data_6CV8
# 
_entry.id   6CV8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CV8         
WWPDB D_1000233428 
BMRB  30404        
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB  'MA structure used for docking' 6CE5  unspecified 
BMRB .                               30404 unspecified 
PDB  .                               6CUS  unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        6CV8 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Vlach, J.'  1 0000-0002-0874-2055 
'Saad, J.S.' 2 0000-0001-9503-6484 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            293 
_citation.language                  ? 
_citation.page_first                18828 
_citation.page_last                 18840 
_citation.title                     
'Structural basis for targeting avian sarcoma virus Gag polyprotein to the plasma membrane for virus assembly.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA118.003944 
_citation.pdbx_database_id_PubMed   30309983 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Vlach, J.'      1 ?                   
primary 'Eastep, G.N.'   2 ?                   
primary 'Ghanam, R.H.'   3 ?                   
primary 'Watanabe, S.M.' 4 ?                   
primary 'Carter, C.A.'   5 ?                   
primary 'Saad, J.S.'     6 0000-0001-9503-6484 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Matrix protein p19'              9209.771 1 ? M1S ? ? 
2 non-polymer syn D-MYO-INOSITOL-1,4,5-TRIPHOSPHATE 420.096  1 ? ?   ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGA
LKAAREE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGA
LKAAREE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  GLU n 
1 3  ALA n 
1 4  VAL n 
1 5  ILE n 
1 6  LYS n 
1 7  VAL n 
1 8  ILE n 
1 9  SER n 
1 10 SER n 
1 11 ALA n 
1 12 CYS n 
1 13 LYS n 
1 14 THR n 
1 15 TYR n 
1 16 CYS n 
1 17 GLY n 
1 18 LYS n 
1 19 THR n 
1 20 SER n 
1 21 PRO n 
1 22 SER n 
1 23 LYS n 
1 24 LYS n 
1 25 GLU n 
1 26 ILE n 
1 27 GLY n 
1 28 ALA n 
1 29 MET n 
1 30 LEU n 
1 31 SER n 
1 32 LEU n 
1 33 LEU n 
1 34 GLN n 
1 35 LYS n 
1 36 GLU n 
1 37 GLY n 
1 38 LEU n 
1 39 LEU n 
1 40 MET n 
1 41 SER n 
1 42 PRO n 
1 43 SER n 
1 44 ASP n 
1 45 LEU n 
1 46 TYR n 
1 47 SER n 
1 48 PRO n 
1 49 GLY n 
1 50 SER n 
1 51 TRP n 
1 52 ASP n 
1 53 PRO n 
1 54 ILE n 
1 55 THR n 
1 56 ALA n 
1 57 ALA n 
1 58 LEU n 
1 59 SER n 
1 60 GLN n 
1 61 ARG n 
1 62 ALA n 
1 63 MET n 
1 64 ILE n 
1 65 LEU n 
1 66 GLY n 
1 67 LYS n 
1 68 SER n 
1 69 GLY n 
1 70 GLU n 
1 71 LEU n 
1 72 LYS n 
1 73 THR n 
1 74 TRP n 
1 75 GLY n 
1 76 LEU n 
1 77 VAL n 
1 78 LEU n 
1 79 GLY n 
1 80 ALA n 
1 81 LEU n 
1 82 LYS n 
1 83 ALA n 
1 84 ALA n 
1 85 ARG n 
1 86 GLU n 
1 87 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   87 
_entity_src_gen.gene_src_common_name               RSV-PrC 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 gag-pol 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'Prague C' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rous sarcoma virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11888 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    POL_RSVP 
_struct_ref.pdbx_db_accession          P03354 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGA
LKAAREE
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6CV8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 87 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P03354 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  87 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       87 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             6CV8 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P03354 
_struct_ref_seq_dif.db_mon_id                    MET 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          1 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'     75.067  
I3P non-polymer         . D-MYO-INOSITOL-1,4,5-TRIPHOSPHATE ? 'C6 H15 O15 P3'  420.096 
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl.experiment_id     1 
_pdbx_nmr_exptl.conditions_id     1 
_pdbx_nmr_exptl.solution_id       1 
_pdbx_nmr_exptl.type              '2D 1H-15N HSQC' 
_pdbx_nmr_exptl.spectrometer_id   1 
_pdbx_nmr_exptl.sample_state      isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            305 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     6 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         100 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  cond1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'100 uM [U-98% 15N] Matrix protein, 50 mM sodium phosphate, 2 mM TCEP, 1.6 mM D-MYO-INOSITOL-1,4,5-TRIPHOSPHATE, 95% H2O/5% D2O' 
_pdbx_nmr_sample_details.solvent_system   '95% H2O/5% D2O' 
_pdbx_nmr_sample_details.label            s1 
_pdbx_nmr_sample_details.type             solution 
_pdbx_nmr_sample_details.details          ? 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             'AVANCE II' 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    700 
_pdbx_nmr_spectrometer.details           ? 
# 
_pdbx_nmr_refine.entry_id           6CV8 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   4 
# 
_pdbx_nmr_ensemble.entry_id                                      6CV8 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             6CV8 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   medoid 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 processing              NMRPipe  ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
2 'data analysis'         Analysis ? CCPN                                                
3 'structure calculation' HADDOCK  ? Bonvin                                              
4 refinement              CNS      ? 'Brunger, Adams, Clore, Gros, Nilges and Read'      
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CV8 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6CV8 
_struct.title                        
'HADDOCK structure of the Rous sarcoma virus matrix protein (M-domain) in complex with inositol 1,4,5-trisphosphate' 
_struct.pdbx_descriptor              'Gag-Pol polyprotein (E.C.2.7.7.-,3.1.-.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CV8 
_struct_keywords.text            'RSV, ASV, Gag, IP3, VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ALA A 3  ? SER A 10 ? ALA A 3  SER A 10 1 ? 8  
HELX_P HELX_P2 AA2 ALA A 11 ? CYS A 16 ? ALA A 11 CYS A 16 1 ? 6  
HELX_P HELX_P3 AA3 GLY A 17 ? SER A 20 ? GLY A 17 SER A 20 5 ? 4  
HELX_P HELX_P4 AA4 SER A 22 ? GLU A 36 ? SER A 22 GLU A 36 1 ? 15 
HELX_P HELX_P5 AA5 SER A 41 ? SER A 47 ? SER A 41 SER A 47 5 ? 7  
HELX_P HELX_P6 AA6 SER A 50 ? GLY A 66 ? SER A 50 GLY A 66 1 ? 17 
HELX_P HELX_P7 AA7 GLU A 70 ? ARG A 85 ? GLU A 70 ARG A 85 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    I3P 
_struct_site.pdbx_auth_seq_id     101 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'binding site for residue I3P A 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 LYS A 6  ? LYS A 6  . ? 1_555 ? 
2 AC1 6 SER A 9  ? SER A 9  . ? 1_555 ? 
3 AC1 6 LYS A 13 ? LYS A 13 . ? 1_555 ? 
4 AC1 6 SER A 22 ? SER A 22 . ? 1_555 ? 
5 AC1 6 LYS A 23 ? LYS A 23 . ? 1_555 ? 
6 AC1 6 LYS A 24 ? LYS A 24 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6CV8 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . SER A 1 1  ? 2.869   3.452   10.438  1.00 0.76 ? 1   SER A N    1  
ATOM   2     C CA   . SER A 1 1  ? 2.432   4.601   11.224  1.00 0.88 ? 1   SER A CA   1  
ATOM   3     C C    . SER A 1 1  ? 3.475   5.714   11.185  1.00 0.88 ? 1   SER A C    1  
ATOM   4     O O    . SER A 1 1  ? 3.157   6.885   11.392  1.00 0.98 ? 1   SER A O    1  
ATOM   5     C CB   . SER A 1 1  ? 2.168   4.184   12.672  1.00 0.96 ? 1   SER A CB   1  
ATOM   6     O OG   . SER A 1 1  ? 0.792   3.926   12.885  1.00 1.05 ? 1   SER A OG   1  
ATOM   7     H H1   . SER A 1 1  ? 3.030   3.735   9.451   1.00 0.73 ? 1   SER A H1   1  
ATOM   8     H H2   . SER A 1 1  ? 2.142   2.708   10.460  1.00 0.79 ? 1   SER A H2   1  
ATOM   9     H H3   . SER A 1 1  ? 3.753   3.069   10.826  1.00 0.72 ? 1   SER A H3   1  
ATOM   10    H HA   . SER A 1 1  ? 1.514   4.973   10.793  1.00 0.95 ? 1   SER A HA   1  
ATOM   11    H HB2  . SER A 1 1  ? 2.729   3.288   12.896  1.00 0.91 ? 1   SER A HB2  1  
ATOM   12    H HB3  . SER A 1 1  ? 2.480   4.978   13.334  1.00 1.02 ? 1   SER A HB3  1  
ATOM   13    H HG   . SER A 1 1  ? 0.452   4.532   13.549  1.00 1.13 ? 1   SER A HG   1  
ATOM   14    N N    . GLU A 1 2  ? 4.722   5.339   10.916  1.00 0.79 ? 2   GLU A N    1  
ATOM   15    C CA   . GLU A 1 2  ? 5.811   6.306   10.851  1.00 0.83 ? 2   GLU A CA   1  
ATOM   16    C C    . GLU A 1 2  ? 7.103   5.638   10.387  1.00 0.76 ? 2   GLU A C    1  
ATOM   17    O O    . GLU A 1 2  ? 7.897   6.235   9.661   1.00 0.77 ? 2   GLU A O    1  
ATOM   18    C CB   . GLU A 1 2  ? 6.024   6.960   12.217  1.00 0.96 ? 2   GLU A CB   1  
ATOM   19    C CG   . GLU A 1 2  ? 6.642   6.031   13.248  1.00 0.99 ? 2   GLU A CG   1  
ATOM   20    C CD   . GLU A 1 2  ? 6.867   6.709   14.586  1.00 1.14 ? 2   GLU A CD   1  
ATOM   21    O OE1  . GLU A 1 2  ? 7.255   7.897   14.590  1.00 1.22 ? 2   GLU A OE1  1  
ATOM   22    O OE2  . GLU A 1 2  ? 6.654   6.053   15.627  1.00 1.19 ? 2   GLU A OE2  1  
ATOM   23    H H    . GLU A 1 2  ? 4.915   4.392   10.760  1.00 0.72 ? 2   GLU A H    1  
ATOM   24    H HA   . GLU A 1 2  ? 5.536   7.067   10.137  1.00 0.86 ? 2   GLU A HA   1  
ATOM   25    H HB2  . GLU A 1 2  ? 6.676   7.813   12.097  1.00 1.02 ? 2   GLU A HB2  1  
ATOM   26    H HB3  . GLU A 1 2  ? 5.070   7.298   12.595  1.00 1.02 ? 2   GLU A HB3  1  
ATOM   27    H HG2  . GLU A 1 2  ? 5.982   5.188   13.395  1.00 0.95 ? 2   GLU A HG2  1  
ATOM   28    H HG3  . GLU A 1 2  ? 7.593   5.680   12.874  1.00 0.95 ? 2   GLU A HG3  1  
ATOM   29    N N    . ALA A 1 3  ? 7.307   4.395   10.813  1.00 0.72 ? 3   ALA A N    1  
ATOM   30    C CA   . ALA A 1 3  ? 8.500   3.647   10.441  1.00 0.70 ? 3   ALA A CA   1  
ATOM   31    C C    . ALA A 1 3  ? 8.233   2.751   9.237   1.00 0.57 ? 3   ALA A C    1  
ATOM   32    O O    . ALA A 1 3  ? 9.003   2.740   8.276   1.00 0.56 ? 3   ALA A O    1  
ATOM   33    C CB   . ALA A 1 3  ? 8.991   2.818   11.618  1.00 0.79 ? 3   ALA A CB   1  
ATOM   34    H H    . ALA A 1 3  ? 6.641   3.975   11.397  1.00 0.73 ? 3   ALA A H    1  
ATOM   35    H HA   . ALA A 1 3  ? 9.272   4.357   10.184  1.00 0.75 ? 3   ALA A HA   1  
ATOM   36    H HB1  . ALA A 1 3  ? 9.175   3.465   12.463  1.00 0.89 ? 3   ALA A HB1  1  
ATOM   37    H HB2  . ALA A 1 3  ? 9.906   2.311   11.346  1.00 0.82 ? 3   ALA A HB2  1  
ATOM   38    H HB3  . ALA A 1 3  ? 8.241   2.087   11.883  1.00 0.76 ? 3   ALA A HB3  1  
ATOM   39    N N    . VAL A 1 4  ? 7.142   1.986   9.296   1.00 0.52 ? 4   VAL A N    1  
ATOM   40    C CA   . VAL A 1 4  ? 6.784   1.062   8.215   1.00 0.45 ? 4   VAL A CA   1  
ATOM   41    C C    . VAL A 1 4  ? 6.755   1.747   6.851   1.00 0.43 ? 4   VAL A C    1  
ATOM   42    O O    . VAL A 1 4  ? 7.112   1.141   5.841   1.00 0.44 ? 4   VAL A O    1  
ATOM   43    C CB   . VAL A 1 4  ? 5.426   0.386   8.475   1.00 0.49 ? 4   VAL A CB   1  
ATOM   44    C CG1  . VAL A 1 4  ? 5.197   -0.751  7.489   1.00 0.55 ? 4   VAL A CG1  1  
ATOM   45    C CG2  . VAL A 1 4  ? 5.353   -0.122  9.907   1.00 0.62 ? 4   VAL A CG2  1  
ATOM   46    H H    . VAL A 1 4  ? 6.563   2.044   10.083  1.00 0.57 ? 4   VAL A H    1  
ATOM   47    H HA   . VAL A 1 4  ? 7.538   0.288   8.190   1.00 0.46 ? 4   VAL A HA   1  
ATOM   48    H HB   . VAL A 1 4  ? 4.646   1.120   8.334   1.00 0.59 ? 4   VAL A HB   1  
ATOM   49    H HG11 . VAL A 1 4  ? 5.208   -0.362  6.482   1.00 0.62 ? 4   VAL A HG11 1  
ATOM   50    H HG12 . VAL A 1 4  ? 4.240   -1.211  7.686   1.00 0.62 ? 4   VAL A HG12 1  
ATOM   51    H HG13 . VAL A 1 4  ? 5.980   -1.487  7.599   1.00 0.62 ? 4   VAL A HG13 1  
ATOM   52    H HG21 . VAL A 1 4  ? 4.372   -0.533  10.094  1.00 0.68 ? 4   VAL A HG21 1  
ATOM   53    H HG22 . VAL A 1 4  ? 5.537   0.694   10.589  1.00 0.78 ? 4   VAL A HG22 1  
ATOM   54    H HG23 . VAL A 1 4  ? 6.099   -0.889  10.056  1.00 0.70 ? 4   VAL A HG23 1  
ATOM   55    N N    . ILE A 1 5  ? 6.346   3.021   6.844   1.00 0.45 ? 5   ILE A N    1  
ATOM   56    C CA   . ILE A 1 5  ? 6.276   3.815   5.619   1.00 0.48 ? 5   ILE A CA   1  
ATOM   57    C C    . ILE A 1 5  ? 7.656   3.933   4.970   1.00 0.46 ? 5   ILE A C    1  
ATOM   58    O O    . ILE A 1 5  ? 7.774   3.947   3.747   1.00 0.57 ? 5   ILE A O    1  
ATOM   59    C CB   . ILE A 1 5  ? 5.723   5.233   5.897   1.00 0.56 ? 5   ILE A CB   1  
ATOM   60    C CG1  . ILE A 1 5  ? 4.392   5.156   6.654   1.00 0.73 ? 5   ILE A CG1  1  
ATOM   61    C CG2  . ILE A 1 5  ? 5.541   6.004   4.596   1.00 0.81 ? 5   ILE A CG2  1  
ATOM   62    C CD1  . ILE A 1 5  ? 3.901   6.501   7.146   1.00 0.82 ? 5   ILE A CD1  1  
ATOM   63    H H    . ILE A 1 5  ? 6.089   3.438   7.692   1.00 0.48 ? 5   ILE A H    1  
ATOM   64    H HA   . ILE A 1 5  ? 5.606   3.317   4.933   1.00 0.50 ? 5   ILE A HA   1  
ATOM   65    H HB   . ILE A 1 5  ? 6.443   5.763   6.504   1.00 0.65 ? 5   ILE A HB   1  
ATOM   66    H HG12 . ILE A 1 5  ? 3.636   4.747   5.999   1.00 0.89 ? 5   ILE A HG12 1  
ATOM   67    H HG13 . ILE A 1 5  ? 4.508   4.510   7.511   1.00 0.89 ? 5   ILE A HG13 1  
ATOM   68    H HG21 . ILE A 1 5  ? 4.886   5.451   3.941   1.00 0.99 ? 5   ILE A HG21 1  
ATOM   69    H HG22 . ILE A 1 5  ? 6.501   6.135   4.118   1.00 0.98 ? 5   ILE A HG22 1  
ATOM   70    H HG23 . ILE A 1 5  ? 5.108   6.970   4.807   1.00 0.91 ? 5   ILE A HG23 1  
ATOM   71    H HD11 . ILE A 1 5  ? 3.781   7.169   6.306   1.00 0.92 ? 5   ILE A HD11 1  
ATOM   72    H HD12 . ILE A 1 5  ? 4.621   6.915   7.837   1.00 0.99 ? 5   ILE A HD12 1  
ATOM   73    H HD13 . ILE A 1 5  ? 2.952   6.377   7.647   1.00 1.11 ? 5   ILE A HD13 1  
ATOM   74    N N    . LYS A 1 6  ? 8.696   4.008   5.802   1.00 0.44 ? 6   LYS A N    1  
ATOM   75    C CA   . LYS A 1 6  ? 10.068  4.109   5.318   1.00 0.45 ? 6   LYS A CA   1  
ATOM   76    C C    . LYS A 1 6  ? 10.611  2.733   4.944   1.00 0.41 ? 6   LYS A C    1  
ATOM   77    O O    . LYS A 1 6  ? 11.438  2.614   4.038   1.00 0.42 ? 6   LYS A O    1  
ATOM   78    C CB   . LYS A 1 6  ? 10.973  4.756   6.369   1.00 0.52 ? 6   LYS A CB   1  
ATOM   79    C CG   . LYS A 1 6  ? 10.689  6.233   6.607   1.00 0.78 ? 6   LYS A CG   1  
ATOM   80    C CD   . LYS A 1 6  ? 10.984  7.078   5.373   1.00 1.08 ? 6   LYS A CD   1  
ATOM   81    C CE   . LYS A 1 6  ? 12.468  7.081   5.028   1.00 1.30 ? 6   LYS A CE   1  
ATOM   82    N NZ   . LYS A 1 6  ? 12.757  7.939   3.847   1.00 1.91 ? 6   LYS A NZ   1  
ATOM   83    H H    . LYS A 1 6  ? 8.534   3.987   6.769   1.00 0.51 ? 6   LYS A H    1  
ATOM   84    H HA   . LYS A 1 6  ? 10.058  4.727   4.432   1.00 0.46 ? 6   LYS A HA   1  
ATOM   85    H HB2  . LYS A 1 6  ? 10.845  4.232   7.305   1.00 0.72 ? 6   LYS A HB2  1  
ATOM   86    H HB3  . LYS A 1 6  ? 12.000  4.655   6.051   1.00 0.62 ? 6   LYS A HB3  1  
ATOM   87    H HG2  . LYS A 1 6  ? 9.648   6.349   6.866   1.00 1.09 ? 6   LYS A HG2  1  
ATOM   88    H HG3  . LYS A 1 6  ? 11.305  6.578   7.424   1.00 0.83 ? 6   LYS A HG3  1  
ATOM   89    H HD2  . LYS A 1 6  ? 10.434  6.679   4.536   1.00 1.25 ? 6   LYS A HD2  1  
ATOM   90    H HD3  . LYS A 1 6  ? 10.667  8.093   5.562   1.00 1.41 ? 6   LYS A HD3  1  
ATOM   91    H HE2  . LYS A 1 6  ? 13.022  7.452   5.876   1.00 1.39 ? 6   LYS A HE2  1  
ATOM   92    H HE3  . LYS A 1 6  ? 12.777  6.069   4.810   1.00 1.37 ? 6   LYS A HE3  1  
ATOM   93    H HZ1  . LYS A 1 6  ? 13.774  7.913   3.627   1.00 2.23 ? 6   LYS A HZ1  1  
ATOM   94    H HZ2  . LYS A 1 6  ? 12.482  8.922   4.042   1.00 2.11 ? 6   LYS A HZ2  1  
ATOM   95    H HZ3  . LYS A 1 6  ? 12.226  7.601   3.019   1.00 2.10 ? 6   LYS A HZ3  1  
ATOM   96    N N    . VAL A 1 7  ? 10.147  1.696   5.650   1.00 0.40 ? 7   VAL A N    1  
ATOM   97    C CA   . VAL A 1 7  ? 10.575  0.332   5.366   1.00 0.41 ? 7   VAL A CA   1  
ATOM   98    C C    . VAL A 1 7  ? 10.090  -0.122  3.993   1.00 0.37 ? 7   VAL A C    1  
ATOM   99    O O    . VAL A 1 7  ? 10.688  -1.000  3.372   1.00 0.41 ? 7   VAL A O    1  
ATOM   100   C CB   . VAL A 1 7  ? 10.056  -0.652  6.432   1.00 0.46 ? 7   VAL A CB   1  
ATOM   101   C CG1  . VAL A 1 7  ? 10.682  -2.025  6.239   1.00 0.52 ? 7   VAL A CG1  1  
ATOM   102   C CG2  . VAL A 1 7  ? 10.338  -0.120  7.829   1.00 0.53 ? 7   VAL A CG2  1  
ATOM   103   H H    . VAL A 1 7  ? 9.504   1.856   6.372   1.00 0.42 ? 7   VAL A H    1  
ATOM   104   H HA   . VAL A 1 7  ? 11.655  0.311   5.381   1.00 0.46 ? 7   VAL A HA   1  
ATOM   105   H HB   . VAL A 1 7  ? 8.986   -0.748  6.315   1.00 0.44 ? 7   VAL A HB   1  
ATOM   106   H HG11 . VAL A 1 7  ? 11.752  -1.955  6.367   1.00 0.57 ? 7   VAL A HG11 1  
ATOM   107   H HG12 . VAL A 1 7  ? 10.462  -2.384  5.244   1.00 0.49 ? 7   VAL A HG12 1  
ATOM   108   H HG13 . VAL A 1 7  ? 10.275  -2.712  6.967   1.00 0.56 ? 7   VAL A HG13 1  
ATOM   109   H HG21 . VAL A 1 7  ? 9.846   0.833   7.958   1.00 0.51 ? 7   VAL A HG21 1  
ATOM   110   H HG22 . VAL A 1 7  ? 11.403  0.006   7.959   1.00 0.57 ? 7   VAL A HG22 1  
ATOM   111   H HG23 . VAL A 1 7  ? 9.967   -0.820  8.563   1.00 0.58 ? 7   VAL A HG23 1  
ATOM   112   N N    . ILE A 1 8  ? 9.000   0.484   3.529   1.00 0.34 ? 8   ILE A N    1  
ATOM   113   C CA   . ILE A 1 8  ? 8.433   0.155   2.228   1.00 0.36 ? 8   ILE A CA   1  
ATOM   114   C C    . ILE A 1 8  ? 8.840   1.196   1.180   1.00 0.34 ? 8   ILE A C    1  
ATOM   115   O O    . ILE A 1 8  ? 8.818   0.923   -0.018  1.00 0.34 ? 8   ILE A O    1  
ATOM   116   C CB   . ILE A 1 8  ? 6.889   0.055   2.295   1.00 0.43 ? 8   ILE A CB   1  
ATOM   117   C CG1  . ILE A 1 8  ? 6.455   -0.829  3.474   1.00 0.57 ? 8   ILE A CG1  1  
ATOM   118   C CG2  . ILE A 1 8  ? 6.324   -0.490  0.989   1.00 0.61 ? 8   ILE A CG2  1  
ATOM   119   C CD1  . ILE A 1 8  ? 6.884   -2.278  3.353   1.00 0.78 ? 8   ILE A CD1  1  
ATOM   120   H H    . ILE A 1 8  ? 8.563   1.168   4.080   1.00 0.34 ? 8   ILE A H    1  
ATOM   121   H HA   . ILE A 1 8  ? 8.822   -0.808  1.930   1.00 0.39 ? 8   ILE A HA   1  
ATOM   122   H HB   . ILE A 1 8  ? 6.493   1.048   2.439   1.00 0.58 ? 8   ILE A HB   1  
ATOM   123   H HG12 . ILE A 1 8  ? 6.883   -0.437  4.384   1.00 0.73 ? 8   ILE A HG12 1  
ATOM   124   H HG13 . ILE A 1 8  ? 5.378   -0.809  3.553   1.00 0.61 ? 8   ILE A HG13 1  
ATOM   125   H HG21 . ILE A 1 8  ? 5.313   -0.830  1.151   1.00 1.01 ? 8   ILE A HG21 1  
ATOM   126   H HG22 . ILE A 1 8  ? 6.932   -1.315  0.648   1.00 1.07 ? 8   ILE A HG22 1  
ATOM   127   H HG23 . ILE A 1 8  ? 6.325   0.291   0.242   1.00 1.06 ? 8   ILE A HG23 1  
ATOM   128   H HD11 . ILE A 1 8  ? 7.962   -2.334  3.335   1.00 0.95 ? 8   ILE A HD11 1  
ATOM   129   H HD12 . ILE A 1 8  ? 6.487   -2.696  2.440   1.00 0.89 ? 8   ILE A HD12 1  
ATOM   130   H HD13 . ILE A 1 8  ? 6.509   -2.837  4.198   1.00 1.07 ? 8   ILE A HD13 1  
ATOM   131   N N    . SER A 1 9  ? 9.233   2.385   1.644   1.00 0.36 ? 9   SER A N    1  
ATOM   132   C CA   . SER A 1 9  ? 9.651   3.460   0.745   1.00 0.37 ? 9   SER A CA   1  
ATOM   133   C C    . SER A 1 9  ? 10.979  3.118   0.079   1.00 0.35 ? 9   SER A C    1  
ATOM   134   O O    . SER A 1 9  ? 11.160  3.344   -1.115  1.00 0.36 ? 9   SER A O    1  
ATOM   135   C CB   . SER A 1 9  ? 9.773   4.781   1.505   1.00 0.43 ? 9   SER A CB   1  
ATOM   136   O OG   . SER A 1 9  ? 10.004  5.862   0.619   1.00 0.49 ? 9   SER A OG   1  
ATOM   137   H H    . SER A 1 9  ? 9.243   2.541   2.612   1.00 0.38 ? 9   SER A H    1  
ATOM   138   H HA   . SER A 1 9  ? 8.896   3.563   -0.020  1.00 0.39 ? 9   SER A HA   1  
ATOM   139   H HB2  . SER A 1 9  ? 8.858   4.967   2.047   1.00 0.45 ? 9   SER A HB2  1  
ATOM   140   H HB3  . SER A 1 9  ? 10.598  4.719   2.200   1.00 0.44 ? 9   SER A HB3  1  
ATOM   141   H HG   . SER A 1 9  ? 9.439   5.770   -0.152  1.00 0.81 ? 9   SER A HG   1  
ATOM   142   N N    . SER A 1 10 ? 11.904  2.564   0.860   1.00 0.36 ? 10  SER A N    1  
ATOM   143   C CA   . SER A 1 10 ? 13.212  2.177   0.343   1.00 0.37 ? 10  SER A CA   1  
ATOM   144   C C    . SER A 1 10 ? 13.099  0.899   -0.485  1.00 0.35 ? 10  SER A C    1  
ATOM   145   O O    . SER A 1 10 ? 13.933  0.629   -1.350  1.00 0.35 ? 10  SER A O    1  
ATOM   146   C CB   . SER A 1 10 ? 14.199  1.971   1.496   1.00 0.43 ? 10  SER A CB   1  
ATOM   147   O OG   . SER A 1 10 ? 15.505  1.709   1.012   1.00 0.46 ? 10  SER A OG   1  
ATOM   148   H H    . SER A 1 10 ? 11.700  2.412   1.806   1.00 0.38 ? 10  SER A H    1  
ATOM   149   H HA   . SER A 1 10 ? 13.568  2.974   -0.290  1.00 0.37 ? 10  SER A HA   1  
ATOM   150   H HB2  . SER A 1 10 ? 14.229  2.860   2.106   1.00 0.45 ? 10  SER A HB2  1  
ATOM   151   H HB3  . SER A 1 10 ? 13.878  1.134   2.097   1.00 0.44 ? 10  SER A HB3  1  
ATOM   152   H HG   . SER A 1 10 ? 15.451  1.205   0.195   1.00 0.67 ? 10  SER A HG   1  
ATOM   153   N N    . ALA A 1 11 ? 12.052  0.120   -0.212  1.00 0.35 ? 11  ALA A N    1  
ATOM   154   C CA   . ALA A 1 11 ? 11.813  -1.130  -0.926  1.00 0.36 ? 11  ALA A CA   1  
ATOM   155   C C    . ALA A 1 11 ? 11.286  -0.865  -2.334  1.00 0.31 ? 11  ALA A C    1  
ATOM   156   O O    . ALA A 1 11 ? 11.792  -1.420  -3.306  1.00 0.33 ? 11  ALA A O    1  
ATOM   157   C CB   . ALA A 1 11 ? 10.832  -2.003  -0.154  1.00 0.40 ? 11  ALA A CB   1  
ATOM   158   H H    . ALA A 1 11 ? 11.424  0.397   0.487   1.00 0.36 ? 11  ALA A H    1  
ATOM   159   H HA   . ALA A 1 11 ? 12.752  -1.659  -0.997  1.00 0.39 ? 11  ALA A HA   1  
ATOM   160   H HB1  . ALA A 1 11 ? 9.875   -1.507  -0.099  1.00 0.38 ? 11  ALA A HB1  1  
ATOM   161   H HB2  . ALA A 1 11 ? 11.209  -2.169  0.845   1.00 0.44 ? 11  ALA A HB2  1  
ATOM   162   H HB3  . ALA A 1 11 ? 10.719  -2.952  -0.658  1.00 0.42 ? 11  ALA A HB3  1  
ATOM   163   N N    . CYS A 1 12 ? 10.283  0.012   -2.433  1.00 0.28 ? 12  CYS A N    1  
ATOM   164   C CA   . CYS A 1 12 ? 9.679   0.355   -3.719  1.00 0.26 ? 12  CYS A CA   1  
ATOM   165   C C    . CYS A 1 12 ? 10.627  1.188   -4.585  1.00 0.25 ? 12  CYS A C    1  
ATOM   166   O O    . CYS A 1 12 ? 10.390  1.361   -5.776  1.00 0.26 ? 12  CYS A O    1  
ATOM   167   C CB   . CYS A 1 12 ? 8.356   1.098   -3.512  1.00 0.28 ? 12  CYS A CB   1  
ATOM   168   S SG   . CYS A 1 12 ? 8.505   2.670   -2.634  1.00 0.26 ? 12  CYS A SG   1  
ATOM   169   H H    . CYS A 1 12 ? 9.938   0.434   -1.618  1.00 0.29 ? 12  CYS A H    1  
ATOM   170   H HA   . CYS A 1 12 ? 9.475   -0.571  -4.236  1.00 0.29 ? 12  CYS A HA   1  
ATOM   171   H HB2  . CYS A 1 12 ? 7.916   1.306   -4.476  1.00 0.29 ? 12  CYS A HB2  1  
ATOM   172   H HB3  . CYS A 1 12 ? 7.685   0.468   -2.947  1.00 0.34 ? 12  CYS A HB3  1  
ATOM   173   H HG   . CYS A 1 12 ? 9.705   2.714   -2.074  1.00 1.12 ? 12  CYS A HG   1  
ATOM   174   N N    . LYS A 1 13 ? 11.699  1.704   -3.986  1.00 0.25 ? 13  LYS A N    1  
ATOM   175   C CA   . LYS A 1 13 ? 12.682  2.490   -4.728  1.00 0.26 ? 13  LYS A CA   1  
ATOM   176   C C    . LYS A 1 13 ? 13.621  1.570   -5.504  1.00 0.31 ? 13  LYS A C    1  
ATOM   177   O O    . LYS A 1 13 ? 14.427  2.025   -6.316  1.00 0.35 ? 13  LYS A O    1  
ATOM   178   C CB   . LYS A 1 13 ? 13.497  3.372   -3.777  1.00 0.29 ? 13  LYS A CB   1  
ATOM   179   C CG   . LYS A 1 13 ? 12.792  4.653   -3.362  1.00 0.79 ? 13  LYS A CG   1  
ATOM   180   C CD   . LYS A 1 13 ? 12.679  5.635   -4.517  1.00 1.28 ? 13  LYS A CD   1  
ATOM   181   C CE   . LYS A 1 13 ? 12.073  6.954   -4.067  1.00 1.89 ? 13  LYS A CE   1  
ATOM   182   N NZ   . LYS A 1 13 ? 11.790  7.857   -5.216  1.00 2.67 ? 13  LYS A NZ   1  
ATOM   183   H H    . LYS A 1 13 ? 11.830  1.555   -3.026  1.00 0.28 ? 13  LYS A H    1  
ATOM   184   H HA   . LYS A 1 13 ? 12.149  3.118   -5.427  1.00 0.25 ? 13  LYS A HA   1  
ATOM   185   H HB2  . LYS A 1 13 ? 13.718  2.805   -2.885  1.00 0.60 ? 13  LYS A HB2  1  
ATOM   186   H HB3  . LYS A 1 13 ? 14.425  3.639   -4.260  1.00 0.66 ? 13  LYS A HB3  1  
ATOM   187   H HG2  . LYS A 1 13 ? 11.799  4.408   -3.014  1.00 1.52 ? 13  LYS A HG2  1  
ATOM   188   H HG3  . LYS A 1 13 ? 13.350  5.115   -2.560  1.00 0.94 ? 13  LYS A HG3  1  
ATOM   189   H HD2  . LYS A 1 13 ? 13.666  5.821   -4.916  1.00 1.26 ? 13  LYS A HD2  1  
ATOM   190   H HD3  . LYS A 1 13 ? 12.054  5.204   -5.284  1.00 1.89 ? 13  LYS A HD3  1  
ATOM   191   H HE2  . LYS A 1 13 ? 11.151  6.753   -3.543  1.00 2.36 ? 13  LYS A HE2  1  
ATOM   192   H HE3  . LYS A 1 13 ? 12.765  7.444   -3.400  1.00 1.74 ? 13  LYS A HE3  1  
ATOM   193   H HZ1  . LYS A 1 13 ? 12.674  8.096   -5.709  1.00 2.68 ? 13  LYS A HZ1  1  
ATOM   194   H HZ2  . LYS A 1 13 ? 11.346  8.735   -4.879  1.00 3.10 ? 13  LYS A HZ2  1  
ATOM   195   H HZ3  . LYS A 1 13 ? 11.146  7.391   -5.886  1.00 3.07 ? 13  LYS A HZ3  1  
ATOM   196   N N    . THR A 1 14 ? 13.501  0.270   -5.247  1.00 0.33 ? 14  THR A N    1  
ATOM   197   C CA   . THR A 1 14 ? 14.335  -0.732  -5.900  1.00 0.39 ? 14  THR A CA   1  
ATOM   198   C C    . THR A 1 14 ? 13.502  -1.634  -6.803  1.00 0.41 ? 14  THR A C    1  
ATOM   199   O O    . THR A 1 14 ? 14.045  -2.403  -7.597  1.00 0.46 ? 14  THR A O    1  
ATOM   200   C CB   . THR A 1 14 ? 15.080  -1.601  -4.869  1.00 0.43 ? 14  THR A CB   1  
ATOM   201   O OG1  . THR A 1 14 ? 15.764  -0.767  -3.930  1.00 0.44 ? 14  THR A OG1  1  
ATOM   202   C CG2  . THR A 1 14 ? 16.075  -2.521  -5.559  1.00 0.50 ? 14  THR A CG2  1  
ATOM   203   H H    . THR A 1 14 ? 12.831  -0.024  -4.594  1.00 0.32 ? 14  THR A H    1  
ATOM   204   H HA   . THR A 1 14 ? 15.068  -0.215  -6.502  1.00 0.41 ? 14  THR A HA   1  
ATOM   205   H HB   . THR A 1 14 ? 14.357  -2.206  -4.341  1.00 0.42 ? 14  THR A HB   1  
ATOM   206   H HG1  . THR A 1 14 ? 15.147  -0.464  -3.260  1.00 0.42 ? 14  THR A HG1  1  
ATOM   207   H HG21 . THR A 1 14 ? 15.555  -3.141  -6.274  1.00 0.50 ? 14  THR A HG21 1  
ATOM   208   H HG22 . THR A 1 14 ? 16.555  -3.148  -4.822  1.00 0.53 ? 14  THR A HG22 1  
ATOM   209   H HG23 . THR A 1 14 ? 16.820  -1.929  -6.069  1.00 0.51 ? 14  THR A HG23 1  
ATOM   210   N N    . TYR A 1 15 ? 12.183  -1.536  -6.678  1.00 0.37 ? 15  TYR A N    1  
ATOM   211   C CA   . TYR A 1 15 ? 11.277  -2.346  -7.483  1.00 0.40 ? 15  TYR A CA   1  
ATOM   212   C C    . TYR A 1 15 ? 10.440  -1.470  -8.409  1.00 0.39 ? 15  TYR A C    1  
ATOM   213   O O    . TYR A 1 15 ? 9.679   -1.971  -9.238  1.00 0.43 ? 15  TYR A O    1  
ATOM   214   C CB   . TYR A 1 15 ? 10.361  -3.175  -6.579  1.00 0.39 ? 15  TYR A CB   1  
ATOM   215   C CG   . TYR A 1 15 ? 11.082  -4.267  -5.826  1.00 0.43 ? 15  TYR A CG   1  
ATOM   216   C CD1  . TYR A 1 15 ? 11.054  -4.316  -4.437  1.00 0.41 ? 15  TYR A CD1  1  
ATOM   217   C CD2  . TYR A 1 15 ? 11.793  -5.251  -6.500  1.00 0.49 ? 15  TYR A CD2  1  
ATOM   218   C CE1  . TYR A 1 15 ? 11.711  -5.314  -3.744  1.00 0.46 ? 15  TYR A CE1  1  
ATOM   219   C CE2  . TYR A 1 15 ? 12.451  -6.254  -5.817  1.00 0.52 ? 15  TYR A CE2  1  
ATOM   220   C CZ   . TYR A 1 15 ? 12.408  -6.282  -4.437  1.00 0.51 ? 15  TYR A CZ   1  
ATOM   221   O OH   . TYR A 1 15 ? 13.065  -7.277  -3.751  1.00 0.56 ? 15  TYR A OH   1  
ATOM   222   H H    . TYR A 1 15 ? 11.810  -0.904  -6.030  1.00 0.33 ? 15  TYR A H    1  
ATOM   223   H HA   . TYR A 1 15 ? 11.876  -3.014  -8.083  1.00 0.45 ? 15  TYR A HA   1  
ATOM   224   H HB2  . TYR A 1 15 ? 9.897   -2.522  -5.855  1.00 0.35 ? 15  TYR A HB2  1  
ATOM   225   H HB3  . TYR A 1 15 ? 9.594   -3.637  -7.184  1.00 0.42 ? 15  TYR A HB3  1  
ATOM   226   H HD1  . TYR A 1 15 ? 10.505  -3.560  -3.896  1.00 0.38 ? 15  TYR A HD1  1  
ATOM   227   H HD2  . TYR A 1 15 ? 11.825  -5.228  -7.580  1.00 0.51 ? 15  TYR A HD2  1  
ATOM   228   H HE1  . TYR A 1 15 ? 11.676  -5.333  -2.665  1.00 0.47 ? 15  TYR A HE1  1  
ATOM   229   H HE2  . TYR A 1 15 ? 12.997  -7.011  -6.361  1.00 0.57 ? 15  TYR A HE2  1  
ATOM   230   H HH   . TYR A 1 15 ? 12.534  -7.557  -3.003  1.00 0.57 ? 15  TYR A HH   1  
ATOM   231   N N    . CYS A 1 16 ? 10.585  -0.158  -8.262  1.00 0.35 ? 16  CYS A N    1  
ATOM   232   C CA   . CYS A 1 16 ? 9.843   0.791   -9.086  1.00 0.36 ? 16  CYS A CA   1  
ATOM   233   C C    . CYS A 1 16 ? 10.739  1.946   -9.525  1.00 0.37 ? 16  CYS A C    1  
ATOM   234   O O    . CYS A 1 16 ? 10.783  2.295   -10.705 1.00 0.42 ? 16  CYS A O    1  
ATOM   235   C CB   . CYS A 1 16 ? 8.637   1.332   -8.315  1.00 0.32 ? 16  CYS A CB   1  
ATOM   236   S SG   . CYS A 1 16 ? 7.695   0.062   -7.435  1.00 0.32 ? 16  CYS A SG   1  
ATOM   237   H H    . CYS A 1 16 ? 11.206  0.181   -7.585  1.00 0.33 ? 16  CYS A H    1  
ATOM   238   H HA   . CYS A 1 16 ? 9.494   0.267   -9.963  1.00 0.41 ? 16  CYS A HA   1  
ATOM   239   H HB2  . CYS A 1 16 ? 8.978   2.050   -7.586  1.00 0.28 ? 16  CYS A HB2  1  
ATOM   240   H HB3  . CYS A 1 16 ? 7.966   1.819   -9.007  1.00 0.35 ? 16  CYS A HB3  1  
ATOM   241   H HG   . CYS A 1 16 ? 8.147   0.007   -6.190  1.00 0.27 ? 16  CYS A HG   1  
ATOM   242   N N    . GLY A 1 17 ? 11.449  2.535   -8.571  1.00 0.33 ? 17  GLY A N    1  
ATOM   243   C CA   . GLY A 1 17 ? 12.333  3.645   -8.880  1.00 0.34 ? 17  GLY A CA   1  
ATOM   244   C C    . GLY A 1 17 ? 11.698  4.990   -8.585  1.00 0.32 ? 17  GLY A C    1  
ATOM   245   O O    . GLY A 1 17 ? 11.194  5.220   -7.485  1.00 0.27 ? 17  GLY A O    1  
ATOM   246   H H    . GLY A 1 17 ? 11.373  2.213   -7.647  1.00 0.29 ? 17  GLY A H    1  
ATOM   247   H HA2  . GLY A 1 17 ? 13.233  3.548   -8.292  1.00 0.34 ? 17  GLY A HA2  1  
ATOM   248   H HA3  . GLY A 1 17 ? 12.592  3.603   -9.926  1.00 0.39 ? 17  GLY A HA3  1  
ATOM   249   N N    . LYS A 1 18 ? 11.725  5.881   -9.569  1.00 0.36 ? 18  LYS A N    1  
ATOM   250   C CA   . LYS A 1 18 ? 11.148  7.212   -9.411  1.00 0.36 ? 18  LYS A CA   1  
ATOM   251   C C    . LYS A 1 18 ? 9.625   7.151   -9.434  1.00 0.36 ? 18  LYS A C    1  
ATOM   252   O O    . LYS A 1 18 ? 8.949   8.055   -8.942  1.00 0.36 ? 18  LYS A O    1  
ATOM   253   C CB   . LYS A 1 18 ? 11.648  8.142   -10.520 1.00 0.43 ? 18  LYS A CB   1  
ATOM   254   C CG   . LYS A 1 18 ? 11.463  7.577   -11.916 1.00 0.48 ? 18  LYS A CG   1  
ATOM   255   C CD   . LYS A 1 18 ? 12.778  7.083   -12.499 1.00 0.52 ? 18  LYS A CD   1  
ATOM   256   C CE   . LYS A 1 18 ? 13.304  8.031   -13.566 1.00 0.58 ? 18  LYS A CE   1  
ATOM   257   N NZ   . LYS A 1 18 ? 14.744  8.353   -13.359 1.00 0.59 ? 18  LYS A NZ   1  
ATOM   258   H H    . LYS A 1 18 ? 12.142  5.639   -10.422 1.00 0.40 ? 18  LYS A H    1  
ATOM   259   H HA   . LYS A 1 18 ? 11.467  7.601   -8.455  1.00 0.34 ? 18  LYS A HA   1  
ATOM   260   H HB2  . LYS A 1 18 ? 11.111  9.077   -10.459 1.00 0.43 ? 18  LYS A HB2  1  
ATOM   261   H HB3  . LYS A 1 18 ? 12.701  8.332   -10.366 1.00 0.43 ? 18  LYS A HB3  1  
ATOM   262   H HG2  . LYS A 1 18 ? 10.770  6.750   -11.871 1.00 0.47 ? 18  LYS A HG2  1  
ATOM   263   H HG3  . LYS A 1 18 ? 11.063  8.349   -12.556 1.00 0.52 ? 18  LYS A HG3  1  
ATOM   264   H HD2  . LYS A 1 18 ? 13.507  7.009   -11.707 1.00 0.49 ? 18  LYS A HD2  1  
ATOM   265   H HD3  . LYS A 1 18 ? 12.621  6.109   -12.940 1.00 0.53 ? 18  LYS A HD3  1  
ATOM   266   H HE2  . LYS A 1 18 ? 13.184  7.566   -14.533 1.00 0.62 ? 18  LYS A HE2  1  
ATOM   267   H HE3  . LYS A 1 18 ? 12.731  8.945   -13.534 1.00 0.58 ? 18  LYS A HE3  1  
ATOM   268   H HZ1  . LYS A 1 18 ? 15.314  7.484   -13.392 1.00 0.60 ? 18  LYS A HZ1  1  
ATOM   269   H HZ2  . LYS A 1 18 ? 14.879  8.808   -12.434 1.00 0.56 ? 18  LYS A HZ2  1  
ATOM   270   H HZ3  . LYS A 1 18 ? 15.076  9.002   -14.102 1.00 0.64 ? 18  LYS A HZ3  1  
ATOM   271   N N    . THR A 1 19 ? 9.088   6.079   -10.008 1.00 0.37 ? 19  THR A N    1  
ATOM   272   C CA   . THR A 1 19 ? 7.645   5.899   -10.094 1.00 0.39 ? 19  THR A CA   1  
ATOM   273   C C    . THR A 1 19 ? 7.050   5.563   -8.732  1.00 0.33 ? 19  THR A C    1  
ATOM   274   O O    . THR A 1 19 ? 5.858   5.767   -8.497  1.00 0.43 ? 19  THR A O    1  
ATOM   275   C CB   . THR A 1 19 ? 7.274   4.785   -11.092 1.00 0.46 ? 19  THR A CB   1  
ATOM   276   O OG1  . THR A 1 19 ? 7.464   3.502   -10.486 1.00 0.53 ? 19  THR A OG1  1  
ATOM   277   C CG2  . THR A 1 19 ? 8.123   4.884   -12.352 1.00 0.61 ? 19  THR A CG2  1  
ATOM   278   H H    . THR A 1 19 ? 9.678   5.391   -10.383 1.00 0.39 ? 19  THR A H    1  
ATOM   279   H HA   . THR A 1 19 ? 7.214   6.825   -10.444 1.00 0.42 ? 19  THR A HA   1  
ATOM   280   H HB   . THR A 1 19 ? 6.236   4.896   -11.366 1.00 0.49 ? 19  THR A HB   1  
ATOM   281   H HG1  . THR A 1 19 ? 7.731   2.866   -11.154 1.00 0.54 ? 19  THR A HG1  1  
ATOM   282   H HG21 . THR A 1 19 ? 7.817   4.122   -13.053 1.00 0.66 ? 19  THR A HG21 1  
ATOM   283   H HG22 . THR A 1 19 ? 9.163   4.744   -12.097 1.00 0.68 ? 19  THR A HG22 1  
ATOM   284   H HG23 . THR A 1 19 ? 7.991   5.859   -12.799 1.00 0.69 ? 19  THR A HG23 1  
ATOM   285   N N    . SER A 1 20 ? 7.900   5.076   -7.820  1.00 0.30 ? 20  SER A N    1  
ATOM   286   C CA   . SER A 1 20 ? 7.485   4.684   -6.465  1.00 0.24 ? 20  SER A CA   1  
ATOM   287   C C    . SER A 1 20 ? 6.674   5.776   -5.757  1.00 0.22 ? 20  SER A C    1  
ATOM   288   O O    . SER A 1 20 ? 6.867   6.967   -6.011  1.00 0.26 ? 20  SER A O    1  
ATOM   289   C CB   . SER A 1 20 ? 8.715   4.347   -5.624  1.00 0.22 ? 20  SER A CB   1  
ATOM   290   O OG   . SER A 1 20 ? 9.436   5.518   -5.281  1.00 0.25 ? 20  SER A OG   1  
ATOM   291   H H    . SER A 1 20 ? 8.844   4.978   -8.067  1.00 0.38 ? 20  SER A H    1  
ATOM   292   H HA   . SER A 1 20 ? 6.872   3.801   -6.549  1.00 0.26 ? 20  SER A HA   1  
ATOM   293   H HB2  . SER A 1 20 ? 8.404   3.855   -4.715  1.00 0.26 ? 20  SER A HB2  1  
ATOM   294   H HB3  . SER A 1 20 ? 9.364   3.692   -6.185  1.00 0.24 ? 20  SER A HB3  1  
ATOM   295   H HG   . SER A 1 20 ? 8.838   6.268   -5.264  1.00 0.41 ? 20  SER A HG   1  
ATOM   296   N N    . PRO A 1 21 ? 5.764   5.375   -4.844  1.00 0.20 ? 21  PRO A N    1  
ATOM   297   C CA   . PRO A 1 21 ? 4.926   6.316   -4.092  1.00 0.22 ? 21  PRO A CA   1  
ATOM   298   C C    . PRO A 1 21 ? 5.734   7.143   -3.097  1.00 0.22 ? 21  PRO A C    1  
ATOM   299   O O    . PRO A 1 21 ? 6.872   6.802   -2.765  1.00 0.24 ? 21  PRO A O    1  
ATOM   300   C CB   . PRO A 1 21 ? 3.941   5.408   -3.352  1.00 0.23 ? 21  PRO A CB   1  
ATOM   301   C CG   . PRO A 1 21 ? 4.625   4.092   -3.249  1.00 0.21 ? 21  PRO A CG   1  
ATOM   302   C CD   . PRO A 1 21 ? 5.478   3.973   -4.479  1.00 0.20 ? 21  PRO A CD   1  
ATOM   303   H HA   . PRO A 1 21 ? 4.383   6.978   -4.751  1.00 0.26 ? 21  PRO A HA   1  
ATOM   304   H HB2  . PRO A 1 21 ? 3.733   5.816   -2.369  1.00 0.25 ? 21  PRO A HB2  1  
ATOM   305   H HB3  . PRO A 1 21 ? 3.029   5.309   -3.917  1.00 0.26 ? 21  PRO A HB3  1  
ATOM   306   H HG2  . PRO A 1 21 ? 5.239   4.067   -2.360  1.00 0.21 ? 21  PRO A HG2  1  
ATOM   307   H HG3  . PRO A 1 21 ? 3.897   3.297   -3.228  1.00 0.24 ? 21  PRO A HG3  1  
ATOM   308   H HD2  . PRO A 1 21 ? 6.390   3.439   -4.255  1.00 0.21 ? 21  PRO A HD2  1  
ATOM   309   H HD3  . PRO A 1 21 ? 4.934   3.474   -5.267  1.00 0.24 ? 21  PRO A HD3  1  
ATOM   310   N N    . SER A 1 22 ? 5.138   8.227   -2.620  1.00 0.24 ? 22  SER A N    1  
ATOM   311   C CA   . SER A 1 22 ? 5.800   9.109   -1.670  1.00 0.26 ? 22  SER A CA   1  
ATOM   312   C C    . SER A 1 22 ? 5.428   8.754   -0.235  1.00 0.23 ? 22  SER A C    1  
ATOM   313   O O    . SER A 1 22 ? 4.580   7.893   0.009   1.00 0.23 ? 22  SER A O    1  
ATOM   314   C CB   . SER A 1 22 ? 5.427   10.566  -1.956  1.00 0.31 ? 22  SER A CB   1  
ATOM   315   O OG   . SER A 1 22 ? 4.023   10.752  -1.921  1.00 0.32 ? 22  SER A OG   1  
ATOM   316   H H    . SER A 1 22 ? 4.226   8.438   -2.912  1.00 0.26 ? 22  SER A H    1  
ATOM   317   H HA   . SER A 1 22 ? 6.866   8.990   -1.793  1.00 0.29 ? 22  SER A HA   1  
ATOM   318   H HB2  . SER A 1 22 ? 5.878   11.201  -1.207  1.00 0.34 ? 22  SER A HB2  1  
ATOM   319   H HB3  . SER A 1 22 ? 5.793   10.844  -2.934  1.00 0.35 ? 22  SER A HB3  1  
ATOM   320   H HG   . SER A 1 22 ? 3.726   11.109  -2.761  1.00 0.54 ? 22  SER A HG   1  
ATOM   321   N N    . LYS A 1 23 ? 6.074   9.429   0.710   1.00 0.24 ? 23  LYS A N    1  
ATOM   322   C CA   . LYS A 1 23 ? 5.823   9.215   2.130   1.00 0.25 ? 23  LYS A CA   1  
ATOM   323   C C    . LYS A 1 23 ? 4.445   9.755   2.520   1.00 0.23 ? 23  LYS A C    1  
ATOM   324   O O    . LYS A 1 23 ? 3.782   9.213   3.405   1.00 0.26 ? 23  LYS A O    1  
ATOM   325   C CB   . LYS A 1 23 ? 6.929   9.897   2.947   1.00 0.29 ? 23  LYS A CB   1  
ATOM   326   C CG   . LYS A 1 23 ? 6.585   10.128  4.410   1.00 0.41 ? 23  LYS A CG   1  
ATOM   327   C CD   . LYS A 1 23 ? 7.543   11.120  5.049   1.00 0.87 ? 23  LYS A CD   1  
ATOM   328   C CE   . LYS A 1 23 ? 6.877   11.890  6.178   1.00 1.02 ? 23  LYS A CE   1  
ATOM   329   N NZ   . LYS A 1 23 ? 7.707   13.039  6.631   1.00 1.62 ? 23  LYS A NZ   1  
ATOM   330   H H    . LYS A 1 23 ? 6.742   10.097  0.442   1.00 0.26 ? 23  LYS A H    1  
ATOM   331   H HA   . LYS A 1 23 ? 5.848   8.152   2.316   1.00 0.27 ? 23  LYS A HA   1  
ATOM   332   H HB2  . LYS A 1 23 ? 7.816   9.282   2.906   1.00 0.35 ? 23  LYS A HB2  1  
ATOM   333   H HB3  . LYS A 1 23 ? 7.149   10.853  2.497   1.00 0.34 ? 23  LYS A HB3  1  
ATOM   334   H HG2  . LYS A 1 23 ? 5.580   10.515  4.479   1.00 0.71 ? 23  LYS A HG2  1  
ATOM   335   H HG3  . LYS A 1 23 ? 6.649   9.188   4.938   1.00 0.67 ? 23  LYS A HG3  1  
ATOM   336   H HD2  . LYS A 1 23 ? 8.391   10.582  5.447   1.00 1.16 ? 23  LYS A HD2  1  
ATOM   337   H HD3  . LYS A 1 23 ? 7.879   11.818  4.296   1.00 1.26 ? 23  LYS A HD3  1  
ATOM   338   H HE2  . LYS A 1 23 ? 5.925   12.262  5.832   1.00 1.11 ? 23  LYS A HE2  1  
ATOM   339   H HE3  . LYS A 1 23 ? 6.720   11.220  7.009   1.00 1.06 ? 23  LYS A HE3  1  
ATOM   340   H HZ1  . LYS A 1 23 ? 7.228   13.544  7.404   1.00 1.74 ? 23  LYS A HZ1  1  
ATOM   341   H HZ2  . LYS A 1 23 ? 7.860   13.701  5.844   1.00 1.95 ? 23  LYS A HZ2  1  
ATOM   342   H HZ3  . LYS A 1 23 ? 8.630   12.702  6.970   1.00 1.88 ? 23  LYS A HZ3  1  
ATOM   343   N N    . LYS A 1 24 ? 4.017   10.813  1.836   1.00 0.20 ? 24  LYS A N    1  
ATOM   344   C CA   . LYS A 1 24 ? 2.722   11.432  2.100   1.00 0.21 ? 24  LYS A CA   1  
ATOM   345   C C    . LYS A 1 24 ? 1.579   10.593  1.531   1.00 0.20 ? 24  LYS A C    1  
ATOM   346   O O    . LYS A 1 24 ? 0.464   10.619  2.053   1.00 0.22 ? 24  LYS A O    1  
ATOM   347   C CB   . LYS A 1 24 ? 2.684   12.842  1.506   1.00 0.24 ? 24  LYS A CB   1  
ATOM   348   C CG   . LYS A 1 24 ? 3.664   13.804  2.158   1.00 0.43 ? 24  LYS A CG   1  
ATOM   349   C CD   . LYS A 1 24 ? 3.791   15.099  1.368   1.00 0.79 ? 24  LYS A CD   1  
ATOM   350   C CE   . LYS A 1 24 ? 4.533   14.882  0.058   1.00 1.35 ? 24  LYS A CE   1  
ATOM   351   N NZ   . LYS A 1 24 ? 5.012   16.164  -0.528  1.00 2.01 ? 24  LYS A NZ   1  
ATOM   352   H H    . LYS A 1 24 ? 4.590   11.190  1.135   1.00 0.20 ? 24  LYS A H    1  
ATOM   353   H HA   . LYS A 1 24 ? 2.601   11.501  3.170   1.00 0.24 ? 24  LYS A HA   1  
ATOM   354   H HB2  . LYS A 1 24 ? 2.919   12.782  0.453   1.00 0.37 ? 24  LYS A HB2  1  
ATOM   355   H HB3  . LYS A 1 24 ? 1.688   13.243  1.621   1.00 0.38 ? 24  LYS A HB3  1  
ATOM   356   H HG2  . LYS A 1 24 ? 3.317   14.036  3.154   1.00 0.80 ? 24  LYS A HG2  1  
ATOM   357   H HG3  . LYS A 1 24 ? 4.634   13.331  2.215   1.00 0.81 ? 24  LYS A HG3  1  
ATOM   358   H HD2  . LYS A 1 24 ? 2.802   15.475  1.150   1.00 1.14 ? 24  LYS A HD2  1  
ATOM   359   H HD3  . LYS A 1 24 ? 4.331   15.823  1.962   1.00 0.95 ? 24  LYS A HD3  1  
ATOM   360   H HE2  . LYS A 1 24 ? 5.382   14.242  0.241   1.00 1.59 ? 24  LYS A HE2  1  
ATOM   361   H HE3  . LYS A 1 24 ? 3.866   14.402  -0.644  1.00 1.51 ? 24  LYS A HE3  1  
ATOM   362   H HZ1  . LYS A 1 24 ? 5.657   16.638  0.136   1.00 2.09 ? 24  LYS A HZ1  1  
ATOM   363   H HZ2  . LYS A 1 24 ? 4.207   16.791  -0.722  1.00 2.20 ? 24  LYS A HZ2  1  
ATOM   364   H HZ3  . LYS A 1 24 ? 5.519   15.982  -1.418  1.00 2.49 ? 24  LYS A HZ3  1  
ATOM   365   N N    . GLU A 1 25 ? 1.859   9.848   0.462   1.00 0.18 ? 25  GLU A N    1  
ATOM   366   C CA   . GLU A 1 25 ? 0.847   9.002   -0.162  1.00 0.17 ? 25  GLU A CA   1  
ATOM   367   C C    . GLU A 1 25 ? 0.547   7.782   0.704   1.00 0.16 ? 25  GLU A C    1  
ATOM   368   O O    . GLU A 1 25 ? -0.576  7.605   1.176   1.00 0.17 ? 25  GLU A O    1  
ATOM   369   C CB   . GLU A 1 25 ? 1.314   8.553   -1.550  1.00 0.17 ? 25  GLU A CB   1  
ATOM   370   C CG   . GLU A 1 25 ? 0.457   9.090   -2.683  1.00 0.19 ? 25  GLU A CG   1  
ATOM   371   C CD   . GLU A 1 25 ? 0.705   8.372   -3.994  1.00 0.18 ? 25  GLU A CD   1  
ATOM   372   O OE1  . GLU A 1 25 ? 0.514   8.997   -5.060  1.00 0.26 ? 25  GLU A OE1  1  
ATOM   373   O OE2  . GLU A 1 25 ? 1.089   7.185   -3.957  1.00 0.21 ? 25  GLU A OE2  1  
ATOM   374   H H    . GLU A 1 25 ? 2.764   9.869   0.088   1.00 0.18 ? 25  GLU A H    1  
ATOM   375   H HA   . GLU A 1 25 ? -0.055  9.586   -0.266  1.00 0.17 ? 25  GLU A HA   1  
ATOM   376   H HB2  . GLU A 1 25 ? 2.328   8.891   -1.703  1.00 0.19 ? 25  GLU A HB2  1  
ATOM   377   H HB3  . GLU A 1 25 ? 1.292   7.474   -1.592  1.00 0.18 ? 25  GLU A HB3  1  
ATOM   378   H HG2  . GLU A 1 25 ? -0.583  8.973   -2.418  1.00 0.23 ? 25  GLU A HG2  1  
ATOM   379   H HG3  . GLU A 1 25 ? 0.677   10.140  -2.817  1.00 0.23 ? 25  GLU A HG3  1  
ATOM   380   N N    . ILE A 1 26 ? 1.559   6.946   0.909   1.00 0.16 ? 26  ILE A N    1  
ATOM   381   C CA   . ILE A 1 26 ? 1.402   5.744   1.719   1.00 0.15 ? 26  ILE A CA   1  
ATOM   382   C C    . ILE A 1 26 ? 0.790   6.072   3.077   1.00 0.15 ? 26  ILE A C    1  
ATOM   383   O O    . ILE A 1 26 ? -0.142  5.404   3.524   1.00 0.14 ? 26  ILE A O    1  
ATOM   384   C CB   . ILE A 1 26 ? 2.753   5.033   1.936   1.00 0.16 ? 26  ILE A CB   1  
ATOM   385   C CG1  . ILE A 1 26 ? 3.357   4.621   0.594   1.00 0.16 ? 26  ILE A CG1  1  
ATOM   386   C CG2  . ILE A 1 26 ? 2.573   3.821   2.837   1.00 0.15 ? 26  ILE A CG2  1  
ATOM   387   C CD1  . ILE A 1 26 ? 4.691   3.917   0.723   1.00 0.17 ? 26  ILE A CD1  1  
ATOM   388   H H    . ILE A 1 26 ? 2.431   7.143   0.507   1.00 0.17 ? 26  ILE A H    1  
ATOM   389   H HA   . ILE A 1 26 ? 0.745   5.069   1.191   1.00 0.14 ? 26  ILE A HA   1  
ATOM   390   H HB   . ILE A 1 26 ? 3.422   5.723   2.428   1.00 0.17 ? 26  ILE A HB   1  
ATOM   391   H HG12 . ILE A 1 26 ? 2.678   3.950   0.090   1.00 0.15 ? 26  ILE A HG12 1  
ATOM   392   H HG13 . ILE A 1 26 ? 3.503   5.502   -0.014  1.00 0.16 ? 26  ILE A HG13 1  
ATOM   393   H HG21 . ILE A 1 26 ? 2.227   4.143   3.809   1.00 0.15 ? 26  ILE A HG21 1  
ATOM   394   H HG22 . ILE A 1 26 ? 3.517   3.308   2.943   1.00 0.16 ? 26  ILE A HG22 1  
ATOM   395   H HG23 . ILE A 1 26 ? 1.846   3.153   2.400   1.00 0.14 ? 26  ILE A HG23 1  
ATOM   396   H HD11 . ILE A 1 26 ? 4.568   3.018   1.309   1.00 0.16 ? 26  ILE A HD11 1  
ATOM   397   H HD12 . ILE A 1 26 ? 5.397   4.573   1.212   1.00 0.19 ? 26  ILE A HD12 1  
ATOM   398   H HD13 . ILE A 1 26 ? 5.060   3.660   -0.259  1.00 0.17 ? 26  ILE A HD13 1  
ATOM   399   N N    . GLY A 1 27 ? 1.318   7.106   3.725   1.00 0.16 ? 27  GLY A N    1  
ATOM   400   C CA   . GLY A 1 27 ? 0.808   7.505   5.024   1.00 0.16 ? 27  GLY A CA   1  
ATOM   401   C C    . GLY A 1 27 ? -0.696  7.707   5.020   1.00 0.15 ? 27  GLY A C    1  
ATOM   402   O O    . GLY A 1 27 ? -1.383  7.315   5.963   1.00 0.15 ? 27  GLY A O    1  
ATOM   403   H H    . GLY A 1 27 ? 2.059   7.601   3.317   1.00 0.17 ? 27  GLY A H    1  
ATOM   404   H HA2  . GLY A 1 27 ? 1.056   6.740   5.746   1.00 0.16 ? 27  GLY A HA2  1  
ATOM   405   H HA3  . GLY A 1 27 ? 1.284   8.429   5.316   1.00 0.17 ? 27  GLY A HA3  1  
ATOM   406   N N    . ALA A 1 28 ? -1.205  8.320   3.958   1.00 0.15 ? 28  ALA A N    1  
ATOM   407   C CA   . ALA A 1 28 ? -2.635  8.573   3.835   1.00 0.14 ? 28  ALA A CA   1  
ATOM   408   C C    . ALA A 1 28 ? -3.396  7.286   3.535   1.00 0.13 ? 28  ALA A C    1  
ATOM   409   O O    . ALA A 1 28 ? -4.463  7.039   4.098   1.00 0.12 ? 28  ALA A O    1  
ATOM   410   C CB   . ALA A 1 28 ? -2.899  9.607   2.750   1.00 0.15 ? 28  ALA A CB   1  
ATOM   411   H H    . ALA A 1 28 ? -0.605  8.608   3.238   1.00 0.16 ? 28  ALA A H    1  
ATOM   412   H HA   . ALA A 1 28 ? -2.983  8.974   4.775   1.00 0.15 ? 28  ALA A HA   1  
ATOM   413   H HB1  . ALA A 1 28 ? -3.957  9.823   2.707   1.00 0.14 ? 28  ALA A HB1  1  
ATOM   414   H HB2  . ALA A 1 28 ? -2.571  9.221   1.797   1.00 0.14 ? 28  ALA A HB2  1  
ATOM   415   H HB3  . ALA A 1 28 ? -2.355  10.513  2.977   1.00 0.16 ? 28  ALA A HB3  1  
ATOM   416   N N    . MET A 1 29 ? -2.842  6.470   2.645   1.00 0.13 ? 29  MET A N    1  
ATOM   417   C CA   . MET A 1 29 ? -3.469  5.208   2.272   1.00 0.11 ? 29  MET A CA   1  
ATOM   418   C C    . MET A 1 29 ? -3.599  4.287   3.479   1.00 0.11 ? 29  MET A C    1  
ATOM   419   O O    . MET A 1 29 ? -4.599  3.584   3.635   1.00 0.10 ? 29  MET A O    1  
ATOM   420   C CB   . MET A 1 29 ? -2.659  4.517   1.172   1.00 0.11 ? 29  MET A CB   1  
ATOM   421   C CG   . MET A 1 29 ? -3.270  3.207   0.702   1.00 0.10 ? 29  MET A CG   1  
ATOM   422   S SD   . MET A 1 29 ? -2.025  1.982   0.252   1.00 0.10 ? 29  MET A SD   1  
ATOM   423   C CE   . MET A 1 29 ? -1.176  1.774   1.817   1.00 0.11 ? 29  MET A CE   1  
ATOM   424   H H    . MET A 1 29 ? -1.991  6.724   2.229   1.00 0.13 ? 29  MET A H    1  
ATOM   425   H HA   . MET A 1 29 ? -4.456  5.428   1.896   1.00 0.11 ? 29  MET A HA   1  
ATOM   426   H HB2  . MET A 1 29 ? -2.586  5.180   0.324   1.00 0.12 ? 29  MET A HB2  1  
ATOM   427   H HB3  . MET A 1 29 ? -1.668  4.313   1.546   1.00 0.12 ? 29  MET A HB3  1  
ATOM   428   H HG2  . MET A 1 29 ? -3.880  2.803   1.496   1.00 0.10 ? 29  MET A HG2  1  
ATOM   429   H HG3  . MET A 1 29 ? -3.889  3.403   -0.161  1.00 0.10 ? 29  MET A HG3  1  
ATOM   430   H HE1  . MET A 1 29 ? -0.535  2.624   1.995   1.00 0.12 ? 29  MET A HE1  1  
ATOM   431   H HE2  . MET A 1 29 ? -0.582  0.872   1.788   1.00 0.11 ? 29  MET A HE2  1  
ATOM   432   H HE3  . MET A 1 29 ? -1.904  1.700   2.612   1.00 0.11 ? 29  MET A HE3  1  
ATOM   433   N N    . LEU A 1 30 ? -2.582  4.291   4.335   1.00 0.12 ? 30  LEU A N    1  
ATOM   434   C CA   . LEU A 1 30 ? -2.580  3.455   5.530   1.00 0.12 ? 30  LEU A CA   1  
ATOM   435   C C    . LEU A 1 30 ? -3.757  3.803   6.437   1.00 0.12 ? 30  LEU A C    1  
ATOM   436   O O    . LEU A 1 30 ? -4.532  2.931   6.826   1.00 0.11 ? 30  LEU A O    1  
ATOM   437   C CB   . LEU A 1 30 ? -1.266  3.622   6.292   1.00 0.13 ? 30  LEU A CB   1  
ATOM   438   C CG   . LEU A 1 30 ? -0.286  2.452   6.203   1.00 0.13 ? 30  LEU A CG   1  
ATOM   439   C CD1  . LEU A 1 30 ? 0.118   2.200   4.760   1.00 0.13 ? 30  LEU A CD1  1  
ATOM   440   C CD2  . LEU A 1 30 ? 0.940   2.717   7.066   1.00 0.15 ? 30  LEU A CD2  1  
ATOM   441   H H    . LEU A 1 30 ? -1.812  4.871   4.157   1.00 0.13 ? 30  LEU A H    1  
ATOM   442   H HA   . LEU A 1 30 ? -2.677  2.426   5.216   1.00 0.11 ? 30  LEU A HA   1  
ATOM   443   H HB2  . LEU A 1 30 ? -0.770  4.504   5.914   1.00 0.14 ? 30  LEU A HB2  1  
ATOM   444   H HB3  . LEU A 1 30 ? -1.501  3.785   7.334   1.00 0.14 ? 30  LEU A HB3  1  
ATOM   445   H HG   . LEU A 1 30 ? -0.768  1.559   6.574   1.00 0.13 ? 30  LEU A HG   1  
ATOM   446   H HD11 . LEU A 1 30 ? 0.411   3.133   4.301   1.00 0.13 ? 30  LEU A HD11 1  
ATOM   447   H HD12 . LEU A 1 30 ? -0.716  1.780   4.222   1.00 0.12 ? 30  LEU A HD12 1  
ATOM   448   H HD13 . LEU A 1 30 ? 0.949   1.511   4.734   1.00 0.13 ? 30  LEU A HD13 1  
ATOM   449   H HD21 . LEU A 1 30 ? 1.606   1.868   7.015   1.00 0.15 ? 30  LEU A HD21 1  
ATOM   450   H HD22 . LEU A 1 30 ? 0.635   2.875   8.089   1.00 0.16 ? 30  LEU A HD22 1  
ATOM   451   H HD23 . LEU A 1 30 ? 1.452   3.597   6.703   1.00 0.15 ? 30  LEU A HD23 1  
ATOM   452   N N    . SER A 1 31 ? -3.882  5.084   6.770   1.00 0.13 ? 31  SER A N    1  
ATOM   453   C CA   . SER A 1 31 ? -4.962  5.549   7.633   1.00 0.13 ? 31  SER A CA   1  
ATOM   454   C C    . SER A 1 31 ? -6.315  5.083   7.106   1.00 0.12 ? 31  SER A C    1  
ATOM   455   O O    . SER A 1 31 ? -7.252  4.860   7.876   1.00 0.12 ? 31  SER A O    1  
ATOM   456   C CB   . SER A 1 31 ? -4.939  7.074   7.739   1.00 0.14 ? 31  SER A CB   1  
ATOM   457   O OG   . SER A 1 31 ? -6.203  7.576   8.141   1.00 0.14 ? 31  SER A OG   1  
ATOM   458   H H    . SER A 1 31 ? -3.234  5.734   6.425   1.00 0.13 ? 31  SER A H    1  
ATOM   459   H HA   . SER A 1 31 ? -4.806  5.125   8.615   1.00 0.13 ? 31  SER A HA   1  
ATOM   460   H HB2  . SER A 1 31 ? -4.199  7.371   8.468   1.00 0.15 ? 31  SER A HB2  1  
ATOM   461   H HB3  . SER A 1 31 ? -4.686  7.495   6.777   1.00 0.14 ? 31  SER A HB3  1  
ATOM   462   H HG   . SER A 1 31 ? -6.747  6.853   8.463   1.00 0.13 ? 31  SER A HG   1  
ATOM   463   N N    . LEU A 1 32 ? -6.413  4.941   5.789   1.00 0.11 ? 32  LEU A N    1  
ATOM   464   C CA   . LEU A 1 32 ? -7.654  4.504   5.156   1.00 0.10 ? 32  LEU A CA   1  
ATOM   465   C C    . LEU A 1 32 ? -7.819  2.991   5.270   1.00 0.09 ? 32  LEU A C    1  
ATOM   466   O O    . LEU A 1 32 ? -8.932  2.486   5.412   1.00 0.09 ? 32  LEU A O    1  
ATOM   467   C CB   . LEU A 1 32 ? -7.673  4.920   3.685   1.00 0.10 ? 32  LEU A CB   1  
ATOM   468   C CG   . LEU A 1 32 ? -8.951  4.592   2.911   1.00 0.09 ? 32  LEU A CG   1  
ATOM   469   C CD1  . LEU A 1 32 ? -8.948  3.138   2.468   1.00 0.08 ? 32  LEU A CD1  1  
ATOM   470   C CD2  . LEU A 1 32 ? -10.179 4.891   3.759   1.00 0.09 ? 32  LEU A CD2  1  
ATOM   471   H H    . LEU A 1 32 ? -5.633  5.136   5.228   1.00 0.11 ? 32  LEU A H    1  
ATOM   472   H HA   . LEU A 1 32 ? -8.471  4.985   5.668   1.00 0.10 ? 32  LEU A HA   1  
ATOM   473   H HB2  . LEU A 1 32 ? -7.518  5.989   3.639   1.00 0.10 ? 32  LEU A HB2  1  
ATOM   474   H HB3  . LEU A 1 32 ? -6.847  4.435   3.189   1.00 0.09 ? 32  LEU A HB3  1  
ATOM   475   H HG   . LEU A 1 32 ? -8.996  5.210   2.026   1.00 0.09 ? 32  LEU A HG   1  
ATOM   476   H HD11 . LEU A 1 32 ? -8.080  2.951   1.853   1.00 0.08 ? 32  LEU A HD11 1  
ATOM   477   H HD12 . LEU A 1 32 ? -9.842  2.932   1.900   1.00 0.08 ? 32  LEU A HD12 1  
ATOM   478   H HD13 . LEU A 1 32 ? -8.917  2.497   3.337   1.00 0.08 ? 32  LEU A HD13 1  
ATOM   479   H HD21 . LEU A 1 32 ? -11.069 4.630   3.206   1.00 0.09 ? 32  LEU A HD21 1  
ATOM   480   H HD22 . LEU A 1 32 ? -10.201 5.943   4.000   1.00 0.10 ? 32  LEU A HD22 1  
ATOM   481   H HD23 . LEU A 1 32 ? -10.138 4.313   4.667   1.00 0.09 ? 32  LEU A HD23 1  
ATOM   482   N N    . LEU A 1 33 ? -6.703  2.273   5.209   1.00 0.09 ? 33  LEU A N    1  
ATOM   483   C CA   . LEU A 1 33 ? -6.723  0.819   5.307   1.00 0.08 ? 33  LEU A CA   1  
ATOM   484   C C    . LEU A 1 33 ? -6.980  0.373   6.744   1.00 0.09 ? 33  LEU A C    1  
ATOM   485   O O    . LEU A 1 33 ? -7.169  -0.813  7.010   1.00 0.09 ? 33  LEU A O    1  
ATOM   486   C CB   . LEU A 1 33 ? -5.397  0.235   4.811   1.00 0.08 ? 33  LEU A CB   1  
ATOM   487   C CG   . LEU A 1 33 ? -5.365  -0.203  3.345   1.00 0.08 ? 33  LEU A CG   1  
ATOM   488   C CD1  . LEU A 1 33 ? -3.966  -0.656  2.955   1.00 0.08 ? 33  LEU A CD1  1  
ATOM   489   C CD2  . LEU A 1 33 ? -6.377  -1.312  3.098   1.00 0.07 ? 33  LEU A CD2  1  
ATOM   490   H H    . LEU A 1 33 ? -5.845  2.733   5.095   1.00 0.10 ? 33  LEU A H    1  
ATOM   491   H HA   . LEU A 1 33 ? -7.524  0.458   4.683   1.00 0.08 ? 33  LEU A HA   1  
ATOM   492   H HB2  . LEU A 1 33 ? -4.628  0.980   4.956   1.00 0.09 ? 33  LEU A HB2  1  
ATOM   493   H HB3  . LEU A 1 33 ? -5.161  -0.621  5.422   1.00 0.09 ? 33  LEU A HB3  1  
ATOM   494   H HG   . LEU A 1 33 ? -5.630  0.637   2.719   1.00 0.08 ? 33  LEU A HG   1  
ATOM   495   H HD11 . LEU A 1 33 ? -3.988  -1.076  1.961   1.00 0.09 ? 33  LEU A HD11 1  
ATOM   496   H HD12 . LEU A 1 33 ? -3.621  -1.402  3.654   1.00 0.10 ? 33  LEU A HD12 1  
ATOM   497   H HD13 . LEU A 1 33 ? -3.296  0.191   2.973   1.00 0.10 ? 33  LEU A HD13 1  
ATOM   498   H HD21 . LEU A 1 33 ? -5.980  -2.249  3.462   1.00 0.07 ? 33  LEU A HD21 1  
ATOM   499   H HD22 . LEU A 1 33 ? -6.570  -1.389  2.040   1.00 0.06 ? 33  LEU A HD22 1  
ATOM   500   H HD23 . LEU A 1 33 ? -7.295  -1.087  3.614   1.00 0.07 ? 33  LEU A HD23 1  
ATOM   501   N N    . GLN A 1 34 ? -6.988  1.332   7.663   1.00 0.10 ? 34  GLN A N    1  
ATOM   502   C CA   . GLN A 1 34 ? -7.224  1.039   9.072   1.00 0.11 ? 34  GLN A CA   1  
ATOM   503   C C    . GLN A 1 34 ? -8.632  1.451   9.485   1.00 0.11 ? 34  GLN A C    1  
ATOM   504   O O    . GLN A 1 34 ? -9.230  0.851   10.380  1.00 0.12 ? 34  GLN A O    1  
ATOM   505   C CB   . GLN A 1 34 ? -6.192  1.757   9.944   1.00 0.12 ? 34  GLN A CB   1  
ATOM   506   C CG   . GLN A 1 34 ? -4.753  1.459   9.555   1.00 0.13 ? 34  GLN A CG   1  
ATOM   507   C CD   . GLN A 1 34 ? -3.875  1.165   10.755  1.00 0.14 ? 34  GLN A CD   1  
ATOM   508   O OE1  . GLN A 1 34 ? -4.038  1.761   11.820  1.00 0.15 ? 34  GLN A OE1  1  
ATOM   509   N NE2  . GLN A 1 34 ? -2.938  0.239   10.589  1.00 0.14 ? 34  GLN A NE2  1  
ATOM   510   H H    . GLN A 1 34 ? -6.828  2.260   7.388   1.00 0.10 ? 34  GLN A H    1  
ATOM   511   H HA   . GLN A 1 34 ? -7.118  -0.027  9.210   1.00 0.11 ? 34  GLN A HA   1  
ATOM   512   H HB2  . GLN A 1 34 ? -6.352  2.824   9.865   1.00 0.13 ? 34  GLN A HB2  1  
ATOM   513   H HB3  . GLN A 1 34 ? -6.335  1.457   10.972  1.00 0.13 ? 34  GLN A HB3  1  
ATOM   514   H HG2  . GLN A 1 34 ? -4.741  0.602   8.900   1.00 0.12 ? 34  GLN A HG2  1  
ATOM   515   H HG3  . GLN A 1 34 ? -4.349  2.315   9.034   1.00 0.13 ? 34  GLN A HG3  1  
ATOM   516   H HE21 . GLN A 1 34 ? -2.865  -0.195  9.714   1.00 0.13 ? 34  GLN A HE21 1  
ATOM   517   H HE22 . GLN A 1 34 ? -2.358  0.028   11.349  1.00 0.15 ? 34  GLN A HE22 1  
ATOM   518   N N    . LYS A 1 35 ? -9.159  2.478   8.828   1.00 0.11 ? 35  LYS A N    1  
ATOM   519   C CA   . LYS A 1 35 ? -10.499 2.970   9.125   1.00 0.11 ? 35  LYS A CA   1  
ATOM   520   C C    . LYS A 1 35 ? -11.562 2.078   8.488   1.00 0.11 ? 35  LYS A C    1  
ATOM   521   O O    . LYS A 1 35 ? -12.624 1.854   9.067   1.00 0.11 ? 35  LYS A O    1  
ATOM   522   C CB   . LYS A 1 35 ? -10.659 4.407   8.625   1.00 0.12 ? 35  LYS A CB   1  
ATOM   523   C CG   . LYS A 1 35 ? -10.847 4.510   7.122   1.00 0.11 ? 35  LYS A CG   1  
ATOM   524   C CD   . LYS A 1 35 ? -11.034 5.954   6.681   1.00 0.11 ? 35  LYS A CD   1  
ATOM   525   C CE   . LYS A 1 35 ? -12.352 6.145   5.946   1.00 0.11 ? 35  LYS A CE   1  
ATOM   526   N NZ   . LYS A 1 35 ? -13.012 7.426   6.316   1.00 0.12 ? 35  LYS A NZ   1  
ATOM   527   H H    . LYS A 1 35 ? -8.633  2.918   8.128   1.00 0.11 ? 35  LYS A H    1  
ATOM   528   H HA   . LYS A 1 35 ? -10.628 2.956   10.197  1.00 0.12 ? 35  LYS A HA   1  
ATOM   529   H HB2  . LYS A 1 35 ? -11.520 4.849   9.105   1.00 0.12 ? 35  LYS A HB2  1  
ATOM   530   H HB3  . LYS A 1 35 ? -9.778  4.971   8.896   1.00 0.12 ? 35  LYS A HB3  1  
ATOM   531   H HG2  . LYS A 1 35 ? -9.974  4.106   6.634   1.00 0.10 ? 35  LYS A HG2  1  
ATOM   532   H HG3  . LYS A 1 35 ? -11.717 3.939   6.838   1.00 0.10 ? 35  LYS A HG3  1  
ATOM   533   H HD2  . LYS A 1 35 ? -11.027 6.590   7.554   1.00 0.12 ? 35  LYS A HD2  1  
ATOM   534   H HD3  . LYS A 1 35 ? -10.222 6.230   6.026   1.00 0.11 ? 35  LYS A HD3  1  
ATOM   535   H HE2  . LYS A 1 35 ? -12.161 6.142   4.883   1.00 0.11 ? 35  LYS A HE2  1  
ATOM   536   H HE3  . LYS A 1 35 ? -13.011 5.326   6.193   1.00 0.11 ? 35  LYS A HE3  1  
ATOM   537   H HZ1  . LYS A 1 35 ? -13.210 7.446   7.336   1.00 0.13 ? 35  LYS A HZ1  1  
ATOM   538   H HZ2  . LYS A 1 35 ? -13.907 7.530   5.798   1.00 0.12 ? 35  LYS A HZ2  1  
ATOM   539   H HZ3  . LYS A 1 35 ? -12.393 8.229   6.078   1.00 0.12 ? 35  LYS A HZ3  1  
ATOM   540   N N    . GLU A 1 36 ? -11.263 1.573   7.296   1.00 0.10 ? 36  GLU A N    1  
ATOM   541   C CA   . GLU A 1 36 ? -12.195 0.704   6.582   1.00 0.09 ? 36  GLU A CA   1  
ATOM   542   C C    . GLU A 1 36 ? -12.278 -0.667  7.247   1.00 0.09 ? 36  GLU A C    1  
ATOM   543   O O    . GLU A 1 36 ? -13.133 -1.483  6.907   1.00 0.09 ? 36  GLU A O    1  
ATOM   544   C CB   . GLU A 1 36 ? -11.764 0.549   5.122   1.00 0.08 ? 36  GLU A CB   1  
ATOM   545   C CG   . GLU A 1 36 ? -11.751 1.858   4.350   1.00 0.08 ? 36  GLU A CG   1  
ATOM   546   C CD   . GLU A 1 36 ? -13.142 2.413   4.120   1.00 0.09 ? 36  GLU A CD   1  
ATOM   547   O OE1  . GLU A 1 36 ? -13.255 3.488   3.493   1.00 0.09 ? 36  GLU A OE1  1  
ATOM   548   O OE2  . GLU A 1 36 ? -14.117 1.775   4.564   1.00 0.09 ? 36  GLU A OE2  1  
ATOM   549   H H    . GLU A 1 36 ? -10.400 1.789   6.885   1.00 0.09 ? 36  GLU A H    1  
ATOM   550   H HA   . GLU A 1 36 ? -13.170 1.168   6.614   1.00 0.10 ? 36  GLU A HA   1  
ATOM   551   H HB2  . GLU A 1 36 ? -10.768 0.132   5.096   1.00 0.08 ? 36  GLU A HB2  1  
ATOM   552   H HB3  . GLU A 1 36 ? -12.443 -0.129  4.628   1.00 0.08 ? 36  GLU A HB3  1  
ATOM   553   H HG2  . GLU A 1 36 ? -11.179 2.584   4.909   1.00 0.09 ? 36  GLU A HG2  1  
ATOM   554   H HG3  . GLU A 1 36 ? -11.281 1.691   3.392   1.00 0.08 ? 36  GLU A HG3  1  
ATOM   555   N N    . GLY A 1 37 ? -11.383 -0.911  8.200   1.00 0.10 ? 37  GLY A N    1  
ATOM   556   C CA   . GLY A 1 37 ? -11.373 -2.184  8.899   1.00 0.10 ? 37  GLY A CA   1  
ATOM   557   C C    . GLY A 1 37 ? -10.651 -3.265  8.120   1.00 0.09 ? 37  GLY A C    1  
ATOM   558   O O    . GLY A 1 37 ? -10.649 -4.430  8.519   1.00 0.10 ? 37  GLY A O    1  
ATOM   559   H H    . GLY A 1 37 ? -10.727 -0.220  8.433   1.00 0.10 ? 37  GLY A H    1  
ATOM   560   H HA2  . GLY A 1 37 ? -10.884 -2.054  9.853   1.00 0.11 ? 37  GLY A HA2  1  
ATOM   561   H HA3  . GLY A 1 37 ? -12.392 -2.497  9.068   1.00 0.11 ? 37  GLY A HA3  1  
ATOM   562   N N    . LEU A 1 38 ? -10.034 -2.880  7.008   1.00 0.08 ? 38  LEU A N    1  
ATOM   563   C CA   . LEU A 1 38 ? -9.305  -3.828  6.171   1.00 0.08 ? 38  LEU A CA   1  
ATOM   564   C C    . LEU A 1 38 ? -8.000  -4.251  6.837   1.00 0.08 ? 38  LEU A C    1  
ATOM   565   O O    . LEU A 1 38 ? -7.451  -5.311  6.533   1.00 0.08 ? 38  LEU A O    1  
ATOM   566   C CB   . LEU A 1 38 ? -9.015  -3.208  4.802   1.00 0.07 ? 38  LEU A CB   1  
ATOM   567   C CG   . LEU A 1 38 ? -10.225 -2.981  3.898   1.00 0.06 ? 38  LEU A CG   1  
ATOM   568   C CD1  . LEU A 1 38 ? -9.913  -1.938  2.837   1.00 0.06 ? 38  LEU A CD1  1  
ATOM   569   C CD2  . LEU A 1 38 ? -10.659 -4.289  3.250   1.00 0.06 ? 38  LEU A CD2  1  
ATOM   570   H H    . LEU A 1 38 ? -10.072 -1.937  6.742   1.00 0.08 ? 38  LEU A H    1  
ATOM   571   H HA   . LEU A 1 38 ? -9.927  -4.699  6.037   1.00 0.08 ? 38  LEU A HA   1  
ATOM   572   H HB2  . LEU A 1 38 ? -8.531  -2.256  4.961   1.00 0.07 ? 38  LEU A HB2  1  
ATOM   573   H HB3  . LEU A 1 38 ? -8.326  -3.856  4.282   1.00 0.06 ? 38  LEU A HB3  1  
ATOM   574   H HG   . LEU A 1 38 ? -11.048 -2.614  4.495   1.00 0.07 ? 38  LEU A HG   1  
ATOM   575   H HD11 . LEU A 1 38 ? -9.673  -0.999  3.315   1.00 0.06 ? 38  LEU A HD11 1  
ATOM   576   H HD12 . LEU A 1 38 ? -10.773 -1.806  2.197   1.00 0.06 ? 38  LEU A HD12 1  
ATOM   577   H HD13 . LEU A 1 38 ? -9.071  -2.266  2.245   1.00 0.05 ? 38  LEU A HD13 1  
ATOM   578   H HD21 . LEU A 1 38 ? -9.837  -4.701  2.684   1.00 0.06 ? 38  LEU A HD21 1  
ATOM   579   H HD22 . LEU A 1 38 ? -11.492 -4.103  2.588   1.00 0.06 ? 38  LEU A HD22 1  
ATOM   580   H HD23 . LEU A 1 38 ? -10.957 -4.990  4.015   1.00 0.07 ? 38  LEU A HD23 1  
ATOM   581   N N    . LEU A 1 39 ? -7.510  -3.417  7.750   1.00 0.09 ? 39  LEU A N    1  
ATOM   582   C CA   . LEU A 1 39 ? -6.270  -3.707  8.462   1.00 0.10 ? 39  LEU A CA   1  
ATOM   583   C C    . LEU A 1 39 ? -6.353  -3.237  9.910   1.00 0.11 ? 39  LEU A C    1  
ATOM   584   O O    . LEU A 1 39 ? -7.031  -2.258  10.218  1.00 0.11 ? 39  LEU A O    1  
ATOM   585   C CB   . LEU A 1 39 ? -5.088  -3.033  7.762   1.00 0.10 ? 39  LEU A CB   1  
ATOM   586   C CG   . LEU A 1 39 ? -4.753  -3.552  6.362   1.00 0.09 ? 39  LEU A CG   1  
ATOM   587   C CD1  . LEU A 1 39 ? -3.539  -2.826  5.802   1.00 0.09 ? 39  LEU A CD1  1  
ATOM   588   C CD2  . LEU A 1 39 ? -4.512  -5.054  6.394   1.00 0.09 ? 39  LEU A CD2  1  
ATOM   589   H H    . LEU A 1 39 ? -7.993  -2.588  7.947   1.00 0.09 ? 39  LEU A H    1  
ATOM   590   H HA   . LEU A 1 39 ? -6.123  -4.776  8.450   1.00 0.10 ? 39  LEU A HA   1  
ATOM   591   H HB2  . LEU A 1 39 ? -5.300  -1.977  7.686   1.00 0.10 ? 39  LEU A HB2  1  
ATOM   592   H HB3  . LEU A 1 39 ? -4.214  -3.161  8.384   1.00 0.11 ? 39  LEU A HB3  1  
ATOM   593   H HG   . LEU A 1 39 ? -5.589  -3.359  5.705   1.00 0.08 ? 39  LEU A HG   1  
ATOM   594   H HD11 . LEU A 1 39 ? -3.424  -3.073  4.757   1.00 0.08 ? 39  LEU A HD11 1  
ATOM   595   H HD12 . LEU A 1 39 ? -2.656  -3.135  6.342   1.00 0.10 ? 39  LEU A HD12 1  
ATOM   596   H HD13 . LEU A 1 39 ? -3.671  -1.762  5.910   1.00 0.09 ? 39  LEU A HD13 1  
ATOM   597   H HD21 . LEU A 1 39 ? -3.840  -5.328  5.594   1.00 0.08 ? 39  LEU A HD21 1  
ATOM   598   H HD22 . LEU A 1 39 ? -5.452  -5.570  6.265   1.00 0.08 ? 39  LEU A HD22 1  
ATOM   599   H HD23 . LEU A 1 39 ? -4.078  -5.329  7.343   1.00 0.10 ? 39  LEU A HD23 1  
ATOM   600   N N    . MET A 1 40 ? -5.657  -3.942  10.795  1.00 0.12 ? 40  MET A N    1  
ATOM   601   C CA   . MET A 1 40 ? -5.649  -3.596  12.212  1.00 0.14 ? 40  MET A CA   1  
ATOM   602   C C    . MET A 1 40 ? -4.356  -2.876  12.589  1.00 0.14 ? 40  MET A C    1  
ATOM   603   O O    . MET A 1 40 ? -4.307  -2.150  13.581  1.00 0.15 ? 40  MET A O    1  
ATOM   604   C CB   . MET A 1 40 ? -5.815  -4.853  13.068  1.00 0.14 ? 40  MET A CB   1  
ATOM   605   C CG   . MET A 1 40 ? -6.176  -4.560  14.516  1.00 0.16 ? 40  MET A CG   1  
ATOM   606   S SD   . MET A 1 40 ? -5.527  -5.795  15.658  1.00 0.17 ? 40  MET A SD   1  
ATOM   607   C CE   . MET A 1 40 ? -3.782  -5.393  15.636  1.00 0.17 ? 40  MET A CE   1  
ATOM   608   H H    . MET A 1 40 ? -5.136  -4.714  10.489  1.00 0.12 ? 40  MET A H    1  
ATOM   609   H HA   . MET A 1 40 ? -6.482  -2.934  12.395  1.00 0.14 ? 40  MET A HA   1  
ATOM   610   H HB2  . MET A 1 40 ? -6.596  -5.464  12.642  1.00 0.14 ? 40  MET A HB2  1  
ATOM   611   H HB3  . MET A 1 40 ? -4.888  -5.407  13.056  1.00 0.14 ? 40  MET A HB3  1  
ATOM   612   H HG2  . MET A 1 40 ? -5.771  -3.594  14.785  1.00 0.16 ? 40  MET A HG2  1  
ATOM   613   H HG3  . MET A 1 40 ? -7.252  -4.535  14.607  1.00 0.15 ? 40  MET A HG3  1  
ATOM   614   H HE1  . MET A 1 40 ? -3.646  -4.361  15.928  1.00 0.18 ? 40  MET A HE1  1  
ATOM   615   H HE2  . MET A 1 40 ? -3.390  -5.539  14.641  1.00 0.17 ? 40  MET A HE2  1  
ATOM   616   H HE3  . MET A 1 40 ? -3.256  -6.034  16.328  1.00 0.18 ? 40  MET A HE3  1  
ATOM   617   N N    . SER A 1 41 ? -3.314  -3.085  11.790  1.00 0.14 ? 41  SER A N    1  
ATOM   618   C CA   . SER A 1 41 ? -2.022  -2.459  12.041  1.00 0.15 ? 41  SER A CA   1  
ATOM   619   C C    . SER A 1 41 ? -1.276  -2.207  10.736  1.00 0.14 ? 41  SER A C    1  
ATOM   620   O O    . SER A 1 41 ? -1.568  -2.804  9.699   1.00 0.13 ? 41  SER A O    1  
ATOM   621   C CB   . SER A 1 41 ? -1.176  -3.342  12.962  1.00 0.16 ? 41  SER A CB   1  
ATOM   622   O OG   . SER A 1 41 ? -1.724  -4.644  13.065  1.00 0.16 ? 41  SER A OG   1  
ATOM   623   H H    . SER A 1 41 ? -3.417  -3.674  11.014  1.00 0.13 ? 41  SER A H    1  
ATOM   624   H HA   . SER A 1 41 ? -2.201  -1.512  12.529  1.00 0.15 ? 41  SER A HA   1  
ATOM   625   H HB2  . SER A 1 41 ? -0.176  -3.416  12.565  1.00 0.16 ? 41  SER A HB2  1  
ATOM   626   H HB3  . SER A 1 41 ? -1.139  -2.900  13.947  1.00 0.17 ? 41  SER A HB3  1  
ATOM   627   H HG   . SER A 1 41 ? -1.486  -5.025  13.914  1.00 0.17 ? 41  SER A HG   1  
ATOM   628   N N    . PRO A 1 42 ? -0.291  -1.298  10.783  1.00 0.15 ? 42  PRO A N    1  
ATOM   629   C CA   . PRO A 1 42 ? 0.517   -0.944  9.613   1.00 0.15 ? 42  PRO A CA   1  
ATOM   630   C C    . PRO A 1 42 ? 1.447   -2.074  9.188   1.00 0.15 ? 42  PRO A C    1  
ATOM   631   O O    . PRO A 1 42 ? 1.976   -2.071  8.077   1.00 0.15 ? 42  PRO A O    1  
ATOM   632   C CB   . PRO A 1 42 ? 1.327   0.264   10.093  1.00 0.16 ? 42  PRO A CB   1  
ATOM   633   C CG   . PRO A 1 42 ? 1.401   0.106   11.572  1.00 0.17 ? 42  PRO A CG   1  
ATOM   634   C CD   . PRO A 1 42 ? 0.110   -0.545  11.985  1.00 0.17 ? 42  PRO A CD   1  
ATOM   635   H HA   . PRO A 1 42 ? -0.104  -0.656  8.777   1.00 0.14 ? 42  PRO A HA   1  
ATOM   636   H HB2  . PRO A 1 42 ? 2.314   0.246   9.647   1.00 0.17 ? 42  PRO A HB2  1  
ATOM   637   H HB3  . PRO A 1 42 ? 0.817   1.179   9.841   1.00 0.16 ? 42  PRO A HB3  1  
ATOM   638   H HG2  . PRO A 1 42 ? 2.242   -0.522  11.832  1.00 0.18 ? 42  PRO A HG2  1  
ATOM   639   H HG3  . PRO A 1 42 ? 1.491   1.073   12.043  1.00 0.18 ? 42  PRO A HG3  1  
ATOM   640   H HD2  . PRO A 1 42 ? 0.272   -1.211  12.820  1.00 0.17 ? 42  PRO A HD2  1  
ATOM   641   H HD3  . PRO A 1 42 ? -0.627  0.203   12.234  1.00 0.16 ? 42  PRO A HD3  1  
ATOM   642   N N    . SER A 1 43 ? 1.644   -3.040  10.080  1.00 0.16 ? 43  SER A N    1  
ATOM   643   C CA   . SER A 1 43 ? 2.514   -4.176  9.799   1.00 0.16 ? 43  SER A CA   1  
ATOM   644   C C    . SER A 1 43 ? 1.747   -5.281  9.079   1.00 0.15 ? 43  SER A C    1  
ATOM   645   O O    . SER A 1 43 ? 2.328   -6.286  8.666   1.00 0.15 ? 43  SER A O    1  
ATOM   646   C CB   . SER A 1 43 ? 3.116   -4.719  11.095  1.00 0.17 ? 43  SER A CB   1  
ATOM   647   O OG   . SER A 1 43 ? 2.104   -5.021  12.042  1.00 0.17 ? 43  SER A OG   1  
ATOM   648   H H    . SER A 1 43 ? 1.193   -2.988  10.948  1.00 0.16 ? 43  SER A H    1  
ATOM   649   H HA   . SER A 1 43 ? 3.312   -3.831  9.158   1.00 0.16 ? 43  SER A HA   1  
ATOM   650   H HB2  . SER A 1 43 ? 3.671   -5.620  10.882  1.00 0.17 ? 43  SER A HB2  1  
ATOM   651   H HB3  . SER A 1 43 ? 3.778   -3.979  11.520  1.00 0.18 ? 43  SER A HB3  1  
ATOM   652   H HG   . SER A 1 43 ? 2.082   -5.969  12.197  1.00 0.17 ? 43  SER A HG   1  
ATOM   653   N N    . ASP A 1 44 ? 0.441   -5.090  8.933   1.00 0.14 ? 44  ASP A N    1  
ATOM   654   C CA   . ASP A 1 44 ? -0.406  -6.069  8.263   1.00 0.12 ? 44  ASP A CA   1  
ATOM   655   C C    . ASP A 1 44 ? 0.003   -6.233  6.803   1.00 0.12 ? 44  ASP A C    1  
ATOM   656   O O    . ASP A 1 44 ? -0.367  -7.208  6.147   1.00 0.11 ? 44  ASP A O    1  
ATOM   657   C CB   . ASP A 1 44 ? -1.875  -5.651  8.350   1.00 0.12 ? 44  ASP A CB   1  
ATOM   658   C CG   . ASP A 1 44 ? -2.808  -6.835  8.496   1.00 0.11 ? 44  ASP A CG   1  
ATOM   659   O OD1  . ASP A 1 44 ? -2.546  -7.878  7.858   1.00 0.11 ? 44  ASP A OD1  1  
ATOM   660   O OD2  . ASP A 1 44 ? -3.799  -6.723  9.245   1.00 0.11 ? 44  ASP A OD2  1  
ATOM   661   H H    . ASP A 1 44 ? 0.036   -4.270  9.285   1.00 0.14 ? 44  ASP A H    1  
ATOM   662   H HA   . ASP A 1 44 ? -0.281  -7.017  8.767   1.00 0.13 ? 44  ASP A HA   1  
ATOM   663   H HB2  . ASP A 1 44 ? -2.009  -5.005  9.205   1.00 0.12 ? 44  ASP A HB2  1  
ATOM   664   H HB3  . ASP A 1 44 ? -2.141  -5.113  7.452   1.00 0.11 ? 44  ASP A HB3  1  
ATOM   665   N N    . LEU A 1 45 ? 0.768   -5.271  6.296   1.00 0.12 ? 45  LEU A N    1  
ATOM   666   C CA   . LEU A 1 45 ? 1.228   -5.306  4.913   1.00 0.12 ? 45  LEU A CA   1  
ATOM   667   C C    . LEU A 1 45 ? 2.123   -6.518  4.667   1.00 0.12 ? 45  LEU A C    1  
ATOM   668   O O    . LEU A 1 45 ? 2.362   -6.903  3.523   1.00 0.12 ? 45  LEU A O    1  
ATOM   669   C CB   . LEU A 1 45 ? 1.983   -4.022  4.571   1.00 0.12 ? 45  LEU A CB   1  
ATOM   670   C CG   . LEU A 1 45 ? 1.369   -3.155  3.471   1.00 0.12 ? 45  LEU A CG   1  
ATOM   671   C CD1  . LEU A 1 45 ? 1.648   -3.757  2.101   1.00 0.11 ? 45  LEU A CD1  1  
ATOM   672   C CD2  . LEU A 1 45 ? -0.129  -2.994  3.690   1.00 0.10 ? 45  LEU A CD2  1  
ATOM   673   H H    . LEU A 1 45 ? 1.031   -4.519  6.868   1.00 0.13 ? 45  LEU A H    1  
ATOM   674   H HA   . LEU A 1 45 ? 0.358   -5.383  4.278   1.00 0.11 ? 45  LEU A HA   1  
ATOM   675   H HB2  . LEU A 1 45 ? 2.051   -3.425  5.469   1.00 0.13 ? 45  LEU A HB2  1  
ATOM   676   H HB3  . LEU A 1 45 ? 2.983   -4.292  4.267   1.00 0.13 ? 45  LEU A HB3  1  
ATOM   677   H HG   . LEU A 1 45 ? 1.820   -2.174  3.501   1.00 0.12 ? 45  LEU A HG   1  
ATOM   678   H HD11 . LEU A 1 45 ? 2.697   -3.655  1.871   1.00 0.12 ? 45  LEU A HD11 1  
ATOM   679   H HD12 . LEU A 1 45 ? 1.063   -3.239  1.355   1.00 0.11 ? 45  LEU A HD12 1  
ATOM   680   H HD13 . LEU A 1 45 ? 1.380   -4.803  2.107   1.00 0.11 ? 45  LEU A HD13 1  
ATOM   681   H HD21 . LEU A 1 45 ? -0.474  -2.110  3.176   1.00 0.10 ? 45  LEU A HD21 1  
ATOM   682   H HD22 . LEU A 1 45 ? -0.330  -2.897  4.746   1.00 0.11 ? 45  LEU A HD22 1  
ATOM   683   H HD23 . LEU A 1 45 ? -0.645  -3.860  3.303   1.00 0.10 ? 45  LEU A HD23 1  
ATOM   684   N N    . TYR A 1 46 ? 2.614   -7.112  5.749   1.00 0.13 ? 46  TYR A N    1  
ATOM   685   C CA   . TYR A 1 46 ? 3.483   -8.278  5.652   1.00 0.14 ? 46  TYR A CA   1  
ATOM   686   C C    . TYR A 1 46 ? 2.670   -9.548  5.427   1.00 0.13 ? 46  TYR A C    1  
ATOM   687   O O    . TYR A 1 46 ? 3.218   -10.648 5.372   1.00 0.13 ? 46  TYR A O    1  
ATOM   688   C CB   . TYR A 1 46 ? 4.326   -8.418  6.919   1.00 0.15 ? 46  TYR A CB   1  
ATOM   689   C CG   . TYR A 1 46 ? 5.092   -7.165  7.280   1.00 0.16 ? 46  TYR A CG   1  
ATOM   690   C CD1  . TYR A 1 46 ? 5.653   -6.363  6.293   1.00 0.16 ? 46  TYR A CD1  1  
ATOM   691   C CD2  . TYR A 1 46 ? 5.255   -6.784  8.606   1.00 0.17 ? 46  TYR A CD2  1  
ATOM   692   C CE1  . TYR A 1 46 ? 6.354   -5.217  6.618   1.00 0.17 ? 46  TYR A CE1  1  
ATOM   693   C CE2  . TYR A 1 46 ? 5.952   -5.639  8.939   1.00 0.18 ? 46  TYR A CE2  1  
ATOM   694   C CZ   . TYR A 1 46 ? 6.500   -4.858  7.941   1.00 0.18 ? 46  TYR A CZ   1  
ATOM   695   O OH   . TYR A 1 46 ? 7.196   -3.718  8.271   1.00 0.19 ? 46  TYR A OH   1  
ATOM   696   H H    . TYR A 1 46 ? 2.386   -6.759  6.635   1.00 0.13 ? 46  TYR A H    1  
ATOM   697   H HA   . TYR A 1 46 ? 4.140   -8.131  4.808   1.00 0.14 ? 46  TYR A HA   1  
ATOM   698   H HB2  . TYR A 1 46 ? 3.680   -8.660  7.750   1.00 0.15 ? 46  TYR A HB2  1  
ATOM   699   H HB3  . TYR A 1 46 ? 5.042   -9.216  6.782   1.00 0.16 ? 46  TYR A HB3  1  
ATOM   700   H HD1  . TYR A 1 46 ? 5.536   -6.645  5.259   1.00 0.15 ? 46  TYR A HD1  1  
ATOM   701   H HD2  . TYR A 1 46 ? 4.825   -7.396  9.384   1.00 0.17 ? 46  TYR A HD2  1  
