38  LEU A CD1  6  
ATOM   7384  C CD2  . LEU A 1 38 ? -11.240 -1.989  4.038   1.00 0.50 ? 38  LEU A CD2  6  
ATOM   7385  H H    . LEU A 1 38 ? -9.802  0.014   7.351   1.00 0.29 ? 38  LEU A H    6  
ATOM   7386  H HA   . LEU A 1 38 ? -10.495 -2.659  6.545   1.00 0.34 ? 38  LEU A HA   6  
ATOM   7387  H HB2  . LEU A 1 38 ? -8.436  -0.696  5.540   1.00 0.34 ? 38  LEU A HB2  6  
ATOM   7388  H HB3  . LEU A 1 38 ? -8.685  -2.283  4.832   1.00 0.35 ? 38  LEU A HB3  6  
ATOM   7389  H HG   . LEU A 1 38 ? -10.808 -0.144  4.994   1.00 0.47 ? 38  LEU A HG   6  
ATOM   7390  H HD11 . LEU A 1 38 ? -8.961  -0.934  2.753   1.00 0.74 ? 38  LEU A HD11 6  
ATOM   7391  H HD12 . LEU A 1 38 ? -9.115  0.646   3.520   1.00 0.78 ? 38  LEU A HD12 6  
ATOM   7392  H HD13 . LEU A 1 38 ? -10.430 0.017   2.527   1.00 0.79 ? 38  LEU A HD13 6  
ATOM   7393  H HD21 . LEU A 1 38 ? -11.939 -1.590  3.319   1.00 0.77 ? 38  LEU A HD21 6  
ATOM   7394  H HD22 . LEU A 1 38 ? -11.777 -2.336  4.908   1.00 0.67 ? 38  LEU A HD22 6  
ATOM   7395  H HD23 . LEU A 1 38 ? -10.699 -2.811  3.595   1.00 0.68 ? 38  LEU A HD23 6  
ATOM   7396  N N    . LEU A 1 39 ? -7.807  -2.061  8.246   1.00 0.31 ? 39  LEU A N    6  
ATOM   7397  C CA   . LEU A 1 39 ? -6.717  -2.651  9.003   1.00 0.40 ? 39  LEU A CA   6  
ATOM   7398  C C    . LEU A 1 39 ? -6.663  -2.031  10.391  1.00 0.39 ? 39  LEU A C    6  
ATOM   7399  O O    . LEU A 1 39 ? -7.541  -1.249  10.766  1.00 0.57 ? 39  LEU A O    6  
ATOM   7400  C CB   . LEU A 1 39 ? -5.377  -2.442  8.288   1.00 0.53 ? 39  LEU A CB   6  
ATOM   7401  C CG   . LEU A 1 39 ? -5.095  -3.389  7.121   1.00 0.67 ? 39  LEU A CG   6  
ATOM   7402  C CD1  . LEU A 1 39 ? -3.727  -3.101  6.528   1.00 0.86 ? 39  LEU A CD1  6  
ATOM   7403  C CD2  . LEU A 1 39 ? -5.182  -4.841  7.570   1.00 0.75 ? 39  LEU A CD2  6  
ATOM   7404  H H    . LEU A 1 39 ? -8.005  -1.109  8.367   1.00 0.31 ? 39  LEU A H    6  
ATOM   7405  H HA   . LEU A 1 39 ? -6.909  -3.708  9.100   1.00 0.47 ? 39  LEU A HA   6  
ATOM   7406  H HB2  . LEU A 1 39 ? -5.351  -1.428  7.914   1.00 0.56 ? 39  LEU A HB2  6  
ATOM   7407  H HB3  . LEU A 1 39 ? -4.586  -2.559  9.014   1.00 0.63 ? 39  LEU A HB3  6  
ATOM   7408  H HG   . LEU A 1 39 ? -5.834  -3.230  6.349   1.00 0.67 ? 39  LEU A HG   6  
ATOM   7409  H HD11 . LEU A 1 39 ? -2.967  -3.272  7.277   1.00 1.10 ? 39  LEU A HD11 6  
ATOM   7410  H HD12 . LEU A 1 39 ? -3.686  -2.073  6.201   1.00 1.10 ? 39  LEU A HD12 6  
ATOM   7411  H HD13 . LEU A 1 39 ? -3.556  -3.755  5.685   1.00 1.09 ? 39  LEU A HD13 6  
ATOM   7412  H HD21 . LEU A 1 39 ? -4.715  -5.476  6.831   1.00 1.19 ? 39  LEU A HD21 6  
ATOM   7413  H HD22 . LEU A 1 39 ? -6.220  -5.120  7.682   1.00 1.13 ? 39  LEU A HD22 6  
ATOM   7414  H HD23 . LEU A 1 39 ? -4.671  -4.954  8.514   1.00 1.12 ? 39  LEU A HD23 6  
ATOM   7415  N N    . MET A 1 40 ? -5.637  -2.382  11.145  1.00 0.35 ? 40  MET A N    6  
ATOM   7416  C CA   . MET A 1 40 ? -5.461  -1.854  12.482  1.00 0.41 ? 40  MET A CA   6  
ATOM   7417  C C    . MET A 1 40 ? -4.203  -0.996  12.546  1.00 0.37 ? 40  MET A C    6  
ATOM   7418  O O    . MET A 1 40 ? -4.255  0.178   12.911  1.00 0.53 ? 40  MET A O    6  
ATOM   7419  C CB   . MET A 1 40 ? -5.379  -3.000  13.488  1.00 0.54 ? 40  MET A CB   6  
ATOM   7420  C CG   . MET A 1 40 ? -5.190  -2.540  14.920  1.00 0.70 ? 40  MET A CG   6  
ATOM   7421  S SD   . MET A 1 40 ? -4.968  -3.915  16.062  1.00 0.94 ? 40  MET A SD   6  
ATOM   7422  C CE   . MET A 1 40 ? -4.908  -3.039  17.622  1.00 1.19 ? 40  MET A CE   6  
ATOM   7423  H H    . MET A 1 40 ? -4.977  -3.017  10.794  1.00 0.44 ? 40  MET A H    6  
ATOM   7424  H HA   . MET A 1 40 ? -6.319  -1.239  12.714  1.00 0.50 ? 40  MET A HA   6  
ATOM   7425  H HB2  . MET A 1 40 ? -6.291  -3.578  13.435  1.00 0.62 ? 40  MET A HB2  6  
ATOM   7426  H HB3  . MET A 1 40 ? -4.547  -3.635  13.222  1.00 0.55 ? 40  MET A HB3  6  
ATOM   7427  H HG2  . MET A 1 40 ? -4.315  -1.908  14.967  1.00 0.73 ? 40  MET A HG2  6  
ATOM   7428  H HG3  . MET A 1 40 ? -6.057  -1.974  15.222  1.00 0.78 ? 40  MET A HG3  6  
ATOM   7429  H HE1  . MET A 1 40 ? -5.751  -2.365  17.687  1.00 1.40 ? 40  MET A HE1  6  
ATOM   7430  H HE2  . MET A 1 40 ? -3.988  -2.475  17.685  1.00 1.50 ? 40  MET A HE2  6  
ATOM   7431  H HE3  . MET A 1 40 ? -4.952  -3.750  18.434  1.00 1.50 ? 40  MET A HE3  6  
ATOM   7432  N N    . SER A 1 41 ? -3.078  -1.585  12.170  1.00 0.33 ? 41  SER A N    6  
ATOM   7433  C CA   . SER A 1 41 ? -1.805  -0.886  12.181  1.00 0.39 ? 41  SER A CA   6  
ATOM   7434  C C    . SER A 1 41 ? -1.150  -0.953  10.802  1.00 0.34 ? 41  SER A C    6  
ATOM   7435  O O    . SER A 1 41 ? -1.451  -1.847  10.011  1.00 0.31 ? 41  SER A O    6  
ATOM   7436  C CB   . SER A 1 41 ? -0.892  -1.512  13.241  1.00 0.50 ? 41  SER A CB   6  
ATOM   7437  O OG   . SER A 1 41 ? -1.465  -2.701  13.768  1.00 0.87 ? 41  SER A OG   6  
ATOM   7438  H H    . SER A 1 41 ? -3.100  -2.526  11.871  1.00 0.38 ? 41  SER A H    6  
ATOM   7439  H HA   . SER A 1 41 ? -1.989  0.146   12.433  1.00 0.51 ? 41  SER A HA   6  
ATOM   7440  H HB2  . SER A 1 41 ? 0.061   -1.755  12.796  1.00 0.83 ? 41  SER A HB2  6  
ATOM   7441  H HB3  . SER A 1 41 ? -0.744  -0.807  14.047  1.00 0.81 ? 41  SER A HB3  6  
ATOM   7442  H HG   . SER A 1 41 ? -1.798  -3.250  13.035  1.00 1.39 ? 41  SER A HG   6  
ATOM   7443  N N    . PRO A 1 42 ? -0.244  -0.009  10.491  1.00 0.43 ? 42  PRO A N    6  
ATOM   7444  C CA   . PRO A 1 42 ? 0.457   0.022   9.197   1.00 0.47 ? 42  PRO A CA   6  
ATOM   7445  C C    . PRO A 1 42 ? 1.383   -1.181  9.010   1.00 0.43 ? 42  PRO A C    6  
ATOM   7446  O O    . PRO A 1 42 ? 1.903   -1.425  7.920   1.00 0.54 ? 42  PRO A O    6  
ATOM   7447  C CB   . PRO A 1 42 ? 1.265   1.324   9.264   1.00 0.61 ? 42  PRO A CB   6  
ATOM   7448  C CG   . PRO A 1 42 ? 1.408   1.624   10.714  1.00 0.65 ? 42  PRO A CG   6  
ATOM   7449  C CD   . PRO A 1 42 ? 0.153   1.114   11.359  1.00 0.57 ? 42  PRO A CD   6  
ATOM   7450  H HA   . PRO A 1 42 ? -0.238  0.068   8.372   1.00 0.51 ? 42  PRO A HA   6  
ATOM   7451  H HB2  . PRO A 1 42 ? 2.233   1.185   8.797   1.00 0.65 ? 42  PRO A HB2  6  
ATOM   7452  H HB3  . PRO A 1 42 ? 0.725   2.118   8.776   1.00 0.73 ? 42  PRO A HB3  6  
ATOM   7453  H HG2  . PRO A 1 42 ? 2.274   1.113   11.113  1.00 0.67 ? 42  PRO A HG2  6  
ATOM   7454  H HG3  . PRO A 1 42 ? 1.494   2.688   10.866  1.00 0.81 ? 42  PRO A HG3  6  
ATOM   7455  H HD2  . PRO A 1 42 ? 0.356   0.775   12.366  1.00 0.58 ? 42  PRO A HD2  6  
ATOM   7456  H HD3  . PRO A 1 42 ? -0.605  1.882   11.362  1.00 0.68 ? 42  PRO A HD3  6  
ATOM   7457  N N    . SER A 1 43 ? 1.583   -1.929  10.084  1.00 0.36 ? 43  SER A N    6  
ATOM   7458  C CA   . SER A 1 43 ? 2.427   -3.107  10.052  1.00 0.41 ? 43  SER A CA   6  
ATOM   7459  C C    . SER A 1 43 ? 1.612   -4.349  9.690   1.00 0.36 ? 43  SER A C    6  
ATOM   7460  O O    . SER A 1 43 ? 2.161   -5.431  9.489   1.00 0.40 ? 43  SER A O    6  
ATOM   7461  C CB   . SER A 1 43 ? 3.096   -3.285  11.409  1.00 0.54 ? 43  SER A CB   6  
ATOM   7462  O OG   . SER A 1 43 ? 2.275   -2.764  12.444  1.00 0.69 ? 43  SER A OG   6  
ATOM   7463  H H    . SER A 1 43 ? 1.161   -1.673  10.930  1.00 0.38 ? 43  SER A H    6  
ATOM   7464  H HA   . SER A 1 43 ? 3.185   -2.954  9.302   1.00 0.49 ? 43  SER A HA   6  
ATOM   7465  H HB2  . SER A 1 43 ? 3.265   -4.334  11.590  1.00 0.70 ? 43  SER A HB2  6  
ATOM   7466  H HB3  . SER A 1 43 ? 4.040   -2.761  11.414  1.00 0.75 ? 43  SER A HB3  6  
ATOM   7467  H HG   . SER A 1 43 ? 1.986   -3.491  13.015  1.00 1.10 ? 43  SER A HG   6  
ATOM   7468  N N    . ASP A 1 44 ? 0.297   -4.179  9.586   1.00 0.32 ? 44  ASP A N    6  
ATOM   7469  C CA   . ASP A 1 44 ? -0.594  -5.285  9.254   1.00 0.32 ? 44  ASP A CA   6  
ATOM   7470  C C    . ASP A 1 44 ? -0.525  -5.621  7.766   1.00 0.29 ? 44  ASP A C    6  
ATOM   7471  O O    . ASP A 1 44 ? -1.124  -6.593  7.310   1.00 0.31 ? 44  ASP A O    6  
ATOM   7472  C CB   . ASP A 1 44 ? -2.037  -4.952  9.638   1.00 0.39 ? 44  ASP A CB   6  
ATOM   7473  C CG   . ASP A 1 44 ? -2.321  -5.178  11.110  1.00 0.54 ? 44  ASP A CG   6  
ATOM   7474  O OD1  . ASP A 1 44 ? -2.334  -6.348  11.545  1.00 0.87 ? 44  ASP A OD1  6  
ATOM   7475  O OD2  . ASP A 1 44 ? -2.551  -4.189  11.840  1.00 0.69 ? 44  ASP A OD2  6  
ATOM   7476  H H    . ASP A 1 44 ? -0.083  -3.290  9.742   1.00 0.35 ? 44  ASP A H    6  
ATOM   7477  H HA   . ASP A 1 44 ? -0.273  -6.146  9.819   1.00 0.40 ? 44  ASP A HA   6  
ATOM   7478  H HB2  . ASP A 1 44 ? -2.233  -3.914  9.409   1.00 0.46 ? 44  ASP A HB2  6  
ATOM   7479  H HB3  . ASP A 1 44 ? -2.707  -5.574  9.064   1.00 0.52 ? 44  ASP A HB3  6  
ATOM   7480  N N    . LEU A 1 45 ? 0.222   -4.815  7.016   1.00 0.31 ? 45  LEU A N    6  
ATOM   7481  C CA   . LEU A 1 45 ? 0.376   -5.020  5.578   1.00 0.36 ? 45  LEU A CA   6  
ATOM   7482  C C    . LEU A 1 45 ? 1.240   -6.244  5.290   1.00 0.34 ? 45  LEU A C    6  
ATOM   7483  O O    . LEU A 1 45 ? 1.281   -6.734  4.162   1.00 0.38 ? 45  LEU A O    6  
ATOM   7484  C CB   . LEU A 1 45 ? 0.997   -3.784  4.917   1.00 0.45 ? 45  LEU A CB   6  
ATOM   7485  C CG   . LEU A 1 45 ? 0.017   -2.671  4.521   1.00 0.60 ? 45  LEU A CG   6  
ATOM   7486  C CD1  . LEU A 1 45 ? -1.205  -3.245  3.822   1.00 0.96 ? 45  LEU A CD1  6  
ATOM   7487  C CD2  . LEU A 1 45 ? -0.397  -1.854  5.735   1.00 0.98 ? 45  LEU A CD2  6  
ATOM   7488  H H    . LEU A 1 45 ? 0.683   -4.064  7.442   1.00 0.35 ? 45  LEU A H    6  
ATOM   7489  H HA   . LEU A 1 45 ? -0.606  -5.185  5.161   1.00 0.41 ? 45  LEU A HA   6  
ATOM   7490  H HB2  . LEU A 1 45 ? 1.722   -3.366  5.601   1.00 0.60 ? 45  LEU A HB2  6  
ATOM   7491  H HB3  . LEU A 1 45 ? 1.517   -4.104  4.026   1.00 0.54 ? 45  LEU A HB3  6  
ATOM   7492  H HG   . LEU A 1 45 ? 0.509   -2.006  3.827   1.00 0.84 ? 45  LEU A HG   6  
ATOM   7493  H HD11 . LEU A 1 45 ? -0.891  -3.930  3.050   1.00 1.37 ? 45  LEU A HD11 6  
ATOM   7494  H HD12 . LEU A 1 45 ? -1.775  -2.442  3.378   1.00 1.34 ? 45  LEU A HD12 6  
ATOM   7495  H HD13 . LEU A 1 45 ? -1.820  -3.767  4.540   1.00 1.38 ? 45  LEU A HD13 6  
ATOM   7496  H HD21 . LEU A 1 45 ? -1.101  -1.093  5.432   1.00 1.28 ? 45  LEU A HD21 6  
ATOM   7497  H HD22 . LEU A 1 45 ? 0.475   -1.387  6.170   1.00 1.36 ? 45  LEU A HD22 6  
ATOM   7498  H HD23 . LEU A 1 45 ? -0.861  -2.502  6.465   1.00 1.37 ? 45  LEU A HD23 6  
ATOM   7499  N N    . TYR A 1 46 ? 1.918   -6.734  6.322   1.00 0.32 ? 46  TYR A N    6  
ATOM   7500  C CA   . TYR A 1 46 ? 2.789   -7.897  6.197   1.00 0.37 ? 46  TYR A CA   6  
ATOM   7501  C C    . TYR A 1 46 ? 1.978   -9.178  6.017   1.00 0.34 ? 46  TYR A C    6  
ATOM   7502  O O    . TYR A 1 46 ? 2.518   -10.207 5.607   1.00 0.44 ? 46  TYR A O    6  
ATOM   7503  C CB   . TYR A 1 46 ? 3.686   -8.030  7.431   1.00 0.47 ? 46  TYR A CB   6  
ATOM   7504  C CG   . TYR A 1 46 ? 4.851   -7.063  7.458   1.00 0.55 ? 46  TYR A CG   6  
ATOM   7505  C CD1  . TYR A 1 46 ? 6.105   -7.448  6.997   1.00 0.87 ? 46  TYR A CD1  6  
ATOM   7506  C CD2  . TYR A 1 46 ? 4.703   -5.775  7.952   1.00 0.64 ? 46  TYR A CD2  6  
ATOM   7507  C CE1  . TYR A 1 46 ? 7.174   -6.576  7.030   1.00 1.01 ? 46  TYR A CE1  6  
ATOM   7508  C CE2  . TYR A 1 46 ? 5.767   -4.896  7.986   1.00 0.76 ? 46  TYR A CE2  6  
ATOM   7509  C CZ   . TYR A 1 46 ? 7.001   -5.302  7.526   1.00 0.86 ? 46  TYR A CZ   6  
ATOM   7510  O OH   . TYR A 1 46 ? 8.067   -4.432  7.563   1.00 1.05 ? 46  TYR A OH   6  
ATOM   7511  H H    . TYR A 1 46 ? 1.828   -6.300  7.197   1.00 0.33 ? 46  TYR A H    6  
ATOM   7512  H HA   . TYR A 1 46 ? 3.412   -7.753  5.327   1.00 0.43 ? 46  TYR A HA   6  
ATOM   7513  H HB2  . TYR A 1 46 ? 3.093   -7.858  8.315   1.00 0.46 ? 46  TYR A HB2  6  
ATOM   7514  H HB3  . TYR A 1 46 ? 4.087   -9.033  7.465   1.00 0.61 ? 46  TYR A HB3  6  
ATOM   7515  H HD1  . TYR A 1 46 ? 6.239   -8.448  6.611   1.00 1.12 ? 46  TYR A HD1  6  
ATOM   7516  H HD2  . TYR A 1 46 ? 3.733   -5.459  8.310   1.00 0.84 ? 46  TYR A HD2  6  
ATOM   7517  H HE1  . TYR A 1 46 ? 8.141   -6.895  6.671   1.00 1.34 ? 46  TYR A HE1  6  
ATOM   7518  H HE2  . TYR A 1 46 ? 5.630   -3.898  8.372   1.00 0.97 ? 46  TYR A HE2  6  
ATOM   7519  H HH   . TYR A 1 46 ? 8.233   -4.166  8.474   1.00 1.14 ? 46  TYR A HH   6  
ATOM   7520  N N    . SER A 1 47 ? 0.687   -9.109  6.322   1.00 0.31 ? 47  SER A N    6  
ATOM   7521  C CA   . SER A 1 47 ? -0.196  -10.260 6.207   1.00 0.29 ? 47  SER A CA   6  
ATOM   7522  C C    . SER A 1 47 ? -0.814  -10.347 4.810   1.00 0.24 ? 47  SER A C    6  
ATOM   7523  O O    . SER A 1 47 ? -1.695  -9.563  4.460   1.00 0.26 ? 47  SER A O    6  
ATOM   7524  C CB   . SER A 1 47 ? -1.288  -10.172 7.272   1.00 0.36 ? 47  SER A CB   6  
ATOM   7525  O OG   . SER A 1 47 ? -0.720  -9.889  8.542   1.00 0.53 ? 47  SER A OG   6  
ATOM   7526  H H    . SER A 1 47 ? 0.316   -8.257  6.633   1.00 0.37 ? 47  SER A H    6  
ATOM   7527  H HA   . SER A 1 47 ? 0.394   -11.147 6.383   1.00 0.33 ? 47  SER A HA   6  
ATOM   7528  H HB2  . SER A 1 47 ? -1.979  -9.385  7.017   1.00 0.43 ? 47  SER A HB2  6  
ATOM   7529  H HB3  . SER A 1 47 ? -1.815  -11.112 7.326   1.00 0.44 ? 47  SER A HB3  6  
ATOM   7530  H HG   . SER A 1 47 ? -1.369  -9.429  9.089   1.00 1.10 ? 47  SER A HG   6  
ATOM   7531  N N    . PRO A 1 48 ? -0.365  -11.321 3.997   1.00 0.24 ? 48  PRO A N    6  
ATOM   7532  C CA   . PRO A 1 48 ? -0.860  -11.506 2.630   1.00 0.25 ? 48  PRO A CA   6  
ATOM   7533  C C    . PRO A 1 48 ? -2.297  -12.021 2.574   1.00 0.26 ? 48  PRO A C    6  
ATOM   7534  O O    . PRO A 1 48 ? -2.940  -11.973 1.525   1.00 0.32 ? 48  PRO A O    6  
ATOM   7535  C CB   . PRO A 1 48 ? 0.103   -12.538 2.038   1.00 0.31 ? 48  PRO A CB   6  
ATOM   7536  C CG   . PRO A 1 48 ? 0.662   -13.274 3.202   1.00 0.38 ? 48  PRO A CG   6  
ATOM   7537  C CD   . PRO A 1 48 ? 0.669   -12.310 4.355   1.00 0.32 ? 48  PRO A CD   6  
ATOM   7538  H HA   . PRO A 1 48 ? -0.793  -10.588 2.063   1.00 0.26 ? 48  PRO A HA   6  
ATOM   7539  H HB2  . PRO A 1 48 ? -0.437  -13.207 1.381   1.00 0.38 ? 48  PRO A HB2  6  
ATOM   7540  H HB3  . PRO A 1 48 ? 0.892   -12.039 1.498   1.00 0.38 ? 48  PRO A HB3  6  
ATOM   7541  H HG2  . PRO A 1 48 ? 0.037   -14.126 3.427   1.00 0.50 ? 48  PRO A HG2  6  
ATOM   7542  H HG3  . PRO A 1 48 ? 1.670   -13.592 2.985   1.00 0.52 ? 48  PRO A HG3  6  
ATOM   7543  H HD2  . PRO A 1 48 ? 0.410   -12.817 5.268   1.00 0.38 ? 48  PRO A HD2  6  
ATOM   7544  H HD3  . PRO A 1 48 ? 1.636   -11.837 4.446   1.00 0.38 ? 48  PRO A HD3  6  
ATOM   7545  N N    . GLY A 1 49 ? -2.801  -12.498 3.705   1.00 0.28 ? 49  GLY A N    6  
ATOM   7546  C CA   . GLY A 1 49 ? -4.157  -13.014 3.752   1.00 0.33 ? 49  GLY A CA   6  
ATOM   7547  C C    . GLY A 1 49 ? -5.191  -11.926 3.980   1.00 0.32 ? 49  GLY A C    6  
ATOM   7548  O O    . GLY A 1 49 ? -6.392  -12.194 3.969   1.00 0.50 ? 49  GLY A O    6  
ATOM   7549  H H    . GLY A 1 49 ? -2.245  -12.505 4.514   1.00 0.30 ? 49  GLY A H    6  
ATOM   7550  H HA2  . GLY A 1 49 ? -4.373  -13.512 2.819   1.00 0.35 ? 49  GLY A HA2  6  
ATOM   7551  H HA3  . GLY A 1 49 ? -4.227  -13.734 4.555   1.00 0.38 ? 49  GLY A HA3  6  
ATOM   7552  N N    . SER A 1 50 ? -4.729  -10.699 4.179   1.00 0.25 ? 50  SER A N    6  
ATOM   7553  C CA   . SER A 1 50 ? -5.627  -9.575  4.416   1.00 0.27 ? 50  SER A CA   6  
ATOM   7554  C C    . SER A 1 50 ? -5.597  -8.589  3.248   1.00 0.22 ? 50  SER A C    6  
ATOM   7555  O O    . SER A 1 50 ? -6.188  -7.511  3.321   1.00 0.28 ? 50  SER A O    6  
ATOM   7556  C CB   . SER A 1 50 ? -5.234  -8.865  5.715   1.00 0.35 ? 50  SER A CB   6  
ATOM   7557  O OG   . SER A 1 50 ? -5.003  -9.802  6.756   1.00 0.47 ? 50  SER A OG   6  
ATOM   7558  H H    . SER A 1 50 ? -3.760  -10.544 4.180   1.00 0.31 ? 50  SER A H    6  
ATOM   7559  H HA   . SER A 1 50 ? -6.627  -9.965  4.516   1.00 0.32 ? 50  SER A HA   6  
ATOM   7560  H HB2  . SER A 1 50 ? -4.332  -8.295  5.552   1.00 0.45 ? 50  SER A HB2  6  
ATOM   7561  H HB3  . SER A 1 50 ? -6.031  -8.202  6.014   1.00 0.45 ? 50  SER A HB3  6  
ATOM   7562  H HG   . SER A 1 50 ? -5.599  -9.614  7.492   1.00 0.93 ? 50  SER A HG   6  
ATOM   7563  N N    . TRP A 1 51 ? -4.933  -8.970  2.163   1.00 0.20 ? 51  TRP A N    6  
ATOM   7564  C CA   . TRP A 1 51 ? -4.820  -8.102  0.995   1.00 0.20 ? 51  TRP A CA   6  
ATOM   7565  C C    . TRP A 1 51 ? -6.101  -8.106  0.162   1.00 0.19 ? 51  TRP A C    6  
ATOM   7566  O O    . TRP A 1 51 ? -6.504  -7.073  -0.375  1.00 0.23 ? 51  TRP A O    6  
ATOM   7567  C CB   . TRP A 1 51 ? -3.642  -8.534  0.116   1.00 0.23 ? 51  TRP A CB   6  
ATOM   7568  C CG   . TRP A 1 51 ? -2.295  -8.329  0.750   1.00 0.24 ? 51  TRP A CG   6  
ATOM   7569  C CD1  . TRP A 1 51 ? -1.994  -7.521  1.810   1.00 0.25 ? 51  TRP A CD1  6  
ATOM   7570  C CD2  . TRP A 1 51 ? -1.063  -8.940  0.349   1.00 0.27 ? 51  TRP A CD2  6  
ATOM   7571  N NE1  . TRP A 1 51 ? -0.653  -7.599  2.096   1.00 0.28 ? 51  TRP A NE1  6  
ATOM   7572  C CE2  . TRP A 1 51 ? -0.059  -8.461  1.213   1.00 0.29 ? 51  TRP A CE2  6  
ATOM   7573  C CE3  . TRP A 1 51 ? -0.714  -9.847  -0.655  1.00 0.30 ? 51  TRP A CE3  6  
ATOM   7574  C CZ2  . TRP A 1 51 ? 1.269   -8.863  1.103   1.00 0.33 ? 51  TRP A CZ2  6  
ATOM   7575  C CZ3  . TRP A 1 51 ? 0.604   -10.242 -0.765  1.00 0.34 ? 51  TRP A CZ3  6  
ATOM   7576  C CH2  . TRP A 1 51 ? 1.582   -9.752  0.112   1.00 0.35 ? 51  TRP A CH2  6  
ATOM   7577  H H    . TRP A 1 51 ? -4.513  -9.858  2.144   1.00 0.26 ? 51  TRP A H    6  
ATOM   7578  H HA   . TRP A 1 51 ? -4.642  -7.098  1.348   1.00 0.22 ? 51  TRP A HA   6  
ATOM   7579  H HB2  . TRP A 1 51 ? -3.740  -9.584  -0.113  1.00 0.25 ? 51  TRP A HB2  6  
ATOM   7580  H HB3  . TRP A 1 51 ? -3.665  -7.969  -0.805  1.00 0.27 ? 51  TRP A HB3  6  
ATOM   7581  H HD1  . TRP A 1 51 ? -2.716  -6.919  2.340   1.00 0.26 ? 51  TRP A HD1  6  
ATOM   7582  H HE1  . TRP A 1 51 ? -0.191  -7.114  2.819   1.00 0.31 ? 51  TRP A HE1  6  
ATOM   7583  H HE3  . TRP A 1 51 ? -1.451  -10.236 -1.341  1.00 0.31 ? 51  TRP A HE3  6  
ATOM   7584  H HZ2  . TRP A 1 51 ? 2.037   -8.496  1.771   1.00 0.35 ? 51  TRP A HZ2  6  
ATOM   7585  H HZ3  . TRP A 1 51 ? 0.892   -10.944 -1.534  1.00 0.38 ? 51  TRP A HZ3  6  
ATOM   7586  H HH2  . TRP A 1 51 ? 2.601   -10.090 -0.012  1.00 0.39 ? 51  TRP A HH2  6  
ATOM   7587  N N    . ASP A 1 52 ? -6.738  -9.267  0.060   1.00 0.23 ? 52  ASP A N    6  
ATOM   7588  C CA   . ASP A 1 52 ? -7.963  -9.409  -0.728  1.00 0.27 ? 52  ASP A CA   6  
ATOM   7589  C C    . ASP A 1 52 ? -9.072  -8.458  -0.263  1.00 0.24 ? 52  ASP A C    6  
ATOM   7590  O O    . ASP A 1 52 ? -9.568  -7.669  -1.068  1.00 0.24 ? 52  ASP A O    6  
ATOM   7591  C CB   . ASP A 1 52 ? -8.463  -10.860 -0.717  1.00 0.37 ? 52  ASP A CB   6  
ATOM   7592  C CG   . ASP A 1 52 ? -8.247  -11.553 -2.047  1.00 0.85 ? 52  ASP A CG   6  
ATOM   7593  O OD1  . ASP A 1 52 ? -8.692  -11.013 -3.084  1.00 1.49 ? 52  ASP A OD1  6  
ATOM   7594  O OD2  . ASP A 1 52 ? -7.636  -12.643 -2.064  1.00 1.39 ? 52  ASP A OD2  6  
ATOM   7595  H H    . ASP A 1 52 ? -6.376  -10.053 0.526   1.00 0.27 ? 52  ASP A H    6  
ATOM   7596  H HA   . ASP A 1 52 ? -7.710  -9.152  -1.747  1.00 0.30 ? 52  ASP A HA   6  
ATOM   7597  H HB2  . ASP A 1 52 ? -7.934  -11.411 0.045   1.00 0.74 ? 52  ASP A HB2  6  
ATOM   7598  H HB3  . ASP A 1 52 ? -9.518  -10.868 -0.493  1.00 0.74 ? 52  ASP A HB3  6  
ATOM   7599  N N    . PRO A 1 53 ? -9.480  -8.498  1.030   1.00 0.23 ? 53  PRO A N    6  
ATOM   7600  C CA   . PRO A 1 53 ? -10.539 -7.614  1.545   1.00 0.24 ? 53  PRO A CA   6  
ATOM   7601  C C    . PRO A 1 53 ? -10.245 -6.133  1.302   1.00 0.21 ? 53  PRO A C    6  
ATOM   7602  O O    . PRO A 1 53 ? -11.159 -5.347  1.041   1.00 0.24 ? 53  PRO A O    6  
ATOM   7603  C CB   . PRO A 1 53 ? -10.577 -7.910  3.051   1.00 0.29 ? 53  PRO A CB   6  
ATOM   7604  C CG   . PRO A 1 53 ? -9.340  -8.684  3.349   1.00 0.33 ? 53  PRO A CG   6  
ATOM   7605  C CD   . PRO A 1 53 ? -8.981  -9.403  2.083   1.00 0.28 ? 53  PRO A CD   6  
ATOM   7606  H HA   . PRO A 1 53 ? -11.494 -7.859  1.108   1.00 0.27 ? 53  PRO A HA   6  
ATOM   7607  H HB2  . PRO A 1 53 ? -10.594 -6.980  3.604   1.00 0.34 ? 53  PRO A HB2  6  
ATOM   7608  H HB3  . PRO A 1 53 ? -11.448 -8.498  3.288   1.00 0.34 ? 53  PRO A HB3  6  
ATOM   7609  H HG2  . PRO A 1 53 ? -8.546  -8.007  3.638   1.00 0.41 ? 53  PRO A HG2  6  
ATOM   7610  H HG3  . PRO A 1 53 ? -9.531  -9.397  4.136   1.00 0.44 ? 53  PRO A HG3  6  
ATOM   7611  H HD2  . PRO A 1 53 ? -7.911  -9.529  2.008   1.00 0.29 ? 53  PRO A HD2  6  
ATOM   7612  H HD3  . PRO A 1 53 ? -9.481  -10.359 2.036   1.00 0.34 ? 53  PRO A HD3  6  
ATOM   7613  N N    . ILE A 1 54 ? -8.970  -5.758  1.381   1.00 0.19 ? 54  ILE A N    6  
ATOM   7614  C CA   . ILE A 1 54 ? -8.564  -4.375  1.159   1.00 0.19 ? 54  ILE A CA   6  
ATOM   7615  C C    . ILE A 1 54 ? -8.748  -3.998  -0.307  1.00 0.16 ? 54  ILE A C    6  
ATOM   7616  O O    . ILE A 1 54 ? -9.367  -2.981  -0.626  1.00 0.17 ? 54  ILE A O    6  
ATOM   7617  C CB   . ILE A 1 54 ? -7.094  -4.137  1.572   1.00 0.22 ? 54  ILE A CB   6  
ATOM   7618  C CG1  . ILE A 1 54 ? -6.912  -4.412  3.067   1.00 0.27 ? 54  ILE A CG1  6  
ATOM   7619  C CG2  . ILE A 1 54 ? -6.668  -2.713  1.234   1.00 0.26 ? 54  ILE A CG2  6  
ATOM   7620  C CD1  . ILE A 1 54 ? -5.469  -4.352  3.518   1.00 0.34 ? 54  ILE A CD1  6  
ATOM   7621  H H    . ILE A 1 54 ? -8.289  -6.430  1.594   1.00 0.19 ? 54  ILE A H    6  
ATOM   7622  H HA   . ILE A 1 54 ? -9.194  -3.740  1.765   1.00 0.23 ? 54  ILE A HA   6  
ATOM   7623  H HB   . ILE A 1 54 ? -6.471  -4.816  1.011   1.00 0.21 ? 54  ILE A HB   6  
ATOM   7624  H HG12 . ILE A 1 54 ? -7.467  -3.679  3.634   1.00 0.31 ? 54  ILE A HG12 6  
ATOM   7625  H HG13 . ILE A 1 54 ? -7.291  -5.398  3.291   1.00 0.27 ? 54  ILE A HG13 6  
ATOM   7626  H HG21 . ILE A 1 54 ? -6.690  -2.575  0.162   1.00 0.58 ? 54  ILE A HG21 6  
ATOM   7627  H HG22 . ILE A 1 54 ? -5.667  -2.538  1.600   1.00 0.60 ? 54  ILE A HG22 6  
ATOM   7628  H HG23 . ILE A 1 54 ? -7.349  -2.016  1.700   1.00 0.58 ? 54  ILE A HG23 6  
ATOM   7629  H HD11 . ILE A 1 54 ? -5.414  -4.572  4.574   1.00 0.71 ? 54  ILE A HD11 6  
ATOM   7630  H HD12 . ILE A 1 54 ? -5.075  -3.362  3.337   1.00 0.68 ? 54  ILE A HD12 6  
ATOM   7631  H HD13 . ILE A 1 54 ? -4.890  -5.077  2.967   1.00 0.71 ? 54  ILE A HD13 6  
ATOM   7632  N N    . THR A 1 55 ? -8.227  -4.840  -1.192  1.00 0.15 ? 55  THR A N    6  
ATOM   7633  C CA   . THR A 1 55 ? -8.331  -4.611  -2.624  1.00 0.17 ? 55  THR A CA   6  
ATOM   7634  C C    . THR A 1 55 ? -9.794  -4.544  -3.056  1.00 0.17 ? 55  THR A C    6  
ATOM   7635  O O    . THR A 1 55 ? -10.175 -3.681  -3.844  1.00 0.19 ? 55  THR A O    6  
ATOM   7636  C CB   . THR A 1 55 ? -7.607  -5.717  -3.417  1.00 0.20 ? 55  THR A CB   6  
ATOM   7637  O OG1  . THR A 1 55 ? -6.318  -5.967  -2.838  1.00 0.20 ? 55  THR A OG1  6  
ATOM   7638  C CG2  . THR A 1 55 ? -7.433  -5.311  -4.871  1.00 0.27 ? 55  THR A CG2  6  
ATOM   7639  H H    . THR A 1 55 ? -7.755  -5.638  -0.870  1.00 0.16 ? 55  THR A H    6  
ATOM   7640  H HA   . THR A 1 55 ? -7.857  -3.666  -2.848  1.00 0.19 ? 55  THR A HA   6  
ATOM   7641  H HB   . THR A 1 55 ? -8.200  -6.621  -3.377  1.00 0.22 ? 55  THR A HB   6  
ATOM   7642  H HG1  . THR A 1 55 ? -6.411  -6.572  -2.090  1.00 0.26 ? 55  THR A HG1  6  
ATOM   7643  H HG21 . THR A 1 55 ? -8.404  -5.166  -5.324  1.00 0.49 ? 55  THR A HG21 6  
ATOM   7644  H HG22 . THR A 1 55 ? -6.900  -6.085  -5.401  1.00 0.48 ? 55  THR A HG22 6  
ATOM   7645  H HG23 . THR A 1 55 ? -6.873  -4.390  -4.921  1.00 0.46 ? 55  THR A HG23 6  
ATOM   7646  N N    . ALA A 1 56 ? -10.610 -5.444  -2.515  1.00 0.18 ? 56  ALA A N    6  
ATOM   7647  C CA   . ALA A 1 56 ? -12.029 -5.485  -2.840  1.00 0.21 ? 56  ALA A CA   6  
ATOM   7648  C C    . ALA A 1 56 ? -12.711 -4.174  -2.466  1.00 0.20 ? 56  ALA A C    6  
ATOM   7649  O O    . ALA A 1 56 ? -13.465 -3.603  -3.259  1.00 0.24 ? 56  ALA A O    6  
ATOM   7650  C CB   . ALA A 1 56 ? -12.700 -6.648  -2.129  1.00 0.25 ? 56  ALA A CB   6  
ATOM   7651  H H    . ALA A 1 56 ? -10.243 -6.104  -1.884  1.00 0.18 ? 56  ALA A H    6  
ATOM   7652  H HA   . ALA A 1 56 ? -12.123 -5.637  -3.905  1.00 0.23 ? 56  ALA A HA   6  
ATOM   7653  H HB1  . ALA A 1 56 ? -12.706 -6.465  -1.066  1.00 0.42 ? 56  ALA A HB1  6  
ATOM   7654  H HB2  . ALA A 1 56 ? -12.155 -7.556  -2.334  1.00 0.43 ? 56  ALA A HB2  6  
ATOM   7655  H HB3  . ALA A 1 56 ? -13.715 -6.749  -2.484  1.00 0.43 ? 56  ALA A HB3  6  
ATOM   7656  N N    . ALA A 1 57 ? -12.420 -3.690  -1.263  1.00 0.19 ? 57  ALA A N    6  
ATOM   7657  C CA   . ALA A 1 57 ? -12.999 -2.446  -0.771  1.00 0.20 ? 57  ALA A CA   6  
ATOM   7658  C C    . ALA A 1 57 ? -12.558 -1.262  -1.622  1.00 0.19 ? 57  ALA A C    6  
ATOM   7659  O O    . ALA A 1 57 ? -13.375 -0.425  -2.006  1.00 0.22 ? 57  ALA A O    6  
ATOM   7660  C CB   . ALA A 1 57 ? -12.620 -2.225  0.686   1.00 0.23 ? 57  ALA A CB   6  
ATOM   7661  H H    . ALA A 1 57 ? -11.803 -4.188  -0.686  1.00 0.20 ? 57  ALA A H    6  
ATOM   7662  H HA   . ALA A 1 57 ? -14.073 -2.534  -0.827  1.00 0.23 ? 57  ALA A HA   6  
ATOM   7663  H HB1  . ALA A 1 57 ? -11.553 -2.067  0.765   1.00 0.41 ? 57  ALA A HB1  6  
ATOM   7664  H HB2  . ALA A 1 57 ? -12.898 -3.093  1.264   1.00 0.39 ? 57  ALA A HB2  6  
ATOM   7665  H HB3  . ALA A 1 57 ? -13.142 -1.358  1.066   1.00 0.38 ? 57  ALA A HB3  6  
ATOM   7666  N N    . LEU A 1 58 ? -11.270 -1.209  -1.935  1.00 0.18 ? 58  LEU A N    6  
ATOM   7667  C CA   . LEU A 1 58 ? -10.725 -0.123  -2.735  1.00 0.19 ? 58  LEU A CA   6  
ATOM   7668  C C    . LEU A 1 58 ? -11.291 -0.144  -4.153  1.00 0.20 ? 58  LEU A C    6  
ATOM   7669  O O    . LEU A 1 58 ? -11.564 0.905   -4.730  1.00 0.24 ? 58  LEU A O    6  
ATOM   7670  C CB   . LEU A 1 58 ? -9.197  -0.185  -2.760  1.00 0.21 ? 58  LEU A CB   6  
ATOM   7671  C CG   . LEU A 1 58 ? -8.523  0.020   -1.398  1.00 0.37 ? 58  LEU A CG   6  
ATOM   7672  C CD1  . LEU A 1 58 ? -7.014  0.098   -1.549  1.00 0.35 ? 58  LEU A CD1  6  
ATOM   7673  C CD2  . LEU A 1 58 ? -9.052  1.274   -0.715  1.00 0.73 ? 58  LEU A CD2  6  
ATOM   7674  H H    . LEU A 1 58 ? -10.669 -1.922  -1.620  1.00 0.19 ? 58  LEU A H    6  
ATOM   7675  H HA   . LEU A 1 58 ? -11.024 0.802   -2.265  1.00 0.20 ? 58  LEU A HA   6  
ATOM   7676  H HB2  . LEU A 1 58 ? -8.903  -1.151  -3.143  1.00 0.31 ? 58  LEU A HB2  6  
ATOM   7677  H HB3  . LEU A 1 58 ? -8.836  0.577   -3.433  1.00 0.39 ? 58  LEU A HB3  6  
ATOM   7678  H HG   . LEU A 1 58 ? -8.750  -0.825  -0.764  1.00 0.55 ? 58  LEU A HG   6  
ATOM   7679  H HD11 . LEU A 1 58 ? -6.562  0.228   -0.576  1.00 0.71 ? 58  LEU A HD11 6  
ATOM   7680  H HD12 . LEU A 1 58 ? -6.758  0.936   -2.179  1.00 0.67 ? 58  LEU A HD12 6  
ATOM   7681  H HD13 . LEU A 1 58 ? -6.648  -0.815  -1.995  1.00 0.64 ? 58  LEU A HD13 6  
ATOM   7682  H HD21 . LEU A 1 58 ? -10.083 1.124   -0.434  1.00 1.19 ? 58  LEU A HD21 6  
ATOM   7683  H HD22 . LEU A 1 58 ? -8.983  2.109   -1.396  1.00 1.00 ? 58  LEU A HD22 6  
ATOM   7684  H HD23 . LEU A 1 58 ? -8.464  1.482   0.167   1.00 1.19 ? 58  LEU A HD23 6  
ATOM   7685  N N    . SER A 1 59 ? -11.485 -1.337  -4.705  1.00 0.20 ? 59  SER A N    6  
ATOM   7686  C CA   . SER A 1 59 ? -12.037 -1.468  -6.048  1.00 0.23 ? 59  SER A CA   6  
ATOM   7687  C C    . SER A 1 59 ? -13.500 -1.033  -6.066  1.00 0.23 ? 59  SER A C    6  
ATOM   7688  O O    . SER A 1 59 ? -13.977 -0.460  -7.049  1.00 0.25 ? 59  SER A O    6  
ATOM   7689  C CB   . SER A 1 59 ? -11.907 -2.912  -6.536  1.00 0.29 ? 59  SER A CB   6  
ATOM   7690  O OG   . SER A 1 59 ? -10.563 -3.353  -6.459  1.00 0.85 ? 59  SER A OG   6  
ATOM   7691  H H    . SER A 1 59 ? -11.243 -2.144  -4.204  1.00 0.21 ? 59  SER A H    6  
ATOM   7692  H HA   . SER A 1 59 ? -11.473 -0.823  -6.702  1.00 0.25 ? 59  SER A HA   6  
ATOM   7693  H HB2  . SER A 1 59 ? -12.520 -3.554  -5.922  1.00 0.65 ? 59  SER A HB2  6  
ATOM   7694  H HB3  . SER A 1 59 ? -12.236 -2.973  -7.564  1.00 0.73 ? 59  SER A HB3  6  
ATOM   7695  H HG   . SER A 1 59 ? -10.337 -3.525  -5.534  1.00 1.33 ? 59  SER A HG   6  
ATOM   7696  N N    . GLN A 1 60 ? -14.199 -1.289  -4.965  1.00 0.24 ? 60  GLN A N    6  
ATOM   7697  C CA   . GLN A 1 60 ? -15.604 -0.928  -4.842  1.00 0.28 ? 60  GLN A CA   6  
ATOM   7698  C C    . GLN A 1 60 ? -15.779 0.587   -4.919  1.00 0.26 ? 60  GLN A C    6  
ATOM   7699  O O    . GLN A 1 60 ? -16.502 1.095   -5.774  1.00 0.29 ? 60  GLN A O    6  
ATOM   7700  C CB   . GLN A 1 60 ? -16.177 -1.456  -3.523  1.00 0.34 ? 60  GLN A CB   6  
ATOM   7701  C CG   . GLN A 1 60 ? -17.697 -1.505  -3.492  1.00 0.50 ? 60  GLN A CG   6  
ATOM   7702  C CD   . GLN A 1 60 ? -18.256 -1.854  -2.126  1.00 0.63 ? 60  GLN A CD   6  
ATOM   7703  O OE1  . GLN A 1 60 ? -19.267 -2.547  -2.018  1.00 0.92 ? 60  GLN A OE1  6  
ATOM   7704  N NE2  . GLN A 1 60 ? -17.616 -1.372  -1.068  1.00 0.77 ? 60  GLN A NE2  6  
ATOM   7705  H H    . GLN A 1 60 ? -13.755 -1.739  -4.214  1.00 0.25 ? 60  GLN A H    6  
ATOM   7706  H HA   . GLN A 1 60 ? -16.135 -1.382  -5.663  1.00 0.31 ? 60  GLN A HA   6  
ATOM   7707  H HB2  . GLN A 1 60 ? -15.804 -2.457  -3.355  1.00 0.45 ? 60  GLN A HB2  6  
ATOM   7708  H HB3  . GLN A 1 60 ? -15.844 -0.821  -2.719  1.00 0.42 ? 60  GLN A HB3  6  
ATOM   7709  H HG2  . GLN A 1 60 ? -18.077 -0.536  -3.777  1.00 0.61 ? 60  GLN A HG2  6  
ATOM   7710  H HG3  . GLN A 1 60 ? -18.033 -2.243  -4.204  1.00 0.63 ? 60  GLN A HG3  6  
ATOM   7711  H HE21 . GLN A 1 60 ? -16.819 -0.815  -1.215  1.00 0.92 ? 60  GLN A HE21 6  
ATOM   7712  H HE22 . GLN A 1 60 ? -17.968 -1.586  -0.176  1.00 0.90 ? 60  GLN A HE22 6  
ATOM   7713  N N    . ARG A 1 61 ? -15.086 1.306   -4.040  1.00 0.29 ? 61  ARG A N    6  
ATOM   7714  C CA   . ARG A 1 61 ? -15.170 2.767   -4.003  1.00 0.34 ? 61  ARG A CA   6  
ATOM   7715  C C    . ARG A 1 61 ? -14.641 3.387   -5.297  1.00 0.30 ? 61  ARG A C    6  
ATOM   7716  O O    . ARG A 1 61 ? -15.092 4.454   -5.716  1.00 0.34 ? 61  ARG A O    6  
ATOM   7717  C CB   . ARG A 1 61 ? -14.401 3.321   -2.793  1.00 0.45 ? 61  ARG A CB   6  
ATOM   7718  C CG   . ARG A 1 61 ? -12.928 2.940   -2.768  1.00 0.65 ? 61  ARG A CG   6  
ATOM   7719  C CD   . ARG A 1 61 ? -12.263 3.346   -1.462  1.00 0.67 ? 61  ARG A CD   6  
ATOM   7720  N NE   . ARG A 1 61 ? -11.691 4.690   -1.526  1.00 0.81 ? 61  ARG A NE   6  
ATOM   7721  C CZ   . ARG A 1 61 ? -12.145 5.733   -0.833  1.00 1.09 ? 61  ARG A CZ   6  
ATOM   7722  N NH1  . ARG A 1 61 ? -13.186 5.600   -0.017  1.00 1.47 ? 61  ARG A NH1  6  
ATOM   7723  N NH2  . ARG A 1 61 ? -11.540 6.906   -0.943  1.00 1.42 ? 61  ARG A NH2  6  
ATOM   7724  H H    . ARG A 1 61 ? -14.508 0.842   -3.391  1.00 0.30 ? 61  ARG A H    6  
ATOM   7725  H HA   . ARG A 1 61 ? -16.213 3.030   -3.903  1.00 0.40 ? 61  ARG A HA   6  
ATOM   7726  H HB2  . ARG A 1 61 ? -14.470 4.399   -2.801  1.00 0.72 ? 61  ARG A HB2  6  
ATOM   7727  H HB3  . ARG A 1 61 ? -14.861 2.948   -1.891  1.00 0.82 ? 61  ARG A HB3  6  
ATOM   7728  H HG2  . ARG A 1 61 ? -12.843 1.869   -2.888  1.00 1.08 ? 61  ARG A HG2  6  
ATOM   7729  H HG3  . ARG A 1 61 ? -12.426 3.436   -3.585  1.00 1.01 ? 61  ARG A HG3  6  
ATOM   7730  H HD2  . ARG A 1 61 ? -12.999 3.318   -0.676  1.00 0.88 ? 61  ARG A HD2  6  
ATOM   7731  H HD3  . ARG A 1 61 ? -11.475 2.642   -1.242  1.00 0.79 ? 61  ARG A HD3  6  
ATOM   7732  H HE   . ARG A 1 61 ? -10.915 4.823   -2.121  1.00 1.11 ? 61  ARG A HE   6  
ATOM   7733  H HH11 . ARG A 1 61 ? -13.522 6.387   0.507   1.00 1.93 ? 61  ARG A HH11 6  
ATOM   7734  H HH12 . ARG A 1 61 ? -13.643 4.711   0.078   1.00 1.47 ? 61  ARG A HH12 6  
ATOM   7735  H HH21 . ARG A 1 61 ? -10.734 7.003   -1.546  1.00 1.53 ? 61  ARG A HH21 6  
ATOM   7736  H HH22 . ARG A 1 61 ? -11.877 7.702   -0.435  1.00 1.76 ? 61  ARG A HH22 6  
ATOM   7737  N N    . ALA A 1 62 ? -13.705 2.700   -5.938  1.00 0.27 ? 62  ALA A N    6  
ATOM   7738  C CA   . ALA A 1 62 ? -13.109 3.185   -7.174  1.00 0.29 ? 62  ALA A CA   6  
ATOM   7739  C C    . ALA A 1 62 ? -14.107 3.171   -8.329  1.00 0.30 ? 62  ALA A C    6  
ATOM   7740  O O    . ALA A 1 62 ? -14.100 4.066   -9.173  1.00 0.41 ? 62  ALA A O    6  
ATOM   7741  C CB   . ALA A 1 62 ? -11.886 2.354   -7.533  1.00 0.31 ? 62  ALA A CB   6  
ATOM   7742  H H    . ALA A 1 62 ? -13.400 1.845   -5.564  1.00 0.26 ? 62  ALA A H    6  
ATOM   7743  H HA   . ALA A 1 62 ? -12.785 4.201   -7.006  1.00 0.34 ? 62  ALA A HA   6  
ATOM   7744  H HB1  . ALA A 1 62 ? -11.176 2.382   -6.718  1.00 0.40 ? 62  ALA A HB1  6  
ATOM   7745  H HB2  . ALA A 1 62 ? -11.428 2.757   -8.424  1.00 0.44 ? 62  ALA A HB2  6  
ATOM   7746  H HB3  . ALA A 1 62 ? -12.184 1.332   -7.715  1.00 0.46 ? 62  ALA A HB3  6  
ATOM   7747  N N    . MET A 1 63 ? -14.970 2.165   -8.361  1.00 0.26 ? 63  MET A N    6  
ATOM   7748  C CA   . MET A 1 63 ? -15.950 2.051   -9.435  1.00 0.32 ? 63  MET A CA   6  
ATOM   7749  C C    . MET A 1 63 ? -17.280 2.707   -9.075  1.00 0.32 ? 63  MET A C    6  
ATOM   7750  O O    . MET A 1 63 ? -17.986 3.196   -9.953  1.00 0.42 ? 63  MET A O    6  
ATOM   7751  C CB   . MET A 1 63 ? -16.175 0.582   -9.811  1.00 0.37 ? 63  MET A CB   6  
ATOM   7752  C CG   . MET A 1 63 ? -16.796 -0.257  -8.702  1.00 0.38 ? 63  MET A CG   6  
ATOM   7753  S SD   . MET A 1 63 ? -17.180 -1.939  -9.228  1.00 0.50 ? 63  MET A SD   6  
ATOM   7754  C CE   . MET A 1 63 ? -15.548 -2.533  -9.677  1.00 0.71 ? 63  MET A CE   6  
ATOM   7755  H H    . MET A 1 63 ? -14.941 1.482   -7.657  1.00 0.27 ? 63  MET A H    6  
ATOM   7756  H HA   . MET A 1 63 ? -15.545 2.563   -10.293 1.00 0.36 ? 63  MET A HA   6  
ATOM   7757  H HB2  . MET A 1 63 ? -16.827 0.540   -10.668 1.00 0.43 ? 63  MET A HB2  6  
ATOM   7758  H HB3  . MET A 1 63 ? -15.223 0.144   -10.073 1.00 0.42 ? 63  MET A HB3  6  
ATOM   7759  H HG2  . MET A 1 63 ? -16.103 -0.305  -7.876  1.00 0.38 ? 63  MET A HG2  6  
ATOM   7760  H HG3  . MET A 1 63 ? -17.708 0.219   -8.376  1.00 0.39 ? 63  MET A HG3  6  
ATOM   7761  H HE1  . MET A 1 63 ? -15.145 -1.913  -10.462 1.00 0.96 ? 63  MET A HE1  6  
ATOM   7762  H HE2  . MET A 1 63 ? -15.618 -3.552  -10.025 1.00 0.93 ? 63  MET A HE2  6  
ATOM   7763  H HE3  . MET A 1 63 ? -14.900 -2.491  -8.814  1.00 0.95 ? 63  MET A HE3  6  
ATOM   7764  N N    . ILE A 1 64 ? -17.624 2.731   -7.794  1.00 0.28 ? 64  ILE A N    6  
ATOM   7765  C CA   . ILE A 1 64 ? -18.889 3.323   -7.379  1.00 0.31 ? 64  ILE A CA   6  
ATOM   7766  C C    . ILE A 1 64 ? -18.780 4.837   -7.213  1.00 0.31 ? 64  ILE A C    6  
ATOM   7767  O O    . ILE A 1 64 ? -19.608 5.583   -7.736  1.00 0.37 ? 64  ILE A O    6  
ATOM   7768  C CB   . ILE A 1 64 ? -19.424 2.692   -6.071  1.00 0.35 ? 64  ILE A CB   6  
ATOM   7769  C CG1  . ILE A 1 64 ? -19.615 1.182   -6.255  1.00 0.38 ? 64  ILE A CG1  6  
ATOM   7770  C CG2  . ILE A 1 64 ? -20.734 3.351   -5.657  1.00 0.43 ? 64  ILE A CG2  6  
ATOM   7771  C CD1  . ILE A 1 64 ? -20.162 0.484   -5.028  1.00 0.46 ? 64  ILE A CD1  6  
ATOM   7772  H H    . ILE A 1 64 ? -17.027 2.335   -7.123  1.00 0.29 ? 64  ILE A H    6  
ATOM   7773  H HA   . ILE A 1 64 ? -19.606 3.122   -8.161  1.00 0.35 ? 64  ILE A HA   6  
ATOM   7774  H HB   . ILE A 1 64 ? -18.698 2.864   -5.290  1.00 0.34 ? 64  ILE A HB   6  
ATOM   7775  H HG12 . ILE A 1 64 ? -20.306 1.009   -7.066  1.00 0.44 ? 64  ILE A HG12 6  
ATOM   7776  H HG13 . ILE A 1 64 ? -18.662 0.731   -6.497  1.00 0.36 ? 64  ILE A HG13 6  
ATOM   7777  H HG21 . ILE A 1 64 ? -21.099 2.890   -4.751  1.00 0.59 ? 64  ILE A HG21 6  
ATOM   7778  H HG22 . ILE A 1 64 ? -21.466 3.226   -6.443  1.00 0.58 ? 64  ILE A HG22 6  
ATOM   7779  H HG23 . ILE A 1 64 ? -20.569 4.403   -5.484  1.00 0.58 ? 64  ILE A HG23 6  
ATOM   7780  H HD11 . ILE A 1 64 ? -21.182 0.793   -4.863  1.00 0.62 ? 64  ILE A HD11 6  
ATOM   7781  H HD12 . ILE A 1 64 ? -19.564 0.749   -4.169  1.00 0.57 ? 64  ILE A HD12 6  
ATOM   7782  H HD13 . ILE A 1 64 ? -20.128 -0.585  -5.176  1.00 0.59 ? 64  ILE A HD13 6  
ATOM   7783  N N    . LEU A 1 65 ? -17.760 5.293   -6.496  1.00 0.29 ? 65  LEU A N    6  
ATOM   7784  C CA   . LEU A 1 65 ? -17.576 6.724   -6.273  1.00 0.33 ? 65  LEU A CA   6  
ATOM   7785  C C    . LEU A 1 65 ? -16.740 7.342   -7.386  1.00 0.34 ? 65  LEU A C    6  
ATOM   7786  O O    . LEU A 1 65 ? -16.755 8.557   -7.583  1.00 0.47 ? 65  LEU A O    6  
ATOM   7787  C CB   . LEU A 1 65 ? -16.924 6.997   -4.913  1.00 0.40 ? 65  LEU A CB   6  
ATOM   7788  C CG   . LEU A 1 65 ? -17.841 6.820   -3.701  1.00 0.93 ? 65  LEU A CG   6  
ATOM   7789  C CD1  . LEU A 1 65 ? -17.803 5.386   -3.200  1.00 1.61 ? 65  LEU A CD1  6  
ATOM   7790  C CD2  . LEU A 1 65 ? -17.451 7.786   -2.593  1.00 0.99 ? 65  LEU A CD2  6  
ATOM   7791  H H    . LEU A 1 65 ? -17.116 4.659   -6.114  1.00 0.30 ? 65  LEU A H    6  
ATOM   7792  H HA   . LEU A 1 65 ? -18.554 7.182   -6.285  1.00 0.39 ? 65  LEU A HA   6  
ATOM   7793  H HB2  . LEU A 1 65 ? -16.079 6.330   -4.801  1.00 0.77 ? 65  LEU A HB2  6  
ATOM   7794  H HB3  . LEU A 1 65 ? -16.558 8.013   -4.914  1.00 0.73 ? 65  LEU A HB3  6  
ATOM   7795  H HG   . LEU A 1 65 ? -18.856 7.042   -3.994  1.00 1.40 ? 65  LEU A HG   6  
ATOM   7796  H HD11 . LEU A 1 65 ? -16.801 5.144   -2.880  1.00 1.79 ? 65  LEU A HD11 6  
ATOM   7797  H HD12 . LEU A 1 65 ? -18.097 4.719   -3.997  1.00 1.94 ? 65  LEU A HD12 6  
ATOM   7798  H HD13 . LEU A 1 65 ? -18.484 5.278   -2.370  1.00 2.09 ? 65  LEU A HD13 6  
ATOM   7799  H HD21 . LEU A 1 65 ? -17.529 8.800   -2.956  1.00 1.31 ? 65  LEU A HD21 6  
ATOM   7800  H HD22 . LEU A 1 65 ? -16.435 7.590   -2.285  1.00 1.14 ? 65  LEU A HD22 6  
ATOM   7801  H HD23 . LEU A 1 65 ? -18.114 7.653   -1.751  1.00 1.50 ? 65  LEU A HD23 6  
ATOM   7802  N N    . GLY A 1 66 ? -16.009 6.502   -8.106  1.00 0.30 ? 66  GLY A N    6  
ATOM   7803  C CA   . GLY A 1 66 ? -15.188 6.982   -9.202  1.00 0.36 ? 66  GLY A CA   6  
ATOM   7804  C C    . GLY A 1 66 ? -13.841 7.508   -8.749  1.00 0.43 ? 66  GLY A C    6  
ATOM   7805  O O    . GLY A 1 66 ? -13.184 8.256   -9.470  1.00 0.81 ? 66  GLY A O    6  
ATOM   7806  H H    . GLY A 1 66 ? -16.031 5.546   -7.895  1.00 0.33 ? 66  GLY A H    6  
ATOM   7807  H HA2  . GLY A 1 66 ? -15.025 6.169   -9.896  1.00 0.40 ? 66  GLY A HA2  6  
ATOM   7808  H HA3  . GLY A 1 66 ? -15.716 7.774   -9.714  1.00 0.41 ? 66  GLY A HA3  6  
ATOM   7809  N N    . LYS A 1 67 ? -13.423 7.121   -7.553  1.00 0.43 ? 67  LYS A N    6  
ATOM   7810  C CA   . LYS A 1 67 ? -12.140 7.562   -7.024  1.00 0.47 ? 67  LYS A CA   6  
ATOM   7811  C C    . LYS A 1 67 ? -11.203 6.379   -6.830  1.00 0.35 ? 67  LYS A C    6  
ATOM   7812  O O    . LYS A 1 67 ? -11.326 5.619   -5.869  1.00 0.44 ? 67  LYS A O    6  
ATOM   7813  C CB   . LYS A 1 67 ? -12.317 8.323   -5.705  1.00 0.65 ? 67  LYS A CB   6  
ATOM   7814  C CG   . LYS A 1 67 ? -13.412 7.767   -4.805  1.00 0.74 ? 67  LYS A CG   6  
ATOM   7815  C CD   . LYS A 1 67 ? -13.434 8.455   -3.448  1.00 1.10 ? 67  LYS A CD   6  
ATOM   7816  C CE   . LYS A 1 67 ? -13.646 9.960   -3.571  1.00 1.28 ? 67  LYS A CE   6  
ATOM   7817  N NZ   . LYS A 1 67 ? -12.464 10.727  -3.090  1.00 1.52 ? 67  LYS A NZ   6  
ATOM   7818  H H    . LYS A 1 67 ? -13.984 6.523   -7.018  1.00 0.69 ? 67  LYS A H    6  
ATOM   7819  H HA   . LYS A 1 67 ? -11.703 8.229   -7.753  1.00 0.55 ? 67  LYS A HA   6  
ATOM   7820  H HB2  . LYS A 1 67 ? -11.385 8.290   -5.159  1.00 0.82 ? 67  LYS A HB2  6  
ATOM   7821  H HB3  . LYS A 1 67 ? -12.555 9.354   -5.929  1.00 0.78 ? 67  LYS A HB3  6  
ATOM   7822  H HG2  . LYS A 1 67 ? -14.368 7.918   -5.283  1.00 0.86 ? 67  LYS A HG2  6  
ATOM   7823  H HG3  . LYS A 1 67 ? -13.243 6.709   -4.659  1.00 0.86 ? 67  LYS A HG3  6  
ATOM   7824  H HD2  . LYS A 1 67 ? -14.237 8.038   -2.859  1.00 1.44 ? 67  LYS A HD2  6  
ATOM   7825  H HD3  . LYS A 1 67 ? -12.494 8.276   -2.947  1.00 1.29 ? 67  LYS A HD3  6  
ATOM   7826  H HE2  . LYS A 1 67 ? -13.824 10.203  -4.609  1.00 1.52 ? 67  LYS A HE2  6  
ATOM   7827  H HE3  . LYS A 1 67 ? -14.509 10.240  -2.985  1.00 1.71 ? 67  LYS A HE3  6  
ATOM   7828  H HZ1  . LYS A 1 67 ? -11.629 10.501  -3.668  1.00 1.85 ? 67  LYS A HZ1  6  
ATOM   7829  H HZ2  . LYS A 1 67 ? -12.261 10.483  -2.101  1.00 1.82 ? 67  LYS A HZ2  6  
ATOM   7830  H HZ3  . LYS A 1 67 ? -12.649 11.750  -3.149  1.00 1.90 ? 67  LYS A HZ3  6  
ATOM   7831  N N    . SER A 1 68 ? -10.270 6.224   -7.757  1.00 0.30 ? 68  SER A N    6  
ATOM   7832  C CA   . SER A 1 68 ? -9.308  5.132   -7.708  1.00 0.32 ? 68  SER A CA   6  
ATOM   7833  C C    . SER A 1 68 ? -7.971  5.604   -7.139  1.00 0.28 ? 68  SER A C    6  
ATOM   7834  O O    . SER A 1 68 ? -6.939  4.960   -7.334  1.00 0.33 ? 68  SER A O    6  
ATOM   7835  C CB   . SER A 1 68 ? -9.110  4.550   -9.110  1.00 0.46 ? 68  SER A CB   6  
ATOM   7836  O OG   . SER A 1 68 ? -9.896  5.247   -10.068 1.00 0.91 ? 68  SER A OG   6  
ATOM   7837  H H    . SER A 1 68 ? -10.230 6.860   -8.503  1.00 0.38 ? 68  SER A H    6  
ATOM   7838  H HA   . SER A 1 68 ? -9.709  4.365   -7.062  1.00 0.38 ? 68  SER A HA   6  
ATOM   7839  H HB2  . SER A 1 68 ? -8.070  4.632   -9.388  1.00 0.76 ? 68  SER A HB2  6  
ATOM   7840  H HB3  . SER A 1 68 ? -9.402  3.510   -9.110  1.00 0.77 ? 68  SER A HB3  6  
ATOM   7841  H HG   . SER A 1 68 ? -9.310  5.739   -10.659 1.00 1.45 ? 68  SER A HG   6  
ATOM   7842  N N    . GLY A 1 69 ? -8.001  6.726   -6.425  1.00 0.29 ? 69  GLY A N    6  
ATOM   7843  C CA   . GLY A 1 69 ? -6.794  7.280   -5.833  1.00 0.35 ? 69  GLY A CA   6  
ATOM   7844  C C    . GLY A 1 69 ? -6.062  6.289   -4.949  1.00 0.32 ? 69  GLY A C    6  
ATOM   7845  O O    . GLY A 1 69 ? -4.891  5.985   -5.181  1.00 0.41 ? 69  GLY A O    6  
ATOM   7846  H H    . GLY A 1 69 ? -8.857  7.190   -6.304  1.00 0.33 ? 69  GLY A H    6  
ATOM   7847  H HA2  . GLY A 1 69 ? -6.132  7.595   -6.626  1.00 0.40 ? 69  GLY A HA2  6  
ATOM   7848  H HA3  . GLY A 1 69 ? -7.065  8.143   -5.242  1.00 0.42 ? 69  GLY A HA3  6  
ATOM   7849  N N    . GLU A 1 70 ? -6.761  5.771   -3.949  1.00 0.34 ? 70  GLU A N    6  
ATOM   7850  C CA   . GLU A 1 70 ? -6.178  4.808   -3.022  1.00 0.38 ? 70  GLU A CA   6  
ATOM   7851  C C    . GLU A 1 70 ? -5.809  3.515   -3.743  1.00 0.32 ? 70  GLU A C    6  
ATOM   7852  O O    . GLU A 1 70 ? -4.870  2.823   -3.358  1.00 0.39 ? 70  GLU A O    6  
ATOM   7853  C CB   . GLU A 1 70 ? -7.158  4.499   -1.884  1.00 0.52 ? 70  GLU A CB   6  
ATOM   7854  C CG   . GLU A 1 70 ? -7.395  5.661   -0.927  1.00 0.66 ? 70  GLU A CG   6  
ATOM   7855  C CD   . GLU A 1 70 ? -8.325  6.720   -1.487  1.00 0.70 ? 70  GLU A CD   6  
ATOM   7856  O OE1  . GLU A 1 70 ? -8.230  7.890   -1.059  1.00 1.24 ? 70  GLU A OE1  6  
ATOM   7857  O OE2  . GLU A 1 70 ? -9.162  6.391   -2.362  1.00 1.08 ? 70  GLU A OE2  6  
ATOM   7858  H H    . GLU A 1 70 ? -7.693  6.048   -3.821  1.00 0.40 ? 70  GLU A H    6  
ATOM   7859  H HA   . GLU A 1 70 ? -5.281  5.244   -2.605  1.00 0.42 ? 70  GLU A HA   6  
ATOM   7860  H HB2  . GLU A 1 70 ? -8.108  4.222   -2.316  1.00 0.52 ? 70  GLU A HB2  6  
ATOM   7861  H HB3  . GLU A 1 70 ? -6.776  3.665   -1.315  1.00 0.64 ? 70  GLU A HB3  6  
ATOM   7862  H HG2  . GLU A 1 70 ? -7.827  5.275   -0.015  1.00 0.80 ? 70  GLU A HG2  6  
ATOM   7863  H HG3  . GLU A 1 70 ? -6.443  6.123   -0.703  1.00 0.82 ? 70  GLU A HG3  6  
ATOM   7864  N N    . LEU A 1 71 ? -6.551  3.208   -4.799  1.00 0.28 ? 71  LEU A N    6  
ATOM   7865  C CA   . LEU A 1 71 ? -6.323  1.994   -5.573  1.00 0.28 ? 71  LEU A CA   6  
ATOM   7866  C C    . LEU A 1 71 ? -4.994  2.051   -6.325  1.00 0.26 ? 71  LEU A C    6  
ATOM   7867  O O    . LEU A 1 71 ? -4.309  1.037   -6.460  1.00 0.30 ? 71  LEU A O    6  
ATOM   7868  C CB   . LEU A 1 71 ? -7.480  1.775   -6.551  1.00 0.34 ? 71  LEU A CB   6  
ATOM   7869  C CG   . LEU A 1 71 ? -7.441  0.457   -7.326  1.00 0.58 ? 71  LEU A CG   6  
ATOM   7870  C CD1  . LEU A 1 71 ? -8.789  -0.241  -7.257  1.00 0.89 ? 71  LEU A CD1  6  
ATOM   7871  C CD2  . LEU A 1 71 ? -7.050  0.706   -8.774  1.00 1.43 ? 71  LEU A CD2  6  
ATOM   7872  H H    . LEU A 1 71 ? -7.266  3.818   -5.070  1.00 0.34 ? 71  LEU A H    6  
ATOM   7873  H HA   . LEU A 1 71 ? -6.292  1.167   -4.880  1.00 0.33 ? 71  LEU A HA   6  
ATOM   7874  H HB2  . LEU A 1 71 ? -8.403  1.811   -5.994  1.00 0.54 ? 71  LEU A HB2  6  
ATOM   7875  H HB3  . LEU A 1 71 ? -7.480  2.586   -7.264  1.00 0.61 ? 71  LEU A HB3  6  
ATOM   7876  H HG   . LEU A 1 71 ? -6.700  -0.194  -6.884  1.00 1.35 ? 71  LEU A HG   6  
ATOM   7877  H HD11 . LEU A 1 71 ? -9.017  -0.486  -6.230  1.00 1.64 ? 71  LEU A HD11 6  
ATOM   7878  H HD12 . LEU A 1 71 ? -8.754  -1.148  -7.843  1.00 1.06 ? 71  LEU A HD12 6  
ATOM   7879  H HD13 . LEU A 1 71 ? -9.555  0.412   -7.650  1.00 1.33 ? 71  LEU A HD13 6  
ATOM   7880  H HD21 . LEU A 1 71 ? -6.120  1.254   -8.808  1.00 2.09 ? 71  LEU A HD21 6  
ATOM   7881  H HD22 . LEU A 1 71 ? -7.824  1.282   -9.258  1.00 1.87 ? 71  LEU A HD22 6  
ATOM   7882  H HD23 . LEU A 1 71 ? -6.928  -0.239  -9.285  1.00 1.71 ? 71  LEU A HD23 6  
ATOM   7883  N N    . LYS A 1 72 ? -4.630  3.235   -6.811  1.00 0.26 ? 72  LYS A N    6  
ATOM   7884  C CA   . LYS A 1 72 ? -3.381  3.408   -7.551  1.00 0.30 ? 72  LYS A CA   6  
ATOM   7885  C C    . LYS A 1 72 ? -2.185  3.062   -6.673  1.00 0.27 ? 72  LYS A C    6  
ATOM   7886  O O    . LYS A 1 72 ? -1.346  2.237   -7.044  1.00 0.33 ? 72  LYS A O    6  
ATOM   7887  C CB   . LYS A 1 72 ? -3.238  4.845   -8.056  1.00 0.39 ? 72  LYS A CB   6  