ATOM   702   H HE1  . TYR A 1 46 ? 6.782   -4.607  5.836   1.00 0.17 ? 46  TYR A HE1  1  
ATOM   703   H HE2  . TYR A 1 46 ? 6.066   -5.359  9.976   1.00 0.19 ? 46  TYR A HE2  1  
ATOM   704   H HH   . TYR A 1 46 ? 7.810   -3.912  8.984   1.00 0.20 ? 46  TYR A HH   1  
ATOM   705   N N    . SER A 1 47 ? 1.356   -9.386  5.295   1.00 0.12 ? 47  SER A N    1  
ATOM   706   C CA   . SER A 1 47 ? 0.464   -10.517 5.078   1.00 0.11 ? 47  SER A CA   1  
ATOM   707   C C    . SER A 1 47 ? -0.035  -10.550 3.637   1.00 0.10 ? 47  SER A C    1  
ATOM   708   O O    . SER A 1 47 ? -1.031  -9.919  3.282   1.00 0.09 ? 47  SER A O    1  
ATOM   709   C CB   . SER A 1 47 ? -0.724  -10.449 6.039   1.00 0.11 ? 47  SER A CB   1  
ATOM   710   O OG   . SER A 1 47 ? -0.441  -11.127 7.250   1.00 0.12 ? 47  SER A OG   1  
ATOM   711   H H    . SER A 1 47 ? 0.978   -8.484  5.346   1.00 0.12 ? 47  SER A H    1  
ATOM   712   H HA   . SER A 1 47 ? 1.021   -11.420 5.276   1.00 0.12 ? 47  SER A HA   1  
ATOM   713   H HB2  . SER A 1 47 ? -0.944  -9.416  6.262   1.00 0.11 ? 47  SER A HB2  1  
ATOM   714   H HB3  . SER A 1 47 ? -1.585  -10.909 5.576   1.00 0.10 ? 47  SER A HB3  1  
ATOM   715   H HG   . SER A 1 47 ? -0.834  -10.647 7.984   1.00 0.12 ? 47  SER A HG   1  
ATOM   716   N N    . PRO A 1 48 ? 0.675   -11.302 2.781   1.00 0.11 ? 48  PRO A N    1  
ATOM   717   C CA   . PRO A 1 48 ? 0.326   -11.435 1.364   1.00 0.10 ? 48  PRO A CA   1  
ATOM   718   C C    . PRO A 1 48 ? -0.955  -12.235 1.157   1.00 0.09 ? 48  PRO A C    1  
ATOM   719   O O    . PRO A 1 48 ? -1.436  -12.375 0.032   1.00 0.09 ? 48  PRO A O    1  
ATOM   720   C CB   . PRO A 1 48 ? 1.525   -12.179 0.772   1.00 0.11 ? 48  PRO A CB   1  
ATOM   721   C CG   . PRO A 1 48 ? 2.107   -12.933 1.917   1.00 0.12 ? 48  PRO A CG   1  
ATOM   722   C CD   . PRO A 1 48 ? 1.876   -12.079 3.134   1.00 0.12 ? 48  PRO A CD   1  
ATOM   723   H HA   . PRO A 1 48 ? 0.226   -10.469 0.889   1.00 0.10 ? 48  PRO A HA   1  
ATOM   724   H HB2  . PRO A 1 48 ? 1.191   -12.853 -0.009  1.00 0.11 ? 48  PRO A HB2  1  
ATOM   725   H HB3  . PRO A 1 48 ? 2.245   -11.478 0.384   1.00 0.11 ? 48  PRO A HB3  1  
ATOM   726   H HG2  . PRO A 1 48 ? 1.605   -13.886 2.021   1.00 0.12 ? 48  PRO A HG2  1  
ATOM   727   H HG3  . PRO A 1 48 ? 3.164   -13.078 1.766   1.00 0.13 ? 48  PRO A HG3  1  
ATOM   728   H HD2  . PRO A 1 48 ? 1.693   -12.701 3.998   1.00 0.12 ? 48  PRO A HD2  1  
ATOM   729   H HD3  . PRO A 1 48 ? 2.720   -11.428 3.306   1.00 0.12 ? 48  PRO A HD3  1  
ATOM   730   N N    . GLY A 1 49 ? -1.503  -12.758 2.248   1.00 0.09 ? 49  GLY A N    1  
ATOM   731   C CA   . GLY A 1 49 ? -2.725  -13.539 2.164   1.00 0.09 ? 49  GLY A CA   1  
ATOM   732   C C    . GLY A 1 49 ? -3.964  -12.709 2.445   1.00 0.08 ? 49  GLY A C    1  
ATOM   733   O O    . GLY A 1 49 ? -5.072  -13.241 2.515   1.00 0.08 ? 49  GLY A O    1  
ATOM   734   H H    . GLY A 1 49 ? -1.077  -12.613 3.119   1.00 0.10 ? 49  GLY A H    1  
ATOM   735   H HA2  . GLY A 1 49 ? -2.803  -13.958 1.172   1.00 0.09 ? 49  GLY A HA2  1  
ATOM   736   H HA3  . GLY A 1 49 ? -2.674  -14.344 2.881   1.00 0.10 ? 49  GLY A HA3  1  
ATOM   737   N N    . SER A 1 50 ? -3.775  -11.404 2.609   1.00 0.08 ? 50  SER A N    1  
ATOM   738   C CA   . SER A 1 50 ? -4.884  -10.501 2.890   1.00 0.07 ? 50  SER A CA   1  
ATOM   739   C C    . SER A 1 50 ? -4.999  -9.429  1.810   1.00 0.06 ? 50  SER A C    1  
ATOM   740   O O    . SER A 1 50 ? -5.822  -8.519  1.909   1.00 0.06 ? 50  SER A O    1  
ATOM   741   C CB   . SER A 1 50 ? -4.702  -9.845  4.259   1.00 0.08 ? 50  SER A CB   1  
ATOM   742   O OG   . SER A 1 50 ? -4.840  -10.792 5.303   1.00 0.09 ? 50  SER A OG   1  
ATOM   743   H H    . SER A 1 50 ? -2.867  -11.041 2.542   1.00 0.08 ? 50  SER A H    1  
ATOM   744   H HA   . SER A 1 50 ? -5.792  -11.085 2.899   1.00 0.07 ? 50  SER A HA   1  
ATOM   745   H HB2  . SER A 1 50 ? -3.717  -9.406  4.317   1.00 0.08 ? 50  SER A HB2  1  
ATOM   746   H HB3  . SER A 1 50 ? -5.447  -9.073  4.388   1.00 0.07 ? 50  SER A HB3  1  
ATOM   747   H HG   . SER A 1 50 ? -5.165  -11.621 4.942   1.00 0.09 ? 50  SER A HG   1  
ATOM   748   N N    . TRP A 1 51 ? -4.168  -9.543  0.781   1.00 0.07 ? 51  TRP A N    1  
ATOM   749   C CA   . TRP A 1 51 ? -4.174  -8.585  -0.318  1.00 0.06 ? 51  TRP A CA   1  
ATOM   750   C C    . TRP A 1 51 ? -5.434  -8.736  -1.164  1.00 0.06 ? 51  TRP A C    1  
ATOM   751   O O    . TRP A 1 51 ? -5.817  -7.819  -1.892  1.00 0.06 ? 51  TRP A O    1  
ATOM   752   C CB   . TRP A 1 51 ? -2.934  -8.770  -1.191  1.00 0.07 ? 51  TRP A CB   1  
ATOM   753   C CG   . TRP A 1 51 ? -1.664  -8.345  -0.517  1.00 0.08 ? 51  TRP A CG   1  
ATOM   754   C CD1  . TRP A 1 51 ? -1.546  -7.510  0.557   1.00 0.08 ? 51  TRP A CD1  1  
ATOM   755   C CD2  . TRP A 1 51 ? -0.332  -8.735  -0.873  1.00 0.09 ? 51  TRP A CD2  1  
ATOM   756   N NE1  . TRP A 1 51 ? -0.222  -7.356  0.891   1.00 0.09 ? 51  TRP A NE1  1  
ATOM   757   C CE2  . TRP A 1 51 ? 0.543   -8.099  0.030   1.00 0.10 ? 51  TRP A CE2  1  
ATOM   758   C CE3  . TRP A 1 51 ? 0.205   -9.560  -1.863  1.00 0.09 ? 51  TRP A CE3  1  
ATOM   759   C CZ2  . TRP A 1 51 ? 1.923   -8.262  -0.034  1.00 0.11 ? 51  TRP A CZ2  1  
ATOM   760   C CZ3  . TRP A 1 51 ? 1.575   -9.722  -1.924  1.00 0.11 ? 51  TRP A CZ3  1  
ATOM   761   C CH2  . TRP A 1 51 ? 2.422   -9.076  -1.014  1.00 0.11 ? 51  TRP A CH2  1  
ATOM   762   H H    . TRP A 1 51 ? -3.533  -10.290 0.760   1.00 0.07 ? 51  TRP A H    1  
ATOM   763   H HA   . TRP A 1 51 ? -4.159  -7.594  0.108   1.00 0.06 ? 51  TRP A HA   1  
ATOM   764   H HB2  . TRP A 1 51 ? -2.839  -9.813  -1.453  1.00 0.07 ? 51  TRP A HB2  1  
ATOM   765   H HB3  . TRP A 1 51 ? -3.045  -8.186  -2.092  1.00 0.07 ? 51  TRP A HB3  1  
ATOM   766   H HD1  . TRP A 1 51 ? -2.380  -7.043  1.059   1.00 0.07 ? 51  TRP A HD1  1  
ATOM   767   H HE1  . TRP A 1 51 ? 0.119   -6.807  1.627   1.00 0.09 ? 51  TRP A HE1  1  
ATOM   768   H HE3  . TRP A 1 51 ? -0.432  -10.067 -2.574  1.00 0.09 ? 51  TRP A HE3  1  
ATOM   769   H HZ2  . TRP A 1 51 ? 2.588   -7.773  0.660   1.00 0.11 ? 51  TRP A HZ2  1  
ATOM   770   H HZ3  . TRP A 1 51 ? 2.008   -10.356 -2.683  1.00 0.11 ? 51  TRP A HZ3  1  
ATOM   771   H HH2  . TRP A 1 51 ? 3.487   -9.231  -1.100  1.00 0.12 ? 51  TRP A HH2  1  
ATOM   772   N N    . ASP A 1 52 ? -6.073  -9.895  -1.065  1.00 0.06 ? 52  ASP A N    1  
ATOM   773   C CA   . ASP A 1 52 ? -7.289  -10.168 -1.822  1.00 0.07 ? 52  ASP A CA   1  
ATOM   774   C C    . ASP A 1 52 ? -8.415  -9.228  -1.393  1.00 0.06 ? 52  ASP A C    1  
ATOM   775   O O    . ASP A 1 52 ? -8.951  -8.457  -2.189  1.00 0.06 ? 52  ASP A O    1  
ATOM   776   C CB   . ASP A 1 52 ? -7.722  -11.621 -1.631  1.00 0.07 ? 52  ASP A CB   1  
ATOM   777   C CG   . ASP A 1 52 ? -7.296  -12.507 -2.785  1.00 0.08 ? 52  ASP A CG   1  
ATOM   778   O OD1  . ASP A 1 52 ? -8.059  -13.431 -3.139  1.00 0.09 ? 52  ASP A OD1  1  
ATOM   779   O OD2  . ASP A 1 52 ? -6.199  -12.277 -3.336  1.00 0.08 ? 52  ASP A OD2  1  
ATOM   780   H H    . ASP A 1 52 ? -5.716  -10.587 -0.470  1.00 0.06 ? 52  ASP A H    1  
ATOM   781   H HA   . ASP A 1 52 ? -7.074  -9.998  -2.866  1.00 0.07 ? 52  ASP A HA   1  
ATOM   782   H HB2  . ASP A 1 52 ? -7.279  -12.005 -0.725  1.00 0.07 ? 52  ASP A HB2  1  
ATOM   783   H HB3  . ASP A 1 52 ? -8.798  -11.661 -1.547  1.00 0.08 ? 52  ASP A HB3  1  
ATOM   784   N N    . PRO A 1 53 ? -8.784  -9.296  -0.105  1.00 0.06 ? 53  PRO A N    1  
ATOM   785   C CA   . PRO A 1 53 ? -9.848  -8.462  0.458   1.00 0.06 ? 53  PRO A CA   1  
ATOM   786   C C    . PRO A 1 53 ? -9.447  -6.993  0.548   1.00 0.05 ? 53  PRO A C    1  
ATOM   787   O O    . PRO A 1 53 ? -10.270 -6.134  0.866   1.00 0.06 ? 53  PRO A O    1  
ATOM   788   C CB   . PRO A 1 53 ? -10.056 -9.047  1.857   1.00 0.06 ? 53  PRO A CB   1  
ATOM   789   C CG   . PRO A 1 53 ? -8.753  -9.683  2.198   1.00 0.06 ? 53  PRO A CG   1  
ATOM   790   C CD   . PRO A 1 53 ? -8.188  -10.192 0.901   1.00 0.06 ? 53  PRO A CD   1  
ATOM   791   H HA   . PRO A 1 53 ? -10.761 -8.549  -0.112  1.00 0.07 ? 53  PRO A HA   1  
ATOM   792   H HB2  . PRO A 1 53 ? -10.299 -8.255  2.556   1.00 0.06 ? 53  PRO A HB2  1  
ATOM   793   H HB3  . PRO A 1 53 ? -10.838 -9.787  1.840   1.00 0.07 ? 53  PRO A HB3  1  
ATOM   794   H HG2  . PRO A 1 53 ? -8.090  -8.948  2.636   1.00 0.06 ? 53  PRO A HG2  1  
ATOM   795   H HG3  . PRO A 1 53 ? -8.909  -10.504 2.878   1.00 0.07 ? 53  PRO A HG3  1  
ATOM   796   H HD2  . PRO A 1 53 ? -7.112  -10.114 0.899   1.00 0.06 ? 53  PRO A HD2  1  
ATOM   797   H HD3  . PRO A 1 53 ? -8.495  -11.214 0.733   1.00 0.07 ? 53  PRO A HD3  1  
ATOM   798   N N    . ILE A 1 54 ? -8.179  -6.713  0.266   1.00 0.05 ? 54  ILE A N    1  
ATOM   799   C CA   . ILE A 1 54 ? -7.671  -5.348  0.315   1.00 0.05 ? 54  ILE A CA   1  
ATOM   800   C C    . ILE A 1 54 ? -7.518  -4.769  -1.089  1.00 0.05 ? 54  ILE A C    1  
ATOM   801   O O    . ILE A 1 54 ? -7.476  -3.550  -1.269  1.00 0.05 ? 54  ILE A O    1  
ATOM   802   C CB   . ILE A 1 54 ? -6.313  -5.278  1.037   1.00 0.05 ? 54  ILE A CB   1  
ATOM   803   C CG1  . ILE A 1 54 ? -6.456  -5.750  2.484   1.00 0.05 ? 54  ILE A CG1  1  
ATOM   804   C CG2  . ILE A 1 54 ? -5.758  -3.862  0.987   1.00 0.05 ? 54  ILE A CG2  1  
ATOM   805   C CD1  . ILE A 1 54 ? -5.133  -6.010  3.170   1.00 0.06 ? 54  ILE A CD1  1  
ATOM   806   H H    . ILE A 1 54 ? -7.572  -7.442  0.020   1.00 0.05 ? 54  ILE A H    1  
ATOM   807   H HA   . ILE A 1 54 ? -8.380  -4.747  0.866   1.00 0.05 ? 54  ILE A HA   1  
ATOM   808   H HB   . ILE A 1 54 ? -5.622  -5.927  0.521   1.00 0.05 ? 54  ILE A HB   1  
ATOM   809   H HG12 . ILE A 1 54 ? -6.979  -4.996  3.052   1.00 0.06 ? 54  ILE A HG12 1  
ATOM   810   H HG13 . ILE A 1 54 ? -7.026  -6.668  2.502   1.00 0.05 ? 54  ILE A HG13 1  
ATOM   811   H HG21 . ILE A 1 54 ? -4.868  -3.801  1.595   1.00 0.06 ? 54  ILE A HG21 1  
ATOM   812   H HG22 . ILE A 1 54 ? -6.500  -3.175  1.362   1.00 0.05 ? 54  ILE A HG22 1  
ATOM   813   H HG23 . ILE A 1 54 ? -5.514  -3.607  -0.034  1.00 0.06 ? 54  ILE A HG23 1  
ATOM   814   H HD11 . ILE A 1 54 ? -5.311  -6.413  4.155   1.00 0.07 ? 54  ILE A HD11 1  
ATOM   815   H HD12 . ILE A 1 54 ? -4.584  -5.084  3.254   1.00 0.07 ? 54  ILE A HD12 1  
ATOM   816   H HD13 . ILE A 1 54 ? -4.560  -6.717  2.590   1.00 0.06 ? 54  ILE A HD13 1  
ATOM   817   N N    . THR A 1 55 ? -7.437  -5.649  -2.082  1.00 0.06 ? 55  THR A N    1  
ATOM   818   C CA   . THR A 1 55 ? -7.290  -5.225  -3.467  1.00 0.06 ? 55  THR A CA   1  
ATOM   819   C C    . THR A 1 55 ? -8.647  -5.075  -4.144  1.00 0.07 ? 55  THR A C    1  
ATOM   820   O O    . THR A 1 55 ? -8.856  -4.162  -4.943  1.00 0.08 ? 55  THR A O    1  
ATOM   821   C CB   . THR A 1 55 ? -6.438  -6.225  -4.273  1.00 0.07 ? 55  THR A CB   1  
ATOM   822   O OG1  . THR A 1 55 ? -5.090  -6.216  -3.792  1.00 0.07 ? 55  THR A OG1  1  
ATOM   823   C CG2  . THR A 1 55 ? -6.456  -5.881  -5.755  1.00 0.08 ? 55  THR A CG2  1  
ATOM   824   H H    . THR A 1 55 ? -7.475  -6.606  -1.877  1.00 0.06 ? 55  THR A H    1  
ATOM   825   H HA   . THR A 1 55 ? -6.787  -4.269  -3.473  1.00 0.07 ? 55  THR A HA   1  
ATOM   826   H HB   . THR A 1 55 ? -6.851  -7.214  -4.142  1.00 0.07 ? 55  THR A HB   1  
ATOM   827   H HG1  . THR A 1 55 ? -4.496  -5.974  -4.507  1.00 0.08 ? 55  THR A HG1  1  
ATOM   828   H HG21 . THR A 1 55 ? -7.473  -5.909  -6.118  1.00 0.09 ? 55  THR A HG21 1  
ATOM   829   H HG22 . THR A 1 55 ? -5.860  -6.599  -6.298  1.00 0.09 ? 55  THR A HG22 1  
ATOM   830   H HG23 . THR A 1 55 ? -6.048  -4.891  -5.900  1.00 0.08 ? 55  THR A HG23 1  
ATOM   831   N N    . ALA A 1 56 ? -9.570  -5.974  -3.818  1.00 0.07 ? 56  ALA A N    1  
ATOM   832   C CA   . ALA A 1 56 ? -10.910 -5.938  -4.391  1.00 0.08 ? 56  ALA A CA   1  
ATOM   833   C C    . ALA A 1 56 ? -11.696 -4.738  -3.875  1.00 0.08 ? 56  ALA A C    1  
ATOM   834   O O    . ALA A 1 56 ? -12.425 -4.092  -4.625  1.00 0.09 ? 56  ALA A O    1  
ATOM   835   C CB   . ALA A 1 56 ? -11.651 -7.230  -4.081  1.00 0.08 ? 56  ALA A CB   1  
ATOM   836   H H    . ALA A 1 56 ? -9.344  -6.679  -3.176  1.00 0.07 ? 56  ALA A H    1  
ATOM   837   H HA   . ALA A 1 56 ? -10.810 -5.856  -5.464  1.00 0.09 ? 56  ALA A HA   1  
ATOM   838   H HB1  . ALA A 1 56 ? -12.620 -7.211  -4.557  1.00 0.09 ? 56  ALA A HB1  1  
ATOM   839   H HB2  . ALA A 1 56 ? -11.776 -7.326  -3.012  1.00 0.08 ? 56  ALA A HB2  1  
ATOM   840   H HB3  . ALA A 1 56 ? -11.083 -8.069  -4.454  1.00 0.09 ? 56  ALA A HB3  1  
ATOM   841   N N    . ALA A 1 57 ? -11.544 -4.446  -2.587  1.00 0.07 ? 57  ALA A N    1  
ATOM   842   C CA   . ALA A 1 57 ? -12.238 -3.322  -1.971  1.00 0.07 ? 57  ALA A CA   1  
ATOM   843   C C    . ALA A 1 57 ? -11.828 -2.003  -2.615  1.00 0.07 ? 57  ALA A C    1  
ATOM   844   O O    . ALA A 1 57 ? -12.674 -1.248  -3.100  1.00 0.08 ? 57  ALA A O    1  
ATOM   845   C CB   . ALA A 1 57 ? -11.963 -3.289  -0.474  1.00 0.06 ? 57  ALA A CB   1  
ATOM   846   H H    . ALA A 1 57 ? -10.949 -5.000  -2.039  1.00 0.07 ? 57  ALA A H    1  
ATOM   847   H HA   . ALA A 1 57 ? -13.298 -3.467  -2.114  1.00 0.08 ? 57  ALA A HA   1  
ATOM   848   H HB1  . ALA A 1 57 ? -12.257 -4.230  -0.033  1.00 0.07 ? 57  ALA A HB1  1  
ATOM   849   H HB2  . ALA A 1 57 ? -12.528 -2.488  -0.022  1.00 0.07 ? 57  ALA A HB2  1  
ATOM   850   H HB3  . ALA A 1 57 ? -10.909 -3.126  -0.306  1.00 0.06 ? 57  ALA A HB3  1  
ATOM   851   N N    . LEU A 1 58 ? -10.528 -1.730  -2.616  1.00 0.07 ? 58  LEU A N    1  
ATOM   852   C CA   . LEU A 1 58 ? -10.007 -0.499  -3.201  1.00 0.08 ? 58  LEU A CA   1  
ATOM   853   C C    . LEU A 1 58 ? -10.442 -0.361  -4.657  1.00 0.09 ? 58  LEU A C    1  
ATOM   854   O O    . LEU A 1 58 ? -10.833 0.719   -5.098  1.00 0.09 ? 58  LEU A O    1  
ATOM   855   C CB   . LEU A 1 58 ? -8.480  -0.474  -3.109  1.00 0.07 ? 58  LEU A CB   1  
ATOM   856   C CG   . LEU A 1 58 ? -7.895  -0.260  -1.713  1.00 0.07 ? 58  LEU A CG   1  
ATOM   857   C CD1  . LEU A 1 58 ? -6.427  -0.654  -1.682  1.00 0.07 ? 58  LEU A CD1  1  
ATOM   858   C CD2  . LEU A 1 58 ? -8.071  1.187   -1.277  1.00 0.07 ? 58  LEU A CD2  1  
ATOM   859   H H    . LEU A 1 58 ? -9.904  -2.370  -2.215  1.00 0.06 ? 58  LEU A H    1  
ATOM   860   H HA   . LEU A 1 58 ? -10.406 0.331   -2.639  1.00 0.08 ? 58  LEU A HA   1  
ATOM   861   H HB2  . LEU A 1 58 ? -8.106  -1.414  -3.489  1.00 0.07 ? 58  LEU A HB2  1  
ATOM   862   H HB3  . LEU A 1 58 ? -8.119  0.317   -3.747  1.00 0.08 ? 58  LEU A HB3  1  
ATOM   863   H HG   . LEU A 1 58 ? -8.422  -0.889  -1.010  1.00 0.06 ? 58  LEU A HG   1  
ATOM   864   H HD11 . LEU A 1 58 ? -6.001  -0.387  -0.727  1.00 0.07 ? 58  LEU A HD11 1  
ATOM   865   H HD12 . LEU A 1 58 ? -5.900  -0.136  -2.470  1.00 0.08 ? 58  LEU A HD12 1  
ATOM   866   H HD13 . LEU A 1 58 ? -6.336  -1.721  -1.831  1.00 0.06 ? 58  LEU A HD13 1  
ATOM   867   H HD21 . LEU A 1 58 ? -9.121  1.394   -1.132  1.00 0.07 ? 58  LEU A HD21 1  
ATOM   868   H HD22 . LEU A 1 58 ? -7.677  1.843   -2.038  1.00 0.08 ? 58  LEU A HD22 1  
ATOM   869   H HD23 . LEU A 1 58 ? -7.541  1.351   -0.350  1.00 0.07 ? 58  LEU A HD23 1  
ATOM   870   N N    . SER A 1 59 ? -10.373 -1.462  -5.397  1.00 0.09 ? 59  SER A N    1  
ATOM   871   C CA   . SER A 1 59 ? -10.759 -1.464  -6.804  1.00 0.10 ? 59  SER A CA   1  
ATOM   872   C C    . SER A 1 59 ? -12.273 -1.373  -6.951  1.00 0.11 ? 59  SER A C    1  
ATOM   873   O O    . SER A 1 59 ? -12.783 -0.992  -8.006  1.00 0.12 ? 59  SER A O    1  
ATOM   874   C CB   . SER A 1 59 ? -10.242 -2.729  -7.494  1.00 0.10 ? 59  SER A CB   1  
ATOM   875   O OG   . SER A 1 59 ? -10.853 -2.902  -8.761  1.00 0.12 ? 59  SER A OG   1  
ATOM   876   H H    . SER A 1 59 ? -10.054 -2.294  -4.988  1.00 0.08 ? 59  SER A H    1  
ATOM   877   H HA   . SER A 1 59 ? -10.312 -0.601  -7.272  1.00 0.11 ? 59  SER A HA   1  
ATOM   878   H HB2  . SER A 1 59 ? -9.174  -2.652  -7.631  1.00 0.10 ? 59  SER A HB2  1  
ATOM   879   H HB3  . SER A 1 59 ? -10.465 -3.589  -6.880  1.00 0.10 ? 59  SER A HB3  1  
ATOM   880   H HG   . SER A 1 59 ? -10.182 -2.878  -9.447  1.00 0.12 ? 59  SER A HG   1  
ATOM   881   N N    . GLN A 1 60 ? -12.988 -1.724  -5.887  1.00 0.10 ? 60  GLN A N    1  
ATOM   882   C CA   . GLN A 1 60 ? -14.445 -1.683  -5.899  1.00 0.11 ? 60  GLN A CA   1  
ATOM   883   C C    . GLN A 1 60 ? -14.951 -0.267  -5.645  1.00 0.11 ? 60  GLN A C    1  
ATOM   884   O O    . GLN A 1 60 ? -15.890 0.194   -6.298  1.00 0.13 ? 60  GLN A O    1  
ATOM   885   C CB   . GLN A 1 60 ? -15.013 -2.635  -4.846  1.00 0.11 ? 60  GLN A CB   1  
ATOM   886   C CG   . GLN A 1 60 ? -16.529 -2.602  -4.746  1.00 0.12 ? 60  GLN A CG   1  
ATOM   887   C CD   . GLN A 1 60 ? -17.053 -3.347  -3.534  1.00 0.12 ? 60  GLN A CD   1  
ATOM   888   O OE1  . GLN A 1 60 ? -17.931 -4.202  -3.648  1.00 0.12 ? 60  GLN A OE1  1  
ATOM   889   N NE2  . GLN A 1 60 ? -16.514 -3.026  -2.364  1.00 0.11 ? 60  GLN A NE2  1  
ATOM   890   H H    . GLN A 1 60 ? -12.524 -2.020  -5.076  1.00 0.09 ? 60  GLN A H    1  
ATOM   891   H HA   . GLN A 1 60 ? -14.778 -2.002  -6.874  1.00 0.12 ? 60  GLN A HA   1  
ATOM   892   H HB2  . GLN A 1 60 ? -14.712 -3.644  -5.090  1.00 0.11 ? 60  GLN A HB2  1  
ATOM   893   H HB3  . GLN A 1 60 ? -14.604 -2.371  -3.881  1.00 0.10 ? 60  GLN A HB3  1  
ATOM   894   H HG2  . GLN A 1 60 ? -16.849 -1.573  -4.681  1.00 0.12 ? 60  GLN A HG2  1  
ATOM   895   H HG3  . GLN A 1 60 ? -16.946 -3.052  -5.635  1.00 0.13 ? 60  GLN A HG3  1  
ATOM   896   H HE21 . GLN A 1 60 ? -15.819 -2.337  -2.347  1.00 0.10 ? 60  GLN A HE21 1  
ATOM   897   H HE22 . GLN A 1 60 ? -16.834 -3.493  -1.564  1.00 0.11 ? 60  GLN A HE22 1  
ATOM   898   N N    . ARG A 1 61 ? -14.327 0.419   -4.694  1.00 0.11 ? 61  ARG A N    1  
ATOM   899   C CA   . ARG A 1 61 ? -14.715 1.783   -4.354  1.00 0.11 ? 61  ARG A CA   1  
ATOM   900   C C    . ARG A 1 61 ? -14.335 2.750   -5.470  1.00 0.12 ? 61  ARG A C    1  
ATOM   901   O O    . ARG A 1 61 ? -15.035 3.730   -5.721  1.00 0.13 ? 61  ARG A O    1  
ATOM   902   C CB   . ARG A 1 61 ? -14.052 2.212   -3.045  1.00 0.10 ? 61  ARG A CB   1  
ATOM   903   C CG   . ARG A 1 61 ? -12.666 2.804   -3.227  1.00 0.10 ? 61  ARG A CG   1  
ATOM   904   C CD   . ARG A 1 61 ? -12.028 3.156   -1.893  1.00 0.09 ? 61  ARG A CD   1  
ATOM   905   N NE   . ARG A 1 61 ? -11.643 4.564   -1.824  1.00 0.10 ? 61  ARG A NE   1  
ATOM   906   C CZ   . ARG A 1 61 ? -11.240 5.161   -0.708  1.00 0.09 ? 61  ARG A CZ   1  
ATOM   907   N NH1  . ARG A 1 61 ? -11.171 4.478   0.426   1.00 0.09 ? 61  ARG A NH1  1  
ATOM   908   N NH2  . ARG A 1 61 ? -10.906 6.445   -0.725  1.00 0.10 ? 61  ARG A NH2  1  
ATOM   909   H H    . ARG A 1 61 ? -13.587 -0.003  -4.208  1.00 0.10 ? 61  ARG A H    1  
ATOM   910   H HA   . ARG A 1 61 ? -15.787 1.800   -4.228  1.00 0.12 ? 61  ARG A HA   1  
ATOM   911   H HB2  . ARG A 1 61 ? -14.676 2.951   -2.566  1.00 0.10 ? 61  ARG A HB2  1  
ATOM   912   H HB3  . ARG A 1 61 ? -13.969 1.350   -2.398  1.00 0.09 ? 61  ARG A HB3  1  
ATOM   913   H HG2  . ARG A 1 61 ? -12.041 2.084   -3.736  1.00 0.09 ? 61  ARG A HG2  1  
ATOM   914   H HG3  . ARG A 1 61 ? -12.744 3.700   -3.827  1.00 0.10 ? 61  ARG A HG3  1  
ATOM   915   H HD2  . ARG A 1 61 ? -12.736 2.949   -1.105  1.00 0.09 ? 61  ARG A HD2  1  
ATOM   916   H HD3  . ARG A 1 61 ? -11.149 2.544   -1.756  1.00 0.08 ? 61  ARG A HD3  1  
ATOM   917   H HE   . ARG A 1 61 ? -11.685 5.087   -2.652  1.00 0.10 ? 61  ARG A HE   1  
ATOM   918   H HH11 . ARG A 1 61 ? -10.868 4.929   1.265   1.00 0.09 ? 61  ARG A HH11 1  
ATOM   919   H HH12 . ARG A 1 61 ? -11.422 3.510   0.443   1.00 0.08 ? 61  ARG A HH12 1  
ATOM   920   H HH21 . ARG A 1 61 ? -10.957 6.963   -1.578  1.00 0.11 ? 61  ARG A HH21 1  
ATOM   921   H HH22 . ARG A 1 61 ? -10.602 6.894   0.115   1.00 0.10 ? 61  ARG A HH22 1  
ATOM   922   N N    . ALA A 1 62 ? -13.221 2.469   -6.137  1.00 0.12 ? 62  ALA A N    1  
ATOM   923   C CA   . ALA A 1 62 ? -12.748 3.314   -7.226  1.00 0.13 ? 62  ALA A CA   1  
ATOM   924   C C    . ALA A 1 62 ? -13.642 3.178   -8.453  1.00 0.14 ? 62  ALA A C    1  
ATOM   925   O O    . ALA A 1 62 ? -14.010 4.173   -9.078  1.00 0.15 ? 62  ALA A O    1  
ATOM   926   C CB   . ALA A 1 62 ? -11.308 2.966   -7.578  1.00 0.12 ? 62  ALA A CB   1  
ATOM   927   H H    . ALA A 1 62 ? -12.703 1.673   -5.890  1.00 0.11 ? 62  ALA A H    1  
ATOM   928   H HA   . ALA A 1 62 ? -12.771 4.340   -6.888  1.00 0.13 ? 62  ALA A HA   1  
ATOM   929   H HB1  . ALA A 1 62 ? -11.260 1.941   -7.917  1.00 0.12 ? 62  ALA A HB1  1  
ATOM   930   H HB2  . ALA A 1 62 ? -10.685 3.086   -6.705  1.00 0.11 ? 62  ALA A HB2  1  
ATOM   931   H HB3  . ALA A 1 62 ? -10.961 3.622   -8.362  1.00 0.13 ? 62  ALA A HB3  1  
ATOM   932   N N    . MET A 1 63 ? -13.987 1.941   -8.794  1.00 0.14 ? 63  MET A N    1  
ATOM   933   C CA   . MET A 1 63 ? -14.839 1.675   -9.948  1.00 0.15 ? 63  MET A CA   1  
ATOM   934   C C    . MET A 1 63 ? -16.260 2.170   -9.699  1.00 0.16 ? 63  MET A C    1  
ATOM   935   O O    . MET A 1 63 ? -16.945 2.610   -10.623 1.00 0.17 ? 63  MET A O    1  
ATOM   936   C CB   . MET A 1 63 ? -14.856 0.179   -10.263 1.00 0.15 ? 63  MET A CB   1  
ATOM   937   C CG   . MET A 1 63 ? -15.642 -0.645  -9.258  1.00 0.15 ? 63  MET A CG   1  
ATOM   938   S SD   . MET A 1 63 ? -15.803 -2.373  -9.750  1.00 0.15 ? 63  MET A SD   1  
ATOM   939   C CE   . MET A 1 63 ? -14.085 -2.881  -9.768  1.00 0.14 ? 63  MET A CE   1  
ATOM   940   H H    . MET A 1 63 ? -13.661 1.188   -8.258  1.00 0.13 ? 63  MET A H    1  
ATOM   941   H HA   . MET A 1 63 ? -14.428 2.208   -10.793 1.00 0.16 ? 63  MET A HA   1  
ATOM   942   H HB2  . MET A 1 63 ? -15.295 0.033   -11.238 1.00 0.16 ? 63  MET A HB2  1  
ATOM   943   H HB3  . MET A 1 63 ? -13.838 -0.185  -10.278 1.00 0.15 ? 63  MET A HB3  1  
ATOM   944   H HG2  . MET A 1 63 ? -15.138 -0.602  -8.304  1.00 0.14 ? 63  MET A HG2  1  
ATOM   945   H HG3  . MET A 1 63 ? -16.629 -0.221  -9.160  1.00 0.15 ? 63  MET A HG3  1  
ATOM   946   H HE1  . MET A 1 63 ? -13.570 -2.379  -10.573 1.00 0.15 ? 63  MET A HE1  1  
ATOM   947   H HE2  . MET A 1 63 ? -14.027 -3.949  -9.912  1.00 0.14 ? 63  MET A HE2  1  
ATOM   948   H HE3  . MET A 1 63 ? -13.623 -2.620  -8.827  1.00 0.13 ? 63  MET A HE3  1  
ATOM   949   N N    . ILE A 1 64 ? -16.695 2.097   -8.446  1.00 0.15 ? 64  ILE A N    1  
ATOM   950   C CA   . ILE A 1 64 ? -18.036 2.538   -8.077  1.00 0.16 ? 64  ILE A CA   1  
ATOM   951   C C    . ILE A 1 64 ? -18.060 4.033   -7.780  1.00 0.16 ? 64  ILE A C    1  
ATOM   952   O O    . ILE A 1 64 ? -18.547 4.829   -8.584  1.00 0.17 ? 64  ILE A O    1  
ATOM   953   C CB   . ILE A 1 64 ? -18.562 1.774   -6.847  1.00 0.15 ? 64  ILE A CB   1  
ATOM   954   C CG1  . ILE A 1 64 ? -18.713 0.286   -7.172  1.00 0.15 ? 64  ILE A CG1  1  
ATOM   955   C CG2  . ILE A 1 64 ? -19.888 2.358   -6.389  1.00 0.16 ? 64  ILE A CG2  1  
ATOM   956   C CD1  . ILE A 1 64 ? -19.125 -0.553  -5.983  1.00 0.15 ? 64  ILE A CD1  1  
ATOM   957   H H    . ILE A 1 64 ? -16.103 1.737   -7.753  1.00 0.14 ? 64  ILE A H    1  
ATOM   958   H HA   . ILE A 1 64 ? -18.694 2.336   -8.909  1.00 0.17 ? 64  ILE A HA   1  
ATOM   959   H HB   . ILE A 1 64 ? -17.848 1.890   -6.046  1.00 0.14 ? 64  ILE A HB   1  
ATOM   960   H HG12 . ILE A 1 64 ? -19.465 0.165   -7.937  1.00 0.16 ? 64  ILE A HG12 1  
ATOM   961   H HG13 . ILE A 1 64 ? -17.771 -0.094  -7.535  1.00 0.15 ? 64  ILE A HG13 1  
ATOM   962   H HG21 . ILE A 1 64 ? -20.222 1.839   -5.502  1.00 0.15 ? 64  ILE A HG21 1  
ATOM   963   H HG22 . ILE A 1 64 ? -20.623 2.242   -7.171  1.00 0.17 ? 64  ILE A HG22 1  
ATOM   964   H HG23 . ILE A 1 64 ? -19.762 3.407   -6.165  1.00 0.16 ? 64  ILE A HG23 1  
ATOM   965   H HD11 . ILE A 1 64 ? -20.143 -0.317  -5.712  1.00 0.15 ? 64  ILE A HD11 1  
ATOM   966   H HD12 . ILE A 1 64 ? -18.472 -0.340  -5.150  1.00 0.14 ? 64  ILE A HD12 1  
ATOM   967   H HD13 . ILE A 1 64 ? -19.053 -1.600  -6.239  1.00 0.15 ? 64  ILE A HD13 1  
ATOM   968   N N    . LEU A 1 65 ? -17.528 4.408   -6.621  1.00 0.15 ? 65  LEU A N    1  
ATOM   969   C CA   . LEU A 1 65 ? -17.486 5.810   -6.217  1.00 0.15 ? 65  LEU A CA   1  
ATOM   970   C C    . LEU A 1 65 ? -16.878 6.675   -7.316  1.00 0.16 ? 65  LEU A C    1  
ATOM   971   O O    . LEU A 1 65 ? -17.325 7.796   -7.557  1.00 0.16 ? 65  LEU A O    1  
ATOM   972   C CB   . LEU A 1 65 ? -16.681 5.964   -4.926  1.00 0.14 ? 65  LEU A CB   1  
ATOM   973   C CG   . LEU A 1 65 ? -17.308 6.846   -3.844  1.00 0.14 ? 65  LEU A CG   1  
ATOM   974   C CD1  . LEU A 1 65 ? -18.217 6.022   -2.946  1.00 0.14 ? 65  LEU A CD1  1  
ATOM   975   C CD2  . LEU A 1 65 ? -16.227 7.535   -3.025  1.00 0.13 ? 65  LEU A CD2  1  
ATOM   976   H H    . LEU A 1 65 ? -17.154 3.727   -6.025  1.00 0.14 ? 65  LEU A H    1  
ATOM   977   H HA   . LEU A 1 65 ? -18.501 6.134   -6.039  1.00 0.16 ? 65  LEU A HA   1  
ATOM   978   H HB2  . LEU A 1 65 ? -16.528 4.980   -4.507  1.00 0.13 ? 65  LEU A HB2  1  
ATOM   979   H HB3  . LEU A 1 65 ? -15.717 6.378   -5.178  1.00 0.14 ? 65  LEU A HB3  1  
ATOM   980   H HG   . LEU A 1 65 ? -17.909 7.610   -4.316  1.00 0.15 ? 65  LEU A HG   1  
ATOM   981   H HD11 . LEU A 1 65 ? -17.631 5.280   -2.424  1.00 0.13 ? 65  LEU A HD11 1  
ATOM   982   H HD12 . LEU A 1 65 ? -18.966 5.529   -3.548  1.00 0.14 ? 65  LEU A HD12 1  
ATOM   983   H HD13 . LEU A 1 65 ? -18.700 6.670   -2.231  1.00 0.14 ? 65  LEU A HD13 1  
ATOM   984   H HD21 . LEU A 1 65 ? -15.712 8.255   -3.643  1.00 0.14 ? 65  LEU A HD21 1  
ATOM   985   H HD22 . LEU A 1 65 ? -15.523 6.799   -2.667  1.00 0.13 ? 65  LEU A HD22 1  
ATOM   986   H HD23 . LEU A 1 65 ? -16.679 8.040   -2.184  1.00 0.14 ? 65  LEU A HD23 1  
ATOM   987   N N    . GLY A 1 66 ? -15.857 6.145   -7.982  1.00 0.15 ? 66  GLY A N    1  
ATOM   988   C CA   . GLY A 1 66 ? -15.205 6.883   -9.049  1.00 0.16 ? 66  GLY A CA   1  
ATOM   989   C C    . GLY A 1 66 ? -13.991 7.650   -8.568  1.00 0.16 ? 66  GLY A C    1  
ATOM   990   O O    . GLY A 1 66 ? -13.791 8.807   -8.937  1.00 0.16 ? 66  GLY A O    1  
ATOM   991   H H    . GLY A 1 66 ? -15.545 5.247   -7.749  1.00 0.15 ? 66  GLY A H    1  
ATOM   992   H HA2  . GLY A 1 66 ? -14.898 6.188   -9.817  1.00 0.16 ? 66  GLY A HA2  1  
ATOM   993   H HA3  . GLY A 1 66 ? -15.913 7.582   -9.473  1.00 0.17 ? 66  GLY A HA3  1  
ATOM   994   N N    . LYS A 1 67 ? -13.176 7.003   -7.738  1.00 0.15 ? 67  LYS A N    1  
ATOM   995   C CA   . LYS A 1 67 ? -11.974 7.632   -7.203  1.00 0.14 ? 67  LYS A CA   1  
ATOM   996   C C    . LYS A 1 67 ? -11.006 6.583   -6.664  1.00 0.13 ? 67  LYS A C    1  
ATOM   997   O O    . LYS A 1 67 ? -11.360 5.787   -5.793  1.00 0.12 ? 67  LYS A O    1  
ATOM   998   C CB   . LYS A 1 67 ? -12.341 8.621   -6.094  1.00 0.14 ? 67  LYS A CB   1  
ATOM   999   C CG   . LYS A 1 67 ? -13.040 7.975   -4.910  1.00 0.13 ? 67  LYS A CG   1  
ATOM   1000  C CD   . LYS A 1 67 ? -12.088 7.772   -3.743  1.00 0.12 ? 67  LYS A CD   1  
ATOM   1001  C CE   . LYS A 1 67 ? -12.157 8.929   -2.760  1.00 0.13 ? 67  LYS A CE   1  
ATOM   1002  N NZ   . LYS A 1 67 ? -11.998 10.245  -3.440  1.00 0.14 ? 67  LYS A NZ   1  
ATOM   1003  H H    . LYS A 1 67 ? -13.390 6.083   -7.480  1.00 0.14 ? 67  LYS A H    1  
ATOM   1004  H HA   . LYS A 1 67 ? -11.494 8.169   -8.008  1.00 0.15 ? 67  LYS A HA   1  
ATOM   1005  H HB2  . LYS A 1 67 ? -11.439 9.095   -5.736  1.00 0.14 ? 67  LYS A HB2  1  
ATOM   1006  H HB3  . LYS A 1 67 ? -12.995 9.375   -6.504  1.00 0.15 ? 67  LYS A HB3  1  
ATOM   1007  H HG2  . LYS A 1 67 ? -13.852 8.613   -4.592  1.00 0.14 ? 67  LYS A HG2  1  
ATOM   1008  H HG3  . LYS A 1 67 ? -13.432 7.015   -5.216  1.00 0.13 ? 67  LYS A HG3  1  
ATOM   1009  H HD2  . LYS A 1 67 ? -12.354 6.860   -3.229  1.00 0.12 ? 67  LYS A HD2  1  
ATOM   1010  H HD3  . LYS A 1 67 ? -11.081 7.692   -4.124  1.00 0.12 ? 67  LYS A HD3  1  
ATOM   1011  H HE2  . LYS A 1 67 ? -13.115 8.906   -2.260  1.00 0.13 ? 67  LYS A HE2  1  
ATOM   1012  H HE3  . LYS A 1 67 ? -11.369 8.812   -2.030  1.00 0.12 ? 67  LYS A HE3  1  
ATOM   1013  H HZ1  . LYS A 1 67 ? -12.748 10.374  -4.149  1.00 0.14 ? 67  LYS A HZ1  1  
ATOM   1014  H HZ2  . LYS A 1 67 ? -11.075 10.292  -3.917  1.00 0.14 ? 67  LYS A HZ2  1  
ATOM   1015  H HZ3  . LYS A 1 67 ? -12.055 11.017  -2.745  1.00 0.14 ? 67  LYS A HZ3  1  
ATOM   1016  N N    . SER A 1 68 ? -9.784  6.588   -7.187  1.00 0.13 ? 68  SER A N    1  
ATOM   1017  C CA   . SER A 1 68 ? -8.767  5.634   -6.760  1.00 0.13 ? 68  SER A CA   1  
ATOM   1018  C C    . SER A 1 68 ? -7.639  6.342   -6.017  1.00 0.13 ? 68  SER A C    1  
ATOM   1019  O O    . SER A 1 68 ? -6.464  6.035   -6.210  1.00 0.13 ? 68  SER A O    1  
ATOM   1020  C CB   . SER A 1 68 ? -8.204  4.882   -7.967  1.00 0.13 ? 68  SER A CB   1  
ATOM   1021  O OG   . SER A 1 68 ? -8.067  5.743   -9.085  1.00 0.14 ? 68  SER A OG   1  
ATOM   1022  H H    . SER A 1 68 ? -9.563  7.246   -7.878  1.00 0.14 ? 68  SER A H    1  
ATOM   1023  H HA   . SER A 1 68 ? -9.236  4.928   -6.093  1.00 0.12 ? 68  SER A HA   1  
ATOM   1024  H HB2  . SER A 1 68 ? -7.235  4.482   -7.717  1.00 0.13 ? 68  SER A HB2  1  
ATOM   1025  H HB3  . SER A 1 68 ? -8.871  4.074   -8.230  1.00 0.13 ? 68  SER A HB3  1  
ATOM   1026  H HG   . SER A 1 68 ? -8.343  5.281   -9.881  1.00 0.15 ? 68  SER A HG   1  
ATOM   1027  N N    . GLY A 1 69 ? -8.006  7.292   -5.161  1.00 0.13 ? 69  GLY A N    1  
ATOM   1028  C CA   . GLY A 1 69 ? -7.014  8.029   -4.400  1.00 0.13 ? 69  GLY A CA   1  
ATOM   1029  C C    . GLY A 1 69 ? -6.156  7.125   -3.539  1.00 0.12 ? 69  GLY A C    1  
ATOM   1030  O O    . GLY A 1 69 ? -5.037  7.485   -3.175  1.00 0.13 ? 69  GLY A O    1  
ATOM   1031  H H    . GLY A 1 69 ? -8.958  7.493   -5.046  1.00 0.13 ? 69  GLY A H    1  
ATOM   1032  H HA2  . GLY A 1 69 ? -6.377  8.566   -5.086  1.00 0.14 ? 69  GLY A HA2  1  
ATOM   1033  H HA3  . GLY A 1 69 ? -7.521  8.740   -3.763  1.00 0.13 ? 69  GLY A HA3  1  
ATOM   1034  N N    . GLU A 1 70 ? -6.681  5.949   -3.209  1.00 0.11 ? 70  GLU A N    1  
ATOM   1035  C CA   . GLU A 1 70 ? -5.955  4.992   -2.383  1.00 0.10 ? 70  GLU A CA   1  
ATOM   1036  C C    . GLU A 1 70 ? -5.461  3.816   -3.219  1.00 0.10 ? 70  GLU A C    1  
ATOM   1037  O O    . GLU A 1 70 ? -4.480  3.158   -2.869  1.00 0.10 ? 70  GLU A O    1  
ATOM   1038  C CB   . GLU A 1 70 ? -6.846  4.486   -1.246  1.00 0.09 ? 70  GLU A CB   1  
ATOM   1039  C CG   . GLU A 1 70 ? -6.613  5.201   0.074   1.00 0.10 ? 70  GLU A CG   1  
ATOM   1040  C CD   . GLU A 1 70 ? -7.331  6.533   0.153   1.00 0.10 ? 70  GLU A CD   1  
ATOM   1041  O OE1  . GLU A 1 70 ? -7.377  7.118   1.256   1.00 0.11 ? 70  GLU A OE1  1  
ATOM   1042  O OE2  . GLU A 1 70 ? -7.846  6.991   -0.887  1.00 0.11 ? 70  GLU A OE2  1  
ATOM   1043  H H    . GLU A 1 70 ? -7.578  5.720   -3.528  1.00 0.11 ? 70  GLU A H    1  
ATOM   1044  H HA   . GLU A 1 70 ? -5.102  5.501   -1.961  1.00 0.11 ? 70  GLU A HA   1  
ATOM   1045  H HB2  . GLU A 1 70 ? -7.880  4.623   -1.527  1.00 0.09 ? 70  GLU A HB2  1  
ATOM   1046  H HB3  . GLU A 1 70 ? -6.658  3.434   -1.099  1.00 0.09 ? 70  GLU A HB3  1  
ATOM   1047  H HG2  . GLU A 1 70 ? -6.966  4.572   0.877   1.00 0.09 ? 70  GLU A HG2  1  
ATOM   1048  H HG3  . GLU A 1 70 ? -5.553  5.372   0.192   1.00 0.10 ? 70  GLU A HG3  1  
ATOM   1049  N N    . LEU A 1 71 ? -6.149  3.553   -4.324  1.00 0.10 ? 71  LEU A N    1  
ATOM   1050  C CA   . LEU A 1 71 ? -5.781  2.455   -5.212  1.00 0.10 ? 71  LEU A CA   1  
ATOM   1051  C C    . LEU A 1 71 ? -4.398  2.680   -5.814  1.00 0.11 ? 71  LEU A C    1  
ATOM   1052  O O    . LEU A 1 71 ? -3.549  1.789   -5.795  1.00 0.11 ? 71  LEU A O    1  
ATOM   1053  C CB   . LEU A 1 71 ? -6.816  2.306   -6.328  1.00 0.11 ? 71  LEU A CB   1  
ATOM   1054  C CG   . LEU A 1 71 ? -7.353  0.893   -6.563  1.00 0.10 ? 71  LEU A CG   1  
ATOM   1055  C CD1  . LEU A 1 71 ? -8.229  0.854   -7.805  1.00 0.11 ? 71  LEU A CD1  1  
ATOM   1056  C CD2  . LEU A 1 71 ? -6.205  -0.098  -6.684  1.00 0.10 ? 71  LEU A CD2  1  
ATOM   1057  H H    . LEU A 1 71 ? -6.922  4.113   -4.550  1.00 0.11 ? 71  LEU A H    1  
ATOM   1058  H HA   . LEU A 1 71 ? -5.763  1.550   -4.625  1.00 0.10 ? 71  LEU A HA   1  
ATOM   1059  H HB2  . LEU A 1 71 ? -7.653  2.949   -6.097  1.00 0.11 ? 71  LEU A HB2  1  
ATOM   1060  H HB3  . LEU A 1 71 ? -6.368  2.651   -7.248  1.00 0.12 ? 71  LEU A HB3  1  
ATOM   1061  H HG   . LEU A 1 71 ? -7.961  0.601   -5.720  1.00 0.10 ? 71  LEU A HG   1  
ATOM   1062  H HD11 . LEU A 1 71 ? -9.137  1.408   -7.624  1.00 0.11 ? 71  LEU A HD11 1  
ATOM   1063  H HD12 . LEU A 1 71 ? -8.471  -0.170  -8.044  1.00 0.11 ? 71  LEU A HD12 1  
ATOM   1064  H HD13 . LEU A 1 71 ? -7.697  1.300   -8.634  1.00 0.12 ? 71  LEU A HD13 1  
ATOM   1065  H HD21 . LEU A 1 71 ? -5.531  0.225   -7.464  1.00 0.11 ? 71  LEU A HD21 1  
ATOM   1066  H HD22 . LEU A 1 71 ? -6.596  -1.074  -6.929  1.00 0.10 ? 71  LEU A HD22 1  
ATOM   1067  H HD23 . LEU A 1 71 ? -5.672  -0.150  -5.747  1.00 0.10 ? 71  LEU A HD23 1  
ATOM   1068  N N    . LYS A 1 72 ? -4.177  3.877   -6.343  1.00 0.12 ? 72  LYS A N    1  
ATOM   1069  C CA   . LYS A 1 72 ? -2.895  4.222   -6.948  1.00 0.13 ? 72  LYS A CA   1  
ATOM   1070  C C    . LYS A 1 72 ? -1.745  3.916   -5.994  1.00 0.13 ? 72  LYS A C    1  
ATOM   1071  O O    . LYS A 1 72 ? -0.635  3.601   -6.426  1.00 0.14 ? 72  LYS A O    1  
ATOM   1072  C CB   . LYS A 1 72 ? -2.872  5.703   -7.332  1.00 0.14 ? 72  LYS A CB   1  
ATOM   1073  C CG   . LYS A 1 72 ? -3.688  6.023   -8.573  1.00 0.15 ? 72  LYS A CG   1  
ATOM   1074  C CD   . LYS A 1 72 ? -2.801  6.474   -9.723  1.00 0.16 ? 72  LYS A CD   1  
ATOM   1075  C CE   . LYS A 1 72 ? -2.190  7.841   -9.451  1.00 0.17 ? 72  LYS A CE   1  
ATOM   1076  N NZ   . LYS A 1 72 ? -2.450  8.796   -10.562 1.00 0.18 ? 72  LYS A NZ   1  
ATOM   1077  H H    . LYS A 1 72 ? -4.893  4.546   -6.327  1.00 0.12 ? 72  LYS A H    1  
ATOM   1078  H HA   . LYS A 1 72 ? -2.778  3.626   -7.839  1.00 0.14 ? 72  LYS A HA   1  
ATOM   1079  H HB2  . LYS A 1 72 ? -3.265  6.282   -6.509  1.00 0.14 ? 72  LYS A HB2  1  
ATOM   1080  H HB3  . LYS A 1 72 ? -1.849  6.000   -7.513  1.00 0.15 ? 72  LYS A HB3  1  
ATOM   1081  H HG2  . LYS A 1 72 ? -4.228  5.138   -8.876  1.00 0.15 ? 72  LYS A HG2  1  
ATOM   1082  H HG3  . LYS A 1 72 ? -4.388  6.812   -8.339  1.00 0.15 ? 72  LYS A HG3  1  
ATOM   1083  H HD2  . LYS A 1 72 ? -2.007  5.755   -9.856  1.00 0.17 ? 72  LYS A HD2  1  
ATOM   1084  H HD3  . LYS A 1 72 ? -3.396  6.528   -10.622 1.00 0.17 ? 72  LYS A HD3  1  
ATOM   1085  H HE2  . LYS A 1 72 ? -2.615  8.238   -8.541  1.00 0.17 ? 72  LYS A HE2  1  
ATOM   1086  H HE3  . LYS A 1 72 ? -1.123  7.726   -9.328  1.00 0.18 ? 72  LYS A HE3  1  
ATOM   1087  H HZ1  . LYS A 1 72 ? -3.475  8.925   -10.690 1.00 0.18 ? 72  LYS A HZ1  1  
ATOM   1088  H HZ2  . LYS A 1 72 ? -2.044  8.434   -11.448 1.00 0.19 ? 72  LYS A HZ2  1  
ATOM   1089  H HZ3  . LYS A 1 72 ? -2.020  9.718   -10.348 1.00 0.19 ? 72  LYS A HZ3  1  
ATOM   1090  N N    . THR A 1 73 ? -2.016  4.009   -4.696  1.00 0.13 ? 73  THR A N    1  
ATOM   1091  C CA   . THR A 1 73 ? -1.004  3.740   -3.683  1.00 0.13 ? 73  THR A CA   1  
ATOM   1092  C C    . THR A 1 73 ? -0.878  2.246   -3.413  1.00 0.12 ? 73  THR A C    1  
ATOM   1093  O O    . THR A 1 73 ? 0.226   1.713   -3.312  1.00 0.12 ? 73  THR A O    1  
ATOM   1094  C CB   . THR A 1 73 ? -1.325  4.465   -2.362  1.00 0.12 ? 73  THR A CB   1  
ATOM   1095  O OG1  . THR A 1 73 ? -1.887  5.755   -2.635  1.00 0.13 ? 73  THR A OG1  1  
ATOM   1096  C CG2  . THR A 1 73 ? -0.074  4.621   -1.513  1.00 0.13 ? 73  THR A CG2  1  
ATOM   1097  H H    . THR A 1 73 ? -2.918  4.266   -4.414  1.00 0.12 ? 73  THR A H    1  
ATOM   1098  H HA   . THR A 1 73 ? -0.058  4.110   -4.050  1.00 0.14 ? 73  THR A HA   1  
ATOM   1099  H HB   . THR A 1 73 ? -2.045  3.876   -1.812  1.00 0.12 ? 73  THR A HB   1  
ATOM   1100  H HG1  . THR A 1 73 ? -1.296  6.246   -3.211  1.00 0.15 ? 73  THR A HG1  1  
ATOM   1101  H HG21 . THR A 1 73 ? 0.695   5.111   -2.090  1.00 0.14 ? 73  THR A HG21 1  
ATOM   1102  H HG22 . THR A 1 73 ? 0.274   3.647   -1.201  1.00 0.13 ? 73  THR A HG22 1  
ATOM   1103  H HG23 . THR A 1 73 ? -0.303  5.216   -0.641  1.00 0.13 ? 73  THR A HG23 1  
ATOM   1104  N N    . TRP A 1 74 ? -2.019  1.574   -3.296  1.00 0.11 ? 74  TRP A N    1  
ATOM   1105  C CA   . TRP A 1 74 ? -2.036  0.138   -3.037  1.00 0.10 ? 74  TRP A CA   1  
ATOM   1106  C C    . TRP A 1 74 ? -1.330  -0.625  -4.152  1.00 0.11 ? 74  TRP A C    1  
ATOM   1107  O O    . TRP A 1 74 ? -0.434  -1.427  -3.895  1.00 0.11 ? 74  TRP A O    1  
ATOM   1108  C CB   . TRP A 1 74 ? -3.476  -0.357  -2.895  1.00 0.09 ? 74  TRP A CB   1  
ATOM   1109  C CG   . TRP A 1 74 ? -3.571  -1.808  -2.528  1.00 0.08 ? 74  TRP A CG   1  
ATOM   1110  C CD1  . TRP A 1 74 ? -4.309  -2.767  -3.163  1.00 0.08 ? 74  TRP A CD1  1  
ATOM   1111  C CD2  . TRP A 1 74 ? -2.909  -2.462  -1.442  1.00 0.08 ? 74  TRP A CD2  1  
ATOM   1112  N NE1  . TRP A 1 74 ? -4.143  -3.978  -2.536  1.00 0.07 ? 74  TRP A NE1  1  
ATOM   1113  C CE2  . TRP A 1 74 ? -3.290  -3.818  -1.477  1.00 0.07 ? 74  TRP A CE2  1  
ATOM   1114  C CE3  . TRP A 1 74 ? -2.029  -2.036  -0.443  1.00 0.08 ? 74  TRP A CE3  1  
ATOM   1115  C CZ2  . TRP A 1 74 ? -2.822  -4.748  -0.552  1.00 0.07 ? 74  TRP A CZ2  1  
ATOM   1116  C CZ3  . TRP A 1 74 ? -1.565  -2.960  0.475   1.00 0.08 ? 74  TRP A CZ3  1  
ATOM   1117  C CH2  . TRP A 1 74 ? -1.961  -4.301  0.415   1.00 0.08 ? 74  TRP A CH2  1  
ATOM   1118  H H    . TRP A 1 74 ? -2.868  2.054   -3.384  1.00 0.10 ? 74  TRP A H    1  
ATOM   1119  H HA   . TRP A 1 74 ? -1.512  -0.036  -2.111  1.00 0.10 ? 74  TRP A HA   1  
ATOM   1120  H HB2  . TRP A 1 74 ? -3.970  0.214   -2.124  1.00 0.08 ? 74  TRP A HB2  1  
ATOM   1121  H HB3  . TRP A 1 74 ? -3.994  -0.214  -3.832  1.00 0.09 ? 74  TRP A HB3  1  
ATOM   1122  H HD1  . TRP A 1 74 ? -4.927  -2.585  -4.030  1.00 0.08 ? 74  TRP A HD1  1  
ATOM   1123  H HE1  . TRP A 1 74 ? -4.569  -4.820  -2.805  1.00 0.07 ? 74  TRP A HE1  1  
ATOM   1124  H HE3  . TRP A 1 74 ? -1.713  -1.006  -0.378  1.00 0.09 ? 74  TRP A HE3  1  
ATOM   1125  H HZ2  . TRP A 1 74 ? -3.116  -5.786  -0.586  1.00 0.07 ? 74  TRP A HZ2  1  
ATOM   1126  H HZ3  . TRP A 1 74 ? -0.887  -2.647  1.254   1.00 0.09 ? 74  TRP A HZ3  1  
ATOM   1127  H HH2  . TRP A 1 74 ? -1.574  -4.987  1.154   1.00 0.08 ? 74  TRP A HH2  1  
ATOM   1128  N N    . GLY A 1 75 ? -1.738  -0.367  -5.390  1.00 0.11 ? 75  GLY A N    1  
ATOM   1129  C CA   . GLY A 1 75 ? -1.134  -1.038  -6.527  1.00 0.12 ? 75  GLY A CA   1  
ATOM   1130  C C    . GLY A 1 75 ? 0.379   -0.944  -6.518  1.00 0.13 ? 75  GLY A C    1  
ATOM   1131  O O    . GLY A 1 75 ? 1.071   -1.920  -6.805  1.00 0.13 ? 75  GLY A O    1  
ATOM   1132  H H    . GLY A 1 75 ? -2.456  0.286   -5.534  1.00 0.11 ? 75  GLY A H    1  
ATOM   1133  H HA2  . GLY A 1 75 ? -1.418  -2.080  -6.508  1.00 0.11 ? 75  GLY A HA2  1  
ATOM   1134  H HA3  . GLY A 1 75 ? -1.506  -0.591  -7.436  1.00 0.12 ? 75  GLY A HA3  1  
ATOM   1135  N N    . LEU A 1 76 ? 0.894   0.237   -6.188  1.00 0.13 ? 76  LEU A N    1  
ATOM   1136  C CA   . LEU A 1 76 ? 2.336   0.456   -6.146  1.00 0.14 ? 76  LEU A CA   1  
ATOM   1137  C C    . LEU A 1 76 ? 2.968   -0.310  -4.988  1.00 0.14 ? 76  LEU A C    1  
ATOM   1138  O O    . LEU A 1 76 ? 3.876   -1.118  -5.189  1.00 0.15 ? 76  LEU A O    1  
ATOM   1139  C CB   . LEU A 1 76 ? 2.640   1.949   -6.009  1.00 0.15 ? 76  LEU A CB   1  
ATOM   1140  C CG   . LEU A 1 76 ? 2.881   2.707   -7.315  1.00 0.16 ? 76  LEU A CG   1  
ATOM   1141  C CD1  . LEU A 1 76 ? 2.415   4.149   -7.190  1.00 0.17 ? 76  LEU A CD1  1  
ATOM   1142  C CD2  . LEU A 1 76 ? 4.355   2.653   -7.696  1.00 0.18 ? 76  LEU A CD2  1  
ATOM   1143  H H    . LEU A 1 76 ? 0.291   0.977   -5.968  1.00 0.13 ? 76  LEU A H    1  
ATOM   1144  H HA   . LEU A 1 76 ? 2.754   0.096   -7.074  1.00 0.15 ? 76  LEU A HA   1  
ATOM   1145  H HB2  . LEU A 1 76 ? 1.808   2.415   -5.500  1.00 0.15 ? 76  LEU A HB2  1  
ATOM   1146  H HB3  . LEU A 1 76 ? 3.517   2.056   -5.391  1.00 0.16 ? 76  LEU A HB3  1  
ATOM   1147  H HG   . LEU A 1 76 ? 2.312   2.240   -8.106  1.00 0.16 ? 76  LEU A HG   1  
ATOM   1148  H HD11 . LEU A 1 76 ? 1.352   4.168   -6.996  1.00 0.16 ? 76  LEU A HD11 1  
ATOM   1149  H HD12 . LEU A 1 76 ? 2.622   4.675   -8.110  1.00 0.18 ? 76  LEU A HD12 1  
ATOM   1150  H HD13 . LEU A 1 76 ? 2.938   4.628   -6.376  1.00 0.17 ? 76  LEU A HD13 1  
ATOM   1151  H HD21 . LEU A 1 76 ? 4.879   3.471   -7.228  1.00 0.17 ? 76  LEU A HD21 1  
ATOM   1152  H HD22 . LEU A 1 76 ? 4.450   2.730   -8.769  1.00 0.22 ? 76  LEU A HD22 1  
ATOM   1153  H HD23 . LEU A 1 76 ? 4.777   1.716   -7.364  1.00 0.25 ? 76  LEU A HD23 1  
ATOM   1154  N N    . VAL A 1 77 ? 2.482   -0.055  -3.778  1.00 0.14 ? 77  VAL A N    1  
ATOM   1155  C CA   . VAL A 1 77 ? 2.999   -0.724  -2.590  1.00 0.13 ? 77  VAL A CA   1  
ATOM   1156  C C    . VAL A 1 77 ? 2.901   -2.238  -2.726  1.00 0.13 ? 77  VAL A C    1  
ATOM   1157  O O    . VAL A 1 77 ? 3.644   -2.980  -2.082  1.00 0.13 ? 77  VAL A O    1  
ATOM   1158  C CB   . VAL A 1 77 ? 2.238   -0.283  -1.325  1.00 0.13 ? 77  VAL A CB   1  
ATOM   1159  C CG1  . VAL A 1 77 ? 2.718   -1.070  -0.114  1.00 0.13 ? 77  VAL A CG1  1  
ATOM   1160  C CG2  . VAL A 1 77 ? 2.401   1.211   -1.099  1.00 0.13 ? 77  VAL A CG2  1  
ATOM   1161  H H    . VAL A 1 77 ? 1.757   0.598   -3.682  1.00 0.13 ? 77  VAL A H    1  
ATOM   1162  H HA   . VAL A 1 77 ? 4.036   -0.447  -2.475  1.00 0.14 ? 77  VAL A HA   1  
ATOM   1163  H HB   . VAL A 1 77 ? 1.187   -0.491  -1.469  1.00 0.12 ? 77  VAL A HB   1  
ATOM   1164  H HG11 . VAL A 1 77 ? 2.457   -2.110  -0.236  1.00 0.15 ? 77  VAL A HG11 1  
ATOM   1165  H HG12 . VAL A 1 77 ? 2.247   -0.681  0.776   1.00 0.16 ? 77  VAL A HG12 1  
ATOM   1166  H HG13 . VAL A 1 77 ? 3.789   -0.975  -0.027  1.00 0.17 ? 77  VAL A HG13 1  
ATOM   1167  H HG21 . VAL A 1 77 ? 3.449   1.444   -0.970  1.00 0.14 ? 77  VAL A HG21 1  
ATOM   1168  H HG22 . VAL A 1 77 ? 1.857   1.503   -0.212  1.00 0.13 ? 77  VAL A HG22 1  
ATOM   1169  H HG23 . VAL A 1 77 ? 2.016   1.750   -1.952  1.00 0.14 ? 77  VAL A HG23 1  
ATOM   1170  N N    . LEU A 1 78 ? 1.980   -2.694  -3.569  1.00 0.12 ? 78  LEU A N    1  
ATOM   1171  C CA   . LEU A 1 78 ? 1.786   -4.121  -3.792  1.00 0.12 ? 78  LEU A CA   1  
ATOM   1172  C C    . LEU A 1 78 ? 2.751   -4.644  -4.852  1.00 0.13 ? 78  LEU A C    1  
ATOM   1173  O O    . LEU A 1 78 ? 3.396   -5.677  -4.665  1.00 0.13 ? 78  LEU A O    1  
ATOM   1174  C CB   . LEU A 1 78 ? 0.344   -4.400  -4.218  1.00 0.11 ? 78  LEU A CB   1  
ATOM   1175  C CG   . LEU A 1 78 ? -0.177  -5.812  -3.944  1.00 0.10 ? 78  LEU A CG   1  
ATOM   1176  C CD1  . LEU A 1 78 ? -0.539  -5.970  -2.475  1.00 0.09 ? 78  LEU A CD1  1  
ATOM   1177  C CD2  . LEU A 1 78 ? -1.378  -6.117  -4.825  1.00 0.09 ? 78  LEU A CD2  1  
ATOM   1178  H H    . LEU A 1 78 ? 1.416   -2.054  -4.051  1.00 0.12 ? 78  LEU A H    1  
ATOM   1179  H HA   . LEU A 1 78 ? 1.982   -4.631  -2.862  1.00 0.11 ? 78  LEU A HA   1  
ATOM   1180  H HB2  . LEU A 1 78 ? -0.298  -3.699  -3.704  1.00 0.10 ? 78  LEU A HB2  1  
ATOM   1181  H HB3  . LEU A 1 78 ? 0.267   -4.216  -5.280  1.00 0.11 ? 78  LEU A HB3  1  
ATOM   1182  H HG   . LEU A 1 78 ? 0.599   -6.526  -4.173  1.00 0.10 ? 78  LEU A HG   1  
ATOM   1183  H HD11 . LEU A 1 78 ? -1.321  -5.272  -2.219  1.00 0.08 ? 78  LEU A HD11 1  
ATOM   1184  H HD12 . LEU A 1 78 ? 0.332   -5.773  -1.866  1.00 0.10 ? 78  LEU A HD12 1  
ATOM   1185  H HD13 . LEU A 1 78 ? -0.882  -6.977  -2.296  1.00 0.09 ? 78  LEU A HD13 1  
ATOM   1186  H HD21 . LEU A 1 78 ? -1.073  -6.118  -5.861  1.00 0.10 ? 78  LEU A HD21 1  
ATOM   1187  H HD22 . LEU A 1 78 ? -2.137  -5.364  -4.674  1.00 0.09 ? 78  LEU A HD22 1  
ATOM   1188  H HD23 . LEU A 1 78 ? -1.778  -7.087  -4.567  1.00 0.09 ? 78  LEU A HD23 1  
ATOM   1189  N N    . GLY A 1 79 ? 2.848   -3.924  -5.965  1.00 0.13 ? 79  GLY A N    1  
ATOM   1190  C CA   . GLY A 1 79 ? 3.737   -4.329  -7.037  1.00 0.15 ? 79  GLY A CA   1  
ATOM   1191  C C    . GLY A 1 79 ? 5.148   -4.593  -6.549  1.00 0.15 ? 79  GLY A C    1  
ATOM   1192  O O    . GLY A 1 79 ? 5.879   -5.388  -7.142  1.00 0.16 ? 79  GLY A O    1  
ATOM   1193  H H    . GLY A 1 79 ? 2.310   -3.109  -6.058  1.00 0.13 ? 79  GLY A H    1  
ATOM   1194  H HA2  . GLY A 1 79 ? 3.350   -5.230  -7.490  1.00 0.14 ? 79  GLY A HA2  1  
ATOM   1195  H HA3  . GLY A 1 79 ? 3.766   -3.547  -7.781  1.00 0.15 ? 79  GLY A HA3  1  
ATOM   1196  N N    . ALA A 1 80 ? 5.534   -3.925  -5.467  1.00 0.15 ? 80  ALA A N    1  
ATOM   1197  C CA   . ALA A 1 80 ? 6.867   -4.092  -4.901  1.00 0.16 ? 80  ALA A CA   1  
ATOM   1198  C C    . ALA A 1 80 ? 6.925   -5.309  -3.985  1.00 0.16 ? 80  ALA A C    1  
ATOM   1199  O O    . ALA A 1 80 ? 7.767   -6.191  -4.160  1.00 0.17 ? 80  ALA A O    1  
ATOM   1200  C CB   . ALA A 1 80 ? 7.280   -2.839  -4.145  1.00 0.17 ? 80  ALA A CB   1  
ATOM   1201  H H    . ALA A 1 80 ? 4.907   -3.303  -5.040  1.00 0.15 ? 80  ALA A H    1  
ATOM   1202  H HA   . ALA A 1 80 ? 7.560   -4.235  -5.719  1.00 0.17 ? 80  ALA A HA   1  
ATOM   1203  H HB1  . ALA A 1 80 ? 6.652   -2.719  -3.275  1.00 0.16 ? 80  ALA A HB1  1  
ATOM   1204  H HB2  . ALA A 1 80 ? 7.173   -1.978  -4.788  1.00 0.18 ? 80  ALA A HB2  1  
ATOM   1205  H HB3  . ALA A 1 80 ? 8.310   -2.929  -3.834  1.00 0.18 ? 80  ALA A HB3  1  
ATOM   1206  N N    . LEU A 1 81 ? 6.028   -5.350  -3.006  1.00 0.15 ? 81  LEU A N    1  
ATOM   1207  C CA   . LEU A 1 81 ? 5.978   -6.459  -2.060  1.00 0.15 ? 81  LEU A CA   1  
ATOM   1208  C C    . LEU A 1 81 ? 5.806   -7.788  -2.788  1.00 0.14 ? 81  LEU A C    1  
ATOM   1209  O O    . LEU A 1 81 ? 6.474   -8.772  -2.472  1.00 0.15 ? 81  LEU A O    1  
ATOM   1210  C CB   . LEU A 1 81 ? 4.832   -6.256  -1.066  1.00 0.14 ? 81  LEU A CB   1  
ATOM   1211  C CG   . LEU A 1 81 ? 5.235   -5.800  0.337   1.00 0.14 ? 81  LEU A CG   1  
ATOM   1212  C CD1  . LEU A 1 81 ? 4.009   -5.686  1.232   1.00 0.13 ? 81  LEU A CD1  1  
ATOM   1213  C CD2  . LEU A 1 81 ? 6.249   -6.759  0.938   1.00 0.15 ? 81  LEU A CD2  1  
ATOM   1214  H H    . LEU A 1 81 ? 5.384   -4.616  -2.917  1.00 0.14 ? 81  LEU A H    1  
ATOM   1215  H HA   . LEU A 1 81 ? 6.912   -6.475  -1.520  1.00 0.15 ? 81  LEU A HA   1  
ATOM   1216  H HB2  . LEU A 1 81 ? 4.158   -5.519  -1.478  1.00 0.13 ? 81  LEU A HB2  1  
ATOM   1217  H HB3  . LEU A 1 81 ? 4.299   -7.190  -0.976  1.00 0.13 ? 81  LEU A HB3  1  
ATOM   1218  H HG   . LEU A 1 81 ? 5.692   -4.823  0.273   1.00 0.15 ? 81  LEU A HG   1  
ATOM   1219  H HD11 . LEU A 1 81 ? 3.779   -6.652  1.653   1.00 0.13 ? 81  LEU A HD11 1  
ATOM   1220  H HD12 . LEU A 1 81 ? 3.169   -5.336  0.651   1.00 0.12 ? 81  LEU A HD12 1  
ATOM   1221  H HD13 . LEU A 1 81 ? 4.212   -4.986  2.030   1.00 0.13 ? 81  LEU A HD13 1  
ATOM   1222  H HD21 . LEU A 1 81 ? 5.927   -7.776  0.772   1.00 0.14 ? 81  LEU A HD21 1  
ATOM   1223  H HD22 . LEU A 1 81 ? 6.331   -6.576  2.000   1.00 0.15 ? 81  LEU A HD22 1  
ATOM   1224  H HD23 . LEU A 1 81 ? 7.212   -6.604  0.473   1.00 0.16 ? 81  LEU A HD23 1  
ATOM   1225  N N    . LYS A 1 82 ? 4.906   -7.808  -3.765  1.00 0.14 ? 82  LYS A N    1  
ATOM   1226  C CA   . LYS A 1 82 ? 4.647   -9.015  -4.541  1.00 0.14 ? 82  LYS A CA   1  
ATOM   1227  C C    . LYS A 1 82 ? 5.946   -9.601  -5.086  1.00 0.15 ? 82  LYS A C    1  
ATOM   1228  O O    . LYS A 1 82 ? 6.078   -10.816 -5.225  1.00 0.15 ? 82  LYS A O    1  
ATOM   1229  C CB   . LYS A 1 82 ? 3.691   -8.707  -5.696  1.00 0.13 ? 82  LYS A CB   1  
ATOM   1230  C CG   . LYS A 1 82 ? 2.277   -9.212  -5.466  1.00 0.12 ? 82  LYS A CG   1  
ATOM   1231  C CD   . LYS A 1 82 ? 1.265   -8.428  -6.286  1.00 0.12 ? 82  LYS A CD   1  
ATOM   1232  C CE   . LYS A 1 82 ? -0.095  -9.112  -6.291  1.00 0.11 ? 82  LYS A CE   1  
ATOM   1233  N NZ   . LYS A 1 82 ? -0.432  -9.665  -7.632  1.00 0.12 ? 82  LYS A NZ   1  
ATOM   1234  H H    . LYS A 1 82 ? 4.404   -6.992  -3.969  1.00 0.13 ? 82  LYS A H    1  
ATOM   1235  H HA   . LYS A 1 82 ? 4.185   -9.738  -3.886  1.00 0.13 ? 82  LYS A HA   1  
ATOM   1236  H HB2  . LYS A 1 82 ? 3.650   -7.637  -5.838  1.00 0.13 ? 82  LYS A HB2  1  
ATOM   1237  H HB3  . LYS A 1 82 ? 4.072   -9.166  -6.596  1.00 0.14 ? 82  LYS A HB3  1  
ATOM   1238  H HG2  . LYS A 1 82 ? 2.226   -10.253 -5.749  1.00 0.12 ? 82  LYS A HG2  1  
ATOM   1239  H HG3  . LYS A 1 82 ? 2.035   -9.110  -4.419  1.00 0.12 ? 82  LYS A HG3  1  
ATOM   1240  H HD2  . LYS A 1 82 ? 1.160   -7.441  -5.865  1.00 0.12 ? 82  LYS A HD2  1  
ATOM   1241  H HD3  . LYS A 1 82 ? 1.623   -8.352  -7.302  1.00 0.13 ? 82  LYS A HD3  1  
ATOM   1242  H HE2  . LYS A 1 82 ? -0.083  -9.917  -5.572  1.00 0.11 ? 82  LYS A HE2  1  
ATOM   1243  H HE3  . LYS A 1 82 ? -0.848  -8.390  -6.010  1.00 0.10 ? 82  LYS A HE3  1  
ATOM   1244  H HZ1  . LYS A 1 82 ? -1.364  -10.127 -7.605  1.00 0.11 ? 82  LYS A HZ1  1  
ATOM   1245  H HZ2  . LYS A 1 82 ? 0.281   -10.365 -7.919  1.00 0.12 ? 82  LYS A HZ2  1  
ATOM   1246  H HZ3  . LYS A 1 82 ? -0.455  -8.902  -8.339  1.00 0.12 ? 82  LYS A HZ3  1  
ATOM   1247  N N    . ALA A 1 83 ? 6.902   -8.729  -5.389  1.00 0.16 ? 83  ALA A N    1  
ATOM   1248  C CA   . ALA A 1 83 ? 8.192   -9.162  -5.913  1.00 0.17 ? 83  ALA A CA   1  
ATOM   1249  C C    . ALA A 1 83 ? 9.139   -9.555  -4.784  1.00 0.18 ? 83  ALA A C    1  
ATOM   1250  O O    . ALA A 1 83 ? 10.010  -10.406 -4.963  1.00 0.19 ? 83  ALA A O    1  
ATOM   1251  C CB   . ALA A 1 83 ? 8.808   -8.064  -6.766  1.00 0.18 ? 83  ALA A CB   1  
ATOM   1252  H H    . ALA A 1 83 ? 6.736   -7.773  -5.258  1.00 0.16 ? 83  ALA A H    1  
ATOM   1253  H HA   . ALA A 1 83 ? 8.022   -10.023 -6.544  1.00 0.17 ? 83  ALA A HA   1  
ATOM   1254  H HB1  . ALA A 1 83 ? 8.998   -7.195  -6.153  1.00 0.18 ? 83  ALA A HB1  1  
ATOM   1255  H HB2  . ALA A 1 83 ? 8.129   -7.801  -7.562  1.00 0.18 ? 83  ALA A HB2  1  
ATOM   1256  H HB3  . ALA A 1 83 ? 9.739   -8.416  -7.188  1.00 0.19 ? 83  ALA A HB3  1  
ATOM   1257  N N    . ALA A 1 84 ? 8.963   -8.930  -3.626  1.00 0.17 ? 84  ALA A N    1  
ATOM   1258  C CA   . ALA A 1 84 ? 9.802   -9.215  -2.469  1.00 0.18 ? 84  ALA A CA   1  
ATOM   1259  C C    . ALA A 1 84 ? 9.456   -10.569 -1.860  1.00 0.18 ? 84  ALA A C    1  
ATOM   1260  O O    . ALA A 1 84 ? 10.284  -11.193 -1.197  1.00 0.18 ? 84  ALA A O    1  
ATOM   1261  C CB   . ALA A 1 84 ? 9.660   -8.114  -1.428  1.00 0.18 ? 84  ALA A CB   1  
ATOM   1262  H H    . ALA A 1 84 ? 8.252   -8.260  -3.547  1.00 0.17 ? 84  ALA A H    1  
ATOM   1263  H HA   . ALA A 1 84 ? 10.831  -9.233  -2.800  1.00 0.19 ? 84  ALA A HA   1  
ATOM   1264  H HB1  . ALA A 1 84 ? 10.331  -8.309  -0.604  1.00 0.19 ? 84  ALA A HB1  1  
ATOM   1265  H HB2  . ALA A 1 84 ? 8.642   -8.090  -1.066  1.00 0.17 ? 84  ALA A HB2  1  
ATOM   1266  H HB3  . ALA A 1 84 ? 9.906   -7.162  -1.875  1.00 0.18 ? 84  ALA A HB3  1  
ATOM   1267  N N    . ARG A 1 85 ? 8.227   -11.018 -2.090  1.00 0.16 ? 85  ARG A N    1  
ATOM   1268  C CA   . ARG A 1 85 ? 7.768   -12.298 -1.563  1.00 0.16 ? 85  ARG A CA   1  
ATOM   1269  C C    . ARG A 1 85 ? 7.765   -13.365 -2.653  1.00 0.16 ? 85  ARG A C    1  
ATOM   1270  O O    . ARG A 1 85 ? 7.063   -14.372 -2.546  1.00 0.16 ? 85  ARG A O    1  
ATOM   1271  C CB   . ARG A 1 85 ? 6.367   -12.157 -0.965  1.00 0.15 ? 85  ARG A CB   1  
ATOM   1272  C CG   . ARG A 1 85 ? 6.306   -11.218 0.229   1.00 0.15 ? 85  ARG A CG   1  
ATOM   1273  C CD   . ARG A 1 85 ? 4.907   -11.164 0.823   1.00 0.14 ? 85  ARG A CD   1  
ATOM   1274  N NE   . ARG A 1 85 ? 4.932   -11.192 2.283   1.00 0.14 ? 85  ARG A NE   1  
ATOM   1275  C CZ   . ARG A 1 85 ? 5.302   -12.252 2.992   1.00 0.14 ? 85  ARG A CZ   1  
ATOM   1276  N NH1  . ARG A 1 85 ? 5.675   -13.366 2.379   1.00 0.15 ? 85  ARG A NH1  1  
ATOM   1277  N NH2  . ARG A 1 85 ? 5.297   -12.200 4.318   1.00 0.15 ? 85  ARG A NH2  1  
ATOM   1278  H H    . ARG A 1 85 ? 7.612   -10.476 -2.628  1.00 0.16 ? 85  ARG A H    1  
ATOM   1279  H HA   . ARG A 1 85 ? 8.454   -12.599 -0.785  1.00 0.17 ? 85  ARG A HA   1  
ATOM   1280  H HB2  . ARG A 1 85 ? 5.700   -11.781 -1.727  1.00 0.14 ? 85  ARG A HB2  1  
ATOM   1281  H HB3  . ARG A 1 85 ? 6.025   -13.131 -0.649  1.00 0.15 ? 85  ARG A HB3  1  
ATOM   1282  H HG2  . ARG A 1 85 ? 6.993   -11.566 0.984   1.00 0.15 ? 85  ARG A HG2  1  
ATOM   1283  H HG3  . ARG A 1 85 ? 6.591   -10.227 -0.091  1.00 0.15 ? 85  ARG A HG3  1  
ATOM   1284  H HD2  . ARG A 1 85 ? 4.426   -10.254 0.499   1.00 0.13 ? 85  ARG A HD2  1  
ATOM   1285  H HD3  . ARG A 1 85 ? 4.346   -12.014 0.465   1.00 0.13 ? 85  ARG A HD3  1  
ATOM   1286  H HE   . ARG A 1 85 ? 4.658   -10.378 2.757   1.00 0.14 ? 85  ARG A HE   1  
ATOM   1287  H HH11 . ARG A 1 85 ? 5.954   -14.163 2.914   1.00 0.15 ? 85  ARG A HH11 1  
ATOM   1288  H HH12 . ARG A 1 85 ? 5.679   -13.409 1.379   1.00 0.15 ? 85  ARG A HH12 1  
ATOM   1289  H HH21 . ARG A 1 85 ? 5.014   -11.361 4.785   1.00 0.15 ? 85  ARG A HH21 1  
ATOM   1290  H HH22 . ARG A 1 85 ? 5.576   -12.998 4.852   1.00 0.15 ? 85  ARG A HH22 1  
ATOM   1291  N N    . GLU A 1 86 ? 8.550   -13.138 -3.700  1.00 0.17 ? 86  GLU A N    1  
ATOM   1292  C CA   . GLU A 1 86 ? 8.634   -14.078 -4.812  1.00 0.17 ? 86  GLU A CA   1  
ATOM   1293  C C    . GLU A 1 86 ? 10.044  -14.648 -4.936  1.00 0.19 ? 86  GLU A C    1  
ATOM   1294  O O    . GLU A 1 86 ? 10.229  -15.784 -5.372  1.00 0.19 ? 86  GLU A O    1  
ATOM   1295  C CB   . GLU A 1 86 ? 8.228   -13.396 -6.120  1.00 0.17 ? 86  GLU A CB   1  
ATOM   1296  C CG   . GLU A 1 86 ? 6.826   -13.754 -6.582  1.00 0.16 ? 86  GLU A CG   1  
ATOM   1297  C CD   . GLU A 1 86 ? 6.503   -13.189 -7.953  1.00 0.17 ? 86  GLU A CD   1  
ATOM   1298  O OE1  . GLU A 1 86 ? 7.160   -13.597 -8.932  1.00 0.18 ? 86  GLU A OE1  1  
ATOM   1299  O OE2  . GLU A 1 86 ? 5.594   -12.338 -8.044  1.00 0.16 ? 86  GLU A OE2  1  
ATOM   1300  H H    . GLU A 1 86 ? 9.085   -12.318 -3.728  1.00 0.17 ? 86  GLU A H    1  
ATOM   1301  H HA   . GLU A 1 86 ? 7.949   -14.889 -4.611  1.00 0.17 ? 86  GLU A HA   1  
ATOM   1302  H HB2  . GLU A 1 86 ? 8.277   -12.326 -5.983  1.00 0.17 ? 86  GLU A HB2  1  
ATOM   1303  H HB3  . GLU A 1 86 ? 8.924   -13.684 -6.894  1.00 0.18 ? 86  GLU A HB3  1  
ATOM   1304  H HG2  . GLU A 1 86 ? 6.737   -14.829 -6.624  1.00 0.17 ? 86  GLU A HG2  1  
ATOM   1305  H HG3  . GLU A 1 86 ? 6.115   -13.362 -5.870  1.00 0.16 ? 86  GLU A HG3  1  
ATOM   1306  N N    . GLU A 1 87 ? 11.034  -13.847 -4.554  1.00 0.19 ? 87  GLU A N    1  
ATOM   1307  C CA   . GLU A 1 87 ? 12.428  -14.271 -4.625  1.00 0.21 ? 87  GLU A CA   1  
ATOM   1308  C C    . GLU A 1 87 ? 12.779  -15.186 -3.458  1.00 0.21 ? 87  GLU A C    1  
ATOM   1309  O O    . GLU A 1 87 ? 13.832  -15.822 -3.449  1.00 0.22 ? 87  GLU A O    1  
ATOM   1310  C CB   . GLU A 1 87 ? 13.354  -13.053 -4.629  1.00 0.21 ? 87  GLU A CB   1  
ATOM   1311  C CG   . GLU A 1 87 ? 13.817  -12.644 -6.016  1.00 0.22 ? 87  GLU A CG   1  
ATOM   1312  C CD   . GLU A 1 87 ? 15.327  -12.563 -6.126  1.00 0.24 ? 87  GLU A CD   1  
ATOM   1313  O OE1  . GLU A 1 87 ? 15.941  -13.547 -6.595  1.00 0.24 ? 87  GLU A OE1  1  
ATOM   1314  O OE2  . GLU A 1 87 ? 15.897  -11.520 -5.746  1.00 0.24 ? 87  GLU A OE2  1  
ATOM   1315  O OXT  . GLU A 1 87 ? 11.996  -15.255 -2.463  1.00 0.20 ? 87  GLU A OXT  1  
ATOM   1316  H H    . GLU A 1 87 ? 10.823  -12.953 -4.216  1.00 0.19 ? 87  GLU A H    1  
ATOM   1317  H HA   . GLU A 1 87 ? 12.562  -14.816 -5.547  1.00 0.21 ? 87  GLU A HA   1  
ATOM   1318  H HB2  . GLU A 1 87 ? 12.832  -12.217 -4.186  1.00 0.21 ? 87  GLU A HB2  1  
ATOM   1319  H HB3  . GLU A 1 87 ? 14.227  -13.276 -4.033  1.00 0.22 ? 87  GLU A HB3  1  
ATOM   1320  H HG2  . GLU A 1 87 ? 13.458  -13.369 -6.731  1.00 0.22 ? 87  GLU A HG2  1  
ATOM   1321  H HG3  . GLU A 1 87 ? 13.403  -11.675 -6.249  1.00 0.22 ? 87  GLU A HG3  1  
HETATM 1322  C C1   . I3P B 2 .  ? 11.445  9.974   0.825   1.00 0.80 ? 101 I3P A C1   1  
HETATM 1323  C C2   . I3P B 2 .  ? 11.656  10.667  2.190   1.00 0.90 ? 101 I3P A C2   1  
HETATM 1324  C C3   . I3P B 2 .  ? 11.474  12.192  2.047   1.00 0.87 ? 101 I3P A C3   1  
HETATM 1325  C C4   . I3P B 2 .  ? 10.077  12.530  1.481   1.00 0.99 ? 101 I3P A C4   1  
HETATM 1326  C C5   . I3P B 2 .  ? 9.864   11.830  0.122   1.00 0.89 ? 101 I3P A C5   1  
HETATM 1327  C C6   . I3P B 2 .  ? 10.049  10.303  0.262   1.00 0.77 ? 101 I3P A C6   1  
HETATM 1328  O O1   . I3P B 2 .  ? 11.560  8.572   0.978   1.00 1.09 ? 101 I3P A O1   1  
HETATM 1329  O O2   . I3P B 2 .  ? 10.741  10.171  3.140   1.00 1.13 ? 101 I3P A O2   1  
HETATM 1330  O O3   . I3P B 2 .  ? 11.653  12.795  3.301   1.00 1.18 ? 101 I3P A O3   1  
HETATM 1331  O O4   . I3P B 2 .  ? 9.988   13.929  1.290   1.00 1.27 ? 101 I3P A O4   1  
HETATM 1332  O O5   . I3P B 2 .  ? 8.547   12.088  -0.327  1.00 1.24 ? 101 I3P A O5   1  
HETATM 1333  O O6   . I3P B 2 .  ? 9.909   9.686   -0.994  1.00 0.95 ? 101 I3P A O6   1  
HETATM 1334  P P1   . I3P B 2 .  ? 13.124  8.020   0.413   1.00 1.49 ? 101 I3P A P1   1  
HETATM 1335  O O11  . I3P B 2 .  ? 13.383  8.409   -1.261  1.00 1.57 ? 101 I3P A O11  1  
HETATM 1336  O O12  . I3P B 2 .  ? 14.220  8.730   1.254   1.00 1.59 ? 101 I3P A O12  1  
HETATM 1337  O O13  . I3P B 2 .  ? 13.297  6.315   0.685   1.00 1.97 ? 101 I3P A O13  1  
HETATM 1338  P P4   . I3P B 2 .  ? 8.700   14.602  2.270   1.00 1.78 ? 101 I3P A P4   1  
HETATM 1339  O O41  . I3P B 2 .  ? 7.352   14.031  1.750   1.00 1.94 ? 101 I3P A O41  1  
HETATM 1340  O O42  . I3P B 2 .  ? 8.851   14.169  3.944   1.00 1.90 ? 101 I3P A O42  1  
HETATM 1341  O O43  . I3P B 2 .  ? 8.620   16.325  2.083   1.00 2.20 ? 101 I3P A O43  1  
HETATM 1342  P P5   . I3P B 2 .  ? 8.572   13.050  -1.792  1.00 1.58 ? 101 I3P A P5   1  
HETATM 1343  O O51  . I3P B 2 .  ? 9.188   12.181  -2.922  1.00 1.56 ? 101 I3P A O51  1  
HETATM 1344  O O52  . I3P B 2 .  ? 6.961   13.455  -2.291  1.00 2.10 ? 101 I3P A O52  1  
HETATM 1345  O O53  . I3P B 2 .  ? 9.545   14.478  -1.629  1.00 1.65 ? 101 I3P A O53  1  
HETATM 1346  H H1   . I3P B 2 .  ? 12.189  10.350  0.117   1.00 0.84 ? 101 I3P A H1   1  
HETATM 1347  H H2   . I3P B 2 .  ? 12.671  10.473  2.543   1.00 1.09 ? 101 I3P A H2   1  
HETATM 1348  H H3   . I3P B 2 .  ? 12.238  12.571  1.362   1.00 0.81 ? 101 I3P A H3   1  
HETATM 1349  H H4   . I3P B 2 .  ? 9.316   12.177  2.184   1.00 1.17 ? 101 I3P A H4   1  
HETATM 1350  H H5   . I3P B 2 .  ? 10.609  12.204  -0.588  1.00 0.89 ? 101 I3P A H5   1  
HETATM 1351  H H6   . I3P B 2 .  ? 9.283   9.903   0.932   1.00 0.90 ? 101 I3P A H6   1  
HETATM 1352  H HO2  . I3P B 2 .  ? 9.914   9.975   2.661   1.00 1.23 ? 101 I3P A HO2  1  
HETATM 1353  H HO3  . I3P B 2 .  ? 11.372  13.727  3.223   1.00 1.33 ? 101 I3P A HO3  1  
HETATM 1354  H HO6  . I3P B 2 .  ? 9.448   10.310  -1.586  1.00 1.04 ? 101 I3P A HO6  1  
HETATM 1355  H HO13 . I3P B 2 .  ? 14.185  6.038   0.396   1.00 2.23 ? 101 I3P A HO13 1  
ATOM   1356  N N    . SER A 1 1  ? 2.829   3.790   9.856   1.00 0.76 ? 1   SER A N    2  
ATOM   1357  C CA   . SER A 1 1  ? 2.388   5.001   10.538  1.00 0.88 ? 1   SER A CA   2  
ATOM   1358  C C    . SER A 1 1  ? 3.513   6.028   10.606  1.00 0.88 ? 1   SER A C    2  
ATOM   1359  O O    . SER A 1 1  ? 3.267   7.227   10.732  1.00 0.98 ? 1   SER A O    2  
ATOM   1360  C CB   . SER A 1 1  ? 1.901   4.666   11.950  1.00 0.96 ? 1   SER A CB   2  
ATOM   1361  O OG   . SER A 1 1  ? 0.492   4.524   11.983  1.00 1.05 ? 1   SER A OG   2  
ATOM   1362  H H1   . SER A 1 1  ? 3.130   4.016   8.886   1.00 0.73 ? 1   SER A H1   2  
ATOM   1363  H H2   . SER A 1 1  ? 2.052   3.100   9.814   1.00 0.79 ? 1   SER A H2   2  
ATOM   1364  H H3   . SER A 1 1  ? 3.629   3.364   10.365  1.00 0.72 ? 1   SER A H3   2  
ATOM   1365  H HA   . SER A 1 1  ? 1.568   5.424   9.976   1.00 0.95 ? 1   SER A HA   2  
ATOM   1366  H HB2  . SER A 1 1  ? 2.351   3.740   12.274  1.00 0.91 ? 1   SER A HB2  2  
ATOM   1367  H HB3  . SER A 1 1  ? 2.187   5.460   12.624  1.00 1.02 ? 1   SER A HB3  2  
ATOM   1368  H HG   . SER A 1 1  ? 0.120   5.157   12.603  1.00 1.13 ? 1   SER A HG   2  
ATOM   1369  N N    . GLU A 1 2  ? 4.751   5.548   10.521  1.00 0.79 ? 2   GLU A N    2  
ATOM   1370  C CA   . GLU A 1 2  ? 5.914   6.424   10.574  1.00 0.83 ? 2   GLU A CA   2  
ATOM   1371  C C    . GLU A 1 2  ? 7.197   5.640   10.310  1.00 0.76 ? 2   GLU A C    2  
ATOM   1372  O O    . GLU A 1 2  ? 8.126   6.144   9.680   1.00 0.77 ? 2   GLU A O    2  
ATOM   1373  C CB   . GLU A 1 2  ? 5.997   7.117   11.935  1.00 0.96 ? 2   GLU A CB   2  
ATOM   1374  C CG   . GLU A 1 2  ? 6.394   6.187   13.069  1.00 0.99 ? 2   GLU A CG   2  
ATOM   1375  C CD   . GLU A 1 2  ? 6.495   6.902   14.403  1.00 1.14 ? 2   GLU A CD   2  
ATOM   1376  O OE1  . GLU A 1 2  ? 6.975   8.055   14.421  1.00 1.22 ? 2   GLU A OE1  2  
ATOM   1377  O OE2  . GLU A 1 2  ? 6.093   6.309   15.425  1.00 1.19 ? 2   GLU A OE2  2  
ATOM   1378  H H    . GLU A 1 2  ? 4.884   4.583   10.422  1.00 0.72 ? 2   GLU A H    2  
ATOM   1379  H HA   . GLU A 1 2  ? 5.800   7.173   9.805   1.00 0.86 ? 2   GLU A HA   2  
ATOM   1380  H HB2  . GLU A 1 2  ? 6.727   7.912   11.877  1.00 1.02 ? 2   GLU A HB2  2  
ATOM   1381  H HB3  . GLU A 1 2  ? 5.032   7.543   12.168  1.00 1.02 ? 2   GLU A HB3  2  
ATOM   1382  H HG2  . GLU A 1 2  ? 5.654   5.405   13.152  1.00 0.95 ? 2   GLU A HG2  2  
ATOM   1383  H HG3  . GLU A 1 2  ? 7.355   5.749   12.838  1.00 0.95 ? 2   GLU A HG3  2  
ATOM   1384  N N    . ALA A 1 3  ? 7.240   4.405   10.799  1.00 0.72 ? 3   ALA A N    2  
ATOM   1385  C CA   . ALA A 1 3  ? 8.408   3.551   10.615  1.00 0.70 ? 3   ALA A CA   2  
ATOM   1386  C C    . ALA A 1 3  ? 8.230   2.630   9.414   1.00 0.57 ? 3   ALA A C    2  
ATOM   1387  O O    . ALA A 1 3  ? 9.117   2.518   8.568   1.00 0.56 ? 3   ALA A O    2  
ATOM   1388  C CB   . ALA A 1 3  ? 8.668   2.737   11.874  1.00 0.79 ? 3   ALA A CB   2  
ATOM   1389  H H    . ALA A 1 3  ? 6.471   4.061   11.299  1.00 0.73 ? 3   ALA A H    2  
ATOM   1390  H HA   . ALA A 1 3  ? 9.263   4.189   10.444  1.00 0.75 ? 3   ALA A HA   2  
ATOM   1391  H HB1  . ALA A 1 3  ? 8.790   3.404   12.715  1.00 0.89 ? 3   ALA A HB1  2  
ATOM   1392  H HB2  . ALA A 1 3  ? 9.567   2.152   11.745  1.00 0.82 ? 3   ALA A HB2  2  
ATOM   1393  H HB3  . ALA A 1 3  ? 7.833   2.078   12.056  1.00 0.76 ? 3   ALA A HB3  2  
ATOM   1394  N N    . VAL A 1 4  ? 7.062   1.992   9.346   1.00 0.52 ? 4   VAL A N    2  
ATOM   1395  C CA   . VAL A 1 4  ? 6.734   1.072   8.259   1.00 0.45 ? 4   VAL A CA   2  
ATOM   1396  C C    . VAL A 1 4  ? 6.723   1.790   6.909   1.00 0.43 ? 4   VAL A C    2  
ATOM   1397  O O    . VAL A 1 4  ? 7.031   1.195   5.879   1.00 0.44 ? 4   VAL A O    2  
ATOM   1398  C CB   . VAL A 1 4  ? 5.359   0.403   8.491   1.00 0.49 ? 4   VAL A CB   2  
ATOM   1399  C CG1  . VAL A 1 4  ? 5.124   -0.720  7.491   1.00 0.55 ? 4   VAL A CG1  2  
ATOM   1400  C CG2  . VAL A 1 4  ? 5.247   -0.118  9.917   1.00 0.62 ? 4   VAL A CG2  2  
ATOM   1401  H H    . VAL A 1 4  ? 6.400   2.144   10.051  1.00 0.57 ? 4   VAL A H    2  
ATOM   1402  H HA   . VAL A 1 4  ? 7.488   0.298   8.238   1.00 0.46 ? 4   VAL A HA   2  
ATOM   1403  H HB   . VAL A 1 4  ? 4.592   1.150   8.344   1.00 0.59 ? 4   VAL A HB   2  
ATOM   1404  H HG11 . VAL A 1 4  ? 5.158   -0.322  6.488   1.00 0.62 ? 4   VAL A HG11 2  
ATOM   1405  H HG12 . VAL A 1 4  ? 4.156   -1.165  7.670   1.00 0.62 ? 4   VAL A HG12 2  
ATOM   1406  H HG13 . VAL A 1 4  ? 5.892   -1.471  7.607   1.00 0.62 ? 4   VAL A HG13 2  
ATOM   1407  H HG21 . VAL A 1 4  ? 4.311   -0.644  10.035  1.00 0.68 ? 4   VAL A HG21 2  
ATOM   1408  H HG22 . VAL A 1 4  ? 5.283   0.711   10.608  1.00 0.78 ? 4   VAL A HG22 2  
ATOM   1409  H HG23 . VAL A 1 4  ? 6.067   -0.792  10.120  1.00 0.70 ? 4   VAL A HG23 2  
ATOM   1410  N N    . ILE A 1 5  ? 6.381   3.078   6.928   1.00 0.45 ? 5   ILE A N    2  
ATOM   1411  C CA   . ILE A 1 5  ? 6.330   3.880   5.708   1.00 0.48 ? 5   ILE A CA   2  
ATOM   1412  C C    . ILE A 1 5  ? 7.720   4.038   5.088   1.00 0.46 ? 5   ILE A C    2  
ATOM   1413  O O    . ILE A 1 5  ? 7.858   4.089   3.868   1.00 0.57 ? 5   ILE A O    2  
ATOM   1414  C CB   . ILE A 1 5  ? 5.725   5.277   5.975   1.00 0.56 ? 5   ILE A CB   2  
ATOM   1415  C CG1  . ILE A 1 5  ? 4.387   5.148   6.710   1.00 0.73 ? 5   ILE A CG1  2  
ATOM   1416  C CG2  . ILE A 1 5  ? 5.538   6.036   4.668   1.00 0.81 ? 5   ILE A CG2  2  
ATOM   1417  C CD1  . ILE A 1 5  ? 3.748   6.477   7.053   1.00 0.82 ? 5   ILE A CD1  2  
ATOM   1418  H H    . ILE A 1 5  ? 6.160   3.500   7.785   1.00 0.48 ? 5   ILE A H    2  
ATOM   1419  H HA   . ILE A 1 5  ? 5.692   3.366   5.003   1.00 0.50 ? 5   ILE A HA   2  
ATOM   1420  H HB   . ILE A 1 5  ? 6.415   5.833   6.592   1.00 0.65 ? 5   ILE A HB   2  
ATOM   1421  H HG12 . ILE A 1 5  ? 3.695   4.599   6.090   1.00 0.89 ? 5   ILE A HG12 2  
ATOM   1422  H HG13 . ILE A 1 5  ? 4.542   4.606   7.632   1.00 0.89 ? 5   ILE A HG13 2  
ATOM   1423  H HG21 . ILE A 1 5  ? 4.922   5.454   4.000   1.00 0.99 ? 5   ILE A HG21 2  
ATOM   1424  H HG22 . ILE A 1 5  ? 6.501   6.209   4.211   1.00 0.98 ? 5   ILE A HG22 2  
ATOM   1425  H HG23 . ILE A 1 5  ? 5.059   6.984   4.867   1.00 0.91 ? 5   ILE A HG23 2  
ATOM   1426  H HD11 . ILE A 1 5  ? 3.664   7.078   6.159   1.00 0.92 ? 5   ILE A HD11 2  
ATOM   1427  H HD12 . ILE A 1 5  ? 4.360   6.995   7.778   1.00 0.99 ? 5   ILE A HD12 2  
ATOM   1428  H HD13 . ILE A 1 5  ? 2.765   6.308   7.467   1.00 1.11 ? 5   ILE A HD13 2  
ATOM   1429  N N    . LYS A 1 6  ? 8.748   4.101   5.934   1.00 0.44 ? 6   LYS A N    2  
ATOM   1430  C CA   . LYS A 1 6  ? 10.124  4.248   5.461   1.00 0.45 ? 6   LYS A CA   2  
ATOM   1431  C C    . LYS A 1 6  ? 10.670  2.926   4.926   1.00 0.41 ? 6   LYS A C    2  
ATOM   1432  O O    . LYS A 1 6  ? 11.471  2.912   3.992   1.00 0.42 ? 6   LYS A O    2  
ATOM   1433  C CB   . LYS A 1 6  ? 11.025  4.766   6.586   1.00 0.52 ? 6   LYS A CB   2  
ATOM   1434  C CG   . LYS A 1 6  ? 10.778  6.223   6.956   1.00 0.78 ? 6   LYS A CG   2  
ATOM   1435  C CD   . LYS A 1 6  ? 11.083  7.168   5.799   1.00 1.08 ? 6   LYS A CD   2  
ATOM   1436  C CE   . LYS A 1 6  ? 12.552  7.124   5.403   1.00 1.30 ? 6   LYS A CE   2  
ATOM   1437  N NZ   . LYS A 1 6  ? 12.853  8.063   4.288   1.00 1.91 ? 6   LYS A NZ   2  
ATOM   1438  H H    . LYS A 1 6  ? 8.578   4.046   6.897   1.00 0.51 ? 6   LYS A H    2  
ATOM   1439  H HA   . LYS A 1 6  ? 10.118  4.967   4.658   1.00 0.46 ? 6   LYS A HA   2  
ATOM   1440  H HB2  . LYS A 1 6  ? 10.863  4.162   7.466   1.00 0.72 ? 6   LYS A HB2  2  
ATOM   1441  H HB3  . LYS A 1 6  ? 12.056  4.665   6.279   1.00 0.62 ? 6   LYS A HB3  2  
ATOM   1442  H HG2  . LYS A 1 6  ? 9.742   6.341   7.238   1.00 1.09 ? 6   LYS A HG2  2  
ATOM   1443  H HG3  . LYS A 1 6  ? 11.410  6.481   7.794   1.00 0.83 ? 6   LYS A HG3  2  
ATOM   1444  H HD2  . LYS A 1 6  ? 10.483  6.886   4.948   1.00 1.25 ? 6   LYS A HD2  2  
ATOM   1445  H HD3  . LYS A 1 6  ? 10.831  8.176   6.097   1.00 1.41 ? 6   LYS A HD3  2  
ATOM   1446  H HE2  . LYS A 1 6  ? 13.152  7.392   6.259   1.00 1.39 ? 6   LYS A HE2  2  
ATOM   1447  H HE3  . LYS A 1 6  ? 12.798  6.120   5.091   1.00 1.37 ? 6   LYS A HE3  2  
ATOM   1448  H HZ1  . LYS A 1 6  ? 13.861  8.008   4.035   1.00 2.23 ? 6   LYS A HZ1  2  
ATOM   1449  H HZ2  . LYS A 1 6  ? 12.632  9.039   4.572   1.00 2.11 ? 6   LYS A HZ2  2  
ATOM   1450  H HZ3  . LYS A 1 6  ? 12.283  7.821   3.452   1.00 2.10 ? 6   LYS A HZ3  2  
ATOM   1451  N N    . VAL A 1 7  ? 10.230  1.819   5.522   1.00 0.40 ? 7   VAL A N    2  
ATOM   1452  C CA   . VAL A 1 7  ? 10.668  0.494   5.103   1.00 0.41 ? 7   VAL A CA   2  
ATOM   1453  C C    . VAL A 1 7  ? 10.064  0.116   3.754   1.00 0.37 ? 7   VAL A C    2  
ATOM   1454  O O    . VAL A 1 7  ? 10.625  -0.695  3.018   1.00 0.41 ? 7   VAL A O    2  
ATOM   1455  C CB   . VAL A 1 7  ? 10.285  -0.578  6.141   1.00 0.46 ? 7   VAL A CB   2  
ATOM   1456  C CG1  . VAL A 1 7  ? 10.928  -1.912  5.792   1.00 0.52 ? 7   VAL A CG1  2  
ATOM   1457  C CG2  . VAL A 1 7  ? 10.687  -0.132  7.539   1.00 0.53 ? 7   VAL A CG2  2  
ATOM   1458  H H    . VAL A 1 7  ? 9.593   1.898   6.264   1.00 0.42 ? 7   VAL A H    2  
ATOM   1459  H HA   . VAL A 1 7  ? 11.744  0.511   5.013   1.00 0.46 ? 7   VAL A HA   2  
ATOM   1460  H HB   . VAL A 1 7  ? 9.213   -0.705  6.120   1.00 0.44 ? 7   VAL A HB   2  
ATOM   1461  H HG11 . VAL A 1 7  ? 12.003  -1.810  5.815   1.00 0.57 ? 7   VAL A HG11 2  
ATOM   1462  H HG12 . VAL A 1 7  ? 10.617  -2.214  4.803   1.00 0.49 ? 7   VAL A HG12 2  
ATOM   1463  H HG13 . VAL A 1 7  ? 10.622  -2.659  6.510   1.00 0.56 ? 7   VAL A HG13 2  
ATOM   1464  H HG21 . VAL A 1 7  ? 10.172  0.785   7.786   1.00 0.51 ? 7   VAL A HG21 2  
ATOM   1465  H HG22 . VAL A 1 7  ? 11.753  0.034   7.572   1.00 0.57 ? 7   VAL A HG22 2  
ATOM   1466  H HG23 . VAL A 1 7  ? 10.420  -0.898  8.252   1.00 0.58 ? 7   VAL A HG23 2  
ATOM   1467  N N    . ILE A 1 8  ? 8.910   0.706   3.450   1.00 0.34 ? 8   ILE A N    2  
ATOM   1468  C CA   . ILE A 1 8  ? 8.216   0.445   2.195   1.00 0.36 ? 8   ILE A CA   2  
ATOM   1469  C C    . ILE A 1 8  ? 8.646   1.443   1.122   1.00 0.34 ? 8   ILE A C    2  
ATOM   1470  O O    . ILE A 1 8  ? 8.735   1.096   -0.055  1.00 0.34 ? 8   ILE A O    2  
ATOM   1471  C CB   . ILE A 1 8  ? 6.681   0.510   2.384   1.00 0.43 ? 8   ILE A CB   2  
ATOM   1472  C CG1  . ILE A 1 8  ? 6.219   -0.548  3.394   1.00 0.57 ? 8   ILE A CG1  2  
ATOM   1473  C CG2  . ILE A 1 8  ? 5.959   0.324   1.055   1.00 0.61 ? 8   ILE A CG2  2  
ATOM   1474  C CD1  . ILE A 1 8  ? 6.484   -1.975  2.957   1.00 0.78 ? 8   ILE A CD1  2  
ATOM   1475  H H    . ILE A 1 8  ? 8.515   1.334   4.090   1.00 0.34 ? 8   ILE A H    2  
ATOM   1476  H HA   . ILE A 1 8  ? 8.477   -0.551  1.870   1.00 0.39 ? 8   ILE A HA   2  
ATOM   1477  H HB   . ILE A 1 8  ? 6.431   1.489   2.763   1.00 0.58 ? 8   ILE A HB   2  
ATOM   1478  H HG12 . ILE A 1 8  ? 6.735   -0.390  4.329   1.00 0.73 ? 8   ILE A HG12 2  
ATOM   1479  H HG13 . ILE A 1 8  ? 5.155   -0.442  3.555   1.00 0.61 ? 8   ILE A HG13 2  
ATOM   1480  H HG21 . ILE A 1 8  ? 6.190   -0.652  0.653   1.00 1.01 ? 8   ILE A HG21 2  
ATOM   1481  H HG22 . ILE A 1 8  ? 6.281   1.085   0.360   1.00 1.07 ? 8   ILE A HG22 2  
ATOM   1482  H HG23 . ILE A 1 8  ? 4.893   0.406   1.210   1.00 1.06 ? 8   ILE A HG23 2  
ATOM   1483  H HD11 . ILE A 1 8  ? 7.547   -2.161  2.962   1.00 0.95 ? 8   ILE A HD11 2  
ATOM   1484  H HD12 . ILE A 1 8  ? 6.098   -2.121  1.959   1.00 0.89 ? 8   ILE A HD12 2  
ATOM   1485  H HD13 . ILE A 1 8  ? 5.995   -2.657  3.636   1.00 1.07 ? 8   ILE A HD13 2  
ATOM   1486  N N    . SER A 1 9  ? 8.926   2.678   1.539   1.00 0.36 ? 9   SER A N    2  
ATOM   1487  C CA   . SER A 1 9  ? 9.354   3.723   0.611   1.00 0.37 ? 9   SER A CA   2  
ATOM   1488  C C    . SER A 1 9  ? 10.736  3.411   0.046   1.00 0.35 ? 9   SER A C    2  
ATOM   1489  O O    . SER A 1 9  ? 11.028  3.730   -1.103  1.00 0.36 ? 9   SER A O    2  
ATOM   1490  C CB   . SER A 1 9  ? 9.368   5.088   1.303   1.00 0.43 ? 9   SER A CB   2  
ATOM   1491  O OG   . SER A 1 9  ? 9.576   6.133   0.369   1.00 0.49 ? 9   SER A OG   2  
ATOM   1492  H H    . SER A 1 9  ? 8.842   2.891   2.492   1.00 0.38 ? 9   SER A H    2  
ATOM   1493  H HA   . SER A 1 9  ? 8.645   3.750   -0.203  1.00 0.39 ? 9   SER A HA   2  
ATOM   1494  H HB2  . SER A 1 9  ? 8.422   5.249   1.798   1.00 0.45 ? 9   SER A HB2  2  
ATOM   1495  H HB3  . SER A 1 9  ? 10.164  5.111   2.033   1.00 0.44 ? 9   SER A HB3  2  
ATOM   1496  H HG   . SER A 1 9  ? 10.510  6.190   0.154   1.00 0.81 ? 9   SER A HG   2  
ATOM   1497  N N    . SER A 1 10 ? 11.579  2.781   0.860   1.00 0.36 ? 10  SER A N    2  
ATOM   1498  C CA   . SER A 1 10 ? 12.927  2.416   0.435   1.00 0.37 ? 10  SER A CA   2  
ATOM   1499  C C    . SER A 1 10 ? 12.901  1.117   -0.368  1.00 0.35 ? 10  SER A C    2  
ATOM   1500  O O    . SER A 1 10 ? 13.790  0.859   -1.181  1.00 0.35 ? 10  SER A O    2  
ATOM   1501  C CB   . SER A 1 10 ? 13.845  2.264   1.651   1.00 0.43 ? 10  SER A CB   2  
ATOM   1502  O OG   . SER A 1 10 ? 15.186  2.027   1.256   1.00 0.46 ? 10  SER A OG   2  
ATOM   1503  H H    . SER A 1 10 ? 11.288  2.557   1.768   1.00 0.38 ? 10  SER A H    2  
ATOM   1504  H HA   . SER A 1 10 ? 13.303  3.208   -0.194  1.00 0.37 ? 10  SER A HA   2  
ATOM   1505  H HB2  . SER A 1 10 ? 13.813  3.170   2.239   1.00 0.45 ? 10  SER A HB2  2  
ATOM   1506  H HB3  . SER A 1 10 ? 13.507  1.433   2.253   1.00 0.44 ? 10  SER A HB3  2  
ATOM   1507  H HG   . SER A 1 10 ? 15.197  1.645   0.375   1.00 0.67 ? 10  SER A HG   2  
ATOM   1508  N N    . ALA A 1 11 ? 11.870  0.306   -0.134  1.00 0.35 ? 11  ALA A N    2  
ATOM   1509  C CA   . ALA A 1 11 ? 11.714  -0.965  -0.834  1.00 0.36 ? 11  ALA A CA   2  
ATOM   1510  C C    . ALA A 1 11 ? 11.240  -0.745  -2.269  1.00 0.31 ? 11  ALA A C    2  
ATOM   1511  O O    . ALA A 1 11 ? 11.811  -1.296  -3.207  1.00 0.33 ? 11  ALA A O    2  
ATOM   1512  C CB   . ALA A 1 11 ? 10.736  -1.865  -0.090  1.00 0.40 ? 11  ALA A CB   2  
ATOM   1513  H H    . ALA A 1 11 ? 11.197  0.571   0.527   1.00 0.36 ? 11  ALA A H    2  
ATOM   1514  H HA   . ALA A 1 11 ? 12.676  -1.456  -0.854  1.00 0.39 ? 11  ALA A HA   2  
ATOM   1515  H HB1  . ALA A 1 11 ? 9.757   -1.407  -0.085  1.00 0.38 ? 11  ALA A HB1  2  
ATOM   1516  H HB2  . ALA A 1 11 ? 11.074  -2.000  0.927   1.00 0.44 ? 11  ALA A HB2  2  
ATOM   1517  H HB3  . ALA A 1 11 ? 10.682  -2.824  -0.583  1.00 0.42 ? 11  ALA A HB3  2  
ATOM   1518  N N    . CYS A 1 12 ? 10.211  0.089   -2.426  1.00 0.28 ? 12  CYS A N    2  
ATOM   1519  C CA   . CYS A 1 12 ? 9.650   0.389   -3.741  1.00 0.26 ? 12  CYS A CA   2  
ATOM   1520  C C    . CYS A 1 12 ? 10.625  1.197   -4.602  1.00 0.25 ? 12  CYS A C    2  
ATOM   1521  O O    . CYS A 1 12 ? 10.406  1.368   -5.796  1.00 0.26 ? 12  CYS A O    2  
ATOM   1522  C CB   . CYS A 1 12 ? 8.323   1.139   -3.596  1.00 0.28 ? 12  CYS A CB   2  
ATOM   1523  S SG   . CYS A 1 12 ? 8.445   2.698   -2.691  1.00 0.26 ? 12  CYS A SG   2  
ATOM   1524  H H    . CYS A 1 12 ? 9.818   0.514   -1.634  1.00 0.29 ? 12  CYS A H    2  
ATOM   1525  H HA   . CYS A 1 12 ? 9.461   -0.553  -4.235  1.00 0.29 ? 12  CYS A HA   2  
ATOM   1526  H HB2  . CYS A 1 12 ? 7.935   1.362   -4.579  1.00 0.29 ? 12  CYS A HB2  2  
ATOM   1527  H HB3  . CYS A 1 12 ? 7.619   0.509   -3.072  1.00 0.34 ? 12  CYS A HB3  2  
ATOM   1528  H HG   . CYS A 1 12 ? 7.289   2.907   -2.078  1.00 1.12 ? 12  CYS A HG   2  
ATOM   1529  N N    . LYS A 1 13 ? 11.700  1.695   -3.994  1.00 0.25 ? 13  LYS A N    2  
ATOM   1530  C CA   . LYS A 1 13 ? 12.709  2.457   -4.727  1.00 0.26 ? 13  LYS A CA   2  
ATOM   1531  C C    . LYS A 1 13 ? 13.630  1.516   -5.501  1.00 0.31 ? 13  LYS A C    2  
ATOM   1532  O O    . LYS A 1 13 ? 14.433  1.953   -6.326  1.00 0.35 ? 13  LYS A O    2  
ATOM   1533  C CB   . LYS A 1 13 ? 13.539  3.313   -3.765  1.00 0.29 ? 13  LYS A CB   2  
ATOM   1534  C CG   . LYS A 1 13 ? 12.849  4.592   -3.320  1.00 0.79 ? 13  LYS A CG   2  
ATOM   1535  C CD   . LYS A 1 13 ? 12.747  5.602   -4.450  1.00 1.28 ? 13  LYS A CD   2  
ATOM   1536  C CE   . LYS A 1 13 ? 12.158  6.917   -3.966  1.00 1.89 ? 13  LYS A CE   2  
ATOM   1537  N NZ   . LYS A 1 13 ? 11.896  7.855   -5.092  1.00 2.67 ? 13  LYS A NZ   2  
ATOM   1538  H H    . LYS A 1 13 ? 11.817  1.547   -3.032  1.00 0.28 ? 13  LYS A H    2  
ATOM   1539  H HA   . LYS A 1 13 ? 12.198  3.103   -5.426  1.00 0.25 ? 13  LYS A HA   2  
ATOM   1540  H HB2  . LYS A 1 13 ? 13.761  2.727   -2.886  1.00 0.60 ? 13  LYS A HB2  2  
ATOM   1541  H HB3  . LYS A 1 13 ? 14.467  3.580   -4.250  1.00 0.66 ? 13  LYS A HB3  2  
ATOM   1542  H HG2  . LYS A 1 13 ? 11.854  4.350   -2.978  1.00 1.52 ? 13  LYS A HG2  2  
ATOM   1543  H HG3  . LYS A 1 13 ? 13.413  5.029   -2.508  1.00 0.94 ? 13  LYS A HG3  2  
ATOM   1544  H HD2  . LYS A 1 13 ? 13.734  5.785   -4.848  1.00 1.26 ? 13  LYS A HD2  2  
ATOM   1545  H HD3  . LYS A 1 13 ? 12.113  5.198   -5.226  1.00 1.89 ? 13  LYS A HD3  2  
ATOM   1546  H HE2  . LYS A 1 13 ? 11.229  6.715   -3.454  1.00 2.36 ? 13  LYS A HE2  2  
ATOM   1547  H HE3  . LYS A 1 13 ? 12.854  7.377   -3.281  1.00 1.74 ? 13  LYS A HE3  2  
ATOM   1548  H HZ1  . LYS A 1 13 ? 12.785  8.085   -5.579  1.00 2.68 ? 13  LYS A HZ1  2  
ATOM   1549  H HZ2  . LYS A 1 13 ? 11.473  8.735   -4.732  1.00 3.10 ? 13  LYS A HZ2  2  
ATOM   1550  H HZ3  . LYS A 1 13 ? 11.240  7.422   -5.773  1.00 3.07 ? 13  LYS A HZ3  2  
ATOM   1551  N N    . THR A 1 14 ? 13.498  0.220   -5.228  1.00 0.33 ? 14  THR A N    2  
ATOM   1552  C CA   . THR A 1 14 ? 14.315  -0.798  -5.878  1.00 0.39 ? 14  THR A CA   2  
ATOM   1553  C C    . THR A 1 14 ? 13.465  -1.703  -6.762  1.00 0.41 ? 14  THR A C    2  
ATOM   1554  O O    . THR A 1 14 ? 13.992  -2.486  -7.553  1.00 0.46 ? 14  THR A O    2  
ATOM   1555  C CB   . THR A 1 14 ? 15.062  -1.662  -4.844  1.00 0.43 ? 14  THR A CB   2  
ATOM   1556  O OG1  . THR A 1 14 ? 15.765  -0.824  -3.922  1.00 0.44 ? 14  THR A OG1  2  
ATOM   1557  C CG2  . THR A 1 14 ? 16.041  -2.600  -5.533  1.00 0.50 ? 14  THR A CG2  2  
ATOM   1558  H H    . THR A 1 14 ? 12.831  -0.060  -4.567  1.00 0.32 ? 14  THR A H    2  
ATOM   1559  H HA   . THR A 1 14 ? 15.047  -0.295  -6.493  1.00 0.41 ? 14  THR A HA   2  
ATOM   1560  H HB   . THR A 1 14 ? 14.339  -2.254  -4.302  1.00 0.42 ? 14  THR A HB   2  
ATOM   1561  H HG1  . THR A 1 14 ? 15.163  -0.529  -3.235  1.00 0.42 ? 14  THR A HG1  2  
ATOM   1562  H HG21 . THR A 1 14 ? 15.508  -3.228  -6.231  1.00 0.50 ? 14  THR A HG21 2  
ATOM   1563  H HG22 . THR A 1 14 ? 16.529  -3.218  -4.793  1.00 0.53 ? 14  THR A HG22 2  
ATOM   1564  H HG23 . THR A 1 14 ? 16.783  -2.021  -6.063  1.00 0.51 ? 14  THR A HG23 2  
ATOM   1565  N N    . TYR A 1 15 ? 12.148  -1.590  -6.625  1.00 0.37 ? 15  TYR A N    2  
ATOM   1566  C CA   . TYR A 1 15 ? 11.226  -2.401  -7.410  1.00 0.40 ? 15  TYR A CA   2  
ATOM   1567  C C    . TYR A 1 15 ? 10.388  -1.527  -8.338  1.00 0.39 ? 15  TYR A C    2  
ATOM   1568  O O    . TYR A 1 15 ? 9.614   -2.030  -9.153  1.00 0.43 ? 15  TYR A O    2  
ATOM   1569  C CB   . TYR A 1 15 ? 10.311  -3.209  -6.488  1.00 0.39 ? 15  TYR A CB   2  
ATOM   1570  C CG   . TYR A 1 15 ? 11.029  -4.300  -5.729  1.00 0.43 ? 15  TYR A CG   2  
ATOM   1571  C CD1  . TYR A 1 15 ? 11.014  -4.332  -4.339  1.00 0.41 ? 15  TYR A CD1  2  
ATOM   1572  C CD2  . TYR A 1 15 ? 11.724  -5.299  -6.399  1.00 0.49 ? 15  TYR A CD2  2  
ATOM   1573  C CE1  . TYR A 1 15 ? 11.669  -5.328  -3.641  1.00 0.46 ? 15  TYR A CE1  2  
ATOM   1574  C CE2  . TYR A 1 15 ? 12.380  -6.300  -5.710  1.00 0.52 ? 15  TYR A CE2  2  
ATOM   1575  C CZ   . TYR A 1 15 ? 12.350  -6.310  -4.329  1.00 0.51 ? 15  TYR A CZ   2  
ATOM   1576  O OH   . TYR A 1 15 ? 13.005  -7.304  -3.638  1.00 0.56 ? 15  TYR A OH   2  
ATOM   1577  H H    . TYR A 1 15 ? 11.788  -0.947  -5.980  1.00 0.33 ? 15  TYR A H    2  
ATOM   1578  H HA   . TYR A 1 15 ? 11.812  -3.082  -8.009  1.00 0.45 ? 15  TYR A HA   2  
ATOM   1579  H HB2  . TYR A 1 15 ? 9.861   -2.544  -5.766  1.00 0.35 ? 15  TYR A HB2  2  
ATOM   1580  H HB3  . TYR A 1 15 ? 9.533   -3.670  -7.079  1.00 0.42 ? 15  TYR A HB3  2  
ATOM   1581  H HD1  . TYR A 1 15 ? 10.479  -3.563  -3.802  1.00 0.38 ? 15  TYR A HD1  2  
ATOM   1582  H HD2  . TYR A 1 15 ? 11.746  -5.289  -7.478  1.00 0.51 ? 15  TYR A HD2  2  
ATOM   1583  H HE1  . TYR A 1 15 ? 11.645  -5.335  -2.561  1.00 0.47 ? 15  TYR A HE1  2  
ATOM   1584  H HE2  . TYR A 1 15 ? 12.912  -7.068  -6.250  1.00 0.57 ? 15  TYR A HE2  2  
ATOM   1585  H HH   . TYR A 1 15 ? 12.443  -7.624  -2.928  1.00 0.57 ? 15  TYR A HH   2  
ATOM   1586  N N    . CYS A 1 16 ? 10.548  -0.215  -8.209  1.00 0.35 ? 16  CYS A N    2  
ATOM   1587  C CA   . CYS A 1 16 ? 9.807   0.732   -9.035  1.00 0.36 ? 16  CYS A CA   2  
ATOM   1588  C C    . CYS A 1 16 ? 10.709  1.872   -9.499  1.00 0.37 ? 16  CYS A C    2  
ATOM   1589  O O    . CYS A 1 16 ? 10.744  2.207   -10.682 1.00 0.42 ? 16  CYS A O    2  
ATOM   1590  C CB   . CYS A 1 16 ? 8.614   1.293   -8.259  1.00 0.32 ? 16  CYS A CB   2  
ATOM   1591  S SG   . CYS A 1 16 ? 7.669   0.043   -7.355  1.00 0.32 ? 16  CYS A SG   2  
ATOM   1592  H H    . CYS A 1 16 ? 11.179  0.126   -7.542  1.00 0.33 ? 16  CYS A H    2  
ATOM   1593  H HA   . CYS A 1 16 ? 9.444   0.201   -9.903  1.00 0.41 ? 16  CYS A HA   2  
ATOM   1594  H HB2  . CYS A 1 16 ? 8.969   2.017   -7.542  1.00 0.28 ? 16  CYS A HB2  2  
ATOM   1595  H HB3  . CYS A 1 16 ? 7.940   1.779   -8.950  1.00 0.35 ? 16  CYS A HB3  2  
ATOM   1596  H HG   . CYS A 1 16 ? 8.183   -0.057  -6.138  1.00 0.27 ? 16  CYS A HG   2  
ATOM   1597  N N    . GLY A 1 17 ? 11.435  2.465   -8.557  1.00 0.33 ? 17  GLY A N    2  
ATOM   1598  C CA   . GLY A 1 17 ? 12.326  3.563   -8.888  1.00 0.34 ? 17  GLY A CA   2  
ATOM   1599  C C    . GLY A 1 17 ? 11.708  4.917   -8.604  1.00 0.32 ? 17  GLY A C    2  
ATOM   1600  O O    . GLY A 1 17 ? 11.216  5.165   -7.502  1.00 0.27 ? 17  GLY A O    2  
ATOM   1601  H H    . GLY A 1 17 ? 11.365  2.156   -7.630  1.00 0.29 ? 17  GLY A H    2  
ATOM   1602  H HA2  . GLY A 1 17 ? 13.232  3.464   -8.309  1.00 0.34 ? 17  GLY A HA2  2  
ATOM   1603  H HA3  . GLY A 1 17 ? 12.574  3.506   -9.938  1.00 0.39 ? 17  GLY A HA3  2  
ATOM   1604  N N    . LYS A 1 18 ? 11.733  5.797   -9.598  1.00 0.36 ? 18  LYS A N    2  
ATOM   1605  C CA   . LYS A 1 18 ? 11.170  7.135   -9.450  1.00 0.36 ? 18  LYS A CA   2  
ATOM   1606  C C    . LYS A 1 18 ? 9.647   7.089   -9.457  1.00 0.36 ? 18  LYS A C    2  
ATOM   1607  O O    . LYS A 1 18 ? 8.985   8.005   -8.970  1.00 0.36 ? 18  LYS A O    2  
ATOM   1608  C CB   . LYS A 1 18 ? 11.669  8.047   -10.575 1.00 0.43 ? 18  LYS A CB   2  
ATOM   1609  C CG   . LYS A 1 18 ? 11.464  7.468   -11.963 1.00 0.48 ? 18  LYS A CG   2  
ATOM   1610  C CD   . LYS A 1 18 ? 12.767  6.954   -12.553 1.00 0.52 ? 18  LYS A CD   2  
ATOM   1611  C CE   . LYS A 1 18 ? 13.292  7.884   -13.636 1.00 0.58 ? 18  LYS A CE   2  
ATOM   1612  N NZ   . LYS A 1 18 ? 14.737  8.195   -13.448 1.00 0.59 ? 18  LYS A NZ   2  
ATOM   1613  H H    . LYS A 1 18 ? 12.138  5.541   -10.452 1.00 0.40 ? 18  LYS A H    2  
ATOM   1614  H HA   . LYS A 1 18 ? 11.502  7.532   -8.503  1.00 0.34 ? 18  LYS A HA   2  
ATOM   1615  H HB2  . LYS A 1 18 ? 11.141  8.988   -10.520 1.00 0.43 ? 18  LYS A HB2  2  
ATOM   1616  H HB3  . LYS A 1 18 ? 12.724  8.228   -10.435 1.00 0.43 ? 18  LYS A HB3  2  
ATOM   1617  H HG2  . LYS A 1 18 ? 10.763  6.649   -11.900 1.00 0.47 ? 18  LYS A HG2  2  
ATOM   1618  H HG3  . LYS A 1 18 ? 11.064  8.236   -12.608 1.00 0.52 ? 18  LYS A HG3  2  
ATOM   1619  H HD2  . LYS A 1 18 ? 13.504  6.882   -11.767 1.00 0.49 ? 18  LYS A HD2  2  
ATOM   1620  H HD3  . LYS A 1 18 ? 12.597  5.977   -12.980 1.00 0.53 ? 18  LYS A HD3  2  
ATOM   1621  H HE2  . LYS A 1 18 ? 13.158  7.409   -14.597 1.00 0.62 ? 18  LYS A HE2  2  
ATOM   1622  H HE3  . LYS A 1 18 ? 12.729  8.805   -13.609 1.00 0.58 ? 18  LYS A HE3  2  
ATOM   1623  H HZ1  . LYS A 1 18 ? 15.298  7.319   -13.476 1.00 0.60 ? 18  LYS A HZ1  2  
ATOM   1624  H HZ2  . LYS A 1 18 ? 14.887  8.659   -12.530 1.00 0.56 ? 18  LYS A HZ2  2  
ATOM   1625  H HZ3  . LYS A 1 18 ? 15.068  8.830   -14.203 1.00 0.64 ? 18  LYS A HZ3  2  
ATOM   1626  N N    . THR A 1 19 ? 9.094   6.015   -10.014 1.00 0.37 ? 19  THR A N    2  
ATOM   1627  C CA   . THR A 1 19 ? 7.648   5.849   -10.082 1.00 0.39 ? 19  THR A CA   2  
ATOM   1628  C C    . THR A 1 19 ? 7.064   5.534   -8.711  1.00 0.33 ? 19  THR A C    2  
ATOM   1629  O O    . THR A 1 19 ? 5.876   5.752   -8.466  1.00 0.43 ? 19  THR A O    2  
ATOM   1630  C CB   . THR A 1 19 ? 7.257   4.727   -11.064 1.00 0.46 ? 19  THR A CB   2  
ATOM   1631  O OG1  . THR A 1 19 ? 7.440   3.449   -10.444 1.00 0.53 ? 19  THR A OG1  2  
ATOM   1632  C CG2  . THR A 1 19 ? 8.093   4.803   -12.333 1.00 0.61 ? 19  THR A CG2  2  
ATOM   1633  H H    . THR A 1 19 ? 9.673   5.317   -10.384 1.00 0.39 ? 19  THR A H    2  
ATOM   1634  H HA   . THR A 1 19 ? 7.222   6.775   -10.440 1.00 0.42 ? 19  THR A HA   2  
ATOM   1635  H HB   . THR A 1 19 ? 6.216   4.845   -11.329 1.00 0.49 ? 19  THR A HB   2  
ATOM   1636  H HG1  . THR A 1 19 ? 7.803   2.831   -11.082 1.00 0.54 ? 19  THR A HG1  2  
ATOM   1637  H HG21 . THR A 1 19 ? 7.776   4.033   -13.020 1.00 0.66 ? 19  THR A HG21 2  
ATOM   1638  H HG22 . THR A 1 19 ? 9.135   4.659   -12.087 1.00 0.68 ? 19  THR A HG22 2  
ATOM   1639  H HG23 . THR A 1 19 ? 7.963   5.772   -12.792 1.00 0.69 ? 19  THR A HG23 2  
ATOM   1640  N N    . SER A 1 20 ? 7.920   5.043   -7.808  1.00 0.30 ? 20  SER A N    2  
ATOM   1641  C CA   . SER A 1 20 ? 7.519   4.669   -6.446  1.00 0.24 ? 20  SER A CA   2  
ATOM   1642  C C    . SER A 1 20 ? 6.735   5.777   -5.736  1.00 0.22 ? 20  SER A C    2  
ATOM   1643  O O    . SER A 1 20 ? 6.964   6.965   -5.974  1.00 0.26 ? 20  SER A O    2  
ATOM   1644  C CB   . SER A 1 20 ? 8.758   4.322   -5.622  1.00 0.22 ? 20  SER A CB   2  
ATOM   1645  O OG   . SER A 1 20 ? 9.485   5.487   -5.283  1.00 0.25 ? 20  SER A OG   2  
ATOM   1646  H H    . SER A 1 20 ? 8.858   4.931   -8.066  1.00 0.38 ? 20  SER A H    2  
ATOM   1647  H HA   . SER A 1 20 ? 6.893   3.793   -6.516  1.00 0.26 ? 20  SER A HA   2  
ATOM   1648  H HB2  . SER A 1 20 ? 8.456   3.825   -4.713  1.00 0.26 ? 20  SER A HB2  2  
ATOM   1649  H HB3  . SER A 1 20 ? 9.397   3.667   -6.195  1.00 0.24 ? 20  SER A HB3  2  
ATOM   1650  H HG   . SER A 1 20 ? 8.876   6.171   -4.992  1.00 0.41 ? 20  SER A HG   2  
ATOM   1651  N N    . PRO A 1 21 ? 5.808   5.391   -4.835  1.00 0.20 ? 21  PRO A N    2  
ATOM   1652  C CA   . PRO A 1 21 ? 4.986   6.345   -4.082  1.00 0.22 ? 21  PRO A CA   2  
ATOM   1653  C C    . PRO A 1 21 ? 5.796   7.124   -3.049  1.00 0.22 ? 21  PRO A C    2  
ATOM   1654  O O    . PRO A 1 21 ? 6.897   6.719   -2.670  1.00 0.24 ? 21  PRO A O    2  
ATOM   1655  C CB   . PRO A 1 21 ? 3.953   5.453   -3.387  1.00 0.23 ? 21  PRO A CB   2  
ATOM   1656  C CG   . PRO A 1 21 ? 4.603   4.120   -3.278  1.00 0.21 ? 21  PRO A CG   2  
ATOM   1657  C CD   . PRO A 1 21 ? 5.494   3.991   -4.480  1.00 0.20 ? 21  PRO A CD   2  
ATOM   1658  H HA   . PRO A 1 21 ? 4.483   7.038   -4.740  1.00 0.26 ? 21  PRO A HA   2  
ATOM   1659  H HB2  . PRO A 1 21 ? 3.721   5.854   -2.408  1.00 0.25 ? 21  PRO A HB2  2  
ATOM   1660  H HB3  . PRO A 1 21 ? 3.059   5.382   -3.986  1.00 0.26 ? 21  PRO A HB3  2  
ATOM   1661  H HG2  . PRO A 1 21 ? 5.185   4.071   -2.368  1.00 0.21 ? 21  PRO A HG2  2  
ATOM   1662  H HG3  . PRO A 1 21 ? 3.855   3.343   -3.289  1.00 0.24 ? 21  PRO A HG3  2  
ATOM   1663  H HD2  . PRO A 1 21 ? 6.391   3.447   -4.226  1.00 0.21 ? 21  PRO A HD2  2  
ATOM   1664  H HD3  . PRO A 1 21 ? 4.970   3.499   -5.284  1.00 0.24 ? 21  PRO A HD3  2  
ATOM   1665  N N    . SER A 1 22 ? 5.242   8.242   -2.599  1.00 0.24 ? 22  SER A N    2  
ATOM   1666  C CA   . SER A 1 22 ? 5.906   9.083   -1.613  1.00 0.26 ? 22  SER A CA   2  
ATOM   1667  C C    . SER A 1 22 ? 5.483   8.707   -0.197  1.00 0.23 ? 22  SER A C    2  
ATOM   1668  O O    . SER A 1 22 ? 4.593   7.877   -0.001  1.00 0.23 ? 22  SER A O    2  
ATOM   1669  C CB   . SER A 1 22 ? 5.584   10.555  -1.875  1.00 0.31 ? 22  SER A CB   2  
ATOM   1670  O OG   . SER A 1 22 ? 4.185   10.783  -1.863  1.00 0.32 ? 22  SER A OG   2  
ATOM   1671  H H    . SER A 1 22 ? 4.362   8.509   -2.938  1.00 0.26 ? 22  SER A H    2  
ATOM   1672  H HA   . SER A 1 22 ? 6.971   8.934   -1.710  1.00 0.29 ? 22  SER A HA   2  
ATOM   1673  H HB2  . SER A 1 22 ? 6.040   11.162  -1.107  1.00 0.34 ? 22  SER A HB2  2  
ATOM   1674  H HB3  . SER A 1 22 ? 5.975   10.842  -2.840  1.00 0.35 ? 22  SER A HB3  2  
ATOM   1675  H HG   . SER A 1 22 ? 3.928   11.241  -2.667  1.00 0.54 ? 22  SER A HG   2  
ATOM   1676  N N    . LYS A 1 23 ? 6.129   9.328   0.786   1.00 0.24 ? 23  LYS A N    2  
ATOM   1677  C CA   . LYS A 1 23 ? 5.824   9.079   2.190   1.00 0.25 ? 23  LYS A CA   2  
ATOM   1678  C C    . LYS A 1 23 ? 4.449   9.646   2.547   1.00 0.23 ? 23  LYS A C    2  
ATOM   1679  O O    . LYS A 1 23 ? 3.744   9.106   3.402   1.00 0.26 ? 23  LYS A O    2  
ATOM   1680  C CB   . LYS A 1 23 ? 6.910   9.700   3.076   1.00 0.29 ? 23  LYS A CB   2  
ATOM   1681  C CG   . LYS A 1 23 ? 6.562   9.747   4.555   1.00 0.41 ? 23  LYS A CG   2  
ATOM   1682  C CD   . LYS A 1 23 ? 6.774   11.141  5.121   1.00 0.87 ? 23  LYS A CD   2  
ATOM   1683  C CE   . LYS A 1 23 ? 6.307   11.240  6.562   1.00 1.02 ? 23  LYS A CE   2  
ATOM   1684  N NZ   . LYS A 1 23 ? 6.421   12.630  7.082   1.00 1.62 ? 23  LYS A NZ   2  
ATOM   1685  H H    . LYS A 1 23 ? 6.833   9.973   0.560   1.00 0.26 ? 23  LYS A H    2  
ATOM   1686  H HA   . LYS A 1 23 ? 5.811   8.010   2.344   1.00 0.27 ? 23  LYS A HA   2  
ATOM   1687  H HB2  . LYS A 1 23 ? 7.818   9.125   2.963   1.00 0.35 ? 23  LYS A HB2  2  
ATOM   1688  H HB3  . LYS A 1 23 ? 7.094   10.710  2.740   1.00 0.34 ? 23  LYS A HB3  2  
ATOM   1689  H HG2  . LYS A 1 23 ? 5.526   9.470   4.681   1.00 0.71 ? 23  LYS A HG2  2  
ATOM   1690  H HG3  . LYS A 1 23 ? 7.193   9.051   5.088   1.00 0.67 ? 23  LYS A HG3  2  
ATOM   1691  H HD2  . LYS A 1 23 ? 7.826   11.379  5.079   1.00 1.16 ? 23  LYS A HD2  2  
ATOM   1692  H HD3  . LYS A 1 23 ? 6.219   11.849  4.523   1.00 1.26 ? 23  LYS A HD3  2  
ATOM   1693  H HE2  . LYS A 1 23 ? 5.274   10.928  6.616   1.00 1.11 ? 23  LYS A HE2  2  
ATOM   1694  H HE3  . LYS A 1 23 ? 6.913   10.585  7.171   1.00 1.06 ? 23  LYS A HE3  2  
ATOM   1695  H HZ1  . LYS A 1 23 ? 6.129   12.664  8.080   1.00 1.74 ? 23  LYS A HZ1  2  
ATOM   1696  H HZ2  . LYS A 1 23 ? 5.812   13.268  6.532   1.00 1.95 ? 23  LYS A HZ2  2  
ATOM   1697  H HZ3  . LYS A 1 23 ? 7.405   12.959  7.007   1.00 1.88 ? 23  LYS A HZ3  2  
ATOM   1698  N N    . LYS A 1 24 ? 4.072   10.731  1.872   1.00 0.20 ? 24  LYS A N    2  
ATOM   1699  C CA   . LYS A 1 24 ? 2.783   11.376  2.105   1.00 0.21 ? 24  LYS A CA   2  
ATOM   1700  C C    . LYS A 1 24 ? 1.638   10.540  1.539   1.00 0.20 ? 24  LYS A C    2  
ATOM   1701  O O    . LYS A 1 24 ? 0.530   10.553  2.076   1.00 0.22 ? 24  LYS A O    2  
ATOM   1702  C CB   . LYS A 1 24 ? 2.766   12.772  1.480   1.00 0.24 ? 24  LYS A CB   2  
ATOM   1703  C CG   . LYS A 1 24 ? 3.598   13.790  2.242   1.00 0.43 ? 24  LYS A CG   2  
ATOM   1704  C CD   . LYS A 1 24 ? 3.846   15.045  1.418   1.00 0.79 ? 24  LYS A CD   2  
ATOM   1705  C CE   . LYS A 1 24 ? 4.652   14.738  0.166   1.00 1.35 ? 24  LYS A CE   2  
ATOM   1706  N NZ   . LYS A 1 24 ? 5.444   15.913  -0.289  1.00 2.01 ? 24  LYS A NZ   2  
ATOM   1707  H H    . LYS A 1 24 ? 4.677   11.107  1.199   1.00 0.20 ? 24  LYS A H    2  
ATOM   1708  H HA   . LYS A 1 24 ? 2.649   11.470  3.172   1.00 0.24 ? 24  LYS A HA   2  
ATOM   1709  H HB2  . LYS A 1 24 ? 3.149   12.707  0.472   1.00 0.37 ? 24  LYS A HB2  2  
ATOM   1710  H HB3  . LYS A 1 24 ? 1.746   13.126  1.445   1.00 0.38 ? 24  LYS A HB3  2  
ATOM   1711  H HG2  . LYS A 1 24 ? 3.073   14.064  3.145   1.00 0.80 ? 24  LYS A HG2  2  
ATOM   1712  H HG3  . LYS A 1 24 ? 4.548   13.344  2.498   1.00 0.81 ? 24  LYS A HG3  2  
ATOM   1713  H HD2  . LYS A 1 24 ? 2.895   15.466  1.127   1.00 1.14 ? 24  LYS A HD2  2  
ATOM   1714  H HD3  . LYS A 1 24 ? 4.389   15.759  2.020   1.00 0.95 ? 24  LYS A HD3  2  
ATOM   1715  H HE2  . LYS A 1 24 ? 5.326   13.922  0.379   1.00 1.59 ? 24  LYS A HE2  2  
ATOM   1716  H HE3  . LYS A 1 24 ? 3.972   14.446  -0.621  1.00 1.51 ? 24  LYS A HE3  2  
ATOM   1717  H HZ1  . LYS A 1 24 ? 6.118   16.197  0.451   1.00 2.09 ? 24  LYS A HZ1  2  
ATOM   1718  H HZ2  . LYS A 1 24 ? 4.813   16.713  -0.494  1.00 2.20 ? 24  LYS A HZ2  2  
ATOM   1719  H HZ3  . LYS A 1 24 ? 5.974   15.673  -1.152  1.00 2.49 ? 24  LYS A HZ3  2  
ATOM   1720  N N    . GLU A 1 25 ? 1.910   9.816   0.453   1.00 0.18 ? 25  GLU A N    2  
ATOM   1721  C CA   . GLU A 1 25 ? 0.896   8.973   -0.170  1.00 0.17 ? 25  GLU A CA   2  
ATOM   1722  C C    . GLU A 1 25 ? 0.593   7.754   0.696   1.00 0.16 ? 25  GLU A C    2  
ATOM   1723  O O    . GLU A 1 25 ? -0.530  7.580   1.170   1.00 0.17 ? 25  GLU A O    2  
ATOM   1724  C CB   . GLU A 1 25 ? 1.358   8.524   -1.558  1.00 0.17 ? 25  GLU A CB   2  
ATOM   1725  C CG   . GLU A 1 25 ? 0.501   9.064   -2.690  1.00 0.19 ? 25  GLU A CG   2  
ATOM   1726  C CD   . GLU A 1 25 ? 0.745   8.345   -4.001  1.00 0.18 ? 25  GLU A CD   2  
ATOM   1727  O OE1  . GLU A 1 25 ? 0.554   8.971   -5.066  1.00 0.26 ? 25  GLU A OE1  2  
ATOM   1728  O OE2  . GLU A 1 25 ? 1.125   7.156   -3.966  1.00 0.21 ? 25  GLU A OE2  2  
ATOM   1729  H H    . GLU A 1 25 ? 2.810   9.850   0.066   1.00 0.18 ? 25  GLU A H    2  
ATOM   1730  H HA   . GLU A 1 25 ? -0.005  9.559   -0.272  1.00 0.17 ? 25  GLU A HA   2  
ATOM   1731  H HB2  . GLU A 1 25 ? 2.373   8.858   -1.712  1.00 0.19 ? 25  GLU A HB2  2  
ATOM   1732  H HB3  . GLU A 1 25 ? 1.334   7.445   -1.601  1.00 0.18 ? 25  GLU A HB3  2  
ATOM   1733  H HG2  . GLU A 1 25 ? -0.539  8.949   -2.423  1.00 0.23 ? 25  GLU A HG2  2  
ATOM   1734  H HG3  . GLU A 1 25 ? 0.723   10.113  -2.824  1.00 0.23 ? 25  GLU A HG3  2  
ATOM   1735  N N    . ILE A 1 26 ? 1.603   6.915   0.900   1.00 0.16 ? 26  ILE A N    2  
ATOM   1736  C CA   . ILE A 1 26 ? 1.444   5.713   1.709   1.00 0.15 ? 26  ILE A CA   2  
ATOM   1737  C C    . ILE A 1 26 ? 0.834   6.042   3.068   1.00 0.15 ? 26  ILE A C    2  
ATOM   1738  O O    . ILE A 1 26 ? -0.099  5.377   3.517   1.00 0.14 ? 26  ILE A O    2  
ATOM   1739  C CB   . ILE A 1 26 ? 2.792   4.998   1.924   1.00 0.16 ? 26  ILE A CB   2  
ATOM   1740  C CG1  . ILE A 1 26 ? 3.394   4.585   0.580   1.00 0.16 ? 26  ILE A CG1  2  
ATOM   1741  C CG2  . ILE A 1 26 ? 2.610   3.786   2.825   1.00 0.15 ? 26  ILE A CG2  2  
ATOM   1742  C CD1  . ILE A 1 26 ? 4.726   3.877   0.708   1.00 0.17 ? 26  ILE A CD1  2  
ATOM   1743  H H    . ILE A 1 26 ? 2.475   7.109   0.497   1.00 0.17 ? 26  ILE A H    2  
ATOM   1744  H HA   . ILE A 1 26 ? 0.783   5.040   1.183   1.00 0.14 ? 26  ILE A HA   2  
ATOM   1745  H HB   . ILE A 1 26 ? 3.464   5.685   2.416   1.00 0.17 ? 26  ILE A HB   2  
ATOM   1746  H HG12 . ILE A 1 26 ? 2.711   3.916   0.078   1.00 0.15 ? 26  ILE A HG12 2  
ATOM   1747  H HG13 . ILE A 1 26 ? 3.541   5.465   -0.027  1.00 0.16 ? 26  ILE A HG13 2  
ATOM   1748  H HG21 . ILE A 1 26 ? 2.269   4.109   3.797   1.00 0.15 ? 26  ILE A HG21 2  
ATOM   1749  H HG22 . ILE A 1 26 ? 3.553   3.269   2.928   1.00 0.16 ? 26  ILE A HG22 2  
ATOM   1750  H HG23 . ILE A 1 26 ? 1.880   3.121   2.390   1.00 0.14 ? 26  ILE A HG23 2  
ATOM   1751  H HD11 . ILE A 1 26 ? 4.605   2.989   1.310   1.00 0.16 ? 26  ILE A HD11 2  
ATOM   1752  H HD12 . ILE A 1 26 ? 5.440   4.537   1.178   1.00 0.19 ? 26  ILE A HD12 2  
ATOM   1753  H HD13 . ILE A 1 26 ? 5.082   3.601   -0.273  1.00 0.17 ? 26  ILE A HD13 2  
ATOM   1754  N N    . GLY A 1 27 ? 1.366   7.074   3.716   1.00 0.16 ? 27  GLY A N    2  
ATOM   1755  C CA   . GLY A 1 27 ? 0.860   7.474   5.016   1.00 0.16 ? 27  GLY A CA   2  
ATOM   1756  C C    . GLY A 1 27 ? -0.643  7.681   5.015   1.00 0.15 ? 27  GLY A C    2  
ATOM   1757  O O    . GLY A 1 27 ? -1.330  7.291   5.958   1.00 0.15 ? 27  GLY A O    2  
ATOM   1758  H H    . GLY A 1 27 ? 2.108   7.568   3.308   1.00 0.17 ? 27  GLY A H    2  
ATOM   1759  H HA2  . GLY A 1 27 ? 1.107   6.709   5.737   1.00 0.16 ? 27  GLY A HA2  2  
ATOM   1760  H HA3  . GLY A 1 27 ? 1.339   8.397   5.308   1.00 0.17 ? 27  GLY A HA3  2  
ATOM   1761  N N    . ALA A 1 28 ? -1.153  8.295   3.953   1.00 0.15 ? 28  ALA A N    2  
ATOM   1762  C CA   . ALA A 1 28 ? -2.582  8.552   3.833   1.00 0.14 ? 28  ALA A CA   2  
ATOM   1763  C C    . ALA A 1 28 ? -3.348  7.268   3.534   1.00 0.13 ? 28  ALA A C    2  
ATOM   1764  O O    . ALA A 1 28 ? -4.414  7.024   4.098   1.00 0.12 ? 28  ALA A O    2  
ATOM   1765  C CB   . ALA A 1 28 ? -2.844  9.589   2.750   1.00 0.15 ? 28  ALA A CB   2  
ATOM   1766  H H    . ALA A 1 28 ? -0.553  8.582   3.233   1.00 0.16 ? 28  ALA A H    2  
ATOM   1767  H HA   . ALA A 1 28 ? -2.928  8.955   4.774   1.00 0.15 ? 28  ALA A HA   2  
ATOM   1768  H HB1  . ALA A 1 28 ? -3.901  9.808   2.709   1.00 0.14 ? 28  ALA A HB1  2  
ATOM   1769  H HB2  . ALA A 1 28 ? -2.520  9.201   1.795   1.00 0.14 ? 28  ALA A HB2  2  
ATOM   1770  H HB3  . ALA A 1 28 ? -2.298  10.492  2.976   1.00 0.16 ? 28  ALA A HB3  2  
ATOM   1771  N N    . MET A 1 29 ? -2.797  6.451   2.643   1.00 0.13 ? 29  MET A N    2  
ATOM   1772  C CA   . MET A 1 29 ? -3.428  5.191   2.270   1.00 0.11 ? 29  MET A CA   2  
ATOM   1773  C C    . MET A 1 29 ? -3.559  4.269   3.478   1.00 0.11 ? 29  MET A C    2  
ATOM   1774  O O    . MET A 1 29 ? -4.561  3.570   3.634   1.00 0.10 ? 29  MET A O    2  
ATOM   1775  C CB   . MET A 1 29 ? -2.622  4.497   1.169   1.00 0.11 ? 29  MET A CB   2  
ATOM   1776  C CG   . MET A 1 29 ? -3.237  3.189   0.699   1.00 0.10 ? 29  MET A CG   2  
ATOM   1777  S SD   . MET A 1 29 ? -1.996  1.961   0.247   1.00 0.10 ? 29  MET A SD   2  
ATOM   1778  C CE   . MET A 1 29 ? -1.147  1.750   1.810   1.00 0.11 ? 29  MET A CE   2  
ATOM   1779  H H    . MET A 1 29 ? -1.946  6.702   2.226   1.00 0.13 ? 29  MET A H    2  
ATOM   1780  H HA   . MET A 1 29 ? -4.415  5.414   1.896   1.00 0.11 ? 29  MET A HA   2  
ATOM   1781  H HB2  . MET A 1 29 ? -2.548  5.162   0.321   1.00 0.12 ? 29  MET A HB2  2  
ATOM   1782  H HB3  . MET A 1 29 ? -1.630  4.291   1.541   1.00 0.12 ? 29  MET A HB3  2  
ATOM   1783  H HG2  . MET A 1 29 ? -3.847  2.788   1.494   1.00 0.10 ? 29  MET A HG2  2  
ATOM   1784  H HG3  . MET A 1 29 ? -3.858  3.388   -0.163  1.00 0.10 ? 29  MET A HG3  2  
ATOM   1785  H HE1  . MET A 1 29 ? -0.520  2.609   1.999   1.00 0.12 ? 29  MET A HE1  2  
ATOM   1786  H HE2  . MET A 1 29 ? -0.536  0.860   1.771   1.00 0.11 ? 29  MET A HE2  2  
ATOM   1787  H HE3  . MET A 1 29 ? -1.873  1.654   2.603   1.00 0.11 ? 29  MET A HE3  2  
ATOM   1788  N N    . LEU A 1 30 ? -2.540  4.270   4.331   1.00 0.12 ? 30  LEU A N    2  
ATOM   1789  C CA   . LEU A 1 30 ? -2.540  3.434   5.526   1.00 0.12 ? 30  LEU A CA   2  
ATOM   1790  C C    . LEU A 1 30 ? -3.713  3.786   6.436   1.00 0.12 ? 30  LEU A C    2  
ATOM   1791  O O    . LEU A 1 30 ? -4.490  2.915   6.826   1.00 0.11 ? 30  LEU A O    2  
ATOM   1792  C CB   . LEU A 1 30 ? -1.223  3.597   6.286   1.00 0.13 ? 30  LEU A CB   2  
ATOM   1793  C CG   . LEU A 1 30 ? -0.246  2.424   6.196   1.00 0.13 ? 30  LEU A CG   2  
ATOM   1794  C CD1  . LEU A 1 30 ? 0.154   2.172   4.752   1.00 0.13 ? 30  LEU A CD1  2  
ATOM   1795  C CD2  . LEU A 1 30 ? 0.982   2.685   7.055   1.00 0.15 ? 30  LEU A CD2  2  
ATOM   1796  H H    . LEU A 1 30 ? -1.769  4.848   4.152   1.00 0.13 ? 30  LEU A H    2  
ATOM   1797  H HA   . LEU A 1 30 ? -2.639  2.406   5.212   1.00 0.11 ? 30  LEU A HA   2  
ATOM   1798  H HB2  . LEU A 1 30 ? -0.725  4.478   5.909   1.00 0.14 ? 30  LEU A HB2  2  
ATOM   1799  H HB3  . LEU A 1 30 ? -1.456  3.759   7.328   1.00 0.14 ? 30  LEU A HB3  2  
ATOM   1800  H HG   . LEU A 1 30 ? -0.731  1.532   6.567   1.00 0.13 ? 30  LEU A HG   2  
ATOM   1801  H HD11 . LEU A 1 30 ? 0.458   3.102   4.295   1.00 0.13 ? 30  LEU A HD11 2  
ATOM   1802  H HD12 . LEU A 1 30 ? -0.686  1.764   4.212   1.00 0.12 ? 30  LEU A HD12 2  
ATOM   1803  H HD13 . LEU A 1 30 ? 0.976   1.472   4.723   1.00 0.13 ? 30  LEU A HD13 2  
ATOM   1804  H HD21 . LEU A 1 30 ? 1.649   1.838   6.997   1.00 0.15 ? 30  LEU A HD21 2  
ATOM   1805  H HD22 . LEU A 1 30 ? 0.679   2.835   8.081   1.00 0.16 ? 30  LEU A HD22 2  
ATOM   1806  H HD23 . LEU A 1 30 ? 1.491   3.569   6.698   1.00 0.15 ? 30  LEU A HD23 2  
ATOM   1807  N N    . SER A 1 31 ? -3.834  5.067   6.769   1.00 0.13 ? 31  SER A N    2  
ATOM   1808  C CA   . SER A 1 31 ? -4.912  5.533   7.634   1.00 0.13 ? 31  SER A CA   2  
ATOM   1809  C C    . SER A 1 31 ? -6.267  5.072   7.109   1.00 0.12 ? 31  SER A C    2  
ATOM   1810  O O    . SER A 1 31 ? -7.203  4.852   7.880   1.00 0.12 ? 31  SER A O    2  
ATOM   1811  C CB   . SER A 1 31 ? -4.883  7.059   7.741   1.00 0.14 ? 31  SER A CB   2  
ATOM   1812  O OG   . SER A 1 31 ? -6.145  7.564   8.145   1.00 0.14 ? 31  SER A OG   2  
ATOM   1813  H H    . SER A 1 31 ? -3.185  5.714   6.423   1.00 0.13 ? 31  SER A H    2  
ATOM   1814  H HA   . SER A 1 31 ? -4.756  5.110   8.615   1.00 0.13 ? 31  SER A HA   2  
ATOM   1815  H HB2  . SER A 1 31 ? -4.142  7.354   8.468   1.00 0.15 ? 31  SER A HB2  2  
ATOM   1816  H HB3  . SER A 1 31 ? -4.632  7.480   6.778   1.00 0.14 ? 31  SER A HB3  2  
ATOM   1817  H HG   . SER A 1 31 ? -6.692  6.842   8.462   1.00 0.13 ? 31  SER A HG   2  
ATOM   1818  N N    . LEU A 1 32 ? -6.367  4.931   5.792   1.00 0.11 ? 32  LEU A N    2  
ATOM   1819  C CA   . LEU A 1 32 ? -7.610  4.498   5.161   1.00 0.10 ? 32  LEU A CA   2  
ATOM   1820  C C    . LEU A 1 32 ? -7.780  2.985   5.275   1.00 0.09 ? 32  LEU A C    2  
ATOM   1821  O O    . LEU A 1 32 ? -8.894  2.484   5.418   1.00 0.09 ? 32  LEU A O    2  
ATOM   1822  C CB   . LEU A 1 32 ? -7.631  4.915   3.691   1.00 0.10 ? 32  LEU A CB   2  
ATOM   1823  C CG   . LEU A 1 32 ? -8.911  4.591   2.918   1.00 0.09 ? 32  LEU A CG   2  
ATOM   1824  C CD1  . LEU A 1 32 ? -8.912  3.137   2.475   1.00 0.08 ? 32  LEU A CD1  2  
ATOM   1825  C CD2  . LEU A 1 32 ? -10.136 4.893   3.767   1.00 0.09 ? 32  LEU A CD2  2  
ATOM   1826  H H    . LEU A 1 32 ? -5.588  5.124   5.230   1.00 0.11 ? 32  LEU A H    2  
ATOM   1827  H HA   . LEU A 1 32 ? -8.425  4.981   5.675   1.00 0.10 ? 32  LEU A HA   2  
ATOM   1828  H HB2  . LEU A 1 32 ? -7.472  5.983   3.643   1.00 0.10 ? 32  LEU A HB2  2  
ATOM   1829  H HB3  . LEU A 1 32 ? -6.806  4.427   3.192   1.00 0.09 ? 32  LEU A HB3  2  
ATOM   1830  H HG   . LEU A 1 32 ? -8.956  5.209   2.033   1.00 0.09 ? 32  LEU A HG   2  
ATOM   1831  H HD11 . LEU A 1 32 ? -8.047  2.948   1.856   1.00 0.08 ? 32  LEU A HD11 2  
ATOM   1832  H HD12 . LEU A 1 32 ? -9.810  2.934   1.909   1.00 0.08 ? 32  LEU A HD12 2  
ATOM   1833  H HD13 . LEU A 1 32 ? -8.881  2.495   3.343   1.00 0.08 ? 32  LEU A HD13 2  
ATOM   1834  H HD21 . LEU A 1 32 ? -11.029 4.633   3.217   1.00 0.09 ? 32  LEU A HD21 2  
ATOM   1835  H HD22 . LEU A 1 32 ? -10.156 5.945   4.008   1.00 0.10 ? 32  LEU A HD22 2  
ATOM   1836  H HD23 . LEU A 1 32 ? -10.094 4.316   4.677   1.00 0.09 ? 32  LEU A HD23 2  
ATOM   1837  N N    . LEU A 1 33 ? -6.666  2.265   5.212   1.00 0.09 ? 33  LEU A N    2  
ATOM   1838  C CA   . LEU A 1 33 ? -6.690  0.810   5.310   1.00 0.08 ? 33  LEU A CA   2  
ATOM   1839  C C    . LEU A 1 33 ? -6.945  0.365   6.746   1.00 0.09 ? 33  LEU A C    2  
ATOM   1840  O O    . LEU A 1 33 ? -7.138  -0.822  7.012   1.00 0.09 ? 33  LEU A O    2  
ATOM   1841  C CB   . LEU A 1 33 ? -5.367  0.223   4.811   1.00 0.08 ? 33  LEU A CB   2  
ATOM   1842  C CG   . LEU A 1 33 ? -5.338  -0.215  3.345   1.00 0.08 ? 33  LEU A CG   2  
ATOM   1843  C CD1  . LEU A 1 33 ? -3.941  -0.672  2.952   1.00 0.08 ? 33  LEU A CD1  2  
ATOM   1844  C CD2  . LEU A 1 33 ? -6.353  -1.321  3.099   1.00 0.07 ? 33  LEU A CD2  2  
ATOM   1845  H H    . LEU A 1 33 ? -5.806  2.722   5.096   1.00 0.10 ? 33  LEU A H    2  
ATOM   1846  H HA   . LEU A 1 33 ? -7.493  0.452   4.686   1.00 0.08 ? 33  LEU A HA   2  
ATOM   1847  H HB2  . LEU A 1 33 ? -4.595  0.964   4.955   1.00 0.09 ? 33  LEU A HB2  2  
ATOM   1848  H HB3  . LEU A 1 33 ? -5.132  -0.635  5.421   1.00 0.09 ? 33  LEU A HB3  2  
ATOM   1849  H HG   . LEU A 1 33 ? -5.601  0.627   2.720   1.00 0.08 ? 33  LEU A HG   2  
ATOM   1850  H HD11 . LEU A 1 33 ? -3.988  -1.215  2.020   1.00 0.09 ? 33  LEU A HD11 2  
ATOM   1851  H HD12 . LEU A 1 33 ? -3.541  -1.313  3.723   1.00 0.10 ? 33  LEU A HD12 2  
ATOM   1852  H HD13 . LEU A 1 33 ? -3.302  0.190   2.834   1.00 0.10 ? 33  LEU A HD13 2  
ATOM   1853  H HD21 . LEU A 1 33 ? -5.962  -2.258  3.467   1.00 0.07 ? 33  LEU A HD21 2  
ATOM   1854  H HD22 . LEU A 1 33 ? -6.544  -1.401  2.040   1.00 0.06 ? 33  LEU A HD22 2  
ATOM   1855  H HD23 . LEU A 1 33 ? -7.273  -1.090  3.611   1.00 0.07 ? 33  LEU A HD23 2  
ATOM   1856  N N    . GLN A 1 34 ? -6.949  1.323   7.666   1.00 0.10 ? 34  GLN A N    2  
ATOM   1857  C CA   . GLN A 1 34 ? -7.184  1.030   9.075   1.00 0.11 ? 34  GLN A CA   2  
ATOM   1858  C C    . GLN A 1 34 ? -8.591  1.446   9.491   1.00 0.11 ? 34  GLN A C    2  
ATOM   1859  O O    . GLN A 1 34 ? -9.188  0.847   10.386  1.00 0.12 ? 34  GLN A O    2  
ATOM   1860  C CB   . GLN A 1 34 ? -6.149  1.746   9.946   1.00 0.12 ? 34  GLN A CB   2  
ATOM   1861  C CG   . GLN A 1 34 ? -4.711  1.444   9.555   1.00 0.13 ? 34  GLN A CG   2  
ATOM   1862  C CD   . GLN A 1 34 ? -3.832  1.145   10.752  1.00 0.14 ? 34  GLN A CD   2  
ATOM   1863  O OE1  . GLN A 1 34 ? -3.991  1.742   11.818  1.00 0.15 ? 34  GLN A OE1  2  
ATOM   1864  N NE2  . GLN A 1 34 ? -2.898  0.217   10.585  1.00 0.14 ? 34  GLN A NE2  2  
ATOM   1865  H H    . GLN A 1 34 ? -6.788  2.250   7.391   1.00 0.10 ? 34  GLN A H    2  
ATOM   1866  H HA   . GLN A 1 34 ? -7.081  -0.036  9.213   1.00 0.11 ? 34  GLN A HA   2  
ATOM   1867  H HB2  . GLN A 1 34 ? -6.305  2.812   9.867   1.00 0.13 ? 34  GLN A HB2  2  
ATOM   1868  H HB3  . GLN A 1 34 ? -6.291  1.445   10.973  1.00 0.13 ? 34  GLN A HB3  2  
ATOM   1869  H HG2  . GLN A 1 34 ? -4.702  0.586   8.899   1.00 0.12 ? 34  GLN A HG2  2  
ATOM   1870  H HG3  . GLN A 1 34 ? -4.306  2.298   9.033   1.00 0.13 ? 34  GLN A HG3  2  
ATOM   1871  H HE21 . GLN A 1 34 ? -2.828  -0.218  9.709   1.00 0.13 ? 34  GLN A HE21 2  
ATOM   1872  H HE22 . GLN A 1 34 ? -2.316  0.004   11.344  1.00 0.15 ? 34  GLN A HE22 2  
ATOM   1873  N N    . LYS A 1 35 ? -9.115  2.476   8.835   1.00 0.11 ? 35  LYS A N    2  
ATOM   1874  C CA   . LYS A 1 35 ? -10.454 2.971   9.134   1.00 0.11 ? 35  LYS A CA   2  
ATOM   1875  C C    . LYS A 1 35 ? -11.519 2.082   8.499   1.00 0.11 ? 35  LYS A C    2  
ATOM   1876  O O    . LYS A 1 35 ? -12.582 1.861   9.080   1.00 0.11 ? 35  LYS A O    2  
ATOM   1877  C CB   . LYS A 1 35 ? -10.610 4.409   8.635   1.00 0.12 ? 35  LYS A CB   2  
ATOM   1878  C CG   . LYS A 1 35 ? -10.800 4.513   7.132   1.00 0.11 ? 35  LYS A CG   2  
ATOM   1879  C CD   . LYS A 1 35 ? -10.984 5.957   6.692   1.00 0.11 ? 35  LYS A CD   2  
ATOM   1880  C CE   . LYS A 1 35 ? -12.302 6.152   5.959   1.00 0.11 ? 35  LYS A CE   2  
ATOM   1881  N NZ   . LYS A 1 35 ? -12.958 7.436   6.330   1.00 0.12 ? 35  LYS A NZ   2  
ATOM   1882  H H    . LYS A 1 35 ? -8.590  2.913   8.133   1.00 0.11 ? 35  LYS A H    2  
ATOM   1883  H HA   . LYS A 1 35 ? -10.581 2.956   10.206  1.00 0.12 ? 35  LYS A HA   2  
ATOM   1884  H HB2  . LYS A 1 35 ? -11.469 4.853   9.116   1.00 0.12 ? 35  LYS A HB2  2  
ATOM   1885  H HB3  . LYS A 1 35 ? -9.727  4.969   8.905   1.00 0.12 ? 35  LYS A HB3  2  
ATOM   1886  H HG2  . LYS A 1 35 ? -9.929  4.105   6.643   1.00 0.10 ? 35  LYS A HG2  2  
ATOM   1887  H HG3  . LYS A 1 35 ? -11.673 3.944   6.849   1.00 0.10 ? 35  LYS A HG3  2  
ATOM   1888  H HD2  . LYS A 1 35 ? -10.973 6.592   7.565   1.00 0.12 ? 35  LYS A HD2  2  
ATOM   1889  H HD3  . LYS A 1 35 ? -10.171 6.231   6.036   1.00 0.11 ? 35  LYS A HD3  2  
ATOM   1890  H HE2  . LYS A 1 35 ? -12.113 6.149   4.896   1.00 0.11 ? 35  LYS A HE2  2  
ATOM   1891  H HE3  . LYS A 1 35 ? -12.963 5.335   6.207   1.00 0.11 ? 35  LYS A HE3  2  
ATOM   1892  H HZ1  . LYS A 1 35 ? -13.154 7.454   7.351   1.00 0.13 ? 35  LYS A HZ1  2  
ATOM   1893  H HZ2  . LYS A 1 35 ? -13.854 7.542   5.814   1.00 0.12 ? 35  LYS A HZ2  2  
ATOM   1894  H HZ3  . LYS A 1 35 ? -12.337 8.236   6.093   1.00 0.12 ? 35  LYS A HZ3  2  
ATOM   1895  N N    . GLU A 1 36 ? -11.225 1.577   7.306   1.00 0.10 ? 36  GLU A N    2  
ATOM   1896  C CA   . GLU A 1 36 ? -12.160 0.712   6.594   1.00 0.09 ? 36  GLU A CA   2  
ATOM   1897  C C    . GLU A 1 36 ? -12.246 -0.659  7.258   1.00 0.09 ? 36  GLU A C    2  
ATOM   1898  O O    . GLU A 1 36 ? -13.104 -1.473  6.919   1.00 0.09 ? 36  GLU A O    2  
ATOM   1899  C CB   . GLU A 1 36 ? -11.731 0.556   5.133   1.00 0.08 ? 36  GLU A CB   2  
ATOM   1900  C CG   . GLU A 1 36 ? -11.716 1.864   4.361   1.00 0.08 ? 36  GLU A CG   2  
ATOM   1901  C CD   . GLU A 1 36 ? -13.106 2.423   4.133   1.00 0.09 ? 36  GLU A CD   2  
ATOM   1902  O OE1  . GLU A 1 36 ? -13.216 3.499   3.506   1.00 0.09 ? 36  GLU A OE1  2  
ATOM   1903  O OE2  . GLU A 1 36 ? -14.083 1.788   4.578   1.00 0.09 ? 36  GLU A OE2  2  
ATOM   1904  H H    . GLU A 1 36 ? -10.362 1.790   6.894   1.00 0.09 ? 36  GLU A H    2  
ATOM   1905  H HA   . GLU A 1 36 ? -13.133 1.177   6.627   1.00 0.10 ? 36  GLU A HA   2  
ATOM   1906  H HB2  . GLU A 1 36 ? -10.737 0.134   5.105   1.00 0.08 ? 36  GLU A HB2  2  
ATOM   1907  H HB3  . GLU A 1 36 ? -12.414 -0.120  4.640   1.00 0.08 ? 36  GLU A HB3  2  
ATOM   1908  H HG2  . GLU A 1 36 ? -11.142 2.588   4.918   1.00 0.09 ? 36  GLU A HG2  2  
ATOM   1909  H HG3  . GLU A 1 36 ? -11.249 1.696   3.402   1.00 0.08 ? 36  GLU A HG3  2  
ATOM   1910  N N    . GLY A 1 37 ? -11.351 -0.907  8.210   1.00 0.10 ? 37  GLY A N    2  
ATOM   1911  C CA   . GLY A 1 37 ? -11.342 -2.180  8.907   1.00 0.10 ? 37  GLY A CA   2  
ATOM   1912  C C    . GLY A 1 37 ? -10.625 -3.263  8.128   1.00 0.09 ? 37  GLY A C    2  
ATOM   1913  O O    . GLY A 1 37 ? -10.625 -4.429  8.526   1.00 0.10 ? 37  GLY A O    2  
ATOM   1914  H H    . GLY A 1 37 ? -10.692 -0.219  8.441   1.00 0.10 ? 37  GLY A H    2  
ATOM   1915  H HA2  . GLY A 1 37 ? -10.852 -2.053  9.861   1.00 0.11 ? 37  GLY A HA2  2  
ATOM   1916  H HA3  . GLY A 1 37 ? -12.363 -2.491  9.078   1.00 0.11 ? 37  GLY A HA3  2  
ATOM   1917  N N    . LEU A 1 38 ? -10.009 -2.879  7.014   1.00 0.08 ? 38  LEU A N    2  
ATOM   1918  C CA   . LEU A 1 38 ? -9.284  -3.829  6.175   1.00 0.08 ? 38  LEU A CA   2  
ATOM   1919  C C    . LEU A 1 38 ? -7.979  -4.257  6.839   1.00 0.08 ? 38  LEU A C    2  
ATOM   1920  O O    . LEU A 1 38 ? -7.434  -5.317  6.535   1.00 0.08 ? 38  LEU A O    2  
ATOM   1921  C CB   . LEU A 1 38 ? -8.994  -3.210  4.807   1.00 0.07 ? 38  LEU A CB   2  
ATOM   1922  C CG   . LEU A 1 38 ? -10.206 -2.980  3.904   1.00 0.06 ? 38  LEU A CG   2  
ATOM   1923  C CD1  . LEU A 1 38 ? -9.892  -1.936  2.843   1.00 0.06 ? 38  LEU A CD1  2  
ATOM   1924  C CD2  . LEU A 1 38 ? -10.645 -4.285  3.256   1.00 0.06 ? 38  LEU A CD2  2  
ATOM   1925  H H    . LEU A 1 38 ? -10.044 -1.937  6.749   1.00 0.08 ? 38  LEU A H    2  
ATOM   1926  H HA   . LEU A 1 38 ? -9.909  -4.700  6.042   1.00 0.08 ? 38  LEU A HA   2  
ATOM   1927  H HB2  . LEU A 1 38 ? -8.509  -2.259  4.966   1.00 0.07 ? 38  LEU A HB2  2  
ATOM   1928  H HB3  . LEU A 1 38 ? -8.307  -3.858  4.285   1.00 0.06 ? 38  LEU A HB3  2  
ATOM   1929  H HG   . LEU A 1 38 ? -11.026 -2.610  4.502   1.00 0.07 ? 38  LEU A HG   2  
ATOM   1930  H HD11 . LEU A 1 38 ? -9.648  -0.999  3.321   1.00 0.06 ? 38  LEU A HD11 2  
ATOM   1931  H HD12 . LEU A 1 38 ? -10.753 -1.801  2.205   1.00 0.06 ? 38  LEU A HD12 2  
ATOM   1932  H HD13 . LEU A 1 38 ? -9.053  -2.267  2.250   1.00 0.05 ? 38  LEU A HD13 2  
ATOM   1933  H HD21 . LEU A 1 38 ? -9.826  -4.697  2.684   1.00 0.06 ? 38  LEU A HD21 2  
ATOM   1934  H HD22 . LEU A 1 38 ? -11.482 -4.098  2.600   1.00 0.06 ? 38  LEU A HD22 2  
ATOM   1935  H HD23 . LEU A 1 38 ? -10.938 -4.988  4.022   1.00 0.07 ? 38  LEU A HD23 2  
ATOM   1936  N N    . LEU A 1 39 ? -7.485  -3.425  7.751   1.00 0.09 ? 39  LEU A N    2  
ATOM   1937  C CA   . LEU A 1 39 ? -6.245  -3.718  8.461   1.00 0.10 ? 39  LEU A CA   2  
ATOM   1938  C C    . LEU A 1 39 ? -6.324  -3.249  9.910   1.00 0.11 ? 39  LEU A C    2  
ATOM   1939  O O    . LEU A 1 39 ? -6.999  -2.267  10.220  1.00 0.11 ? 39  LEU A O    2  
ATOM   1940  C CB   . LEU A 1 39 ? -5.062  -3.048  7.760   1.00 0.10 ? 39  LEU A CB   2  
ATOM   1941  C CG   . LEU A 1 39 ? -4.731  -3.566  6.359   1.00 0.09 ? 39  LEU A CG   2  
ATOM   1942  C CD1  . LEU A 1 39 ? -3.516  -2.845  5.797   1.00 0.09 ? 39  LEU A CD1  2  
ATOM   1943  C CD2  . LEU A 1 39 ? -4.494  -5.069  6.390   1.00 0.09 ? 39  LEU A CD2  2  
ATOM   1944  H H    . LEU A 1 39 ? -7.965  -2.594  7.950   1.00 0.09 ? 39  LEU A H    2  
ATOM   1945  H HA   . LEU A 1 39 ? -6.101  -4.788  8.449   1.00 0.10 ? 39  LEU A HA   2  
ATOM   1946  H HB2  . LEU A 1 39 ? -5.272  -1.991  7.685   1.00 0.10 ? 39  LEU A HB2  2  
ATOM   1947  H HB3  . LEU A 1 39 ? -4.188  -3.177  8.380   1.00 0.11 ? 39  LEU A HB3  2  
ATOM   1948  H HG   . LEU A 1 39 ? -5.567  -3.372  5.704   1.00 0.08 ? 39  LEU A HG   2  
ATOM   1949  H HD11 . LEU A 1 39 ? -3.421  -3.067  4.745   1.00 0.08 ? 39  LEU A HD11 2  
ATOM   1950  H HD12 . LEU A 1 39 ? -2.629  -3.178  6.316   1.00 0.10 ? 39  LEU A HD12 2  
ATOM   1951  H HD13 . LEU A 1 39 ? -3.632  -1.781  5.933   1.00 0.09 ? 39  LEU A HD13 2  
ATOM   1952  H HD21 . LEU A 1 39 ? -3.823  -5.345  5.590   1.00 0.08 ? 39  LEU A HD21 2  
ATOM   1953  H HD22 . LEU A 1 39 ? -5.436  -5.583  6.262   1.00 0.08 ? 39  LEU A HD22 2  
ATOM   1954  H HD23 . LEU A 1 39 ? -4.061  -5.347  7.338   1.00 0.10 ? 39  LEU A HD23 2  
ATOM   1955  N N    . MET A 1 40 ? -5.628  -3.956  10.794  1.00 0.12 ? 40  MET A N    2  
ATOM   1956  C CA   . MET A 1 40 ? -5.617  -3.611  12.211  1.00 0.14 ? 40  MET A CA   2  
ATOM   1957  C C    . MET A 1 40 ? -4.322  -2.895  12.586  1.00 0.14 ? 40  MET A C    2  
ATOM   1958  O O    . MET A 1 40 ? -4.268  -2.170  13.579  1.00 0.15 ? 40  MET A O    2  
ATOM   1959  C CB   . MET A 1 40 ? -5.785  -4.867  13.067  1.00 0.14 ? 40  MET A CB   2  
ATOM   1960  C CG   . MET A 1 40 ? -6.143  -4.573  14.515  1.00 0.16 ? 40  MET A CG   2  
ATOM   1961  S SD   . MET A 1 40 ? -5.496  -5.811  15.655  1.00 0.17 ? 40  MET A SD   2  
ATOM   1962  C CE   . MET A 1 40 ? -3.750  -5.414  15.631  1.00 0.17 ? 40  MET A CE   2  
ATOM   1963  H H    . MET A 1 40 ? -5.111  -4.729  10.486  1.00 0.12 ? 40  MET A H    2  
ATOM   1964  H HA   . MET A 1 40 ? -6.448  -2.946  12.396  1.00 0.14 ? 40  MET A HA   2  
ATOM   1965  H HB2  . MET A 1 40 ? -6.569  -5.476  12.641  1.00 0.14 ? 40  MET A HB2  2  
ATOM   1966  H HB3  . MET A 1 40 ? -4.861  -5.424  13.053  1.00 0.14 ? 40  MET A HB3  2  
ATOM   1967  H HG2  . MET A 1 40 ? -5.735  -3.610  14.784  1.00 0.16 ? 40  MET A HG2  2  
ATOM   1968  H HG3  . MET A 1 40 ? -7.219  -4.545  14.608  1.00 0.15 ? 40  MET A HG3  2  
ATOM   1969  H HE1  . MET A 1 40 ? -3.611  -4.385  15.928  1.00 0.18 ? 40  MET A HE1  2  
ATOM   1970  H HE2  . MET A 1 40 ? -3.362  -5.557  14.634  1.00 0.17 ? 40  MET A HE2  2  
ATOM   1971  H HE3  . MET A 1 40 ? -3.224  -6.061  16.318  1.00 0.18 ? 40  MET A HE3  2  
ATOM   1972  N N    . SER A 1 41 ? -3.282  -3.106  11.785  1.00 0.14 ? 41  SER A N    2  
ATOM   1973  C CA   . SER A 1 41 ? -1.988  -2.484  12.035  1.00 0.15 ? 41  SER A CA   2  
ATOM   1974  C C    . SER A 1 41 ? -1.243  -2.233  10.727  1.00 0.14 ? 41  SER A C    2  
ATOM   1975  O O    . SER A 1 41 ? -1.537  -2.830  9.691   1.00 0.13 ? 41  SER A O    2  
ATOM   1976  C CB   . SER A 1 41 ? -1.143  -3.369  12.953  1.00 0.16 ? 41  SER A CB   2  
ATOM   1977  O OG   . SER A 1 41 ? -1.694  -4.670  13.057  1.00 0.16 ? 41  SER A OG   2  
ATOM   1978  H H    . SER A 1 41 ? -3.388  -3.694  11.008  1.00 0.13 ? 41  SER A H    2  
ATOM   1979  H HA   . SER A 1 41 ? -2.163  -1.537  12.523  1.00 0.15 ? 41  SER A HA   2  
ATOM   1980  H HB2  . SER A 1 41 ? -0.142  -3.448  12.554  1.00 0.16 ? 41  SER A HB2  2  
ATOM   1981  H HB3  . SER A 1 41 ? -1.103  -2.928  13.939  1.00 0.17 ? 41  SER A HB3  2  
ATOM   1982  H HG   . SER A 1 41 ? -1.513  -5.027  13.930  1.00 0.17 ? 41  SER A HG   2  
ATOM   1983  N N    . PRO A 1 42 ? -0.256  -1.328  10.774  1.00 0.15 ? 42  PRO A N    2  
ATOM   1984  C CA   . PRO A 1 42 ? 0.552   -0.975  9.603   1.00 0.15 ? 42  PRO A CA   2  
ATOM   1985  C C    . PRO A 1 42 ? 1.478   -2.109  9.175   1.00 0.15 ? 42  PRO A C    2  
ATOM   1986  O O    . PRO A 1 42 ? 2.005   -2.106  8.063   1.00 0.15 ? 42  PRO A O    2  
ATOM   1987  C CB   . PRO A 1 42 ? 1.366   0.230   10.081  1.00 0.16 ? 42  PRO A CB   2  
ATOM   1988  C CG   . PRO A 1 42 ? 1.442   0.071   11.561  1.00 0.17 ? 42  PRO A CG   2  
ATOM   1989  C CD   . PRO A 1 42 ? 0.150   -0.577  11.975  1.00 0.17 ? 42  PRO A CD   2  
ATOM   1990  H HA   . PRO A 1 42 ? -0.069  -0.686  8.768   1.00 0.14 ? 42  PRO A HA   2  
ATOM   1991  H HB2  . PRO A 1 42 ? 2.353   0.208   9.635   1.00 0.17 ? 42  PRO A HB2  2  
ATOM   1992  H HB3  . PRO A 1 42 ? 0.859   1.147   9.831   1.00 0.16 ? 42  PRO A HB3  2  
ATOM   1993  H HG2  . PRO A 1 42 ? 2.282   -0.560  11.819  1.00 0.18 ? 42  PRO A HG2  2  
ATOM   1994  H HG3  . PRO A 1 42 ? 1.536   1.037   12.031  1.00 0.18 ? 42  PRO A HG3  2  
ATOM   1995  H HD2  . PRO A 1 42 ? 0.311   -1.242  12.810  1.00 0.17 ? 42  PRO A HD2  2  
ATOM   1996  H HD3  . PRO A 1 42 ? -0.585  0.174   12.225  1.00 0.16 ? 42  PRO A HD3  2  
ATOM   1997  N N    . SER A 1 43 ? 1.673   -3.075  10.067  1.00 0.16 ? 43  SER A N    2  
ATOM   1998  C CA   . SER A 1 43 ? 2.540   -4.213  9.784   1.00 0.16 ? 43  SER A CA   2  
ATOM   1999  C C    . SER A 1 43 ? 1.768   -5.317  9.065   1.00 0.15 ? 43  SER A C    2  
ATOM   2000  O O    . SER A 1 43 ? 2.345   -6.322  8.650   1.00 0.15 ? 43  SER A O    2  
ATOM   2001  C CB   . SER A 1 43 ? 3.142   -4.759  11.079  1.00 0.17 ? 43  SER A CB   2  
ATOM   2002  O OG   . SER A 1 43 ? 2.131   -5.058  12.026  1.00 0.17 ? 43  SER A OG   2  
ATOM   2003  H H    . SER A 1 43 ? 1.223   -3.022  10.936  1.00 0.16 ? 43  SER A H    2  
ATOM   2004  H HA   . SER A 1 43 ? 3.337   -3.871  9.142   1.00 0.16 ? 43  SER A HA   2  
ATOM   2005  H HB2  . SER A 1 43 ? 3.695   -5.661  10.865  1.00 0.17 ? 43  SER A HB2  2  
ATOM   2006  H HB3  . SER A 1 43 ? 3.808   -4.021  11.503  1.00 0.18 ? 43  SER A HB3  2  
ATOM   2007  H HG   . SER A 1 43 ? 2.152   -5.996  12.232  1.00 0.17 ? 43  SER A HG   2  
ATOM   2008  N N    . ASP A 1 44 ? 0.463   -5.121  8.921   1.00 0.14 ? 44  ASP A N    2  
ATOM   2009  C CA   . ASP A 1 44 ? -0.388  -6.098  8.252   1.00 0.12 ? 44  ASP A CA   2  
ATOM   2010  C C    . ASP A 1 44 ? 0.018   -6.262  6.791   1.00 0.12 ? 44  ASP A C    2  
ATOM   2011  O O    . ASP A 1 44 ? -0.356  -7.236  6.135   1.00 0.11 ? 44  ASP A O    2  
ATOM   2012  C CB   . ASP A 1 44 ? -1.856  -5.675  8.342   1.00 0.12 ? 44  ASP A CB   2  
ATOM   2013  C CG   . ASP A 1 44 ? -2.792  -6.857  8.488   1.00 0.11 ? 44  ASP A CG   2  
ATOM   2014  O OD1  . ASP A 1 44 ? -2.534  -7.900  7.850   1.00 0.11 ? 44  ASP A OD1  2  
ATOM   2015  O OD2  . ASP A 1 44 ? -3.781  -6.742  9.239   1.00 0.11 ? 44  ASP A OD2  2  
ATOM   2016  H H    . ASP A 1 44 ? 0.061   -4.300  9.274   1.00 0.14 ? 44  ASP A H    2  
ATOM   2017  H HA   . ASP A 1 44 ? -0.265  -7.045  8.755   1.00 0.13 ? 44  ASP A HA   2  
ATOM   2018  H HB2  . ASP A 1 44 ? -1.986  -5.029  9.197   1.00 0.12 ? 44  ASP A HB2  2  
ATOM   2019  H HB3  . ASP A 1 44 ? -2.122  -5.136  7.445   1.00 0.11 ? 44  ASP A HB3  2  
ATOM   2020  N N    . LEU A 1 45 ? 0.786   -5.302  6.284   1.00 0.12 ? 45  LEU A N    2  
ATOM   2021  C CA   . LEU A 1 45 ? 1.242   -5.339  4.900   1.00 0.12 ? 45  LEU A CA   2  
ATOM   2022  C C    . LEU A 1 45 ? 2.134   -6.552  4.652   1.00 0.12 ? 45  LEU A C    2  
ATOM   2023  O O    . LEU A 1 45 ? 2.369   -6.938  3.507   1.00 0.12 ? 45  LEU A O    2  
ATOM   2024  C CB   . LEU A 1 45 ? 2.000   -4.055  4.557   1.00 0.12 ? 45  LEU A CB   2  
ATOM   2025  C CG   . LEU A 1 45 ? 1.388   -3.187  3.458   1.00 0.12 ? 45  LEU A CG   2  
ATOM   2026  C CD1  . LEU A 1 45 ? 1.662   -3.789  2.088   1.00 0.11 ? 45  LEU A CD1  2  
ATOM   2027  C CD2  . LEU A 1 45 ? -0.109  -3.021  3.680   1.00 0.10 ? 45  LEU A CD2  2  
ATOM   2028  H H    . LEU A 1 45 ? 1.052   -4.552  6.855   1.00 0.13 ? 45  LEU A H    2  
ATOM   2029  H HA   . LEU A 1 45 ? 0.371   -5.412  4.266   1.00 0.11 ? 45  LEU A HA   2  
ATOM   2030  H HB2  . LEU A 1 45 ? 2.072   -3.459  5.455   1.00 0.13 ? 45  LEU A HB2  2  
ATOM   2031  H HB3  . LEU A 1 45 ? 2.999   -4.329  4.251   1.00 0.13 ? 45  LEU A HB3  2  
ATOM   2032  H HG   . LEU A 1 45 ? 1.842   -2.207  3.488   1.00 0.12 ? 45  LEU A HG   2  
ATOM   2033  H HD11 . LEU A 1 45 ? 2.709   -3.680  1.851   1.00 0.12 ? 45  LEU A HD11 2  
ATOM   2034  H HD12 . LEU A 1 45 ? 1.070   -3.276  1.344   1.00 0.11 ? 45  LEU A HD12 2  
ATOM   2035  H HD13 . LEU A 1 45 ? 1.401   -4.837  2.096   1.00 0.11 ? 45  LEU A HD13 2  
ATOM   2036  H HD21 . LEU A 1 45 ? -0.452  -2.132  3.173   1.00 0.10 ? 45  LEU A HD21 2  
ATOM   2037  H HD22 . LEU A 1 45 ? -0.309  -2.933  4.737   1.00 0.11 ? 45  LEU A HD22 2  
ATOM   2038  H HD23 . LEU A 1 45 ? -0.629  -3.882  3.286   1.00 0.10 ? 45  LEU A HD23 2  
ATOM   2039  N N    . TYR A 1 46 ? 2.625   -7.149  5.733   1.00 0.13 ? 46  TYR A N    2  
ATOM   2040  C CA   . TYR A 1 46 ? 3.490   -8.317  5.634   1.00 0.14 ? 46  TYR A CA   2  
ATOM   2041  C C    . TYR A 1 46 ? 2.673   -9.584  5.409   1.00 0.13 ? 46  TYR A C    2  
ATOM   2042  O O    . TYR A 1 46 ? 3.217   -10.686 5.354   1.00 0.13 ? 46  TYR A O    2  
ATOM   2043  C CB   . TYR A 1 46 ? 4.336   -8.459  6.900   1.00 0.15 ? 46  TYR A CB   2  
ATOM   2044  C CG   . TYR A 1 46 ? 5.105   -7.209  7.259   1.00 0.16 ? 46  TYR A CG   2  
ATOM   2045  C CD1  . TYR A 1 46 ? 5.667   -6.408  6.273   1.00 0.16 ? 46  TYR A CD1  2  
ATOM   2046  C CD2  . TYR A 1 46 ? 5.271   -6.828  8.585   1.00 0.17 ? 46  TYR A CD2  2  
ATOM   2047  C CE1  . TYR A 1 46 ? 6.371   -5.264  6.596   1.00 0.17 ? 46  TYR A CE1  2  
ATOM   2048  C CE2  . TYR A 1 46 ? 5.972   -5.686  8.918   1.00 0.18 ? 46  TYR A CE2  2  
ATOM   2049  C CZ   . TYR A 1 46 ? 6.521   -4.907  7.919   1.00 0.18 ? 46  TYR A CZ   2  
ATOM   2050  O OH   . TYR A 1 46 ? 7.221   -3.769  8.248   1.00 0.19 ? 46  TYR A OH   2  
ATOM   2051  H H    . TYR A 1 46 ? 2.399   -6.795  6.619   1.00 0.13 ? 46  TYR A H    2  
ATOM   2052  H HA   . TYR A 1 46 ? 4.146   -8.172  4.789   1.00 0.14 ? 46  TYR A HA   2  
ATOM   2053  H HB2  . TYR A 1 46 ? 3.689   -8.700  7.731   1.00 0.15 ? 46  TYR A HB2  2  
ATOM   2054  H HB3  . TYR A 1 46 ? 5.047   -9.260  6.761   1.00 0.16 ? 46  TYR A HB3  2  
ATOM   2055  H HD1  . TYR A 1 46 ? 5.547   -6.689  5.237   1.00 0.15 ? 46  TYR A HD1  2  
ATOM   2056  H HD2  . TYR A 1 46 ? 4.841   -7.440  9.364   1.00 0.17 ? 46  TYR A HD2  2  
ATOM   2057  H HE1  . TYR A 1 46 ? 6.800   -4.655  5.814   1.00 0.17 ? 46  TYR A HE1  2  
ATOM   2058  H HE2  . TYR A 1 46 ? 6.089   -5.406  9.955   1.00 0.19 ? 46  TYR A HE2  2  
ATOM   2059  H HH   . TYR A 1 46 ? 7.831   -3.963  8.964   1.00 0.20 ? 46  TYR A HH   2  
ATOM   2060  N N    . SER A 1 47 ? 1.359   -9.419  5.279   1.00 0.12 ? 47  SER A N    2  
ATOM   2061  C CA   . SER A 1 47 ? 0.464   -10.548 5.064   1.00 0.11 ? 47  SER A CA   2  
ATOM   2062  C C    . SER A 1 47 ? -0.037  -10.578 3.623   1.00 0.10 ? 47  SER A C    2  
ATOM   2063  O O    . SER A 1 47 ? -1.033  -9.944  3.271   1.00 0.09 ? 47  SER A O    2  
ATOM   2064  C CB   . SER A 1 47 ? -0.723  -10.476 6.027   1.00 0.11 ? 47  SER A CB   2  
ATOM   2065  O OG   . SER A 1 47 ? -0.440  -11.155 7.237   1.00 0.12 ? 47  SER A OG   2  
ATOM   2066  H H    . SER A 1 47 ? 0.984   -8.515  5.332   1.00 0.12 ? 47  SER A H    2  
ATOM   2067  H HA   . SER A 1 47 ? 1.019   -11.451 5.260   1.00 0.12 ? 47  SER A HA   2  
ATOM   2068  H HB2  . SER A 1 47 ? -0.939  -9.442  6.251   1.00 0.11 ? 47  SER A HB2  2  
ATOM   2069  H HB3  . SER A 1 47 ? -1.586  -10.932 5.565   1.00 0.10 ? 47  SER A HB3  2  
ATOM   2070  H HG   . SER A 1 47 ? -0.850  -10.687 7.969   1.00 0.12 ? 47  SER A HG   2  
ATOM   2071  N N    . PRO A 1 48 ? 0.669   -11.331 2.766   1.00 0.11 ? 48  PRO A N    2  
ATOM   2072  C CA   . PRO A 1 48 ? 0.317   -11.463 1.350   1.00 0.10 ? 48  PRO A CA   2  
ATOM   2073  C C    . PRO A 1 48 ? -0.967  -12.259 1.144   1.00 0.09 ? 48  PRO A C    2  
ATOM   2074  O O    . PRO A 1 48 ? -1.450  -12.397 0.020   1.00 0.09 ? 48  PRO A O    2  
ATOM   2075  C CB   . PRO A 1 48 ? 1.512   -12.211 0.755   1.00 0.11 ? 48  PRO A CB   2  
ATOM   2076  C CG   . PRO A 1 48 ? 2.094   -12.966 1.899   1.00 0.12 ? 48  PRO A CG   2  
ATOM   2077  C CD   . PRO A 1 48 ? 1.867   -12.112 3.117   1.00 0.12 ? 48  PRO A CD   2  
ATOM   2078  H HA   . PRO A 1 48 ? 0.220   -10.497 0.875   1.00 0.10 ? 48  PRO A HA   2  
ATOM   2079  H HB2  . PRO A 1 48 ? 1.176   -12.882 -0.025  1.00 0.11 ? 48  PRO A HB2  2  
ATOM   2080  H HB3  . PRO A 1 48 ? 2.234   -11.511 0.366   1.00 0.11 ? 48  PRO A HB3  2  
ATOM   2081  H HG2  . PRO A 1 48 ? 1.590   -13.918 2.004   1.00 0.12 ? 48  PRO A HG2  2  
ATOM   2082  H HG3  . PRO A 1 48 ? 3.151   -13.113 1.746   1.00 0.13 ? 48  PRO A HG3  2  
ATOM   2083  H HD2  . PRO A 1 48 ? 1.684   -12.733 3.981   1.00 0.12 ? 48  PRO A HD2  2  
ATOM   2084  H HD3  . PRO A 1 48 ? 2.714   -11.464 3.288   1.00 0.12 ? 48  PRO A HD3  2  
ATOM   2085  N N    . GLY A 1 49 ? -1.515  -12.781 2.237   1.00 0.09 ? 49  GLY A N    2  
ATOM   2086  C CA   . GLY A 1 49 ? -2.739  -13.558 2.154   1.00 0.09 ? 49  GLY A CA   2  
ATOM   2087  C C    . GLY A 1 49 ? -3.975  -12.725 2.437   1.00 0.08 ? 49  GLY A C    2  
ATOM   2088  O O    . GLY A 1 49 ? -5.084  -13.253 2.509   1.00 0.08 ? 49  GLY A O    2  
ATOM   2089  H H    . GLY A 1 49 ? -1.086  -12.637 3.106   1.00 0.10 ? 49  GLY A H    2  
ATOM   2090  H HA2  . GLY A 1 49 ? -2.820  -13.977 1.162   1.00 0.09 ? 49  GLY A HA2  2  
ATOM   2091  H HA3  . GLY A 1 49 ? -2.690  -14.364 2.871   1.00 0.10 ? 49  GLY A HA3  2  
ATOM   2092  N N    . SER A 1 50 ? -3.782  -11.421 2.601   1.00 0.08 ? 50  SER A N    2  
ATOM   2093  C CA   . SER A 1 50 ? -4.888  -10.514 2.884   1.00 0.07 ? 50  SER A CA   2  
ATOM   2094  C C    . SER A 1 50 ? -5.002  -9.442  1.806   1.00 0.06 ? 50  SER A C    2  
ATOM   2095  O O    . SER A 1 50 ? -5.822  -8.529  1.905   1.00 0.06 ? 50  SER A O    2  
ATOM   2096  C CB   . SER A 1 50 ? -4.702  -9.859  4.254   1.00 0.08 ? 50  SER A CB   2  
ATOM   2097  O OG   . SER A 1 50 ? -4.841  -10.807 5.298   1.00 0.09 ? 50  SER A OG   2  
ATOM   2098  H H    . SER A 1 50 ? -2.874  -11.059 2.533   1.00 0.08 ? 50  SER A H    2  
ATOM   2099  H HA   . SER A 1 50 ? -5.798  -11.095 2.894   1.00 0.07 ? 50  SER A HA   2  
ATOM   2100  H HB2  . SER A 1 50 ? -3.715  -9.423  4.310   1.00 0.08 ? 50  SER A HB2  2  
ATOM   2101  H HB3  . SER A 1 50 ? -5.444  -9.085  4.384   1.00 0.07 ? 50  SER A HB3  2  
ATOM   2102  H HG   . SER A 1 50 ? -5.185  -11.629 4.940   1.00 0.09 ? 50  SER A HG   2  
ATOM   2103  N N    . TRP A 1 51 ? -4.172  -9.557  0.775   1.00 0.07 ? 51  TRP A N    2  
ATOM   2104  C CA   . TRP A 1 51 ? -4.178  -8.599  -0.324  1.00 0.06 ? 51  TRP A CA   2  
ATOM   2105  C C    . TRP A 1 51 ? -5.439  -8.746  -1.168  1.00 0.06 ? 51  TRP A C    2  
ATOM   2106  O O    . TRP A 1 51 ? -5.822  -7.828  -1.894  1.00 0.06 ? 51  TRP A O    2  
ATOM   2107  C CB   . TRP A 1 51 ? -2.939  -8.787  -1.199  1.00 0.07 ? 51  TRP A CB   2  
ATOM   2108  C CG   . TRP A 1 51 ? -1.667  -8.366  -0.527  1.00 0.08 ? 51  TRP A CG   2  
ATOM   2109  C CD1  . TRP A 1 51 ? -1.545  -7.532  0.547   1.00 0.08 ? 51  TRP A CD1  2  
ATOM   2110  C CD2  . TRP A 1 51 ? -0.337  -8.760  -0.885  1.00 0.09 ? 51  TRP A CD2  2  
ATOM   2111  N NE1  . TRP A 1 51 ? -0.220  -7.383  0.879   1.00 0.09 ? 51  TRP A NE1  2  
ATOM   2112  C CE2  . TRP A 1 51 ? 0.541   -8.126  0.016   1.00 0.10 ? 51  TRP A CE2  2  
ATOM   2113  C CE3  . TRP A 1 51 ? 0.195   -9.586  -1.877  1.00 0.09 ? 51  TRP A CE3  2  
ATOM   2114  C CZ2  . TRP A 1 51 ? 1.921   -8.294  -0.049  1.00 0.11 ? 51  TRP A CZ2  2  
ATOM   2115  C CZ3  . TRP A 1 51 ? 1.565   -9.752  -1.940  1.00 0.11 ? 51  TRP A CZ3  2  
ATOM   2116  C CH2  . TRP A 1 51 ? 2.416   -9.108  -1.031  1.00 0.11 ? 51  TRP A CH2  2  
ATOM   2117  H H    . TRP A 1 51 ? -3.540  -10.306 0.752   1.00 0.07 ? 51  TRP A H    2  
ATOM   2118  H HA   . TRP A 1 51 ? -4.159  -7.607  0.102   1.00 0.06 ? 51  TRP A HA   2  
ATOM   2119  H HB2  . TRP A 1 51 ? -2.848  -9.831  -1.461  1.00 0.07 ? 51  TRP A HB2  2  
ATOM   2120  H HB3  . TRP A 1 51 ? -3.051  -8.202  -2.100  1.00 0.07 ? 51  TRP A HB3  2  
ATOM   2121  H HD1  . TRP A 1 51 ? -2.377  -7.063  1.052   1.00 0.07 ? 51  TRP A HD1  2  
ATOM   2122  H HE1  . TRP A 1 51 ? 0.124   -6.834  1.614   1.00 0.09 ? 51  TRP A HE1  2  
ATOM   2123  H HE3  . TRP A 1 51 ? -0.444  -10.091 -2.587  1.00 0.09 ? 51  TRP A HE3  2  
ATOM   2124  H HZ2  . TRP A 1 51 ? 2.588   -7.807  0.643   1.00 0.11 ? 51  TRP A HZ2  2  
ATOM   2125  H HZ3  . TRP A 1 51 ? 1.995   -10.387 -2.700  1.00 0.11 ? 51  TRP A HZ3  2  
ATOM   2126  H HH2  . TRP A 1 51 ? 3.480   -9.266  -1.119  1.00 0.12 ? 51  TRP A HH2  2  
ATOM   2127  N N    . ASP A 1 52 ? -6.081  -9.904  -1.068  1.00 0.06 ? 52  ASP A N    2  
ATOM   2128  C CA   . ASP A 1 52 ? -7.300  -10.171 -1.823  1.00 0.07 ? 52  ASP A CA   2  
ATOM   2129  C C    . ASP A 1 52 ? -8.422  -9.230  -1.392  1.00 0.06 ? 52  ASP A C    2  
ATOM   2130  O O    . ASP A 1 52 ? -8.957  -8.457  -2.187  1.00 0.06 ? 52  ASP A O    2  
ATOM   2131  C CB   . ASP A 1 52 ? -7.737  -11.624 -1.632  1.00 0.07 ? 52  ASP A CB   2  
ATOM   2132  C CG   . ASP A 1 52 ? -7.315  -12.511 -2.787  1.00 0.08 ? 52  ASP A CG   2  
ATOM   2133  O OD1  . ASP A 1 52 ? -8.082  -13.432 -3.140  1.00 0.09 ? 52  ASP A OD1  2  
ATOM   2134  O OD2  . ASP A 1 52 ? -6.219  -12.283 -3.340  1.00 0.08 ? 52  ASP A OD2  2  
ATOM   2135  H H    . ASP A 1 52 ? -5.726  -10.597 -0.474  1.00 0.06 ? 52  ASP A H    2  
ATOM   2136  H HA   . ASP A 1 52 ? -7.086  -10.003 -2.867  1.00 0.07 ? 52  ASP A HA   2  
ATOM   2137  H HB2  . ASP A 1 52 ? -7.293  -12.011 -0.727  1.00 0.07 ? 52  ASP A HB2  2  
ATOM   2138  H HB3  . ASP A 1 52 ? -8.813  -11.662 -1.546  1.00 0.08 ? 52  ASP A HB3  2  
ATOM   2139  N N    . PRO A 1 53 ? -8.789  -9.297  -0.103  1.00 0.06 ? 53  PRO A N    2  
ATOM   2140  C CA   . PRO A 1 53 ? -9.850  -8.459  0.462   1.00 0.06 ? 53  PRO A CA   2  
ATOM   2141  C C    . PRO A 1 53 ? -9.445  -6.991  0.551   1.00 0.05 ? 53  PRO A C    2  
ATOM   2142  O O    . PRO A 1 53 ? -10.265 -6.131  0.871   1.00 0.06 ? 53  PRO A O    2  
ATOM   2143  C CB   . PRO A 1 53 ? -10.057 -9.044  1.861   1.00 0.06 ? 53  PRO A CB   2  
ATOM   2144  C CG   . PRO A 1 53 ? -8.755  -9.684  2.199   1.00 0.06 ? 53  PRO A CG   2  
ATOM   2145  C CD   . PRO A 1 53 ? -8.195  -10.195 0.901   1.00 0.06 ? 53  PRO A CD   2  
ATOM   2146  H HA   . PRO A 1 53 ? -10.765 -8.544  -0.107  1.00 0.07 ? 53  PRO A HA   2  
ATOM   2147  H HB2  . PRO A 1 53 ? -10.297 -8.252  2.560   1.00 0.06 ? 53  PRO A HB2  2  
ATOM   2148  H HB3  . PRO A 1 53 ? -10.842 -9.783  1.844   1.00 0.07 ? 53  PRO A HB3  2  
ATOM   2149  H HG2  . PRO A 1 53 ? -8.090  -8.952  2.637   1.00 0.06 ? 53  PRO A HG2  2  
ATOM   2150  H HG3  . PRO A 1 53 ? -8.914  -10.506 2.879   1.00 0.07 ? 53  PRO A HG3  2  
ATOM   2151  H HD2  . PRO A 1 53 ? -7.117  -10.120 0.897   1.00 0.06 ? 53  PRO A HD2  2  
ATOM   2152  H HD3  . PRO A 1 53 ? -8.505  -11.216 0.734   1.00 0.07 ? 53  PRO A HD3  2  
ATOM   2153  N N    . ILE A 1 54 ? -8.177  -6.715  0.267   1.00 0.05 ? 54  ILE A N    2  
ATOM   2154  C CA   . ILE A 1 54 ? -7.664  -5.352  0.316   1.00 0.05 ? 54  ILE A CA   2  
ATOM   2155  C C    . ILE A 1 54 ? -7.511  -4.772  -1.087  1.00 0.05 ? 54  ILE A C    2  
ATOM   2156  O O    . ILE A 1 54 ? -7.467  -3.554  -1.267  1.00 0.05 ? 54  ILE A O    2  
ATOM   2157  C CB   . ILE A 1 54 ? -6.305  -5.286  1.036   1.00 0.05 ? 54  ILE A CB   2  
ATOM   2158  C CG1  . ILE A 1 54 ? -6.447  -5.759  2.484   1.00 0.05 ? 54  ILE A CG1  2  
ATOM   2159  C CG2  . ILE A 1 54 ? -5.746  -3.872  0.985   1.00 0.05 ? 54  ILE A CG2  2  
ATOM   2160  C CD1  . ILE A 1 54 ? -5.123  -6.022  3.167   1.00 0.06 ? 54  ILE A CD1  2  
ATOM   2161  H H    . ILE A 1 54 ? -7.572  -7.446  0.020   1.00 0.05 ? 54  ILE A H    2  
ATOM   2162  H HA   . ILE A 1 54 ? -8.371  -4.750  0.868   1.00 0.05 ? 54  ILE A HA   2  
ATOM   2163  H HB   . ILE A 1 54 ? -5.616  -5.937  0.518   1.00 0.05 ? 54  ILE A HB   2  
ATOM   2164  H HG12 . ILE A 1 54 ? -6.967  -5.003  3.052   1.00 0.06 ? 54  ILE A HG12 2  
ATOM   2165  H HG13 . ILE A 1 54 ? -7.019  -6.675  2.502   1.00 0.05 ? 54  ILE A HG13 2  
ATOM   2166  H HG21 . ILE A 1 54 ? -4.859  -3.812  1.598   1.00 0.06 ? 54  ILE A HG21 2  
ATOM   2167  H HG22 . ILE A 1 54 ? -6.488  -3.182  1.355   1.00 0.05 ? 54  ILE A HG22 2  
ATOM   2168  H HG23 . ILE A 1 54 ? -5.497  -3.620  -0.035  1.00 0.06 ? 54  ILE A HG23 2  
ATOM   2169  H HD11 . ILE A 1 54 ? -5.302  -6.415  4.157   1.00 0.07 ? 54  ILE A HD11 2  
ATOM   2170  H HD12 . ILE A 1 54 ? -4.566  -5.100  3.240   1.00 0.07 ? 54  ILE A HD12 2  
ATOM   2171  H HD13 . ILE A 1 54 ? -4.558  -6.740  2.591   1.00 0.06 ? 54  ILE A HD13 2  
ATOM   2172  N N    . THR A 1 55 ? -7.435  -5.652  -2.081  1.00 0.06 ? 55  THR A N    2  
ATOM   2173  C CA   . THR A 1 55 ? -7.289  -5.229  -3.466  1.00 0.06 ? 55  THR A CA   2  
ATOM   2174  C C    . THR A 1 55 ? -8.647  -5.074  -4.141  1.00 0.07 ? 55  THR A C    2  
ATOM   2175  O O    . THR A 1 55 ? -8.855  -4.160  -4.939  1.00 0.08 ? 55  THR A O    2  
ATOM   2176  C CB   . THR A 1 55 ? -6.441  -6.230  -4.273  1.00 0.07 ? 55  THR A CB   2  
ATOM   2177  O OG1  . THR A 1 55 ? -5.092  -6.226  -3.796  1.00 0.07 ? 55  THR A OG1  2  
ATOM   2178  C CG2  . THR A 1 55 ? -6.461  -5.886  -5.756  1.00 0.08 ? 55  THR A CG2  2  
ATOM   2179  H H    . THR A 1 55 ? -7.475  -6.610  -1.876  1.00 0.06 ? 55  THR A H    2  
ATOM   2180  H HA   . THR A 1 55 ? -6.784  -4.274  -3.472  1.00 0.07 ? 55  THR A HA   2  
ATOM   2181  H HB   . THR A 1 55 ? -6.857  -7.219  -4.143  1.00 0.07 ? 55  THR A HB   2  
ATOM   2182  H HG1  . THR A 1 55 ? -4.501  -5.972  -4.508  1.00 0.08 ? 55  THR A HG1  2  
ATOM   2183  H HG21 . THR A 1 55 ? -7.478  -5.911  -6.117  1.00 0.09 ? 55  THR A HG21 2  
ATOM   2184  H HG22 . THR A 1 55 ? -5.868  -6.606  -6.301  1.00 0.09 ? 55  THR A HG22 2  
ATOM   2185  H HG23 . THR A 1 55 ? -6.051  -4.898  -5.902  1.00 0.08 ? 55  THR A HG23 2  
ATOM   2186  N N    . ALA A 1 56 ? -9.572  -5.971  -3.814  1.00 0.07 ? 56  ALA A N    2  
ATOM   2187  C CA   . ALA A 1 56 ? -10.912 -5.931  -4.385  1.00 0.08 ? 56  ALA A CA   2  
ATOM   2188  C C    . ALA A 1 56 ? -11.695 -4.728  -3.866  1.00 0.08 ? 56  ALA A C    2  
ATOM   2189  O O    . ALA A 1 56 ? -12.423 -4.080  -4.616  1.00 0.09 ? 56  ALA A O    2  
ATOM   2190  C CB   . ALA A 1 56 ? -11.657 -7.221  -4.074  1.00 0.08 ? 56  ALA A CB   2  
ATOM   2191  H H    . ALA A 1 56 ? -9.347  -6.678  -3.173  1.00 0.07 ? 56  ALA A H    2  
ATOM   2192  H HA   . ALA A 1 56 ? -10.814 -5.848  -5.457  1.00 0.09 ? 56  ALA A HA   2  
ATOM   2193  H HB1  . ALA A 1 56 ? -12.627 -7.200  -4.549  1.00 0.09 ? 56  ALA A HB1  2  
ATOM   2194  H HB2  . ALA A 1 56 ? -11.781 -7.316  -3.006  1.00 0.08 ? 56  ALA A HB2  2  
ATOM   2195  H HB3  . ALA A 1 56 ? -11.091 -8.062  -4.448  1.00 0.09 ? 56  ALA A HB3  2  
ATOM   2196  N N    . ALA A 1 57 ? -11.539 -4.437  -2.579  1.00 0.07 ? 57  ALA A N    2  
ATOM   2197  C CA   . ALA A 1 57 ? -12.229 -3.312  -1.961  1.00 0.07 ? 57  ALA A CA   2  
ATOM   2198  C C    . ALA A 1 57 ? -11.817 -1.994  -2.605  1.00 0.07 ? 57  ALA A C    2  
ATOM   2199  O O    . ALA A 1 57 ? -12.660 -1.237  -3.088  1.00 0.08 ? 57  ALA A O    2  
ATOM   2200  C CB   . ALA A 1 57 ? -11.952 -3.280  -0.465  1.00 0.06 ? 57  ALA A CB   2  
ATOM   2201  H H    . ALA A 1 57 ? -10.945 -4.993  -2.032  1.00 0.07 ? 57  ALA A H    2  
ATOM   2202  H HA   . ALA A 1 57 ? -13.290 -3.454  -2.103  1.00 0.08 ? 57  ALA A HA   2  
ATOM   2203  H HB1  . ALA A 1 57 ? -12.247 -4.221  -0.024  1.00 0.07 ? 57  ALA A HB1  2  
ATOM   2204  H HB2  . ALA A 1 57 ? -12.514 -2.478  -0.012  1.00 0.07 ? 57  ALA A HB2  2  
ATOM   2205  H HB3  . ALA A 1 57 ? -10.897 -3.120  -0.298  1.00 0.06 ? 57  ALA A HB3  2  
ATOM   2206  N N    . LEU A 1 58 ? -10.515 -1.724  -2.609  1.00 0.07 ? 58  LEU A N    2  
ATOM   2207  C CA   . LEU A 1 58 ? -9.991  -0.495  -3.194  1.00 0.08 ? 58  LEU A CA   2  
ATOM   2208  C C    . LEU A 1 58 ? -10.429 -0.355  -4.649  1.00 0.09 ? 58  LEU A C    2  
ATOM   2209  O O    . LEU A 1 58 ? -10.817 0.727   -5.089  1.00 0.09 ? 58  LEU A O    2  
ATOM   2210  C CB   . LEU A 1 58 ? -8.465  -0.475  -3.105  1.00 0.07 ? 58  LEU A CB   2  
ATOM   2211  C CG   . LEU A 1 58 ? -7.877  -0.263  -1.709  1.00 0.07 ? 58  LEU A CG   2  
ATOM   2212  C CD1  . LEU A 1 58 ? -6.409  -0.661  -1.682  1.00 0.07 ? 58  LEU A CD1  2  
ATOM   2213  C CD2  . LEU A 1 58 ? -8.048  1.184   -1.272  1.00 0.07 ? 58  LEU A CD2  2  
ATOM   2214  H H    . LEU A 1 58 ? -9.893  -2.366  -2.208  1.00 0.06 ? 58  LEU A H    2  
ATOM   2215  H HA   . LEU A 1 58 ? -10.387 0.336   -2.630  1.00 0.08 ? 58  LEU A HA   2  
ATOM   2216  H HB2  . LEU A 1 58 ? -8.094  -1.415  -3.486  1.00 0.07 ? 58  LEU A HB2  2  
ATOM   2217  H HB3  . LEU A 1 58 ? -8.102  0.316   -3.743  1.00 0.08 ? 58  LEU A HB3  2  
ATOM   2218  H HG   . LEU A 1 58 ? -8.404  -0.890  -1.006  1.00 0.06 ? 58  LEU A HG   2  
ATOM   2219  H HD11 . LEU A 1 58 ? -5.981  -0.394  -0.727  1.00 0.07 ? 58  LEU A HD11 2  
ATOM   2220  H HD12 . LEU A 1 58 ? -5.883  -0.146  -2.471  1.00 0.08 ? 58  LEU A HD12 2  
ATOM   2221  H HD13 . LEU A 1 58 ? -6.323  -1.728  -1.829  1.00 0.06 ? 58  LEU A HD13 2  
ATOM   2222  H HD21 . LEU A 1 58 ? -9.097  1.396   -1.129  1.00 0.07 ? 58  LEU A HD21 2  
ATOM   2223  H HD22 . LEU A 1 58 ? -7.650  1.839   -2.033  1.00 0.08 ? 58  LEU A HD22 2  
ATOM   2224  H HD23 . LEU A 1 58 ? -7.519  1.346   -0.344  1.00 0.07 ? 58  LEU A HD23 2  
ATOM   2225  N N    . SER A 1 59 ? -10.364 -1.457  -5.390  1.00 0.09 ? 59  SER A N    2  
ATOM   2226  C CA   . SER A 1 59 ? -10.752 -1.457  -6.796  1.00 0.10 ? 59  SER A CA   2  
ATOM   2227  C C    . SER A 1 59 ? -12.267 -1.361  -6.941  1.00 0.11 ? 59  SER A C    2  
ATOM   2228  O O    . SER A 1 59 ? -12.777 -0.978  -7.994  1.00 0.12 ? 59  SER A O    2  
ATOM   2229  C CB   . SER A 1 59 ? -10.240 -2.722  -7.488  1.00 0.10 ? 59  SER A CB   2  
ATOM   2230  O OG   . SER A 1 59 ? -10.854 -2.894  -8.754  1.00 0.12 ? 59  SER A OG   2  
ATOM   2231  H H    . SER A 1 59 ? -10.047 -2.290  -4.981  1.00 0.08 ? 59  SER A H    2  
ATOM   2232  H HA   . SER A 1 59 ? -10.303 -0.594  -7.264  1.00 0.11 ? 59  SER A HA   2  
ATOM   2233  H HB2  . SER A 1 59 ? -9.172  -2.648  -7.626  1.00 0.10 ? 59  SER A HB2  2  
ATOM   2234  H HB3  . SER A 1 59 ? -10.465 -3.582  -6.873  1.00 0.10 ? 59  SER A HB3  2  
ATOM   2235  H HG   . SER A 1 59 ? -10.183 -2.877  -9.440  1.00 0.12 ? 59  SER A HG   2  
ATOM   2236  N N    . GLN A 1 60 ? -12.981 -1.711  -5.875  1.00 0.10 ? 60  GLN A N    2  
ATOM   2237  C CA   . GLN A 1 60 ? -14.438 -1.665  -5.884  1.00 0.11 ? 60  GLN A CA   2  
ATOM   2238  C C    . GLN A 1 60 ? -14.940 -0.248  -5.630  1.00 0.11 ? 60  GLN A C    2  
ATOM   2239  O O    . GLN A 1 60 ? -15.878 0.216   -6.281  1.00 0.13 ? 60  GLN A O    2  
ATOM   2240  C CB   . GLN A 1 60 ? -15.006 -2.616  -4.831  1.00 0.11 ? 60  GLN A CB   2  
ATOM   2241  C CG   . GLN A 1 60 ? -16.523 -2.578  -4.729  1.00 0.12 ? 60  GLN A CG   2  
ATOM   2242  C CD   . GLN A 1 60 ? -17.046 -3.322  -3.516  1.00 0.12 ? 60  GLN A CD   2  
ATOM   2243  O OE1  . GLN A 1 60 ? -17.927 -4.175  -3.630  1.00 0.12 ? 60  GLN A OE1  2  
ATOM   2244  N NE2  . GLN A 1 60 ? -16.505 -3.004  -2.347  1.00 0.11 ? 60  GLN A NE2  2  
ATOM   2245  H H    . GLN A 1 60 ? -12.517 -2.008  -5.065  1.00 0.09 ? 60  GLN A H    2  
ATOM   2246  H HA   . GLN A 1 60 ? -14.773 -1.983  -6.860  1.00 0.12 ? 60  GLN A HA   2  
ATOM   2247  H HB2  . GLN A 1 60 ? -14.709 -3.625  -5.076  1.00 0.11 ? 60  GLN A HB2  2  
ATOM   2248  H HB3  . GLN A 1 60 ? -14.595 -2.354  -3.867  1.00 0.10 ? 60  GLN A HB3  2  
ATOM   2249  H HG2  . GLN A 1 60 ? -16.839 -1.548  -4.663  1.00 0.12 ? 60  GLN A HG2  2  
ATOM   2250  H HG3  . GLN A 1 60 ? -16.942 -3.026  -5.618  1.00 0.13 ? 60  GLN A HG3  2  
ATOM   2251  H HE21 . GLN A 1 60 ? -15.807 -2.316  -2.332  1.00 0.10 ? 60  GLN A HE21 2  
ATOM   2252  H HE22 . GLN A 1 60 ? -16.825 -3.470  -1.546  1.00 0.11 ? 60  GLN A HE22 2  
ATOM   2253  N N    . ARG A 1 61 ? -14.312 0.436   -4.679  1.00 0.11 ? 61  ARG A N    2  
ATOM   2254  C CA   . ARG A 1 61 ? -14.695 1.800   -4.339  1.00 0.11 ? 61  ARG A CA   2  
ATOM   2255  C C    . ARG A 1 61 ? -14.314 2.768   -5.454  1.00 0.12 ? 61  ARG A C    2  
ATOM   2256  O O    . ARG A 1 61 ? -15.012 3.750   -5.704  1.00 0.13 ? 61  ARG A O    2  
ATOM   2257  C CB   . ARG A 1 61 ? -14.029 2.227   -3.030  1.00 0.10 ? 61  ARG A CB   2  
ATOM   2258  C CG   . ARG A 1 61 ? -12.641 2.816   -3.215  1.00 0.10 ? 61  ARG A CG   2  
ATOM   2259  C CD   . ARG A 1 61 ? -12.000 3.166   -1.881  1.00 0.09 ? 61  ARG A CD   2  
ATOM   2260  N NE   . ARG A 1 61 ? -11.610 4.572   -1.813  1.00 0.10 ? 61  ARG A NE   2  
ATOM   2261  C CZ   . ARG A 1 61 ? -11.204 5.168   -0.697  1.00 0.09 ? 61  ARG A CZ   2  
ATOM   2262  N NH1  . ARG A 1 61 ? -11.135 4.484   0.436   1.00 0.09 ? 61  ARG A NH1  2  
ATOM   2263  N NH2  . ARG A 1 61 ? -10.867 6.450   -0.714  1.00 0.10 ? 61  ARG A NH2  2  
ATOM   2264  H H    . ARG A 1 61 ? -13.572 0.012   -4.195  1.00 0.10 ? 61  ARG A H    2  
ATOM   2265  H HA   . ARG A 1 61 ? -15.767 1.821   -4.210  1.00 0.12 ? 61  ARG A HA   2  
ATOM   2266  H HB2  . ARG A 1 61 ? -14.650 2.969   -2.549  1.00 0.10 ? 61  ARG A HB2  2  