ATOM   7888  C CG   . LYS A 1 72 ? -4.194  5.209   -9.177  1.00 0.50 ? 72  LYS A CG   6  
ATOM   7889  C CD   . LYS A 1 72 ? -3.656  6.362   -10.014 1.00 0.74 ? 72  LYS A CD   6  
ATOM   7890  C CE   . LYS A 1 72 ? -3.329  7.585   -9.163  1.00 1.11 ? 72  LYS A CE   6  
ATOM   7891  N NZ   . LYS A 1 72 ? -2.888  8.742   -9.992  1.00 1.44 ? 72  LYS A NZ   6  
ATOM   7892  H H    . LYS A 1 72 ? -5.212  4.011   -6.664  1.00 0.28 ? 72  LYS A H    6  
ATOM   7893  H HA   . LYS A 1 72 ? -3.399  2.736   -8.395  1.00 0.35 ? 72  LYS A HA   6  
ATOM   7894  H HB2  . LYS A 1 72 ? -3.415  5.522   -7.233  1.00 0.45 ? 72  LYS A HB2  6  
ATOM   7895  H HB3  . LYS A 1 72 ? -2.229  4.986   -8.413  1.00 0.49 ? 72  LYS A HB3  6  
ATOM   7896  H HG2  . LYS A 1 72 ? -4.329  4.350   -9.815  1.00 0.76 ? 72  LYS A HG2  6  
ATOM   7897  H HG3  . LYS A 1 72 ? -5.142  5.496   -8.749  1.00 0.74 ? 72  LYS A HG3  6  
ATOM   7898  H HD2  . LYS A 1 72 ? -2.759  6.038   -10.517 1.00 0.98 ? 72  LYS A HD2  6  
ATOM   7899  H HD3  . LYS A 1 72 ? -4.401  6.636   -10.748 1.00 0.88 ? 72  LYS A HD3  6  
ATOM   7900  H HE2  . LYS A 1 72 ? -4.212  7.868   -8.609  1.00 1.39 ? 72  LYS A HE2  6  
ATOM   7901  H HE3  . LYS A 1 72 ? -2.540  7.327   -8.471  1.00 1.42 ? 72  LYS A HE3  6  
ATOM   7902  H HZ1  . LYS A 1 72 ? -3.645  9.023   -10.648 1.00 1.73 ? 72  LYS A HZ1  6  
ATOM   7903  H HZ2  . LYS A 1 72 ? -2.044  8.489   -10.544 1.00 1.79 ? 72  LYS A HZ2  6  
ATOM   7904  H HZ3  . LYS A 1 72 ? -2.652  9.553   -9.382  1.00 1.75 ? 72  LYS A HZ3  6  
ATOM   7905  N N    . THR A 1 73 ? -2.122  3.692   -5.509  1.00 0.23 ? 73  THR A N    6  
ATOM   7906  C CA   . THR A 1 73 ? -1.034  3.465   -4.571  1.00 0.24 ? 73  THR A CA   6  
ATOM   7907  C C    . THR A 1 73 ? -1.023  2.013   -4.098  1.00 0.21 ? 73  THR A C    6  
ATOM   7908  O O    . THR A 1 73 ? 0.033   1.376   -4.029  1.00 0.24 ? 73  THR A O    6  
ATOM   7909  C CB   . THR A 1 73 ? -1.163  4.408   -3.364  1.00 0.29 ? 73  THR A CB   6  
ATOM   7910  O OG1  . THR A 1 73 ? -1.786  5.634   -3.779  1.00 0.39 ? 73  THR A OG1  6  
ATOM   7911  C CG2  . THR A 1 73 ? 0.201   4.704   -2.758  1.00 0.35 ? 73  THR A CG2  6  
ATOM   7912  H H    . THR A 1 73 ? -2.825  4.335   -5.270  1.00 0.26 ? 73  THR A H    6  
ATOM   7913  H HA   . THR A 1 73 ? -0.103  3.678   -5.077  1.00 0.26 ? 73  THR A HA   6  
ATOM   7914  H HB   . THR A 1 73 ? -1.779  3.931   -2.615  1.00 0.32 ? 73  THR A HB   6  
ATOM   7915  H HG1  . THR A 1 73 ? -1.190  6.110   -4.382  1.00 0.74 ? 73  THR A HG1  6  
ATOM   7916  H HG21 . THR A 1 73 ? 0.828   5.179   -3.498  1.00 0.57 ? 73  THR A HG21 6  
ATOM   7917  H HG22 . THR A 1 73 ? 0.661   3.779   -2.435  1.00 0.56 ? 73  THR A HG22 6  
ATOM   7918  H HG23 . THR A 1 73 ? 0.083   5.362   -1.911  1.00 0.58 ? 73  THR A HG23 6  
ATOM   7919  N N    . TRP A 1 74 ? -2.211  1.491   -3.804  1.00 0.18 ? 74  TRP A N    6  
ATOM   7920  C CA   . TRP A 1 74 ? -2.356  0.120   -3.341  1.00 0.18 ? 74  TRP A CA   6  
ATOM   7921  C C    . TRP A 1 74 ? -1.846  -0.858  -4.388  1.00 0.17 ? 74  TRP A C    6  
ATOM   7922  O O    . TRP A 1 74 ? -1.037  -1.725  -4.082  1.00 0.19 ? 74  TRP A O    6  
ATOM   7923  C CB   . TRP A 1 74 ? -3.818  -0.185  -3.012  1.00 0.19 ? 74  TRP A CB   6  
ATOM   7924  C CG   . TRP A 1 74 ? -4.048  -1.602  -2.573  1.00 0.20 ? 74  TRP A CG   6  
ATOM   7925  C CD1  . TRP A 1 74 ? -4.861  -2.524  -3.168  1.00 0.23 ? 74  TRP A CD1  6  
ATOM   7926  C CD2  . TRP A 1 74 ? -3.456  -2.258  -1.446  1.00 0.27 ? 74  TRP A CD2  6  
ATOM   7927  N NE1  . TRP A 1 74 ? -4.813  -3.709  -2.476  1.00 0.25 ? 74  TRP A NE1  6  
ATOM   7928  C CE2  . TRP A 1 74 ? -3.958  -3.571  -1.417  1.00 0.27 ? 74  TRP A CE2  6  
ATOM   7929  C CE3  . TRP A 1 74 ? -2.548  -1.863  -0.460  1.00 0.38 ? 74  TRP A CE3  6  
ATOM   7930  C CZ2  . TRP A 1 74 ? -3.584  -4.492  -0.442  1.00 0.36 ? 74  TRP A CZ2  6  
ATOM   7931  C CZ3  . TRP A 1 74 ? -2.181  -2.776  0.508   1.00 0.48 ? 74  TRP A CZ3  6  
ATOM   7932  C CH2  . TRP A 1 74 ? -2.697  -4.078  0.510   1.00 0.46 ? 74  TRP A CH2  6  
ATOM   7933  H H    . TRP A 1 74 ? -3.012  2.051   -3.889  1.00 0.20 ? 74  TRP A H    6  
ATOM   7934  H HA   . TRP A 1 74 ? -1.762  0.011   -2.445  1.00 0.20 ? 74  TRP A HA   6  
ATOM   7935  H HB2  . TRP A 1 74 ? -4.142  0.468   -2.215  1.00 0.22 ? 74  TRP A HB2  6  
ATOM   7936  H HB3  . TRP A 1 74 ? -4.423  -0.002  -3.887  1.00 0.21 ? 74  TRP A HB3  6  
ATOM   7937  H HD1  . TRP A 1 74 ? -5.453  -2.332  -4.052  1.00 0.30 ? 74  TRP A HD1  6  
ATOM   7938  H HE1  . TRP A 1 74 ? -5.313  -4.529  -2.707  1.00 0.28 ? 74  TRP A HE1  6  
ATOM   7939  H HE3  . TRP A 1 74 ? -2.140  -0.865  -0.444  1.00 0.40 ? 74  TRP A HE3  6  
ATOM   7940  H HZ2  . TRP A 1 74 ? -3.974  -5.498  -0.425  1.00 0.36 ? 74  TRP A HZ2  6  
ATOM   7941  H HZ3  . TRP A 1 74 ? -1.480  -2.487  1.277   1.00 0.58 ? 74  TRP A HZ3  6  
ATOM   7942  H HH2  . TRP A 1 74 ? -2.379  -4.759  1.286   1.00 0.54 ? 74  TRP A HH2  6  
ATOM   7943  N N    . GLY A 1 75 ? -2.309  -0.701  -5.626  1.00 0.18 ? 75  GLY A N    6  
ATOM   7944  C CA   . GLY A 1 75 ? -1.895  -1.588  -6.702  1.00 0.21 ? 75  GLY A CA   6  
ATOM   7945  C C    . GLY A 1 75 ? -0.391  -1.617  -6.892  1.00 0.20 ? 75  GLY A C    6  
ATOM   7946  O O    . GLY A 1 75 ? 0.183   -2.656  -7.228  1.00 0.25 ? 75  GLY A O    6  
ATOM   7947  H H    . GLY A 1 75 ? -2.947  0.028   -5.812  1.00 0.20 ? 75  GLY A H    6  
ATOM   7948  H HA2  . GLY A 1 75 ? -2.234  -2.586  -6.480  1.00 0.24 ? 75  GLY A HA2  6  
ATOM   7949  H HA3  . GLY A 1 75 ? -2.354  -1.259  -7.623  1.00 0.24 ? 75  GLY A HA3  6  
ATOM   7950  N N    . LEU A 1 76 ? 0.252   -0.481  -6.672  1.00 0.20 ? 76  LEU A N    6  
ATOM   7951  C CA   . LEU A 1 76 ? 1.694   -0.385  -6.822  1.00 0.24 ? 76  LEU A CA   6  
ATOM   7952  C C    . LEU A 1 76 ? 2.411   -1.125  -5.698  1.00 0.23 ? 76  LEU A C    6  
ATOM   7953  O O    . LEU A 1 76 ? 3.307   -1.931  -5.951  1.00 0.28 ? 76  LEU A O    6  
ATOM   7954  C CB   . LEU A 1 76 ? 2.122   1.080   -6.847  1.00 0.30 ? 76  LEU A CB   6  
ATOM   7955  C CG   . LEU A 1 76 ? 1.736   1.848   -8.110  1.00 0.40 ? 76  LEU A CG   6  
ATOM   7956  C CD1  . LEU A 1 76 ? 1.898   3.348   -7.899  1.00 0.51 ? 76  LEU A CD1  6  
ATOM   7957  C CD2  . LEU A 1 76 ? 2.574   1.381   -9.289  1.00 0.56 ? 76  LEU A CD2  6  
ATOM   7958  H H    . LEU A 1 76 ? -0.259  0.314   -6.402  1.00 0.22 ? 76  LEU A H    6  
ATOM   7959  H HA   . LEU A 1 76 ? 1.960   -0.844  -7.764  1.00 0.27 ? 76  LEU A HA   6  
ATOM   7960  H HB2  . LEU A 1 76 ? 1.674   1.575   -5.998  1.00 0.34 ? 76  LEU A HB2  6  
ATOM   7961  H HB3  . LEU A 1 76 ? 3.196   1.123   -6.740  1.00 0.36 ? 76  LEU A HB3  6  
ATOM   7962  H HG   . LEU A 1 76 ? 0.698   1.656   -8.340  1.00 0.51 ? 76  LEU A HG   6  
ATOM   7963  H HD11 . LEU A 1 76 ? 1.286   3.662   -7.065  1.00 0.93 ? 76  LEU A HD11 6  
ATOM   7964  H HD12 . LEU A 1 76 ? 1.588   3.874   -8.790  1.00 0.87 ? 76  LEU A HD12 6  
ATOM   7965  H HD13 . LEU A 1 76 ? 2.933   3.574   -7.691  1.00 0.94 ? 76  LEU A HD13 6  
ATOM   7966  H HD21 . LEU A 1 76 ? 3.619   1.550   -9.080  1.00 0.97 ? 76  LEU A HD21 6  
ATOM   7967  H HD22 . LEU A 1 76 ? 2.289   1.931   -10.171 1.00 0.98 ? 76  LEU A HD22 6  
ATOM   7968  H HD23 . LEU A 1 76 ? 2.407   0.326   -9.455  1.00 1.01 ? 76  LEU A HD23 6  
ATOM   7969  N N    . VAL A 1 77 ? 2.002   -0.857  -4.464  1.00 0.22 ? 77  VAL A N    6  
ATOM   7970  C CA   . VAL A 1 77 ? 2.609   -1.495  -3.299  1.00 0.25 ? 77  VAL A CA   6  
ATOM   7971  C C    . VAL A 1 77 ? 2.279   -2.985  -3.257  1.00 0.23 ? 77  VAL A C    6  
ATOM   7972  O O    . VAL A 1 77 ? 3.146   -3.813  -2.984  1.00 0.24 ? 77  VAL A O    6  
ATOM   7973  C CB   . VAL A 1 77 ? 2.142   -0.828  -1.984  1.00 0.29 ? 77  VAL A CB   6  
ATOM   7974  C CG1  . VAL A 1 77 ? 2.764   -1.512  -0.774  1.00 0.34 ? 77  VAL A CG1  6  
ATOM   7975  C CG2  . VAL A 1 77 ? 2.477   0.655   -1.989  1.00 0.35 ? 77  VAL A CG2  6  
ATOM   7976  H H    . VAL A 1 77 ? 1.270   -0.211  -4.331  1.00 0.22 ? 77  VAL A H    6  
ATOM   7977  H HA   . VAL A 1 77 ? 3.678   -1.378  -3.377  1.00 0.29 ? 77  VAL A HA   6  
ATOM   7978  H HB   . VAL A 1 77 ? 1.070   -0.931  -1.915  1.00 0.30 ? 77  VAL A HB   6  
ATOM   7979  H HG11 . VAL A 1 77 ? 2.465   -2.549  -0.750  1.00 0.46 ? 77  VAL A HG11 6  
ATOM   7980  H HG12 . VAL A 1 77 ? 2.426   -1.021  0.128   1.00 0.50 ? 77  VAL A HG12 6  
ATOM   7981  H HG13 . VAL A 1 77 ? 3.840   -1.447  -0.835  1.00 0.49 ? 77  VAL A HG13 6  
ATOM   7982  H HG21 . VAL A 1 77 ? 3.547   0.783   -2.064  1.00 0.59 ? 77  VAL A HG21 6  
ATOM   7983  H HG22 . VAL A 1 77 ? 2.126   1.106   -1.071  1.00 0.59 ? 77  VAL A HG22 6  
ATOM   7984  H HG23 . VAL A 1 77 ? 2.000   1.131   -2.830  1.00 0.55 ? 77  VAL A HG23 6  
ATOM   7985  N N    . LEU A 1 78 ? 1.021   -3.312  -3.545  1.00 0.21 ? 78  LEU A N    6  
ATOM   7986  C CA   . LEU A 1 78 ? 0.556   -4.693  -3.541  1.00 0.21 ? 78  LEU A CA   6  
ATOM   7987  C C    . LEU A 1 78 ? 1.381   -5.545  -4.499  1.00 0.20 ? 78  LEU A C    6  
ATOM   7988  O O    . LEU A 1 78 ? 1.734   -6.680  -4.179  1.00 0.22 ? 78  LEU A O    6  
ATOM   7989  C CB   . LEU A 1 78 ? -0.927  -4.754  -3.924  1.00 0.22 ? 78  LEU A CB   6  
ATOM   7990  C CG   . LEU A 1 78 ? -1.546  -6.152  -3.953  1.00 0.25 ? 78  LEU A CG   6  
ATOM   7991  C CD1  . LEU A 1 78 ? -1.451  -6.806  -2.584  1.00 0.35 ? 78  LEU A CD1  6  
ATOM   7992  C CD2  . LEU A 1 78 ? -2.994  -6.079  -4.409  1.00 0.34 ? 78  LEU A CD2  6  
ATOM   7993  H H    . LEU A 1 78 ? 0.381   -2.598  -3.768  1.00 0.20 ? 78  LEU A H    6  
ATOM   7994  H HA   . LEU A 1 78 ? 0.675   -5.079  -2.540  1.00 0.24 ? 78  LEU A HA   6  
ATOM   7995  H HB2  . LEU A 1 78 ? -1.485  -4.155  -3.216  1.00 0.26 ? 78  LEU A HB2  6  
ATOM   7996  H HB3  . LEU A 1 78 ? -1.039  -4.317  -4.904  1.00 0.23 ? 78  LEU A HB3  6  
ATOM   7997  H HG   . LEU A 1 78 ? -1.002  -6.766  -4.656  1.00 0.28 ? 78  LEU A HG   6  
ATOM   7998  H HD11 . LEU A 1 78 ? -0.412  -6.897  -2.298  1.00 0.67 ? 78  LEU A HD11 6  
ATOM   7999  H HD12 . LEU A 1 78 ? -1.900  -7.786  -2.623  1.00 0.70 ? 78  LEU A HD12 6  
ATOM   8000  H HD13 . LEU A 1 78 ? -1.971  -6.198  -1.858  1.00 0.68 ? 78  LEU A HD13 6  
ATOM   8001  H HD21 . LEU A 1 78 ? -3.046  -5.581  -5.366  1.00 0.67 ? 78  LEU A HD21 6  
ATOM   8002  H HD22 . LEU A 1 78 ? -3.572  -5.525  -3.683  1.00 0.68 ? 78  LEU A HD22 6  
ATOM   8003  H HD23 . LEU A 1 78 ? -3.395  -7.078  -4.501  1.00 0.71 ? 78  LEU A HD23 6  
ATOM   8004  N N    . GLY A 1 79 ? 1.690   -4.991  -5.670  1.00 0.20 ? 79  GLY A N    6  
ATOM   8005  C CA   . GLY A 1 79 ? 2.486   -5.719  -6.645  1.00 0.22 ? 79  GLY A CA   6  
ATOM   8006  C C    . GLY A 1 79 ? 3.846   -6.093  -6.095  1.00 0.21 ? 79  GLY A C    6  
ATOM   8007  O O    . GLY A 1 79 ? 4.311   -7.220  -6.271  1.00 0.27 ? 79  GLY A O    6  
ATOM   8008  H H    . GLY A 1 79 ? 1.367   -4.087  -5.877  1.00 0.20 ? 79  GLY A H    6  
ATOM   8009  H HA2  . GLY A 1 79 ? 1.962   -6.622  -6.921  1.00 0.24 ? 79  GLY A HA2  6  
ATOM   8010  H HA3  . GLY A 1 79 ? 2.618   -5.108  -7.525  1.00 0.24 ? 79  GLY A HA3  6  
ATOM   8011  N N    . ALA A 1 80 ? 4.472   -5.148  -5.401  1.00 0.19 ? 80  ALA A N    6  
ATOM   8012  C CA   . ALA A 1 80 ? 5.782   -5.375  -4.810  1.00 0.22 ? 80  ALA A CA   6  
ATOM   8013  C C    . ALA A 1 80 ? 5.685   -6.391  -3.678  1.00 0.21 ? 80  ALA A C    6  
ATOM   8014  O O    . ALA A 1 80 ? 6.524   -7.283  -3.555  1.00 0.25 ? 80  ALA A O    6  
ATOM   8015  C CB   . ALA A 1 80 ? 6.365   -4.067  -4.303  1.00 0.25 ? 80  ALA A CB   6  
ATOM   8016  H H    . ALA A 1 80 ? 4.038   -4.275  -5.279  1.00 0.21 ? 80  ALA A H    6  
ATOM   8017  H HA   . ALA A 1 80 ? 6.434   -5.764  -5.579  1.00 0.25 ? 80  ALA A HA   6  
ATOM   8018  H HB1  . ALA A 1 80 ? 5.715   -3.652  -3.547  1.00 0.41 ? 80  ALA A HB1  6  
ATOM   8019  H HB2  . ALA A 1 80 ? 6.454   -3.370  -5.124  1.00 0.39 ? 80  ALA A HB2  6  
ATOM   8020  H HB3  . ALA A 1 80 ? 7.340   -4.249  -3.877  1.00 0.43 ? 80  ALA A HB3  6  
ATOM   8021  N N    . LEU A 1 81 ? 4.645   -6.252  -2.861  1.00 0.21 ? 81  LEU A N    6  
ATOM   8022  C CA   . LEU A 1 81 ? 4.416   -7.154  -1.738  1.00 0.25 ? 81  LEU A CA   6  
ATOM   8023  C C    . LEU A 1 81 ? 4.193   -8.581  -2.226  1.00 0.22 ? 81  LEU A C    6  
ATOM   8024  O O    . LEU A 1 81 ? 4.712   -9.536  -1.641  1.00 0.23 ? 81  LEU A O    6  
ATOM   8025  C CB   . LEU A 1 81 ? 3.211   -6.693  -0.914  1.00 0.33 ? 81  LEU A CB   6  
ATOM   8026  C CG   . LEU A 1 81 ? 3.442   -5.452  -0.049  1.00 0.50 ? 81  LEU A CG   6  
ATOM   8027  C CD1  . LEU A 1 81 ? 2.147   -5.026  0.624   1.00 0.60 ? 81  LEU A CD1  6  
ATOM   8028  C CD2  . LEU A 1 81 ? 4.521   -5.721  0.991   1.00 0.72 ? 81  LEU A CD2  6  
ATOM   8029  H H    . LEU A 1 81 ? 4.020   -5.510  -3.011  1.00 0.21 ? 81  LEU A H    6  
ATOM   8030  H HA   . LEU A 1 81 ? 5.297   -7.136  -1.114  1.00 0.30 ? 81  LEU A HA   6  
ATOM   8031  H HB2  . LEU A 1 81 ? 2.397   -6.482  -1.593  1.00 0.41 ? 81  LEU A HB2  6  
ATOM   8032  H HB3  . LEU A 1 81 ? 2.915   -7.503  -0.266  1.00 0.38 ? 81  LEU A HB3  6  
ATOM   8033  H HG   . LEU A 1 81 ? 3.776   -4.640  -0.676  1.00 0.60 ? 81  LEU A HG   6  
ATOM   8034  H HD11 . LEU A 1 81 ? 1.414   -4.784  -0.130  1.00 0.98 ? 81  LEU A HD11 6  
ATOM   8035  H HD12 . LEU A 1 81 ? 2.332   -4.158  1.239   1.00 0.95 ? 81  LEU A HD12 6  
ATOM   8036  H HD13 . LEU A 1 81 ? 1.778   -5.833  1.241   1.00 1.12 ? 81  LEU A HD13 6  
ATOM   8037  H HD21 . LEU A 1 81 ? 4.270   -6.608  1.552   1.00 1.02 ? 81  LEU A HD21 6  
ATOM   8038  H HD22 . LEU A 1 81 ? 4.589   -4.878  1.663   1.00 1.04 ? 81  LEU A HD22 6  
ATOM   8039  H HD23 . LEU A 1 81 ? 5.471   -5.865  0.496   1.00 1.02 ? 81  LEU A HD23 6  
ATOM   8040  N N    . LYS A 1 82 ? 3.421   -8.722  -3.298  1.00 0.22 ? 82  LYS A N    6  
ATOM   8041  C CA   . LYS A 1 82 ? 3.140   -10.032 -3.870  1.00 0.24 ? 82  LYS A CA   6  
ATOM   8042  C C    . LYS A 1 82 ? 4.438   -10.715 -4.288  1.00 0.24 ? 82  LYS A C    6  
ATOM   8043  O O    . LYS A 1 82 ? 4.668   -11.877 -3.954  1.00 0.29 ? 82  LYS A O    6  
ATOM   8044  C CB   . LYS A 1 82 ? 2.207   -9.913  -5.077  1.00 0.31 ? 82  LYS A CB   6  
ATOM   8045  C CG   . LYS A 1 82 ? 0.738   -9.754  -4.710  1.00 0.52 ? 82  LYS A CG   6  
ATOM   8046  C CD   . LYS A 1 82 ? -0.145  -9.753  -5.947  1.00 0.61 ? 82  LYS A CD   6  
ATOM   8047  C CE   . LYS A 1 82 ? -1.622  -9.674  -5.590  1.00 0.90 ? 82  LYS A CE   6  
ATOM   8048  N NZ   . LYS A 1 82 ? -2.490  -9.699  -6.798  1.00 1.19 ? 82  LYS A NZ   6  
ATOM   8049  H H    . LYS A 1 82 ? 3.024   -7.923  -3.714  1.00 0.23 ? 82  LYS A H    6  
ATOM   8050  H HA   . LYS A 1 82 ? 2.659   -10.630 -3.110  1.00 0.26 ? 82  LYS A HA   6  
ATOM   8051  H HB2  . LYS A 1 82 ? 2.504   -9.055  -5.661  1.00 0.53 ? 82  LYS A HB2  6  
ATOM   8052  H HB3  . LYS A 1 82 ? 2.310   -10.800 -5.683  1.00 0.51 ? 82  LYS A HB3  6  
ATOM   8053  H HG2  . LYS A 1 82 ? 0.447   -10.576 -4.073  1.00 0.82 ? 82  LYS A HG2  6  
ATOM   8054  H HG3  . LYS A 1 82 ? 0.607   -8.821  -4.183  1.00 0.81 ? 82  LYS A HG3  6  
ATOM   8055  H HD2  . LYS A 1 82 ? 0.111   -8.901  -6.560  1.00 0.84 ? 82  LYS A HD2  6  
ATOM   8056  H HD3  . LYS A 1 82 ? 0.032   -10.662 -6.502  1.00 0.84 ? 82  LYS A HD3  6  
ATOM   8057  H HE2  . LYS A 1 82 ? -1.872  -10.516 -4.963  1.00 1.22 ? 82  LYS A HE2  6  
ATOM   8058  H HE3  . LYS A 1 82 ? -1.800  -8.757  -5.047  1.00 1.21 ? 82  LYS A HE3  6  
ATOM   8059  H HZ1  . LYS A 1 82 ? -3.009  -10.597 -6.849  1.00 1.48 ? 82  LYS A HZ1  6  
ATOM   8060  H HZ2  . LYS A 1 82 ? -1.912  -9.601  -7.661  1.00 1.54 ? 82  LYS A HZ2  6  
ATOM   8061  H HZ3  . LYS A 1 82 ? -3.174  -8.915  -6.766  1.00 1.55 ? 82  LYS A HZ3  6  
ATOM   8062  N N    . ALA A 1 83 ? 5.287   -9.969  -4.992  1.00 0.24 ? 83  ALA A N    6  
ATOM   8063  C CA   . ALA A 1 83 ? 6.567   -10.487 -5.464  1.00 0.28 ? 83  ALA A CA   6  
ATOM   8064  C C    . ALA A 1 83 ? 7.500   -10.798 -4.298  1.00 0.28 ? 83  ALA A C    6  
ATOM   8065  O O    . ALA A 1 83 ? 8.289   -11.744 -4.350  1.00 0.34 ? 83  ALA A O    6  
ATOM   8066  C CB   . ALA A 1 83 ? 7.220   -9.490  -6.408  1.00 0.35 ? 83  ALA A CB   6  
ATOM   8067  H H    . ALA A 1 83 ? 5.042   -9.040  -5.203  1.00 0.25 ? 83  ALA A H    6  
ATOM   8068  H HA   . ALA A 1 83 ? 6.377   -11.398 -6.013  1.00 0.32 ? 83  ALA A HA   6  
ATOM   8069  H HB1  . ALA A 1 83 ? 7.463   -8.589  -5.865  1.00 0.48 ? 83  ALA A HB1  6  
ATOM   8070  H HB2  . ALA A 1 83 ? 6.536   -9.254  -7.211  1.00 0.53 ? 83  ALA A HB2  6  
ATOM   8071  H HB3  . ALA A 1 83 ? 8.124   -9.917  -6.819  1.00 0.54 ? 83  ALA A HB3  6  
ATOM   8072  N N    . ALA A 1 84 ? 7.406   -9.993  -3.247  1.00 0.26 ? 84  ALA A N    6  
ATOM   8073  C CA   . ALA A 1 84 ? 8.232   -10.178 -2.059  1.00 0.31 ? 84  ALA A CA   6  
ATOM   8074  C C    . ALA A 1 84 ? 7.859   -11.464 -1.328  1.00 0.32 ? 84  ALA A C    6  
ATOM   8075  O O    . ALA A 1 84 ? 8.720   -12.147 -0.776  1.00 0.45 ? 84  ALA A O    6  
ATOM   8076  C CB   . ALA A 1 84 ? 8.106   -8.977  -1.129  1.00 0.35 ? 84  ALA A CB   6  
ATOM   8077  H H    . ALA A 1 84 ? 6.773   -9.245  -3.275  1.00 0.26 ? 84  ALA A H    6  
ATOM   8078  H HA   . ALA A 1 84 ? 9.262   -10.244 -2.381  1.00 0.36 ? 84  ALA A HA   6  
ATOM   8079  H HB1  . ALA A 1 84 ? 8.813   -9.072  -0.320  1.00 0.55 ? 84  ALA A HB1  6  
ATOM   8080  H HB2  . ALA A 1 84 ? 7.103   -8.934  -0.729  1.00 0.50 ? 84  ALA A HB2  6  
ATOM   8081  H HB3  . ALA A 1 84 ? 8.311   -8.071  -1.683  1.00 0.52 ? 84  ALA A HB3  6  
ATOM   8082  N N    . ARG A 1 85 ? 6.573   -11.797 -1.344  1.00 0.29 ? 85  ARG A N    6  
ATOM   8083  C CA   . ARG A 1 85 ? 6.088   -13.000 -0.683  1.00 0.35 ? 85  ARG A CA   6  
ATOM   8084  C C    . ARG A 1 85 ? 6.248   -14.222 -1.580  1.00 0.35 ? 85  ARG A C    6  
ATOM   8085  O O    . ARG A 1 85 ? 6.061   -15.354 -1.134  1.00 0.48 ? 85  ARG A O    6  
ATOM   8086  C CB   . ARG A 1 85 ? 4.620   -12.843 -0.274  1.00 0.42 ? 85  ARG A CB   6  
ATOM   8087  C CG   . ARG A 1 85 ? 4.419   -12.069 1.020   1.00 0.54 ? 85  ARG A CG   6  
ATOM   8088  C CD   . ARG A 1 85 ? 5.051   -12.782 2.208   1.00 0.74 ? 85  ARG A CD   6  
ATOM   8089  N NE   . ARG A 1 85 ? 4.608   -12.217 3.483   1.00 0.66 ? 85  ARG A NE   6  
ATOM   8090  C CZ   . ARG A 1 85 ? 4.826   -12.782 4.674   1.00 0.66 ? 85  ARG A CZ   6  
ATOM   8091  N NH1  . ARG A 1 85 ? 5.483   -13.934 4.759   1.00 0.83 ? 85  ARG A NH1  6  
ATOM   8092  N NH2  . ARG A 1 85 ? 4.366   -12.202 5.774   1.00 0.79 ? 85  ARG A NH2  6  
ATOM   8093  H H    . ARG A 1 85 ? 5.935   -11.214 -1.810  1.00 0.31 ? 85  ARG A H    6  
ATOM   8094  H HA   . ARG A 1 85 ? 6.682   -13.149 0.206   1.00 0.41 ? 85  ARG A HA   6  
ATOM   8095  H HB2  . ARG A 1 85 ? 4.092   -12.322 -1.061  1.00 0.47 ? 85  ARG A HB2  6  
ATOM   8096  H HB3  . ARG A 1 85 ? 4.187   -13.823 -0.152  1.00 0.49 ? 85  ARG A HB3  6  
ATOM   8097  H HG2  . ARG A 1 85 ? 4.869   -11.095 0.915   1.00 0.96 ? 85  ARG A HG2  6  
ATOM   8098  H HG3  . ARG A 1 85 ? 3.359   -11.960 1.199   1.00 1.03 ? 85  ARG A HG3  6  
ATOM   8099  H HD2  . ARG A 1 85 ? 4.776   -13.826 2.173   1.00 1.28 ? 85  ARG A HD2  6  
ATOM   8100  H HD3  . ARG A 1 85 ? 6.125   -12.693 2.138   1.00 1.22 ? 85  ARG A HD3  6  
ATOM   8101  H HE   . ARG A 1 85 ? 4.138   -11.354 3.451   1.00 0.81 ? 85  ARG A HE   6  
ATOM   8102  H HH11 . ARG A 1 85 ? 5.646   -14.360 5.656   1.00 1.01 ? 85  ARG A HH11 6  
ATOM   8103  H HH12 . ARG A 1 85 ? 5.824   -14.381 3.930   1.00 0.90 ? 85  ARG A HH12 6  
ATOM   8104  H HH21 . ARG A 1 85 ? 3.854   -11.336 5.710   1.00 0.90 ? 85  ARG A HH21 6  
ATOM   8105  H HH22 . ARG A 1 85 ? 4.523   -12.618 6.674   1.00 0.92 ? 85  ARG A HH22 6  
ATOM   8106  N N    . GLU A 1 86 ? 6.596   -13.996 -2.841  1.00 0.35 ? 86  GLU A N    6  
ATOM   8107  C CA   . GLU A 1 86 ? 6.785   -15.091 -3.786  1.00 0.40 ? 86  GLU A CA   6  
ATOM   8108  C C    . GLU A 1 86 ? 8.024   -15.898 -3.421  1.00 0.43 ? 86  GLU A C    6  
ATOM   8109  O O    . GLU A 1 86 ? 8.084   -17.103 -3.655  1.00 0.65 ? 86  GLU A O    6  
ATOM   8110  C CB   . GLU A 1 86 ? 6.917   -14.563 -5.218  1.00 0.50 ? 86  GLU A CB   6  
ATOM   8111  C CG   . GLU A 1 86 ? 5.595   -14.131 -5.833  1.00 0.68 ? 86  GLU A CG   6  
ATOM   8112  C CD   . GLU A 1 86 ? 5.713   -13.813 -7.309  1.00 0.87 ? 86  GLU A CD   6  
ATOM   8113  O OE1  . GLU A 1 86 ? 5.205   -14.604 -8.133  1.00 1.32 ? 86  GLU A OE1  6  
ATOM   8114  O OE2  . GLU A 1 86 ? 6.315   -12.777 -7.658  1.00 1.25 ? 86  GLU A OE2  6  
ATOM   8115  H H    . GLU A 1 86 ? 6.738   -13.073 -3.142  1.00 0.42 ? 86  GLU A H    6  
ATOM   8116  H HA   . GLU A 1 86 ? 5.918   -15.733 -3.727  1.00 0.47 ? 86  GLU A HA   6  
ATOM   8117  H HB2  . GLU A 1 86 ? 7.584   -13.711 -5.214  1.00 0.63 ? 86  GLU A HB2  6  
ATOM   8118  H HB3  . GLU A 1 86 ? 7.341   -15.337 -5.836  1.00 0.63 ? 86  GLU A HB3  6  
ATOM   8119  H HG2  . GLU A 1 86 ? 4.877   -14.928 -5.708  1.00 0.90 ? 86  GLU A HG2  6  
ATOM   8120  H HG3  . GLU A 1 86 ? 5.243   -13.250 -5.315  1.00 0.93 ? 86  GLU A HG3  6  
ATOM   8121  N N    . GLU A 1 87 ? 9.002   -15.225 -2.835  1.00 0.47 ? 87  GLU A N    6  
ATOM   8122  C CA   . GLU A 1 87 ? 10.244  -15.871 -2.442  1.00 0.58 ? 87  GLU A CA   6  
ATOM   8123  C C    . GLU A 1 87 ? 10.456  -15.745 -0.938  1.00 0.68 ? 87  GLU A C    6  
ATOM   8124  O O    . GLU A 1 87 ? 9.833   -16.517 -0.181  1.00 1.13 ? 87  GLU A O    6  
ATOM   8125  C CB   . GLU A 1 87 ? 11.425  -15.257 -3.198  1.00 0.77 ? 87  GLU A CB   6  
ATOM   8126  C CG   . GLU A 1 87 ? 11.280  -15.326 -4.709  1.00 1.10 ? 87  GLU A CG   6  
ATOM   8127  C CD   . GLU A 1 87 ? 12.541  -14.907 -5.430  1.00 1.15 ? 87  GLU A CD   6  
ATOM   8128  O OE1  . GLU A 1 87 ? 13.433  -15.762 -5.619  1.00 1.51 ? 87  GLU A OE1  6  
ATOM   8129  O OE2  . GLU A 1 87 ? 12.655  -13.721 -5.801  1.00 1.44 ? 87  GLU A OE2  6  
ATOM   8130  O OXT  . GLU A 1 87 ? 11.235  -14.868 -0.515  1.00 1.02 ? 87  GLU A OXT  6  
ATOM   8131  H H    . GLU A 1 87 ? 8.881   -14.271 -2.648  1.00 0.60 ? 87  GLU A H    6  
ATOM   8132  H HA   . GLU A 1 87 ? 10.167  -16.918 -2.698  1.00 0.71 ? 87  GLU A HA   6  
ATOM   8133  H HB2  . GLU A 1 87 ? 11.521  -14.220 -2.914  1.00 1.08 ? 87  GLU A HB2  6  
ATOM   8134  H HB3  . GLU A 1 87 ? 12.326  -15.784 -2.920  1.00 1.00 ? 87  GLU A HB3  6  
ATOM   8135  H HG2  . GLU A 1 87 ? 11.042  -16.340 -4.988  1.00 1.52 ? 87  GLU A HG2  6  
ATOM   8136  H HG3  . GLU A 1 87 ? 10.475  -14.672 -5.011  1.00 1.59 ? 87  GLU A HG3  6  
HETATM 8137  C C1   . IHP B 2 .  ? 13.893  9.419   1.832   1.00 0.87 ? 101 IHP A C1   6  
HETATM 8138  C C2   . IHP B 2 .  ? 12.638  10.069  2.421   1.00 0.83 ? 101 IHP A C2   6  
HETATM 8139  C C3   . IHP B 2 .  ? 12.063  11.069  1.416   1.00 0.67 ? 101 IHP A C3   6  
HETATM 8140  C C4   . IHP B 2 .  ? 11.699  10.340  0.120   1.00 0.52 ? 101 IHP A C4   6  
HETATM 8141  C C5   . IHP B 2 .  ? 12.954  9.691   -0.468  1.00 0.61 ? 101 IHP A C5   6  
HETATM 8142  C C6   . IHP B 2 .  ? 13.530  8.691   0.537   1.00 0.77 ? 101 IHP A C6   6  
HETATM 8143  O O11  . IHP B 2 .  ? 14.431  8.485   2.769   1.00 1.21 ? 101 IHP A O11  6  
HETATM 8144  P P1   . IHP B 2 .  ? 15.915  8.613   3.379   1.00 1.54 ? 101 IHP A P1   6  
HETATM 8145  O O21  . IHP B 2 .  ? 16.082  9.945   3.999   1.00 1.58 ? 101 IHP A O21  6  
HETATM 8146  O O31  . IHP B 2 .  ? 16.136  7.471   4.492   1.00 1.93 ? 101 IHP A O31  6  
HETATM 8147  O O41  . IHP B 2 .  ? 16.997  8.428   2.200   1.00 1.56 ? 101 IHP A O41  6  
HETATM 8148  O O12  . IHP B 2 .  ? 11.666  9.059   2.699   1.00 0.85 ? 101 IHP A O12  6  
HETATM 8149  P P2   . IHP B 2 .  ? 11.084  8.784   4.174   1.00 1.21 ? 101 IHP A P2   6  
HETATM 8150  O O22  . IHP B 2 .  ? 10.530  10.039  4.727   1.00 1.39 ? 101 IHP A O22  6  
HETATM 8151  O O32  . IHP B 2 .  ? 9.921   7.672   4.094   1.00 1.20 ? 101 IHP A O32  6  
HETATM 8152  O O42  . IHP B 2 .  ? 12.268  8.253   5.127   1.00 1.55 ? 101 IHP A O42  6  
HETATM 8153  O O13  . IHP B 2 .  ? 10.889  11.674  1.966   1.00 0.90 ? 101 IHP A O13  6  
HETATM 8154  P P3   . IHP B 2 .  ? 10.754  13.260  2.209   1.00 1.24 ? 101 IHP A P3   6  
HETATM 8155  O O23  . IHP B 2 .  ? 11.881  13.729  3.047   1.00 1.39 ? 101 IHP A O23  6  
HETATM 8156  O O33  . IHP B 2 .  ? 10.783  14.024  0.793   1.00 1.27 ? 101 IHP A O33  6  
HETATM 8157  O O43  . IHP B 2 .  ? 9.364   13.571  2.957   1.00 1.57 ? 101 IHP A O43  6  
HETATM 8158  O O14  . IHP B 2 .  ? 11.161  11.275  -0.816  1.00 0.74 ? 101 IHP A O14  6  
HETATM 8159  P P4   . IHP B 2 .  ? 9.677   11.148  -1.428  1.00 1.00 ? 101 IHP A P4   6  
HETATM 8160  O O24  . IHP B 2 .  ? 9.361   12.436  -2.341  1.00 1.39 ? 101 IHP A O24  6  
HETATM 8161  O O34  . IHP B 2 .  ? 9.576   9.814   -2.326  1.00 1.09 ? 101 IHP A O34  6  
HETATM 8162  O O44  . IHP B 2 .  ? 8.694   11.075  -0.323  1.00 1.01 ? 101 IHP A O44  6  
HETATM 8163  O O15  . IHP B 2 .  ? 12.615  9.011   -1.678  1.00 0.86 ? 101 IHP A O15  6  
HETATM 8164  P P5   . IHP B 2 .  ? 13.269  9.379   -3.102  1.00 1.20 ? 101 IHP A P5   6  
HETATM 8165  O O25  . IHP B 2 .  ? 14.743  9.310   -3.002  1.00 1.28 ? 101 IHP A O25  6  
HETATM 8166  O O35  . IHP B 2 .  ? 12.758  8.330   -4.214  1.00 1.56 ? 101 IHP A O35  6  
HETATM 8167  O O45  . IHP B 2 .  ? 12.828  10.868  -3.527  1.00 1.25 ? 101 IHP A O45  6  
HETATM 8168  O O16  . IHP B 2 .  ? 14.702  8.086   -0.014  1.00 1.06 ? 101 IHP A O16  6  
HETATM 8169  P P6   . IHP B 2 .  ? 14.837  6.500   -0.257  1.00 1.40 ? 101 IHP A P6   6  
HETATM 8170  O O26  . IHP B 2 .  ? 13.711  6.030   -1.093  1.00 1.39 ? 101 IHP A O26  6  
HETATM 8171  O O36  . IHP B 2 .  ? 16.229  6.189   -1.006  1.00 1.74 ? 101 IHP A O36  6  
HETATM 8172  O O46  . IHP B 2 .  ? 14.808  5.736   1.160   1.00 1.56 ? 101 IHP A O46  6  
HETATM 8173  H H1   . IHP B 2 .  ? 14.629  10.197  1.628   1.00 0.89 ? 101 IHP A H1   6  
HETATM 8174  H H2   . IHP B 2 .  ? 12.907  10.596  3.344   1.00 1.08 ? 101 IHP A H2   6  
HETATM 8175  H H3   . IHP B 2 .  ? 12.810  11.842  1.205   1.00 0.73 ? 101 IHP A H3   6  
HETATM 8176  H H4   . IHP B 2 .  ? 10.948  9.572   0.317   1.00 0.51 ? 101 IHP A H4   6  
HETATM 8177  H H5   . IHP B 2 .  ? 13.696  10.461  -0.660  1.00 0.66 ? 101 IHP A H5   6  
HETATM 8178  H H6   . IHP B 2 .  ? 12.793  7.918   0.759   1.00 0.80 ? 101 IHP A H6   6  
ATOM   8179  N N    . SER A 1 1  ? 3.286   6.469   10.745  1.00 1.45 ? 1   SER A N    7  
ATOM   8180  C CA   . SER A 1 1  ? 4.394   5.510   10.933  1.00 0.98 ? 1   SER A CA   7  
ATOM   8181  C C    . SER A 1 1  ? 5.647   6.028   10.242  1.00 0.92 ? 1   SER A C    7  
ATOM   8182  O O    . SER A 1 1  ? 5.587   7.004   9.493   1.00 1.21 ? 1   SER A O    7  
ATOM   8183  C CB   . SER A 1 1  ? 4.008   4.139   10.374  1.00 1.66 ? 1   SER A CB   7  
ATOM   8184  O OG   . SER A 1 1  ? 3.402   4.260   9.099   1.00 2.07 ? 1   SER A OG   7  
ATOM   8185  H H1   . SER A 1 1  ? 3.534   7.386   11.168  1.00 1.90 ? 1   SER A H1   7  
ATOM   8186  H H2   . SER A 1 1  ? 2.419   6.116   11.196  1.00 1.69 ? 1   SER A H2   7  
ATOM   8187  H H3   . SER A 1 1  ? 3.105   6.606   9.731   1.00 1.94 ? 1   SER A H3   7  
ATOM   8188  H HA   . SER A 1 1  ? 4.590   5.422   11.990  1.00 1.33 ? 1   SER A HA   7  
ATOM   8189  H HB2  . SER A 1 1  ? 4.895   3.530   10.280  1.00 2.07 ? 1   SER A HB2  7  
ATOM   8190  H HB3  . SER A 1 1  ? 3.313   3.659   11.048  1.00 2.12 ? 1   SER A HB3  7  
ATOM   8191  H HG   . SER A 1 1  ? 2.443   4.334   9.202   1.00 2.51 ? 1   SER A HG   7  
ATOM   8192  N N    . GLU A 1 2  ? 6.779   5.384   10.498  1.00 0.80 ? 2   GLU A N    7  
ATOM   8193  C CA   . GLU A 1 2  ? 8.036   5.795   9.893   1.00 0.85 ? 2   GLU A CA   7  
ATOM   8194  C C    . GLU A 1 2  ? 8.810   4.590   9.364   1.00 0.72 ? 2   GLU A C    7  
ATOM   8195  O O    . GLU A 1 2  ? 9.021   4.464   8.159   1.00 0.72 ? 2   GLU A O    7  
ATOM   8196  C CB   . GLU A 1 2  ? 8.879   6.579   10.907  1.00 1.13 ? 2   GLU A CB   7  
ATOM   8197  C CG   . GLU A 1 2  ? 8.799   6.035   12.328  1.00 1.33 ? 2   GLU A CG   7  
ATOM   8198  C CD   . GLU A 1 2  ? 9.140   7.076   13.370  1.00 1.48 ? 2   GLU A CD   7  
ATOM   8199  O OE1  . GLU A 1 2  ? 10.337  7.401   13.523  1.00 1.99 ? 2   GLU A OE1  7  
ATOM   8200  O OE2  . GLU A 1 2  ? 8.210   7.565   14.052  1.00 1.97 ? 2   GLU A OE2  7  
ATOM   8201  H H    . GLU A 1 2  ? 6.770   4.619   11.110  1.00 0.89 ? 2   GLU A H    7  
ATOM   8202  H HA   . GLU A 1 2  ? 7.802   6.441   9.063   1.00 0.92 ? 2   GLU A HA   7  
ATOM   8203  H HB2  . GLU A 1 2  ? 9.913   6.551   10.594  1.00 1.41 ? 2   GLU A HB2  7  
ATOM   8204  H HB3  . GLU A 1 2  ? 8.544   7.606   10.919  1.00 1.30 ? 2   GLU A HB3  7  
ATOM   8205  H HG2  . GLU A 1 2  ? 7.793   5.684   12.509  1.00 1.76 ? 2   GLU A HG2  7  
ATOM   8206  H HG3  . GLU A 1 2  ? 9.489   5.210   12.423  1.00 1.92 ? 2   GLU A HG3  7  
ATOM   8207  N N    . ALA A 1 3  ? 9.202   3.696   10.265  1.00 0.74 ? 3   ALA A N    7  
ATOM   8208  C CA   . ALA A 1 3  ? 9.964   2.507   9.894   1.00 0.73 ? 3   ALA A CA   7  
ATOM   8209  C C    . ALA A 1 3  ? 9.176   1.610   8.946   1.00 0.59 ? 3   ALA A C    7  
ATOM   8210  O O    . ALA A 1 3  ? 9.728   1.077   7.985   1.00 0.57 ? 3   ALA A O    7  
ATOM   8211  C CB   . ALA A 1 3  ? 10.373  1.729   11.135  1.00 0.89 ? 3   ALA A CB   7  
ATOM   8212  H H    . ALA A 1 3  ? 8.974   3.839   11.206  1.00 0.83 ? 3   ALA A H    7  
ATOM   8213  H HA   . ALA A 1 3  ? 10.864  2.834   9.395   1.00 0.80 ? 3   ALA A HA   7  
ATOM   8214  H HB1  . ALA A 1 3  ? 10.792  2.408   11.864  1.00 1.15 ? 3   ALA A HB1  7  
ATOM   8215  H HB2  . ALA A 1 3  ? 11.111  0.989   10.868  1.00 1.06 ? 3   ALA A HB2  7  
ATOM   8216  H HB3  . ALA A 1 3  ? 9.507   1.241   11.553  1.00 0.95 ? 3   ALA A HB3  7  
ATOM   8217  N N    . VAL A 1 4  ? 7.885   1.452   9.217   1.00 0.56 ? 4   VAL A N    7  
ATOM   8218  C CA   . VAL A 1 4  ? 7.029   0.620   8.381   1.00 0.50 ? 4   VAL A CA   7  
ATOM   8219  C C    . VAL A 1 4  ? 7.001   1.136   6.944   1.00 0.45 ? 4   VAL A C    7  
ATOM   8220  O O    . VAL A 1 4  ? 7.021   0.355   5.992   1.00 0.48 ? 4   VAL A O    7  
ATOM   8221  C CB   . VAL A 1 4  ? 5.589   0.555   8.933   1.00 0.57 ? 4   VAL A CB   7  
ATOM   8222  C CG1  . VAL A 1 4  ? 4.680   -0.218  7.990   1.00 0.82 ? 4   VAL A CG1  7  
ATOM   8223  C CG2  . VAL A 1 4  ? 5.572   -0.074  10.317  1.00 0.79 ? 4   VAL A CG2  7  
ATOM   8224  H H    . VAL A 1 4  ? 7.503   1.898   10.004  1.00 0.63 ? 4   VAL A H    7  
ATOM   8225  H HA   . VAL A 1 4  ? 7.439   -0.380  8.384   1.00 0.54 ? 4   VAL A HA   7  
ATOM   8226  H HB   . VAL A 1 4  ? 5.210   1.564   9.016   1.00 0.63 ? 4   VAL A HB   7  
ATOM   8227  H HG11 . VAL A 1 4  ? 4.626   0.293   7.041   1.00 1.06 ? 4   VAL A HG11 7  
ATOM   8228  H HG12 . VAL A 1 4  ? 3.691   -0.286  8.419   1.00 0.99 ? 4   VAL A HG12 7  
ATOM   8229  H HG13 . VAL A 1 4  ? 5.076   -1.211  7.843   1.00 1.13 ? 4   VAL A HG13 7  
ATOM   8230  H HG21 . VAL A 1 4  ? 4.558   -0.097  10.688  1.00 1.11 ? 4   VAL A HG21 7  
ATOM   8231  H HG22 . VAL A 1 4  ? 6.186   0.509   10.986  1.00 1.16 ? 4   VAL A HG22 7  
ATOM   8232  H HG23 . VAL A 1 4  ? 5.957   -1.081  10.260  1.00 1.27 ? 4   VAL A HG23 7  
ATOM   8233  N N    . ILE A 1 5  ? 6.970   2.454   6.788   1.00 0.48 ? 5   ILE A N    7  
ATOM   8234  C CA   . ILE A 1 5  ? 6.945   3.058   5.465   1.00 0.51 ? 5   ILE A CA   7  
ATOM   8235  C C    . ILE A 1 5  ? 8.272   2.820   4.751   1.00 0.46 ? 5   ILE A C    7  
ATOM   8236  O O    . ILE A 1 5  ? 8.296   2.546   3.553   1.00 0.47 ? 5   ILE A O    7  
ATOM   8237  C CB   . ILE A 1 5  ? 6.657   4.573   5.530   1.00 0.65 ? 5   ILE A CB   7  
ATOM   8238  C CG1  . ILE A 1 5  ? 5.344   4.830   6.270   1.00 0.81 ? 5   ILE A CG1  7  
ATOM   8239  C CG2  . ILE A 1 5  ? 6.601   5.166   4.129   1.00 0.81 ? 5   ILE A CG2  7  
ATOM   8240  C CD1  . ILE A 1 5  ? 4.977   6.295   6.364   1.00 0.98 ? 5   ILE A CD1  7  
ATOM   8241  H H    . ILE A 1 5  ? 6.969   3.033   7.578   1.00 0.54 ? 5   ILE A H    7  
ATOM   8242  H HA   . ILE A 1 5  ? 6.155   2.585   4.898   1.00 0.55 ? 5   ILE A HA   7  
ATOM   8243  H HB   . ILE A 1 5  ? 7.465   5.049   6.066   1.00 0.71 ? 5   ILE A HB   7  
ATOM   8244  H HG12 . ILE A 1 5  ? 4.543   4.322   5.754   1.00 0.91 ? 5   ILE A HG12 7  
ATOM   8245  H HG13 . ILE A 1 5  ? 5.424   4.444   7.276   1.00 0.85 ? 5   ILE A HG13 7  
ATOM   8246  H HG21 . ILE A 1 5  ? 5.804   4.696   3.571   1.00 1.02 ? 5   ILE A HG21 7  
ATOM   8247  H HG22 . ILE A 1 5  ? 7.543   4.991   3.628   1.00 1.00 ? 5   ILE A HG22 7  
ATOM   8248  H HG23 . ILE A 1 5  ? 6.419   6.228   4.195   1.00 1.04 ? 5   ILE A HG23 7  
ATOM   8249  H HD11 . ILE A 1 5  ? 4.960   6.723   5.372   1.00 1.27 ? 5   ILE A HD11 7  
ATOM   8250  H HD12 . ILE A 1 5  ? 5.709   6.811   6.967   1.00 1.29 ? 5   ILE A HD12 7  
ATOM   8251  H HD13 . ILE A 1 5  ? 4.001   6.393   6.816   1.00 1.30 ? 5   ILE A HD13 7  
ATOM   8252  N N    . LYS A 1 6  ? 9.365   2.900   5.508   1.00 0.49 ? 6   LYS A N    7  
ATOM   8253  C CA   . LYS A 1 6  ? 10.705  2.694   4.962   1.00 0.50 ? 6   LYS A CA   7  
ATOM   8254  C C    . LYS A 1 6  ? 10.821  1.304   4.351   1.00 0.46 ? 6   LYS A C    7  
ATOM   8255  O O    . LYS A 1 6  ? 11.410  1.128   3.287   1.00 0.47 ? 6   LYS A O    7  
ATOM   8256  C CB   . LYS A 1 6  ? 11.777  2.873   6.045   1.00 0.61 ? 6   LYS A CB   7  
ATOM   8257  C CG   . LYS A 1 6  ? 11.749  4.230   6.737   1.00 0.85 ? 6   LYS A CG   7  
ATOM   8258  C CD   . LYS A 1 6  ? 11.797  5.381   5.745   1.00 1.11 ? 6   LYS A CD   7  
ATOM   8259  C CE   . LYS A 1 6  ? 13.070  5.358   4.914   1.00 1.11 ? 6   LYS A CE   7  
ATOM   8260  N NZ   . LYS A 1 6  ? 13.081  6.433   3.892   1.00 1.12 ? 6   LYS A NZ   7  
ATOM   8261  H H    . LYS A 1 6  ? 9.269   3.101   6.462   1.00 0.53 ? 6   LYS A H    7  
ATOM   8262  H HA   . LYS A 1 6  ? 10.862  3.429   4.187   1.00 0.52 ? 6   LYS A HA   7  
ATOM   8263  H HB2  . LYS A 1 6  ? 11.641  2.109   6.796   1.00 0.84 ? 6   LYS A HB2  7  
ATOM   8264  H HB3  . LYS A 1 6  ? 12.750  2.746   5.592   1.00 0.80 ? 6   LYS A HB3  7  
ATOM   8265  H HG2  . LYS A 1 6  ? 10.839  4.307   7.314   1.00 1.25 ? 6   LYS A HG2  7  
ATOM   8266  H HG3  . LYS A 1 6  ? 12.600  4.302   7.397   1.00 1.02 ? 6   LYS A HG3  7  
ATOM   8267  H HD2  . LYS A 1 6  ? 10.947  5.308   5.083   1.00 1.57 ? 6   LYS A HD2  7  
ATOM   8268  H HD3  . LYS A 1 6  ? 11.751  6.312   6.289   1.00 1.65 ? 6   LYS A HD3  7  
ATOM   8269  H HE2  . LYS A 1 6  ? 13.915  5.490   5.572   1.00 1.38 ? 6   LYS A HE2  7  
ATOM   8270  H HE3  . LYS A 1 6  ? 13.145  4.400   4.419   1.00 1.51 ? 6   LYS A HE3  7  
ATOM   8271  H HZ1  . LYS A 1 6  ? 13.123  7.364   4.353   1.00 1.52 ? 6   LYS A HZ1  7  
ATOM   8272  H HZ2  . LYS A 1 6  ? 12.225  6.384   3.314   1.00 1.47 ? 6   LYS A HZ2  7  
ATOM   8273  H HZ3  . LYS A 1 6  ? 13.906  6.332   3.269   1.00 1.48 ? 6   LYS A HZ3  7  
ATOM   8274  N N    . VAL A 1 7  ? 10.246  0.321   5.034   1.00 0.46 ? 7   VAL A N    7  
ATOM   8275  C CA   . VAL A 1 7  ? 10.267  -1.057  4.564   1.00 0.48 ? 7   VAL A CA   7  
ATOM   8276  C C    . VAL A 1 7  ? 9.573   -1.176  3.210   1.00 0.44 ? 7   VAL A C    7  
ATOM   8277  O O    . VAL A 1 7  ? 10.060  -1.864  2.311   1.00 0.54 ? 7   VAL A O    7  
ATOM   8278  C CB   . VAL A 1 7  ? 9.588   -2.006  5.579   1.00 0.54 ? 7   VAL A CB   7  
ATOM   8279  C CG1  . VAL A 1 7  ? 9.544   -3.437  5.055   1.00 0.60 ? 7   VAL A CG1  7  
ATOM   8280  C CG2  . VAL A 1 7  ? 10.306  -1.952  6.920   1.00 0.61 ? 7   VAL A CG2  7  
ATOM   8281  H H    . VAL A 1 7  ? 9.806   0.529   5.886   1.00 0.48 ? 7   VAL A H    7  
ATOM   8282  H HA   . VAL A 1 7  ? 11.300  -1.356  4.456   1.00 0.53 ? 7   VAL A HA   7  
ATOM   8283  H HB   . VAL A 1 7  ? 8.571   -1.672  5.729   1.00 0.55 ? 7   VAL A HB   7  
ATOM   8284  H HG11 . VAL A 1 7  ? 10.550  -3.826  4.987   1.00 0.73 ? 7   VAL A HG11 7  
ATOM   8285  H HG12 . VAL A 1 7  ? 9.090   -3.448  4.074   1.00 0.72 ? 7   VAL A HG12 7  
ATOM   8286  H HG13 . VAL A 1 7  ? 8.964   -4.050  5.727   1.00 0.79 ? 7   VAL A HG13 7  
ATOM   8287  H HG21 . VAL A 1 7  ? 10.340  -0.929  7.269   1.00 0.75 ? 7   VAL A HG21 7  
ATOM   8288  H HG22 . VAL A 1 7  ? 11.313  -2.327  6.805   1.00 0.79 ? 7   VAL A HG22 7  
ATOM   8289  H HG23 . VAL A 1 7  ? 9.775   -2.559  7.639   1.00 0.78 ? 7   VAL A HG23 7  
ATOM   8290  N N    . ILE A 1 8  ? 8.449   -0.484  3.067   1.00 0.38 ? 8   ILE A N    7  
ATOM   8291  C CA   . ILE A 1 8  ? 7.680   -0.509  1.829   1.00 0.40 ? 8   ILE A CA   7  
ATOM   8292  C C    . ILE A 1 8  ? 8.423   0.213   0.701   1.00 0.37 ? 8   ILE A C    7  
ATOM   8293  O O    . ILE A 1 8  ? 8.563   -0.318  -0.403  1.00 0.40 ? 8   ILE A O    7  
ATOM   8294  C CB   . ILE A 1 8  ? 6.290   0.146   2.016   1.00 0.47 ? 8   ILE A CB   7  
ATOM   8295  C CG1  . ILE A 1 8  ? 5.540   -0.486  3.199   1.00 0.52 ? 8   ILE A CG1  7  
ATOM   8296  C CG2  . ILE A 1 8  ? 5.465   0.034   0.742   1.00 0.56 ? 8   ILE A CG2  7  
ATOM   8297  C CD1  . ILE A 1 8  ? 5.318   -1.977  3.065   1.00 0.61 ? 8   ILE A CD1  7  
ATOM   8298  H H    . ILE A 1 8  ? 8.126   0.061   3.816   1.00 0.39 ? 8   ILE A H    7  
ATOM   8299  H HA   . ILE A 1 8  ? 7.534   -1.543  1.545   1.00 0.44 ? 8   ILE A HA   7  
ATOM   8300  H HB   . ILE A 1 8  ? 6.443   1.196   2.219   1.00 0.50 ? 8   ILE A HB   7  
ATOM   8301  H HG12 . ILE A 1 8  ? 6.102   -0.318  4.105   1.00 0.53 ? 8   ILE A HG12 7  
ATOM   8302  H HG13 . ILE A 1 8  ? 4.572   -0.015  3.293   1.00 0.59 ? 8   ILE A HG13 7  
ATOM   8303  H HG21 . ILE A 1 8  ? 4.532   0.564   0.869   1.00 0.96 ? 8   ILE A HG21 7  
ATOM   8304  H HG22 . ILE A 1 8  ? 5.262   -1.008  0.534   1.00 1.01 ? 8   ILE A HG22 7  
ATOM   8305  H HG23 . ILE A 1 8  ? 6.016   0.464   -0.084  1.00 1.00 ? 8   ILE A HG23 7  
ATOM   8306  H HD11 . ILE A 1 8  ? 6.271   -2.480  3.030   1.00 0.96 ? 8   ILE A HD11 7  
ATOM   8307  H HD12 . ILE A 1 8  ? 4.770   -2.179  2.158   1.00 0.94 ? 8   ILE A HD12 7  
ATOM   8308  H HD13 . ILE A 1 8  ? 4.753   -2.333  3.914   1.00 0.97 ? 8   ILE A HD13 7  
ATOM   8309  N N    . SER A 1 9  ? 8.913   1.414   0.990   1.00 0.37 ? 9   SER A N    7  
ATOM   8310  C CA   . SER A 1 9  ? 9.616   2.208   -0.006  1.00 0.41 ? 9   SER A CA   7  
ATOM   8311  C C    . SER A 1 9  ? 10.876  1.500   -0.507  1.00 0.40 ? 9   SER A C    7  
ATOM   8312  O O    . SER A 1 9  ? 11.058  1.331   -1.716  1.00 0.46 ? 9   SER A O    7  
ATOM   8313  C CB   . SER A 1 9  ? 9.958   3.588   0.560   1.00 0.49 ? 9   SER A CB   7  
ATOM   8314  O OG   . SER A 1 9  ? 10.393  3.503   1.905   1.00 1.22 ? 9   SER A OG   7  
ATOM   8315  H H    . SER A 1 9  ? 8.803   1.776   1.898   1.00 0.39 ? 9   SER A H    7  
ATOM   8316  H HA   . SER A 1 9  ? 8.944   2.337   -0.842  1.00 0.45 ? 9   SER A HA   7  
ATOM   8317  H HB2  . SER A 1 9  ? 10.746  4.031   -0.030  1.00 1.05 ? 9   SER A HB2  7  
ATOM   8318  H HB3  . SER A 1 9  ? 9.081   4.216   0.520   1.00 1.19 ? 9   SER A HB3  7  
ATOM   8319  H HG   . SER A 1 9  ? 10.391  4.385   2.293   1.00 1.36 ? 9   SER A HG   7  
ATOM   8320  N N    . SER A 1 10 ? 11.718  1.055   0.415   1.00 0.39 ? 10  SER A N    7  
ATOM   8321  C CA   . SER A 1 10 ? 12.961  0.380   0.054   1.00 0.43 ? 10  SER A CA   7  
ATOM   8322  C C    . SER A 1 10 ? 12.696  -0.887  -0.753  1.00 0.42 ? 10  SER A C    7  
ATOM   8323  O O    . SER A 1 10 ? 13.487  -1.256  -1.621  1.00 0.56 ? 10  SER A O    7  
ATOM   8324  C CB   . SER A 1 10 ? 13.768  0.053   1.309   1.00 0.52 ? 10  SER A CB   7  
ATOM   8325  O OG   . SER A 1 10 ? 14.030  1.230   2.055   1.00 1.17 ? 10  SER A OG   7  
ATOM   8326  H H    . SER A 1 10 ? 11.504  1.190   1.367   1.00 0.41 ? 10  SER A H    7  
ATOM   8327  H HA   . SER A 1 10 ? 13.533  1.062   -0.557  1.00 0.47 ? 10  SER A HA   7  
ATOM   8328  H HB2  . SER A 1 10 ? 13.211  -0.636  1.927   1.00 0.93 ? 10  SER A HB2  7  
ATOM   8329  H HB3  . SER A 1 10 ? 14.710  -0.397  1.025   1.00 1.00 ? 10  SER A HB3  7  
ATOM   8330  H HG   . SER A 1 10 ? 13.603  1.983   1.622   1.00 1.54 ? 10  SER A HG   7  
ATOM   8331  N N    . ALA A 1 11 ? 11.574  -1.540  -0.481  1.00 0.37 ? 11  ALA A N    7  
ATOM   8332  C CA   . ALA A 1 11 ? 11.215  -2.759  -1.186  1.00 0.41 ? 11  ALA A CA   7  
ATOM   8333  C C    . ALA A 1 11 ? 10.735  -2.458  -2.603  1.00 0.37 ? 11  ALA A C    7  
ATOM   8334  O O    . ALA A 1 11 ? 11.224  -3.045  -3.569  1.00 0.42 ? 11  ALA A O    7  
ATOM   8335  C CB   . ALA A 1 11 ? 10.147  -3.521  -0.419  1.00 0.47 ? 11  ALA A CB   7  
ATOM   8336  H H    . ALA A 1 11 ? 10.972  -1.194  0.216   1.00 0.41 ? 11  ALA A H    7  
ATOM   8337  H HA   . ALA A 1 11 ? 12.096  -3.382  -1.241  1.00 0.47 ? 11  ALA A HA   7  
ATOM   8338  H HB1  . ALA A 1 11 ? 9.249   -2.925  -0.366  1.00 0.52 ? 11  ALA A HB1  7  
ATOM   8339  H HB2  . ALA A 1 11 ? 10.500  -3.729  0.580   1.00 0.58 ? 11  ALA A HB2  7  
ATOM   8340  H HB3  . ALA A 1 11 ? 9.935   -4.450  -0.926  1.00 0.58 ? 11  ALA A HB3  7  
ATOM   8341  N N    . CYS A 1 12 ? 9.795   -1.524  -2.729  1.00 0.34 ? 12  CYS A N    7  
ATOM   8342  C CA   . CYS A 1 12 ? 9.245   -1.168  -4.033  1.00 0.37 ? 12  CYS A CA   7  
ATOM   8343  C C    . CYS A 1 12 ? 10.322  -0.616  -4.966  1.00 0.39 ? 12  CYS A C    7  
ATOM   8344  O O    . CYS A 1 12 ? 10.218  -0.740  -6.185  1.00 0.44 ? 12  CYS A O    7  
ATOM   8345  C CB   . CYS A 1 12 ? 8.096   -0.165  -3.889  1.00 0.42 ? 12  CYS A CB   7  
ATOM   8346  S SG   . CYS A 1 12 ? 8.567   1.443   -3.216  1.00 0.66 ? 12  CYS A SG   7  
ATOM   8347  H H    . CYS A 1 12 ? 9.457   -1.069  -1.922  1.00 0.35 ? 12  CYS A H    7  
ATOM   8348  H HA   . CYS A 1 12 ? 8.852   -2.073  -4.472  1.00 0.43 ? 12  CYS A HA   7  
ATOM   8349  H HB2  . CYS A 1 12 ? 7.657   0.009   -4.862  1.00 0.63 ? 12  CYS A HB2  7  
ATOM   8350  H HB3  . CYS A 1 12 ? 7.346   -0.583  -3.234  1.00 0.63 ? 12  CYS A HB3  7  
ATOM   8351  H HG   . CYS A 1 12 ? 9.643   1.277   -2.456  1.00 1.11 ? 12  CYS A HG   7  
ATOM   8352  N N    . LYS A 1 13 ? 11.368  -0.031  -4.395  1.00 0.41 ? 13  LYS A N    7  
ATOM   8353  C CA   . LYS A 1 13 ? 12.458  0.524   -5.192  1.00 0.49 ? 13  LYS A CA   7  
ATOM   8354  C C    . LYS A 1 13 ? 13.219  -0.579  -5.926  1.00 0.49 ? 13  LYS A C    7  
ATOM   8355  O O    . LYS A 1 13 ? 13.899  -0.321  -6.917  1.00 0.58 ? 13  LYS A O    7  
ATOM   8356  C CB   . LYS A 1 13 ? 13.423  1.329   -4.314  1.00 0.63 ? 13  LYS A CB   7  
ATOM   8357  C CG   . LYS A 1 13 ? 12.828  2.614   -3.758  1.00 0.96 ? 13  LYS A CG   7  
ATOM   8358  C CD   . LYS A 1 13 ? 12.646  3.665   -4.839  1.00 1.06 ? 13  LYS A CD   7  
ATOM   8359  C CE   . LYS A 1 13 ? 11.714  4.773   -4.380  1.00 1.40 ? 13  LYS A CE   7  
ATOM   8360  N NZ   . LYS A 1 13 ? 12.351  5.665   -3.375  1.00 1.34 ? 13  LYS A NZ   7  
ATOM   8361  H H    . LYS A 1 13 ? 11.404  0.037   -3.416  1.00 0.43 ? 13  LYS A H    7  
ATOM   8362  H HA   . LYS A 1 13 ? 12.021  1.184   -5.926  1.00 0.52 ? 13  LYS A HA   7  
ATOM   8363  H HB2  . LYS A 1 13 ? 13.733  0.714   -3.482  1.00 0.79 ? 13  LYS A HB2  7  
ATOM   8364  H HB3  . LYS A 1 13 ? 14.293  1.588   -4.900  1.00 0.85 ? 13  LYS A HB3  7  
ATOM   8365  H HG2  . LYS A 1 13 ? 11.865  2.394   -3.321  1.00 1.66 ? 13  LYS A HG2  7  
ATOM   8366  H HG3  . LYS A 1 13 ? 13.489  3.003   -2.997  1.00 1.57 ? 13  LYS A HG3  7  
ATOM   8367  H HD2  . LYS A 1 13 ? 13.609  4.093   -5.078  1.00 1.45 ? 13  LYS A HD2  7  
ATOM   8368  H HD3  . LYS A 1 13 ? 12.231  3.197   -5.720  1.00 1.68 ? 13  LYS A HD3  7  
ATOM   8369  H HE2  . LYS A 1 13 ? 11.427  5.362   -5.238  1.00 1.92 ? 13  LYS A HE2  7  
ATOM   8370  H HE3  . LYS A 1 13 ? 10.833  4.325   -3.943  1.00 1.72 ? 13  LYS A HE3  7  
ATOM   8371  H HZ1  . LYS A 1 13 ? 11.741  6.486   -3.185  1.00 1.65 ? 13  LYS A HZ1  7  
ATOM   8372  H HZ2  . LYS A 1 13 ? 13.261  6.013   -3.730  1.00 1.65 ? 13  LYS A HZ2  7  
ATOM   8373  H HZ3  . LYS A 1 13 ? 12.512  5.157   -2.482  1.00 1.73 ? 13  LYS A HZ3  7  
ATOM   8374  N N    . THR A 1 14 ? 13.101  -1.806  -5.438  1.00 0.49 ? 14  THR A N    7  
ATOM   8375  C CA   . THR A 1 14 ? 13.781  -2.935  -6.050  1.00 0.56 ? 14  THR A CA   7  
ATOM   8376  C C    . THR A 1 14 ? 12.837  -3.750  -6.941  1.00 0.54 ? 14  THR A C    7  
ATOM   8377  O O    . THR A 1 14 ? 13.281  -4.443  -7.858  1.00 0.72 ? 14  THR A O    7  
ATOM   8378  C CB   . THR A 1 14 ? 14.386  -3.850  -4.971  1.00 0.65 ? 14  THR A CB   7  
ATOM   8379  O OG1  . THR A 1 14 ? 14.836  -3.055  -3.862  1.00 0.77 ? 14  THR A OG1  7  
ATOM   8380  C CG2  . THR A 1 14 ? 15.551  -4.659  -5.531  1.00 0.83 ? 14  THR A CG2  7  
ATOM   8381  H H    . THR A 1 14 ? 12.558  -1.955  -4.633  1.00 0.48 ? 14  THR A H    7  
ATOM   8382  H HA   . THR A 1 14 ? 14.586  -2.549  -6.657  1.00 0.63 ? 14  THR A HA   7  
ATOM   8383  H HB   . THR A 1 14 ? 13.623  -4.532  -4.629  1.00 0.82 ? 14  THR A HB   7  
ATOM   8384  H HG1  . THR A 1 14 ? 15.350  -2.305  -4.189  1.00 0.99 ? 14  THR A HG1  7  
ATOM   8385  H HG21 . THR A 1 14 ? 16.286  -3.989  -5.952  1.00 1.01 ? 14  THR A HG21 7  
ATOM   8386  H HG22 . THR A 1 14 ? 15.188  -5.323  -6.303  1.00 1.11 ? 14  THR A HG22 7  
ATOM   8387  H HG23 . THR A 1 14 ? 16.002  -5.240  -4.740  1.00 1.00 ? 14  THR A HG23 7  
ATOM   8388  N N    . TYR A 1 15 ? 11.537  -3.670  -6.675  1.00 0.49 ? 15  TYR A N    7  
ATOM   8389  C CA   . TYR A 1 15 ? 10.557  -4.414  -7.464  1.00 0.54 ? 15  TYR A CA   7  
ATOM   8390  C C    . TYR A 1 15 ? 9.971   -3.557  -8.583  1.00 0.56 ? 15  TYR A C    7  
ATOM   8391  O O    . TYR A 1 15 ? 9.574   -4.070  -9.632  1.00 0.72 ? 15  TYR A O    7  