ATOM   2267  H HB3  . ARG A 1 61 ? -13.948 1.366   -2.384  1.00 0.09 ? 61  ARG A HB3  2  
ATOM   2268  H HG2  . ARG A 1 61 ? -12.019 2.094   -3.724  1.00 0.09 ? 61  ARG A HG2  2  
ATOM   2269  H HG3  . ARG A 1 61 ? -12.718 3.712   -3.814  1.00 0.10 ? 61  ARG A HG3  2  
ATOM   2270  H HD2  . ARG A 1 61 ? -12.707 2.960   -1.092  1.00 0.09 ? 61  ARG A HD2  2  
ATOM   2271  H HD3  . ARG A 1 61 ? -11.122 2.551   -1.746  1.00 0.08 ? 61  ARG A HD3  2  
ATOM   2272  H HE   . ARG A 1 61 ? -11.653 5.096   -2.639  1.00 0.10 ? 61  ARG A HE   2  
ATOM   2273  H HH11 . ARG A 1 61 ? -10.830 4.934   1.275   1.00 0.09 ? 61  ARG A HH11 2  
ATOM   2274  H HH12 . ARG A 1 61 ? -11.390 3.517   0.454   1.00 0.08 ? 61  ARG A HH12 2  
ATOM   2275  H HH21 . ARG A 1 61 ? -10.918 6.969   -1.567  1.00 0.11 ? 61  ARG A HH21 2  
ATOM   2276  H HH22 . ARG A 1 61 ? -10.560 6.899   0.126   1.00 0.10 ? 61  ARG A HH22 2  
ATOM   2277  N N    . ALA A 1 62 ? -13.201 2.484   -6.123  1.00 0.12 ? 62  ALA A N    2  
ATOM   2278  C CA   . ALA A 1 62 ? -12.728 3.328   -7.214  1.00 0.13 ? 62  ALA A CA   2  
ATOM   2279  C C    . ALA A 1 62 ? -13.625 3.195   -8.439  1.00 0.14 ? 62  ALA A C    2  
ATOM   2280  O O    . ALA A 1 62 ? -13.991 4.190   -9.062  1.00 0.15 ? 62  ALA A O    2  
ATOM   2281  C CB   . ALA A 1 62 ? -11.291 2.975   -7.568  1.00 0.12 ? 62  ALA A CB   2  
ATOM   2282  H H    . ALA A 1 62 ? -12.686 1.687   -5.878  1.00 0.11 ? 62  ALA A H    2  
ATOM   2283  H HA   . ALA A 1 62 ? -12.749 4.353   -6.874  1.00 0.13 ? 62  ALA A HA   2  
ATOM   2284  H HB1  . ALA A 1 62 ? -11.245 1.952   -7.909  1.00 0.12 ? 62  ALA A HB1  2  
ATOM   2285  H HB2  . ALA A 1 62 ? -10.666 3.092   -6.695  1.00 0.11 ? 62  ALA A HB2  2  
ATOM   2286  H HB3  . ALA A 1 62 ? -10.942 3.631   -8.351  1.00 0.13 ? 62  ALA A HB3  2  
ATOM   2287  N N    . MET A 1 63 ? -13.974 1.958   -8.780  1.00 0.14 ? 63  MET A N    2  
ATOM   2288  C CA   . MET A 1 63 ? -14.828 1.696   -9.932  1.00 0.15 ? 63  MET A CA   2  
ATOM   2289  C C    . MET A 1 63 ? -16.248 2.195   -9.681  1.00 0.16 ? 63  MET A C    2  
ATOM   2290  O O    . MET A 1 63 ? -16.933 2.637   -10.603 1.00 0.17 ? 63  MET A O    2  
ATOM   2291  C CB   . MET A 1 63 ? -14.850 0.200   -10.247 1.00 0.15 ? 63  MET A CB   2  
ATOM   2292  C CG   . MET A 1 63 ? -15.637 -0.623  -9.241  1.00 0.15 ? 63  MET A CG   2  
ATOM   2293  S SD   . MET A 1 63 ? -15.804 -2.350  -9.734  1.00 0.15 ? 63  MET A SD   2  
ATOM   2294  C CE   . MET A 1 63 ? -14.088 -2.862  -9.754  1.00 0.14 ? 63  MET A CE   2  
ATOM   2295  H H    . MET A 1 63 ? -13.649 1.204   -8.244  1.00 0.13 ? 63  MET A H    2  
ATOM   2296  H HA   . MET A 1 63 ? -14.417 2.227   -10.778 1.00 0.16 ? 63  MET A HA   2  
ATOM   2297  H HB2  . MET A 1 63 ? -15.292 0.055   -11.222 1.00 0.16 ? 63  MET A HB2  2  
ATOM   2298  H HB3  . MET A 1 63 ? -13.834 -0.167  -10.264 1.00 0.15 ? 63  MET A HB3  2  
ATOM   2299  H HG2  . MET A 1 63 ? -15.131 -0.582  -8.289  1.00 0.14 ? 63  MET A HG2  2  
ATOM   2300  H HG3  . MET A 1 63 ? -16.623 -0.195  -9.143  1.00 0.15 ? 63  MET A HG3  2  
ATOM   2301  H HE1  . MET A 1 63 ? -13.569 -2.352  -10.552 1.00 0.15 ? 63  MET A HE1  2  
ATOM   2302  H HE2  . MET A 1 63 ? -14.033 -3.929  -9.914  1.00 0.14 ? 63  MET A HE2  2  
ATOM   2303  H HE3  . MET A 1 63 ? -13.627 -2.615  -8.809  1.00 0.13 ? 63  MET A HE3  2  
ATOM   2304  N N    . ILE A 1 64 ? -16.682 2.122   -8.427  1.00 0.15 ? 64  ILE A N    2  
ATOM   2305  C CA   . ILE A 1 64 ? -18.020 2.567   -8.055  1.00 0.16 ? 64  ILE A CA   2  
ATOM   2306  C C    . ILE A 1 64 ? -18.039 4.062   -7.758  1.00 0.16 ? 64  ILE A C    2  
ATOM   2307  O O    . ILE A 1 64 ? -18.525 4.860   -8.560  1.00 0.17 ? 64  ILE A O    2  
ATOM   2308  C CB   . ILE A 1 64 ? -18.546 1.804   -6.826  1.00 0.15 ? 64  ILE A CB   2  
ATOM   2309  C CG1  . ILE A 1 64 ? -18.703 0.317   -7.150  1.00 0.15 ? 64  ILE A CG1  2  
ATOM   2310  C CG2  . ILE A 1 64 ? -19.870 2.392   -6.364  1.00 0.16 ? 64  ILE A CG2  2  
ATOM   2311  C CD1  . ILE A 1 64 ? -19.115 -0.521  -5.961  1.00 0.15 ? 64  ILE A CD1  2  
ATOM   2312  H H    . ILE A 1 64 ? -16.088 1.761   -7.736  1.00 0.14 ? 64  ILE A H    2  
ATOM   2313  H HA   . ILE A 1 64 ? -18.680 2.367   -8.887  1.00 0.17 ? 64  ILE A HA   2  
ATOM   2314  H HB   . ILE A 1 64 ? -17.830 1.917   -6.025  1.00 0.14 ? 64  ILE A HB   2  
ATOM   2315  H HG12 . ILE A 1 64 ? -19.456 0.199   -7.915  1.00 0.16 ? 64  ILE A HG12 2  
ATOM   2316  H HG13 . ILE A 1 64 ? -17.762 -0.066  -7.515  1.00 0.15 ? 64  ILE A HG13 2  
ATOM   2317  H HG21 . ILE A 1 64 ? -20.210 1.866   -5.484  1.00 0.15 ? 64  ILE A HG21 2  
ATOM   2318  H HG22 . ILE A 1 64 ? -20.603 2.289   -7.150  1.00 0.17 ? 64  ILE A HG22 2  
ATOM   2319  H HG23 . ILE A 1 64 ? -19.737 3.438   -6.130  1.00 0.16 ? 64  ILE A HG23 2  
ATOM   2320  H HD11 . ILE A 1 64 ? -20.133 -0.285  -5.690  1.00 0.15 ? 64  ILE A HD11 2  
ATOM   2321  H HD12 . ILE A 1 64 ? -18.462 -0.308  -5.128  1.00 0.14 ? 64  ILE A HD12 2  
ATOM   2322  H HD13 . ILE A 1 64 ? -19.044 -1.568  -6.216  1.00 0.15 ? 64  ILE A HD13 2  
ATOM   2323  N N    . LEU A 1 65 ? -17.505 4.436   -6.600  1.00 0.15 ? 65  LEU A N    2  
ATOM   2324  C CA   . LEU A 1 65 ? -17.457 5.837   -6.195  1.00 0.15 ? 65  LEU A CA   2  
ATOM   2325  C C    . LEU A 1 65 ? -16.849 6.701   -7.295  1.00 0.16 ? 65  LEU A C    2  
ATOM   2326  O O    . LEU A 1 65 ? -17.293 7.823   -7.535  1.00 0.16 ? 65  LEU A O    2  
ATOM   2327  C CB   . LEU A 1 65 ? -16.650 5.988   -4.905  1.00 0.14 ? 65  LEU A CB   2  
ATOM   2328  C CG   . LEU A 1 65 ? -17.273 6.872   -3.822  1.00 0.14 ? 65  LEU A CG   2  
ATOM   2329  C CD1  . LEU A 1 65 ? -18.183 6.050   -2.923  1.00 0.14 ? 65  LEU A CD1  2  
ATOM   2330  C CD2  . LEU A 1 65 ? -16.188 7.557   -3.005  1.00 0.13 ? 65  LEU A CD2  2  
ATOM   2331  H H    . LEU A 1 65 ? -17.131 3.753   -6.004  1.00 0.14 ? 65  LEU A H    2  
ATOM   2332  H HA   . LEU A 1 65 ? -18.470 6.164   -6.016  1.00 0.16 ? 65  LEU A HA   2  
ATOM   2333  H HB2  . LEU A 1 65 ? -16.498 5.004   -4.487  1.00 0.13 ? 65  LEU A HB2  2  
ATOM   2334  H HB3  . LEU A 1 65 ? -15.685 6.401   -5.160  1.00 0.14 ? 65  LEU A HB3  2  
ATOM   2335  H HG   . LEU A 1 65 ? -17.872 7.637   -4.293  1.00 0.15 ? 65  LEU A HG   2  
ATOM   2336  H HD11 . LEU A 1 65 ? -17.600 5.298   -2.412  1.00 0.13 ? 65  LEU A HD11 2  
ATOM   2337  H HD12 . LEU A 1 65 ? -18.943 5.570   -3.523  1.00 0.14 ? 65  LEU A HD12 2  
ATOM   2338  H HD13 . LEU A 1 65 ? -18.652 6.698   -2.198  1.00 0.14 ? 65  LEU A HD13 2  
ATOM   2339  H HD21 . LEU A 1 65 ? -15.663 8.266   -3.627  1.00 0.14 ? 65  LEU A HD21 2  
ATOM   2340  H HD22 . LEU A 1 65 ? -15.492 6.817   -2.637  1.00 0.13 ? 65  LEU A HD22 2  
ATOM   2341  H HD23 . LEU A 1 65 ? -16.638 8.073   -2.170  1.00 0.14 ? 65  LEU A HD23 2  
ATOM   2342  N N    . GLY A 1 66 ? -15.830 6.168   -7.963  1.00 0.15 ? 66  GLY A N    2  
ATOM   2343  C CA   . GLY A 1 66 ? -15.179 6.905   -9.031  1.00 0.16 ? 66  GLY A CA   2  
ATOM   2344  C C    . GLY A 1 66 ? -13.961 7.667   -8.551  1.00 0.16 ? 66  GLY A C    2  
ATOM   2345  O O    . GLY A 1 66 ? -13.758 8.824   -8.920  1.00 0.16 ? 66  GLY A O    2  
ATOM   2346  H H    . GLY A 1 66 ? -15.520 5.268   -7.731  1.00 0.15 ? 66  GLY A H    2  
ATOM   2347  H HA2  . GLY A 1 66 ? -14.874 6.209   -9.799  1.00 0.16 ? 66  GLY A HA2  2  
ATOM   2348  H HA3  . GLY A 1 66 ? -15.884 7.605   -9.453  1.00 0.17 ? 66  GLY A HA3  2  
ATOM   2349  N N    . LYS A 1 67 ? -13.147 7.019   -7.723  1.00 0.15 ? 67  LYS A N    2  
ATOM   2350  C CA   . LYS A 1 67 ? -11.942 7.643   -7.190  1.00 0.14 ? 67  LYS A CA   2  
ATOM   2351  C C    . LYS A 1 67 ? -10.977 6.591   -6.652  1.00 0.13 ? 67  LYS A C    2  
ATOM   2352  O O    . LYS A 1 67 ? -11.331 5.797   -5.782  1.00 0.12 ? 67  LYS A O    2  
ATOM   2353  C CB   . LYS A 1 67 ? -12.304 8.632   -6.079  1.00 0.14 ? 67  LYS A CB   2  
ATOM   2354  C CG   . LYS A 1 67 ? -13.004 7.988   -4.895  1.00 0.13 ? 67  LYS A CG   2  
ATOM   2355  C CD   . LYS A 1 67 ? -12.050 7.782   -3.730  1.00 0.12 ? 67  LYS A CD   2  
ATOM   2356  C CE   . LYS A 1 67 ? -12.114 8.940   -2.745  1.00 0.13 ? 67  LYS A CE   2  
ATOM   2357  N NZ   . LYS A 1 67 ? -11.952 10.255  -3.426  1.00 0.14 ? 67  LYS A NZ   2  
ATOM   2358  H H    . LYS A 1 67 ? -13.362 6.098   -7.466  1.00 0.14 ? 67  LYS A H    2  
ATOM   2359  H HA   . LYS A 1 67 ? -11.462 8.178   -7.995  1.00 0.15 ? 67  LYS A HA   2  
ATOM   2360  H HB2  . LYS A 1 67 ? -11.400 9.104   -5.724  1.00 0.14 ? 67  LYS A HB2  2  
ATOM   2361  H HB3  . LYS A 1 67 ? -12.957 9.390   -6.488  1.00 0.15 ? 67  LYS A HB3  2  
ATOM   2362  H HG2  . LYS A 1 67 ? -13.813 8.628   -4.576  1.00 0.14 ? 67  LYS A HG2  2  
ATOM   2363  H HG3  . LYS A 1 67 ? -13.398 7.030   -5.201  1.00 0.13 ? 67  LYS A HG3  2  
ATOM   2364  H HD2  . LYS A 1 67 ? -12.318 6.871   -3.216  1.00 0.12 ? 67  LYS A HD2  2  
ATOM   2365  H HD3  . LYS A 1 67 ? -11.043 7.700   -4.111  1.00 0.12 ? 67  LYS A HD3  2  
ATOM   2366  H HE2  . LYS A 1 67 ? -13.071 8.919   -2.245  1.00 0.13 ? 67  LYS A HE2  2  
ATOM   2367  H HE3  . LYS A 1 67 ? -11.325 8.821   -2.017  1.00 0.12 ? 67  LYS A HE3  2  
ATOM   2368  H HZ1  . LYS A 1 67 ? -12.703 10.386  -4.134  1.00 0.14 ? 67  LYS A HZ1  2  
ATOM   2369  H HZ2  . LYS A 1 67 ? -11.029 10.299  -3.904  1.00 0.14 ? 67  LYS A HZ2  2  
ATOM   2370  H HZ3  . LYS A 1 67 ? -12.006 11.027  -2.731  1.00 0.14 ? 67  LYS A HZ3  2  
ATOM   2371  N N    . SER A 1 68 ? -9.756  6.593   -7.178  1.00 0.13 ? 68  SER A N    2  
ATOM   2372  C CA   . SER A 1 68 ? -8.740  5.636   -6.753  1.00 0.13 ? 68  SER A CA   2  
ATOM   2373  C C    . SER A 1 68 ? -7.609  6.340   -6.011  1.00 0.13 ? 68  SER A C    2  
ATOM   2374  O O    . SER A 1 68 ? -6.434  6.031   -6.206  1.00 0.13 ? 68  SER A O    2  
ATOM   2375  C CB   . SER A 1 68 ? -8.182  4.883   -7.962  1.00 0.13 ? 68  SER A CB   2  
ATOM   2376  O OG   . SER A 1 68 ? -8.043  5.743   -9.079  1.00 0.14 ? 68  SER A OG   2  
ATOM   2377  H H    . SER A 1 68 ? -9.533  7.252   -7.869  1.00 0.14 ? 68  SER A H    2  
ATOM   2378  H HA   . SER A 1 68 ? -9.209  4.930   -6.084  1.00 0.12 ? 68  SER A HA   2  
ATOM   2379  H HB2  . SER A 1 68 ? -7.212  4.479   -7.714  1.00 0.13 ? 68  SER A HB2  2  
ATOM   2380  H HB3  . SER A 1 68 ? -8.851  4.077   -8.223  1.00 0.13 ? 68  SER A HB3  2  
ATOM   2381  H HG   . SER A 1 68 ? -8.281  5.269   -9.880  1.00 0.15 ? 68  SER A HG   2  
ATOM   2382  N N    . GLY A 1 69 ? -7.972  7.290   -5.154  1.00 0.13 ? 69  GLY A N    2  
ATOM   2383  C CA   . GLY A 1 69 ? -6.976  8.025   -4.394  1.00 0.13 ? 69  GLY A CA   2  
ATOM   2384  C C    . GLY A 1 69 ? -6.119  7.118   -3.535  1.00 0.12 ? 69  GLY A C    2  
ATOM   2385  O O    . GLY A 1 69 ? -4.999  7.474   -3.173  1.00 0.13 ? 69  GLY A O    2  
ATOM   2386  H H    . GLY A 1 69 ? -8.922  7.494   -5.038  1.00 0.13 ? 69  GLY A H    2  
ATOM   2387  H HA2  . GLY A 1 69 ? -6.338  8.561   -5.081  1.00 0.14 ? 69  GLY A HA2  2  
ATOM   2388  H HA3  . GLY A 1 69 ? -7.479  8.736   -3.757  1.00 0.13 ? 69  GLY A HA3  2  
ATOM   2389  N N    . GLU A 1 70 ? -6.647  5.943   -3.206  1.00 0.11 ? 70  GLU A N    2  
ATOM   2390  C CA   . GLU A 1 70 ? -5.922  4.984   -2.380  1.00 0.10 ? 70  GLU A CA   2  
ATOM   2391  C C    . GLU A 1 70 ? -5.433  3.806   -3.218  1.00 0.10 ? 70  GLU A C    2  
ATOM   2392  O O    . GLU A 1 70 ? -4.453  3.146   -2.869  1.00 0.10 ? 70  GLU A O    2  
ATOM   2393  C CB   . GLU A 1 70 ? -6.813  4.481   -1.242  1.00 0.09 ? 70  GLU A CB   2  
ATOM   2394  C CG   . GLU A 1 70 ? -6.575  5.194   0.078   1.00 0.10 ? 70  GLU A CG   2  
ATOM   2395  C CD   . GLU A 1 70 ? -7.289  6.528   0.158   1.00 0.10 ? 70  GLU A CD   2  
ATOM   2396  O OE1  . GLU A 1 70 ? -7.332  7.113   1.261   1.00 0.11 ? 70  GLU A OE1  2  
ATOM   2397  O OE2  . GLU A 1 70 ? -7.805  6.988   -0.881  1.00 0.11 ? 70  GLU A OE2  2  
ATOM   2398  H H    . GLU A 1 70 ? -7.545  5.717   -3.523  1.00 0.11 ? 70  GLU A H    2  
ATOM   2399  H HA   . GLU A 1 70 ? -5.067  5.490   -1.959  1.00 0.11 ? 70  GLU A HA   2  
ATOM   2400  H HB2  . GLU A 1 70 ? -7.847  4.620   -1.521  1.00 0.09 ? 70  GLU A HB2  2  
ATOM   2401  H HB3  . GLU A 1 70 ? -6.628  3.427   -1.096  1.00 0.09 ? 70  GLU A HB3  2  
ATOM   2402  H HG2  . GLU A 1 70 ? -6.929  4.565   0.881   1.00 0.09 ? 70  GLU A HG2  2  
ATOM   2403  H HG3  . GLU A 1 70 ? -5.515  5.362   0.194   1.00 0.10 ? 70  GLU A HG3  2  
ATOM   2404  N N    . LEU A 1 71 ? -6.124  3.547   -4.322  1.00 0.10 ? 71  LEU A N    2  
ATOM   2405  C CA   . LEU A 1 71 ? -5.760  2.448   -5.211  1.00 0.10 ? 71  LEU A CA   2  
ATOM   2406  C C    . LEU A 1 71 ? -4.378  2.669   -5.815  1.00 0.11 ? 71  LEU A C    2  
ATOM   2407  O O    . LEU A 1 71 ? -3.531  1.775   -5.798  1.00 0.11 ? 71  LEU A O    2  
ATOM   2408  C CB   . LEU A 1 71 ? -6.799  2.302   -6.325  1.00 0.11 ? 71  LEU A CB   2  
ATOM   2409  C CG   . LEU A 1 71 ? -7.340  0.891   -6.560  1.00 0.10 ? 71  LEU A CG   2  
ATOM   2410  C CD1  . LEU A 1 71 ? -8.217  0.855   -7.801  1.00 0.11 ? 71  LEU A CD1  2  
ATOM   2411  C CD2  . LEU A 1 71 ? -6.194  -0.104  -6.683  1.00 0.10 ? 71  LEU A CD2  2  
ATOM   2412  H H    . LEU A 1 71 ? -6.895  4.108   -4.547  1.00 0.11 ? 71  LEU A H    2  
ATOM   2413  H HA   . LEU A 1 71 ? -5.744  1.542   -4.625  1.00 0.10 ? 71  LEU A HA   2  
ATOM   2414  H HB2  . LEU A 1 71 ? -7.633  2.947   -6.092  1.00 0.11 ? 71  LEU A HB2  2  
ATOM   2415  H HB3  . LEU A 1 71 ? -6.351  2.646   -7.246  1.00 0.12 ? 71  LEU A HB3  2  
ATOM   2416  H HG   . LEU A 1 71 ? -7.947  0.600   -5.716  1.00 0.10 ? 71  LEU A HG   2  
ATOM   2417  H HD11 . LEU A 1 71 ? -9.120  1.418   -7.620  1.00 0.11 ? 71  LEU A HD11 2  
ATOM   2418  H HD12 . LEU A 1 71 ? -8.470  -0.168  -8.034  1.00 0.11 ? 71  LEU A HD12 2  
ATOM   2419  H HD13 . LEU A 1 71 ? -7.682  1.291   -8.632  1.00 0.12 ? 71  LEU A HD13 2  
ATOM   2420  H HD21 . LEU A 1 71 ? -5.519  0.219   -7.462  1.00 0.11 ? 71  LEU A HD21 2  
ATOM   2421  H HD22 . LEU A 1 71 ? -6.589  -1.078  -6.931  1.00 0.10 ? 71  LEU A HD22 2  
ATOM   2422  H HD23 . LEU A 1 71 ? -5.662  -0.160  -5.746  1.00 0.10 ? 71  LEU A HD23 2  
ATOM   2423  N N    . LYS A 1 72 ? -4.154  3.865   -6.344  1.00 0.12 ? 72  LYS A N    2  
ATOM   2424  C CA   . LYS A 1 72 ? -2.873  4.207   -6.951  1.00 0.13 ? 72  LYS A CA   2  
ATOM   2425  C C    . LYS A 1 72 ? -1.722  3.897   -5.999  1.00 0.13 ? 72  LYS A C    2  
ATOM   2426  O O    . LYS A 1 72 ? -0.613  3.579   -6.433  1.00 0.14 ? 72  LYS A O    2  
ATOM   2427  C CB   . LYS A 1 72 ? -2.846  5.688   -7.335  1.00 0.14 ? 72  LYS A CB   2  
ATOM   2428  C CG   . LYS A 1 72 ? -3.662  6.011   -8.574  1.00 0.15 ? 72  LYS A CG   2  
ATOM   2429  C CD   . LYS A 1 72 ? -2.777  6.460   -9.725  1.00 0.16 ? 72  LYS A CD   2  
ATOM   2430  C CE   . LYS A 1 72 ? -2.161  7.825   -9.454  1.00 0.17 ? 72  LYS A CE   2  
ATOM   2431  N NZ   . LYS A 1 72 ? -2.420  8.781   -10.564 1.00 0.18 ? 72  LYS A NZ   2  
ATOM   2432  H H    . LYS A 1 72 ? -4.868  4.537   -6.326  1.00 0.12 ? 72  LYS A H    2  
ATOM   2433  H HA   . LYS A 1 72 ? -2.758  3.611   -7.843  1.00 0.14 ? 72  LYS A HA   2  
ATOM   2434  H HB2  . LYS A 1 72 ? -3.236  6.268   -6.511  1.00 0.14 ? 72  LYS A HB2  2  
ATOM   2435  H HB3  . LYS A 1 72 ? -1.822  5.982   -7.517  1.00 0.15 ? 72  LYS A HB3  2  
ATOM   2436  H HG2  . LYS A 1 72 ? -4.206  5.128   -8.876  1.00 0.15 ? 72  LYS A HG2  2  
ATOM   2437  H HG3  . LYS A 1 72 ? -4.360  6.802   -8.338  1.00 0.15 ? 72  LYS A HG3  2  
ATOM   2438  H HD2  . LYS A 1 72 ? -1.985  5.739   -9.860  1.00 0.17 ? 72  LYS A HD2  2  
ATOM   2439  H HD3  . LYS A 1 72 ? -3.373  6.516   -10.624 1.00 0.17 ? 72  LYS A HD3  2  
ATOM   2440  H HE2  . LYS A 1 72 ? -2.583  8.222   -8.543  1.00 0.17 ? 72  LYS A HE2  2  
ATOM   2441  H HE3  . LYS A 1 72 ? -1.094  7.707   -9.333  1.00 0.18 ? 72  LYS A HE3  2  
ATOM   2442  H HZ1  . LYS A 1 72 ? -3.444  8.912   -10.691 1.00 0.18 ? 72  LYS A HZ1  2  
ATOM   2443  H HZ2  . LYS A 1 72 ? -2.017  8.418   -11.451 1.00 0.19 ? 72  LYS A HZ2  2  
ATOM   2444  H HZ3  . LYS A 1 72 ? -1.987  9.702   -10.350 1.00 0.19 ? 72  LYS A HZ3  2  
ATOM   2445  N N    . THR A 1 73 ? -1.990  3.990   -4.701  1.00 0.13 ? 73  THR A N    2  
ATOM   2446  C CA   . THR A 1 73 ? -0.977  3.719   -3.689  1.00 0.13 ? 73  THR A CA   2  
ATOM   2447  C C    . THR A 1 73 ? -0.856  2.224   -3.420  1.00 0.12 ? 73  THR A C    2  
ATOM   2448  O O    . THR A 1 73 ? 0.247   1.688   -3.322  1.00 0.12 ? 73  THR A O    2  
ATOM   2449  C CB   . THR A 1 73 ? -1.294  4.444   -2.368  1.00 0.12 ? 73  THR A CB   2  
ATOM   2450  O OG1  . THR A 1 73 ? -1.853  5.734   -2.639  1.00 0.13 ? 73  THR A OG1  2  
ATOM   2451  C CG2  . THR A 1 73 ? -0.041  4.595   -1.520  1.00 0.13 ? 73  THR A CG2  2  
ATOM   2452  H H    . THR A 1 73 ? -2.891  4.249   -4.417  1.00 0.12 ? 73  THR A H    2  
ATOM   2453  H HA   . THR A 1 73 ? -0.030  4.085   -4.059  1.00 0.14 ? 73  THR A HA   2  
ATOM   2454  H HB   . THR A 1 73 ? -2.015  3.856   -1.816  1.00 0.12 ? 73  THR A HB   2  
ATOM   2455  H HG1  . THR A 1 73 ? -1.237  6.245   -3.172  1.00 0.15 ? 73  THR A HG1  2  
ATOM   2456  H HG21 . THR A 1 73 ? 0.725   5.095   -2.095  1.00 0.14 ? 73  THR A HG21 2  
ATOM   2457  H HG22 . THR A 1 73 ? 0.312   3.619   -1.221  1.00 0.13 ? 73  THR A HG22 2  
ATOM   2458  H HG23 . THR A 1 73 ? -0.270  5.180   -0.642  1.00 0.13 ? 73  THR A HG23 2  
ATOM   2459  N N    . TRP A 1 74 ? -1.997  1.555   -3.301  1.00 0.11 ? 74  TRP A N    2  
ATOM   2460  C CA   . TRP A 1 74 ? -2.019  0.119   -3.043  1.00 0.10 ? 74  TRP A CA   2  
ATOM   2461  C C    . TRP A 1 74 ? -1.317  -0.645  -4.159  1.00 0.11 ? 74  TRP A C    2  
ATOM   2462  O O    . TRP A 1 74 ? -0.423  -1.451  -3.905  1.00 0.11 ? 74  TRP A O    2  
ATOM   2463  C CB   . TRP A 1 74 ? -3.460  -0.373  -2.899  1.00 0.09 ? 74  TRP A CB   2  
ATOM   2464  C CG   . TRP A 1 74 ? -3.558  -1.823  -2.532  1.00 0.08 ? 74  TRP A CG   2  
ATOM   2465  C CD1  . TRP A 1 74 ? -4.300  -2.779  -3.167  1.00 0.08 ? 74  TRP A CD1  2  
ATOM   2466  C CD2  . TRP A 1 74 ? -2.897  -2.479  -1.448  1.00 0.08 ? 74  TRP A CD2  2  
ATOM   2467  N NE1  . TRP A 1 74 ? -4.138  -3.991  -2.541  1.00 0.07 ? 74  TRP A NE1  2  
ATOM   2468  C CE2  . TRP A 1 74 ? -3.281  -3.835  -1.483  1.00 0.07 ? 74  TRP A CE2  2  
ATOM   2469  C CE3  . TRP A 1 74 ? -2.014  -2.056  -0.449  1.00 0.08 ? 74  TRP A CE3  2  
ATOM   2470  C CZ2  . TRP A 1 74 ? -2.815  -4.766  -0.559  1.00 0.07 ? 74  TRP A CZ2  2  
ATOM   2471  C CZ3  . TRP A 1 74 ? -1.552  -2.981  0.467   1.00 0.08 ? 74  TRP A CZ3  2  
ATOM   2472  C CH2  . TRP A 1 74 ? -1.951  -4.322  0.407   1.00 0.08 ? 74  TRP A CH2  2  
ATOM   2473  H H    . TRP A 1 74 ? -2.846  2.038   -3.388  1.00 0.10 ? 74  TRP A H    2  
ATOM   2474  H HA   . TRP A 1 74 ? -1.493  -0.058  -2.117  1.00 0.10 ? 74  TRP A HA   2  
ATOM   2475  H HB2  . TRP A 1 74 ? -3.951  0.200   -2.127  1.00 0.08 ? 74  TRP A HB2  2  
ATOM   2476  H HB3  . TRP A 1 74 ? -3.978  -0.227  -3.835  1.00 0.09 ? 74  TRP A HB3  2  
ATOM   2477  H HD1  . TRP A 1 74 ? -4.919  -2.595  -4.032  1.00 0.08 ? 74  TRP A HD1  2  
ATOM   2478  H HE1  . TRP A 1 74 ? -4.566  -4.832  -2.808  1.00 0.07 ? 74  TRP A HE1  2  
ATOM   2479  H HE3  . TRP A 1 74 ? -1.695  -1.027  -0.385  1.00 0.09 ? 74  TRP A HE3  2  
ATOM   2480  H HZ2  . TRP A 1 74 ? -3.113  -5.803  -0.592  1.00 0.07 ? 74  TRP A HZ2  2  
ATOM   2481  H HZ3  . TRP A 1 74 ? -0.871  -2.672  1.245   1.00 0.09 ? 74  TRP A HZ3  2  
ATOM   2482  H HH2  . TRP A 1 74 ? -1.565  -5.010  1.145   1.00 0.08 ? 74  TRP A HH2  2  
ATOM   2483  N N    . GLY A 1 75 ? -1.727  -0.386  -5.397  1.00 0.11 ? 75  GLY A N    2  
ATOM   2484  C CA   . GLY A 1 75 ? -1.126  -1.059  -6.534  1.00 0.12 ? 75  GLY A CA   2  
ATOM   2485  C C    . GLY A 1 75 ? 0.388   -0.969  -6.528  1.00 0.13 ? 75  GLY A C    2  
ATOM   2486  O O    . GLY A 1 75 ? 1.076   -1.947  -6.817  1.00 0.13 ? 75  GLY A O    2  
ATOM   2487  H H    . GLY A 1 75 ? -2.442  0.269   -5.539  1.00 0.11 ? 75  GLY A H    2  
ATOM   2488  H HA2  . GLY A 1 75 ? -1.413  -2.100  -6.515  1.00 0.11 ? 75  GLY A HA2  2  
ATOM   2489  H HA3  . GLY A 1 75 ? -1.499  -0.610  -7.443  1.00 0.12 ? 75  GLY A HA3  2  
ATOM   2490  N N    . LEU A 1 76 ? 0.906   0.210   -6.199  1.00 0.13 ? 76  LEU A N    2  
ATOM   2491  C CA   . LEU A 1 76 ? 2.349   0.425   -6.159  1.00 0.14 ? 76  LEU A CA   2  
ATOM   2492  C C    . LEU A 1 76 ? 2.981   -0.344  -5.003  1.00 0.14 ? 76  LEU A C    2  
ATOM   2493  O O    . LEU A 1 76 ? 3.885   -1.153  -5.204  1.00 0.15 ? 76  LEU A O    2  
ATOM   2494  C CB   . LEU A 1 76 ? 2.657   1.918   -6.022  1.00 0.15 ? 76  LEU A CB   2  
ATOM   2495  C CG   . LEU A 1 76 ? 2.899   2.675   -7.328  1.00 0.16 ? 76  LEU A CG   2  
ATOM   2496  C CD1  . LEU A 1 76 ? 2.436   4.119   -7.202  1.00 0.17 ? 76  LEU A CD1  2  
ATOM   2497  C CD2  . LEU A 1 76 ? 4.371   2.616   -7.712  1.00 0.18 ? 76  LEU A CD2  2  
ATOM   2498  H H    . LEU A 1 76 ? 0.306   0.952   -5.977  1.00 0.13 ? 76  LEU A H    2  
ATOM   2499  H HA   . LEU A 1 76 ? 2.764   0.064   -7.087  1.00 0.15 ? 76  LEU A HA   2  
ATOM   2500  H HB2  . LEU A 1 76 ? 1.828   2.386   -5.512  1.00 0.15 ? 76  LEU A HB2  2  
ATOM   2501  H HB3  . LEU A 1 76 ? 3.537   2.022   -5.406  1.00 0.16 ? 76  LEU A HB3  2  
ATOM   2502  H HG   . LEU A 1 76 ? 2.328   2.210   -8.118  1.00 0.16 ? 76  LEU A HG   2  
ATOM   2503  H HD11 . LEU A 1 76 ? 1.375   4.141   -7.001  1.00 0.16 ? 76  LEU A HD11 2  
ATOM   2504  H HD12 . LEU A 1 76 ? 2.639   4.644   -8.124  1.00 0.18 ? 76  LEU A HD12 2  
ATOM   2505  H HD13 . LEU A 1 76 ? 2.966   4.597   -6.391  1.00 0.17 ? 76  LEU A HD13 2  
ATOM   2506  H HD21 . LEU A 1 76 ? 4.901   3.424   -7.232  1.00 0.17 ? 76  LEU A HD21 2  
ATOM   2507  H HD22 . LEU A 1 76 ? 4.467   2.710   -8.784  1.00 0.22 ? 76  LEU A HD22 2  
ATOM   2508  H HD23 . LEU A 1 76 ? 4.788   1.672   -7.395  1.00 0.25 ? 76  LEU A HD23 2  
ATOM   2509  N N    . VAL A 1 77 ? 2.497   -0.087  -3.792  1.00 0.14 ? 77  VAL A N    2  
ATOM   2510  C CA   . VAL A 1 77 ? 3.014   -0.758  -2.604  1.00 0.13 ? 77  VAL A CA   2  
ATOM   2511  C C    . VAL A 1 77 ? 2.913   -2.272  -2.742  1.00 0.13 ? 77  VAL A C    2  
ATOM   2512  O O    . VAL A 1 77 ? 3.654   -3.016  -2.099  1.00 0.13 ? 77  VAL A O    2  
ATOM   2513  C CB   . VAL A 1 77 ? 2.257   -0.315  -1.338  1.00 0.13 ? 77  VAL A CB   2  
ATOM   2514  C CG1  . VAL A 1 77 ? 2.736   -1.104  -0.129  1.00 0.13 ? 77  VAL A CG1  2  
ATOM   2515  C CG2  . VAL A 1 77 ? 2.425   1.179   -1.112  1.00 0.13 ? 77  VAL A CG2  2  
ATOM   2516  H H    . VAL A 1 77 ? 1.774   0.568   -3.694  1.00 0.13 ? 77  VAL A H    2  
ATOM   2517  H HA   . VAL A 1 77 ? 4.053   -0.484  -2.492  1.00 0.14 ? 77  VAL A HA   2  
ATOM   2518  H HB   . VAL A 1 77 ? 1.206   -0.521  -1.481  1.00 0.12 ? 77  VAL A HB   2  
ATOM   2519  H HG11 . VAL A 1 77 ? 2.398   -2.127  -0.209  1.00 0.15 ? 77  VAL A HG11 2  
ATOM   2520  H HG12 . VAL A 1 77 ? 2.336   -0.661  0.772   1.00 0.16 ? 77  VAL A HG12 2  
ATOM   2521  H HG13 . VAL A 1 77 ? 3.816   -1.084  -0.091  1.00 0.17 ? 77  VAL A HG13 2  
ATOM   2522  H HG21 . VAL A 1 77 ? 3.473   1.408   -0.986  1.00 0.14 ? 77  VAL A HG21 2  
ATOM   2523  H HG22 . VAL A 1 77 ? 1.884   1.471   -0.224  1.00 0.13 ? 77  VAL A HG22 2  
ATOM   2524  H HG23 . VAL A 1 77 ? 2.038   1.718   -1.964  1.00 0.14 ? 77  VAL A HG23 2  
ATOM   2525  N N    . LEU A 1 78 ? 1.989   -2.725  -3.583  1.00 0.12 ? 78  LEU A N    2  
ATOM   2526  C CA   . LEU A 1 78 ? 1.790   -4.151  -3.806  1.00 0.12 ? 78  LEU A CA   2  
ATOM   2527  C C    . LEU A 1 78 ? 2.751   -4.677  -4.868  1.00 0.13 ? 78  LEU A C    2  
ATOM   2528  O O    . LEU A 1 78 ? 3.393   -5.711  -4.682  1.00 0.13 ? 78  LEU A O    2  
ATOM   2529  C CB   . LEU A 1 78 ? 0.346   -4.426  -4.230  1.00 0.11 ? 78  LEU A CB   2  
ATOM   2530  C CG   . LEU A 1 78 ? -0.179  -5.836  -3.954  1.00 0.10 ? 78  LEU A CG   2  
ATOM   2531  C CD1  . LEU A 1 78 ? -0.538  -5.994  -2.486  1.00 0.09 ? 78  LEU A CD1  2  
ATOM   2532  C CD2  . LEU A 1 78 ? -1.382  -6.138  -4.835  1.00 0.09 ? 78  LEU A CD2  2  
ATOM   2533  H H    . LEU A 1 78 ? 1.426   -2.082  -4.064  1.00 0.12 ? 78  LEU A H    2  
ATOM   2534  H HA   . LEU A 1 78 ? 1.986   -4.663  -2.876  1.00 0.11 ? 78  LEU A HA   2  
ATOM   2535  H HB2  . LEU A 1 78 ? -0.293  -3.724  -3.715  1.00 0.10 ? 78  LEU A HB2  2  
ATOM   2536  H HB3  . LEU A 1 78 ? 0.268   -4.241  -5.291  1.00 0.11 ? 78  LEU A HB3  2  
ATOM   2537  H HG   . LEU A 1 78 ? 0.595   -6.552  -4.186  1.00 0.10 ? 78  LEU A HG   2  
ATOM   2538  H HD11 . LEU A 1 78 ? -1.313  -5.287  -2.227  1.00 0.08 ? 78  LEU A HD11 2  
ATOM   2539  H HD12 . LEU A 1 78 ? 0.336   -5.809  -1.879  1.00 0.10 ? 78  LEU A HD12 2  
ATOM   2540  H HD13 . LEU A 1 78 ? -0.893  -6.998  -2.308  1.00 0.09 ? 78  LEU A HD13 2  
ATOM   2541  H HD21 . LEU A 1 78 ? -1.078  -6.143  -5.871  1.00 0.10 ? 78  LEU A HD21 2  
ATOM   2542  H HD22 . LEU A 1 78 ? -2.137  -5.379  -4.686  1.00 0.09 ? 78  LEU A HD22 2  
ATOM   2543  H HD23 . LEU A 1 78 ? -1.787  -7.104  -4.573  1.00 0.09 ? 78  LEU A HD23 2  
ATOM   2544  N N    . GLY A 1 79 ? 2.848   -3.956  -5.981  1.00 0.13 ? 79  GLY A N    2  
ATOM   2545  C CA   . GLY A 1 79 ? 3.735   -4.363  -7.054  1.00 0.15 ? 79  GLY A CA   2  
ATOM   2546  C C    . GLY A 1 79 ? 5.146   -4.632  -6.569  1.00 0.15 ? 79  GLY A C    2  
ATOM   2547  O O    . GLY A 1 79 ? 5.873   -5.428  -7.163  1.00 0.16 ? 79  GLY A O    2  
ATOM   2548  H H    . GLY A 1 79 ? 2.314   -3.140  -6.073  1.00 0.13 ? 79  GLY A H    2  
ATOM   2549  H HA2  . GLY A 1 79 ? 3.345   -5.263  -7.507  1.00 0.14 ? 79  GLY A HA2  2  
ATOM   2550  H HA3  . GLY A 1 79 ? 3.765   -3.581  -7.798  1.00 0.15 ? 79  GLY A HA3  2  
ATOM   2551  N N    . ALA A 1 80 ? 5.535   -3.964  -5.487  1.00 0.15 ? 80  ALA A N    2  
ATOM   2552  C CA   . ALA A 1 80 ? 6.869   -4.136  -4.924  1.00 0.16 ? 80  ALA A CA   2  
ATOM   2553  C C    . ALA A 1 80 ? 6.925   -5.354  -4.008  1.00 0.16 ? 80  ALA A C    2  
ATOM   2554  O O    . ALA A 1 80 ? 7.764   -6.238  -4.185  1.00 0.17 ? 80  ALA A O    2  
ATOM   2555  C CB   . ALA A 1 80 ? 7.287   -2.884  -4.168  1.00 0.17 ? 80  ALA A CB   2  
ATOM   2556  H H    . ALA A 1 80 ? 4.911   -3.342  -5.059  1.00 0.15 ? 80  ALA A H    2  
ATOM   2557  H HA   . ALA A 1 80 ? 7.560   -4.282  -5.742  1.00 0.17 ? 80  ALA A HA   2  
ATOM   2558  H HB1  . ALA A 1 80 ? 6.636   -2.743  -3.318  1.00 0.16 ? 80  ALA A HB1  2  
ATOM   2559  H HB2  . ALA A 1 80 ? 7.216   -2.028  -4.822  1.00 0.18 ? 80  ALA A HB2  2  
ATOM   2560  H HB3  . ALA A 1 80 ? 8.305   -2.993  -3.826  1.00 0.18 ? 80  ALA A HB3  2  
ATOM   2561  N N    . LEU A 1 81 ? 6.029   -5.392  -3.027  1.00 0.15 ? 81  LEU A N    2  
ATOM   2562  C CA   . LEU A 1 81 ? 5.977   -6.501  -2.081  1.00 0.15 ? 81  LEU A CA   2  
ATOM   2563  C C    . LEU A 1 81 ? 5.800   -7.830  -2.810  1.00 0.14 ? 81  LEU A C    2  
ATOM   2564  O O    . LEU A 1 81 ? 6.466   -8.816  -2.496  1.00 0.15 ? 81  LEU A O    2  
ATOM   2565  C CB   . LEU A 1 81 ? 4.834   -6.295  -1.087  1.00 0.14 ? 81  LEU A CB   2  
ATOM   2566  C CG   . LEU A 1 81 ? 5.240   -5.842  0.317   1.00 0.14 ? 81  LEU A CG   2  
ATOM   2567  C CD1  . LEU A 1 81 ? 4.017   -5.724  1.214   1.00 0.13 ? 81  LEU A CD1  2  
ATOM   2568  C CD2  . LEU A 1 81 ? 6.253   -6.804  0.916   1.00 0.15 ? 81  LEU A CD2  2  
ATOM   2569  H H    . LEU A 1 81 ? 5.387   -4.657  -2.938  1.00 0.14 ? 81  LEU A H    2  
ATOM   2570  H HA   . LEU A 1 81 ? 6.912   -6.521  -1.544  1.00 0.15 ? 81  LEU A HA   2  
ATOM   2571  H HB2  . LEU A 1 81 ? 4.162   -5.556  -1.497  1.00 0.13 ? 81  LEU A HB2  2  
ATOM   2572  H HB3  . LEU A 1 81 ? 4.298   -7.228  -0.995  1.00 0.13 ? 81  LEU A HB3  2  
ATOM   2573  H HG   . LEU A 1 81 ? 5.701   -4.866  0.253   1.00 0.15 ? 81  LEU A HG   2  
ATOM   2574  H HD11 . LEU A 1 81 ? 3.788   -6.689  1.639   1.00 0.13 ? 81  LEU A HD11 2  
ATOM   2575  H HD12 . LEU A 1 81 ? 3.175   -5.377  0.633   1.00 0.12 ? 81  LEU A HD12 2  
ATOM   2576  H HD13 . LEU A 1 81 ? 4.221   -5.021  2.009   1.00 0.13 ? 81  LEU A HD13 2  
ATOM   2577  H HD21 . LEU A 1 81 ? 5.925   -7.820  0.755   1.00 0.14 ? 81  LEU A HD21 2  
ATOM   2578  H HD22 . LEU A 1 81 ? 6.340   -6.619  1.977   1.00 0.15 ? 81  LEU A HD22 2  
ATOM   2579  H HD23 . LEU A 1 81 ? 7.214   -6.656  0.446   1.00 0.16 ? 81  LEU A HD23 2  
ATOM   2580  N N    . LYS A 1 82 ? 4.898   -7.847  -3.785  1.00 0.14 ? 82  LYS A N    2  
ATOM   2581  C CA   . LYS A 1 82 ? 4.635   -9.053  -4.562  1.00 0.14 ? 82  LYS A CA   2  
ATOM   2582  C C    . LYS A 1 82 ? 5.931   -9.643  -5.109  1.00 0.15 ? 82  LYS A C    2  
ATOM   2583  O O    . LYS A 1 82 ? 6.060   -10.859 -5.248  1.00 0.15 ? 82  LYS A O    2  
ATOM   2584  C CB   . LYS A 1 82 ? 3.678   -8.742  -5.715  1.00 0.13 ? 82  LYS A CB   2  
ATOM   2585  C CG   . LYS A 1 82 ? 2.262   -9.243  -5.483  1.00 0.12 ? 82  LYS A CG   2  
ATOM   2586  C CD   . LYS A 1 82 ? 1.252   -8.456  -6.301  1.00 0.12 ? 82  LYS A CD   2  
ATOM   2587  C CE   . LYS A 1 82 ? -0.110  -9.135  -6.304  1.00 0.11 ? 82  LYS A CE   2  
ATOM   2588  N NZ   . LYS A 1 82 ? -0.451  -9.687  -7.645  1.00 0.12 ? 82  LYS A NZ   2  
ATOM   2589  H H    . LYS A 1 82 ? 4.398   -7.029  -3.988  1.00 0.13 ? 82  LYS A H    2  
ATOM   2590  H HA   . LYS A 1 82 ? 4.172   -9.776  -3.906  1.00 0.13 ? 82  LYS A HA   2  
ATOM   2591  H HB2  . LYS A 1 82 ? 3.639   -7.672  -5.856  1.00 0.13 ? 82  LYS A HB2  2  
ATOM   2592  H HB3  . LYS A 1 82 ? 4.057   -9.201  -6.616  1.00 0.14 ? 82  LYS A HB3  2  
ATOM   2593  H HG2  . LYS A 1 82 ? 2.208   -10.284 -5.766  1.00 0.12 ? 82  LYS A HG2  2  
ATOM   2594  H HG3  . LYS A 1 82 ? 2.022   -9.140  -4.435  1.00 0.12 ? 82  LYS A HG3  2  
ATOM   2595  H HD2  . LYS A 1 82 ? 1.151   -7.469  -5.878  1.00 0.12 ? 82  LYS A HD2  2  
ATOM   2596  H HD3  . LYS A 1 82 ? 1.608   -8.380  -7.318  1.00 0.13 ? 82  LYS A HD3  2  
ATOM   2597  H HE2  . LYS A 1 82 ? -0.100  -9.941  -5.586  1.00 0.11 ? 82  LYS A HE2  2  
ATOM   2598  H HE3  . LYS A 1 82 ? -0.860  -8.412  -6.021  1.00 0.10 ? 82  LYS A HE3  2  
ATOM   2599  H HZ1  . LYS A 1 82 ? -1.384  -10.146 -7.616  1.00 0.11 ? 82  LYS A HZ1  2  
ATOM   2600  H HZ2  . LYS A 1 82 ? 0.260   -10.389 -7.934  1.00 0.12 ? 82  LYS A HZ2  2  
ATOM   2601  H HZ3  . LYS A 1 82 ? -0.473  -8.924  -8.351  1.00 0.12 ? 82  LYS A HZ3  2  
ATOM   2602  N N    . ALA A 1 83 ? 6.889   -8.774  -5.413  1.00 0.16 ? 83  ALA A N    2  
ATOM   2603  C CA   . ALA A 1 83 ? 8.177   -9.210  -5.939  1.00 0.17 ? 83  ALA A CA   2  
ATOM   2604  C C    . ALA A 1 83 ? 9.124   -9.606  -4.813  1.00 0.18 ? 83  ALA A C    2  
ATOM   2605  O O    . ALA A 1 83 ? 9.993   -10.459 -4.993  1.00 0.19 ? 83  ALA A O    2  
ATOM   2606  C CB   . ALA A 1 83 ? 8.796   -8.113  -6.793  1.00 0.18 ? 83  ALA A CB   2  
ATOM   2607  H H    . ALA A 1 83 ? 6.726   -7.817  -5.281  1.00 0.16 ? 83  ALA A H    2  
ATOM   2608  H HA   . ALA A 1 83 ? 8.005   -10.070 -6.570  1.00 0.17 ? 83  ALA A HA   2  
ATOM   2609  H HB1  . ALA A 1 83 ? 8.989   -7.246  -6.179  1.00 0.18 ? 83  ALA A HB1  2  
ATOM   2610  H HB2  . ALA A 1 83 ? 8.115   -7.847  -7.587  1.00 0.18 ? 83  ALA A HB2  2  
ATOM   2611  H HB3  . ALA A 1 83 ? 9.723   -8.468  -7.218  1.00 0.19 ? 83  ALA A HB3  2  
ATOM   2612  N N    . ALA A 1 84 ? 8.953   -8.980  -3.654  1.00 0.17 ? 84  ALA A N    2  
ATOM   2613  C CA   . ALA A 1 84 ? 9.794   -9.269  -2.498  1.00 0.18 ? 84  ALA A CA   2  
ATOM   2614  C C    . ALA A 1 84 ? 9.444   -10.623 -1.890  1.00 0.18 ? 84  ALA A C    2  
ATOM   2615  O O    . ALA A 1 84 ? 10.271  -11.248 -1.228  1.00 0.18 ? 84  ALA A O    2  
ATOM   2616  C CB   . ALA A 1 84 ? 9.656   -8.168  -1.457  1.00 0.18 ? 84  ALA A CB   2  
ATOM   2617  H H    . ALA A 1 84 ? 8.244   -8.309  -3.573  1.00 0.17 ? 84  ALA A H    2  
ATOM   2618  H HA   . ALA A 1 84 ? 10.821  -9.290  -2.831  1.00 0.19 ? 84  ALA A HA   2  
ATOM   2619  H HB1  . ALA A 1 84 ? 10.328  -8.364  -0.634  1.00 0.19 ? 84  ALA A HB1  2  
ATOM   2620  H HB2  . ALA A 1 84 ? 8.639   -8.142  -1.092  1.00 0.17 ? 84  ALA A HB2  2  
ATOM   2621  H HB3  . ALA A 1 84 ? 9.902   -7.216  -1.904  1.00 0.18 ? 84  ALA A HB3  2  
ATOM   2622  N N    . ARG A 1 85 ? 8.213   -11.068 -2.117  1.00 0.16 ? 85  ARG A N    2  
ATOM   2623  C CA   . ARG A 1 85 ? 7.752   -12.346 -1.590  1.00 0.16 ? 85  ARG A CA   2  
ATOM   2624  C C    . ARG A 1 85 ? 7.743   -13.413 -2.680  1.00 0.16 ? 85  ARG A C    2  
ATOM   2625  O O    . ARG A 1 85 ? 7.039   -14.418 -2.573  1.00 0.16 ? 85  ARG A O    2  
ATOM   2626  C CB   . ARG A 1 85 ? 6.352   -12.202 -0.990  1.00 0.15 ? 85  ARG A CB   2  
ATOM   2627  C CG   . ARG A 1 85 ? 6.295   -11.263 0.204   1.00 0.15 ? 85  ARG A CG   2  
ATOM   2628  C CD   . ARG A 1 85 ? 4.898   -11.205 0.802   1.00 0.14 ? 85  ARG A CD   2  
ATOM   2629  N NE   . ARG A 1 85 ? 4.925   -11.233 2.261   1.00 0.14 ? 85  ARG A NE   2  
ATOM   2630  C CZ   . ARG A 1 85 ? 5.293   -12.295 2.969   1.00 0.14 ? 85  ARG A CZ   2  
ATOM   2631  N NH1  . ARG A 1 85 ? 5.663   -13.410 2.355   1.00 0.15 ? 85  ARG A NH1  2  
ATOM   2632  N NH2  . ARG A 1 85 ? 5.291   -12.243 4.295   1.00 0.15 ? 85  ARG A NH2  2  
ATOM   2633  H H    . ARG A 1 85 ? 7.599   -10.523 -2.654  1.00 0.16 ? 85  ARG A H    2  
ATOM   2634  H HA   . ARG A 1 85 ? 8.437   -12.650 -0.813  1.00 0.17 ? 85  ARG A HA   2  
ATOM   2635  H HB2  . ARG A 1 85 ? 5.685   -11.823 -1.750  1.00 0.14 ? 85  ARG A HB2  2  
ATOM   2636  H HB3  . ARG A 1 85 ? 6.007   -13.175 -0.673  1.00 0.15 ? 85  ARG A HB3  2  
ATOM   2637  H HG2  . ARG A 1 85 ? 6.984   -11.613 0.959   1.00 0.15 ? 85  ARG A HG2  2  
ATOM   2638  H HG3  . ARG A 1 85 ? 6.582   -10.272 -0.115  1.00 0.15 ? 85  ARG A HG3  2  
ATOM   2639  H HD2  . ARG A 1 85 ? 4.419   -10.293 0.479   1.00 0.13 ? 85  ARG A HD2  2  
ATOM   2640  H HD3  . ARG A 1 85 ? 4.333   -12.053 0.444   1.00 0.13 ? 85  ARG A HD3  2  
ATOM   2641  H HE   . ARG A 1 85 ? 4.654   -10.419 2.736   1.00 0.14 ? 85  ARG A HE   2  
ATOM   2642  H HH11 . ARG A 1 85 ? 5.940   -14.208 2.890   1.00 0.15 ? 85  ARG A HH11 2  
ATOM   2643  H HH12 . ARG A 1 85 ? 5.665   -13.453 1.356   1.00 0.15 ? 85  ARG A HH12 2  
ATOM   2644  H HH21 . ARG A 1 85 ? 5.011   -11.404 4.763   1.00 0.15 ? 85  ARG A HH21 2  
ATOM   2645  H HH22 . ARG A 1 85 ? 5.568   -13.043 4.829   1.00 0.15 ? 85  ARG A HH22 2  
ATOM   2646  N N    . GLU A 1 86 ? 8.527   -13.187 -3.729  1.00 0.17 ? 86  GLU A N    2  
ATOM   2647  C CA   . GLU A 1 86 ? 8.606   -14.128 -4.841  1.00 0.17 ? 86  GLU A CA   2  
ATOM   2648  C C    . GLU A 1 86 ? 10.015  -14.701 -4.968  1.00 0.19 ? 86  GLU A C    2  
ATOM   2649  O O    . GLU A 1 86 ? 10.196  -15.838 -5.404  1.00 0.19 ? 86  GLU A O    2  
ATOM   2650  C CB   . GLU A 1 86 ? 8.200   -13.444 -6.148  1.00 0.17 ? 86  GLU A CB   2  
ATOM   2651  C CG   . GLU A 1 86 ? 6.797   -13.798 -6.608  1.00 0.16 ? 86  GLU A CG   2  
ATOM   2652  C CD   . GLU A 1 86 ? 6.473   -13.231 -7.978  1.00 0.17 ? 86  GLU A CD   2  
ATOM   2653  O OE1  . GLU A 1 86 ? 7.127   -13.641 -8.958  1.00 0.18 ? 86  GLU A OE1  2  
ATOM   2654  O OE2  . GLU A 1 86 ? 5.566   -12.378 -8.068  1.00 0.16 ? 86  GLU A OE2  2  
ATOM   2655  H H    . GLU A 1 86 ? 9.065   -12.369 -3.757  1.00 0.17 ? 86  GLU A H    2  
ATOM   2656  H HA   . GLU A 1 86 ? 7.919   -14.936 -4.639  1.00 0.17 ? 86  GLU A HA   2  
ATOM   2657  H HB2  . GLU A 1 86 ? 8.253   -12.374 -6.011  1.00 0.17 ? 86  GLU A HB2  2  
ATOM   2658  H HB3  . GLU A 1 86 ? 8.894   -13.734 -6.923  1.00 0.18 ? 86  GLU A HB3  2  
ATOM   2659  H HG2  . GLU A 1 86 ? 6.705   -14.873 -6.650  1.00 0.17 ? 86  GLU A HG2  2  
ATOM   2660  H HG3  . GLU A 1 86 ? 6.088   -13.404 -5.895  1.00 0.16 ? 86  GLU A HG3  2  
ATOM   2661  N N    . GLU A 1 87 ? 11.009  -13.904 -4.587  1.00 0.19 ? 87  GLU A N    2  
ATOM   2662  C CA   . GLU A 1 87 ? 12.401  -14.331 -4.660  1.00 0.21 ? 87  GLU A CA   2  
ATOM   2663  C C    . GLU A 1 87 ? 12.751  -15.248 -3.494  1.00 0.21 ? 87  GLU A C    2  
ATOM   2664  O O    . GLU A 1 87 ? 13.802  -15.888 -3.487  1.00 0.22 ? 87  GLU A O    2  
ATOM   2665  C CB   . GLU A 1 87 ? 13.330  -13.116 -4.665  1.00 0.21 ? 87  GLU A CB   2  
ATOM   2666  C CG   . GLU A 1 87 ? 13.793  -12.708 -6.053  1.00 0.22 ? 87  GLU A CG   2  
ATOM   2667  C CD   . GLU A 1 87 ? 15.302  -12.632 -6.166  1.00 0.24 ? 87  GLU A CD   2  
ATOM   2668  O OE1  . GLU A 1 87 ? 15.912  -13.617 -6.636  1.00 0.24 ? 87  GLU A OE1  2  
ATOM   2669  O OE2  . GLU A 1 87 ? 15.876  -11.591 -5.786  1.00 0.24 ? 87  GLU A OE2  2  
ATOM   2670  O OXT  . GLU A 1 87 ? 11.969  -15.315 -2.498  1.00 0.20 ? 87  GLU A OXT  2  
ATOM   2671  H H    . GLU A 1 87 ? 10.801  -13.009 -4.248  1.00 0.19 ? 87  GLU A H    2  
ATOM   2672  H HA   . GLU A 1 87 ? 12.531  -14.877 -5.582  1.00 0.21 ? 87  GLU A HA   2  
ATOM   2673  H HB2  . GLU A 1 87 ? 12.811  -12.279 -4.222  1.00 0.21 ? 87  GLU A HB2  2  
ATOM   2674  H HB3  . GLU A 1 87 ? 14.203  -13.342 -4.071  1.00 0.22 ? 87  GLU A HB3  2  
ATOM   2675  H HG2  . GLU A 1 87 ? 13.430  -13.432 -6.768  1.00 0.22 ? 87  GLU A HG2  2  
ATOM   2676  H HG3  . GLU A 1 87 ? 13.380  -11.738 -6.286  1.00 0.22 ? 87  GLU A HG3  2  
HETATM 2677  C C1   . I3P B 2 .  ? 11.220  9.899   1.093   1.00 0.80 ? 101 I3P A C1   2  
HETATM 2678  C C2   . I3P B 2 .  ? 11.390  10.477  2.516   1.00 0.90 ? 101 I3P A C2   2  
HETATM 2679  C C3   . I3P B 2 .  ? 11.210  12.007  2.494   1.00 0.87 ? 101 I3P A C3   2  
HETATM 2680  C C4   . I3P B 2 .  ? 9.828   12.391  1.919   1.00 0.99 ? 101 I3P A C4   2  
HETATM 2681  C C5   . I3P B 2 .  ? 9.654   11.806  0.501   1.00 0.89 ? 101 I3P A C5   2  
HETATM 2682  C C6   . I3P B 2 .  ? 9.839   10.272  0.519   1.00 0.77 ? 101 I3P A C6   2  
HETATM 2683  O O1   . I3P B 2 .  ? 11.334  8.488   1.131   1.00 1.09 ? 101 I3P A O1   2  
HETATM 2684  O O2   . I3P B 2 .  ? 10.451  9.904   3.395   1.00 1.13 ? 101 I3P A O2   2  
HETATM 2685  O O3   . I3P B 2 .  ? 11.350  12.506  3.799   1.00 1.18 ? 101 I3P A O3   2  
HETATM 2686  O O4   . I3P B 2 .  ? 9.740   13.802  1.842   1.00 1.27 ? 101 I3P A O4   2  
HETATM 2687  O O5   . I3P B 2 .  ? 8.349   12.101  0.038   1.00 1.24 ? 101 I3P A O5   2  
HETATM 2688  O O6   . I3P B 2 .  ? 9.736   9.762   -0.787  1.00 0.95 ? 101 I3P A O6   2  
HETATM 2689  P P1   . I3P B 2 .  ? 12.914  7.987   0.567   1.00 1.49 ? 101 I3P A P1   2  
HETATM 2690  O O11  . I3P B 2 .  ? 13.219  8.512   -1.060  1.00 1.57 ? 101 I3P A O11  2  
HETATM 2691  O O12  . I3P B 2 .  ? 13.984  8.625   1.495   1.00 1.59 ? 101 I3P A O12  2  
HETATM 2692  O O13  . I3P B 2 .  ? 13.085  6.264   0.702   1.00 1.97 ? 101 I3P A O13  2  
HETATM 2693  P P4   . I3P B 2 .  ? 8.423   14.391  2.837   1.00 1.78 ? 101 I3P A P4   2  
HETATM 2694  O O41  . I3P B 2 .  ? 7.093   13.865  2.234   1.00 1.94 ? 101 I3P A O41  2  
HETATM 2695  O O42  . I3P B 2 .  ? 8.529   13.821  4.474   1.00 1.90 ? 101 I3P A O42  2  
HETATM 2696  O O43  . I3P B 2 .  ? 8.345   16.123  2.792   1.00 2.20 ? 101 I3P A O43  2  
HETATM 2697  P P5   . I3P B 2 .  ? 8.415   13.181  -1.341  1.00 1.58 ? 101 I3P A P5   2  
HETATM 2698  O O51  . I3P B 2 .  ? 9.063   12.408  -2.521  1.00 1.56 ? 101 I3P A O51  2  
HETATM 2699  O O52  . I3P B 2 .  ? 6.817   13.626  -1.850  1.00 2.10 ? 101 I3P A O52  2  
HETATM 2700  O O53  . I3P B 2 .  ? 9.379   14.591  -1.033  1.00 1.65 ? 101 I3P A O53  2  
HETATM 2701  H H1   . I3P B 2 .  ? 11.983  10.335  0.439   1.00 0.84 ? 101 I3P A H1   2  
HETATM 2702  H H2   . I3P B 2 .  ? 12.399  10.259  2.875   1.00 1.09 ? 101 I3P A H2   2  
HETATM 2703  H H3   . I3P B 2 .  ? 11.990  12.447  1.865   1.00 0.81 ? 101 I3P A H3   2  
HETATM 2704  H H4   . I3P B 2 .  ? 9.046   11.981  2.565   1.00 1.17 ? 101 I3P A H4   2  
HETATM 2705  H H5   . I3P B 2 .  ? 10.418  12.237  -0.154  1.00 0.89 ? 101 I3P A H5   2  
HETATM 2706  H H6   . I3P B 2 .  ? 9.055   9.820   1.130   1.00 0.90 ? 101 I3P A H6   2  
HETATM 2707  H HO2  . I3P B 2 .  ? 9.761   9.489   2.841   1.00 1.23 ? 101 I3P A HO2  2  
HETATM 2708  H HO3  . I3P B 2 .  ? 10.883  13.364  3.831   1.00 1.33 ? 101 I3P A HO3  2  
HETATM 2709  H HO6  . I3P B 2 .  ? 9.407   10.485  -1.357  1.00 1.04 ? 101 I3P A HO6  2  
HETATM 2710  H HO13 . I3P B 2 .  ? 13.983  6.004   0.430   1.00 2.23 ? 101 I3P A HO13 2  
ATOM   2711  N N    . SER A 1 1  ? 2.855   3.692   10.429  1.00 0.76 ? 1   SER A N    3  
ATOM   2712  C CA   . SER A 1 1  ? 2.485   4.815   11.284  1.00 0.88 ? 1   SER A CA   3  
ATOM   2713  C C    . SER A 1 1  ? 3.636   5.810   11.401  1.00 0.88 ? 1   SER A C    3  
ATOM   2714  O O    . SER A 1 1  ? 3.423   6.987   11.689  1.00 0.98 ? 1   SER A O    3  
ATOM   2715  C CB   . SER A 1 1  ? 2.085   4.315   12.673  1.00 0.96 ? 1   SER A CB   3  
ATOM   2716  O OG   . SER A 1 1  ? 0.678   4.188   12.783  1.00 1.05 ? 1   SER A OG   3  
ATOM   2717  H H1   . SER A 1 1  ? 3.112   4.033   9.481   1.00 0.73 ? 1   SER A H1   3  
ATOM   2718  H H2   . SER A 1 1  ? 2.057   3.030   10.343  1.00 0.79 ? 1   SER A H2   3  
ATOM   2719  H H3   . SER A 1 1  ? 3.668   3.186   10.835  1.00 0.72 ? 1   SER A H3   3  
ATOM   2720  H HA   . SER A 1 1  ? 1.640   5.315   10.834  1.00 0.95 ? 1   SER A HA   3  
ATOM   2721  H HB2  . SER A 1 1  ? 2.535   3.349   12.849  1.00 0.91 ? 1   SER A HB2  3  
ATOM   2722  H HB3  . SER A 1 1  ? 2.430   5.015   13.418  1.00 1.02 ? 1   SER A HB3  3  
ATOM   2723  H HG   . SER A 1 1  ? 0.354   4.792   13.456  1.00 1.13 ? 1   SER A HG   3  
ATOM   2724  N N    . GLU A 1 2  ? 4.853   5.328   11.174  1.00 0.79 ? 2   GLU A N    3  
ATOM   2725  C CA   . GLU A 1 2  ? 6.037   6.175   11.256  1.00 0.83 ? 2   GLU A CA   3  
ATOM   2726  C C    . GLU A 1 2  ? 7.283   5.412   10.813  1.00 0.76 ? 2   GLU A C    3  
ATOM   2727  O O    . GLU A 1 2  ? 8.179   5.978   10.188  1.00 0.77 ? 2   GLU A O    3  
ATOM   2728  C CB   . GLU A 1 2  ? 6.223   6.694   12.683  1.00 0.96 ? 2   GLU A CB   3  
ATOM   2729  C CG   . GLU A 1 2  ? 6.673   5.624   13.665  1.00 0.99 ? 2   GLU A CG   3  
ATOM   2730  C CD   . GLU A 1 2  ? 6.875   6.167   15.067  1.00 1.14 ? 2   GLU A CD   3  
ATOM   2731  O OE1  . GLU A 1 2  ? 7.380   7.303   15.195  1.00 1.22 ? 2   GLU A OE1  3  
ATOM   2732  O OE2  . GLU A 1 2  ? 6.528   5.457   16.034  1.00 1.19 ? 2   GLU A OE2  3  
ATOM   2733  H H    . GLU A 1 2  ? 4.959   4.381   10.949  1.00 0.72 ? 2   GLU A H    3  
ATOM   2734  H HA   . GLU A 1 2  ? 5.889   7.015   10.594  1.00 0.86 ? 2   GLU A HA   3  
ATOM   2735  H HB2  . GLU A 1 2  ? 6.964   7.479   12.675  1.00 1.02 ? 2   GLU A HB2  3  
ATOM   2736  H HB3  . GLU A 1 2  ? 5.285   7.099   13.031  1.00 1.02 ? 2   GLU A HB3  3  
ATOM   2737  H HG2  . GLU A 1 2  ? 5.923   4.848   13.701  1.00 0.95 ? 2   GLU A HG2  3  
ATOM   2738  H HG3  . GLU A 1 2  ? 7.607   5.206   13.318  1.00 0.95 ? 2   GLU A HG3  3  
ATOM   2739  N N    . ALA A 1 3  ? 7.330   4.125   11.141  1.00 0.72 ? 3   ALA A N    3  
ATOM   2740  C CA   . ALA A 1 3  ? 8.465   3.286   10.776  1.00 0.70 ? 3   ALA A CA   3  
ATOM   2741  C C    . ALA A 1 3  ? 8.190   2.523   9.486   1.00 0.57 ? 3   ALA A C    3  
ATOM   2742  O O    . ALA A 1 3  ? 9.017   2.506   8.574   1.00 0.56 ? 3   ALA A O    3  
ATOM   2743  C CB   . ALA A 1 3  ? 8.790   2.319   11.906  1.00 0.79 ? 3   ALA A CB   3  
ATOM   2744  H H    . ALA A 1 3  ? 6.588   3.733   11.647  1.00 0.73 ? 3   ALA A H    3  
ATOM   2745  H HA   . ALA A 1 3  ? 9.321   3.929   10.627  1.00 0.75 ? 3   ALA A HA   3  
ATOM   2746  H HB1  . ALA A 1 3  ? 8.981   2.875   12.812  1.00 0.89 ? 3   ALA A HB1  3  
ATOM   2747  H HB2  . ALA A 1 3  ? 9.665   1.742   11.645  1.00 0.82 ? 3   ALA A HB2  3  
ATOM   2748  H HB3  . ALA A 1 3  ? 7.953   1.654   12.061  1.00 0.76 ? 3   ALA A HB3  3  
ATOM   2749  N N    . VAL A 1 4  ? 7.008   1.908   9.415   1.00 0.52 ? 4   VAL A N    3  
ATOM   2750  C CA   . VAL A 1 4  ? 6.604   1.117   8.252   1.00 0.45 ? 4   VAL A CA   3  
ATOM   2751  C C    . VAL A 1 4  ? 6.559   1.959   6.971   1.00 0.43 ? 4   VAL A C    3  
ATOM   2752  O O    . VAL A 1 4  ? 6.709   1.432   5.869   1.00 0.44 ? 4   VAL A O    3  
ATOM   2753  C CB   . VAL A 1 4  ? 5.226   0.453   8.475   1.00 0.49 ? 4   VAL A CB   3  
ATOM   2754  C CG1  . VAL A 1 4  ? 4.975   -0.630  7.437   1.00 0.55 ? 4   VAL A CG1  3  
ATOM   2755  C CG2  . VAL A 1 4  ? 5.124   -0.122  9.882   1.00 0.62 ? 4   VAL A CG2  3  
ATOM   2756  H H    . VAL A 1 4  ? 6.390   1.988   10.170  1.00 0.57 ? 4   VAL A H    3  
ATOM   2757  H HA   . VAL A 1 4  ? 7.335   0.331   8.122   1.00 0.46 ? 4   VAL A HA   3  
ATOM   2758  H HB   . VAL A 1 4  ? 4.464   1.211   8.363   1.00 0.59 ? 4   VAL A HB   3  
ATOM   2759  H HG11 . VAL A 1 4  ? 4.994   -0.194  6.450   1.00 0.62 ? 4   VAL A HG11 3  
ATOM   2760  H HG12 . VAL A 1 4  ? 4.010   -1.081  7.613   1.00 0.62 ? 4   VAL A HG12 3  
ATOM   2761  H HG13 . VAL A 1 4  ? 5.744   -1.385  7.513   1.00 0.62 ? 4   VAL A HG13 3  
ATOM   2762  H HG21 . VAL A 1 4  ? 4.208   -0.685  9.975   1.00 0.68 ? 4   VAL A HG21 3  
ATOM   2763  H HG22 . VAL A 1 4  ? 5.124   0.684   10.601  1.00 0.78 ? 4   VAL A HG22 3  
ATOM   2764  H HG23 . VAL A 1 4  ? 5.966   -0.770  10.068  1.00 0.70 ? 4   VAL A HG23 3  
ATOM   2765  N N    . ILE A 1 5  ? 6.369   3.268   7.120   1.00 0.45 ? 5   ILE A N    3  
ATOM   2766  C CA   . ILE A 1 5  ? 6.314   4.171   5.969   1.00 0.48 ? 5   ILE A CA   3  
ATOM   2767  C C    . ILE A 1 5  ? 7.714   4.409   5.387   1.00 0.46 ? 5   ILE A C    3  
ATOM   2768  O O    . ILE A 1 5  ? 7.864   5.035   4.339   1.00 0.57 ? 5   ILE A O    3  
ATOM   2769  C CB   . ILE A 1 5  ? 5.671   5.528   6.343   1.00 0.56 ? 5   ILE A CB   3  
ATOM   2770  C CG1  . ILE A 1 5  ? 4.505   5.322   7.316   1.00 0.73 ? 5   ILE A CG1  3  
ATOM   2771  C CG2  . ILE A 1 5  ? 5.189   6.252   5.090   1.00 0.81 ? 5   ILE A CG2  3  
ATOM   2772  C CD1  . ILE A 1 5  ? 3.860   6.611   7.778   1.00 0.82 ? 5   ILE A CD1  3  
ATOM   2773  H H    . ILE A 1 5  ? 6.267   3.637   8.022   1.00 0.48 ? 5   ILE A H    3  
ATOM   2774  H HA   . ILE A 1 5  ? 5.698   3.703   5.213   1.00 0.50 ? 5   ILE A HA   3  
ATOM   2775  H HB   . ILE A 1 5  ? 6.424   6.140   6.817   1.00 0.65 ? 5   ILE A HB   3  
ATOM   2776  H HG12 . ILE A 1 5  ? 3.744   4.727   6.834   1.00 0.89 ? 5   ILE A HG12 3  
ATOM   2777  H HG13 . ILE A 1 5  ? 4.863   4.798   8.190   1.00 0.89 ? 5   ILE A HG13 3  
ATOM   2778  H HG21 . ILE A 1 5  ? 4.445   5.650   4.591   1.00 0.99 ? 5   ILE A HG21 3  
ATOM   2779  H HG22 . ILE A 1 5  ? 6.025   6.416   4.426   1.00 0.98 ? 5   ILE A HG22 3  
ATOM   2780  H HG23 . ILE A 1 5  ? 4.758   7.203   5.368   1.00 0.91 ? 5   ILE A HG23 3  
ATOM   2781  H HD11 . ILE A 1 5  ? 3.496   7.159   6.922   1.00 0.92 ? 5   ILE A HD11 3  
ATOM   2782  H HD12 . ILE A 1 5  ? 4.589   7.210   8.304   1.00 0.99 ? 5   ILE A HD12 3  
ATOM   2783  H HD13 . ILE A 1 5  ? 3.036   6.385   8.438   1.00 1.11 ? 5   ILE A HD13 3  
ATOM   2784  N N    . LYS A 1 6  ? 8.736   3.899   6.073   1.00 0.44 ? 6   LYS A N    3  
ATOM   2785  C CA   . LYS A 1 6  ? 10.117  4.050   5.622   1.00 0.45 ? 6   LYS A CA   3  
ATOM   2786  C C    . LYS A 1 6  ? 10.693  2.717   5.152   1.00 0.41 ? 6   LYS A C    3  
ATOM   2787  O O    . LYS A 1 6  ? 11.511  2.681   4.231   1.00 0.42 ? 6   LYS A O    3  
ATOM   2788  C CB   . LYS A 1 6  ? 10.988  4.627   6.737   1.00 0.52 ? 6   LYS A CB   3  
ATOM   2789  C CG   . LYS A 1 6  ? 10.825  6.128   6.931   1.00 0.78 ? 6   LYS A CG   3  
ATOM   2790  C CD   . LYS A 1 6  ? 11.264  6.914   5.701   1.00 1.08 ? 6   LYS A CD   3  
ATOM   2791  C CE   . LYS A 1 6  ? 12.731  6.678   5.372   1.00 1.30 ? 6   LYS A CE   3  
ATOM   2792  N NZ   . LYS A 1 6  ? 13.167  7.468   4.188   1.00 1.91 ? 6   LYS A NZ   3  
ATOM   2793  H H    . LYS A 1 6  ? 8.557   3.411   6.903   1.00 0.51 ? 6   LYS A H    3  
ATOM   2794  H HA   . LYS A 1 6  ? 10.115  4.734   4.788   1.00 0.46 ? 6   LYS A HA   3  
ATOM   2795  H HB2  . LYS A 1 6  ? 10.733  4.138   7.665   1.00 0.72 ? 6   LYS A HB2  3  
ATOM   2796  H HB3  . LYS A 1 6  ? 12.024  4.426   6.510   1.00 0.62 ? 6   LYS A HB3  3  
ATOM   2797  H HG2  . LYS A 1 6  ? 9.785   6.344   7.128   1.00 1.09 ? 6   LYS A HG2  3  
ATOM   2798  H HG3  . LYS A 1 6  ? 11.422  6.438   7.776   1.00 0.83 ? 6   LYS A HG3  3  
ATOM   2799  H HD2  . LYS A 1 6  ? 10.665  6.610   4.858   1.00 1.25 ? 6   LYS A HD2  3  
ATOM   2800  H HD3  . LYS A 1 6  ? 11.113  7.968   5.887   1.00 1.41 ? 6   LYS A HD3  3  
ATOM   2801  H HE2  . LYS A 1 6  ? 13.329  6.965   6.223   1.00 1.39 ? 6   LYS A HE2  3  
ATOM   2802  H HE3  . LYS A 1 6  ? 12.878  5.628   5.167   1.00 1.37 ? 6   LYS A HE3  3  
ATOM   2803  H HZ1  . LYS A 1 6  ? 14.166  7.275   3.978   1.00 2.23 ? 6   LYS A HZ1  3  
ATOM   2804  H HZ2  . LYS A 1 6  ? 13.052  8.484   4.373   1.00 2.11 ? 6   LYS A HZ2  3  
ATOM   2805  H HZ3  . LYS A 1 6  ? 12.594  7.212   3.357   1.00 2.10 ? 6   LYS A HZ3  3  
ATOM   2806  N N    . VAL A 1 7  ? 10.266  1.623   5.787   1.00 0.40 ? 7   VAL A N    3  
ATOM   2807  C CA   . VAL A 1 7  ? 10.740  0.295   5.420   1.00 0.41 ? 7   VAL A CA   3  
ATOM   2808  C C    . VAL A 1 7  ? 10.186  -0.132  4.064   1.00 0.37 ? 7   VAL A C    3  
ATOM   2809  O O    . VAL A 1 7  ? 10.784  -0.953  3.370   1.00 0.41 ? 7   VAL A O    3  
ATOM   2810  C CB   . VAL A 1 7  ? 10.343  -0.755  6.475   1.00 0.46 ? 7   VAL A CB   3  
ATOM   2811  C CG1  . VAL A 1 7  ? 11.020  -2.085  6.186   1.00 0.52 ? 7   VAL A CG1  3  
ATOM   2812  C CG2  . VAL A 1 7  ? 10.692  -0.261  7.872   1.00 0.53 ? 7   VAL A CG2  3  
ATOM   2813  H H    . VAL A 1 7  ? 9.621   1.716   6.518   1.00 0.42 ? 7   VAL A H    3  
ATOM   2814  H HA   . VAL A 1 7  ? 11.819  0.328   5.363   1.00 0.46 ? 7   VAL A HA   3  
ATOM   2815  H HB   . VAL A 1 7  ? 9.274   -0.900  6.425   1.00 0.44 ? 7   VAL A HB   3  
ATOM   2816  H HG11 . VAL A 1 7  ? 12.092  -1.963  6.233   1.00 0.57 ? 7   VAL A HG11 3  
ATOM   2817  H HG12 . VAL A 1 7  ? 10.739  -2.425  5.199   1.00 0.49 ? 7   VAL A HG12 3  
ATOM   2818  H HG13 . VAL A 1 7  ? 10.709  -2.816  6.918   1.00 0.56 ? 7   VAL A HG13 3  
ATOM   2819  H HG21 . VAL A 1 7  ? 10.153  0.652   8.077   1.00 0.51 ? 7   VAL A HG21 3  
ATOM   2820  H HG22 . VAL A 1 7  ? 11.754  -0.074  7.933   1.00 0.57 ? 7   VAL A HG22 3  
ATOM   2821  H HG23 . VAL A 1 7  ? 10.417  -1.013  8.598   1.00 0.58 ? 7   VAL A HG23 3  
ATOM   2822  N N    . ILE A 1 8  ? 9.037   0.434   3.699   1.00 0.34 ? 8   ILE A N    3  
ATOM   2823  C CA   . ILE A 1 8  ? 8.395   0.122   2.426   1.00 0.36 ? 8   ILE A CA   3  
ATOM   2824  C C    . ILE A 1 8  ? 8.740   1.177   1.372   1.00 0.34 ? 8   ILE A C    3  
ATOM   2825  O O    . ILE A 1 8  ? 8.712   0.900   0.172   1.00 0.34 ? 8   ILE A O    3  
ATOM   2826  C CB   . ILE A 1 8  ? 6.857   0.024   2.580   1.00 0.43 ? 8   ILE A CB   3  
ATOM   2827  C CG1  . ILE A 1 8  ? 6.490   -0.925  3.729   1.00 0.57 ? 8   ILE A CG1  3  
ATOM   2828  C CG2  . ILE A 1 8  ? 6.210   -0.441  1.281   1.00 0.61 ? 8   ILE A CG2  3  
ATOM   2829  C CD1  . ILE A 1 8  ? 6.959   -2.351  3.527   1.00 0.78 ? 8   ILE A CD1  3  
ATOM   2830  H H    . ILE A 1 8  ? 8.610   1.077   4.303   1.00 0.34 ? 8   ILE A H    3  
ATOM   2831  H HA   . ILE A 1 8  ? 8.765   -0.837  2.094   1.00 0.39 ? 8   ILE A HA   3  
ATOM   2832  H HB   . ILE A 1 8  ? 6.479   1.011   2.805   1.00 0.58 ? 8   ILE A HB   3  
ATOM   2833  H HG12 . ILE A 1 8  ? 6.935   -0.560  4.643   1.00 0.73 ? 8   ILE A HG12 3  
ATOM   2834  H HG13 . ILE A 1 8  ? 5.415   -0.941  3.842   1.00 0.61 ? 8   ILE A HG13 3  
ATOM   2835  H HG21 . ILE A 1 8  ? 5.142   -0.524  1.421   1.00 1.01 ? 8   ILE A HG21 3  
ATOM   2836  H HG22 . ILE A 1 8  ? 6.612   -1.405  1.003   1.00 1.07 ? 8   ILE A HG22 3  
ATOM   2837  H HG23 . ILE A 1 8  ? 6.418   0.274   0.499   1.00 1.06 ? 8   ILE A HG23 3  
ATOM   2838  H HD11 . ILE A 1 8  ? 8.038   -2.379  3.525   1.00 0.95 ? 8   ILE A HD11 3  
ATOM   2839  H HD12 . ILE A 1 8  ? 6.587   -2.722  2.583   1.00 0.89 ? 8   ILE A HD12 3  
ATOM   2840  H HD13 . ILE A 1 8  ? 6.584   -2.970  4.329   1.00 1.07 ? 8   ILE A HD13 3  
ATOM   2841  N N    . SER A 1 9  ? 9.084   2.383   1.827   1.00 0.36 ? 9   SER A N    3  
ATOM   2842  C CA   . SER A 1 9  ? 9.437   3.474   0.918   1.00 0.37 ? 9   SER A CA   3  
ATOM   2843  C C    . SER A 1 9  ? 10.780  3.207   0.243   1.00 0.35 ? 9   SER A C    3  
ATOM   2844  O O    . SER A 1 9  ? 10.968  3.530   -0.928  1.00 0.36 ? 9   SER A O    3  
ATOM   2845  C CB   . SER A 1 9  ? 9.487   4.804   1.670   1.00 0.43 ? 9   SER A CB   3  
ATOM   2846  O OG   . SER A 1 9  ? 9.611   5.893   0.774   1.00 0.49 ? 9   SER A OG   3  
ATOM   2847  H H    . SER A 1 9  ? 9.103   2.542   2.794   1.00 0.38 ? 9   SER A H    3  
ATOM   2848  H HA   . SER A 1 9  ? 8.672   3.529   0.158   1.00 0.39 ? 9   SER A HA   3  
ATOM   2849  H HB2  . SER A 1 9  ? 8.580   4.926   2.242   1.00 0.45 ? 9   SER A HB2  3  
ATOM   2850  H HB3  . SER A 1 9  ? 10.336  4.804   2.337   1.00 0.44 ? 9   SER A HB3  3  
ATOM   2851  H HG   . SER A 1 9  ? 9.631   5.565   -0.129  1.00 0.81 ? 9   SER A HG   3  
ATOM   2852  N N    . SER A 1 10 ? 11.708  2.615   0.990   1.00 0.36 ? 10  SER A N    3  
ATOM   2853  C CA   . SER A 1 10 ? 13.028  2.293   0.459   1.00 0.37 ? 10  SER A CA   3  
ATOM   2854  C C    . SER A 1 10 ? 12.969  1.014   -0.371  1.00 0.35 ? 10  SER A C    3  
ATOM   2855  O O    . SER A 1 10 ? 13.819  0.774   -1.230  1.00 0.35 ? 10  SER A O    3  
ATOM   2856  C CB   . SER A 1 10 ? 14.036  2.131   1.601   1.00 0.43 ? 10  SER A CB   3  
ATOM   2857  O OG   . SER A 1 10 ? 15.354  1.985   1.103   1.00 0.46 ? 10  SER A OG   3  
ATOM   2858  H H    . SER A 1 10 ? 11.499  2.388   1.920   1.00 0.38 ? 10  SER A H    3  
ATOM   2859  H HA   . SER A 1 10 ? 13.340  3.108   -0.176  1.00 0.37 ? 10  SER A HA   3  
ATOM   2860  H HB2  . SER A 1 10 ? 13.999  3.002   2.237   1.00 0.45 ? 10  SER A HB2  3  
ATOM   2861  H HB3  . SER A 1 10 ? 13.783  1.254   2.179   1.00 0.44 ? 10  SER A HB3  3  
ATOM   2862  H HG   . SER A 1 10 ? 15.322  1.747   0.173   1.00 0.67 ? 10  SER A HG   3  
ATOM   2863  N N    . ALA A 1 11 ? 11.950  0.201   -0.104  1.00 0.35 ? 11  ALA A N    3  
ATOM   2864  C CA   . ALA A 1 11 ? 11.755  -1.059  -0.814  1.00 0.36 ? 11  ALA A CA   3  
ATOM   2865  C C    . ALA A 1 11 ? 11.247  -0.815  -2.233  1.00 0.31 ? 11  ALA A C    3  
ATOM   2866  O O    . ALA A 1 11 ? 11.785  -1.364  -3.193  1.00 0.33 ? 11  ALA A O    3  
ATOM   2867  C CB   . ALA A 1 11 ? 10.783  -1.953  -0.054  1.00 0.40 ? 11  ALA A CB   3  
ATOM   2868  H H    . ALA A 1 11 ? 11.308  0.458   0.591   1.00 0.36 ? 11  ALA A H    3  
ATOM   2869  H HA   . ALA A 1 11 ? 12.708  -1.564  -0.865  1.00 0.39 ? 11  ALA A HA   3  
ATOM   2870  H HB1  . ALA A 1 11 ? 9.813   -1.480  -0.019  1.00 0.38 ? 11  ALA A HB1  3  
ATOM   2871  H HB2  . ALA A 1 11 ? 11.146  -2.105  0.951   1.00 0.44 ? 11  ALA A HB2  3  
ATOM   2872  H HB3  . ALA A 1 11 ? 10.702  -2.905  -0.556  1.00 0.42 ? 11  ALA A HB3  3  
ATOM   2873  N N    . CYS A 1 12 ? 10.224  0.035   -2.354  1.00 0.28 ? 12  CYS A N    3  
ATOM   2874  C CA   . CYS A 1 12 ? 9.632   0.359   -3.652  1.00 0.26 ? 12  CYS A CA   3  
ATOM   2875  C C    . CYS A 1 12 ? 10.576  1.205   -4.508  1.00 0.25 ? 12  CYS A C    3  
ATOM   2876  O O    . CYS A 1 12 ? 10.361  1.359   -5.707  1.00 0.26 ? 12  CYS A O    3  
ATOM   2877  C CB   . CYS A 1 12 ? 8.294   1.081   -3.468  1.00 0.28 ? 12  CYS A CB   3  
ATOM   2878  S SG   . CYS A 1 12 ? 8.405   2.641   -2.562  1.00 0.26 ? 12  CYS A SG   3  
ATOM   2879  H H    . CYS A 1 12 ? 9.856   0.454   -1.547  1.00 0.29 ? 12  CYS A H    3  
ATOM   2880  H HA   . CYS A 1 12 ? 9.452   -0.574  -4.166  1.00 0.29 ? 12  CYS A HA   3  
ATOM   2881  H HB2  . CYS A 1 12 ? 7.876   1.297   -4.439  1.00 0.29 ? 12  CYS A HB2  3  
ATOM   2882  H HB3  . CYS A 1 12 ? 7.618   0.434   -2.927  1.00 0.34 ? 12  CYS A HB3  3  
ATOM   2883  H HG   . CYS A 1 12 ? 9.544   3.230   -2.897  1.00 1.12 ? 12  CYS A HG   3  
ATOM   2884  N N    . LYS A 1 13 ? 11.620  1.756   -3.890  1.00 0.25 ? 13  LYS A N    3  
ATOM   2885  C CA   . LYS A 1 13 ? 12.600  2.563   -4.614  1.00 0.26 ? 13  LYS A CA   3  
ATOM   2886  C C    . LYS A 1 13 ? 13.593  1.662   -5.347  1.00 0.31 ? 13  LYS A C    3  
ATOM   2887  O O    . LYS A 1 13 ? 14.425  2.135   -6.122  1.00 0.35 ? 13  LYS A O    3  
ATOM   2888  C CB   . LYS A 1 13 ? 13.350  3.487   -3.651  1.00 0.29 ? 13  LYS A CB   3  
ATOM   2889  C CG   . LYS A 1 13 ? 12.618  4.785   -3.344  1.00 0.79 ? 13  LYS A CG   3  
ATOM   2890  C CD   . LYS A 1 13 ? 12.675  5.749   -4.519  1.00 1.28 ? 13  LYS A CD   3  
ATOM   2891  C CE   . LYS A 1 13 ? 11.984  7.065   -4.197  1.00 1.89 ? 13  LYS A CE   3  
ATOM   2892  N NZ   . LYS A 1 13 ? 11.933  7.967   -5.380  1.00 2.67 ? 13  LYS A NZ   3  
ATOM   2893  H H    . LYS A 1 13 ? 11.734  1.615   -2.927  1.00 0.28 ? 13  LYS A H    3  
ATOM   2894  H HA   . LYS A 1 13 ? 12.068  3.161   -5.339  1.00 0.25 ? 13  LYS A HA   3  
ATOM   2895  H HB2  . LYS A 1 13 ? 13.508  2.963   -2.720  1.00 0.60 ? 13  LYS A HB2  3  
ATOM   2896  H HB3  . LYS A 1 13 ? 14.309  3.734   -4.081  1.00 0.66 ? 13  LYS A HB3  3  
ATOM   2897  H HG2  . LYS A 1 13 ? 11.584  4.562   -3.125  1.00 1.52 ? 13  LYS A HG2  3  
ATOM   2898  H HG3  . LYS A 1 13 ? 13.077  5.251   -2.485  1.00 0.94 ? 13  LYS A HG3  3  
ATOM   2899  H HD2  . LYS A 1 13 ? 13.708  5.948   -4.759  1.00 1.26 ? 13  LYS A HD2  3  
ATOM   2900  H HD3  . LYS A 1 13 ? 12.187  5.295   -5.369  1.00 1.89 ? 13  LYS A HD3  3  
ATOM   2901  H HE2  . LYS A 1 13 ? 10.975  6.858   -3.870  1.00 2.36 ? 13  LYS A HE2  3  
ATOM   2902  H HE3  . LYS A 1 13 ? 12.525  7.557   -3.403  1.00 1.74 ? 13  LYS A HE3  3  
ATOM   2903  H HZ1  . LYS A 1 13 ? 12.897  8.182   -5.706  1.00 2.68 ? 13  LYS A HZ1  3  
ATOM   2904  H HZ2  . LYS A 1 13 ? 11.458  8.858   -5.130  1.00 3.10 ? 13  LYS A HZ2  3  
ATOM   2905  H HZ3  . LYS A 1 13 ? 11.409  7.512   -6.154  1.00 3.07 ? 13  LYS A HZ3  3  
ATOM   2906  N N    . THR A 1 14 ? 13.487  0.360   -5.097  1.00 0.33 ? 14  THR A N    3  
ATOM   2907  C CA   . THR A 1 14 ? 14.368  -0.625  -5.710  1.00 0.39 ? 14  THR A CA   3  
ATOM   2908  C C    . THR A 1 14 ? 13.594  -1.552  -6.640  1.00 0.41 ? 14  THR A C    3  
ATOM   2909  O O    . THR A 1 14 ? 14.184  -2.311  -7.409  1.00 0.46 ? 14  THR A O    3  
ATOM   2910  C CB   . THR A 1 14 ? 15.090  -1.473  -4.645  1.00 0.43 ? 14  THR A CB   3  
ATOM   2911  O OG1  . THR A 1 14 ? 15.718  -0.619  -3.683  1.00 0.44 ? 14  THR A OG1  3  
ATOM   2912  C CG2  . THR A 1 14 ? 16.132  -2.374  -5.288  1.00 0.50 ? 14  THR A CG2  3  
ATOM   2913  H H    . THR A 1 14 ? 12.792  0.053   -4.476  1.00 0.32 ? 14  THR A H    3  
ATOM   2914  H HA   . THR A 1 14 ? 15.113  -0.094  -6.284  1.00 0.41 ? 14  THR A HA   3  
ATOM   2915  H HB   . THR A 1 14 ? 14.360  -2.092  -4.143  1.00 0.42 ? 14  THR A HB   3  
ATOM   2916  H HG1  . THR A 1 14 ? 15.085  -0.385  -3.001  1.00 0.42 ? 14  THR A HG1  3  
ATOM   2917  H HG21 . THR A 1 14 ? 15.654  -3.018  -6.011  1.00 0.50 ? 14  THR A HG21 3  
ATOM   2918  H HG22 . THR A 1 14 ? 16.607  -2.977  -4.527  1.00 0.53 ? 14  THR A HG22 3  
ATOM   2919  H HG23 . THR A 1 14 ? 16.877  -1.768  -5.783  1.00 0.51 ? 14  THR A HG23 3  
ATOM   2920  N N    . TYR A 1 15 ? 12.268  -1.482  -6.570  1.00 0.37 ? 15  TYR A N    3  
ATOM   2921  C CA   . TYR A 1 15 ? 11.414  -2.316  -7.406  1.00 0.40 ? 15  TYR A CA   3  
ATOM   2922  C C    . TYR A 1 15 ? 10.595  -1.463  -8.370  1.00 0.39 ? 15  TYR A C    3  
ATOM   2923  O O    . TYR A 1 15 ? 9.881   -1.985  -9.225  1.00 0.43 ? 15  TYR A O    3  
ATOM   2924  C CB   . TYR A 1 15 ? 10.480  -3.160  -6.535  1.00 0.39 ? 15  TYR A CB   3  
ATOM   2925  C CG   . TYR A 1 15 ? 11.194  -4.234  -5.747  1.00 0.43 ? 15  TYR A CG   3  
ATOM   2926  C CD1  . TYR A 1 15 ? 11.111  -4.276  -4.360  1.00 0.41 ? 15  TYR A CD1  3  
ATOM   2927  C CD2  . TYR A 1 15 ? 11.954  -5.204  -6.387  1.00 0.49 ? 15  TYR A CD2  3  
ATOM   2928  C CE1  . TYR A 1 15 ? 11.762  -5.255  -3.635  1.00 0.46 ? 15  TYR A CE1  3  
ATOM   2929  C CE2  . TYR A 1 15 ? 12.607  -6.188  -5.671  1.00 0.52 ? 15  TYR A CE2  3  
ATOM   2930  C CZ   . TYR A 1 15 ? 12.508  -6.210  -4.294  1.00 0.51 ? 15  TYR A CZ   3  
ATOM   2931  O OH   . TYR A 1 15 ? 13.159  -7.187  -3.577  1.00 0.56 ? 15  TYR A OH   3  
ATOM   2932  H H    . TYR A 1 15 ? 11.855  -0.855  -5.940  1.00 0.33 ? 15  TYR A H    3  
ATOM   2933  H HA   . TYR A 1 15 ? 12.051  -2.974  -7.978  1.00 0.45 ? 15  TYR A HA   3  
ATOM   2934  H HB2  . TYR A 1 15 ? 9.974   -2.516  -5.833  1.00 0.35 ? 15  TYR A HB2  3  
ATOM   2935  H HB3  . TYR A 1 15 ? 9.749   -3.642  -7.167  1.00 0.42 ? 15  TYR A HB3  3  
ATOM   2936  H HD1  . TYR A 1 15 ? 10.524  -3.529  -3.846  1.00 0.38 ? 15  TYR A HD1  3  
ATOM   2937  H HD2  . TYR A 1 15 ? 12.030  -5.185  -7.464  1.00 0.51 ? 15  TYR A HD2  3  
ATOM   2938  H HE1  . TYR A 1 15 ? 11.684  -5.271  -2.559  1.00 0.47 ? 15  TYR A HE1  3  
ATOM   2939  H HE2  . TYR A 1 15 ? 13.191  -6.936  -6.189  1.00 0.57 ? 15  TYR A HE2  3  
ATOM   2940  H HH   . TYR A 1 15 ? 12.575  -7.531  -2.897  1.00 0.57 ? 15  TYR A HH   3  
ATOM   2941  N N    . CYS A 1 16 ? 10.706  -0.147  -8.225  1.00 0.35 ? 16  CYS A N    3  
ATOM   2942  C CA   . CYS A 1 16 ? 9.977   0.781   -9.082  1.00 0.36 ? 16  CYS A CA   3  
ATOM   2943  C C    . CYS A 1 16 ? 10.863  1.953   -9.492  1.00 0.37 ? 16  CYS A C    3  
ATOM   2944  O O    . CYS A 1 16 ? 10.947  2.298   -10.671 1.00 0.42 ? 16  CYS A O    3  
ATOM   2945  C CB   . CYS A 1 16 ? 8.728   1.297   -8.364  1.00 0.32 ? 16  CYS A CB   3  
ATOM   2946  S SG   . CYS A 1 16 ? 7.780   0.011   -7.516  1.00 0.32 ? 16  CYS A SG   3  
ATOM   2947  H H    . CYS A 1 16 ? 11.291  0.209   -7.525  1.00 0.33 ? 16  CYS A H    3  
ATOM   2948  H HA   . CYS A 1 16 ? 9.676   0.246   -9.970  1.00 0.41 ? 16  CYS A HA   3  
ATOM   2949  H HB2  . CYS A 1 16 ? 9.023   2.028   -7.626  1.00 0.28 ? 16  CYS A HB2  3  
ATOM   2950  H HB3  . CYS A 1 16 ? 8.075   1.767   -9.085  1.00 0.35 ? 16  CYS A HB3  3  
ATOM   2951  H HG   . CYS A 1 16 ? 8.150   0.002   -6.244  1.00 0.27 ? 16  CYS A HG   3  
ATOM   2952  N N    . GLY A 1 17 ? 11.521  2.562   -8.512  1.00 0.33 ? 17  GLY A N    3  
ATOM   2953  C CA   . GLY A 1 17 ? 12.392  3.691   -8.792  1.00 0.34 ? 17  GLY A CA   3  
ATOM   2954  C C    . GLY A 1 17 ? 11.716  5.021   -8.531  1.00 0.32 ? 17  GLY A C    3  
ATOM   2955  O O    . GLY A 1 17 ? 11.162  5.246   -7.454  1.00 0.27 ? 17  GLY A O    3  
ATOM   2956  H H    . GLY A 1 17 ? 11.415  2.244   -7.591  1.00 0.29 ? 17  GLY A H    3  
ATOM   2957  H HA2  . GLY A 1 17 ? 13.270  3.617   -8.167  1.00 0.34 ? 17  GLY A HA2  3  
ATOM   2958  H HA3  . GLY A 1 17 ? 12.694  3.650   -9.828  1.00 0.39 ? 17  GLY A HA3  3  
ATOM   2959  N N    . LYS A 1 18 ? 11.762  5.909   -9.517  1.00 0.36 ? 18  LYS A N    3  
ATOM   2960  C CA   . LYS A 1 18 ? 11.150  7.228   -9.391  1.00 0.36 ? 18  LYS A CA   3  
ATOM   2961  C C    . LYS A 1 18 ? 9.631   7.133   -9.475  1.00 0.36 ? 18  LYS A C    3  
ATOM   2962  O O    . LYS A 1 18 ? 8.915   8.023   -9.016  1.00 0.36 ? 18  LYS A O    3  
ATOM   2963  C CB   . LYS A 1 18 ? 11.674  8.164   -10.484 1.00 0.43 ? 18  LYS A CB   3  
ATOM   2964  C CG   . LYS A 1 18 ? 11.558  7.588   -11.883 1.00 0.48 ? 18  LYS A CG   3  
ATOM   2965  C CD   . LYS A 1 18 ? 12.906  7.122   -12.410 1.00 0.52 ? 18  LYS A CD   3  
ATOM   2966  C CE   . LYS A 1 18 ? 13.454  8.075   -13.460 1.00 0.58 ? 18  LYS A CE   3  
ATOM   2967  N NZ   . LYS A 1 18 ? 14.877  8.431   -13.197 1.00 0.59 ? 18  LYS A NZ   3  
ATOM   2968  H H    . LYS A 1 18 ? 12.219  5.672   -10.352 1.00 0.40 ? 18  LYS A H    3  
ATOM   2969  H HA   . LYS A 1 18 ? 11.421  7.628   -8.425  1.00 0.34 ? 18  LYS A HA   3  
ATOM   2970  H HB2  . LYS A 1 18 ? 11.114  9.087   -10.450 1.00 0.43 ? 18  LYS A HB2  3  
ATOM   2971  H HB3  . LYS A 1 18 ? 12.715  8.378   -10.289 1.00 0.43 ? 18  LYS A HB3  3  
ATOM   2972  H HG2  . LYS A 1 18 ? 10.882  6.746   -11.861 1.00 0.47 ? 18  LYS A HG2  3  
ATOM   2973  H HG3  . LYS A 1 18 ? 11.166  8.348   -12.544 1.00 0.52 ? 18  LYS A HG3  3  
ATOM   2974  H HD2  . LYS A 1 18 ? 13.604  7.067   -11.588 1.00 0.49 ? 18  LYS A HD2  3  
ATOM   2975  H HD3  . LYS A 1 18 ? 12.790  6.143   -12.850 1.00 0.53 ? 18  LYS A HD3  3  
ATOM   2976  H HE2  . LYS A 1 18 ? 13.384  7.604   -14.429 1.00 0.62 ? 18  LYS A HE2  3  
ATOM   2977  H HE3  . LYS A 1 18 ? 12.860  8.978   -13.456 1.00 0.58 ? 18  LYS A HE3  3  
ATOM   2978  H HZ1  . LYS A 1 18 ? 15.467  7.575   -13.202 1.00 0.60 ? 18  LYS A HZ1  3  
ATOM   2979  H HZ2  . LYS A 1 18 ? 14.964  8.893   -12.269 1.00 0.56 ? 18  LYS A HZ2  3  
ATOM   2980  H HZ3  . LYS A 1 18 ? 15.224  9.084   -13.929 1.00 0.64 ? 18  LYS A HZ3  3  
ATOM   2981  N N    . THR A 1 19 ? 9.142   6.045   -10.064 1.00 0.37 ? 19  THR A N    3  
ATOM   2982  C CA   . THR A 1 19 ? 7.707   5.833   -10.207 1.00 0.39 ? 19  THR A CA   3  
ATOM   2983  C C    . THR A 1 19 ? 7.065   5.490   -8.869  1.00 0.33 ? 19  THR A C    3  
ATOM   2984  O O    . THR A 1 19 ? 5.861   5.668   -8.683  1.00 0.43 ? 19  THR A O    3  
ATOM   2985  C CB   . THR A 1 19 ? 7.404   4.706   -11.214 1.00 0.46 ? 19  THR A CB   3  
ATOM   2986  O OG1  . THR A 1 19 ? 7.596   3.431   -10.592 1.00 0.53 ? 19  THR A OG1  3  
ATOM   2987  C CG2  . THR A 1 19 ? 8.299   4.819   -12.438 1.00 0.61 ? 19  THR A CG2  3  
ATOM   2988  H H    . THR A 1 19 ? 9.761   5.370   -10.410 1.00 0.39 ? 19  THR A H    3  
ATOM   2989  H HA   . THR A 1 19 ? 7.271   6.748   -10.580 1.00 0.42 ? 19  THR A HA   3  
ATOM   2990  H HB   . THR A 1 19 ? 6.373   4.794   -11.529 1.00 0.49 ? 19  THR A HB   3  
ATOM   2991  H HG1  . THR A 1 19 ? 8.014   2.831   -11.214 1.00 0.54 ? 19  THR A HG1  3  
ATOM   2992  H HG21 . THR A 1 19 ? 8.044   4.042   -13.144 1.00 0.66 ? 19  THR A HG21 3  
ATOM   2993  H HG22 . THR A 1 19 ? 9.332   4.710   -12.141 1.00 0.68 ? 19  THR A HG22 3  
ATOM   2994  H HG23 . THR A 1 19 ? 8.158   5.785   -12.901 1.00 0.69 ? 19  THR A HG23 3  
ATOM   2995  N N    . SER A 1 20 ? 7.892   5.021   -7.925  1.00 0.30 ? 20  SER A N    3  
ATOM   2996  C CA   . SER A 1 20 ? 7.435   4.626   -6.586  1.00 0.24 ? 20  SER A CA   3  
ATOM   2997  C C    . SER A 1 20 ? 6.612   5.723   -5.902  1.00 0.22 ? 20  SER A C    3  
ATOM   2998  O O    . SER A 1 20 ? 6.792   6.910   -6.178  1.00 0.26 ? 20  SER A O    3  
ATOM   2999  C CB   . SER A 1 20 ? 8.641   4.268   -5.714  1.00 0.22 ? 20  SER A CB   3  
ATOM   3000  O OG   . SER A 1 20 ? 9.334   5.429   -5.295  1.00 0.25 ? 20  SER A OG   3  
ATOM   3001  H H    . SER A 1 20 ? 8.846   4.943   -8.136  1.00 0.38 ? 20  SER A H    3  
ATOM   3002  H HA   . SER A 1 20 ? 6.817   3.750   -6.697  1.00 0.26 ? 20  SER A HA   3  
ATOM   3003  H HB2  . SER A 1 20 ? 8.306   3.730   -4.840  1.00 0.26 ? 20  SER A HB2  3  
ATOM   3004  H HB3  . SER A 1 20 ? 9.318   3.646   -6.281  1.00 0.24 ? 20  SER A HB3  3  
ATOM   3005  H HG   . SER A 1 20 ? 8.702   6.086   -4.991  1.00 0.41 ? 20  SER A HG   3  
ATOM   3006  N N    . PRO A 1 21 ? 5.703   5.329   -4.985  1.00 0.20 ? 21  PRO A N    3  
ATOM   3007  C CA   . PRO A 1 21 ? 4.846   6.275   -4.260  1.00 0.22 ? 21  PRO A CA   3  
ATOM   3008  C C    . PRO A 1 21 ? 5.634   7.135   -3.277  1.00 0.22 ? 21  PRO A C    3  
ATOM   3009  O O    . PRO A 1 21 ? 6.774   6.817   -2.927  1.00 0.24 ? 21  PRO A O    3  
ATOM   3010  C CB   . PRO A 1 21 ? 3.866   5.367   -3.513  1.00 0.23 ? 21  PRO A CB   3  
ATOM   3011  C CG   . PRO A 1 21 ? 4.580   4.074   -3.358  1.00 0.21 ? 21  PRO A CG   3  
ATOM   3012  C CD   . PRO A 1 21 ? 5.446   3.932   -4.577  1.00 0.20 ? 21  PRO A CD   3  
ATOM   3013  H HA   . PRO A 1 21 ? 4.303   6.916   -4.939  1.00 0.26 ? 21  PRO A HA   3  
ATOM   3014  H HB2  . PRO A 1 21 ? 3.625   5.798   -2.550  1.00 0.25 ? 21  PRO A HB2  3  
ATOM   3015  H HB3  . PRO A 1 21 ? 2.969   5.229   -4.096  1.00 0.26 ? 21  PRO A HB3  3  
ATOM   3016  H HG2  . PRO A 1 21 ? 5.186   4.096   -2.464  1.00 0.21 ? 21  PRO A HG2  3  
ATOM   3017  H HG3  . PRO A 1 21 ? 3.871   3.262   -3.316  1.00 0.24 ? 21  PRO A HG3  3  
ATOM   3018  H HD2  . PRO A 1 21 ? 6.368   3.428   -4.327  1.00 0.21 ? 21  PRO A HD2  3  
ATOM   3019  H HD3  . PRO A 1 21 ? 4.922   3.397   -5.352  1.00 0.24 ? 21  PRO A HD3  3  
ATOM   3020  N N    . SER A 1 22 ? 5.018   8.222   -2.831  1.00 0.24 ? 22  SER A N    3  
ATOM   3021  C CA   . SER A 1 22 ? 5.659   9.138   -1.898  1.00 0.26 ? 22  SER A CA   3  
ATOM   3022  C C    . SER A 1 22 ? 5.328   8.786   -0.452  1.00 0.23 ? 22  SER A C    3  
ATOM   3023  O O    . SER A 1 22 ? 4.471   7.940   -0.184  1.00 0.23 ? 22  SER A O    3  
ATOM   3024  C CB   . SER A 1 22 ? 5.223   10.575  -2.192  1.00 0.31 ? 22  SER A CB   3  
ATOM   3025  O OG   . SER A 1 22 ? 3.810   10.693  -2.176  1.00 0.32 ? 22  SER A OG   3  
ATOM   3026  H H    . SER A 1 22 ? 4.107   8.412   -3.136  1.00 0.26 ? 22  SER A H    3  
ATOM   3027  H HA   . SER A 1 22 ? 6.728   9.063   -2.039  1.00 0.29 ? 22  SER A HA   3  
ATOM   3028  H HB2  . SER A 1 22 ? 5.632   11.232  -1.440  1.00 0.34 ? 22  SER A HB2  3  
ATOM   3029  H HB3  . SER A 1 22 ? 5.588   10.868  -3.165  1.00 0.35 ? 22  SER A HB3  3  
ATOM   3030  H HG   . SER A 1 22 ? 3.470   10.582  -3.068  1.00 0.54 ? 22  SER A HG   3  
ATOM   3031  N N    . LYS A 1 23 ? 6.020   9.444   0.474   1.00 0.24 ? 23  LYS A N    3  
ATOM   3032  C CA   . LYS A 1 23 ? 5.810   9.233   1.903   1.00 0.25 ? 23  LYS A CA   3  
ATOM   3033  C C    . LYS A 1 23 ? 4.441   9.766   2.326   1.00 0.23 ? 23  LYS A C    3  
ATOM   3034  O O    . LYS A 1 23 ? 3.793   9.211   3.216   1.00 0.26 ? 23  LYS A O    3  
ATOM   3035  C CB   . LYS A 1 23 ? 6.926   9.929   2.690   1.00 0.29 ? 23  LYS A CB   3  
ATOM   3036  C CG   . LYS A 1 23 ? 6.725   9.937   4.197   1.00 0.41 ? 23  LYS A CG   3  
ATOM   3037  C CD   . LYS A 1 23 ? 7.729   10.853  4.878   1.00 0.87 ? 23  LYS A CD   3  
ATOM   3038  C CE   . LYS A 1 23 ? 7.407   11.045  6.350   1.00 1.02 ? 23  LYS A CE   3  
ATOM   3039  N NZ   . LYS A 1 23 ? 8.292   12.062  6.981   1.00 1.62 ? 23  LYS A NZ   3  
ATOM   3040  H H    . LYS A 1 23 ? 6.696   10.095  0.186   1.00 0.26 ? 23  LYS A H    3  
ATOM   3041  H HA   . LYS A 1 23 ? 5.850   8.171   2.093   1.00 0.27 ? 23  LYS A HA   3  
ATOM   3042  H HB2  . LYS A 1 23 ? 7.859   9.428   2.482   1.00 0.35 ? 23  LYS A HB2  3  
ATOM   3043  H HB3  . LYS A 1 23 ? 6.998   10.953  2.355   1.00 0.34 ? 23  LYS A HB3  3  
ATOM   3044  H HG2  . LYS A 1 23 ? 5.726   10.284  4.418   1.00 0.71 ? 23  LYS A HG2  3  
ATOM   3045  H HG3  . LYS A 1 23 ? 6.853   8.933   4.574   1.00 0.67 ? 23  LYS A HG3  3  
ATOM   3046  H HD2  . LYS A 1 23 ? 8.713   10.419  4.792   1.00 1.16 ? 23  LYS A HD2  3  
ATOM   3047  H HD3  . LYS A 1 23 ? 7.714   11.815  4.388   1.00 1.26 ? 23  LYS A HD3  3  
ATOM   3048  H HE2  . LYS A 1 23 ? 6.380   11.367  6.443   1.00 1.11 ? 23  LYS A HE2  3  
ATOM   3049  H HE3  . LYS A 1 23 ? 7.535   10.102  6.861   1.00 1.06 ? 23  LYS A HE3  3  
ATOM   3050  H HZ1  . LYS A 1 23 ? 8.025   12.203  7.977   1.00 1.74 ? 23  LYS A HZ1  3  
ATOM   3051  H HZ2  . LYS A 1 23 ? 8.206   12.970  6.480   1.00 1.95 ? 23  LYS A HZ2  3  
ATOM   3052  H HZ3  . LYS A 1 23 ? 9.283   11.751  6.938   1.00 1.88 ? 23  LYS A HZ3  3  
ATOM   3053  N N    . LYS A 1 24 ? 4.004   10.838  1.667   1.00 0.20 ? 24  LYS A N    3  
ATOM   3054  C CA   . LYS A 1 24 ? 2.713   11.457  1.961   1.00 0.21 ? 24  LYS A CA   3  
ATOM   3055  C C    . LYS A 1 24 ? 1.557   10.624  1.404   1.00 0.20 ? 24  LYS A C    3  
ATOM   3056  O O    . LYS A 1 24 ? 0.446   10.664  1.932   1.00 0.22 ? 24  LYS A O    3  
ATOM   3057  C CB   . LYS A 1 24 ? 2.672   12.873  1.383   1.00 0.24 ? 24  LYS A CB   3  
ATOM   3058  C CG   . LYS A 1 24 ? 3.537   13.864  2.150   1.00 0.43 ? 24  LYS A CG   3  
ATOM   3059  C CD   . LYS A 1 24 ? 4.139   14.916  1.231   1.00 0.79 ? 24  LYS A CD   3  
ATOM   3060  C CE   . LYS A 1 24 ? 5.182   14.311  0.305   1.00 1.35 ? 24  LYS A CE   3  
ATOM   3061  N NZ   . LYS A 1 24 ? 6.217   15.306  -0.091  1.00 2.01 ? 24  LYS A NZ   3  
ATOM   3062  H H    . LYS A 1 24 ? 4.568   11.225  0.966   1.00 0.20 ? 24  LYS A H    3  
ATOM   3063  H HA   . LYS A 1 24 ? 2.612   11.514  3.034   1.00 0.24 ? 24  LYS A HA   3  
ATOM   3064  H HB2  . LYS A 1 24 ? 3.016   12.844  0.361   1.00 0.37 ? 24  LYS A HB2  3  
ATOM   3065  H HB3  . LYS A 1 24 ? 1.652   13.229  1.401   1.00 0.38 ? 24  LYS A HB3  3  
ATOM   3066  H HG2  . LYS A 1 24 ? 2.929   14.358  2.894   1.00 0.80 ? 24  LYS A HG2  3  
ATOM   3067  H HG3  . LYS A 1 24 ? 4.337   13.326  2.637   1.00 0.81 ? 24  LYS A HG3  3  
ATOM   3068  H HD2  . LYS A 1 24 ? 3.351   15.350  0.634   1.00 1.14 ? 24  LYS A HD2  3  
ATOM   3069  H HD3  . LYS A 1 24 ? 4.604   15.683  1.831   1.00 0.95 ? 24  LYS A HD3  3  
ATOM   3070  H HE2  . LYS A 1 24 ? 5.662   13.489  0.812   1.00 1.59 ? 24  LYS A HE2  3  
ATOM   3071  H HE3  . LYS A 1 24 ? 4.688   13.947  -0.584  1.00 1.51 ? 24  LYS A HE3  3  
ATOM   3072  H HZ1  . LYS A 1 24 ? 6.743   15.626  0.747   1.00 2.09 ? 24  LYS A HZ1  3  
ATOM   3073  H HZ2  . LYS A 1 24 ? 5.771   16.128  -0.542  1.00 2.20 ? 24  LYS A HZ2  3  
ATOM   3074  H HZ3  . LYS A 1 24 ? 6.887   14.876  -0.763  1.00 2.49 ? 24  LYS A HZ3  3  
ATOM   3075  N N    . GLU A 1 25 ? 1.826   9.875   0.335   1.00 0.18 ? 25  GLU A N    3  
ATOM   3076  C CA   . GLU A 1 25 ? 0.812   9.024   -0.279  1.00 0.17 ? 25  GLU A CA   3  
ATOM   3077  C C    . GLU A 1 25 ? 0.521   7.808   0.595   1.00 0.16 ? 25  GLU A C    3  
ATOM   3078  O O    . GLU A 1 25 ? -0.599  7.629   1.075   1.00 0.17 ? 25  GLU A O    3  
ATOM   3079  C CB   . GLU A 1 25 ? 1.269   8.570   -1.667  1.00 0.17 ? 25  GLU A CB   3  
ATOM   3080  C CG   . GLU A 1 25 ? 0.403   9.101   -2.797  1.00 0.19 ? 25  GLU A CG   3  
ATOM   3081  C CD   . GLU A 1 25 ? 0.645   8.377   -4.106  1.00 0.18 ? 25  GLU A CD   3  
ATOM   3082  O OE1  . GLU A 1 25 ? 0.444   8.997   -5.173  1.00 0.26 ? 25  GLU A OE1  3  
ATOM   3083  O OE2  . GLU A 1 25 ? 1.032   7.190   -4.067  1.00 0.21 ? 25  GLU A OE2  3  
ATOM   3084  H H    . GLU A 1 25 ? 2.727   9.896   -0.048  1.00 0.18 ? 25  GLU A H    3  
ATOM   3085  H HA   . GLU A 1 25 ? -0.093  9.605   -0.379  1.00 0.17 ? 25  GLU A HA   3  
ATOM   3086  H HB2  . GLU A 1 25 ? 2.281   8.910   -1.829  1.00 0.19 ? 25  GLU A HB2  3  
ATOM   3087  H HB3  . GLU A 1 25 ? 1.251   7.492   -1.704  1.00 0.18 ? 25  GLU A HB3  3  
ATOM   3088  H HG2  . GLU A 1 25 ? -0.635  8.982   -2.524  1.00 0.23 ? 25  GLU A HG2  3  
ATOM   3089  H HG3  . GLU A 1 25 ? 0.619   10.150  -2.937  1.00 0.23 ? 25  GLU A HG3  3  
ATOM   3090  N N    . ILE A 1 26 ? 1.536   6.975   0.797   1.00 0.16 ? 26  ILE A N    3  
ATOM   3091  C CA   . ILE A 1 26 ? 1.389   5.776   1.612   1.00 0.15 ? 26  ILE A CA   3  
ATOM   3092  C C    . ILE A 1 26 ? 0.784   6.107   2.973   1.00 0.15 ? 26  ILE A C    3  
ATOM   3093  O O    . ILE A 1 26 ? -0.143  5.440   3.431   1.00 0.14 ? 26  ILE A O    3  
ATOM   3094  C CB   . ILE A 1 26 ? 2.742   5.070   1.823   1.00 0.16 ? 26  ILE A CB   3  
ATOM   3095  C CG1  . ILE A 1 26 ? 3.338   4.653   0.478   1.00 0.16 ? 26  ILE A CG1  3  
ATOM   3096  C CG2  . ILE A 1 26 ? 2.572   3.861   2.731   1.00 0.15 ? 26  ILE A CG2  3  
ATOM   3097  C CD1  . ILE A 1 26 ? 4.675   3.954   0.602   1.00 0.17 ? 26  ILE A CD1  3  
ATOM   3098  H H    . ILE A 1 26 ? 2.405   7.171   0.388   1.00 0.17 ? 26  ILE A H    3  
ATOM   3099  H HA   . ILE A 1 26 ? 0.729   5.097   1.093   1.00 0.14 ? 26  ILE A HA   3  
ATOM   3100  H HB   . ILE A 1 26 ? 3.413   5.763   2.308   1.00 0.17 ? 26  ILE A HB   3  
ATOM   3101  H HG12 . ILE A 1 26 ? 2.657   3.978   -0.017  1.00 0.15 ? 26  ILE A HG12 3  
ATOM   3102  H HG13 . ILE A 1 26 ? 3.477   5.532   -0.135  1.00 0.16 ? 26  ILE A HG13 3  
ATOM   3103  H HG21 . ILE A 1 26 ? 2.235   4.187   3.705   1.00 0.15 ? 26  ILE A HG21 3  
ATOM   3104  H HG22 . ILE A 1 26 ? 3.517   3.349   2.830   1.00 0.16 ? 26  ILE A HG22 3  
ATOM   3105  H HG23 . ILE A 1 26 ? 1.841   3.190   2.304   1.00 0.14 ? 26  ILE A HG23 3  
ATOM   3106  H HD11 . ILE A 1 26 ? 4.565   3.073   1.217   1.00 0.16 ? 26  ILE A HD11 3  
ATOM   3107  H HD12 . ILE A 1 26 ? 5.391   4.622   1.057   1.00 0.19 ? 26  ILE A HD12 3  
ATOM   3108  H HD13 . ILE A 1 26 ? 5.023   3.666   -0.379  1.00 0.17 ? 26  ILE A HD13 3  
ATOM   3109  N N    . GLY A 1 27 ? 1.315   7.146   3.613   1.00 0.16 ? 27  GLY A N    3  
ATOM   3110  C CA   . GLY A 1 27 ? 0.813   7.549   4.913   1.00 0.16 ? 27  GLY A CA   3  
ATOM   3111  C C    . GLY A 1 27 ? -0.691  7.747   4.921   1.00 0.15 ? 27  GLY A C    3  
ATOM   3112  O O    . GLY A 1 27 ? -1.371  7.359   5.869   1.00 0.15 ? 27  GLY A O    3  
ATOM   3113  H H    . GLY A 1 27 ? 2.051   7.642   3.199   1.00 0.17 ? 27  GLY A H    3  
ATOM   3114  H HA2  . GLY A 1 27 ? 1.068   6.790   5.637   1.00 0.16 ? 27  GLY A HA2  3  
ATOM   3115  H HA3  . GLY A 1 27 ? 1.289   8.476   5.199   1.00 0.17 ? 27  GLY A HA3  3  
ATOM   3116  N N    . ALA A 1 28 ? -1.210  8.354   3.858   1.00 0.15 ? 28  ALA A N    3  
ATOM   3117  C CA   . ALA A 1 28 ? -2.641  8.603   3.746   1.00 0.14 ? 28  ALA A CA   3  
ATOM   3118  C C    . ALA A 1 28 ? -3.401  7.314   3.456   1.00 0.13 ? 28  ALA A C    3  
ATOM   3119  O O    . ALA A 1 28 ? -4.463  7.067   4.027   1.00 0.12 ? 28  ALA A O    3  
ATOM   3120  C CB   . ALA A 1 28 ? -2.915  9.633   2.658   1.00 0.15 ? 28  ALA A CB   3  
ATOM   3121  H H    . ALA A 1 28 ? -0.616  8.642   3.134   1.00 0.16 ? 28  ALA A H    3  
ATOM   3122  H HA   . ALA A 1 28 ? -2.984  9.008   4.687   1.00 0.15 ? 28  ALA A HA   3  
ATOM   3123  H HB1  . ALA A 1 28 ? -3.974  9.847   2.622   1.00 0.14 ? 28  ALA A HB1  3  
ATOM   3124  H HB2  . ALA A 1 28 ? -2.594  9.242   1.703   1.00 0.14 ? 28  ALA A HB2  3  
ATOM   3125  H HB3  . ALA A 1 28 ? -2.372  10.541  2.877   1.00 0.16 ? 28  ALA A HB3  3  
ATOM   3126  N N    . MET A 1 29 ? -2.852  6.495   2.566   1.00 0.13 ? 29  MET A N    3  
ATOM   3127  C CA   . MET A 1 29 ? -3.477  5.230   2.203   1.00 0.11 ? 29  MET A CA   3  
ATOM   3128  C C    . MET A 1 29 ? -3.597  4.313   3.416   1.00 0.11 ? 29  MET A C    3  
ATOM   3129  O O    . MET A 1 29 ? -4.593  3.609   3.580   1.00 0.10 ? 29  MET A O    3  
ATOM   3130  C CB   . MET A 1 29 ? -2.674  4.536   1.101   1.00 0.11 ? 29  MET A CB   3  
ATOM   3131  C CG   . MET A 1 29 ? -3.284  3.221   0.639   1.00 0.10 ? 29  MET A CG   3  
ATOM   3132  S SD   . MET A 1 29 ? -2.039  1.998   0.188   1.00 0.10 ? 29  MET A SD   3  
ATOM   3133  C CE   . MET A 1 29 ? -1.179  1.799   1.746   1.00 0.11 ? 29  MET A CE   3  
ATOM   3134  H H    . MET A 1 29 ? -2.004  6.749   2.143   1.00 0.13 ? 29  MET A H    3  
ATOM   3135  H HA   . MET A 1 29 ? -4.468  5.445   1.833   1.00 0.11 ? 29  MET A HA   3  
ATOM   3136  H HB2  . MET A 1 29 ? -2.608  5.196   0.249   1.00 0.12 ? 29  MET A HB2  3  
ATOM   3137  H HB3  . MET A 1 29 ? -1.679  4.337   1.468   1.00 0.12 ? 29  MET A HB3  3  
ATOM   3138  H HG2  . MET A 1 29 ? -3.887  2.820   1.440   1.00 0.10 ? 29  MET A HG2  3  
ATOM   3139  H HG3  . MET A 1 29 ? -3.910  3.413   -0.220  1.00 0.10 ? 29  MET A HG3  3  
ATOM   3140  H HE1  . MET A 1 29 ? -0.570  2.670   1.936   1.00 0.12 ? 29  MET A HE1  3  
ATOM   3141  H HE2  . MET A 1 29 ? -0.551  0.922   1.702   1.00 0.11 ? 29  MET A HE2  3  
ATOM   3142  H HE3  . MET A 1 29 ? -1.901  1.687   2.541   1.00 0.11 ? 29  MET A HE3  3  
ATOM   3143  N N    . LEU A 1 30 ? -2.573  4.324   4.263   1.00 0.12 ? 30  LEU A N    3  
ATOM   3144  C CA   . LEU A 1 30 ? -2.562  3.493   5.462   1.00 0.12 ? 30  LEU A CA   3  
ATOM   3145  C C    . LEU A 1 30 ? -3.732  3.843   6.376   1.00 0.12 ? 30  LEU A C    3  
ATOM   3146  O O    . LEU A 1 30 ? -4.502  2.969   6.774   1.00 0.11 ? 30  LEU A O    3  
ATOM   3147  C CB   . LEU A 1 30 ? -1.242  3.667   6.214   1.00 0.13 ? 30  LEU A CB   3  
ATOM   3148  C CG   . LEU A 1 30 ? -0.259  2.499   6.124   1.00 0.13 ? 30  LEU A CG   3  
ATOM   3149  C CD1  . LEU A 1 30 ? 0.135   2.242   4.678   1.00 0.13 ? 30  LEU A CD1  3  
ATOM   3150  C CD2  . LEU A 1 30 ? 0.973   2.772   6.975   1.00 0.15 ? 30  LEU A CD2  3  
ATOM   3151  H H    . LEU A 1 30 ? -1.806  4.905   4.077   1.00 0.13 ? 30  LEU A H    3  
ATOM   3152  H HA   . LEU A 1 30 ? -2.657  2.463   5.153   1.00 0.11 ? 30  LEU A HA   3  
ATOM   3153  H HB2  . LEU A 1 30 ? -0.751  4.549   5.829   1.00 0.14 ? 30  LEU A HB2  3  
ATOM   3154  H HB3  . LEU A 1 30 ? -1.470  3.834   7.256   1.00 0.14 ? 30  LEU A HB3  3  
ATOM   3155  H HG   . LEU A 1 30 ? -0.736  1.606   6.502   1.00 0.13 ? 30  LEU A HG   3  
ATOM   3156  H HD11 . LEU A 1 30 ? 0.431   3.173   4.216   1.00 0.13 ? 30  LEU A HD11 3  
ATOM   3157  H HD12 . LEU A 1 30 ? -0.705  1.827   4.146   1.00 0.12 ? 30  LEU A HD12 3  
ATOM   3158  H HD13 . LEU A 1 30 ? 0.961   1.547   4.648   1.00 0.13 ? 30  LEU A HD13 3  
ATOM   3159  H HD21 . LEU A 1 30 ? 1.646   1.929   6.914   1.00 0.15 ? 30  LEU A HD21 3  
ATOM   3160  H HD22 . LEU A 1 30 ? 0.674   2.920   8.003   1.00 0.16 ? 30  LEU A HD22 3  
ATOM   3161  H HD23 . LEU A 1 30 ? 1.472   3.658   6.614   1.00 0.15 ? 30  LEU A HD23 3  
ATOM   3162  N N    . SER A 1 31 ? -3.859  5.125   6.704   1.00 0.13 ? 31  SER A N    3  
ATOM   3163  C CA   . SER A 1 31 ? -4.933  5.590   7.573   1.00 0.13 ? 31  SER A CA   3  
ATOM   3164  C C    . SER A 1 31 ? -6.289  5.119   7.058   1.00 0.12 ? 31  SER A C    3  
ATOM   3165  O O    . SER A 1 31 ? -7.219  4.897   7.834   1.00 0.12 ? 31  SER A O    3  
ATOM   3166  C CB   . SER A 1 31 ? -4.914  7.116   7.673   1.00 0.14 ? 31  SER A CB   3  
ATOM   3167  O OG   . SER A 1 31 ? -6.175  7.617   8.080   1.00 0.14 ? 31  SER A OG   3  
ATOM   3168  H H    . SER A 1 31 ? -3.214  5.774   6.352   1.00 0.13 ? 31  SER A H    3  
ATOM   3169  H HA   . SER A 1 31 ? -4.770  5.171   8.555   1.00 0.13 ? 31  SER A HA   3  
ATOM   3170  H HB2  . SER A 1 31 ? -4.169  7.419   8.394   1.00 0.15 ? 31  SER A HB2  3  
ATOM   3171  H HB3  . SER A 1 31 ? -4.669  7.534   6.707   1.00 0.14 ? 31  SER A HB3  3  
ATOM   3172  H HG   . SER A 1 31 ? -6.714  6.894   8.411   1.00 0.13 ? 31  SER A HG   3  
ATOM   3173  N N    . LEU A 1 32 ? -6.396  4.970   5.741   1.00 0.11 ? 32  LEU A N    3  
ATOM   3174  C CA   . LEU A 1 32 ? -7.639  4.527   5.119   1.00 0.10 ? 32  LEU A CA   3  
ATOM   3175  C C    . LEU A 1 32 ? -7.801  3.014   5.242   1.00 0.09 ? 32  LEU A C    3  
ATOM   3176  O O    . LEU A 1 32 ? -8.912  2.508   5.394   1.00 0.09 ? 32  LEU A O    3  
ATOM   3177  C CB   . LEU A 1 32 ? -7.671  4.938   3.647   1.00 0.10 ? 32  LEU A CB   3  
ATOM   3178  C CG   . LEU A 1 32 ? -8.954  4.603   2.883   1.00 0.09 ? 32  LEU A CG   3  
ATOM   3179  C CD1  . LEU A 1 32 ? -8.949  3.146   2.447   1.00 0.08 ? 32  LEU A CD1  3  
ATOM   3180  C CD2  . LEU A 1 32 ? -10.176 4.902   3.738   1.00 0.09 ? 32  LEU A CD2  3  
ATOM   3181  H H    . LEU A 1 32 ? -5.620  5.165   5.174   1.00 0.11 ? 32  LEU A H    3  
ATOM   3182  H HA   . LEU A 1 32 ? -8.455  5.008   5.636   1.00 0.10 ? 32  LEU A HA   3  
ATOM   3183  H HB2  . LEU A 1 32 ? -7.518  6.006   3.594   1.00 0.10 ? 32  LEU A HB2  3  
ATOM   3184  H HB3  . LEU A 1 32 ? -6.847  4.452   3.147   1.00 0.09 ? 32  LEU A HB3  3  
ATOM   3185  H HG   . LEU A 1 32 ? -9.006  5.216   1.996   1.00 0.09 ? 32  LEU A HG   3  
ATOM   3186  H HD11 . LEU A 1 32 ? -8.088  2.960   1.823   1.00 0.08 ? 32  LEU A HD11 3  
ATOM   3187  H HD12 . LEU A 1 32 ? -9.849  2.935   1.889   1.00 0.08 ? 32  LEU A HD12 3  
ATOM   3188  H HD13 . LEU A 1 32 ? -8.907  2.510   3.318   1.00 0.08 ? 32  LEU A HD13 3  
ATOM   3189  H HD21 . LEU A 1 32 ? -11.070 4.634   3.194   1.00 0.09 ? 32  LEU A HD21 3  
ATOM   3190  H HD22 . LEU A 1 32 ? -10.200 5.956   3.973   1.00 0.10 ? 32  LEU A HD22 3  
ATOM   3191  H HD23 . LEU A 1 32 ? -10.126 4.330   4.651   1.00 0.09 ? 32  LEU A HD23 3  
ATOM   3192  N N    . LEU A 1 33 ? -6.683  2.300   5.176   1.00 0.09 ? 33  LEU A N    3  
ATOM   3193  C CA   . LEU A 1 33 ? -6.698  0.846   5.281   1.00 0.08 ? 33  LEU A CA   3  
ATOM   3194  C C    . LEU A 1 33 ? -6.944  0.406   6.721   1.00 0.09 ? 33  LEU A C    3  
ATOM   3195  O O    . LEU A 1 33 ? -7.128  -0.780  6.993   1.00 0.09 ? 33  LEU A O    3  
ATOM   3196  C CB   . LEU A 1 33 ? -5.375  0.263   4.777   1.00 0.08 ? 33  LEU A CB   3  
ATOM   3197  C CG   . LEU A 1 33 ? -5.352  -0.181  3.314   1.00 0.08 ? 33  LEU A CG   3  
ATOM   3198  C CD1  . LEU A 1 33 ? -3.954  -0.633  2.915   1.00 0.08 ? 33  LEU A CD1  3  
ATOM   3199  C CD2  . LEU A 1 33 ? -6.361  -1.294  3.078   1.00 0.07 ? 33  LEU A CD2  3  
ATOM   3200  H H    . LEU A 1 33 ? -5.826  2.762   5.054   1.00 0.10 ? 33  LEU A H    3  
ATOM   3201  H HA   . LEU A 1 33 ? -7.503  0.480   4.663   1.00 0.08 ? 33  LEU A HA   3  
ATOM   3202  H HB2  . LEU A 1 33 ? -4.607  1.010   4.913   1.00 0.09 ? 33  LEU A HB2  3  
ATOM   3203  H HB3  . LEU A 1 33 ? -5.132  -0.590  5.390   1.00 0.09 ? 33  LEU A HB3  3  
ATOM   3204  H HG   . LEU A 1 33 ? -5.623  0.656   2.686   1.00 0.08 ? 33  LEU A HG   3  
ATOM   3205  H HD11 . LEU A 1 33 ? -4.007  -1.206  2.001   1.00 0.09 ? 33  LEU A HD11 3  
ATOM   3206  H HD12 . LEU A 1 33 ? -3.536  -1.243  3.700   1.00 0.10 ? 33  LEU A HD12 3  
ATOM   3207  H HD13 . LEU A 1 33 ? -3.329  0.233   2.760   1.00 0.10 ? 33  LEU A HD13 3  
ATOM   3208  H HD21 . LEU A 1 33 ? -5.962  -2.227  3.447   1.00 0.07 ? 33  LEU A HD21 3  
ATOM   3209  H HD22 . LEU A 1 33 ? -6.560  -1.379  2.021   1.00 0.06 ? 33  LEU A HD22 3  
ATOM   3210  H HD23 . LEU A 1 33 ? -7.279  -1.067  3.596   1.00 0.07 ? 33  LEU A HD23 3  
ATOM   3211  N N    . GLN A 1 34 ? -6.947  1.369   7.636   1.00 0.10 ? 34  GLN A N    3  
ATOM   3212  C CA   . GLN A 1 34 ? -7.173  1.081   9.048   1.00 0.11 ? 34  GLN A CA   3  
ATOM   3213  C C    . GLN A 1 34 ? -8.580  1.491   9.468   1.00 0.11 ? 34  GLN A C    3  
ATOM   3214  O O    . GLN A 1 34 ? -9.169  0.893   10.370  1.00 0.12 ? 34  GLN A O    3  
ATOM   3215  C CB   . GLN A 1 34 ? -6.138  1.806   9.909   1.00 0.12 ? 34  GLN A CB   3  
ATOM   3216  C CG   . GLN A 1 34 ? -4.700  1.510   9.512   1.00 0.13 ? 34  GLN A CG   3  
ATOM   3217  C CD   . GLN A 1 34 ? -3.813  1.223   10.706  1.00 0.14 ? 34  GLN A CD   3  
ATOM   3218  O OE1  . GLN A 1 34 ? -3.969  1.823   11.769  1.00 0.15 ? 34  GLN A OE1  3  
ATOM   3219  N NE2  . GLN A 1 34 ? -2.874  0.298   10.538  1.00 0.14 ? 34  GLN A NE2  3  
ATOM   3220  H H    . GLN A 1 34 ? -6.793  2.295   7.356   1.00 0.10 ? 34  GLN A H    3  
ATOM   3221  H HA   . GLN A 1 34 ? -7.064  0.016   9.189   1.00 0.11 ? 34  GLN A HA   3  
ATOM   3222  H HB2  . GLN A 1 34 ? -6.300  2.870   9.826   1.00 0.13 ? 34  GLN A HB2  3  
ATOM   3223  H HB3  . GLN A 1 34 ? -6.272  1.510   10.939  1.00 0.13 ? 34  GLN A HB3  3  
ATOM   3224  H HG2  . GLN A 1 34 ? -4.691  0.649   8.860   1.00 0.12 ? 34  GLN A HG2  3  
ATOM   3225  H HG3  . GLN A 1 34 ? -4.303  2.365   8.983   1.00 0.13 ? 34  GLN A HG3  3  
ATOM   3226  H HE21 . GLN A 1 34 ? -2.807  -0.140  9.663   1.00 0.13 ? 34  GLN A HE21 3  
ATOM   3227  H HE22 . GLN A 1 34 ? -2.288  0.092   11.294  1.00 0.15 ? 34  GLN A HE22 3  
ATOM   3228  N N    . LYS A 1 35 ? -9.114  2.515   8.811   1.00 0.11 ? 35  LYS A N    3  
ATOM   3229  C CA   . LYS A 1 35 ? -10.453 3.005   9.116   1.00 0.11 ? 35  LYS A CA   3  
ATOM   3230  C C    . LYS A 1 35 ? -11.518 2.106   8.491   1.00 0.11 ? 35  LYS A C    3  
ATOM   3231  O O    . LYS A 1 35 ? -12.575 1.882   9.078   1.00 0.11 ? 35  LYS A O    3  
ATOM   3232  C CB   . LYS A 1 35 ? -10.620 4.439   8.610   1.00 0.12 ? 35  LYS A CB   3  
ATOM   3233  C CG   . LYS A 1 35 ? -10.818 4.534   7.108   1.00 0.11 ? 35  LYS A CG   3  
ATOM   3234  C CD   . LYS A 1 35 ? -11.013 5.976   6.662   1.00 0.11 ? 35  LYS A CD   3  
ATOM   3235  C CE   . LYS A 1 35 ? -12.336 6.159   5.935   1.00 0.11 ? 35  LYS A CE   3  
ATOM   3236  N NZ   . LYS A 1 35 ? -12.997 7.442   6.304   1.00 0.12 ? 35  LYS A NZ   3  
ATOM   3237  H H    . LYS A 1 35 ? -8.594  2.952   8.104   1.00 0.11 ? 35  LYS A H    3  
ATOM   3238  H HA   . LYS A 1 35 ? -10.574 2.993   10.188  1.00 0.12 ? 35  LYS A HA   3  
ATOM   3239  H HB2  . LYS A 1 35 ? -11.478 4.881   9.095   1.00 0.12 ? 35  LYS A HB2  3  
ATOM   3240  H HB3  . LYS A 1 35 ? -9.738  5.005   8.873   1.00 0.12 ? 35  LYS A HB3  3  
ATOM   3241  H HG2  . LYS A 1 35 ? -9.948  4.129   6.616   1.00 0.10 ? 35  LYS A HG2  3  
ATOM   3242  H HG3  . LYS A 1 35 ? -11.690 3.960   6.832   1.00 0.10 ? 35  LYS A HG3  3  
ATOM   3243  H HD2  . LYS A 1 35 ? -11.001 6.615   7.533   1.00 0.12 ? 35  LYS A HD2  3  
ATOM   3244  H HD3  . LYS A 1 35 ? -10.205 6.251   6.000   1.00 0.11 ? 35  LYS A HD3  3  
ATOM   3245  H HE2  . LYS A 1 35 ? -12.152 6.153   4.872   1.00 0.11 ? 35  LYS A HE2  3  
ATOM   3246  H HE3  . LYS A 1 35 ? -12.992 5.341   6.191   1.00 0.11 ? 35  LYS A HE3  3  
ATOM   3247  H HZ1  . LYS A 1 35 ? -13.188 7.464   7.326   1.00 0.13 ? 35  LYS A HZ1  3  
ATOM   3248  H HZ2  . LYS A 1 35 ? -13.897 7.541   5.792   1.00 0.12 ? 35  LYS A HZ2  3  
ATOM   3249  H HZ3  . LYS A 1 35 ? -12.382 8.244   6.059   1.00 0.12 ? 35  LYS A HZ3  3  
ATOM   3250  N N    . GLU A 1 36 ? -11.227 1.597   7.297   1.00 0.10 ? 36  GLU A N    3  
ATOM   3251  C CA   . GLU A 1 36 ? -12.160 0.723   6.595   1.00 0.09 ? 36  GLU A CA   3  
ATOM   3252  C C    . GLU A 1 36 ? -12.236 -0.645  7.266   1.00 0.09 ? 36  GLU A C    3  
ATOM   3253  O O    . GLU A 1 36 ? -13.092 -1.465  6.935   1.00 0.09 ? 36  GLU A O    3  
ATOM   3254  C CB   . GLU A 1 36 ? -11.739 0.563   5.132   1.00 0.08 ? 36  GLU A CB   3  
ATOM   3255  C CG   . GLU A 1 36 ? -11.735 1.868   4.355   1.00 0.08 ? 36  GLU A CG   3  
ATOM   3256  C CD   . GLU A 1 36 ? -13.130 2.418   4.131   1.00 0.09 ? 36  GLU A CD   3  
ATOM   3257  O OE1  . GLU A 1 36 ? -13.250 3.490   3.500   1.00 0.09 ? 36  GLU A OE1  3  
ATOM   3258  O OE2  . GLU A 1 36 ? -14.100 1.779   4.585   1.00 0.09 ? 36  GLU A OE2  3  
ATOM   3259  H H    . GLU A 1 36 ? -10.367 1.814   6.880   1.00 0.09 ? 36  GLU A H    3  
ATOM   3260  H HA   . GLU A 1 36 ? -13.136 1.183   6.631   1.00 0.10 ? 36  GLU A HA   3  
ATOM   3261  H HB2  . GLU A 1 36 ? -10.743 0.146   5.101   1.00 0.08 ? 36  GLU A HB2  3  
ATOM   3262  H HB3  . GLU A 1 36 ? -12.420 -0.119  4.646   1.00 0.08 ? 36  GLU A HB3  3  
ATOM   3263  H HG2  . GLU A 1 36 ? -11.162 2.597   4.905   1.00 0.09 ? 36  GLU A HG2  3  
ATOM   3264  H HG3  . GLU A 1 36 ? -11.272 1.698   3.393   1.00 0.08 ? 36  GLU A HG3  3  
ATOM   3265  N N    . GLY A 1 37 ? -11.333 -0.882  8.215   1.00 0.10 ? 37  GLY A N    3  
ATOM   3266  C CA   . GLY A 1 37 ? -11.315 -2.153  8.918   1.00 0.10 ? 37  GLY A CA   3  
ATOM   3267  C C    . GLY A 1 37 ? -10.595 -3.236  8.139   1.00 0.09 ? 37  GLY A C    3  
ATOM   3268  O O    . GLY A 1 37 ? -10.588 -4.400  8.542   1.00 0.10 ? 37  GLY A O    3  
ATOM   3269  H H    . GLY A 1 37 ? -10.678 -0.190  8.439   1.00 0.10 ? 37  GLY A H    3  
ATOM   3270  H HA2  . GLY A 1 37 ? -10.819 -2.019  9.868   1.00 0.11 ? 37  GLY A HA2  3  
ATOM   3271  H HA3  . GLY A 1 37 ? -12.332 -2.469  9.096   1.00 0.11 ? 37  GLY A HA3  3  
ATOM   3272  N N    . LEU A 1 38 ? -9.988  -2.854  7.021   1.00 0.08 ? 38  LEU A N    3  
ATOM   3273  C CA   . LEU A 1 38 ? -9.261  -3.804  6.182   1.00 0.08 ? 38  LEU A CA   3  
ATOM   3274  C C    . LEU A 1 38 ? -7.952  -4.221  6.841   1.00 0.08 ? 38  LEU A C    3  
ATOM   3275  O O    . LEU A 1 38 ? -7.402  -5.280  6.538   1.00 0.08 ? 38  LEU A O    3  
ATOM   3276  C CB   . LEU A 1 38 ? -8.983  -3.189  4.809   1.00 0.07 ? 38  LEU A CB   3  
ATOM   3277  C CG   . LEU A 1 38 ? -10.201 -2.970  3.912   1.00 0.06 ? 38  LEU A CG   3  
ATOM   3278  C CD1  . LEU A 1 38 ? -9.899  -1.930  2.844   1.00 0.06 ? 38  LEU A CD1  3  
ATOM   3279  C CD2  . LEU A 1 38 ? -10.636 -4.281  3.273   1.00 0.06 ? 38  LEU A CD2  3  
ATOM   3280  H H    . LEU A 1 38 ? -10.029 -1.913  6.750   1.00 0.08 ? 38  LEU A H    3  
ATOM   3281  H HA   . LEU A 1 38 ? -9.883  -4.678  6.057   1.00 0.08 ? 38  LEU A HA   3  
ATOM   3282  H HB2  . LEU A 1 38 ? -8.501  -2.235  4.960   1.00 0.07 ? 38  LEU A HB2  3  
ATOM   3283  H HB3  . LEU A 1 38 ? -8.295  -3.838  4.286   1.00 0.06 ? 38  LEU A HB3  3  
ATOM   3284  H HG   . LEU A 1 38 ? -11.020 -2.602  4.512   1.00 0.07 ? 38  LEU A HG   3  
ATOM   3285  H HD11 . LEU A 1 38 ? -9.657  -0.989  3.316   1.00 0.06 ? 38  LEU A HD11 3  
ATOM   3286  H HD12 . LEU A 1 38 ? -10.764 -1.803  2.210   1.00 0.06 ? 38  LEU A HD12 3  
ATOM   3287  H HD13 . LEU A 1 38 ? -9.061  -2.259  2.248   1.00 0.05 ? 38  LEU A HD13 3  
ATOM   3288  H HD21 . LEU A 1 38 ? -9.820  -4.689  2.694   1.00 0.06 ? 38  LEU A HD21 3  
ATOM   3289  H HD22 . LEU A 1 38 ? -11.481 -4.103  2.624   1.00 0.06 ? 38  LEU A HD22 3  
ATOM   3290  H HD23 . LEU A 1 38 ? -10.916 -4.983  4.043   1.00 0.07 ? 38  LEU A HD23 3  
ATOM   3291  N N    . LEU A 1 39 ? -7.458  -3.382  7.745   1.00 0.09 ? 39  LEU A N    3  
ATOM   3292  C CA   . LEU A 1 39 ? -6.211  -3.665  8.451   1.00 0.10 ? 39  LEU A CA   3  
ATOM   3293  C C    . LEU A 1 39 ? -6.285  -3.189  9.898   1.00 0.11 ? 39  LEU A C    3  
ATOM   3294  O O    . LEU A 1 39 ? -6.964  -2.210  10.207  1.00 0.11 ? 39  LEU A O    3  
ATOM   3295  C CB   . LEU A 1 39 ? -5.036  -2.992  7.740   1.00 0.10 ? 39  LEU A CB   3  
ATOM   3296  C CG   . LEU A 1 39 ? -4.710  -3.515  6.340   1.00 0.09 ? 39  LEU A CG   3  
ATOM   3297  C CD1  . LEU A 1 39 ? -3.501  -2.789  5.768   1.00 0.09 ? 39  LEU A CD1  3  
ATOM   3298  C CD2  . LEU A 1 39 ? -4.465  -5.016  6.376   1.00 0.09 ? 39  LEU A CD2  3  
ATOM   3299  H H    . LEU A 1 39 ? -7.941  -2.553  7.944   1.00 0.09 ? 39  LEU A H    3  
ATOM   3300  H HA   . LEU A 1 39 ? -6.061  -4.734  8.443   1.00 0.10 ? 39  LEU A HA   3  
ATOM   3301  H HB2  . LEU A 1 39 ? -5.252  -1.936  7.662   1.00 0.10 ? 39  LEU A HB2  3  
ATOM   3302  H HB3  . LEU A 1 39 ? -4.157  -3.113  8.356   1.00 0.11 ? 39  LEU A HB3  3  
ATOM   3303  H HG   . LEU A 1 39 ? -5.551  -3.328  5.688   1.00 0.08 ? 39  LEU A HG   3  
ATOM   3304  H HD11 . LEU A 1 39 ? -3.403  -3.026  4.719   1.00 0.08 ? 39  LEU A HD11 3  
ATOM   3305  H HD12 . LEU A 1 39 ? -2.611  -3.106  6.293   1.00 0.10 ? 39  LEU A HD12 3  
ATOM   3306  H HD13 . LEU A 1 39 ? -3.629  -1.725  5.888   1.00 0.09 ? 39  LEU A HD13 3  
ATOM   3307  H HD21 . LEU A 1 39 ? -3.797  -5.292  5.574   1.00 0.08 ? 39  LEU A HD21 3  
ATOM   3308  H HD22 . LEU A 1 39 ? -5.404  -5.536  6.256   1.00 0.08 ? 39  LEU A HD22 3  
ATOM   3309  H HD23 . LEU A 1 39 ? -4.024  -5.287  7.324   1.00 0.10 ? 39  LEU A HD23 3  
ATOM   3310  N N    . MET A 1 40 ? -5.580  -3.888  10.781  1.00 0.12 ? 40  MET A N    3  
ATOM   3311  C CA   . MET A 1 40 ? -5.564  -3.536  12.196  1.00 0.14 ? 40  MET A CA   3  
ATOM   3312  C C    . MET A 1 40 ? -4.270  -2.812  12.561  1.00 0.14 ? 40  MET A C    3  
ATOM   3313  O O    . MET A 1 40 ? -4.215  -2.081  13.550  1.00 0.15 ? 40  MET A O    3  
ATOM   3314  C CB   . MET A 1 40 ? -5.721  -4.789  13.059  1.00 0.14 ? 40  MET A CB   3  
ATOM   3315  C CG   . MET A 1 40 ? -6.072  -4.491  14.509  1.00 0.16 ? 40  MET A CG   3  
ATOM   3316  S SD   . MET A 1 40 ? -5.412  -5.720  15.651  1.00 0.17 ? 40  MET A SD   3  
ATOM   3317  C CE   . MET A 1 40 ? -3.668  -5.314  15.615  1.00 0.17 ? 40  MET A CE   3  
ATOM   3318  H H    . MET A 1 40 ? -5.060  -4.660  10.474  1.00 0.12 ? 40  MET A H    3  
ATOM   3319  H HA   . MET A 1 40 ? -6.397  -2.875  12.383  1.00 0.14 ? 40  MET A HA   3  
ATOM   3320  H HB2  . MET A 1 40 ? -6.503  -5.406  12.641  1.00 0.14 ? 40  MET A HB2  3  
ATOM   3321  H HB3  . MET A 1 40 ? -4.793  -5.342  13.043  1.00 0.14 ? 40  MET A HB3  3  
ATOM   3322  H HG2  . MET A 1 40 ? -5.668  -3.524  14.770  1.00 0.16 ? 40  MET A HG2  3  
ATOM   3323  H HG3  . MET A 1 40 ? -7.148  -4.469  14.607  1.00 0.15 ? 40  MET A HG3  3  
ATOM   3324  H HE1  . MET A 1 40 ? -3.533  -4.284  15.912  1.00 0.18 ? 40  MET A HE1  3  
ATOM   3325  H HE2  . MET A 1 40 ? -3.286  -5.452  14.615  1.00 0.17 ? 40  MET A HE2  3  
ATOM   3326  H HE3  . MET A 1 40 ? -3.134  -5.958  16.297  1.00 0.18 ? 40  MET A HE3  3  
ATOM   3327  N N    . SER A 1 41 ? -3.234  -3.021  11.755  1.00 0.14 ? 41  SER A N    3  
ATOM   3328  C CA   . SER A 1 41 ? -1.941  -2.390  11.996  1.00 0.15 ? 41  SER A CA   3  
ATOM   3329  C C    . SER A 1 41 ? -1.205  -2.142  10.683  1.00 0.14 ? 41  SER A C    3  
ATOM   3330  O O    . SER A 1 41 ? -1.502  -2.746  9.651   1.00 0.13 ? 41  SER A O    3  
ATOM   3331  C CB   . SER A 1 41 ? -1.086  -3.267  12.913  1.00 0.16 ? 41  SER A CB   3  
ATOM   3332  O OG   . SER A 1 41 ? -1.631  -4.571  13.026  1.00 0.16 ? 41  SER A OG   3  
ATOM   3333  H H    . SER A 1 41 ? -3.341  -3.613  10.982  1.00 0.13 ? 41  SER A H    3  
ATOM   3334  H HA   . SER A 1 41 ? -2.120  -1.442  12.480  1.00 0.15 ? 41  SER A HA   3  
ATOM   3335  H HB2  . SER A 1 41 ? -0.088  -3.341  12.509  1.00 0.16 ? 41  SER A HB2  3  
ATOM   3336  H HB3  . SER A 1 41 ? -1.044  -2.821  13.897  1.00 0.17 ? 41  SER A HB3  3  
ATOM   3337  H HG   . SER A 1 41 ? -1.456  -4.915  13.905  1.00 0.17 ? 41  SER A HG   3  
ATOM   3338  N N    . PRO A 1 42 ? -0.223  -1.231  10.719  1.00 0.15 ? 42  PRO A N    3  
ATOM   3339  C CA   . PRO A 1 42 ? 0.576   -0.879  9.543   1.00 0.15 ? 42  PRO A CA   3  
ATOM   3340  C C    . PRO A 1 42 ? 1.507   -2.010  9.115   1.00 0.15 ? 42  PRO A C    3  
ATOM   3341  O O    . PRO A 1 42 ? 2.028   -2.010  8.000   1.00 0.15 ? 42  PRO A O    3  
ATOM   3342  C CB   . PRO A 1 42 ? 1.386   0.332   10.011  1.00 0.16 ? 42  PRO A CB   3  
ATOM   3343  C CG   . PRO A 1 42 ? 1.472   0.181   11.490  1.00 0.17 ? 42  PRO A CG   3  
ATOM   3344  C CD   . PRO A 1 42 ? 0.185   -0.472  11.915  1.00 0.17 ? 42  PRO A CD   3  
ATOM   3345  H HA   . PRO A 1 42 ? -0.050  -0.598  8.709   1.00 0.14 ? 42  PRO A HA   3  
ATOM   3346  H HB2  . PRO A 1 42 ? 2.371   0.315   9.559   1.00 0.17 ? 42  PRO A HB2  3  
ATOM   3347  H HB3  . PRO A 1 42 ? 0.872   1.245   9.760   1.00 0.16 ? 42  PRO A HB3  3  
ATOM   3348  H HG2  . PRO A 1 42 ? 2.317   -0.444  11.747  1.00 0.18 ? 42  PRO A HG2  3  
ATOM   3349  H HG3  . PRO A 1 42 ? 1.563   1.150   11.956  1.00 0.18 ? 42  PRO A HG3  3  
ATOM   3350  H HD2  . PRO A 1 42 ? 0.355   -1.133  12.752  1.00 0.17 ? 42  PRO A HD2  3  
ATOM   3351  H HD3  . PRO A 1 42 ? -0.552  0.276   12.166  1.00 0.16 ? 42  PRO A HD3  3  
ATOM   3352  N N    . SER A 1 43 ? 1.712   -2.971  10.010  1.00 0.16 ? 43  SER A N    3  
ATOM   3353  C CA   . SER A 1 43 ? 2.583   -4.106  9.728   1.00 0.16 ? 43  SER A CA   3  
ATOM   3354  C C    . SER A 1 43 ? 1.814   -5.216  9.018   1.00 0.15 ? 43  SER A C    3  
ATOM   3355  O O    . SER A 1 43 ? 2.394   -6.221  8.605   1.00 0.15 ? 43  SER A O    3  
ATOM   3356  C CB   . SER A 1 43 ? 3.196   -4.642  11.023  1.00 0.17 ? 43  SER A CB   3  
ATOM   3357  O OG   . SER A 1 43 ? 2.191   -4.943  11.976  1.00 0.17 ? 43  SER A OG   3  
ATOM   3358  H H    . SER A 1 43 ? 1.266   -2.916  10.882  1.00 0.16 ? 43  SER A H    3  
ATOM   3359  H HA   . SER A 1 43 ? 3.375   -3.762  9.080   1.00 0.16 ? 43  SER A HA   3  
ATOM   3360  H HB2  . SER A 1 43 ? 3.753   -5.542  10.810  1.00 0.17 ? 43  SER A HB2  3  
ATOM   3361  H HB3  . SER A 1 43 ? 3.860   -3.898  11.439  1.00 0.18 ? 43  SER A HB3  3  
ATOM   3362  H HG   . SER A 1 43 ? 2.226   -5.877  12.195  1.00 0.17 ? 43  SER A HG   3  
ATOM   3363  N N    . ASP A 1 44 ? 0.507   -5.029  8.881   1.00 0.14 ? 44  ASP A N    3  
ATOM   3364  C CA   . ASP A 1 44 ? -0.343  -6.014  8.220   1.00 0.12 ? 44  ASP A CA   3  
ATOM   3365  C C    . ASP A 1 44 ? 0.056   -6.182  6.759   1.00 0.12 ? 44  ASP A C    3  
ATOM   3366  O O    . ASP A 1 44 ? -0.316  -7.162  6.110   1.00 0.11 ? 44  ASP A O    3  
ATOM   3367  C CB   . ASP A 1 44 ? -1.812  -5.599  8.316   1.00 0.12 ? 44  ASP A CB   3  
ATOM   3368  C CG   . ASP A 1 44 ? -2.741  -6.784  8.473   1.00 0.11 ? 44  ASP A CG   3  
ATOM   3369  O OD1  . ASP A 1 44 ? -2.481  -7.830  7.839   1.00 0.11 ? 44  ASP A OD1  3  
ATOM   3370  O OD2  . ASP A 1 44 ? -3.727  -6.671  9.229   1.00 0.11 ? 44  ASP A OD2  3  
ATOM   3371  H H    . ASP A 1 44 ? 0.103   -4.208  9.231   1.00 0.14 ? 44  ASP A H    3  
ATOM   3372  H HA   . ASP A 1 44 ? -0.212  -6.958  8.728   1.00 0.13 ? 44  ASP A HA   3  
ATOM   3373  H HB2  . ASP A 1 44 ? -1.942  -4.949  9.169   1.00 0.12 ? 44  ASP A HB2  3  
ATOM   3374  H HB3  . ASP A 1 44 ? -2.085  -5.065  7.418   1.00 0.11 ? 44  ASP A HB3  3  
ATOM   3375  N N    . LEU A 1 45 ? 0.816   -5.221  6.243   1.00 0.12 ? 45  LEU A N    3  
ATOM   3376  C CA   . LEU A 1 45 ? 1.265   -5.261  4.856   1.00 0.12 ? 45  LEU A CA   3  
ATOM   3377  C C    . LEU A 1 45 ? 2.163   -6.471  4.608   1.00 0.12 ? 45  LEU A C    3  
ATOM   3378  O O    . LEU A 1 45 ? 2.394   -6.860  3.465   1.00 0.12 ? 45  LEU A O    3  
ATOM   3379  C CB   . LEU A 1 45 ? 2.014   -3.976  4.504   1.00 0.12 ? 45  LEU A CB   3  
ATOM   3380  C CG   . LEU A 1 45 ? 1.391   -3.116  3.403   1.00 0.12 ? 45  LEU A CG   3  
ATOM   3381  C CD1  . LEU A 1 45 ? 1.661   -3.722  2.035   1.00 0.11 ? 45  LEU A CD1  3  
ATOM   3382  C CD2  . LEU A 1 45 ? -0.106  -2.957  3.633   1.00 0.10 ? 45  LEU A CD2  3  
ATOM   3383  H H    . LEU A 1 45 ? 1.081   -4.466  6.809   1.00 0.13 ? 45  LEU A H    3  
ATOM   3384  H HA   . LEU A 1 45 ? 0.391   -5.343  4.228   1.00 0.11 ? 45  LEU A HA   3  
ATOM   3385  H HB2  . LEU A 1 45 ? 2.087   -3.374  5.397   1.00 0.13 ? 45  LEU A HB2  3  
ATOM   3386  H HB3  . LEU A 1 45 ? 3.013   -4.245  4.192   1.00 0.13 ? 45  LEU A HB3  3  
ATOM   3387  H HG   . LEU A 1 45 ? 1.840   -2.133  3.426   1.00 0.12 ? 45  LEU A HG   3  
ATOM   3388  H HD11 . LEU A 1 45 ? 2.708   -3.620  1.797   1.00 0.12 ? 45  LEU A HD11 3  
ATOM   3389  H HD12 . LEU A 1 45 ? 1.072   -3.209  1.290   1.00 0.11 ? 45  LEU A HD12 3  
ATOM   3390  H HD13 . LEU A 1 45 ? 1.395   -4.769  2.046   1.00 0.11 ? 45  LEU A HD13 3  
ATOM   3391  H HD21 . LEU A 1 45 ? -0.456  -2.074  3.120   1.00 0.10 ? 45  LEU A HD21 3  
ATOM   3392  H HD22 . LEU A 1 45 ? -0.300  -2.861  4.690   1.00 0.11 ? 45  LEU A HD22 3  
ATOM   3393  H HD23 . LEU A 1 45 ? -0.623  -3.824  3.249   1.00 0.10 ? 45  LEU A HD23 3  
ATOM   3394  N N    . TYR A 1 46 ? 2.663   -7.060  5.690   1.00 0.13 ? 46  TYR A N    3  
ATOM   3395  C CA   . TYR A 1 46 ? 3.533   -8.223  5.592   1.00 0.14 ? 46  TYR A CA   3  
ATOM   3396  C C    . TYR A 1 46 ? 2.722   -9.497  5.377   1.00 0.13 ? 46  TYR A C    3  
ATOM   3397  O O    . TYR A 1 46 ? 3.272   -10.595 5.325   1.00 0.13 ? 46  TYR A O    3  
ATOM   3398  C CB   . TYR A 1 46 ? 4.387   -8.355  6.854   1.00 0.15 ? 46  TYR A CB   3  
ATOM   3399  C CG   . TYR A 1 46 ? 5.151   -7.100  7.203   1.00 0.16 ? 46  TYR A CG   3  
ATOM   3400  C CD1  . TYR A 1 46 ? 5.703   -6.300  6.210   1.00 0.16 ? 46  TYR A CD1  3  
ATOM   3401  C CD2  . TYR A 1 46 ? 5.322   -6.712  8.526   1.00 0.17 ? 46  TYR A CD2  3  
ATOM   3402  C CE1  . TYR A 1 46 ? 6.403   -5.150  6.524   1.00 0.17 ? 46  TYR A CE1  3  
ATOM   3403  C CE2  . TYR A 1 46 ? 6.019   -5.563  8.850   1.00 0.18 ? 46  TYR A CE2  3  
ATOM   3404  C CZ   . TYR A 1 46 ? 6.557   -4.786  7.844   1.00 0.18 ? 46  TYR A CZ   3  
ATOM   3405  O OH   . TYR A 1 46 ? 7.254   -3.643  8.165   1.00 0.19 ? 46  TYR A OH   3  
ATOM   3406  H H    . TYR A 1 46 ? 2.440   -6.704  6.576   1.00 0.13 ? 46  TYR A H    3  
ATOM   3407  H HA   . TYR A 1 46 ? 4.183   -8.080  4.743   1.00 0.14 ? 46  TYR A HA   3  
ATOM   3408  H HB2  . TYR A 1 46 ? 3.746   -8.596  7.689   1.00 0.15 ? 46  TYR A HB2  3  
ATOM   3409  H HB3  . TYR A 1 46 ? 5.102   -9.153  6.715   1.00 0.16 ? 46  TYR A HB3  3  
ATOM   3410  H HD1  . TYR A 1 46 ? 5.579   -6.587  5.176   1.00 0.15 ? 46  TYR A HD1  3  
ATOM   3411  H HD2  . TYR A 1 46 ? 4.900   -7.322  9.310   1.00 0.17 ? 46  TYR A HD2  3  
ATOM   3412  H HE1  . TYR A 1 46 ? 6.824   -4.543  5.737   1.00 0.17 ? 46  TYR A HE1  3  
ATOM   3413  H HE2  . TYR A 1 46 ? 6.140   -5.278  9.884   1.00 0.19 ? 46  TYR A HE2  3  
ATOM   3414  H HH   . TYR A 1 46 ? 7.869   -3.830  8.877   1.00 0.20 ? 46  TYR A HH   3  
ATOM   3415  N N    . SER A 1 47 ? 1.407   -9.339  5.254   1.00 0.12 ? 47  SER A N    3  
ATOM   3416  C CA   . SER A 1 47 ? 0.516   -10.473 5.049   1.00 0.11 ? 47  SER A CA   3  
ATOM   3417  C C    . SER A 1 47 ? 0.008   -10.514 3.611   1.00 0.10 ? 47  SER A C    3  
ATOM   3418  O O    . SER A 1 47 ? -0.993  -9.886  3.262   1.00 0.09 ? 47  SER A O    3  
ATOM   3419  C CB   . SER A 1 47 ? -0.665  -10.404 6.017   1.00 0.11 ? 47  SER A CB   3  
ATOM   3420  O OG   . SER A 1 47 ? -0.372  -11.075 7.230   1.00 0.12 ? 47  SER A OG   3  
ATOM   3421  H H    . SER A 1 47 ? 1.027   -8.437  5.305   1.00 0.12 ? 47  SER A H    3  
ATOM   3422  H HA   . SER A 1 47 ? 1.077   -11.373 5.247   1.00 0.12 ? 47  SER A HA   3  
ATOM   3423  H HB2  . SER A 1 47 ? -0.887  -9.370  6.238   1.00 0.11 ? 47  SER A HB2  3  
ATOM   3424  H HB3  . SER A 1 47 ? -1.528  -10.868 5.563   1.00 0.10 ? 47  SER A HB3  3  
ATOM   3425  H HG   . SER A 1 47 ? -0.790  -10.612 7.961   1.00 0.12 ? 47  SER A HG   3  
ATOM   3426  N N    . PRO A 1 48 ? 0.713   -11.267 2.755   1.00 0.11 ? 48  PRO A N    3  
ATOM   3427  C CA   . PRO A 1 48 ? 0.354   -11.407 1.341   1.00 0.10 ? 48  PRO A CA   3  
ATOM   3428  C C    . PRO A 1 48 ? -0.926  -12.211 1.146   1.00 0.09 ? 48  PRO A C    3  
ATOM   3429  O O    . PRO A 1 48 ? -1.414  -12.357 0.024   1.00 0.09 ? 48  PRO A O    3  
ATOM   3430  C CB   . PRO A 1 48 ? 1.550   -12.151 0.743   1.00 0.11 ? 48  PRO A CB   3  
ATOM   3431  C CG   . PRO A 1 48 ? 2.143   -12.898 1.887   1.00 0.12 ? 48  PRO A CG   3  
ATOM   3432  C CD   . PRO A 1 48 ? 1.917   -12.039 3.102   1.00 0.12 ? 48  PRO A CD   3  
ATOM   3433  H HA   . PRO A 1 48 ? 0.249   -10.444 0.862   1.00 0.10 ? 48  PRO A HA   3  
ATOM   3434  H HB2  . PRO A 1 48 ? 1.214   -12.828 -0.033  1.00 0.11 ? 48  PRO A HB2  3  
ATOM   3435  H HB3  . PRO A 1 48 ? 2.266   -11.450 0.346   1.00 0.11 ? 48  PRO A HB3  3  
ATOM   3436  H HG2  . PRO A 1 48 ? 1.644   -13.851 1.999   1.00 0.12 ? 48  PRO A HG2  3  
ATOM   3437  H HG3  . PRO A 1 48 ? 3.199   -13.040 1.728   1.00 0.13 ? 48  PRO A HG3  3  
ATOM   3438  H HD2  . PRO A 1 48 ? 1.744   -12.658 3.970   1.00 0.12 ? 48  PRO A HD2  3  
ATOM   3439  H HD3  . PRO A 1 48 ? 2.762   -11.386 3.265   1.00 0.12 ? 48  PRO A HD3  3  
ATOM   3440  N N    . GLY A 1 49 ? -1.466  -12.731 2.244   1.00 0.09 ? 49  GLY A N    3  
ATOM   3441  C CA   . GLY A 1 49 ? -2.686  -13.515 2.171   1.00 0.09 ? 49  GLY A CA   3  
ATOM   3442  C C    . GLY A 1 49 ? -3.924  -12.688 2.457   1.00 0.08 ? 49  GLY A C    3  
ATOM   3443  O O    . GLY A 1 49 ? -5.030  -13.221 2.537   1.00 0.08 ? 49  GLY A O    3  
ATOM   3444  H H    . GLY A 1 49 ? -1.032  -12.580 3.109   1.00 0.10 ? 49  GLY A H    3  
ATOM   3445  H HA2  . GLY A 1 49 ? -2.770  -13.939 1.181   1.00 0.09 ? 49  GLY A HA2  3  
ATOM   3446  H HA3  . GLY A 1 49 ? -2.628  -14.317 2.891   1.00 0.10 ? 49  GLY A HA3  3  
ATOM   3447  N N    . SER A 1 50 ? -3.738  -11.382 2.614   1.00 0.08 ? 50  SER A N    3  
ATOM   3448  C CA   . SER A 1 50 ? -4.848  -10.480 2.899   1.00 0.07 ? 50  SER A CA   3  
ATOM   3449  C C    . SER A 1 50 ? -4.973  -9.413  1.816   1.00 0.06 ? 50  SER A C    3  
ATOM   3450  O O    . SER A 1 50 ? -5.798  -8.504  1.916   1.00 0.06 ? 50  SER A O    3  
ATOM   3451  C CB   . SER A 1 50 ? -4.657  -9.817  4.264   1.00 0.08 ? 50  SER A CB   3  
ATOM   3452  O OG   . SER A 1 50 ? -4.786  -10.761 5.313   1.00 0.09 ? 50  SER A OG   3  
ATOM   3453  H H    . SER A 1 50 ? -2.832  -11.016 2.538   1.00 0.08 ? 50  SER A H    3  
ATOM   3454  H HA   . SER A 1 50 ? -5.754  -11.066 2.917   1.00 0.07 ? 50  SER A HA   3  
ATOM   3455  H HB2  . SER A 1 50 ? -3.672  -9.376  4.313   1.00 0.08 ? 50  SER A HB2  3  
ATOM   3456  H HB3  . SER A 1 50 ? -5.403  -9.047  4.394   1.00 0.07 ? 50  SER A HB3  3  
ATOM   3457  H HG   . SER A 1 50 ? -5.128  -11.586 4.961   1.00 0.09 ? 50  SER A HG   3  
ATOM   3458  N N    . TRP A 1 51 ? -4.148  -9.529  0.781   1.00 0.07 ? 51  TRP A N    3  
ATOM   3459  C CA   . TRP A 1 51 ? -4.165  -8.576  -0.323  1.00 0.06 ? 51  TRP A CA   3  
ATOM   3460  C C    . TRP A 1 51 ? -5.431  -8.734  -1.159  1.00 0.06 ? 51  TRP A C    3  
ATOM   3461  O O    . TRP A 1 51 ? -5.821  -7.822  -1.888  1.00 0.06 ? 51  TRP A O    3  
ATOM   3462  C CB   . TRP A 1 51 ? -2.930  -8.762  -1.204  1.00 0.07 ? 51  TRP A CB   3  
ATOM   3463  C CG   . TRP A 1 51 ? -1.656  -8.331  -0.540  1.00 0.08 ? 51  TRP A CG   3  
ATOM   3464  C CD1  . TRP A 1 51 ? -1.534  -7.490  0.529   1.00 0.08 ? 51  TRP A CD1  3  
ATOM   3465  C CD2  . TRP A 1 51 ? -0.327  -8.719  -0.904  1.00 0.09 ? 51  TRP A CD2  3  
ATOM   3466  N NE1  . TRP A 1 51 ? -0.208  -7.332  0.853   1.00 0.09 ? 51  TRP A NE1  3  
ATOM   3467  C CE2  . TRP A 1 51 ? 0.553   -8.077  -0.011  1.00 0.10 ? 51  TRP A CE2  3  
ATOM   3468  C CE3  . TRP A 1 51 ? 0.205   -9.547  -1.895  1.00 0.09 ? 51  TRP A CE3  3  
ATOM   3469  C CZ2  . TRP A 1 51 ? 1.934   -8.237  -0.083  1.00 0.11 ? 51  TRP A CZ2  3  
ATOM   3470  C CZ3  . TRP A 1 51 ? 1.575   -9.705  -1.964  1.00 0.11 ? 51  TRP A CZ3  3  
ATOM   3471  C CH2  . TRP A 1 51 ? 2.427   -9.053  -1.063  1.00 0.11 ? 51  TRP A CH2  3  
ATOM   3472  H H    . TRP A 1 51 ? -3.513  -10.275 0.758   1.00 0.07 ? 51  TRP A H    3  
ATOM   3473  H HA   . TRP A 1 51 ? -4.150  -7.582  0.099   1.00 0.06 ? 51  TRP A HA   3  
ATOM   3474  H HB2  . TRP A 1 51 ? -2.834  -9.806  -1.461  1.00 0.07 ? 51  TRP A HB2  3  
ATOM   3475  H HB3  . TRP A 1 51 ? -3.050  -8.182  -2.107  1.00 0.07 ? 51  TRP A HB3  3  
ATOM   3476  H HD1  . TRP A 1 51 ? -2.365  -7.024  1.036   1.00 0.07 ? 51  TRP A HD1  3  
ATOM   3477  H HE1  . TRP A 1 51 ? 0.138   -6.779  1.584   1.00 0.09 ? 51  TRP A HE1  3  
ATOM   3478  H HE3  . TRP A 1 51 ? -0.435  -10.058 -2.598  1.00 0.09 ? 51  TRP A HE3  3  
ATOM   3479  H HZ2  . TRP A 1 51 ? 2.602   -7.743  0.604   1.00 0.11 ? 51  TRP A HZ2  3  
ATOM   3480  H HZ3  . TRP A 1 51 ? 2.005   -10.342 -2.723  1.00 0.11 ? 51  TRP A HZ3  3  
ATOM   3481  H HH2  . TRP A 1 51 ? 3.492   -9.205  -1.156  1.00 0.12 ? 51  TRP A HH2  3  
ATOM   3482  N N    . ASP A 1 52 ? -6.065  -9.895  -1.050  1.00 0.06 ? 52  ASP A N    3  
ATOM   3483  C CA   . ASP A 1 52 ? -7.286  -10.173 -1.796  1.00 0.07 ? 52  ASP A CA   3  
ATOM   3484  C C    . ASP A 1 52 ? -8.411  -9.235  -1.364  1.00 0.06 ? 52  ASP A C    3  
ATOM   3485  O O    . ASP A 1 52 ? -8.955  -8.469  -2.159  1.00 0.06 ? 52  ASP A O    3  
ATOM   3486  C CB   . ASP A 1 52 ? -7.714  -11.626 -1.597  1.00 0.07 ? 52  ASP A CB   3  
ATOM   3487  C CG   . ASP A 1 52 ? -7.294  -12.518 -2.750  1.00 0.08 ? 52  ASP A CG   3  
ATOM   3488  O OD1  . ASP A 1 52 ? -8.058  -13.444 -3.094  1.00 0.09 ? 52  ASP A OD1  3  
ATOM   3489  O OD2  . ASP A 1 52 ? -6.202  -12.286 -3.310  1.00 0.08 ? 52  ASP A OD2  3  
ATOM   3490  H H    . ASP A 1 52 ? -5.703  -10.583 -0.454  1.00 0.06 ? 52  ASP A H    3  
ATOM   3491  H HA   . ASP A 1 52 ? -7.080  -10.008 -2.843  1.00 0.07 ? 52  ASP A HA   3  
ATOM   3492  H HB2  . ASP A 1 52 ? -7.264  -12.006 -0.692  1.00 0.07 ? 52  ASP A HB2  3  
ATOM   3493  H HB3  . ASP A 1 52 ? -8.790  -11.670 -1.505  1.00 0.08 ? 52  ASP A HB3  3  
ATOM   3494  N N    . PRO A 1 53 ? -8.771  -9.298  -0.073  1.00 0.06 ? 53  PRO A N    3  
ATOM   3495  C CA   . PRO A 1 53 ? -9.833  -8.464  0.493   1.00 0.06 ? 53  PRO A CA   3  
ATOM   3496  C C    . PRO A 1 53 ? -9.436  -6.993  0.574   1.00 0.05 ? 53  PRO A C    3  
ATOM   3497  O O    . PRO A 1 53 ? -10.259 -6.136  0.895   1.00 0.06 ? 53  PRO A O    3  
ATOM   3498  C CB   . PRO A 1 53 ? -10.030 -9.043  1.896   1.00 0.06 ? 53  PRO A CB   3  
ATOM   3499  C CG   . PRO A 1 53 ? -8.723  -9.675  2.230   1.00 0.06 ? 53  PRO A CG   3  
ATOM   3500  C CD   . PRO A 1 53 ? -8.167  -10.188 0.932   1.00 0.06 ? 53  PRO A CD   3  
ATOM   3501  H HA   . PRO A 1 53 ? -10.751 -8.556  -0.070  1.00 0.07 ? 53  PRO A HA   3  
ATOM   3502  H HB2  . PRO A 1 53 ? -10.270 -8.249  2.594   1.00 0.06 ? 53  PRO A HB2  3  
ATOM   3503  H HB3  . PRO A 1 53 ? -10.810 -9.786  1.888   1.00 0.07 ? 53  PRO A HB3  3  
ATOM   3504  H HG2  . PRO A 1 53 ? -8.059  -8.937  2.661   1.00 0.06 ? 53  PRO A HG2  3  
ATOM   3505  H HG3  . PRO A 1 53 ? -8.873  -10.494 2.916   1.00 0.07 ? 53  PRO A HG3  3  
ATOM   3506  H HD2  . PRO A 1 53 ? -7.090  -10.108 0.922   1.00 0.06 ? 53  PRO A HD2  3  
ATOM   3507  H HD3  . PRO A 1 53 ? -8.471  -11.212 0.772   1.00 0.07 ? 53  PRO A HD3  3  
ATOM   3508  N N    . ILE A 1 54 ? -8.171  -6.712  0.282   1.00 0.05 ? 54  ILE A N    3  
ATOM   3509  C CA   . ILE A 1 54 ? -7.666  -5.346  0.321   1.00 0.05 ? 54  ILE A CA   3  
ATOM   3510  C C    . ILE A 1 54 ? -7.524  -4.771  -1.085  1.00 0.05 ? 54  ILE A C    3  
ATOM   3511  O O    . ILE A 1 54 ? -7.487  -3.554  -1.272  1.00 0.05 ? 54  ILE A O    3  
ATOM   3512  C CB   . ILE A 1 54 ? -6.303  -5.269  1.034   1.00 0.05 ? 54  ILE A CB   3  
ATOM   3513  C CG1  . ILE A 1 54 ? -6.434  -5.735  2.484   1.00 0.05 ? 54  ILE A CG1  3  
ATOM   3514  C CG2  . ILE A 1 54 ? -5.753  -3.852  0.974   1.00 0.05 ? 54  ILE A CG2  3  
ATOM   3515  C CD1  . ILE A 1 54 ? -5.106  -5.988  3.161   1.00 0.06 ? 54  ILE A CD1  3  
ATOM   3516  H H    . ILE A 1 54 ? -7.564  -7.440  0.035   1.00 0.05 ? 54  ILE A H    3  
ATOM   3517  H HA   . ILE A 1 54 ? -8.373  -4.744  0.875   1.00 0.05 ? 54  ILE A HA   3  
ATOM   3518  H HB   . ILE A 1 54 ? -5.614  -5.918  0.515   1.00 0.05 ? 54  ILE A HB   3  
ATOM   3519  H HG12 . ILE A 1 54 ? -6.956  -4.980  3.053   1.00 0.06 ? 54  ILE A HG12 3  
ATOM   3520  H HG13 . ILE A 1 54 ? -7.002  -6.654  2.510   1.00 0.05 ? 54  ILE A HG13 3  
ATOM   3521  H HG21 . ILE A 1 54 ? -4.865  -3.783  1.584   1.00 0.06 ? 54  ILE A HG21 3  
ATOM   3522  H HG22 . ILE A 1 54 ? -6.497  -3.163  1.340   1.00 0.05 ? 54  ILE A HG22 3  
ATOM   3523  H HG23 . ILE A 1 54 ? -5.506  -3.604  -0.049  1.00 0.06 ? 54  ILE A HG23 3  
ATOM   3524  H HD11 . ILE A 1 54 ? -5.277  -6.363  4.159   1.00 0.07 ? 54  ILE A HD11 3  
ATOM   3525  H HD12 . ILE A 1 54 ? -4.547  -5.065  3.214   1.00 0.07 ? 54  ILE A HD12 3  
ATOM   3526  H HD13 . ILE A 1 54 ? -4.545  -6.717  2.594   1.00 0.06 ? 54  ILE A HD13 3  
ATOM   3527  N N    . THR A 1 55 ? -7.449  -5.656  -2.076  1.00 0.06 ? 55  THR A N    3  
ATOM   3528  C CA   . THR A 1 55 ? -7.312  -5.239  -3.464  1.00 0.06 ? 55  THR A CA   3  
ATOM   3529  C C    . THR A 1 55 ? -8.674  -5.094  -4.132  1.00 0.07 ? 55  THR A C    3  
ATOM   3530  O O    . THR A 1 55 ? -8.891  -4.185  -4.934  1.00 0.08 ? 55  THR A O    3  
ATOM   3531  C CB   . THR A 1 55 ? -6.463  -6.239  -4.271  1.00 0.07 ? 55  THR A CB   3  
ATOM   3532  O OG1  . THR A 1 55 ? -5.111  -6.225  -3.801  1.00 0.07 ? 55  THR A OG1  3  
ATOM   3533  C CG2  . THR A 1 55 ? -6.492  -5.902  -5.754  1.00 0.08 ? 55  THR A CG2  3  
ATOM   3534  H H    . THR A 1 55 ? -7.482  -6.612  -1.866  1.00 0.06 ? 55  THR A H    3  
ATOM   3535  H HA   . THR A 1 55 ? -6.812  -4.281  -3.477  1.00 0.07 ? 55  THR A HA   3  
ATOM   3536  H HB   . THR A 1 55 ? -6.873  -7.229  -4.133  1.00 0.07 ? 55  THR A HB   3  
ATOM   3537  H HG1  . THR A 1 55 ? -4.525  -5.968  -4.516  1.00 0.08 ? 55  THR A HG1  3  
ATOM   3538  H HG21 . THR A 1 55 ? -7.512  -5.934  -6.111  1.00 0.09 ? 55  THR A HG21 3  
ATOM   3539  H HG22 . THR A 1 55 ? -5.898  -6.620  -6.299  1.00 0.09 ? 55  THR A HG22 3  
ATOM   3540  H HG23 . THR A 1 55 ? -6.090  -4.912  -5.907  1.00 0.08 ? 55  THR A HG23 3  
ATOM   3541  N N    . ALA A 1 56 ? -9.593  -5.994  -3.795  1.00 0.07 ? 56  ALA A N    3  
ATOM   3542  C CA   . ALA A 1 56 ? -10.936 -5.964  -4.358  1.00 0.08 ? 56  ALA A CA   3  
ATOM   3543  C C    . ALA A 1 56 ? -11.722 -4.764  -3.842  1.00 0.08 ? 56  ALA A C    3  
ATOM   3544  O O    . ALA A 1 56 ? -12.458 -4.123  -4.591  1.00 0.09 ? 56  ALA A O    3  
ATOM   3545  C CB   . ALA A 1 56 ? -11.672 -7.256  -4.038  1.00 0.08 ? 56  ALA A CB   3  
ATOM   3546  H H    . ALA A 1 56 ? -9.360  -6.696  -3.152  1.00 0.07 ? 56  ALA A H    3  
ATOM   3547  H HA   . ALA A 1 56 ? -10.845 -5.886  -5.432  1.00 0.09 ? 56  ALA A HA   3  
ATOM   3548  H HB1  . ALA A 1 56 ? -12.644 -7.244  -4.508  1.00 0.09 ? 56  ALA A HB1  3  
ATOM   3549  H HB2  . ALA A 1 56 ? -11.790 -7.348  -2.968  1.00 0.08 ? 56  ALA A HB2  3  
ATOM   3550  H HB3  . ALA A 1 56 ? -11.103 -8.096  -4.411  1.00 0.09 ? 56  ALA A HB3  3  
ATOM   3551  N N    . ALA A 1 57 ? -11.562 -4.465  -2.557  1.00 0.07 ? 57  ALA A N    3  
ATOM   3552  C CA   . ALA A 1 57 ? -12.254 -3.342  -1.941  1.00 0.07 ? 57  ALA A CA   3  
ATOM   3553  C C    . ALA A 1 57 ? -11.853 -2.024  -2.593  1.00 0.07 ? 57  ALA A C    3  
ATOM   3554  O O    . ALA A 1 57 ? -12.703 -1.273  -3.074  1.00 0.08 ? 57  ALA A O    3  
ATOM   3555  C CB   . ALA A 1 57 ? -11.969 -3.302  -0.446  1.00 0.06 ? 57  ALA A CB   3  
ATOM   3556  H H    . ALA A 1 57 ? -10.962 -5.015  -2.009  1.00 0.07 ? 57  ALA A H    3  
ATOM   3557  H HA   . ALA A 1 57 ? -13.315 -3.490  -2.076  1.00 0.08 ? 57  ALA A HA   3  
ATOM   3558  H HB1  . ALA A 1 57 ? -12.256 -4.241  0.001   1.00 0.07 ? 57  ALA A HB1  3  
ATOM   3559  H HB2  . ALA A 1 57 ? -12.534 -2.500  0.007   1.00 0.07 ? 57  ALA A HB2  3  
ATOM   3560  H HB3  . ALA A 1 57 ? -10.914 -3.134  -0.285  1.00 0.06 ? 57  ALA A HB3  3  
ATOM   3561  N N    . LEU A 1 58 ? -10.553 -1.747  -2.605  1.00 0.07 ? 58  LEU A N    3  
ATOM   3562  C CA   . LEU A 1 58 ? -10.038 -0.517  -3.199  1.00 0.08 ? 58  LEU A CA   3  
ATOM   3563  C C    . LEU A 1 58 ? -10.485 -0.388  -4.651  1.00 0.09 ? 58  LEU A C    3  
ATOM   3564  O O    . LEU A 1 58 ? -10.882 0.690   -5.095  1.00 0.09 ? 58  LEU A O    3  
ATOM   3565  C CB   . LEU A 1 58 ? -8.512  -0.489  -3.118  1.00 0.07 ? 58  LEU A CB   3  
ATOM   3566  C CG   . LEU A 1 58 ? -7.917  -0.267  -1.727  1.00 0.07 ? 58  LEU A CG   3  
ATOM   3567  C CD1  . LEU A 1 58 ? -6.447  -0.657  -1.705  1.00 0.07 ? 58  LEU A CD1  3  
ATOM   3568  C CD2  . LEU A 1 58 ? -8.094  1.181   -1.295  1.00 0.07 ? 58  LEU A CD2  3  
ATOM   3569  H H    . LEU A 1 58 ? -9.925  -2.385  -2.204  1.00 0.06 ? 58  LEU A H    3  
ATOM   3570  H HA   . LEU A 1 58 ? -10.436 0.313   -2.637  1.00 0.08 ? 58  LEU A HA   3  
ATOM   3571  H HB2  . LEU A 1 58 ? -8.139  -1.429  -3.496  1.00 0.07 ? 58  LEU A HB2  3  
ATOM   3572  H HB3  . LEU A 1 58 ? -8.157  0.301   -3.762  1.00 0.08 ? 58  LEU A HB3  3  
ATOM   3573  H HG   . LEU A 1 58 ? -8.438  -0.894  -1.017  1.00 0.06 ? 58  LEU A HG   3  
ATOM   3574  H HD11 . LEU A 1 58 ? -6.015  -0.382  -0.755  1.00 0.07 ? 58  LEU A HD11 3  
ATOM   3575  H HD12 . LEU A 1 58 ? -5.929  -0.144  -2.500  1.00 0.08 ? 58  LEU A HD12 3  
ATOM   3576  H HD13 . LEU A 1 58 ? -6.356  -1.725  -1.847  1.00 0.06 ? 58  LEU A HD13 3  
ATOM   3577  H HD21 . LEU A 1 58 ? -9.144  1.390   -1.158  1.00 0.07 ? 58  LEU A HD21 3  
ATOM   3578  H HD22 . LEU A 1 58 ? -7.694  1.835   -2.056  1.00 0.08 ? 58  LEU A HD22 3  
ATOM   3579  H HD23 . LEU A 1 58 ? -7.570  1.347   -0.366  1.00 0.07 ? 58  LEU A HD23 3  
ATOM   3580  N N    . SER A 1 59 ? -10.418 -1.492  -5.388  1.00 0.09 ? 59  SER A N    3  
ATOM   3581  C CA   . SER A 1 59 ? -10.814 -1.501  -6.792  1.00 0.10 ? 59  SER A CA   3  
ATOM   3582  C C    . SER A 1 59 ? -12.330 -1.414  -6.929  1.00 0.11 ? 59  SER A C    3  
ATOM   3583  O O    . SER A 1 59 ? -12.848 -1.040  -7.981  1.00 0.12 ? 59  SER A O    3  
ATOM   3584  C CB   . SER A 1 59 ? -10.299 -2.767  -7.480  1.00 0.10 ? 59  SER A CB   3  
ATOM   3585  O OG   . SER A 1 59 ? -10.918 -2.947  -8.742  1.00 0.12 ? 59  SER A OG   3  
ATOM   3586  H H    . SER A 1 59 ? -10.094 -2.321  -4.977  1.00 0.08 ? 59  SER A H    3  
ATOM   3587  H HA   . SER A 1 59 ? -10.372 -0.638  -7.267  1.00 0.11 ? 59  SER A HA   3  
ATOM   3588  H HB2  . SER A 1 59 ? -9.232  -2.688  -7.626  1.00 0.10 ? 59  SER A HB2  3  
ATOM   3589  H HB3  . SER A 1 59 ? -10.515 -3.624  -6.860  1.00 0.10 ? 59  SER A HB3  3  
ATOM   3590  H HG   . SER A 1 59 ? -10.251 -2.932  -9.432  1.00 0.12 ? 59  SER A HG   3  
ATOM   3591  N N    . GLN A 1 60 ? -13.036 -1.763  -5.858  1.00 0.10 ? 60  GLN A N    3  
ATOM   3592  C CA   . GLN A 1 60 ? -14.494 -1.725  -5.860  1.00 0.11 ? 60  GLN A CA   3  
ATOM   3593  C C    . GLN A 1 60 ? -15.002 -0.309  -5.608  1.00 0.11 ? 60  GLN A C    3  
ATOM   3594  O O    . GLN A 1 60 ? -15.946 0.145   -6.257  1.00 0.13 ? 60  GLN A O    3  
ATOM   3595  C CB   . GLN A 1 60 ? -15.051 -2.674  -4.798  1.00 0.11 ? 60  GLN A CB   3  
ATOM   3596  C CG   . GLN A 1 60 ? -16.566 -2.644  -4.688  1.00 0.12 ? 60  GLN A CG   3  
ATOM   3597  C CD   . GLN A 1 60 ? -17.080 -3.385  -3.469  1.00 0.12 ? 60  GLN A CD   3  
ATOM   3598  O OE1  . GLN A 1 60 ? -17.957 -4.243  -3.573  1.00 0.12 ? 60  GLN A OE1  3  
ATOM   3599  N NE2  . GLN A 1 60 ? -16.533 -3.059  -2.304  1.00 0.11 ? 60  GLN A NE2  3  
ATOM   3600  H H    . GLN A 1 60 ? -12.566 -2.053  -5.049  1.00 0.09 ? 60  GLN A H    3  
ATOM   3601  H HA   . GLN A 1 60 ? -14.832 -2.050  -6.831  1.00 0.12 ? 60  GLN A HA   3  
ATOM   3602  H HB2  . GLN A 1 60 ? -14.749 -3.683  -5.040  1.00 0.11 ? 60  GLN A HB2  3  
ATOM   3603  H HB3  . GLN A 1 60 ? -14.636 -2.405  -3.838  1.00 0.10 ? 60  GLN A HB3  3  
ATOM   3604  H HG2  . GLN A 1 60 ? -16.888 -1.615  -4.626  1.00 0.12 ? 60  GLN A HG2  3  
ATOM   3605  H HG3  . GLN A 1 60 ? -16.989 -3.099  -5.573  1.00 0.13 ? 60  GLN A HG3  3  
ATOM   3606  H HE21 . GLN A 1 60 ? -15.839 -2.367  -2.296  1.00 0.10 ? 60  GLN A HE21 3  
ATOM   3607  H HE22 . GLN A 1 60 ? -16.847 -3.522  -1.500  1.00 0.11 ? 60  GLN A HE22 3  
ATOM   3608  N N    . ARG A 1 61 ? -14.372 0.382   -4.664  1.00 0.11 ? 61  ARG A N    3  
ATOM   3609  C CA   . ARG A 1 61 ? -14.761 1.746   -4.329  1.00 0.11 ? 61  ARG A CA   3  
ATOM   3610  C C    . ARG A 1 61 ? -14.391 2.710   -5.450  1.00 0.12 ? 61  ARG A C    3  
ATOM   3611  O O    . ARG A 1 61 ? -15.097 3.688   -5.701  1.00 0.13 ? 61  ARG A O    3  
ATOM   3612  C CB   . ARG A 1 61 ? -14.090 2.183   -3.025  1.00 0.10 ? 61  ARG A CB   3  
ATOM   3613  C CG   . ARG A 1 61 ? -12.707 2.778   -3.221  1.00 0.10 ? 61  ARG A CG   3  
ATOM   3614  C CD   . ARG A 1 61 ? -12.061 3.138   -1.893  1.00 0.09 ? 61  ARG A CD   3  
ATOM   3615  N NE   . ARG A 1 61 ? -11.678 4.546   -1.833  1.00 0.10 ? 61  ARG A NE   3  
ATOM   3616  C CZ   . ARG A 1 61 ? -11.269 5.150   -0.722  1.00 0.09 ? 61  ARG A CZ   3  
ATOM   3617  N NH1  . ARG A 1 61 ? -11.191 4.471   0.414   1.00 0.09 ? 61  ARG A NH1  3  
ATOM   3618  N NH2  . ARG A 1 61 ? -10.940 6.434   -0.747  1.00 0.10 ? 61  ARG A NH2  3  
ATOM   3619  H H    . ARG A 1 61 ? -13.628 -0.036  -4.182  1.00 0.10 ? 61  ARG A H    3  
ATOM   3620  H HA   . ARG A 1 61 ? -15.833 1.762   -4.194  1.00 0.12 ? 61  ARG A HA   3  
ATOM   3621  H HB2  . ARG A 1 61 ? -14.713 2.924   -2.545  1.00 0.10 ? 61  ARG A HB2  3  
ATOM   3622  H HB3  . ARG A 1 61 ? -14.001 1.324   -2.375  1.00 0.09 ? 61  ARG A HB3  3  
ATOM   3623  H HG2  . ARG A 1 61 ? -12.084 2.058   -3.730  1.00 0.09 ? 61  ARG A HG2  3  
ATOM   3624  H HG3  . ARG A 1 61 ? -12.791 3.671   -3.823  1.00 0.10 ? 61  ARG A HG3  3  
ATOM   3625  H HD2  . ARG A 1 61 ? -12.762 2.932   -1.098  1.00 0.09 ? 61  ARG A HD2  3  
ATOM   3626  H HD3  . ARG A 1 61 ? -11.178 2.529   -1.759  1.00 0.08 ? 61  ARG A HD3  3  
ATOM   3627  H HE   . ARG A 1 61 ? -11.728 5.067   -2.661  1.00 0.10 ? 61  ARG A HE   3  
ATOM   3628  H HH11 . ARG A 1 61 ? -10.883 4.928   1.249   1.00 0.09 ? 61  ARG A HH11 3  
ATOM   3629  H HH12 . ARG A 1 61 ? -11.439 3.503   0.437   1.00 0.08 ? 61  ARG A HH12 3  
ATOM   3630  H HH21 . ARG A 1 61 ? -10.997 6.948   -1.601  1.00 0.11 ? 61  ARG A HH21 3  
ATOM   3631  H HH22 . ARG A 1 61 ? -10.630 6.888   0.089   1.00 0.10 ? 61  ARG A HH22 3  
ATOM   3632  N N    . ALA A 1 62 ? -13.281 2.429   -6.125  1.00 0.12 ? 62  ALA A N    3  
ATOM   3633  C CA   . ALA A 1 62 ? -12.818 3.271   -7.221  1.00 0.13 ? 62  ALA A CA   3  
ATOM   3634  C C    . ALA A 1 62 ? -13.721 3.127   -8.441  1.00 0.14 ? 62  ALA A C    3  
ATOM   3635  O O    . ALA A 1 62 ? -14.096 4.118   -9.067  1.00 0.15 ? 62  ALA A O    3  
ATOM   3636  C CB   . ALA A 1 62 ? -11.381 2.924   -7.581  1.00 0.12 ? 62  ALA A CB   3  
ATOM   3637  H H    . ALA A 1 62 ? -12.760 1.636   -5.878  1.00 0.11 ? 62  ALA A H    3  
ATOM   3638  H HA   . ALA A 1 62 ? -12.843 4.298   -6.887  1.00 0.13 ? 62  ALA A HA   3  
ATOM   3639  H HB1  . ALA A 1 62 ? -11.332 1.900   -7.919  1.00 0.12 ? 62  ALA A HB1  3  
ATOM   3640  H HB2  . ALA A 1 62 ? -10.752 3.048   -6.712  1.00 0.11 ? 62  ALA A HB2  3  
ATOM   3641  H HB3  . ALA A 1 62 ? -11.040 3.579   -8.369  1.00 0.13 ? 62  ALA A HB3  3  
ATOM   3642  N N    . MET A 1 63 ? -14.066 1.887   -8.774  1.00 0.14 ? 63  MET A N    3  
ATOM   3643  C CA   . MET A 1 63 ? -14.925 1.614   -9.921  1.00 0.15 ? 63  MET A CA   3  
ATOM   3644  C C    . MET A 1 63 ? -16.346 2.106   -9.664  1.00 0.16 ? 63  MET A C    3  
ATOM   3645  O O    . MET A 1 63 ? -17.038 2.541   -10.584 1.00 0.17 ? 63  MET A O    3  
ATOM   3646  C CB   . MET A 1 63 ? -14.940 0.117   -10.228 1.00 0.15 ? 63  MET A CB   3  
ATOM   3647  C CG   . MET A 1 63 ? -15.716 -0.706  -9.215  1.00 0.15 ? 63  MET A CG   3  
ATOM   3648  S SD   . MET A 1 63 ? -15.877 -2.435  -9.698  1.00 0.15 ? 63  MET A SD   3  
ATOM   3649  C CE   . MET A 1 63 ? -14.158 -2.939  -9.726  1.00 0.14 ? 63  MET A CE   3  
ATOM   3650  H H    . MET A 1 63 ? -13.734 1.137   -8.236  1.00 0.13 ? 63  MET A H    3  
ATOM   3651  H HA   . MET A 1 63 ? -14.520 2.143   -10.771 1.00 0.16 ? 63  MET A HA   3  
ATOM   3652  H HB2  . MET A 1 63 ? -15.386 -0.035  -11.200 1.00 0.16 ? 63  MET A HB2  3  
ATOM   3653  H HB3  . MET A 1 63 ? -13.922 -0.244  -10.249 1.00 0.15 ? 63  MET A HB3  3  
ATOM   3654  H HG2  . MET A 1 63 ? -15.205 -0.657  -8.265  1.00 0.14 ? 63  MET A HG2  3  
ATOM   3655  H HG3  . MET A 1 63 ? -16.704 -0.282  -9.112  1.00 0.15 ? 63  MET A HG3  3  
ATOM   3656  H HE1  . MET A 1 63 ? -13.642 -2.414  -10.516 1.00 0.15 ? 63  MET A HE1  3  
ATOM   3657  H HE2  . MET A 1 63 ? -14.097 -4.003  -9.901  1.00 0.14 ? 63  MET A HE2  3  
ATOM   3658  H HE3  . MET A 1 63 ? -13.699 -2.703  -8.777  1.00 0.13 ? 63  MET A HE3  3  
ATOM   3659  N N    . ILE A 1 64 ? -16.772 2.038   -8.407  1.00 0.15 ? 64  ILE A N    3  
ATOM   3660  C CA   . ILE A 1 64 ? -18.111 2.477   -8.030  1.00 0.16 ? 64  ILE A CA   3  
ATOM   3661  C C    . ILE A 1 64 ? -18.136 3.973   -7.740  1.00 0.16 ? 64  ILE A C    3  
ATOM   3662  O O    . ILE A 1 64 ? -18.631 4.765   -8.543  1.00 0.17 ? 64  ILE A O    3  
ATOM   3663  C CB   . ILE A 1 64 ? -18.626 1.717   -6.794  1.00 0.15 ? 64  ILE A CB   3  
ATOM   3664  C CG1  . ILE A 1 64 ? -18.776 0.228   -7.111  1.00 0.15 ? 64  ILE A CG1  3  
ATOM   3665  C CG2  . ILE A 1 64 ? -19.950 2.300   -6.328  1.00 0.16 ? 64  ILE A CG2  3  
ATOM   3666  C CD1  . ILE A 1 64 ? -19.176 -0.607  -5.916  1.00 0.15 ? 64  ILE A CD1  3  
ATOM   3667  H H    . ILE A 1 64 ? -16.172 1.683   -7.718  1.00 0.14 ? 64  ILE A H    3  
ATOM   3668  H HA   . ILE A 1 64 ? -18.774 2.269   -8.857  1.00 0.17 ? 64  ILE A HA   3  
ATOM   3669  H HB   . ILE A 1 64 ? -17.907 1.838   -5.999  1.00 0.14 ? 64  ILE A HB   3  
ATOM   3670  H HG12 . ILE A 1 64 ? -19.533 0.102   -7.871  1.00 0.16 ? 64  ILE A HG12 3  
ATOM   3671  H HG13 . ILE A 1 64 ? -17.836 -0.152  -7.480  1.00 0.15 ? 64  ILE A HG13 3  
ATOM   3672  H HG21 . ILE A 1 64 ? -20.288 1.769   -5.450  1.00 0.15 ? 64  ILE A HG21 3  
ATOM   3673  H HG22 . ILE A 1 64 ? -20.684 2.199   -7.114  1.00 0.17 ? 64  ILE A HG22 3  
ATOM   3674  H HG23 . ILE A 1 64 ? -19.820 3.345   -6.090  1.00 0.16 ? 64  ILE A HG23 3  
ATOM   3675  H HD11 . ILE A 1 64 ? -20.190 -0.366  -5.632  1.00 0.15 ? 64  ILE A HD11 3  
ATOM   3676  H HD12 . ILE A 1 64 ? -18.512 -0.397  -5.091  1.00 0.14 ? 64  ILE A HD12 3  
ATOM   3677  H HD13 . ILE A 1 64 ? -19.115 -1.655  -6.171  1.00 0.15 ? 64  ILE A HD13 3  
ATOM   3678  N N    . LEU A 1 65 ? -17.597 4.355   -6.586  1.00 0.15 ? 65  LEU A N    3  
ATOM   3679  C CA   . LEU A 1 65 ? -17.556 5.758   -6.188  1.00 0.15 ? 65  LEU A CA   3  
ATOM   3680  C C    . LEU A 1 65 ? -16.959 6.621   -7.296  1.00 0.16 ? 65  LEU A C    3  
ATOM   3681  O O    . LEU A 1 65 ? -17.411 7.739   -7.538  1.00 0.16 ? 65  LEU A O    3  
ATOM   3682  C CB   . LEU A 1 65 ? -16.742 5.921   -4.903  1.00 0.14 ? 65  LEU A CB   3  
ATOM   3683  C CG   . LEU A 1 65 ? -17.364 6.806   -3.822  1.00 0.14 ? 65  LEU A CG   3  
ATOM   3684  C CD1  . LEU A 1 65 ? -18.264 5.983   -2.914  1.00 0.14 ? 65  LEU A CD1  3  
ATOM   3685  C CD2  . LEU A 1 65 ? -16.278 7.500   -3.014  1.00 0.13 ? 65  LEU A CD2  3  
ATOM   3686  H H    . LEU A 1 65 ? -17.217 3.678   -5.990  1.00 0.14 ? 65  LEU A H    3  
ATOM   3687  H HA   . LEU A 1 65 ? -18.570 6.081   -6.005  1.00 0.16 ? 65  LEU A HA   3  
ATOM   3688  H HB2  . LEU A 1 65 ? -16.583 4.939   -4.482  1.00 0.13 ? 65  LEU A HB2  3  
ATOM   3689  H HB3  . LEU A 1 65 ? -15.781 6.337   -5.166  1.00 0.14 ? 65  LEU A HB3  3  
ATOM   3690  H HG   . LEU A 1 65 ? -17.970 7.566   -4.293  1.00 0.15 ? 65  LEU A HG   3  
ATOM   3691  H HD11 . LEU A 1 65 ? -17.677 5.229   -2.411  1.00 0.13 ? 65  LEU A HD11 3  
ATOM   3692  H HD12 . LEU A 1 65 ? -19.032 5.506   -3.505  1.00 0.14 ? 65  LEU A HD12 3  
ATOM   3693  H HD13 . LEU A 1 65 ? -18.724 6.630   -2.181  1.00 0.14 ? 65  LEU A HD13 3  
ATOM   3694  H HD21 . LEU A 1 65 ? -15.751 8.199   -3.645  1.00 0.14 ? 65  LEU A HD21 3  
ATOM   3695  H HD22 . LEU A 1 65 ? -15.586 6.765   -2.634  1.00 0.13 ? 65  LEU A HD22 3  
ATOM   3696  H HD23 . LEU A 1 65 ? -16.729 8.031   -2.188  1.00 0.14 ? 65  LEU A HD23 3  
ATOM   3697  N N    . GLY A 1 66 ? -15.941 6.091   -7.967  1.00 0.15 ? 66  GLY A N    3  
ATOM   3698  C CA   . GLY A 1 66 ? -15.298 6.826   -9.042  1.00 0.16 ? 66  GLY A CA   3  
ATOM   3699  C C    . GLY A 1 66 ? -14.082 7.597   -8.572  1.00 0.16 ? 66  GLY A C    3  
ATOM   3700  O O    . GLY A 1 66 ? -13.888 8.753   -8.948  1.00 0.16 ? 66  GLY A O    3  
ATOM   3701  H H    . GLY A 1 66 ? -15.624 5.193   -7.732  1.00 0.15 ? 66  GLY A H    3  
ATOM   3702  H HA2  . GLY A 1 66 ? -14.995 6.128   -9.808  1.00 0.16 ? 66  GLY A HA2  3  
ATOM   3703  H HA3  . GLY A 1 66 ? -16.010 7.520   -9.463  1.00 0.17 ? 66  GLY A HA3  3  
ATOM   3704  N N    . LYS A 1 67 ? -13.260 6.957   -7.746  1.00 0.15 ? 67  LYS A N    3  
ATOM   3705  C CA   . LYS A 1 67 ? -12.056 7.590   -7.222  1.00 0.14 ? 67  LYS A CA   3  
ATOM   3706  C C    . LYS A 1 67 ? -11.082 6.546   -6.685  1.00 0.13 ? 67  LYS A C    3  
ATOM   3707  O O    . LYS A 1 67 ? -11.427 5.754   -5.809  1.00 0.12 ? 67  LYS A O    3  
ATOM   3708  C CB   . LYS A 1 67 ? -12.417 8.583   -6.115  1.00 0.14 ? 67  LYS A CB   3  
ATOM   3709  C CG   . LYS A 1 67 ? -13.107 7.940   -4.924  1.00 0.13 ? 67  LYS A CG   3  
ATOM   3710  C CD   . LYS A 1 67 ? -12.147 7.745   -3.762  1.00 0.12 ? 67  LYS A CD   3  
ATOM   3711  C CE   . LYS A 1 67 ? -12.210 8.907   -2.783  1.00 0.13 ? 67  LYS A CE   3  
ATOM   3712  N NZ   . LYS A 1 67 ? -12.060 10.220  -3.470  1.00 0.14 ? 67  LYS A NZ   3  
ATOM   3713  H H    . LYS A 1 67 ? -13.469 6.036   -7.483  1.00 0.14 ? 67  LYS A H    3  
ATOM   3714  H HA   . LYS A 1 67 ? -11.583 8.124   -8.033  1.00 0.15 ? 67  LYS A HA   3  
ATOM   3715  H HB2  . LYS A 1 67 ? -11.514 9.061   -5.766  1.00 0.14 ? 67  LYS A HB2  3  
ATOM   3716  H HB3  . LYS A 1 67 ? -13.077 9.335   -6.523  1.00 0.15 ? 67  LYS A HB3  3  
ATOM   3717  H HG2  . LYS A 1 67 ? -13.918 8.577   -4.603  1.00 0.14 ? 67  LYS A HG2  3  
ATOM   3718  H HG3  . LYS A 1 67 ? -13.498 6.979   -5.222  1.00 0.13 ? 67  LYS A HG3  3  
ATOM   3719  H HD2  . LYS A 1 67 ? -12.406 6.835   -3.243  1.00 0.12 ? 67  LYS A HD2  3  
ATOM   3720  H HD3  . LYS A 1 67 ? -11.141 7.666   -4.149  1.00 0.12 ? 67  LYS A HD3  3  
ATOM   3721  H HE2  . LYS A 1 67 ? -13.164 8.883   -2.277  1.00 0.13 ? 67  LYS A HE2  3  
ATOM   3722  H HE3  . LYS A 1 67 ? -11.417 8.796   -2.058  1.00 0.12 ? 67  LYS A HE3  3  
ATOM   3723  H HZ1  . LYS A 1 67 ? -12.815 10.343  -4.175  1.00 0.14 ? 67  LYS A HZ1  3  
ATOM   3724  H HZ2  . LYS A 1 67 ? -11.140 10.267  -3.954  1.00 0.14 ? 67  LYS A HZ2  3  
ATOM   3725  H HZ3  . LYS A 1 67 ? -12.115 10.995  -2.779  1.00 0.14 ? 67  LYS A HZ3  3  
ATOM   3726  N N    . SER A 1 68 ? -9.864  6.552   -7.217  1.00 0.13 ? 68  SER A N    3  
ATOM   3727  C CA   . SER A 1 68 ? -8.841  5.603   -6.793  1.00 0.13 ? 68  SER A CA   3  
ATOM   3728  C C    . SER A 1 68 ? -7.709  6.317   -6.061  1.00 0.13 ? 68  SER A C    3  
ATOM   3729  O O    . SER A 1 68 ? -6.534  6.012   -6.262  1.00 0.13 ? 68  SER A O    3  
ATOM   3730  C CB   . SER A 1 68 ? -8.284  4.847   -8.001  1.00 0.13 ? 68  SER A CB   3  
ATOM   3731  O OG   . SER A 1 68 ? -8.157  5.702   -9.124  1.00 0.14 ? 68  SER A OG   3  
ATOM   3732  H H    . SER A 1 68 ? -9.649  7.209   -7.913  1.00 0.14 ? 68  SER A H    3  
ATOM   3733  H HA   . SER A 1 68 ? -9.303  4.898   -6.119  1.00 0.12 ? 68  SER A HA   3  
ATOM   3734  H HB2  . SER A 1 68 ? -7.312  4.450   -7.757  1.00 0.13 ? 68  SER A HB2  3  
ATOM   3735  H HB3  . SER A 1 68 ? -8.952  4.036   -8.255  1.00 0.13 ? 68  SER A HB3  3  
ATOM   3736  H HG   . SER A 1 68 ? -8.388  5.221   -9.922  1.00 0.15 ? 68  SER A HG   3  
ATOM   3737  N N    . GLY A 1 69 ? -8.072  7.269   -5.207  1.00 0.13 ? 69  GLY A N    3  
ATOM   3738  C CA   . GLY A 1 69 ? -7.078  8.012   -4.455  1.00 0.13 ? 69  GLY A CA   3  
ATOM   3739  C C    . GLY A 1 69 ? -6.211  7.115   -3.597  1.00 0.12 ? 69  GLY A C    3  
ATOM   3740  O O    . GLY A 1 69 ? -5.091  7.479   -3.243  1.00 0.13 ? 69  GLY A O    3  
ATOM   3741  H H    . GLY A 1 69 ? -9.024  7.469   -5.086  1.00 0.13 ? 69  GLY A H    3  
ATOM   3742  H HA2  . GLY A 1 69 ? -6.446  8.549   -5.149  1.00 0.14 ? 69  GLY A HA2  3  
ATOM   3743  H HA3  . GLY A 1 69 ? -7.581  8.725   -3.818  1.00 0.13 ? 69  GLY A HA3  3  
ATOM   3744  N N    . GLU A 1 70 ? -6.730  5.938   -3.259  1.00 0.11 ? 70  GLU A N    3  
ATOM   3745  C CA   . GLU A 1 70 ? -5.995  4.987   -2.433  1.00 0.10 ? 70  GLU A CA   3  
ATOM   3746  C C    . GLU A 1 70 ? -5.505  3.808   -3.268  1.00 0.10 ? 70  GLU A C    3  
ATOM   3747  O O    . GLU A 1 70 ? -4.519  3.155   -2.921  1.00 0.10 ? 70  GLU A O    3  
ATOM   3748  C CB   . GLU A 1 70 ? -6.878  4.484   -1.288  1.00 0.09 ? 70  GLU A CB   3  
ATOM   3749  C CG   . GLU A 1 70 ? -6.637  5.205   0.027   1.00 0.10 ? 70  GLU A CG   3  
ATOM   3750  C CD   . GLU A 1 70 ? -7.357  6.535   0.106   1.00 0.10 ? 70  GLU A CD   3  
ATOM   3751  O OE1  . GLU A 1 70 ? -7.398  7.126   1.206   1.00 0.11 ? 70  GLU A OE1  3  
ATOM   3752  O OE2  . GLU A 1 70 ? -7.882  6.988   -0.934  1.00 0.11 ? 70  GLU A OE2  3  
ATOM   3753  H H    . GLU A 1 70 ? -7.628  5.706   -3.570  1.00 0.11 ? 70  GLU A H    3  
ATOM   3754  H HA   . GLU A 1 70 ? -5.141  5.499   -2.019  1.00 0.11 ? 70  GLU A HA   3  
ATOM   3755  H HB2  . GLU A 1 70 ? -7.914  4.617   -1.562  1.00 0.09 ? 70  GLU A HB2  3  
ATOM   3756  H HB3  . GLU A 1 70 ? -6.686  3.432   -1.137  1.00 0.09 ? 70  GLU A HB3  3  
ATOM   3757  H HG2  . GLU A 1 70 ? -6.982  4.578   0.836   1.00 0.09 ? 70  GLU A HG2  3  
ATOM   3758  H HG3  . GLU A 1 70 ? -5.577  5.379   0.137   1.00 0.10 ? 70  GLU A HG3  3  
ATOM   3759  N N    . LEU A 1 71 ? -6.201  3.540   -4.367  1.00 0.10 ? 71  LEU A N    3  
ATOM   3760  C CA   . LEU A 1 71 ? -5.835  2.438   -5.252  1.00 0.10 ? 71  LEU A CA   3  
ATOM   3761  C C    . LEU A 1 71 ? -4.458  2.664   -5.865  1.00 0.11 ? 71  LEU A C    3  
ATOM   3762  O O    . LEU A 1 71 ? -3.605  1.775   -5.849  1.00 0.11 ? 71  LEU A O    3  
ATOM   3763  C CB   . LEU A 1 71 ? -6.879  2.282   -6.360  1.00 0.11 ? 71  LEU A CB   3  
ATOM   3764  C CG   . LEU A 1 71 ? -7.414  0.867   -6.586  1.00 0.10 ? 71  LEU A CG   3  
ATOM   3765  C CD1  . LEU A 1 71 ? -8.297  0.820   -7.822  1.00 0.11 ? 71  LEU A CD1  3  
ATOM   3766  C CD2  . LEU A 1 71 ? -6.263  -0.123  -6.710  1.00 0.10 ? 71  LEU A CD2  3  
ATOM   3767  H H    . LEU A 1 71 ? -6.976  4.095   -4.590  1.00 0.11 ? 71  LEU A H    3  
ATOM   3768  H HA   . LEU A 1 71 ? -5.811  1.535   -4.663  1.00 0.10 ? 71  LEU A HA   3  
ATOM   3769  H HB2  . LEU A 1 71 ? -7.715  2.924   -6.126  1.00 0.11 ? 71  LEU A HB2  3  
ATOM   3770  H HB3  . LEU A 1 71 ? -6.438  2.623   -7.285  1.00 0.12 ? 71  LEU A HB3  3  
ATOM   3771  H HG   . LEU A 1 71 ? -8.014  0.576   -5.737  1.00 0.10 ? 71  LEU A HG   3  
ATOM   3772  H HD11 . LEU A 1 71 ? -9.205  1.374   -7.636  1.00 0.11 ? 71  LEU A HD11 3  
ATOM   3773  H HD12 . LEU A 1 71 ? -8.540  -0.207  -8.052  1.00 0.11 ? 71  LEU A HD12 3  
ATOM   3774  H HD13 . LEU A 1 71 ? -7.772  1.262   -8.656  1.00 0.12 ? 71  LEU A HD13 3  
ATOM   3775  H HD21 . LEU A 1 71 ? -5.593  0.201   -7.493  1.00 0.11 ? 71  LEU A HD21 3  
ATOM   3776  H HD22 . LEU A 1 71 ? -6.653  -1.099  -6.953  1.00 0.10 ? 71  LEU A HD22 3  
ATOM   3777  H HD23 . LEU A 1 71 ? -5.726  -0.172  -5.775  1.00 0.10 ? 71  LEU A HD23 3  
ATOM   3778  N N    . LYS A 1 72 ? -4.243  3.860   -6.401  1.00 0.12 ? 72  LYS A N    3  
ATOM   3779  C CA   . LYS A 1 72 ? -2.967  4.205   -7.016  1.00 0.13 ? 72  LYS A CA   3  
ATOM   3780  C C    . LYS A 1 72 ? -1.809  3.907   -6.070  1.00 0.13 ? 72  LYS A C    3  
ATOM   3781  O O    . LYS A 1 72 ? -0.701  3.592   -6.508  1.00 0.14 ? 72  LYS A O    3  
ATOM   3782  C CB   . LYS A 1 72 ? -2.950  5.685   -7.407  1.00 0.14 ? 72  LYS A CB   3  
ATOM   3783  C CG   . LYS A 1 72 ? -3.775  5.997   -8.644  1.00 0.15 ? 72  LYS A CG   3  
ATOM   3784  C CD   . LYS A 1 72 ? -2.898  6.446   -9.801  1.00 0.16 ? 72  LYS A CD   3  
ATOM   3785  C CE   . LYS A 1 72 ? -2.289  7.815   -9.540  1.00 0.17 ? 72  LYS A CE   3  
ATOM   3786  N NZ   . LYS A 1 72 ? -2.560  8.765   -10.653 1.00 0.18 ? 72  LYS A NZ   3  
ATOM   3787  H H    . LYS A 1 72 ? -4.961  4.527   -6.383  1.00 0.12 ? 72  LYS A H    3  
ATOM   3788  H HA   . LYS A 1 72 ? -2.854  3.605   -7.907  1.00 0.14 ? 72  LYS A HA   3  
ATOM   3789  H HB2  . LYS A 1 72 ? -3.339  6.266   -6.585  1.00 0.14 ? 72  LYS A HB2  3  
ATOM   3790  H HB3  . LYS A 1 72 ? -1.929  5.983   -7.597  1.00 0.15 ? 72  LYS A HB3  3  
ATOM   3791  H HG2  . LYS A 1 72 ? -4.315  5.110   -8.939  1.00 0.15 ? 72  LYS A HG2  3  
ATOM   3792  H HG3  . LYS A 1 72 ? -4.476  6.785   -8.408  1.00 0.15 ? 72  LYS A HG3  3  
ATOM   3793  H HD2  . LYS A 1 72 ? -2.103  5.728   -9.938  1.00 0.17 ? 72  LYS A HD2  3  
ATOM   3794  H HD3  . LYS A 1 72 ? -3.500  6.494   -10.698 1.00 0.17 ? 72  LYS A HD3  3  
ATOM   3795  H HE2  . LYS A 1 72 ? -2.709  8.214   -8.629  1.00 0.17 ? 72  LYS A HE2  3  
ATOM   3796  H HE3  . LYS A 1 72 ? -1.220  7.703   -9.426  1.00 0.18 ? 72  LYS A HE3  3  
ATOM   3797  H HZ1  . LYS A 1 72 ? -3.585  8.890   -10.776 1.00 0.18 ? 72  LYS A HZ1  3  
ATOM   3798  H HZ2  . LYS A 1 72 ? -2.158  8.399   -11.541 1.00 0.19 ? 72  LYS A HZ2  3  
ATOM   3799  H HZ3  . LYS A 1 72 ? -2.130  9.688   -10.447 1.00 0.19 ? 72  LYS A HZ3  3  
ATOM   3800  N N    . THR A 1 73 ? -2.071  4.004   -4.771  1.00 0.13 ? 73  THR A N    3  
ATOM   3801  C CA   . THR A 1 73 ? -1.051  3.743   -3.763  1.00 0.13 ? 73  THR A CA   3  
ATOM   3802  C C    . THR A 1 73 ? -0.920  2.250   -3.487  1.00 0.12 ? 73  THR A C    3  
ATOM   3803  O O    . THR A 1 73 ? 0.187   1.720   -3.393  1.00 0.12 ? 73  THR A O    3  
ATOM   3804  C CB   . THR A 1 73 ? -1.364  4.472   -2.443  1.00 0.12 ? 73  THR A CB   3  
ATOM   3805  O OG1  . THR A 1 73 ? -1.931  5.759   -2.718  1.00 0.13 ? 73  THR A OG1  3  
ATOM   3806  C CG2  . THR A 1 73 ? -0.108  4.635   -1.603  1.00 0.13 ? 73  THR A CG2  3  
ATOM   3807  H H    . THR A 1 73 ? -2.972  4.259   -4.483  1.00 0.12 ? 73  THR A H    3  
ATOM   3808  H HA   . THR A 1 73 ? -0.108  4.113   -4.139  1.00 0.14 ? 73  THR A HA   3  
ATOM   3809  H HB   . THR A 1 73 ? -2.079  3.884   -1.885  1.00 0.12 ? 73  THR A HB   3  
ATOM   3810  H HG1  . THR A 1 73 ? -1.314  6.276   -3.240  1.00 0.15 ? 73  THR A HG1  3  
ATOM   3811  H HG21 . THR A 1 73 ? 0.647   5.148   -2.180  1.00 0.14 ? 73  THR A HG21 3  
ATOM   3812  H HG22 . THR A 1 73 ? 0.260   3.662   -1.313  1.00 0.13 ? 73  THR A HG22 3  
ATOM   3813  H HG23 . THR A 1 73 ? -0.338  5.211   -0.720  1.00 0.13 ? 73  THR A HG23 3  
ATOM   3814  N N    . TRP A 1 74 ? -2.058  1.575   -3.359  1.00 0.11 ? 74  TRP A N    3  
ATOM   3815  C CA   . TRP A 1 74 ? -2.069  0.141   -3.094  1.00 0.10 ? 74  TRP A CA   3  
ATOM   3816  C C    . TRP A 1 74 ? -1.369  -0.625  -4.211  1.00 0.11 ? 74  TRP A C    3  
ATOM   3817  O O    . TRP A 1 74 ? -0.469  -1.425  -3.957  1.00 0.11 ? 74  TRP A O    3  
ATOM   3818  C CB   . TRP A 1 74 ? -3.506  -0.359  -2.940  1.00 0.09 ? 74  TRP A CB   3  
ATOM   3819  C CG   . TRP A 1 74 ? -3.595  -1.808  -2.566  1.00 0.08 ? 74  TRP A CG   3  
ATOM   3820  C CD1  . TRP A 1 74 ? -4.335  -2.771  -3.192  1.00 0.08 ? 74  TRP A CD1  3  
ATOM   3821  C CD2  . TRP A 1 74 ? -2.924  -2.455  -1.482  1.00 0.08 ? 74  TRP A CD2  3  
ATOM   3822  N NE1  . TRP A 1 74 ? -4.162  -3.979  -2.561  1.00 0.07 ? 74  TRP A NE1  3  
ATOM   3823  C CE2  . TRP A 1 74 ? -3.301  -3.812  -1.508  1.00 0.07 ? 74  TRP A CE2  3  
ATOM   3824  C CE3  . TRP A 1 74 ? -2.039  -2.023  -0.490  1.00 0.08 ? 74  TRP A CE3  3  
ATOM   3825  C CZ2  . TRP A 1 74 ? -2.824  -4.736  -0.583  1.00 0.07 ? 74  TRP A CZ2  3  
ATOM   3826  C CZ3  . TRP A 1 74 ? -1.566  -2.941  0.428   1.00 0.08 ? 74  TRP A CZ3  3  
ATOM   3827  C CH2  . TRP A 1 74 ? -1.959  -4.284  0.376   1.00 0.08 ? 74  TRP A CH2  3  
ATOM   3828  H H    . TRP A 1 74 ? -2.909  2.053   -3.444  1.00 0.10 ? 74  TRP A H    3  
ATOM   3829  H HA   . TRP A 1 74 ? -1.537  -0.029  -2.171  1.00 0.10 ? 74  TRP A HA   3  
ATOM   3830  H HB2  . TRP A 1 74 ? -3.997  0.215   -2.169  1.00 0.08 ? 74  TRP A HB2  3  