ATOM   8392  C CB   . TYR A 1 15 ? 9.443   -4.955  -6.564  1.00 0.55 ? 15  TYR A CB   7  
ATOM   8393  C CG   . TYR A 1 15 ? 9.950   -5.892  -5.484  1.00 0.60 ? 15  TYR A CG   7  
ATOM   8394  C CD1  . TYR A 1 15 ? 9.728   -5.623  -4.139  1.00 0.67 ? 15  TYR A CD1  7  
ATOM   8395  C CD2  . TYR A 1 15 ? 10.666  -7.037  -5.814  1.00 0.80 ? 15  TYR A CD2  7  
ATOM   8396  C CE1  . TYR A 1 15 ? 10.204  -6.468  -3.156  1.00 0.78 ? 15  TYR A CE1  7  
ATOM   8397  C CE2  . TYR A 1 15 ? 11.142  -7.889  -4.835  1.00 0.91 ? 15  TYR A CE2  7  
ATOM   8398  C CZ   . TYR A 1 15 ? 10.910  -7.599  -3.509  1.00 0.84 ? 15  TYR A CZ   7  
ATOM   8399  O OH   . TYR A 1 15 ? 11.392  -8.439  -2.530  1.00 1.00 ? 15  TYR A OH   7  
ATOM   8400  H H    . TYR A 1 15 ? 11.231  -3.113  -5.929  1.00 0.54 ? 15  TYR A H    7  
ATOM   8401  H HA   . TYR A 1 15 ? 11.074  -5.250  -7.913  1.00 0.62 ? 15  TYR A HA   7  
ATOM   8402  H HB2  . TYR A 1 15 ? 8.943   -4.128  -6.081  1.00 0.54 ? 15  TYR A HB2  7  
ATOM   8403  H HB3  . TYR A 1 15 ? 8.730   -5.497  -7.168  1.00 0.63 ? 15  TYR A HB3  7  
ATOM   8404  H HD1  . TYR A 1 15 ? 9.172   -4.736  -3.865  1.00 0.79 ? 15  TYR A HD1  7  
ATOM   8405  H HD2  . TYR A 1 15 ? 10.848  -7.262  -6.855  1.00 0.96 ? 15  TYR A HD2  7  
ATOM   8406  H HE1  . TYR A 1 15 ? 10.021  -6.243  -2.115  1.00 0.93 ? 15  TYR A HE1  7  
ATOM   8407  H HE2  . TYR A 1 15 ? 11.693  -8.772  -5.111  1.00 1.14 ? 15  TYR A HE2  7  
ATOM   8408  H HH   . TYR A 1 15 ? 12.200  -8.862  -2.842  1.00 1.22 ? 15  TYR A HH   7  
ATOM   8409  N N    . CYS A 1 16 ? 9.914   -2.256  -8.359  1.00 0.50 ? 16  CYS A N    7  
ATOM   8410  C CA   . CYS A 1 16 ? 9.386   -1.333  -9.352  1.00 0.55 ? 16  CYS A CA   7  
ATOM   8411  C C    . CYS A 1 16 ? 10.489  -0.403  -9.846  1.00 0.57 ? 16  CYS A C    7  
ATOM   8412  O O    . CYS A 1 16 ? 10.745  -0.312  -11.046 1.00 0.88 ? 16  CYS A O    7  
ATOM   8413  C CB   . CYS A 1 16 ? 8.225   -0.523  -8.767  1.00 0.54 ? 16  CYS A CB   7  
ATOM   8414  S SG   . CYS A 1 16 ? 6.897   -1.536  -8.069  1.00 0.67 ? 16  CYS A SG   7  
ATOM   8415  H H    . CYS A 1 16 ? 10.230  -1.902  -7.500  1.00 0.50 ? 16  CYS A H    7  
ATOM   8416  H HA   . CYS A 1 16 ? 9.023   -1.915  -10.185 1.00 0.64 ? 16  CYS A HA   7  
ATOM   8417  H HB2  . CYS A 1 16 ? 8.601   0.111   -7.977  1.00 0.56 ? 16  CYS A HB2  7  
ATOM   8418  H HB3  . CYS A 1 16 ? 7.797   0.095   -9.542  1.00 0.63 ? 16  CYS A HB3  7  
ATOM   8419  H HG   . CYS A 1 16 ? 6.433   -0.909  -6.995  1.00 1.15 ? 16  CYS A HG   7  
ATOM   8420  N N    . GLY A 1 17 ? 11.148  0.278   -8.918  1.00 0.49 ? 17  GLY A N    7  
ATOM   8421  C CA   . GLY A 1 17 ? 12.222  1.180   -9.286  1.00 0.56 ? 17  GLY A CA   7  
ATOM   8422  C C    . GLY A 1 17 ? 11.758  2.616   -9.330  1.00 0.52 ? 17  GLY A C    7  
ATOM   8423  O O    . GLY A 1 17 ? 11.538  3.232   -8.289  1.00 0.66 ? 17  GLY A O    7  
ATOM   8424  H H    . GLY A 1 17 ? 10.896  0.179   -7.973  1.00 0.62 ? 17  GLY A H    7  
ATOM   8425  H HA2  . GLY A 1 17 ? 13.017  1.090   -8.561  1.00 0.65 ? 17  GLY A HA2  7  
ATOM   8426  H HA3  . GLY A 1 17 ? 12.598  0.902   -10.259 1.00 0.63 ? 17  GLY A HA3  7  
ATOM   8427  N N    . LYS A 1 18 ? 11.586  3.147   -10.532 1.00 0.50 ? 18  LYS A N    7  
ATOM   8428  C CA   . LYS A 1 18 ? 11.138  4.525   -10.692 1.00 0.56 ? 18  LYS A CA   7  
ATOM   8429  C C    . LYS A 1 18 ? 9.624   4.584   -10.862 1.00 0.53 ? 18  LYS A C    7  
ATOM   8430  O O    . LYS A 1 18 ? 9.037   5.663   -10.971 1.00 0.62 ? 18  LYS A O    7  
ATOM   8431  C CB   . LYS A 1 18 ? 11.839  5.202   -11.876 1.00 0.70 ? 18  LYS A CB   7  
ATOM   8432  C CG   . LYS A 1 18 ? 12.074  4.295   -13.079 1.00 0.81 ? 18  LYS A CG   7  
ATOM   8433  C CD   . LYS A 1 18 ? 13.543  3.920   -13.227 1.00 1.11 ? 18  LYS A CD   7  
ATOM   8434  C CE   . LYS A 1 18 ? 14.398  5.129   -13.589 1.00 1.46 ? 18  LYS A CE   7  
ATOM   8435  N NZ   . LYS A 1 18 ? 15.851  4.815   -13.572 1.00 1.82 ? 18  LYS A NZ   7  
ATOM   8436  H H    . LYS A 1 18 ? 11.763  2.603   -11.329 1.00 0.58 ? 18  LYS A H    7  
ATOM   8437  H HA   . LYS A 1 18 ? 11.400  5.054   -9.787  1.00 0.60 ? 18  LYS A HA   7  
ATOM   8438  H HB2  . LYS A 1 18 ? 11.235  6.035   -12.202 1.00 0.87 ? 18  LYS A HB2  7  
ATOM   8439  H HB3  . LYS A 1 18 ? 12.796  5.575   -11.542 1.00 0.79 ? 18  LYS A HB3  7  
ATOM   8440  H HG2  . LYS A 1 18 ? 11.495  3.393   -12.956 1.00 0.90 ? 18  LYS A HG2  7  
ATOM   8441  H HG3  . LYS A 1 18 ? 11.755  4.810   -13.972 1.00 1.06 ? 18  LYS A HG3  7  
ATOM   8442  H HD2  . LYS A 1 18 ? 13.899  3.506   -12.295 1.00 1.33 ? 18  LYS A HD2  7  
ATOM   8443  H HD3  . LYS A 1 18 ? 13.633  3.180   -14.009 1.00 1.44 ? 18  LYS A HD3  7  
ATOM   8444  H HE2  . LYS A 1 18 ? 14.121  5.466   -14.578 1.00 1.85 ? 18  LYS A HE2  7  
ATOM   8445  H HE3  . LYS A 1 18 ? 14.202  5.917   -12.876 1.00 1.67 ? 18  LYS A HE3  7  
ATOM   8446  H HZ1  . LYS A 1 18 ? 16.150  4.554   -12.610 1.00 2.13 ? 18  LYS A HZ1  7  
ATOM   8447  H HZ2  . LYS A 1 18 ? 16.401  5.645   -13.877 1.00 2.19 ? 18  LYS A HZ2  7  
ATOM   8448  H HZ3  . LYS A 1 18 ? 16.056  4.022   -14.213 1.00 2.14 ? 18  LYS A HZ3  7  
ATOM   8449  N N    . THR A 1 19 ? 9.002   3.416   -10.892 1.00 0.49 ? 19  THR A N    7  
ATOM   8450  C CA   . THR A 1 19 ? 7.559   3.317   -11.028 1.00 0.52 ? 19  THR A CA   7  
ATOM   8451  C C    . THR A 1 19 ? 6.905   3.183   -9.658  1.00 0.48 ? 19  THR A C    7  
ATOM   8452  O O    . THR A 1 19 ? 5.680   3.139   -9.542  1.00 0.62 ? 19  THR A O    7  
ATOM   8453  C CB   . THR A 1 19 ? 7.166   2.105   -11.892 1.00 0.62 ? 19  THR A CB   7  
ATOM   8454  O OG1  . THR A 1 19 ? 8.175   1.092   -11.787 1.00 0.83 ? 19  THR A OG1  7  
ATOM   8455  C CG2  . THR A 1 19 ? 6.992   2.508   -13.346 1.00 0.91 ? 19  THR A CG2  7  
ATOM   8456  H H    . THR A 1 19 ? 9.527   2.593   -10.833 1.00 0.49 ? 19  THR A H    7  
ATOM   8457  H HA   . THR A 1 19 ? 7.201   4.213   -11.507 1.00 0.60 ? 19  THR A HA   7  
ATOM   8458  H HB   . THR A 1 19 ? 6.230   1.710   -11.527 1.00 0.72 ? 19  THR A HB   7  
ATOM   8459  H HG1  . THR A 1 19 ? 7.859   0.278   -12.200 1.00 1.10 ? 19  THR A HG1  7  
ATOM   8460  H HG21 . THR A 1 19 ? 6.787   1.631   -13.940 1.00 1.10 ? 19  THR A HG21 7  
ATOM   8461  H HG22 . THR A 1 19 ? 7.897   2.982   -13.700 1.00 1.23 ? 19  THR A HG22 7  
ATOM   8462  H HG23 . THR A 1 19 ? 6.168   3.199   -13.430 1.00 1.17 ? 19  THR A HG23 7  
ATOM   8463  N N    . SER A 1 20 ? 7.738   3.123   -8.625  1.00 0.42 ? 20  SER A N    7  
ATOM   8464  C CA   . SER A 1 20 ? 7.270   2.984   -7.254  1.00 0.42 ? 20  SER A CA   7  
ATOM   8465  C C    . SER A 1 20 ? 6.444   4.198   -6.830  1.00 0.41 ? 20  SER A C    7  
ATOM   8466  O O    . SER A 1 20 ? 6.712   5.322   -7.266  1.00 0.46 ? 20  SER A O    7  
ATOM   8467  C CB   . SER A 1 20 ? 8.473   2.814   -6.326  1.00 0.46 ? 20  SER A CB   7  
ATOM   8468  O OG   . SER A 1 20 ? 9.510   2.099   -6.976  1.00 0.97 ? 20  SER A OG   7  
ATOM   8469  H H    . SER A 1 20 ? 8.701   3.178   -8.791  1.00 0.49 ? 20  SER A H    7  
ATOM   8470  H HA   . SER A 1 20 ? 6.653   2.101   -7.195  1.00 0.48 ? 20  SER A HA   7  
ATOM   8471  H HB2  . SER A 1 20 ? 8.846   3.785   -6.037  1.00 0.70 ? 20  SER A HB2  7  
ATOM   8472  H HB3  . SER A 1 20 ? 8.172   2.265   -5.444  1.00 0.81 ? 20  SER A HB3  7  
ATOM   8473  H HG   . SER A 1 20 ? 10.198  2.718   -7.257  1.00 1.21 ? 20  SER A HG   7  
ATOM   8474  N N    . PRO A 1 21 ? 5.421   3.987   -5.988  1.00 0.43 ? 21  PRO A N    7  
ATOM   8475  C CA   . PRO A 1 21 ? 4.563   5.067   -5.502  1.00 0.49 ? 21  PRO A CA   7  
ATOM   8476  C C    . PRO A 1 21 ? 5.317   6.013   -4.573  1.00 0.42 ? 21  PRO A C    7  
ATOM   8477  O O    . PRO A 1 21 ? 6.179   5.584   -3.803  1.00 0.46 ? 21  PRO A O    7  
ATOM   8478  C CB   . PRO A 1 21 ? 3.452   4.333   -4.743  1.00 0.62 ? 21  PRO A CB   7  
ATOM   8479  C CG   . PRO A 1 21 ? 4.038   3.019   -4.365  1.00 0.63 ? 21  PRO A CG   7  
ATOM   8480  C CD   . PRO A 1 21 ? 5.024   2.675   -5.445  1.00 0.50 ? 21  PRO A CD   7  
ATOM   8481  H HA   . PRO A 1 21 ? 4.138   5.632   -6.319  1.00 0.57 ? 21  PRO A HA   7  
ATOM   8482  H HB2  . PRO A 1 21 ? 3.170   4.900   -3.864  1.00 0.69 ? 21  PRO A HB2  7  
ATOM   8483  H HB3  . PRO A 1 21 ? 2.597   4.187   -5.384  1.00 0.76 ? 21  PRO A HB3  7  
ATOM   8484  H HG2  . PRO A 1 21 ? 4.537   3.103   -3.410  1.00 0.76 ? 21  PRO A HG2  7  
ATOM   8485  H HG3  . PRO A 1 21 ? 3.264   2.269   -4.322  1.00 0.81 ? 21  PRO A HG3  7  
ATOM   8486  H HD2  . PRO A 1 21 ? 5.877   2.158   -5.030  1.00 0.55 ? 21  PRO A HD2  7  
ATOM   8487  H HD3  . PRO A 1 21 ? 4.552   2.073   -6.209  1.00 0.57 ? 21  PRO A HD3  7  
ATOM   8488  N N    . SER A 1 22 ? 5.000   7.296   -4.664  1.00 0.43 ? 22  SER A N    7  
ATOM   8489  C CA   . SER A 1 22 ? 5.637   8.309   -3.837  1.00 0.43 ? 22  SER A CA   7  
ATOM   8490  C C    . SER A 1 22 ? 5.342   8.065   -2.354  1.00 0.38 ? 22  SER A C    7  
ATOM   8491  O O    . SER A 1 22 ? 4.227   7.690   -1.989  1.00 0.39 ? 22  SER A O    7  
ATOM   8492  C CB   . SER A 1 22 ? 5.142   9.688   -4.265  1.00 0.56 ? 22  SER A CB   7  
ATOM   8493  O OG   . SER A 1 22 ? 4.701   9.662   -5.615  1.00 1.11 ? 22  SER A OG   7  
ATOM   8494  H H    . SER A 1 22 ? 4.322   7.575   -5.313  1.00 0.53 ? 22  SER A H    7  
ATOM   8495  H HA   . SER A 1 22 ? 6.702   8.251   -3.999  1.00 0.47 ? 22  SER A HA   7  
ATOM   8496  H HB2  . SER A 1 22 ? 4.322   9.990   -3.632  1.00 0.96 ? 22  SER A HB2  7  
ATOM   8497  H HB3  . SER A 1 22 ? 5.947   10.400  -4.180  1.00 0.81 ? 22  SER A HB3  7  
ATOM   8498  H HG   . SER A 1 22 ? 5.458   9.797   -6.201  1.00 1.48 ? 22  SER A HG   7  
ATOM   8499  N N    . LYS A 1 23 ? 6.346   8.283   -1.514  1.00 0.44 ? 23  LYS A N    7  
ATOM   8500  C CA   . LYS A 1 23 ? 6.223   8.083   -0.070  1.00 0.50 ? 23  LYS A CA   7  
ATOM   8501  C C    . LYS A 1 23 ? 5.067   8.886   0.512   1.00 0.42 ? 23  LYS A C    7  
ATOM   8502  O O    . LYS A 1 23 ? 4.246   8.357   1.263   1.00 0.42 ? 23  LYS A O    7  
ATOM   8503  C CB   . LYS A 1 23 ? 7.531   8.485   0.612   1.00 0.69 ? 23  LYS A CB   7  
ATOM   8504  C CG   . LYS A 1 23 ? 7.617   8.128   2.090   1.00 0.63 ? 23  LYS A CG   7  
ATOM   8505  C CD   . LYS A 1 23 ? 6.943   9.161   2.990   1.00 1.12 ? 23  LYS A CD   7  
ATOM   8506  C CE   . LYS A 1 23 ? 7.473   10.569  2.754   1.00 1.17 ? 23  LYS A CE   7  
ATOM   8507  N NZ   . LYS A 1 23 ? 8.945   10.592  2.594   1.00 1.60 ? 23  LYS A NZ   7  
ATOM   8508  H H    . LYS A 1 23 ? 7.211   8.583   -1.877  1.00 0.50 ? 23  LYS A H    7  
ATOM   8509  H HA   . LYS A 1 23 ? 6.044   7.033   0.106   1.00 0.56 ? 23  LYS A HA   7  
ATOM   8510  H HB2  . LYS A 1 23 ? 8.347   7.996   0.103   1.00 1.00 ? 23  LYS A HB2  7  
ATOM   8511  H HB3  . LYS A 1 23 ? 7.656   9.553   0.515   1.00 1.02 ? 23  LYS A HB3  7  
ATOM   8512  H HG2  . LYS A 1 23 ? 7.137   7.174   2.245   1.00 0.92 ? 23  LYS A HG2  7  
ATOM   8513  H HG3  . LYS A 1 23 ? 8.657   8.054   2.367   1.00 0.87 ? 23  LYS A HG3  7  
ATOM   8514  H HD2  . LYS A 1 23 ? 5.881   9.152   2.795   1.00 1.72 ? 23  LYS A HD2  7  
ATOM   8515  H HD3  . LYS A 1 23 ? 7.122   8.890   4.020   1.00 1.84 ? 23  LYS A HD3  7  
ATOM   8516  H HE2  . LYS A 1 23 ? 7.017   10.969  1.861   1.00 1.51 ? 23  LYS A HE2  7  
ATOM   8517  H HE3  . LYS A 1 23 ? 7.203   11.184  3.599   1.00 1.35 ? 23  LYS A HE3  7  
ATOM   8518  H HZ1  . LYS A 1 23 ? 9.360   11.340  3.185   1.00 2.03 ? 23  LYS A HZ1  7  
ATOM   8519  H HZ2  . LYS A 1 23 ? 9.197   10.778  1.602   1.00 1.91 ? 23  LYS A HZ2  7  
ATOM   8520  H HZ3  . LYS A 1 23 ? 9.351   9.680   2.878   1.00 2.03 ? 23  LYS A HZ3  7  
ATOM   8521  N N    . LYS A 1 24 ? 5.009   10.164  0.161   1.00 0.41 ? 24  LYS A N    7  
ATOM   8522  C CA   . LYS A 1 24 ? 3.965   11.053  0.657   1.00 0.45 ? 24  LYS A CA   7  
ATOM   8523  C C    . LYS A 1 24 ? 2.584   10.605  0.175   1.00 0.40 ? 24  LYS A C    7  
ATOM   8524  O O    . LYS A 1 24 ? 1.561   10.993  0.737   1.00 0.48 ? 24  LYS A O    7  
ATOM   8525  C CB   . LYS A 1 24 ? 4.268   12.494  0.240   1.00 0.56 ? 24  LYS A CB   7  
ATOM   8526  C CG   . LYS A 1 24 ? 5.584   13.013  0.812   1.00 0.83 ? 24  LYS A CG   7  
ATOM   8527  C CD   . LYS A 1 24 ? 5.820   14.473  0.472   1.00 1.00 ? 24  LYS A CD   7  
ATOM   8528  C CE   . LYS A 1 24 ? 7.108   14.673  -0.317  1.00 1.56 ? 24  LYS A CE   7  
ATOM   8529  N NZ   . LYS A 1 24 ? 8.325   14.377  0.491   1.00 2.04 ? 24  LYS A NZ   7  
ATOM   8530  H H    . LYS A 1 24 ? 5.692   10.522  -0.450  1.00 0.44 ? 24  LYS A H    7  
ATOM   8531  H HA   . LYS A 1 24 ? 3.979   10.997  1.736   1.00 0.51 ? 24  LYS A HA   7  
ATOM   8532  H HB2  . LYS A 1 24 ? 4.321   12.543  -0.838  1.00 0.63 ? 24  LYS A HB2  7  
ATOM   8533  H HB3  . LYS A 1 24 ? 3.469   13.134  0.584   1.00 0.77 ? 24  LYS A HB3  7  
ATOM   8534  H HG2  . LYS A 1 24 ? 5.563   12.908  1.885   1.00 1.37 ? 24  LYS A HG2  7  
ATOM   8535  H HG3  . LYS A 1 24 ? 6.396   12.425  0.410   1.00 1.33 ? 24  LYS A HG3  7  
ATOM   8536  H HD2  . LYS A 1 24 ? 4.991   14.833  -0.116  1.00 1.50 ? 24  LYS A HD2  7  
ATOM   8537  H HD3  . LYS A 1 24 ? 5.885   15.039  1.388   1.00 1.29 ? 24  LYS A HD3  7  
ATOM   8538  H HE2  . LYS A 1 24 ? 7.093   14.019  -1.175  1.00 1.84 ? 24  LYS A HE2  7  
ATOM   8539  H HE3  . LYS A 1 24 ? 7.150   15.698  -0.651  1.00 2.19 ? 24  LYS A HE3  7  
ATOM   8540  H HZ1  . LYS A 1 24 ? 8.327   14.938  1.364   1.00 2.22 ? 24  LYS A HZ1  7  
ATOM   8541  H HZ2  . LYS A 1 24 ? 9.183   14.607  -0.053  1.00 2.45 ? 24  LYS A HZ2  7  
ATOM   8542  H HZ3  . LYS A 1 24 ? 8.356   13.367  0.739   1.00 2.55 ? 24  LYS A HZ3  7  
ATOM   8543  N N    . GLU A 1 25 ? 2.563   9.774   -0.860  1.00 0.34 ? 25  GLU A N    7  
ATOM   8544  C CA   . GLU A 1 25 ? 1.317   9.247   -1.382  1.00 0.37 ? 25  GLU A CA   7  
ATOM   8545  C C    . GLU A 1 25 ? 0.934   8.001   -0.587  1.00 0.31 ? 25  GLU A C    7  
ATOM   8546  O O    . GLU A 1 25 ? -0.227  7.820   -0.206  1.00 0.34 ? 25  GLU A O    7  
ATOM   8547  C CB   . GLU A 1 25 ? 1.452   8.916   -2.869  1.00 0.45 ? 25  GLU A CB   7  
ATOM   8548  C CG   . GLU A 1 25 ? 0.163   8.421   -3.499  1.00 0.90 ? 25  GLU A CG   7  
ATOM   8549  C CD   . GLU A 1 25 ? 0.307   8.126   -4.975  1.00 1.00 ? 25  GLU A CD   7  
ATOM   8550  O OE1  . GLU A 1 25 ? 0.674   9.046   -5.735  1.00 1.30 ? 25  GLU A OE1  7  
ATOM   8551  O OE2  . GLU A 1 25 ? 0.026   6.979   -5.391  1.00 1.58 ? 25  GLU A OE2  7  
ATOM   8552  H H    . GLU A 1 25 ? 3.410   9.504   -1.276  1.00 0.36 ? 25  GLU A H    7  
ATOM   8553  H HA   . GLU A 1 25 ? 0.554   9.999   -1.249  1.00 0.42 ? 25  GLU A HA   7  
ATOM   8554  H HB2  . GLU A 1 25 ? 1.769   9.804   -3.396  1.00 0.97 ? 25  GLU A HB2  7  
ATOM   8555  H HB3  . GLU A 1 25 ? 2.205   8.148   -2.988  1.00 0.87 ? 25  GLU A HB3  7  
ATOM   8556  H HG2  . GLU A 1 25 ? -0.146  7.518   -2.995  1.00 1.42 ? 25  GLU A HG2  7  
ATOM   8557  H HG3  . GLU A 1 25 ? -0.598  9.179   -3.371  1.00 1.47 ? 25  GLU A HG3  7  
ATOM   8558  N N    . ILE A 1 26 ? 1.930   7.156   -0.321  1.00 0.29 ? 26  ILE A N    7  
ATOM   8559  C CA   . ILE A 1 26 ? 1.720   5.928   0.441   1.00 0.29 ? 26  ILE A CA   7  
ATOM   8560  C C    . ILE A 1 26 ? 1.193   6.255   1.834   1.00 0.27 ? 26  ILE A C    7  
ATOM   8561  O O    . ILE A 1 26 ? 0.287   5.589   2.337   1.00 0.28 ? 26  ILE A O    7  
ATOM   8562  C CB   . ILE A 1 26 ? 3.024   5.105   0.574   1.00 0.33 ? 26  ILE A CB   7  
ATOM   8563  C CG1  . ILE A 1 26 ? 3.636   4.836   -0.802  1.00 0.36 ? 26  ILE A CG1  7  
ATOM   8564  C CG2  . ILE A 1 26 ? 2.754   3.790   1.297   1.00 0.41 ? 26  ILE A CG2  7  
ATOM   8565  C CD1  . ILE A 1 26 ? 5.028   4.238   -0.747  1.00 0.45 ? 26  ILE A CD1  7  
ATOM   8566  H H    . ILE A 1 26 ? 2.832   7.361   -0.653  1.00 0.30 ? 26  ILE A H    7  
ATOM   8567  H HA   . ILE A 1 26 ? 0.989   5.332   -0.082  1.00 0.32 ? 26  ILE A HA   7  
ATOM   8568  H HB   . ILE A 1 26 ? 3.723   5.676   1.166   1.00 0.34 ? 26  ILE A HB   7  
ATOM   8569  H HG12 . ILE A 1 26 ? 3.001   4.150   -1.341  1.00 0.44 ? 26  ILE A HG12 7  
ATOM   8570  H HG13 . ILE A 1 26 ? 3.695   5.768   -1.349  1.00 0.35 ? 26  ILE A HG13 7  
ATOM   8571  H HG21 . ILE A 1 26 ? 2.308   3.992   2.257   1.00 0.52 ? 26  ILE A HG21 7  
ATOM   8572  H HG22 . ILE A 1 26 ? 3.682   3.257   1.436   1.00 0.53 ? 26  ILE A HG22 7  
ATOM   8573  H HG23 . ILE A 1 26 ? 2.078   3.187   0.707   1.00 0.54 ? 26  ILE A HG23 7  
ATOM   8574  H HD11 . ILE A 1 26 ? 4.989   3.278   -0.254  1.00 0.90 ? 26  ILE A HD11 7  
ATOM   8575  H HD12 . ILE A 1 26 ? 5.681   4.898   -0.195  1.00 0.91 ? 26  ILE A HD12 7  
ATOM   8576  H HD13 . ILE A 1 26 ? 5.407   4.111   -1.749  1.00 0.92 ? 26  ILE A HD13 7  
ATOM   8577  N N    . GLY A 1 27 ? 1.759   7.295   2.442   1.00 0.27 ? 27  GLY A N    7  
ATOM   8578  C CA   . GLY A 1 27 ? 1.338   7.712   3.771   1.00 0.29 ? 27  GLY A CA   7  
ATOM   8579  C C    . GLY A 1 27 ? -0.141  8.051   3.829   1.00 0.28 ? 27  GLY A C    7  
ATOM   8580  O O    . GLY A 1 27 ? -0.828  7.710   4.798   1.00 0.32 ? 27  GLY A O    7  
ATOM   8581  H H    . GLY A 1 27 ? 2.479   7.783   1.982   1.00 0.28 ? 27  GLY A H    7  
ATOM   8582  H HA2  . GLY A 1 27 ? 1.541   6.913   4.467   1.00 0.32 ? 27  GLY A HA2  7  
ATOM   8583  H HA3  . GLY A 1 27 ? 1.908   8.583   4.059   1.00 0.33 ? 27  GLY A HA3  7  
ATOM   8584  N N    . ALA A 1 28 ? -0.636  8.700   2.777   1.00 0.27 ? 28  ALA A N    7  
ATOM   8585  C CA   . ALA A 1 28 ? -2.042  9.078   2.698   1.00 0.30 ? 28  ALA A CA   7  
ATOM   8586  C C    . ALA A 1 28 ? -2.917  7.834   2.563   1.00 0.29 ? 28  ALA A C    7  
ATOM   8587  O O    . ALA A 1 28 ? -3.950  7.707   3.228   1.00 0.32 ? 28  ALA A O    7  
ATOM   8588  C CB   . ALA A 1 28 ? -2.275  10.031  1.531   1.00 0.35 ? 28  ALA A CB   7  
ATOM   8589  H H    . ALA A 1 28 ? -0.038  8.931   2.035   1.00 0.27 ? 28  ALA A H    7  
ATOM   8590  H HA   . ALA A 1 28 ? -2.302  9.593   3.613   1.00 0.34 ? 28  ALA A HA   7  
ATOM   8591  H HB1  . ALA A 1 28 ? -1.595  10.868  1.605   1.00 0.47 ? 28  ALA A HB1  7  
ATOM   8592  H HB2  . ALA A 1 28 ? -3.292  10.391  1.554   1.00 0.50 ? 28  ALA A HB2  7  
ATOM   8593  H HB3  . ALA A 1 28 ? -2.101  9.507   0.603   1.00 0.45 ? 28  ALA A HB3  7  
ATOM   8594  N N    . MET A 1 29 ? -2.487  6.905   1.713   1.00 0.27 ? 29  MET A N    7  
ATOM   8595  C CA   . MET A 1 29 ? -3.217  5.660   1.496   1.00 0.30 ? 29  MET A CA   7  
ATOM   8596  C C    . MET A 1 29 ? -3.237  4.839   2.783   1.00 0.28 ? 29  MET A C    7  
ATOM   8597  O O    . MET A 1 29 ? -4.249  4.236   3.141   1.00 0.31 ? 29  MET A O    7  
ATOM   8598  C CB   . MET A 1 29 ? -2.568  4.851   0.369   1.00 0.34 ? 29  MET A CB   7  
ATOM   8599  C CG   . MET A 1 29 ? -3.240  3.513   0.111   1.00 0.40 ? 29  MET A CG   7  
ATOM   8600  S SD   . MET A 1 29 ? -2.130  2.324   -0.668  1.00 0.49 ? 29  MET A SD   7  
ATOM   8601  C CE   . MET A 1 29 ? -0.971  2.003   0.661   1.00 0.52 ? 29  MET A CE   7  
ATOM   8602  H H    . MET A 1 29 ? -1.654  7.062   1.217   1.00 0.27 ? 29  MET A H    7  
ATOM   8603  H HA   . MET A 1 29 ? -4.232  5.906   1.222   1.00 0.34 ? 29  MET A HA   7  
ATOM   8604  H HB2  . MET A 1 29 ? -2.607  5.429   -0.544  1.00 0.38 ? 29  MET A HB2  7  
ATOM   8605  H HB3  . MET A 1 29 ? -1.534  4.665   0.623   1.00 0.34 ? 29  MET A HB3  7  
ATOM   8606  H HG2  . MET A 1 29 ? -3.576  3.109   1.053   1.00 0.40 ? 29  MET A HG2  7  
ATOM   8607  H HG3  . MET A 1 29 ? -4.091  3.671   -0.537  1.00 0.49 ? 29  MET A HG3  7  
ATOM   8608  H HE1  . MET A 1 29 ? -0.463  2.920   0.930   1.00 0.81 ? 29  MET A HE1  7  
ATOM   8609  H HE2  . MET A 1 29 ? -0.244  1.273   0.334   1.00 0.89 ? 29  MET A HE2  7  
ATOM   8610  H HE3  . MET A 1 29 ? -1.503  1.620   1.519   1.00 0.86 ? 29  MET A HE3  7  
ATOM   8611  N N    . LEU A 1 30 ? -2.109  4.842   3.479   1.00 0.29 ? 30  LEU A N    7  
ATOM   8612  C CA   . LEU A 1 30 ? -1.965  4.121   4.735   1.00 0.32 ? 30  LEU A CA   7  
ATOM   8613  C C    . LEU A 1 30 ? -2.958  4.643   5.770   1.00 0.30 ? 30  LEU A C    7  
ATOM   8614  O O    . LEU A 1 30 ? -3.511  3.878   6.561   1.00 0.33 ? 30  LEU A O    7  
ATOM   8615  C CB   . LEU A 1 30 ? -0.533  4.270   5.248   1.00 0.39 ? 30  LEU A CB   7  
ATOM   8616  C CG   . LEU A 1 30 ? -0.080  3.230   6.273   1.00 0.78 ? 30  LEU A CG   7  
ATOM   8617  C CD1  . LEU A 1 30 ? -0.178  1.825   5.699   1.00 1.32 ? 30  LEU A CD1  7  
ATOM   8618  C CD2  . LEU A 1 30 ? 1.343   3.522   6.715   1.00 1.04 ? 30  LEU A CD2  7  
ATOM   8619  H H    . LEU A 1 30 ? -1.337  5.342   3.129   1.00 0.29 ? 30  LEU A H    7  
ATOM   8620  H HA   . LEU A 1 30 ? -2.168  3.078   4.549   1.00 0.36 ? 30  LEU A HA   7  
ATOM   8621  H HB2  . LEU A 1 30 ? 0.135   4.219   4.400   1.00 0.71 ? 30  LEU A HB2  7  
ATOM   8622  H HB3  . LEU A 1 30 ? -0.438  5.249   5.696   1.00 0.65 ? 30  LEU A HB3  7  
ATOM   8623  H HG   . LEU A 1 30 ? -0.722  3.284   7.141   1.00 1.11 ? 30  LEU A HG   7  
ATOM   8624  H HD11 . LEU A 1 30 ? -1.215  1.560   5.567   1.00 1.67 ? 30  LEU A HD11 7  
ATOM   8625  H HD12 . LEU A 1 30 ? 0.290   1.127   6.377   1.00 1.61 ? 30  LEU A HD12 7  
ATOM   8626  H HD13 . LEU A 1 30 ? 0.326   1.791   4.744   1.00 1.72 ? 30  LEU A HD13 7  
ATOM   8627  H HD21 . LEU A 1 30 ? 1.687   2.733   7.366   1.00 1.49 ? 30  LEU A HD21 7  
ATOM   8628  H HD22 . LEU A 1 30 ? 1.369   4.462   7.245   1.00 1.30 ? 30  LEU A HD22 7  
ATOM   8629  H HD23 . LEU A 1 30 ? 1.984   3.579   5.848   1.00 1.27 ? 30  LEU A HD23 7  
ATOM   8630  N N    . SER A 1 31 ? -3.183  5.952   5.746   1.00 0.29 ? 31  SER A N    7  
ATOM   8631  C CA   . SER A 1 31 ? -4.120  6.589   6.659   1.00 0.32 ? 31  SER A CA   7  
ATOM   8632  C C    . SER A 1 31 ? -5.551  6.215   6.280   1.00 0.28 ? 31  SER A C    7  
ATOM   8633  O O    . SER A 1 31 ? -6.414  6.042   7.141   1.00 0.29 ? 31  SER A O    7  
ATOM   8634  C CB   . SER A 1 31 ? -3.936  8.108   6.615   1.00 0.40 ? 31  SER A CB   7  
ATOM   8635  O OG   . SER A 1 31 ? -4.557  8.744   7.721   1.00 1.20 ? 31  SER A OG   7  
ATOM   8636  H H    . SER A 1 31 ? -2.697  6.507   5.097   1.00 0.31 ? 31  SER A H    7  
ATOM   8637  H HA   . SER A 1 31 ? -3.915  6.233   7.658   1.00 0.36 ? 31  SER A HA   7  
ATOM   8638  H HB2  . SER A 1 31 ? -2.881  8.340   6.633   1.00 0.94 ? 31  SER A HB2  7  
ATOM   8639  H HB3  . SER A 1 31 ? -4.372  8.493   5.703   1.00 1.08 ? 31  SER A HB3  7  
ATOM   8640  H HG   . SER A 1 31 ? -4.365  8.246   8.529   1.00 1.76 ? 31  SER A HG   7  
ATOM   8641  N N    . LEU A 1 32 ? -5.788  6.079   4.980   1.00 0.27 ? 32  LEU A N    7  
ATOM   8642  C CA   . LEU A 1 32 ? -7.105  5.716   4.470   1.00 0.29 ? 32  LEU A CA   7  
ATOM   8643  C C    . LEU A 1 32 ? -7.489  4.323   4.965   1.00 0.26 ? 32  LEU A C    7  
ATOM   8644  O O    . LEU A 1 32 ? -8.644  4.069   5.302   1.00 0.29 ? 32  LEU A O    7  
ATOM   8645  C CB   . LEU A 1 32 ? -7.102  5.769   2.935   1.00 0.35 ? 32  LEU A CB   7  
ATOM   8646  C CG   . LEU A 1 32 ? -8.475  5.839   2.250   1.00 0.67 ? 32  LEU A CG   7  
ATOM   8647  C CD1  . LEU A 1 32 ? -9.006  4.445   1.953   1.00 1.15 ? 32  LEU A CD1  7  
ATOM   8648  C CD2  . LEU A 1 32 ? -9.467  6.619   3.101   1.00 1.17 ? 32  LEU A CD2  7  
ATOM   8649  H H    . LEU A 1 32 ? -5.057  6.233   4.344   1.00 0.29 ? 32  LEU A H    7  
ATOM   8650  H HA   . LEU A 1 32 ? -7.818  6.432   4.850   1.00 0.32 ? 32  LEU A HA   7  
ATOM   8651  H HB2  . LEU A 1 32 ? -6.537  6.638   2.632   1.00 0.51 ? 32  LEU A HB2  7  
ATOM   8652  H HB3  . LEU A 1 32 ? -6.592  4.891   2.572   1.00 0.56 ? 32  LEU A HB3  7  
ATOM   8653  H HG   . LEU A 1 32 ? -8.367  6.355   1.309   1.00 0.58 ? 32  LEU A HG   7  
ATOM   8654  H HD11 . LEU A 1 32 ? -8.325  3.935   1.286   1.00 1.26 ? 32  LEU A HD11 7  
ATOM   8655  H HD12 . LEU A 1 32 ? -9.978  4.520   1.487   1.00 1.47 ? 32  LEU A HD12 7  
ATOM   8656  H HD13 . LEU A 1 32 ? -9.091  3.887   2.876   1.00 1.37 ? 32  LEU A HD13 7  
ATOM   8657  H HD21 . LEU A 1 32 ? -10.392 6.741   2.552   1.00 1.52 ? 32  LEU A HD21 7  
ATOM   8658  H HD22 . LEU A 1 32 ? -9.056  7.591   3.332   1.00 1.23 ? 32  LEU A HD22 7  
ATOM   8659  H HD23 . LEU A 1 32 ? -9.661  6.081   4.016   1.00 1.41 ? 32  LEU A HD23 7  
ATOM   8660  N N    . LEU A 1 33 ? -6.504  3.433   5.025   1.00 0.27 ? 33  LEU A N    7  
ATOM   8661  C CA   . LEU A 1 33 ? -6.730  2.073   5.491   1.00 0.31 ? 33  LEU A CA   7  
ATOM   8662  C C    . LEU A 1 33 ? -7.164  2.079   6.954   1.00 0.27 ? 33  LEU A C    7  
ATOM   8663  O O    . LEU A 1 33 ? -7.959  1.240   7.385   1.00 0.33 ? 33  LEU A O    7  
ATOM   8664  C CB   . LEU A 1 33 ? -5.461  1.238   5.316   1.00 0.41 ? 33  LEU A CB   7  
ATOM   8665  C CG   . LEU A 1 33 ? -4.914  1.176   3.885   1.00 0.49 ? 33  LEU A CG   7  
ATOM   8666  C CD1  . LEU A 1 33 ? -3.606  0.404   3.837   1.00 0.61 ? 33  LEU A CD1  7  
ATOM   8667  C CD2  . LEU A 1 33 ? -5.937  0.553   2.946   1.00 0.68 ? 33  LEU A CD2  7  
ATOM   8668  H H    . LEU A 1 33 ? -5.601  3.696   4.735   1.00 0.29 ? 33  LEU A H    7  
ATOM   8669  H HA   . LEU A 1 33 ? -7.521  1.645   4.895   1.00 0.35 ? 33  LEU A HA   7  
ATOM   8670  H HB2  . LEU A 1 33 ? -4.696  1.651   5.957   1.00 0.42 ? 33  LEU A HB2  7  
ATOM   8671  H HB3  . LEU A 1 33 ? -5.671  0.229   5.642   1.00 0.50 ? 33  LEU A HB3  7  
ATOM   8672  H HG   . LEU A 1 33 ? -4.718  2.181   3.541   1.00 0.46 ? 33  LEU A HG   7  
ATOM   8673  H HD11 . LEU A 1 33 ? -3.198  0.445   2.836   1.00 1.08 ? 33  LEU A HD11 7  
ATOM   8674  H HD12 . LEU A 1 33 ? -3.785  -0.628  4.109   1.00 1.05 ? 33  LEU A HD12 7  
ATOM   8675  H HD13 . LEU A 1 33 ? -2.905  0.842   4.530   1.00 1.03 ? 33  LEU A HD13 7  
ATOM   8676  H HD21 . LEU A 1 33 ? -6.220  -0.422  3.316   1.00 1.04 ? 33  LEU A HD21 7  
ATOM   8677  H HD22 . LEU A 1 33 ? -5.507  0.454   1.960   1.00 0.99 ? 33  LEU A HD22 7  
ATOM   8678  H HD23 . LEU A 1 33 ? -6.810  1.186   2.895   1.00 0.89 ? 33  LEU A HD23 7  
ATOM   8679  N N    . GLN A 1 34 ? -6.637  3.037   7.708   1.00 0.26 ? 34  GLN A N    7  
ATOM   8680  C CA   . GLN A 1 34 ? -6.977  3.183   9.116   1.00 0.31 ? 34  GLN A CA   7  
ATOM   8681  C C    . GLN A 1 34 ? -8.383  3.747   9.253   1.00 0.29 ? 34  GLN A C    7  
ATOM   8682  O O    . GLN A 1 34 ? -9.156  3.318   10.105  1.00 0.38 ? 34  GLN A O    7  
ATOM   8683  C CB   . GLN A 1 34 ? -5.985  4.112   9.811   1.00 0.42 ? 34  GLN A CB   7  
ATOM   8684  C CG   . GLN A 1 34 ? -4.647  3.462   10.113  1.00 0.72 ? 34  GLN A CG   7  
ATOM   8685  C CD   . GLN A 1 34 ? -4.743  2.431   11.221  1.00 1.04 ? 34  GLN A CD   7  
ATOM   8686  O OE1  . GLN A 1 34 ? -5.549  2.562   12.145  1.00 1.62 ? 34  GLN A OE1  7  
ATOM   8687  N NE2  . GLN A 1 34 ? -3.927  1.396   11.137  1.00 1.51 ? 34  GLN A NE2  7  
ATOM   8688  H H    . GLN A 1 34 ? -6.003  3.666   7.303   1.00 0.29 ? 34  GLN A H    7  
ATOM   8689  H HA   . GLN A 1 34 ? -6.939  2.207   9.577   1.00 0.36 ? 34  GLN A HA   7  
ATOM   8690  H HB2  . GLN A 1 34 ? -5.813  4.971   9.180   1.00 0.67 ? 34  GLN A HB2  7  
ATOM   8691  H HB3  . GLN A 1 34 ? -6.417  4.445   10.743  1.00 0.61 ? 34  GLN A HB3  7  
ATOM   8692  H HG2  . GLN A 1 34 ? -4.286  2.978   9.220   1.00 1.27 ? 34  GLN A HG2  7  
ATOM   8693  H HG3  . GLN A 1 34 ? -3.948  4.229   10.414  1.00 1.25 ? 34  GLN A HG3  7  
ATOM   8694  H HE21 . GLN A 1 34 ? -3.314  1.349   10.372  1.00 1.73 ? 34  GLN A HE21 7  
ATOM   8695  H HE22 . GLN A 1 34 ? -3.963  0.721   11.848  1.00 1.94 ? 34  GLN A HE22 7  
ATOM   8696  N N    . LYS A 1 35 ? -8.696  4.710   8.393   1.00 0.29 ? 35  LYS A N    7  
ATOM   8697  C CA   . LYS A 1 35 ? -10.000 5.355   8.385   1.00 0.37 ? 35  LYS A CA   7  
ATOM   8698  C C    . LYS A 1 35 ? -11.106 4.346   8.081   1.00 0.32 ? 35  LYS A C    7  
ATOM   8699  O O    . LYS A 1 35 ? -12.117 4.286   8.781   1.00 0.36 ? 35  LYS A O    7  
ATOM   8700  C CB   . LYS A 1 35 ? -10.009 6.480   7.343   1.00 0.50 ? 35  LYS A CB   7  
ATOM   8701  C CG   . LYS A 1 35 ? -11.402 6.933   6.935   1.00 0.67 ? 35  LYS A CG   7  
ATOM   8702  C CD   . LYS A 1 35 ? -11.351 8.042   5.902   1.00 0.77 ? 35  LYS A CD   7  
ATOM   8703  C CE   . LYS A 1 35 ? -12.704 8.242   5.236   1.00 1.00 ? 35  LYS A CE   7  
ATOM   8704  N NZ   . LYS A 1 35 ? -13.801 8.400   6.229   1.00 1.37 ? 35  LYS A NZ   7  
ATOM   8705  H H    . LYS A 1 35 ? -8.020  5.001   7.744   1.00 0.33 ? 35  LYS A H    7  
ATOM   8706  H HA   . LYS A 1 35 ? -10.170 5.778   9.363   1.00 0.45 ? 35  LYS A HA   7  
ATOM   8707  H HB2  . LYS A 1 35 ? -9.483  7.332   7.747   1.00 0.88 ? 35  LYS A HB2  7  
ATOM   8708  H HB3  . LYS A 1 35 ? -9.491  6.137   6.459   1.00 1.00 ? 35  LYS A HB3  7  
ATOM   8709  H HG2  . LYS A 1 35 ? -11.936 6.091   6.518   1.00 1.20 ? 35  LYS A HG2  7  
ATOM   8710  H HG3  . LYS A 1 35 ? -11.920 7.292   7.809   1.00 1.10 ? 35  LYS A HG3  7  
ATOM   8711  H HD2  . LYS A 1 35 ? -11.062 8.962   6.390   1.00 1.19 ? 35  LYS A HD2  7  
ATOM   8712  H HD3  . LYS A 1 35 ? -10.622 7.787   5.149   1.00 1.15 ? 35  LYS A HD3  7  
ATOM   8713  H HE2  . LYS A 1 35 ? -12.659 9.127   4.620   1.00 1.52 ? 35  LYS A HE2  7  
ATOM   8714  H HE3  . LYS A 1 35 ? -12.913 7.384   4.614   1.00 1.60 ? 35  LYS A HE3  7  
ATOM   8715  H HZ1  . LYS A 1 35 ? -14.656 8.759   5.759   1.00 1.85 ? 35  LYS A HZ1  7  
ATOM   8716  H HZ2  . LYS A 1 35 ? -13.521 9.072   6.971   1.00 1.75 ? 35  LYS A HZ2  7  
ATOM   8717  H HZ3  . LYS A 1 35 ? -14.023 7.483   6.673   1.00 1.76 ? 35  LYS A HZ3  7  
ATOM   8718  N N    . GLU A 1 36 ? -10.898 3.545   7.041   1.00 0.29 ? 36  GLU A N    7  
ATOM   8719  C CA   . GLU A 1 36 ? -11.875 2.541   6.635   1.00 0.31 ? 36  GLU A CA   7  
ATOM   8720  C C    . GLU A 1 36 ? -11.987 1.420   7.660   1.00 0.29 ? 36  GLU A C    7  
ATOM   8721  O O    . GLU A 1 36 ? -12.995 0.714   7.716   1.00 0.39 ? 36  GLU A O    7  
ATOM   8722  C CB   . GLU A 1 36 ? -11.499 1.959   5.272   1.00 0.37 ? 36  GLU A CB   7  
ATOM   8723  C CG   . GLU A 1 36 ? -11.603 2.963   4.140   1.00 0.43 ? 36  GLU A CG   7  
ATOM   8724  C CD   . GLU A 1 36 ? -12.998 3.528   3.988   1.00 0.64 ? 36  GLU A CD   7  
ATOM   8725  O OE1  . GLU A 1 36 ? -13.128 4.722   3.648   1.00 1.30 ? 36  GLU A OE1  7  
ATOM   8726  O OE2  . GLU A 1 36 ? -13.975 2.780   4.200   1.00 1.21 ? 36  GLU A OE2  7  
ATOM   8727  H H    . GLU A 1 36 ? -10.063 3.637   6.528   1.00 0.32 ? 36  GLU A H    7  
ATOM   8728  H HA   . GLU A 1 36 ? -12.834 3.030   6.551   1.00 0.38 ? 36  GLU A HA   7  
ATOM   8729  H HB2  . GLU A 1 36 ? -10.483 1.597   5.316   1.00 0.40 ? 36  GLU A HB2  7  
ATOM   8730  H HB3  . GLU A 1 36 ? -12.156 1.132   5.051   1.00 0.47 ? 36  GLU A HB3  7  
ATOM   8731  H HG2  . GLU A 1 36 ? -10.921 3.777   4.335   1.00 0.46 ? 36  GLU A HG2  7  
ATOM   8732  H HG3  . GLU A 1 36 ? -11.326 2.475   3.218   1.00 0.50 ? 36  GLU A HG3  7  
ATOM   8733  N N    . GLY A 1 37 ? -10.955 1.263   8.477   1.00 0.27 ? 37  GLY A N    7  
ATOM   8734  C CA   . GLY A 1 37 ? -10.960 0.221   9.477   1.00 0.30 ? 37  GLY A CA   7  
ATOM   8735  C C    . GLY A 1 37 ? -10.689 -1.139  8.874   1.00 0.29 ? 37  GLY A C    7  
ATOM   8736  O O    . GLY A 1 37 ? -11.193 -2.158  9.350   1.00 0.41 ? 37  GLY A O    7  
ATOM   8737  H H    . GLY A 1 37 ? -10.191 1.874   8.408   1.00 0.30 ? 37  GLY A H    7  
ATOM   8738  H HA2  . GLY A 1 37 ? -10.201 0.437   10.215  1.00 0.33 ? 37  GLY A HA2  7  
ATOM   8739  H HA3  . GLY A 1 37 ? -11.926 0.201   9.963   1.00 0.35 ? 37  GLY A HA3  7  
ATOM   8740  N N    . LEU A 1 38 ? -9.898  -1.149  7.808   1.00 0.25 ? 38  LEU A N    7  
ATOM   8741  C CA   . LEU A 1 38 ? -9.543  -2.388  7.132   1.00 0.28 ? 38  LEU A CA   7  
ATOM   8742  C C    . LEU A 1 38 ? -8.372  -3.048  7.842   1.00 0.32 ? 38  LEU A C    7  
ATOM   8743  O O    . LEU A 1 38 ? -8.259  -4.274  7.881   1.00 0.46 ? 38  LEU A O    7  
ATOM   8744  C CB   . LEU A 1 38 ? -9.183  -2.117  5.668   1.00 0.31 ? 38  LEU A CB   7  
ATOM   8745  C CG   . LEU A 1 38 ? -10.372 -1.825  4.748   1.00 0.40 ? 38  LEU A CG   7  
ATOM   8746  C CD1  . LEU A 1 38 ? -9.896  -1.190  3.452   1.00 0.51 ? 38  LEU A CD1  7  
ATOM   8747  C CD2  . LEU A 1 38 ? -11.148 -3.102  4.458   1.00 0.50 ? 38  LEU A CD2  7  
ATOM   8748  H H    . LEU A 1 38 ? -9.542  -0.299  7.471   1.00 0.29 ? 38  LEU A H    7  
ATOM   8749  H HA   . LEU A 1 38 ? -10.398 -3.046  7.174   1.00 0.34 ? 38  LEU A HA   7  
ATOM   8750  H HB2  . LEU A 1 38 ? -8.510  -1.269  5.636   1.00 0.34 ? 38  LEU A HB2  7  
ATOM   8751  H HB3  . LEU A 1 38 ? -8.663  -2.981  5.282   1.00 0.35 ? 38  LEU A HB3  7  
ATOM   8752  H HG   . LEU A 1 38 ? -11.039 -1.130  5.237   1.00 0.47 ? 38  LEU A HG   7  
ATOM   8753  H HD11 . LEU A 1 38 ? -9.197  -1.852  2.963   1.00 0.74 ? 38  LEU A HD11 7  
ATOM   8754  H HD12 . LEU A 1 38 ? -9.413  -0.250  3.666   1.00 0.78 ? 38  LEU A HD12 7  
ATOM   8755  H HD13 . LEU A 1 38 ? -10.742 -1.019  2.802   1.00 0.79 ? 38  LEU A HD13 7  
ATOM   8756  H HD21 . LEU A 1 38 ? -11.988 -2.874  3.818   1.00 0.77 ? 38  LEU A HD21 7  
ATOM   8757  H HD22 . LEU A 1 38 ? -11.507 -3.527  5.384   1.00 0.67 ? 38  LEU A HD22 7  
ATOM   8758  H HD23 . LEU A 1 38 ? -10.501 -3.811  3.961   1.00 0.68 ? 38  LEU A HD23 7  
ATOM   8759  N N    . LEU A 1 39 ? -7.515  -2.222  8.421   1.00 0.31 ? 39  LEU A N    7  
ATOM   8760  C CA   . LEU A 1 39 ? -6.346  -2.704  9.136   1.00 0.40 ? 39  LEU A CA   7  
ATOM   8761  C C    . LEU A 1 39 ? -6.332  -2.135  10.545  1.00 0.39 ? 39  LEU A C    7  
ATOM   8762  O O    . LEU A 1 39 ? -7.064  -1.190  10.844  1.00 0.57 ? 39  LEU A O    7  
ATOM   8763  C CB   . LEU A 1 39 ? -5.061  -2.295  8.406   1.00 0.53 ? 39  LEU A CB   7  
ATOM   8764  C CG   . LEU A 1 39 ? -4.891  -2.862  6.995   1.00 0.67 ? 39  LEU A CG   7  
ATOM   8765  C CD1  . LEU A 1 39 ? -3.579  -2.392  6.388   1.00 0.86 ? 39  LEU A CD1  7  
ATOM   8766  C CD2  . LEU A 1 39 ? -4.957  -4.382  7.015   1.00 0.75 ? 39  LEU A CD2  7  
ATOM   8767  H H    . LEU A 1 39 ? -7.686  -1.257  8.388   1.00 0.31 ? 39  LEU A H    7  
ATOM   8768  H HA   . LEU A 1 39 ? -6.402  -3.781  9.187   1.00 0.47 ? 39  LEU A HA   7  
ATOM   8769  H HB2  . LEU A 1 39 ? -5.040  -1.218  8.340   1.00 0.56 ? 39  LEU A HB2  7  
ATOM   8770  H HB3  . LEU A 1 39 ? -4.219  -2.616  8.999   1.00 0.63 ? 39  LEU A HB3  7  
ATOM   8771  H HG   . LEU A 1 39 ? -5.693  -2.501  6.370   1.00 0.67 ? 39  LEU A HG   7  
ATOM   8772  H HD11 . LEU A 1 39 ? -2.753  -2.747  6.990   1.00 1.10 ? 39  LEU A HD11 7  
ATOM   8773  H HD12 . LEU A 1 39 ? -3.564  -1.312  6.356   1.00 1.10 ? 39  LEU A HD12 7  
ATOM   8774  H HD13 . LEU A 1 39 ? -3.485  -2.785  5.385   1.00 1.09 ? 39  LEU A HD13 7  
ATOM   8775  H HD21 . LEU A 1 39 ? -4.438  -4.776  6.155   1.00 1.19 ? 39  LEU A HD21 7  
ATOM   8776  H HD22 . LEU A 1 39 ? -5.990  -4.695  6.985   1.00 1.13 ? 39  LEU A HD22 7  
ATOM   8777  H HD23 . LEU A 1 39 ? -4.496  -4.752  7.918   1.00 1.12 ? 39  LEU A HD23 7  
ATOM   8778  N N    . MET A 1 40 ? -5.503  -2.706  11.398  1.00 0.35 ? 40  MET A N    7  
ATOM   8779  C CA   . MET A 1 40 ? -5.385  -2.240  12.769  1.00 0.41 ? 40  MET A CA   7  
ATOM   8780  C C    . MET A 1 40 ? -4.114  -1.422  12.909  1.00 0.37 ? 40  MET A C    7  
ATOM   8781  O O    . MET A 1 40 ? -4.091  -0.379  13.558  1.00 0.53 ? 40  MET A O    7  
ATOM   8782  C CB   . MET A 1 40 ? -5.358  -3.422  13.743  1.00 0.54 ? 40  MET A CB   7  
ATOM   8783  C CG   . MET A 1 40 ? -5.164  -3.007  15.195  1.00 0.70 ? 40  MET A CG   7  
ATOM   8784  S SD   . MET A 1 40 ? -4.713  -4.387  16.266  1.00 0.94 ? 40  MET A SD   7  
ATOM   8785  C CE   . MET A 1 40 ? -3.101  -4.818  15.612  1.00 1.19 ? 40  MET A CE   7  
ATOM   8786  H H    . MET A 1 40 ? -4.937  -3.454  11.096  1.00 0.44 ? 40  MET A H    7  
ATOM   8787  H HA   . MET A 1 40 ? -6.233  -1.612  12.987  1.00 0.50 ? 40  MET A HA   7  
ATOM   8788  H HB2  . MET A 1 40 ? -6.293  -3.958  13.667  1.00 0.62 ? 40  MET A HB2  7  
ATOM   8789  H HB3  . MET A 1 40 ? -4.550  -4.084  13.466  1.00 0.55 ? 40  MET A HB3  7  
ATOM   8790  H HG2  . MET A 1 40 ? -4.380  -2.264  15.239  1.00 0.73 ? 40  MET A HG2  7  
ATOM   8791  H HG3  . MET A 1 40 ? -6.084  -2.577  15.559  1.00 0.78 ? 40  MET A HG3  7  
ATOM   8792  H HE1  . MET A 1 40 ? -3.207  -5.201  14.609  1.00 1.40 ? 40  MET A HE1  7  
ATOM   8793  H HE2  . MET A 1 40 ? -2.649  -5.573  16.238  1.00 1.50 ? 40  MET A HE2  7  
ATOM   8794  H HE3  . MET A 1 40 ? -2.472  -3.940  15.596  1.00 1.50 ? 40  MET A HE3  7  
ATOM   8795  N N    . SER A 1 41 ? -3.067  -1.889  12.262  1.00 0.33 ? 41  SER A N    7  
ATOM   8796  C CA   . SER A 1 41 ? -1.784  -1.222  12.305  1.00 0.39 ? 41  SER A CA   7  
ATOM   8797  C C    . SER A 1 41 ? -1.169  -1.170  10.911  1.00 0.34 ? 41  SER A C    7  
ATOM   8798  O O    . SER A 1 41 ? -1.509  -1.982  10.053  1.00 0.31 ? 41  SER A O    7  
ATOM   8799  C CB   . SER A 1 41 ? -0.861  -1.963  13.276  1.00 0.50 ? 41  SER A CB   7  
ATOM   8800  O OG   . SER A 1 41 ? -1.143  -3.353  13.285  1.00 0.87 ? 41  SER A OG   7  
ATOM   8801  H H    . SER A 1 41 ? -3.159  -2.715  11.726  1.00 0.38 ? 41  SER A H    7  
ATOM   8802  H HA   . SER A 1 41 ? -1.939  -0.214  12.660  1.00 0.51 ? 41  SER A HA   7  
ATOM   8803  H HB2  . SER A 1 41 ? 0.167   -1.820  12.977  1.00 0.83 ? 41  SER A HB2  7  
ATOM   8804  H HB3  . SER A 1 41 ? -1.004  -1.573  14.273  1.00 0.81 ? 41  SER A HB3  7  
ATOM   8805  H HG   . SER A 1 41 ? -1.797  -3.558  12.602  1.00 1.39 ? 41  SER A HG   7  
ATOM   8806  N N    . PRO A 1 42 ? -0.264  -0.210  10.660  1.00 0.43 ? 42  PRO A N    7  
ATOM   8807  C CA   . PRO A 1 42 ? 0.402   -0.078  9.360   1.00 0.47 ? 42  PRO A CA   7  
ATOM   8808  C C    . PRO A 1 42 ? 1.308   -1.275  9.066   1.00 0.43 ? 42  PRO A C    7  
ATOM   8809  O O    . PRO A 1 42 ? 1.773   -1.459  7.942   1.00 0.54 ? 42  PRO A O    7  
ATOM   8810  C CB   . PRO A 1 42 ? 1.228   1.205   9.504   1.00 0.61 ? 42  PRO A CB   7  
ATOM   8811  C CG   . PRO A 1 42 ? 1.400   1.401   10.967  1.00 0.65 ? 42  PRO A CG   7  
ATOM   8812  C CD   . PRO A 1 42 ? 0.171   0.829   11.614  1.00 0.57 ? 42  PRO A CD   7  
ATOM   8813  H HA   . PRO A 1 42 ? -0.314  0.035   8.559   1.00 0.51 ? 42  PRO A HA   7  
ATOM   8814  H HB2  . PRO A 1 42 ? 2.187   1.081   9.015   1.00 0.65 ? 42  PRO A HB2  7  
ATOM   8815  H HB3  . PRO A 1 42 ? 0.694   2.039   9.078   1.00 0.73 ? 42  PRO A HB3  7  
ATOM   8816  H HG2  . PRO A 1 42 ? 2.284   0.878   11.303  1.00 0.67 ? 42  PRO A HG2  7  
ATOM   8817  H HG3  . PRO A 1 42 ? 1.476   2.454   11.191  1.00 0.81 ? 42  PRO A HG3  7  
ATOM   8818  H HD2  . PRO A 1 42 ? 0.414   0.393   12.573  1.00 0.58 ? 42  PRO A HD2  7  
ATOM   8819  H HD3  . PRO A 1 42 ? -0.587  1.589   11.724  1.00 0.68 ? 42  PRO A HD3  7  
ATOM   8820  N N    . SER A 1 43 ? 1.546   -2.089  10.088  1.00 0.36 ? 43  SER A N    7  
ATOM   8821  C CA   . SER A 1 43 ? 2.377   -3.275  9.963   1.00 0.41 ? 43  SER A CA   7  
ATOM   8822  C C    . SER A 1 43 ? 1.530   -4.502  9.608   1.00 0.36 ? 43  SER A C    7  
ATOM   8823  O O    . SER A 1 43 ? 2.018   -5.629  9.605   1.00 0.40 ? 43  SER A O    7  
ATOM   8824  C CB   . SER A 1 43 ? 3.125   -3.504  11.274  1.00 0.54 ? 43  SER A CB   7  
ATOM   8825  O OG   . SER A 1 43 ? 2.420   -2.924  12.364  1.00 0.69 ? 43  SER A OG   7  
ATOM   8826  H H    . SER A 1 43 ? 1.163   -1.876  10.965  1.00 0.38 ? 43  SER A H    7  
ATOM   8827  H HA   . SER A 1 43 ? 3.094   -3.099  9.175   1.00 0.49 ? 43  SER A HA   7  
ATOM   8828  H HB2  . SER A 1 43 ? 3.225   -4.566  11.449  1.00 0.70 ? 43  SER A HB2  7  
ATOM   8829  H HB3  . SER A 1 43 ? 4.106   -3.053  11.213  1.00 0.75 ? 43  SER A HB3  7  
ATOM   8830  H HG   . SER A 1 43 ? 2.185   -3.617  12.996  1.00 1.10 ? 43  SER A HG   7  
ATOM   8831  N N    . ASP A 1 44 ? 0.261   -4.272  9.298   1.00 0.32 ? 44  ASP A N    7  
ATOM   8832  C CA   . ASP A 1 44 ? -0.650  -5.362  8.947   1.00 0.32 ? 44  ASP A CA   7  
ATOM   8833  C C    . ASP A 1 44 ? -0.453  -5.803  7.501   1.00 0.29 ? 44  ASP A C    7  
ATOM   8834  O O    . ASP A 1 44 ? -1.021  -6.801  7.063   1.00 0.31 ? 44  ASP A O    7  
ATOM   8835  C CB   . ASP A 1 44 ? -2.108  -4.949  9.157   1.00 0.39 ? 44  ASP A CB   7  
ATOM   8836  C CG   . ASP A 1 44 ? -2.604  -5.239  10.560  1.00 0.54 ? 44  ASP A CG   7  
ATOM   8837  O OD1  . ASP A 1 44 ? -2.470  -6.395  11.015  1.00 0.87 ? 44  ASP A OD1  7  
ATOM   8838  O OD2  . ASP A 1 44 ? -3.138  -4.313  11.211  1.00 0.69 ? 44  ASP A OD2  7  
ATOM   8839  H H    . ASP A 1 44 ? -0.077  -3.350  9.312   1.00 0.35 ? 44  ASP A H    7  
ATOM   8840  H HA   . ASP A 1 44 ? -0.427  -6.196  9.596   1.00 0.40 ? 44  ASP A HA   7  
ATOM   8841  H HB2  . ASP A 1 44 ? -2.209  -3.889  8.970   1.00 0.46 ? 44  ASP A HB2  7  
ATOM   8842  H HB3  . ASP A 1 44 ? -2.729  -5.491  8.460   1.00 0.52 ? 44  ASP A HB3  7  
ATOM   8843  N N    . LEU A 1 45 ? 0.370   -5.068  6.763   1.00 0.31 ? 45  LEU A N    7  
ATOM   8844  C CA   . LEU A 1 45 ? 0.621   -5.389  5.363   1.00 0.36 ? 45  LEU A CA   7  
ATOM   8845  C C    . LEU A 1 45 ? 1.507   -6.622  5.227   1.00 0.34 ? 45  LEU A C    7  
ATOM   8846  O O    . LEU A 1 45 ? 1.621   -7.187  4.142   1.00 0.38 ? 45  LEU A O    7  
ATOM   8847  C CB   . LEU A 1 45 ? 1.262   -4.207  4.631   1.00 0.45 ? 45  LEU A CB   7  
ATOM   8848  C CG   . LEU A 1 45 ? 0.308   -3.081  4.207   1.00 0.60 ? 45  LEU A CG   7  
ATOM   8849  C CD1  . LEU A 1 45 ? -1.059  -3.630  3.831   1.00 0.96 ? 45  LEU A CD1  7  
ATOM   8850  C CD2  . LEU A 1 45 ? 0.182   -2.042  5.306   1.00 0.98 ? 45  LEU A CD2  7  
ATOM   8851  H H    . LEU A 1 45 ? 0.820   -4.298  7.169   1.00 0.35 ? 45  LEU A H    7  
ATOM   8852  H HA   . LEU A 1 45 ? -0.333  -5.604  4.904   1.00 0.41 ? 45  LEU A HA   7  
ATOM   8853  H HB2  . LEU A 1 45 ? 2.014   -3.782  5.276   1.00 0.60 ? 45  LEU A HB2  7  
ATOM   8854  H HB3  . LEU A 1 45 ? 1.748   -4.585  3.743   1.00 0.54 ? 45  LEU A HB3  7  
ATOM   8855  H HG   . LEU A 1 45 ? 0.715   -2.590  3.333   1.00 0.84 ? 45  LEU A HG   7  
ATOM   8856  H HD11 . LEU A 1 45 ? -0.945  -4.397  3.077   1.00 1.37 ? 45  LEU A HD11 7  
ATOM   8857  H HD12 . LEU A 1 45 ? -1.671  -2.831  3.441   1.00 1.34 ? 45  LEU A HD12 7  
ATOM   8858  H HD13 . LEU A 1 45 ? -1.532  -4.049  4.707   1.00 1.38 ? 45  LEU A HD13 7  
ATOM   8859  H HD21 . LEU A 1 45 ? 1.159   -1.650  5.545   1.00 1.28 ? 45  LEU A HD21 7  
ATOM   8860  H HD22 . LEU A 1 45 ? -0.247  -2.499  6.184   1.00 1.36 ? 45  LEU A HD22 7  
ATOM   8861  H HD23 . LEU A 1 45 ? -0.456  -1.239  4.970   1.00 1.37 ? 45  LEU A HD23 7  
ATOM   8862  N N    . TYR A 1 46 ? 2.122   -7.044  6.328   1.00 0.32 ? 46  TYR A N    7  
ATOM   8863  C CA   . TYR A 1 46 ? 2.986   -8.220  6.314   1.00 0.37 ? 46  TYR A CA   7  
ATOM   8864  C C    . TYR A 1 46 ? 2.160   -9.495  6.161   1.00 0.34 ? 46  TYR A C    7  
ATOM   8865  O O    . TYR A 1 46 ? 2.689   -10.551 5.819   1.00 0.44 ? 46  TYR A O    7  
ATOM   8866  C CB   . TYR A 1 46 ? 3.817   -8.298  7.599   1.00 0.47 ? 46  TYR A CB   7  
ATOM   8867  C CG   . TYR A 1 46 ? 4.873   -7.220  7.729   1.00 0.55 ? 46  TYR A CG   7  
ATOM   8868  C CD1  . TYR A 1 46 ? 5.959   -7.166  6.865   1.00 0.87 ? 46  TYR A CD1  7  
ATOM   8869  C CD2  . TYR A 1 46 ? 4.787   -6.262  8.731   1.00 0.64 ? 46  TYR A CD2  7  
ATOM   8870  C CE1  . TYR A 1 46 ? 6.927   -6.189  6.997   1.00 1.01 ? 46  TYR A CE1  7  
ATOM   8871  C CE2  . TYR A 1 46 ? 5.746   -5.281  8.867   1.00 0.76 ? 46  TYR A CE2  7  
ATOM   8872  C CZ   . TYR A 1 46 ? 6.815   -5.248  8.001   1.00 0.86 ? 46  TYR A CZ   7  
ATOM   8873  O OH   . TYR A 1 46 ? 7.774   -4.271  8.138   1.00 1.05 ? 46  TYR A OH   7  
ATOM   8874  H H    . TYR A 1 46 ? 1.992   -6.555  7.168   1.00 0.33 ? 46  TYR A H    7  
ATOM   8875  H HA   . TYR A 1 46 ? 3.653   -8.131  5.469   1.00 0.43 ? 46  TYR A HA   7  
ATOM   8876  H HB2  . TYR A 1 46 ? 3.155   -8.211  8.446   1.00 0.46 ? 46  TYR A HB2  7  
ATOM   8877  H HB3  . TYR A 1 46 ? 4.317   -9.255  7.638   1.00 0.61 ? 46  TYR A HB3  7  
ATOM   8878  H HD1  . TYR A 1 46 ? 6.044   -7.903  6.081   1.00 1.12 ? 46  TYR A HD1  7  
ATOM   8879  H HD2  . TYR A 1 46 ? 3.948   -6.289  9.410   1.00 0.84 ? 46  TYR A HD2  7  
ATOM   8880  H HE1  . TYR A 1 46 ? 7.764   -6.162  6.315   1.00 1.34 ? 46  TYR A HE1  7  
ATOM   8881  H HE2  . TYR A 1 46 ? 5.656   -4.547  9.654   1.00 0.97 ? 46  TYR A HE2  7  
ATOM   8882  H HH   . TYR A 1 46 ? 7.753   -3.928  9.040   1.00 1.14 ? 46  TYR A HH   7  
ATOM   8883  N N    . SER A 1 47 ? 0.861   -9.390  6.419   1.00 0.31 ? 47  SER A N    7  
ATOM   8884  C CA   . SER A 1 47 ? -0.036  -10.531 6.314   1.00 0.29 ? 47  SER A CA   7  
ATOM   8885  C C    . SER A 1 47 ? -0.682  -10.589 4.928   1.00 0.24 ? 47  SER A C    7  
ATOM   8886  O O    . SER A 1 47 ? -1.536  -9.766  4.596   1.00 0.26 ? 47  SER A O    7  
ATOM   8887  C CB   . SER A 1 47 ? -1.108  -10.449 7.402   1.00 0.36 ? 47  SER A CB   7  
ATOM   8888  O OG   . SER A 1 47 ? -0.522  -10.215 8.676   1.00 0.53 ? 47  SER A OG   7  
ATOM   8889  H H    . SER A 1 47 ? 0.494   -8.519  6.685   1.00 0.37 ? 47  SER A H    7  
ATOM   8890  H HA   . SER A 1 47 ? 0.549   -11.426 6.462   1.00 0.33 ? 47  SER A HA   7  
ATOM   8891  H HB2  . SER A 1 47 ? -1.787  -9.642  7.175   1.00 0.43 ? 47  SER A HB2  7  
ATOM   8892  H HB3  . SER A 1 47 ? -1.654  -11.381 7.435   1.00 0.44 ? 47  SER A HB3  7  
ATOM   8893  H HG   . SER A 1 47 ? -1.019  -9.525  9.134   1.00 1.10 ? 47  SER A HG   7  
ATOM   8894  N N    . PRO A 1 48 ? -0.289  -11.577 4.105   1.00 0.24 ? 48  PRO A N    7  
ATOM   8895  C CA   . PRO A 1 48 ? -0.817  -11.740 2.743   1.00 0.25 ? 48  PRO A CA   7  
ATOM   8896  C C    . PRO A 1 48 ? -2.264  -12.230 2.709   1.00 0.26 ? 48  PRO A C    7  
ATOM   8897  O O    . PRO A 1 48 ? -2.891  -12.266 1.649   1.00 0.32 ? 48  PRO A O    7  
ATOM   8898  C CB   . PRO A 1 48 ? 0.113   -12.789 2.129   1.00 0.31 ? 48  PRO A CB   7  
ATOM   8899  C CG   . PRO A 1 48 ? 0.631   -13.571 3.282   1.00 0.38 ? 48  PRO A CG   7  
ATOM   8900  C CD   . PRO A 1 48 ? 0.707   -12.613 4.438   1.00 0.32 ? 48  PRO A CD   7  
ATOM   8901  H HA   . PRO A 1 48 ? -0.743  -10.819 2.181   1.00 0.26 ? 48  PRO A HA   7  
ATOM   8902  H HB2  . PRO A 1 48 ? -0.442  -13.422 1.447   1.00 0.38 ? 48  PRO A HB2  7  
ATOM   8903  H HB3  . PRO A 1 48 ? 0.928   -12.307 1.613   1.00 0.38 ? 48  PRO A HB3  7  
ATOM   8904  H HG2  . PRO A 1 48 ? -0.046  -14.383 3.506   1.00 0.50 ? 48  PRO A HG2  7  
ATOM   8905  H HG3  . PRO A 1 48 ? 1.616   -13.952 3.056   1.00 0.52 ? 48  PRO A HG3  7  
ATOM   8906  H HD2  . PRO A 1 48 ? 0.450   -13.112 5.360   1.00 0.38 ? 48  PRO A HD2  7  
ATOM   8907  H HD3  . PRO A 1 48 ? 1.695   -12.183 4.503   1.00 0.38 ? 48  PRO A HD3  7  
ATOM   8908  N N    . GLY A 1 49 ? -2.792  -12.598 3.868   1.00 0.28 ? 49  GLY A N    7  
ATOM   8909  C CA   . GLY A 1 49 ? -4.157  -13.077 3.942   1.00 0.33 ? 49  GLY A CA   7  
ATOM   8910  C C    . GLY A 1 49 ? -5.158  -11.966 4.198   1.00 0.32 ? 49  GLY A C    7  
ATOM   8911  O O    . GLY A 1 49 ? -6.357  -12.223 4.312   1.00 0.50 ? 49  GLY A O    7  
ATOM   8912  H H    . GLY A 1 49 ? -2.245  -12.558 4.679   1.00 0.30 ? 49  GLY A H    7  
ATOM   8913  H HA2  . GLY A 1 49 ? -4.407  -13.561 3.010   1.00 0.35 ? 49  GLY A HA2  7  
ATOM   8914  H HA3  . GLY A 1 49 ? -4.227  -13.799 4.741   1.00 0.38 ? 49  GLY A HA3  7  
ATOM   8915  N N    . SER A 1 50 ? -4.676  -10.736 4.286   1.00 0.25 ? 50  SER A N    7  
ATOM   8916  C CA   . SER A 1 50 ? -5.549  -9.599  4.534   1.00 0.27 ? 50  SER A CA   7  
ATOM   8917  C C    . SER A 1 50 ? -5.436  -8.558  3.420   1.00 0.22 ? 50  SER A C    7  
ATOM   8918  O O    . SER A 1 50 ? -5.793  -7.397  3.608   1.00 0.28 ? 50  SER A O    7  
ATOM   8919  C CB   . SER A 1 50 ? -5.198  -8.966  5.882   1.00 0.35 ? 50  SER A CB   7  
ATOM   8920  O OG   . SER A 1 50 ? -5.113  -9.952  6.900   1.00 0.47 ? 50  SER A OG   7  
ATOM   8921  H H    . SER A 1 50 ? -3.710  -10.589 4.196   1.00 0.31 ? 50  SER A H    7  
ATOM   8922  H HA   . SER A 1 50 ? -6.565  -9.961  4.569   1.00 0.32 ? 50  SER A HA   7  
ATOM   8923  H HB2  . SER A 1 50 ? -4.246  -8.465  5.805   1.00 0.45 ? 50  SER A HB2  7  
ATOM   8924  H HB3  . SER A 1 50 ? -5.961  -8.251  6.152   1.00 0.45 ? 50  SER A HB3  7  
ATOM   8925  H HG   . SER A 1 50 ? -5.989  -10.326 7.054   1.00 0.93 ? 50  SER A HG   7  
ATOM   8926  N N    . TRP A 1 51 ? -4.968  -8.980  2.253   1.00 0.20 ? 51  TRP A N    7  
ATOM   8927  C CA   . TRP A 1 51 ? -4.807  -8.065  1.125   1.00 0.20 ? 51  TRP A CA   7  
ATOM   8928  C C    . TRP A 1 51 ? -6.068  -8.010  0.264   1.00 0.19 ? 51  TRP A C    7  
ATOM   8929  O O    . TRP A 1 51 ? -6.509  -6.931  -0.140  1.00 0.23 ? 51  TRP A O    7  
ATOM   8930  C CB   . TRP A 1 51 ? -3.620  -8.493  0.257   1.00 0.23 ? 51  TRP A CB   7  
ATOM   8931  C CG   . TRP A 1 51 ? -2.284  -8.362  0.921   1.00 0.24 ? 51  TRP A CG   7  
ATOM   8932  C CD1  . TRP A 1 51 ? -1.974  -7.608  2.017   1.00 0.25 ? 51  TRP A CD1  7  
ATOM   8933  C CD2  . TRP A 1 51 ? -1.066  -9.000  0.514   1.00 0.27 ? 51  TRP A CD2  7  
ATOM   8934  N NE1  . TRP A 1 51 ? -0.638  -7.742  2.315   1.00 0.28 ? 51  TRP A NE1  7  
ATOM   8935  C CE2  . TRP A 1 51 ? -0.062  -8.590  1.408   1.00 0.29 ? 51  TRP A CE2  7  
ATOM   8936  C CE3  . TRP A 1 51 ? -0.728  -9.875  -0.524  1.00 0.30 ? 51  TRP A CE3  7  
ATOM   8937  C CZ2  . TRP A 1 51 ? 1.256   -9.028  1.299   1.00 0.33 ? 51  TRP A CZ2  7  
ATOM   8938  C CZ3  . TRP A 1 51 ? 0.581   -10.313 -0.626  1.00 0.34 ? 51  TRP A CZ3  7  
ATOM   8939  C CH2  . TRP A 1 51 ? 1.558   -9.887  0.280   1.00 0.35 ? 51  TRP A CH2  7  
ATOM   8940  H H    . TRP A 1 51 ? -4.736  -9.928  2.141   1.00 0.26 ? 51  TRP A H    7  
ATOM   8941  H HA   . TRP A 1 51 ? -4.613  -7.079  1.524   1.00 0.22 ? 51  TRP A HA   7  
ATOM   8942  H HB2  . TRP A 1 51 ? -3.746  -9.526  -0.022  1.00 0.25 ? 51  TRP A HB2  7  
ATOM   8943  H HB3  . TRP A 1 51 ? -3.607  -7.886  -0.636  1.00 0.27 ? 51  TRP A HB3  7  
ATOM   8944  H HD1  . TRP A 1 51 ? -2.682  -7.002  2.563   1.00 0.26 ? 51  TRP A HD1  7  
ATOM   8945  H HE1  . TRP A 1 51 ? -0.172  -7.305  3.061   1.00 0.31 ? 51  TRP A HE1  7  
ATOM   8946  H HE3  . TRP A 1 51 ? -1.468  -10.217 -1.230  1.00 0.31 ? 51  TRP A HE3  7  
ATOM   8947  H HZ2  . TRP A 1 51 ? 2.022   -8.711  1.992   1.00 0.35 ? 51  TRP A HZ2  7  
ATOM   8948  H HZ3  . TRP A 1 51 ? 0.863   -10.988 -1.420  1.00 0.38 ? 51  TRP A HZ3  7  
ATOM   8949  H HH2  . TRP A 1 51 ? 2.570   -10.250 0.160   1.00 0.39 ? 51  TRP A HH2  7  
ATOM   8950  N N    . ASP A 1 52 ? -6.646  -9.182  0.003   1.00 0.23 ? 52  ASP A N    7  
ATOM   8951  C CA   . ASP A 1 52 ? -7.849  -9.302  -0.832  1.00 0.27 ? 52  ASP A CA   7  
ATOM   8952  C C    . ASP A 1 52 ? -8.979  -8.368  -0.381  1.00 0.24 ? 52  ASP A C    7  
ATOM   8953  O O    . ASP A 1 52 ? -9.501  -7.612  -1.202  1.00 0.24 ? 52  ASP A O    7  
ATOM   8954  C CB   . ASP A 1 52 ? -8.346  -10.751 -0.871  1.00 0.37 ? 52  ASP A CB   7  
ATOM   8955  C CG   . ASP A 1 52 ? -9.447  -10.959 -1.894  1.00 0.85 ? 52  ASP A CG   7  
ATOM   8956  O OD1  . ASP A 1 52 ? -10.629 -11.056 -1.502  1.00 1.49 ? 52  ASP A OD1  7  
ATOM   8957  O OD2  . ASP A 1 52 ? -9.136  -11.027 -3.102  1.00 1.39 ? 52  ASP A OD2  7  
ATOM   8958  H H    . ASP A 1 52 ? -6.255  -9.994  0.388   1.00 0.27 ? 52  ASP A H    7  
ATOM   8959  H HA   . ASP A 1 52 ? -7.565  -9.018  -1.835  1.00 0.30 ? 52  ASP A HA   7  
ATOM   8960  H HB2  . ASP A 1 52 ? -7.521  -11.400 -1.119  1.00 0.74 ? 52  ASP A HB2  7  
ATOM   8961  H HB3  . ASP A 1 52 ? -8.730  -11.019 0.102   1.00 0.74 ? 52  ASP A HB3  7  
ATOM   8962  N N    . PRO A 1 53 ? -9.382  -8.391  0.917   1.00 0.23 ? 53  PRO A N    7  
ATOM   8963  C CA   . PRO A 1 53 ? -10.455 -7.519  1.417   1.00 0.24 ? 53  PRO A CA   7  
ATOM   8964  C C    . PRO A 1 53 ? -10.192 -6.045  1.122   1.00 0.21 ? 53  PRO A C    7  
ATOM   8965  O O    . PRO A 1 53 ? -11.110 -5.302  0.779   1.00 0.24 ? 53  PRO A O    7  
ATOM   8966  C CB   . PRO A 1 53 ? -10.469 -7.772  2.933   1.00 0.29 ? 53  PRO A CB   7  
ATOM   8967  C CG   . PRO A 1 53 ? -9.204  -8.501  3.235   1.00 0.33 ? 53  PRO A CG   7  
ATOM   8968  C CD   . PRO A 1 53 ? -8.858  -9.260  1.989   1.00 0.28 ? 53  PRO A CD   7  
ATOM   8969  H HA   . PRO A 1 53 ? -11.412 -7.798  1.001   1.00 0.27 ? 53  PRO A HA   7  
ATOM   8970  H HB2  . PRO A 1 53 ? -10.503 -6.829  3.462   1.00 0.34 ? 53  PRO A HB2  7  
ATOM   8971  H HB3  . PRO A 1 53 ? -11.318 -8.380  3.201   1.00 0.34 ? 53  PRO A HB3  7  
ATOM   8972  H HG2  . PRO A 1 53 ? -8.423  -7.794  3.475   1.00 0.41 ? 53  PRO A HG2  7  
ATOM   8973  H HG3  . PRO A 1 53 ? -9.360  -9.187  4.053   1.00 0.44 ? 53  PRO A HG3  7  
ATOM   8974  H HD2  . PRO A 1 53 ? -7.787  -9.379  1.903   1.00 0.29 ? 53  PRO A HD2  7  
ATOM   8975  H HD3  . PRO A 1 53 ? -9.350  -10.221 1.984   1.00 0.34 ? 53  PRO A HD3  7  
ATOM   8976  N N    . ILE A 1 54 ? -8.931  -5.636  1.233   1.00 0.19 ? 54  ILE A N    7  
ATOM   8977  C CA   . ILE A 1 54 ? -8.557  -4.253  0.974   1.00 0.19 ? 54  ILE A CA   7  
ATOM   8978  C C    . ILE A 1 54 ? -8.739  -3.918  -0.504  1.00 0.16 ? 54  ILE A C    7  
ATOM   8979  O O    . ILE A 1 54 ? -9.389  -2.928  -0.849  1.00 0.17 ? 54  ILE A O    7  
ATOM   8980  C CB   . ILE A 1 54 ? -7.094  -3.966  1.380   1.00 0.22 ? 54  ILE A CB   7  
ATOM   8981  C CG1  . ILE A 1 54 ? -6.895  -4.250  2.870   1.00 0.27 ? 54  ILE A CG1  7  
ATOM   8982  C CG2  . ILE A 1 54 ? -6.727  -2.523  1.051   1.00 0.26 ? 54  ILE A CG2  7  
ATOM   8983  C CD1  . ILE A 1 54 ? -5.481  -4.001  3.352   1.00 0.34 ? 54  ILE A CD1  7  
ATOM   8984  H H    . ILE A 1 54 ? -8.238  -6.284  1.485   1.00 0.19 ? 54  ILE A H    7  
ATOM   8985  H HA   . ILE A 1 54 ? -9.203  -3.616  1.563   1.00 0.23 ? 54  ILE A HA   7  
ATOM   8986  H HB   . ILE A 1 54 ? -6.452  -4.616  0.808   1.00 0.21 ? 54  ILE A HB   7  
ATOM   8987  H HG12 . ILE A 1 54 ? -7.555  -3.618  3.443   1.00 0.31 ? 54  ILE A HG12 7  
ATOM   8988  H HG13 . ILE A 1 54 ? -7.134  -5.285  3.067   1.00 0.27 ? 54  ILE A HG13 7  
ATOM   8989  H HG21 . ILE A 1 54 ? -5.705  -2.334  1.342   1.00 0.58 ? 54  ILE A HG21 7  
ATOM   8990  H HG22 . ILE A 1 54 ? -7.384  -1.853  1.589   1.00 0.60 ? 54  ILE A HG22 7  
ATOM   8991  H HG23 . ILE A 1 54 ? -6.835  -2.355  -0.011  1.00 0.58 ? 54  ILE A HG23 7  
ATOM   8992  H HD11 . ILE A 1 54 ? -5.416  -4.224  4.406   1.00 0.71 ? 54  ILE A HD11 7  
ATOM   8993  H HD12 . ILE A 1 54 ? -5.220  -2.967  3.187   1.00 0.68 ? 54  ILE A HD12 7  
ATOM   8994  H HD13 . ILE A 1 54 ? -4.798  -4.636  2.807   1.00 0.71 ? 54  ILE A HD13 7  
ATOM   8995  N N    . THR A 1 55 ? -8.169  -4.756  -1.366  1.00 0.15 ? 55  THR A N    7  
ATOM   8996  C CA   . THR A 1 55 ? -8.267  -4.563  -2.804  1.00 0.17 ? 55  THR A CA   7  
ATOM   8997  C C    . THR A 1 55 ? -9.726  -4.519  -3.242  1.00 0.17 ? 55  THR A C    7  
ATOM   8998  O O    . THR A 1 55 ? -10.122 -3.645  -4.013  1.00 0.19 ? 55  THR A O    7  
ATOM   8999  C CB   . THR A 1 55 ? -7.536  -5.683  -3.570  1.00 0.20 ? 55  THR A CB   7  
ATOM   9000  O OG1  . THR A 1 55 ? -6.315  -6.019  -2.892  1.00 0.20 ? 55  THR A OG1  7  
ATOM   9001  C CG2  . THR A 1 55 ? -7.222  -5.251  -4.996  1.00 0.27 ? 55  THR A CG2  7  
ATOM   9002  H H    . THR A 1 55 ? -7.662  -5.526  -1.023  1.00 0.16 ? 55  THR A H    7  
ATOM   9003  H HA   . THR A 1 55 ? -7.799  -3.619  -3.048  1.00 0.19 ? 55  THR A HA   7  
ATOM   9004  H HB   . THR A 1 55 ? -8.176  -6.554  -3.605  1.00 0.22 ? 55  THR A HB   7  
ATOM   9005  H HG1  . THR A 1 55 ? -6.196  -6.973  -2.902  1.00 0.26 ? 55  THR A HG1  7  
ATOM   9006  H HG21 . THR A 1 55 ? -6.724  -6.057  -5.517  1.00 0.49 ? 55  THR A HG21 7  
ATOM   9007  H HG22 . THR A 1 55 ? -6.579  -4.385  -4.974  1.00 0.48 ? 55  THR A HG22 7  
ATOM   9008  H HG23 . THR A 1 55 ? -8.141  -5.005  -5.510  1.00 0.46 ? 55  THR A HG23 7  
ATOM   9009  N N    . ALA A 1 56 ? -10.522 -5.453  -2.731  1.00 0.18 ? 56  ALA A N    7  
ATOM   9010  C CA   . ALA A 1 56 ? -11.938 -5.520  -3.063  1.00 0.21 ? 56  ALA A CA   7  
ATOM   9011  C C    . ALA A 1 56 ? -12.656 -4.248  -2.622  1.00 0.20 ? 56  ALA A C    7  
ATOM   9012  O O    . ALA A 1 56 ? -13.407 -3.648  -3.392  1.00 0.24 ? 56  ALA A O    7  
ATOM   9013  C CB   . ALA A 1 56 ? -12.576 -6.739  -2.414  1.00 0.25 ? 56  ALA A CB   7  
ATOM   9014  H H    . ALA A 1 56 ? -10.142 -6.120  -2.114  1.00 0.18 ? 56  ALA A H    7  
ATOM   9015  H HA   . ALA A 1 56 ? -12.027 -5.619  -4.136  1.00 0.23 ? 56  ALA A HA   7  
ATOM   9016  H HB1  . ALA A 1 56 ? -12.511 -6.650  -1.340  1.00 0.42 ? 56  ALA A HB1  7  
ATOM   9017  H HB2  . ALA A 1 56 ? -12.054 -7.630  -2.734  1.00 0.43 ? 56  ALA A HB2  7  
ATOM   9018  H HB3  . ALA A 1 56 ? -13.614 -6.803  -2.709  1.00 0.43 ? 56  ALA A HB3  7  
ATOM   9019  N N    . ALA A 1 57 ? -12.400 -3.833  -1.384  1.00 0.19 ? 57  ALA A N    7  
ATOM   9020  C CA   . ALA A 1 57 ? -13.014 -2.632  -0.832  1.00 0.20 ? 57  ALA A CA   7  
ATOM   9021  C C    . ALA A 1 57 ? -12.638 -1.397  -1.644  1.00 0.19 ? 57  ALA A C    7  
ATOM   9022  O O    . ALA A 1 57 ? -13.495 -0.577  -1.975  1.00 0.22 ? 57  ALA A O    7  
ATOM   9023  C CB   . ALA A 1 57 ? -12.602 -2.452  0.623   1.00 0.23 ? 57  ALA A CB   7  
ATOM   9024  H H    . ALA A 1 57 ? -11.786 -4.357  -0.820  1.00 0.20 ? 57  ALA A H    7  
ATOM   9025  H HA   . ALA A 1 57 ? -14.088 -2.760  -0.862  1.00 0.23 ? 57  ALA A HA   7  
ATOM   9026  H HB1  . ALA A 1 57 ? -12.977 -3.277  1.209   1.00 0.41 ? 57  ALA A HB1  7  
ATOM   9027  H HB2  . ALA A 1 57 ? -13.010 -1.527  1.001   1.00 0.39 ? 57  ALA A HB2  7  
ATOM   9028  H HB3  . ALA A 1 57 ? -11.524 -2.424  0.690   1.00 0.38 ? 57  ALA A HB3  7  
ATOM   9029  N N    . LEU A 1 58 ? -11.357 -1.277  -1.975  1.00 0.18 ? 58  LEU A N    7  
ATOM   9030  C CA   . LEU A 1 58 ? -10.871 -0.141  -2.745  1.00 0.19 ? 58  LEU A CA   7  
ATOM   9031  C C    . LEU A 1 58 ? -11.445 -0.158  -4.157  1.00 0.20 ? 58  LEU A C    7  
ATOM   9032  O O    . LEU A 1 58 ? -11.776 0.891   -4.701  1.00 0.24 ? 58  LEU A O    7  
ATOM   9033  C CB   . LEU A 1 58 ? -9.343  -0.125  -2.784  1.00 0.21 ? 58  LEU A CB   7  
ATOM   9034  C CG   . LEU A 1 58 ? -8.668  0.154   -1.436  1.00 0.37 ? 58  LEU A CG   7  
ATOM   9035  C CD1  . LEU A 1 58 ? -7.166  0.286   -1.609  1.00 0.35 ? 58  LEU A CD1  7  
ATOM   9036  C CD2  . LEU A 1 58 ? -9.241  1.408   -0.790  1.00 0.73 ? 58  LEU A CD2  7  
ATOM   9037  H H    . LEU A 1 58 ? -10.719 -1.973  -1.685  1.00 0.19 ? 58  LEU A H    7  
ATOM   9038  H HA   . LEU A 1 58 ? -11.214 0.757   -2.252  1.00 0.20 ? 58  LEU A HA   7  
ATOM   9039  H HB2  . LEU A 1 58 ? -9.004  -1.085  -3.142  1.00 0.31 ? 58  LEU A HB2  7  
ATOM   9040  H HB3  . LEU A 1 58 ? -9.029  0.635   -3.486  1.00 0.39 ? 58  LEU A HB3  7  
ATOM   9041  H HG   . LEU A 1 58 ? -8.854  -0.678  -0.772  1.00 0.55 ? 58  LEU A HG   7  
ATOM   9042  H HD11 . LEU A 1 58 ? -6.708  0.451   -0.647  1.00 0.71 ? 58  LEU A HD11 7  
ATOM   9043  H HD12 . LEU A 1 58 ? -6.949  1.120   -2.258  1.00 0.67 ? 58  LEU A HD12 7  
ATOM   9044  H HD13 . LEU A 1 58 ? -6.774  -0.622  -2.043  1.00 0.64 ? 58  LEU A HD13 7  
ATOM   9045  H HD21 . LEU A 1 58 ? -10.264 1.226   -0.500  1.00 1.19 ? 58  LEU A HD21 7  
ATOM   9046  H HD22 . LEU A 1 58 ? -9.207  2.226   -1.495  1.00 1.00 ? 58  LEU A HD22 7  
ATOM   9047  H HD23 . LEU A 1 58 ? -8.660  1.661   0.084   1.00 1.19 ? 58  LEU A HD23 7  
ATOM   9048  N N    . SER A 1 59 ? -11.572 -1.345  -4.741  1.00 0.20 ? 59  SER A N    7  
ATOM   9049  C CA   . SER A 1 59 ? -12.130 -1.473  -6.084  1.00 0.23 ? 59  SER A CA   7  
ATOM   9050  C C    . SER A 1 59 ? -13.585 -1.019  -6.079  1.00 0.23 ? 59  SER A C    7  
ATOM   9051  O O    . SER A 1 59 ? -14.029 -0.301  -6.976  1.00 0.25 ? 59  SER A O    7  
ATOM   9052  C CB   . SER A 1 59 ? -12.017 -2.916  -6.578  1.00 0.29 ? 59  SER A CB   7  
ATOM   9053  O OG   . SER A 1 59 ? -10.666 -3.351  -6.570  1.00 0.85 ? 59  SER A OG   7  
ATOM   9054  H H    . SER A 1 59 ? -11.285 -2.153  -4.260  1.00 0.21 ? 59  SER A H    7  
ATOM   9055  H HA   . SER A 1 59 ? -11.564 -0.829  -6.741  1.00 0.25 ? 59  SER A HA   7  
ATOM   9056  H HB2  . SER A 1 59 ? -12.592 -3.563  -5.930  1.00 0.65 ? 59  SER A HB2  7  
ATOM   9057  H HB3  . SER A 1 59 ? -12.399 -2.982  -7.585  1.00 0.73 ? 59  SER A HB3  7  
ATOM   9058  H HG   . SER A 1 59 ? -10.354 -3.404  -5.656  1.00 1.33 ? 59  SER A HG   7  
ATOM   9059  N N    . GLN A 1 60 ? -14.315 -1.440  -5.051  1.00 0.24 ? 60  GLN A N    7  
ATOM   9060  C CA   . GLN A 1 60 ? -15.710 -1.060  -4.896  1.00 0.28 ? 60  GLN A CA   7  
ATOM   9061  C C    . GLN A 1 60 ? -15.809 0.452   -4.709  1.00 0.26 ? 60  GLN A C    7  
ATOM   9062  O O    . GLN A 1 60 ? -16.603 1.124   -5.362  1.00 0.29 ? 60  GLN A O    7  
ATOM   9063  C CB   . GLN A 1 60 ? -16.325 -1.780  -3.694  1.00 0.34 ? 60  GLN A CB   7  
ATOM   9064  C CG   . GLN A 1 60 ? -17.769 -1.388  -3.425  1.00 0.50 ? 60  GLN A CG   7  
ATOM   9065  C CD   . GLN A 1 60 ? -18.250 -1.792  -2.043  1.00 0.63 ? 60  GLN A CD   7  
ATOM   9066  O OE1  . GLN A 1 60 ? -19.425 -2.102  -1.851  1.00 0.92 ? 60  GLN A OE1  7  
ATOM   9067  N NE2  . GLN A 1 60 ? -17.354 -1.782  -1.066  1.00 0.77 ? 60  GLN A NE2  7  
ATOM   9068  H H    . GLN A 1 60 ? -13.904 -2.031  -4.382  1.00 0.25 ? 60  GLN A H    7  
ATOM   9069  H HA   . GLN A 1 60 ? -16.238 -1.342  -5.793  1.00 0.31 ? 60  GLN A HA   7  
ATOM   9070  H HB2  . GLN A 1 60 ? -16.289 -2.845  -3.870  1.00 0.45 ? 60  GLN A HB2  7  
ATOM   9071  H HB3  . GLN A 1 60 ? -15.741 -1.550  -2.814  1.00 0.42 ? 60  GLN A HB3  7  
ATOM   9072  H HG2  . GLN A 1 60 ? -17.858 -0.316  -3.522  1.00 0.61 ? 60  GLN A HG2  7  
ATOM   9073  H HG3  . GLN A 1 60 ? -18.398 -1.866  -4.162  1.00 0.63 ? 60  GLN A HG3  7  
ATOM   9074  H HE21 . GLN A 1 60 ? -16.435 -1.520  -1.280  1.00 0.92 ? 60  GLN A HE21 7  
ATOM   9075  H HE22 . GLN A 1 60 ? -17.650 -2.038  -0.165  1.00 0.90 ? 60  GLN A HE22 7  
ATOM   9076  N N    . ARG A 1 61 ? -14.964 0.970   -3.824  1.00 0.29 ? 61  ARG A N    7  
ATOM   9077  C CA   . ARG A 1 61 ? -14.910 2.396   -3.526  1.00 0.34 ? 61  ARG A CA   7  
ATOM   9078  C C    . ARG A 1 61 ? -14.627 3.200   -4.792  1.00 0.30 ? 61  ARG A C    7  
ATOM   9079  O O    . ARG A 1 61 ? -15.293 4.194   -5.070  1.00 0.34 ? 61  ARG A O    7  
ATOM   9080  C CB   . ARG A 1 61 ? -13.820 2.642   -2.477  1.00 0.45 ? 61  ARG A CB   7  
ATOM   9081  C CG   . ARG A 1 61 ? -13.372 4.090   -2.337  1.00 0.65 ? 61  ARG A CG   7  
ATOM   9082  C CD   . ARG A 1 61 ? -12.006 4.168   -1.664  1.00 0.67 ? 61  ARG A CD   7  
ATOM   9083  N NE   . ARG A 1 61 ? -11.813 5.416   -0.925  1.00 0.81 ? 61  ARG A NE   7  
ATOM   9084  C CZ   . ARG A 1 61 ? -12.224 5.607   0.331   1.00 1.09 ? 61  ARG A CZ   7  
ATOM   9085  N NH1  . ARG A 1 61 ? -12.843 4.637   0.987   1.00 1.47 ? 61  ARG A NH1  7  
ATOM   9086  N NH2  . ARG A 1 61 ? -12.016 6.774   0.929   1.00 1.42 ? 61  ARG A NH2  7  
ATOM   9087  H H    . ARG A 1 61 ? -14.351 0.367   -3.348  1.00 0.30 ? 61  ARG A H    7  
ATOM   9088  H HA   . ARG A 1 61 ? -15.866 2.692   -3.124  1.00 0.40 ? 61  ARG A HA   7  
ATOM   9089  H HB2  . ARG A 1 61 ? -14.187 2.314   -1.518  1.00 0.72 ? 61  ARG A HB2  7  
ATOM   9090  H HB3  . ARG A 1 61 ? -12.955 2.048   -2.737  1.00 0.82 ? 61  ARG A HB3  7  
ATOM   9091  H HG2  . ARG A 1 61 ? -13.308 4.536   -3.319  1.00 1.08 ? 61  ARG A HG2  7  
ATOM   9092  H HG3  . ARG A 1 61 ? -14.093 4.627   -1.738  1.00 1.01 ? 61  ARG A HG3  7  
ATOM   9093  H HD2  . ARG A 1 61 ? -11.909 3.339   -0.980  1.00 0.88 ? 61  ARG A HD2  7  
ATOM   9094  H HD3  . ARG A 1 61 ? -11.244 4.091   -2.426  1.00 0.79 ? 61  ARG A HD3  7  
ATOM   9095  H HE   . ARG A 1 61 ? -11.319 6.142   -1.384  1.00 1.11 ? 61  ARG A HE   7  
ATOM   9096  H HH11 . ARG A 1 61 ? -13.149 4.782   1.942   1.00 1.93 ? 61  ARG A HH11 7  
ATOM   9097  H HH12 . ARG A 1 61 ? -13.007 3.753   0.545   1.00 1.47 ? 61  ARG A HH12 7  
ATOM   9098  H HH21 . ARG A 1 61 ? -11.548 7.515   0.442   1.00 1.53 ? 61  ARG A HH21 7  
ATOM   9099  H HH22 . ARG A 1 61 ? -12.330 6.916   1.871   1.00 1.76 ? 61  ARG A HH22 7  
ATOM   9100  N N    . ALA A 1 62 ? -13.654 2.739   -5.565  1.00 0.27 ? 62  ALA A N    7  
ATOM   9101  C CA   . ALA A 1 62 ? -13.263 3.407   -6.800  1.00 0.29 ? 62  ALA A CA   7  
ATOM   9102  C C    . ALA A 1 62 ? -14.405 3.465   -7.804  1.00 0.30 ? 62  ALA A C    7  
ATOM   9103  O O    . ALA A 1 62 ? -14.759 4.537   -8.290  1.00 0.41 ? 62  ALA A O    7  
ATOM   9104  C CB   . ALA A 1 62 ? -12.065 2.705   -7.417  1.00 0.31 ? 62  ALA A CB   7  
ATOM   9105  H H    . ALA A 1 62 ? -13.175 1.924   -5.293  1.00 0.26 ? 62  ALA A H    7  
ATOM   9106  H HA   . ALA A 1 62 ? -12.966 4.415   -6.552  1.00 0.34 ? 62  ALA A HA   7  
ATOM   9107  H HB1  . ALA A 1 62 ? -12.343 1.702   -7.703  1.00 0.40 ? 62  ALA A HB1  7  
ATOM   9108  H HB2  . ALA A 1 62 ? -11.260 2.664   -6.697  1.00 0.44 ? 62  ALA A HB2  7  
ATOM   9109  H HB3  . ALA A 1 62 ? -11.738 3.250   -8.288  1.00 0.46 ? 62  ALA A HB3  7  
ATOM   9110  N N    . MET A 1 63 ? -15.002 2.315   -8.085  1.00 0.26 ? 63  MET A N    7  
ATOM   9111  C CA   . MET A 1 63 ? -16.085 2.233   -9.063  1.00 0.32 ? 63  MET A CA   7  
ATOM   9112  C C    . MET A 1 63 ? -17.371 2.911   -8.580  1.00 0.32 ? 63  MET A C    7  
ATOM   9113  O O    . MET A 1 63 ? -18.256 3.210   -9.382  1.00 0.42 ? 63  MET A O    7  
ATOM   9114  C CB   . MET A 1 63 ? -16.368 0.769   -9.415  1.00 0.37 ? 63  MET A CB   7  
ATOM   9115  C CG   . MET A 1 63 ? -17.194 0.030   -8.369  1.00 0.38 ? 63  MET A CG   7  
ATOM   9116  S SD   . MET A 1 63 ? -17.580 -1.667  -8.843  1.00 0.50 ? 63  MET A SD   7  
ATOM   9117  C CE   . MET A 1 63 ? -15.968 -2.432  -8.701  1.00 0.71 ? 63  MET A CE   7  
ATOM   9118  H H    . MET A 1 63 ? -14.705 1.496   -7.627  1.00 0.27 ? 63  MET A H    7  
ATOM   9119  H HA   . MET A 1 63 ? -15.750 2.739   -9.954  1.00 0.36 ? 63  MET A HA   7  
ATOM   9120  H HB2  . MET A 1 63 ? -16.899 0.733   -10.356 1.00 0.43 ? 63  MET A HB2  7  
ATOM   9121  H HB3  . MET A 1 63 ? -15.425 0.253   -9.527  1.00 0.42 ? 63  MET A HB3  7  
ATOM   9122  H HG2  . MET A 1 63 ? -16.639 0.011   -7.443  1.00 0.38 ? 63  MET A HG2  7  
ATOM   9123  H HG3  . MET A 1 63 ? -18.120 0.565   -8.218  1.00 0.39 ? 63  MET A HG3  7  
ATOM   9124  H HE1  . MET A 1 63 ? -15.274 -1.931  -9.357  1.00 0.96 ? 63  MET A HE1  7  
ATOM   9125  H HE2  . MET A 1 63 ? -16.040 -3.474  -8.978  1.00 0.93 ? 63  MET A HE2  7  
ATOM   9126  H HE3  . MET A 1 63 ? -15.621 -2.354  -7.681  1.00 0.95 ? 63  MET A HE3  7  
ATOM   9127  N N    . ILE A 1 64 ? -17.487 3.149   -7.281  1.00 0.28 ? 64  ILE A N    7  
ATOM   9128  C CA   . ILE A 1 64 ? -18.685 3.782   -6.738  1.00 0.31 ? 64  ILE A CA   7  
ATOM   9129  C C    . ILE A 1 64 ? -18.496 5.286   -6.554  1.00 0.31 ? 64  ILE A C    7  
ATOM   9130  O O    . ILE A 1 64 ? -19.340 6.078   -6.977  1.00 0.37 ? 64  ILE A O    7  
ATOM   9131  C CB   . ILE A 1 64 ? -19.118 3.137   -5.397  1.00 0.35 ? 64  ILE A CB   7  
ATOM   9132  C CG1  . ILE A 1 64 ? -19.683 1.736   -5.651  1.00 0.38 ? 64  ILE A CG1  7  
ATOM   9133  C CG2  . ILE A 1 64 ? -20.149 4.005   -4.681  1.00 0.43 ? 64  ILE A CG2  7  
ATOM   9134  C CD1  . ILE A 1 64 ? -20.236 1.062   -4.410  1.00 0.46 ? 64  ILE A CD1  7  
ATOM   9135  H H    . ILE A 1 64 ? -16.761 2.886   -6.674  1.00 0.29 ? 64  ILE A H    7  
ATOM   9136  H HA   . ILE A 1 64 ? -19.482 3.625   -7.452  1.00 0.35 ? 64  ILE A HA   7  
ATOM   9137  H HB   . ILE A 1 64 ? -18.249 3.055   -4.762  1.00 0.34 ? 64  ILE A HB   7  
ATOM   9138  H HG12 . ILE A 1 64 ? -20.485 1.806   -6.371  1.00 0.44 ? 64  ILE A HG12 7  
ATOM   9139  H HG13 . ILE A 1 64 ? -18.901 1.109   -6.051  1.00 0.36 ? 64  ILE A HG13 7  
ATOM   9140  H HG21 . ILE A 1 64 ? -20.260 3.671   -3.660  1.00 0.59 ? 64  ILE A HG21 7  
ATOM   9141  H HG22 . ILE A 1 64 ? -21.098 3.927   -5.189  1.00 0.58 ? 64  ILE A HG22 7  
ATOM   9142  H HG23 . ILE A 1 64 ? -19.821 5.035   -4.691  1.00 0.58 ? 64  ILE A HG23 7  
ATOM   9143  H HD11 . ILE A 1 64 ? -21.073 1.633   -4.034  1.00 0.62 ? 64  ILE A HD11 7  
ATOM   9144  H HD12 . ILE A 1 64 ? -19.467 1.011   -3.653  1.00 0.57 ? 64  ILE A HD12 7  
ATOM   9145  H HD13 . ILE A 1 64 ? -20.564 0.064   -4.658  1.00 0.59 ? 64  ILE A HD13 7  
ATOM   9146  N N    . LEU A 1 65 ? -17.385 5.679   -5.946  1.00 0.29 ? 65  LEU A N    7  
ATOM   9147  C CA   . LEU A 1 65 ? -17.116 7.091   -5.689  1.00 0.33 ? 65  LEU A CA   7  
ATOM   9148  C C    . LEU A 1 65 ? -16.630 7.813   -6.939  1.00 0.34 ? 65  LEU A C    7  
ATOM   9149  O O    . LEU A 1 65 ? -16.845 9.016   -7.089  1.00 0.47 ? 65  LEU A O    7  
ATOM   9150  C CB   . LEU A 1 65 ? -16.087 7.247   -4.565  1.00 0.40 ? 65  LEU A CB   7  
ATOM   9151  C CG   . LEU A 1 65 ? -16.676 7.388   -3.159  1.00 0.93 ? 65  LEU A CG   7  
ATOM   9152  C CD1  . LEU A 1 65 ? -17.369 6.106   -2.729  1.00 1.61 ? 65  LEU A CD1  7  
ATOM   9153  C CD2  . LEU A 1 65 ? -15.588 7.766   -2.167  1.00 0.99 ? 65  LEU A CD2  7  
ATOM   9154  H H    . LEU A 1 65 ? -16.725 5.004   -5.666  1.00 0.30 ? 65  LEU A H    7  
ATOM   9155  H HA   . LEU A 1 65 ? -18.042 7.544   -5.370  1.00 0.39 ? 65  LEU A HA   7  
ATOM   9156  H HB2  . LEU A 1 65 ? -15.440 6.384   -4.576  1.00 0.77 ? 65  LEU A HB2  7  
ATOM   9157  H HB3  . LEU A 1 65 ? -15.493 8.125   -4.772  1.00 0.73 ? 65  LEU A HB3  7  
ATOM   9158  H HG   . LEU A 1 65 ? -17.414 8.177   -3.164  1.00 1.40 ? 65  LEU A HG   7  
ATOM   9159  H HD11 . LEU A 1 65 ? -16.656 5.295   -2.727  1.00 1.79 ? 65  LEU A HD11 7  
ATOM   9160  H HD12 . LEU A 1 65 ? -18.170 5.878   -3.419  1.00 1.94 ? 65  LEU A HD12 7  
ATOM   9161  H HD13 . LEU A 1 65 ? -17.774 6.231   -1.736  1.00 2.09 ? 65  LEU A HD13 7  
ATOM   9162  H HD21 . LEU A 1 65 ? -16.003 7.800   -1.172  1.00 1.31 ? 65  LEU A HD21 7  
ATOM   9163  H HD22 . LEU A 1 65 ? -15.188 8.736   -2.424  1.00 1.14 ? 65  LEU A HD22 7  
ATOM   9164  H HD23 . LEU A 1 65 ? -14.799 7.031   -2.202  1.00 1.50 ? 65  LEU A HD23 7  
ATOM   9165  N N    . GLY A 1 66 ? -15.969 7.088   -7.828  1.00 0.30 ? 66  GLY A N    7  
ATOM   9166  C CA   . GLY A 1 66 ? -15.472 7.691   -9.051  1.00 0.36 ? 66  GLY A CA   7  
ATOM   9167  C C    . GLY A 1 66 ? -14.039 8.168   -8.919  1.00 0.43 ? 66  GLY A C    7  
ATOM   9168  O O    . GLY A 1 66 ? -13.601 9.053   -9.655  1.00 0.81 ? 66  GLY A O    7  
ATOM   9169  H H    . GLY A 1 66 ? -15.819 6.131   -7.659  1.00 0.33 ? 66  GLY A H    7  
ATOM   9170  H HA2  . GLY A 1 66 ? -15.524 6.963   -9.844  1.00 0.40 ? 66  GLY A HA2  7  
ATOM   9171  H HA3  . GLY A 1 66 ? -16.099 8.534   -9.309  1.00 0.41 ? 66  GLY A HA3  7  
ATOM   9172  N N    . LYS A 1 67 ? -13.312 7.586   -7.979  1.00 0.43 ? 67  LYS A N    7  
ATOM   9173  C CA   . LYS A 1 67 ? -11.918 7.943   -7.753  1.00 0.47 ? 67  LYS A CA   7  
ATOM   9174  C C    . LYS A 1 67 ? -11.106 6.680   -7.492  1.00 0.35 ? 67  LYS A C    7  
ATOM   9175  O O    . LYS A 1 67 ? -11.529 5.811   -6.737  1.00 0.44 ? 67  LYS A O    7  
ATOM   9176  C CB   . LYS A 1 67 ? -11.780 8.920   -6.578  1.00 0.65 ? 67  LYS A CB   7  
ATOM   9177  C CG   . LYS A 1 67 ? -12.198 8.340   -5.234  1.00 0.74 ? 67  LYS A CG   7  
ATOM   9178  C CD   . LYS A 1 67 ? -11.495 9.033   -4.075  1.00 1.10 ? 67  LYS A CD   7  
ATOM   9179  C CE   . LYS A 1 67 ? -12.260 10.255  -3.584  1.00 1.28 ? 67  LYS A CE   7  
ATOM   9180  N NZ   . LYS A 1 67 ? -12.234 11.369  -4.569  1.00 1.52 ? 67  LYS A NZ   7  
ATOM   9181  H H    . LYS A 1 67 ? -13.716 6.884   -7.427  1.00 0.69 ? 67  LYS A H    7  
ATOM   9182  H HA   . LYS A 1 67 ? -11.548 8.416   -8.651  1.00 0.55 ? 67  LYS A HA   7  
ATOM   9183  H HB2  . LYS A 1 67 ? -10.748 9.228   -6.505  1.00 0.82 ? 67  LYS A HB2  7  
ATOM   9184  H HB3  . LYS A 1 67 ? -12.392 9.788   -6.774  1.00 0.78 ? 67  LYS A HB3  7  
ATOM   9185  H HG2  . LYS A 1 67 ? -13.265 8.458   -5.117  1.00 0.86 ? 67  LYS A HG2  7  
ATOM   9186  H HG3  . LYS A 1 67 ? -11.950 7.288   -5.218  1.00 0.86 ? 67  LYS A HG3  7  
ATOM   9187  H HD2  . LYS A 1 67 ? -11.394 8.333   -3.259  1.00 1.44 ? 67  LYS A HD2  7  
ATOM   9188  H HD3  . LYS A 1 67 ? -10.514 9.345   -4.404  1.00 1.29 ? 67  LYS A HD3  7  
ATOM   9189  H HE2  . LYS A 1 67 ? -13.285 9.975   -3.404  1.00 1.52 ? 67  LYS A HE2  7  
ATOM   9190  H HE3  . LYS A 1 67 ? -11.814 10.594  -2.660  1.00 1.71 ? 67  LYS A HE3  7  
ATOM   9191  H HZ1  . LYS A 1 67 ? -11.252 11.616  -4.806  1.00 1.85 ? 67  LYS A HZ1  7  
ATOM   9192  H HZ2  . LYS A 1 67 ? -12.702 12.211  -4.172  1.00 1.82 ? 67  LYS A HZ2  7  
ATOM   9193  H HZ3  . LYS A 1 67 ? -12.735 11.094  -5.437  1.00 1.90 ? 67  LYS A HZ3  7  
ATOM   9194  N N    . SER A 1 68 ? -9.954  6.574   -8.125  1.00 0.30 ? 68  SER A N    7  
ATOM   9195  C CA   . SER A 1 68 ? -9.111  5.401   -7.957  1.00 0.32 ? 68  SER A CA   7  
ATOM   9196  C C    . SER A 1 68 ? -7.720  5.789   -7.460  1.00 0.28 ? 68  SER A C    7  
ATOM   9197  O O    . SER A 1 68 ? -6.757  5.045   -7.643  1.00 0.33 ? 68  SER A O    7  
ATOM   9198  C CB   . SER A 1 68 ? -9.011  4.644   -9.286  1.00 0.46 ? 68  SER A CB   7  
ATOM   9199  O OG   . SER A 1 68 ? -10.133 4.919   -10.115 1.00 0.91 ? 68  SER A OG   7  
ATOM   9200  H H    . SER A 1 68 ? -9.661  7.297   -8.720  1.00 0.38 ? 68  SER A H    7  
ATOM   9201  H HA   . SER A 1 68 ? -9.578  4.759   -7.225  1.00 0.38 ? 68  SER A HA   7  
ATOM   9202  H HB2  . SER A 1 68 ? -8.113  4.945   -9.804  1.00 0.76 ? 68  SER A HB2  7  
ATOM   9203  H HB3  . SER A 1 68 ? -8.976  3.581   -9.092  1.00 0.77 ? 68  SER A HB3  7  
ATOM   9204  H HG   . SER A 1 68 ? -10.920 4.501   -9.743  1.00 1.45 ? 68  SER A HG   7  
ATOM   9205  N N    . GLY A 1 69 ? -7.628  6.948   -6.815  1.00 0.29 ? 69  GLY A N    7  
ATOM   9206  C CA   . GLY A 1 69 ? -6.353  7.424   -6.303  1.00 0.35 ? 69  GLY A CA   7  
ATOM   9207  C C    . GLY A 1 69 ? -5.718  6.456   -5.321  1.00 0.32 ? 69  GLY A C    7  
ATOM   9208  O O    . GLY A 1 69 ? -4.564  6.054   -5.488  1.00 0.41 ? 69  GLY A O    7  
ATOM   9209  H H    . GLY A 1 69 ? -8.437  7.481   -6.674  1.00 0.33 ? 69  GLY A H    7  
ATOM   9210  H HA2  . GLY A 1 69 ? -5.679  7.571   -7.133  1.00 0.40 ? 69  GLY A HA2  7  
ATOM   9211  H HA3  . GLY A 1 69 ? -6.509  8.372   -5.809  1.00 0.42 ? 69  GLY A HA3  7  
ATOM   9212  N N    . GLU A 1 70 ? -6.484  6.065   -4.312  1.00 0.34 ? 70  GLU A N    7  
ATOM   9213  C CA   . GLU A 1 70 ? -6.009  5.140   -3.292  1.00 0.38 ? 70  GLU A CA   7  
ATOM   9214  C C    . GLU A 1 70 ? -5.728  3.765   -3.900  1.00 0.32 ? 70  GLU A C    7  
ATOM   9215  O O    . GLU A 1 70 ? -4.826  3.050   -3.464  1.00 0.39 ? 70  GLU A O    7  
ATOM   9216  C CB   . GLU A 1 70 ? -7.046  5.014   -2.166  1.00 0.52 ? 70  GLU A CB   7  
ATOM   9217  C CG   . GLU A 1 70 ? -7.538  6.352   -1.627  1.00 0.66 ? 70  GLU A CG   7  
ATOM   9218  C CD   . GLU A 1 70 ? -8.841  6.804   -2.263  1.00 0.70 ? 70  GLU A CD   7  
ATOM   9219  O OE1  . GLU A 1 70 ? -9.767  7.200   -1.518  1.00 1.24 ? 70  GLU A OE1  7  
ATOM   9220  O OE2  . GLU A 1 70 ? -8.942  6.766   -3.508  1.00 1.08 ? 70  GLU A OE2  7  
ATOM   9221  H H    . GLU A 1 70 ? -7.405  6.420   -4.243  1.00 0.40 ? 70  GLU A H    7  
ATOM   9222  H HA   . GLU A 1 70 ? -5.090  5.537   -2.882  1.00 0.42 ? 70  GLU A HA   7  
ATOM   9223  H HB2  . GLU A 1 70 ? -7.898  4.467   -2.539  1.00 0.52 ? 70  GLU A HB2  7  
ATOM   9224  H HB3  . GLU A 1 70 ? -6.606  4.461   -1.349  1.00 0.64 ? 70  GLU A HB3  7  
ATOM   9225  H HG2  . GLU A 1 70 ? -7.689  6.261   -0.562  1.00 0.80 ? 70  GLU A HG2  7  
ATOM   9226  H HG3  . GLU A 1 70 ? -6.782  7.101   -1.819  1.00 0.82 ? 70  GLU A HG3  7  
ATOM   9227  N N    . LEU A 1 71 ? -6.501  3.414   -4.922  1.00 0.28 ? 71  LEU A N    7  
ATOM   9228  C CA   . LEU A 1 71 ? -6.353  2.129   -5.597  1.00 0.28 ? 71  LEU A CA   7  
ATOM   9229  C C    . LEU A 1 71 ? -5.033  2.070   -6.364  1.00 0.26 ? 71  LEU A C    7  
ATOM   9230  O O    . LEU A 1 71 ? -4.371  1.031   -6.395  1.00 0.30 ? 71  LEU A O    7  
ATOM   9231  C CB   . LEU A 1 71 ? -7.533  1.895   -6.550  1.00 0.34 ? 71  LEU A CB   7  
ATOM   9232  C CG   . LEU A 1 71 ? -7.920  0.428   -6.776  1.00 0.58 ? 71  LEU A CG   7  
ATOM   9233  C CD1  . LEU A 1 71 ? -9.335  0.331   -7.318  1.00 0.89 ? 71  LEU A CD1  7  
ATOM   9234  C CD2  . LEU A 1 71 ? -6.946  -0.255  -7.729  1.00 1.43 ? 71  LEU A CD2  7  
ATOM   9235  H H    . LEU A 1 71 ? -7.186  4.041   -5.232  1.00 0.34 ? 71  LEU A H    7  
ATOM   9236  H HA   . LEU A 1 71 ? -6.351  1.358   -4.843  1.00 0.33 ? 71  LEU A HA   7  
ATOM   9237  H HB2  . LEU A 1 71 ? -8.392  2.414   -6.154  1.00 0.54 ? 71  LEU A HB2  7  
ATOM   9238  H HB3  . LEU A 1 71 ? -7.283  2.329   -7.509  1.00 0.61 ? 71  LEU A HB3  7  
ATOM   9239  H HG   . LEU A 1 71 ? -7.890  -0.096  -5.831  1.00 1.35 ? 71  LEU A HG   7  
ATOM   9240  H HD11 . LEU A 1 71 ? -10.026 0.721   -6.585  1.00 1.64 ? 71  LEU A HD11 7  
ATOM   9241  H HD12 . LEU A 1 71 ? -9.573  -0.703  -7.525  1.00 1.06 ? 71  LEU A HD12 7  
ATOM   9242  H HD13 . LEU A 1 71 ? -9.414  0.908   -8.227  1.00 1.33 ? 71  LEU A HD13 7  
ATOM   9243  H HD21 . LEU A 1 71 ? -5.958  -0.254  -7.293  1.00 2.09 ? 71  LEU A HD21 7  
ATOM   9244  H HD22 . LEU A 1 71 ? -6.926  0.279   -8.668  1.00 1.87 ? 71  LEU A HD22 7  
ATOM   9245  H HD23 . LEU A 1 71 ? -7.261  -1.274  -7.898  1.00 1.71 ? 71  LEU A HD23 7  
ATOM   9246  N N    . LYS A 1 72 ? -4.655  3.185   -6.978  1.00 0.26 ? 72  LYS A N    7  
ATOM   9247  C CA   . LYS A 1 72 ? -3.412  3.253   -7.739  1.00 0.30 ? 72  LYS A CA   7  
ATOM   9248  C C    . LYS A 1 72 ? -2.216  2.962   -6.845  1.00 0.27 ? 72  LYS A C    7  
ATOM   9249  O O    . LYS A 1 72 ? -1.344  2.170   -7.200  1.00 0.33 ? 72  LYS A O    7  
ATOM   9250  C CB   . LYS A 1 72 ? -3.260  4.628   -8.394  1.00 0.39 ? 72  LYS A CB   7  
ATOM   9251  C CG   . LYS A 1 72 ? -4.229  4.860   -9.542  1.00 0.50 ? 72  LYS A CG   7  
ATOM   9252  C CD   . LYS A 1 72 ? -3.517  5.361   -10.785 1.00 0.74 ? 72  LYS A CD   7  
ATOM   9253  C CE   . LYS A 1 72 ? -3.038  6.792   -10.621 1.00 1.11 ? 72  LYS A CE   7  
ATOM   9254  N NZ   . LYS A 1 72 ? -2.266  7.254   -11.805 1.00 1.44 ? 72  LYS A NZ   7  
ATOM   9255  H H    . LYS A 1 72 ? -5.228  3.981   -6.923  1.00 0.28 ? 72  LYS A H    7  
ATOM   9256  H HA   . LYS A 1 72 ? -3.459  2.501   -8.512  1.00 0.35 ? 72  LYS A HA   7  
ATOM   9257  H HB2  . LYS A 1 72 ? -3.428  5.389   -7.647  1.00 0.45 ? 72  LYS A HB2  7  
ATOM   9258  H HB3  . LYS A 1 72 ? -2.254  4.725   -8.773  1.00 0.49 ? 72  LYS A HB3  7  
ATOM   9259  H HG2  . LYS A 1 72 ? -4.723  3.929   -9.774  1.00 0.76 ? 72  LYS A HG2  7  
ATOM   9260  H HG3  . LYS A 1 72 ? -4.962  5.593   -9.237  1.00 0.74 ? 72  LYS A HG3  7  
ATOM   9261  H HD2  . LYS A 1 72 ? -2.663  4.728   -10.978 1.00 0.98 ? 72  LYS A HD2  7  
ATOM   9262  H HD3  . LYS A 1 72 ? -4.199  5.312   -11.622 1.00 0.88 ? 72  LYS A HD3  7  
ATOM   9263  H HE2  . LYS A 1 72 ? -3.897  7.432   -10.490 1.00 1.39 ? 72  LYS A HE2  7  
ATOM   9264  H HE3  . LYS A 1 72 ? -2.410  6.849   -9.745  1.00 1.42 ? 72  LYS A HE3  7  
ATOM   9265  H HZ1  . LYS A 1 72 ? -2.815  7.097   -12.674 1.00 1.73 ? 72  LYS A HZ1  7  
ATOM   9266  H HZ2  . LYS A 1 72 ? -1.369  6.730   -11.878 1.00 1.79 ? 72  LYS A HZ2  7  
ATOM   9267  H HZ3  . LYS A 1 72 ? -2.054  8.269   -11.721 1.00 1.75 ? 72  LYS A HZ3  7  
ATOM   9268  N N    . THR A 1 73 ? -2.193  3.590   -5.679  1.00 0.23 ? 73  THR A N    7  
ATOM   9269  C CA   . THR A 1 73 ? -1.113  3.394   -4.729  1.00 0.24 ? 73  THR A CA   7  
ATOM   9270  C C    . THR A 1 73 ? -1.098  1.954   -4.219  1.00 0.21 ? 73  THR A C    7  
ATOM   9271  O O    . THR A 1 73 ? -0.046  1.310   -4.173  1.00 0.24 ? 73  THR A O    7  
ATOM   9272  C CB   . THR A 1 73 ? -1.255  4.359   -3.538  1.00 0.29 ? 73  THR A CB   7  
ATOM   9273  O OG1  . THR A 1 73 ? -1.760  5.622   -3.999  1.00 0.39 ? 73  THR A OG1  7  
ATOM   9274  C CG2  . THR A 1 73 ? 0.083   4.567   -2.843  1.00 0.35 ? 73  THR A CG2  7  
ATOM   9275  H H    . THR A 1 73 ? -2.923  4.205   -5.448  1.00 0.26 ? 73  THR A H    7  
ATOM   9276  H HA   . THR A 1 73 ? -0.180  3.604   -5.231  1.00 0.26 ? 73  THR A HA   7  
ATOM   9277  H HB   . THR A 1 73 ? -1.951  3.935   -2.829  1.00 0.32 ? 73  THR A HB   7  
ATOM   9278  H HG1  . THR A 1 73 ? -1.065  6.075   -4.508  1.00 0.74 ? 73  THR A HG1  7  
ATOM   9279  H HG21 . THR A 1 73 ? 0.765   5.065   -3.515  1.00 0.57 ? 73  THR A HG21 7  
ATOM   9280  H HG22 . THR A 1 73 ? 0.495   3.610   -2.557  1.00 0.56 ? 73  THR A HG22 7  
ATOM   9281  H HG23 . THR A 1 73 ? -0.061  5.172   -1.960  1.00 0.58 ? 73  THR A HG23 7  
ATOM   9282  N N    . TRP A 1 74 ? -2.276  1.449   -3.863  1.00 0.18 ? 74  TRP A N    7  
ATOM   9283  C CA   . TRP A 1 74 ? -2.415  0.093   -3.351  1.00 0.18 ? 74  TRP A CA   7  
ATOM   9284  C C    . TRP A 1 74 ? -1.964  -0.935  -4.379  1.00 0.17 ? 74  TRP A C    7  
ATOM   9285  O O    . TRP A 1 74 ? -1.226  -1.860  -4.050  1.00 0.19 ? 74  TRP A O    7  
ATOM   9286  C CB   . TRP A 1 74 ? -3.864  -0.182  -2.941  1.00 0.19 ? 74  TRP A CB   7  
ATOM   9287  C CG   . TRP A 1 74 ? -4.099  -1.595  -2.487  1.00 0.20 ? 74  TRP A CG   7  
ATOM   9288  C CD1  . TRP A 1 74 ? -4.908  -2.523  -3.076  1.00 0.23 ? 74  TRP A CD1  7  
ATOM   9289  C CD2  . TRP A 1 74 ? -3.509  -2.239  -1.352  1.00 0.27 ? 74  TRP A CD2  7  
ATOM   9290  N NE1  . TRP A 1 74 ? -4.859  -3.703  -2.374  1.00 0.25 ? 74  TRP A NE1  7  
ATOM   9291  C CE2  . TRP A 1 74 ? -4.008  -3.553  -1.312  1.00 0.27 ? 74  TRP A CE2  7  
ATOM   9292  C CE3  . TRP A 1 74 ? -2.613  -1.829  -0.363  1.00 0.38 ? 74  TRP A CE3  7  
ATOM   9293  C CZ2  . TRP A 1 74 ? -3.638  -4.462  -0.325  1.00 0.36 ? 74  TRP A CZ2  7  
ATOM   9294  C CZ3  . TRP A 1 74 ? -2.242  -2.732  0.613   1.00 0.48 ? 74  TRP A CZ3  7  
ATOM   9295  C CH2  . TRP A 1 74 ? -2.754  -4.035  0.628   1.00 0.46 ? 74  TRP A CH2  7  
ATOM   9296  H H    . TRP A 1 74 ? -3.077  2.010   -3.942  1.00 0.20 ? 74  TRP A H    7  
ATOM   9297  H HA   . TRP A 1 74 ? -1.785  0.006   -2.478  1.00 0.20 ? 74  TRP A HA   7  
ATOM   9298  H HB2  . TRP A 1 74 ? -4.131  0.477   -2.128  1.00 0.22 ? 74  TRP A HB2  7  
ATOM   9299  H HB3  . TRP A 1 74 ? -4.511  0.011   -3.782  1.00 0.21 ? 74  TRP A HB3  7  
ATOM   9300  H HD1  . TRP A 1 74 ? -5.494  -2.344  -3.966  1.00 0.30 ? 74  TRP A HD1  7  
ATOM   9301  H HE1  . TRP A 1 74 ? -5.355  -4.526  -2.600  1.00 0.28 ? 74  TRP A HE1  7  
ATOM   9302  H HE3  . TRP A 1 74 ? -2.207  -0.828  -0.360  1.00 0.40 ? 74  TRP A HE3  7  
ATOM   9303  H HZ2  . TRP A 1 74 ? -4.023  -5.470  -0.301  1.00 0.36 ? 74  TRP A HZ2  7  
ATOM   9304  H HZ3  . TRP A 1 74 ? -1.547  -2.430  1.382   1.00 0.58 ? 74  TRP A HZ3  7  
ATOM   9305  H HH2  . TRP A 1 74 ? -2.438  -4.706  1.411   1.00 0.54 ? 74  TRP A HH2  7  
ATOM   9306  N N    . GLY A 1 75 ? -2.404  -0.761  -5.621  1.00 0.18 ? 75  GLY A N    7  
ATOM   9307  C CA   . GLY A 1 75 ? -2.043  -1.689  -6.681  1.00 0.21 ? 75  GLY A CA   7  
ATOM   9308  C C    . GLY A 1 75 ? -0.544  -1.859  -6.817  1.00 0.20 ? 75  GLY A C    7  
ATOM   9309  O O    . GLY A 1 75 ? -0.050  -2.976  -6.992  1.00 0.25 ? 75  GLY A O    7  
ATOM   9310  H H    . GLY A 1 75 ? -2.985  0.009   -5.821  1.00 0.20 ? 75  GLY A H    7  
ATOM   9311  H HA2  . GLY A 1 75 ? -2.484  -2.650  -6.466  1.00 0.24 ? 75  GLY A HA2  7  
ATOM   9312  H HA3  . GLY A 1 75 ? -2.439  -1.325  -7.616  1.00 0.24 ? 75  GLY A HA3  7  
ATOM   9313  N N    . LEU A 1 76 ? 0.179   -0.751  -6.725  1.00 0.20 ? 76  LEU A N    7  
ATOM   9314  C CA   . LEU A 1 76 ? 1.632   -0.774  -6.833  1.00 0.24 ? 76  LEU A CA   7  
ATOM   9315  C C    . LEU A 1 76 ? 2.257   -1.463  -5.623  1.00 0.23 ? 76  LEU A C    7  
ATOM   9316  O O    . LEU A 1 76 ? 3.146   -2.306  -5.770  1.00 0.28 ? 76  LEU A O    7  
ATOM   9317  C CB   . LEU A 1 76 ? 2.178   0.650   -6.960  1.00 0.30 ? 76  LEU A CB   7  
ATOM   9318  C CG   . LEU A 1 76 ? 1.675   1.432   -8.175  1.00 0.40 ? 76  LEU A CG   7  
ATOM   9319  C CD1  . LEU A 1 76 ? 1.959   2.915   -8.006  1.00 0.51 ? 76  LEU A CD1  7  
ATOM   9320  C CD2  . LEU A 1 76 ? 2.315   0.911   -9.452  1.00 0.56 ? 76  LEU A CD2  7  
ATOM   9321  H H    . LEU A 1 76 ? -0.277  0.106   -6.583  1.00 0.22 ? 76  LEU A H    7  
ATOM   9322  H HA   . LEU A 1 76 ? 1.891   -1.330  -7.721  1.00 0.27 ? 76  LEU A HA   7  
ATOM   9323  H HB2  . LEU A 1 76 ? 1.909   1.196   -6.067  1.00 0.34 ? 76  LEU A HB2  7  
ATOM   9324  H HB3  . LEU A 1 76 ? 3.254   0.595   -7.018  1.00 0.36 ? 76  LEU A HB3  7  
ATOM   9325  H HG   . LEU A 1 76 ? 0.605   1.304   -8.258  1.00 0.51 ? 76  LEU A HG   7  
ATOM   9326  H HD11 . LEU A 1 76 ? 1.429   3.290   -7.144  1.00 0.93 ? 76  LEU A HD11 7  
ATOM   9327  H HD12 . LEU A 1 76 ? 1.633   3.446   -8.887  1.00 0.87 ? 76  LEU A HD12 7  
ATOM   9328  H HD13 . LEU A 1 76 ? 3.020   3.065   -7.869  1.00 0.94 ? 76  LEU A HD13 7  
ATOM   9329  H HD21 . LEU A 1 76 ? 3.387   1.007   -9.382  1.00 0.97 ? 76  LEU A HD21 7  
ATOM   9330  H HD22 . LEU A 1 76 ? 1.956   1.484   -10.294 1.00 0.98 ? 76  LEU A HD22 7  
ATOM   9331  H HD23 . LEU A 1 76 ? 2.056   -0.128  -9.587  1.00 1.01 ? 76  LEU A HD23 7  
ATOM   9332  N N    . VAL A 1 77 ? 1.792   -1.101  -4.432  1.00 0.22 ? 77  VAL A N    7  
ATOM   9333  C CA   . VAL A 1 77 ? 2.301   -1.684  -3.196  1.00 0.25 ? 77  VAL A CA   7  
ATOM   9334  C C    . VAL A 1 77 ? 2.021   -3.186  -3.157  1.00 0.23 ? 77  VAL A C    7  
ATOM   9335  O O    . VAL A 1 77 ? 2.904   -3.985  -2.840  1.00 0.24 ? 77  VAL A O    7  
ATOM   9336  C CB   . VAL A 1 77 ? 1.676   -1.010  -1.954  1.00 0.29 ? 77  VAL A CB   7  
ATOM   9337  C CG1  . VAL A 1 77 ? 2.108   -1.713  -0.675  1.00 0.34 ? 77  VAL A CG1  7  
ATOM   9338  C CG2  . VAL A 1 77 ? 2.047   0.467   -1.904  1.00 0.35 ? 77  VAL A CG2  7  
ATOM   9339  H H    . VAL A 1 77 ? 1.079   -0.423  -4.383  1.00 0.22 ? 77  VAL A H    7  
ATOM   9340  H HA   . VAL A 1 77 ? 3.370   -1.527  -3.170  1.00 0.29 ? 77  VAL A HA   7  
ATOM   9341  H HB   . VAL A 1 77 ? 0.601   -1.084  -2.031  1.00 0.30 ? 77  VAL A HB   7  
ATOM   9342  H HG11 . VAL A 1 77 ? 1.747   -2.731  -0.684  1.00 0.46 ? 77  VAL A HG11 7  
ATOM   9343  H HG12 . VAL A 1 77 ? 1.699   -1.193  0.180   1.00 0.50 ? 77  VAL A HG12 7  
ATOM   9344  H HG13 . VAL A 1 77 ? 3.186   -1.715  -0.612  1.00 0.49 ? 77  VAL A HG13 7  
ATOM   9345  H HG21 . VAL A 1 77 ? 1.747   0.944   -2.826  1.00 0.59 ? 77  VAL A HG21 7  
ATOM   9346  H HG22 . VAL A 1 77 ? 3.113   0.566   -1.778  1.00 0.59 ? 77  VAL A HG22 7  
ATOM   9347  H HG23 . VAL A 1 77 ? 1.539   0.937   -1.076  1.00 0.55 ? 77  VAL A HG23 7  
ATOM   9348  N N    . LEU A 1 78 ? 0.794   -3.552  -3.506  1.00 0.21 ? 78  LEU A N    7  
ATOM   9349  C CA   . LEU A 1 78 ? 0.372   -4.945  -3.524  1.00 0.21 ? 78  LEU A CA   7  
ATOM   9350  C C    . LEU A 1 78 ? 1.220   -5.753  -4.502  1.00 0.20 ? 78  LEU A C    7  
ATOM   9351  O O    . LEU A 1 78 ? 1.609   -6.883  -4.211  1.00 0.22 ? 78  LEU A O    7  
ATOM   9352  C CB   . LEU A 1 78 ? -1.108  -5.032  -3.910  1.00 0.22 ? 78  LEU A CB   7  
ATOM   9353  C CG   . LEU A 1 78 ? -1.674  -6.446  -4.052  1.00 0.25 ? 78  LEU A CG   7  
ATOM   9354  C CD1  . LEU A 1 78 ? -1.687  -7.157  -2.709  1.00 0.35 ? 78  LEU A CD1  7  
ATOM   9355  C CD2  . LEU A 1 78 ? -3.073  -6.400  -4.649  1.00 0.34 ? 78  LEU A CD2  7  
ATOM   9356  H H    . LEU A 1 78 ? 0.143   -2.856  -3.755  1.00 0.20 ? 78  LEU A H    7  
ATOM   9357  H HA   . LEU A 1 78 ? 0.501   -5.345  -2.532  1.00 0.24 ? 78  LEU A HA   7  
ATOM   9358  H HB2  . LEU A 1 78 ? -1.683  -4.512  -3.159  1.00 0.26 ? 78  LEU A HB2  7  
ATOM   9359  H HB3  . LEU A 1 78 ? -1.239  -4.523  -4.854  1.00 0.23 ? 78  LEU A HB3  7  
ATOM   9360  H HG   . LEU A 1 78 ? -1.043  -7.013  -4.720  1.00 0.28 ? 78  LEU A HG   7  
ATOM   9361  H HD11 . LEU A 1 78 ? -2.240  -6.565  -1.994  1.00 0.67 ? 78  LEU A HD11 7  
ATOM   9362  H HD12 . LEU A 1 78 ? -0.673  -7.286  -2.361  1.00 0.70 ? 78  LEU A HD12 7  
ATOM   9363  H HD13 . LEU A 1 78 ? -2.154  -8.122  -2.816  1.00 0.68 ? 78  LEU A HD13 7  
ATOM   9364  H HD21 . LEU A 1 78 ? -3.030  -5.955  -5.631  1.00 0.67 ? 78  LEU A HD21 7  
ATOM   9365  H HD22 . LEU A 1 78 ? -3.716  -5.808  -4.015  1.00 0.68 ? 78  LEU A HD22 7  
ATOM   9366  H HD23 . LEU A 1 78 ? -3.465  -7.403  -4.724  1.00 0.71 ? 78  LEU A HD23 7  
ATOM   9367  N N    . GLY A 1 79 ? 1.511   -5.161  -5.657  1.00 0.20 ? 79  GLY A N    7  
ATOM   9368  C CA   . GLY A 1 79 ? 2.313   -5.832  -6.664  1.00 0.22 ? 79  GLY A CA   7  
ATOM   9369  C C    . GLY A 1 79 ? 3.714   -6.145  -6.173  1.00 0.21 ? 79  GLY A C    7  
ATOM   9370  O O    . GLY A 1 79 ? 4.230   -7.242  -6.394  1.00 0.27 ? 79  GLY A O    7  
ATOM   9371  H H    . GLY A 1 79 ? 1.175   -4.254  -5.829  1.00 0.20 ? 79  GLY A H    7  
ATOM   9372  H HA2  . GLY A 1 79 ? 1.825   -6.755  -6.943  1.00 0.24 ? 79  GLY A HA2  7  
ATOM   9373  H HA3  . GLY A 1 79 ? 2.383   -5.198  -7.536  1.00 0.24 ? 79  GLY A HA3  7  
ATOM   9374  N N    . ALA A 1 80 ? 4.318   -5.184  -5.490  1.00 0.19 ? 80  ALA A N    7  
ATOM   9375  C CA   . ALA A 1 80 ? 5.664   -5.347  -4.962  1.00 0.22 ? 80  ALA A CA   7  
ATOM   9376  C C    . ALA A 1 80 ? 5.686   -6.346  -3.809  1.00 0.21 ? 80  ALA A C    7  
ATOM   9377  O O    . ALA A 1 80 ? 6.545   -7.227  -3.758  1.00 0.25 ? 80  ALA A O    7  
ATOM   9378  C CB   . ALA A 1 80 ? 6.225   -4.003  -4.515  1.00 0.25 ? 80  ALA A CB   7  
ATOM   9379  H H    . ALA A 1 80 ? 3.844   -4.338  -5.338  1.00 0.21 ? 80  ALA A H    7  
ATOM   9380  H HA   . ALA A 1 80 ? 6.289   -5.722  -5.758  1.00 0.25 ? 80  ALA A HA   7  
ATOM   9381  H HB1  . ALA A 1 80 ? 5.537   -3.533  -3.831  1.00 0.41 ? 80  ALA A HB1  7  
ATOM   9382  H HB2  . ALA A 1 80 ? 6.364   -3.368  -5.376  1.00 0.39 ? 80  ALA A HB2  7  
ATOM   9383  H HB3  . ALA A 1 80 ? 7.174   -4.154  -4.022  1.00 0.43 ? 80  ALA A HB3  7  
ATOM   9384  N N    . LEU A 1 81 ? 4.728   -6.219  -2.900  1.00 0.21 ? 81  LEU A N    7  
ATOM   9385  C CA   . LEU A 1 81 ? 4.649   -7.104  -1.746  1.00 0.25 ? 81  LEU A CA   7  
ATOM   9386  C C    . LEU A 1 81 ? 4.354   -8.539  -2.172  1.00 0.22 ? 81  LEU A C    7  
ATOM   9387  O O    . LEU A 1 81 ? 4.879   -9.489  -1.586  1.00 0.23 ? 81  LEU A O    7  
ATOM   9388  C CB   . LEU A 1 81 ? 3.576   -6.618  -0.776  1.00 0.33 ? 81  LEU A CB   7  
ATOM   9389  C CG   . LEU A 1 81 ? 4.088   -6.208  0.609   1.00 0.50 ? 81  LEU A CG   7  
ATOM   9390  C CD1  . LEU A 1 81 ? 2.975   -5.568  1.431   1.00 0.60 ? 81  LEU A CD1  7  
ATOM   9391  C CD2  . LEU A 1 81 ? 4.674   -7.408  1.340   1.00 0.72 ? 81  LEU A CD2  7  
ATOM   9392  H H    . LEU A 1 81 ? 4.052   -5.512  -3.008  1.00 0.21 ? 81  LEU A H    7  
ATOM   9393  H HA   . LEU A 1 81 ? 5.607   -7.080  -1.249  1.00 0.30 ? 81  LEU A HA   7  
ATOM   9394  H HB2  . LEU A 1 81 ? 3.084   -5.769  -1.222  1.00 0.41 ? 81  LEU A HB2  7  
ATOM   9395  H HB3  . LEU A 1 81 ? 2.853   -7.408  -0.651  1.00 0.38 ? 81  LEU A HB3  7  
ATOM   9396  H HG   . LEU A 1 81 ? 4.873   -5.477  0.489   1.00 0.60 ? 81  LEU A HG   7  
ATOM   9397  H HD11 . LEU A 1 81 ? 2.164   -6.269  1.550   1.00 0.98 ? 81  LEU A HD11 7  
ATOM   9398  H HD12 . LEU A 1 81 ? 2.615   -4.685  0.924   1.00 0.95 ? 81  LEU A HD12 7  
ATOM   9399  H HD13 . LEU A 1 81 ? 3.358   -5.295  2.402   1.00 1.12 ? 81  LEU A HD13 7  