ATOM   3831  H HB3  . TRP A 1 74 ? -4.031  -0.220  -3.874  1.00 0.09 ? 74  TRP A HB3  3  
ATOM   3832  H HD1  . TRP A 1 74 ? -4.960  -2.594  -4.055  1.00 0.08 ? 74  TRP A HD1  3  
ATOM   3833  H HE1  . TRP A 1 74 ? -4.588  -4.822  -2.822  1.00 0.07 ? 74  TRP A HE1  3  
ATOM   3834  H HE3  . TRP A 1 74 ? -1.724  -0.991  -0.433  1.00 0.09 ? 74  TRP A HE3  3  
ATOM   3835  H HZ2  . TRP A 1 74 ? -3.117  -5.775  -0.609  1.00 0.07 ? 74  TRP A HZ2  3  
ATOM   3836  H HZ3  . TRP A 1 74 ? -0.882  -2.624  1.200   1.00 0.09 ? 74  TRP A HZ3  3  
ATOM   3837  H HH2  . TRP A 1 74 ? -1.564  -4.966  1.115   1.00 0.08 ? 74  TRP A HH2  3  
ATOM   3838  N N    . GLY A 1 75 ? -1.787  -0.373  -5.448  1.00 0.11 ? 75  GLY A N    3  
ATOM   3839  C CA   . GLY A 1 75 ? -1.189  -1.049  -6.585  1.00 0.12 ? 75  GLY A CA   3  
ATOM   3840  C C    . GLY A 1 75 ? 0.324   -0.950  -6.588  1.00 0.13 ? 75  GLY A C    3  
ATOM   3841  O O    . GLY A 1 75 ? 1.016   -1.927  -6.876  1.00 0.13 ? 75  GLY A O    3  
ATOM   3842  H H    . GLY A 1 75 ? -2.507  0.276   -5.588  1.00 0.11 ? 75  GLY A H    3  
ATOM   3843  H HA2  . GLY A 1 75 ? -1.470  -2.092  -6.560  1.00 0.11 ? 75  GLY A HA2  3  
ATOM   3844  H HA3  . GLY A 1 75 ? -1.568  -0.606  -7.493  1.00 0.12 ? 75  GLY A HA3  3  
ATOM   3845  N N    . LEU A 1 76 ? 0.839   0.233   -6.267  1.00 0.13 ? 76  LEU A N    3  
ATOM   3846  C CA   . LEU A 1 76 ? 2.280   0.456   -6.235  1.00 0.14 ? 76  LEU A CA   3  
ATOM   3847  C C    . LEU A 1 76 ? 2.923   -0.304  -5.080  1.00 0.14 ? 76  LEU A C    3  
ATOM   3848  O O    . LEU A 1 76 ? 3.830   -1.109  -5.282  1.00 0.15 ? 76  LEU A O    3  
ATOM   3849  C CB   . LEU A 1 76 ? 2.580   1.951   -6.108  1.00 0.15 ? 76  LEU A CB   3  
ATOM   3850  C CG   . LEU A 1 76 ? 2.812   2.703   -7.418  1.00 0.16 ? 76  LEU A CG   3  
ATOM   3851  C CD1  . LEU A 1 76 ? 2.341   4.145   -7.296  1.00 0.17 ? 76  LEU A CD1  3  
ATOM   3852  C CD2  . LEU A 1 76 ? 4.282   2.651   -7.810  1.00 0.18 ? 76  LEU A CD2  3  
ATOM   3853  H H    . LEU A 1 76 ? 0.234   0.973   -6.045  1.00 0.13 ? 76  LEU A H    3  
ATOM   3854  H HA   . LEU A 1 76 ? 2.693   0.093   -7.164  1.00 0.15 ? 76  LEU A HA   3  
ATOM   3855  H HB2  . LEU A 1 76 ? 1.752   2.417   -5.594  1.00 0.15 ? 76  LEU A HB2  3  
ATOM   3856  H HB3  . LEU A 1 76 ? 3.463   2.062   -5.497  1.00 0.16 ? 76  LEU A HB3  3  
ATOM   3857  H HG   . LEU A 1 76 ? 2.238   2.231   -8.203  1.00 0.16 ? 76  LEU A HG   3  
ATOM   3858  H HD11 . LEU A 1 76 ? 1.282   4.162   -7.083  1.00 0.16 ? 76  LEU A HD11 3  
ATOM   3859  H HD12 . LEU A 1 76 ? 2.530   4.665   -8.225  1.00 0.18 ? 76  LEU A HD12 3  
ATOM   3860  H HD13 . LEU A 1 76 ? 2.878   4.632   -6.496  1.00 0.17 ? 76  LEU A HD13 3  
ATOM   3861  H HD21 . LEU A 1 76 ? 4.815   3.450   -7.318  1.00 0.17 ? 76  LEU A HD21 3  
ATOM   3862  H HD22 . LEU A 1 76 ? 4.373   2.763   -8.880  1.00 0.22 ? 76  LEU A HD22 3  
ATOM   3863  H HD23 . LEU A 1 76 ? 4.700   1.701   -7.512  1.00 0.25 ? 76  LEU A HD23 3  
ATOM   3864  N N    . VAL A 1 77 ? 2.444   -0.044  -3.867  1.00 0.14 ? 77  VAL A N    3  
ATOM   3865  C CA   . VAL A 1 77 ? 2.971   -0.706  -2.679  1.00 0.13 ? 77  VAL A CA   3  
ATOM   3866  C C    . VAL A 1 77 ? 2.877   -2.223  -2.809  1.00 0.13 ? 77  VAL A C    3  
ATOM   3867  O O    . VAL A 1 77 ? 3.626   -2.958  -2.167  1.00 0.13 ? 77  VAL A O    3  
ATOM   3868  C CB   . VAL A 1 77 ? 2.218   -0.262  -1.411  1.00 0.13 ? 77  VAL A CB   3  
ATOM   3869  C CG1  . VAL A 1 77 ? 2.709   -1.042  -0.200  1.00 0.13 ? 77  VAL A CG1  3  
ATOM   3870  C CG2  . VAL A 1 77 ? 2.380   1.233   -1.192  1.00 0.13 ? 77  VAL A CG2  3  
ATOM   3871  H H    . VAL A 1 77 ? 1.718   0.607   -3.768  1.00 0.13 ? 77  VAL A H    3  
ATOM   3872  H HA   . VAL A 1 77 ? 4.009   -0.427  -2.574  1.00 0.14 ? 77  VAL A HA   3  
ATOM   3873  H HB   . VAL A 1 77 ? 1.167   -0.474  -1.547  1.00 0.12 ? 77  VAL A HB   3  
ATOM   3874  H HG11 . VAL A 1 77 ? 2.456   -2.086  -0.319  1.00 0.15 ? 77  VAL A HG11 3  
ATOM   3875  H HG12 . VAL A 1 77 ? 2.237   -0.656  0.692   1.00 0.16 ? 77  VAL A HG12 3  
ATOM   3876  H HG13 . VAL A 1 77 ? 3.780   -0.939  -0.116  1.00 0.17 ? 77  VAL A HG13 3  
ATOM   3877  H HG21 . VAL A 1 77 ? 3.427   1.469   -1.074  1.00 0.14 ? 77  VAL A HG21 3  
ATOM   3878  H HG22 . VAL A 1 77 ? 1.842   1.527   -0.302  1.00 0.13 ? 77  VAL A HG22 3  
ATOM   3879  H HG23 . VAL A 1 77 ? 1.984   1.767   -2.044  1.00 0.14 ? 77  VAL A HG23 3  
ATOM   3880  N N    . LEU A 1 78 ? 1.951   -2.683  -3.643  1.00 0.12 ? 78  LEU A N    3  
ATOM   3881  C CA   . LEU A 1 78 ? 1.759   -4.112  -3.858  1.00 0.12 ? 78  LEU A CA   3  
ATOM   3882  C C    . LEU A 1 78 ? 2.717   -4.637  -4.923  1.00 0.13 ? 78  LEU A C    3  
ATOM   3883  O O    . LEU A 1 78 ? 3.366   -5.667  -4.735  1.00 0.13 ? 78  LEU A O    3  
ATOM   3884  C CB   . LEU A 1 78 ? 0.314   -4.397  -4.273  1.00 0.11 ? 78  LEU A CB   3  
ATOM   3885  C CG   . LEU A 1 78 ? -0.201  -5.808  -3.987  1.00 0.10 ? 78  LEU A CG   3  
ATOM   3886  C CD1  . LEU A 1 78 ? -0.552  -5.961  -2.517  1.00 0.09 ? 78  LEU A CD1  3  
ATOM   3887  C CD2  . LEU A 1 78 ? -1.408  -6.121  -4.860  1.00 0.09 ? 78  LEU A CD2  3  
ATOM   3888  H H    . LEU A 1 78 ? 1.381   -2.046  -4.124  1.00 0.12 ? 78  LEU A H    3  
ATOM   3889  H HA   . LEU A 1 78 ? 1.963   -4.618  -2.926  1.00 0.11 ? 78  LEU A HA   3  
ATOM   3890  H HB2  . LEU A 1 78 ? -0.326  -3.696  -3.757  1.00 0.10 ? 78  LEU A HB2  3  
ATOM   3891  H HB3  . LEU A 1 78 ? 0.229   -4.217  -5.334  1.00 0.11 ? 78  LEU A HB3  3  
ATOM   3892  H HG   . LEU A 1 78 ? 0.575   -6.522  -4.219  1.00 0.10 ? 78  LEU A HG   3  
ATOM   3893  H HD11 . LEU A 1 78 ? -1.323  -5.252  -2.254  1.00 0.08 ? 78  LEU A HD11 3  
ATOM   3894  H HD12 . LEU A 1 78 ? 0.327   -5.777  -1.916  1.00 0.10 ? 78  LEU A HD12 3  
ATOM   3895  H HD13 . LEU A 1 78 ? -0.909  -6.964  -2.333  1.00 0.09 ? 78  LEU A HD13 3  
ATOM   3896  H HD21 . LEU A 1 78 ? -1.110  -6.124  -5.899  1.00 0.10 ? 78  LEU A HD21 3  
ATOM   3897  H HD22 . LEU A 1 78 ? -2.168  -5.369  -4.706  1.00 0.09 ? 78  LEU A HD22 3  
ATOM   3898  H HD23 . LEU A 1 78 ? -1.802  -7.091  -4.596  1.00 0.09 ? 78  LEU A HD23 3  
ATOM   3899  N N    . GLY A 1 79 ? 2.804   -3.922  -6.040  1.00 0.13 ? 79  GLY A N    3  
ATOM   3900  C CA   . GLY A 1 79 ? 3.688   -4.329  -7.115  1.00 0.15 ? 79  GLY A CA   3  
ATOM   3901  C C    . GLY A 1 79 ? 5.103   -4.588  -6.637  1.00 0.15 ? 79  GLY A C    3  
ATOM   3902  O O    . GLY A 1 79 ? 5.830   -5.383  -7.230  1.00 0.16 ? 79  GLY A O    3  
ATOM   3903  H H    . GLY A 1 79 ? 2.265   -3.109  -6.132  1.00 0.13 ? 79  GLY A H    3  
ATOM   3904  H HA2  . GLY A 1 79 ? 3.300   -5.233  -7.562  1.00 0.14 ? 79  GLY A HA2  3  
ATOM   3905  H HA3  . GLY A 1 79 ? 3.709   -3.550  -7.863  1.00 0.15 ? 79  GLY A HA3  3  
ATOM   3906  N N    . ALA A 1 80 ? 5.494   -3.913  -5.561  1.00 0.15 ? 80  ALA A N    3  
ATOM   3907  C CA   . ALA A 1 80 ? 6.832   -4.075  -5.004  1.00 0.16 ? 80  ALA A CA   3  
ATOM   3908  C C    . ALA A 1 80 ? 6.900   -5.288  -4.082  1.00 0.16 ? 80  ALA A C    3  
ATOM   3909  O O    . ALA A 1 80 ? 7.743   -6.168  -4.259  1.00 0.17 ? 80  ALA A O    3  
ATOM   3910  C CB   . ALA A 1 80 ? 7.247   -2.817  -4.256  1.00 0.17 ? 80  ALA A CB   3  
ATOM   3911  H H    . ALA A 1 80 ? 4.869   -3.292  -5.132  1.00 0.15 ? 80  ALA A H    3  
ATOM   3912  H HA   . ALA A 1 80 ? 7.519   -4.221  -5.825  1.00 0.17 ? 80  ALA A HA   3  
ATOM   3913  H HB1  . ALA A 1 80 ? 6.594   -2.670  -3.408  1.00 0.16 ? 80  ALA A HB1  3  
ATOM   3914  H HB2  . ALA A 1 80 ? 7.178   -1.965  -4.916  1.00 0.18 ? 80  ALA A HB2  3  
ATOM   3915  H HB3  . ALA A 1 80 ? 8.265   -2.923  -3.910  1.00 0.18 ? 80  ALA A HB3  3  
ATOM   3916  N N    . LEU A 1 81 ? 6.009   -5.326  -3.097  1.00 0.15 ? 81  LEU A N    3  
ATOM   3917  C CA   . LEU A 1 81 ? 5.968   -6.431  -2.145  1.00 0.15 ? 81  LEU A CA   3  
ATOM   3918  C C    . LEU A 1 81 ? 5.795   -7.764  -2.867  1.00 0.14 ? 81  LEU A C    3  
ATOM   3919  O O    . LEU A 1 81 ? 6.468   -8.745  -2.551  1.00 0.15 ? 81  LEU A O    3  
ATOM   3920  C CB   . LEU A 1 81 ? 4.830   -6.227  -1.145  1.00 0.14 ? 81  LEU A CB   3  
ATOM   3921  C CG   . LEU A 1 81 ? 5.241   -5.764  0.254   1.00 0.14 ? 81  LEU A CG   3  
ATOM   3922  C CD1  . LEU A 1 81 ? 4.022   -5.649  1.157   1.00 0.13 ? 81  LEU A CD1  3  
ATOM   3923  C CD2  . LEU A 1 81 ? 6.263   -6.718  0.852   1.00 0.15 ? 81  LEU A CD2  3  
ATOM   3924  H H    . LEU A 1 81 ? 5.364   -4.593  -3.007  1.00 0.14 ? 81  LEU A H    3  
ATOM   3925  H HA   . LEU A 1 81 ? 6.907   -6.443  -1.613  1.00 0.15 ? 81  LEU A HA   3  
ATOM   3926  H HB2  . LEU A 1 81 ? 4.151   -5.494  -1.556  1.00 0.13 ? 81  LEU A HB2  3  
ATOM   3927  H HB3  . LEU A 1 81 ? 4.299   -7.161  -1.046  1.00 0.13 ? 81  LEU A HB3  3  
ATOM   3928  H HG   . LEU A 1 81 ? 5.696   -4.787  0.183   1.00 0.15 ? 81  LEU A HG   3  
ATOM   3929  H HD11 . LEU A 1 81 ? 3.800   -6.614  1.586   1.00 0.13 ? 81  LEU A HD11 3  
ATOM   3930  H HD12 . LEU A 1 81 ? 3.175   -5.308  0.579   1.00 0.12 ? 81  LEU A HD12 3  
ATOM   3931  H HD13 . LEU A 1 81 ? 4.226   -4.942  1.948   1.00 0.13 ? 81  LEU A HD13 3  
ATOM   3932  H HD21 . LEU A 1 81 ? 5.930   -7.735  0.713   1.00 0.14 ? 81  LEU A HD21 3  
ATOM   3933  H HD22 . LEU A 1 81 ? 6.367   -6.516  1.908   1.00 0.15 ? 81  LEU A HD22 3  
ATOM   3934  H HD23 . LEU A 1 81 ? 7.215   -6.579  0.364   1.00 0.16 ? 81  LEU A HD23 3  
ATOM   3935  N N    . LYS A 1 82 ? 4.888   -7.791  -3.837  1.00 0.14 ? 82  LYS A N    3  
ATOM   3936  C CA   . LYS A 1 82 ? 4.627   -9.003  -4.606  1.00 0.14 ? 82  LYS A CA   3  
ATOM   3937  C C    . LYS A 1 82 ? 5.923   -9.587  -5.157  1.00 0.15 ? 82  LYS A C    3  
ATOM   3938  O O    . LYS A 1 82 ? 6.058   -10.803 -5.292  1.00 0.15 ? 82  LYS A O    3  
ATOM   3939  C CB   . LYS A 1 82 ? 3.662   -8.701  -5.756  1.00 0.13 ? 82  LYS A CB   3  
ATOM   3940  C CG   . LYS A 1 82 ? 2.250   -9.210  -5.514  1.00 0.12 ? 82  LYS A CG   3  
ATOM   3941  C CD   . LYS A 1 82 ? 1.231   -8.432  -6.329  1.00 0.12 ? 82  LYS A CD   3  
ATOM   3942  C CE   . LYS A 1 82 ? -0.127  -9.118  -6.322  1.00 0.11 ? 82  LYS A CE   3  
ATOM   3943  N NZ   . LYS A 1 82 ? -0.472  -9.679  -7.659  1.00 0.12 ? 82  LYS A NZ   3  
ATOM   3944  H H    . LYS A 1 82 ? 4.382   -6.977  -4.041  1.00 0.13 ? 82  LYS A H    3  
ATOM   3945  H HA   . LYS A 1 82 ? 4.172   -9.724  -3.945  1.00 0.13 ? 82  LYS A HA   3  
ATOM   3946  H HB2  . LYS A 1 82 ? 3.616   -7.632  -5.902  1.00 0.13 ? 82  LYS A HB2  3  
ATOM   3947  H HB3  . LYS A 1 82 ? 4.038   -9.163  -6.656  1.00 0.14 ? 82  LYS A HB3  3  
ATOM   3948  H HG2  . LYS A 1 82 ? 2.200   -10.251 -5.791  1.00 0.12 ? 82  LYS A HG2  3  
ATOM   3949  H HG3  . LYS A 1 82 ? 2.016   -9.102  -4.464  1.00 0.12 ? 82  LYS A HG3  3  
ATOM   3950  H HD2  . LYS A 1 82 ? 1.127   -7.442  -5.911  1.00 0.12 ? 82  LYS A HD2  3  
ATOM   3951  H HD3  . LYS A 1 82 ? 1.581   -8.359  -7.348  1.00 0.13 ? 82  LYS A HD3  3  
ATOM   3952  H HE2  . LYS A 1 82 ? -0.108  -9.920  -5.599  1.00 0.11 ? 82  LYS A HE2  3  
ATOM   3953  H HE3  . LYS A 1 82 ? -0.880  -8.397  -6.039  1.00 0.10 ? 82  LYS A HE3  3  
ATOM   3954  H HZ1  . LYS A 1 82 ? -1.402  -10.143 -7.622  1.00 0.11 ? 82  LYS A HZ1  3  
ATOM   3955  H HZ2  . LYS A 1 82 ? 0.241   -10.378 -7.948  1.00 0.12 ? 82  LYS A HZ2  3  
ATOM   3956  H HZ3  . LYS A 1 82 ? -0.503  -8.918  -8.368  1.00 0.12 ? 82  LYS A HZ3  3  
ATOM   3957  N N    . ALA A 1 83 ? 6.875   -8.715  -5.471  1.00 0.16 ? 83  ALA A N    3  
ATOM   3958  C CA   . ALA A 1 83 ? 8.162   -9.146  -6.002  1.00 0.17 ? 83  ALA A CA   3  
ATOM   3959  C C    . ALA A 1 83 ? 9.117   -9.532  -4.880  1.00 0.18 ? 83  ALA A C    3  
ATOM   3960  O O    . ALA A 1 83 ? 9.991   -10.380 -5.060  1.00 0.19 ? 83  ALA A O    3  
ATOM   3961  C CB   . ALA A 1 83 ? 8.770   -8.050  -6.865  1.00 0.18 ? 83  ALA A CB   3  
ATOM   3962  H H    . ALA A 1 83 ? 6.708   -7.758  -5.343  1.00 0.16 ? 83  ALA A H    3  
ATOM   3963  H HA   . ALA A 1 83 ? 7.992   -10.010 -6.628  1.00 0.17 ? 83  ALA A HA   3  
ATOM   3964  H HB1  . ALA A 1 83 ? 8.963   -7.178  -6.256  1.00 0.18 ? 83  ALA A HB1  3  
ATOM   3965  H HB2  . ALA A 1 83 ? 8.083   -7.791  -7.656  1.00 0.18 ? 83  ALA A HB2  3  
ATOM   3966  H HB3  . ALA A 1 83 ? 9.697   -8.401  -7.292  1.00 0.19 ? 83  ALA A HB3  3  
ATOM   3967  N N    . ALA A 1 84 ? 8.949   -8.901  -3.722  1.00 0.17 ? 84  ALA A N    3  
ATOM   3968  C CA   . ALA A 1 84 ? 9.798   -9.180  -2.570  1.00 0.18 ? 84  ALA A CA   3  
ATOM   3969  C C    . ALA A 1 84 ? 9.459   -10.532 -1.953  1.00 0.18 ? 84  ALA A C    3  
ATOM   3970  O O    . ALA A 1 84 ? 10.293  -11.150 -1.293  1.00 0.18 ? 84  ALA A O    3  
ATOM   3971  C CB   . ALA A 1 84 ? 9.660   -8.075  -1.533  1.00 0.18 ? 84  ALA A CB   3  
ATOM   3972  H H    . ALA A 1 84 ? 8.237   -8.233  -3.641  1.00 0.17 ? 84  ALA A H    3  
ATOM   3973  H HA   . ALA A 1 84 ? 10.824  -9.197  -2.909  1.00 0.19 ? 84  ALA A HA   3  
ATOM   3974  H HB1  . ALA A 1 84 ? 10.339  -8.262  -0.714  1.00 0.19 ? 84  ALA A HB1  3  
ATOM   3975  H HB2  . ALA A 1 84 ? 8.645   -8.054  -1.162  1.00 0.17 ? 84  ALA A HB2  3  
ATOM   3976  H HB3  . ALA A 1 84 ? 9.897   -7.123  -1.986  1.00 0.18 ? 84  ALA A HB3  3  
ATOM   3977  N N    . ARG A 1 85 ? 8.229   -10.985 -2.172  1.00 0.16 ? 85  ARG A N    3  
ATOM   3978  C CA   . ARG A 1 85 ? 7.779   -12.264 -1.636  1.00 0.16 ? 85  ARG A CA   3  
ATOM   3979  C C    . ARG A 1 85 ? 7.769   -13.336 -2.721  1.00 0.16 ? 85  ARG A C    3  
ATOM   3980  O O    . ARG A 1 85 ? 7.071   -14.344 -2.605  1.00 0.16 ? 85  ARG A O    3  
ATOM   3981  C CB   . ARG A 1 85 ? 6.382   -12.124 -1.029  1.00 0.15 ? 85  ARG A CB   3  
ATOM   3982  C CG   . ARG A 1 85 ? 6.325   -11.180 0.161   1.00 0.15 ? 85  ARG A CG   3  
ATOM   3983  C CD   . ARG A 1 85 ? 4.930   -11.128 0.765   1.00 0.14 ? 85  ARG A CD   3  
ATOM   3984  N NE   . ARG A 1 85 ? 4.965   -11.148 2.225   1.00 0.14 ? 85  ARG A NE   3  
ATOM   3985  C CZ   . ARG A 1 85 ? 5.343   -12.205 2.936   1.00 0.14 ? 85  ARG A CZ   3  
ATOM   3986  N NH1  . ARG A 1 85 ? 5.717   -13.320 2.325   1.00 0.15 ? 85  ARG A NH1  3  
ATOM   3987  N NH2  . ARG A 1 85 ? 5.348   -12.146 4.262   1.00 0.15 ? 85  ARG A NH2  3  
ATOM   3988  H H    . ARG A 1 85 ? 7.610   -10.446 -2.707  1.00 0.16 ? 85  ARG A H    3  
ATOM   3989  H HA   . ARG A 1 85 ? 8.469   -12.559 -0.861  1.00 0.17 ? 85  ARG A HA   3  
ATOM   3990  H HB2  . ARG A 1 85 ? 5.708   -11.753 -1.787  1.00 0.14 ? 85  ARG A HB2  3  
ATOM   3991  H HB3  . ARG A 1 85 ? 6.043   -13.097 -0.706  1.00 0.15 ? 85  ARG A HB3  3  
ATOM   3992  H HG2  . ARG A 1 85 ? 7.019   -11.523 0.913   1.00 0.15 ? 85  ARG A HG2  3  
ATOM   3993  H HG3  . ARG A 1 85 ? 6.605   -10.189 -0.165  1.00 0.15 ? 85  ARG A HG3  3  
ATOM   3994  H HD2  . ARG A 1 85 ? 4.445   -10.219 0.441   1.00 0.13 ? 85  ARG A HD2  3  
ATOM   3995  H HD3  . ARG A 1 85 ? 4.369   -11.980 0.415   1.00 0.13 ? 85  ARG A HD3  3  
ATOM   3996  H HE   . ARG A 1 85 ? 4.693   -10.333 2.698   1.00 0.14 ? 85  ARG A HE   3  
ATOM   3997  H HH11 . ARG A 1 85 ? 6.001   -14.114 2.862   1.00 0.15 ? 85  ARG A HH11 3  
ATOM   3998  H HH12 . ARG A 1 85 ? 5.713   -13.368 1.326   1.00 0.15 ? 85  ARG A HH12 3  
ATOM   3999  H HH21 . ARG A 1 85 ? 5.067   -11.307 4.727   1.00 0.15 ? 85  ARG A HH21 3  
ATOM   4000  H HH22 . ARG A 1 85 ? 5.634   -12.941 4.798   1.00 0.15 ? 85  ARG A HH22 3  
ATOM   4001  N N    . GLU A 1 86 ? 8.546   -13.110 -3.776  1.00 0.17 ? 86  GLU A N    3  
ATOM   4002  C CA   . GLU A 1 86 ? 8.624   -14.056 -4.883  1.00 0.17 ? 86  GLU A CA   3  
ATOM   4003  C C    . GLU A 1 86 ? 10.036  -14.622 -5.015  1.00 0.19 ? 86  GLU A C    3  
ATOM   4004  O O    . GLU A 1 86 ? 10.221  -15.760 -5.447  1.00 0.19 ? 86  GLU A O    3  
ATOM   4005  C CB   . GLU A 1 86 ? 8.208   -13.381 -6.190  1.00 0.17 ? 86  GLU A CB   3  
ATOM   4006  C CG   . GLU A 1 86 ? 6.803   -13.744 -6.642  1.00 0.16 ? 86  GLU A CG   3  
ATOM   4007  C CD   . GLU A 1 86 ? 6.469   -13.186 -8.013  1.00 0.17 ? 86  GLU A CD   3  
ATOM   4008  O OE1  . GLU A 1 86 ? 7.120   -13.597 -8.995  1.00 0.18 ? 86  GLU A OE1  3  
ATOM   4009  O OE2  . GLU A 1 86 ? 5.557   -12.338 -8.101  1.00 0.16 ? 86  GLU A OE2  3  
ATOM   4010  H H    . GLU A 1 86 ? 9.079   -12.289 -3.810  1.00 0.17 ? 86  GLU A H    3  
ATOM   4011  H HA   . GLU A 1 86 ? 7.943   -14.868 -4.674  1.00 0.17 ? 86  GLU A HA   3  
ATOM   4012  H HB2  . GLU A 1 86 ? 8.256   -12.310 -6.060  1.00 0.17 ? 86  GLU A HB2  3  
ATOM   4013  H HB3  . GLU A 1 86 ? 8.899   -13.671 -6.968  1.00 0.18 ? 86  GLU A HB3  3  
ATOM   4014  H HG2  . GLU A 1 86 ? 6.718   -14.820 -6.678  1.00 0.17 ? 86  GLU A HG2  3  
ATOM   4015  H HG3  . GLU A 1 86 ? 6.096   -13.350 -5.927  1.00 0.16 ? 86  GLU A HG3  3  
ATOM   4016  N N    . GLU A 1 87 ? 11.027  -13.818 -4.644  1.00 0.19 ? 87  GLU A N    3  
ATOM   4017  C CA   . GLU A 1 87 ? 12.420  -14.237 -4.722  1.00 0.21 ? 87  GLU A CA   3  
ATOM   4018  C C    . GLU A 1 87 ? 12.782  -15.147 -3.554  1.00 0.21 ? 87  GLU A C    3  
ATOM   4019  O O    . GLU A 1 87 ? 13.838  -15.782 -3.550  1.00 0.22 ? 87  GLU A O    3  
ATOM   4020  C CB   . GLU A 1 87 ? 13.343  -13.018 -4.738  1.00 0.21 ? 87  GLU A CB   3  
ATOM   4021  C CG   . GLU A 1 87 ? 13.796  -12.614 -6.130  1.00 0.22 ? 87  GLU A CG   3  
ATOM   4022  C CD   . GLU A 1 87 ? 15.304  -12.530 -6.253  1.00 0.24 ? 87  GLU A CD   3  
ATOM   4023  O OE1  . GLU A 1 87 ? 15.918  -13.514 -6.720  1.00 0.24 ? 87  GLU A OE1  3  
ATOM   4024  O OE2  . GLU A 1 87 ? 15.875  -11.484 -5.880  1.00 0.24 ? 87  GLU A OE2  3  
ATOM   4025  O OXT  . GLU A 1 87 ? 12.006  -15.214 -2.554  1.00 0.20 ? 87  GLU A OXT  3  
ATOM   4026  H H    . GLU A 1 87 ? 10.816  -12.923 -4.308  1.00 0.19 ? 87  GLU A H    3  
ATOM   4027  H HA   . GLU A 1 87 ? 12.549  -14.787 -5.643  1.00 0.21 ? 87  GLU A HA   3  
ATOM   4028  H HB2  . GLU A 1 87 ? 12.822  -12.181 -4.296  1.00 0.21 ? 87  GLU A HB2  3  
ATOM   4029  H HB3  . GLU A 1 87 ? 14.220  -13.236 -4.147  1.00 0.22 ? 87  GLU A HB3  3  
ATOM   4030  H HG2  . GLU A 1 87 ? 13.434  -13.343 -6.839  1.00 0.22 ? 87  GLU A HG2  3  
ATOM   4031  H HG3  . GLU A 1 87 ? 13.377  -11.647 -6.366  1.00 0.22 ? 87  GLU A HG3  3  
HETATM 4032  C C1   . I3P B 2 .  ? 11.685  9.400   1.086   1.00 0.80 ? 101 I3P A C1   3  
HETATM 4033  C C2   . I3P B 2 .  ? 11.993  10.106  2.427   1.00 0.90 ? 101 I3P A C2   3  
HETATM 4034  C C3   . I3P B 2 .  ? 11.886  11.635  2.260   1.00 0.87 ? 101 I3P A C3   3  
HETATM 4035  C C4   . I3P B 2 .  ? 10.484  12.037  1.753   1.00 0.99 ? 101 I3P A C4   3  
HETATM 4036  C C5   . I3P B 2 .  ? 10.171  11.324  0.418   1.00 0.89 ? 101 I3P A C5   3  
HETATM 4037  C C6   . I3P B 2 .  ? 10.282  9.792   0.581   1.00 0.77 ? 101 I3P A C6   3  
HETATM 4038  O O1   . I3P B 2 .  ? 11.731  7.996   1.263   1.00 1.09 ? 101 I3P A O1   3  
HETATM 4039  O O2   . I3P B 2 .  ? 11.099  9.677   3.427   1.00 1.13 ? 101 I3P A O2   3  
HETATM 4040  O O3   . I3P B 2 .  ? 12.153  12.251  3.493   1.00 1.18 ? 101 I3P A O3   3  
HETATM 4041  O O4   . I3P B 2 .  ? 10.460  13.435  1.537   1.00 1.27 ? 101 I3P A O4   3  
HETATM 4042  O O5   . I3P B 2 .  ? 8.851   11.645  0.024   1.00 1.24 ? 101 I3P A O5   3  
HETATM 4043  O O6   . I3P B 2 .  ? 10.052  9.162   -0.655  1.00 0.95 ? 101 I3P A O6   3  
HETATM 4044  P P1   . I3P B 2 .  ? 13.236  7.353   0.639   1.00 1.49 ? 101 I3P A P1   3  
HETATM 4045  O O11  . I3P B 2 .  ? 13.439  7.697   -1.051  1.00 1.57 ? 101 I3P A O11  3  
HETATM 4046  O O12  . I3P B 2 .  ? 14.406  8.018   1.416   1.00 1.59 ? 101 I3P A O12  3  
HETATM 4047  O O13  . I3P B 2 .  ? 13.332  5.646   0.938   1.00 1.97 ? 101 I3P A O13  3  
HETATM 4048  P P4   . I3P B 2 .  ? 9.255   14.194  2.559   1.00 1.78 ? 101 I3P A P4   3  
HETATM 4049  O O41  . I3P B 2 .  ? 7.858   13.687  2.112   1.00 1.94 ? 101 I3P A O41  3  
HETATM 4050  O O42  . I3P B 2 .  ? 9.460   13.784  4.234   1.00 1.90 ? 101 I3P A O42  3  
HETATM 4051  O O43  . I3P B 2 .  ? 9.257   15.915  2.341   1.00 2.20 ? 101 I3P A O43  3  
HETATM 4052  P P5   . I3P B 2 .  ? 8.859   12.578  -1.460  1.00 1.58 ? 101 I3P A P5   3  
HETATM 4053  O O51  . I3P B 2 .  ? 9.375   11.657  -2.599  1.00 1.56 ? 101 I3P A O51  3  
HETATM 4054  O O52  . I3P B 2 .  ? 7.251   13.059  -1.894  1.00 2.10 ? 101 I3P A O52  3  
HETATM 4055  O O53  . I3P B 2 .  ? 9.913   13.955  -1.371  1.00 1.65 ? 101 I3P A O53  3  
HETATM 4056  H H1   . I3P B 2 .  ? 12.415  9.723   0.337   1.00 0.84 ? 101 I3P A H1   3  
HETATM 4057  H H2   . I3P B 2 .  ? 13.013  9.863   2.737   1.00 1.09 ? 101 I3P A H2   3  
HETATM 4058  H H3   . I3P B 2 .  ? 12.635  11.964  1.534   1.00 0.81 ? 101 I3P A H3   3  
HETATM 4059  H H4   . I3P B 2 .  ? 9.737   11.739  2.493   1.00 1.17 ? 101 I3P A H4   3  
HETATM 4060  H H5   . I3P B 2 .  ? 10.900  11.645  -0.333  1.00 0.89 ? 101 I3P A H5   3  
HETATM 4061  H H6   . I3P B 2 .  ? 9.533   9.446   1.292   1.00 0.90 ? 101 I3P A H6   3  
HETATM 4062  H HO2  . I3P B 2 .  ? 10.319  9.309   2.973   1.00 1.23 ? 101 I3P A HO2  3  
HETATM 4063  H HO3  . I3P B 2 .  ? 11.744  13.137  3.465   1.00 1.33 ? 101 I3P A HO3  3  
HETATM 4064  H HO6  . I3P B 2 .  ? 9.680   9.832   -1.258  1.00 1.04 ? 101 I3P A HO6  3  
HETATM 4065  H HO13 . I3P B 2 .  ? 14.183  5.308   0.603   1.00 2.23 ? 101 I3P A HO13 3  
ATOM   4066  N N    . SER A 1 1  ? 2.875   3.883   10.013  1.00 0.76 ? 1   SER A N    4  
ATOM   4067  C CA   . SER A 1 1  ? 2.431   5.161   10.556  1.00 0.88 ? 1   SER A CA   4  
ATOM   4068  C C    . SER A 1 1  ? 3.566   6.180   10.549  1.00 0.88 ? 1   SER A C    4  
ATOM   4069  O O    . SER A 1 1  ? 3.329   7.388   10.545  1.00 0.98 ? 1   SER A O    4  
ATOM   4070  C CB   . SER A 1 1  ? 1.905   4.977   11.982  1.00 0.96 ? 1   SER A CB   4  
ATOM   4071  O OG   . SER A 1 1  ? 0.495   4.851   11.993  1.00 1.05 ? 1   SER A OG   4  
ATOM   4072  H H1   . SER A 1 1  ? 3.190   4.002   9.030   1.00 0.73 ? 1   SER A H1   4  
ATOM   4073  H H2   . SER A 1 1  ? 2.095   3.194   10.035  1.00 0.79 ? 1   SER A H2   4  
ATOM   4074  H H3   . SER A 1 1  ? 3.666   3.510   10.575  1.00 0.72 ? 1   SER A H3   4  
ATOM   4075  H HA   . SER A 1 1  ? 1.630   5.530   9.933   1.00 0.95 ? 1   SER A HA   4  
ATOM   4076  H HB2  . SER A 1 1  ? 2.337   4.084   12.411  1.00 0.91 ? 1   SER A HB2  4  
ATOM   4077  H HB3  . SER A 1 1  ? 2.183   5.834   12.579  1.00 1.02 ? 1   SER A HB3  4  
ATOM   4078  H HG   . SER A 1 1  ? 0.115   5.540   12.543  1.00 1.13 ? 1   SER A HG   4  
ATOM   4079  N N    . GLU A 1 2  ? 4.799   5.683   10.545  1.00 0.79 ? 2   GLU A N    4  
ATOM   4080  C CA   . GLU A 1 2  ? 5.970   6.550   10.538  1.00 0.83 ? 2   GLU A CA   4  
ATOM   4081  C C    . GLU A 1 2  ? 7.250   5.733   10.389  1.00 0.76 ? 2   GLU A C    4  
ATOM   4082  O O    . GLU A 1 2  ? 8.201   6.161   9.735   1.00 0.77 ? 2   GLU A O    4  
ATOM   4083  C CB   . GLU A 1 2  ? 6.027   7.379   11.822  1.00 0.96 ? 2   GLU A CB   4  
ATOM   4084  C CG   . GLU A 1 2  ? 6.386   6.565   13.056  1.00 0.99 ? 2   GLU A CG   4  
ATOM   4085  C CD   . GLU A 1 2  ? 6.461   7.412   14.313  1.00 1.14 ? 2   GLU A CD   4  
ATOM   4086  O OE1  . GLU A 1 2  ? 6.953   8.557   14.225  1.00 1.22 ? 2   GLU A OE1  4  
ATOM   4087  O OE2  . GLU A 1 2  ? 6.028   6.931   15.379  1.00 1.19 ? 2   GLU A OE2  4  
ATOM   4088  H H    . GLU A 1 2  ? 4.924   4.712   10.548  1.00 0.72 ? 2   GLU A H    4  
ATOM   4089  H HA   . GLU A 1 2  ? 5.884   7.218   9.694   1.00 0.86 ? 2   GLU A HA   4  
ATOM   4090  H HB2  . GLU A 1 2  ? 6.766   8.156   11.704  1.00 1.02 ? 2   GLU A HB2  4  
ATOM   4091  H HB3  . GLU A 1 2  ? 5.061   7.833   11.987  1.00 1.02 ? 2   GLU A HB3  4  
ATOM   4092  H HG2  . GLU A 1 2  ? 5.636   5.802   13.198  1.00 0.95 ? 2   GLU A HG2  4  
ATOM   4093  H HG3  . GLU A 1 2  ? 7.347   6.099   12.896  1.00 0.95 ? 2   GLU A HG3  4  
ATOM   4094  N N    . ALA A 1 3  ? 7.268   4.553   11.002  1.00 0.72 ? 3   ALA A N    4  
ATOM   4095  C CA   . ALA A 1 3  ? 8.430   3.676   10.936  1.00 0.70 ? 3   ALA A CA   4  
ATOM   4096  C C    . ALA A 1 3  ? 8.273   2.639   9.832   1.00 0.57 ? 3   ALA A C    4  
ATOM   4097  O O    . ALA A 1 3  ? 9.179   2.433   9.024   1.00 0.56 ? 3   ALA A O    4  
ATOM   4098  C CB   . ALA A 1 3  ? 8.651   2.993   12.278  1.00 0.79 ? 3   ALA A CB   4  
ATOM   4099  H H    . ALA A 1 3  ? 6.484   4.270   11.515  1.00 0.73 ? 3   ALA A H    4  
ATOM   4100  H HA   . ALA A 1 3  ? 9.296   4.286   10.723  1.00 0.75 ? 3   ALA A HA   4  
ATOM   4101  H HB1  . ALA A 1 3  ? 8.758   3.741   13.050  1.00 0.89 ? 3   ALA A HB1  4  
ATOM   4102  H HB2  . ALA A 1 3  ? 9.547   2.391   12.233  1.00 0.82 ? 3   ALA A HB2  4  
ATOM   4103  H HB3  . ALA A 1 3  ? 7.804   2.362   12.505  1.00 0.76 ? 3   ALA A HB3  4  
ATOM   4104  N N    . VAL A 1 4  ? 7.096   2.018   9.782   1.00 0.52 ? 4   VAL A N    4  
ATOM   4105  C CA   . VAL A 1 4  ? 6.794   1.000   8.778   1.00 0.45 ? 4   VAL A CA   4  
ATOM   4106  C C    . VAL A 1 4  ? 6.776   1.595   7.367   1.00 0.43 ? 4   VAL A C    4  
ATOM   4107  O O    . VAL A 1 4  ? 7.098   0.912   6.393   1.00 0.44 ? 4   VAL A O    4  
ATOM   4108  C CB   . VAL A 1 4  ? 5.433   0.326   9.061   1.00 0.49 ? 4   VAL A CB   4  
ATOM   4109  C CG1  . VAL A 1 4  ? 5.208   -0.859  8.132   1.00 0.55 ? 4   VAL A CG1  4  
ATOM   4110  C CG2  . VAL A 1 4  ? 5.341   -0.110  10.516  1.00 0.62 ? 4   VAL A CG2  4  
ATOM   4111  H H    . VAL A 1 4  ? 6.411   2.250   10.441  1.00 0.57 ? 4   VAL A H    4  
ATOM   4112  H HA   . VAL A 1 4  ? 7.565   0.243   8.828   1.00 0.46 ? 4   VAL A HA   4  
ATOM   4113  H HB   . VAL A 1 4  ? 4.655   1.051   8.875   1.00 0.59 ? 4   VAL A HB   4  
ATOM   4114  H HG11 . VAL A 1 4  ? 5.214   -0.518  7.108   1.00 0.62 ? 4   VAL A HG11 4  
ATOM   4115  H HG12 . VAL A 1 4  ? 4.255   -1.315  8.355   1.00 0.62 ? 4   VAL A HG12 4  
ATOM   4116  H HG13 . VAL A 1 4  ? 5.996   -1.582  8.275   1.00 0.62 ? 4   VAL A HG13 4  
ATOM   4117  H HG21 . VAL A 1 4  ? 4.409   -0.632  10.676  1.00 0.68 ? 4   VAL A HG21 4  
ATOM   4118  H HG22 . VAL A 1 4  ? 5.380   0.759   11.156  1.00 0.78 ? 4   VAL A HG22 4  
ATOM   4119  H HG23 . VAL A 1 4  ? 6.166   -0.767  10.750  1.00 0.70 ? 4   VAL A HG23 4  
ATOM   4120  N N    . ILE A 1 5  ? 6.415   2.874   7.267   1.00 0.45 ? 5   ILE A N    4  
ATOM   4121  C CA   . ILE A 1 5  ? 6.351   3.561   5.977   1.00 0.48 ? 5   ILE A CA   4  
ATOM   4122  C C    . ILE A 1 5  ? 7.733   3.656   5.326   1.00 0.46 ? 5   ILE A C    4  
ATOM   4123  O O    . ILE A 1 5  ? 7.855   3.565   4.108   1.00 0.57 ? 5   ILE A O    4  
ATOM   4124  C CB   . ILE A 1 5  ? 5.751   4.982   6.121   1.00 0.56 ? 5   ILE A CB   4  
ATOM   4125  C CG1  . ILE A 1 5  ? 4.369   4.910   6.776   1.00 0.73 ? 5   ILE A CG1  4  
ATOM   4126  C CG2  . ILE A 1 5  ? 5.654   5.668   4.762   1.00 0.81 ? 5   ILE A CG2  4  
ATOM   4127  C CD1  . ILE A 1 5  ? 3.740   6.267   7.021   1.00 0.82 ? 5   ILE A CD1  4  
ATOM   4128  H H    . ILE A 1 5  ? 6.189   3.370   8.082   1.00 0.48 ? 5   ILE A H    4  
ATOM   4129  H HA   . ILE A 1 5  ? 5.703   2.987   5.331   1.00 0.50 ? 5   ILE A HA   4  
ATOM   4130  H HB   . ILE A 1 5  ? 6.409   5.565   6.746   1.00 0.65 ? 5   ILE A HB   4  
ATOM   4131  H HG12 . ILE A 1 5  ? 3.705   4.349   6.137   1.00 0.89 ? 5   ILE A HG12 4  
ATOM   4132  H HG13 . ILE A 1 5  ? 4.456   4.406   7.726   1.00 0.89 ? 5   ILE A HG13 4  
ATOM   4133  H HG21 . ILE A 1 5  ? 5.069   5.055   4.092   1.00 0.99 ? 5   ILE A HG21 4  
ATOM   4134  H HG22 . ILE A 1 5  ? 6.645   5.803   4.354   1.00 0.98 ? 5   ILE A HG22 4  
ATOM   4135  H HG23 . ILE A 1 5  ? 5.176   6.629   4.879   1.00 0.91 ? 5   ILE A HG23 4  
ATOM   4136  H HD11 . ILE A 1 5  ? 3.635   6.791   6.083   1.00 0.92 ? 5   ILE A HD11 4  
ATOM   4137  H HD12 . ILE A 1 5  ? 4.368   6.840   7.686   1.00 0.99 ? 5   ILE A HD12 4  
ATOM   4138  H HD13 . ILE A 1 5  ? 2.766   6.135   7.470   1.00 1.11 ? 5   ILE A HD13 4  
ATOM   4139  N N    . LYS A 1 6  ? 8.771   3.824   6.145   1.00 0.44 ? 6   LYS A N    4  
ATOM   4140  C CA   . LYS A 1 6  ? 10.142  3.926   5.641   1.00 0.45 ? 6   LYS A CA   4  
ATOM   4141  C C    . LYS A 1 6  ? 10.673  2.569   5.170   1.00 0.41 ? 6   LYS A C    4  
ATOM   4142  O O    . LYS A 1 6  ? 11.502  2.504   4.261   1.00 0.42 ? 6   LYS A O    4  
ATOM   4143  C CB   . LYS A 1 6  ? 11.065  4.505   6.719   1.00 0.52 ? 6   LYS A CB   4  
ATOM   4144  C CG   . LYS A 1 6  ? 10.793  5.970   7.049   1.00 0.78 ? 6   LYS A CG   4  
ATOM   4145  C CD   . LYS A 1 6  ? 11.029  6.883   5.848   1.00 1.08 ? 6   LYS A CD   4  
ATOM   4146  C CE   . LYS A 1 6  ? 12.491  6.895   5.423   1.00 1.30 ? 6   LYS A CE   4  
ATOM   4147  N NZ   . LYS A 1 6  ? 12.728  7.810   4.271   1.00 1.91 ? 6   LYS A NZ   4  
ATOM   4148  H H    . LYS A 1 6  ? 8.613   3.883   7.110   1.00 0.51 ? 6   LYS A H    4  
ATOM   4149  H HA   . LYS A 1 6  ? 10.128  4.598   4.799   1.00 0.46 ? 6   LYS A HA   4  
ATOM   4150  H HB2  . LYS A 1 6  ? 10.942  3.928   7.624   1.00 0.72 ? 6   LYS A HB2  4  
ATOM   4151  H HB3  . LYS A 1 6  ? 12.087  4.417   6.386   1.00 0.62 ? 6   LYS A HB3  4  
ATOM   4152  H HG2  . LYS A 1 6  ? 9.765   6.072   7.366   1.00 1.09 ? 6   LYS A HG2  4  
ATOM   4153  H HG3  . LYS A 1 6  ? 11.448  6.272   7.853   1.00 0.83 ? 6   LYS A HG3  4  
ATOM   4154  H HD2  . LYS A 1 6  ? 10.429  6.538   5.021   1.00 1.25 ? 6   LYS A HD2  4  
ATOM   4155  H HD3  . LYS A 1 6  ? 10.732  7.888   6.112   1.00 1.41 ? 6   LYS A HD3  4  
ATOM   4156  H HE2  . LYS A 1 6  ? 13.093  7.220   6.258   1.00 1.39 ? 6   LYS A HE2  4  
ATOM   4157  H HE3  . LYS A 1 6  ? 12.779  5.893   5.141   1.00 1.37 ? 6   LYS A HE3  4  
ATOM   4158  H HZ1  . LYS A 1 6  ? 13.739  7.821   4.026   1.00 2.23 ? 6   LYS A HZ1  4  
ATOM   4159  H HZ2  . LYS A 1 6  ? 12.432  8.777   4.512   1.00 2.11 ? 6   LYS A HZ2  4  
ATOM   4160  H HZ3  . LYS A 1 6  ? 12.186  7.491   3.442   1.00 2.10 ? 6   LYS A HZ3  4  
ATOM   4161  N N    . VAL A 1 7  ? 10.188  1.492   5.790   1.00 0.40 ? 7   VAL A N    4  
ATOM   4162  C CA   . VAL A 1 7  ? 10.602  0.141   5.434   1.00 0.41 ? 7   VAL A CA   4  
ATOM   4163  C C    . VAL A 1 7  ? 10.000  -0.286  4.100   1.00 0.37 ? 7   VAL A C    4  
ATOM   4164  O O    . VAL A 1 7  ? 10.549  -1.142  3.405   1.00 0.41 ? 7   VAL A O    4  
ATOM   4165  C CB   . VAL A 1 7  ? 10.192  -0.875  6.518   1.00 0.46 ? 7   VAL A CB   4  
ATOM   4166  C CG1  . VAL A 1 7  ? 10.811  -2.236  6.234   1.00 0.52 ? 7   VAL A CG1  4  
ATOM   4167  C CG2  . VAL A 1 7  ? 10.592  -0.374  7.897   1.00 0.53 ? 7   VAL A CG2  4  
ATOM   4168  H H    . VAL A 1 7  ? 9.530   1.613   6.507   1.00 0.42 ? 7   VAL A H    4  
ATOM   4169  H HA   . VAL A 1 7  ? 11.679  0.133   5.352   1.00 0.46 ? 7   VAL A HA   4  
ATOM   4170  H HB   . VAL A 1 7  ? 9.116   -0.982  6.495   1.00 0.44 ? 7   VAL A HB   4  
ATOM   4171  H HG11 . VAL A 1 7  ? 11.887  -2.153  6.256   1.00 0.57 ? 7   VAL A HG11 4  
ATOM   4172  H HG12 . VAL A 1 7  ? 10.495  -2.579  5.260   1.00 0.49 ? 7   VAL A HG12 4  
ATOM   4173  H HG13 . VAL A 1 7  ? 10.488  -2.942  6.985   1.00 0.56 ? 7   VAL A HG13 4  
ATOM   4174  H HG21 . VAL A 1 7  ? 10.097  0.566   8.096   1.00 0.51 ? 7   VAL A HG21 4  
ATOM   4175  H HG22 . VAL A 1 7  ? 11.663  -0.231  7.931   1.00 0.57 ? 7   VAL A HG22 4  
ATOM   4176  H HG23 . VAL A 1 7  ? 10.301  -1.099  8.642   1.00 0.58 ? 7   VAL A HG23 4  
ATOM   4177  N N    . ILE A 1 8  ? 8.876   0.336   3.746   1.00 0.34 ? 8   ILE A N    4  
ATOM   4178  C CA   . ILE A 1 8  ? 8.182   0.044   2.496   1.00 0.36 ? 8   ILE A CA   4  
ATOM   4179  C C    . ILE A 1 8  ? 8.571   1.047   1.405   1.00 0.34 ? 8   ILE A C    4  
ATOM   4180  O O    . ILE A 1 8  ? 8.608   0.707   0.221   1.00 0.34 ? 8   ILE A O    4  
ATOM   4181  C CB   . ILE A 1 8  ? 6.647   0.064   2.692   1.00 0.43 ? 8   ILE A CB   4  
ATOM   4182  C CG1  . ILE A 1 8  ? 6.231   -0.885  3.824   1.00 0.57 ? 8   ILE A CG1  4  
ATOM   4183  C CG2  . ILE A 1 8  ? 5.931   -0.304  1.398   1.00 0.61 ? 8   ILE A CG2  4  
ATOM   4184  C CD1  . ILE A 1 8  ? 6.596   -2.336  3.582   1.00 0.78 ? 8   ILE A CD1  4  
ATOM   4185  H H    . ILE A 1 8  ? 8.498   1.012   4.349   1.00 0.34 ? 8   ILE A H    4  
ATOM   4186  H HA   . ILE A 1 8  ? 8.472   -0.947  2.179   1.00 0.39 ? 8   ILE A HA   4  
ATOM   4187  H HB   . ILE A 1 8  ? 6.357   1.070   2.954   1.00 0.58 ? 8   ILE A HB   4  
ATOM   4188  H HG12 . ILE A 1 8  ? 6.715   -0.575  4.738   1.00 0.73 ? 8   ILE A HG12 4  
ATOM   4189  H HG13 . ILE A 1 8  ? 5.160   -0.829  3.955   1.00 0.61 ? 8   ILE A HG13 4  
ATOM   4190  H HG21 . ILE A 1 8  ? 4.865   -0.316  1.568   1.00 1.01 ? 8   ILE A HG21 4  
ATOM   4191  H HG22 . ILE A 1 8  ? 6.256   -1.283  1.073   1.00 1.07 ? 8   ILE A HG22 4  
ATOM   4192  H HG23 . ILE A 1 8  ? 6.167   0.424   0.637   1.00 1.06 ? 8   ILE A HG23 4  
ATOM   4193  H HD11 . ILE A 1 8  ? 7.670   -2.441  3.577   1.00 0.95 ? 8   ILE A HD11 4  
ATOM   4194  H HD12 . ILE A 1 8  ? 6.199   -2.652  2.628   1.00 0.89 ? 8   ILE A HD12 4  
ATOM   4195  H HD13 . ILE A 1 8  ? 6.177   -2.948  4.367   1.00 1.07 ? 8   ILE A HD13 4  
ATOM   4196  N N    . SER A 1 9  ? 8.870   2.282   1.812   1.00 0.36 ? 9   SER A N    4  
ATOM   4197  C CA   . SER A 1 9  ? 9.258   3.335   0.873   1.00 0.37 ? 9   SER A CA   4  
ATOM   4198  C C    . SER A 1 9  ? 10.620  3.038   0.252   1.00 0.35 ? 9   SER A C    4  
ATOM   4199  O O    . SER A 1 9  ? 10.852  3.329   -0.920  1.00 0.36 ? 9   SER A O    4  
ATOM   4200  C CB   . SER A 1 9  ? 9.290   4.694   1.575   1.00 0.43 ? 9   SER A CB   4  
ATOM   4201  O OG   . SER A 1 9  ? 9.468   5.747   0.643   1.00 0.49 ? 9   SER A OG   4  
ATOM   4202  H H    . SER A 1 9  ? 8.825   2.491   2.769   1.00 0.38 ? 9   SER A H    4  
ATOM   4203  H HA   . SER A 1 9  ? 8.518   3.364   0.087   1.00 0.39 ? 9   SER A HA   4  
ATOM   4204  H HB2  . SER A 1 9  ? 8.359   4.849   2.099   1.00 0.45 ? 9   SER A HB2  4  
ATOM   4205  H HB3  . SER A 1 9  ? 10.108  4.713   2.280   1.00 0.44 ? 9   SER A HB3  4  
ATOM   4206  H HG   . SER A 1 9  ? 10.075  5.467   -0.046  1.00 0.81 ? 9   SER A HG   4  
ATOM   4207  N N    . SER A 1 10 ? 11.518  2.457   1.044   1.00 0.36 ? 10  SER A N    4  
ATOM   4208  C CA   . SER A 1 10 ? 12.851  2.112   0.563   1.00 0.37 ? 10  SER A CA   4  
ATOM   4209  C C    . SER A 1 10 ? 12.797  0.845   -0.289  1.00 0.35 ? 10  SER A C    4  
ATOM   4210  O O    . SER A 1 10 ? 13.687  0.589   -1.102  1.00 0.35 ? 10  SER A O    4  
ATOM   4211  C CB   . SER A 1 10 ? 13.810  1.914   1.740   1.00 0.43 ? 10  SER A CB   4  
ATOM   4212  O OG   . SER A 1 10 ? 15.140  1.718   1.292   1.00 0.46 ? 10  SER A OG   4  
ATOM   4213  H H    . SER A 1 10 ? 11.278  2.256   1.973   1.00 0.38 ? 10  SER A H    4  
ATOM   4214  H HA   . SER A 1 10 ? 13.205  2.929   -0.049  1.00 0.37 ? 10  SER A HA   4  
ATOM   4215  H HB2  . SER A 1 10 ? 13.784  2.788   2.374   1.00 0.45 ? 10  SER A HB2  4  
ATOM   4216  H HB3  . SER A 1 10 ? 13.504  1.048   2.308   1.00 0.44 ? 10  SER A HB3  4  
ATOM   4217  H HG   . SER A 1 10 ? 15.133  1.191   0.488   1.00 0.67 ? 10  SER A HG   4  
ATOM   4218  N N    . ALA A 1 11 ? 11.737  0.062   -0.096  1.00 0.35 ? 11  ALA A N    4  
ATOM   4219  C CA   . ALA A 1 11 ? 11.544  -1.180  -0.839  1.00 0.36 ? 11  ALA A CA   4  
ATOM   4220  C C    . ALA A 1 11 ? 11.092  -0.899  -2.269  1.00 0.31 ? 11  ALA A C    4  
ATOM   4221  O O    . ALA A 1 11 ? 11.652  -1.438  -3.220  1.00 0.33 ? 11  ALA A O    4  
ATOM   4222  C CB   . ALA A 1 11 ? 10.530  -2.069  -0.132  1.00 0.40 ? 11  ALA A CB   4  
ATOM   4223  H H    . ALA A 1 11 ? 11.063  0.329   0.565   1.00 0.36 ? 11  ALA A H    4  
ATOM   4224  H HA   . ALA A 1 11 ? 12.489  -1.702  -0.866  1.00 0.39 ? 11  ALA A HA   4  
ATOM   4225  H HB1  . ALA A 1 11 ? 9.570   -1.575  -0.112  1.00 0.38 ? 11  ALA A HB1  4  
ATOM   4226  H HB2  . ALA A 1 11 ? 10.859  -2.257  0.880   1.00 0.44 ? 11  ALA A HB2  4  
ATOM   4227  H HB3  . ALA A 1 11 ? 10.441  -3.006  -0.661  1.00 0.42 ? 11  ALA A HB3  4  
ATOM   4228  N N    . CYS A 1 12 ? 10.089  -0.028  -2.408  1.00 0.28 ? 12  CYS A N    4  
ATOM   4229  C CA   . CYS A 1 12 ? 9.550   0.331   -3.717  1.00 0.26 ? 12  CYS A CA   4  
ATOM   4230  C C    . CYS A 1 12 ? 10.530  1.190   -4.518  1.00 0.25 ? 12  CYS A C    4  
ATOM   4231  O O    . CYS A 1 12 ? 10.349  1.389   -5.714  1.00 0.26 ? 12  CYS A O    4  
ATOM   4232  C CB   . CYS A 1 12 ? 8.209   1.056   -3.564  1.00 0.28 ? 12  CYS A CB   4  
ATOM   4233  S SG   . CYS A 1 12 ? 8.277   2.543   -2.541  1.00 0.26 ? 12  CYS A SG   4  
ATOM   4234  H H    . CYS A 1 12 ? 9.700   0.381   -1.605  1.00 0.29 ? 12  CYS A H    4  
ATOM   4235  H HA   . CYS A 1 12 ? 9.382   -0.588  -4.260  1.00 0.29 ? 12  CYS A HA   4  
ATOM   4236  H HB2  . CYS A 1 12 ? 7.856   1.349   -4.541  1.00 0.29 ? 12  CYS A HB2  4  
ATOM   4237  H HB3  . CYS A 1 12 ? 7.494   0.381   -3.117  1.00 0.34 ? 12  CYS A HB3  4  
ATOM   4238  H HG   . CYS A 1 12 ? 9.550   2.802   -2.275  1.00 1.12 ? 12  CYS A HG   4  
ATOM   4239  N N    . LYS A 1 13 ? 11.567  1.697   -3.856  1.00 0.25 ? 13  LYS A N    4  
ATOM   4240  C CA   . LYS A 1 13 ? 12.579  2.509   -4.529  1.00 0.26 ? 13  LYS A CA   4  
ATOM   4241  C C    . LYS A 1 13 ? 13.575  1.618   -5.271  1.00 0.31 ? 13  LYS A C    4  
ATOM   4242  O O    . LYS A 1 13 ? 14.422  2.102   -6.021  1.00 0.35 ? 13  LYS A O    4  
ATOM   4243  C CB   . LYS A 1 13 ? 13.321  3.387   -3.518  1.00 0.29 ? 13  LYS A CB   4  
ATOM   4244  C CG   . LYS A 1 13 ? 12.608  4.689   -3.191  1.00 0.79 ? 13  LYS A CG   4  
ATOM   4245  C CD   . LYS A 1 13 ? 12.705  5.684   -4.337  1.00 1.28 ? 13  LYS A CD   4  
ATOM   4246  C CE   . LYS A 1 13 ? 11.974  6.978   -4.015  1.00 1.89 ? 13  LYS A CE   4  
ATOM   4247  N NZ   . LYS A 1 13 ? 12.035  7.946   -5.143  1.00 2.67 ? 13  LYS A NZ   4  
ATOM   4248  H H    . LYS A 1 13 ? 11.655  1.523   -2.896  1.00 0.28 ? 13  LYS A H    4  
ATOM   4249  H HA   . LYS A 1 13 ? 12.075  3.143   -5.244  1.00 0.25 ? 13  LYS A HA   4  
ATOM   4250  H HB2  . LYS A 1 13 ? 13.445  2.831   -2.600  1.00 0.60 ? 13  LYS A HB2  4  
ATOM   4251  H HB3  . LYS A 1 13 ? 14.296  3.627   -3.915  1.00 0.66 ? 13  LYS A HB3  4  
ATOM   4252  H HG2  . LYS A 1 13 ? 11.566  4.479   -2.999  1.00 1.52 ? 13  LYS A HG2  4  
ATOM   4253  H HG3  . LYS A 1 13 ? 13.056  5.124   -2.310  1.00 0.94 ? 13  LYS A HG3  4  
ATOM   4254  H HD2  . LYS A 1 13 ? 13.744  5.906   -4.522  1.00 1.26 ? 13  LYS A HD2  4  
ATOM   4255  H HD3  . LYS A 1 13 ? 12.266  5.244   -5.221  1.00 1.89 ? 13  LYS A HD3  4  
ATOM   4256  H HE2  . LYS A 1 13 ? 10.939  6.749   -3.805  1.00 2.36 ? 13  LYS A HE2  4  
ATOM   4257  H HE3  . LYS A 1 13 ? 12.427  7.423   -3.144  1.00 1.74 ? 13  LYS A HE3  4  
ATOM   4258  H HZ1  . LYS A 1 13 ? 13.025  8.187   -5.354  1.00 2.68 ? 13  LYS A HZ1  4  
ATOM   4259  H HZ2  . LYS A 1 13 ? 11.523  8.816   -4.894  1.00 3.10 ? 13  LYS A HZ2  4  
ATOM   4260  H HZ3  . LYS A 1 13 ? 11.601  7.532   -5.993  1.00 3.07 ? 13  LYS A HZ3  4  
ATOM   4261  N N    . THR A 1 14 ? 13.454  0.311   -5.054  1.00 0.33 ? 14  THR A N    4  
ATOM   4262  C CA   . THR A 1 14 ? 14.332  -0.667  -5.683  1.00 0.39 ? 14  THR A CA   4  
ATOM   4263  C C    . THR A 1 14 ? 13.561  -1.555  -6.652  1.00 0.41 ? 14  THR A C    4  
ATOM   4264  O O    . THR A 1 14 ? 14.154  -2.299  -7.434  1.00 0.46 ? 14  THR A O    4  
ATOM   4265  C CB   . THR A 1 14 ? 15.028  -1.555  -4.633  1.00 0.43 ? 14  THR A CB   4  
ATOM   4266  O OG1  . THR A 1 14 ? 15.651  -0.738  -3.638  1.00 0.44 ? 14  THR A OG1  4  
ATOM   4267  C CG2  . THR A 1 14 ? 16.068  -2.450  -5.289  1.00 0.50 ? 14  THR A CG2  4  
ATOM   4268  H H    . THR A 1 14 ? 12.751  -0.006  -4.448  1.00 0.32 ? 14  THR A H    4  
ATOM   4269  H HA   . THR A 1 14 ? 15.093  -0.129  -6.231  1.00 0.41 ? 14  THR A HA   4  
ATOM   4270  H HB   . THR A 1 14 ? 14.283  -2.179  -4.162  1.00 0.42 ? 14  THR A HB   4  
ATOM   4271  H HG1  . THR A 1 14 ? 15.006  -0.501  -2.968  1.00 0.42 ? 14  THR A HG1  4  
ATOM   4272  H HG21 . THR A 1 14 ? 15.594  -3.065  -6.039  1.00 0.50 ? 14  THR A HG21 4  
ATOM   4273  H HG22 . THR A 1 14 ? 16.523  -3.082  -4.539  1.00 0.53 ? 14  THR A HG22 4  
ATOM   4274  H HG23 . THR A 1 14 ? 16.828  -1.838  -5.752  1.00 0.51 ? 14  THR A HG23 4  
ATOM   4275  N N    . TYR A 1 15 ? 12.235  -1.472  -6.599  1.00 0.37 ? 15  TYR A N    4  
ATOM   4276  C CA   . TYR A 1 15 ? 11.383  -2.269  -7.472  1.00 0.40 ? 15  TYR A CA   4  
ATOM   4277  C C    . TYR A 1 15 ? 10.591  -1.378  -8.422  1.00 0.39 ? 15  TYR A C    4  
ATOM   4278  O O    . TYR A 1 15 ? 9.882   -1.866  -9.303  1.00 0.43 ? 15  TYR A O    4  
ATOM   4279  C CB   . TYR A 1 15 ? 10.427  -3.127  -6.641  1.00 0.39 ? 15  TYR A CB   4  
ATOM   4280  C CG   . TYR A 1 15 ? 11.116  -4.232  -5.874  1.00 0.43 ? 15  TYR A CG   4  
ATOM   4281  C CD1  . TYR A 1 15 ? 11.011  -4.315  -4.491  1.00 0.41 ? 15  TYR A CD1  4  
ATOM   4282  C CD2  . TYR A 1 15 ? 11.873  -5.194  -6.532  1.00 0.49 ? 15  TYR A CD2  4  
ATOM   4283  C CE1  . TYR A 1 15 ? 11.639  -5.324  -3.786  1.00 0.46 ? 15  TYR A CE1  4  
ATOM   4284  C CE2  . TYR A 1 15 ? 12.503  -6.206  -5.837  1.00 0.52 ? 15  TYR A CE2  4  
ATOM   4285  C CZ   . TYR A 1 15 ? 12.384  -6.268  -4.462  1.00 0.51 ? 15  TYR A CZ   4  
ATOM   4286  O OH   . TYR A 1 15 ? 13.011  -7.273  -3.765  1.00 0.56 ? 15  TYR A OH   4  
ATOM   4287  H H    . TYR A 1 15 ? 11.821  -0.858  -5.957  1.00 0.33 ? 15  TYR A H    4  
ATOM   4288  H HA   . TYR A 1 15 ? 12.021  -2.918  -8.053  1.00 0.45 ? 15  TYR A HA   4  
ATOM   4289  H HB2  . TYR A 1 15 ? 9.917   -2.497  -5.927  1.00 0.35 ? 15  TYR A HB2  4  
ATOM   4290  H HB3  . TYR A 1 15 ? 9.699   -3.581  -7.297  1.00 0.42 ? 15  TYR A HB3  4  
ATOM   4291  H HD1  . TYR A 1 15 ? 10.426  -3.576  -3.963  1.00 0.38 ? 15  TYR A HD1  4  
ATOM   4292  H HD2  . TYR A 1 15 ? 11.965  -5.143  -7.607  1.00 0.51 ? 15  TYR A HD2  4  
ATOM   4293  H HE1  . TYR A 1 15 ? 11.545  -5.369  -2.711  1.00 0.47 ? 15  TYR A HE1  4  
ATOM   4294  H HE2  . TYR A 1 15 ? 13.086  -6.944  -6.367  1.00 0.57 ? 15  TYR A HE2  4  
ATOM   4295  H HH   . TYR A 1 15 ? 12.407  -7.640  -3.115  1.00 0.57 ? 15  TYR A HH   4  
ATOM   4296  N N    . CYS A 1 16 ? 10.714  -0.068  -8.237  1.00 0.35 ? 16  CYS A N    4  
ATOM   4297  C CA   . CYS A 1 16 ? 10.010  0.894   -9.076  1.00 0.36 ? 16  CYS A CA   4  
ATOM   4298  C C    . CYS A 1 16 ? 10.917  2.066   -9.439  1.00 0.37 ? 16  CYS A C    4  
ATOM   4299  O O    . CYS A 1 16 ? 11.022  2.445   -10.605 1.00 0.42 ? 16  CYS A O    4  
ATOM   4300  C CB   . CYS A 1 16 ? 8.757   1.404   -8.361  1.00 0.32 ? 16  CYS A CB   4  
ATOM   4301  S SG   . CYS A 1 16 ? 7.781   0.106   -7.566  1.00 0.32 ? 16  CYS A SG   4  
ATOM   4302  H H    . CYS A 1 16 ? 11.294  0.259   -7.518  1.00 0.33 ? 16  CYS A H    4  
ATOM   4303  H HA   . CYS A 1 16 ? 9.715   0.388   -9.984  1.00 0.41 ? 16  CYS A HA   4  
ATOM   4304  H HB2  . CYS A 1 16 ? 9.050   2.108   -7.597  1.00 0.28 ? 16  CYS A HB2  4  
ATOM   4305  H HB3  . CYS A 1 16 ? 8.120   1.903   -9.077  1.00 0.35 ? 16  CYS A HB3  4  
ATOM   4306  H HG   . CYS A 1 16 ? 8.124   0.062   -6.287  1.00 0.27 ? 16  CYS A HG   4  
ATOM   4307  N N    . GLY A 1 17 ? 11.567  2.638   -8.432  1.00 0.33 ? 17  GLY A N    4  
ATOM   4308  C CA   . GLY A 1 17 ? 12.455  3.763   -8.664  1.00 0.34 ? 17  GLY A CA   4  
ATOM   4309  C C    . GLY A 1 17 ? 11.792  5.095   -8.374  1.00 0.32 ? 17  GLY A C    4  
ATOM   4310  O O    . GLY A 1 17 ? 11.225  5.294   -7.298  1.00 0.27 ? 17  GLY A O    4  
ATOM   4311  H H    . GLY A 1 17 ? 11.443  2.293   -7.522  1.00 0.29 ? 17  GLY A H    4  
ATOM   4312  H HA2  . GLY A 1 17 ? 13.323  3.660   -8.030  1.00 0.34 ? 17  GLY A HA2  4  
ATOM   4313  H HA3  . GLY A 1 17 ? 12.773  3.749   -9.697  1.00 0.39 ? 17  GLY A HA3  4  
ATOM   4314  N N    . LYS A 1 18 ? 11.864  6.010   -9.333  1.00 0.36 ? 18  LYS A N    4  
ATOM   4315  C CA   . LYS A 1 18 ? 11.266  7.331   -9.176  1.00 0.36 ? 18  LYS A CA   4  
ATOM   4316  C C    . LYS A 1 18 ? 9.748   7.258   -9.285  1.00 0.36 ? 18  LYS A C    4  
ATOM   4317  O O    . LYS A 1 18 ? 9.036   8.143   -8.810  1.00 0.36 ? 18  LYS A O    4  
ATOM   4318  C CB   . LYS A 1 18 ? 11.818  8.293   -10.232 1.00 0.43 ? 18  LYS A CB   4  
ATOM   4319  C CG   . LYS A 1 18 ? 11.717  7.760   -11.650 1.00 0.48 ? 18  LYS A CG   4  
ATOM   4320  C CD   . LYS A 1 18 ? 13.065  7.293   -12.170 1.00 0.52 ? 18  LYS A CD   4  
ATOM   4321  C CE   . LYS A 1 18 ? 13.641  8.270   -13.184 1.00 0.58 ? 18  LYS A CE   4  
ATOM   4322  N NZ   . LYS A 1 18 ? 15.064  8.600   -12.889 1.00 0.59 ? 18  LYS A NZ   4  
ATOM   4323  H H    . LYS A 1 18 ? 12.330  5.792   -10.167 1.00 0.40 ? 18  LYS A H    4  
ATOM   4324  H HA   . LYS A 1 18 ? 11.528  7.700   -8.195  1.00 0.34 ? 18  LYS A HA   4  
ATOM   4325  H HB2  . LYS A 1 18 ? 11.269  9.222   -10.179 1.00 0.43 ? 18  LYS A HB2  4  
ATOM   4326  H HB3  . LYS A 1 18 ? 12.858  8.488   -10.016 1.00 0.43 ? 18  LYS A HB3  4  
ATOM   4327  H HG2  . LYS A 1 18 ? 11.030  6.927   -11.662 1.00 0.47 ? 18  LYS A HG2  4  
ATOM   4328  H HG3  . LYS A 1 18 ? 11.344  8.545   -12.293 1.00 0.52 ? 18  LYS A HG3  4  
ATOM   4329  H HD2  . LYS A 1 18 ? 13.751  7.205   -11.340 1.00 0.49 ? 18  LYS A HD2  4  
ATOM   4330  H HD3  . LYS A 1 18 ? 12.944  6.329   -12.642 1.00 0.53 ? 18  LYS A HD3  4  
ATOM   4331  H HE2  . LYS A 1 18 ? 13.579  7.828   -14.167 1.00 0.62 ? 18  LYS A HE2  4  
ATOM   4332  H HE3  . LYS A 1 18 ? 13.058  9.179   -13.161 1.00 0.58 ? 18  LYS A HE3  4  
ATOM   4333  H HZ1  . LYS A 1 18 ? 15.644  7.737   -12.912 1.00 0.60 ? 18  LYS A HZ1  4  
ATOM   4334  H HZ2  . LYS A 1 18 ? 15.143  9.032   -11.947 1.00 0.56 ? 18  LYS A HZ2  4  
ATOM   4335  H HZ3  . LYS A 1 18 ? 15.429  9.269   -13.597 1.00 0.64 ? 18  LYS A HZ3  4  
ATOM   4336  N N    . THR A 1 19 ? 9.254   6.196   -9.914  1.00 0.37 ? 19  THR A N    4  
ATOM   4337  C CA   . THR A 1 19 ? 7.819   6.005   -10.084 1.00 0.39 ? 19  THR A CA   4  
ATOM   4338  C C    . THR A 1 19 ? 7.153   5.631   -8.766  1.00 0.33 ? 19  THR A C    4  
ATOM   4339  O O    . THR A 1 19 ? 5.947   5.818   -8.592  1.00 0.43 ? 19  THR A O    4  
ATOM   4340  C CB   . THR A 1 19 ? 7.516   4.913   -11.128 1.00 0.46 ? 19  THR A CB   4  
ATOM   4341  O OG1  . THR A 1 19 ? 7.685   3.617   -10.542 1.00 0.53 ? 19  THR A OG1  4  
ATOM   4342  C CG2  . THR A 1 19 ? 8.432   5.051   -12.336 1.00 0.61 ? 19  THR A CG2  4  
ATOM   4343  H H    . THR A 1 19 ? 9.870   5.523   -10.270 1.00 0.39 ? 19  THR A H    4  
ATOM   4344  H HA   . THR A 1 19 ? 7.400   6.936   -10.436 1.00 0.42 ? 19  THR A HA   4  
ATOM   4345  H HB   . THR A 1 19 ? 6.492   5.022   -11.457 1.00 0.49 ? 19  THR A HB   4  
ATOM   4346  H HG1  . THR A 1 19 ? 8.076   3.022   -11.186 1.00 0.54 ? 19  THR A HG1  4  
ATOM   4347  H HG21 . THR A 1 19 ? 8.178   4.298   -13.068 1.00 0.66 ? 19  THR A HG21 4  
ATOM   4348  H HG22 . THR A 1 19 ? 9.459   4.919   -12.026 1.00 0.68 ? 19  THR A HG22 4  
ATOM   4349  H HG23 . THR A 1 19 ? 8.310   6.031   -12.770 1.00 0.69 ? 19  THR A HG23 4  
ATOM   4350  N N    . SER A 1 20 ? 7.954   5.117   -7.825  1.00 0.30 ? 20  SER A N    4  
ATOM   4351  C CA   . SER A 1 20 ? 7.462   4.689   -6.511  1.00 0.24 ? 20  SER A CA   4  
ATOM   4352  C C    . SER A 1 20 ? 6.706   5.803   -5.781  1.00 0.22 ? 20  SER A C    4  
ATOM   4353  O O    . SER A 1 20 ? 6.982   6.989   -5.982  1.00 0.26 ? 20  SER A O    4  
ATOM   4354  C CB   . SER A 1 20 ? 8.633   4.218   -5.647  1.00 0.22 ? 20  SER A CB   4  
ATOM   4355  O OG   . SER A 1 20 ? 9.395   5.316   -5.178  1.00 0.25 ? 20  SER A OG   4  
ATOM   4356  H H    . SER A 1 20 ? 8.911   5.026   -8.022  1.00 0.38 ? 20  SER A H    4  
ATOM   4357  H HA   . SER A 1 20 ? 6.790   3.860   -6.665  1.00 0.26 ? 20  SER A HA   4  
ATOM   4358  H HB2  . SER A 1 20 ? 8.255   3.672   -4.798  1.00 0.26 ? 20  SER A HB2  4  
ATOM   4359  H HB3  . SER A 1 20 ? 9.274   3.576   -6.233  1.00 0.24 ? 20  SER A HB3  4  
ATOM   4360  H HG   . SER A 1 20 ? 8.928   6.134   -5.368  1.00 0.41 ? 20  SER A HG   4  
ATOM   4361  N N    . PRO A 1 21 ? 5.746   5.429   -4.909  1.00 0.20 ? 21  PRO A N    4  
ATOM   4362  C CA   . PRO A 1 21 ? 4.949   6.394   -4.144  1.00 0.22 ? 21  PRO A CA   4  
ATOM   4363  C C    . PRO A 1 21 ? 5.777   7.115   -3.083  1.00 0.22 ? 21  PRO A C    4  
ATOM   4364  O O    . PRO A 1 21 ? 6.826   6.628   -2.660  1.00 0.24 ? 21  PRO A O    4  
ATOM   4365  C CB   . PRO A 1 21 ? 3.874   5.527   -3.485  1.00 0.23 ? 21  PRO A CB   4  
ATOM   4366  C CG   . PRO A 1 21 ? 4.470   4.168   -3.403  1.00 0.21 ? 21  PRO A CG   4  
ATOM   4367  C CD   . PRO A 1 21 ? 5.366   4.035   -4.601  1.00 0.20 ? 21  PRO A CD   4  
ATOM   4368  H HA   . PRO A 1 21 ? 4.483   7.123   -4.791  1.00 0.26 ? 21  PRO A HA   4  
ATOM   4369  H HB2  . PRO A 1 21 ? 3.645   5.911   -2.498  1.00 0.25 ? 21  PRO A HB2  4  
ATOM   4370  H HB3  . PRO A 1 21 ? 2.986   5.507   -4.096  1.00 0.26 ? 21  PRO A HB3  4  
ATOM   4371  H HG2  . PRO A 1 21 ? 5.041   4.073   -2.490  1.00 0.21 ? 21  PRO A HG2  4  
ATOM   4372  H HG3  . PRO A 1 21 ? 3.692   3.421   -3.441  1.00 0.24 ? 21  PRO A HG3  4  
ATOM   4373  H HD2  . PRO A 1 21 ? 6.235   3.443   -4.356  1.00 0.21 ? 21  PRO A HD2  4  
ATOM   4374  H HD3  . PRO A 1 21 ? 4.828   3.593   -5.425  1.00 0.24 ? 21  PRO A HD3  4  
ATOM   4375  N N    . SER A 1 22 ? 5.293   8.273   -2.657  1.00 0.24 ? 22  SER A N    4  
ATOM   4376  C CA   . SER A 1 22 ? 5.984   9.070   -1.653  1.00 0.26 ? 22  SER A CA   4  
ATOM   4377  C C    . SER A 1 22 ? 5.502   8.723   -0.249  1.00 0.23 ? 22  SER A C    4  
ATOM   4378  O O    . SER A 1 22 ? 4.590   7.911   -0.074  1.00 0.23 ? 22  SER A O    4  
ATOM   4379  C CB   . SER A 1 22 ? 5.760   10.558  -1.922  1.00 0.31 ? 22  SER A CB   4  
ATOM   4380  O OG   . SER A 1 22 ? 4.377   10.868  -1.959  1.00 0.32 ? 22  SER A OG   4  
ATOM   4381  H H    . SER A 1 22 ? 4.446   8.601   -3.026  1.00 0.26 ? 22  SER A H    4  
ATOM   4382  H HA   . SER A 1 22 ? 7.039   8.854   -1.725  1.00 0.29 ? 22  SER A HA   4  
ATOM   4383  H HB2  . SER A 1 22 ? 6.223   11.137  -1.137  1.00 0.34 ? 22  SER A HB2  4  
ATOM   4384  H HB3  . SER A 1 22 ? 6.200   10.822  -2.872  1.00 0.35 ? 22  SER A HB3  4  
ATOM   4385  H HG   . SER A 1 22 ? 4.168   11.307  -2.786  1.00 0.54 ? 22  SER A HG   4  
ATOM   4386  N N    . LYS A 1 23 ? 6.122   9.348   0.748   1.00 0.24 ? 23  LYS A N    4  
ATOM   4387  C CA   . LYS A 1 23 ? 5.759   9.128   2.141   1.00 0.25 ? 23  LYS A CA   4  
ATOM   4388  C C    . LYS A 1 23 ? 4.375   9.711   2.432   1.00 0.23 ? 23  LYS A C    4  
ATOM   4389  O O    . LYS A 1 23 ? 3.630   9.186   3.261   1.00 0.26 ? 23  LYS A O    4  
ATOM   4390  C CB   . LYS A 1 23 ? 6.806   9.766   3.058   1.00 0.29 ? 23  LYS A CB   4  
ATOM   4391  C CG   . LYS A 1 23 ? 6.447   9.720   4.535   1.00 0.41 ? 23  LYS A CG   4  
ATOM   4392  C CD   . LYS A 1 23 ? 7.046   10.896  5.286   1.00 0.87 ? 23  LYS A CD   4  
ATOM   4393  C CE   . LYS A 1 23 ? 6.534   10.966  6.714   1.00 1.02 ? 23  LYS A CE   4  
ATOM   4394  N NZ   . LYS A 1 23 ? 6.901   12.251  7.370   1.00 1.62 ? 23  LYS A NZ   4  
ATOM   4395  H H    . LYS A 1 23 ? 6.847   9.975   0.537   1.00 0.26 ? 23  LYS A H    4  
ATOM   4396  H HA   . LYS A 1 23 ? 5.736   8.063   2.316   1.00 0.27 ? 23  LYS A HA   4  
ATOM   4397  H HB2  . LYS A 1 23 ? 7.745   9.249   2.925   1.00 0.35 ? 23  LYS A HB2  4  
ATOM   4398  H HB3  . LYS A 1 23 ? 6.932   10.800  2.774   1.00 0.34 ? 23  LYS A HB3  4  
ATOM   4399  H HG2  . LYS A 1 23 ? 5.372   9.751   4.635   1.00 0.71 ? 23  LYS A HG2  4  
ATOM   4400  H HG3  . LYS A 1 23 ? 6.825   8.801   4.960   1.00 0.67 ? 23  LYS A HG3  4  
ATOM   4401  H HD2  . LYS A 1 23 ? 8.120   10.791  5.305   1.00 1.16 ? 23  LYS A HD2  4  
ATOM   4402  H HD3  . LYS A 1 23 ? 6.780   11.810  4.773   1.00 1.26 ? 23  LYS A HD3  4  
ATOM   4403  H HE2  . LYS A 1 23 ? 5.459   10.872  6.703   1.00 1.11 ? 23  LYS A HE2  4  
ATOM   4404  H HE3  . LYS A 1 23 ? 6.961   10.149  7.276   1.00 1.06 ? 23  LYS A HE3  4  
ATOM   4405  H HZ1  . LYS A 1 23 ? 6.548   12.267  8.348   1.00 1.74 ? 23  LYS A HZ1  4  
ATOM   4406  H HZ2  . LYS A 1 23 ? 6.485   13.050  6.851   1.00 1.95 ? 23  LYS A HZ2  4  
ATOM   4407  H HZ3  . LYS A 1 23 ? 7.935   12.362  7.383   1.00 1.88 ? 23  LYS A HZ3  4  
ATOM   4408  N N    . LYS A 1 24 ? 4.039   10.796  1.732   1.00 0.20 ? 24  LYS A N    4  
ATOM   4409  C CA   . LYS A 1 24 ? 2.748   11.455  1.903   1.00 0.21 ? 24  LYS A CA   4  
ATOM   4410  C C    . LYS A 1 24 ? 1.607   10.610  1.337   1.00 0.20 ? 24  LYS A C    4  
ATOM   4411  O O    . LYS A 1 24 ? 0.490   10.647  1.851   1.00 0.22 ? 24  LYS A O    4  
ATOM   4412  C CB   . LYS A 1 24 ? 2.764   12.833  1.237   1.00 0.24 ? 24  LYS A CB   4  
ATOM   4413  C CG   . LYS A 1 24 ? 3.561   13.873  2.011   1.00 0.43 ? 24  LYS A CG   4  
ATOM   4414  C CD   . LYS A 1 24 ? 3.834   15.115  1.173   1.00 0.79 ? 24  LYS A CD   4  
ATOM   4415  C CE   . LYS A 1 24 ? 4.693   14.792  -0.040  1.00 1.35 ? 24  LYS A CE   4  
ATOM   4416  N NZ   . LYS A 1 24 ? 5.519   15.955  -0.464  1.00 2.01 ? 24  LYS A NZ   4  
ATOM   4417  H H    . LYS A 1 24 ? 4.677   11.160  1.085   1.00 0.20 ? 24  LYS A H    4  
ATOM   4418  H HA   . LYS A 1 24 ? 2.586   11.584  2.963   1.00 0.24 ? 24  LYS A HA   4  
ATOM   4419  H HB2  . LYS A 1 24 ? 3.195   12.739  0.252   1.00 0.37 ? 24  LYS A HB2  4  
ATOM   4420  H HB3  . LYS A 1 24 ? 1.748   13.186  1.143   1.00 0.38 ? 24  LYS A HB3  4  
ATOM   4421  H HG2  . LYS A 1 24 ? 3.002   14.162  2.888   1.00 0.80 ? 24  LYS A HG2  4  
ATOM   4422  H HG3  . LYS A 1 24 ? 4.503   13.439  2.312   1.00 0.81 ? 24  LYS A HG3  4  
ATOM   4423  H HD2  . LYS A 1 24 ? 2.894   15.524  0.835   1.00 1.14 ? 24  LYS A HD2  4  
ATOM   4424  H HD3  . LYS A 1 24 ? 4.348   15.844  1.782   1.00 0.95 ? 24  LYS A HD3  4  
ATOM   4425  H HE2  . LYS A 1 24 ? 5.344   13.968  0.206   1.00 1.59 ? 24  LYS A HE2  4  
ATOM   4426  H HE3  . LYS A 1 24 ? 4.045   14.505  -0.857  1.00 1.51 ? 24  LYS A HE3  4  
ATOM   4427  H HZ1  . LYS A 1 24 ? 6.161   16.234  0.305   1.00 2.09 ? 24  LYS A HZ1  4  
ATOM   4428  H HZ2  . LYS A 1 24 ? 4.909   16.761  -0.703  1.00 2.20 ? 24  LYS A HZ2  4  
ATOM   4429  H HZ3  . LYS A 1 24 ? 6.087   15.703  -1.299  1.00 2.49 ? 24  LYS A HZ3  4  
ATOM   4430  N N    . GLU A 1 25 ? 1.889   9.849   0.276   1.00 0.18 ? 25  GLU A N    4  
ATOM   4431  C CA   . GLU A 1 25 ? 0.870   9.000   -0.331  1.00 0.17 ? 25  GLU A CA   4  
ATOM   4432  C C    . GLU A 1 25 ? 0.579   7.786   0.546   1.00 0.16 ? 25  GLU A C    4  
ATOM   4433  O O    . GLU A 1 25 ? -0.540  7.613   1.032   1.00 0.17 ? 25  GLU A O    4  
ATOM   4434  C CB   . GLU A 1 25 ? 1.320   8.542   -1.720  1.00 0.17 ? 25  GLU A CB   4  
ATOM   4435  C CG   . GLU A 1 25 ? 0.451   9.073   -2.848  1.00 0.19 ? 25  GLU A CG   4  
ATOM   4436  C CD   . GLU A 1 25 ? 0.685   8.345   -4.156  1.00 0.18 ? 25  GLU A CD   4  
ATOM   4437  O OE1  . GLU A 1 25 ? 0.482   8.963   -5.224  1.00 0.26 ? 25  GLU A OE1  4  
ATOM   4438  O OE2  . GLU A 1 25 ? 1.068   7.158   -4.116  1.00 0.21 ? 25  GLU A OE2  4  
ATOM   4439  H H    . GLU A 1 25 ? 2.794   9.860   -0.099  1.00 0.18 ? 25  GLU A H    4  
ATOM   4440  H HA   . GLU A 1 25 ? -0.033  9.584   -0.429  1.00 0.17 ? 25  GLU A HA   4  
ATOM   4441  H HB2  . GLU A 1 25 ? 2.333   8.877   -1.887  1.00 0.19 ? 25  GLU A HB2  4  
ATOM   4442  H HB3  . GLU A 1 25 ? 1.298   7.462   -1.756  1.00 0.18 ? 25  GLU A HB3  4  
ATOM   4443  H HG2  . GLU A 1 25 ? -0.586  8.957   -2.571  1.00 0.23 ? 25  GLU A HG2  4  
ATOM   4444  H HG3  . GLU A 1 25 ? 0.670   10.121  -2.991  1.00 0.23 ? 25  GLU A HG3  4  
ATOM   4445  N N    . ILE A 1 26 ? 1.592   6.950   0.746   1.00 0.16 ? 26  ILE A N    4  
ATOM   4446  C CA   . ILE A 1 26 ? 1.443   5.754   1.565   1.00 0.15 ? 26  ILE A CA   4  
ATOM   4447  C C    . ILE A 1 26 ? 0.846   6.091   2.927   1.00 0.15 ? 26  ILE A C    4  
ATOM   4448  O O    . ILE A 1 26 ? -0.081  5.427   3.389   1.00 0.14 ? 26  ILE A O    4  
ATOM   4449  C CB   . ILE A 1 26 ? 2.795   5.043   1.772   1.00 0.16 ? 26  ILE A CB   4  
ATOM   4450  C CG1  . ILE A 1 26 ? 3.385   4.622   0.426   1.00 0.16 ? 26  ILE A CG1  4  
ATOM   4451  C CG2  . ILE A 1 26 ? 2.624   3.838   2.683   1.00 0.15 ? 26  ILE A CG2  4  
ATOM   4452  C CD1  . ILE A 1 26 ? 4.719   3.919   0.545   1.00 0.17 ? 26  ILE A CD1  4  
ATOM   4453  H H    . ILE A 1 26 ? 2.460   7.144   0.333   1.00 0.17 ? 26  ILE A H    4  
ATOM   4454  H HA   . ILE A 1 26 ? 0.779   5.076   1.049   1.00 0.14 ? 26  ILE A HA   4  
ATOM   4455  H HB   . ILE A 1 26 ? 3.470   5.735   2.253   1.00 0.17 ? 26  ILE A HB   4  
ATOM   4456  H HG12 . ILE A 1 26 ? 2.699   3.949   -0.066  1.00 0.15 ? 26  ILE A HG12 4  
ATOM   4457  H HG13 . ILE A 1 26 ? 3.525   5.499   -0.190  1.00 0.16 ? 26  ILE A HG13 4  
ATOM   4458  H HG21 . ILE A 1 26 ? 2.295   4.166   3.658   1.00 0.15 ? 26  ILE A HG21 4  
ATOM   4459  H HG22 . ILE A 1 26 ? 3.569   3.321   2.777   1.00 0.16 ? 26  ILE A HG22 4  
ATOM   4460  H HG23 . ILE A 1 26 ? 1.889   3.169   2.261   1.00 0.14 ? 26  ILE A HG23 4  
ATOM   4461  H HD11 . ILE A 1 26 ? 4.610   3.043   1.167   1.00 0.16 ? 26  ILE A HD11 4  
ATOM   4462  H HD12 . ILE A 1 26 ? 5.441   4.588   0.990   1.00 0.19 ? 26  ILE A HD12 4  
ATOM   4463  H HD13 . ILE A 1 26 ? 5.060   3.623   -0.436  1.00 0.17 ? 26  ILE A HD13 4  
ATOM   4464  N N    . GLY A 1 27 ? 1.382   7.128   3.563   1.00 0.16 ? 27  GLY A N    4  
ATOM   4465  C CA   . GLY A 1 27 ? 0.887   7.536   4.865   1.00 0.16 ? 27  GLY A CA   4  
ATOM   4466  C C    . GLY A 1 27 ? -0.617  7.740   4.877   1.00 0.15 ? 27  GLY A C    4  
ATOM   4467  O O    . GLY A 1 27 ? -1.294  7.355   5.829   1.00 0.15 ? 27  GLY A O    4  
ATOM   4468  H H    . GLY A 1 27 ? 2.118   7.621   3.144   1.00 0.17 ? 27  GLY A H    4  
ATOM   4469  H HA2  . GLY A 1 27 ? 1.142   6.777   5.589   1.00 0.16 ? 27  GLY A HA2  4  
ATOM   4470  H HA3  . GLY A 1 27 ? 1.366   8.462   5.146   1.00 0.17 ? 27  GLY A HA3  4  
ATOM   4471  N N    . ALA A 1 28 ? -1.138  8.346   3.816   1.00 0.15 ? 28  ALA A N    4  
ATOM   4472  C CA   . ALA A 1 28 ? -2.569  8.599   3.707   1.00 0.14 ? 28  ALA A CA   4  
ATOM   4473  C C    . ALA A 1 28 ? -3.335  7.311   3.424   1.00 0.13 ? 28  ALA A C    4  
ATOM   4474  O O    . ALA A 1 28 ? -4.394  7.068   4.000   1.00 0.12 ? 28  ALA A O    4  
ATOM   4475  C CB   . ALA A 1 28 ? -2.843  9.627   2.619   1.00 0.15 ? 28  ALA A CB   4  
ATOM   4476  H H    . ALA A 1 28 ? -0.546  8.629   3.087   1.00 0.16 ? 28  ALA A H    4  
ATOM   4477  H HA   . ALA A 1 28 ? -2.907  9.007   4.648   1.00 0.15 ? 28  ALA A HA   4  
ATOM   4478  H HB1  . ALA A 1 28 ? -3.901  9.844   2.587   1.00 0.14 ? 28  ALA A HB1  4  
ATOM   4479  H HB2  . ALA A 1 28 ? -2.528  9.234   1.664   1.00 0.14 ? 28  ALA A HB2  4  
ATOM   4480  H HB3  . ALA A 1 28 ? -2.296  10.534  2.833   1.00 0.16 ? 28  ALA A HB3  4  
ATOM   4481  N N    . MET A 1 29 ? -2.791  6.489   2.534   1.00 0.13 ? 29  MET A N    4  
ATOM   4482  C CA   . MET A 1 29 ? -3.421  5.225   2.176   1.00 0.11 ? 29  MET A CA   4  
ATOM   4483  C C    . MET A 1 29 ? -3.539  4.311   3.391   1.00 0.11 ? 29  MET A C    4  
ATOM   4484  O O    . MET A 1 29 ? -4.538  3.611   3.561   1.00 0.10 ? 29  MET A O    4  
ATOM   4485  C CB   . MET A 1 29 ? -2.625  4.526   1.072   1.00 0.11 ? 29  MET A CB   4  
ATOM   4486  C CG   . MET A 1 29 ? -3.242  3.213   0.616   1.00 0.10 ? 29  MET A CG   4  
ATOM   4487  S SD   . MET A 1 29 ? -2.003  1.984   0.161   1.00 0.10 ? 29  MET A SD   4  
ATOM   4488  C CE   . MET A 1 29 ? -1.137  1.786   1.718   1.00 0.11 ? 29  MET A CE   4  
ATOM   4489  H H    . MET A 1 29 ? -1.944  6.739   2.107   1.00 0.13 ? 29  MET A H    4  
ATOM   4490  H HA   . MET A 1 29 ? -4.413  5.444   1.809   1.00 0.11 ? 29  MET A HA   4  
ATOM   4491  H HB2  . MET A 1 29 ? -2.561  5.184   0.218   1.00 0.12 ? 29  MET A HB2  4  
ATOM   4492  H HB3  . MET A 1 29 ? -1.629  4.325   1.435   1.00 0.12 ? 29  MET A HB3  4  
ATOM   4493  H HG2  . MET A 1 29 ? -3.844  2.816   1.420   1.00 0.10 ? 29  MET A HG2  4  
ATOM   4494  H HG3  . MET A 1 29 ? -3.870  3.405   -0.241  1.00 0.10 ? 29  MET A HG3  4  
ATOM   4495  H HE1  . MET A 1 29 ? -0.521  2.654   1.901   1.00 0.12 ? 29  MET A HE1  4  
ATOM   4496  H HE2  . MET A 1 29 ? -0.515  0.904   1.674   1.00 0.11 ? 29  MET A HE2  4  
ATOM   4497  H HE3  . MET A 1 29 ? -1.856  1.680   2.516   1.00 0.11 ? 29  MET A HE3  4  
ATOM   4498  N N    . LEU A 1 30 ? -2.513  4.320   4.234   1.00 0.12 ? 30  LEU A N    4  
ATOM   4499  C CA   . LEU A 1 30 ? -2.498  3.493   5.435   1.00 0.12 ? 30  LEU A CA   4  
ATOM   4500  C C    . LEU A 1 30 ? -3.665  3.848   6.354   1.00 0.12 ? 30  LEU A C    4  
ATOM   4501  O O    . LEU A 1 30 ? -4.436  2.978   6.757   1.00 0.11 ? 30  LEU A O    4  
ATOM   4502  C CB   . LEU A 1 30 ? -1.176  3.664   6.182   1.00 0.13 ? 30  LEU A CB   4  
ATOM   4503  C CG   . LEU A 1 30 ? -0.197  2.492   6.089   1.00 0.13 ? 30  LEU A CG   4  
ATOM   4504  C CD1  . LEU A 1 30 ? 0.190   2.231   4.643   1.00 0.13 ? 30  LEU A CD1  4  
ATOM   4505  C CD2  . LEU A 1 30 ? 1.039   2.762   6.936   1.00 0.15 ? 30  LEU A CD2  4  
ATOM   4506  H H    . LEU A 1 30 ? -1.744  4.899   4.044   1.00 0.13 ? 30  LEU A H    4  
ATOM   4507  H HA   . LEU A 1 30 ? -2.599  2.463   5.128   1.00 0.11 ? 30  LEU A HA   4  
ATOM   4508  H HB2  . LEU A 1 30 ? -0.683  4.543   5.793   1.00 0.14 ? 30  LEU A HB2  4  
ATOM   4509  H HB3  . LEU A 1 30 ? -1.399  3.833   7.225   1.00 0.14 ? 30  LEU A HB3  4  
ATOM   4510  H HG   . LEU A 1 30 ? -0.676  1.602   6.471   1.00 0.13 ? 30  LEU A HG   4  
ATOM   4511  H HD11 . LEU A 1 30 ? 0.490   3.159   4.178   1.00 0.13 ? 30  LEU A HD11 4  
ATOM   4512  H HD12 . LEU A 1 30 ? -0.654  1.819   4.114   1.00 0.12 ? 30  LEU A HD12 4  
ATOM   4513  H HD13 . LEU A 1 30 ? 1.012   1.531   4.612   1.00 0.13 ? 30  LEU A HD13 4  
ATOM   4514  H HD21 . LEU A 1 30 ? 1.716   1.925   6.861   1.00 0.15 ? 30  LEU A HD21 4  
ATOM   4515  H HD22 . LEU A 1 30 ? 0.747   2.898   7.966   1.00 0.16 ? 30  LEU A HD22 4  
ATOM   4516  H HD23 . LEU A 1 30 ? 1.531   3.656   6.580   1.00 0.15 ? 30  LEU A HD23 4  
ATOM   4517  N N    . SER A 1 31 ? -3.785  5.131   6.678   1.00 0.13 ? 31  SER A N    4  
ATOM   4518  C CA   . SER A 1 31 ? -4.856  5.601   7.551   1.00 0.13 ? 31  SER A CA   4  
ATOM   4519  C C    . SER A 1 31 ? -6.215  5.134   7.042   1.00 0.12 ? 31  SER A C    4  
ATOM   4520  O O    . SER A 1 31 ? -7.142  4.917   7.823   1.00 0.12 ? 31  SER A O    4  
ATOM   4521  C CB   . SER A 1 31 ? -4.830  7.128   7.647   1.00 0.14 ? 31  SER A CB   4  
ATOM   4522  O OG   . SER A 1 31 ? -6.088  7.633   8.059   1.00 0.14 ? 31  SER A OG   4  
ATOM   4523  H H    . SER A 1 31 ? -3.141  5.778   6.322   1.00 0.13 ? 31  SER A H    4  
ATOM   4524  H HA   . SER A 1 31 ? -4.689  5.185   8.533   1.00 0.13 ? 31  SER A HA   4  
ATOM   4525  H HB2  . SER A 1 31 ? -4.082  7.430   8.364   1.00 0.15 ? 31  SER A HB2  4  
ATOM   4526  H HB3  . SER A 1 31 ? -4.588  7.543   6.679   1.00 0.14 ? 31  SER A HB3  4  
ATOM   4527  H HG   . SER A 1 31 ? -6.630  6.912   8.387   1.00 0.13 ? 31  SER A HG   4  
ATOM   4528  N N    . LEU A 1 32 ? -6.327  4.984   5.726   1.00 0.11 ? 32  LEU A N    4  
ATOM   4529  C CA   . LEU A 1 32 ? -7.574  4.543   5.111   1.00 0.10 ? 32  LEU A CA   4  
ATOM   4530  C C    . LEU A 1 32 ? -7.740  3.031   5.237   1.00 0.09 ? 32  LEU A C    4  
ATOM   4531  O O    . LEU A 1 32 ? -8.852  2.528   5.393   1.00 0.09 ? 32  LEU A O    4  
ATOM   4532  C CB   . LEU A 1 32 ? -7.610  4.950   3.637   1.00 0.10 ? 32  LEU A CB   4  
ATOM   4533  C CG   . LEU A 1 32 ? -8.897  4.618   2.880   1.00 0.09 ? 32  LEU A CG   4  
ATOM   4534  C CD1  . LEU A 1 32 ? -8.899  3.161   2.446   1.00 0.08 ? 32  LEU A CD1  4  
ATOM   4535  C CD2  . LEU A 1 32 ? -10.115 4.923   3.738   1.00 0.09 ? 32  LEU A CD2  4  
ATOM   4536  H H    . LEU A 1 32 ? -5.553  5.174   5.156   1.00 0.11 ? 32  LEU A H    4  
ATOM   4537  H HA   . LEU A 1 32 ? -8.386  5.028   5.628   1.00 0.10 ? 32  LEU A HA   4  
ATOM   4538  H HB2  . LEU A 1 32 ? -7.455  6.018   3.581   1.00 0.10 ? 32  LEU A HB2  4  
ATOM   4539  H HB3  . LEU A 1 32 ? -6.789  4.461   3.135   1.00 0.09 ? 32  LEU A HB3  4  
ATOM   4540  H HG   . LEU A 1 32 ? -8.951  5.229   1.991   1.00 0.09 ? 32  LEU A HG   4  
ATOM   4541  H HD11 . LEU A 1 32 ? -8.040  2.970   1.820   1.00 0.08 ? 32  LEU A HD11 4  
ATOM   4542  H HD12 . LEU A 1 32 ? -9.802  2.952   1.892   1.00 0.08 ? 32  LEU A HD12 4  
ATOM   4543  H HD13 . LEU A 1 32 ? -8.857  2.525   3.318   1.00 0.08 ? 32  LEU A HD13 4  
ATOM   4544  H HD21 . LEU A 1 32 ? -11.012 4.657   3.198   1.00 0.09 ? 32  LEU A HD21 4  
ATOM   4545  H HD22 . LEU A 1 32 ? -10.135 5.977   3.970   1.00 0.10 ? 32  LEU A HD22 4  
ATOM   4546  H HD23 . LEU A 1 32 ? -10.063 4.354   4.652   1.00 0.09 ? 32  LEU A HD23 4  
ATOM   4547  N N    . LEU A 1 33 ? -6.625  2.312   5.168   1.00 0.09 ? 33  LEU A N    4  
ATOM   4548  C CA   . LEU A 1 33 ? -6.644  0.858   5.275   1.00 0.08 ? 33  LEU A CA   4  
ATOM   4549  C C    . LEU A 1 33 ? -6.886  0.423   6.717   1.00 0.09 ? 33  LEU A C    4  
ATOM   4550  O O    . LEU A 1 33 ? -7.074  -0.762  6.994   1.00 0.09 ? 33  LEU A O    4  
ATOM   4551  C CB   . LEU A 1 33 ? -5.326  0.270   4.768   1.00 0.08 ? 33  LEU A CB   4  
ATOM   4552  C CG   . LEU A 1 33 ? -5.309  -0.177  3.306   1.00 0.08 ? 33  LEU A CG   4  
ATOM   4553  C CD1  . LEU A 1 33 ? -3.915  -0.634  2.902   1.00 0.08 ? 33  LEU A CD1  4  
ATOM   4554  C CD2  . LEU A 1 33 ? -6.325  -1.288  3.076   1.00 0.07 ? 33  LEU A CD2  4  
ATOM   4555  H H    . LEU A 1 33 ? -5.768  2.771   5.041   1.00 0.10 ? 33  LEU A H    4  
ATOM   4556  H HA   . LEU A 1 33 ? -7.453  0.493   4.662   1.00 0.08 ? 33  LEU A HA   4  
ATOM   4557  H HB2  . LEU A 1 33 ? -4.554  1.015   4.900   1.00 0.09 ? 33  LEU A HB2  4  
ATOM   4558  H HB3  . LEU A 1 33 ? -5.083  -0.582  5.382   1.00 0.09 ? 33  LEU A HB3  4  
ATOM   4559  H HG   . LEU A 1 33 ? -5.580  0.659   2.677   1.00 0.08 ? 33  LEU A HG   4  
ATOM   4560  H HD11 . LEU A 1 33 ? -3.975  -1.212  1.993   1.00 0.09 ? 33  LEU A HD11 4  
ATOM   4561  H HD12 . LEU A 1 33 ? -3.493  -1.241  3.689   1.00 0.10 ? 33  LEU A HD12 4  
ATOM   4562  H HD13 . LEU A 1 33 ? -3.288  0.229   2.740   1.00 0.10 ? 33  LEU A HD13 4  
ATOM   4563  H HD21 . LEU A 1 33 ? -5.927  -2.221  3.447   1.00 0.07 ? 33  LEU A HD21 4  
ATOM   4564  H HD22 . LEU A 1 33 ? -6.526  -1.374  2.020   1.00 0.06 ? 33  LEU A HD22 4  
ATOM   4565  H HD23 . LEU A 1 33 ? -7.240  -1.055  3.596   1.00 0.07 ? 33  LEU A HD23 4  
ATOM   4566  N N    . GLN A 1 34 ? -6.882  1.388   7.631   1.00 0.10 ? 34  GLN A N    4  
ATOM   4567  C CA   . GLN A 1 34 ? -7.104  1.103   9.044   1.00 0.11 ? 34  GLN A CA   4  
ATOM   4568  C C    . GLN A 1 34 ? -8.508  1.520   9.470   1.00 0.11 ? 34  GLN A C    4  
ATOM   4569  O O    . GLN A 1 34 ? -9.095  0.925   10.375  1.00 0.12 ? 34  GLN A O    4  
ATOM   4570  C CB   . GLN A 1 34 ? -6.063  1.827   9.900   1.00 0.12 ? 34  GLN A CB   4  
ATOM   4571  C CG   . GLN A 1 34 ? -4.628  1.526   9.497   1.00 0.13 ? 34  GLN A CG   4  
ATOM   4572  C CD   . GLN A 1 34 ? -3.737  1.237   10.688  1.00 0.14 ? 34  GLN A CD   4  
ATOM   4573  O OE1  . GLN A 1 34 ? -3.887  1.841   11.752  1.00 0.15 ? 34  GLN A OE1  4  
ATOM   4574  N NE2  . GLN A 1 34 ? -2.802  0.310   10.519  1.00 0.14 ? 34  GLN A NE2  4  
ATOM   4575  H H    . GLN A 1 34 ? -6.727  2.312   7.348   1.00 0.10 ? 34  GLN A H    4  
ATOM   4576  H HA   . GLN A 1 34 ? -6.997  0.038   9.188   1.00 0.11 ? 34  GLN A HA   4  
ATOM   4577  H HB2  . GLN A 1 34 ? -6.221  2.892   9.816   1.00 0.13 ? 34  GLN A HB2  4  
ATOM   4578  H HB3  . GLN A 1 34 ? -6.194  1.533   10.931  1.00 0.13 ? 34  GLN A HB3  4  
ATOM   4579  H HG2  . GLN A 1 34 ? -4.623  0.663   8.848   1.00 0.12 ? 34  GLN A HG2  4  
ATOM   4580  H HG3  . GLN A 1 34 ? -4.229  2.378   8.966   1.00 0.13 ? 34  GLN A HG3  4  
ATOM   4581  H HE21 . GLN A 1 34 ? -2.739  -0.130  9.646   1.00 0.13 ? 34  GLN A HE21 4  
ATOM   4582  H HE22 . GLN A 1 34 ? -2.214  0.103   11.274  1.00 0.15 ? 34  GLN A HE22 4  
ATOM   4583  N N    . LYS A 1 35 ? -9.041  2.543   8.812   1.00 0.11 ? 35  LYS A N    4  
ATOM   4584  C CA   . LYS A 1 35 ? -10.377 3.038   9.120   1.00 0.11 ? 35  LYS A CA   4  
ATOM   4585  C C    . LYS A 1 35 ? -11.447 2.142   8.502   1.00 0.11 ? 35  LYS A C    4  
ATOM   4586  O O    . LYS A 1 35 ? -12.503 1.923   9.094   1.00 0.11 ? 35  LYS A O    4  
ATOM   4587  C CB   . LYS A 1 35 ? -10.542 4.472   8.613   1.00 0.12 ? 35  LYS A CB   4  
ATOM   4588  C CG   . LYS A 1 35 ? -10.745 4.565   7.111   1.00 0.11 ? 35  LYS A CG   4  
ATOM   4589  C CD   . LYS A 1 35 ? -10.937 6.005   6.663   1.00 0.11 ? 35  LYS A CD   4  
ATOM   4590  C CE   . LYS A 1 35 ? -12.263 6.192   5.941   1.00 0.11 ? 35  LYS A CE   4  
ATOM   4591  N NZ   . LYS A 1 35 ? -12.918 7.478   6.310   1.00 0.12 ? 35  LYS A NZ   4  
ATOM   4592  H H    . LYS A 1 35 ? -8.522  2.977   8.103   1.00 0.11 ? 35  LYS A H    4  
ATOM   4593  H HA   . LYS A 1 35 ? -10.494 3.029   10.194  1.00 0.12 ? 35  LYS A HA   4  
ATOM   4594  H HB2  . LYS A 1 35 ? -11.397 4.917   9.100   1.00 0.12 ? 35  LYS A HB2  4  
ATOM   4595  H HB3  . LYS A 1 35 ? -9.658  5.035   8.870   1.00 0.12 ? 35  LYS A HB3  4  
ATOM   4596  H HG2  . LYS A 1 35 ? -9.879  4.155   6.617   1.00 0.10 ? 35  LYS A HG2  4  
ATOM   4597  H HG3  . LYS A 1 35 ? -11.620 3.992   6.841   1.00 0.10 ? 35  LYS A HG3  4  
ATOM   4598  H HD2  . LYS A 1 35 ? -10.920 6.646   7.532   1.00 0.12 ? 35  LYS A HD2  4  
ATOM   4599  H HD3  . LYS A 1 35 ? -10.132 6.277   5.998   1.00 0.11 ? 35  LYS A HD3  4  
ATOM   4600  H HE2  . LYS A 1 35 ? -12.083 6.183   4.877   1.00 0.11 ? 35  LYS A HE2  4  
ATOM   4601  H HE3  . LYS A 1 35 ? -12.920 5.376   6.202   1.00 0.11 ? 35  LYS A HE3  4  
ATOM   4602  H HZ1  . LYS A 1 35 ? -13.105 7.503   7.333   1.00 0.13 ? 35  LYS A HZ1  4  
ATOM   4603  H HZ2  . LYS A 1 35 ? -13.819 7.578   5.802   1.00 0.12 ? 35  LYS A HZ2  4  
ATOM   4604  H HZ3  . LYS A 1 35 ? -12.302 8.277   6.061   1.00 0.12 ? 35  LYS A HZ3  4  
ATOM   4605  N N    . GLU A 1 36 ? -11.163 1.629   7.309   1.00 0.10 ? 36  GLU A N    4  
ATOM   4606  C CA   . GLU A 1 36 ? -12.103 0.757   6.612   1.00 0.09 ? 36  GLU A CA   4  
ATOM   4607  C C    . GLU A 1 36 ? -12.180 -0.610  7.287   1.00 0.09 ? 36  GLU A C    4  
ATOM   4608  O O    . GLU A 1 36 ? -13.039 -1.427  6.961   1.00 0.09 ? 36  GLU A O    4  
ATOM   4609  C CB   . GLU A 1 36 ? -11.688 0.592   5.148   1.00 0.08 ? 36  GLU A CB   4  
ATOM   4610  C CG   . GLU A 1 36 ? -11.682 1.895   4.368   1.00 0.08 ? 36  GLU A CG   4  
ATOM   4611  C CD   . GLU A 1 36 ? -13.075 2.450   4.148   1.00 0.09 ? 36  GLU A CD   4  
ATOM   4612  O OE1  . GLU A 1 36 ? -13.194 3.521   3.516   1.00 0.09 ? 36  GLU A OE1  4  