ATOM   9400  H HD21 . LEU A 1 81 ? 3.953   -8.213  1.350   1.00 1.02 ? 81  LEU A HD21 7  
ATOM   9401  H HD22 . LEU A 1 81 ? 4.915   -7.129  2.355   1.00 1.04 ? 81  LEU A HD22 7  
ATOM   9402  H HD23 . LEU A 1 81 ? 5.570   -7.736  0.836   1.00 1.02 ? 81  LEU A HD23 7  
ATOM   9403  N N    . LYS A 1 82 ? 3.515   -8.696  -3.189  1.00 0.22 ? 82  LYS A N    7  
ATOM   9404  C CA   . LYS A 1 82 ? 3.173   -10.020 -3.694  1.00 0.24 ? 82  LYS A CA   7  
ATOM   9405  C C    . LYS A 1 82 ? 4.414   -10.726 -4.219  1.00 0.24 ? 82  LYS A C    7  
ATOM   9406  O O    . LYS A 1 82 ? 4.596   -11.918 -3.994  1.00 0.29 ? 82  LYS A O    7  
ATOM   9407  C CB   . LYS A 1 82 ? 2.121   -9.933  -4.802  1.00 0.31 ? 82  LYS A CB   7  
ATOM   9408  C CG   . LYS A 1 82 ? 0.758   -10.447 -4.377  1.00 0.52 ? 82  LYS A CG   7  
ATOM   9409  C CD   . LYS A 1 82 ? -0.125  -10.760 -5.575  1.00 0.61 ? 82  LYS A CD   7  
ATOM   9410  C CE   . LYS A 1 82 ? -0.696  -9.496  -6.200  1.00 0.90 ? 82  LYS A CE   7  
ATOM   9411  N NZ   . LYS A 1 82 ? -1.525  -9.799  -7.398  1.00 1.19 ? 82  LYS A NZ   7  
ATOM   9412  H H    . LYS A 1 82 ? 3.106   -7.902  -3.603  1.00 0.23 ? 82  LYS A H    7  
ATOM   9413  H HA   . LYS A 1 82 ? 2.770   -10.593 -2.872  1.00 0.26 ? 82  LYS A HA   7  
ATOM   9414  H HB2  . LYS A 1 82 ? 2.015   -8.902  -5.105  1.00 0.53 ? 82  LYS A HB2  7  
ATOM   9415  H HB3  . LYS A 1 82 ? 2.454   -10.516 -5.647  1.00 0.51 ? 82  LYS A HB3  7  
ATOM   9416  H HG2  . LYS A 1 82 ? 0.887   -11.347 -3.796  1.00 0.82 ? 82  LYS A HG2  7  
ATOM   9417  H HG3  . LYS A 1 82 ? 0.273   -9.693  -3.773  1.00 0.81 ? 82  LYS A HG3  7  
ATOM   9418  H HD2  . LYS A 1 82 ? 0.463   -11.280 -6.316  1.00 0.84 ? 82  LYS A HD2  7  
ATOM   9419  H HD3  . LYS A 1 82 ? -0.940  -11.391 -5.254  1.00 0.84 ? 82  LYS A HD3  7  
ATOM   9420  H HE2  . LYS A 1 82 ? -1.310  -8.993  -5.468  1.00 1.22 ? 82  LYS A HE2  7  
ATOM   9421  H HE3  . LYS A 1 82 ? 0.121   -8.851  -6.489  1.00 1.21 ? 82  LYS A HE3  7  
ATOM   9422  H HZ1  . LYS A 1 82 ? -2.266  -10.487 -7.157  1.00 1.48 ? 82  LYS A HZ1  7  
ATOM   9423  H HZ2  . LYS A 1 82 ? -0.932  -10.199 -8.155  1.00 1.54 ? 82  LYS A HZ2  7  
ATOM   9424  H HZ3  . LYS A 1 82 ? -1.977  -8.931  -7.754  1.00 1.55 ? 82  LYS A HZ3  7  
ATOM   9425  N N    . ALA A 1 83 ? 5.274   -9.971  -4.898  1.00 0.24 ? 83  ALA A N    7  
ATOM   9426  C CA   . ALA A 1 83 ? 6.507   -10.516 -5.457  1.00 0.28 ? 83  ALA A CA   7  
ATOM   9427  C C    . ALA A 1 83 ? 7.514   -10.822 -4.352  1.00 0.28 ? 83  ALA A C    7  
ATOM   9428  O O    . ALA A 1 83 ? 8.278   -11.786 -4.440  1.00 0.34 ? 83  ALA A O    7  
ATOM   9429  C CB   . ALA A 1 83 ? 7.107   -9.549  -6.471  1.00 0.35 ? 83  ALA A CB   7  
ATOM   9430  H H    . ALA A 1 83 ? 5.073   -9.020  -5.027  1.00 0.25 ? 83  ALA A H    7  
ATOM   9431  H HA   . ALA A 1 83 ? 6.263   -11.435 -5.972  1.00 0.32 ? 83  ALA A HA   7  
ATOM   9432  H HB1  . ALA A 1 83 ? 7.392   -8.634  -5.971  1.00 0.48 ? 83  ALA A HB1  7  
ATOM   9433  H HB2  . ALA A 1 83 ? 6.378   -9.329  -7.235  1.00 0.53 ? 83  ALA A HB2  7  
ATOM   9434  H HB3  . ALA A 1 83 ? 7.978   -9.998  -6.923  1.00 0.54 ? 83  ALA A HB3  7  
ATOM   9435  N N    . ALA A 1 84 ? 7.504   -9.996  -3.311  1.00 0.26 ? 84  ALA A N    7  
ATOM   9436  C CA   . ALA A 1 84 ? 8.405   -10.169 -2.177  1.00 0.31 ? 84  ALA A CA   7  
ATOM   9437  C C    . ALA A 1 84 ? 8.099   -11.466 -1.440  1.00 0.32 ? 84  ALA A C    7  
ATOM   9438  O O    . ALA A 1 84 ? 9.003   -12.202 -1.049  1.00 0.45 ? 84  ALA A O    7  
ATOM   9439  C CB   . ALA A 1 84 ? 8.295   -8.983  -1.226  1.00 0.35 ? 84  ALA A CB   7  
ATOM   9440  H H    . ALA A 1 84 ? 6.876   -9.241  -3.310  1.00 0.26 ? 84  ALA A H    7  
ATOM   9441  H HA   . ALA A 1 84 ? 9.418   -10.206 -2.554  1.00 0.36 ? 84  ALA A HA   7  
ATOM   9442  H HB1  . ALA A 1 84 ? 8.985   -9.112  -0.403  1.00 0.55 ? 84  ALA A HB1  7  
ATOM   9443  H HB2  . ALA A 1 84 ? 7.287   -8.921  -0.844  1.00 0.50 ? 84  ALA A HB2  7  
ATOM   9444  H HB3  . ALA A 1 84 ? 8.536   -8.073  -1.757  1.00 0.52 ? 84  ALA A HB3  7  
ATOM   9445  N N    . ARG A 1 85 ? 6.816   -11.755 -1.273  1.00 0.29 ? 85  ARG A N    7  
ATOM   9446  C CA   . ARG A 1 85 ? 6.394   -12.963 -0.578  1.00 0.35 ? 85  ARG A CA   7  
ATOM   9447  C C    . ARG A 1 85 ? 6.170   -14.117 -1.551  1.00 0.35 ? 85  ARG A C    7  
ATOM   9448  O O    . ARG A 1 85 ? 5.561   -15.126 -1.201  1.00 0.48 ? 85  ARG A O    7  
ATOM   9449  C CB   . ARG A 1 85 ? 5.123   -12.700 0.232   1.00 0.42 ? 85  ARG A CB   7  
ATOM   9450  C CG   . ARG A 1 85 ? 5.394   -12.320 1.680   1.00 0.54 ? 85  ARG A CG   7  
ATOM   9451  C CD   . ARG A 1 85 ? 4.138   -12.416 2.531   1.00 0.74 ? 85  ARG A CD   7  
ATOM   9452  N NE   . ARG A 1 85 ? 4.450   -12.573 3.951   1.00 0.66 ? 85  ARG A NE   7  
ATOM   9453  C CZ   . ARG A 1 85 ? 4.369   -13.727 4.612   1.00 0.66 ? 85  ARG A CZ   7  
ATOM   9454  N NH1  . ARG A 1 85 ? 3.991   -14.835 3.983   1.00 0.83 ? 85  ARG A NH1  7  
ATOM   9455  N NH2  . ARG A 1 85 ? 4.681   -13.776 5.901   1.00 0.79 ? 85  ARG A NH2  7  
ATOM   9456  H H    . ARG A 1 85 ? 6.133   -11.140 -1.624  1.00 0.31 ? 85  ARG A H    7  
ATOM   9457  H HA   . ARG A 1 85 ? 7.186   -13.240 0.099   1.00 0.41 ? 85  ARG A HA   7  
ATOM   9458  H HB2  . ARG A 1 85 ? 4.572   -11.896 -0.233  1.00 0.47 ? 85  ARG A HB2  7  
ATOM   9459  H HB3  . ARG A 1 85 ? 4.516   -13.594 0.223   1.00 0.49 ? 85  ARG A HB3  7  
ATOM   9460  H HG2  . ARG A 1 85 ? 6.141   -12.986 2.084   1.00 0.96 ? 85  ARG A HG2  7  
ATOM   9461  H HG3  . ARG A 1 85 ? 5.762   -11.305 1.714   1.00 1.03 ? 85  ARG A HG3  7  
ATOM   9462  H HD2  . ARG A 1 85 ? 3.561   -11.514 2.398   1.00 1.28 ? 85  ARG A HD2  7  
ATOM   9463  H HD3  . ARG A 1 85 ? 3.560   -13.265 2.203   1.00 1.22 ? 85  ARG A HD3  7  
ATOM   9464  H HE   . ARG A 1 85 ? 4.734   -11.765 4.444   1.00 0.81 ? 85  ARG A HE   7  
ATOM   9465  H HH11 . ARG A 1 85 ? 3.929   -15.703 4.485   1.00 1.01 ? 85  ARG A HH11 7  
ATOM   9466  H HH12 . ARG A 1 85 ? 3.766   -14.809 3.006   1.00 0.90 ? 85  ARG A HH12 7  
ATOM   9467  H HH21 . ARG A 1 85 ? 4.979   -12.941 6.381   1.00 0.90 ? 85  ARG A HH21 7  
ATOM   9468  H HH22 . ARG A 1 85 ? 4.625   -14.640 6.404   1.00 0.92 ? 85  ARG A HH22 7  
ATOM   9469  N N    . GLU A 1 86 ? 6.672   -13.970 -2.767  1.00 0.35 ? 86  GLU A N    7  
ATOM   9470  C CA   . GLU A 1 86 ? 6.531   -15.006 -3.776  1.00 0.40 ? 86  GLU A CA   7  
ATOM   9471  C C    . GLU A 1 86 ? 7.864   -15.715 -3.985  1.00 0.43 ? 86  GLU A C    7  
ATOM   9472  O O    . GLU A 1 86 ? 7.999   -16.581 -4.851  1.00 0.65 ? 86  GLU A O    7  
ATOM   9473  C CB   . GLU A 1 86 ? 6.038   -14.405 -5.092  1.00 0.50 ? 86  GLU A CB   7  
ATOM   9474  C CG   . GLU A 1 86 ? 5.310   -15.396 -5.983  1.00 0.68 ? 86  GLU A CG   7  
ATOM   9475  C CD   . GLU A 1 86 ? 4.852   -14.773 -7.279  1.00 0.87 ? 86  GLU A CD   7  
ATOM   9476  O OE1  . GLU A 1 86 ? 5.673   -14.667 -8.214  1.00 1.32 ? 86  GLU A OE1  7  
ATOM   9477  O OE2  . GLU A 1 86 ? 3.670   -14.381 -7.373  1.00 1.25 ? 86  GLU A OE2  7  
ATOM   9478  H H    . GLU A 1 86 ? 7.154   -13.144 -2.991  1.00 0.42 ? 86  GLU A H    7  
ATOM   9479  H HA   . GLU A 1 86 ? 5.805   -15.722 -3.420  1.00 0.47 ? 86  GLU A HA   7  
ATOM   9480  H HB2  . GLU A 1 86 ? 5.365   -13.589 -4.873  1.00 0.63 ? 86  GLU A HB2  7  
ATOM   9481  H HB3  . GLU A 1 86 ? 6.888   -14.022 -5.637  1.00 0.63 ? 86  GLU A HB3  7  
ATOM   9482  H HG2  . GLU A 1 86 ? 5.977   -16.214 -6.207  1.00 0.90 ? 86  GLU A HG2  7  
ATOM   9483  H HG3  . GLU A 1 86 ? 4.446   -15.772 -5.453  1.00 0.93 ? 86  GLU A HG3  7  
ATOM   9484  N N    . GLU A 1 87 ? 8.845   -15.347 -3.176  1.00 0.47 ? 87  GLU A N    7  
ATOM   9485  C CA   . GLU A 1 87 ? 10.172  -15.931 -3.267  1.00 0.58 ? 87  GLU A CA   7  
ATOM   9486  C C    . GLU A 1 87 ? 10.553  -16.595 -1.954  1.00 0.68 ? 87  GLU A C    7  
ATOM   9487  O O    . GLU A 1 87 ? 11.579  -17.308 -1.919  1.00 1.13 ? 87  GLU A O    7  
ATOM   9488  C CB   . GLU A 1 87 ? 11.200  -14.860 -3.627  1.00 0.77 ? 87  GLU A CB   7  
ATOM   9489  C CG   . GLU A 1 87 ? 11.128  -14.408 -5.077  1.00 1.10 ? 87  GLU A CG   7  
ATOM   9490  C CD   . GLU A 1 87 ? 12.473  -13.964 -5.612  1.00 1.15 ? 87  GLU A CD   7  
ATOM   9491  O OE1  . GLU A 1 87 ? 13.353  -14.832 -5.806  1.00 1.51 ? 87  GLU A OE1  7  
ATOM   9492  O OE2  . GLU A 1 87 ? 12.654  -12.748 -5.844  1.00 1.44 ? 87  GLU A OE2  7  
ATOM   9493  O OXT  . GLU A 1 87 ? 9.823   -16.399 -0.959  1.00 1.02 ? 87  GLU A OXT  7  
ATOM   9494  H H    . GLU A 1 87 ? 8.668   -14.677 -2.485  1.00 0.60 ? 87  GLU A H    7  
ATOM   9495  H HA   . GLU A 1 87 ? 10.156  -16.680 -4.044  1.00 0.71 ? 87  GLU A HA   7  
ATOM   9496  H HB2  . GLU A 1 87 ? 11.039  -13.997 -2.995  1.00 1.08 ? 87  GLU A HB2  7  
ATOM   9497  H HB3  . GLU A 1 87 ? 12.188  -15.250 -3.443  1.00 1.00 ? 87  GLU A HB3  7  
ATOM   9498  H HG2  . GLU A 1 87 ? 10.773  -15.231 -5.677  1.00 1.52 ? 87  GLU A HG2  7  
ATOM   9499  H HG3  . GLU A 1 87 ? 10.435  -13.582 -5.150  1.00 1.59 ? 87  GLU A HG3  7  
HETATM 9500  C C1   . IHP B 2 .  ? 13.792  9.508   1.901   1.00 0.87 ? 101 IHP A C1   7  
HETATM 9501  C C2   . IHP B 2 .  ? 12.673  10.343  2.529   1.00 0.83 ? 101 IHP A C2   7  
HETATM 9502  C C3   . IHP B 2 .  ? 12.150  11.347  1.502   1.00 0.67 ? 101 IHP A C3   7  
HETATM 9503  C C4   . IHP B 2 .  ? 11.602  10.596  0.286   1.00 0.52 ? 101 IHP A C4   7  
HETATM 9504  C C5   . IHP B 2 .  ? 12.721  9.761   -0.342  1.00 0.61 ? 101 IHP A C5   7  
HETATM 9505  C C6   . IHP B 2 .  ? 13.247  8.756   0.686   1.00 0.77 ? 101 IHP A C6   7  
HETATM 9506  O O11  . IHP B 2 .  ? 14.281  8.569   2.861   1.00 1.21 ? 101 IHP A O11  7  
HETATM 9507  P P1   . IHP B 2 .  ? 15.813  8.543   3.357   1.00 1.54 ? 101 IHP A P1   7  
HETATM 9508  O O21  . IHP B 2 .  ? 16.188  9.879   3.874   1.00 1.58 ? 101 IHP A O21  7  
HETATM 9509  O O31  . IHP B 2 .  ? 15.977  7.449   4.528   1.00 1.93 ? 101 IHP A O31  7  
HETATM 9510  O O41  . IHP B 2 .  ? 16.772  8.155   2.122   1.00 1.56 ? 101 IHP A O41  7  
HETATM 9511  O O12  . IHP B 2 .  ? 11.610  9.482   2.940   1.00 0.85 ? 101 IHP A O12  7  
HETATM 9512  P P2   . IHP B 2 .  ? 11.113  9.369   4.467   1.00 1.21 ? 101 IHP A P2   7  
HETATM 9513  O O22  . IHP B 2 .  ? 10.759  10.715  4.972   1.00 1.39 ? 101 IHP A O22  7  
HETATM 9514  O O32  . IHP B 2 .  ? 9.821   8.412   4.543   1.00 1.20 ? 101 IHP A O32  7  
HETATM 9515  O O42  . IHP B 2 .  ? 12.292  8.750   5.372   1.00 1.55 ? 101 IHP A O42  7  
HETATM 9516  O O13  . IHP B 2 .  ? 11.104  12.128  2.088   1.00 0.90 ? 101 IHP A O13  7  
HETATM 9517  P P3   . IHP B 2 .  ? 11.182  13.728  2.232   1.00 1.24 ? 101 IHP A P3   7  
HETATM 9518  O O23  . IHP B 2 .  ? 12.418  14.100  2.957   1.00 1.39 ? 101 IHP A O23  7  
HETATM 9519  O O33  . IHP B 2 .  ? 11.195  14.399  0.769   1.00 1.27 ? 101 IHP A O33  7  
HETATM 9520  O O43  . IHP B 2 .  ? 9.900   14.256  3.051   1.00 1.57 ? 101 IHP A O43  7  
HETATM 9521  O O14  . IHP B 2 .  ? 11.112  11.534  -0.674  1.00 0.74 ? 101 IHP A O14  7  
HETATM 9522  P P4   . IHP B 2 .  ? 9.580   11.561  -1.172  1.00 1.00 ? 101 IHP A P4   7  
HETATM 9523  O O24  . IHP B 2 .  ? 9.356   12.822  -2.147  1.00 1.39 ? 101 IHP A O24  7  
HETATM 9524  O O34  . IHP B 2 .  ? 9.251   10.201  -1.968  1.00 1.09 ? 101 IHP A O34  7  
HETATM 9525  O O44  . IHP B 2 .  ? 8.684   11.676  -0.000  1.00 1.01 ? 101 IHP A O44  7  
HETATM 9526  O O15  . IHP B 2 .  ? 12.211  9.060   -1.476  1.00 0.86 ? 101 IHP A O15  7  
HETATM 9527  P P5   . IHP B 2 .  ? 12.793  9.258   -2.965  1.00 1.20 ? 101 IHP A P5   7  
HETATM 9528  O O25  . IHP B 2 .  ? 14.252  9.009   -2.960  1.00 1.28 ? 101 IHP A O25  7  
HETATM 9529  O O35  . IHP B 2 .  ? 12.075  8.218   -3.965  1.00 1.56 ? 101 IHP A O35  7  
HETATM 9530  O O45  . IHP B 2 .  ? 12.506  10.763  -3.458  1.00 1.25 ? 101 IHP A O45  7  
HETATM 9531  O O16  . IHP B 2 .  ? 14.289  7.977   0.099   1.00 1.06 ? 101 IHP A O16  7  
HETATM 9532  P P6   . IHP B 2 .  ? 14.212  6.375   -0.045  1.00 1.40 ? 101 IHP A P6   7  
HETATM 9533  O O26  . IHP B 2 .  ? 12.977  6.003   -0.771  1.00 1.39 ? 101 IHP A O26  7  
HETATM 9534  O O36  . IHP B 2 .  ? 15.495  5.848   -0.865  1.00 1.74 ? 101 IHP A O36  7  
HETATM 9535  O O46  . IHP B 2 .  ? 14.198  5.705   1.418   1.00 1.56 ? 101 IHP A O46  7  
HETATM 9536  H H1   . IHP B 2 .  ? 14.599  10.172  1.593   1.00 0.89 ? 101 IHP A H1   7  
HETATM 9537  H H2   . IHP B 2 .  ? 13.061  10.882  3.392   1.00 1.08 ? 101 IHP A H2   7  
HETATM 9538  H H3   . IHP B 2 .  ? 12.972  11.996  1.194   1.00 0.73 ? 101 IHP A H3   7  
HETATM 9539  H H4   . IHP B 2 .  ? 10.791  9.930   0.596   1.00 0.51 ? 101 IHP A H4   7  
HETATM 9540  H H5   . IHP B 2 .  ? 13.532  10.424  -0.650  1.00 0.66 ? 101 IHP A H5   7  
HETATM 9541  H H6   . IHP B 2 .  ? 12.446  8.092   1.027   1.00 0.80 ? 101 IHP A H6   7  
ATOM   9542  N N    . SER A 1 1  ? 2.883   5.256   9.595   1.00 1.45 ? 1   SER A N    8  
ATOM   9543  C CA   . SER A 1 1  ? 3.801   5.818   10.605  1.00 0.98 ? 1   SER A CA   8  
ATOM   9544  C C    . SER A 1 1  ? 5.110   6.272   9.954   1.00 0.92 ? 1   SER A C    8  
ATOM   9545  O O    . SER A 1 1  ? 5.173   7.370   9.396   1.00 1.21 ? 1   SER A O    8  
ATOM   9546  C CB   . SER A 1 1  ? 4.057   4.770   11.683  1.00 1.66 ? 1   SER A CB   8  
ATOM   9547  O OG   . SER A 1 1  ? 3.924   3.462   11.146  1.00 2.07 ? 1   SER A OG   8  
ATOM   9548  H H1   . SER A 1 1  ? 3.011   5.739   8.684   1.00 1.90 ? 1   SER A H1   8  
ATOM   9549  H H2   . SER A 1 1  ? 1.896   5.383   9.902   1.00 1.69 ? 1   SER A H2   8  
ATOM   9550  H H3   . SER A 1 1  ? 3.068   4.243   9.474   1.00 1.94 ? 1   SER A H3   8  
ATOM   9551  H HA   . SER A 1 1  ? 3.324   6.677   11.055  1.00 1.33 ? 1   SER A HA   8  
ATOM   9552  H HB2  . SER A 1 1  ? 5.060   4.890   12.072  1.00 2.07 ? 1   SER A HB2  8  
ATOM   9553  H HB3  . SER A 1 1  ? 3.342   4.893   12.481  1.00 2.12 ? 1   SER A HB3  8  
ATOM   9554  H HG   . SER A 1 1  ? 4.155   2.814   11.827  1.00 2.51 ? 1   SER A HG   8  
ATOM   9555  N N    . GLU A 1 2  ? 6.152   5.435   9.999   1.00 0.80 ? 2   GLU A N    8  
ATOM   9556  C CA   . GLU A 1 2  ? 7.436   5.799   9.400   1.00 0.85 ? 2   GLU A CA   8  
ATOM   9557  C C    . GLU A 1 2  ? 8.264   4.574   9.003   1.00 0.72 ? 2   GLU A C    8  
ATOM   9558  O O    . GLU A 1 2  ? 8.530   4.356   7.822   1.00 0.72 ? 2   GLU A O    8  
ATOM   9559  C CB   . GLU A 1 2  ? 8.240   6.697   10.351  1.00 1.13 ? 2   GLU A CB   8  
ATOM   9560  C CG   . GLU A 1 2  ? 8.139   6.317   11.825  1.00 1.33 ? 2   GLU A CG   8  
ATOM   9561  C CD   . GLU A 1 2  ? 8.708   7.384   12.736  1.00 1.48 ? 2   GLU A CD   8  
ATOM   9562  O OE1  . GLU A 1 2  ? 9.448   7.033   13.680  1.00 1.99 ? 2   GLU A OE1  8  
ATOM   9563  O OE2  . GLU A 1 2  ? 8.422   8.581   12.507  1.00 1.97 ? 2   GLU A OE2  8  
ATOM   9564  H H    . GLU A 1 2  ? 6.058   4.564   10.444  1.00 0.89 ? 2   GLU A H    8  
ATOM   9565  H HA   . GLU A 1 2  ? 7.220   6.360   8.502   1.00 0.92 ? 2   GLU A HA   8  
ATOM   9566  H HB2  . GLU A 1 2  ? 9.280   6.655   10.065  1.00 1.41 ? 2   GLU A HB2  8  
ATOM   9567  H HB3  . GLU A 1 2  ? 7.889   7.712   10.239  1.00 1.30 ? 2   GLU A HB3  8  
ATOM   9568  H HG2  . GLU A 1 2  ? 7.100   6.166   12.077  1.00 1.76 ? 2   GLU A HG2  8  
ATOM   9569  H HG3  . GLU A 1 2  ? 8.684   5.398   11.985  1.00 1.92 ? 2   GLU A HG3  8  
ATOM   9570  N N    . ALA A 1 3  ? 8.658   3.773   9.988   1.00 0.74 ? 3   ALA A N    8  
ATOM   9571  C CA   . ALA A 1 3  ? 9.475   2.586   9.742   1.00 0.73 ? 3   ALA A CA   8  
ATOM   9572  C C    . ALA A 1 3  ? 8.835   1.653   8.721   1.00 0.59 ? 3   ALA A C    8  
ATOM   9573  O O    . ALA A 1 3  ? 9.501   1.188   7.797   1.00 0.57 ? 3   ALA A O    8  
ATOM   9574  C CB   . ALA A 1 3  ? 9.734   1.840   11.042  1.00 0.89 ? 3   ALA A CB   8  
ATOM   9575  H H    . ALA A 1 3  ? 8.394   3.984   10.910  1.00 0.83 ? 3   ALA A H    8  
ATOM   9576  H HA   . ALA A 1 3  ? 10.427  2.916   9.356   1.00 0.80 ? 3   ALA A HA   8  
ATOM   9577  H HB1  . ALA A 1 3  ? 10.470  1.070   10.871  1.00 1.15 ? 3   ALA A HB1  8  
ATOM   9578  H HB2  . ALA A 1 3  ? 8.815   1.388   11.388  1.00 1.06 ? 3   ALA A HB2  8  
ATOM   9579  H HB3  . ALA A 1 3  ? 10.099  2.530   11.789  1.00 0.95 ? 3   ALA A HB3  8  
ATOM   9580  N N    . VAL A 1 4  ? 7.537   1.405   8.879   1.00 0.56 ? 4   VAL A N    8  
ATOM   9581  C CA   . VAL A 1 4  ? 6.803   0.525   7.971   1.00 0.50 ? 4   VAL A CA   8  
ATOM   9582  C C    . VAL A 1 4  ? 6.879   1.030   6.529   1.00 0.45 ? 4   VAL A C    8  
ATOM   9583  O O    . VAL A 1 4  ? 6.868   0.242   5.582   1.00 0.48 ? 4   VAL A O    8  
ATOM   9584  C CB   . VAL A 1 4  ? 5.324   0.381   8.397   1.00 0.57 ? 4   VAL A CB   8  
ATOM   9585  C CG1  . VAL A 1 4  ? 4.599   -0.613  7.503   1.00 0.82 ? 4   VAL A CG1  8  
ATOM   9586  C CG2  . VAL A 1 4  ? 5.231   -0.048  9.855   1.00 0.79 ? 4   VAL A CG2  8  
ATOM   9587  H H    . VAL A 1 4  ? 7.062   1.817   9.631   1.00 0.63 ? 4   VAL A H    8  
ATOM   9588  H HA   . VAL A 1 4  ? 7.262   -0.453  8.019   1.00 0.54 ? 4   VAL A HA   8  
ATOM   9589  H HB   . VAL A 1 4  ? 4.842   1.343   8.295   1.00 0.63 ? 4   VAL A HB   8  
ATOM   9590  H HG11 . VAL A 1 4  ? 4.629   -0.268  6.482   1.00 1.06 ? 4   VAL A HG11 8  
ATOM   9591  H HG12 . VAL A 1 4  ? 3.571   -0.701  7.823   1.00 0.99 ? 4   VAL A HG12 8  
ATOM   9592  H HG13 . VAL A 1 4  ? 5.081   -1.576  7.571   1.00 1.13 ? 4   VAL A HG13 8  
ATOM   9593  H HG21 . VAL A 1 4  ? 5.727   0.682   10.477  1.00 1.11 ? 4   VAL A HG21 8  
ATOM   9594  H HG22 . VAL A 1 4  ? 5.706   -1.010  9.979   1.00 1.16 ? 4   VAL A HG22 8  
ATOM   9595  H HG23 . VAL A 1 4  ? 4.192   -0.120  10.145  1.00 1.27 ? 4   VAL A HG23 8  
ATOM   9596  N N    . ILE A 1 5  ? 6.986   2.341   6.365   1.00 0.48 ? 5   ILE A N    8  
ATOM   9597  C CA   . ILE A 1 5  ? 7.077   2.925   5.038   1.00 0.51 ? 5   ILE A CA   8  
ATOM   9598  C C    . ILE A 1 5  ? 8.376   2.493   4.367   1.00 0.46 ? 5   ILE A C    8  
ATOM   9599  O O    . ILE A 1 5  ? 8.369   2.027   3.234   1.00 0.47 ? 5   ILE A O    8  
ATOM   9600  C CB   . ILE A 1 5  ? 7.004   4.470   5.071   1.00 0.65 ? 5   ILE A CB   8  
ATOM   9601  C CG1  . ILE A 1 5  ? 5.692   4.928   5.712   1.00 0.81 ? 5   ILE A CG1  8  
ATOM   9602  C CG2  . ILE A 1 5  ? 7.135   5.045   3.663   1.00 0.81 ? 5   ILE A CG2  8  
ATOM   9603  C CD1  . ILE A 1 5  ? 5.588   6.429   5.882   1.00 0.98 ? 5   ILE A CD1  8  
ATOM   9604  H H    . ILE A 1 5  ? 7.022   2.924   7.152   1.00 0.54 ? 5   ILE A H    8  
ATOM   9605  H HA   . ILE A 1 5  ? 6.245   2.558   4.456   1.00 0.55 ? 5   ILE A HA   8  
ATOM   9606  H HB   . ILE A 1 5  ? 7.832   4.834   5.660   1.00 0.71 ? 5   ILE A HB   8  
ATOM   9607  H HG12 . ILE A 1 5  ? 4.868   4.613   5.092   1.00 0.91 ? 5   ILE A HG12 8  
ATOM   9608  H HG13 . ILE A 1 5  ? 5.595   4.477   6.689   1.00 0.85 ? 5   ILE A HG13 8  
ATOM   9609  H HG21 . ILE A 1 5  ? 6.310   4.703   3.055   1.00 1.02 ? 5   ILE A HG21 8  
ATOM   9610  H HG22 . ILE A 1 5  ? 8.066   4.716   3.226   1.00 1.00 ? 5   ILE A HG22 8  
ATOM   9611  H HG23 . ILE A 1 5  ? 7.123   6.124   3.712   1.00 1.04 ? 5   ILE A HG23 8  
ATOM   9612  H HD11 . ILE A 1 5  ? 6.388   6.777   6.517   1.00 1.27 ? 5   ILE A HD11 8  
ATOM   9613  H HD12 . ILE A 1 5  ? 4.639   6.674   6.333   1.00 1.29 ? 5   ILE A HD12 8  
ATOM   9614  H HD13 . ILE A 1 5  ? 5.661   6.907   4.915   1.00 1.30 ? 5   ILE A HD13 8  
ATOM   9615  N N    . LYS A 1 6  ? 9.478   2.607   5.097   1.00 0.49 ? 6   LYS A N    8  
ATOM   9616  C CA   . LYS A 1 6  ? 10.797  2.247   4.580   1.00 0.50 ? 6   LYS A CA   8  
ATOM   9617  C C    . LYS A 1 6  ? 10.885  0.765   4.224   1.00 0.46 ? 6   LYS A C    8  
ATOM   9618  O O    . LYS A 1 6  ? 11.474  0.397   3.206   1.00 0.47 ? 6   LYS A O    8  
ATOM   9619  C CB   . LYS A 1 6  ? 11.880  2.582   5.611   1.00 0.61 ? 6   LYS A CB   8  
ATOM   9620  C CG   . LYS A 1 6  ? 11.804  4.003   6.147   1.00 0.85 ? 6   LYS A CG   8  
ATOM   9621  C CD   . LYS A 1 6  ? 11.791  5.028   5.024   1.00 1.11 ? 6   LYS A CD   8  
ATOM   9622  C CE   . LYS A 1 6  ? 13.119  5.075   4.283   1.00 1.11 ? 6   LYS A CE   8  
ATOM   9623  N NZ   . LYS A 1 6  ? 13.079  6.014   3.133   1.00 1.12 ? 6   LYS A NZ   8  
ATOM   9624  H H    . LYS A 1 6  ? 9.404   2.944   6.016   1.00 0.53 ? 6   LYS A H    8  
ATOM   9625  H HA   . LYS A 1 6  ? 10.974  2.827   3.688   1.00 0.52 ? 6   LYS A HA   8  
ATOM   9626  H HB2  . LYS A 1 6  ? 11.787  1.902   6.445   1.00 0.84 ? 6   LYS A HB2  8  
ATOM   9627  H HB3  . LYS A 1 6  ? 12.847  2.445   5.154   1.00 0.80 ? 6   LYS A HB3  8  
ATOM   9628  H HG2  . LYS A 1 6  ? 10.899  4.112   6.728   1.00 1.25 ? 6   LYS A HG2  8  
ATOM   9629  H HG3  . LYS A 1 6  ? 12.663  4.184   6.778   1.00 1.02 ? 6   LYS A HG3  8  
ATOM   9630  H HD2  . LYS A 1 6  ? 11.012  4.769   4.324   1.00 1.57 ? 6   LYS A HD2  8  
ATOM   9631  H HD3  . LYS A 1 6  ? 11.588  5.998   5.446   1.00 1.65 ? 6   LYS A HD3  8  
ATOM   9632  H HE2  . LYS A 1 6  ? 13.890  5.391   4.968   1.00 1.38 ? 6   LYS A HE2  8  
ATOM   9633  H HE3  . LYS A 1 6  ? 13.350  4.084   3.920   1.00 1.51 ? 6   LYS A HE3  8  
ATOM   9634  H HZ1  . LYS A 1 6  ? 12.628  5.566   2.314   1.00 1.52 ? 6   LYS A HZ1  8  
ATOM   9635  H HZ2  . LYS A 1 6  ? 14.044  6.299   2.867   1.00 1.47 ? 6   LYS A HZ2  8  
ATOM   9636  H HZ3  . LYS A 1 6  ? 12.543  6.868   3.386   1.00 1.48 ? 6   LYS A HZ3  8  
ATOM   9637  N N    . VAL A 1 7  ? 10.291  -0.077  5.059   1.00 0.46 ? 7   VAL A N    8  
ATOM   9638  C CA   . VAL A 1 7  ? 10.320  -1.525  4.847   1.00 0.48 ? 7   VAL A CA   8  
ATOM   9639  C C    . VAL A 1 7  ? 9.714   -1.926  3.496   1.00 0.44 ? 7   VAL A C    8  
ATOM   9640  O O    . VAL A 1 7  ? 10.142  -2.907  2.880   1.00 0.54 ? 7   VAL A O    8  
ATOM   9641  C CB   . VAL A 1 7  ? 9.581   -2.272  5.982   1.00 0.54 ? 7   VAL A CB   8  
ATOM   9642  C CG1  . VAL A 1 7  ? 9.721   -3.779  5.825   1.00 0.60 ? 7   VAL A CG1  8  
ATOM   9643  C CG2  . VAL A 1 7  ? 10.095  -1.827  7.343   1.00 0.61 ? 7   VAL A CG2  8  
ATOM   9644  H H    . VAL A 1 7  ? 9.818   0.281   5.841   1.00 0.48 ? 7   VAL A H    8  
ATOM   9645  H HA   . VAL A 1 7  ? 11.355  -1.835  4.864   1.00 0.53 ? 7   VAL A HA   8  
ATOM   9646  H HB   . VAL A 1 7  ? 8.532   -2.023  5.919   1.00 0.55 ? 7   VAL A HB   8  
ATOM   9647  H HG11 . VAL A 1 7  ? 10.764  -4.053  5.876   1.00 0.73 ? 7   VAL A HG11 8  
ATOM   9648  H HG12 . VAL A 1 7  ? 9.316   -4.081  4.870   1.00 0.72 ? 7   VAL A HG12 8  
ATOM   9649  H HG13 . VAL A 1 7  ? 9.180   -4.275  6.617   1.00 0.79 ? 7   VAL A HG13 8  
ATOM   9650  H HG21 . VAL A 1 7  ? 9.889   -0.776  7.481   1.00 0.75 ? 7   VAL A HG21 8  
ATOM   9651  H HG22 . VAL A 1 7  ? 11.161  -1.993  7.399   1.00 0.79 ? 7   VAL A HG22 8  
ATOM   9652  H HG23 . VAL A 1 7  ? 9.601   -2.394  8.117   1.00 0.78 ? 7   VAL A HG23 8  
ATOM   9653  N N    . ILE A 1 8  ? 8.741   -1.161  3.019   1.00 0.38 ? 8   ILE A N    8  
ATOM   9654  C CA   . ILE A 1 8  ? 8.090   -1.479  1.754   1.00 0.40 ? 8   ILE A CA   8  
ATOM   9655  C C    . ILE A 1 8  ? 8.510   -0.530  0.627   1.00 0.37 ? 8   ILE A C    8  
ATOM   9656  O O    . ILE A 1 8  ? 8.619   -0.946  -0.530  1.00 0.40 ? 8   ILE A O    8  
ATOM   9657  C CB   . ILE A 1 8  ? 6.554   -1.455  1.895   1.00 0.47 ? 8   ILE A CB   8  
ATOM   9658  C CG1  . ILE A 1 8  ? 6.110   -2.186  3.169   1.00 0.52 ? 8   ILE A CG1  8  
ATOM   9659  C CG2  . ILE A 1 8  ? 5.907   -2.079  0.670   1.00 0.56 ? 8   ILE A CG2  8  
ATOM   9660  C CD1  . ILE A 1 8  ? 6.438   -3.666  3.179   1.00 0.61 ? 8   ILE A CD1  8  
ATOM   9661  H H    . ILE A 1 8  ? 8.455   -0.371  3.528   1.00 0.39 ? 8   ILE A H    8  
ATOM   9662  H HA   . ILE A 1 8  ? 8.380   -2.484  1.479   1.00 0.44 ? 8   ILE A HA   8  
ATOM   9663  H HB   . ILE A 1 8  ? 6.239   -0.425  1.953   1.00 0.50 ? 8   ILE A HB   8  
ATOM   9664  H HG12 . ILE A 1 8  ? 6.600   -1.737  4.019   1.00 0.53 ? 8   ILE A HG12 8  
ATOM   9665  H HG13 . ILE A 1 8  ? 5.041   -2.085  3.282   1.00 0.59 ? 8   ILE A HG13 8  
ATOM   9666  H HG21 . ILE A 1 8  ? 4.843   -2.171  0.832   1.00 0.96 ? 8   ILE A HG21 8  
ATOM   9667  H HG22 . ILE A 1 8  ? 6.333   -3.056  0.497   1.00 1.01 ? 8   ILE A HG22 8  
ATOM   9668  H HG23 . ILE A 1 8  ? 6.088   -1.452  -0.188  1.00 1.00 ? 8   ILE A HG23 8  
ATOM   9669  H HD11 . ILE A 1 8  ? 5.994   -4.128  4.048   1.00 0.96 ? 8   ILE A HD11 8  
ATOM   9670  H HD12 . ILE A 1 8  ? 7.509   -3.795  3.212   1.00 0.94 ? 8   ILE A HD12 8  
ATOM   9671  H HD13 . ILE A 1 8  ? 6.046   -4.128  2.285   1.00 0.97 ? 8   ILE A HD13 8  
ATOM   9672  N N    . SER A 1 9  ? 8.769   0.733   0.966   1.00 0.37 ? 9   SER A N    8  
ATOM   9673  C CA   . SER A 1 9  ? 9.161   1.738   -0.026  1.00 0.41 ? 9   SER A CA   8  
ATOM   9674  C C    . SER A 1 9  ? 10.410  1.301   -0.786  1.00 0.40 ? 9   SER A C    8  
ATOM   9675  O O    . SER A 1 9  ? 10.395  1.217   -2.016  1.00 0.46 ? 9   SER A O    8  
ATOM   9676  C CB   . SER A 1 9  ? 9.392   3.106   0.639   1.00 0.49 ? 9   SER A CB   8  
ATOM   9677  O OG   . SER A 1 9  ? 9.750   4.095   -0.316  1.00 1.22 ? 9   SER A OG   8  
ATOM   9678  H H    . SER A 1 9  ? 8.684   1.002   1.906   1.00 0.39 ? 9   SER A H    8  
ATOM   9679  H HA   . SER A 1 9  ? 8.350   1.828   -0.731  1.00 0.45 ? 9   SER A HA   8  
ATOM   9680  H HB2  . SER A 1 9  ? 8.485   3.419   1.135   1.00 1.05 ? 9   SER A HB2  8  
ATOM   9681  H HB3  . SER A 1 9  ? 10.187  3.021   1.367   1.00 1.19 ? 9   SER A HB3  8  
ATOM   9682  H HG   . SER A 1 9  ? 9.195   4.874   -0.195  1.00 1.36 ? 9   SER A HG   8  
ATOM   9683  N N    . SER A 1 10 ? 11.478  0.992   -0.059  1.00 0.39 ? 10  SER A N    8  
ATOM   9684  C CA   . SER A 1 10 ? 12.718  0.559   -0.685  1.00 0.43 ? 10  SER A CA   8  
ATOM   9685  C C    . SER A 1 10 ? 12.493  -0.722  -1.489  1.00 0.42 ? 10  SER A C    8  
ATOM   9686  O O    . SER A 1 10 ? 13.151  -0.956  -2.497  1.00 0.56 ? 10  SER A O    8  
ATOM   9687  C CB   . SER A 1 10 ? 13.792  0.342   0.381   1.00 0.52 ? 10  SER A CB   8  
ATOM   9688  O OG   . SER A 1 10 ? 13.631  1.255   1.454   1.00 1.17 ? 10  SER A OG   8  
ATOM   9689  H H    . SER A 1 10 ? 11.436  1.066   0.917   1.00 0.41 ? 10  SER A H    8  
ATOM   9690  H HA   . SER A 1 10 ? 13.040  1.341   -1.358  1.00 0.47 ? 10  SER A HA   8  
ATOM   9691  H HB2  . SER A 1 10 ? 13.717  -0.663  0.765   1.00 0.93 ? 10  SER A HB2  8  
ATOM   9692  H HB3  . SER A 1 10 ? 14.770  0.488   -0.058  1.00 1.00 ? 10  SER A HB3  8  
ATOM   9693  H HG   . SER A 1 10 ? 13.643  2.160   1.110   1.00 1.54 ? 10  SER A HG   8  
ATOM   9694  N N    . ALA A 1 11 ? 11.531  -1.532  -1.054  1.00 0.37 ? 11  ALA A N    8  
ATOM   9695  C CA   . ALA A 1 11 ? 11.222  -2.780  -1.732  1.00 0.41 ? 11  ALA A CA   8  
ATOM   9696  C C    . ALA A 1 11 ? 10.554  -2.515  -3.073  1.00 0.37 ? 11  ALA A C    8  
ATOM   9697  O O    . ALA A 1 11 ? 11.016  -2.999  -4.108  1.00 0.42 ? 11  ALA A O    8  
ATOM   9698  C CB   . ALA A 1 11 ? 10.341  -3.659  -0.857  1.00 0.47 ? 11  ALA A CB   8  
ATOM   9699  H H    . ALA A 1 11 ? 11.011  -1.276  -0.265  1.00 0.41 ? 11  ALA A H    8  
ATOM   9700  H HA   . ALA A 1 11 ? 12.151  -3.301  -1.904  1.00 0.47 ? 11  ALA A HA   8  
ATOM   9701  H HB1  . ALA A 1 11 ? 9.374   -3.192  -0.734  1.00 0.52 ? 11  ALA A HB1  8  
ATOM   9702  H HB2  . ALA A 1 11 ? 10.806  -3.781  0.110   1.00 0.58 ? 11  ALA A HB2  8  
ATOM   9703  H HB3  . ALA A 1 11 ? 10.219  -4.626  -1.321  1.00 0.58 ? 11  ALA A HB3  8  
ATOM   9704  N N    . CYS A 1 12 ? 9.485   -1.724  -3.064  1.00 0.34 ? 12  CYS A N    8  
ATOM   9705  C CA   . CYS A 1 12 ? 8.764   -1.415  -4.293  1.00 0.37 ? 12  CYS A CA   8  
ATOM   9706  C C    . CYS A 1 12 ? 9.665   -0.661  -5.268  1.00 0.39 ? 12  CYS A C    8  
ATOM   9707  O O    . CYS A 1 12 ? 9.604   -0.877  -6.479  1.00 0.44 ? 12  CYS A O    8  
ATOM   9708  C CB   . CYS A 1 12 ? 7.485   -0.617  -4.000  1.00 0.42 ? 12  CYS A CB   8  
ATOM   9709  S SG   . CYS A 1 12 ? 7.752   1.008   -3.258  1.00 0.66 ? 12  CYS A SG   8  
ATOM   9710  H H    . CYS A 1 12 ? 9.172   -1.345  -2.209  1.00 0.35 ? 12  CYS A H    8  
ATOM   9711  H HA   . CYS A 1 12 ? 8.489   -2.355  -4.747  1.00 0.43 ? 12  CYS A HA   8  
ATOM   9712  H HB2  . CYS A 1 12 ? 6.946   -0.466  -4.923  1.00 0.63 ? 12  CYS A HB2  8  
ATOM   9713  H HB3  . CYS A 1 12 ? 6.866   -1.186  -3.320  1.00 0.63 ? 12  CYS A HB3  8  
ATOM   9714  H HG   . CYS A 1 12 ? 8.868   0.957   -2.541  1.00 1.11 ? 12  CYS A HG   8  
ATOM   9715  N N    . LYS A 1 13 ? 10.541  0.186   -4.730  1.00 0.41 ? 13  LYS A N    8  
ATOM   9716  C CA   . LYS A 1 13 ? 11.458  0.961   -5.556  1.00 0.49 ? 13  LYS A CA   8  
ATOM   9717  C C    . LYS A 1 13 ? 12.581  0.084   -6.107  1.00 0.49 ? 13  LYS A C    8  
ATOM   9718  O O    . LYS A 1 13 ? 13.449  0.554   -6.840  1.00 0.58 ? 13  LYS A O    8  
ATOM   9719  C CB   . LYS A 1 13 ? 12.019  2.142   -4.766  1.00 0.63 ? 13  LYS A CB   8  
ATOM   9720  C CG   . LYS A 1 13 ? 10.984  3.224   -4.505  1.00 0.96 ? 13  LYS A CG   8  
ATOM   9721  C CD   . LYS A 1 13 ? 11.554  4.367   -3.688  1.00 1.06 ? 13  LYS A CD   8  
ATOM   9722  C CE   . LYS A 1 13 ? 10.523  5.459   -3.462  1.00 1.40 ? 13  LYS A CE   8  
ATOM   9723  N NZ   . LYS A 1 13 ? 11.128  6.670   -2.859  1.00 1.34 ? 13  LYS A NZ   8  
ATOM   9724  H H    . LYS A 1 13 ? 10.567  0.296   -3.753  1.00 0.43 ? 13  LYS A H    8  
ATOM   9725  H HA   . LYS A 1 13 ? 10.891  1.343   -6.390  1.00 0.52 ? 13  LYS A HA   8  
ATOM   9726  H HB2  . LYS A 1 13 ? 12.388  1.787   -3.815  1.00 0.79 ? 13  LYS A HB2  8  
ATOM   9727  H HB3  . LYS A 1 13 ? 12.837  2.579   -5.321  1.00 0.85 ? 13  LYS A HB3  8  
ATOM   9728  H HG2  . LYS A 1 13 ? 10.638  3.610   -5.452  1.00 1.66 ? 13  LYS A HG2  8  
ATOM   9729  H HG3  . LYS A 1 13 ? 10.153  2.790   -3.970  1.00 1.57 ? 13  LYS A HG3  8  
ATOM   9730  H HD2  . LYS A 1 13 ? 11.876  3.986   -2.731  1.00 1.45 ? 13  LYS A HD2  8  
ATOM   9731  H HD3  . LYS A 1 13 ? 12.400  4.785   -4.214  1.00 1.68 ? 13  LYS A HD3  8  
ATOM   9732  H HE2  . LYS A 1 13 ? 10.082  5.724   -4.411  1.00 1.92 ? 13  LYS A HE2  8  
ATOM   9733  H HE3  . LYS A 1 13 ? 9.756   5.082   -2.801  1.00 1.72 ? 13  LYS A HE3  8  
ATOM   9734  H HZ1  . LYS A 1 13 ? 11.560  6.442   -1.942  1.00 1.65 ? 13  LYS A HZ1  8  
ATOM   9735  H HZ2  . LYS A 1 13 ? 10.405  7.400   -2.716  1.00 1.65 ? 13  LYS A HZ2  8  
ATOM   9736  H HZ3  . LYS A 1 13 ? 11.865  7.052   -3.484  1.00 1.73 ? 13  LYS A HZ3  8  
ATOM   9737  N N    . THR A 1 14 ? 12.559  -1.189  -5.745  1.00 0.49 ? 14  THR A N    8  
ATOM   9738  C CA   . THR A 1 14 ? 13.541  -2.144  -6.230  1.00 0.56 ? 14  THR A CA   8  
ATOM   9739  C C    . THR A 1 14 ? 12.891  -3.078  -7.253  1.00 0.54 ? 14  THR A C    8  
ATOM   9740  O O    . THR A 1 14 ? 13.488  -3.414  -8.274  1.00 0.72 ? 14  THR A O    8  
ATOM   9741  C CB   . THR A 1 14 ? 14.145  -2.960  -5.070  1.00 0.65 ? 14  THR A CB   8  
ATOM   9742  O OG1  . THR A 1 14 ? 14.787  -2.077  -4.141  1.00 0.77 ? 14  THR A OG1  8  
ATOM   9743  C CG2  . THR A 1 14 ? 15.152  -3.982  -5.577  1.00 0.83 ? 14  THR A CG2  8  
ATOM   9744  H H    . THR A 1 14 ? 11.865  -1.495  -5.123  1.00 0.48 ? 14  THR A H    8  
ATOM   9745  H HA   . THR A 1 14 ? 14.336  -1.592  -6.713  1.00 0.63 ? 14  THR A HA   8  
ATOM   9746  H HB   . THR A 1 14 ? 13.345  -3.485  -4.564  1.00 0.82 ? 14  THR A HB   8  
ATOM   9747  H HG1  . THR A 1 14 ? 14.113  -1.575  -3.658  1.00 0.99 ? 14  THR A HG1  8  
ATOM   9748  H HG21 . THR A 1 14 ? 15.991  -3.468  -6.020  1.00 1.01 ? 14  THR A HG21 8  
ATOM   9749  H HG22 . THR A 1 14 ? 14.682  -4.610  -6.320  1.00 1.11 ? 14  THR A HG22 8  
ATOM   9750  H HG23 . THR A 1 14 ? 15.494  -4.590  -4.753  1.00 1.00 ? 14  THR A HG23 8  
ATOM   9751  N N    . TYR A 1 15 ? 11.654  -3.477  -6.979  1.00 0.49 ? 15  TYR A N    8  
ATOM   9752  C CA   . TYR A 1 15 ? 10.919  -4.359  -7.880  1.00 0.54 ? 15  TYR A CA   8  
ATOM   9753  C C    . TYR A 1 15 ? 10.373  -3.573  -9.069  1.00 0.56 ? 15  TYR A C    8  
ATOM   9754  O O    . TYR A 1 15 ? 10.476  -4.008  -10.217 1.00 0.72 ? 15  TYR A O    8  
ATOM   9755  C CB   . TYR A 1 15 ? 9.766   -5.049  -7.144  1.00 0.55 ? 15  TYR A CB   8  
ATOM   9756  C CG   . TYR A 1 15 ? 10.210  -6.085  -6.132  1.00 0.60 ? 15  TYR A CG   8  
ATOM   9757  C CD1  . TYR A 1 15 ? 10.022  -5.878  -4.772  1.00 0.67 ? 15  TYR A CD1  8  
ATOM   9758  C CD2  . TYR A 1 15 ? 10.813  -7.271  -6.538  1.00 0.80 ? 15  TYR A CD2  8  
ATOM   9759  C CE1  . TYR A 1 15 ? 10.422  -6.821  -3.844  1.00 0.78 ? 15  TYR A CE1  8  
ATOM   9760  C CE2  . TYR A 1 15 ? 11.215  -8.217  -5.616  1.00 0.91 ? 15  TYR A CE2  8  
ATOM   9761  C CZ   . TYR A 1 15 ? 11.018  -7.989  -4.271  1.00 0.84 ? 15  TYR A CZ   8  
ATOM   9762  O OH   . TYR A 1 15 ? 11.416  -8.929  -3.348  1.00 1.00 ? 15  TYR A OH   8  
ATOM   9763  H H    . TYR A 1 15 ? 11.229  -3.181  -6.145  1.00 0.54 ? 15  TYR A H    8  
ATOM   9764  H HA   . TYR A 1 15 ? 11.605  -5.109  -8.244  1.00 0.62 ? 15  TYR A HA   8  
ATOM   9765  H HB2  . TYR A 1 15 ? 9.190   -4.302  -6.620  1.00 0.54 ? 15  TYR A HB2  8  
ATOM   9766  H HB3  . TYR A 1 15 ? 9.133   -5.543  -7.868  1.00 0.63 ? 15  TYR A HB3  8  
ATOM   9767  H HD1  . TYR A 1 15 ? 9.558   -4.961  -4.439  1.00 0.79 ? 15  TYR A HD1  8  
ATOM   9768  H HD2  . TYR A 1 15 ? 10.968  -7.448  -7.592  1.00 0.96 ? 15  TYR A HD2  8  
ATOM   9769  H HE1  . TYR A 1 15 ? 10.266  -6.643  -2.791  1.00 0.93 ? 15  TYR A HE1  8  
ATOM   9770  H HE2  . TYR A 1 15 ? 11.682  -9.131  -5.951  1.00 1.14 ? 15  TYR A HE2  8  
ATOM   9771  H HH   . TYR A 1 15 ? 12.199  -9.389  -3.677  1.00 1.22 ? 15  TYR A HH   8  
ATOM   9772  N N    . CYS A 1 16 ? 9.785   -2.421  -8.786  1.00 0.50 ? 16  CYS A N    8  
ATOM   9773  C CA   . CYS A 1 16 ? 9.223   -1.575  -9.828  1.00 0.55 ? 16  CYS A CA   8  
ATOM   9774  C C    . CYS A 1 16 ? 10.242  -0.531  -10.274 1.00 0.57 ? 16  CYS A C    8  
ATOM   9775  O O    . CYS A 1 16 ? 10.469  -0.337  -11.468 1.00 0.88 ? 16  CYS A O    8  
ATOM   9776  C CB   . CYS A 1 16 ? 7.947   -0.895  -9.320  1.00 0.54 ? 16  CYS A CB   8  
ATOM   9777  S SG   . CYS A 1 16 ? 6.806   -2.022  -8.481  1.00 0.67 ? 16  CYS A SG   8  
ATOM   9778  H H    . CYS A 1 16 ? 9.721   -2.129  -7.849  1.00 0.50 ? 16  CYS A H    8  
ATOM   9779  H HA   . CYS A 1 16 ? 8.974   -2.204  -10.671 1.00 0.64 ? 16  CYS A HA   8  
ATOM   9780  H HB2  . CYS A 1 16 ? 8.216   -0.118  -8.621  1.00 0.56 ? 16  CYS A HB2  8  
ATOM   9781  H HB3  . CYS A 1 16 ? 7.422   -0.455  -10.156 1.00 0.63 ? 16  CYS A HB3  8  
ATOM   9782  H HG   . CYS A 1 16 ? 6.445   -2.960  -9.347  1.00 1.15 ? 16  CYS A HG   8  
ATOM   9783  N N    . GLY A 1 17 ? 10.863  0.131   -9.310  1.00 0.49 ? 17  GLY A N    8  
ATOM   9784  C CA   . GLY A 1 17 ? 11.856  1.138   -9.625  1.00 0.56 ? 17  GLY A CA   8  
ATOM   9785  C C    . GLY A 1 17 ? 11.372  2.540   -9.319  1.00 0.52 ? 17  GLY A C    8  
ATOM   9786  O O    . GLY A 1 17 ? 10.965  2.827   -8.195  1.00 0.66 ? 17  GLY A O    8  
ATOM   9787  H H    . GLY A 1 17 ? 10.644  -0.063  -8.372  1.00 0.62 ? 17  GLY A H    8  
ATOM   9788  H HA2  . GLY A 1 17 ? 12.747  0.943   -9.046  1.00 0.65 ? 17  GLY A HA2  8  
ATOM   9789  H HA3  . GLY A 1 17 ? 12.099  1.073   -10.673 1.00 0.63 ? 17  GLY A HA3  8  
ATOM   9790  N N    . LYS A 1 18 ? 11.399  3.409   -10.320 1.00 0.50 ? 18  LYS A N    8  
ATOM   9791  C CA   . LYS A 1 18 ? 10.960  4.790   -10.140 1.00 0.56 ? 18  LYS A CA   8  
ATOM   9792  C C    . LYS A 1 18 ? 9.457   4.914   -10.365 1.00 0.53 ? 18  LYS A C    8  
ATOM   9793  O O    . LYS A 1 18 ? 8.863   5.964   -10.127 1.00 0.62 ? 18  LYS A O    8  
ATOM   9794  C CB   . LYS A 1 18 ? 11.719  5.726   -11.084 1.00 0.70 ? 18  LYS A CB   8  
ATOM   9795  C CG   . LYS A 1 18 ? 11.461  5.463   -12.561 1.00 0.81 ? 18  LYS A CG   8  
ATOM   9796  C CD   . LYS A 1 18 ? 12.759  5.214   -13.315 1.00 1.11 ? 18  LYS A CD   8  
ATOM   9797  C CE   . LYS A 1 18 ? 13.617  6.468   -13.399 1.00 1.46 ? 18  LYS A CE   8  
ATOM   9798  N NZ   . LYS A 1 18 ? 14.969  6.184   -13.949 1.00 1.82 ? 18  LYS A NZ   8  
ATOM   9799  H H    . LYS A 1 18 ? 11.718  3.117   -11.204 1.00 0.58 ? 18  LYS A H    8  
ATOM   9800  H HA   . LYS A 1 18 ? 11.179  5.070   -9.120  1.00 0.60 ? 18  LYS A HA   8  
ATOM   9801  H HB2  . LYS A 1 18 ? 11.434  6.744   -10.867 1.00 0.87 ? 18  LYS A HB2  8  
ATOM   9802  H HB3  . LYS A 1 18 ? 12.778  5.613   -10.901 1.00 0.79 ? 18  LYS A HB3  8  
ATOM   9803  H HG2  . LYS A 1 18 ? 10.828  4.594   -12.658 1.00 0.90 ? 18  LYS A HG2  8  
ATOM   9804  H HG3  . LYS A 1 18 ? 10.965  6.323   -12.988 1.00 1.06 ? 18  LYS A HG3  8  
ATOM   9805  H HD2  . LYS A 1 18 ? 13.317  4.446   -12.803 1.00 1.33 ? 18  LYS A HD2  8  
ATOM   9806  H HD3  . LYS A 1 18 ? 12.523  4.882   -14.315 1.00 1.44 ? 18  LYS A HD3  8  
ATOM   9807  H HE2  . LYS A 1 18 ? 13.124  7.182   -14.040 1.00 1.85 ? 18  LYS A HE2  8  
ATOM   9808  H HE3  . LYS A 1 18 ? 13.720  6.884   -12.408 1.00 1.67 ? 18  LYS A HE3  8  
ATOM   9809  H HZ1  . LYS A 1 18 ? 15.592  7.002   -13.804 1.00 2.13 ? 18  LYS A HZ1  8  
ATOM   9810  H HZ2  . LYS A 1 18 ? 14.906  5.986   -14.970 1.00 2.19 ? 18  LYS A HZ2  8  
ATOM   9811  H HZ3  . LYS A 1 18 ? 15.385  5.356   -13.476 1.00 2.14 ? 18  LYS A HZ3  8  
ATOM   9812  N N    . THR A 1 19 ? 8.849   3.830   -10.830 1.00 0.49 ? 19  THR A N    8  
ATOM   9813  C CA   . THR A 1 19 ? 7.416   3.796   -11.081 1.00 0.52 ? 19  THR A CA   8  
ATOM   9814  C C    . THR A 1 19 ? 6.639   3.696   -9.770  1.00 0.48 ? 19  THR A C    8  
ATOM   9815  O O    . THR A 1 19 ? 5.424   3.903   -9.733  1.00 0.62 ? 19  THR A O    8  
ATOM   9816  C CB   . THR A 1 19 ? 7.055   2.596   -11.974 1.00 0.62 ? 19  THR A CB   8  
ATOM   9817  O OG1  . THR A 1 19 ? 8.251   2.037   -12.538 1.00 0.83 ? 19  THR A OG1  8  
ATOM   9818  C CG2  . THR A 1 19 ? 6.105   3.014   -13.086 1.00 0.91 ? 19  THR A CG2  8  
ATOM   9819  H H    . THR A 1 19 ? 9.382   3.033   -11.028 1.00 0.49 ? 19  THR A H    8  
ATOM   9820  H HA   . THR A 1 19 ? 7.138   4.705   -11.592 1.00 0.60 ? 19  THR A HA   8  
ATOM   9821  H HB   . THR A 1 19 ? 6.568   1.848   -11.366 1.00 0.72 ? 19  THR A HB   8  
ATOM   9822  H HG1  . THR A 1 19 ? 8.174   2.018   -13.500 1.00 1.10 ? 19  THR A HG1  8  
ATOM   9823  H HG21 . THR A 1 19 ? 5.870   2.159   -13.700 1.00 1.10 ? 19  THR A HG21 8  
ATOM   9824  H HG22 . THR A 1 19 ? 6.573   3.774   -13.693 1.00 1.23 ? 19  THR A HG22 8  
ATOM   9825  H HG23 . THR A 1 19 ? 5.196   3.405   -12.652 1.00 1.17 ? 19  THR A HG23 8  
ATOM   9826  N N    . SER A 1 20 ? 7.355   3.374   -8.704  1.00 0.42 ? 20  SER A N    8  
ATOM   9827  C CA   . SER A 1 20 ? 6.770   3.238   -7.381  1.00 0.42 ? 20  SER A CA   8  
ATOM   9828  C C    . SER A 1 20 ? 6.280   4.592   -6.862  1.00 0.41 ? 20  SER A C    8  
ATOM   9829  O O    . SER A 1 20 ? 6.824   5.634   -7.227  1.00 0.46 ? 20  SER A O    8  
ATOM   9830  C CB   . SER A 1 20 ? 7.816   2.655   -6.437  1.00 0.46 ? 20  SER A CB   8  
ATOM   9831  O OG   . SER A 1 20 ? 8.735   1.851   -7.157  1.00 0.97 ? 20  SER A OG   8  
ATOM   9832  H H    . SER A 1 20 ? 8.315   3.222   -8.809  1.00 0.49 ? 20  SER A H    8  
ATOM   9833  H HA   . SER A 1 20 ? 5.933   2.559   -7.450  1.00 0.48 ? 20  SER A HA   8  
ATOM   9834  H HB2  . SER A 1 20 ? 8.354   3.459   -5.958  1.00 0.70 ? 20  SER A HB2  8  
ATOM   9835  H HB3  . SER A 1 20 ? 7.328   2.047   -5.688  1.00 0.81 ? 20  SER A HB3  8  
ATOM   9836  H HG   . SER A 1 20 ? 9.582   2.316   -7.228  1.00 1.21 ? 20  SER A HG   8  
ATOM   9837  N N    . PRO A 1 21 ? 5.256   4.590   -5.997  1.00 0.43 ? 21  PRO A N    8  
ATOM   9838  C CA   . PRO A 1 21 ? 4.685   5.821   -5.446  1.00 0.49 ? 21  PRO A CA   8  
ATOM   9839  C C    . PRO A 1 21 ? 5.561   6.439   -4.364  1.00 0.42 ? 21  PRO A C    8  
ATOM   9840  O O    . PRO A 1 21 ? 6.270   5.733   -3.643  1.00 0.46 ? 21  PRO A O    8  
ATOM   9841  C CB   . PRO A 1 21 ? 3.353   5.350   -4.857  1.00 0.62 ? 21  PRO A CB   8  
ATOM   9842  C CG   . PRO A 1 21 ? 3.581   3.928   -4.485  1.00 0.63 ? 21  PRO A CG   8  
ATOM   9843  C CD   . PRO A 1 21 ? 4.577   3.386   -5.476  1.00 0.50 ? 21  PRO A CD   8  
ATOM   9844  H HA   . PRO A 1 21 ? 4.502   6.553   -6.218  1.00 0.57 ? 21  PRO A HA   8  
ATOM   9845  H HB2  . PRO A 1 21 ? 3.102   5.944   -3.987  1.00 0.69 ? 21  PRO A HB2  8  
ATOM   9846  H HB3  . PRO A 1 21 ? 2.572   5.417   -5.598  1.00 0.76 ? 21  PRO A HB3  8  
ATOM   9847  H HG2  . PRO A 1 21 ? 3.979   3.874   -3.482  1.00 0.76 ? 21  PRO A HG2  8  
ATOM   9848  H HG3  . PRO A 1 21 ? 2.658   3.374   -4.554  1.00 0.81 ? 21  PRO A HG3  8  
ATOM   9849  H HD2  . PRO A 1 21 ? 5.280   2.734   -4.981  1.00 0.55 ? 21  PRO A HD2  8  
ATOM   9850  H HD3  . PRO A 1 21 ? 4.069   2.858   -6.269  1.00 0.57 ? 21  PRO A HD3  8  
ATOM   9851  N N    . SER A 1 22 ? 5.517   7.760   -4.269  1.00 0.43 ? 22  SER A N    8  
ATOM   9852  C CA   . SER A 1 22 ? 6.288   8.486   -3.275  1.00 0.43 ? 22  SER A CA   8  
ATOM   9853  C C    . SER A 1 22 ? 5.650   8.333   -1.899  1.00 0.38 ? 22  SER A C    8  
ATOM   9854  O O    . SER A 1 22 ? 4.467   7.987   -1.787  1.00 0.39 ? 22  SER A O    8  
ATOM   9855  C CB   . SER A 1 22 ? 6.374   9.961   -3.665  1.00 0.56 ? 22  SER A CB   8  
ATOM   9856  O OG   . SER A 1 22 ? 5.183   10.390  -4.311  1.00 1.11 ? 22  SER A OG   8  
ATOM   9857  H H    . SER A 1 22 ? 4.949   8.265   -4.890  1.00 0.53 ? 22  SER A H    8  
ATOM   9858  H HA   . SER A 1 22 ? 7.283   8.067   -3.250  1.00 0.47 ? 22  SER A HA   8  
ATOM   9859  H HB2  . SER A 1 22 ? 6.526   10.560  -2.780  1.00 0.96 ? 22  SER A HB2  8  
ATOM   9860  H HB3  . SER A 1 22 ? 7.205   10.102  -4.342  1.00 0.81 ? 22  SER A HB3  8  
ATOM   9861  H HG   . SER A 1 22 ? 5.306   10.342  -5.267  1.00 1.48 ? 22  SER A HG   8  
ATOM   9862  N N    . LYS A 1 23 ? 6.428   8.604   -0.857  1.00 0.44 ? 23  LYS A N    8  
ATOM   9863  C CA   . LYS A 1 23 ? 5.948   8.487   0.515   1.00 0.50 ? 23  LYS A CA   8  
ATOM   9864  C C    . LYS A 1 23 ? 4.707   9.352   0.735   1.00 0.42 ? 23  LYS A C    8  
ATOM   9865  O O    . LYS A 1 23 ? 3.831   8.999   1.522   1.00 0.42 ? 23  LYS A O    8  
ATOM   9866  C CB   . LYS A 1 23 ? 7.056   8.871   1.502   1.00 0.69 ? 23  LYS A CB   8  
ATOM   9867  C CG   . LYS A 1 23 ? 6.632   8.798   2.964   1.00 0.63 ? 23  LYS A CG   8  
ATOM   9868  C CD   . LYS A 1 23 ? 6.231   10.163  3.504   1.00 1.12 ? 23  LYS A CD   8  
ATOM   9869  C CE   . LYS A 1 23 ? 7.421   10.929  4.050   1.00 1.17 ? 23  LYS A CE   8  
ATOM   9870  N NZ   . LYS A 1 23 ? 8.506   11.086  3.044   1.00 1.60 ? 23  LYS A NZ   8  
ATOM   9871  H H    . LYS A 1 23 ? 7.359   8.886   -1.017  1.00 0.50 ? 23  LYS A H    8  
ATOM   9872  H HA   . LYS A 1 23 ? 5.679   7.455   0.678   1.00 0.56 ? 23  LYS A HA   8  
ATOM   9873  H HB2  . LYS A 1 23 ? 7.898   8.208   1.357   1.00 1.00 ? 23  LYS A HB2  8  
ATOM   9874  H HB3  . LYS A 1 23 ? 7.368   9.885   1.293   1.00 1.02 ? 23  LYS A HB3  8  
ATOM   9875  H HG2  . LYS A 1 23 ? 5.789   8.129   3.050   1.00 0.92 ? 23  LYS A HG2  8  
ATOM   9876  H HG3  . LYS A 1 23 ? 7.457   8.418   3.551   1.00 0.87 ? 23  LYS A HG3  8  
ATOM   9877  H HD2  . LYS A 1 23 ? 5.782   10.736  2.708   1.00 1.72 ? 23  LYS A HD2  8  
ATOM   9878  H HD3  . LYS A 1 23 ? 5.511   10.024  4.297   1.00 1.84 ? 23  LYS A HD3  8  
ATOM   9879  H HE2  . LYS A 1 23 ? 7.090   11.907  4.360   1.00 1.51 ? 23  LYS A HE2  8  
ATOM   9880  H HE3  . LYS A 1 23 ? 7.810   10.397  4.904   1.00 1.35 ? 23  LYS A HE3  8  
ATOM   9881  H HZ1  . LYS A 1 23 ? 8.116   11.318  2.111   1.00 2.03 ? 23  LYS A HZ1  8  
ATOM   9882  H HZ2  . LYS A 1 23 ? 9.054   10.204  2.971   1.00 1.91 ? 23  LYS A HZ2  8  
ATOM   9883  H HZ3  . LYS A 1 23 ? 9.154   11.845  3.335   1.00 2.03 ? 23  LYS A HZ3  8  
ATOM   9884  N N    . LYS A 1 24 ? 4.632   10.472  0.022   1.00 0.41 ? 24  LYS A N    8  
ATOM   9885  C CA   . LYS A 1 24 ? 3.496   11.379  0.140   1.00 0.45 ? 24  LYS A CA   8  
ATOM   9886  C C    . LYS A 1 24 ? 2.186   10.648  -0.153  1.00 0.40 ? 24  LYS A C    8  
ATOM   9887  O O    . LYS A 1 24 ? 1.184   10.843  0.538   1.00 0.48 ? 24  LYS A O    8  
ATOM   9888  C CB   . LYS A 1 24 ? 3.652   12.567  -0.815  1.00 0.56 ? 24  LYS A CB   8  
ATOM   9889  C CG   . LYS A 1 24 ? 4.608   13.648  -0.324  1.00 0.83 ? 24  LYS A CG   8  
ATOM   9890  C CD   . LYS A 1 24 ? 6.059   13.303  -0.621  1.00 1.00 ? 24  LYS A CD   8  
ATOM   9891  C CE   . LYS A 1 24 ? 7.002   14.380  -0.108  1.00 1.56 ? 24  LYS A CE   8  
ATOM   9892  N NZ   . LYS A 1 24 ? 8.419   14.055  -0.398  1.00 2.04 ? 24  LYS A NZ   8  
ATOM   9893  H H    . LYS A 1 24 ? 5.357   10.691  -0.599  1.00 0.44 ? 24  LYS A H    8  
ATOM   9894  H HA   . LYS A 1 24 ? 3.468   11.746  1.157   1.00 0.51 ? 24  LYS A HA   8  
ATOM   9895  H HB2  . LYS A 1 24 ? 4.014   12.204  -1.764  1.00 0.63 ? 24  LYS A HB2  8  
ATOM   9896  H HB3  . LYS A 1 24 ? 2.683   13.018  -0.962  1.00 0.77 ? 24  LYS A HB3  8  
ATOM   9897  H HG2  . LYS A 1 24 ? 4.365   14.577  -0.817  1.00 1.37 ? 24  LYS A HG2  8  
ATOM   9898  H HG3  . LYS A 1 24 ? 4.486   13.763  0.743   1.00 1.33 ? 24  LYS A HG3  8  
ATOM   9899  H HD2  . LYS A 1 24 ? 6.300   12.368  -0.142  1.00 1.50 ? 24  LYS A HD2  8  
ATOM   9900  H HD3  . LYS A 1 24 ? 6.185   13.207  -1.690  1.00 1.29 ? 24  LYS A HD3  8  
ATOM   9901  H HE2  . LYS A 1 24 ? 6.752   15.316  -0.582  1.00 1.84 ? 24  LYS A HE2  8  
ATOM   9902  H HE3  . LYS A 1 24 ? 6.876   14.474  0.960   1.00 2.19 ? 24  LYS A HE3  8  
ATOM   9903  H HZ1  . LYS A 1 24 ? 8.586   14.044  -1.425  1.00 2.22 ? 24  LYS A HZ1  8  
ATOM   9904  H HZ2  . LYS A 1 24 ? 8.659   13.116  -0.018  1.00 2.45 ? 24  LYS A HZ2  8  
ATOM   9905  H HZ3  . LYS A 1 24 ? 9.050   14.756  0.036   1.00 2.55 ? 24  LYS A HZ3  8  
ATOM   9906  N N    . GLU A 1 25 ? 2.210   9.785   -1.161  1.00 0.34 ? 25  GLU A N    8  
ATOM   9907  C CA   . GLU A 1 25 ? 1.031   9.021   -1.541  1.00 0.37 ? 25  GLU A CA   8  
ATOM   9908  C C    . GLU A 1 25 ? 0.852   7.817   -0.618  1.00 0.31 ? 25  GLU A C    8  
ATOM   9909  O O    . GLU A 1 25 ? -0.273  7.425   -0.298  1.00 0.34 ? 25  GLU A O    8  
ATOM   9910  C CB   . GLU A 1 25 ? 1.148   8.558   -2.991  1.00 0.45 ? 25  GLU A CB   8  
ATOM   9911  C CG   . GLU A 1 25 ? -0.184  8.505   -3.719  1.00 0.90 ? 25  GLU A CG   8  
ATOM   9912  C CD   . GLU A 1 25 ? -0.036  8.051   -5.152  1.00 1.00 ? 25  GLU A CD   8  
ATOM   9913  O OE1  . GLU A 1 25 ? 0.126   8.922   -6.038  1.00 1.30 ? 25  GLU A OE1  8  
ATOM   9914  O OE2  . GLU A 1 25 ? -0.077  6.827   -5.400  1.00 1.58 ? 25  GLU A OE2  8  
ATOM   9915  H H    . GLU A 1 25 ? 3.046   9.656   -1.660  1.00 0.36 ? 25  GLU A H    8  
ATOM   9916  H HA   . GLU A 1 25 ? 0.170   9.665   -1.444  1.00 0.42 ? 25  GLU A HA   8  
ATOM   9917  H HB2  . GLU A 1 25 ? 1.800   9.236   -3.526  1.00 0.97 ? 25  GLU A HB2  8  
ATOM   9918  H HB3  . GLU A 1 25 ? 1.580   7.570   -3.007  1.00 0.87 ? 25  GLU A HB3  8  
ATOM   9919  H HG2  . GLU A 1 25 ? -0.836  7.816   -3.204  1.00 1.42 ? 25  GLU A HG2  8  
ATOM   9920  H HG3  . GLU A 1 25 ? -0.626  9.490   -3.713  1.00 1.47 ? 25  GLU A HG3  8  
ATOM   9921  N N    . ILE A 1 26 ? 1.971   7.245   -0.186  1.00 0.29 ? 26  ILE A N    8  
ATOM   9922  C CA   . ILE A 1 26 ? 1.955   6.090   0.708   1.00 0.29 ? 26  ILE A CA   8  
ATOM   9923  C C    . ILE A 1 26 ? 1.350   6.468   2.059   1.00 0.27 ? 26  ILE A C    8  
ATOM   9924  O O    . ILE A 1 26 ? 0.506   5.748   2.596   1.00 0.28 ? 26  ILE A O    8  
ATOM   9925  C CB   . ILE A 1 26 ? 3.377   5.521   0.918   1.00 0.33 ? 26  ILE A CB   8  
ATOM   9926  C CG1  . ILE A 1 26 ? 3.997   5.136   -0.429  1.00 0.36 ? 26  ILE A CG1  8  
ATOM   9927  C CG2  . ILE A 1 26 ? 3.344   4.315   1.851   1.00 0.41 ? 26  ILE A CG2  8  
ATOM   9928  C CD1  . ILE A 1 26 ? 5.452   4.730   -0.335  1.00 0.45 ? 26  ILE A CD1  8  
ATOM   9929  H H    . ILE A 1 26 ? 2.835   7.609   -0.479  1.00 0.30 ? 26  ILE A H    8  
ATOM   9930  H HA   . ILE A 1 26 ? 1.345   5.322   0.252   1.00 0.32 ? 26  ILE A HA   8  
ATOM   9931  H HB   . ILE A 1 26 ? 3.984   6.285   1.381   1.00 0.34 ? 26  ILE A HB   8  
ATOM   9932  H HG12 . ILE A 1 26 ? 3.447   4.305   -0.846  1.00 0.44 ? 26  ILE A HG12 8  
ATOM   9933  H HG13 . ILE A 1 26 ? 3.930   5.978   -1.102  1.00 0.35 ? 26  ILE A HG13 8  
ATOM   9934  H HG21 . ILE A 1 26 ? 3.033   4.631   2.836   1.00 0.52 ? 26  ILE A HG21 8  
ATOM   9935  H HG22 . ILE A 1 26 ? 4.327   3.876   1.908   1.00 0.53 ? 26  ILE A HG22 8  
ATOM   9936  H HG23 . ILE A 1 26 ? 2.644   3.585   1.471   1.00 0.54 ? 26  ILE A HG23 8  
ATOM   9937  H HD11 . ILE A 1 26 ? 5.791   4.377   -1.298  1.00 0.90 ? 26  ILE A HD11 8  
ATOM   9938  H HD12 . ILE A 1 26 ? 5.557   3.942   0.395   1.00 0.91 ? 26  ILE A HD12 8  
ATOM   9939  H HD13 . ILE A 1 26 ? 6.044   5.580   -0.033  1.00 0.92 ? 26  ILE A HD13 8  
ATOM   9940  N N    . GLY A 1 27 ? 1.767   7.616   2.582   1.00 0.27 ? 27  GLY A N    8  
ATOM   9941  C CA   . GLY A 1 27 ? 1.264   8.092   3.858   1.00 0.29 ? 27  GLY A CA   8  
ATOM   9942  C C    . GLY A 1 27 ? -0.239  8.285   3.852   1.00 0.28 ? 27  GLY A C    8  
ATOM   9943  O O    . GLY A 1 27 ? -0.918  7.962   4.828   1.00 0.32 ? 27  GLY A O    8  
ATOM   9944  H H    . GLY A 1 27 ? 2.441   8.146   2.098   1.00 0.28 ? 27  GLY A H    8  
ATOM   9945  H HA2  . GLY A 1 27 ? 1.521   7.380   4.628   1.00 0.32 ? 27  GLY A HA2  8  
ATOM   9946  H HA3  . GLY A 1 27 ? 1.734   9.038   4.086   1.00 0.33 ? 27  GLY A HA3  8  
ATOM   9947  N N    . ALA A 1 28 ? -0.759  8.805   2.748   1.00 0.27 ? 28  ALA A N    8  
ATOM   9948  C CA   . ALA A 1 28 ? -2.192  9.027   2.619   1.00 0.30 ? 28  ALA A CA   8  
ATOM   9949  C C    . ALA A 1 28 ? -2.938  7.701   2.640   1.00 0.29 ? 28  ALA A C    8  
ATOM   9950  O O    . ALA A 1 28 ? -3.964  7.557   3.311   1.00 0.32 ? 28  ALA A O    8  
ATOM   9951  C CB   . ALA A 1 28 ? -2.499  9.787   1.339   1.00 0.35 ? 28  ALA A CB   8  
ATOM   9952  H H    . ALA A 1 28 ? -0.165  9.050   2.005   1.00 0.27 ? 28  ALA A H    8  
ATOM   9953  H HA   . ALA A 1 28 ? -2.514  9.627   3.456   1.00 0.34 ? 28  ALA A HA   8  
ATOM   9954  H HB1  . ALA A 1 28 ? -1.904  10.686  1.304   1.00 0.47 ? 28  ALA A HB1  8  
ATOM   9955  H HB2  . ALA A 1 28 ? -3.547  10.047  1.320   1.00 0.50 ? 28  ALA A HB2  8  
ATOM   9956  H HB3  . ALA A 1 28 ? -2.266  9.165   0.489   1.00 0.45 ? 28  ALA A HB3  8  
ATOM   9957  N N    . MET A 1 29 ? -2.399  6.728   1.917   1.00 0.27 ? 29  MET A N    8  
ATOM   9958  C CA   . MET A 1 29 ? -2.997  5.403   1.843   1.00 0.30 ? 29  MET A CA   8  
ATOM   9959  C C    . MET A 1 29 ? -2.956  4.715   3.205   1.00 0.28 ? 29  MET A C    8  
ATOM   9960  O O    . MET A 1 29 ? -3.919  4.063   3.606   1.00 0.31 ? 29  MET A O    8  
ATOM   9961  C CB   . MET A 1 29 ? -2.272  4.545   0.803   1.00 0.34 ? 29  MET A CB   8  
ATOM   9962  C CG   . MET A 1 29 ? -2.926  3.191   0.566   1.00 0.40 ? 29  MET A CG   8  
ATOM   9963  S SD   . MET A 1 29 ? -1.881  2.073   -0.391  1.00 0.49 ? 29  MET A SD   8  
ATOM   9964  C CE   . MET A 1 29 ? -0.565  1.745   0.779   1.00 0.52 ? 29  MET A CE   8  
ATOM   9965  H H    . MET A 1 29 ? -1.574  6.910   1.415   1.00 0.27 ? 29  MET A H    8  
ATOM   9966  H HA   . MET A 1 29 ? -4.027  5.521   1.544   1.00 0.34 ? 29  MET A HA   8  
ATOM   9967  H HB2  . MET A 1 29 ? -2.250  5.079   -0.134  1.00 0.38 ? 29  MET A HB2  8  
ATOM   9968  H HB3  . MET A 1 29 ? -1.258  4.376   1.135   1.00 0.34 ? 29  MET A HB3  8  
ATOM   9969  H HG2  . MET A 1 29 ? -3.135  2.736   1.522   1.00 0.40 ? 29  MET A HG2  8  
ATOM   9970  H HG3  . MET A 1 29 ? -3.854  3.343   0.033   1.00 0.49 ? 29  MET A HG3  8  
ATOM   9971  H HE1  . MET A 1 29 ? -0.019  2.656   0.971   1.00 0.81 ? 29  MET A HE1  8  
ATOM   9972  H HE2  . MET A 1 29 ? 0.103   1.002   0.370   1.00 0.89 ? 29  MET A HE2  8  
ATOM   9973  H HE3  . MET A 1 29 ? -0.989  1.379   1.700   1.00 0.86 ? 29  MET A HE3  8  
ATOM   9974  N N    . LEU A 1 30 ? -1.846  4.879   3.917   1.00 0.29 ? 30  LEU A N    8  
ATOM   9975  C CA   . LEU A 1 30 ? -1.682  4.274   5.236   1.00 0.32 ? 30  LEU A CA   8  
ATOM   9976  C C    . LEU A 1 30 ? -2.760  4.764   6.196   1.00 0.30 ? 30  LEU A C    8  
ATOM   9977  O O    . LEU A 1 30 ? -3.378  3.968   6.906   1.00 0.33 ? 30  LEU A O    8  
ATOM   9978  C CB   . LEU A 1 30 ? -0.289  4.576   5.798   1.00 0.39 ? 30  LEU A CB   8  
ATOM   9979  C CG   . LEU A 1 30 ? 0.701   3.408   5.751   1.00 0.78 ? 30  LEU A CG   8  
ATOM   9980  C CD1  . LEU A 1 30 ? 0.905   2.929   4.322   1.00 1.32 ? 30  LEU A CD1  8  
ATOM   9981  C CD2  . LEU A 1 30 ? 2.029   3.808   6.374   1.00 1.04 ? 30  LEU A CD2  8  
ATOM   9982  H H    . LEU A 1 30 ? -1.115  5.423   3.546   1.00 0.29 ? 30  LEU A H    8  
ATOM   9983  H HA   . LEU A 1 30 ? -1.787  3.206   5.119   1.00 0.36 ? 30  LEU A HA   8  
ATOM   9984  H HB2  . LEU A 1 30 ? 0.130   5.398   5.238   1.00 0.71 ? 30  LEU A HB2  8  
ATOM   9985  H HB3  . LEU A 1 30 ? -0.399  4.883   6.827   1.00 0.65 ? 30  LEU A HB3  8  
ATOM   9986  H HG   . LEU A 1 30 ? 0.302   2.583   6.321   1.00 1.11 ? 30  LEU A HG   8  
ATOM   9987  H HD11 . LEU A 1 30 ? 1.156   3.770   3.693   1.00 1.67 ? 30  LEU A HD11 8  
ATOM   9988  H HD12 . LEU A 1 30 ? -0.003  2.468   3.965   1.00 1.61 ? 30  LEU A HD12 8  
ATOM   9989  H HD13 . LEU A 1 30 ? 1.708   2.208   4.297   1.00 1.72 ? 30  LEU A HD13 8  
ATOM   9990  H HD21 . LEU A 1 30 ? 2.717   2.978   6.309   1.00 1.49 ? 30  LEU A HD21 8  
ATOM   9991  H HD22 . LEU A 1 30 ? 1.877   4.069   7.411   1.00 1.30 ? 30  LEU A HD22 8  
ATOM   9992  H HD23 . LEU A 1 30 ? 2.436   4.656   5.844   1.00 1.27 ? 30  LEU A HD23 8  
ATOM   9993  N N    . SER A 1 31 ? -2.992  6.069   6.207   1.00 0.29 ? 31  SER A N    8  
ATOM   9994  C CA   . SER A 1 31 ? -4.011  6.647   7.072   1.00 0.32 ? 31  SER A CA   8  
ATOM   9995  C C    . SER A 1 31 ? -5.400  6.184   6.635   1.00 0.28 ? 31  SER A C    8  
ATOM   9996  O O    . SER A 1 31 ? -6.272  5.923   7.465   1.00 0.29 ? 31  SER A O    8  
ATOM   9997  C CB   . SER A 1 31 ? -3.918  8.173   7.044   1.00 0.40 ? 31  SER A CB   8  
ATOM   9998  O OG   . SER A 1 31 ? -2.607  8.602   7.382   1.00 1.20 ? 31  SER A OG   8  
ATOM   9999  H H    . SER A 1 31 ? -2.463  6.661   5.625   1.00 0.31 ? 31  SER A H    8  
ATOM   10000 H HA   . SER A 1 31 ? -3.830  6.301   8.076   1.00 0.36 ? 31  SER A HA   8  
ATOM   10001 H HB2  . SER A 1 31 ? -4.157  8.530   6.053   1.00 0.94 ? 31  SER A HB2  8  
ATOM   10002 H HB3  . SER A 1 31 ? -4.616  8.589   7.756   1.00 1.08 ? 31  SER A HB3  8  
ATOM   10003 H HG   . SER A 1 31 ? -2.273  8.057   8.109   1.00 1.76 ? 31  SER A HG   8  
ATOM   10004 N N    . LEU A 1 32 ? -5.584  6.062   5.326   1.00 0.27 ? 32  LEU A N    8  
ATOM   10005 C CA   . LEU A 1 32 ? -6.851  5.621   4.763   1.00 0.29 ? 32  LEU A CA   8  
ATOM   10006 C C    . LEU A 1 32 ? -7.147  4.187   5.200   1.00 0.26 ? 32  LEU A C    8  
ATOM   10007 O O    . LEU A 1 32 ? -8.282  3.844   5.545   1.00 0.29 ? 32  LEU A O    8  
ATOM   10008 C CB   . LEU A 1 32 ? -6.797  5.715   3.231   1.00 0.35 ? 32  LEU A CB   8  
ATOM   10009 C CG   . LEU A 1 32 ? -8.150  5.756   2.504   1.00 0.67 ? 32  LEU A CG   8  
ATOM   10010 C CD1  . LEU A 1 32 ? -8.723  4.358   2.328   1.00 1.15 ? 32  LEU A CD1  8  
ATOM   10011 C CD2  . LEU A 1 32 ? -9.137  6.648   3.242   1.00 1.17 ? 32  LEU A CD2  8  
ATOM   10012 H H    . LEU A 1 32 ? -4.842  6.276   4.718   1.00 0.29 ? 32  LEU A H    8  
ATOM   10013 H HA   . LEU A 1 32 ? -7.628  6.271   5.132   1.00 0.32 ? 32  LEU A HA   8  
ATOM   10014 H HB2  . LEU A 1 32 ? -6.251  6.611   2.971   1.00 0.51 ? 32  LEU A HB2  8  
ATOM   10015 H HB3  . LEU A 1 32 ? -6.245  4.863   2.863   1.00 0.56 ? 32  LEU A HB3  8  
ATOM   10016 H HG   . LEU A 1 32 ? -8.003  6.174   1.519   1.00 0.58 ? 32  LEU A HG   8  
ATOM   10017 H HD11 . LEU A 1 32 ? -8.024  3.747   1.774   1.00 1.26 ? 32  LEU A HD11 8  
ATOM   10018 H HD12 . LEU A 1 32 ? -9.657  4.419   1.788   1.00 1.47 ? 32  LEU A HD12 8  
ATOM   10019 H HD13 . LEU A 1 32 ? -8.899  3.917   3.299   1.00 1.37 ? 32  LEU A HD13 8  
ATOM   10020 H HD21 . LEU A 1 32 ? -10.007 6.808   2.623   1.00 1.52 ? 32  LEU A HD21 8  
ATOM   10021 H HD22 . LEU A 1 32 ? -8.672  7.597   3.462   1.00 1.23 ? 32  LEU A HD22 8  
ATOM   10022 H HD23 . LEU A 1 32 ? -9.436  6.172   4.163   1.00 1.41 ? 32  LEU A HD23 8  
ATOM   10023 N N    . LEU A 1 33 ? -6.108  3.362   5.211   1.00 0.27 ? 33  LEU A N    8  
ATOM   10024 C CA   . LEU A 1 33 ? -6.234  1.962   5.593   1.00 0.31 ? 33  LEU A CA   8  
ATOM   10025 C C    . LEU A 1 33 ? -6.507  1.799   7.087   1.00 0.27 ? 33  LEU A C    8  
ATOM   10026 O O    . LEU A 1 33 ? -6.863  0.710   7.534   1.00 0.33 ? 33  LEU A O    8  
ATOM   10027 C CB   . LEU A 1 33 ? -4.974  1.187   5.206   1.00 0.41 ? 33  LEU A CB   8  
ATOM   10028 C CG   . LEU A 1 33 ? -4.713  1.081   3.700   1.00 0.49 ? 33  LEU A CG   8  
ATOM   10029 C CD1  . LEU A 1 33 ? -3.440  0.296   3.430   1.00 0.61 ? 33  LEU A CD1  8  
ATOM   10030 C CD2  . LEU A 1 33 ? -5.896  0.439   2.990   1.00 0.68 ? 33  LEU A CD2  8  
ATOM   10031 H H    . LEU A 1 33 ? -5.224  3.705   4.941   1.00 0.29 ? 33  LEU A H    8  
ATOM   10032 H HA   . LEU A 1 33 ? -7.069  1.550   5.047   1.00 0.35 ? 33  LEU A HA   8  
ATOM   10033 H HB2  . LEU A 1 33 ? -4.125  1.672   5.665   1.00 0.42 ? 33  LEU A HB2  8  
ATOM   10034 H HB3  . LEU A 1 33 ? -5.057  0.187   5.604   1.00 0.50 ? 33  LEU A HB3  8  
ATOM   10035 H HG   . LEU A 1 33 ? -4.582  2.075   3.298   1.00 0.46 ? 33  LEU A HG   8  
ATOM   10036 H HD11 . LEU A 1 33 ? -3.271  0.246   2.365   1.00 1.08 ? 33  LEU A HD11 8  
ATOM   10037 H HD12 . LEU A 1 33 ? -3.543  -0.705  3.825   1.00 1.05 ? 33  LEU A HD12 8  
ATOM   10038 H HD13 . LEU A 1 33 ? -2.604  0.789   3.905   1.00 1.03 ? 33  LEU A HD13 8  
ATOM   10039 H HD21 . LEU A 1 33 ? -6.153  -0.487  3.482   1.00 1.04 ? 33  LEU A HD21 8  
ATOM   10040 H HD22 . LEU A 1 33 ? -5.631  0.236   1.961   1.00 0.99 ? 33  LEU A HD22 8  
ATOM   10041 H HD23 . LEU A 1 33 ? -6.742  1.108   3.018   1.00 0.89 ? 33  LEU A HD23 8  
ATOM   10042 N N    . GLN A 1 34 ? -6.385  2.877   7.851   1.00 0.26 ? 34  GLN A N    8  
ATOM   10043 C CA   . GLN A 1 34 ? -6.628  2.814   9.287   1.00 0.31 ? 34  GLN A CA   8  
ATOM   10044 C C    . GLN A 1 34 ? -7.819  3.675   9.703   1.00 0.29 ? 34  GLN A C    8  
ATOM   10045 O O    . GLN A 1 34 ? -8.034  3.896   10.894  1.00 0.38 ? 34  GLN A O    8  
ATOM   10046 C CB   . GLN A 1 34 ? -5.385  3.259   10.058  1.00 0.42 ? 34  GLN A CB   8  
ATOM   10047 C CG   . GLN A 1 34 ? -4.272  2.224   10.078  1.00 0.72 ? 34  GLN A CG   8  
ATOM   10048 C CD   . GLN A 1 34 ? -3.054  2.696   10.848  1.00 1.04 ? 34  GLN A CD   8  
ATOM   10049 O OE1  . GLN A 1 34 ? -2.170  3.348   10.296  1.00 1.62 ? 34  GLN A OE1  8  
ATOM   10050 N NE2  . GLN A 1 34 ? -2.987  2.354   12.124  1.00 1.51 ? 34  GLN A NE2  8  
ATOM   10051 H H    . GLN A 1 34 ? -6.117  3.732   7.446   1.00 0.29 ? 34  GLN A H    8  
ATOM   10052 H HA   . GLN A 1 34 ? -6.841  1.787   9.539   1.00 0.36 ? 34  GLN A HA   8  
ATOM   10053 H HB2  . GLN A 1 34 ? -5.000  4.160   9.603   1.00 0.67 ? 34  GLN A HB2  8  
ATOM   10054 H HB3  . GLN A 1 34 ? -5.666  3.475   11.079  1.00 0.61 ? 34  GLN A HB3  8  
ATOM   10055 H HG2  . GLN A 1 34 ? -4.644  1.323   10.543  1.00 1.27 ? 34  GLN A HG2  8  
ATOM   10056 H HG3  . GLN A 1 34 ? -3.980  2.009   9.061   1.00 1.25 ? 34  GLN A HG3  8  
ATOM   10057 H HE21 . GLN A 1 34 ? -3.717  1.813   12.500  1.00 1.73 ? 34  GLN A HE21 8  
ATOM   10058 H HE22 . GLN A 1 34 ? -2.213  2.660   12.645  1.00 1.94 ? 34  GLN A HE22 8  
ATOM   10059 N N    . LYS A 1 35 ? -8.598  4.165   8.741   1.00 0.29 ? 35  LYS A N    8  
ATOM   10060 C CA   . LYS A 1 35 ? -9.749  5.001   9.080   1.00 0.37 ? 35  LYS A CA   8  
ATOM   10061 C C    . LYS A 1 35 ? -11.071 4.401   8.595   1.00 0.32 ? 35  LYS A C    8  
ATOM   10062 O O    . LYS A 1 35 ? -12.130 4.709   9.137   1.00 0.36 ? 35  LYS A O    8  
ATOM   10063 C CB   . LYS A 1 35 ? -9.572  6.419   8.526   1.00 0.50 ? 35  LYS A CB   8  
ATOM   10064 C CG   . LYS A 1 35 ? -9.762  6.534   7.023   1.00 0.67 ? 35  LYS A CG   8  
ATOM   10065 C CD   . LYS A 1 35 ? -9.564  7.966   6.545   1.00 0.77 ? 35  LYS A CD   8  
ATOM   10066 C CE   . LYS A 1 35 ? -10.719 8.868   6.959   1.00 1.00 ? 35  LYS A CE   8  
ATOM   10067 N NZ   . LYS A 1 35 ? -10.532 10.263  6.480   1.00 1.37 ? 35  LYS A NZ   8  
ATOM   10068 H H    . LYS A 1 35 ? -8.387  3.977   7.802   1.00 0.33 ? 35  LYS A H    8  
ATOM   10069 H HA   . LYS A 1 35 ? -9.785  5.062   10.156  1.00 0.45 ? 35  LYS A HA   8  
ATOM   10070 H HB2  . LYS A 1 35 ? -10.291 7.067   9.003   1.00 0.88 ? 35  LYS A HB2  8  
ATOM   10071 H HB3  . LYS A 1 35 ? -8.578  6.763   8.767   1.00 1.00 ? 35  LYS A HB3  8  
ATOM   10072 H HG2  . LYS A 1 35 ? -9.045  5.896   6.531   1.00 1.20 ? 35  LYS A HG2  8  
ATOM   10073 H HG3  . LYS A 1 35 ? -10.762 6.213   6.768   1.00 1.10 ? 35  LYS A HG3  8  
ATOM   10074 H HD2  . LYS A 1 35 ? -8.653  8.352   6.976   1.00 1.19 ? 35  LYS A HD2  8  
ATOM   10075 H HD3  . LYS A 1 35 ? -9.483  7.969   5.470   1.00 1.15 ? 35  LYS A HD3  8  
ATOM   10076 H HE2  . LYS A 1 35 ? -11.634 8.473   6.544   1.00 1.52 ? 35  LYS A HE2  8  
ATOM   10077 H HE3  . LYS A 1 35 ? -10.788 8.875   8.038   1.00 1.60 ? 35  LYS A HE3  8  
ATOM   10078 H HZ1  . LYS A 1 35 ? -9.711  10.696  6.949   1.00 1.85 ? 35  LYS A HZ1  8  
ATOM   10079 H HZ2  . LYS A 1 35 ? -11.378 10.832  6.691   1.00 1.75 ? 35  LYS A HZ2  8  
ATOM   10080 H HZ3  . LYS A 1 35 ? -10.375 10.273  5.452   1.00 1.76 ? 35  LYS A HZ3  8  
ATOM   10081 N N    . GLU A 1 36 ? -11.014 3.549   7.578   1.00 0.29 ? 36  GLU A N    8  
ATOM   10082 C CA   . GLU A 1 36 ? -12.221 2.926   7.036   1.00 0.31 ? 36  GLU A CA   8  
ATOM   10083 C C    . GLU A 1 36 ? -12.565 1.644   7.790   1.00 0.29 ? 36  GLU A C    8  
ATOM   10084 O O    . GLU A 1 36 ? -13.660 1.105   7.649   1.00 0.39 ? 36  GLU A O    8  
ATOM   10085 C CB   . GLU A 1 36 ? -12.055 2.628   5.542   1.00 0.37 ? 36  GLU A CB   8  
ATOM   10086 C CG   . GLU A 1 36 ? -11.673 3.844   4.709   1.00 0.43 ? 36  GLU A CG   8  
ATOM   10087 C CD   . GLU A 1 36 ? -12.824 4.813   4.521   1.00 0.64 ? 36  GLU A CD   8  
ATOM   10088 O OE1  . GLU A 1 36 ? -12.634 5.840   3.837   1.00 1.30 ? 36  GLU A OE1  8  
ATOM   10089 O OE2  . GLU A 1 36 ? -13.931 4.550   5.045   1.00 1.21 ? 36  GLU A OE2  8  
ATOM   10090 H H    . GLU A 1 36 ? -10.146 3.339   7.178   1.00 0.32 ? 36  GLU A H    8  
ATOM   10091 H HA   . GLU A 1 36 ? -13.035 3.624   7.162   1.00 0.38 ? 36  GLU A HA   8  
ATOM   10092 H HB2  . GLU A 1 36 ? -11.288 1.877   5.418   1.00 0.40 ? 36  GLU A HB2  8  
ATOM   10093 H HB3  . GLU A 1 36 ? -12.987 2.238   5.161   1.00 0.47 ? 36  GLU A HB3  8  
ATOM   10094 H HG2  . GLU A 1 36 ? -10.864 4.362   5.201   1.00 0.46 ? 36  GLU A HG2  8  
ATOM   10095 H HG3  . GLU A 1 36 ? -11.342 3.509   3.735   1.00 0.50 ? 36  GLU A HG3  8  
ATOM   10096 N N    . GLY A 1 37 ? -11.628 1.159   8.589   1.00 0.27 ? 37  GLY A N    8  
ATOM   10097 C CA   . GLY A 1 37 ? -11.866 -0.047  9.354   1.00 0.30 ? 37  GLY A CA   8  
ATOM   10098 C C    . GLY A 1 37 ? -11.305 -1.285  8.687   1.00 0.29 ? 37  GLY A C    8  
ATOM   10099 O O    . GLY A 1 37 ? -11.640 -2.405  9.065   1.00 0.41 ? 37  GLY A O    8  
ATOM   10100 H H    . GLY A 1 37 ? -10.771 1.623   8.660   1.00 0.30 ? 37  GLY A H    8  
ATOM   10101 H HA2  . GLY A 1 37 ? -11.409 0.063   10.327  1.00 0.33 ? 37  GLY A HA2  8  
ATOM   10102 H HA3  . GLY A 1 37 ? -12.931 -0.172  9.484   1.00 0.35 ? 37  GLY A HA3  8  
ATOM   10103 N N    . LEU A 1 38 ? -10.465 -1.088  7.680   1.00 0.25 ? 38  LEU A N    8  
ATOM   10104 C CA   . LEU A 1 38 ? -9.854  -2.205  6.970   1.00 0.28 ? 38  LEU A CA   8  
ATOM   10105 C C    . LEU A 1 38 ? -8.721  -2.798  7.797   1.00 0.32 ? 38  LEU A C    8  
ATOM   10106 O O    . LEU A 1 38 ? -8.696  -3.999  8.066   1.00 0.46 ? 38  LEU A O    8  
ATOM   10107 C CB   . LEU A 1 38 ? -9.327  -1.753  5.607   1.00 0.31 ? 38  LEU A CB   8  
ATOM   10108 C CG   . LEU A 1 38 ? -10.401 -1.357  4.593   1.00 0.40 ? 38  LEU A CG   8  
ATOM   10109 C CD1  . LEU A 1 38 ? -9.778  -0.625  3.416   1.00 0.51 ? 38  LEU A CD1  8  
ATOM   10110 C CD2  . LEU A 1 38 ? -11.157 -2.586  4.114   1.00 0.50 ? 38  LEU A CD2  8  
ATOM   10111 H H    . LEU A 1 38 ? -10.256 -0.172  7.405   1.00 0.29 ? 38  LEU A H    8  
ATOM   10112 H HA   . LEU A 1 38 ? -10.611 -2.961  6.824   1.00 0.34 ? 38  LEU A HA   8  
ATOM   10113 H HB2  . LEU A 1 38 ? -8.674  -0.908  5.760   1.00 0.34 ? 38  LEU A HB2  8  
ATOM   10114 H HB3  . LEU A 1 38 ? -8.747  -2.560  5.184   1.00 0.35 ? 38  LEU A HB3  8  
ATOM   10115 H HG   . LEU A 1 38 ? -11.105 -0.692  5.066   1.00 0.47 ? 38  LEU A HG   8  
ATOM   10116 H HD11 . LEU A 1 38 ? -9.070  -1.273  2.924   1.00 0.74 ? 38  LEU A HD11 8  
ATOM   10117 H HD12 . LEU A 1 38 ? -9.272  0.261   3.770   1.00 0.78 ? 38  LEU A HD12 8  
ATOM   10118 H HD13 . LEU A 1 38 ? -10.552 -0.342  2.718   1.00 0.79 ? 38  LEU A HD13 8  
ATOM   10119 H HD21 . LEU A 1 38 ? -11.879 -2.296  3.364   1.00 0.77 ? 38  LEU A HD21 8  
ATOM   10120 H HD22 . LEU A 1 38 ? -11.669 -3.042  4.948   1.00 0.67 ? 38  LEU A HD22 8  
ATOM   10121 H HD23 . LEU A 1 38 ? -10.461 -3.294  3.689   1.00 0.68 ? 38  LEU A HD23 8  
ATOM   10122 N N    . LEU A 1 39 ? -7.796  -1.943  8.209   1.00 0.31 ? 39  LEU A N    8  
ATOM   10123 C CA   . LEU A 1 39 ? -6.659  -2.369  9.009   1.00 0.40 ? 39  LEU A CA   8  
ATOM   10124 C C    . LEU A 1 39 ? -6.665  -1.653  10.351  1.00 0.39 ? 39  LEU A C    8  
ATOM   10125 O O    . LEU A 1 39 ? -7.376  -0.661  10.533  1.00 0.57 ? 39  LEU A O    8  
ATOM   10126 C CB   . LEU A 1 39 ? -5.341  -2.086  8.282   1.00 0.53 ? 39  LEU A CB   8  
ATOM   10127 C CG   . LEU A 1 39 ? -5.140  -2.837  6.967   1.00 0.67 ? 39  LEU A CG   8  
ATOM   10128 C CD1  . LEU A 1 39 ? -3.794  -2.485  6.362   1.00 0.86 ? 39  LEU A CD1  8  
ATOM   10129 C CD2  . LEU A 1 39 ? -5.256  -4.339  7.181   1.00 0.75 ? 39  LEU A CD2  8  
ATOM   10130 H H    . LEU A 1 39 ? -7.883  -0.994  7.977   1.00 0.31 ? 39  LEU A H    8  
ATOM   10131 H HA   . LEU A 1 39 ? -6.749  -3.431  9.177   1.00 0.47 ? 39  LEU A HA   8  
ATOM   10132 H HB2  . LEU A 1 39 ? -5.287  -1.028  8.075   1.00 0.56 ? 39  LEU A HB2  8  
ATOM   10133 H HB3  . LEU A 1 39 ? -4.528  -2.344  8.943   1.00 0.63 ? 39  LEU A HB3  8  
ATOM   10134 H HG   . LEU A 1 39 ? -5.905  -2.536  6.271   1.00 0.67 ? 39  LEU A HG   8  
ATOM   10135 H HD11 . LEU A 1 39 ? -3.005  -2.847  7.003   1.00 1.10 ? 39  LEU A HD11 8  
ATOM   10136 H HD12 . LEU A 1 39 ? -3.713  -1.413  6.264   1.00 1.10 ? 39  LEU A HD12 8  
ATOM   10137 H HD13 . LEU A 1 39 ? -3.705  -2.944  5.388   1.00 1.09 ? 39  LEU A HD13 8  
ATOM   10138 H HD21 . LEU A 1 39 ? -4.670  -4.856  6.436   1.00 1.19 ? 39  LEU A HD21 8  
ATOM   10139 H HD22 . LEU A 1 39 ? -6.291  -4.634  7.093   1.00 1.13 ? 39  LEU A HD22 8  
ATOM   10140 H HD23 . LEU A 1 39 ? -4.892  -4.593  8.166   1.00 1.12 ? 39  LEU A HD23 8  
ATOM   10141 N N    . MET A 1 40 ? -5.872  -2.153  11.281  1.00 0.35 ? 40  MET A N    8  
ATOM   10142 C CA   . MET A 1 40 ? -5.785  -1.566  12.608  1.00 0.41 ? 40  MET A CA   8  
ATOM   10143 C C    . MET A 1 40 ? -4.435  -0.885  12.794  1.00 0.37 ? 40  MET A C    8  
ATOM   10144 O O    . MET A 1 40 ? -4.346  0.201   13.375  1.00 0.53 ? 40  MET A O    8  
ATOM   10145 C CB   . MET A 1 40 ? -5.987  -2.648  13.670  1.00 0.54 ? 40  MET A CB   8  
ATOM   10146 C CG   . MET A 1 40 ? -5.829  -2.151  15.098  1.00 0.70 ? 40  MET A CG   8  
ATOM   10147 S SD   . MET A 1 40 ? -6.123  -3.444  16.322  1.00 0.94 ? 40  MET A SD   8  
ATOM   10148 C CE   . MET A 1 40 ? -4.970  -4.704  15.775  1.00 1.19 ? 40  MET A CE   8  
ATOM   10149 H H    . MET A 1 40 ? -5.321  -2.945  11.071  1.00 0.44 ? 40  MET A H    8  
ATOM   10150 H HA   . MET A 1 40 ? -6.568  -0.828  12.698  1.00 0.50 ? 40  MET A HA   8  
ATOM   10151 H HB2  . MET A 1 40 ? -6.981  -3.057  13.563  1.00 0.62 ? 40  MET A HB2  8  
ATOM   10152 H HB3  . MET A 1 40 ? -5.264  -3.434  13.505  1.00 0.55 ? 40  MET A HB3  8  
ATOM   10153 H HG2  . MET A 1 40 ? -4.825  -1.778  15.225  1.00 0.73 ? 40  MET A HG2  8  
ATOM   10154 H HG3  . MET A 1 40 ? -6.535  -1.350  15.265  1.00 0.78 ? 40  MET A HG3  8  
ATOM   10155 H HE1  . MET A 1 40 ? -3.989  -4.268  15.666  1.00 1.40 ? 40  MET A HE1  8  
ATOM   10156 H HE2  . MET A 1 40 ? -5.297  -5.101  14.827  1.00 1.50 ? 40  MET A HE2  8  
ATOM   10157 H HE3  . MET A 1 40 ? -4.932  -5.500  16.504  1.00 1.50 ? 40  MET A HE3  8  
ATOM   10158 N N    . SER A 1 41 ? -3.394  -1.523  12.285  1.00 0.33 ? 41  SER A N    8  
ATOM   10159 C CA   . SER A 1 41 ? -2.042  -0.997  12.384  1.00 0.39 ? 41  SER A CA   8  
ATOM   10160 C C    . SER A 1 41 ? -1.357  -1.027  11.018  1.00 0.34 ? 41  SER A C    8  
ATOM   10161 O O    . SER A 1 41 ? -1.792  -1.739  10.117  1.00 0.31 ? 41  SER A O    8  
ATOM   10162 C CB   . SER A 1 41 ? -1.243  -1.820  13.401  1.00 0.50 ? 41  SER A CB   8  
ATOM   10163 O OG   . SER A 1 41 ? -1.927  -3.020  13.743  1.00 0.87 ? 41  SER A OG   8  
ATOM   10164 H H    . SER A 1 41 ? -3.536  -2.383  11.828  1.00 0.38 ? 41  SER A H    8  
ATOM   10165 H HA   . SER A 1 41 ? -2.101  0.025   12.724  1.00 0.51 ? 41  SER A HA   8  
ATOM   10166 H HB2  . SER A 1 41 ? -0.282  -2.075  12.981  1.00 0.83 ? 41  SER A HB2  8  
ATOM   10167 H HB3  . SER A 1 41 ? -1.099  -1.237  14.297  1.00 0.81 ? 41  SER A HB3  8  
ATOM   10168 H HG   . SER A 1 41 ? -1.989  -3.597  12.956  1.00 1.39 ? 41  SER A HG   8  
ATOM   10169 N N    . PRO A 1 42 ? -0.279  -0.247  10.836  1.00 0.43 ? 42  PRO A N    8  
ATOM   10170 C CA   . PRO A 1 42 ? 0.455   -0.221  9.568   1.00 0.47 ? 42  PRO A CA   8  
ATOM   10171 C C    . PRO A 1 42 ? 1.190   -1.537  9.306   1.00 0.43 ? 42  PRO A C    8  
ATOM   10172 O O    . PRO A 1 42 ? 1.485   -1.889  8.161   1.00 0.54 ? 42  PRO A O    8  
ATOM   10173 C CB   . PRO A 1 42 ? 1.453   0.925   9.753   1.00 0.61 ? 42  PRO A CB   8  
ATOM   10174 C CG   . PRO A 1 42 ? 1.611   1.075   11.229  1.00 0.65 ? 42  PRO A CG   8  
ATOM   10175 C CD   . PRO A 1 42 ? 0.292   0.688   11.831  1.00 0.57 ? 42  PRO A CD   8  
ATOM   10176 H HA   . PRO A 1 42 ? -0.198  -0.003  8.738   1.00 0.51 ? 42  PRO A HA   8  
ATOM   10177 H HB2  . PRO A 1 42 ? 2.394   0.670   9.285   1.00 0.65 ? 42  PRO A HB2  8  
ATOM   10178 H HB3  . PRO A 1 42 ? 1.054   1.831   9.330   1.00 0.73 ? 42  PRO A HB3  8  
ATOM   10179 H HG2  . PRO A 1 42 ? 2.395   0.417   11.582  1.00 0.67 ? 42  PRO A HG2  8  
ATOM   10180 H HG3  . PRO A 1 42 ? 1.841   2.100   11.473  1.00 0.81 ? 42  PRO A HG3  8  
ATOM   10181 H HD2  . PRO A 1 42 ? 0.444   0.199   12.781  1.00 0.58 ? 42  PRO A HD2  8  
ATOM   10182 H HD3  . PRO A 1 42 ? -0.338  1.557   11.948  1.00 0.68 ? 42  PRO A HD3  8  
ATOM   10183 N N    . SER A 1 43 ? 1.454   -2.273  10.378  1.00 0.36 ? 43  SER A N    8  
ATOM   10184 C CA   . SER A 1 43 ? 2.152   -3.549  10.300  1.00 0.41 ? 43  SER A CA   8  
ATOM   10185 C C    . SER A 1 43 ? 1.223   -4.663  9.807   1.00 0.36 ? 43  SER A C    8  
ATOM   10186 O O    . SER A 1 43 ? 1.657   -5.795  9.580   1.00 0.40 ? 43  SER A O    8  
ATOM   10187 C CB   . SER A 1 43 ? 2.711   -3.895  11.678  1.00 0.54 ? 43  SER A CB   8  
ATOM   10188 O OG   . SER A 1 43 ? 1.987   -3.222  12.698  1.00 0.69 ? 43  SER A OG   8  
ATOM   10189 H H    . SER A 1 43 ? 1.174   -1.947  11.258  1.00 0.38 ? 43  SER A H    8  
ATOM   10190 H HA   . SER A 1 43 ? 2.969   -3.440  9.605   1.00 0.49 ? 43  SER A HA   8  
ATOM   10191 H HB2  . SER A 1 43 ? 2.633   -4.961  11.842  1.00 0.70 ? 43  SER A HB2  8  
ATOM   10192 H HB3  . SER A 1 43 ? 3.748   -3.596  11.733  1.00 0.75 ? 43  SER A HB3  8  
ATOM   10193 H HG   . SER A 1 43 ? 1.705   -3.862  13.366  1.00 1.10 ? 43  SER A HG   8  
ATOM   10194 N N    . ASP A 1 44 ? -0.050  -4.331  9.625   1.00 0.32 ? 44  ASP A N    8  
ATOM   10195 C CA   . ASP A 1 44 ? -1.040  -5.298  9.163   1.00 0.32 ? 44  ASP A CA   8  
ATOM   10196 C C    . ASP A 1 44 ? -0.798  -5.655  7.701   1.00 0.29 ? 44  ASP A C    8  
ATOM   10197 O O    . ASP A 1 44 ? -1.297  -6.663  7.204   1.00 0.31 ? 44  ASP A O    8  
ATOM   10198 C CB   . ASP A 1 44 ? -2.463  -4.746  9.326   1.00 0.39 ? 44  ASP A CB   8  
ATOM   10199 C CG   . ASP A 1 44 ? -2.870  -4.514  10.774  1.00 0.54 ? 44  ASP A CG   8  
ATOM   10200 O OD1  . ASP A 1 44 ? -2.023  -4.679  11.678  1.00 0.87 ? 44  ASP A OD1  8  
ATOM   10201 O OD2  . ASP A 1 44 ? -4.041  -4.152  11.016  1.00 0.69 ? 44  ASP A OD2  8  
ATOM   10202 H H    . ASP A 1 44 ? -0.335  -3.411  9.816   1.00 0.35 ? 44  ASP A H    8  
ATOM   10203 H HA   . ASP A 1 44 ? -0.937  -6.190  9.762   1.00 0.40 ? 44  ASP A HA   8  
ATOM   10204 H HB2  . ASP A 1 44 ? -2.536  -3.804  8.804   1.00 0.46 ? 44  ASP A HB2  8  
ATOM   10205 H HB3  . ASP A 1 44 ? -3.160  -5.445  8.887   1.00 0.52 ? 44  ASP A HB3  8  
ATOM   10206 N N    . LEU A 1 45 ? -0.008  -4.828  7.023   1.00 0.31 ? 45  LEU A N    8  
ATOM   10207 C CA   . LEU A 1 45 ? 0.308   -5.038  5.613   1.00 0.36 ? 45  LEU A CA   8  
ATOM   10208 C C    . LEU A 1 45 ? 1.147   -6.300  5.411   1.00 0.34 ? 45  LEU A C    8  
ATOM   10209 O O    . LEU A 1 45 ? 1.146   -6.887  4.330   1.00 0.38 ? 45  LEU A O    8  
ATOM   10210 C CB   . LEU A 1 45 ? 1.061   -3.824  5.055   1.00 0.45 ? 45  LEU A CB   8  
ATOM   10211 C CG   . LEU A 1 45 ? 0.404   -3.125  3.861   1.00 0.60 ? 45  LEU A CG   8  
ATOM   10212 C CD1  . LEU A 1 45 ? 0.250   -4.083  2.692   1.00 0.96 ? 45  LEU A CD1  8  
ATOM   10213 C CD2  . LEU A 1 45 ? -0.942  -2.542  4.260   1.00 0.98 ? 45  LEU A CD2  8  
ATOM   10214 H H    . LEU A 1 45 ? 0.374   -4.053  7.486   1.00 0.35 ? 45  LEU A H    8  
ATOM   10215 H HA   . LEU A 1 45 ? -0.622  -5.149  5.079   1.00 0.41 ? 45  LEU A HA   8  
ATOM   10216 H HB2  . LEU A 1 45 ? 1.171   -3.102  5.849   1.00 0.60 ? 45  LEU A HB2  8  
ATOM   10217 H HB3  . LEU A 1 45 ? 2.047   -4.150  4.753   1.00 0.54 ? 45  LEU A HB3  8  
ATOM   10218 H HG   . LEU A 1 45 ? 1.039   -2.312  3.539   1.00 0.84 ? 45  LEU A HG   8  
ATOM   10219 H HD11 . LEU A 1 45 ? 1.220   -4.467  2.414   1.00 1.37 ? 45  LEU A HD11 8  
ATOM   10220 H HD12 . LEU A 1 45 ? -0.184  -3.561  1.852   1.00 1.34 ? 45  LEU A HD12 8  
ATOM   10221 H HD13 . LEU A 1 45 ? -0.393  -4.903  2.977   1.00 1.38 ? 45  LEU A HD13 8  
ATOM   10222 H HD21 . LEU A 1 45 ? -1.209  -1.752  3.574   1.00 1.28 ? 45  LEU A HD21 8  
ATOM   10223 H HD22 . LEU A 1 45 ? -0.876  -2.141  5.260   1.00 1.36 ? 45  LEU A HD22 8  
ATOM   10224 H HD23 . LEU A 1 45 ? -1.696  -3.315  4.229   1.00 1.37 ? 45  LEU A HD23 8  
ATOM   10225 N N    . TYR A 1 46 ? 1.851   -6.717  6.459   1.00 0.32 ? 46  TYR A N    8  
ATOM   10226 C CA   . TYR A 1 46 ? 2.695   -7.903  6.387   1.00 0.37 ? 46  TYR A CA   8  
ATOM   10227 C C    . TYR A 1 46 ? 1.851   -9.174  6.334   1.00 0.34 ? 46  TYR A C    8  
ATOM   10228 O O    . TYR A 1 46 ? 2.349   -10.247 5.994   1.00 0.44 ? 46  TYR A O    8  
ATOM   10229 C CB   . TYR A 1 46 ? 3.648   -7.962  7.585   1.00 0.47 ? 46  TYR A CB   8  
ATOM   10230 C CG   . TYR A 1 46 ? 4.558   -6.757  7.713   1.00 0.55 ? 46  TYR A CG   8  
ATOM   10231 C CD1  . TYR A 1 46 ? 5.302   -6.296  6.634   1.00 0.87 ? 46  TYR A CD1  8  
ATOM   10232 C CD2  . TYR A 1 46 ? 4.672   -6.083  8.921   1.00 0.64 ? 46  TYR A CD2  8  
ATOM   10233 C CE1  . TYR A 1 46 ? 6.135   -5.197  6.758   1.00 1.01 ? 46  TYR A CE1  8  
ATOM   10234 C CE2  . TYR A 1 46 ? 5.499   -4.985  9.054   1.00 0.76 ? 46  TYR A CE2  8  
ATOM   10235 C CZ   . TYR A 1 46 ? 6.227   -4.546  7.971   1.00 0.86 ? 46  TYR A CZ   8  
ATOM   10236 O OH   . TYR A 1 46 ? 7.053   -3.454  8.103   1.00 1.05 ? 46  TYR A OH   8  
ATOM   10237 H H    . TYR A 1 46 ? 1.797   -6.219  7.302   1.00 0.33 ? 46  TYR A H    8  
ATOM   10238 H HA   . TYR A 1 46 ? 3.278   -7.837  5.481   1.00 0.43 ? 46  TYR A HA   8  
ATOM   10239 H HB2  . TYR A 1 46 ? 3.069   -8.033  8.493   1.00 0.46 ? 46  TYR A HB2  8  
ATOM   10240 H HB3  . TYR A 1 46 ? 4.270   -8.837  7.494   1.00 0.61 ? 46  TYR A HB3  8  
ATOM   10241 H HD1  . TYR A 1 46 ? 5.226   -6.808  5.687   1.00 1.12 ? 46  TYR A HD1  8  
ATOM   10242 H HD2  . TYR A 1 46 ? 4.100   -6.429  9.769   1.00 0.84 ? 46  TYR A HD2  8  
ATOM   10243 H HE1  . TYR A 1 46 ? 6.705   -4.851  5.909   1.00 1.34 ? 46  TYR A HE1  8  
ATOM   10244 H HE2  . TYR A 1 46 ? 5.573   -4.475  10.004  1.00 0.97 ? 46  TYR A HE2  8  
ATOM   10245 H HH   . TYR A 1 46 ? 7.689   -3.620  8.809   1.00 1.14 ? 46  TYR A HH   8  
ATOM   10246 N N    . SER A 1 47 ? 0.576   -9.046  6.670   1.00 0.31 ? 47  SER A N    8  
ATOM   10247 C CA   . SER A 1 47 ? -0.337  -10.175 6.663   1.00 0.29 ? 47  SER A CA   8  
ATOM   10248 C C    . SER A 1 47 ? -1.022  -10.289 5.299   1.00 0.24 ? 47  SER A C    8  
ATOM   10249 O O    . SER A 1 47 ? -1.850  -9.450  4.935   1.00 0.26 ? 47  SER A O    8  
ATOM   10250 C CB   . SER A 1 47 ? -1.370  -10.003 7.774   1.00 0.36 ? 47  SER A CB   8  
ATOM   10251 O OG   . SER A 1 47 ? -0.755  -9.547  8.969   1.00 0.53 ? 47  SER A OG   8  
ATOM   10252 H H    . SER A 1 47 ? 0.234   -8.166  6.921   1.00 0.37 ? 47  SER A H    8  
ATOM   10253 H HA   . SER A 1 47 ? 0.239   -11.070 6.847   1.00 0.33 ? 47  SER A HA   8  
ATOM   10254 H HB2  . SER A 1 47 ? -2.112  -9.281  7.465   1.00 0.43 ? 47  SER A HB2  8  
ATOM   10255 H HB3  . SER A 1 47 ? -1.848  -10.950 7.968   1.00 0.44 ? 47  SER A HB3  8  
ATOM   10256 H HG   . SER A 1 47 ? -1.266  -8.809  9.327   1.00 1.10 ? 47  SER A HG   8  
ATOM   10257 N N    . PRO A 1 48 ? -0.694  -11.340 4.533   1.00 0.24 ? 48  PRO A N    8  
ATOM   10258 C CA   . PRO A 1 48 ? -1.255  -11.558 3.193   1.00 0.25 ? 48  PRO A CA   8  
ATOM   10259 C C    . PRO A 1 48 ? -2.723  -11.963 3.219   1.00 0.26 ? 48  PRO A C    8  
ATOM   10260 O O    . PRO A 1 48 ? -3.410  -11.886 2.204   1.00 0.32 ? 48  PRO A O    8  
ATOM   10261 C CB   . PRO A 1 48 ? -0.396  -12.694 2.636   1.00 0.31 ? 48  PRO A CB   8  
ATOM   10262 C CG   . PRO A 1 48 ? 0.094   -13.429 3.831   1.00 0.38 ? 48  PRO A CG   8  
ATOM   10263 C CD   . PRO A 1 48 ? 0.248   -12.405 4.920   1.00 0.32 ? 48  PRO A CD   8  
ATOM   10264 H HA   . PRO A 1 48 ? -1.139  -10.682 2.572   1.00 0.26 ? 48  PRO A HA   8  
ATOM   10265 H HB2  . PRO A 1 48 ? -0.999  -13.335 2.004   1.00 0.38 ? 48  PRO A HB2  8  
ATOM   10266 H HB3  . PRO A 1 48 ? 0.433   -12.290 2.079   1.00 0.38 ? 48  PRO A HB3  8  
ATOM   10267 H HG2  . PRO A 1 48 ? -0.629  -14.179 4.118   1.00 0.50 ? 48  PRO A HG2  8  
ATOM   10268 H HG3  . PRO A 1 48 ? 1.049   -13.885 3.617   1.00 0.52 ? 48  PRO A HG3  8  
ATOM   10269 H HD2  . PRO A 1 48 ? -0.023  -12.829 5.874   1.00 0.38 ? 48  PRO A HD2  8  
ATOM   10270 H HD3  . PRO A 1 48 ? 1.260   -12.031 4.944   1.00 0.38 ? 48  PRO A HD3  8  
ATOM   10271 N N    . GLY A 1 49 ? -3.203  -12.376 4.384   1.00 0.28 ? 49  GLY A N    8  
ATOM   10272 C CA   . GLY A 1 49 ? -4.587  -12.788 4.515   1.00 0.33 ? 49  GLY A CA   8  
ATOM   10273 C C    . GLY A 1 49 ? -5.537  -11.610 4.574   1.00 0.32 ? 49  GLY A C    8  
ATOM   10274 O O    . GLY A 1 49 ? -6.755  -11.782 4.560   1.00 0.50 ? 49  GLY A O    8  
ATOM   10275 H H    . GLY A 1 49 ? -2.611  -12.403 5.167   1.00 0.30 ? 49  GLY A H    8  
ATOM   10276 H HA2  . GLY A 1 49 ? -4.849  -13.406 3.669   1.00 0.35 ? 49  GLY A HA2  8  
ATOM   10277 H HA3  . GLY A 1 49 ? -4.694  -13.368 5.418   1.00 0.38 ? 49  GLY A HA3  8  
ATOM   10278 N N    . SER A 1 50 ? -4.985  -10.408 4.633   1.00 0.25 ? 50  SER A N    8  
ATOM   10279 C CA   . SER A 1 50 ? -5.795  -9.204  4.698   1.00 0.27 ? 50  SER A CA   8  
ATOM   10280 C C    . SER A 1 50 ? -5.694  -8.402  3.401   1.00 0.22 ? 50  SER A C    8  
ATOM   10281 O O    . SER A 1 50 ? -6.236  -7.304  3.296   1.00 0.28 ? 50  SER A O    8  
ATOM   10282 C CB   . SER A 1 50 ? -5.345  -8.352  5.886   1.00 0.35 ? 50  SER A CB   8  
ATOM   10283 O OG   . SER A 1 50 ? -4.217  -8.936  6.528   1.00 0.47 ? 50  SER A OG   8  
ATOM   10284 H H    . SER A 1 50 ? -4.007  -10.326 4.647   1.00 0.31 ? 50  SER A H    8  
ATOM   10285 H HA   . SER A 1 50 ? -6.821  -9.501  4.845   1.00 0.32 ? 50  SER A HA   8  
ATOM   10286 H HB2  . SER A 1 50 ? -5.077  -7.364  5.540   1.00 0.45 ? 50  SER A HB2  8  
ATOM   10287 H HB3  . SER A 1 50 ? -6.152  -8.278  6.601   1.00 0.45 ? 50  SER A HB3  8  
ATOM   10288 H HG   . SER A 1 50 ? -3.412  -8.516  6.197   1.00 0.93 ? 50  SER A HG   8  
ATOM   10289 N N    . TRP A 1 51 ? -5.025  -8.967  2.406   1.00 0.20 ? 51  TRP A N    8  
ATOM   10290 C CA   . TRP A 1 51 ? -4.844  -8.285  1.126   1.00 0.20 ? 51  TRP A CA   8  
ATOM   10291 C C    . TRP A 1 51 ? -6.123  -8.304  0.292   1.00 0.19 ? 51  TRP A C    8  
ATOM   10292 O O    . TRP A 1 51 ? -6.495  -7.295  -0.318  1.00 0.23 ? 51  TRP A O    8  
ATOM   10293 C CB   . TRP A 1 51 ? -3.701  -8.927  0.332   1.00 0.23 ? 51  TRP A CB   8  
ATOM   10294 C CG   . TRP A 1 51 ? -2.338  -8.708  0.926   1.00 0.24 ? 51  TRP A CG   8  
ATOM   10295 C CD1  . TRP A 1 51 ? -2.016  -7.907  1.986   1.00 0.25 ? 51  TRP A CD1  8  
ATOM   10296 C CD2  . TRP A 1 51 ? -1.106  -9.292  0.479   1.00 0.27 ? 51  TRP A CD2  8  
ATOM   10297 N NE1  . TRP A 1 51 ? -0.664  -7.967  2.231   1.00 0.28 ? 51  TRP A NE1  8  
ATOM   10298 C CE2  . TRP A 1 51 ? -0.084  -8.805  1.315   1.00 0.29 ? 51  TRP A CE2  8  
ATOM   10299 C CE3  . TRP A 1 51 ? -0.769  -10.176 -0.549  1.00 0.30 ? 51  TRP A CE3  8  
ATOM   10300 C CZ2  . TRP A 1 51 ? 1.249   -9.178  1.159   1.00 0.33 ? 51  TRP A CZ2  8  
ATOM   10301 C CZ3  . TRP A 1 51 ? 0.556   -10.545 -0.705  1.00 0.34 ? 51  TRP A CZ3  8  
ATOM   10302 C CH2  . TRP A 1 51 ? 1.550   -10.046 0.146   1.00 0.35 ? 51  TRP A CH2  8  
ATOM   10303 H H    . TRP A 1 51 ? -4.647  -9.864  2.530   1.00 0.26 ? 51  TRP A H    8  
ATOM   10304 H HA   . TRP A 1 51 ? -4.585  -7.257  1.335   1.00 0.22 ? 51  TRP A HA   8  
ATOM   10305 H HB2  . TRP A 1 51 ? -3.868  -9.991  0.280   1.00 0.25 ? 51  TRP A HB2  8  
ATOM   10306 H HB3  . TRP A 1 51 ? -3.698  -8.521  -0.670  1.00 0.27 ? 51  TRP A HB3  8  
ATOM   10307 H HD1  . TRP A 1 51 ? -2.731  -7.324  2.546   1.00 0.26 ? 51  TRP A HD1  8  
ATOM   10308 H HE1  . TRP A 1 51 ? -0.188  -7.485  2.945   1.00 0.31 ? 51  TRP A HE1  8  
ATOM   10309 H HE3  . TRP A 1 51 ? -1.523  -10.571 -1.213  1.00 0.31 ? 51  TRP A HE3  8  
ATOM   10310 H HZ2  . TRP A 1 51 ? 2.027   -8.799  1.806   1.00 0.35 ? 51  TRP A HZ2  8  
ATOM   10311 H HZ3  . TRP A 1 51 ? 0.834   -11.231 -1.492  1.00 0.38 ? 51  TRP A HZ3  8  
ATOM   10312 H HH2  . TRP A 1 51 ? 2.571   -10.359 -0.012  1.00 0.39 ? 51  TRP A HH2  8  
ATOM   10313 N N    . ASP A 1 52 ? -6.794  -9.450  0.276   1.00 0.23 ? 52  ASP A N    8  
ATOM   10314 C CA   . ASP A 1 52 ? -8.026  -9.619  -0.493  1.00 0.27 ? 52  ASP A CA   8  
ATOM   10315 C C    . ASP A 1 52 ? -9.115  -8.613  -0.084  1.00 0.24 ? 52  ASP A C    8  
ATOM   10316 O O    . ASP A 1 52 ? -9.616  -7.882  -0.940  1.00 0.24 ? 52  ASP A O    8  
ATOM   10317 C CB   . ASP A 1 52 ? -8.558  -11.054 -0.371  1.00 0.37 ? 52  ASP A CB   8  
ATOM   10318 C CG   . ASP A 1 52 ? -7.825  -12.045 -1.257  1.00 0.85 ? 52  ASP A CG   8  
ATOM   10319 O OD1  . ASP A 1 52 ? -8.339  -12.373 -2.346  1.00 1.49 ? 52  ASP A OD1  8  
ATOM   10320 O OD2  . ASP A 1 52 ? -6.737  -12.516 -0.864  1.00 1.39 ? 52  ASP A OD2  8  
ATOM   10321 H H    . ASP A 1 52 ? -6.453  -10.208 0.797   1.00 0.27 ? 52  ASP A H    8  
ATOM   10322 H HA   . ASP A 1 52 ? -7.779  -9.438  -1.529  1.00 0.30 ? 52  ASP A HA   8  
ATOM   10323 H HB2  . ASP A 1 52 ? -8.457  -11.379 0.654   1.00 0.74 ? 52  ASP A HB2  8  
ATOM   10324 H HB3  . ASP A 1 52 ? -9.603  -11.062 -0.643  1.00 0.74 ? 52  ASP A HB3  8  
ATOM   10325 N N    . PRO A 1 53 ? -9.499  -8.542  1.219   1.00 0.23 ? 53  PRO A N    8  
ATOM   10326 C CA   . PRO A 1 53 ? -10.541 -7.611  1.683   1.00 0.24 ? 53  PRO A CA   8  
ATOM   10327 C C    . PRO A 1 53 ? -10.247 -6.152  1.327   1.00 0.21 ? 53  PRO A C    8  
ATOM   10328 O O    . PRO A 1 53 ? -11.141 -5.420  0.896   1.00 0.24 ? 53  PRO A O    8  
ATOM   10329 C CB   . PRO A 1 53 ? -10.552 -7.791  3.209   1.00 0.29 ? 53  PRO A CB   8  
ATOM   10330 C CG   . PRO A 1 53 ? -9.309  -8.542  3.541   1.00 0.33 ? 53  PRO A CG   8  
ATOM   10331 C CD   . PRO A 1 53 ? -8.986  -9.365  2.331   1.00 0.28 ? 53  PRO A CD   8  
ATOM   10332 H HA   . PRO A 1 53 ? -11.508 -7.880  1.285   1.00 0.27 ? 53  PRO A HA   8  
ATOM   10333 H HB2  . PRO A 1 53 ? -10.557 -6.822  3.693   1.00 0.34 ? 53  PRO A HB2  8  
ATOM   10334 H HB3  . PRO A 1 53 ? -11.417 -8.359  3.506   1.00 0.34 ? 53  PRO A HB3  8  
ATOM   10335 H HG2  . PRO A 1 53 ? -8.507  -7.846  3.752   1.00 0.41 ? 53  PRO A HG2  8  
ATOM   10336 H HG3  . PRO A 1 53 ? -9.484  -9.186  4.389   1.00 0.44 ? 53  PRO A HG3  8  
ATOM   10337 H HD2  . PRO A 1 53 ? -7.920  -9.512  2.246   1.00 0.29 ? 53  PRO A HD2  8  
ATOM   10338 H HD3  . PRO A 1 53 ? -9.498  -10.316 2.376   1.00 0.34 ? 53  PRO A HD3  8  
ATOM   10339 N N    . ILE A 1 54 ? -8.995  -5.738  1.495   1.00 0.19 ? 54  ILE A N    8  
ATOM   10340 C CA   . ILE A 1 54 ? -8.600  -4.365  1.194   1.00 0.19 ? 54  ILE A CA   8  
ATOM   10341 C C    . ILE A 1 54 ? -8.760  -4.060  -0.291  1.00 0.16 ? 54  ILE A C    8  
ATOM   10342 O O    . ILE A 1 54 ? -9.389  -3.069  -0.663  1.00 0.17 ? 54  ILE A O    8  
ATOM   10343 C CB   . ILE A 1 54 ? -7.142  -4.086  1.613   1.00 0.22 ? 54  ILE A CB   8  
ATOM   10344 C CG1  . ILE A 1 54 ? -6.981  -4.266  3.121   1.00 0.27 ? 54  ILE A CG1  8  
ATOM   10345 C CG2  . ILE A 1 54 ? -6.728  -2.678  1.203   1.00 0.26 ? 54  ILE A CG2  8  
ATOM   10346 C CD1  . ILE A 1 54 ? -5.549  -4.160  3.587   1.00 0.34 ? 54  ILE A CD1  8  
ATOM   10347 H H    . ILE A 1 54 ? -8.323  -6.369  1.828   1.00 0.19 ? 54  ILE A H    8  
ATOM   10348 H HA   . ILE A 1 54 ? -9.246  -3.706  1.756   1.00 0.23 ? 54  ILE A HA   8  
ATOM   10349 H HB   . ILE A 1 54 ? -6.500  -4.787  1.102   1.00 0.21 ? 54  ILE A HB   8  
ATOM   10350 H HG12 . ILE A 1 54 ? -7.551  -3.504  3.631   1.00 0.31 ? 54  ILE A HG12 8  
ATOM   10351 H HG13 . ILE A 1 54 ? -7.354  -5.240  3.403   1.00 0.27 ? 54  ILE A HG13 8  
ATOM   10352 H HG21 . ILE A 1 54 ? -5.691  -2.517  1.461   1.00 0.58 ? 54  ILE A HG21 8  
ATOM   10353 H HG22 . ILE A 1 54 ? -7.343  -1.958  1.719   1.00 0.60 ? 54  ILE A HG22 8  
ATOM   10354 H HG23 . ILE A 1 54 ? -6.857  -2.561  0.137   1.00 0.58 ? 54  ILE A HG23 8  
ATOM   10355 H HD11 . ILE A 1 54 ? -5.517  -4.231  4.663   1.00 0.71 ? 54  ILE A HD11 8  
ATOM   10356 H HD12 . ILE A 1 54 ? -5.137  -3.212  3.275   1.00 0.68 ? 54  ILE A HD12 8  
ATOM   10357 H HD13 . ILE A 1 54 ? -4.969  -4.963  3.155   1.00 0.71 ? 54  ILE A HD13 8  
ATOM   10358 N N    . THR A 1 55 ? -8.204  -4.925  -1.131  1.00 0.15 ? 55  THR A N    8  
ATOM   10359 C CA   . THR A 1 55 ? -8.279  -4.747  -2.573  1.00 0.17 ? 55  THR A CA   8  
ATOM   10360 C C    . THR A 1 55 ? -9.733  -4.696  -3.046  1.00 0.17 ? 55  THR A C    8  
ATOM   10361 O O    . THR A 1 55 ? -10.107 -3.835  -3.843  1.00 0.19 ? 55  THR A O    8  
ATOM   10362 C CB   . THR A 1 55 ? -7.532  -5.877  -3.311  1.00 0.20 ? 55  THR A CB   8  
ATOM   10363 O OG1  . THR A 1 55 ? -6.236  -6.071  -2.723  1.00 0.20 ? 55  THR A OG1  8  
ATOM   10364 C CG2  . THR A 1 55 ? -7.373  -5.547  -4.787  1.00 0.27 ? 55  THR A CG2  8  
ATOM   10365 H H    . THR A 1 55 ? -7.728  -5.705  -0.770  1.00 0.16 ? 55  THR A H    8  
ATOM   10366 H HA   . THR A 1 55 ? -7.800  -3.810  -2.817  1.00 0.19 ? 55  THR A HA   8  
ATOM   10367 H HB   . THR A 1 55 ? -8.103  -6.790  -3.218  1.00 0.22 ? 55  THR A HB   8  
ATOM   10368 H HG1  . THR A 1 55 ? -6.323  -6.606  -1.921  1.00 0.26 ? 55  THR A HG1  8  
ATOM   10369 H HG21 . THR A 1 55 ? -6.866  -6.360  -5.285  1.00 0.49 ? 55  THR A HG21 8  
ATOM   10370 H HG22 . THR A 1 55 ? -6.791  -4.644  -4.890  1.00 0.48 ? 55  THR A HG22 8  
ATOM   10371 H HG23 . THR A 1 55 ? -8.347  -5.403  -5.229  1.00 0.46 ? 55  THR A HG23 8  
ATOM   10372 N N    . ALA A 1 56 ? -10.553 -5.604  -2.528  1.00 0.18 ? 56  ALA A N    8  
ATOM   10373 C CA   . ALA A 1 56 ? -11.960 -5.661  -2.896  1.00 0.21 ? 56  ALA A CA   8  
ATOM   10374 C C    . ALA A 1 56 ? -12.681 -4.370  -2.523  1.00 0.20 ? 56  ALA A C    8  
ATOM   10375 O O    . ALA A 1 56 ? -13.467 -3.843  -3.308  1.00 0.24 ? 56  ALA A O    8  
ATOM   10376 C CB   . ALA A 1 56 ? -12.634 -6.852  -2.235  1.00 0.25 ? 56  ALA A CB   8  
ATOM   10377 H H    . ALA A 1 56 ? -10.202 -6.254  -1.879  1.00 0.18 ? 56  ALA A H    8  
ATOM   10378 H HA   . ALA A 1 56 ? -12.018 -5.793  -3.966  1.00 0.23 ? 56  ALA A HA   8  
ATOM   10379 H HB1  . ALA A 1 56 ? -12.626 -6.720  -1.163  1.00 0.42 ? 56  ALA A HB1  8  
ATOM   10380 H HB2  . ALA A 1 56 ? -12.099 -7.755  -2.491  1.00 0.43 ? 56  ALA A HB2  8  
ATOM   10381 H HB3  . ALA A 1 56 ? -13.654 -6.927  -2.581  1.00 0.43 ? 56  ALA A HB3  8  
ATOM   10382 N N    . ALA A 1 57 ? -12.394 -3.857  -1.333  1.00 0.19 ? 57  ALA A N    8  
ATOM   10383 C CA   . ALA A 1 57 ? -13.021 -2.631  -0.857  1.00 0.20 ? 57  ALA A CA   8  
ATOM   10384 C C    . ALA A 1 57 ? -12.557 -1.414  -1.657  1.00 0.19 ? 57  ALA A C    8  
ATOM   10385 O O    . ALA A 1 57 ? -13.374 -0.602  -2.099  1.00 0.22 ? 57  ALA A O    8  
ATOM   10386 C CB   . ALA A 1 57 ? -12.728 -2.428  0.620   1.00 0.23 ? 57  ALA A CB   8  
ATOM   10387 H H    . ALA A 1 57 ? -11.744 -4.318  -0.755  1.00 0.20 ? 57  ALA A H    8  
ATOM   10388 H HA   . ALA A 1 57 ? -14.091 -2.739  -0.973  1.00 0.23 ? 57  ALA A HA   8  
ATOM   10389 H HB1  . ALA A 1 57 ? -13.071 -3.287  1.178   1.00 0.41 ? 57  ALA A HB1  8  
ATOM   10390 H HB2  . ALA A 1 57 ? -13.238 -1.543  0.970   1.00 0.39 ? 57  ALA A HB2  8  
ATOM   10391 H HB3  . ALA A 1 57 ? -11.663 -2.311  0.761   1.00 0.38 ? 57  ALA A HB3  8  
ATOM   10392 N N    . LEU A 1 58 ? -11.245 -1.296  -1.854  1.00 0.18 ? 58  LEU A N    8  
ATOM   10393 C CA   . LEU A 1 58 ? -10.679 -0.167  -2.587  1.00 0.19 ? 58  LEU A CA   8  
ATOM   10394 C C    . LEU A 1 58 ? -11.197 -0.112  -4.022  1.00 0.20 ? 58  LEU A C    8  
ATOM   10395 O O    . LEU A 1 58 ? -11.671 0.931   -4.467  1.00 0.24 ? 58  LEU A O    8  
ATOM   10396 C CB   . LEU A 1 58 ? -9.148  -0.224  -2.575  1.00 0.21 ? 58  LEU A CB   8  
ATOM   10397 C CG   . LEU A 1 58 ? -8.500  0.008   -1.205  1.00 0.37 ? 58  LEU A CG   8  
ATOM   10398 C CD1  . LEU A 1 58 ? -6.989  0.081   -1.339  1.00 0.35 ? 58  LEU A CD1  8  
ATOM   10399 C CD2  . LEU A 1 58 ? -9.035  1.278   -0.558  1.00 0.73 ? 58  LEU A CD2  8  
ATOM   10400 H H    . LEU A 1 58 ? -10.642 -1.984  -1.491  1.00 0.19 ? 58  LEU A H    8  
ATOM   10401 H HA   . LEU A 1 58 ? -10.991 0.735   -2.082  1.00 0.20 ? 58  LEU A HA   8  
ATOM   10402 H HB2  . LEU A 1 58 ? -8.842  -1.196  -2.936  1.00 0.31 ? 58  LEU A HB2  8  
ATOM   10403 H HB3  . LEU A 1 58 ? -8.777  0.526   -3.256  1.00 0.39 ? 58  LEU A HB3  8  
ATOM   10404 H HG   . LEU A 1 58 ? -8.737  -0.824  -0.558  1.00 0.55 ? 58  LEU A HG   8  
ATOM   10405 H HD11 . LEU A 1 58 ? -6.548  0.215   -0.362  1.00 0.71 ? 58  LEU A HD11 8  
ATOM   10406 H HD12 . LEU A 1 58 ? -6.723  0.914   -1.971  1.00 0.67 ? 58  LEU A HD12 8  
ATOM   10407 H HD13 . LEU A 1 58 ? -6.622  -0.837  -1.777  1.00 0.64 ? 58  LEU A HD13 8  
ATOM   10408 H HD21 . LEU A 1 58 ? -10.063 1.127   -0.266  1.00 1.19 ? 58  LEU A HD21 8  