ATOM   4613  O OE2  . GLU A 1 36 ? -14.047 1.816   4.608   1.00 0.09 ? 36  GLU A OE2  4  
ATOM   4614  H H    . GLU A 1 36 ? -10.304 1.841   6.888   1.00 0.09 ? 36  GLU A H    4  
ATOM   4615  H HA   . GLU A 1 36 ? -13.076 1.221   6.651   1.00 0.10 ? 36  GLU A HA   4  
ATOM   4616  H HB2  . GLU A 1 36 ? -10.693 0.172   5.113   1.00 0.08 ? 36  GLU A HB2  4  
ATOM   4617  H HB3  . GLU A 1 36 ? -12.373 -0.089  4.666   1.00 0.08 ? 36  GLU A HB3  4  
ATOM   4618  H HG2  . GLU A 1 36 ? -11.104 2.624   4.914   1.00 0.09 ? 36  GLU A HG2  4  
ATOM   4619  H HG3  . GLU A 1 36 ? -11.223 1.722   3.405   1.00 0.08 ? 36  GLU A HG3  4  
ATOM   4620  N N    . GLY A 1 37 ? -11.274 -0.848  8.231   1.00 0.10 ? 37  GLY A N    4  
ATOM   4621  C CA   . GLY A 1 37 ? -11.257 -2.117  8.937   1.00 0.10 ? 37  GLY A CA   4  
ATOM   4622  C C    . GLY A 1 37 ? -10.543 -3.203  8.158   1.00 0.09 ? 37  GLY A C    4  
ATOM   4623  O O    . GLY A 1 37 ? -10.538 -4.367  8.564   1.00 0.10 ? 37  GLY A O    4  
ATOM   4624  H H    . GLY A 1 37 ? -10.615 -0.157  8.452   1.00 0.10 ? 37  GLY A H    4  
ATOM   4625  H HA2  . GLY A 1 37 ? -10.757 -1.982  9.885   1.00 0.11 ? 37  GLY A HA2  4  
ATOM   4626  H HA3  . GLY A 1 37 ? -12.274 -2.429  9.121   1.00 0.11 ? 37  GLY A HA3  4  
ATOM   4627  N N    . LEU A 1 38 ? -9.940  -2.826  7.037   1.00 0.08 ? 38  LEU A N    4  
ATOM   4628  C CA   . LEU A 1 38 ? -9.221  -3.781  6.198   1.00 0.08 ? 38  LEU A CA   4  
ATOM   4629  C C    . LEU A 1 38 ? -7.909  -4.201  6.853   1.00 0.08 ? 38  LEU A C    4  
ATOM   4630  O O    . LEU A 1 38 ? -7.364  -5.262  6.550   1.00 0.08 ? 38  LEU A O    4  
ATOM   4631  C CB   . LEU A 1 38 ? -8.945  -3.170  4.822   1.00 0.07 ? 38  LEU A CB   4  
ATOM   4632  C CG   . LEU A 1 38 ? -10.166 -2.949  3.930   1.00 0.06 ? 38  LEU A CG   4  
ATOM   4633  C CD1  . LEU A 1 38 ? -9.865  -1.911  2.859   1.00 0.06 ? 38  LEU A CD1  4  
ATOM   4634  C CD2  . LEU A 1 38 ? -10.608 -4.260  3.295   1.00 0.06 ? 38  LEU A CD2  4  
ATOM   4635  H H    . LEU A 1 38 ? -9.980  -1.886  6.765   1.00 0.08 ? 38  LEU A H    4  
ATOM   4636  H HA   . LEU A 1 38 ? -9.845  -4.653  6.076   1.00 0.08 ? 38  LEU A HA   4  
ATOM   4637  H HB2  . LEU A 1 38 ? -8.460  -2.217  4.970   1.00 0.07 ? 38  LEU A HB2  4  
ATOM   4638  H HB3  . LEU A 1 38 ? -8.262  -3.821  4.298   1.00 0.06 ? 38  LEU A HB3  4  
ATOM   4639  H HG   . LEU A 1 38 ? -10.982 -2.577  4.533   1.00 0.07 ? 38  LEU A HG   4  
ATOM   4640  H HD11 . LEU A 1 38 ? -9.618  -0.971  3.328   1.00 0.06 ? 38  LEU A HD11 4  
ATOM   4641  H HD12 . LEU A 1 38 ? -10.732 -1.782  2.228   1.00 0.06 ? 38  LEU A HD12 4  
ATOM   4642  H HD13 . LEU A 1 38 ? -9.030  -2.245  2.259   1.00 0.05 ? 38  LEU A HD13 4  
ATOM   4643  H HD21 . LEU A 1 38 ? -9.795  -4.671  2.714   1.00 0.06 ? 38  LEU A HD21 4  
ATOM   4644  H HD22 . LEU A 1 38 ? -11.454 -4.080  2.649   1.00 0.06 ? 38  LEU A HD22 4  
ATOM   4645  H HD23 . LEU A 1 38 ? -10.888 -4.959  4.069   1.00 0.07 ? 38  LEU A HD23 4  
ATOM   4646  N N    . LEU A 1 39 ? -7.408  -3.361  7.753   1.00 0.09 ? 39  LEU A N    4  
ATOM   4647  C CA   . LEU A 1 39 ? -6.160  -3.647  8.454   1.00 0.10 ? 39  LEU A CA   4  
ATOM   4648  C C    . LEU A 1 39 ? -6.226  -3.167  9.900   1.00 0.11 ? 39  LEU A C    4  
ATOM   4649  O O    . LEU A 1 39 ? -6.901  -2.186  10.209  1.00 0.11 ? 39  LEU A O    4  
ATOM   4650  C CB   . LEU A 1 39 ? -4.986  -2.979  7.737   1.00 0.10 ? 39  LEU A CB   4  
ATOM   4651  C CG   . LEU A 1 39 ? -4.667  -3.506  6.337   1.00 0.09 ? 39  LEU A CG   4  
ATOM   4652  C CD1  . LEU A 1 39 ? -3.458  -2.786  5.759   1.00 0.09 ? 39  LEU A CD1  4  
ATOM   4653  C CD2  . LEU A 1 39 ? -4.427  -5.008  6.375   1.00 0.09 ? 39  LEU A CD2  4  
ATOM   4654  H H    . LEU A 1 39 ? -7.888  -2.530  7.951   1.00 0.09 ? 39  LEU A H    4  
ATOM   4655  H HA   . LEU A 1 39 ? -6.014  -4.717  8.448   1.00 0.10 ? 39  LEU A HA   4  
ATOM   4656  H HB2  . LEU A 1 39 ? -5.198  -1.923  7.657   1.00 0.10 ? 39  LEU A HB2  4  
ATOM   4657  H HB3  . LEU A 1 39 ? -4.105  -3.103  8.350   1.00 0.11 ? 39  LEU A HB3  4  
ATOM   4658  H HG   . LEU A 1 39 ? -5.510  -3.319  5.688   1.00 0.08 ? 39  LEU A HG   4  
ATOM   4659  H HD11 . LEU A 1 39 ? -3.370  -3.020  4.708   1.00 0.08 ? 39  LEU A HD11 4  
ATOM   4660  H HD12 . LEU A 1 39 ? -2.567  -3.110  6.275   1.00 0.10 ? 39  LEU A HD12 4  
ATOM   4661  H HD13 . LEU A 1 39 ? -3.578  -1.721  5.883   1.00 0.09 ? 39  LEU A HD13 4  
ATOM   4662  H HD21 . LEU A 1 39 ? -3.762  -5.288  5.571   1.00 0.08 ? 39  LEU A HD21 4  
ATOM   4663  H HD22 . LEU A 1 39 ? -5.368  -5.525  6.260   1.00 0.08 ? 39  LEU A HD22 4  
ATOM   4664  H HD23 . LEU A 1 39 ? -3.983  -5.279  7.322   1.00 0.10 ? 39  LEU A HD23 4  
ATOM   4665  N N    . MET A 1 40 ? -5.521  -3.867  10.782  1.00 0.12 ? 40  MET A N    4  
ATOM   4666  C CA   . MET A 1 40 ? -5.497  -3.513  12.196  1.00 0.14 ? 40  MET A CA   4  
ATOM   4667  C C    . MET A 1 40 ? -4.201  -2.792  12.554  1.00 0.14 ? 40  MET A C    4  
ATOM   4668  O O    . MET A 1 40 ? -4.139  -2.059  13.542  1.00 0.15 ? 40  MET A O    4  
ATOM   4669  C CB   . MET A 1 40 ? -5.655  -4.763  13.063  1.00 0.14 ? 40  MET A CB   4  
ATOM   4670  C CG   . MET A 1 40 ? -6.000  -4.460  14.513  1.00 0.16 ? 40  MET A CG   4  
ATOM   4671  S SD   . MET A 1 40 ? -5.339  -5.689  15.655  1.00 0.17 ? 40  MET A SD   4  
ATOM   4672  C CE   . MET A 1 40 ? -3.595  -5.288  15.612  1.00 0.17 ? 40  MET A CE   4  
ATOM   4673  H H    . MET A 1 40 ? -5.005  -4.642  10.474  1.00 0.12 ? 40  MET A H    4  
ATOM   4674  H HA   . MET A 1 40 ? -6.328  -2.848  12.385  1.00 0.14 ? 40  MET A HA   4  
ATOM   4675  H HB2  . MET A 1 40 ? -6.441  -5.377  12.649  1.00 0.14 ? 40  MET A HB2  4  
ATOM   4676  H HB3  . MET A 1 40 ? -4.729  -5.319  13.044  1.00 0.14 ? 40  MET A HB3  4  
ATOM   4677  H HG2  . MET A 1 40 ? -5.591  -3.494  14.771  1.00 0.16 ? 40  MET A HG2  4  
ATOM   4678  H HG3  . MET A 1 40 ? -7.074  -4.434  14.615  1.00 0.15 ? 40  MET A HG3  4  
ATOM   4679  H HE1  . MET A 1 40 ? -3.454  -4.258  15.904  1.00 0.18 ? 40  MET A HE1  4  
ATOM   4680  H HE2  . MET A 1 40 ? -3.216  -5.433  14.610  1.00 0.17 ? 40  MET A HE2  4  
ATOM   4681  H HE3  . MET A 1 40 ? -3.059  -5.932  16.294  1.00 0.18 ? 40  MET A HE3  4  
ATOM   4682  N N    . SER A 1 41 ? -3.167  -3.006  11.745  1.00 0.14 ? 41  SER A N    4  
ATOM   4683  C CA   . SER A 1 41 ? -1.872  -2.379  11.978  1.00 0.15 ? 41  SER A CA   4  
ATOM   4684  C C    . SER A 1 41 ? -1.140  -2.136  10.662  1.00 0.14 ? 41  SER A C    4  
ATOM   4685  O O    . SER A 1 41 ? -1.443  -2.741  9.633   1.00 0.13 ? 41  SER A O    4  
ATOM   4686  C CB   . SER A 1 41 ? -1.017  -3.256  12.895  1.00 0.16 ? 41  SER A CB   4  
ATOM   4687  O OG   . SER A 1 41 ? -1.565  -4.557  13.014  1.00 0.16 ? 41  SER A OG   4  
ATOM   4688  H H    . SER A 1 41 ? -3.280  -3.599  10.974  1.00 0.13 ? 41  SER A H    4  
ATOM   4689  H HA   . SER A 1 41 ? -2.045  -1.430  12.462  1.00 0.15 ? 41  SER A HA   4  
ATOM   4690  H HB2  . SER A 1 41 ? -0.021  -3.335  12.487  1.00 0.16 ? 41  SER A HB2  4  
ATOM   4691  H HB3  . SER A 1 41 ? -0.969  -2.808  13.876  1.00 0.17 ? 41  SER A HB3  4  
ATOM   4692  H HG   . SER A 1 41 ? -1.391  -4.900  13.893  1.00 0.17 ? 41  SER A HG   4  
ATOM   4693  N N    . PRO A 1 42 ? -0.155  -1.227  10.693  1.00 0.15 ? 42  PRO A N    4  
ATOM   4694  C CA   . PRO A 1 42 ? 0.641   -0.882  9.512   1.00 0.15 ? 42  PRO A CA   4  
ATOM   4695  C C    . PRO A 1 42 ? 1.566   -2.016  9.084   1.00 0.15 ? 42  PRO A C    4  
ATOM   4696  O O    . PRO A 1 42 ? 2.082   -2.020  7.967   1.00 0.15 ? 42  PRO A O    4  
ATOM   4697  C CB   . PRO A 1 42 ? 1.457   0.328   9.974   1.00 0.16 ? 42  PRO A CB   4  
ATOM   4698  C CG   . PRO A 1 42 ? 1.547   0.180   11.454  1.00 0.17 ? 42  PRO A CG   4  
ATOM   4699  C CD   . PRO A 1 42 ? 0.260   -0.467  11.885  1.00 0.17 ? 42  PRO A CD   4  
ATOM   4700  H HA   . PRO A 1 42 ? 0.012   -0.599  8.681   1.00 0.14 ? 42  PRO A HA   4  
ATOM   4701  H HB2  . PRO A 1 42 ? 2.439   0.306   9.519   1.00 0.17 ? 42  PRO A HB2  4  
ATOM   4702  H HB3  . PRO A 1 42 ? 0.945   1.242   9.723   1.00 0.16 ? 42  PRO A HB3  4  
ATOM   4703  H HG2  . PRO A 1 42 ? 2.391   -0.447  11.709  1.00 0.18 ? 42  PRO A HG2  4  
ATOM   4704  H HG3  . PRO A 1 42 ? 1.643   1.149   11.917  1.00 0.18 ? 42  PRO A HG3  4  
ATOM   4705  H HD2  . PRO A 1 42 ? 0.432   -1.127  12.723  1.00 0.17 ? 42  PRO A HD2  4  
ATOM   4706  H HD3  . PRO A 1 42 ? -0.474  0.283   12.138  1.00 0.16 ? 42  PRO A HD3  4  
ATOM   4707  N N    . SER A 1 43 ? 1.771   -2.976  9.980   1.00 0.16 ? 43  SER A N    4  
ATOM   4708  C CA   . SER A 1 43 ? 2.637   -4.114  9.697   1.00 0.16 ? 43  SER A CA   4  
ATOM   4709  C C    . SER A 1 43 ? 1.862   -5.224  8.993   1.00 0.15 ? 43  SER A C    4  
ATOM   4710  O O    . SER A 1 43 ? 2.437   -6.231  8.579   1.00 0.15 ? 43  SER A O    4  
ATOM   4711  C CB   . SER A 1 43 ? 3.254   -4.649  10.990  1.00 0.17 ? 43  SER A CB   4  
ATOM   4712  O OG   . SER A 1 43 ? 2.252   -4.944  11.949  1.00 0.17 ? 43  SER A OG   4  
ATOM   4713  H H    . SER A 1 43 ? 1.329   -2.917  10.854  1.00 0.16 ? 43  SER A H    4  
ATOM   4714  H HA   . SER A 1 43 ? 3.429   -3.774  9.045   1.00 0.16 ? 43  SER A HA   4  
ATOM   4715  H HB2  . SER A 1 43 ? 3.806   -5.552  10.777  1.00 0.17 ? 43  SER A HB2  4  
ATOM   4716  H HB3  . SER A 1 43 ? 3.921   -3.908  11.402  1.00 0.18 ? 43  SER A HB3  4  
ATOM   4717  H HG   . SER A 1 43 ? 2.286   -5.878  12.171  1.00 0.17 ? 43  SER A HG   4  
ATOM   4718  N N    . ASP A 1 44 ? 0.555   -5.032  8.860   1.00 0.14 ? 44  ASP A N    4  
ATOM   4719  C CA   . ASP A 1 44 ? -0.300  -6.015  8.205   1.00 0.12 ? 44  ASP A CA   4  
ATOM   4720  C C    . ASP A 1 44 ? 0.092   -6.188  6.742   1.00 0.12 ? 44  ASP A C    4  
ATOM   4721  O O    . ASP A 1 44 ? -0.286  -7.168  6.097   1.00 0.11 ? 44  ASP A O    4  
ATOM   4722  C CB   . ASP A 1 44 ? -1.769  -5.595  8.306   1.00 0.12 ? 44  ASP A CB   4  
ATOM   4723  C CG   . ASP A 1 44 ? -2.700  -6.778  8.469   1.00 0.11 ? 44  ASP A CG   4  
ATOM   4724  O OD1  . ASP A 1 44 ? -2.446  -7.825  7.837   1.00 0.11 ? 44  ASP A OD1  4  
ATOM   4725  O OD2  . ASP A 1 44 ? -3.683  -6.660  9.229   1.00 0.11 ? 44  ASP A OD2  4  
ATOM   4726  H H    . ASP A 1 44 ? 0.155   -4.209  9.210   1.00 0.14 ? 44  ASP A H    4  
ATOM   4727  H HA   . ASP A 1 44 ? -0.170  -6.959  8.715   1.00 0.13 ? 44  ASP A HA   4  
ATOM   4728  H HB2  . ASP A 1 44 ? -1.892  -4.944  9.158   1.00 0.12 ? 44  ASP A HB2  4  
ATOM   4729  H HB3  . ASP A 1 44 ? -2.043  -5.063  7.408   1.00 0.11 ? 44  ASP A HB3  4  
ATOM   4730  N N    . LEU A 1 45 ? 0.853   -5.231  6.221   1.00 0.12 ? 45  LEU A N    4  
ATOM   4731  C CA   . LEU A 1 45 ? 1.296   -5.276  4.832   1.00 0.12 ? 45  LEU A CA   4  
ATOM   4732  C C    . LEU A 1 45 ? 2.188   -6.489  4.585   1.00 0.12 ? 45  LEU A C    4  
ATOM   4733  O O    . LEU A 1 45 ? 2.414   -6.882  3.441   1.00 0.12 ? 45  LEU A O    4  
ATOM   4734  C CB   . LEU A 1 45 ? 2.048   -3.993  4.475   1.00 0.12 ? 45  LEU A CB   4  
ATOM   4735  C CG   . LEU A 1 45 ? 1.424   -3.134  3.375   1.00 0.12 ? 45  LEU A CG   4  
ATOM   4736  C CD1  . LEU A 1 45 ? 1.686   -3.744  2.007   1.00 0.11 ? 45  LEU A CD1  4  
ATOM   4737  C CD2  . LEU A 1 45 ? -0.071  -2.970  3.610   1.00 0.10 ? 45  LEU A CD2  4  
ATOM   4738  H H    . LEU A 1 45 ? 1.122   -4.476  6.785   1.00 0.13 ? 45  LEU A H    4  
ATOM   4739  H HA   . LEU A 1 45 ? 0.420   -5.356  4.208   1.00 0.11 ? 45  LEU A HA   4  
ATOM   4740  H HB2  . LEU A 1 45 ? 2.127   -3.390  5.367   1.00 0.13 ? 45  LEU A HB2  4  
ATOM   4741  H HB3  . LEU A 1 45 ? 3.044   -4.266  4.161   1.00 0.13 ? 45  LEU A HB3  4  
ATOM   4742  H HG   . LEU A 1 45 ? 1.876   -2.152  3.394   1.00 0.12 ? 45  LEU A HG   4  
ATOM   4743  H HD11 . LEU A 1 45 ? 2.731   -3.640  1.761   1.00 0.12 ? 45  LEU A HD11 4  
ATOM   4744  H HD12 . LEU A 1 45 ? 1.090   -3.235  1.264   1.00 0.11 ? 45  LEU A HD12 4  
ATOM   4745  H HD13 . LEU A 1 45 ? 1.423   -4.791  2.023   1.00 0.11 ? 45  LEU A HD13 4  
ATOM   4746  H HD21 . LEU A 1 45 ? -0.421  -2.085  3.099   1.00 0.10 ? 45  LEU A HD21 4  
ATOM   4747  H HD22 . LEU A 1 45 ? -0.262  -2.874  4.669   1.00 0.11 ? 45  LEU A HD22 4  
ATOM   4748  H HD23 . LEU A 1 45 ? -0.594  -3.835  3.228   1.00 0.10 ? 45  LEU A HD23 4  
ATOM   4749  N N    . TYR A 1 46 ? 2.691   -7.077  5.665   1.00 0.13 ? 46  TYR A N    4  
ATOM   4750  C CA   . TYR A 1 46 ? 3.558   -8.244  5.566   1.00 0.14 ? 46  TYR A CA   4  
ATOM   4751  C C    . TYR A 1 46 ? 2.740   -9.515  5.357   1.00 0.13 ? 46  TYR A C    4  
ATOM   4752  O O    . TYR A 1 46 ? 3.287   -10.616 5.305   1.00 0.13 ? 46  TYR A O    4  
ATOM   4753  C CB   . TYR A 1 46 ? 4.415   -8.376  6.826   1.00 0.15 ? 46  TYR A CB   4  
ATOM   4754  C CG   . TYR A 1 46 ? 5.185   -7.122  7.169   1.00 0.16 ? 46  TYR A CG   4  
ATOM   4755  C CD1  . TYR A 1 46 ? 5.736   -6.326  6.171   1.00 0.16 ? 46  TYR A CD1  4  
ATOM   4756  C CD2  . TYR A 1 46 ? 5.363   -6.731  8.490   1.00 0.17 ? 46  TYR A CD2  4  
ATOM   4757  C CE1  . TYR A 1 46 ? 6.441   -5.179  6.480   1.00 0.17 ? 46  TYR A CE1  4  
ATOM   4758  C CE2  . TYR A 1 46 ? 6.065   -5.584  8.809   1.00 0.18 ? 46  TYR A CE2  4  
ATOM   4759  C CZ   . TYR A 1 46 ? 6.602   -4.812  7.799   1.00 0.18 ? 46  TYR A CZ   4  
ATOM   4760  O OH   . TYR A 1 46 ? 7.303   -3.670  8.114   1.00 0.19 ? 46  TYR A OH   4  
ATOM   4761  H H    . TYR A 1 46 ? 2.473   -6.718  6.551   1.00 0.13 ? 46  TYR A H    4  
ATOM   4762  H HA   . TYR A 1 46 ? 4.205   -8.103  4.714   1.00 0.14 ? 46  TYR A HA   4  
ATOM   4763  H HB2  . TYR A 1 46 ? 3.777   -8.612  7.664   1.00 0.15 ? 46  TYR A HB2  4  
ATOM   4764  H HB3  . TYR A 1 46 ? 5.128   -9.176  6.685   1.00 0.16 ? 46  TYR A HB3  4  
ATOM   4765  H HD1  . TYR A 1 46 ? 5.607   -6.615  5.138   1.00 0.15 ? 46  TYR A HD1  4  
ATOM   4766  H HD2  . TYR A 1 46 ? 4.942   -7.339  9.278   1.00 0.17 ? 46  TYR A HD2  4  
ATOM   4767  H HE1  . TYR A 1 46 ? 6.861   -4.574  5.690   1.00 0.17 ? 46  TYR A HE1  4  
ATOM   4768  H HE2  . TYR A 1 46 ? 6.190   -5.298  9.842   1.00 0.19 ? 46  TYR A HE2  4  
ATOM   4769  H HH   . TYR A 1 46 ? 7.920   -3.858  8.825   1.00 0.20 ? 46  TYR A HH   4  
ATOM   4770  N N    . SER A 1 47 ? 1.426   -9.353  5.240   1.00 0.12 ? 47  SER A N    4  
ATOM   4771  C CA   . SER A 1 47 ? 0.531   -10.485 5.040   1.00 0.11 ? 47  SER A CA   4  
ATOM   4772  C C    . SER A 1 47 ? 0.017   -10.527 3.605   1.00 0.10 ? 47  SER A C    4  
ATOM   4773  O O    . SER A 1 47 ? -0.983  -9.897  3.257   1.00 0.09 ? 47  SER A O    4  
ATOM   4774  C CB   . SER A 1 47 ? -0.646  -10.409 6.013   1.00 0.11 ? 47  SER A CB   4  
ATOM   4775  O OG   . SER A 1 47 ? -0.351  -11.079 7.226   1.00 0.12 ? 47  SER A OG   4  
ATOM   4776  H H    . SER A 1 47 ? 1.049   -8.450  5.289   1.00 0.12 ? 47  SER A H    4  
ATOM   4777  H HA   . SER A 1 47 ? 1.089   -11.386 5.237   1.00 0.12 ? 47  SER A HA   4  
ATOM   4778  H HB2  . SER A 1 47 ? -0.863  -9.375  6.233   1.00 0.11 ? 47  SER A HB2  4  
ATOM   4779  H HB3  . SER A 1 47 ? -1.513  -10.871 5.563   1.00 0.10 ? 47  SER A HB3  4  
ATOM   4780  H HG   . SER A 1 47 ? -0.763  -10.613 7.958   1.00 0.12 ? 47  SER A HG   4  
ATOM   4781  N N    . PRO A 1 48 ? 0.717   -11.284 2.746   1.00 0.11 ? 48  PRO A N    4  
ATOM   4782  C CA   . PRO A 1 48 ? 0.351   -11.426 1.335   1.00 0.10 ? 48  PRO A CA   4  
ATOM   4783  C C    . PRO A 1 48 ? -0.932  -12.227 1.146   1.00 0.09 ? 48  PRO A C    4  
ATOM   4784  O O    . PRO A 1 48 ? -1.427  -12.373 0.028   1.00 0.09 ? 48  PRO A O    4  
ATOM   4785  C CB   . PRO A 1 48 ? 1.543   -12.176 0.733   1.00 0.11 ? 48  PRO A CB   4  
ATOM   4786  C CG   . PRO A 1 48 ? 2.137   -12.921 1.877   1.00 0.12 ? 48  PRO A CG   4  
ATOM   4787  C CD   . PRO A 1 48 ? 1.919   -12.060 3.091   1.00 0.12 ? 48  PRO A CD   4  
ATOM   4788  H HA   . PRO A 1 48 ? 0.247   -10.463 0.854   1.00 0.10 ? 48  PRO A HA   4  
ATOM   4789  H HB2  . PRO A 1 48 ? 1.200   -12.853 -0.040  1.00 0.11 ? 48  PRO A HB2  4  
ATOM   4790  H HB3  . PRO A 1 48 ? 2.259   -11.478 0.332   1.00 0.11 ? 48  PRO A HB3  4  
ATOM   4791  H HG2  . PRO A 1 48 ? 1.636   -13.874 1.993   1.00 0.12 ? 48  PRO A HG2  4  
ATOM   4792  H HG3  . PRO A 1 48 ? 3.192   -13.068 1.715   1.00 0.13 ? 48  PRO A HG3  4  
ATOM   4793  H HD2  . PRO A 1 48 ? 1.747   -12.676 3.961   1.00 0.12 ? 48  PRO A HD2  4  
ATOM   4794  H HD3  . PRO A 1 48 ? 2.766   -11.409 3.250   1.00 0.12 ? 48  PRO A HD3  4  
ATOM   4795  N N    . GLY A 1 49 ? -1.469  -12.742 2.247   1.00 0.09 ? 49  GLY A N    4  
ATOM   4796  C CA   . GLY A 1 49 ? -2.692  -13.523 2.182   1.00 0.09 ? 49  GLY A CA   4  
ATOM   4797  C C    . GLY A 1 49 ? -3.927  -12.690 2.471   1.00 0.08 ? 49  GLY A C    4  
ATOM   4798  O O    . GLY A 1 49 ? -5.034  -13.220 2.556   1.00 0.08 ? 49  GLY A O    4  
ATOM   4799  H H    . GLY A 1 49 ? -1.032  -12.591 3.112   1.00 0.10 ? 49  GLY A H    4  
ATOM   4800  H HA2  . GLY A 1 49 ? -2.782  -13.948 1.193   1.00 0.09 ? 49  GLY A HA2  4  
ATOM   4801  H HA3  . GLY A 1 49 ? -2.634  -14.324 2.904   1.00 0.10 ? 49  GLY A HA3  4  
ATOM   4802  N N    . SER A 1 50 ? -3.736  -11.385 2.624   1.00 0.08 ? 50  SER A N    4  
ATOM   4803  C CA   . SER A 1 50 ? -4.842  -10.478 2.911   1.00 0.07 ? 50  SER A CA   4  
ATOM   4804  C C    . SER A 1 50 ? -4.967  -9.414  1.826   1.00 0.06 ? 50  SER A C    4  
ATOM   4805  O O    . SER A 1 50 ? -5.789  -8.502  1.928   1.00 0.06 ? 50  SER A O    4  
ATOM   4806  C CB   . SER A 1 50 ? -4.643  -9.813  4.275   1.00 0.08 ? 50  SER A CB   4  
ATOM   4807  O OG   . SER A 1 50 ? -4.771  -10.754 5.326   1.00 0.09 ? 50  SER A OG   4  
ATOM   4808  H H    . SER A 1 50 ? -2.829  -11.021 2.545   1.00 0.08 ? 50  SER A H    4  
ATOM   4809  H HA   . SER A 1 50 ? -5.750  -11.061 2.933   1.00 0.07 ? 50  SER A HA   4  
ATOM   4810  H HB2  . SER A 1 50 ? -3.657  -9.375  4.319   1.00 0.08 ? 50  SER A HB2  4  
ATOM   4811  H HB3  . SER A 1 50 ? -5.386  -9.040  4.407   1.00 0.07 ? 50  SER A HB3  4  
ATOM   4812  H HG   . SER A 1 50 ? -5.119  -11.578 4.978   1.00 0.09 ? 50  SER A HG   4  
ATOM   4813  N N    . TRP A 1 51 ? -4.147  -9.534  0.789   1.00 0.07 ? 51  TRP A N    4  
ATOM   4814  C CA   . TRP A 1 51 ? -4.165  -8.584  -0.316  1.00 0.06 ? 51  TRP A CA   4  
ATOM   4815  C C    . TRP A 1 51 ? -5.434  -8.739  -1.148  1.00 0.06 ? 51  TRP A C    4  
ATOM   4816  O O    . TRP A 1 51 ? -5.826  -7.827  -1.877  1.00 0.06 ? 51  TRP A O    4  
ATOM   4817  C CB   . TRP A 1 51 ? -2.935  -8.776  -1.202  1.00 0.07 ? 51  TRP A CB   4  
ATOM   4818  C CG   . TRP A 1 51 ? -1.657  -8.347  -0.545  1.00 0.08 ? 51  TRP A CG   4  
ATOM   4819  C CD1  . TRP A 1 51 ? -1.528  -7.505  0.522   1.00 0.08 ? 51  TRP A CD1  4  
ATOM   4820  C CD2  . TRP A 1 51 ? -0.330  -8.741  -0.913  1.00 0.09 ? 51  TRP A CD2  4  
ATOM   4821  N NE1  . TRP A 1 51 ? -0.199  -7.350  0.840   1.00 0.09 ? 51  TRP A NE1  4  
ATOM   4822  C CE2  . TRP A 1 51 ? 0.555   -8.099  -0.025  1.00 0.10 ? 51  TRP A CE2  4  
ATOM   4823  C CE3  . TRP A 1 51 ? 0.195   -9.572  -1.904  1.00 0.09 ? 51  TRP A CE3  4  
ATOM   4824  C CZ2  . TRP A 1 51 ? 1.935   -8.264  -0.102  1.00 0.11 ? 51  TRP A CZ2  4  
ATOM   4825  C CZ3  . TRP A 1 51 ? 1.565   -9.735  -1.979  1.00 0.11 ? 51  TRP A CZ3  4  
ATOM   4826  C CH2  . TRP A 1 51 ? 2.422   -9.084  -1.083  1.00 0.11 ? 51  TRP A CH2  4  
ATOM   4827  H H    . TRP A 1 51 ? -3.515  -10.282 0.765   1.00 0.07 ? 51  TRP A H    4  
ATOM   4828  H HA   . TRP A 1 51 ? -4.145  -7.589  0.102   1.00 0.06 ? 51  TRP A HA   4  
ATOM   4829  H HB2  . TRP A 1 51 ? -2.844  -9.820  -1.458  1.00 0.07 ? 51  TRP A HB2  4  
ATOM   4830  H HB3  . TRP A 1 51 ? -3.056  -8.197  -2.106  1.00 0.07 ? 51  TRP A HB3  4  
ATOM   4831  H HD1  . TRP A 1 51 ? -2.355  -7.035  1.031   1.00 0.07 ? 51  TRP A HD1  4  
ATOM   4832  H HE1  . TRP A 1 51 ? 0.150   -6.796  1.568   1.00 0.09 ? 51  TRP A HE1  4  
ATOM   4833  H HE3  . TRP A 1 51 ? -0.449  -10.083 -2.604  1.00 0.09 ? 51  TRP A HE3  4  
ATOM   4834  H HZ2  . TRP A 1 51 ? 2.608   -7.771  0.582   1.00 0.11 ? 51  TRP A HZ2  4  
ATOM   4835  H HZ3  . TRP A 1 51 ? 1.989   -10.375 -2.739  1.00 0.11 ? 51  TRP A HZ3  4  
ATOM   4836  H HH2  . TRP A 1 51 ? 3.486   -9.240  -1.179  1.00 0.12 ? 51  TRP A HH2  4  
ATOM   4837  N N    . ASP A 1 52 ? -6.073  -9.898  -1.034  1.00 0.06 ? 52  ASP A N    4  
ATOM   4838  C CA   . ASP A 1 52 ? -7.299  -10.174 -1.775  1.00 0.07 ? 52  ASP A CA   4  
ATOM   4839  C C    . ASP A 1 52 ? -8.418  -9.232  -1.341  1.00 0.06 ? 52  ASP A C    4  
ATOM   4840  O O    . ASP A 1 52 ? -8.962  -8.465  -2.135  1.00 0.06 ? 52  ASP A O    4  
ATOM   4841  C CB   . ASP A 1 52 ? -7.730  -11.626 -1.570  1.00 0.07 ? 52  ASP A CB   4  
ATOM   4842  C CG   . ASP A 1 52 ? -7.317  -12.519 -2.723  1.00 0.08 ? 52  ASP A CG   4  
ATOM   4843  O OD1  . ASP A 1 52 ? -8.085  -13.444 -3.063  1.00 0.09 ? 52  ASP A OD1  4  
ATOM   4844  O OD2  . ASP A 1 52 ? -6.227  -12.294 -3.288  1.00 0.08 ? 52  ASP A OD2  4  
ATOM   4845  H H    . ASP A 1 52 ? -5.710  -10.586 -0.438  1.00 0.06 ? 52  ASP A H    4  
ATOM   4846  H HA   . ASP A 1 52 ? -7.095  -10.012 -2.823  1.00 0.07 ? 52  ASP A HA   4  
ATOM   4847  H HB2  . ASP A 1 52 ? -7.277  -12.005 -0.667  1.00 0.07 ? 52  ASP A HB2  4  
ATOM   4848  H HB3  . ASP A 1 52 ? -8.805  -11.665 -1.474  1.00 0.08 ? 52  ASP A HB3  4  
ATOM   4849  N N    . PRO A 1 53 ? -8.772  -9.290  -0.047  1.00 0.06 ? 53  PRO A N    4  
ATOM   4850  C CA   . PRO A 1 53 ? -9.830  -8.451  0.521   1.00 0.06 ? 53  PRO A CA   4  
ATOM   4851  C C    . PRO A 1 53 ? -9.428  -6.982  0.597   1.00 0.05 ? 53  PRO A C    4  
ATOM   4852  O O    . PRO A 1 53 ? -10.246 -6.121  0.919   1.00 0.06 ? 53  PRO A O    4  
ATOM   4853  C CB   . PRO A 1 53 ? -10.023 -9.027  1.927   1.00 0.06 ? 53  PRO A CB   4  
ATOM   4854  C CG   . PRO A 1 53 ? -8.716  -9.662  2.257   1.00 0.06 ? 53  PRO A CG   4  
ATOM   4855  C CD   . PRO A 1 53 ? -8.167  -10.180 0.957   1.00 0.06 ? 53  PRO A CD   4  
ATOM   4856  H HA   . PRO A 1 53 ? -10.750 -8.541  -0.037  1.00 0.07 ? 53  PRO A HA   4  
ATOM   4857  H HB2  . PRO A 1 53 ? -10.258 -8.230  2.623   1.00 0.06 ? 53  PRO A HB2  4  
ATOM   4858  H HB3  . PRO A 1 53 ? -10.805 -9.767  1.923   1.00 0.07 ? 53  PRO A HB3  4  
ATOM   4859  H HG2  . PRO A 1 53 ? -8.048  -8.925  2.683   1.00 0.06 ? 53  PRO A HG2  4  
ATOM   4860  H HG3  . PRO A 1 53 ? -8.866  -10.478 2.944   1.00 0.07 ? 53  PRO A HG3  4  
ATOM   4861  H HD2  . PRO A 1 53 ? -7.090  -10.102 0.943   1.00 0.06 ? 53  PRO A HD2  4  
ATOM   4862  H HD3  . PRO A 1 53 ? -8.476  -11.203 0.800   1.00 0.07 ? 53  PRO A HD3  4  
ATOM   4863  N N    . ILE A 1 54 ? -8.163  -6.705  0.300   1.00 0.05 ? 54  ILE A N    4  
ATOM   4864  C CA   . ILE A 1 54 ? -7.652  -5.340  0.333   1.00 0.05 ? 54  ILE A CA   4  
ATOM   4865  C C    . ILE A 1 54 ? -7.515  -4.770  -1.075  1.00 0.05 ? 54  ILE A C    4  
ATOM   4866  O O    . ILE A 1 54 ? -7.475  -3.553  -1.264  1.00 0.05 ? 54  ILE A O    4  
ATOM   4867  C CB   . ILE A 1 54 ? -6.287  -5.267  1.040   1.00 0.05 ? 54  ILE A CB   4  
ATOM   4868  C CG1  . ILE A 1 54 ? -6.414  -5.729  2.493   1.00 0.05 ? 54  ILE A CG1  4  
ATOM   4869  C CG2  . ILE A 1 54 ? -5.732  -3.851  0.975   1.00 0.05 ? 54  ILE A CG2  4  
ATOM   4870  C CD1  . ILE A 1 54 ? -5.084  -5.985  3.165   1.00 0.06 ? 54  ILE A CD1  4  
ATOM   4871  H H    . ILE A 1 54 ? -7.559  -7.435  0.052   1.00 0.05 ? 54  ILE A H    4  
ATOM   4872  H HA   . ILE A 1 54 ? -8.355  -4.736  0.889   1.00 0.05 ? 54  ILE A HA   4  
ATOM   4873  H HB   . ILE A 1 54 ? -5.602  -5.919  0.521   1.00 0.05 ? 54  ILE A HB   4  
ATOM   4874  H HG12 . ILE A 1 54 ? -6.931  -4.971  3.061   1.00 0.06 ? 54  ILE A HG12 4  
ATOM   4875  H HG13 . ILE A 1 54 ? -6.984  -6.646  2.522   1.00 0.05 ? 54  ILE A HG13 4  
ATOM   4876  H HG21 . ILE A 1 54 ? -4.841  -3.785  1.582   1.00 0.06 ? 54  ILE A HG21 4  
ATOM   4877  H HG22 . ILE A 1 54 ? -6.473  -3.160  1.344   1.00 0.05 ? 54  ILE A HG22 4  
ATOM   4878  H HG23 . ILE A 1 54 ? -5.489  -3.607  -0.049  1.00 0.06 ? 54  ILE A HG23 4  
ATOM   4879  H HD11 . ILE A 1 54 ? -5.252  -6.361  4.163   1.00 0.07 ? 54  ILE A HD11 4  
ATOM   4880  H HD12 . ILE A 1 54 ? -4.523  -5.064  3.217   1.00 0.07 ? 54  ILE A HD12 4  
ATOM   4881  H HD13 . ILE A 1 54 ? -4.527  -6.714  2.596   1.00 0.06 ? 54  ILE A HD13 4  
ATOM   4882  N N    . THR A 1 55 ? -7.446  -5.656  -2.063  1.00 0.06 ? 55  THR A N    4  
ATOM   4883  C CA   . THR A 1 55 ? -7.313  -5.242  -3.452  1.00 0.06 ? 55  THR A CA   4  
ATOM   4884  C C    . THR A 1 55 ? -8.678  -5.095  -4.116  1.00 0.07 ? 55  THR A C    4  
ATOM   4885  O O    . THR A 1 55 ? -8.895  -4.187  -4.918  1.00 0.08 ? 55  THR A O    4  
ATOM   4886  C CB   . THR A 1 55 ? -6.471  -6.247  -4.260  1.00 0.07 ? 55  THR A CB   4  
ATOM   4887  O OG1  . THR A 1 55 ? -5.117  -6.237  -3.796  1.00 0.07 ? 55  THR A OG1  4  
ATOM   4888  C CG2  . THR A 1 55 ? -6.505  -5.914  -5.745  1.00 0.08 ? 55  THR A CG2  4  
ATOM   4889  H H    . THR A 1 55 ? -7.481  -6.613  -1.851  1.00 0.06 ? 55  THR A H    4  
ATOM   4890  H HA   . THR A 1 55 ? -6.810  -4.287  -3.470  1.00 0.07 ? 55  THR A HA   4  
ATOM   4891  H HB   . THR A 1 55 ? -6.883  -7.236  -4.120  1.00 0.07 ? 55  THR A HB   4  
ATOM   4892  H HG1  . THR A 1 55 ? -4.534  -5.984  -4.515  1.00 0.08 ? 55  THR A HG1  4  
ATOM   4893  H HG21 . THR A 1 55 ? -7.527  -5.943  -6.097  1.00 0.09 ? 55  THR A HG21 4  
ATOM   4894  H HG22 . THR A 1 55 ? -5.916  -6.635  -6.291  1.00 0.09 ? 55  THR A HG22 4  
ATOM   4895  H HG23 . THR A 1 55 ? -6.100  -4.925  -5.902  1.00 0.08 ? 55  THR A HG23 4  
ATOM   4896  N N    . ALA A 1 56 ? -9.599  -5.992  -3.773  1.00 0.07 ? 56  ALA A N    4  
ATOM   4897  C CA   . ALA A 1 56 ? -10.944 -5.958  -4.331  1.00 0.08 ? 56  ALA A CA   4  
ATOM   4898  C C    . ALA A 1 56 ? -11.724 -4.754  -3.814  1.00 0.08 ? 56  ALA A C    4  
ATOM   4899  O O    . ALA A 1 56 ? -12.461 -4.112  -4.562  1.00 0.09 ? 56  ALA A O    4  
ATOM   4900  C CB   . ALA A 1 56 ? -11.683 -7.247  -4.006  1.00 0.08 ? 56  ALA A CB   4  
ATOM   4901  H H    . ALA A 1 56 ? -9.366  -6.693  -3.129  1.00 0.07 ? 56  ALA A H    4  
ATOM   4902  H HA   . ALA A 1 56 ? -10.856 -5.883  -5.406  1.00 0.09 ? 56  ALA A HA   4  
ATOM   4903  H HB1  . ALA A 1 56 ? -12.657 -7.232  -4.472  1.00 0.09 ? 56  ALA A HB1  4  
ATOM   4904  H HB2  . ALA A 1 56 ? -11.797 -7.336  -2.935  1.00 0.08 ? 56  ALA A HB2  4  
ATOM   4905  H HB3  . ALA A 1 56 ? -11.119 -8.090  -4.378  1.00 0.09 ? 56  ALA A HB3  4  
ATOM   4906  N N    . ALA A 1 57 ? -11.557 -4.454  -2.530  1.00 0.07 ? 57  ALA A N    4  
ATOM   4907  C CA   . ALA A 1 57 ? -12.244 -3.326  -1.913  1.00 0.07 ? 57  ALA A CA   4  
ATOM   4908  C C    . ALA A 1 57 ? -11.840 -2.011  -2.571  1.00 0.07 ? 57  ALA A C    4  
ATOM   4909  O O    . ALA A 1 57 ? -12.690 -1.259  -3.051  1.00 0.08 ? 57  ALA A O    4  
ATOM   4910  C CB   . ALA A 1 57 ? -11.952 -3.283  -0.421  1.00 0.06 ? 57  ALA A CB   4  
ATOM   4911  H H    . ALA A 1 57 ? -10.957 -5.004  -1.985  1.00 0.07 ? 57  ALA A H    4  
ATOM   4912  H HA   . ALA A 1 57 ? -13.306 -3.471  -2.045  1.00 0.08 ? 57  ALA A HA   4  
ATOM   4913  H HB1  . ALA A 1 57 ? -12.241 -4.221  0.029   1.00 0.07 ? 57  ALA A HB1  4  
ATOM   4914  H HB2  . ALA A 1 57 ? -12.512 -2.479  0.033   1.00 0.07 ? 57  ALA A HB2  4  
ATOM   4915  H HB3  . ALA A 1 57 ? -10.896 -3.119  -0.265  1.00 0.06 ? 57  ALA A HB3  4  
ATOM   4916  N N    . LEU A 1 58 ? -10.540 -1.739  -2.588  1.00 0.07 ? 58  LEU A N    4  
ATOM   4917  C CA   . LEU A 1 58 ? -10.024 -0.513  -3.187  1.00 0.08 ? 58  LEU A CA   4  
ATOM   4918  C C    . LEU A 1 58 ? -10.475 -0.384  -4.639  1.00 0.09 ? 58  LEU A C    4  
ATOM   4919  O O    . LEU A 1 58 ? -10.870 0.694   -5.083  1.00 0.09 ? 58  LEU A O    4  
ATOM   4920  C CB   . LEU A 1 58 ? -8.497  -0.488  -3.113  1.00 0.07 ? 58  LEU A CB   4  
ATOM   4921  C CG   . LEU A 1 58 ? -7.895  -0.266  -1.724  1.00 0.07 ? 58  LEU A CG   4  
ATOM   4922  C CD1  . LEU A 1 58 ? -6.427  -0.661  -1.708  1.00 0.07 ? 58  LEU A CD1  4  
ATOM   4923  C CD2  . LEU A 1 58 ? -8.066  1.184   -1.295  1.00 0.07 ? 58  LEU A CD2  4  
ATOM   4924  H H    . LEU A 1 58 ? -9.912  -2.377  -2.190  1.00 0.06 ? 58  LEU A H    4  
ATOM   4925  H HA   . LEU A 1 58 ? -10.417 0.322   -2.626  1.00 0.08 ? 58  LEU A HA   4  
ATOM   4926  H HB2  . LEU A 1 58 ? -8.127  -1.431  -3.490  1.00 0.07 ? 58  LEU A HB2  4  
ATOM   4927  H HB3  . LEU A 1 58 ? -8.142  0.299   -3.759  1.00 0.08 ? 58  LEU A HB3  4  
ATOM   4928  H HG   . LEU A 1 58 ? -8.415  -0.889  -1.011  1.00 0.06 ? 58  LEU A HG   4  
ATOM   4929  H HD11 . LEU A 1 58 ? -5.990  -0.385  -0.760  1.00 0.07 ? 58  LEU A HD11 4  
ATOM   4930  H HD12 . LEU A 1 58 ? -5.910  -0.150  -2.506  1.00 0.08 ? 58  LEU A HD12 4  
ATOM   4931  H HD13 . LEU A 1 58 ? -6.340  -1.729  -1.847  1.00 0.06 ? 58  LEU A HD13 4  
ATOM   4932  H HD21 . LEU A 1 58 ? -9.115  1.397   -1.151  1.00 0.07 ? 58  LEU A HD21 4  
ATOM   4933  H HD22 . LEU A 1 58 ? -7.669  1.834   -2.061  1.00 0.08 ? 58  LEU A HD22 4  
ATOM   4934  H HD23 . LEU A 1 58 ? -7.535  1.351   -0.370  1.00 0.07 ? 58  LEU A HD23 4  
ATOM   4935  N N    . SER A 1 59 ? -10.415 -1.490  -5.373  1.00 0.09 ? 59  SER A N    4  
ATOM   4936  C CA   . SER A 1 59 ? -10.816 -1.501  -6.775  1.00 0.10 ? 59  SER A CA   4  
ATOM   4937  C C    . SER A 1 59 ? -12.333 -1.408  -6.906  1.00 0.11 ? 59  SER A C    4  
ATOM   4938  O O    . SER A 1 59 ? -12.854 -1.035  -7.957  1.00 0.12 ? 59  SER A O    4  
ATOM   4939  C CB   . SER A 1 59 ? -10.308 -2.770  -7.463  1.00 0.10 ? 59  SER A CB   4  
ATOM   4940  O OG   . SER A 1 59 ? -10.933 -2.951  -8.722  1.00 0.12 ? 59  SER A OG   4  
ATOM   4941  H H    . SER A 1 59 ? -10.092 -2.319  -4.962  1.00 0.08 ? 59  SER A H    4  
ATOM   4942  H HA   . SER A 1 59 ? -10.374 -0.640  -7.253  1.00 0.11 ? 59  SER A HA   4  
ATOM   4943  H HB2  . SER A 1 59 ? -9.242  -2.695  -7.612  1.00 0.10 ? 59  SER A HB2  4  
ATOM   4944  H HB3  . SER A 1 59 ? -10.525 -3.625  -6.840  1.00 0.10 ? 59  SER A HB3  4  
ATOM   4945  H HG   . SER A 1 59 ? -10.268 -2.940  -9.414  1.00 0.12 ? 59  SER A HG   4  
ATOM   4946  N N    . GLN A 1 60 ? -13.036 -1.753  -5.832  1.00 0.10 ? 60  GLN A N    4  
ATOM   4947  C CA   . GLN A 1 60 ? -14.494 -1.710  -5.828  1.00 0.11 ? 60  GLN A CA   4  
ATOM   4948  C C    . GLN A 1 60 ? -14.995 -0.292  -5.578  1.00 0.11 ? 60  GLN A C    4  
ATOM   4949  O O    . GLN A 1 60 ? -15.941 0.164   -6.223  1.00 0.13 ? 60  GLN A O    4  
ATOM   4950  C CB   . GLN A 1 60 ? -15.049 -2.656  -4.762  1.00 0.11 ? 60  GLN A CB   4  
ATOM   4951  C CG   . GLN A 1 60 ? -16.565 -2.620  -4.646  1.00 0.12 ? 60  GLN A CG   4  
ATOM   4952  C CD   . GLN A 1 60 ? -17.076 -3.357  -3.423  1.00 0.12 ? 60  GLN A CD   4  
ATOM   4953  O OE1  . GLN A 1 60 ? -17.955 -4.212  -3.522  1.00 0.12 ? 60  GLN A OE1  4  
ATOM   4954  N NE2  . GLN A 1 60 ? -16.524 -3.030  -2.261  1.00 0.11 ? 60  GLN A NE2  4  
ATOM   4955  H H    . GLN A 1 60 ? -12.563 -2.043  -5.024  1.00 0.09 ? 60  GLN A H    4  
ATOM   4956  H HA   . GLN A 1 60 ? -14.837 -2.035  -6.797  1.00 0.12 ? 60  GLN A HA   4  
ATOM   4957  H HB2  . GLN A 1 60 ? -14.752 -3.665  -5.003  1.00 0.11 ? 60  GLN A HB2  4  
ATOM   4958  H HB3  . GLN A 1 60 ? -14.630 -2.386  -3.804  1.00 0.10 ? 60  GLN A HB3  4  
ATOM   4959  H HG2  . GLN A 1 60 ? -16.882 -1.590  -4.584  1.00 0.12 ? 60  GLN A HG2  4  
ATOM   4960  H HG3  . GLN A 1 60 ? -16.992 -3.076  -5.527  1.00 0.13 ? 60  GLN A HG3  4  
ATOM   4961  H HE21 . GLN A 1 60 ? -15.827 -2.340  -2.257  1.00 0.10 ? 60  GLN A HE21 4  
ATOM   4962  H HE22 . GLN A 1 60 ? -16.835 -3.490  -1.454  1.00 0.11 ? 60  GLN A HE22 4  
ATOM   4963  N N    . ARG A 1 61 ? -14.360 0.399   -4.638  1.00 0.11 ? 61  ARG A N    4  
ATOM   4964  C CA   . ARG A 1 61 ? -14.743 1.765   -4.303  1.00 0.11 ? 61  ARG A CA   4  
ATOM   4965  C C    . ARG A 1 61 ? -14.375 2.726   -5.428  1.00 0.12 ? 61  ARG A C    4  
ATOM   4966  O O    . ARG A 1 61 ? -15.077 3.704   -5.678  1.00 0.13 ? 61  ARG A O    4  
ATOM   4967  C CB   . ARG A 1 61 ? -14.066 2.202   -3.004  1.00 0.10 ? 61  ARG A CB   4  
ATOM   4968  C CG   . ARG A 1 61 ? -12.681 2.793   -3.206  1.00 0.10 ? 61  ARG A CG   4  
ATOM   4969  C CD   . ARG A 1 61 ? -12.028 3.152   -1.881  1.00 0.09 ? 61  ARG A CD   4  
ATOM   4970  N NE   . ARG A 1 61 ? -11.641 4.560   -1.826  1.00 0.10 ? 61  ARG A NE   4  
ATOM   4971  C CZ   . ARG A 1 61 ? -11.226 5.165   -0.718  1.00 0.09 ? 61  ARG A CZ   4  
ATOM   4972  N NH1  . ARG A 1 61 ? -11.144 4.489   0.420   1.00 0.09 ? 61  ARG A NH1  4  
ATOM   4973  N NH2  . ARG A 1 61 ? -10.891 6.448   -0.747  1.00 0.10 ? 61  ARG A NH2  4  
ATOM   4974  H H    . ARG A 1 61 ? -13.615 -0.021  -4.158  1.00 0.10 ? 61  ARG A H    4  
ATOM   4975  H HA   . ARG A 1 61 ? -15.814 1.784   -4.165  1.00 0.12 ? 61  ARG A HA   4  
ATOM   4976  H HB2  . ARG A 1 61 ? -14.684 2.946   -2.522  1.00 0.10 ? 61  ARG A HB2  4  
ATOM   4977  H HB3  . ARG A 1 61 ? -13.976 1.345   -2.352  1.00 0.09 ? 61  ARG A HB3  4  
ATOM   4978  H HG2  . ARG A 1 61 ? -12.062 2.068   -3.715  1.00 0.09 ? 61  ARG A HG2  4  
ATOM   4979  H HG3  . ARG A 1 61 ? -12.765 3.684   -3.810  1.00 0.10 ? 61  ARG A HG3  4  
ATOM   4980  H HD2  . ARG A 1 61 ? -12.727 2.950   -1.083  1.00 0.09 ? 61  ARG A HD2  4  
ATOM   4981  H HD3  . ARG A 1 61 ? -11.147 2.541   -1.750  1.00 0.08 ? 61  ARG A HD3  4  
ATOM   4982  H HE   . ARG A 1 61 ? -11.692 5.079   -2.655  1.00 0.10 ? 61  ARG A HE   4  
ATOM   4983  H HH11 . ARG A 1 61 ? -10.832 4.946   1.252   1.00 0.09 ? 61  ARG A HH11 4  
ATOM   4984  H HH12 . ARG A 1 61 ? -11.396 3.521   0.446   1.00 0.08 ? 61  ARG A HH12 4  
ATOM   4985  H HH21 . ARG A 1 61 ? -10.952 6.960   -1.602  1.00 0.11 ? 61  ARG A HH21 4  
ATOM   4986  H HH22 . ARG A 1 61 ? -10.577 6.903   0.087   1.00 0.10 ? 61  ARG A HH22 4  
ATOM   4987  N N    . ALA A 1 62 ? -13.268 2.439   -6.107  1.00 0.12 ? 62  ALA A N    4  
ATOM   4988  C CA   . ALA A 1 62 ? -12.806 3.276   -7.207  1.00 0.13 ? 62  ALA A CA   4  
ATOM   4989  C C    . ALA A 1 62 ? -13.714 3.133   -8.422  1.00 0.14 ? 62  ALA A C    4  
ATOM   4990  O O    . ALA A 1 62 ? -14.089 4.123   -9.050  1.00 0.15 ? 62  ALA A O    4  
ATOM   4991  C CB   . ALA A 1 62 ? -11.373 2.924   -7.572  1.00 0.12 ? 62  ALA A CB   4  
ATOM   4992  H H    . ALA A 1 62 ? -12.749 1.645   -5.860  1.00 0.11 ? 62  ALA A H    4  
ATOM   4993  H HA   . ALA A 1 62 ? -12.826 4.305   -6.875  1.00 0.13 ? 62  ALA A HA   4  
ATOM   4994  H HB1  . ALA A 1 62 ? -11.328 1.899   -7.908  1.00 0.12 ? 62  ALA A HB1  4  
ATOM   4995  H HB2  . ALA A 1 62 ? -10.739 3.049   -6.706  1.00 0.11 ? 62  ALA A HB2  4  
ATOM   4996  H HB3  . ALA A 1 62 ? -11.032 3.577   -8.363  1.00 0.13 ? 62  ALA A HB3  4  
ATOM   4997  N N    . MET A 1 63 ? -14.064 1.894   -8.752  1.00 0.14 ? 63  MET A N    4  
ATOM   4998  C CA   . MET A 1 63 ? -14.929 1.621   -9.894  1.00 0.15 ? 63  MET A CA   4  
ATOM   4999  C C    . MET A 1 63 ? -16.347 2.119   -9.633  1.00 0.16 ? 63  MET A C    4  
ATOM   5000  O O    . MET A 1 63 ? -17.042 2.553   -10.552 1.00 0.17 ? 63  MET A O    4  
ATOM   5001  C CB   . MET A 1 63 ? -14.950 0.123   -10.199 1.00 0.15 ? 63  MET A CB   4  
ATOM   5002  C CG   . MET A 1 63 ? -15.726 -0.694  -9.180  1.00 0.15 ? 63  MET A CG   4  
ATOM   5003  S SD   . MET A 1 63 ? -15.895 -2.425  -9.659  1.00 0.15 ? 63  MET A SD   4  
ATOM   5004  C CE   . MET A 1 63 ? -14.177 -2.934  -9.692  1.00 0.14 ? 63  MET A CE   4  
ATOM   5005  H H    . MET A 1 63 ? -13.734 1.144   -8.214  1.00 0.13 ? 63  MET A H    4  
ATOM   5006  H HA   . MET A 1 63 ? -14.527 2.147   -10.747 1.00 0.16 ? 63  MET A HA   4  
ATOM   5007  H HB2  . MET A 1 63 ? -15.401 -0.029  -11.168 1.00 0.16 ? 63  MET A HB2  4  
ATOM   5008  H HB3  . MET A 1 63 ? -13.935 -0.241  -10.223 1.00 0.15 ? 63  MET A HB3  4  
ATOM   5009  H HG2  . MET A 1 63 ? -15.211 -0.646  -8.233  1.00 0.14 ? 63  MET A HG2  4  
ATOM   5010  H HG3  . MET A 1 63 ? -16.712 -0.268  -9.075  1.00 0.15 ? 63  MET A HG3  4  
ATOM   5011  H HE1  . MET A 1 63 ? -13.664 -2.416  -10.489 1.00 0.15 ? 63  MET A HE1  4  
ATOM   5012  H HE2  . MET A 1 63 ? -14.120 -3.999  -9.859  1.00 0.14 ? 63  MET A HE2  4  
ATOM   5013  H HE3  . MET A 1 63 ? -13.712 -2.692  -8.748  1.00 0.13 ? 63  MET A HE3  4  
ATOM   5014  N N    . ILE A 1 64 ? -16.769 2.054   -8.374  1.00 0.15 ? 64  ILE A N    4  
ATOM   5015  C CA   . ILE A 1 64 ? -18.105 2.499   -7.994  1.00 0.16 ? 64  ILE A CA   4  
ATOM   5016  C C    . ILE A 1 64 ? -18.125 3.995   -7.706  1.00 0.16 ? 64  ILE A C    4  
ATOM   5017  O O    . ILE A 1 64 ? -18.620 4.788   -8.508  1.00 0.17 ? 64  ILE A O    4  
ATOM   5018  C CB   . ILE A 1 64 ? -18.617 1.744   -6.754  1.00 0.15 ? 64  ILE A CB   4  
ATOM   5019  C CG1  . ILE A 1 64 ? -18.774 0.254   -7.066  1.00 0.15 ? 64  ILE A CG1  4  
ATOM   5020  C CG2  . ILE A 1 64 ? -19.938 2.331   -6.283  1.00 0.16 ? 64  ILE A CG2  4  
ATOM   5021  C CD1  . ILE A 1 64 ? -19.173 -0.577  -5.868  1.00 0.15 ? 64  ILE A CD1  4  
ATOM   5022  H H    . ILE A 1 64 ? -16.169 1.699   -7.686  1.00 0.14 ? 64  ILE A H    4  
ATOM   5023  H HA   . ILE A 1 64 ? -18.772 2.292   -8.817  1.00 0.17 ? 64  ILE A HA   4  
ATOM   5024  H HB   . ILE A 1 64 ? -17.894 1.863   -5.960  1.00 0.14 ? 64  ILE A HB   4  
ATOM   5025  H HG12 . ILE A 1 64 ? -19.534 0.129   -7.823  1.00 0.16 ? 64  ILE A HG12 4  
ATOM   5026  H HG13 . ILE A 1 64 ? -17.836 -0.129  -7.438  1.00 0.15 ? 64  ILE A HG13 4  
ATOM   5027  H HG21 . ILE A 1 64 ? -20.273 1.805   -5.401  1.00 0.15 ? 64  ILE A HG21 4  
ATOM   5028  H HG22 . ILE A 1 64 ? -20.676 2.229   -7.065  1.00 0.17 ? 64  ILE A HG22 4  
ATOM   5029  H HG23 . ILE A 1 64 ? -19.804 3.377   -6.050  1.00 0.16 ? 64  ILE A HG23 4  
ATOM   5030  H HD11 . ILE A 1 64 ? -20.186 -0.335  -5.582  1.00 0.15 ? 64  ILE A HD11 4  
ATOM   5031  H HD12 . ILE A 1 64 ? -18.507 -0.364  -5.045  1.00 0.14 ? 64  ILE A HD12 4  
ATOM   5032  H HD13 . ILE A 1 64 ? -19.110 -1.627  -6.119  1.00 0.15 ? 64  ILE A HD13 4  
ATOM   5033  N N    . LEU A 1 65 ? -17.580 4.378   -6.556  1.00 0.15 ? 65  LEU A N    4  
ATOM   5034  C CA   . LEU A 1 65 ? -17.532 5.783   -6.160  1.00 0.15 ? 65  LEU A CA   4  
ATOM   5035  C C    . LEU A 1 65 ? -16.936 6.641   -7.272  1.00 0.16 ? 65  LEU A C    4  
ATOM   5036  O O    . LEU A 1 65 ? -17.385 7.760   -7.516  1.00 0.16 ? 65  LEU A O    4  
ATOM   5037  C CB   . LEU A 1 65 ? -16.712 5.944   -4.880  1.00 0.14 ? 65  LEU A CB   4  
ATOM   5038  C CG   . LEU A 1 65 ? -17.328 6.834   -3.797  1.00 0.14 ? 65  LEU A CG   4  
ATOM   5039  C CD1  . LEU A 1 65 ? -18.227 6.017   -2.884  1.00 0.14 ? 65  LEU A CD1  4  
ATOM   5040  C CD2  . LEU A 1 65 ? -16.236 7.527   -2.995  1.00 0.13 ? 65  LEU A CD2  4  
ATOM   5041  H H    . LEU A 1 65 ? -17.199 3.701   -5.959  1.00 0.14 ? 65  LEU A H    4  
ATOM   5042  H HA   . LEU A 1 65 ? -18.544 6.109   -5.974  1.00 0.16 ? 65  LEU A HA   4  
ATOM   5043  H HB2  . LEU A 1 65 ? -16.555 4.962   -4.457  1.00 0.13 ? 65  LEU A HB2  4  
ATOM   5044  H HB3  . LEU A 1 65 ? -15.751 6.357   -5.146  1.00 0.14 ? 65  LEU A HB3  4  
ATOM   5045  H HG   . LEU A 1 65 ? -17.933 7.596   -4.268  1.00 0.15 ? 65  LEU A HG   4  
ATOM   5046  H HD11 . LEU A 1 65 ? -17.639 5.264   -2.380  1.00 0.13 ? 65  LEU A HD11 4  
ATOM   5047  H HD12 . LEU A 1 65 ? -18.997 5.539   -3.471  1.00 0.14 ? 65  LEU A HD12 4  
ATOM   5048  H HD13 . LEU A 1 65 ? -18.684 6.667   -2.153  1.00 0.14 ? 65  LEU A HD13 4  
ATOM   5049  H HD21 . LEU A 1 65 ? -15.711 8.226   -3.629  1.00 0.14 ? 65  LEU A HD21 4  
ATOM   5050  H HD22 . LEU A 1 65 ? -15.542 6.790   -2.620  1.00 0.13 ? 65  LEU A HD22 4  
ATOM   5051  H HD23 . LEU A 1 65 ? -16.681 8.058   -2.166  1.00 0.14 ? 65  LEU A HD23 4  
ATOM   5052  N N    . GLY A 1 66 ? -15.923 6.105   -7.947  1.00 0.15 ? 66  GLY A N    4  
ATOM   5053  C CA   . GLY A 1 66 ? -15.282 6.836   -9.026  1.00 0.16 ? 66  GLY A CA   4  
ATOM   5054  C C    . GLY A 1 66 ? -14.062 7.604   -8.562  1.00 0.16 ? 66  GLY A C    4  
ATOM   5055  O O    . GLY A 1 66 ? -13.864 8.759   -8.941  1.00 0.16 ? 66  GLY A O    4  
ATOM   5056  H H    . GLY A 1 66 ? -15.608 5.207   -7.711  1.00 0.15 ? 66  GLY A H    4  
ATOM   5057  H HA2  . GLY A 1 66 ? -14.984 6.136   -9.792  1.00 0.16 ? 66  GLY A HA2  4  
ATOM   5058  H HA3  . GLY A 1 66 ? -15.994 7.532   -9.445  1.00 0.17 ? 66  GLY A HA3  4  
ATOM   5059  N N    . LYS A 1 67 ? -13.239 6.963   -7.737  1.00 0.15 ? 67  LYS A N    4  
ATOM   5060  C CA   . LYS A 1 67 ? -12.031 7.594   -7.220  1.00 0.14 ? 67  LYS A CA   4  
ATOM   5061  C C    . LYS A 1 67 ? -11.058 6.548   -6.685  1.00 0.13 ? 67  LYS A C    4  
ATOM   5062  O O    . LYS A 1 67 ? -11.402 5.758   -5.805  1.00 0.12 ? 67  LYS A O    4  
ATOM   5063  C CB   . LYS A 1 67 ? -12.384 8.590   -6.113  1.00 0.14 ? 67  LYS A CB   4  
ATOM   5064  C CG   . LYS A 1 67 ? -13.071 7.952   -4.918  1.00 0.13 ? 67  LYS A CG   4  
ATOM   5065  C CD   . LYS A 1 67 ? -12.106 7.757   -3.760  1.00 0.12 ? 67  LYS A CD   4  
ATOM   5066  C CE   . LYS A 1 67 ? -12.163 8.920   -2.783  1.00 0.13 ? 67  LYS A CE   4  
ATOM   5067  N NZ   . LYS A 1 67 ? -12.010 10.232  -3.475  1.00 0.14 ? 67  LYS A NZ   4  
ATOM   5068  H H    . LYS A 1 67 ? -13.450 6.043   -7.472  1.00 0.14 ? 67  LYS A H    4  
ATOM   5069  H HA   . LYS A 1 67 ? -11.559 8.124   -8.034  1.00 0.15 ? 67  LYS A HA   4  
ATOM   5070  H HB2  . LYS A 1 67 ? -11.478 9.066   -5.770  1.00 0.14 ? 67  LYS A HB2  4  
ATOM   5071  H HB3  . LYS A 1 67 ? -13.043 9.344   -6.520  1.00 0.15 ? 67  LYS A HB3  4  
ATOM   5072  H HG2  . LYS A 1 67 ? -13.878 8.592   -4.596  1.00 0.14 ? 67  LYS A HG2  4  
ATOM   5073  H HG3  . LYS A 1 67 ? -13.466 6.991   -5.213  1.00 0.13 ? 67  LYS A HG3  4  
ATOM   5074  H HD2  . LYS A 1 67 ? -12.367 6.848   -3.237  1.00 0.12 ? 67  LYS A HD2  4  
ATOM   5075  H HD3  . LYS A 1 67 ? -11.102 7.674   -4.151  1.00 0.12 ? 67  LYS A HD3  4  
ATOM   5076  H HE2  . LYS A 1 67 ? -13.115 8.901   -2.274  1.00 0.13 ? 67  LYS A HE2  4  
ATOM   5077  H HE3  . LYS A 1 67 ? -11.367 8.808   -2.061  1.00 0.12 ? 67  LYS A HE3  4  
ATOM   5078  H HZ1  . LYS A 1 67 ? -12.768 10.356  -4.177  1.00 0.14 ? 67  LYS A HZ1  4  
ATOM   5079  H HZ2  . LYS A 1 67 ? -11.093 10.274  -3.961  1.00 0.14 ? 67  LYS A HZ2  4  
ATOM   5080  H HZ3  . LYS A 1 67 ? -12.061 11.008  -2.784  1.00 0.14 ? 67  LYS A HZ3  4  
ATOM   5081  N N    . SER A 1 68 ? -9.842  6.549   -7.222  1.00 0.13 ? 68  SER A N    4  
ATOM   5082  C CA   . SER A 1 68 ? -8.821  5.597   -6.800  1.00 0.13 ? 68  SER A CA   4  
ATOM   5083  C C    . SER A 1 68 ? -7.684  6.308   -6.073  1.00 0.13 ? 68  SER A C    4  
ATOM   5084  O O    . SER A 1 68 ? -6.509  6.000   -6.278  1.00 0.13 ? 68  SER A O    4  
ATOM   5085  C CB   . SER A 1 68 ? -8.272  4.836   -8.009  1.00 0.13 ? 68  SER A CB   4  
ATOM   5086  O OG   . SER A 1 68 ? -8.144  5.689   -9.133  1.00 0.14 ? 68  SER A OG   4  
ATOM   5087  H H    . SER A 1 68 ? -9.627  7.202   -7.919  1.00 0.14 ? 68  SER A H    4  
ATOM   5088  H HA   . SER A 1 68 ? -9.282  4.894   -6.122  1.00 0.12 ? 68  SER A HA   4  
ATOM   5089  H HB2  . SER A 1 68 ? -7.298  4.437   -7.766  1.00 0.13 ? 68  SER A HB2  4  
ATOM   5090  H HB3  . SER A 1 68 ? -8.942  4.028   -8.258  1.00 0.13 ? 68  SER A HB3  4  
ATOM   5091  H HG   . SER A 1 68 ? -8.379  5.206   -9.929  1.00 0.15 ? 68  SER A HG   4  
ATOM   5092  N N    . GLY A 1 69 ? -8.040  7.264   -5.220  1.00 0.13 ? 69  GLY A N    4  
ATOM   5093  C CA   . GLY A 1 69 ? -7.039  8.005   -4.474  1.00 0.13 ? 69  GLY A CA   4  
ATOM   5094  C C    . GLY A 1 69 ? -6.172  7.107   -3.618  1.00 0.12 ? 69  GLY A C    4  
ATOM   5095  O O    . GLY A 1 69 ? -5.049  7.467   -3.268  1.00 0.13 ? 69  GLY A O    4  
ATOM   5096  H H    . GLY A 1 69 ? -8.990  7.466   -5.096  1.00 0.13 ? 69  GLY A H    4  
ATOM   5097  H HA2  . GLY A 1 69 ? -6.408  8.538   -5.171  1.00 0.14 ? 69  GLY A HA2  4  
ATOM   5098  H HA3  . GLY A 1 69 ? -7.538  8.721   -3.837  1.00 0.13 ? 69  GLY A HA3  4  
ATOM   5099  N N    . GLU A 1 70 ? -6.694  5.932   -3.275  1.00 0.11 ? 70  GLU A N    4  
ATOM   5100  C CA   . GLU A 1 70 ? -5.959  4.981   -2.449  1.00 0.10 ? 70  GLU A CA   4  
ATOM   5101  C C    . GLU A 1 70 ? -5.476  3.799   -3.284  1.00 0.10 ? 70  GLU A C    4  
ATOM   5102  O O    . GLU A 1 70 ? -4.491  3.142   -2.940  1.00 0.10 ? 70  GLU A O    4  
ATOM   5103  C CB   . GLU A 1 70 ? -6.838  4.483   -1.299  1.00 0.09 ? 70  GLU A CB   4  
ATOM   5104  C CG   . GLU A 1 70 ? -6.590  5.206   0.012   1.00 0.10 ? 70  GLU A CG   4  
ATOM   5105  C CD   . GLU A 1 70 ? -7.306  6.539   0.092   1.00 0.10 ? 70  GLU A CD   4  
ATOM   5106  O OE1  . GLU A 1 70 ? -7.339  7.132   1.189   1.00 0.11 ? 70  GLU A OE1  4  
ATOM   5107  O OE2  . GLU A 1 70 ? -7.833  6.992   -0.946  1.00 0.11 ? 70  GLU A OE2  4  
ATOM   5108  H H    . GLU A 1 70 ? -7.595  5.703   -3.582  1.00 0.11 ? 70  GLU A H    4  
ATOM   5109  H HA   . GLU A 1 70 ? -5.101  5.492   -2.040  1.00 0.11 ? 70  GLU A HA   4  
ATOM   5110  H HB2  . GLU A 1 70 ? -7.876  4.619   -1.570  1.00 0.09 ? 70  GLU A HB2  4  
ATOM   5111  H HB3  . GLU A 1 70 ? -6.650  3.432   -1.147  1.00 0.09 ? 70  GLU A HB3  4  
ATOM   5112  H HG2  . GLU A 1 70 ? -6.934  4.582   0.824   1.00 0.09 ? 70  GLU A HG2  4  
ATOM   5113  H HG3  . GLU A 1 70 ? -5.529  5.377   0.117   1.00 0.10 ? 70  GLU A HG3  4  
ATOM   5114  N N    . LEU A 1 71 ? -6.177  3.530   -4.380  1.00 0.10 ? 71  LEU A N    4  
ATOM   5115  C CA   . LEU A 1 71 ? -5.819  2.426   -5.264  1.00 0.10 ? 71  LEU A CA   4  
ATOM   5116  C C    . LEU A 1 71 ? -4.442  2.645   -5.882  1.00 0.11 ? 71  LEU A C    4  
ATOM   5117  O O    . LEU A 1 71 ? -3.594  1.754   -5.867  1.00 0.11 ? 71  LEU A O    4  
ATOM   5118  C CB   . LEU A 1 71 ? -6.867  2.270   -6.368  1.00 0.11 ? 71  LEU A CB   4  
ATOM   5119  C CG   . LEU A 1 71 ? -7.408  0.856   -6.587  1.00 0.10 ? 71  LEU A CG   4  
ATOM   5120  C CD1  . LEU A 1 71 ? -8.296  0.810   -7.820  1.00 0.11 ? 71  LEU A CD1  4  
ATOM   5121  C CD2  . LEU A 1 71 ? -6.261  -0.137  -6.715  1.00 0.10 ? 71  LEU A CD2  4  
ATOM   5122  H H    . LEU A 1 71 ? -6.951  4.087   -4.600  1.00 0.11 ? 71  LEU A H    4  
ATOM   5123  H HA   . LEU A 1 71 ? -5.795  1.524   -4.672  1.00 0.10 ? 71  LEU A HA   4  
ATOM   5124  H HB2  . LEU A 1 71 ? -7.700  2.914   -6.131  1.00 0.11 ? 71  LEU A HB2  4  
ATOM   5125  H HB3  . LEU A 1 71 ? -6.429  2.608   -7.294  1.00 0.12 ? 71  LEU A HB3  4  
ATOM   5126  H HG   . LEU A 1 71 ? -8.005  0.569   -5.736  1.00 0.10 ? 71  LEU A HG   4  
ATOM   5127  H HD11 . LEU A 1 71 ? -9.200  1.370   -7.634  1.00 0.11 ? 71  LEU A HD11 4  
ATOM   5128  H HD12 . LEU A 1 71 ? -8.547  -0.216  -8.045  1.00 0.11 ? 71  LEU A HD12 4  
ATOM   5129  H HD13 . LEU A 1 71 ? -7.771  1.244   -8.659  1.00 0.12 ? 71  LEU A HD13 4  
ATOM   5130  H HD21 . LEU A 1 71 ? -5.594  0.183   -7.502  1.00 0.11 ? 71  LEU A HD21 4  
ATOM   5131  H HD22 . LEU A 1 71 ? -6.656  -1.113  -6.954  1.00 0.10 ? 71  LEU A HD22 4  
ATOM   5132  H HD23 . LEU A 1 71 ? -5.721  -0.187  -5.782  1.00 0.10 ? 71  LEU A HD23 4  
ATOM   5133  N N    . LYS A 1 72 ? -4.226  3.839   -6.422  1.00 0.12 ? 72  LYS A N    4  
ATOM   5134  C CA   . LYS A 1 72 ? -2.952  4.180   -7.043  1.00 0.13 ? 72  LYS A CA   4  
ATOM   5135  C C    . LYS A 1 72 ? -1.791  3.878   -6.101  1.00 0.13 ? 72  LYS A C    4  
ATOM   5136  O O    . LYS A 1 72 ? -0.685  3.560   -6.542  1.00 0.14 ? 72  LYS A O    4  
ATOM   5137  C CB   . LYS A 1 72 ? -2.931  5.657   -7.437  1.00 0.14 ? 72  LYS A CB   4  
ATOM   5138  C CG   . LYS A 1 72 ? -3.761  5.970   -8.672  1.00 0.15 ? 72  LYS A CG   4  
ATOM   5139  C CD   . LYS A 1 72 ? -2.887  6.413   -9.833  1.00 0.16 ? 72  LYS A CD   4  
ATOM   5140  C CE   . LYS A 1 72 ? -2.272  7.781   -9.578  1.00 0.17 ? 72  LYS A CE   4  
ATOM   5141  N NZ   . LYS A 1 72 ? -2.544  8.729   -10.692 1.00 0.18 ? 72  LYS A NZ   4  
ATOM   5142  H H    . LYS A 1 72 ? -4.942  4.508   -6.402  1.00 0.12 ? 72  LYS A H    4  
ATOM   5143  H HA   . LYS A 1 72 ? -2.844  3.577   -7.932  1.00 0.14 ? 72  LYS A HA   4  
ATOM   5144  H HB2  . LYS A 1 72 ? -3.315  6.242   -6.614  1.00 0.14 ? 72  LYS A HB2  4  
ATOM   5145  H HB3  . LYS A 1 72 ? -1.910  5.952   -7.631  1.00 0.15 ? 72  LYS A HB3  4  
ATOM   5146  H HG2  . LYS A 1 72 ? -4.305  5.084   -8.962  1.00 0.15 ? 72  LYS A HG2  4  
ATOM   5147  H HG3  . LYS A 1 72 ? -4.458  6.761   -8.435  1.00 0.15 ? 72  LYS A HG3  4  
ATOM   5148  H HD2  . LYS A 1 72 ? -2.094  5.693   -9.971  1.00 0.17 ? 72  LYS A HD2  4  
ATOM   5149  H HD3  . LYS A 1 72 ? -3.491  6.461   -10.728 1.00 0.17 ? 72  LYS A HD3  4  
ATOM   5150  H HE2  . LYS A 1 72 ? -2.686  8.183   -8.666  1.00 0.17 ? 72  LYS A HE2  4  
ATOM   5151  H HE3  . LYS A 1 72 ? -1.203  7.666   -9.466  1.00 0.18 ? 72  LYS A HE3  4  
ATOM   5152  H HZ1  . LYS A 1 72 ? -3.569  8.858   -10.809 1.00 0.18 ? 72  LYS A HZ1  4  
ATOM   5153  H HZ2  . LYS A 1 72 ? -2.147  8.360   -11.580 1.00 0.19 ? 72  LYS A HZ2  4  
ATOM   5154  H HZ3  . LYS A 1 72 ? -2.110  9.652   -10.489 1.00 0.19 ? 72  LYS A HZ3  4  
ATOM   5155  N N    . THR A 1 73 ? -2.047  3.979   -4.801  1.00 0.13 ? 73  THR A N    4  
ATOM   5156  C CA   . THR A 1 73 ? -1.024  3.717   -3.797  1.00 0.13 ? 73  THR A CA   4  
ATOM   5157  C C    . THR A 1 73 ? -0.897  2.224   -3.518  1.00 0.12 ? 73  THR A C    4  
ATOM   5158  O O    . THR A 1 73 ? 0.208   1.692   -3.427  1.00 0.12 ? 73  THR A O    4  
ATOM   5159  C CB   . THR A 1 73 ? -1.330  4.451   -2.477  1.00 0.12 ? 73  THR A CB   4  
ATOM   5160  O OG1  . THR A 1 73 ? -1.895  5.738   -2.752  1.00 0.13 ? 73  THR A OG1  4  
ATOM   5161  C CG2  . THR A 1 73 ? -0.070  4.611   -1.642  1.00 0.13 ? 73  THR A CG2  4  
ATOM   5162  H H    . THR A 1 73 ? -2.946  4.238   -4.510  1.00 0.12 ? 73  THR A H    4  
ATOM   5163  H HA   . THR A 1 73 ? -0.081  4.083   -4.178  1.00 0.14 ? 73  THR A HA   4  
ATOM   5164  H HB   . THR A 1 73 ? -2.045  3.866   -1.915  1.00 0.12 ? 73  THR A HB   4  
ATOM   5165  H HG1  . THR A 1 73 ? -1.275  6.254   -3.275  1.00 0.15 ? 73  THR A HG1  4  
ATOM   5166  H HG21 . THR A 1 73 ? 0.686   5.118   -2.225  1.00 0.14 ? 73  THR A HG21 4  
ATOM   5167  H HG22 . THR A 1 73 ? 0.295   3.637   -1.349  1.00 0.13 ? 73  THR A HG22 4  
ATOM   5168  H HG23 . THR A 1 73 ? -0.294  5.192   -0.761  1.00 0.13 ? 73  THR A HG23 4  
ATOM   5169  N N    . TRP A 1 74 ? -2.035  1.554   -3.384  1.00 0.11 ? 74  TRP A N    4  
ATOM   5170  C CA   . TRP A 1 74 ? -2.052  0.120   -3.116  1.00 0.10 ? 74  TRP A CA   4  
ATOM   5171  C C    . TRP A 1 74 ? -1.358  -0.651  -4.234  1.00 0.11 ? 74  TRP A C    4  
ATOM   5172  O O    . TRP A 1 74 ? -0.460  -1.453  -3.982  1.00 0.11 ? 74  TRP A O    4  
ATOM   5173  C CB   . TRP A 1 74 ? -3.490  -0.374  -2.955  1.00 0.09 ? 74  TRP A CB   4  
ATOM   5174  C CG   . TRP A 1 74 ? -3.582  -1.821  -2.578  1.00 0.08 ? 74  TRP A CG   4  
ATOM   5175  C CD1  . TRP A 1 74 ? -4.328  -2.784  -3.198  1.00 0.08 ? 74  TRP A CD1  4  
ATOM   5176  C CD2  . TRP A 1 74 ? -2.908  -2.469  -1.495  1.00 0.08 ? 74  TRP A CD2  4  
ATOM   5177  N NE1  . TRP A 1 74 ? -4.156  -3.991  -2.565  1.00 0.07 ? 74  TRP A NE1  4  
ATOM   5178  C CE2  . TRP A 1 74 ? -3.290  -3.826  -1.516  1.00 0.07 ? 74  TRP A CE2  4  
ATOM   5179  C CE3  . TRP A 1 74 ? -2.018  -2.038  -0.507  1.00 0.08 ? 74  TRP A CE3  4  
ATOM   5180  C CZ2  . TRP A 1 74 ? -2.813  -4.749  -0.591  1.00 0.07 ? 74  TRP A CZ2  4  
ATOM   5181  C CZ3  . TRP A 1 74 ? -1.545  -2.955  0.412   1.00 0.08 ? 74  TRP A CZ3  4  
ATOM   5182  C CH2  . TRP A 1 74 ? -1.942  -4.297  0.363   1.00 0.08 ? 74  TRP A CH2  4  
ATOM   5183  H H    . TRP A 1 74 ? -2.886  2.034   -3.466  1.00 0.10 ? 74  TRP A H    4  
ATOM   5184  H HA   . TRP A 1 74 ? -1.517  -0.049  -2.195  1.00 0.10 ? 74  TRP A HA   4  
ATOM   5185  H HB2  . TRP A 1 74 ? -3.975  0.204   -2.183  1.00 0.08 ? 74  TRP A HB2  4  
ATOM   5186  H HB3  . TRP A 1 74 ? -4.017  -0.236  -3.887  1.00 0.09 ? 74  TRP A HB3  4  
ATOM   5187  H HD1  . TRP A 1 74 ? -4.955  -2.607  -4.058  1.00 0.08 ? 74  TRP A HD1  4  
ATOM   5188  H HE1  . TRP A 1 74 ? -4.586  -4.835  -2.823  1.00 0.07 ? 74  TRP A HE1  4  
ATOM   5189  H HE3  . TRP A 1 74 ? -1.700  -1.007  -0.453  1.00 0.09 ? 74  TRP A HE3  4  
ATOM   5190  H HZ2  . TRP A 1 74 ? -3.109  -5.787  -0.614  1.00 0.07 ? 74  TRP A HZ2  4  
ATOM   5191  H HZ3  . TRP A 1 74 ? -0.857  -2.639  1.180   1.00 0.09 ? 74  TRP A HZ3  4  
ATOM   5192  H HH2  . TRP A 1 74 ? -1.547  -4.978  1.102   1.00 0.08 ? 74  TRP A HH2  4  
ATOM   5193  N N    . GLY A 1 75 ? -1.780  -0.401  -5.469  1.00 0.11 ? 75  GLY A N    4  
ATOM   5194  C CA   . GLY A 1 75 ? -1.188  -1.081  -6.607  1.00 0.12 ? 75  GLY A CA   4  
ATOM   5195  C C    . GLY A 1 75 ? 0.324   -0.986  -6.616  1.00 0.13 ? 75  GLY A C    4  
ATOM   5196  O O    . GLY A 1 75 ? 1.012   -1.965  -6.904  1.00 0.13 ? 75  GLY A O    4  
ATOM   5197  H H    . GLY A 1 75 ? -2.500  0.251   -5.609  1.00 0.11 ? 75  GLY A H    4  
ATOM   5198  H HA2  . GLY A 1 75 ? -1.474  -2.122  -6.579  1.00 0.11 ? 75  GLY A HA2  4  
ATOM   5199  H HA3  . GLY A 1 75 ? -1.572  -0.638  -7.515  1.00 0.12 ? 75  GLY A HA3  4  
ATOM   5200  N N    . LEU A 1 76 ? 0.843   0.196   -6.300  1.00 0.13 ? 76  LEU A N    4  
ATOM   5201  C CA   . LEU A 1 76 ? 2.286   0.414   -6.275  1.00 0.14 ? 76  LEU A CA   4  
ATOM   5202  C C    . LEU A 1 76 ? 2.930   -0.346  -5.120  1.00 0.14 ? 76  LEU A C    4  
ATOM   5203  O O    . LEU A 1 76 ? 3.835   -1.155  -5.324  1.00 0.15 ? 76  LEU A O    4  
ATOM   5204  C CB   . LEU A 1 76 ? 2.591   1.908   -6.152  1.00 0.15 ? 76  LEU A CB   4  
ATOM   5205  C CG   . LEU A 1 76 ? 2.820   2.657   -7.464  1.00 0.16 ? 76  LEU A CG   4  
ATOM   5206  C CD1  . LEU A 1 76 ? 2.355   4.100   -7.344  1.00 0.17 ? 76  LEU A CD1  4  
ATOM   5207  C CD2  . LEU A 1 76 ? 4.288   2.598   -7.862  1.00 0.18 ? 76  LEU A CD2  4  
ATOM   5208  H H    . LEU A 1 76 ? 0.243   0.938   -6.078  1.00 0.13 ? 76  LEU A H    4  
ATOM   5209  H HA   . LEU A 1 76 ? 2.693   0.047   -7.205  1.00 0.15 ? 76  LEU A HA   4  
ATOM   5210  H HB2  . LEU A 1 76 ? 1.766   2.378   -5.636  1.00 0.15 ? 76  LEU A HB2  4  
ATOM   5211  H HB3  . LEU A 1 76 ? 3.478   2.018   -5.544  1.00 0.16 ? 76  LEU A HB3  4  
ATOM   5212  H HG   . LEU A 1 76 ? 2.241   2.185   -8.246  1.00 0.16 ? 76  LEU A HG   4  
ATOM   5213  H HD11 . LEU A 1 76 ? 1.296   4.122   -7.134  1.00 0.16 ? 76  LEU A HD11 4  
ATOM   5214  H HD12 . LEU A 1 76 ? 2.548   4.620   -8.271  1.00 0.18 ? 76  LEU A HD12 4  
ATOM   5215  H HD13 . LEU A 1 76 ? 2.891   4.586   -6.542  1.00 0.17 ? 76  LEU A HD13 4  
ATOM   5216  H HD21 . LEU A 1 76 ? 4.831   3.379   -7.352  1.00 0.17 ? 76  LEU A HD21 4  
ATOM   5217  H HD22 . LEU A 1 76 ? 4.377   2.736   -8.930  1.00 0.22 ? 76  LEU A HD22 4  
ATOM   5218  H HD23 . LEU A 1 76 ? 4.697   1.637   -7.588  1.00 0.25 ? 76  LEU A HD23 4  
ATOM   5219  N N    . VAL A 1 77 ? 2.458   -0.082  -3.906  1.00 0.14 ? 77  VAL A N    4  
ATOM   5220  C CA   . VAL A 1 77 ? 2.986   -0.743  -2.718  1.00 0.13 ? 77  VAL A CA   4  
ATOM   5221  C C    . VAL A 1 77 ? 2.888   -2.259  -2.844  1.00 0.13 ? 77  VAL A C    4  
ATOM   5222  O O    . VAL A 1 77 ? 3.637   -2.996  -2.204  1.00 0.13 ? 77  VAL A O    4  
ATOM   5223  C CB   . VAL A 1 77 ? 2.241   -0.293  -1.449  1.00 0.13 ? 77  VAL A CB   4  
ATOM   5224  C CG1  . VAL A 1 77 ? 2.734   -1.073  -0.238  1.00 0.13 ? 77  VAL A CG1  4  
ATOM   5225  C CG2  . VAL A 1 77 ? 2.408   1.203   -1.234  1.00 0.13 ? 77  VAL A CG2  4  
ATOM   5226  H H    . VAL A 1 77 ? 1.734   0.573   -3.806  1.00 0.13 ? 77  VAL A H    4  
ATOM   5227  H HA   . VAL A 1 77 ? 4.027   -0.466  -2.618  1.00 0.14 ? 77  VAL A HA   4  
ATOM   5228  H HB   . VAL A 1 77 ? 1.189   -0.502  -1.580  1.00 0.12 ? 77  VAL A HB   4  
ATOM   5229  H HG11 . VAL A 1 77 ? 2.413   -2.101  -0.318  1.00 0.15 ? 77  VAL A HG11 4  
ATOM   5230  H HG12 . VAL A 1 77 ? 2.327   -0.636  0.662   1.00 0.16 ? 77  VAL A HG12 4  
ATOM   5231  H HG13 . VAL A 1 77 ? 3.812   -1.034  -0.201  1.00 0.17 ? 77  VAL A HG13 4  
ATOM   5232  H HG21 . VAL A 1 77 ? 3.457   1.435   -1.120  1.00 0.14 ? 77  VAL A HG21 4  
ATOM   5233  H HG22 . VAL A 1 77 ? 1.875   1.500   -0.343  1.00 0.13 ? 77  VAL A HG22 4  
ATOM   5234  H HG23 . VAL A 1 77 ? 2.011   1.735   -2.086  1.00 0.14 ? 77  VAL A HG23 4  
ATOM   5235  N N    . LEU A 1 78 ? 1.957   -2.719  -3.675  1.00 0.12 ? 78  LEU A N    4  
ATOM   5236  C CA   . LEU A 1 78 ? 1.759   -4.148  -3.886  1.00 0.12 ? 78  LEU A CA   4  
ATOM   5237  C C    . LEU A 1 78 ? 2.711   -4.677  -4.953  1.00 0.13 ? 78  LEU A C    4  
ATOM   5238  O O    . LEU A 1 78 ? 3.357   -5.709  -4.766  1.00 0.13 ? 78  LEU A O    4  
ATOM   5239  C CB   . LEU A 1 78 ? 0.312   -4.428  -4.293  1.00 0.11 ? 78  LEU A CB   4  
ATOM   5240  C CG   . LEU A 1 78 ? -0.208  -5.837  -4.004  1.00 0.10 ? 78  LEU A CG   4  
ATOM   5241  C CD1  . LEU A 1 78 ? -0.552  -5.985  -2.531  1.00 0.09 ? 78  LEU A CD1  4  
ATOM   5242  C CD2  . LEU A 1 78 ? -1.418  -6.148  -4.871  1.00 0.09 ? 78  LEU A CD2  4  
ATOM   5243  H H    . LEU A 1 78 ? 1.388   -2.081  -4.155  1.00 0.12 ? 78  LEU A H    4  
ATOM   5244  H HA   . LEU A 1 78 ? 1.965   -4.652  -2.954  1.00 0.11 ? 78  LEU A HA   4  
ATOM   5245  H HB2  . LEU A 1 78 ? -0.324  -3.724  -3.778  1.00 0.10 ? 78  LEU A HB2  4  
ATOM   5246  H HB3  . LEU A 1 78 ? 0.223   -4.250  -5.355  1.00 0.11 ? 78  LEU A HB3  4  
ATOM   5247  H HG   . LEU A 1 78 ? 0.565   -6.554  -4.237  1.00 0.10 ? 78  LEU A HG   4  
ATOM   5248  H HD11 . LEU A 1 78 ? -1.321  -5.274  -2.268  1.00 0.08 ? 78  LEU A HD11 4  
ATOM   5249  H HD12 . LEU A 1 78 ? 0.329   -5.801  -1.935  1.00 0.10 ? 78  LEU A HD12 4  
ATOM   5250  H HD13 . LEU A 1 78 ? -0.910  -6.987  -2.344  1.00 0.09 ? 78  LEU A HD13 4  
ATOM   5251  H HD21 . LEU A 1 78 ? -1.125  -6.157  -5.910  1.00 0.10 ? 78  LEU A HD21 4  
ATOM   5252  H HD22 . LEU A 1 78 ? -2.174  -5.392  -4.717  1.00 0.09 ? 78  LEU A HD22 4  
ATOM   5253  H HD23 . LEU A 1 78 ? -1.817  -7.114  -4.600  1.00 0.09 ? 78  LEU A HD23 4  
ATOM   5254  N N    . GLY A 1 79 ? 2.796   -3.965  -6.071  1.00 0.13 ? 79  GLY A N    4  
ATOM   5255  C CA   . GLY A 1 79 ? 3.674   -4.378  -7.150  1.00 0.15 ? 79  GLY A CA   4  
ATOM   5256  C C    . GLY A 1 79 ? 5.091   -4.640  -6.676  1.00 0.15 ? 79  GLY A C    4  
ATOM   5257  O O    . GLY A 1 79 ? 5.812   -5.438  -7.272  1.00 0.16 ? 79  GLY A O    4  
ATOM   5258  H H    . GLY A 1 79 ? 2.259   -3.151  -6.164  1.00 0.13 ? 79  GLY A H    4  
ATOM   5259  H HA2  . GLY A 1 79 ? 3.281   -5.281  -7.593  1.00 0.14 ? 79  GLY A HA2  4  
ATOM   5260  H HA3  . GLY A 1 79 ? 3.694   -3.601  -7.899  1.00 0.15 ? 79  GLY A HA3  4  
ATOM   5261  N N    . ALA A 1 80 ? 5.488   -3.964  -5.604  1.00 0.15 ? 80  ALA A N    4  
ATOM   5262  C CA   . ALA A 1 80 ? 6.828   -4.130  -5.052  1.00 0.16 ? 80  ALA A CA   4  
ATOM   5263  C C    . ALA A 1 80 ? 6.894   -5.340  -4.128  1.00 0.16 ? 80  ALA A C    4  
ATOM   5264  O O    . ALA A 1 80 ? 7.735   -6.224  -4.307  1.00 0.17 ? 80  ALA A O    4  
ATOM   5265  C CB   . ALA A 1 80 ? 7.250   -2.871  -4.307  1.00 0.17 ? 80  ALA A CB   4  
ATOM   5266  H H    . ALA A 1 80 ? 4.866   -3.340  -5.173  1.00 0.15 ? 80  ALA A H    4  
ATOM   5267  H HA   . ALA A 1 80 ? 7.512   -4.279  -5.875  1.00 0.17 ? 80  ALA A HA   4  
ATOM   5268  H HB1  . ALA A 1 80 ? 6.597   -2.717  -3.462  1.00 0.16 ? 80  ALA A HB1  4  
ATOM   5269  H HB2  . ALA A 1 80 ? 7.186   -2.022  -4.972  1.00 0.18 ? 80  ALA A HB2  4  
ATOM   5270  H HB3  . ALA A 1 80 ? 8.267   -2.982  -3.961  1.00 0.18 ? 80  ALA A HB3  4  
ATOM   5271  N N    . LEU A 1 81 ? 6.008   -5.374  -3.138  1.00 0.15 ? 81  LEU A N    4  
ATOM   5272  C CA   . LEU A 1 81 ? 5.967   -6.476  -2.185  1.00 0.15 ? 81  LEU A CA   4  
ATOM   5273  C C    . LEU A 1 81 ? 5.787   -7.811  -2.902  1.00 0.14 ? 81  LEU A C    4  
ATOM   5274  O O    . LEU A 1 81 ? 6.458   -8.793  -2.588  1.00 0.15 ? 81  LEU A O    4  
ATOM   5275  C CB   . LEU A 1 81 ? 4.834   -6.266  -1.180  1.00 0.14 ? 81  LEU A CB   4  
ATOM   5276  C CG   . LEU A 1 81 ? 5.251   -5.802  0.216   1.00 0.14 ? 81  LEU A CG   4  
ATOM   5277  C CD1  . LEU A 1 81 ? 4.036   -5.681  1.124   1.00 0.13 ? 81  LEU A CD1  4  
ATOM   5278  C CD2  . LEU A 1 81 ? 6.273   -6.757  0.813   1.00 0.15 ? 81  LEU A CD2  4  
ATOM   5279  H H    . LEU A 1 81 ? 5.366   -4.639  -3.048  1.00 0.14 ? 81  LEU A H    4  
ATOM   5280  H HA   . LEU A 1 81 ? 6.908   -6.491  -1.656  1.00 0.15 ? 81  LEU A HA   4  
ATOM   5281  H HB2  . LEU A 1 81 ? 4.156   -5.531  -1.589  1.00 0.13 ? 81  LEU A HB2  4  
ATOM   5282  H HB3  . LEU A 1 81 ? 4.301   -7.199  -1.077  1.00 0.13 ? 81  LEU A HB3  4  
ATOM   5283  H HG   . LEU A 1 81 ? 5.710   -4.826  0.141   1.00 0.15 ? 81  LEU A HG   4  
ATOM   5284  H HD11 . LEU A 1 81 ? 3.814   -6.643  1.558   1.00 0.13 ? 81  LEU A HD11 4  
ATOM   5285  H HD12 . LEU A 1 81 ? 3.189   -5.340  0.549   1.00 0.12 ? 81  LEU A HD12 4  
ATOM   5286  H HD13 . LEU A 1 81 ? 4.246   -4.972  1.912   1.00 0.13 ? 81  LEU A HD13 4  
ATOM   5287  H HD21 . LEU A 1 81 ? 5.939   -7.774  0.672   1.00 0.14 ? 81  LEU A HD21 4  
ATOM   5288  H HD22 . LEU A 1 81 ? 6.378   -6.557  1.868   1.00 0.15 ? 81  LEU A HD22 4  
ATOM   5289  H HD23 . LEU A 1 81 ? 7.225   -6.619  0.324   1.00 0.16 ? 81  LEU A HD23 4  
ATOM   5290  N N    . LYS A 1 82 ? 4.876   -7.837  -3.868  1.00 0.14 ? 82  LYS A N    4  
ATOM   5291  C CA   . LYS A 1 82 ? 4.608   -9.049  -4.634  1.00 0.14 ? 82  LYS A CA   4  
ATOM   5292  C C    . LYS A 1 82 ? 5.900   -9.639  -5.190  1.00 0.15 ? 82  LYS A C    4  
ATOM   5293  O O    . LYS A 1 82 ? 6.030   -10.855 -5.322  1.00 0.15 ? 82  LYS A O    4  
ATOM   5294  C CB   . LYS A 1 82 ? 3.640   -8.746  -5.781  1.00 0.13 ? 82  LYS A CB   4  
ATOM   5295  C CG   . LYS A 1 82 ? 2.228   -9.250  -5.532  1.00 0.12 ? 82  LYS A CG   4  
ATOM   5296  C CD   . LYS A 1 82 ? 1.207   -8.470  -6.345  1.00 0.12 ? 82  LYS A CD   4  
ATOM   5297  C CE   . LYS A 1 82 ? -0.154  -9.153  -6.331  1.00 0.11 ? 82  LYS A CE   4  
ATOM   5298  N NZ   . LYS A 1 82 ? -0.505  -9.714  -7.665  1.00 0.12 ? 82  LYS A NZ   4  
ATOM   5299  H H    . LYS A 1 82 ? 4.372   -7.020  -4.073  1.00 0.13 ? 82  LYS A H    4  
ATOM   5300  H HA   . LYS A 1 82 ? 4.153   -9.767  -3.970  1.00 0.13 ? 82  LYS A HA   4  
ATOM   5301  H HB2  . LYS A 1 82 ? 3.597   -7.677  -5.929  1.00 0.13 ? 82  LYS A HB2  4  
ATOM   5302  H HB3  . LYS A 1 82 ? 4.011   -9.212  -6.682  1.00 0.14 ? 82  LYS A HB3  4  
ATOM   5303  H HG2  . LYS A 1 82 ? 2.172   -10.293 -5.807  1.00 0.12 ? 82  LYS A HG2  4  
ATOM   5304  H HG3  . LYS A 1 82 ? 1.996   -9.140  -4.482  1.00 0.12 ? 82  LYS A HG3  4  
ATOM   5305  H HD2  . LYS A 1 82 ? 1.108   -7.480  -5.929  1.00 0.12 ? 82  LYS A HD2  4  
ATOM   5306  H HD3  . LYS A 1 82 ? 1.554   -8.400  -7.366  1.00 0.13 ? 82  LYS A HD3  4  
ATOM   5307  H HE2  . LYS A 1 82 ? -0.134  -9.953  -5.608  1.00 0.11 ? 82  LYS A HE2  4  
ATOM   5308  H HE3  . LYS A 1 82 ? -0.902  -8.428  -6.046  1.00 0.10 ? 82  LYS A HE3  4  
ATOM   5309  H HZ1  . LYS A 1 82 ? -1.437  -10.175 -7.624  1.00 0.11 ? 82  LYS A HZ1  4  
ATOM   5310  H HZ2  . LYS A 1 82 ? 0.204   -10.417 -7.956  1.00 0.12 ? 82  LYS A HZ2  4  
ATOM   5311  H HZ3  . LYS A 1 82 ? -0.536  -8.955  -8.376  1.00 0.12 ? 82  LYS A HZ3  4  
ATOM   5312  N N    . ALA A 1 83 ? 6.853   -8.770  -5.509  1.00 0.16 ? 83  ALA A N    4  
ATOM   5313  C CA   . ALA A 1 83 ? 8.137   -9.207  -6.044  1.00 0.17 ? 83  ALA A CA   4  
ATOM   5314  C C    . ALA A 1 83 ? 9.096   -9.593  -4.924  1.00 0.18 ? 83  ALA A C    4  
ATOM   5315  O O    . ALA A 1 83 ? 9.965   -10.445 -5.106  1.00 0.19 ? 83  ALA A O    4  
ATOM   5316  C CB   . ALA A 1 83 ? 8.745   -8.115  -6.911  1.00 0.18 ? 83  ALA A CB   4  
ATOM   5317  H H    . ALA A 1 83 ? 6.689   -7.812  -5.382  1.00 0.16 ? 83  ALA A H    4  
ATOM   5318  H HA   . ALA A 1 83 ? 7.961   -10.072 -6.667  1.00 0.17 ? 83  ALA A HA   4  
ATOM   5319  H HB1  . ALA A 1 83 ? 8.943   -7.243  -6.305  1.00 0.18 ? 83  ALA A HB1  4  
ATOM   5320  H HB2  . ALA A 1 83 ? 8.056   -7.856  -7.701  1.00 0.18 ? 83  ALA A HB2  4  
ATOM   5321  H HB3  . ALA A 1 83 ? 9.670   -8.470  -7.342  1.00 0.19 ? 83  ALA A HB3  4  
ATOM   5322  N N    . ALA A 1 84 ? 8.934   -8.959  -3.768  1.00 0.17 ? 84  ALA A N    4  
ATOM   5323  C CA   . ALA A 1 84 ? 9.786   -9.238  -2.618  1.00 0.18 ? 84  ALA A CA   4  
ATOM   5324  C C    . ALA A 1 84 ? 9.445   -10.589 -1.998  1.00 0.18 ? 84  ALA A C    4  
ATOM   5325  O O    . ALA A 1 84 ? 10.280  -11.208 -1.339  1.00 0.18 ? 84  ALA A O    4  
ATOM   5326  C CB   . ALA A 1 84 ? 9.656   -8.130  -1.583  1.00 0.18 ? 84  ALA A CB   4  
ATOM   5327  H H    . ALA A 1 84 ? 8.224   -8.289  -3.685  1.00 0.17 ? 84  ALA A H    4  
ATOM   5328  H HA   . ALA A 1 84 ? 10.811  -9.260  -2.961  1.00 0.19 ? 84  ALA A HA   4  
ATOM   5329  H HB1  . ALA A 1 84 ? 10.339  -8.317  -0.768  1.00 0.19 ? 84  ALA A HB1  4  
ATOM   5330  H HB2  . ALA A 1 84 ? 8.644   -8.107  -1.206  1.00 0.17 ? 84  ALA A HB2  4  
ATOM   5331  H HB3  . ALA A 1 84 ? 9.892   -7.180  -2.040  1.00 0.18 ? 84  ALA A HB3  4  
ATOM   5332  N N    . ARG A 1 85 ? 8.213   -11.038 -2.210  1.00 0.16 ? 85  ARG A N    4  
ATOM   5333  C CA   . ARG A 1 85 ? 7.761   -12.314 -1.670  1.00 0.16 ? 85  ARG A CA   4  
ATOM   5334  C C    . ARG A 1 85 ? 7.743   -13.388 -2.752  1.00 0.16 ? 85  ARG A C    4  
ATOM   5335  O O    . ARG A 1 85 ? 7.043   -14.394 -2.632  1.00 0.16 ? 85  ARG A O    4  
ATOM   5336  C CB   . ARG A 1 85 ? 6.366   -12.168 -1.058  1.00 0.15 ? 85  ARG A CB   4  
ATOM   5337  C CG   . ARG A 1 85 ? 6.318   -11.221 0.130   1.00 0.15 ? 85  ARG A CG   4  
ATOM   5338  C CD   . ARG A 1 85 ? 4.926   -11.163 0.741   1.00 0.14 ? 85  ARG A CD   4  
ATOM   5339  N NE   . ARG A 1 85 ? 4.967   -11.180 2.200   1.00 0.14 ? 85  ARG A NE   4  
ATOM   5340  C CZ   . ARG A 1 85 ? 5.344   -12.237 2.912   1.00 0.14 ? 85  ARG A CZ   4  
ATOM   5341  N NH1  . ARG A 1 85 ? 5.711   -13.354 2.302   1.00 0.15 ? 85  ARG A NH1  4  
ATOM   5342  N NH2  . ARG A 1 85 ? 5.354   -12.175 4.238   1.00 0.15 ? 85  ARG A NH2  4  
ATOM   5343  H H    . ARG A 1 85 ? 7.593   -10.499 -2.745  1.00 0.16 ? 85  ARG A H    4  
ATOM   5344  H HA   . ARG A 1 85 ? 8.453   -12.610 -0.897  1.00 0.17 ? 85  ARG A HA   4  
ATOM   5345  H HB2  . ARG A 1 85 ? 5.691   -11.796 -1.814  1.00 0.14 ? 85  ARG A HB2  4  
ATOM   5346  H HB3  . ARG A 1 85 ? 6.026   -13.139 -0.730  1.00 0.15 ? 85  ARG A HB3  4  
ATOM   5347  H HG2  . ARG A 1 85 ? 7.014   -11.565 0.881   1.00 0.15 ? 85  ARG A HG2  4  
ATOM   5348  H HG3  . ARG A 1 85 ? 6.600   -10.232 -0.199  1.00 0.15 ? 85  ARG A HG3  4  
ATOM   5349  H HD2  . ARG A 1 85 ? 4.443   -10.254 0.416   1.00 0.13 ? 85  ARG A HD2  4  
ATOM   5350  H HD3  . ARG A 1 85 ? 4.360   -12.014 0.395   1.00 0.13 ? 85  ARG A HD3  4  
ATOM   5351  H HE   . ARG A 1 85 ? 4.699   -10.364 2.672   1.00 0.14 ? 85  ARG A HE   4  
ATOM   5352  H HH11 . ARG A 1 85 ? 5.994   -14.149 2.840   1.00 0.15 ? 85  ARG A HH11 4  
ATOM   5353  H HH12 . ARG A 1 85 ? 5.703   -13.404 1.303   1.00 0.15 ? 85  ARG A HH12 4  
ATOM   5354  H HH21 . ARG A 1 85 ? 5.077   -11.334 4.702   1.00 0.15 ? 85  ARG A HH21 4  
ATOM   5355  H HH22 . ARG A 1 85 ? 5.639   -12.971 4.773   1.00 0.15 ? 85  ARG A HH22 4  
ATOM   5356  N N    . GLU A 1 86 ? 8.517   -13.167 -3.810  1.00 0.17 ? 86  GLU A N    4  
ATOM   5357  C CA   . GLU A 1 86 ? 8.587   -14.117 -4.916  1.00 0.17 ? 86  GLU A CA   4  
ATOM   5358  C C    . GLU A 1 86 ? 9.996   -14.687 -5.053  1.00 0.19 ? 86  GLU A C    4  
ATOM   5359  O O    . GLU A 1 86 ? 10.176  -15.826 -5.483  1.00 0.19 ? 86  GLU A O    4  
ATOM   5360  C CB   . GLU A 1 86 ? 8.168   -13.442 -6.224  1.00 0.17 ? 86  GLU A CB   4  
ATOM   5361  C CG   . GLU A 1 86 ? 6.761   -13.802 -6.669  1.00 0.16 ? 86  GLU A CG   4  
ATOM   5362  C CD   . GLU A 1 86 ? 6.423   -13.246 -8.040  1.00 0.17 ? 86  GLU A CD   4  
ATOM   5363  O OE1  . GLU A 1 86 ? 7.069   -13.660 -9.023  1.00 0.18 ? 86  GLU A OE1  4  
ATOM   5364  O OE2  . GLU A 1 86 ? 5.514   -12.394 -8.126  1.00 0.16 ? 86  GLU A OE2  4  
ATOM   5365  H H    . GLU A 1 86 ? 9.052   -12.348 -3.849  1.00 0.17 ? 86  GLU A H    4  
ATOM   5366  H HA   . GLU A 1 86 ? 7.904   -14.925 -4.703  1.00 0.17 ? 86  GLU A HA   4  
ATOM   5367  H HB2  . GLU A 1 86 ? 8.219   -12.371 -6.096  1.00 0.17 ? 86  GLU A HB2  4  
ATOM   5368  H HB3  . GLU A 1 86 ? 8.856   -13.736 -7.004  1.00 0.18 ? 86  GLU A HB3  4  
ATOM   5369  H HG2  . GLU A 1 86 ? 6.671   -14.877 -6.702  1.00 0.17 ? 86  GLU A HG2  4  
ATOM   5370  H HG3  . GLU A 1 86 ? 6.057   -13.405 -5.952  1.00 0.16 ? 86  GLU A HG3  4  
ATOM   5371  N N    . GLU A 1 87 ? 10.992  -13.885 -4.687  1.00 0.19 ? 87  GLU A N    4  
ATOM   5372  C CA   . GLU A 1 87 ? 12.384  -14.310 -4.770  1.00 0.21 ? 87  GLU A CA   4  
ATOM   5373  C C    . GLU A 1 87 ? 12.747  -15.218 -3.601  1.00 0.21 ? 87  GLU A C    4  
ATOM   5374  O O    . GLU A 1 87 ? 13.800  -15.855 -3.600  1.00 0.22 ? 87  GLU A O    4  
ATOM   5375  C CB   . GLU A 1 87 ? 13.310  -13.093 -4.793  1.00 0.21 ? 87  GLU A CB   4  
ATOM   5376  C CG   . GLU A 1 87 ? 13.759  -12.694 -6.187  1.00 0.22 ? 87  GLU A CG   4  
ATOM   5377  C CD   . GLU A 1 87 ? 15.267  -12.616 -6.315  1.00 0.24 ? 87  GLU A CD   4  
ATOM   5378  O OE1  . GLU A 1 87 ? 15.875  -13.602 -6.784  1.00 0.24 ? 87  GLU A OE1  4  
ATOM   5379  O OE2  . GLU A 1 87 ? 15.842  -11.570 -5.948  1.00 0.24 ? 87  GLU A OE2  4  
ATOM   5380  O OXT  . GLU A 1 87 ? 11.975  -15.280 -2.598  1.00 0.20 ? 87  GLU A OXT  4  
ATOM   5381  H H    . GLU A 1 87 ? 10.785  -12.988 -4.352  1.00 0.19 ? 87  GLU A H    4  
ATOM   5382  H HA   . GLU A 1 87 ? 12.507  -14.862 -5.690  1.00 0.21 ? 87  GLU A HA   4  
ATOM   5383  H HB2  . GLU A 1 87 ? 12.794  -12.254 -4.350  1.00 0.21 ? 87  GLU A HB2  4  
ATOM   5384  H HB3  . GLU A 1 87 ? 14.189  -13.313 -4.204  1.00 0.22 ? 87  GLU A HB3  4  
ATOM   5385  H HG2  . GLU A 1 87 ? 13.392  -13.424 -6.893  1.00 0.22 ? 87  GLU A HG2  4  
ATOM   5386  H HG3  . GLU A 1 87 ? 13.342  -11.725 -6.423  1.00 0.22 ? 87  GLU A HG3  4  
HETATM 5387  C C1   . I3P B 2 .  ? 11.126  9.793   1.051   1.00 0.80 ? 101 I3P A C1   4  
HETATM 5388  C C2   . I3P B 2 .  ? 11.258  10.337  2.491   1.00 0.90 ? 101 I3P A C2   4  
HETATM 5389  C C3   . I3P B 2 .  ? 11.125  11.874  2.492   1.00 0.87 ? 101 I3P A C3   4  
HETATM 5390  C C4   . I3P B 2 .  ? 9.777   12.311  1.875   1.00 0.99 ? 101 I3P A C4   4  
HETATM 5391  C C5   . I3P B 2 .  ? 9.641   11.759  0.439   1.00 0.89 ? 101 I3P A C5   4  
HETATM 5392  C C6   . I3P B 2 .  ? 9.779   10.220  0.433   1.00 0.77 ? 101 I3P A C6   4  
HETATM 5393  O O1   . I3P B 2 .  ? 11.195  8.381   1.065   1.00 1.09 ? 101 I3P A O1   4  
HETATM 5394  O O2   . I3P B 2 .  ? 10.269  9.778   3.322   1.00 1.13 ? 101 I3P A O2   4  
HETATM 5395  O O3   . I3P B 2 .  ? 11.230  12.344  3.812   1.00 1.18 ? 101 I3P A O3   4  