ATOM   10409 H HD22 . LEU A 1 58 ? -8.977  2.094   -1.262  1.00 1.00 ? 58  LEU A HD22 8  
ATOM   10410 H HD23 . LEU A 1 58 ? -8.443  1.514   0.315   1.00 1.19 ? 58  LEU A HD23 8  
ATOM   10411 N N    . SER A 1 59 ? -11.130 -1.229  -4.731  1.00 0.20 ? 59  SER A N    8  
ATOM   10412 C CA   . SER A 1 59 ? -11.598 -1.281  -6.111  1.00 0.23 ? 59  SER A CA   8  
ATOM   10413 C C    . SER A 1 59 ? -13.101 -1.007  -6.195  1.00 0.23 ? 59  SER A C    8  
ATOM   10414 O O    . SER A 1 59 ? -13.589 -0.458  -7.188  1.00 0.25 ? 59  SER A O    8  
ATOM   10415 C CB   . SER A 1 59 ? -11.267 -2.641  -6.728  1.00 0.29 ? 59  SER A CB   8  
ATOM   10416 O OG   . SER A 1 59 ? -9.868  -2.886  -6.702  1.00 0.85 ? 59  SER A OG   8  
ATOM   10417 H H    . SER A 1 59 ? -10.749 -2.040  -4.323  1.00 0.21 ? 59  SER A H    8  
ATOM   10418 H HA   . SER A 1 59 ? -11.077 -0.511  -6.662  1.00 0.25 ? 59  SER A HA   8  
ATOM   10419 H HB2  . SER A 1 59 ? -11.765 -3.419  -6.169  1.00 0.65 ? 59  SER A HB2  8  
ATOM   10420 H HB3  . SER A 1 59 ? -11.604 -2.662  -7.753  1.00 0.73 ? 59  SER A HB3  8  
ATOM   10421 H HG   . SER A 1 59 ? -9.633  -3.476  -7.424  1.00 1.33 ? 59  SER A HG   8  
ATOM   10422 N N    . GLN A 1 60 ? -13.826 -1.370  -5.141  1.00 0.24 ? 60  GLN A N    8  
ATOM   10423 C CA   . GLN A 1 60 ? -15.268 -1.166  -5.094  1.00 0.28 ? 60  GLN A CA   8  
ATOM   10424 C C    . GLN A 1 60 ? -15.600 0.319   -4.993  1.00 0.26 ? 60  GLN A C    8  
ATOM   10425 O O    . GLN A 1 60 ? -16.287 0.868   -5.853  1.00 0.29 ? 60  GLN A O    8  
ATOM   10426 C CB   . GLN A 1 60 ? -15.872 -1.919  -3.907  1.00 0.34 ? 60  GLN A CB   8  
ATOM   10427 C CG   . GLN A 1 60 ? -17.389 -1.993  -3.941  1.00 0.50 ? 60  GLN A CG   8  
ATOM   10428 C CD   . GLN A 1 60 ? -17.954 -2.745  -2.757  1.00 0.63 ? 60  GLN A CD   8  
ATOM   10429 O OE1  . GLN A 1 60 ? -18.104 -3.968  -2.798  1.00 0.92 ? 60  GLN A OE1  8  
ATOM   10430 N NE2  . GLN A 1 60 ? -18.273 -2.026  -1.695  1.00 0.77 ? 60  GLN A NE2  8  
ATOM   10431 H H    . GLN A 1 60 ? -13.378 -1.785  -4.372  1.00 0.25 ? 60  GLN A H    8  
ATOM   10432 H HA   . GLN A 1 60 ? -15.689 -1.554  -6.008  1.00 0.31 ? 60  GLN A HA   8  
ATOM   10433 H HB2  . GLN A 1 60 ? -15.482 -2.926  -3.900  1.00 0.45 ? 60  GLN A HB2  8  
ATOM   10434 H HB3  . GLN A 1 60 ? -15.577 -1.424  -2.994  1.00 0.42 ? 60  GLN A HB3  8  
ATOM   10435 H HG2  . GLN A 1 60 ? -17.788 -0.989  -3.936  1.00 0.61 ? 60  GLN A HG2  8  
ATOM   10436 H HG3  . GLN A 1 60 ? -17.691 -2.497  -4.846  1.00 0.63 ? 60  GLN A HG3  8  
ATOM   10437 H HE21 . GLN A 1 60 ? -18.132 -1.054  -1.732  1.00 0.92 ? 60  GLN A HE21 8  
ATOM   10438 H HE22 . GLN A 1 60 ? -18.639 -2.493  -0.911  1.00 0.90 ? 60  GLN A HE22 8  
ATOM   10439 N N    . ARG A 1 61 ? -15.088 0.972   -3.957  1.00 0.29 ? 61  ARG A N    8  
ATOM   10440 C CA   . ARG A 1 61 ? -15.342 2.396   -3.752  1.00 0.34 ? 61  ARG A CA   8  
ATOM   10441 C C    . ARG A 1 61 ? -14.794 3.219   -4.916  1.00 0.30 ? 61  ARG A C    8  
ATOM   10442 O O    . ARG A 1 61 ? -15.344 4.265   -5.261  1.00 0.34 ? 61  ARG A O    8  
ATOM   10443 C CB   . ARG A 1 61 ? -14.738 2.878   -2.428  1.00 0.45 ? 61  ARG A CB   8  
ATOM   10444 C CG   . ARG A 1 61 ? -13.242 2.630   -2.295  1.00 0.65 ? 61  ARG A CG   8  
ATOM   10445 C CD   . ARG A 1 61 ? -12.760 2.884   -0.874  1.00 0.67 ? 61  ARG A CD   8  
ATOM   10446 N NE   . ARG A 1 61 ? -11.887 4.055   -0.786  1.00 0.81 ? 61  ARG A NE   8  
ATOM   10447 C CZ   . ARG A 1 61 ? -11.848 4.877   0.260   1.00 1.09 ? 61  ARG A CZ   8  
ATOM   10448 N NH1  . ARG A 1 61 ? -12.634 4.661   1.316   1.00 1.47 ? 61  ARG A NH1  8  
ATOM   10449 N NH2  . ARG A 1 61 ? -11.018 5.913   0.248   1.00 1.42 ? 61  ARG A NH2  8  
ATOM   10450 H H    . ARG A 1 61 ? -14.530 0.484   -3.309  1.00 0.30 ? 61  ARG A H    8  
ATOM   10451 H HA   . ARG A 1 61 ? -16.413 2.531   -3.713  1.00 0.40 ? 61  ARG A HA   8  
ATOM   10452 H HB2  . ARG A 1 61 ? -14.910 3.941   -2.335  1.00 0.72 ? 61  ARG A HB2  8  
ATOM   10453 H HB3  . ARG A 1 61 ? -15.239 2.372   -1.615  1.00 0.82 ? 61  ARG A HB3  8  
ATOM   10454 H HG2  . ARG A 1 61 ? -13.032 1.603   -2.560  1.00 1.08 ? 61  ARG A HG2  8  
ATOM   10455 H HG3  . ARG A 1 61 ? -12.716 3.292   -2.969  1.00 1.01 ? 61  ARG A HG3  8  
ATOM   10456 H HD2  . ARG A 1 61 ? -13.620 3.044   -0.240  1.00 0.88 ? 61  ARG A HD2  8  
ATOM   10457 H HD3  . ARG A 1 61 ? -12.218 2.015   -0.531  1.00 0.79 ? 61  ARG A HD3  8  
ATOM   10458 H HE   . ARG A 1 61 ? -11.294 4.235   -1.552  1.00 1.11 ? 61  ARG A HE   8  
ATOM   10459 H HH11 . ARG A 1 61 ? -12.605 5.281   2.110   1.00 1.93 ? 61  ARG A HH11 8  
ATOM   10460 H HH12 . ARG A 1 61 ? -13.262 3.879   1.323   1.00 1.47 ? 61  ARG A HH12 8  
ATOM   10461 H HH21 . ARG A 1 61 ? -10.417 6.068   -0.554  1.00 1.53 ? 61  ARG A HH21 8  
ATOM   10462 H HH22 . ARG A 1 61 ? -10.982 6.542   1.025   1.00 1.76 ? 61  ARG A HH22 8  
ATOM   10463 N N    . ALA A 1 62 ? -13.725 2.726   -5.530  1.00 0.27 ? 62  ALA A N    8  
ATOM   10464 C CA   . ALA A 1 62 ? -13.107 3.406   -6.659  1.00 0.29 ? 62  ALA A CA   8  
ATOM   10465 C C    . ALA A 1 62 ? -14.045 3.445   -7.860  1.00 0.30 ? 62  ALA A C    8  
ATOM   10466 O O    . ALA A 1 62 ? -14.150 4.464   -8.537  1.00 0.41 ? 62  ALA A O    8  
ATOM   10467 C CB   . ALA A 1 62 ? -11.800 2.731   -7.039  1.00 0.31 ? 62  ALA A CB   8  
ATOM   10468 H H    . ALA A 1 62 ? -13.337 1.880   -5.211  1.00 0.26 ? 62  ALA A H    8  
ATOM   10469 H HA   . ALA A 1 62 ? -12.884 4.421   -6.356  1.00 0.34 ? 62  ALA A HA   8  
ATOM   10470 H HB1  . ALA A 1 62 ? -11.983 1.688   -7.253  1.00 0.40 ? 62  ALA A HB1  8  
ATOM   10471 H HB2  . ALA A 1 62 ? -11.098 2.813   -6.222  1.00 0.44 ? 62  ALA A HB2  8  
ATOM   10472 H HB3  . ALA A 1 62 ? -11.389 3.210   -7.915  1.00 0.46 ? 62  ALA A HB3  8  
ATOM   10473 N N    . MET A 1 63 ? -14.743 2.342   -8.108  1.00 0.26 ? 63  MET A N    8  
ATOM   10474 C CA   . MET A 1 63 ? -15.662 2.260   -9.243  1.00 0.32 ? 63  MET A CA   8  
ATOM   10475 C C    . MET A 1 63 ? -16.983 2.974   -8.951  1.00 0.32 ? 63  MET A C    8  
ATOM   10476 O O    . MET A 1 63 ? -17.681 3.401   -9.870  1.00 0.42 ? 63  MET A O    8  
ATOM   10477 C CB   . MET A 1 63 ? -15.924 0.796   -9.623  1.00 0.37 ? 63  MET A CB   8  
ATOM   10478 C CG   . MET A 1 63 ? -16.902 0.084   -8.704  1.00 0.38 ? 63  MET A CG   8  
ATOM   10479 S SD   . MET A 1 63 ? -17.213 -1.621  -9.197  1.00 0.50 ? 63  MET A SD   8  
ATOM   10480 C CE   . MET A 1 63 ? -15.581 -2.335  -9.030  1.00 0.71 ? 63  MET A CE   8  
ATOM   10481 H H    . MET A 1 63 ? -14.638 1.565   -7.519  1.00 0.27 ? 63  MET A H    8  
ATOM   10482 H HA   . MET A 1 63 ? -15.185 2.752   -10.077 1.00 0.36 ? 63  MET A HA   8  
ATOM   10483 H HB2  . MET A 1 63 ? -16.320 0.763   -10.626 1.00 0.43 ? 63  MET A HB2  8  
ATOM   10484 H HB3  . MET A 1 63 ? -14.988 0.258   -9.600  1.00 0.42 ? 63  MET A HB3  8  
ATOM   10485 H HG2  . MET A 1 63 ? -16.495 0.084   -7.703  1.00 0.38 ? 63  MET A HG2  8  
ATOM   10486 H HG3  . MET A 1 63 ? -17.837 0.621   -8.709  1.00 0.39 ? 63  MET A HG3  8  
ATOM   10487 H HE1  . MET A 1 63 ? -14.899 -1.845  -9.710  1.00 0.96 ? 63  MET A HE1  8  
ATOM   10488 H HE2  . MET A 1 63 ? -15.628 -3.387  -9.266  1.00 0.93 ? 63  MET A HE2  8  
ATOM   10489 H HE3  . MET A 1 63 ? -15.233 -2.209  -8.016  1.00 0.95 ? 63  MET A HE3  8  
ATOM   10490 N N    . ILE A 1 64 ? -17.320 3.109   -7.675  1.00 0.28 ? 64  ILE A N    8  
ATOM   10491 C CA   . ILE A 1 64 ? -18.562 3.766   -7.288  1.00 0.31 ? 64  ILE A CA   8  
ATOM   10492 C C    . ILE A 1 64 ? -18.378 5.278   -7.186  1.00 0.31 ? 64  ILE A C    8  
ATOM   10493 O O    . ILE A 1 64 ? -19.172 6.046   -7.729  1.00 0.37 ? 64  ILE A O    8  
ATOM   10494 C CB   . ILE A 1 64 ? -19.103 3.221   -5.945  1.00 0.35 ? 64  ILE A CB   8  
ATOM   10495 C CG1  . ILE A 1 64 ? -19.362 1.717   -6.047  1.00 0.38 ? 64  ILE A CG1  8  
ATOM   10496 C CG2  . ILE A 1 64 ? -20.377 3.955   -5.544  1.00 0.43 ? 64  ILE A CG2  8  
ATOM   10497 C CD1  . ILE A 1 64 ? -19.705 1.067   -4.721  1.00 0.46 ? 64  ILE A CD1  8  
ATOM   10498 H H    . ILE A 1 64 ? -16.726 2.754   -6.981  1.00 0.29 ? 64  ILE A H    8  
ATOM   10499 H HA   . ILE A 1 64 ? -19.296 3.561   -8.053  1.00 0.35 ? 64  ILE A HA   8  
ATOM   10500 H HB   . ILE A 1 64 ? -18.359 3.401   -5.183  1.00 0.34 ? 64  ILE A HB   8  
ATOM   10501 H HG12 . ILE A 1 64 ? -20.186 1.545   -6.723  1.00 0.44 ? 64  ILE A HG12 8  
ATOM   10502 H HG13 . ILE A 1 64 ? -18.478 1.235   -6.436  1.00 0.36 ? 64  ILE A HG13 8  
ATOM   10503 H HG21 . ILE A 1 64 ? -20.731 3.570   -4.600  1.00 0.59 ? 64  ILE A HG21 8  
ATOM   10504 H HG22 . ILE A 1 64 ? -21.134 3.805   -6.302  1.00 0.58 ? 64  ILE A HG22 8  
ATOM   10505 H HG23 . ILE A 1 64 ? -20.169 5.009   -5.449  1.00 0.58 ? 64  ILE A HG23 8  
ATOM   10506 H HD11 . ILE A 1 64 ? -20.588 1.531   -4.309  1.00 0.62 ? 64  ILE A HD11 8  
ATOM   10507 H HD12 . ILE A 1 64 ? -18.880 1.192   -4.036  1.00 0.57 ? 64  ILE A HD12 8  
ATOM   10508 H HD13 . ILE A 1 64 ? -19.889 0.014   -4.869  1.00 0.59 ? 64  ILE A HD13 8  
ATOM   10509 N N    . LEU A 1 65 ? -17.322 5.706   -6.509  1.00 0.29 ? 65  LEU A N    8  
ATOM   10510 C CA   . LEU A 1 65 ? -17.058 7.131   -6.335  1.00 0.33 ? 65  LEU A CA   8  
ATOM   10511 C C    . LEU A 1 65 ? -16.332 7.722   -7.543  1.00 0.34 ? 65  LEU A C    8  
ATOM   10512 O O    . LEU A 1 65 ? -16.458 8.912   -7.831  1.00 0.47 ? 65  LEU A O    8  
ATOM   10513 C CB   . LEU A 1 65 ? -16.247 7.374   -5.060  1.00 0.40 ? 65  LEU A CB   8  
ATOM   10514 C CG   . LEU A 1 65 ? -17.068 7.508   -3.769  1.00 0.93 ? 65  LEU A CG   8  
ATOM   10515 C CD1  . LEU A 1 65 ? -17.690 6.174   -3.375  1.00 1.61 ? 65  LEU A CD1  8  
ATOM   10516 C CD2  . LEU A 1 65 ? -16.198 8.046   -2.641  1.00 0.99 ? 65  LEU A CD2  8  
ATOM   10517 H H    . LEU A 1 65 ? -16.705 5.049   -6.111  1.00 0.30 ? 65  LEU A H    8  
ATOM   10518 H HA   . LEU A 1 65 ? -18.012 7.627   -6.238  1.00 0.39 ? 65  LEU A HA   8  
ATOM   10519 H HB2  . LEU A 1 65 ? -15.557 6.552   -4.936  1.00 0.77 ? 65  LEU A HB2  8  
ATOM   10520 H HB3  . LEU A 1 65 ? -15.676 8.282   -5.191  1.00 0.73 ? 65  LEU A HB3  8  
ATOM   10521 H HG   . LEU A 1 65 ? -17.872 8.213   -3.935  1.00 1.40 ? 65  LEU A HG   8  
ATOM   10522 H HD11 . LEU A 1 65 ? -16.909 5.448   -3.204  1.00 1.79 ? 65  LEU A HD11 8  
ATOM   10523 H HD12 . LEU A 1 65 ? -18.333 5.828   -4.170  1.00 1.94 ? 65  LEU A HD12 8  
ATOM   10524 H HD13 . LEU A 1 65 ? -18.271 6.297   -2.471  1.00 2.09 ? 65  LEU A HD13 8  
ATOM   10525 H HD21 . LEU A 1 65 ? -15.756 8.985   -2.943  1.00 1.31 ? 65  LEU A HD21 8  
ATOM   10526 H HD22 . LEU A 1 65 ? -15.414 7.336   -2.418  1.00 1.14 ? 65  LEU A HD22 8  
ATOM   10527 H HD23 . LEU A 1 65 ? -16.804 8.200   -1.760  1.00 1.50 ? 65  LEU A HD23 8  
ATOM   10528 N N    . GLY A 1 66 ? -15.572 6.892   -8.245  1.00 0.30 ? 66  GLY A N    8  
ATOM   10529 C CA   . GLY A 1 66 ? -14.850 7.361   -9.414  1.00 0.36 ? 66  GLY A CA   8  
ATOM   10530 C C    . GLY A 1 66 ? -13.459 7.864   -9.083  1.00 0.43 ? 66  GLY A C    8  
ATOM   10531 O O    . GLY A 1 66 ? -12.846 8.582   -9.873  1.00 0.81 ? 66  GLY A O    8  
ATOM   10532 H H    . GLY A 1 66 ? -15.503 5.954   -7.974  1.00 0.33 ? 66  GLY A H    8  
ATOM   10533 H HA2  . GLY A 1 66 ? -14.764 6.548   -10.116 1.00 0.40 ? 66  GLY A HA2  8  
ATOM   10534 H HA3  . GLY A 1 66 ? -15.412 8.161   -9.875  1.00 0.41 ? 66  GLY A HA3  8  
ATOM   10535 N N    . LYS A 1 67 ? -12.959 7.490   -7.913  1.00 0.43 ? 67  LYS A N    8  
ATOM   10536 C CA   . LYS A 1 67 ? -11.632 7.907   -7.482  1.00 0.47 ? 67  LYS A CA   8  
ATOM   10537 C C    . LYS A 1 67 ? -10.765 6.684   -7.201  1.00 0.35 ? 67  LYS A C    8  
ATOM   10538 O O    . LYS A 1 67 ? -11.132 5.821   -6.402  1.00 0.44 ? 67  LYS A O    8  
ATOM   10539 C CB   . LYS A 1 67 ? -11.720 8.802   -6.236  1.00 0.65 ? 67  LYS A CB   8  
ATOM   10540 C CG   . LYS A 1 67 ? -12.516 8.197   -5.087  1.00 0.74 ? 67  LYS A CG   8  
ATOM   10541 C CD   . LYS A 1 67 ? -12.210 8.886   -3.763  1.00 1.10 ? 67  LYS A CD   8  
ATOM   10542 C CE   . LYS A 1 67 ? -12.664 10.337  -3.767  1.00 1.28 ? 67  LYS A CE   8  
ATOM   10543 N NZ   . LYS A 1 67 ? -12.125 11.093  -2.608  1.00 1.52 ? 67  LYS A NZ   8  
ATOM   10544 H H    . LYS A 1 67 ? -13.491 6.914   -7.328  1.00 0.69 ? 67  LYS A H    8  
ATOM   10545 H HA   . LYS A 1 67 ? -11.183 8.470   -8.287  1.00 0.55 ? 67  LYS A HA   8  
ATOM   10546 H HB2  . LYS A 1 67 ? -10.721 9.006   -5.882  1.00 0.82 ? 67  LYS A HB2  8  
ATOM   10547 H HB3  . LYS A 1 67 ? -12.186 9.736   -6.513  1.00 0.78 ? 67  LYS A HB3  8  
ATOM   10548 H HG2  . LYS A 1 67 ? -13.570 8.301   -5.299  1.00 0.86 ? 67  LYS A HG2  8  
ATOM   10549 H HG3  . LYS A 1 67 ? -12.267 7.150   -5.004  1.00 0.86 ? 67  LYS A HG3  8  
ATOM   10550 H HD2  . LYS A 1 67 ? -12.721 8.362   -2.971  1.00 1.44 ? 67  LYS A HD2  8  
ATOM   10551 H HD3  . LYS A 1 67 ? -11.143 8.854   -3.590  1.00 1.29 ? 67  LYS A HD3  8  
ATOM   10552 H HE2  . LYS A 1 67 ? -12.327 10.805  -4.677  1.00 1.52 ? 67  LYS A HE2  8  
ATOM   10553 H HE3  . LYS A 1 67 ? -13.743 10.362  -3.730  1.00 1.71 ? 67  LYS A HE3  8  
ATOM   10554 H HZ1  . LYS A 1 67 ? -12.511 10.710  -1.721  1.00 1.85 ? 67  LYS A HZ1  8  
ATOM   10555 H HZ2  . LYS A 1 67 ? -12.390 12.096  -2.679  1.00 1.82 ? 67  LYS A HZ2  8  
ATOM   10556 H HZ3  . LYS A 1 67 ? -11.088 11.021  -2.580  1.00 1.90 ? 67  LYS A HZ3  8  
ATOM   10557 N N    . SER A 1 68 ? -9.619  6.608   -7.858  1.00 0.30 ? 68  SER A N    8  
ATOM   10558 C CA   . SER A 1 68 ? -8.717  5.478   -7.684  1.00 0.32 ? 68  SER A CA   8  
ATOM   10559 C C    . SER A 1 68 ? -7.400  5.917   -7.049  1.00 0.28 ? 68  SER A C    8  
ATOM   10560 O O    . SER A 1 68 ? -6.346  5.340   -7.321  1.00 0.33 ? 68  SER A O    8  
ATOM   10561 C CB   . SER A 1 68 ? -8.455  4.814   -9.036  1.00 0.46 ? 68  SER A CB   8  
ATOM   10562 O OG   . SER A 1 68 ? -9.669  4.600   -9.743  1.00 0.91 ? 68  SER A OG   8  
ATOM   10563 H H    . SER A 1 68 ? -9.363  7.335   -8.469  1.00 0.38 ? 68  SER A H    8  
ATOM   10564 H HA   . SER A 1 68 ? -9.200  4.767   -7.033  1.00 0.38 ? 68  SER A HA   8  
ATOM   10565 H HB2  . SER A 1 68 ? -7.816  5.450   -9.628  1.00 0.76 ? 68  SER A HB2  8  
ATOM   10566 H HB3  . SER A 1 68 ? -7.971  3.862   -8.879  1.00 0.77 ? 68  SER A HB3  8  
ATOM   10567 H HG   . SER A 1 68 ? -10.325 5.243   -9.451  1.00 1.45 ? 68  SER A HG   8  
ATOM   10568 N N    . GLY A 1 69 ? -7.472  6.929   -6.190  1.00 0.29 ? 69  GLY A N    8  
ATOM   10569 C CA   . GLY A 1 69 ? -6.283  7.436   -5.529  1.00 0.35 ? 69  GLY A CA   8  
ATOM   10570 C C    . GLY A 1 69 ? -5.585  6.378   -4.699  1.00 0.32 ? 69  GLY A C    8  
ATOM   10571 O O    . GLY A 1 69 ? -4.378  6.176   -4.822  1.00 0.41 ? 69  GLY A O    8  
ATOM   10572 H H    . GLY A 1 69 ? -8.343  7.333   -5.998  1.00 0.33 ? 69  GLY A H    8  
ATOM   10573 H HA2  . GLY A 1 69 ? -5.595  7.799   -6.277  1.00 0.40 ? 69  GLY A HA2  8  
ATOM   10574 H HA3  . GLY A 1 69 ? -6.564  8.257   -4.886  1.00 0.42 ? 69  GLY A HA3  8  
ATOM   10575 N N    . GLU A 1 70 ? -6.354  5.693   -3.867  1.00 0.34 ? 70  GLU A N    8  
ATOM   10576 C CA   . GLU A 1 70 ? -5.811  4.649   -3.013  1.00 0.38 ? 70  GLU A CA   8  
ATOM   10577 C C    . GLU A 1 70 ? -5.460  3.418   -3.840  1.00 0.32 ? 70  GLU A C    8  
ATOM   10578 O O    . GLU A 1 70 ? -4.495  2.715   -3.546  1.00 0.39 ? 70  GLU A O    8  
ATOM   10579 C CB   . GLU A 1 70 ? -6.812  4.269   -1.916  1.00 0.52 ? 70  GLU A CB   8  
ATOM   10580 C CG   . GLU A 1 70 ? -7.211  5.430   -1.014  1.00 0.66 ? 70  GLU A CG   8  
ATOM   10581 C CD   . GLU A 1 70 ? -8.322  6.282   -1.599  1.00 0.70 ? 70  GLU A CD   8  
ATOM   10582 O OE1  . GLU A 1 70 ? -8.111  7.498   -1.780  1.00 1.24 ? 70  GLU A OE1  8  
ATOM   10583 O OE2  . GLU A 1 70 ? -9.416  5.737   -1.877  1.00 1.08 ? 70  GLU A OE2  8  
ATOM   10584 H H    . GLU A 1 70 ? -7.313  5.898   -3.822  1.00 0.40 ? 70  GLU A H    8  
ATOM   10585 H HA   . GLU A 1 70 ? -4.911  5.029   -2.554  1.00 0.42 ? 70  GLU A HA   8  
ATOM   10586 H HB2  . GLU A 1 70 ? -7.704  3.877   -2.380  1.00 0.52 ? 70  GLU A HB2  8  
ATOM   10587 H HB3  . GLU A 1 70 ? -6.373  3.498   -1.300  1.00 0.64 ? 70  GLU A HB3  8  
ATOM   10588 H HG2  . GLU A 1 70 ? -7.541  5.035   -0.066  1.00 0.80 ? 70  GLU A HG2  8  
ATOM   10589 H HG3  . GLU A 1 70 ? -6.343  6.055   -0.858  1.00 0.82 ? 70  GLU A HG3  8  
ATOM   10590 N N    . LEU A 1 71 ? -6.245  3.180   -4.885  1.00 0.28 ? 71  LEU A N    8  
ATOM   10591 C CA   . LEU A 1 71 ? -6.039  2.030   -5.762  1.00 0.28 ? 71  LEU A CA   8  
ATOM   10592 C C    . LEU A 1 71 ? -4.667  2.071   -6.430  1.00 0.26 ? 71  LEU A C    8  
ATOM   10593 O O    . LEU A 1 71 ? -3.999  1.044   -6.549  1.00 0.30 ? 71  LEU A O    8  
ATOM   10594 C CB   . LEU A 1 71 ? -7.131  1.967   -6.833  1.00 0.34 ? 71  LEU A CB   8  
ATOM   10595 C CG   . LEU A 1 71 ? -8.011  0.710   -6.810  1.00 0.58 ? 71  LEU A CG   8  
ATOM   10596 C CD1  . LEU A 1 71 ? -8.956  0.706   -7.998  1.00 0.89 ? 71  LEU A CD1  8  
ATOM   10597 C CD2  . LEU A 1 71 ? -7.157  -0.552  -6.801  1.00 1.43 ? 71  LEU A CD2  8  
ATOM   10598 H H    . LEU A 1 71 ? -6.984  3.797   -5.071  1.00 0.34 ? 71  LEU A H    8  
ATOM   10599 H HA   . LEU A 1 71 ? -6.096  1.139   -5.155  1.00 0.33 ? 71  LEU A HA   8  
ATOM   10600 H HB2  . LEU A 1 71 ? -7.770  2.830   -6.712  1.00 0.54 ? 71  LEU A HB2  8  
ATOM   10601 H HB3  . LEU A 1 71 ? -6.655  2.028   -7.801  1.00 0.61 ? 71  LEU A HB3  8  
ATOM   10602 H HG   . LEU A 1 71 ? -8.609  0.717   -5.910  1.00 1.35 ? 71  LEU A HG   8  
ATOM   10603 H HD11 . LEU A 1 71 ? -9.686  1.493   -7.876  1.00 1.64 ? 71  LEU A HD11 8  
ATOM   10604 H HD12 . LEU A 1 71 ? -9.460  -0.248  -8.056  1.00 1.06 ? 71  LEU A HD12 8  
ATOM   10605 H HD13 . LEU A 1 71 ? -8.395  0.873   -8.905  1.00 1.33 ? 71  LEU A HD13 8  
ATOM   10606 H HD21 . LEU A 1 71 ? -6.622  -0.620  -5.866  1.00 2.09 ? 71  LEU A HD21 8  
ATOM   10607 H HD22 . LEU A 1 71 ? -6.452  -0.514  -7.618  1.00 1.87 ? 71  LEU A HD22 8  
ATOM   10608 H HD23 . LEU A 1 71 ? -7.793  -1.417  -6.913  1.00 1.71 ? 71  LEU A HD23 8  
ATOM   10609 N N    . LYS A 1 72 ? -4.251  3.256   -6.865  1.00 0.26 ? 72  LYS A N    8  
ATOM   10610 C CA   . LYS A 1 72 ? -2.957  3.416   -7.521  1.00 0.30 ? 72  LYS A CA   8  
ATOM   10611 C C    . LYS A 1 72 ? -1.821  2.990   -6.602  1.00 0.27 ? 72  LYS A C    8  
ATOM   10612 O O    . LYS A 1 72 ? -1.018  2.117   -6.950  1.00 0.33 ? 72  LYS A O    8  
ATOM   10613 C CB   . LYS A 1 72 ? -2.745  4.866   -7.956  1.00 0.39 ? 72  LYS A CB   8  
ATOM   10614 C CG   . LYS A 1 72 ? -3.495  5.239   -9.225  1.00 0.50 ? 72  LYS A CG   8  
ATOM   10615 C CD   . LYS A 1 72 ? -2.598  5.983   -10.204 1.00 0.74 ? 72  LYS A CD   8  
ATOM   10616 C CE   . LYS A 1 72 ? -2.142  7.319   -9.644  1.00 1.11 ? 72  LYS A CE   8  
ATOM   10617 N NZ   . LYS A 1 72 ? -1.207  8.012   -10.567 1.00 1.44 ? 72  LYS A NZ   8  
ATOM   10618 H H    . LYS A 1 72 ? -4.830  4.043   -6.743  1.00 0.28 ? 72  LYS A H    8  
ATOM   10619 H HA   . LYS A 1 72 ? -2.952  2.783   -8.396  1.00 0.35 ? 72  LYS A HA   8  
ATOM   10620 H HB2  . LYS A 1 72 ? -3.077  5.522   -7.163  1.00 0.45 ? 72  LYS A HB2  8  
ATOM   10621 H HB3  . LYS A 1 72 ? -1.690  5.028   -8.125  1.00 0.49 ? 72  LYS A HB3  8  
ATOM   10622 H HG2  . LYS A 1 72 ? -3.855  4.339   -9.697  1.00 0.76 ? 72  LYS A HG2  8  
ATOM   10623 H HG3  . LYS A 1 72 ? -4.331  5.873   -8.964  1.00 0.74 ? 72  LYS A HG3  8  
ATOM   10624 H HD2  . LYS A 1 72 ? -1.729  5.378   -10.415 1.00 0.98 ? 72  LYS A HD2  8  
ATOM   10625 H HD3  . LYS A 1 72 ? -3.145  6.157   -11.119 1.00 0.88 ? 72  LYS A HD3  8  
ATOM   10626 H HE2  . LYS A 1 72 ? -3.009  7.945   -9.487  1.00 1.39 ? 72  LYS A HE2  8  
ATOM   10627 H HE3  . LYS A 1 72 ? -1.647  7.152   -8.699  1.00 1.42 ? 72  LYS A HE3  8  
ATOM   10628 H HZ1  . LYS A 1 72 ? -1.658  8.150   -11.494 1.00 1.73 ? 72  LYS A HZ1  8  
ATOM   10629 H HZ2  . LYS A 1 72 ? -0.344  7.447   -10.693 1.00 1.79 ? 72  LYS A HZ2  8  
ATOM   10630 H HZ3  . LYS A 1 72 ? -0.948  8.943   -10.181 1.00 1.75 ? 72  LYS A HZ3  8  
ATOM   10631 N N    . THR A 1 73 ? -1.770  3.601   -5.427  1.00 0.23 ? 73  THR A N    8  
ATOM   10632 C CA   . THR A 1 73 ? -0.743  3.303   -4.445  1.00 0.24 ? 73  THR A CA   8  
ATOM   10633 C C    . THR A 1 73 ? -0.785  1.831   -4.035  1.00 0.21 ? 73  THR A C    8  
ATOM   10634 O O    . THR A 1 73 ? 0.241   1.149   -4.025  1.00 0.24 ? 73  THR A O    8  
ATOM   10635 C CB   . THR A 1 73 ? -0.927  4.186   -3.199  1.00 0.29 ? 73  THR A CB   8  
ATOM   10636 O OG1  . THR A 1 73 ? -1.492  5.449   -3.580  1.00 0.39 ? 73  THR A OG1  8  
ATOM   10637 C CG2  . THR A 1 73 ? 0.399   4.410   -2.489  1.00 0.35 ? 73  THR A CG2  8  
ATOM   10638 H H    . THR A 1 73 ? -2.445  4.281   -5.213  1.00 0.26 ? 73  THR A H    8  
ATOM   10639 H HA   . THR A 1 73 ? 0.221   3.522   -4.881  1.00 0.26 ? 73  THR A HA   8  
ATOM   10640 H HB   . THR A 1 73 ? -1.604  3.688   -2.518  1.00 0.32 ? 73  THR A HB   8  
ATOM   10641 H HG1  . THR A 1 73 ? -0.948  5.847   -4.284  1.00 0.74 ? 73  THR A HG1  8  
ATOM   10642 H HG21 . THR A 1 73 ? 1.080   4.927   -3.149  1.00 0.57 ? 73  THR A HG21 8  
ATOM   10643 H HG22 . THR A 1 73 ? 0.823   3.457   -2.210  1.00 0.56 ? 73  THR A HG22 8  
ATOM   10644 H HG23 . THR A 1 73 ? 0.233   5.006   -1.603  1.00 0.58 ? 73  THR A HG23 8  
ATOM   10645 N N    . TRP A 1 74 ? -1.987  1.350   -3.730  1.00 0.18 ? 74  TRP A N    8  
ATOM   10646 C CA   . TRP A 1 74 ? -2.193  -0.031  -3.309  1.00 0.18 ? 74  TRP A CA   8  
ATOM   10647 C C    . TRP A 1 74 ? -1.707  -1.017  -4.369  1.00 0.17 ? 74  TRP A C    8  
ATOM   10648 O O    . TRP A 1 74 ? -0.947  -1.929  -4.064  1.00 0.19 ? 74  TRP A O    8  
ATOM   10649 C CB   . TRP A 1 74 ? -3.676  -0.273  -3.007  1.00 0.19 ? 74  TRP A CB   8  
ATOM   10650 C CG   . TRP A 1 74 ? -3.973  -1.659  -2.525  1.00 0.20 ? 74  TRP A CG   8  
ATOM   10651 C CD1  . TRP A 1 74 ? -4.693  -2.618  -3.178  1.00 0.23 ? 74  TRP A CD1  8  
ATOM   10652 C CD2  . TRP A 1 74 ? -3.557  -2.243  -1.285  1.00 0.27 ? 74  TRP A CD2  8  
ATOM   10653 N NE1  . TRP A 1 74 ? -4.751  -3.761  -2.420  1.00 0.25 ? 74  TRP A NE1  8  
ATOM   10654 C CE2  . TRP A 1 74 ? -4.060  -3.557  -1.254  1.00 0.27 ? 74  TRP A CE2  8  
ATOM   10655 C CE3  . TRP A 1 74 ? -2.804  -1.785  -0.200  1.00 0.38 ? 74  TRP A CE3  8  
ATOM   10656 C CZ2  . TRP A 1 74 ? -3.841  -4.414  -0.179  1.00 0.36 ? 74  TRP A CZ2  8  
ATOM   10657 C CZ3  . TRP A 1 74 ? -2.587  -2.637  0.866   1.00 0.48 ? 74  TRP A CZ3  8  
ATOM   10658 C CH2  . TRP A 1 74 ? -3.103  -3.939  0.870   1.00 0.46 ? 74  TRP A CH2  8  
ATOM   10659 H H    . TRP A 1 74 ? -2.765  1.949   -3.785  1.00 0.20 ? 74  TRP A H    8  
ATOM   10660 H HA   . TRP A 1 74 ? -1.624  -0.188  -2.406  1.00 0.20 ? 74  TRP A HA   8  
ATOM   10661 H HB2  . TRP A 1 74 ? -3.998  0.418   -2.245  1.00 0.22 ? 74  TRP A HB2  8  
ATOM   10662 H HB3  . TRP A 1 74 ? -4.252  -0.102  -3.906  1.00 0.21 ? 74  TRP A HB3  8  
ATOM   10663 H HD1  . TRP A 1 74 ? -5.146  -2.482  -4.149  1.00 0.30 ? 74  TRP A HD1  8  
ATOM   10664 H HE1  . TRP A 1 74 ? -5.215  -4.595  -2.675  1.00 0.28 ? 74  TRP A HE1  8  
ATOM   10665 H HE3  . TRP A 1 74 ? -2.397  -0.783  -0.184  1.00 0.40 ? 74  TRP A HE3  8  
ATOM   10666 H HZ2  . TRP A 1 74 ? -4.233  -5.420  -0.160  1.00 0.36 ? 74  TRP A HZ2  8  
ATOM   10667 H HZ3  . TRP A 1 74 ? -2.011  -2.298  1.713   1.00 0.58 ? 74  TRP A HZ3  8  
ATOM   10668 H HH2  . TRP A 1 74 ? -2.910  -4.568  1.726   1.00 0.54 ? 74  TRP A HH2  8  
ATOM   10669 N N    . GLY A 1 75 ? -2.126  -0.809  -5.614  1.00 0.18 ? 75  GLY A N    8  
ATOM   10670 C CA   . GLY A 1 75 ? -1.735  -1.699  -6.699  1.00 0.21 ? 75  GLY A CA   8  
ATOM   10671 C C    . GLY A 1 75 ? -0.231  -1.821  -6.859  1.00 0.20 ? 75  GLY A C    8  
ATOM   10672 O O    . GLY A 1 75 ? 0.287   -2.906  -7.134  1.00 0.25 ? 75  GLY A O    8  
ATOM   10673 H H    . GLY A 1 75 ? -2.707  -0.037  -5.801  1.00 0.20 ? 75  GLY A H    8  
ATOM   10674 H HA2  . GLY A 1 75 ? -2.144  -2.680  -6.508  1.00 0.24 ? 75  GLY A HA2  8  
ATOM   10675 H HA3  . GLY A 1 75 ? -2.152  -1.324  -7.622  1.00 0.24 ? 75  GLY A HA3  8  
ATOM   10676 N N    . LEU A 1 76 ? 0.470   -0.710  -6.678  1.00 0.20 ? 76  LEU A N    8  
ATOM   10677 C CA   . LEU A 1 76 ? 1.922   -0.695  -6.809  1.00 0.24 ? 76  LEU A CA   8  
ATOM   10678 C C    . LEU A 1 76 ? 2.592   -1.343  -5.598  1.00 0.23 ? 76  LEU A C    8  
ATOM   10679 O O    . LEU A 1 76 ? 3.464   -2.201  -5.743  1.00 0.28 ? 76  LEU A O    8  
ATOM   10680 C CB   . LEU A 1 76 ? 2.426   0.739   -6.990  1.00 0.30 ? 76  LEU A CB   8  
ATOM   10681 C CG   . LEU A 1 76 ? 2.117   1.366   -8.352  1.00 0.40 ? 76  LEU A CG   8  
ATOM   10682 C CD1  . LEU A 1 76 ? 2.293   2.876   -8.300  1.00 0.51 ? 76  LEU A CD1  8  
ATOM   10683 C CD2  . LEU A 1 76 ? 3.009   0.759   -9.428  1.00 0.56 ? 76  LEU A CD2  8  
ATOM   10684 H H    . LEU A 1 76 ? -0.001  0.121   -6.443  1.00 0.22 ? 76  LEU A H    8  
ATOM   10685 H HA   . LEU A 1 76 ? 2.176   -1.268  -7.688  1.00 0.27 ? 76  LEU A HA   8  
ATOM   10686 H HB2  . LEU A 1 76 ? 1.981   1.354   -6.224  1.00 0.34 ? 76  LEU A HB2  8  
ATOM   10687 H HB3  . LEU A 1 76 ? 3.496   0.742   -6.854  1.00 0.36 ? 76  LEU A HB3  8  
ATOM   10688 H HG   . LEU A 1 76 ? 1.091   1.157   -8.613  1.00 0.51 ? 76  LEU A HG   8  
ATOM   10689 H HD11 . LEU A 1 76 ? 1.728   3.277   -7.471  1.00 0.93 ? 76  LEU A HD11 8  
ATOM   10690 H HD12 . LEU A 1 76 ? 1.937   3.312   -9.222  1.00 0.87 ? 76  LEU A HD12 8  
ATOM   10691 H HD13 . LEU A 1 76 ? 3.340   3.113   -8.172  1.00 0.94 ? 76  LEU A HD13 8  
ATOM   10692 H HD21 . LEU A 1 76 ? 4.046   0.904   -9.160  1.00 0.97 ? 76  LEU A HD21 8  
ATOM   10693 H HD22 . LEU A 1 76 ? 2.812   1.242   -10.372 1.00 0.98 ? 76  LEU A HD22 8  
ATOM   10694 H HD23 . LEU A 1 76 ? 2.805   -0.298  -9.513  1.00 1.01 ? 76  LEU A HD23 8  
ATOM   10695 N N    . VAL A 1 77 ? 2.168   -0.936  -4.404  1.00 0.22 ? 77  VAL A N    8  
ATOM   10696 C CA   . VAL A 1 77 ? 2.728   -1.463  -3.163  1.00 0.25 ? 77  VAL A CA   8  
ATOM   10697 C C    . VAL A 1 77 ? 2.452   -2.961  -3.032  1.00 0.23 ? 77  VAL A C    8  
ATOM   10698 O O    . VAL A 1 77 ? 3.348   -3.744  -2.706  1.00 0.24 ? 77  VAL A O    8  
ATOM   10699 C CB   . VAL A 1 77 ? 2.150   -0.721  -1.935  1.00 0.29 ? 77  VAL A CB   8  
ATOM   10700 C CG1  . VAL A 1 77 ? 2.557   -1.403  -0.639  1.00 0.34 ? 77  VAL A CG1  8  
ATOM   10701 C CG2  . VAL A 1 77 ? 2.599   0.732   -1.930  1.00 0.35 ? 77  VAL A CG2  8  
ATOM   10702 H H    . VAL A 1 77 ? 1.453   -0.263  -4.356  1.00 0.22 ? 77  VAL A H    8  
ATOM   10703 H HA   . VAL A 1 77 ? 3.795   -1.305  -3.185  1.00 0.29 ? 77  VAL A HA   8  
ATOM   10704 H HB   . VAL A 1 77 ? 1.070   -0.741  -2.002  1.00 0.30 ? 77  VAL A HB   8  
ATOM   10705 H HG11 . VAL A 1 77 ? 2.140   -2.398  -0.608  1.00 0.46 ? 77  VAL A HG11 8  
ATOM   10706 H HG12 . VAL A 1 77 ? 2.189   -0.833  0.200   1.00 0.50 ? 77  VAL A HG12 8  
ATOM   10707 H HG13 . VAL A 1 77 ? 3.634   -1.462  -0.587  1.00 0.49 ? 77  VAL A HG13 8  
ATOM   10708 H HG21 . VAL A 1 77 ? 3.677   0.774   -1.925  1.00 0.59 ? 77  VAL A HG21 8  
ATOM   10709 H HG22 . VAL A 1 77 ? 2.214   1.224   -1.048  1.00 0.59 ? 77  VAL A HG22 8  
ATOM   10710 H HG23 . VAL A 1 77 ? 2.224   1.229   -2.812  1.00 0.55 ? 77  VAL A HG23 8  
ATOM   10711 N N    . LEU A 1 78 ? 1.215   -3.354  -3.310  1.00 0.21 ? 78  LEU A N    8  
ATOM   10712 C CA   . LEU A 1 78 ? 0.814   -4.752  -3.219  1.00 0.21 ? 78  LEU A CA   8  
ATOM   10713 C C    . LEU A 1 78 ? 1.583   -5.609  -4.216  1.00 0.20 ? 78  LEU A C    8  
ATOM   10714 O O    . LEU A 1 78 ? 1.978   -6.731  -3.905  1.00 0.22 ? 78  LEU A O    8  
ATOM   10715 C CB   . LEU A 1 78 ? -0.688  -4.892  -3.458  1.00 0.22 ? 78  LEU A CB   8  
ATOM   10716 C CG   . LEU A 1 78 ? -1.280  -6.247  -3.074  1.00 0.25 ? 78  LEU A CG   8  
ATOM   10717 C CD1  . LEU A 1 78 ? -1.117  -6.493  -1.585  1.00 0.35 ? 78  LEU A CD1  8  
ATOM   10718 C CD2  . LEU A 1 78 ? -2.748  -6.315  -3.466  1.00 0.34 ? 78  LEU A CD2  8  
ATOM   10719 H H    . LEU A 1 78 ? 0.546   -2.680  -3.576  1.00 0.20 ? 78  LEU A H    8  
ATOM   10720 H HA   . LEU A 1 78 ? 1.043   -5.094  -2.223  1.00 0.24 ? 78  LEU A HA   8  
ATOM   10721 H HB2  . LEU A 1 78 ? -1.193  -4.125  -2.886  1.00 0.26 ? 78  LEU A HB2  8  
ATOM   10722 H HB3  . LEU A 1 78 ? -0.882  -4.722  -4.506  1.00 0.23 ? 78  LEU A HB3  8  
ATOM   10723 H HG   . LEU A 1 78 ? -0.754  -7.027  -3.604  1.00 0.28 ? 78  LEU A HG   8  
ATOM   10724 H HD11 . LEU A 1 78 ? -1.536  -5.663  -1.035  1.00 0.67 ? 78  LEU A HD11 8  
ATOM   10725 H HD12 . LEU A 1 78 ? -0.069  -6.590  -1.347  1.00 0.70 ? 78  LEU A HD12 8  
ATOM   10726 H HD13 . LEU A 1 78 ? -1.634  -7.400  -1.312  1.00 0.68 ? 78  LEU A HD13 8  
ATOM   10727 H HD21 . LEU A 1 78 ? -2.854  -6.061  -4.510  1.00 0.67 ? 78  LEU A HD21 8  
ATOM   10728 H HD22 . LEU A 1 78 ? -3.314  -5.615  -2.867  1.00 0.68 ? 78  LEU A HD22 8  
ATOM   10729 H HD23 . LEU A 1 78 ? -3.121  -7.315  -3.298  1.00 0.71 ? 78  LEU A HD23 8  
ATOM   10730 N N    . GLY A 1 79 ? 1.797   -5.067  -5.410  1.00 0.20 ? 79  GLY A N    8  
ATOM   10731 C CA   . GLY A 1 79 ? 2.522   -5.789  -6.438  1.00 0.22 ? 79  GLY A CA   8  
ATOM   10732 C C    . GLY A 1 79 ? 3.923   -6.156  -5.995  1.00 0.21 ? 79  GLY A C    8  
ATOM   10733 O O    . GLY A 1 79 ? 4.383   -7.278  -6.213  1.00 0.27 ? 79  GLY A O    8  
ATOM   10734 H H    . GLY A 1 79 ? 1.460   -4.165  -5.595  1.00 0.20 ? 79  GLY A H    8  
ATOM   10735 H HA2  . GLY A 1 79 ? 1.983   -6.693  -6.678  1.00 0.24 ? 79  GLY A HA2  8  
ATOM   10736 H HA3  . GLY A 1 79 ? 2.583   -5.172  -7.321  1.00 0.24 ? 79  GLY A HA3  8  
ATOM   10737 N N    . ALA A 1 80 ? 4.594   -5.210  -5.354  1.00 0.19 ? 80  ALA A N    8  
ATOM   10738 C CA   . ALA A 1 80 ? 5.948   -5.427  -4.868  1.00 0.22 ? 80  ALA A CA   8  
ATOM   10739 C C    . ALA A 1 80 ? 5.966   -6.468  -3.755  1.00 0.21 ? 80  ALA A C    8  
ATOM   10740 O O    . ALA A 1 80 ? 6.848   -7.326  -3.709  1.00 0.25 ? 80  ALA A O    8  
ATOM   10741 C CB   . ALA A 1 80 ? 6.546   -4.122  -4.378  1.00 0.25 ? 80  ALA A CB   8  
ATOM   10742 H H    . ALA A 1 80 ? 4.167   -4.337  -5.208  1.00 0.21 ? 80  ALA A H    8  
ATOM   10743 H HA   . ALA A 1 80 ? 6.546   -5.783  -5.695  1.00 0.25 ? 80  ALA A HA   8  
ATOM   10744 H HB1  . ALA A 1 80 ? 5.951   -3.736  -3.565  1.00 0.41 ? 80  ALA A HB1  8  
ATOM   10745 H HB2  . ALA A 1 80 ? 6.560   -3.403  -5.187  1.00 0.39 ? 80  ALA A HB2  8  
ATOM   10746 H HB3  . ALA A 1 80 ? 7.555   -4.296  -4.033  1.00 0.43 ? 80  ALA A HB3  8  
ATOM   10747 N N    . LEU A 1 81 ? 4.983   -6.388  -2.862  1.00 0.21 ? 81  LEU A N    8  
ATOM   10748 C CA   . LEU A 1 81 ? 4.882   -7.322  -1.745  1.00 0.25 ? 81  LEU A CA   8  
ATOM   10749 C C    . LEU A 1 81 ? 4.572   -8.728  -2.241  1.00 0.22 ? 81  LEU A C    8  
ATOM   10750 O O    . LEU A 1 81 ? 5.061   -9.711  -1.682  1.00 0.23 ? 81  LEU A O    8  
ATOM   10751 C CB   . LEU A 1 81 ? 3.813   -6.864  -0.751  1.00 0.33 ? 81  LEU A CB   8  
ATOM   10752 C CG   . LEU A 1 81 ? 4.335   -6.019  0.414   1.00 0.50 ? 81  LEU A CG   8  
ATOM   10753 C CD1  . LEU A 1 81 ? 3.178   -5.395  1.176   1.00 0.60 ? 81  LEU A CD1  8  
ATOM   10754 C CD2  . LEU A 1 81 ? 5.189   -6.867  1.347   1.00 0.72 ? 81  LEU A CD2  8  
ATOM   10755 H H    . LEU A 1 81 ? 4.307   -5.680  -2.957  1.00 0.21 ? 81  LEU A H    8  
ATOM   10756 H HA   . LEU A 1 81 ? 5.839   -7.337  -1.247  1.00 0.30 ? 81  LEU A HA   8  
ATOM   10757 H HB2  . LEU A 1 81 ? 3.074   -6.285  -1.287  1.00 0.41 ? 81  LEU A HB2  8  
ATOM   10758 H HB3  . LEU A 1 81 ? 3.334   -7.742  -0.344  1.00 0.38 ? 81  LEU A HB3  8  
ATOM   10759 H HG   . LEU A 1 81 ? 4.952   -5.220  0.023   1.00 0.60 ? 81  LEU A HG   8  
ATOM   10760 H HD11 . LEU A 1 81 ? 2.513   -6.173  1.522   1.00 0.98 ? 81  LEU A HD11 8  
ATOM   10761 H HD12 . LEU A 1 81 ? 2.636   -4.722  0.525   1.00 0.95 ? 81  LEU A HD12 8  
ATOM   10762 H HD13 . LEU A 1 81 ? 3.560   -4.845  2.023   1.00 1.12 ? 81  LEU A HD13 8  
ATOM   10763 H HD21 . LEU A 1 81 ? 4.618   -7.724  1.680   1.00 1.02 ? 81  LEU A HD21 8  
ATOM   10764 H HD22 . LEU A 1 81 ? 5.483   -6.278  2.204   1.00 1.04 ? 81  LEU A HD22 8  
ATOM   10765 H HD23 . LEU A 1 81 ? 6.071   -7.204  0.825   1.00 1.02 ? 81  LEU A HD23 8  
ATOM   10766 N N    . LYS A 1 82 ? 3.762   -8.820  -3.291  1.00 0.22 ? 82  LYS A N    8  
ATOM   10767 C CA   . LYS A 1 82 ? 3.402   -10.110 -3.869  1.00 0.24 ? 82  LYS A CA   8  
ATOM   10768 C C    . LYS A 1 82 ? 4.651   -10.823 -4.371  1.00 0.24 ? 82  LYS A C    8  
ATOM   10769 O O    . LYS A 1 82 ? 4.884   -11.986 -4.056  1.00 0.29 ? 82  LYS A O    8  
ATOM   10770 C CB   . LYS A 1 82 ? 2.406   -9.930  -5.016  1.00 0.31 ? 82  LYS A CB   8  
ATOM   10771 C CG   . LYS A 1 82 ? 0.976   -9.694  -4.557  1.00 0.52 ? 82  LYS A CG   8  
ATOM   10772 C CD   . LYS A 1 82 ? 0.043   -9.495  -5.740  1.00 0.61 ? 82  LYS A CD   8  
ATOM   10773 C CE   . LYS A 1 82 ? -1.417  -9.603  -5.333  1.00 0.90 ? 82  LYS A CE   8  
ATOM   10774 N NZ   . LYS A 1 82 ? -2.315  -9.715  -6.515  1.00 1.19 ? 82  LYS A NZ   8  
ATOM   10775 H H    . LYS A 1 82 ? 3.393   -7.997  -3.687  1.00 0.23 ? 82  LYS A H    8  
ATOM   10776 H HA   . LYS A 1 82 ? 2.945   -10.707 -3.094  1.00 0.26 ? 82  LYS A HA   8  
ATOM   10777 H HB2  . LYS A 1 82 ? 2.715   -9.085  -5.614  1.00 0.53 ? 82  LYS A HB2  8  
ATOM   10778 H HB3  . LYS A 1 82 ? 2.422   -10.818 -5.631  1.00 0.51 ? 82  LYS A HB3  8  
ATOM   10779 H HG2  . LYS A 1 82 ? 0.646   -10.549 -3.987  1.00 0.82 ? 82  LYS A HG2  8  
ATOM   10780 H HG3  . LYS A 1 82 ? 0.946   -8.810  -3.935  1.00 0.81 ? 82  LYS A HG3  8  
ATOM   10781 H HD2  . LYS A 1 82 ? 0.217   -8.515  -6.157  1.00 0.84 ? 82  LYS A HD2  8  
ATOM   10782 H HD3  . LYS A 1 82 ? 0.258   -10.248 -6.485  1.00 0.84 ? 82  LYS A HD3  8  
ATOM   10783 H HE2  . LYS A 1 82 ? -1.543  -10.479 -4.712  1.00 1.22 ? 82  LYS A HE2  8  
ATOM   10784 H HE3  . LYS A 1 82 ? -1.686  -8.720  -4.771  1.00 1.21 ? 82  LYS A HE3  8  
ATOM   10785 H HZ1  . LYS A 1 82 ? -1.979  -10.465 -7.154  1.00 1.48 ? 82  LYS A HZ1  8  
ATOM   10786 H HZ2  . LYS A 1 82 ? -2.339  -8.815  -7.035  1.00 1.54 ? 82  LYS A HZ2  8  
ATOM   10787 H HZ3  . LYS A 1 82 ? -3.282  -9.949  -6.209  1.00 1.55 ? 82  LYS A HZ3  8  
ATOM   10788 N N    . ALA A 1 83 ? 5.465   -10.102 -5.132  1.00 0.24 ? 83  ALA A N    8  
ATOM   10789 C CA   . ALA A 1 83 ? 6.697   -10.660 -5.674  1.00 0.28 ? 83  ALA A CA   8  
ATOM   10790 C C    . ALA A 1 83 ? 7.683   -10.985 -4.555  1.00 0.28 ? 83  ALA A C    8  
ATOM   10791 O O    . ALA A 1 83 ? 8.492   -11.907 -4.669  1.00 0.34 ? 83  ALA A O    8  
ATOM   10792 C CB   . ALA A 1 83 ? 7.322   -9.689  -6.664  1.00 0.35 ? 83  ALA A CB   8  
ATOM   10793 H H    . ALA A 1 83 ? 5.228   -9.171  -5.338  1.00 0.25 ? 83  ALA A H    8  
ATOM   10794 H HA   . ALA A 1 83 ? 6.449   -11.570 -6.201  1.00 0.32 ? 83  ALA A HA   8  
ATOM   10795 H HB1  . ALA A 1 83 ? 7.502   -8.741  -6.177  1.00 0.48 ? 83  ALA A HB1  8  
ATOM   10796 H HB2  . ALA A 1 83 ? 6.653   -9.544  -7.499  1.00 0.53 ? 83  ALA A HB2  8  
ATOM   10797 H HB3  . ALA A 1 83 ? 8.259   -10.092 -7.018  1.00 0.54 ? 83  ALA A HB3  8  
ATOM   10798 N N    . ALA A 1 84 ? 7.600   -10.226 -3.469  1.00 0.26 ? 84  ALA A N    8  
ATOM   10799 C CA   . ALA A 1 84 ? 8.480   -10.422 -2.323  1.00 0.31 ? 84  ALA A CA   8  
ATOM   10800 C C    . ALA A 1 84 ? 8.150   -11.714 -1.580  1.00 0.32 ? 84  ALA A C    8  
ATOM   10801 O O    . ALA A 1 84 ? 9.021   -12.313 -0.948  1.00 0.45 ? 84  ALA A O    8  
ATOM   10802 C CB   . ALA A 1 84 ? 8.389   -9.231  -1.378  1.00 0.35 ? 84  ALA A CB   8  
ATOM   10803 H H    . ALA A 1 84 ? 6.930   -9.511  -3.439  1.00 0.26 ? 84  ALA A H    8  
ATOM   10804 H HA   . ALA A 1 84 ? 9.495   -10.480 -2.690  1.00 0.36 ? 84  ALA A HA   8  
ATOM   10805 H HB1  . ALA A 1 84 ? 9.106   -9.351  -0.579  1.00 0.55 ? 84  ALA A HB1  8  
ATOM   10806 H HB2  . ALA A 1 84 ? 7.393   -9.176  -0.963  1.00 0.50 ? 84  ALA A HB2  8  
ATOM   10807 H HB3  . ALA A 1 84 ? 8.603   -8.323  -1.921  1.00 0.52 ? 84  ALA A HB3  8  
ATOM   10808 N N    . ARG A 1 85 ? 6.893   -12.145 -1.657  1.00 0.29 ? 85  ARG A N    8  
ATOM   10809 C CA   . ARG A 1 85 ? 6.468   -13.366 -0.981  1.00 0.35 ? 85  ARG A CA   8  
ATOM   10810 C C    . ARG A 1 85 ? 6.547   -14.571 -1.911  1.00 0.35 ? 85  ARG A C    8  
ATOM   10811 O O    . ARG A 1 85 ? 6.317   -15.706 -1.494  1.00 0.48 ? 85  ARG A O    8  
ATOM   10812 C CB   . ARG A 1 85 ? 5.045   -13.221 -0.442  1.00 0.42 ? 85  ARG A CB   8  
ATOM   10813 C CG   . ARG A 1 85 ? 4.980   -12.615 0.951   1.00 0.54 ? 85  ARG A CG   8  
ATOM   10814 C CD   . ARG A 1 85 ? 3.708   -13.024 1.670   1.00 0.74 ? 85  ARG A CD   8  
ATOM   10815 N NE   . ARG A 1 85 ? 3.667   -12.527 3.046   1.00 0.66 ? 85  ARG A NE   8  
ATOM   10816 C CZ   . ARG A 1 85 ? 3.650   -13.309 4.129   1.00 0.66 ? 85  ARG A CZ   8  
ATOM   10817 N NH1  . ARG A 1 85 ? 3.659   -14.632 4.004   1.00 0.83 ? 85  ARG A NH1  8  
ATOM   10818 N NH2  . ARG A 1 85 ? 3.580   -12.763 5.339   1.00 0.79 ? 85  ARG A NH2  8  
ATOM   10819 H H    . ARG A 1 85 ? 6.236   -11.625 -2.173  1.00 0.31 ? 85  ARG A H    8  
ATOM   10820 H HA   . ARG A 1 85 ? 7.139   -13.532 -0.152  1.00 0.41 ? 85  ARG A HA   8  
ATOM   10821 H HB2  . ARG A 1 85 ? 4.484   -12.588 -1.114  1.00 0.47 ? 85  ARG A HB2  8  
ATOM   10822 H HB3  . ARG A 1 85 ? 4.583   -14.196 -0.410  1.00 0.49 ? 85  ARG A HB3  8  
ATOM   10823 H HG2  . ARG A 1 85 ? 5.831   -12.954 1.523   1.00 0.96 ? 85  ARG A HG2  8  
ATOM   10824 H HG3  . ARG A 1 85 ? 5.006   -11.538 0.869   1.00 1.03 ? 85  ARG A HG3  8  
ATOM   10825 H HD2  . ARG A 1 85 ? 2.865   -12.621 1.130   1.00 1.28 ? 85  ARG A HD2  8  
ATOM   10826 H HD3  . ARG A 1 85 ? 3.644   -14.101 1.683   1.00 1.22 ? 85  ARG A HD3  8  
ATOM   10827 H HE   . ARG A 1 85 ? 3.664   -11.548 3.171   1.00 0.81 ? 85  ARG A HE   8  
ATOM   10828 H HH11 . ARG A 1 85 ? 3.643   -15.217 4.818   1.00 1.01 ? 85  ARG A HH11 8  
ATOM   10829 H HH12 . ARG A 1 85 ? 3.688   -15.056 3.093   1.00 0.90 ? 85  ARG A HH12 8  
ATOM   10830 H HH21 . ARG A 1 85 ? 3.550   -11.764 5.441   1.00 0.90 ? 85  ARG A HH21 8  
ATOM   10831 H HH22 . ARG A 1 85 ? 3.561   -13.345 6.157   1.00 0.92 ? 85  ARG A HH22 8  
ATOM   10832 N N    . GLU A 1 86 ? 6.877   -14.327 -3.167  1.00 0.35 ? 86  GLU A N    8  
ATOM   10833 C CA   . GLU A 1 86 ? 6.981   -15.399 -4.145  1.00 0.40 ? 86  GLU A CA   8  
ATOM   10834 C C    . GLU A 1 86 ? 8.440   -15.741 -4.421  1.00 0.43 ? 86  GLU A C    8  
ATOM   10835 O O    . GLU A 1 86 ? 8.803   -16.130 -5.530  1.00 0.65 ? 86  GLU A O    8  
ATOM   10836 C CB   . GLU A 1 86 ? 6.269   -15.013 -5.441  1.00 0.50 ? 86  GLU A CB   8  
ATOM   10837 C CG   . GLU A 1 86 ? 4.756   -15.095 -5.348  1.00 0.68 ? 86  GLU A CG   8  
ATOM   10838 C CD   . GLU A 1 86 ? 4.111   -15.366 -6.688  1.00 0.87 ? 86  GLU A CD   8  
ATOM   10839 O OE1  . GLU A 1 86 ? 3.911   -16.551 -7.031  1.00 1.32 ? 86  GLU A OE1  8  
ATOM   10840 O OE2  . GLU A 1 86 ? 3.800   -14.396 -7.409  1.00 1.25 ? 86  GLU A OE2  8  
ATOM   10841 H H    . GLU A 1 86 ? 7.060   -13.404 -3.444  1.00 0.42 ? 86  GLU A H    8  
ATOM   10842 H HA   . GLU A 1 86 ? 6.495   -16.270 -3.729  1.00 0.47 ? 86  GLU A HA   8  
ATOM   10843 H HB2  . GLU A 1 86 ? 6.539   -14.000 -5.700  1.00 0.63 ? 86  GLU A HB2  8  
ATOM   10844 H HB3  . GLU A 1 86 ? 6.596   -15.676 -6.227  1.00 0.63 ? 86  GLU A HB3  8  
ATOM   10845 H HG2  . GLU A 1 86 ? 4.490   -15.893 -4.671  1.00 0.90 ? 86  GLU A HG2  8  
ATOM   10846 H HG3  . GLU A 1 86 ? 4.377   -14.159 -4.966  1.00 0.93 ? 86  GLU A HG3  8  
ATOM   10847 N N    . GLU A 1 87 ? 9.268   -15.606 -3.397  1.00 0.47 ? 87  GLU A N    8  
ATOM   10848 C CA   . GLU A 1 87 ? 10.683  -15.899 -3.516  1.00 0.58 ? 87  GLU A CA   8  
ATOM   10849 C C    . GLU A 1 87 ? 11.182  -16.527 -2.223  1.00 0.68 ? 87  GLU A C    8  
ATOM   10850 O O    . GLU A 1 87 ? 12.086  -17.387 -2.278  1.00 1.13 ? 87  GLU A O    8  
ATOM   10851 C CB   . GLU A 1 87 ? 11.468  -14.622 -3.831  1.00 0.77 ? 87  GLU A CB   8  
ATOM   10852 C CG   . GLU A 1 87 ? 12.677  -14.855 -4.723  1.00 1.10 ? 87  GLU A CG   8  
ATOM   10853 C CD   . GLU A 1 87 ? 13.631  -13.680 -4.731  1.00 1.15 ? 87  GLU A CD   8  
ATOM   10854 O OE1  . GLU A 1 87 ? 14.717  -13.791 -4.122  1.00 1.51 ? 87  GLU A OE1  8  
ATOM   10855 O OE2  . GLU A 1 87 ? 13.305  -12.637 -5.347  1.00 1.44 ? 87  GLU A OE2  8  
ATOM   10856 O OXT  . GLU A 1 87 ? 10.655  -16.164 -1.149  1.00 1.02 ? 87  GLU A OXT  8  
ATOM   10857 H H    . GLU A 1 87 ? 8.917   -15.304 -2.535  1.00 0.60 ? 87  GLU A H    8  
ATOM   10858 H HA   . GLU A 1 87 ? 10.813  -16.606 -4.323  1.00 0.71 ? 87  GLU A HA   8  
ATOM   10859 H HB2  . GLU A 1 87 ? 10.812  -13.923 -4.329  1.00 1.08 ? 87  GLU A HB2  8  
ATOM   10860 H HB3  . GLU A 1 87 ? 11.809  -14.185 -2.904  1.00 1.00 ? 87  GLU A HB3  8  
ATOM   10861 H HG2  . GLU A 1 87 ? 13.208  -15.726 -4.367  1.00 1.52 ? 87  GLU A HG2  8  
ATOM   10862 H HG3  . GLU A 1 87 ? 12.334  -15.030 -5.731  1.00 1.59 ? 87  GLU A HG3  8  
HETATM 10863 C C1   . IHP B 2 .  ? 13.761  9.303   1.472   1.00 0.87 ? 101 IHP A C1   8  
HETATM 10864 C C2   . IHP B 2 .  ? 12.551  10.010  2.087   1.00 0.83 ? 101 IHP A C2   8  
HETATM 10865 C C3   . IHP B 2 .  ? 12.028  11.066  1.113   1.00 0.67 ? 101 IHP A C3   8  
HETATM 10866 C C4   . IHP B 2 .  ? 11.612  10.392  -0.198  1.00 0.52 ? 101 IHP A C4   8  
HETATM 10867 C C5   . IHP B 2 .  ? 12.824  9.688   -0.813  1.00 0.61 ? 101 IHP A C5   8  
HETATM 10868 C C6   . IHP B 2 .  ? 13.348  8.630   0.163   1.00 0.77 ? 101 IHP A C6   8  
HETATM 10869 O O11  . IHP B 2 .  ? 14.251  8.317   2.382   1.00 1.21 ? 101 IHP A O11  8  
HETATM 10870 P P1   . IHP B 2 .  ? 15.744  8.343   2.982   1.00 1.54 ? 101 IHP A P1   8  
HETATM 10871 O O21  . IHP B 2 .  ? 15.993  9.647   3.632   1.00 1.58 ? 101 IHP A O21  8  
HETATM 10872 O O31  . IHP B 2 .  ? 15.905  7.163   4.065   1.00 1.93 ? 101 IHP A O31  8  
HETATM 10873 O O41  . IHP B 2 .  ? 16.805  8.126   1.790   1.00 1.56 ? 101 IHP A O41  8  
HETATM 10874 O O12  . IHP B 2 .  ? 11.523  9.051   2.349   1.00 0.85 ? 101 IHP A O12  8  
HETATM 10875 P P2   . IHP B 2 .  ? 10.937  8.775   3.822   1.00 1.21 ? 101 IHP A P2   8  
HETATM 10876 O O22  . IHP B 2 .  ? 10.460  10.045  4.410   1.00 1.39 ? 101 IHP A O22  8  
HETATM 10877 O O32  . IHP B 2 .  ? 9.710   7.735   3.725   1.00 1.20 ? 101 IHP A O32  8  
HETATM 10878 O O42  . IHP B 2 .  ? 12.093  8.153   4.752   1.00 1.55 ? 101 IHP A O42  8  
HETATM 10879 O O13  . IHP B 2 .  ? 10.896  11.726  1.686   1.00 0.90 ? 101 IHP A O13  8  
HETATM 10880 P P3   . IHP B 2 .  ? 10.854  13.309  1.968   1.00 1.24 ? 101 IHP A P3   8  
HETATM 10881 O O23  . IHP B 2 .  ? 12.013  13.691  2.808   1.00 1.39 ? 101 IHP A O23  8  
HETATM 10882 O O33  . IHP B 2 .  ? 10.918  14.106  0.573   1.00 1.27 ? 101 IHP A O33  8  
HETATM 10883 O O43  . IHP B 2 .  ? 9.488   13.682  2.737   1.00 1.57 ? 101 IHP A O43  8  
HETATM 10884 O O14  . IHP B 2 .  ? 11.123  11.381  -1.107  1.00 0.74 ? 101 IHP A O14  8  
HETATM 10885 P P4   . IHP B 2 .  ? 9.630   11.355  -1.708  1.00 1.00 ? 101 IHP A P4   8  
HETATM 10886 O O24  . IHP B 2 .  ? 9.383   12.680  -2.588  1.00 1.39 ? 101 IHP A O24  8  
HETATM 10887 O O34  . IHP B 2 .  ? 9.444   10.052  -2.637  1.00 1.09 ? 101 IHP A O34  8  
HETATM 10888 O O44  . IHP B 2 .  ? 8.652   11.310  -0.598  1.00 1.01 ? 101 IHP A O44  8  
HETATM 10889 O O15  . IHP B 2 .  ? 12.437  9.057   -2.035  1.00 0.86 ? 101 IHP A O15  8  
HETATM 10890 P P5   . IHP B 2 .  ? 13.101  9.422   -3.457  1.00 1.20 ? 101 IHP A P5   8  
HETATM 10891 O O25  . IHP B 2 .  ? 14.569  9.265   -3.370  1.00 1.28 ? 101 IHP A O25  8  
HETATM 10892 O O35  . IHP B 2 .  ? 12.521  8.432   -4.589  1.00 1.56 ? 101 IHP A O35  8  
HETATM 10893 O O45  . IHP B 2 .  ? 12.745  10.944  -3.842  1.00 1.25 ? 101 IHP A O45  8  
HETATM 10894 O O16  . IHP B 2 .  ? 14.478  7.972   -0.413  1.00 1.06 ? 101 IHP A O16  8  
HETATM 10895 P P6   . IHP B 2 .  ? 14.518  6.388   -0.695  1.00 1.40 ? 101 IHP A P6   8  
HETATM 10896 O O26  . IHP B 2 .  ? 13.361  6.004   -1.535  1.00 1.39 ? 101 IHP A O26  8  
HETATM 10897 O O36  . IHP B 2 .  ? 15.885  6.015   -1.463  1.00 1.74 ? 101 IHP A O36  8  
HETATM 10898 O O46  . IHP B 2 .  ? 14.456  5.592   0.703   1.00 1.56 ? 101 IHP A O46  8  
HETATM 10899 H H1   . IHP B 2 .  ? 14.547  10.037  1.269   1.00 0.89 ? 101 IHP A H1   8  
HETATM 10900 H H2   . IHP B 2 .  ? 12.850  10.496  3.023   1.00 1.08 ? 101 IHP A H2   8  
HETATM 10901 H H3   . IHP B 2 .  ? 12.820  11.795  0.909   1.00 0.73 ? 101 IHP A H3   8  
HETATM 10902 H H4   . IHP B 2 .  ? 10.822  9.666   0.002   1.00 0.51 ? 101 IHP A H4   8  
HETATM 10903 H H5   . IHP B 2 .  ? 13.598  10.435  -1.015  1.00 0.66 ? 101 IHP A H5   8  
HETATM 10904 H H6   . IHP B 2 .  ? 12.565  7.890   0.349   1.00 0.80 ? 101 IHP A H6   8  
ATOM   10905 N N    . SER A 1 1  ? 3.035   4.667   10.236  1.00 1.45 ? 1   SER A N    9  
ATOM   10906 C CA   . SER A 1 1  ? 3.803   5.424   11.242  1.00 0.98 ? 1   SER A CA   9  
ATOM   10907 C C    . SER A 1 1  ? 4.902   6.252   10.578  1.00 0.92 ? 1   SER A C    9  
ATOM   10908 O O    . SER A 1 1  ? 4.643   7.355   10.088  1.00 1.21 ? 1   SER A O    9  
ATOM   10909 C CB   . SER A 1 1  ? 4.397   4.453   12.258  1.00 1.66 ? 1   SER A CB   9  
ATOM   10910 O OG   . SER A 1 1  ? 4.767   3.235   11.633  1.00 2.07 ? 1   SER A OG   9  
ATOM   10911 H H1   . SER A 1 1  ? 2.185   4.261   10.670  1.00 1.90 ? 1   SER A H1   9  
ATOM   10912 H H2   . SER A 1 1  ? 3.616   3.896   9.854   1.00 1.69 ? 1   SER A H2   9  
ATOM   10913 H H3   . SER A 1 1  ? 2.749   5.293   9.456   1.00 1.94 ? 1   SER A H3   9  
ATOM   10914 H HA   . SER A 1 1  ? 3.126   6.095   11.751  1.00 1.33 ? 1   SER A HA   9  
ATOM   10915 H HB2  . SER A 1 1  ? 5.271   4.895   12.710  1.00 2.07 ? 1   SER A HB2  9  
ATOM   10916 H HB3  . SER A 1 1  ? 3.663   4.244   13.021  1.00 2.12 ? 1   SER A HB3  9  
ATOM   10917 H HG   . SER A 1 1  ? 4.948   2.572   12.315  1.00 2.51 ? 1   SER A HG   9  
ATOM   10918 N N    . GLU A 1 2  ? 6.122   5.717   10.540  1.00 0.80 ? 2   GLU A N    9  
ATOM   10919 C CA   . GLU A 1 2  ? 7.240   6.434   9.939   1.00 0.85 ? 2   GLU A CA   9  
ATOM   10920 C C    . GLU A 1 2  ? 8.283   5.481   9.348   1.00 0.72 ? 2   GLU A C    9  
ATOM   10921 O O    . GLU A 1 2  ? 8.471   5.434   8.133   1.00 0.72 ? 2   GLU A O    9  
ATOM   10922 C CB   . GLU A 1 2  ? 7.887   7.356   10.981  1.00 1.13 ? 2   GLU A CB   9  
ATOM   10923 C CG   . GLU A 1 2  ? 8.085   6.706   12.344  1.00 1.33 ? 2   GLU A CG   9  
ATOM   10924 C CD   . GLU A 1 2  ? 8.450   7.702   13.418  1.00 1.48 ? 2   GLU A CD   9  
ATOM   10925 O OE1  . GLU A 1 2  ? 9.646   7.807   13.754  1.00 1.99 ? 2   GLU A OE1  9  
ATOM   10926 O OE2  . GLU A 1 2  ? 7.539   8.378   13.937  1.00 1.97 ? 2   GLU A OE2  9  
ATOM   10927 H H    . GLU A 1 2  ? 6.273   4.830   10.931  1.00 0.89 ? 2   GLU A H    9  
ATOM   10928 H HA   . GLU A 1 2  ? 6.843   7.045   9.139   1.00 0.92 ? 2   GLU A HA   9  
ATOM   10929 H HB2  . GLU A 1 2  ? 8.851   7.670   10.613  1.00 1.41 ? 2   GLU A HB2  9  
ATOM   10930 H HB3  . GLU A 1 2  ? 7.259   8.224   11.109  1.00 1.30 ? 2   GLU A HB3  9  
ATOM   10931 H HG2  . GLU A 1 2  ? 7.168   6.216   12.631  1.00 1.76 ? 2   GLU A HG2  9  
ATOM   10932 H HG3  . GLU A 1 2  ? 8.876   5.976   12.271  1.00 1.92 ? 2   GLU A HG3  9  
ATOM   10933 N N    . ALA A 1 3  ? 8.927   4.693   10.207  1.00 0.74 ? 3   ALA A N    9  
ATOM   10934 C CA   . ALA A 1 3  ? 9.971   3.772   9.775   1.00 0.73 ? 3   ALA A CA   9  
ATOM   10935 C C    . ALA A 1 3  ? 9.408   2.650   8.916   1.00 0.59 ? 3   ALA A C    9  
ATOM   10936 O O    . ALA A 1 3  ? 10.043  2.218   7.954   1.00 0.57 ? 3   ALA A O    9  
ATOM   10937 C CB   . ALA A 1 3  ? 10.710  3.202   10.978  1.00 0.89 ? 3   ALA A CB   9  
ATOM   10938 H H    . ALA A 1 3  ? 8.687   4.728   11.158  1.00 0.83 ? 3   ALA A H    9  
ATOM   10939 H HA   . ALA A 1 3  ? 10.681  4.333   9.186   1.00 0.80 ? 3   ALA A HA   9  
ATOM   10940 H HB1  . ALA A 1 3  ? 11.125  4.008   11.563  1.00 1.15 ? 3   ALA A HB1  9  
ATOM   10941 H HB2  . ALA A 1 3  ? 11.507  2.555   10.638  1.00 1.06 ? 3   ALA A HB2  9  
ATOM   10942 H HB3  . ALA A 1 3  ? 10.023  2.632   11.586  1.00 0.95 ? 3   ALA A HB3  9  
ATOM   10943 N N    . VAL A 1 4  ? 8.207   2.192   9.254   1.00 0.56 ? 4   VAL A N    9  
ATOM   10944 C CA   . VAL A 1 4  ? 7.567   1.117   8.505   1.00 0.50 ? 4   VAL A CA   9  
ATOM   10945 C C    . VAL A 1 4  ? 7.298   1.544   7.061   1.00 0.45 ? 4   VAL A C    9  
ATOM   10946 O O    . VAL A 1 4  ? 7.212   0.708   6.162   1.00 0.48 ? 4   VAL A O    9  
ATOM   10947 C CB   . VAL A 1 4  ? 6.249   0.656   9.168   1.00 0.57 ? 4   VAL A CB   9  
ATOM   10948 C CG1  . VAL A 1 4  ? 5.786   -0.669  8.579   1.00 0.82 ? 4   VAL A CG1  9  
ATOM   10949 C CG2  . VAL A 1 4  ? 6.422   0.537   10.676  1.00 0.79 ? 4   VAL A CG2  9  
ATOM   10950 H H    . VAL A 1 4  ? 7.747   2.580   10.030  1.00 0.63 ? 4   VAL A H    9  
ATOM   10951 H HA   . VAL A 1 4  ? 8.248   0.278   8.491   1.00 0.54 ? 4   VAL A HA   9  
ATOM   10952 H HB   . VAL A 1 4  ? 5.489   1.398   8.971   1.00 0.63 ? 4   VAL A HB   9  
ATOM   10953 H HG11 . VAL A 1 4  ? 5.678   -0.569  7.508   1.00 1.06 ? 4   VAL A HG11 9  
ATOM   10954 H HG12 . VAL A 1 4  ? 4.834   -0.943  9.010   1.00 0.99 ? 4   VAL A HG12 9  
ATOM   10955 H HG13 . VAL A 1 4  ? 6.515   -1.434  8.797   1.00 1.13 ? 4   VAL A HG13 9  
ATOM   10956 H HG21 . VAL A 1 4  ? 7.217   -0.161  10.893  1.00 1.11 ? 4   VAL A HG21 9  
ATOM   10957 H HG22 . VAL A 1 4  ? 5.502   0.180   11.117  1.00 1.16 ? 4   VAL A HG22 9  
ATOM   10958 H HG23 . VAL A 1 4  ? 6.668   1.504   11.088  1.00 1.27 ? 4   VAL A HG23 9  
ATOM   10959 N N    . ILE A 1 5  ? 7.183   2.849   6.838   1.00 0.48 ? 5   ILE A N    9  
ATOM   10960 C CA   . ILE A 1 5  ? 6.943   3.367   5.497   1.00 0.51 ? 5   ILE A CA   9  
ATOM   10961 C C    . ILE A 1 5  ? 8.205   3.223   4.655   1.00 0.46 ? 5   ILE A C    9  
ATOM   10962 O O    . ILE A 1 5  ? 8.145   2.815   3.497   1.00 0.47 ? 5   ILE A O    9  
ATOM   10963 C CB   . ILE A 1 5  ? 6.513   4.852   5.510   1.00 0.65 ? 5   ILE A CB   9  
ATOM   10964 C CG1  . ILE A 1 5  ? 5.404   5.085   6.539   1.00 0.81 ? 5   ILE A CG1  9  
ATOM   10965 C CG2  . ILE A 1 5  ? 6.048   5.279   4.122   1.00 0.81 ? 5   ILE A CG2  9  
ATOM   10966 C CD1  . ILE A 1 5  ? 5.038   6.543   6.712   1.00 0.98 ? 5   ILE A CD1  9  
ATOM   10967 H H    . ILE A 1 5  ? 7.272   3.474   7.584   1.00 0.54 ? 5   ILE A H    9  
ATOM   10968 H HA   . ILE A 1 5  ? 6.150   2.785   5.051   1.00 0.55 ? 5   ILE A HA   9  
ATOM   10969 H HB   . ILE A 1 5  ? 7.370   5.451   5.775   1.00 0.71 ? 5   ILE A HB   9  
ATOM   10970 H HG12 . ILE A 1 5  ? 4.515   4.558   6.228   1.00 0.91 ? 5   ILE A HG12 9  
ATOM   10971 H HG13 . ILE A 1 5  ? 5.726   4.707   7.497   1.00 0.85 ? 5   ILE A HG13 9  
ATOM   10972 H HG21 . ILE A 1 5  ? 5.177   4.704   3.840   1.00 1.02 ? 5   ILE A HG21 9  
ATOM   10973 H HG22 . ILE A 1 5  ? 6.842   5.104   3.410   1.00 1.00 ? 5   ILE A HG22 9  
ATOM   10974 H HG23 . ILE A 1 5  ? 5.798   6.332   4.131   1.00 1.04 ? 5   ILE A HG23 9  
ATOM   10975 H HD11 . ILE A 1 5  ? 4.621   6.918   5.789   1.00 1.27 ? 5   ILE A HD11 9  
ATOM   10976 H HD12 . ILE A 1 5  ? 5.924   7.110   6.964   1.00 1.29 ? 5   ILE A HD12 9  
ATOM   10977 H HD13 . ILE A 1 5  ? 4.310   6.641   7.503   1.00 1.30 ? 5   ILE A HD13 9  
ATOM   10978 N N    . LYS A 1 6  ? 9.349   3.527   5.262   1.00 0.49 ? 6   LYS A N    9  
ATOM   10979 C CA   . LYS A 1 6  ? 10.635  3.435   4.574   1.00 0.50 ? 6   LYS A CA   9  
ATOM   10980 C C    . LYS A 1 6  ? 10.941  1.987   4.202   1.00 0.46 ? 6   LYS A C    9  
ATOM   10981 O O    . LYS A 1 6  ? 11.525  1.712   3.154   1.00 0.47 ? 6   LYS A O    9  
ATOM   10982 C CB   . LYS A 1 6  ? 11.758  4.002   5.446   1.00 0.61 ? 6   LYS A CB   9  
ATOM   10983 C CG   . LYS A 1 6  ? 11.585  5.474   5.790   1.00 0.85 ? 6   LYS A CG   9  
ATOM   10984 C CD   . LYS A 1 6  ? 11.695  6.365   4.559   1.00 1.11 ? 6   LYS A CD   9  
ATOM   10985 C CE   . LYS A 1 6  ? 13.143  6.599   4.151   1.00 1.11 ? 6   LYS A CE   9  
ATOM   10986 N NZ   . LYS A 1 6  ? 13.264  7.689   3.147   1.00 1.12 ? 6   LYS A NZ   9  
ATOM   10987 H H    . LYS A 1 6  ? 9.331   3.821   6.196   1.00 0.53 ? 6   LYS A H    9  
ATOM   10988 H HA   . LYS A 1 6  ? 10.566  4.014   3.665   1.00 0.52 ? 6   LYS A HA   9  
ATOM   10989 H HB2  . LYS A 1 6  ? 11.799  3.443   6.369   1.00 0.84 ? 6   LYS A HB2  9  
ATOM   10990 H HB3  . LYS A 1 6  ? 12.696  3.884   4.921   1.00 0.80 ? 6   LYS A HB3  9  
ATOM   10991 H HG2  . LYS A 1 6  ? 10.613  5.617   6.238   1.00 1.25 ? 6   LYS A HG2  9  
ATOM   10992 H HG3  . LYS A 1 6  ? 12.351  5.759   6.497   1.00 1.02 ? 6   LYS A HG3  9  
ATOM   10993 H HD2  . LYS A 1 6  ? 11.176  5.894   3.739   1.00 1.57 ? 6   LYS A HD2  9  
ATOM   10994 H HD3  . LYS A 1 6  ? 11.235  7.314   4.778   1.00 1.65 ? 6   LYS A HD3  9  
ATOM   10995 H HE2  . LYS A 1 6  ? 13.713  6.864   5.029   1.00 1.38 ? 6   LYS A HE2  9  
ATOM   10996 H HE3  . LYS A 1 6  ? 13.536  5.686   3.728   1.00 1.51 ? 6   LYS A HE3  9  
ATOM   10997 H HZ1  . LYS A 1 6  ? 14.146  7.583   2.606   1.00 1.52 ? 6   LYS A HZ1  9  
ATOM   10998 H HZ2  . LYS A 1 6  ? 13.280  8.615   3.620   1.00 1.47 ? 6   LYS A HZ2  9  
ATOM   10999 H HZ3  . LYS A 1 6  ? 12.463  7.663   2.488   1.00 1.48 ? 6   LYS A HZ3  9  
ATOM   11000 N N    . VAL A 1 7  ? 10.537  1.066   5.069   1.00 0.46 ? 7   VAL A N    9  
ATOM   11001 C CA   . VAL A 1 7  ? 10.740  -0.359  4.826   1.00 0.48 ? 7   VAL A CA   9  
ATOM   11002 C C    . VAL A 1 7  ? 9.968   -0.787  3.576   1.00 0.44 ? 7   VAL A C    9  
ATOM   11003 O O    . VAL A 1 7  ? 10.359  -1.715  2.865   1.00 0.54 ? 7   VAL A O    9  
ATOM   11004 C CB   . VAL A 1 7  ? 10.286  -1.201  6.044   1.00 0.54 ? 7   VAL A CB   9  
ATOM   11005 C CG1  . VAL A 1 7  ? 10.447  -2.691  5.779   1.00 0.60 ? 7   VAL A CG1  9  
ATOM   11006 C CG2  . VAL A 1 7  ? 11.058  -0.796  7.295   1.00 0.61 ? 7   VAL A CG2  9  
ATOM   11007 H H    . VAL A 1 7  ? 10.102  1.353   5.901   1.00 0.48 ? 7   VAL A H    9  
ATOM   11008 H HA   . VAL A 1 7  ? 11.794  -0.528  4.662   1.00 0.53 ? 7   VAL A HA   9  
ATOM   11009 H HB   . VAL A 1 7  ? 9.239   -1.005  6.220   1.00 0.55 ? 7   VAL A HB   9  
ATOM   11010 H HG11 . VAL A 1 7  ? 11.469  -2.898  5.495   1.00 0.73 ? 7   VAL A HG11 9  
ATOM   11011 H HG12 . VAL A 1 7  ? 9.782   -2.987  4.980   1.00 0.72 ? 7   VAL A HG12 9  
ATOM   11012 H HG13 . VAL A 1 7  ? 10.203  -3.245  6.673   1.00 0.79 ? 7   VAL A HG13 9  
ATOM   11013 H HG21 . VAL A 1 7  ? 10.862  0.242   7.521   1.00 0.75 ? 7   VAL A HG21 9  
ATOM   11014 H HG22 . VAL A 1 7  ? 12.117  -0.934  7.126   1.00 0.79 ? 7   VAL A HG22 9  
ATOM   11015 H HG23 . VAL A 1 7  ? 10.745  -1.410  8.128   1.00 0.78 ? 7   VAL A HG23 9  
ATOM   11016 N N    . ILE A 1 8  ? 8.885   -0.078  3.299   1.00 0.38 ? 8   ILE A N    9  
ATOM   11017 C CA   . ILE A 1 8  ? 8.056   -0.362  2.143   1.00 0.40 ? 8   ILE A CA   9  
ATOM   11018 C C    . ILE A 1 8  ? 8.616   0.315   0.890   1.00 0.37 ? 8   ILE A C    9  
ATOM   11019 O O    . ILE A 1 8  ? 8.711   -0.308  -0.172  1.00 0.40 ? 8   ILE A O    9  
ATOM   11020 C CB   . ILE A 1 8  ? 6.597   0.097   2.379   1.00 0.47 ? 8   ILE A CB   9  
ATOM   11021 C CG1  . ILE A 1 8  ? 5.944   -0.734  3.491   1.00 0.52 ? 8   ILE A CG1  9  
ATOM   11022 C CG2  . ILE A 1 8  ? 5.778   0.009   1.097   1.00 0.56 ? 8   ILE A CG2  9  
ATOM   11023 C CD1  . ILE A 1 8  ? 5.952   -2.227  3.224   1.00 0.61 ? 8   ILE A CD1  9  
ATOM   11024 H H    . ILE A 1 8  ? 8.637   0.665   3.890   1.00 0.39 ? 8   ILE A H    9  
ATOM   11025 H HA   . ILE A 1 8  ? 8.055   -1.432  1.991   1.00 0.44 ? 8   ILE A HA   9  
ATOM   11026 H HB   . ILE A 1 8  ? 6.623   1.131   2.686   1.00 0.50 ? 8   ILE A HB   9  
ATOM   11027 H HG12 . ILE A 1 8  ? 6.467   -0.561  4.419   1.00 0.53 ? 8   ILE A HG12 9  
ATOM   11028 H HG13 . ILE A 1 8  ? 4.915   -0.422  3.602   1.00 0.59 ? 8   ILE A HG13 9  
ATOM   11029 H HG21 . ILE A 1 8  ? 5.763   -1.014  0.749   1.00 0.96 ? 8   ILE A HG21 9  
ATOM   11030 H HG22 . ILE A 1 8  ? 6.223   0.640   0.343   1.00 1.01 ? 8   ILE A HG22 9  
ATOM   11031 H HG23 . ILE A 1 8  ? 4.769   0.338   1.291   1.00 1.00 ? 8   ILE A HG23 9  
ATOM   11032 H HD11 . ILE A 1 8  ? 6.960   -2.603  3.309   1.00 0.96 ? 8   ILE A HD11 9  
ATOM   11033 H HD12 . ILE A 1 8  ? 5.580   -2.414  2.227   1.00 0.94 ? 8   ILE A HD12 9  
ATOM   11034 H HD13 . ILE A 1 8  ? 5.319   -2.726  3.943   1.00 0.97 ? 8   ILE A HD13 9  
ATOM   11035 N N    . SER A 1 9  ? 9.012   1.579   1.020   1.00 0.37 ? 9   SER A N    9  
ATOM   11036 C CA   . SER A 1 9  ? 9.551   2.331   -0.107  1.00 0.41 ? 9   SER A CA   9  
ATOM   11037 C C    . SER A 1 9  ? 10.854  1.715   -0.612  1.00 0.40 ? 9   SER A C    9  
ATOM   11038 O O    . SER A 1 9  ? 11.032  1.540   -1.821  1.00 0.46 ? 9   SER A O    9  
ATOM   11039 C CB   . SER A 1 9  ? 9.755   3.801   0.274   1.00 0.49 ? 9   SER A CB   9  
ATOM   11040 O OG   . SER A 1 9  ? 10.342  3.921   1.556   1.00 1.22 ? 9   SER A OG   9  
ATOM   11041 H H    . SER A 1 9  ? 8.938   2.021   1.896   1.00 0.39 ? 9   SER A H    9  
ATOM   11042 H HA   . SER A 1 9  ? 8.823   2.281   -0.903  1.00 0.45 ? 9   SER A HA   9  
ATOM   11043 H HB2  . SER A 1 9  ? 10.403  4.272   -0.451  1.00 1.05 ? 9   SER A HB2  9  
ATOM   11044 H HB3  . SER A 1 9  ? 8.800   4.306   0.281   1.00 1.19 ? 9   SER A HB3  9  
ATOM   11045 H HG   . SER A 1 9  ? 10.967  4.660   1.553   1.00 1.36 ? 9   SER A HG   9  
ATOM   11046 N N    . SER A 1 10 ? 11.747  1.360   0.310   1.00 0.39 ? 10  SER A N    9  
ATOM   11047 C CA   . SER A 1 10 ? 13.026  0.759   -0.057  1.00 0.43 ? 10  SER A CA   9  
ATOM   11048 C C    . SER A 1 10 ? 12.822  -0.568  -0.792  1.00 0.42 ? 10  SER A C    9  
ATOM   11049 O O    . SER A 1 10 ? 13.651  -0.971  -1.605  1.00 0.56 ? 10  SER A O    9  
ATOM   11050 C CB   . SER A 1 10 ? 13.888  0.533   1.187   1.00 0.52 ? 10  SER A CB   9  
ATOM   11051 O OG   . SER A 1 10 ? 14.171  1.755   1.852   1.00 1.17 ? 10  SER A OG   9  
ATOM   11052 H H    . SER A 1 10 ? 11.541  1.510   1.263   1.00 0.41 ? 10  SER A H    9  
ATOM   11053 H HA   . SER A 1 10 ? 13.534  1.446   -0.716  1.00 0.47 ? 10  SER A HA   9  
ATOM   11054 H HB2  . SER A 1 10 ? 13.364  -0.119  1.871   1.00 0.93 ? 10  SER A HB2  9  
ATOM   11055 H HB3  . SER A 1 10 ? 14.821  0.071   0.896   1.00 1.00 ? 10  SER A HB3  9  
ATOM   11056 H HG   . SER A 1 10 ? 13.670  2.474   1.438   1.00 1.54 ? 10  SER A HG   9  
ATOM   11057 N N    . ALA A 1 11 ? 11.704  -1.230  -0.511  1.00 0.37 ? 11  ALA A N    9  
ATOM   11058 C CA   . ALA A 1 11 ? 11.393  -2.508  -1.133  1.00 0.41 ? 11  ALA A CA   9  
ATOM   11059 C C    . ALA A 1 11 ? 10.953  -2.334  -2.582  1.00 0.37 ? 11  ALA A C    9  
ATOM   11060 O O    . ALA A 1 11 ? 11.474  -2.996  -3.479  1.00 0.42 ? 11  ALA A O    9  
ATOM   11061 C CB   . ALA A 1 11 ? 10.321  -3.232  -0.339  1.00 0.47 ? 11  ALA A CB   9  
ATOM   11062 H H    . ALA A 1 11 ? 11.075  -0.850  0.136   1.00 0.41 ? 11  ALA A H    9  
ATOM   11063 H HA   . ALA A 1 11 ? 12.288  -3.109  -1.112  1.00 0.47 ? 11  ALA A HA   9  
ATOM   11064 H HB1  . ALA A 1 11 ? 9.371   -2.735  -0.482  1.00 0.52 ? 11  ALA A HB1  9  
ATOM   11065 H HB2  . ALA A 1 11 ? 10.579  -3.217  0.707   1.00 0.58 ? 11  ALA A HB2  9  
ATOM   11066 H HB3  . ALA A 1 11 ? 10.248  -4.254  -0.679  1.00 0.58 ? 11  ALA A HB3  9  
ATOM   11067 N N    . CYS A 1 12 ? 9.998   -1.435  -2.822  1.00 0.34 ? 12  CYS A N    9  
ATOM   11068 C CA   . CYS A 1 12 ? 9.509   -1.203  -4.181  1.00 0.37 ? 12  CYS A CA   9  
ATOM   11069 C C    . CYS A 1 12 ? 10.601  -0.608  -5.067  1.00 0.39 ? 12  CYS A C    9  
ATOM   11070 O O    . CYS A 1 12 ? 10.498  -0.630  -6.290  1.00 0.44 ? 12  CYS A O    9  
ATOM   11071 C CB   . CYS A 1 12 ? 8.264   -0.310  -4.177  1.00 0.42 ? 12  CYS A CB   9  
ATOM   11072 S SG   . CYS A 1 12 ? 8.317   1.055   -2.998  1.00 0.66 ? 12  CYS A SG   9  
ATOM   11073 H H    . CYS A 1 12 ? 9.613   -0.926  -2.074  1.00 0.35 ? 12  CYS A H    9  
ATOM   11074 H HA   . CYS A 1 12 ? 9.239   -2.167  -4.587  1.00 0.43 ? 12  CYS A HA   9  
ATOM   11075 H HB2  . CYS A 1 12 ? 8.133   0.115   -5.160  1.00 0.63 ? 12  CYS A HB2  9  
ATOM   11076 H HB3  . CYS A 1 12 ? 7.402   -0.916  -3.938  1.00 0.63 ? 12  CYS A HB3  9  
ATOM   11077 H HG   . CYS A 1 12 ? 9.589   1.282   -2.688  1.00 1.11 ? 12  CYS A HG   9  
ATOM   11078 N N    . LYS A 1 13 ? 11.660  -0.100  -4.444  1.00 0.41 ? 13  LYS A N    9  
ATOM   11079 C CA   . LYS A 1 13 ? 12.777  0.470   -5.183  1.00 0.49 ? 13  LYS A CA   9  
ATOM   11080 C C    . LYS A 1 13 ? 13.531  -0.632  -5.930  1.00 0.49 ? 13  LYS A C    9  
ATOM   11081 O O    . LYS A 1 13 ? 14.190  -0.382  -6.938  1.00 0.58 ? 13  LYS A O    9  
ATOM   11082 C CB   . LYS A 1 13 ? 13.724  1.206   -4.234  1.00 0.63 ? 13  LYS A CB   9  
ATOM   11083 C CG   . LYS A 1 13 ? 13.201  2.546   -3.743  1.00 0.96 ? 13  LYS A CG   9  
ATOM   11084 C CD   . LYS A 1 13 ? 13.303  3.618   -4.813  1.00 1.06 ? 13  LYS A CD   9  
ATOM   11085 C CE   . LYS A 1 13 ? 12.673  4.927   -4.360  1.00 1.40 ? 13  LYS A CE   9  
ATOM   11086 N NZ   . LYS A 1 13 ? 13.541  5.687   -3.420  1.00 1.34 ? 13  LYS A NZ   9  
ATOM   11087 H H    . LYS A 1 13 ? 11.689  -0.104  -3.464  1.00 0.43 ? 13  LYS A H    9  
ATOM   11088 H HA   . LYS A 1 13 ? 12.378  1.169   -5.902  1.00 0.52 ? 13  LYS A HA   9  
ATOM   11089 H HB2  . LYS A 1 13 ? 13.901  0.580   -3.370  1.00 0.79 ? 13  LYS A HB2  9  
ATOM   11090 H HB3  . LYS A 1 13 ? 14.664  1.373   -4.740  1.00 0.85 ? 13  LYS A HB3  9  
ATOM   11091 H HG2  . LYS A 1 13 ? 12.165  2.434   -3.460  1.00 1.66 ? 13  LYS A HG2  9  
ATOM   11092 H HG3  . LYS A 1 13 ? 13.778  2.852   -2.884  1.00 1.57 ? 13  LYS A HG3  9  
ATOM   11093 H HD2  . LYS A 1 13 ? 14.346  3.790   -5.034  1.00 1.45 ? 13  LYS A HD2  9  
ATOM   11094 H HD3  . LYS A 1 13 ? 12.797  3.273   -5.703  1.00 1.68 ? 13  LYS A HD3  9  
ATOM   11095 H HE2  . LYS A 1 13 ? 12.491  5.539   -5.230  1.00 1.92 ? 13  LYS A HE2  9  
ATOM   11096 H HE3  . LYS A 1 13 ? 11.734  4.706   -3.874  1.00 1.72 ? 13  LYS A HE3  9  
ATOM   11097 H HZ1  . LYS A 1 13 ? 14.490  5.809   -3.822  1.00 1.65 ? 13  LYS A HZ1  9  
ATOM   11098 H HZ2  . LYS A 1 13 ? 13.623  5.186   -2.513  1.00 1.65 ? 13  LYS A HZ2  9  
ATOM   11099 H HZ3  . LYS A 1 13 ? 13.130  6.632   -3.241  1.00 1.73 ? 13  LYS A HZ3  9  
ATOM   11100 N N    . THR A 1 14 ? 13.422  -1.855  -5.424  1.00 0.49 ? 14  THR A N    9  
ATOM   11101 C CA   . THR A 1 14 ? 14.079  -2.995  -6.036  1.00 0.56 ? 14  THR A CA   9  
ATOM   11102 C C    . THR A 1 14 ? 13.126  -3.767  -6.948  1.00 0.54 ? 14  THR A C    9  
ATOM   11103 O O    . THR A 1 14 ? 13.549  -4.386  -7.925  1.00 0.72 ? 14  THR A O    9  
ATOM   11104 C CB   . THR A 1 14 ? 14.624  -3.953  -4.962  1.00 0.65 ? 14  THR A CB   9  
ATOM   11105 O OG1  . THR A 1 14 ? 14.652  -3.293  -3.689  1.00 0.77 ? 14  THR A OG1  9  
ATOM   11106 C CG2  . THR A 1 14 ? 16.019  -4.436  -5.325  1.00 0.83 ? 14  THR A CG2  9  
ATOM   11107 H H    . THR A 1 14 ? 12.903  -1.991  -4.602  1.00 0.48 ? 14  THR A H    9  
ATOM   11108 H HA   . THR A 1 14 ? 14.910  -2.631  -6.622  1.00 0.63 ? 14  THR A HA   9  
ATOM   11109 H HB   . THR A 1 14 ? 13.968  -4.811  -4.900  1.00 0.82 ? 14  THR A HB   9  
ATOM   11110 H HG1  . THR A 1 14 ? 15.287  -2.568  -3.720  1.00 0.99 ? 14  THR A HG1  9  
ATOM   11111 H HG21 . THR A 1 14 ? 16.696  -3.595  -5.357  1.00 1.01 ? 14  THR A HG21 9  
ATOM   11112 H HG22 . THR A 1 14 ? 15.994  -4.916  -6.295  1.00 1.11 ? 14  THR A HG22 9  
ATOM   11113 H HG23 . THR A 1 14 ? 16.358  -5.142  -4.583  1.00 1.00 ? 14  THR A HG23 9  
ATOM   11114 N N    . TYR A 1 15 ? 11.839  -3.732  -6.628  1.00 0.49 ? 15  TYR A N    9  
ATOM   11115 C CA   . TYR A 1 15 ? 10.842  -4.447  -7.419  1.00 0.54 ? 15  TYR A CA   9  
ATOM   11116 C C    . TYR A 1 15 ? 10.366  -3.609  -8.602  1.00 0.56 ? 15  TYR A C    9  
ATOM   11117 O O    . TYR A 1 15 ? 10.389  -4.065  -9.741  1.00 0.72 ? 15  TYR A O    9  
ATOM   11118 C CB   . TYR A 1 15 ? 9.649   -4.848  -6.547  1.00 0.55 ? 15  TYR A CB   9  
ATOM   11119 C CG   . TYR A 1 15 ? 10.034  -5.644  -5.317  1.00 0.60 ? 15  TYR A CG   9  
ATOM   11120 C CD1  . TYR A 1 15 ? 9.495   -5.339  -4.074  1.00 0.67 ? 15  TYR A CD1  9  
ATOM   11121 C CD2  . TYR A 1 15 ? 10.947  -6.690  -5.394  1.00 0.80 ? 15  TYR A CD2  9  
ATOM   11122 C CE1  . TYR A 1 15 ? 9.854   -6.051  -2.944  1.00 0.78 ? 15  TYR A CE1  9  
ATOM   11123 C CE2  . TYR A 1 15 ? 11.308  -7.407  -4.270  1.00 0.91 ? 15  TYR A CE2  9  
ATOM   11124 C CZ   . TYR A 1 15 ? 10.761  -7.084  -3.048  1.00 0.84 ? 15  TYR A CZ   9  
ATOM   11125 O OH   . TYR A 1 15 ? 11.124  -7.794  -1.924  1.00 1.00 ? 15  TYR A OH   9  
ATOM   11126 H H    . TYR A 1 15 ? 11.557  -3.223  -5.841  1.00 0.54 ? 15  TYR A H    9  
ATOM   11127 H HA   . TYR A 1 15 ? 11.310  -5.345  -7.797  1.00 0.62 ? 15  TYR A HA   9  
ATOM   11128 H HB2  . TYR A 1 15 ? 9.137   -3.955  -6.217  1.00 0.54 ? 15  TYR A HB2  9  
ATOM   11129 H HB3  . TYR A 1 15 ? 8.970   -5.451  -7.132  1.00 0.63 ? 15  TYR A HB3  9  
ATOM   11130 H HD1  . TYR A 1 15 ? 8.788   -4.530  -3.996  1.00 0.79 ? 15  TYR A HD1  9  
ATOM   11131 H HD2  . TYR A 1 15 ? 11.376  -6.942  -6.355  1.00 0.96 ? 15  TYR A HD2  9  
ATOM   11132 H HE1  . TYR A 1 15 ? 9.422   -5.798  -1.987  1.00 0.93 ? 15  TYR A HE1  9  
ATOM   11133 H HE2  . TYR A 1 15 ? 12.018  -8.216  -4.352  1.00 1.14 ? 15  TYR A HE2  9  
ATOM   11134 H HH   . TYR A 1 15 ? 12.084  -7.772  -1.831  1.00 1.22 ? 15  TYR A HH   9  
ATOM   11135 N N    . CYS A 1 16 ? 9.940   -2.382  -8.324  1.00 0.50 ? 16  CYS A N    9  
ATOM   11136 C CA   . CYS A 1 16 ? 9.452   -1.489  -9.366  1.00 0.55 ? 16  CYS A CA   9  
ATOM   11137 C C    . CYS A 1 16 ? 10.592  -0.645  -9.932  1.00 0.57 ? 16  CYS A C    9  
ATOM   11138 O O    . CYS A 1 16 ? 10.590  -0.289  -11.111 1.00 0.88 ? 16  CYS A O    9  
ATOM   11139 C CB   . CYS A 1 16 ? 8.348   -0.589  -8.809  1.00 0.54 ? 16  CYS A CB   9  
ATOM   11140 S SG   . CYS A 1 16 ? 7.177   -1.456  -7.734  1.00 0.67 ? 16  CYS A SG   9  
ATOM   11141 H H    . CYS A 1 16 ? 9.955   -2.067  -7.397  1.00 0.50 ? 16  CYS A H    9  
ATOM   11142 H HA   . CYS A 1 16 ? 9.042   -2.097  -10.157 1.00 0.64 ? 16  CYS A HA   9  
ATOM   11143 H HB2  . CYS A 1 16 ? 8.796   0.204   -8.232  1.00 0.56 ? 16  CYS A HB2  9  
ATOM   11144 H HB3  . CYS A 1 16 ? 7.787   -0.162  -9.630  1.00 0.63 ? 16  CYS A HB3  9  
ATOM   11145 H HG   . CYS A 1 16 ? 6.673   -2.476  -8.416  1.00 1.15 ? 16  CYS A HG   9  
ATOM   11146 N N    . GLY A 1 17 ? 11.558  -0.318  -9.087  1.00 0.49 ? 17  GLY A N    9  
ATOM   11147 C CA   . GLY A 1 17 ? 12.695  0.465   -9.527  1.00 0.56 ? 17  GLY A CA   9  
ATOM   11148 C C    . GLY A 1 17 ? 12.423  1.954   -9.526  1.00 0.52 ? 17  GLY A C    9  
ATOM   11149 O O    . GLY A 1 17 ? 12.678  2.639   -8.536  1.00 0.66 ? 17  GLY A O    9  
ATOM   11150 H H    . GLY A 1 17 ? 11.496  -0.603  -8.152  1.00 0.62 ? 17  GLY A H    9  
ATOM   11151 H HA2  . GLY A 1 17 ? 13.530  0.264   -8.872  1.00 0.65 ? 17  GLY A HA2  9  
ATOM   11152 H HA3  . GLY A 1 17 ? 12.960  0.162   -10.529 1.00 0.63 ? 17  GLY A HA3  9  
ATOM   11153 N N    . LYS A 1 18 ? 11.902  2.454   -10.639 1.00 0.50 ? 18  LYS A N    9  
ATOM   11154 C CA   . LYS A 1 18 ? 11.602  3.876   -10.773 1.00 0.56 ? 18  LYS A CA   9  
ATOM   11155 C C    . LYS A 1 18 ? 10.099  4.107   -10.857 1.00 0.53 ? 18  LYS A C    9  
ATOM   11156 O O    . LYS A 1 18 ? 9.632   5.245   -10.852 1.00 0.62 ? 18  LYS A O    9  
ATOM   11157 C CB   . LYS A 1 18 ? 12.300  4.479   -12.006 1.00 0.70 ? 18  LYS A CB   9  
ATOM   11158 C CG   . LYS A 1 18 ? 12.636  3.469   -13.093 1.00 0.81 ? 18  LYS A CG   9  
ATOM   11159 C CD   . LYS A 1 18 ? 14.062  2.948   -12.954 1.00 1.11 ? 18  LYS A CD   9  
ATOM   11160 C CE   . LYS A 1 18 ? 15.081  3.977   -13.424 1.00 1.46 ? 18  LYS A CE   9  
ATOM   11161 N NZ   . LYS A 1 18 ? 16.477  3.597   -13.061 1.00 1.82 ? 18  LYS A NZ   9  
ATOM   11162 H H    . LYS A 1 18 ? 11.709  1.850   -11.387 1.00 0.58 ? 18  LYS A H    9  
ATOM   11163 H HA   . LYS A 1 18 ? 11.974  4.368   -9.888  1.00 0.60 ? 18  LYS A HA   9  
ATOM   11164 H HB2  . LYS A 1 18 ? 11.655  5.229   -12.433 1.00 0.87 ? 18  LYS A HB2  9  
ATOM   11165 H HB3  . LYS A 1 18 ? 13.218  4.949   -11.689 1.00 0.79 ? 18  LYS A HB3  9  
ATOM   11166 H HG2  . LYS A 1 18 ? 11.952  2.636   -13.018 1.00 0.90 ? 18  LYS A HG2  9  
ATOM   11167 H HG3  . LYS A 1 18 ? 12.526  3.943   -14.058 1.00 1.06 ? 18  LYS A HG3  9  
ATOM   11168 H HD2  . LYS A 1 18 ? 14.250  2.719   -11.915 1.00 1.33 ? 18  LYS A HD2  9  
ATOM   11169 H HD3  . LYS A 1 18 ? 14.167  2.051   -13.548 1.00 1.44 ? 18  LYS A HD3  9  
ATOM   11170 H HE2  . LYS A 1 18 ? 15.012  4.069   -14.497 1.00 1.85 ? 18  LYS A HE2  9  
ATOM   11171 H HE3  . LYS A 1 18 ? 14.849  4.927   -12.970 1.00 1.67 ? 18  LYS A HE3  9  
ATOM   11172 H HZ1  . LYS A 1 18 ? 16.605  3.641   -12.029 1.00 2.13 ? 18  LYS A HZ1  9  
ATOM   11173 H HZ2  . LYS A 1 18 ? 17.156  4.245   -13.511 1.00 2.19 ? 18  LYS A HZ2  9  
ATOM   11174 H HZ3  . LYS A 1 18 ? 16.682  2.629   -13.380 1.00 2.14 ? 18  LYS A HZ3  9  
ATOM   11175 N N    . THR A 1 19 ? 9.341   3.024   -10.937 1.00 0.49 ? 19  THR A N    9  
ATOM   11176 C CA   . THR A 1 19 ? 7.891   3.118   -11.011 1.00 0.52 ? 19  THR A CA   9  
ATOM   11177 C C    . THR A 1 19 ? 7.266   2.916   -9.632  1.00 0.48 ? 19  THR A C    9  
ATOM   11178 O O    . THR A 1 19 ? 6.099   2.543   -9.514  1.00 0.62 ? 19  THR A O    9  
ATOM   11179 C CB   . THR A 1 19 ? 7.327   2.076   -11.991 1.00 0.62 ? 19  THR A CB   9  
ATOM   11180 O OG1  . THR A 1 19 ? 8.398   1.270   -12.511 1.00 0.83 ? 19  THR A OG1  9  
ATOM   11181 C CG2  . THR A 1 19 ? 6.593   2.751   -13.141 1.00 0.91 ? 19  THR A CG2  9  
ATOM   11182 H H    . THR A 1 19 ? 9.763   2.139   -10.963 1.00 0.49 ? 19  THR A H    9  
ATOM   11183 H HA   . THR A 1 19 ? 7.639   4.103   -11.373 1.00 0.60 ? 19  THR A HA   9  
ATOM   11184 H HB   . THR A 1 19 ? 6.632   1.442   -11.460 1.00 0.72 ? 19  THR A HB   9  
ATOM   11185 H HG1  . THR A 1 19 ? 8.071   0.378   -12.693 1.00 1.10 ? 19  THR A HG1  9  
ATOM   11186 H HG21 . THR A 1 19 ? 6.125   2.001   -13.759 1.00 1.10 ? 19  THR A HG21 9  
ATOM   11187 H HG22 . THR A 1 19 ? 7.296   3.317   -13.735 1.00 1.23 ? 19  THR A HG22 9  
ATOM   11188 H HG23 . THR A 1 19 ? 5.838   3.415   -12.749 1.00 1.17 ? 19  THR A HG23 9  
ATOM   11189 N N    . SER A 1 20 ? 8.053   3.179   -8.596  1.00 0.42 ? 20  SER A N    9  
ATOM   11190 C CA   . SER A 1 20 ? 7.608   3.026   -7.219  1.00 0.42 ? 20  SER A CA   9  
ATOM   11191 C C    . SER A 1 20 ? 6.845   4.262   -6.748  1.00 0.41 ? 20  SER A C    9  
ATOM   11192 O O    . SER A 1 20 ? 7.242   5.390   -7.046  1.00 0.46 ? 20  SER A O    9  
ATOM   11193 C CB   . SER A 1 20 ? 8.818   2.787   -6.320  1.00 0.46 ? 20  SER A CB   9  
ATOM   11194 O OG   . SER A 1 20 ? 9.953   3.479   -6.818  1.00 0.97 ? 20  SER A OG   9  
ATOM   11195 H H    . SER A 1 20 ? 8.966   3.500   -8.761  1.00 0.49 ? 20  SER A H    9  
ATOM   11196 H HA   . SER A 1 20 ? 6.954   2.167   -7.171  1.00 0.48 ? 20  SER A HA   9  
ATOM   11197 H HB2  . SER A 1 20 ? 8.600   3.146   -5.324  1.00 0.70 ? 20  SER A HB2  9  
ATOM   11198 H HB3  . SER A 1 20 ? 9.041   1.732   -6.284  1.00 0.81 ? 20  SER A HB3  9  
ATOM   11199 H HG   . SER A 1 20 ? 9.924   4.400   -6.522  1.00 1.21 ? 20  SER A HG   9  
ATOM   11200 N N    . PRO A 1 21 ? 5.743   4.068   -6.012  1.00 0.43 ? 21  PRO A N    9  
ATOM   11201 C CA   . PRO A 1 21 ? 4.936   5.176   -5.500  1.00 0.49 ? 21  PRO A CA   9  
ATOM   11202 C C    . PRO A 1 21 ? 5.662   5.943   -4.400  1.00 0.42 ? 21  PRO A C    9  
ATOM   11203 O O    . PRO A 1 21 ? 6.409   5.359   -3.612  1.00 0.46 ? 21  PRO A O    9  
ATOM   11204 C CB   . PRO A 1 21 ? 3.689   4.484   -4.942  1.00 0.62 ? 21  PRO A CB   9  
ATOM   11205 C CG   . PRO A 1 21 ? 4.126   3.099   -4.619  1.00 0.63 ? 21  PRO A CG   9  
ATOM   11206 C CD   . PRO A 1 21 ? 5.201   2.755   -5.614  1.00 0.50 ? 21  PRO A CD   9  
ATOM   11207 H HA   . PRO A 1 21 ? 4.653   5.859   -6.287  1.00 0.57 ? 21  PRO A HA   9  
ATOM   11208 H HB2  . PRO A 1 21 ? 3.348   5.000   -4.054  1.00 0.69 ? 21  PRO A HB2  9  
ATOM   11209 H HB3  . PRO A 1 21 ? 2.910   4.461   -5.685  1.00 0.76 ? 21  PRO A HB3  9  
ATOM   11210 H HG2  . PRO A 1 21 ? 4.518   3.067   -3.612  1.00 0.76 ? 21  PRO A HG2  9  
ATOM   11211 H HG3  . PRO A 1 21 ? 3.297   2.418   -4.723  1.00 0.81 ? 21  PRO A HG3  9  
ATOM   11212 H HD2  . PRO A 1 21 ? 5.965   2.150   -5.150  1.00 0.55 ? 21  PRO A HD2  9  
ATOM   11213 H HD3  . PRO A 1 21 ? 4.775   2.241   -6.463  1.00 0.57 ? 21  PRO A HD3  9  
ATOM   11214 N N    . SER A 1 22 ? 5.445   7.247   -4.356  1.00 0.43 ? 22  SER A N    9  
ATOM   11215 C CA   . SER A 1 22 ? 6.077   8.103   -3.365  1.00 0.43 ? 22  SER A CA   9  
ATOM   11216 C C    . SER A 1 22 ? 5.547   7.794   -1.970  1.00 0.38 ? 22  SER A C    9  
ATOM   11217 O O    . SER A 1 22 ? 4.358   7.502   -1.798  1.00 0.39 ? 22  SER A O    9  
ATOM   11218 C CB   . SER A 1 22 ? 5.821   9.565   -3.719  1.00 0.56 ? 22  SER A CB   9  
ATOM   11219 O OG   . SER A 1 22 ? 4.543   9.721   -4.319  1.00 1.11 ? 22  SER A OG   9  
ATOM   11220 H H    . SER A 1 22 ? 4.834   7.651   -5.005  1.00 0.53 ? 22  SER A H    9  
ATOM   11221 H HA   . SER A 1 22 ? 7.138   7.911   -3.391  1.00 0.47 ? 22  SER A HA   9  
ATOM   11222 H HB2  . SER A 1 22 ? 5.861   10.165  -2.822  1.00 0.96 ? 22  SER A HB2  9  
ATOM   11223 H HB3  . SER A 1 22 ? 6.575   9.902   -4.415  1.00 0.81 ? 22  SER A HB3  9  
ATOM   11224 H HG   . SER A 1 22 ? 4.574   10.449  -4.953  1.00 1.48 ? 22  SER A HG   9  
ATOM   11225 N N    . LYS A 1 23 ? 6.420   7.865   -0.972  1.00 0.44 ? 23  LYS A N    9  
ATOM   11226 C CA   . LYS A 1 23 ? 6.020   7.582   0.398   1.00 0.50 ? 23  LYS A CA   9  
ATOM   11227 C C    . LYS A 1 23 ? 5.006   8.615   0.888   1.00 0.42 ? 23  LYS A C    9  
ATOM   11228 O O    . LYS A 1 23 ? 4.205   8.327   1.777   1.00 0.42 ? 23  LYS A O    9  
ATOM   11229 C CB   . LYS A 1 23 ? 7.247   7.502   1.319   1.00 0.69 ? 23  LYS A CB   9  
ATOM   11230 C CG   . LYS A 1 23 ? 7.336   8.607   2.361   1.00 0.63 ? 23  LYS A CG   9  
ATOM   11231 C CD   . LYS A 1 23 ? 8.328   9.672   1.946   1.00 1.12 ? 23  LYS A CD   9  
ATOM   11232 C CE   . LYS A 1 23 ? 8.129   10.946  2.742   1.00 1.17 ? 23  LYS A CE   9  
ATOM   11233 N NZ   . LYS A 1 23 ? 9.182   11.944  2.448   1.00 1.60 ? 23  LYS A NZ   9  
ATOM   11234 H H    . LYS A 1 23 ? 7.353   8.108   -1.162  1.00 0.50 ? 23  LYS A H    9  
ATOM   11235 H HA   . LYS A 1 23 ? 5.536   6.616   0.391   1.00 0.56 ? 23  LYS A HA   9  
ATOM   11236 H HB2  . LYS A 1 23 ? 7.226   6.555   1.837   1.00 1.00 ? 23  LYS A HB2  9  
ATOM   11237 H HB3  . LYS A 1 23 ? 8.137   7.542   0.707   1.00 1.02 ? 23  LYS A HB3  9  
ATOM   11238 H HG2  . LYS A 1 23 ? 6.362   9.061   2.476   1.00 0.92 ? 23  LYS A HG2  9  
ATOM   11239 H HG3  . LYS A 1 23 ? 7.651   8.180   3.303   1.00 0.87 ? 23  LYS A HG3  9  
ATOM   11240 H HD2  . LYS A 1 23 ? 9.329   9.304   2.110   1.00 1.72 ? 23  LYS A HD2  9  
ATOM   11241 H HD3  . LYS A 1 23 ? 8.187   9.888   0.898   1.00 1.84 ? 23  LYS A HD3  9  
ATOM   11242 H HE2  . LYS A 1 23 ? 7.166   11.366  2.493   1.00 1.51 ? 23  LYS A HE2  9  
ATOM   11243 H HE3  . LYS A 1 23 ? 8.153   10.706  3.795   1.00 1.35 ? 23  LYS A HE3  9  
ATOM   11244 H HZ1  . LYS A 1 23 ? 10.091  11.638  2.849   1.00 2.03 ? 23  LYS A HZ1  9  
ATOM   11245 H HZ2  . LYS A 1 23 ? 8.937   12.865  2.856   1.00 1.91 ? 23  LYS A HZ2  9  
ATOM   11246 H HZ3  . LYS A 1 23 ? 9.295   12.050  1.415   1.00 2.03 ? 23  LYS A HZ3  9  
ATOM   11247 N N    . LYS A 1 24 ? 5.022   9.809   0.286   1.00 0.41 ? 24  LYS A N    9  
ATOM   11248 C CA   . LYS A 1 24 ? 4.075   10.859  0.654   1.00 0.45 ? 24  LYS A CA   9  
ATOM   11249 C C    . LYS A 1 24 ? 2.653   10.378  0.387   1.00 0.40 ? 24  LYS A C    9  
ATOM   11250 O O    . LYS A 1 24 ? 1.728   10.655  1.152   1.00 0.48 ? 24  LYS A O    9  
ATOM   11251 C CB   . LYS A 1 24 ? 4.328   12.144  -0.146  1.00 0.56 ? 24  LYS A CB   9  
ATOM   11252 C CG   . LYS A 1 24 ? 5.723   12.723  0.022   1.00 0.83 ? 24  LYS A CG   9  
ATOM   11253 C CD   . LYS A 1 24 ? 5.746   14.217  -0.281  1.00 1.00 ? 24  LYS A CD   9  
ATOM   11254 C CE   . LYS A 1 24 ? 6.830   14.579  -1.287  1.00 1.56 ? 24  LYS A CE   9  
ATOM   11255 N NZ   . LYS A 1 24 ? 8.197   14.397  -0.737  1.00 2.04 ? 24  LYS A NZ   9  
ATOM   11256 H H    . LYS A 1 24 ? 5.690   9.984   -0.412  1.00 0.44 ? 24  LYS A H    9  
ATOM   11257 H HA   . LYS A 1 24 ? 4.188   11.063  1.709   1.00 0.51 ? 24  LYS A HA   9  
ATOM   11258 H HB2  . LYS A 1 24 ? 4.177   11.933  -1.195  1.00 0.63 ? 24  LYS A HB2  9  
ATOM   11259 H HB3  . LYS A 1 24 ? 3.613   12.892  0.166   1.00 0.77 ? 24  LYS A HB3  9  
ATOM   11260 H HG2  . LYS A 1 24 ? 6.052   12.564  1.038   1.00 1.37 ? 24  LYS A HG2  9  
ATOM   11261 H HG3  . LYS A 1 24 ? 6.392   12.218  -0.659  1.00 1.33 ? 24  LYS A HG3  9  
ATOM   11262 H HD2  . LYS A 1 24 ? 4.789   14.504  -0.687  1.00 1.50 ? 24  LYS A HD2  9  
ATOM   11263 H HD3  . LYS A 1 24 ? 5.925   14.757  0.637   1.00 1.29 ? 24  LYS A HD3  9  
ATOM   11264 H HE2  . LYS A 1 24 ? 6.718   13.952  -2.157  1.00 1.84 ? 24  LYS A HE2  9  
ATOM   11265 H HE3  . LYS A 1 24 ? 6.703   15.613  -1.573  1.00 2.19 ? 24  LYS A HE3  9  
ATOM   11266 H HZ1  . LYS A 1 24 ? 8.209   13.612  -0.059  1.00 2.22 ? 24  LYS A HZ1  9  
ATOM   11267 H HZ2  . LYS A 1 24 ? 8.519   15.260  -0.260  1.00 2.45 ? 24  LYS A HZ2  9  
ATOM   11268 H HZ3  . LYS A 1 24 ? 8.864   14.172  -1.508  1.00 2.55 ? 24  LYS A HZ3  9  
ATOM   11269 N N    . GLU A 1 25 ? 2.508   9.635   -0.700  1.00 0.34 ? 25  GLU A N    9  
ATOM   11270 C CA   . GLU A 1 25 ? 1.224   9.095   -1.104  1.00 0.37 ? 25  GLU A CA   9  
ATOM   11271 C C    . GLU A 1 25 ? 0.885   7.868   -0.264  1.00 0.31 ? 25  GLU A C    9  
ATOM   11272 O O    . GLU A 1 25 ? -0.261  7.675   0.142   1.00 0.34 ? 25  GLU A O    9  
ATOM   11273 C CB   . GLU A 1 25 ? 1.269   8.727   -2.586  1.00 0.45 ? 25  GLU A CB   9  
ATOM   11274 C CG   . GLU A 1 25 ? -0.095  8.529   -3.218  1.00 0.90 ? 25  GLU A CG   9  
ATOM   11275 C CD   . GLU A 1 25 ? 0.005   8.179   -4.683  1.00 1.00 ? 25  GLU A CD   9  
ATOM   11276 O OE1  . GLU A 1 25 ? -0.282  9.049   -5.530  1.00 1.30 ? 25  GLU A OE1  9  
ATOM   11277 O OE2  . GLU A 1 25 ? 0.377   7.032   -5.001  1.00 1.58 ? 25  GLU A OE2  9  
ATOM   11278 H H    . GLU A 1 25 ? 3.297   9.436   -1.248  1.00 0.36 ? 25  GLU A H    9  
ATOM   11279 H HA   . GLU A 1 25 ? 0.473   9.855   -0.946  1.00 0.42 ? 25  GLU A HA   9  
ATOM   11280 H HB2  . GLU A 1 25 ? 1.776   9.514   -3.121  1.00 0.97 ? 25  GLU A HB2  9  
ATOM   11281 H HB3  . GLU A 1 25 ? 1.831   7.811   -2.699  1.00 0.87 ? 25  GLU A HB3  9  
ATOM   11282 H HG2  . GLU A 1 25 ? -0.604  7.726   -2.706  1.00 1.42 ? 25  GLU A HG2  9  
ATOM   11283 H HG3  . GLU A 1 25 ? -0.664  9.440   -3.117  1.00 1.47 ? 25  GLU A HG3  9  
ATOM   11284 N N    . ILE A 1 26 ? 1.900   7.050   0.003   1.00 0.29 ? 26  ILE A N    9  
ATOM   11285 C CA   . ILE A 1 26 ? 1.732   5.840   0.804   1.00 0.29 ? 26  ILE A CA   9  
ATOM   11286 C C    . ILE A 1 26 ? 1.226   6.186   2.204   1.00 0.27 ? 26  ILE A C    9  
ATOM   11287 O O    . ILE A 1 26 ? 0.348   5.509   2.741   1.00 0.28 ? 26  ILE A O    9  
ATOM   11288 C CB   . ILE A 1 26 ? 3.052   5.039   0.911   1.00 0.33 ? 26  ILE A CB   9  
ATOM   11289 C CG1  . ILE A 1 26 ? 3.539   4.637   -0.486  1.00 0.36 ? 26  ILE A CG1  9  
ATOM   11290 C CG2  . ILE A 1 26 ? 2.865   3.799   1.782   1.00 0.41 ? 26  ILE A CG2  9  
ATOM   11291 C CD1  . ILE A 1 26 ? 4.869   3.912   -0.486  1.00 0.45 ? 26  ILE A CD1  9  
ATOM   11292 H H    . ILE A 1 26 ? 2.790   7.266   -0.355  1.00 0.30 ? 26  ILE A H    9  
ATOM   11293 H HA   . ILE A 1 26 ? 0.996   5.220   0.312   1.00 0.32 ? 26  ILE A HA   9  
ATOM   11294 H HB   . ILE A 1 26 ? 3.793   5.670   1.377   1.00 0.34 ? 26  ILE A HB   9  
ATOM   11295 H HG12 . ILE A 1 26 ? 2.810   3.985   -0.941  1.00 0.44 ? 26  ILE A HG12 9  
ATOM   11296 H HG13 . ILE A 1 26 ? 3.645   5.526   -1.092  1.00 0.35 ? 26  ILE A HG13 9  
ATOM   11297 H HG21 . ILE A 1 26 ? 2.552   4.098   2.773   1.00 0.52 ? 26  ILE A HG21 9  
ATOM   11298 H HG22 . ILE A 1 26 ? 3.799   3.261   1.848   1.00 0.53 ? 26  ILE A HG22 9  
ATOM   11299 H HG23 . ILE A 1 26 ? 2.110   3.162   1.344   1.00 0.54 ? 26  ILE A HG23 9  
ATOM   11300 H HD11 . ILE A 1 26 ? 5.139   3.654   -1.501  1.00 0.90 ? 26  ILE A HD11 9  
ATOM   11301 H HD12 . ILE A 1 26 ? 4.786   3.012   0.104   1.00 0.91 ? 26  ILE A HD12 9  
ATOM   11302 H HD13 . ILE A 1 26 ? 5.630   4.553   -0.062  1.00 0.92 ? 26  ILE A HD13 9  
ATOM   11303 N N    . GLY A 1 27 ? 1.771   7.254   2.784   1.00 0.27 ? 27  GLY A N    9  
ATOM   11304 C CA   . GLY A 1 27 ? 1.353   7.681   4.107   1.00 0.29 ? 27  GLY A CA   9  
ATOM   11305 C C    . GLY A 1 27 ? -0.113  8.069   4.137   1.00 0.28 ? 27  GLY A C    9  
ATOM   11306 O O    . GLY A 1 27 ? -0.833  7.747   5.085   1.00 0.32 ? 27  GLY A O    9  
ATOM   11307 H H    . GLY A 1 27 ? 2.474   7.754   2.310   1.00 0.28 ? 27  GLY A H    9  
ATOM   11308 H HA2  . GLY A 1 27 ? 1.517   6.873   4.806   1.00 0.32 ? 27  GLY A HA2  9  
ATOM   11309 H HA3  . GLY A 1 27 ? 1.946   8.531   4.408   1.00 0.33 ? 27  GLY A HA3  9  
ATOM   11310 N N    . ALA A 1 28 ? -0.553  8.753   3.086   1.00 0.27 ? 28  ALA A N    9  
ATOM   11311 C CA   . ALA A 1 28 ? -1.941  9.180   2.976   1.00 0.30 ? 28  ALA A CA   9  
ATOM   11312 C C    . ALA A 1 28 ? -2.856  7.969   2.833   1.00 0.29 ? 28  ALA A C    9  
ATOM   11313 O O    . ALA A 1 28 ? -3.870  7.856   3.529   1.00 0.32 ? 28  ALA A O    9  
ATOM   11314 C CB   . ALA A 1 28 ? -2.115  10.117  1.791   1.00 0.35 ? 28  ALA A CB   9  
ATOM   11315 H H    . ALA A 1 28 ? 0.075   8.979   2.368   1.00 0.27 ? 28  ALA A H    9  
ATOM   11316 H HA   . ALA A 1 28 ? -2.201  9.716   3.877   1.00 0.34 ? 28  ALA A HA   9  
ATOM   11317 H HB1  . ALA A 1 28 ? -1.484  10.984  1.922   1.00 0.47 ? 28  ALA A HB1  9  
ATOM   11318 H HB2  . ALA A 1 28 ? -3.146  10.429  1.726   1.00 0.50 ? 28  ALA A HB2  9  
ATOM   11319 H HB3  . ALA A 1 28 ? -1.838  9.604   0.883   1.00 0.45 ? 28  ALA A HB3  9  
ATOM   11320 N N    . MET A 1 29 ? -2.481  7.058   1.938   1.00 0.27 ? 29  MET A N    9  
ATOM   11321 C CA   . MET A 1 29 ? -3.246  5.840   1.699   1.00 0.30 ? 29  MET A CA   9  
ATOM   11322 C C    . MET A 1 29 ? -3.354  5.024   2.985   1.00 0.28 ? 29  MET A C    9  
ATOM   11323 O O    . MET A 1 29 ? -4.404  4.457   3.293   1.00 0.31 ? 29  MET A O    9  
ATOM   11324 C CB   . MET A 1 29 ? -2.574  5.003   0.607   1.00 0.34 ? 29  MET A CB   9  
ATOM   11325 C CG   . MET A 1 29 ? -3.226  3.650   0.377   1.00 0.40 ? 29  MET A CG   9  
ATOM   11326 S SD   . MET A 1 29 ? -2.132  2.487   -0.463  1.00 0.49 ? 29  MET A SD   9  
ATOM   11327 C CE   . MET A 1 29 ? -0.907  2.185   0.806   1.00 0.52 ? 29  MET A CE   9  
ATOM   11328 H H    . MET A 1 29 ? -1.661  7.214   1.416   1.00 0.27 ? 29  MET A H    9  
ATOM   11329 H HA   . MET A 1 29 ? -4.238  6.121   1.377   1.00 0.34 ? 29  MET A HA   9  
ATOM   11330 H HB2  . MET A 1 29 ? -2.604  5.553   -0.320  1.00 0.38 ? 29  MET A HB2  9  
ATOM   11331 H HB3  . MET A 1 29 ? -1.544  4.837   0.884   1.00 0.34 ? 29  MET A HB3  9  
ATOM   11332 H HG2  . MET A 1 29 ? -3.504  3.234   1.333   1.00 0.40 ? 29  MET A HG2  9  
ATOM   11333 H HG3  . MET A 1 29 ? -4.112  3.787   -0.225  1.00 0.49 ? 29  MET A HG3  9  
ATOM   11334 H HE1  . MET A 1 29 ? -0.387  3.102   1.036   1.00 0.81 ? 29  MET A HE1  9  
ATOM   11335 H HE2  . MET A 1 29 ? -0.200  1.449   0.452   1.00 0.89 ? 29  MET A HE2  9  
ATOM   11336 H HE3  . MET A 1 29 ? -1.395  1.814   1.695   1.00 0.86 ? 29  MET A HE3  9  
ATOM   11337 N N    . LEU A 1 30 ? -2.257  4.988   3.731   1.00 0.29 ? 30  LEU A N    9  
ATOM   11338 C CA   . LEU A 1 30 ? -2.194  4.259   4.989   1.00 0.32 ? 30  LEU A CA   9  
ATOM   11339 C C    . LEU A 1 30 ? -3.266  4.752   5.960   1.00 0.30 ? 30  LEU A C    9  
ATOM   11340 O O    . LEU A 1 30 ? -4.012  3.954   6.531   1.00 0.33 ? 30  LEU A O    9  
ATOM   11341 C CB   . LEU A 1 30 ? -0.808  4.427   5.616   1.00 0.39 ? 30  LEU A CB   9  
ATOM   11342 C CG   . LEU A 1 30 ? -0.232  3.181   6.283   1.00 0.78 ? 30  LEU A CG   9  
ATOM   11343 C CD1  . LEU A 1 30 ? 1.085   2.794   5.626   1.00 1.32 ? 30  LEU A CD1  9  
ATOM   11344 C CD2  . LEU A 1 30 ? -0.038  3.418   7.773   1.00 1.04 ? 30  LEU A CD2  9  
ATOM   11345 H H    . LEU A 1 30 ? -1.455  5.461   3.417   1.00 0.29 ? 30  LEU A H    9  
ATOM   11346 H HA   . LEU A 1 30 ? -2.364  3.215   4.780   1.00 0.36 ? 30  LEU A HA   9  
ATOM   11347 H HB2  . LEU A 1 30 ? -0.126  4.739   4.842   1.00 0.71 ? 30  LEU A HB2  9  
ATOM   11348 H HB3  . LEU A 1 30 ? -0.866  5.211   6.359   1.00 0.65 ? 30  LEU A HB3  9  
ATOM   11349 H HG   . LEU A 1 30 ? -0.924  2.361   6.160   1.00 1.11 ? 30  LEU A HG   9  
ATOM   11350 H HD11 . LEU A 1 30 ? 1.784   3.615   5.710   1.00 1.67 ? 30  LEU A HD11 9  
ATOM   11351 H HD12 . LEU A 1 30 ? 0.915   2.572   4.581   1.00 1.61 ? 30  LEU A HD12 9  
ATOM   11352 H HD13 . LEU A 1 30 ? 1.493   1.923   6.117   1.00 1.72 ? 30  LEU A HD13 9  
ATOM   11353 H HD21 . LEU A 1 30 ? 0.352   2.523   8.234   1.00 1.49 ? 30  LEU A HD21 9  
ATOM   11354 H HD22 . LEU A 1 30 ? -0.986  3.672   8.222   1.00 1.30 ? 30  LEU A HD22 9  
ATOM   11355 H HD23 . LEU A 1 30 ? 0.658   4.230   7.919   1.00 1.27 ? 30  LEU A HD23 9  
ATOM   11356 N N    . SER A 1 31 ? -3.346  6.069   6.124   1.00 0.29 ? 31  SER A N    9  
ATOM   11357 C CA   . SER A 1 31 ? -4.321  6.682   7.019   1.00 0.32 ? 31  SER A CA   9  
ATOM   11358 C C    . SER A 1 31 ? -5.747  6.348   6.585   1.00 0.28 ? 31  SER A C    9  
ATOM   11359 O O    . SER A 1 31 ? -6.611  6.070   7.418   1.00 0.29 ? 31  SER A O    9  
ATOM   11360 C CB   . SER A 1 31 ? -4.121  8.201   7.047   1.00 0.40 ? 31  SER A CB   9  
ATOM   11361 O OG   . SER A 1 31 ? -5.089  8.840   7.869   1.00 1.20 ? 31  SER A OG   9  
ATOM   11362 H H    . SER A 1 31 ? -2.728  6.649   5.626   1.00 0.31 ? 31  SER A H    9  
ATOM   11363 H HA   . SER A 1 31 ? -4.157  6.290   8.010   1.00 0.36 ? 31  SER A HA   9  
ATOM   11364 H HB2  . SER A 1 31 ? -3.136  8.423   7.434   1.00 0.94 ? 31  SER A HB2  9  
ATOM   11365 H HB3  . SER A 1 31 ? -4.208  8.588   6.044   1.00 1.08 ? 31  SER A HB3  9  
ATOM   11366 H HG   . SER A 1 31 ? -5.965  8.726   7.476   1.00 1.76 ? 31  SER A HG   9  
ATOM   11367 N N    . LEU A 1 32 ? -5.979  6.364   5.279   1.00 0.27 ? 32  LEU A N    9  
ATOM   11368 C CA   . LEU A 1 32 ? -7.298  6.078   4.725   1.00 0.29 ? 32  LEU A CA   9  
ATOM   11369 C C    . LEU A 1 32 ? -7.731  4.654   5.060   1.00 0.26 ? 32  LEU A C    9  
ATOM   11370 O O    . LEU A 1 32 ? -8.816  4.434   5.595   1.00 0.29 ? 32  LEU A O    9  
ATOM   11371 C CB   . LEU A 1 32 ? -7.278  6.289   3.201   1.00 0.35 ? 32  LEU A CB   9  
ATOM   11372 C CG   . LEU A 1 32 ? -8.634  6.224   2.477   1.00 0.67 ? 32  LEU A CG   9  
ATOM   11373 C CD1  . LEU A 1 32 ? -8.974  4.794   2.086   1.00 1.15 ? 32  LEU A CD1  9  
ATOM   11374 C CD2  . LEU A 1 32 ? -9.745  6.822   3.328   1.00 1.17 ? 32  LEU A CD2  9  
ATOM   11375 H H    . LEU A 1 32 ? -5.240  6.578   4.665   1.00 0.29 ? 32  LEU A H    9  
ATOM   11376 H HA   . LEU A 1 32 ? -8.000  6.769   5.166   1.00 0.32 ? 32  LEU A HA   9  
ATOM   11377 H HB2  . LEU A 1 32 ? -6.845  7.258   3.009   1.00 0.51 ? 32  LEU A HB2  9  
ATOM   11378 H HB3  . LEU A 1 32 ? -6.632  5.539   2.769   1.00 0.56 ? 32  LEU A HB3  9  
ATOM   11379 H HG   . LEU A 1 32 ? -8.568  6.803   1.569   1.00 0.58 ? 32  LEU A HG   9  
ATOM   11380 H HD11 . LEU A 1 32 ? -8.242  4.430   1.384   1.00 1.26 ? 32  LEU A HD11 9  
ATOM   11381 H HD12 . LEU A 1 32 ? -9.953  4.770   1.632   1.00 1.47 ? 32  LEU A HD12 9  
ATOM   11382 H HD13 . LEU A 1 32 ? -8.971  4.169   2.967   1.00 1.37 ? 32  LEU A HD13 9  
ATOM   11383 H HD21 . LEU A 1 32 ? -10.679 6.765   2.790   1.00 1.52 ? 32  LEU A HD21 9  
ATOM   11384 H HD22 . LEU A 1 32 ? -9.516  7.855   3.544   1.00 1.23 ? 32  LEU A HD22 9  
ATOM   11385 H HD23 . LEU A 1 32 ? -9.828  6.270   4.253   1.00 1.41 ? 32  LEU A HD23 9  
ATOM   11386 N N    . LEU A 1 33 ? -6.870  3.694   4.756   1.00 0.27 ? 33  LEU A N    9  
ATOM   11387 C CA   . LEU A 1 33 ? -7.171  2.287   5.000   1.00 0.31 ? 33  LEU A CA   9  
ATOM   11388 C C    . LEU A 1 33 ? -7.388  2.003   6.483   1.00 0.27 ? 33  LEU A C    9  
ATOM   11389 O O    . LEU A 1 33 ? -8.225  1.176   6.850   1.00 0.33 ? 33  LEU A O    9  
ATOM   11390 C CB   . LEU A 1 33 ? -6.041  1.408   4.461   1.00 0.41 ? 33  LEU A CB   9  
ATOM   11391 C CG   . LEU A 1 33 ? -5.734  1.576   2.972   1.00 0.49 ? 33  LEU A CG   9  
ATOM   11392 C CD1  . LEU A 1 33 ? -4.566  0.690   2.564   1.00 0.61 ? 33  LEU A CD1  9  
ATOM   11393 C CD2  . LEU A 1 33 ? -6.963  1.255   2.138   1.00 0.68 ? 33  LEU A CD2  9  
ATOM   11394 H H    . LEU A 1 33 ? -6.007  3.937   4.356   1.00 0.29 ? 33  LEU A H    9  
ATOM   11395 H HA   . LEU A 1 33 ? -8.079  2.049   4.466   1.00 0.35 ? 33  LEU A HA   9  
ATOM   11396 H HB2  . LEU A 1 33 ? -5.144  1.633   5.019   1.00 0.42 ? 33  LEU A HB2  9  
ATOM   11397 H HB3  . LEU A 1 33 ? -6.303  0.375   4.637   1.00 0.50 ? 33  LEU A HB3  9  
ATOM   11398 H HG   . LEU A 1 33 ? -5.458  2.603   2.779   1.00 0.46 ? 33  LEU A HG   9  
ATOM   11399 H HD11 . LEU A 1 33 ? -4.346  0.843   1.519   1.00 1.08 ? 33  LEU A HD11 9  
ATOM   11400 H HD12 . LEU A 1 33 ? -4.826  -0.346  2.730   1.00 1.05 ? 33  LEU A HD12 9  
ATOM   11401 H HD13 . LEU A 1 33 ? -3.699  0.943   3.157   1.00 1.03 ? 33  LEU A HD13 9  
ATOM   11402 H HD21 . LEU A 1 33 ? -7.298  0.253   2.364   1.00 1.04 ? 33  LEU A HD21 9  
ATOM   11403 H HD22 . LEU A 1 33 ? -6.714  1.324   1.091   1.00 0.99 ? 33  LEU A HD22 9  
ATOM   11404 H HD23 . LEU A 1 33 ? -7.748  1.959   2.371   1.00 0.89 ? 33  LEU A HD23 9  
ATOM   11405 N N    . GLN A 1 34 ? -6.641  2.693   7.333   1.00 0.26 ? 34  GLN A N    9  
ATOM   11406 C CA   . GLN A 1 34 ? -6.760  2.495   8.771   1.00 0.31 ? 34  GLN A CA   9  
ATOM   11407 C C    . GLN A 1 34 ? -8.069  3.064   9.310   1.00 0.29 ? 34  GLN A C    9  
ATOM   11408 O O    . GLN A 1 34 ? -8.794  2.379   10.030  1.00 0.38 ? 34  GLN A O    9  
ATOM   11409 C CB   . GLN A 1 34 ? -5.586  3.132   9.508   1.00 0.42 ? 34  GLN A CB   9  
ATOM   11410 C CG   . GLN A 1 34 ? -4.267  2.412   9.290   1.00 0.72 ? 34  GLN A CG   9  
ATOM   11411 C CD   . GLN A 1 34 ? -3.166  2.933   10.190  1.00 1.04 ? 34  GLN A CD   9  
ATOM   11412 O OE1  . GLN A 1 34 ? -3.200  4.082   10.628  1.00 1.62 ? 34  GLN A OE1  9  
ATOM   11413 N NE2  . GLN A 1 34 ? -2.179  2.098   10.467  1.00 1.51 ? 34  GLN A NE2  9  
ATOM   11414 H H    . GLN A 1 34 ? -5.994  3.345   6.987   1.00 0.29 ? 34  GLN A H    9  
ATOM   11415 H HA   . GLN A 1 34 ? -6.748  1.433   8.953   1.00 0.36 ? 34  GLN A HA   9  
ATOM   11416 H HB2  . GLN A 1 34 ? -5.477  4.152   9.173   1.00 0.67 ? 34  GLN A HB2  9  
ATOM   1141