HETATM 5396  O O4   . I3P B 2 .  ? 9.736   13.725  1.823   1.00 1.27 ? 101 I3P A O4   4  
HETATM 5397  O O5   . I3P B 2 .  ? 8.364   12.102  -0.065  1.00 1.24 ? 101 I3P A O5   4  
HETATM 5398  O O6   . I3P B 2 .  ? 9.711   9.739   -0.885  1.00 0.95 ? 101 I3P A O6   4  
HETATM 5399  P P1   . I3P B 2 .  ? 12.781  7.840   0.552   1.00 1.49 ? 101 I3P A P1   4  
HETATM 5400  O O11  . I3P B 2 .  ? 13.163  8.388   -1.052  1.00 1.57 ? 101 I3P A O11  4  
HETATM 5401  O O12  . I3P B 2 .  ? 13.833  8.428   1.532   1.00 1.59 ? 101 I3P A O12  4  
HETATM 5402  O O13  . I3P B 2 .  ? 12.894  6.111   0.659   1.00 1.97 ? 101 I3P A O13  4  
HETATM 5403  P P4   . I3P B 2 .  ? 8.400   14.335  2.778   1.00 1.78 ? 101 I3P A P4   4  
HETATM 5404  O O41  . I3P B 2 .  ? 7.078   13.862  2.116   1.00 1.94 ? 101 I3P A O41  4  
HETATM 5405  O O42  . I3P B 2 .  ? 8.426   13.731  4.406   1.00 1.90 ? 101 I3P A O42  4  
HETATM 5406  O O43  . I3P B 2 .  ? 8.375   16.070  2.766   1.00 2.20 ? 101 I3P A O43  4  
HETATM 5407  P P5   . I3P B 2 .  ? 8.515   13.205  -1.420  1.00 1.58 ? 101 I3P A P5   4  
HETATM 5408  O O51  . I3P B 2 .  ? 9.185   12.436  -2.590  1.00 1.56 ? 101 I3P A O51  4  
HETATM 5409  O O52  . I3P B 2 .  ? 6.952   13.708  -1.981  1.00 2.10 ? 101 I3P A O52  4  
HETATM 5410  O O53  . I3P B 2 .  ? 9.508   14.580  -1.047  1.00 1.65 ? 101 I3P A O53  4  
HETATM 5411  H H1   . I3P B 2 .  ? 11.926  10.219  0.435   1.00 0.84 ? 101 I3P A H1   4  
HETATM 5412  H H2   . I3P B 2 .  ? 12.244  10.077  2.883   1.00 1.09 ? 101 I3P A H2   4  
HETATM 5413  H H3   . I3P B 2 .  ? 11.941  12.302  1.901   1.00 0.81 ? 101 I3P A H3   4  
HETATM 5414  H H4   . I3P B 2 .  ? 8.961   11.913  2.484   1.00 1.17 ? 101 I3P A H4   4  
HETATM 5415  H H5   . I3P B 2 .  ? 10.444  12.179  -0.177  1.00 0.89 ? 101 I3P A H5   4  
HETATM 5416  H H6   . I3P B 2 .  ? 8.959   9.781   1.006   1.00 0.90 ? 101 I3P A H6   4  
HETATM 5417  H HO2  . I3P B 2 .  ? 9.712   9.206   2.762   1.00 1.23 ? 101 I3P A HO2  4  
HETATM 5418  H HO3  . I3P B 2 .  ? 10.762  13.199  3.856   1.00 1.33 ? 101 I3P A HO3  4  
HETATM 5419  H HO6  . I3P B 2 .  ? 9.445   10.483  -1.458  1.00 1.04 ? 101 I3P A HO6  4  
HETATM 5420  H HO13 . I3P B 2 .  ? 13.788  5.830   0.392   1.00 2.23 ? 101 I3P A HO13 4  
ATOM   5421  N N    . SER A 1 1  ? 3.429   3.996   10.668  1.00 0.76 ? 1   SER A N    5  
ATOM   5422  C CA   . SER A 1 1  ? 3.074   5.232   11.356  1.00 0.88 ? 1   SER A CA   5  
ATOM   5423  C C    . SER A 1 1  ? 4.235   6.222   11.328  1.00 0.88 ? 1   SER A C    5  
ATOM   5424  O O    . SER A 1 1  ? 4.037   7.430   11.448  1.00 0.98 ? 1   SER A O    5  
ATOM   5425  C CB   . SER A 1 1  ? 2.672   4.938   12.802  1.00 0.96 ? 1   SER A CB   5  
ATOM   5426  O OG   . SER A 1 1  ? 1.265   4.845   12.932  1.00 1.05 ? 1   SER A OG   5  
ATOM   5427  H H1   . SER A 1 1  ? 3.661   4.194   9.674   1.00 0.73 ? 1   SER A H1   5  
ATOM   5428  H H2   . SER A 1 1  ? 2.631   3.329   10.699  1.00 0.79 ? 1   SER A H2   5  
ATOM   5429  H H3   . SER A 1 1  ? 4.252   3.556   11.124  1.00 0.72 ? 1   SER A H3   5  
ATOM   5430  H HA   . SER A 1 1  ? 2.232   5.674   10.842  1.00 0.95 ? 1   SER A HA   5  
ATOM   5431  H HB2  . SER A 1 1  ? 3.113   4.002   13.113  1.00 0.91 ? 1   SER A HB2  5  
ATOM   5432  H HB3  . SER A 1 1  ? 3.029   5.733   13.441  1.00 1.02 ? 1   SER A HB3  5  
ATOM   5433  H HG   . SER A 1 1  ? 0.956   5.506   13.557  1.00 1.13 ? 1   SER A HG   5  
ATOM   5434  N N    . GLU A 1 2  ? 5.447   5.698   11.170  1.00 0.79 ? 2   GLU A N    5  
ATOM   5435  C CA   . GLU A 1 2  ? 6.640   6.535   11.129  1.00 0.83 ? 2   GLU A CA   5  
ATOM   5436  C C    . GLU A 1 2  ? 7.875   5.704   10.794  1.00 0.76 ? 2   GLU A C    5  
ATOM   5437  O O    . GLU A 1 2  ? 8.776   6.165   10.095  1.00 0.77 ? 2   GLU A O    5  
ATOM   5438  C CB   . GLU A 1 2  ? 6.837   7.248   12.468  1.00 0.96 ? 2   GLU A CB   5  
ATOM   5439  C CG   . GLU A 1 2  ? 7.279   6.323   13.590  1.00 0.99 ? 2   GLU A CG   5  
ATOM   5440  C CD   . GLU A 1 2  ? 7.492   7.056   14.901  1.00 1.14 ? 2   GLU A CD   5  
ATOM   5441  O OE1  . GLU A 1 2  ? 8.010   8.193   14.865  1.00 1.22 ? 2   GLU A OE1  5  
ATOM   5442  O OE2  . GLU A 1 2  ? 7.141   6.495   15.958  1.00 1.19 ? 2   GLU A OE2  5  
ATOM   5443  H H    . GLU A 1 2  ? 5.541   4.728   11.080  1.00 0.72 ? 2   GLU A H    5  
ATOM   5444  H HA   . GLU A 1 2  ? 6.498   7.275   10.355  1.00 0.86 ? 2   GLU A HA   5  
ATOM   5445  H HB2  . GLU A 1 2  ? 7.586   8.016   12.346  1.00 1.02 ? 2   GLU A HB2  5  
ATOM   5446  H HB3  . GLU A 1 2  ? 5.904   7.710   12.757  1.00 1.02 ? 2   GLU A HB3  5  
ATOM   5447  H HG2  . GLU A 1 2  ? 6.521   5.569   13.736  1.00 0.95 ? 2   GLU A HG2  5  
ATOM   5448  H HG3  . GLU A 1 2  ? 8.206   5.849   13.303  1.00 0.95 ? 2   GLU A HG3  5  
ATOM   5449  N N    . ALA A 1 3  ? 7.910   4.476   11.302  1.00 0.72 ? 3   ALA A N    5  
ATOM   5450  C CA   . ALA A 1 3  ? 9.034   3.581   11.056  1.00 0.70 ? 3   ALA A CA   5  
ATOM   5451  C C    . ALA A 1 3  ? 8.746   2.646   9.888   1.00 0.57 ? 3   ALA A C    5  
ATOM   5452  O O    . ALA A 1 3  ? 9.569   2.490   8.986   1.00 0.56 ? 3   ALA A O    5  
ATOM   5453  C CB   . ALA A 1 3  ? 9.353   2.779   12.311  1.00 0.79 ? 3   ALA A CB   5  
ATOM   5454  H H    . ALA A 1 3  ? 7.166   4.168   11.859  1.00 0.73 ? 3   ALA A H    5  
ATOM   5455  H HA   . ALA A 1 3  ? 9.896   4.186   10.817  1.00 0.75 ? 3   ALA A HA   5  
ATOM   5456  H HB1  . ALA A 1 3  ? 9.553   3.455   13.128  1.00 0.89 ? 3   ALA A HB1  5  
ATOM   5457  H HB2  . ALA A 1 3  ? 10.221  2.162   12.132  1.00 0.82 ? 3   ALA A HB2  5  
ATOM   5458  H HB3  . ALA A 1 3  ? 8.510   2.151   12.560  1.00 0.76 ? 3   ALA A HB3  5  
ATOM   5459  N N    . VAL A 1 4  ? 7.575   2.008   9.912   1.00 0.52 ? 4   VAL A N    5  
ATOM   5460  C CA   . VAL A 1 4  ? 7.185   1.061   8.863   1.00 0.45 ? 4   VAL A CA   5  
ATOM   5461  C C    . VAL A 1 4  ? 7.011   1.740   7.506   1.00 0.43 ? 4   VAL A C    5  
ATOM   5462  O O    . VAL A 1 4  ? 7.164   1.100   6.466   1.00 0.44 ? 4   VAL A O    5  
ATOM   5463  C CB   . VAL A 1 4  ? 5.891   0.313   9.228   1.00 0.49 ? 4   VAL A CB   5  
ATOM   5464  C CG1  . VAL A 1 4  ? 5.591   -0.768  8.198   1.00 0.55 ? 4   VAL A CG1  5  
ATOM   5465  C CG2  . VAL A 1 4  ? 6.003   -0.289  10.621  1.00 0.62 ? 4   VAL A CG2  5  
ATOM   5466  H H    . VAL A 1 4  ? 6.958   2.177   10.654  1.00 0.57 ? 4   VAL A H    5  
ATOM   5467  H HA   . VAL A 1 4  ? 7.977   0.331   8.778   1.00 0.46 ? 4   VAL A HA   5  
ATOM   5468  H HB   . VAL A 1 4  ? 5.075   1.019   9.227   1.00 0.59 ? 4   VAL A HB   5  
ATOM   5469  H HG11 . VAL A 1 4  ? 5.458   -0.313  7.227   1.00 0.62 ? 4   VAL A HG11 5  
ATOM   5470  H HG12 . VAL A 1 4  ? 4.687   -1.290  8.477   1.00 0.62 ? 4   VAL A HG12 5  
ATOM   5471  H HG13 . VAL A 1 4  ? 6.413   -1.467  8.159   1.00 0.62 ? 4   VAL A HG13 5  
ATOM   5472  H HG21 . VAL A 1 4  ? 5.082   -0.797  10.869  1.00 0.68 ? 4   VAL A HG21 5  
ATOM   5473  H HG22 . VAL A 1 4  ? 6.186   0.496   11.338  1.00 0.78 ? 4   VAL A HG22 5  
ATOM   5474  H HG23 . VAL A 1 4  ? 6.820   -0.996  10.643  1.00 0.70 ? 4   VAL A HG23 5  
ATOM   5475  N N    . ILE A 1 5  ? 6.723   3.040   7.517   1.00 0.45 ? 5   ILE A N    5  
ATOM   5476  C CA   . ILE A 1 5  ? 6.554   3.792   6.279   1.00 0.48 ? 5   ILE A CA   5  
ATOM   5477  C C    . ILE A 1 5  ? 7.894   3.934   5.551   1.00 0.46 ? 5   ILE A C    5  
ATOM   5478  O O    . ILE A 1 5  ? 7.936   4.019   4.326   1.00 0.57 ? 5   ILE A O    5  
ATOM   5479  C CB   . ILE A 1 5  ? 5.953   5.193   6.536   1.00 0.56 ? 5   ILE A CB   5  
ATOM   5480  C CG1  . ILE A 1 5  ? 4.710   5.086   7.424   1.00 0.73 ? 5   ILE A CG1  5  
ATOM   5481  C CG2  . ILE A 1 5  ? 5.604   5.872   5.218   1.00 0.81 ? 5   ILE A CG2  5  
ATOM   5482  C CD1  . ILE A 1 5  ? 4.079   6.424   7.750   1.00 0.82 ? 5   ILE A CD1  5  
ATOM   5483  H H    . ILE A 1 5  ? 6.628   3.502   8.376   1.00 0.48 ? 5   ILE A H    5  
ATOM   5484  H HA   . ILE A 1 5  ? 5.872   3.240   5.648   1.00 0.50 ? 5   ILE A HA   5  
ATOM   5485  H HB   . ILE A 1 5  ? 6.697   5.793   7.038   1.00 0.65 ? 5   ILE A HB   5  
ATOM   5486  H HG12 . ILE A 1 5  ? 3.967   4.484   6.922   1.00 0.89 ? 5   ILE A HG12 5  
ATOM   5487  H HG13 . ILE A 1 5  ? 4.981   4.611   8.356   1.00 0.89 ? 5   ILE A HG13 5  
ATOM   5488  H HG21 . ILE A 1 5  ? 4.973   5.218   4.632   1.00 0.99 ? 5   ILE A HG21 5  
ATOM   5489  H HG22 . ILE A 1 5  ? 6.510   6.085   4.669   1.00 0.98 ? 5   ILE A HG22 5  
ATOM   5490  H HG23 . ILE A 1 5  ? 5.078   6.794   5.417   1.00 0.91 ? 5   ILE A HG23 5  
ATOM   5491  H HD11 . ILE A 1 5  ? 3.886   6.964   6.835   1.00 0.92 ? 5   ILE A HD11 5  
ATOM   5492  H HD12 . ILE A 1 5  ? 4.752   6.997   8.372   1.00 0.99 ? 5   ILE A HD12 5  
ATOM   5493  H HD13 . ILE A 1 5  ? 3.150   6.265   8.276   1.00 1.11 ? 5   ILE A HD13 5  
ATOM   5494  N N    . LYS A 1 6  ? 8.986   3.942   6.319   1.00 0.44 ? 6   LYS A N    5  
ATOM   5495  C CA   . LYS A 1 6  ? 10.328  4.054   5.750   1.00 0.45 ? 6   LYS A CA   5  
ATOM   5496  C C    . LYS A 1 6  ? 10.769  2.724   5.146   1.00 0.41 ? 6   LYS A C    5  
ATOM   5497  O O    . LYS A 1 6  ? 11.486  2.697   4.146   1.00 0.42 ? 6   LYS A O    5  
ATOM   5498  C CB   . LYS A 1 6  ? 11.332  4.499   6.816   1.00 0.52 ? 6   LYS A CB   5  
ATOM   5499  C CG   . LYS A 1 6  ? 11.313  5.995   7.100   1.00 0.78 ? 6   LYS A CG   5  
ATOM   5500  C CD   . LYS A 1 6  ? 11.770  6.812   5.896   1.00 1.08 ? 6   LYS A CD   5  
ATOM   5501  C CE   . LYS A 1 6  ? 13.220  6.526   5.534   1.00 1.30 ? 6   LYS A CE   5  
ATOM   5502  N NZ   . LYS A 1 6  ? 13.666  7.331   4.364   1.00 1.91 ? 6   LYS A NZ   5  
ATOM   5503  H H    . LYS A 1 6  ? 8.886   3.870   7.291   1.00 0.51 ? 6   LYS A H    5  
ATOM   5504  H HA   . LYS A 1 6  ? 10.293  4.795   4.967   1.00 0.46 ? 6   LYS A HA   5  
ATOM   5505  H HB2  . LYS A 1 6  ? 11.113  3.979   7.737   1.00 0.72 ? 6   LYS A HB2  5  
ATOM   5506  H HB3  . LYS A 1 6  ? 12.326  4.229   6.491   1.00 0.62 ? 6   LYS A HB3  5  
ATOM   5507  H HG2  . LYS A 1 6  ? 10.306  6.288   7.357   1.00 1.09 ? 6   LYS A HG2  5  
ATOM   5508  H HG3  . LYS A 1 6  ? 11.971  6.201   7.931   1.00 0.83 ? 6   LYS A HG3  5  
ATOM   5509  H HD2  . LYS A 1 6  ? 11.146  6.570   5.051   1.00 1.25 ? 6   LYS A HD2  5  
ATOM   5510  H HD3  . LYS A 1 6  ? 11.669  7.862   6.130   1.00 1.41 ? 6   LYS A HD3  5  
ATOM   5511  H HE2  . LYS A 1 6  ? 13.844  6.764   6.382   1.00 1.39 ? 6   LYS A HE2  5  
ATOM   5512  H HE3  . LYS A 1 6  ? 13.319  5.477   5.296   1.00 1.37 ? 6   LYS A HE3  5  
ATOM   5513  H HZ1  . LYS A 1 6  ? 14.667  7.135   4.156   1.00 2.23 ? 6   LYS A HZ1  5  
ATOM   5514  H HZ2  . LYS A 1 6  ? 13.558  8.345   4.564   1.00 2.11 ? 6   LYS A HZ2  5  
ATOM   5515  H HZ3  . LYS A 1 6  ? 13.096  7.092   3.527   1.00 2.10 ? 6   LYS A HZ3  5  
ATOM   5516  N N    . VAL A 1 7  ? 10.339  1.626   5.764   1.00 0.40 ? 7   VAL A N    5  
ATOM   5517  C CA   . VAL A 1 7  ? 10.672  0.290   5.286   1.00 0.41 ? 7   VAL A CA   5  
ATOM   5518  C C    . VAL A 1 7  ? 9.940   -0.026  3.986   1.00 0.37 ? 7   VAL A C    5  
ATOM   5519  O O    . VAL A 1 7  ? 10.394  -0.848  3.190   1.00 0.41 ? 7   VAL A O    5  
ATOM   5520  C CB   . VAL A 1 7  ? 10.323  -0.784  6.333   1.00 0.46 ? 7   VAL A CB   5  
ATOM   5521  C CG1  . VAL A 1 7  ? 10.866  -2.140  5.907   1.00 0.52 ? 7   VAL A CG1  5  
ATOM   5522  C CG2  . VAL A 1 7  ? 10.862  -0.389  7.700   1.00 0.53 ? 7   VAL A CG2  5  
ATOM   5523  H H    . VAL A 1 7  ? 9.782   1.719   6.565   1.00 0.42 ? 7   VAL A H    5  
ATOM   5524  H HA   . VAL A 1 7  ? 11.737  0.256   5.106   1.00 0.46 ? 7   VAL A HA   5  
ATOM   5525  H HB   . VAL A 1 7  ? 9.247   -0.857  6.401   1.00 0.44 ? 7   VAL A HB   5  
ATOM   5526  H HG11 . VAL A 1 7  ? 11.942  -2.094  5.848   1.00 0.57 ? 7   VAL A HG11 5  
ATOM   5527  H HG12 . VAL A 1 7  ? 10.462  -2.401  4.939   1.00 0.49 ? 7   VAL A HG12 5  
ATOM   5528  H HG13 . VAL A 1 7  ? 10.576  -2.887  6.631   1.00 0.56 ? 7   VAL A HG13 5  
ATOM   5529  H HG21 . VAL A 1 7  ? 10.422  0.549   8.003   1.00 0.51 ? 7   VAL A HG21 5  
ATOM   5530  H HG22 . VAL A 1 7  ? 11.935  -0.283  7.647   1.00 0.57 ? 7   VAL A HG22 5  
ATOM   5531  H HG23 . VAL A 1 7  ? 10.611  -1.154  8.420   1.00 0.58 ? 7   VAL A HG23 5  
ATOM   5532  N N    . ILE A 1 8  ? 8.810   0.644   3.772   1.00 0.34 ? 8   ILE A N    5  
ATOM   5533  C CA   . ILE A 1 8  ? 8.015   0.452   2.564   1.00 0.36 ? 8   ILE A CA   5  
ATOM   5534  C C    . ILE A 1 8  ? 8.439   1.444   1.478   1.00 0.34 ? 8   ILE A C    5  
ATOM   5535  O O    . ILE A 1 8  ? 8.423   1.122   0.289   1.00 0.34 ? 8   ILE A O    5  
ATOM   5536  C CB   . ILE A 1 8  ? 6.503   0.615   2.853   1.00 0.43 ? 8   ILE A CB   5  
ATOM   5537  C CG1  . ILE A 1 8  ? 6.055   -0.363  3.946   1.00 0.57 ? 8   ILE A CG1  5  
ATOM   5538  C CG2  . ILE A 1 8  ? 5.682   0.410   1.586   1.00 0.61 ? 8   ILE A CG2  5  
ATOM   5539  C CD1  . ILE A 1 8  ? 6.238   -1.822  3.579   1.00 0.78 ? 8   ILE A CD1  5  
ATOM   5540  H H    . ILE A 1 8  ? 8.502   1.285   4.447   1.00 0.34 ? 8   ILE A H    5  
ATOM   5541  H HA   . ILE A 1 8  ? 8.187   -0.554  2.207   1.00 0.39 ? 8   ILE A HA   5  
ATOM   5542  H HB   . ILE A 1 8  ? 6.336   1.625   3.198   1.00 0.58 ? 8   ILE A HB   5  
ATOM   5543  H HG12 . ILE A 1 8  ? 6.627   -0.175  4.842   1.00 0.73 ? 8   ILE A HG12 5  
ATOM   5544  H HG13 . ILE A 1 8  ? 5.007   -0.202  4.154   1.00 0.61 ? 8   ILE A HG13 5  
ATOM   5545  H HG21 . ILE A 1 8  ? 4.645   0.635   1.789   1.00 1.01 ? 8   ILE A HG21 5  
ATOM   5546  H HG22 . ILE A 1 8  ? 5.770   -0.617  1.262   1.00 1.07 ? 8   ILE A HG22 5  
ATOM   5547  H HG23 . ILE A 1 8  ? 6.047   1.066   0.809   1.00 1.06 ? 8   ILE A HG23 5  
ATOM   5548  H HD11 . ILE A 1 8  ? 7.292   -2.047  3.509   1.00 0.95 ? 8   ILE A HD11 5  
ATOM   5549  H HD12 . ILE A 1 8  ? 5.764   -2.017  2.628   1.00 0.89 ? 8   ILE A HD12 5  
ATOM   5550  H HD13 . ILE A 1 8  ? 5.788   -2.444  4.340   1.00 1.07 ? 8   ILE A HD13 5  
ATOM   5551  N N    . SER A 1 9  ? 8.835   2.645   1.902   1.00 0.36 ? 9   SER A N    5  
ATOM   5552  C CA   . SER A 1 9  ? 9.270   3.687   0.974   1.00 0.37 ? 9   SER A CA   5  
ATOM   5553  C C    . SER A 1 9  ? 10.614  3.332   0.343   1.00 0.35 ? 9   SER A C    5  
ATOM   5554  O O    . SER A 1 9  ? 10.835  3.582   -0.838  1.00 0.36 ? 9   SER A O    5  
ATOM   5555  C CB   . SER A 1 9  ? 9.370   5.036   1.693   1.00 0.43 ? 9   SER A CB   5  
ATOM   5556  O OG   . SER A 1 9  ? 9.686   6.079   0.787   1.00 0.49 ? 9   SER A OG   5  
ATOM   5557  H H    . SER A 1 9  ? 8.831   2.836   2.864   1.00 0.38 ? 9   SER A H    5  
ATOM   5558  H HA   . SER A 1 9  ? 8.528   3.763   0.193   1.00 0.39 ? 9   SER A HA   5  
ATOM   5559  H HB2  . SER A 1 9  ? 8.426   5.261   2.165   1.00 0.45 ? 9   SER A HB2  5  
ATOM   5560  H HB3  . SER A 1 9  ? 10.144  4.983   2.446   1.00 0.44 ? 9   SER A HB3  5  
ATOM   5561  H HG   . SER A 1 9  ? 9.054   6.078   0.065   1.00 0.81 ? 9   SER A HG   5  
ATOM   5562  N N    . SER A 1 10 ? 11.506  2.740   1.136   1.00 0.36 ? 10  SER A N    5  
ATOM   5563  C CA   . SER A 1 10 ? 12.824  2.347   0.648   1.00 0.37 ? 10  SER A CA   5  
ATOM   5564  C C    . SER A 1 10 ? 12.731  1.070   -0.186  1.00 0.35 ? 10  SER A C    5  
ATOM   5565  O O    . SER A 1 10 ? 13.577  0.812   -1.043  1.00 0.35 ? 10  SER A O    5  
ATOM   5566  C CB   . SER A 1 10 ? 13.787  2.140   1.821   1.00 0.43 ? 10  SER A CB   5  
ATOM   5567  O OG   . SER A 1 10 ? 15.108  1.893   1.365   1.00 0.46 ? 10  SER A OG   5  
ATOM   5568  H H    . SER A 1 10 ? 11.271  2.566   2.071   1.00 0.38 ? 10  SER A H    5  
ATOM   5569  H HA   . SER A 1 10 ? 13.198  3.144   0.022   1.00 0.37 ? 10  SER A HA   5  
ATOM   5570  H HB2  . SER A 1 10 ? 13.795  3.026   2.437   1.00 0.45 ? 10  SER A HB2  5  
ATOM   5571  H HB3  . SER A 1 10 ? 13.459  1.296   2.408   1.00 0.44 ? 10  SER A HB3  5  
ATOM   5572  H HG   . SER A 1 10 ? 15.080  1.578   0.458   1.00 0.67 ? 10  SER A HG   5  
ATOM   5573  N N    . ALA A 1 11 ? 11.690  0.279   0.075   1.00 0.35 ? 11  ALA A N    5  
ATOM   5574  C CA   . ALA A 1 11 ? 11.468  -0.969  -0.648  1.00 0.36 ? 11  ALA A CA   5  
ATOM   5575  C C    . ALA A 1 11 ? 11.088  -0.701  -2.102  1.00 0.31 ? 11  ALA A C    5  
ATOM   5576  O O    . ALA A 1 11 ? 11.661  -1.289  -3.017  1.00 0.33 ? 11  ALA A O    5  
ATOM   5577  C CB   . ALA A 1 11 ? 10.384  -1.793  0.035   1.00 0.40 ? 11  ALA A CB   5  
ATOM   5578  H H    . ALA A 1 11 ? 11.056  0.543   0.773   1.00 0.36 ? 11  ALA A H    5  
ATOM   5579  H HA   . ALA A 1 11 ? 12.388  -1.537  -0.624  1.00 0.39 ? 11  ALA A HA   5  
ATOM   5580  H HB1  . ALA A 1 11 ? 9.449   -1.253  0.002   1.00 0.38 ? 11  ALA A HB1  5  
ATOM   5581  H HB2  . ALA A 1 11 ? 10.661  -1.970  1.063   1.00 0.44 ? 11  ALA A HB2  5  
ATOM   5582  H HB3  . ALA A 1 11 ? 10.272  -2.738  -0.477  1.00 0.42 ? 11  ALA A HB3  5  
ATOM   5583  N N    . CYS A 1 12 ? 10.135  0.211   -2.299  1.00 0.28 ? 12  CYS A N    5  
ATOM   5584  C CA   . CYS A 1 12 ? 9.667   0.564   -3.637  1.00 0.26 ? 12  CYS A CA   5  
ATOM   5585  C C    . CYS A 1 12 ? 10.695  1.410   -4.393  1.00 0.25 ? 12  CYS A C    5  
ATOM   5586  O O    . CYS A 1 12 ? 10.588  1.584   -5.603  1.00 0.26 ? 12  CYS A O    5  
ATOM   5587  C CB   . CYS A 1 12 ? 8.329   1.304   -3.555  1.00 0.28 ? 12  CYS A CB   5  
ATOM   5588  S SG   . CYS A 1 12 ? 8.355   2.775   -2.504  1.00 0.26 ? 12  CYS A SG   5  
ATOM   5589  H H    . CYS A 1 12 ? 9.738   0.660   -1.524  1.00 0.29 ? 12  CYS A H    5  
ATOM   5590  H HA   . CYS A 1 12 ? 9.518   -0.357  -4.181  1.00 0.29 ? 12  CYS A HA   5  
ATOM   5591  H HB2  . CYS A 1 12 ? 8.037   1.616   -4.546  1.00 0.29 ? 12  CYS A HB2  5  
ATOM   5592  H HB3  . CYS A 1 12 ? 7.580   0.633   -3.160  1.00 0.34 ? 12  CYS A HB3  5  
ATOM   5593  H HG   . CYS A 1 12 ? 7.363   3.568   -2.883  1.00 1.12 ? 12  CYS A HG   5  
ATOM   5594  N N    . LYS A 1 13 ? 11.693  1.931   -3.682  1.00 0.25 ? 13  LYS A N    5  
ATOM   5595  C CA   . LYS A 1 13 ? 12.739  2.738   -4.310  1.00 0.26 ? 13  LYS A CA   5  
ATOM   5596  C C    . LYS A 1 13 ? 13.781  1.841   -4.978  1.00 0.31 ? 13  LYS A C    5  
ATOM   5597  O O    . LYS A 1 13 ? 14.651  2.317   -5.708  1.00 0.35 ? 13  LYS A O    5  
ATOM   5598  C CB   . LYS A 1 13 ? 13.421  3.636   -3.273  1.00 0.29 ? 13  LYS A CB   5  
ATOM   5599  C CG   . LYS A 1 13 ? 12.622  4.877   -2.909  1.00 0.79 ? 13  LYS A CG   5  
ATOM   5600  C CD   . LYS A 1 13 ? 12.730  5.954   -3.977  1.00 1.28 ? 13  LYS A CD   5  
ATOM   5601  C CE   . LYS A 1 13 ? 11.971  7.209   -3.577  1.00 1.89 ? 13  LYS A CE   5  
ATOM   5602  N NZ   . LYS A 1 13 ? 12.115  8.293   -4.586  1.00 2.67 ? 13  LYS A NZ   5  
ATOM   5603  H H    . LYS A 1 13 ? 11.727  1.771   -2.714  1.00 0.28 ? 13  LYS A H    5  
ATOM   5604  H HA   . LYS A 1 13 ? 12.276  3.356   -5.064  1.00 0.25 ? 13  LYS A HA   5  
ATOM   5605  H HB2  . LYS A 1 13 ? 13.583  3.063   -2.372  1.00 0.60 ? 13  LYS A HB2  5  
ATOM   5606  H HB3  . LYS A 1 13 ? 14.378  3.952   -3.663  1.00 0.66 ? 13  LYS A HB3  5  
ATOM   5607  H HG2  . LYS A 1 13 ? 11.584  4.602   -2.796  1.00 1.52 ? 13  LYS A HG2  5  
ATOM   5608  H HG3  . LYS A 1 13 ? 12.995  5.271   -1.975  1.00 0.94 ? 13  LYS A HG3  5  
ATOM   5609  H HD2  . LYS A 1 13 ? 13.771  6.204   -4.119  1.00 1.26 ? 13  LYS A HD2  5  
ATOM   5610  H HD3  . LYS A 1 13 ? 12.319  5.574   -4.901  1.00 1.89 ? 13  LYS A HD3  5  
ATOM   5611  H HE2  . LYS A 1 13 ? 10.924  6.963   -3.473  1.00 2.36 ? 13  LYS A HE2  5  
ATOM   5612  H HE3  . LYS A 1 13 ? 12.352  7.558   -2.629  1.00 1.74 ? 13  LYS A HE3  5  
ATOM   5613  H HZ1  . LYS A 1 13 ? 13.119  8.542   -4.702  1.00 2.68 ? 13  LYS A HZ1  5  
ATOM   5614  H HZ2  . LYS A 1 13 ? 11.593  9.138   -4.280  1.00 3.10 ? 13  LYS A HZ2  5  
ATOM   5615  H HZ3  . LYS A 1 13 ? 11.739  7.979   -5.504  1.00 3.07 ? 13  LYS A HZ3  5  
ATOM   5616  N N    . THR A 1 14 ? 13.676  0.539   -4.724  1.00 0.33 ? 14  THR A N    5  
ATOM   5617  C CA   . THR A 1 14 ? 14.604  -0.437  -5.282  1.00 0.39 ? 14  THR A CA   5  
ATOM   5618  C C    . THR A 1 14 ? 13.903  -1.354  -6.278  1.00 0.41 ? 14  THR A C    5  
ATOM   5619  O O    . THR A 1 14 ? 14.551  -2.103  -7.009  1.00 0.46 ? 14  THR A O    5  
ATOM   5620  C CB   . THR A 1 14 ? 15.248  -1.296  -4.177  1.00 0.43 ? 14  THR A CB   5  
ATOM   5621  O OG1  . THR A 1 14 ? 15.800  -0.452  -3.162  1.00 0.44 ? 14  THR A OG1  5  
ATOM   5622  C CG2  . THR A 1 14 ? 16.337  -2.187  -4.752  1.00 0.50 ? 14  THR A CG2  5  
ATOM   5623  H H    . THR A 1 14 ? 12.953  0.227   -4.140  1.00 0.32 ? 14  THR A H    5  
ATOM   5624  H HA   . THR A 1 14 ? 15.388  0.102   -5.793  1.00 0.41 ? 14  THR A HA   5  
ATOM   5625  H HB   . THR A 1 14 ? 14.485  -1.922  -3.737  1.00 0.42 ? 14  THR A HB   5  
ATOM   5626  H HG1  . THR A 1 14 ? 15.102  -0.166  -2.568  1.00 0.42 ? 14  THR A HG1  5  
ATOM   5627  H HG21 . THR A 1 14 ? 15.919  -2.815  -5.525  1.00 0.50 ? 14  THR A HG21 5  
ATOM   5628  H HG22 . THR A 1 14 ? 16.748  -2.806  -3.967  1.00 0.53 ? 14  THR A HG22 5  
ATOM   5629  H HG23 . THR A 1 14 ? 17.120  -1.573  -5.172  1.00 0.51 ? 14  THR A HG23 5  
ATOM   5630  N N    . TYR A 1 15 ? 12.576  -1.288  -6.305  1.00 0.37 ? 15  TYR A N    5  
ATOM   5631  C CA   . TYR A 1 15 ? 11.788  -2.114  -7.211  1.00 0.40 ? 15  TYR A CA   5  
ATOM   5632  C C    . TYR A 1 15 ? 11.040  -1.252  -8.222  1.00 0.39 ? 15  TYR A C    5  
ATOM   5633  O O    . TYR A 1 15 ? 10.392  -1.765  -9.134  1.00 0.43 ? 15  TYR A O    5  
ATOM   5634  C CB   . TYR A 1 15 ? 10.796  -2.971  -6.421  1.00 0.39 ? 15  TYR A CB   5  
ATOM   5635  C CG   . TYR A 1 15 ? 11.452  -4.051  -5.595  1.00 0.43 ? 15  TYR A CG   5  
ATOM   5636  C CD1  . TYR A 1 15 ? 11.267  -4.110  -4.219  1.00 0.41 ? 15  TYR A CD1  5  
ATOM   5637  C CD2  . TYR A 1 15 ? 12.260  -5.013  -6.189  1.00 0.49 ? 15  TYR A CD2  5  
ATOM   5638  C CE1  . TYR A 1 15 ? 11.866  -5.097  -3.460  1.00 0.46 ? 15  TYR A CE1  5  
ATOM   5639  C CE2  . TYR A 1 15 ? 12.861  -6.005  -5.439  1.00 0.52 ? 15  TYR A CE2  5  
ATOM   5640  C CZ   . TYR A 1 15 ? 12.662  -6.043  -4.072  1.00 0.51 ? 15  TYR A CZ   5  
ATOM   5641  O OH   . TYR A 1 15 ? 13.261  -7.026  -3.321  1.00 0.56 ? 15  TYR A OH   5  
ATOM   5642  H H    . TYR A 1 15 ? 12.115  -0.670  -5.699  1.00 0.33 ? 15  TYR A H    5  
ATOM   5643  H HA   . TYR A 1 15 ? 12.467  -2.763  -7.741  1.00 0.45 ? 15  TYR A HA   5  
ATOM   5644  H HB2  . TYR A 1 15 ? 10.236  -2.336  -5.751  1.00 0.35 ? 15  TYR A HB2  5  
ATOM   5645  H HB3  . TYR A 1 15 ? 10.113  -3.447  -7.111  1.00 0.42 ? 15  TYR A HB3  5  
ATOM   5646  H HD1  . TYR A 1 15 ? 10.643  -3.371  -3.741  1.00 0.38 ? 15  TYR A HD1  5  
ATOM   5647  H HD2  . TYR A 1 15 ? 12.416  -4.981  -7.257  1.00 0.51 ? 15  TYR A HD2  5  
ATOM   5648  H HE1  . TYR A 1 15 ? 11.709  -5.126  -2.391  1.00 0.47 ? 15  TYR A HE1  5  
ATOM   5649  H HE2  . TYR A 1 15 ? 13.484  -6.743  -5.920  1.00 0.57 ? 15  TYR A HE2  5  
ATOM   5650  H HH   . TYR A 1 15 ? 12.622  -7.397  -2.708  1.00 0.57 ? 15  TYR A HH   5  
ATOM   5651  N N    . CYS A 1 16 ? 11.136  0.062   -8.054  1.00 0.35 ? 16  CYS A N    5  
ATOM   5652  C CA   . CYS A 1 16 ? 10.469  1.000   -8.952  1.00 0.36 ? 16  CYS A CA   5  
ATOM   5653  C C    . CYS A 1 16 ? 11.380  2.178   -9.282  1.00 0.37 ? 16  CYS A C    5  
ATOM   5654  O O    . CYS A 1 16 ? 11.548  2.537   -10.447 1.00 0.42 ? 16  CYS A O    5  
ATOM   5655  C CB   . CYS A 1 16 ? 9.169   1.505   -8.322  1.00 0.32 ? 16  CYS A CB   5  
ATOM   5656  S SG   . CYS A 1 16 ? 8.166   0.206   -7.561  1.00 0.32 ? 16  CYS A SG   5  
ATOM   5657  H H    . CYS A 1 16 ? 11.667  0.412   -7.310  1.00 0.33 ? 16  CYS A H    5  
ATOM   5658  H HA   . CYS A 1 16 ? 10.235  0.473   -9.866  1.00 0.41 ? 16  CYS A HA   5  
ATOM   5659  H HB2  . CYS A 1 16 ? 9.407   2.226   -7.556  1.00 0.28 ? 16  CYS A HB2  5  
ATOM   5660  H HB3  . CYS A 1 16 ? 8.570   1.981   -9.084  1.00 0.35 ? 16  CYS A HB3  5  
ATOM   5661  H HG   . CYS A 1 16 ? 8.462   0.164   -6.271  1.00 0.27 ? 16  CYS A HG   5  
ATOM   5662  N N    . GLY A 1 17 ? 11.962  2.777   -8.250  1.00 0.33 ? 17  GLY A N    5  
ATOM   5663  C CA   . GLY A 1 17 ? 12.846  3.911   -8.451  1.00 0.34 ? 17  GLY A CA   5  
ATOM   5664  C C    . GLY A 1 17 ? 12.150  5.237   -8.225  1.00 0.32 ? 17  GLY A C    5  
ATOM   5665  O O    . GLY A 1 17 ? 11.516  5.447   -7.189  1.00 0.27 ? 17  GLY A O    5  
ATOM   5666  H H    . GLY A 1 17 ? 11.789  2.448   -7.343  1.00 0.29 ? 17  GLY A H    5  
ATOM   5667  H HA2  . GLY A 1 17 ? 13.677  3.832   -7.765  1.00 0.34 ? 17  GLY A HA2  5  
ATOM   5668  H HA3  . GLY A 1 17 ? 13.224  3.883   -9.462  1.00 0.39 ? 17  GLY A HA3  5  
ATOM   5669  N N    . LYS A 1 18 ? 12.266  6.137   -9.195  1.00 0.36 ? 18  LYS A N    5  
ATOM   5670  C CA   . LYS A 1 18 ? 11.642  7.452   -9.098  1.00 0.36 ? 18  LYS A CA   5  
ATOM   5671  C C    . LYS A 1 18 ? 10.134  7.354   -9.295  1.00 0.36 ? 18  LYS A C    5  
ATOM   5672  O O    . LYS A 1 18 ? 9.383   8.237   -8.880  1.00 0.36 ? 18  LYS A O    5  
ATOM   5673  C CB   . LYS A 1 18 ? 12.243  8.402   -10.139 1.00 0.43 ? 18  LYS A CB   5  
ATOM   5674  C CG   . LYS A 1 18 ? 12.232  7.843   -11.550 1.00 0.48 ? 18  LYS A CG   5  
ATOM   5675  C CD   . LYS A 1 18 ? 13.616  7.385   -11.981 1.00 0.52 ? 18  LYS A CD   5  
ATOM   5676  C CE   . LYS A 1 18 ? 14.237  8.352   -12.976 1.00 0.58 ? 18  LYS A CE   5  
ATOM   5677  N NZ   . LYS A 1 18 ? 15.636  8.709   -12.605 1.00 0.59 ? 18  LYS A NZ   5  
ATOM   5678  H H    . LYS A 1 18 ? 12.783  5.911   -9.996  1.00 0.40 ? 18  LYS A H    5  
ATOM   5679  H HA   . LYS A 1 18 ? 11.839  7.841   -8.111  1.00 0.34 ? 18  LYS A HA   5  
ATOM   5680  H HB2  . LYS A 1 18 ? 11.679  9.323   -10.135 1.00 0.43 ? 18  LYS A HB2  5  
ATOM   5681  H HB3  . LYS A 1 18 ? 13.265  8.616   -9.865  1.00 0.43 ? 18  LYS A HB3  5  
ATOM   5682  H HG2  . LYS A 1 18 ? 11.559  6.999   -11.587 1.00 0.47 ? 18  LYS A HG2  5  
ATOM   5683  H HG3  . LYS A 1 18 ? 11.888  8.609   -12.228 1.00 0.52 ? 18  LYS A HG3  5  
ATOM   5684  H HD2  . LYS A 1 18 ? 14.252  7.323   -11.110 1.00 0.49 ? 18  LYS A HD2  5  
ATOM   5685  H HD3  . LYS A 1 18 ? 13.535  6.411   -12.441 1.00 0.53 ? 18  LYS A HD3  5  
ATOM   5686  H HE2  . LYS A 1 18 ? 14.240  7.893   -13.953 1.00 0.62 ? 18  LYS A HE2  5  
ATOM   5687  H HE3  . LYS A 1 18 ? 13.641  9.253   -13.006 1.00 0.58 ? 18  LYS A HE3  5  
ATOM   5688  H HZ1  . LYS A 1 18 ? 16.227  7.853   -12.576 1.00 0.60 ? 18  LYS A HZ1  5  
ATOM   5689  H HZ2  . LYS A 1 18 ? 15.653  9.160   -11.668 1.00 0.56 ? 18  LYS A HZ2  5  
ATOM   5690  H HZ3  . LYS A 1 18 ? 16.033  9.370   -13.304 1.00 0.64 ? 18  LYS A HZ3  5  
ATOM   5691  N N    . THR A 1 19 ? 9.692   6.273   -9.932  1.00 0.37 ? 19  THR A N    5  
ATOM   5692  C CA   . THR A 1 19 ? 8.273   6.059   -10.183 1.00 0.39 ? 19  THR A CA   5  
ATOM   5693  C C    . THR A 1 19 ? 7.535   5.699   -8.899  1.00 0.33 ? 19  THR A C    5  
ATOM   5694  O O    . THR A 1 19 ? 6.319   5.872   -8.801  1.00 0.43 ? 19  THR A O    5  
ATOM   5695  C CB   . THR A 1 19 ? 8.047   4.945   -11.223 1.00 0.46 ? 19  THR A CB   5  
ATOM   5696  O OG1  . THR A 1 19 ? 8.197   3.662   -10.603 1.00 0.53 ? 19  THR A OG1  5  
ATOM   5697  C CG2  . THR A 1 19 ? 9.031   5.073   -12.376 1.00 0.61 ? 19  THR A CG2  5  
ATOM   5698  H H    . THR A 1 19 ? 10.338  5.603   -10.239 1.00 0.39 ? 19  THR A H    5  
ATOM   5699  H HA   . THR A 1 19 ? 7.863   6.978   -10.577 1.00 0.42 ? 19  THR A HA   5  
ATOM   5700  H HB   . THR A 1 19 ? 7.043   5.032   -11.612 1.00 0.49 ? 19  THR A HB   5  
ATOM   5701  H HG1  . THR A 1 19 ? 8.616   3.055   -11.219 1.00 0.54 ? 19  THR A HG1  5  
ATOM   5702  H HG21 . THR A 1 19 ? 8.827   4.308   -13.111 1.00 0.66 ? 19  THR A HG21 5  
ATOM   5703  H HG22 . THR A 1 19 ? 10.038  4.956   -12.005 1.00 0.68 ? 19  THR A HG22 5  
ATOM   5704  H HG23 . THR A 1 19 ? 8.927   6.047   -12.831 1.00 0.69 ? 19  THR A HG23 5  
ATOM   5705  N N    . SER A 1 20 ? 8.288   5.214   -7.897  1.00 0.30 ? 20  SER A N    5  
ATOM   5706  C CA   . SER A 1 20 ? 7.722   4.804   -6.599  1.00 0.24 ? 20  SER A CA   5  
ATOM   5707  C C    . SER A 1 20 ? 6.897   5.911   -5.939  1.00 0.22 ? 20  SER A C    5  
ATOM   5708  O O    . SER A 1 20 ? 7.118   7.098   -6.186  1.00 0.26 ? 20  SER A O    5  
ATOM   5709  C CB   . SER A 1 20 ? 8.837   4.376   -5.639  1.00 0.22 ? 20  SER A CB   5  
ATOM   5710  O OG   . SER A 1 20 ? 9.588   5.488   -5.190  1.00 0.25 ? 20  SER A OG   5  
ATOM   5711  H H    . SER A 1 20 ? 9.254   5.130   -8.035  1.00 0.38 ? 20  SER A H    5  
ATOM   5712  H HA   . SER A 1 20 ? 7.078   3.957   -6.778  1.00 0.26 ? 20  SER A HA   5  
ATOM   5713  H HB2  . SER A 1 20 ? 8.404   3.885   -4.782  1.00 0.26 ? 20  SER A HB2  5  
ATOM   5714  H HB3  . SER A 1 20 ? 9.501   3.692   -6.146  1.00 0.24 ? 20  SER A HB3  5  
ATOM   5715  H HG   . SER A 1 20 ? 9.316   6.273   -5.673  1.00 0.41 ? 20  SER A HG   5  
ATOM   5716  N N    . PRO A 1 21 ? 5.918   5.521   -5.094  1.00 0.20 ? 21  PRO A N    5  
ATOM   5717  C CA   . PRO A 1 21 ? 5.055   6.475   -4.391  1.00 0.22 ? 21  PRO A CA   5  
ATOM   5718  C C    . PRO A 1 21 ? 5.801   7.229   -3.295  1.00 0.22 ? 21  PRO A C    5  
ATOM   5719  O O    . PRO A 1 21 ? 6.836   6.774   -2.805  1.00 0.24 ? 21  PRO A O    5  
ATOM   5720  C CB   . PRO A 1 21 ? 3.964   5.589   -3.783  1.00 0.23 ? 21  PRO A CB   5  
ATOM   5721  C CG   . PRO A 1 21 ? 4.589   4.246   -3.640  1.00 0.21 ? 21  PRO A CG   5  
ATOM   5722  C CD   . PRO A 1 21 ? 5.575   4.120   -4.767  1.00 0.20 ? 21  PRO A CD   5  
ATOM   5723  H HA   . PRO A 1 21 ? 4.609   7.183   -5.074  1.00 0.26 ? 21  PRO A HA   5  
ATOM   5724  H HB2  . PRO A 1 21 ? 3.665   5.983   -2.821  1.00 0.25 ? 21  PRO A HB2  5  
ATOM   5725  H HB3  . PRO A 1 21 ? 3.117   5.535   -4.446  1.00 0.26 ? 21  PRO A HB3  5  
ATOM   5726  H HG2  . PRO A 1 21 ? 5.093   4.178   -2.685  1.00 0.21 ? 21  PRO A HG2  5  
ATOM   5727  H HG3  . PRO A 1 21 ? 3.836   3.479   -3.724  1.00 0.24 ? 21  PRO A HG3  5  
ATOM   5728  H HD2  . PRO A 1 21 ? 6.449   3.578   -4.440  1.00 0.21 ? 21  PRO A HD2  5  
ATOM   5729  H HD3  . PRO A 1 21 ? 5.120   3.629   -5.611  1.00 0.24 ? 21  PRO A HD3  5  
ATOM   5730  N N    . SER A 1 22 ? 5.266   8.380   -2.914  1.00 0.24 ? 22  SER A N    5  
ATOM   5731  C CA   . SER A 1 22 ? 5.878   9.204   -1.882  1.00 0.26 ? 22  SER A CA   5  
ATOM   5732  C C    . SER A 1 22 ? 5.405   8.790   -0.493  1.00 0.23 ? 22  SER A C    5  
ATOM   5733  O O    . SER A 1 22 ? 4.484   7.982   -0.352  1.00 0.23 ? 22  SER A O    5  
ATOM   5734  C CB   . SER A 1 22 ? 5.550   10.679  -2.126  1.00 0.31 ? 22  SER A CB   5  
ATOM   5735  O OG   . SER A 1 22 ? 4.149   10.897  -2.133  1.00 0.32 ? 22  SER A OG   5  
ATOM   5736  H H    . SER A 1 22 ? 4.437   8.685   -3.338  1.00 0.26 ? 22  SER A H    5  
ATOM   5737  H HA   . SER A 1 22 ? 6.948   9.070   -1.940  1.00 0.29 ? 22  SER A HA   5  
ATOM   5738  H HB2  . SER A 1 22 ? 5.989   11.277  -1.342  1.00 0.34 ? 22  SER A HB2  5  
ATOM   5739  H HB3  . SER A 1 22 ? 5.955   10.982  -3.080  1.00 0.35 ? 22  SER A HB3  5  
ATOM   5740  H HG   . SER A 1 22 ? 3.875   11.192  -3.005  1.00 0.54 ? 22  SER A HG   5  
ATOM   5741  N N    . LYS A 1 23 ? 6.045   9.351   0.530   1.00 0.24 ? 23  LYS A N    5  
ATOM   5742  C CA   . LYS A 1 23 ? 5.693   9.062   1.915   1.00 0.25 ? 23  LYS A CA   5  
ATOM   5743  C C    . LYS A 1 23 ? 4.330   9.672   2.253   1.00 0.23 ? 23  LYS A C    5  
ATOM   5744  O O    . LYS A 1 23 ? 3.622   9.190   3.139   1.00 0.26 ? 23  LYS A O    5  
ATOM   5745  C CB   . LYS A 1 23 ? 6.786   9.606   2.848   1.00 0.29 ? 23  LYS A CB   5  
ATOM   5746  C CG   . LYS A 1 23 ? 6.512   9.403   4.332   1.00 0.41 ? 23  LYS A CG   5  
ATOM   5747  C CD   . LYS A 1 23 ? 5.996   10.679  4.980   1.00 0.87 ? 23  LYS A CD   5  
ATOM   5748  C CE   . LYS A 1 23 ? 5.908   10.545  6.489   1.00 1.02 ? 23  LYS A CE   5  
ATOM   5749  N NZ   . LYS A 1 23 ? 5.588   11.846  7.139   1.00 1.62 ? 23  LYS A NZ   5  
ATOM   5750  H H    . LYS A 1 23 ? 6.776   9.979   0.346   1.00 0.26 ? 23  LYS A H    5  
ATOM   5751  H HA   . LYS A 1 23 ? 5.633   7.989   2.026   1.00 0.27 ? 23  LYS A HA   5  
ATOM   5752  H HB2  . LYS A 1 23 ? 7.717   9.112   2.611   1.00 0.35 ? 23  LYS A HB2  5  
ATOM   5753  H HB3  . LYS A 1 23 ? 6.898   10.664  2.668   1.00 0.34 ? 23  LYS A HB3  5  
ATOM   5754  H HG2  . LYS A 1 23 ? 5.772   8.627   4.450   1.00 0.71 ? 23  LYS A HG2  5  
ATOM   5755  H HG3  . LYS A 1 23 ? 7.428   9.108   4.821   1.00 0.67 ? 23  LYS A HG3  5  
ATOM   5756  H HD2  . LYS A 1 23 ? 6.665   11.490  4.741   1.00 1.16 ? 23  LYS A HD2  5  
ATOM   5757  H HD3  . LYS A 1 23 ? 5.012   10.896  4.589   1.00 1.26 ? 23  LYS A HD3  5  
ATOM   5758  H HE2  . LYS A 1 23 ? 5.133   9.831   6.732   1.00 1.11 ? 23  LYS A HE2  5  
ATOM   5759  H HE3  . LYS A 1 23 ? 6.856   10.189  6.863   1.00 1.06 ? 23  LYS A HE3  5  
ATOM   5760  H HZ1  . LYS A 1 23 ? 5.535   11.727  8.171   1.00 1.74 ? 23  LYS A HZ1  5  
ATOM   5761  H HZ2  . LYS A 1 23 ? 4.673   12.201  6.795   1.00 1.95 ? 23  LYS A HZ2  5  
ATOM   5762  H HZ3  . LYS A 1 23 ? 6.324   12.545  6.916   1.00 1.88 ? 23  LYS A HZ3  5  
ATOM   5763  N N    . LYS A 1 24 ? 3.966   10.723  1.520   1.00 0.20 ? 24  LYS A N    5  
ATOM   5764  C CA   . LYS A 1 24 ? 2.692   11.406  1.723   1.00 0.21 ? 24  LYS A CA   5  
ATOM   5765  C C    . LYS A 1 24 ? 1.529   10.563  1.202   1.00 0.20 ? 24  LYS A C    5  
ATOM   5766  O O    . LYS A 1 24 ? 0.436   10.586  1.766   1.00 0.22 ? 24  LYS A O    5  
ATOM   5767  C CB   . LYS A 1 24 ? 2.704   12.767  1.025   1.00 0.24 ? 24  LYS A CB   5  
ATOM   5768  C CG   . LYS A 1 24 ? 3.644   13.773  1.670   1.00 0.43 ? 24  LYS A CG   5  
ATOM   5769  C CD   . LYS A 1 24 ? 3.706   15.071  0.879   1.00 0.79 ? 24  LYS A CD   5  
ATOM   5770  C CE   . LYS A 1 24 ? 4.658   14.965  -0.303  1.00 1.35 ? 24  LYS A CE   5  
ATOM   5771  N NZ   . LYS A 1 24 ? 6.070   14.786  0.134   1.00 2.01 ? 24  LYS A NZ   5  
ATOM   5772  H H    . LYS A 1 24 ? 4.572   11.048  0.822   1.00 0.20 ? 24  LYS A H    5  
ATOM   5773  H HA   . LYS A 1 24 ? 2.563   11.557  2.785   1.00 0.24 ? 24  LYS A HA   5  
ATOM   5774  H HB2  . LYS A 1 24 ? 3.008   12.629  -0.002  1.00 0.37 ? 24  LYS A HB2  5  
ATOM   5775  H HB3  . LYS A 1 24 ? 1.706   13.176  1.044   1.00 0.38 ? 24  LYS A HB3  5  
ATOM   5776  H HG2  . LYS A 1 24 ? 3.295   13.989  2.669   1.00 0.80 ? 24  LYS A HG2  5  
ATOM   5777  H HG3  . LYS A 1 24 ? 4.635   13.345  1.719   1.00 0.81 ? 24  LYS A HG3  5  
ATOM   5778  H HD2  . LYS A 1 24 ? 2.717   15.304  0.510   1.00 1.14 ? 24  LYS A HD2  5  
ATOM   5779  H HD3  . LYS A 1 24 ? 4.043   15.864  1.531   1.00 0.95 ? 24  LYS A HD3  5  
ATOM   5780  H HE2  . LYS A 1 24 ? 4.367   14.119  -0.907  1.00 1.59 ? 24  LYS A HE2  5  
ATOM   5781  H HE3  . LYS A 1 24 ? 4.583   15.869  -0.891  1.00 1.51 ? 24  LYS A HE3  5  
ATOM   5782  H HZ1  . LYS A 1 24 ? 6.178   13.879  0.632   1.00 2.09 ? 24  LYS A HZ1  5  
ATOM   5783  H HZ2  . LYS A 1 24 ? 6.348   15.554  0.775   1.00 2.20 ? 24  LYS A HZ2  5  
ATOM   5784  H HZ3  . LYS A 1 24 ? 6.703   14.792  -0.692  1.00 2.49 ? 24  LYS A HZ3  5  
ATOM   5785  N N    . GLU A 1 25 ? 1.775   9.821   0.122   1.00 0.18 ? 25  GLU A N    5  
ATOM   5786  C CA   . GLU A 1 25 ? 0.752   8.968   -0.473  1.00 0.17 ? 25  GLU A CA   5  
ATOM   5787  C C    . GLU A 1 25 ? 0.470   7.759   0.413   1.00 0.16 ? 25  GLU A C    5  
ATOM   5788  O O    . GLU A 1 25 ? -0.645  7.587   0.909   1.00 0.17 ? 25  GLU A O    5  
ATOM   5789  C CB   . GLU A 1 25 ? 1.192   8.503   -1.863  1.00 0.17 ? 25  GLU A CB   5  
ATOM   5790  C CG   . GLU A 1 25 ? 0.314   9.026   -2.987  1.00 0.19 ? 25  GLU A CG   5  
ATOM   5791  C CD   . GLU A 1 25 ? 0.539   8.291   -4.292  1.00 0.18 ? 25  GLU A CD   5  
ATOM   5792  O OE1  . GLU A 1 25 ? 0.328   8.904   -5.362  1.00 0.26 ? 25  GLU A OE1  5  
ATOM   5793  O OE2  . GLU A 1 25 ? 0.924   7.105   -4.249  1.00 0.21 ? 25  GLU A OE2  5  
ATOM   5794  H H    . GLU A 1 25 ? 2.667   9.849   -0.283  1.00 0.18 ? 25  GLU A H    5  
ATOM   5795  H HA   . GLU A 1 25 ? -0.151  9.550   -0.567  1.00 0.17 ? 25  GLU A HA   5  
ATOM   5796  H HB2  . GLU A 1 25 ? 2.204   8.839   -2.039  1.00 0.19 ? 25  GLU A HB2  5  
ATOM   5797  H HB3  . GLU A 1 25 ? 1.171   7.423   -1.892  1.00 0.18 ? 25  GLU A HB3  5  
ATOM   5798  H HG2  . GLU A 1 25 ? -0.720  8.911   -2.700  1.00 0.23 ? 25  GLU A HG2  5  
ATOM   5799  H HG3  . GLU A 1 25 ? 0.531   10.074  -3.137  1.00 0.23 ? 25  GLU A HG3  5  
ATOM   5800  N N    . ILE A 1 26 ? 1.486   6.926   0.611   1.00 0.16 ? 26  ILE A N    5  
ATOM   5801  C CA   . ILE A 1 26 ? 1.344   5.733   1.437   1.00 0.15 ? 26  ILE A CA   5  
ATOM   5802  C C    . ILE A 1 26 ? 0.757   6.077   2.801   1.00 0.15 ? 26  ILE A C    5  
ATOM   5803  O O    . ILE A 1 26 ? -0.165  5.415   3.275   1.00 0.14 ? 26  ILE A O    5  
ATOM   5804  C CB   . ILE A 1 26 ? 2.700   5.026   1.637   1.00 0.16 ? 26  ILE A CB   5  
ATOM   5805  C CG1  . ILE A 1 26 ? 3.279   4.598   0.289   1.00 0.16 ? 26  ILE A CG1  5  
ATOM   5806  C CG2  . ILE A 1 26 ? 2.537   3.824   2.557   1.00 0.15 ? 26  ILE A CG2  5  
ATOM   5807  C CD1  . ILE A 1 26 ? 4.616   3.896   0.402   1.00 0.17 ? 26  ILE A CD1  5  
ATOM   5808  H H    . ILE A 1 26 ? 2.349   7.117   0.190   1.00 0.17 ? 26  ILE A H    5  
ATOM   5809  H HA   . ILE A 1 26 ? 0.678   5.051   0.930   1.00 0.14 ? 26  ILE A HA   5  
ATOM   5810  H HB   . ILE A 1 26 ? 3.378   5.721   2.109   1.00 0.17 ? 26  ILE A HB   5  
ATOM   5811  H HG12 . ILE A 1 26 ? 2.590   3.921   -0.194  1.00 0.15 ? 26  ILE A HG12 5  
ATOM   5812  H HG13 . ILE A 1 26 ? 3.413   5.471   -0.333  1.00 0.16 ? 26  ILE A HG13 5  
ATOM   5813  H HG21 . ILE A 1 26 ? 2.210   4.159   3.529   1.00 0.15 ? 26  ILE A HG21 5  
ATOM   5814  H HG22 . ILE A 1 26 ? 3.483   3.313   2.650   1.00 0.16 ? 26  ILE A HG22 5  
ATOM   5815  H HG23 . ILE A 1 26 ? 1.803   3.150   2.141   1.00 0.14 ? 26  ILE A HG23 5  
ATOM   5816  H HD11 . ILE A 1 26 ? 4.507   3.010   1.010   1.00 0.16 ? 26  ILE A HD11 5  
ATOM   5817  H HD12 . ILE A 1 26 ? 5.334   4.561   0.858   1.00 0.19 ? 26  ILE A HD12 5  
ATOM   5818  H HD13 . ILE A 1 26 ? 4.960   3.616   -0.583  1.00 0.17 ? 26  ILE A HD13 5  
ATOM   5819  N N    . GLY A 1 27 ? 1.296   7.119   3.427   1.00 0.16 ? 27  GLY A N    5  
ATOM   5820  C CA   . GLY A 1 27 ? 0.812   7.533   4.731   1.00 0.16 ? 27  GLY A CA   5  
ATOM   5821  C C    . GLY A 1 27 ? -0.691  7.735   4.753   1.00 0.15 ? 27  GLY A C    5  
ATOM   5822  O O    . GLY A 1 27 ? -1.361  7.354   5.713   1.00 0.15 ? 27  GLY A O    5  
ATOM   5823  H H    . GLY A 1 27 ? 2.030   7.610   3.000   1.00 0.17 ? 27  GLY A H    5  
ATOM   5824  H HA2  . GLY A 1 27 ? 1.074   6.778   5.457   1.00 0.16 ? 27  GLY A HA2  5  
ATOM   5825  H HA3  . GLY A 1 27 ? 1.292   8.462   5.003   1.00 0.17 ? 27  GLY A HA3  5  
ATOM   5826  N N    . ALA A 1 28 ? -1.222  8.335   3.693   1.00 0.15 ? 28  ALA A N    5  
ATOM   5827  C CA   . ALA A 1 28 ? -2.653  8.585   3.594   1.00 0.14 ? 28  ALA A CA   5  
ATOM   5828  C C    . ALA A 1 28 ? -3.421  7.295   3.325   1.00 0.13 ? 28  ALA A C    5  
ATOM   5829  O O    . ALA A 1 28 ? -4.476  7.054   3.910   1.00 0.12 ? 28  ALA A O    5  
ATOM   5830  C CB   . ALA A 1 28 ? -2.938  9.608   2.503   1.00 0.15 ? 28  ALA A CB   5  
ATOM   5831  H H    . ALA A 1 28 ? -0.636  8.614   2.958   1.00 0.16 ? 28  ALA A H    5  
ATOM   5832  H HA   . ALA A 1 28 ? -2.985  8.999   4.536   1.00 0.15 ? 28  ALA A HA   5  
ATOM   5833  H HB1  . ALA A 1 28 ? -3.996  9.822   2.477   1.00 0.14 ? 28  ALA A HB1  5  
ATOM   5834  H HB2  . ALA A 1 28 ? -2.629  9.209   1.547   1.00 0.14 ? 28  ALA A HB2  5  
ATOM   5835  H HB3  . ALA A 1 28 ? -2.391  10.516  2.708   1.00 0.16 ? 28  ALA A HB3  5  
ATOM   5836  N N    . MET A 1 29 ? -2.882  6.469   2.434   1.00 0.13 ? 29  MET A N    5  
ATOM   5837  C CA   . MET A 1 29 ? -3.515  5.201   2.088   1.00 0.11 ? 29  MET A CA   5  
ATOM   5838  C C    . MET A 1 29 ? -3.621  4.295   3.309   1.00 0.11 ? 29  MET A C    5  
ATOM   5839  O O    . MET A 1 29 ? -4.618  3.594   3.491   1.00 0.10 ? 29  MET A O    5  
ATOM   5840  C CB   . MET A 1 29 ? -2.726  4.498   0.982   1.00 0.11 ? 29  MET A CB   5  
ATOM   5841  C CG   . MET A 1 29 ? -3.344  3.182   0.538   1.00 0.10 ? 29  MET A CG   5  
ATOM   5842  S SD   . MET A 1 29 ? -2.107  1.951   0.081   1.00 0.10 ? 29  MET A SD   5  
ATOM   5843  C CE   . MET A 1 29 ? -1.229  1.763   1.631   1.00 0.11 ? 29  MET A CE   5  
ATOM   5844  H H    . MET A 1 29 ? -2.039  6.717   1.999   1.00 0.13 ? 29  MET A H    5  
ATOM   5845  H HA   . MET A 1 29 ? -4.509  5.417   1.727   1.00 0.11 ? 29  MET A HA   5  
ATOM   5846  H HB2  . MET A 1 29 ? -2.668  5.151   0.124   1.00 0.12 ? 29  MET A HB2  5  
ATOM   5847  H HB3  . MET A 1 29 ? -1.727  4.299   1.339   1.00 0.12 ? 29  MET A HB3  5  
ATOM   5848  H HG2  . MET A 1 29 ? -3.939  2.788   1.349   1.00 0.10 ? 29  MET A HG2  5  
ATOM   5849  H HG3  . MET A 1 29 ? -3.980  3.368   -0.315  1.00 0.10 ? 29  MET A HG3  5  
ATOM   5850  H HE1  . MET A 1 29 ? -0.592  2.621   1.792   1.00 0.12 ? 29  MET A HE1  5  
ATOM   5851  H HE2  . MET A 1 29 ? -0.627  0.867   1.598   1.00 0.11 ? 29  MET A HE2  5  
ATOM   5852  H HE3  . MET A 1 29 ? -1.942  1.688   2.439   1.00 0.11 ? 29  MET A HE3  5  
ATOM   5853  N N    . LEU A 1 30 ? -2.588  4.310   4.145   1.00 0.12 ? 30  LEU A N    5  
ATOM   5854  C CA   . LEU A 1 30 ? -2.564  3.489   5.350   1.00 0.12 ? 30  LEU A CA   5  
ATOM   5855  C C    . LEU A 1 30 ? -3.722  3.847   6.275   1.00 0.12 ? 30  LEU A C    5  
ATOM   5856  O O    . LEU A 1 30 ? -4.491  2.979   6.689   1.00 0.11 ? 30  LEU A O    5  
ATOM   5857  C CB   . LEU A 1 30 ? -1.236  3.666   6.085   1.00 0.13 ? 30  LEU A CB   5  
ATOM   5858  C CG   . LEU A 1 30 ? -0.257  2.494   5.992   1.00 0.13 ? 30  LEU A CG   5  
ATOM   5859  C CD1  . LEU A 1 30 ? 0.120   2.227   4.545   1.00 0.13 ? 30  LEU A CD1  5  
ATOM   5860  C CD2  . LEU A 1 30 ? 0.986   2.770   6.827   1.00 0.15 ? 30  LEU A CD2  5  
ATOM   5861  H H    . LEU A 1 30 ? -1.822  4.889   3.945   1.00 0.13 ? 30  LEU A H    5  
ATOM   5862  H HA   . LEU A 1 30 ? -2.665  2.457   5.050   1.00 0.11 ? 30  LEU A HA   5  
ATOM   5863  H HB2  . LEU A 1 30 ? -0.748  4.543   5.688   1.00 0.14 ? 30  LEU A HB2  5  
ATOM   5864  H HB3  . LEU A 1 30 ? -1.451  3.840   7.129   1.00 0.14 ? 30  LEU A HB3  5  
ATOM   5865  H HG   . LEU A 1 30 ? -0.731  1.606   6.382   1.00 0.13 ? 30  LEU A HG   5  
ATOM   5866  H HD11 . LEU A 1 30 ? 0.413   3.152   4.072   1.00 0.13 ? 30  LEU A HD11 5  
ATOM   5867  H HD12 . LEU A 1 30 ? -0.728  1.808   4.024   1.00 0.12 ? 30  LEU A HD12 5  
ATOM   5868  H HD13 . LEU A 1 30 ? 0.943   1.528   4.510   1.00 0.13 ? 30  LEU A HD13 5  
ATOM   5869  H HD21 . LEU A 1 30 ? 1.651   1.921   6.775   1.00 0.15 ? 30  LEU A HD21 5  
ATOM   5870  H HD22 . LEU A 1 30 ? 0.699   2.941   7.854   1.00 0.16 ? 30  LEU A HD22 5  
ATOM   5871  H HD23 . LEU A 1 30 ? 1.490   3.646   6.444   1.00 0.15 ? 30  LEU A HD23 5  
ATOM   5872  N N    . SER A 1 31 ? -3.843  5.133   6.594   1.00 0.13 ? 31  SER A N    5  
ATOM   5873  C CA   . SER A 1 31 ? -4.908  5.606   7.473   1.00 0.13 ? 31  SER A CA   5  
ATOM   5874  C C    . SER A 1 31 ? -6.271  5.134   6.976   1.00 0.12 ? 31  SER A C    5  
ATOM   5875  O O    . SER A 1 31 ? -7.192  4.920   7.765   1.00 0.12 ? 31  SER A O    5  
ATOM   5876  C CB   . SER A 1 31 ? -4.883  7.133   7.559   1.00 0.14 ? 31  SER A CB   5  
ATOM   5877  O OG   . SER A 1 31 ? -6.139  7.639   7.979   1.00 0.14 ? 31  SER A OG   5  
ATOM   5878  H H    . SER A 1 31 ? -3.202  5.778   6.229   1.00 0.13 ? 31  SER A H    5  
ATOM   5879  H HA   . SER A 1 31 ? -4.733  5.195   8.456   1.00 0.13 ? 31  SER A HA   5  
ATOM   5880  H HB2  . SER A 1 31 ? -4.130  7.440   8.270   1.00 0.15 ? 31  SER A HB2  5  
ATOM   5881  H HB3  . SER A 1 31 ? -4.649  7.543   6.587   1.00 0.14 ? 31  SER A HB3  5  
ATOM   5882  H HG   . SER A 1 31 ? -6.676  6.921   8.319   1.00 0.13 ? 31  SER A HG   5  
ATOM   5883  N N    . LEU A 1 32 ? -6.393  4.976   5.663   1.00 0.11 ? 32  LEU A N    5  
ATOM   5884  C CA   . LEU A 1 32 ? -7.644  4.531   5.059   1.00 0.10 ? 32  LEU A CA   5  
ATOM   5885  C C    . LEU A 1 32 ? -7.807  3.020   5.194   1.00 0.09 ? 32  LEU A C    5  
ATOM   5886  O O    . LEU A 1 32 ? -8.917  2.517   5.363   1.00 0.09 ? 32  LEU A O    5  
ATOM   5887  C CB   . LEU A 1 32 ? -7.692  4.930   3.584   1.00 0.10 ? 32  LEU A CB   5  
ATOM   5888  C CG   . LEU A 1 32 ? -8.983  4.592   2.838   1.00 0.09 ? 32  LEU A CG   5  
ATOM   5889  C CD1  . LEU A 1 32 ? -8.988  3.133   2.412   1.00 0.08 ? 32  LEU A CD1  5  
ATOM   5890  C CD2  . LEU A 1 32 ? -10.195 4.901   3.704   1.00 0.09 ? 32  LEU A CD2  5  
ATOM   5891  H H    . LEU A 1 32 ? -5.623  5.164   5.085   1.00 0.11 ? 32  LEU A H    5  
ATOM   5892  H HA   . LEU A 1 32 ? -8.452  5.018   5.581   1.00 0.10 ? 32  LEU A HA   5  
ATOM   5893  H HB2  . LEU A 1 32 ? -7.538  5.997   3.520   1.00 0.10 ? 32  LEU A HB2  5  
ATOM   5894  H HB3  . LEU A 1 32 ? -6.874  4.439   3.077   1.00 0.09 ? 32  LEU A HB3  5  
ATOM   5895  H HG   . LEU A 1 32 ? -9.046  5.199   1.946   1.00 0.09 ? 32  LEU A HG   5  
ATOM   5896  H HD11 . LEU A 1 32 ? -8.132  2.938   1.783   1.00 0.08 ? 32  LEU A HD11 5  
ATOM   5897  H HD12 . LEU A 1 32 ? -9.893  2.920   1.863   1.00 0.08 ? 32  LEU A HD12 5  
ATOM   5898  H HD13 . LEU A 1 32 ? -8.941  2.502   3.288   1.00 0.08 ? 32  LEU A HD13 5  
ATOM   5899  H HD21 . LEU A 1 32 ? -11.096 4.631   3.173   1.00 0.09 ? 32  LEU A HD21 5  
ATOM   5900  H HD22 . LEU A 1 32 ? -10.214 5.955   3.931   1.00 0.10 ? 32  LEU A HD22 5  
ATOM   5901  H HD23 . LEU A 1 32 ? -10.136 4.336   4.621   1.00 0.09 ? 32  LEU A HD23 5  
ATOM   5902  N N    . LEU A 1 33 ? -6.691  2.302   5.121   1.00 0.09 ? 33  LEU A N    5  
ATOM   5903  C CA   . LEU A 1 33 ? -6.708  0.849   5.237   1.00 0.08 ? 33  LEU A CA   5  
ATOM   5904  C C    . LEU A 1 33 ? -6.938  0.420   6.683   1.00 0.09 ? 33  LEU A C    5  
ATOM   5905  O O    . LEU A 1 33 ? -7.121  -0.763  6.967   1.00 0.09 ? 33  LEU A O    5  
ATOM   5906  C CB   . LEU A 1 33 ? -5.393  0.259   4.723   1.00 0.08 ? 33  LEU A CB   5  
ATOM   5907  C CG   . LEU A 1 33 ? -5.388  -0.197  3.262   1.00 0.08 ? 33  LEU A CG   5  
ATOM   5908  C CD1  . LEU A 1 33 ? -3.995  -0.653  2.851   1.00 0.08 ? 33  LEU A CD1  5  
ATOM   5909  C CD2  . LEU A 1 33 ? -6.402  -1.310  3.047   1.00 0.07 ? 33  LEU A CD2  5  
ATOM   5910  H H    . LEU A 1 33 ? -5.835  2.761   4.986   1.00 0.10 ? 33  LEU A H    5  
ATOM   5911  H HA   . LEU A 1 33 ? -7.521  0.480   4.632   1.00 0.08 ? 33  LEU A HA   5  
ATOM   5912  H HB2  . LEU A 1 33 ? -4.621  1.005   4.845   1.00 0.09 ? 33  LEU A HB2  5  
ATOM   5913  H HB3  . LEU A 1 33 ? -5.144  -0.590  5.340   1.00 0.09 ? 33  LEU A HB3  5  
ATOM   5914  H HG   . LEU A 1 33 ? -5.664  0.637   2.631   1.00 0.08 ? 33  LEU A HG   5  
ATOM   5915  H HD11 . LEU A 1 33 ? -4.053  -1.187  1.913   1.00 0.09 ? 33  LEU A HD11 5  
ATOM   5916  H HD12 . LEU A 1 33 ? -3.590  -1.304  3.611   1.00 0.10 ? 33  LEU A HD12 5  
ATOM   5917  H HD13 . LEU A 1 33 ? -3.354  0.207   2.736   1.00 0.10 ? 33  LEU A HD13 5  
ATOM   5918  H HD21 . LEU A 1 33 ? -6.001  -2.239  3.422   1.00 0.07 ? 33  LEU A HD21 5  
ATOM   5919  H HD22 . LEU A 1 33 ? -6.610  -1.404  1.993   1.00 0.06 ? 33  LEU A HD22 5  
ATOM   5920  H HD23 . LEU A 1 33 ? -7.315  -1.074  3.572   1.00 0.07 ? 33  LEU A HD23 5  
ATOM   5921  N N    . GLN A 1 34 ? -6.929  1.390   7.592   1.00 0.10 ? 34  GLN A N    5  
ATOM   5922  C CA   . GLN A 1 34 ? -7.138  1.114   9.008   1.00 0.11 ? 34  GLN A CA   5  
ATOM   5923  C C    . GLN A 1 34 ? -8.539  1.530   9.442   1.00 0.11 ? 34  GLN A C    5  
ATOM   5924  O O    . GLN A 1 34 ? -9.120  0.940   10.354  1.00 0.12 ? 34  GLN A O    5  
ATOM   5925  C CB   . GLN A 1 34 ? -6.091  1.843   9.851   1.00 0.12 ? 34  GLN A CB   5  
ATOM   5926  C CG   . GLN A 1 34 ? -4.660  1.541   9.440   1.00 0.13 ? 34  GLN A CG   5  
ATOM   5927  C CD   . GLN A 1 34 ? -3.759  1.261   10.625  1.00 0.14 ? 34  GLN A CD   5  
ATOM   5928  O OE1  . GLN A 1 34 ? -3.901  1.870   11.687  1.00 0.15 ? 34  GLN A OE1  5  
ATOM   5929  N NE2  . GLN A 1 34 ? -2.824  0.333   10.453  1.00 0.14 ? 34  GLN A NE2  5  
ATOM   5930  H H    . GLN A 1 34 ? -6.776  2.314   7.302   1.00 0.10 ? 34  GLN A H    5  
ATOM   5931  H HA   . GLN A 1 34 ? -7.030  0.050   9.156   1.00 0.11 ? 34  GLN A HA   5  
ATOM   5932  H HB2  . GLN A 1 34 ? -6.252  2.907   9.762   1.00 0.13 ? 34  GLN A HB2  5  
ATOM   5933  H HB3  . GLN A 1 34 ? -6.215  1.555   10.884  1.00 0.13 ? 34  GLN A HB3  5  
ATOM   5934  H HG2  . GLN A 1 34 ? -4.658  0.675   8.795   1.00 0.12 ? 34  GLN A HG2  5  
ATOM   5935  H HG3  . GLN A 1 34 ? -4.267  2.391   8.900   1.00 0.13 ? 34  GLN A HG3  5  
ATOM   5936  H HE21 . GLN A 1 34 ? -2.768  -0.112  9.582   1.00 0.13 ? 34  GLN A HE21 5  
ATOM   5937  H HE22 . GLN A 1 34 ? -2.229  0.132   11.204  1.00 0.15 ? 34  GLN A HE22 5  
ATOM   5938  N N    . LYS A 1 35 ? -9.079  2.550   8.783   1.00 0.11 ? 35  LYS A N    5  
ATOM   5939  C CA   . LYS A 1 35 ? -10.414 3.044   9.098   1.00 0.11 ? 35  LYS A CA   5  
ATOM   5940  C C    . LYS A 1 35 ? -11.487 2.144   8.494   1.00 0.11 ? 35  LYS A C    5  
ATOM   5941  O O    . LYS A 1 35 ? -12.539 1.927   9.095   1.00 0.11 ? 35  LYS A O    5  
ATOM   5942  C CB   . LYS A 1 35 ? -10.584 4.475   8.585   1.00 0.12 ? 35  LYS A CB   5  
ATOM   5943  C CG   . LYS A 1 35 ? -10.799 4.560   7.084   1.00 0.11 ? 35  LYS A CG   5  
ATOM   5944  C CD   . LYS A 1 35 ? -10.996 5.997   6.629   1.00 0.11 ? 35  LYS A CD   5  
ATOM   5945  C CE   . LYS A 1 35 ? -12.328 6.179   5.917   1.00 0.11 ? 35  LYS A CE   5  
ATOM   5946  N NZ   . LYS A 1 35 ? -12.981 7.466   6.283   1.00 0.12 ? 35  LYS A NZ   5  
ATOM   5947  H H    . LYS A 1 35 ? -8.566  2.980   8.066   1.00 0.11 ? 35  LYS A H    5  
ATOM   5948  H HA   . LYS A 1 35 ? -10.523 3.042   10.172  1.00 0.12 ? 35  LYS A HA   5  
ATOM   5949  H HB2  . LYS A 1 35 ? -11.435 4.923   9.075   1.00 0.12 ? 35  LYS A HB2  5  
ATOM   5950  H HB3  . LYS A 1 35 ? -9.698  5.042   8.832   1.00 0.12 ? 35  LYS A HB3  5  
ATOM   5951  H HG2  . LYS A 1 35 ? -9.936  4.149   6.585   1.00 0.10 ? 35  LYS A HG2  5  
ATOM   5952  H HG3  . LYS A 1 35 ? -11.675 3.984   6.823   1.00 0.10 ? 35  LYS A HG3  5  
ATOM   5953  H HD2  . LYS A 1 35 ? -10.973 6.643   7.494   1.00 0.12 ? 35  LYS A HD2  5  
ATOM   5954  H HD3  . LYS A 1 35 ? -10.197 6.266   5.956   1.00 0.11 ? 35  LYS A HD3  5  
ATOM   5955  H HE2  . LYS A 1 35 ? -12.156 6.164   4.850   1.00 0.11 ? 35  LYS A HE2  5  
ATOM   5956  H HE3  . LYS A 1 35 ? -12.982 5.363   6.187   1.00 0.11 ? 35  LYS A HE3  5  
ATOM   5957  H HZ1  . LYS A 1 35 ? -13.160 7.496   7.307   1.00 0.13 ? 35  LYS A HZ1  5  
ATOM   5958  H HZ2  . LYS A 1 35 ? -13.887 7.562   5.781   1.00 0.12 ? 35  LYS A HZ2  5  
ATOM   5959  H HZ3  . LYS A 1 35 ? -12.367 8.264   6.025   1.00 0.12 ? 35  LYS A HZ3  5  
ATOM   5960  N N    . GLU A 1 36 ? -11.212 1.625   7.301   1.00 0.10 ? 36  GLU A N    5  
ATOM   5961  C CA   . GLU A 1 36 ? -12.155 0.748   6.616   1.00 0.09 ? 36  GLU A CA   5  
ATOM   5962  C C    . GLU A 1 36 ? -12.225 -0.615  7.298   1.00 0.09 ? 36  GLU A C    5  
ATOM   5963  O O    . GLU A 1 36 ? -13.086 -1.436  6.984   1.00 0.09 ? 36  GLU A O    5  
ATOM   5964  C CB   . GLU A 1 36 ? -11.751 0.576   5.151   1.00 0.08 ? 36  GLU A CB   5  
ATOM   5965  C CG   . GLU A 1 36 ? -11.754 1.874   4.362   1.00 0.08 ? 36  GLU A CG   5  
ATOM   5966  C CD   . GLU A 1 36 ? -13.150 2.426   4.150   1.00 0.09 ? 36  GLU A CD   5  
ATOM   5967  O OE1  . GLU A 1 36 ? -13.275 3.493   3.513   1.00 0.09 ? 36  GLU A OE1  5  
ATOM   5968  O OE2  . GLU A 1 36 ? -14.116 1.793   4.621   1.00 0.09 ? 36  GLU A OE2  5  
ATOM   5969  H H    . GLU A 1 36 ? -10.357 1.836   6.872   1.00 0.09 ? 36  GLU A H    5  
ATOM   5970  H HA   . GLU A 1 36 ? -13.130 1.210   6.660   1.00 0.10 ? 36  GLU A HA   5  
ATOM   5971  H HB2  . GLU A 1 36 ? -10.757 0.157   5.110   1.00 0.08 ? 36  GLU A HB2  5  
ATOM   5972  H HB3  . GLU A 1 36 ? -12.440 -0.110  4.677   1.00 0.08 ? 36  GLU A HB3  5  
ATOM   5973  H HG2  . GLU A 1 36 ? -11.173 2.606   4.900   1.00 0.09 ? 36  GLU A HG2  5  
ATOM   5974  H HG3  . GLU A 1 36 ? -11.302 1.696   3.397   1.00 0.08 ? 36  GLU A HG3  5  
ATOM   5975  N N    . GLY A 1 37 ? -11.313 -0.847  8.238   1.00 0.10 ? 37  GLY A N    5  
ATOM   5976  C CA   . GLY A 1 37 ? -11.288 -2.112  8.951   1.00 0.10 ? 37  GLY A CA   5  
ATOM   5977  C C    . GLY A 1 37 ? -10.580 -3.202  8.172   1.00 0.09 ? 37  GLY A C    5  
ATOM   5978  O O    . GLY A 1 37 ? -10.570 -4.363  8.585   1.00 0.10 ? 37  GLY A O    5  
ATOM   5979  H H    . GLY A 1 37 ? -10.653 -0.155  8.449   1.00 0.10 ? 37  GLY A H    5  
ATOM   5980  H HA2  . GLY A 1 37 ? -10.781 -1.972  9.895   1.00 0.11 ? 37  GLY A HA2  5  
ATOM   5981  H HA3  . GLY A 1 37 ? -12.304 -2.425  9.143   1.00 0.11 ? 37  GLY A HA3  5  
ATOM   5982  N N    . LEU A 1 38 ? -9.985  -2.831  7.044   1.00 0.08 ? 38  LEU A N    5  
ATOM   5983  C CA   . LEU A 1 38 ? -9.271  -3.789  6.204   1.00 0.08 ? 38  LEU A CA   5  
ATOM   5984  C C    . LEU A 1 38 ? -7.953  -4.204  6.851   1.00 0.08 ? 38  LEU A C    5  
ATOM   5985  O O    . LEU A 1 38 ? -7.409  -5.266  6.550   1.00 0.08 ? 38  LEU A O    5  
ATOM   5986  C CB   . LEU A 1 38 ? -9.007  -3.185  4.823   1.00 0.07 ? 38  LEU A CB   5  
ATOM   5987  C CG   . LEU A 1 38 ? -10.234 -2.970  3.939   1.00 0.06 ? 38  LEU A CG   5  
ATOM   5988  C CD1  . LEU A 1 38 ? -9.942  -1.939  2.860   1.00 0.06 ? 38  LEU A CD1  5  
ATOM   5989  C CD2  . LEU A 1 38 ? -10.680 -4.286  3.314   1.00 0.06 ? 38  LEU A CD2  5  
ATOM   5990  H H    . LEU A 1 38 ? -10.028 -1.892  6.767   1.00 0.08 ? 38  LEU A H    5  
ATOM   5991  H HA   . LEU A 1 38 ? -9.895  -4.662  6.093   1.00 0.08 ? 38  LEU A HA   5  
ATOM   5992  H HB2  . LEU A 1 38 ? -8.522  -2.230  4.962   1.00 0.07 ? 38  LEU A HB2  5  
ATOM   5993  H HB3  . LEU A 1 38 ? -8.326  -3.838  4.298   1.00 0.06 ? 38  LEU A HB3  5  
ATOM   5994  H HG   . LEU A 1 38 ? -11.046 -2.596  4.547   1.00 0.07 ? 38  LEU A HG   5  
ATOM   5995  H HD11 . LEU A 1 38 ? -9.694  -0.994  3.322   1.00 0.06 ? 38  LEU A HD11 5  
ATOM   5996  H HD12 . LEU A 1 38 ? -10.815 -1.814  2.235   1.00 0.06 ? 38  LEU A HD12 5  
ATOM   5997  H HD13 . LEU A 1 38 ? -9.112  -2.275  2.257   1.00 0.05 ? 38  LEU A HD13 5  
ATOM   5998  H HD21 . LEU A 1 38 ? -9.868  -4.704  2.738   1.00 0.06 ? 38  LEU A HD21 5  
ATOM   5999  H HD22 . LEU A 1 38 ? -11.527 -4.109  2.668   1.00 0.06 ? 38  LEU A HD22 5  
ATOM   6000  H HD23 . LEU A 1 38 ? -10.962 -4.977  4.094   1.00 0.07 ? 38  LEU A HD23 5  
ATOM   6001  N N    . LEU A 1 39 ? -7.447  -3.358  7.744   1.00 0.09 ? 39  LEU A N    5  
ATOM   6002  C CA   . LEU A 1 39 ? -6.194  -3.639  8.436   1.00 0.10 ? 39  LEU A CA   5  
ATOM   6003  C C    . LEU A 1 39 ? -6.249  -3.152  9.880   1.00 0.11 ? 39  LEU A C    5  
ATOM   6004  O O    . LEU A 1 39 ? -6.922  -2.169  10.189  1.00 0.11 ? 39  LEU A O    5  
ATOM   6005  C CB   . LEU A 1 39 ? -5.025  -2.973  7.706   1.00 0.10 ? 39  LEU A CB   5  
ATOM   6006  C CG   . LEU A 1 39 ? -4.716  -3.508  6.307   1.00 0.09 ? 39  LEU A CG   5  
ATOM   6007  C CD1  . LEU A 1 39 ? -3.514  -2.790  5.715   1.00 0.09 ? 39  LEU A CD1  5  
ATOM   6008  C CD2  . LEU A 1 39 ? -4.474  -5.009  6.352   1.00 0.09 ? 39  LEU A CD2  5  
ATOM   6009  H H    . LEU A 1 39 ? -7.927  -2.527  7.941   1.00 0.09 ? 39  LEU A H    5  
ATOM   6010  H HA   . LEU A 1 39 ? -6.046  -4.708  8.435   1.00 0.10 ? 39  LEU A HA   5  
ATOM   6011  H HB2  . LEU A 1 39 ? -5.240  -1.918  7.623   1.00 0.10 ? 39  LEU A HB2  5  
ATOM   6012  H HB3  . LEU A 1 39 ? -4.139  -3.092  8.313   1.00 0.11 ? 39  LEU A HB3  5  
ATOM   6013  H HG   . LEU A 1 39 ? -5.564  -3.325  5.663   1.00 0.08 ? 39  LEU A HG   5  
ATOM   6014  H HD11 . LEU A 1 39 ? -3.438  -3.023  4.664   1.00 0.08 ? 39  LEU A HD11 5  
ATOM   6015  H HD12 . LEU A 1 39 ? -2.616  -3.115  6.221   1.00 0.10 ? 39  LEU A HD12 5  
ATOM   6016  H HD13 . LEU A 1 39 ? -3.630  -1.725  5.842   1.00 0.09 ? 39  LEU A HD13 5  
ATOM   6017  H HD21 . LEU A 1 39 ? -3.814  -5.293  5.545   1.00 0.08 ? 39  LEU A HD21 5  
ATOM   6018  H HD22 . LEU A 1 39 ? -5.416  -5.528  6.245   1.00 0.08 ? 39  LEU A HD22 5  
ATOM   6019  H HD23 . LEU A 1 39 ? -4.025  -5.274  7.297   1.00 0.10 ? 39  LEU A HD23 5  
ATOM   6020  N N    . MET A 1 40 ? -5.536  -3.845  10.760  1.00 0.12 ? 40  MET A N    5  
ATOM   6021  C CA   . MET A 1 40 ? -5.502  -3.483  12.173  1.00 0.14 ? 40  MET A CA   5  
ATOM   6022  C C    . MET A 1 40 ? -4.204  -2.758  12.517  1.00 0.14 ? 40  MET A C    5  
ATOM   6023  O O    . MET A 1 40 ? -4.135  -2.020  13.500  1.00 0.15 ? 40  MET A O    5  
ATOM   6024  C CB   . MET A 1 40 ? -5.651  -4.729  13.047  1.00 0.14 ? 40  MET A CB   5  
ATOM   6025  C CG   . MET A 1 40 ? -5.984  -4.418  14.498  1.00 0.16 ? 40  MET A CG   5  
ATOM   6026  S SD   . MET A 1 40 ? -5.314  -5.640  15.641  1.00 0.17 ? 40  MET A SD   5  
ATOM   6027  C CE   . MET A 1 40 ? -3.570  -5.237  15.582  1.00 0.17 ? 40  MET A CE   5  
ATOM   6028  H H    . MET A 1 40 ? -5.021  -4.621  10.453  1.00 0.12 ? 40  MET A H    5  
ATOM   6029  H HA   . MET A 1 40 ? -6.332  -2.818  12.364  1.00 0.14 ? 40  MET A HA   5  
ATOM   6030  H HB2  . MET A 1 40 ? -6.439  -5.346  12.642  1.00 0.14 ? 40  MET A HB2  5  
ATOM   6031  H HB3  . MET A 1 40 ? -4.724  -5.284  13.024  1.00 0.14 ? 40  MET A HB3  5  
ATOM   6032  H HG2  . MET A 1 40 ? -5.575  -3.450  14.747  1.00 0.16 ? 40  MET A HG2  5  
ATOM   6033  H HG3  . MET A 1 40 ? -7.059  -4.393  14.608  1.00 0.15 ? 40  MET A HG3  5  
ATOM   6034  H HE1  . MET A 1 40 ? -3.430  -4.202  15.857  1.00 0.18 ? 40  MET A HE1  5  
ATOM   6035  H HE2  . MET A 1 40 ? -3.196  -5.397  14.582  1.00 0.17 ? 40  MET A HE2  5  
ATOM   6036  H HE3  . MET A 1 40 ? -3.031  -5.869  16.273  1.00 0.18 ? 40  MET A HE3  5  
ATOM   6037  N N    . SER A 1 41 ? -3.176  -2.976  11.701  1.00 0.14 ? 41  SER A N    5  
ATOM   6038  C CA   . SER A 1 41 ? -1.879  -2.346  11.920  1.00 0.15 ? 41  SER A CA   5  
ATOM   6039  C C    . SER A 1 41 ? -1.159  -2.110  10.597  1.00 0.14 ? 41  SER A C    5  
ATOM   6040  O O    . SER A 1 41 ? -1.468  -2.720  9.574   1.00 0.13 ? 41  SER A O    5  
ATOM   6041  C CB   . SER A 1 41 ? -1.016  -3.217  12.835  1.00 0.16 ? 41  SER A CB   5  
ATOM   6042  O OG   . SER A 1 41 ? -1.561  -4.519  12.965  1.00 0.16 ? 41  SER A OG   5  
ATOM   6043  H H    . SER A 1 41 ? -3.293  -3.574  10.933  1.00 0.13 ? 41  SER A H    5  
ATOM   6044  H HA   . SER A 1 41 ? -2.051  -1.394  12.400  1.00 0.15 ? 41  SER A HA   5  
ATOM   6045  H HB2  . SER A 1 41 ? -0.023  -3.297  12.419  1.00 0.16 ? 41  SER A HB2  5  
ATOM   6046  H HB3  . SER A 1 41 ? -0.961  -2.764  13.815  1.00 0.17 ? 41  SER A HB3  5  
ATOM   6047  H HG   . SER A 1 41 ? -1.341  -4.874  13.830  1.00 0.17 ? 41  SER A HG   5  
ATOM   6048  N N    . PRO A 1 42 ? -0.174  -1.200  10.615  1.00 0.15 ? 42  PRO A N    5  
ATOM   6049  C CA   . PRO A 1 42 ? 0.612   -0.859  9.427   1.00 0.15 ? 42  PRO A CA   5  
ATOM   6050  C C    . PRO A 1 42 ? 1.536   -1.995  8.998   1.00 0.15 ? 42  PRO A C    5  
ATOM   6051  O O    . PRO A 1 42 ? 2.043   -2.005  7.877   1.00 0.15 ? 42  PRO A O    5  
ATOM   6052  C CB   . PRO A 1 42 ? 1.431   0.354   9.876   1.00 0.16 ? 42  PRO A CB   5  
ATOM   6053  C CG   . PRO A 1 42 ? 1.532   0.215   11.356  1.00 0.17 ? 42  PRO A CG   5  
ATOM   6054  C CD   . PRO A 1 42 ? 0.250   -0.433  11.801  1.00 0.17 ? 42  PRO A CD   5  
ATOM   6055  H HA   . PRO A 1 42 ? -0.023  -0.582  8.599   1.00 0.14 ? 42  PRO A HA   5  
ATOM   6056  H HB2  . PRO A 1 42 ? 2.410   0.331   9.413   1.00 0.17 ? 42  PRO A HB2  5  
ATOM   6057  H HB3  . PRO A 1 42 ? 0.915   1.266   9.623   1.00 0.16 ? 42  PRO A HB3  5  
ATOM   6058  H HG2  . PRO A 1 42 ? 2.379   -0.411  11.607  1.00 0.18 ? 42  PRO A HG2  5  
ATOM   6059  H HG3  . PRO A 1 42 ? 1.631   1.186   11.812  1.00 0.18 ? 42  PRO A HG3  5  
ATOM   6060  H HD2  . PRO A 1 42 ? 0.428   -1.088  12.640  1.00 0.17 ? 42  PRO A HD2  5  
ATOM   6061  H HD3  . PRO A 1 42 ? -0.483  0.319   12.054  1.00 0.16 ? 42  PRO A HD3  5  
ATOM   6062  N N    . SER A 1 43 ? 1.749   -2.950  9.898   1.00 0.16 ? 43  SER A N    5  
ATOM   6063  C CA   . SER A 1 43 ? 2.614   -4.088  9.613   1.00 0.16 ? 43  SER A CA   5  
ATOM   6064  C C    . SER A 1 43 ? 1.835   -5.203  8.922   1.00 0.15 ? 43  SER A C    5  
ATOM   6065  O O    . SER A 1 43 ? 2.407   -6.212  8.509   1.00 0.15 ? 43  SER A O    5  
ATOM   6066  C CB   . SER A 1 43 ? 3.241   -4.616  10.906  1.00 0.17 ? 43  SER A CB   5  
ATOM   6067  O OG   . SER A 1 43 ? 2.247   -4.906  11.873  1.00 0.17 ? 43  SER A OG   5  
ATOM   6068  H H    . SER A 1 43 ? 1.314   -2.887  10.773  1.00 0.16 ? 43  SER A H    5  
ATOM   6069  H HA   . SER A 1 43 ? 3.399   -3.751  8.954   1.00 0.16 ? 43  SER A HA   5  
ATOM   6070  H HB2  . SER A 1 43 ? 3.793   -5.519  10.693  1.00 0.17 ? 43  SER A HB2  5  
ATOM   6071  H HB3  . SER A 1 43 ? 3.911   -3.871  11.308  1.00 0.18 ? 43  SER A HB3  5  
ATOM   6072  H HG   . SER A 1 43 ? 2.264   -5.845  12.079  1.00 0.17 ? 43  SER A HG   5  
ATOM   6073  N N    . ASP A 1 44 ? 0.527   -5.013  8.798   1.00 0.14 ? 44  ASP A N    5  
ATOM   6074  C CA   . ASP A 1 44 ? -0.333  -6.002  8.156   1.00 0.12 ? 44  ASP A CA   5  
ATOM   6075  C C    . ASP A 1 44 ? 0.049   -6.183  6.690   1.00 0.12 ? 44  ASP A C    5  
ATOM   6076  O O    . ASP A 1 44 ? -0.334  -7.165  6.054   1.00 0.11 ? 44  ASP A O    5  
ATOM   6077  C CB   . ASP A 1 44 ? -1.800  -5.583  8.265   1.00 0.12 ? 44  ASP A CB   5  
ATOM   6078  C CG   . ASP A 1 44 ? -2.729  -6.766  8.443   1.00 0.11 ? 44  ASP A CG   5  
ATOM   6079  O OD1  . ASP A 1 44 ? -2.479  -7.816  7.813   1.00 0.11 ? 44  ASP A OD1  5  
ATOM   6080  O OD2  . ASP A 1 44 ? -3.706  -6.645  9.209   1.00 0.11 ? 44  ASP A OD2  5  
ATOM   6081  H H    . ASP A 1 44 ? 0.128   -4.190  9.147   1.00 0.14 ? 44  ASP A H    5  
ATOM   6082  H HA   . ASP A 1 44 ? -0.197  -6.942  8.668   1.00 0.13 ? 44  ASP A HA   5  
ATOM   6083  H HB2  . ASP A 1 44 ? -1.918  -4.926  9.115   1.00 0.12 ? 44  ASP A HB2  5  
ATOM   6084  H HB3  . ASP A 1 44 ? -2.083  -5.055  7.366   1.00 0.11 ? 44  ASP A HB3  5  
ATOM   6085  N N    . LEU A 1 45 ? 0.805   -5.226  6.158   1.00 0.12 ? 45  LEU A N    5  
ATOM   6086  C CA   . LEU A 1 45 ? 1.236   -5.278  4.767   1.00 0.12 ? 45  LEU A CA   5  
ATOM   6087  C C    . LEU A 1 45 ? 2.129   -6.492  4.518   1.00 0.12 ? 45  LEU A C    5  
ATOM   6088  O O    . LEU A 1 45 ? 2.345   -6.891  3.375   1.00 0.12 ? 45  LEU A O    5  
ATOM   6089  C CB   . LEU A 1 45 ? 1.985   -3.997  4.396   1.00 0.12 ? 45  LEU A CB   5  
ATOM   6090  C CG   . LEU A 1 45 ? 1.350   -3.145  3.296   1.00 0.12 ? 45  LEU A CG   5  
ATOM   6091  C CD1  . LEU A 1 45 ? 1.602   -3.762  1.929   1.00 0.11 ? 45  LEU A CD1  5  
ATOM   6092  C CD2  . LEU A 1 45 ? -0.143  -2.981  3.541   1.00 0.10 ? 45  LEU A CD2  5  
ATOM   6093  H H    . LEU A 1 45 ? 1.077   -4.468  6.715   1.00 0.13 ? 45  LEU A H    5  
ATOM   6094  H HA   . LEU A 1 45 ? 0.355   -5.363  4.149   1.00 0.11 ? 45  LEU A HA   5  
ATOM   6095  H HB2  . LEU A 1 45 ? 2.069   -3.389  5.284   1.00 0.13 ? 45  LEU A HB2  5  
ATOM   6096  H HB3  . LEU A 1 45 ? 2.979   -4.271  4.075   1.00 0.13 ? 45  LEU A HB3  5  
ATOM   6097  H HG   . LEU A 1 45 ? 1.801   -2.163  3.306   1.00 0.12 ? 45  LEU A HG   5  
ATOM   6098  H HD11 . LEU A 1 45 ? 2.643   -3.645  1.669   1.00 0.12 ? 45  LEU A HD11 5  
ATOM   6099  H HD12 . LEU A 1 45 ? 0.989   -3.268  1.191   1.00 0.11 ? 45  LEU A HD12 5  
ATOM   6100  H HD13 . LEU A 1 45 ? 1.355   -4.813  1.957   1.00 0.11 ? 45  LEU A HD13 5  
ATOM   6101  H HD21 . LEU A 1 45 ? -0.497  -2.096  3.034   1.00 0.10 ? 45  LEU A HD21 5  
ATOM   6102  H HD22 . LEU A 1 45 ? -0.326  -2.884  4.602   1.00 0.11 ? 45  LEU A HD22 5  
ATOM   6103  H HD23 . LEU A 1 45 ? -0.667  -3.846  3.163   1.00 0.10 ? 45  LEU A HD23 5  
ATOM   6104  N N    . TYR A 1 46 ? 2.641   -7.074  5.598   1.00 0.13 ? 46  TYR A N    5  
ATOM   6105  C CA   . TYR A 1 46 ? 3.508   -8.240  5.499   1.00 0.14 ? 46  TYR A CA   5  
ATOM   6106  C C    . TYR A 1 46 ? 2.691   -9.513  5.303   1.00 0.13 ? 46  TYR A C    5  
ATOM   6107  O O    . TYR A 1 46 ? 3.238   -10.613 5.252   1.00 0.13 ? 46  TYR A O    5  
ATOM   6108  C CB   . TYR A 1 46 ? 4.375   -8.363  6.752   1.00 0.15 ? 46  TYR A CB   5  
ATOM   6109  C CG   . TYR A 1 46 ? 5.146   -7.106  7.083   1.00 0.16 ? 46  TYR A CG   5  
ATOM   6110  C CD1  . TYR A 1 46 ? 5.689   -6.316  6.076   1.00 0.16 ? 46  TYR A CD1  5  
ATOM   6111  C CD2  . TYR A 1 46 ? 5.334   -6.709  8.400   1.00 0.17 ? 46  TYR A CD2  5  
ATOM   6112  C CE1  . TYR A 1 46 ? 6.394   -5.166  6.374   1.00 0.17 ? 46  TYR A CE1  5  
ATOM   6113  C CE2  . TYR A 1 46 ? 6.036   -5.560  8.706   1.00 0.18 ? 46  TYR A CE2  5  
ATOM   6114  C CZ   . TYR A 1 46 ? 6.565   -4.792  7.690   1.00 0.18 ? 46  TYR A CZ   5  
ATOM   6115  O OH   . TYR A 1 46 ? 7.267   -3.647  7.992   1.00 0.19 ? 46  TYR A OH   5  
ATOM   6116  H H    . TYR A 1 46 ? 2.428   -6.709  6.484   1.00 0.13 ? 46  TYR A H    5  
ATOM   6117  H HA   . TYR A 1 46 ? 4.148   -8.104  4.641   1.00 0.14 ? 46  TYR A HA   5  
ATOM   6118  H HB2  . TYR A 1 46 ? 3.744   -8.597  7.596   1.00 0.15 ? 46  TYR A HB2  5  
ATOM   6119  H HB3  . TYR A 1 46 ? 5.088   -9.163  6.610   1.00 0.16 ? 46  TYR A HB3  5  
ATOM   6120  H HD1  . TYR A 1 46 ? 5.552   -6.610  5.046   1.00 0.15 ? 46  TYR A HD1  5  
ATOM   6121  H HD2  . TYR A 1 46 ? 4.919   -7.313  9.194   1.00 0.17 ? 46  TYR A HD2  5  
ATOM   6122  H HE1  . TYR A 1 46 ? 6.807   -4.564  5.576   1.00 0.17 ? 46  TYR A HE1  5  
ATOM   6123  H HE2  . TYR A 1 46 ? 6.171   -5.267  9.738   1.00 0.19 ? 46  TYR A HE2  5  
ATOM   6124  H HH   . TYR A 1 46 ? 7.888   -3.830  8.702   1.00 0.20 ? 46  TYR A HH   5  
ATOM   6125  N N    . SER A 1 47 ? 1.375   -9.354  5.195   1.00 0.12 ? 47  SER A N    5  
ATOM   6126  C CA   . SER A 1 47 ? 0.479   -10.487 5.008   1.00 0.11 ? 47  SER A CA   5  
ATOM   6127  C C    . SER A 1 47 ? -0.046  -10.537 3.577   1.00 0.10 ? 47  SER A C    5  
ATOM   6128  O O    . SER A 1 47 ? -1.049  -9.912  3.235   1.00 0.09 ? 47  SER A O    5  
ATOM   6129  C CB   . SER A 1 47 ? -0.690  -10.408 5.990   1.00 0.11 ? 47  SER A CB   5  
ATOM   6130  O OG   . SER A 1 47 ? -0.384  -11.071 7.204   1.00 0.12 ? 47  SER A OG   5  
ATOM   6131  H H    . SER A 1 47 ? 0.997   -8.450  5.242   1.00 0.12 ? 47  SER A H    5  
ATOM   6132  H HA   . SER A 1 47 ? 1.042   -11.387 5.206   1.00 0.12 ? 47  SER A HA   5  
ATOM   6133  H HB2  . SER A 1 47 ? -0.906  -9.372  6.206   1.00 0.11 ? 47  SER A HB2  5  
ATOM   6134  H HB3  . SER A 1 47 ? -1.559  -10.873 5.550   1.00 0.10 ? 47  SER A HB3  5  
ATOM   6135  H HG   . SER A 1 47 ? -0.774  -10.590 7.938   1.00 0.12 ? 47  SER A HG   5  
ATOM   6136  N N    . PRO A 1 48 ? 0.649   -11.300 2.718   1.00 0.11 ? 48  PRO A N    5  
ATOM   6137  C CA   . PRO A 1 48 ? 0.273   -11.449 1.310   1.00 0.10 ? 48  PRO A CA   5  
ATOM   6138  C C    . PRO A 1 48 ? -1.011  -12.252 1.136   1.00 0.09 ? 48  PRO A C    5  
ATOM   6139  O O    . PRO A 1 48 ? -1.514  -12.405 0.022   1.00 0.09 ? 48  PRO A O    5  
ATOM   6140  C CB   . PRO A 1 48 ? 1.460   -12.201 0.704   1.00 0.11 ? 48  PRO A CB   5  
ATOM   6141  C CG   . PRO A 1 48 ? 2.064   -12.940 1.846   1.00 0.12 ? 48  PRO A CG   5  
ATOM   6142  C CD   . PRO A 1 48 ? 1.856   -12.071 3.057   1.00 0.12 ? 48  PRO A CD   5  
ATOM   6143  H HA   . PRO A 1 48 ? 0.164   -10.490 0.824   1.00 0.10 ? 48  PRO A HA   5  
ATOM   6144  H HB2  . PRO A 1 48 ? 1.113   -12.883 -0.063  1.00 0.11 ? 48  PRO A HB2  5  
ATOM   6145  H HB3  . PRO A 1 48 ? 2.172   -11.504 0.293   1.00 0.11 ? 48  PRO A HB3  5  
ATOM   6146  H HG2  . PRO A 1 48 ? 1.566   -13.892 1.971   1.00 0.12 ? 48  PRO A HG2  5  
ATOM   6147  H HG3  . PRO A 1 48 ? 3.119   -13.085 1.677   1.00 0.13 ? 48  PRO A HG3  5  
ATOM   6148  H HD2  . PRO A 1 48 ? 1.690   -12.683 3.932   1.00 0.12 ? 48  PRO A HD2  5  
ATOM   6149  H HD3  . PRO A 1 48 ? 2.703   -11.419 3.206   1.00 0.12 ? 48  PRO A HD3  5  
ATOM   6150  N N    . GLY A 1 49 ? -1.539  -12.762 2.244   1.00 0.09 ? 49  GLY A N    5  
ATOM   6151  C CA   . GLY A 1 49 ? -2.761  -13.545 2.191   1.00 0.09 ? 49  GLY A CA   5  
ATOM   6152  C C    . GLY A 1 49 ? -3.995  -12.713 2.486   1.00 0.08 ? 49  GLY A C    5  
ATOM   6153  O O    . GLY A 1 49 ? -5.101  -13.243 2.583   1.00 0.08 ? 49  GLY A O    5  
ATOM   6154  H H    . GLY A 1 49 ? -1.096  -12.606 3.104   1.00 0.10 ? 49  GLY A H    5  
ATOM   6155  H HA2  . GLY A 1 49 ? -2.858  -13.976 1.206   1.00 0.09 ? 49  GLY A HA2  5  
ATOM   6156  H HA3  . GLY A 1 49 ? -2.697  -14.342 2.918   1.00 0.10 ? 49  GLY A HA3  5  
ATOM   6157  N N    . SER A 1 50 ? -3.804  -11.406 2.631   1.00 0.08 ? 50  SER A N    5  
ATOM   6158  C CA   . SER A 1 50 ? -4.908  -10.500 2.921   1.00 0.07 ? 50  SER A CA   5  
ATOM   6159  C C    . SER A 1 50 ? -5.044  -9.441  1.832   1.00 0.06 ? 50  SER A C    5  
ATOM   6160  O O    . SER A 1 50 ? -5.867  -8.529  1.934   1.00 0.06 ? 50  SER A O    5  
ATOM   6161  C CB   . SER A 1 50 ? -4.701  -9.826  4.279   1.00 0.08 ? 50  SER A CB   5  
ATOM   6162  O OG   . SER A 1 50 ? -4.819  -10.762 5.337   1.00 0.09 ? 50  SER A OG   5  
ATOM   6163  H H    . SER A 1 50 ? -2.899  -11.042 2.542   1.00 0.08 ? 50  SER A H    5  
ATOM   6164  H HA   . SER A 1 50 ? -5.816  -11.083 2.954   1.00 0.07 ? 50  SER A HA   5  
ATOM   6165  H HB2  . SER A 1 50 ? -3.715  -9.387  4.313   1.00 0.08 ? 50  SER A HB2  5  
ATOM   6166  H HB3  . SER A 1 50 ? -5.444  -9.053  4.413   1.00 0.07 ? 50  SER A HB3  5  
ATOM   6167  H HG   . SER A 1 50 ? -5.162  -11.590 4.994   1.00 0.09 ? 50  SER A HG   5  
ATOM   6168  N N    . TRP A 1 51 ? -4.233  -9.566  0.789   1.00 0.07 ? 51  TRP A N    5  
ATOM   6169  C CA   . TRP A 1 51 ? -4.260  -8.621  -0.322  1.00 0.06 ? 51  TRP A CA   5  
ATOM   6170  C C    . TRP A 1 51 ? -5.536  -8.783  -1.143  1.00 0.06 ? 51  TRP A C    5  
ATOM   6171  O O    . TRP A 1 51 ? -5.933  -7.876  -1.873  1.00 0.06 ? 51  TRP A O    5  
ATOM   6172  C CB   . TRP A 1 51 ? -3.036  -8.817  -1.216  1.00 0.07 ? 51  TRP A CB   5  
ATOM   6173  C CG   . TRP A 1 51 ? -1.754  -8.383  -0.571  1.00 0.08 ? 51  TRP A CG   5  
ATOM   6174  C CD1  . TRP A 1 51 ? -1.617  -7.534  0.489   1.00 0.08 ? 51  TRP A CD1  5  
ATOM   6175  C CD2  . TRP A 1 51 ? -0.430  -8.777  -0.947  1.00 0.09 ? 51  TRP A CD2  5  
ATOM   6176  N NE1  . TRP A 1 51 ? -0.286  -7.378  0.797   1.00 0.09 ? 51  TRP A NE1  5  
ATOM   6177  C CE2  . TRP A 1 51 ? 0.462   -8.130  -0.069  1.00 0.10 ? 51  TRP A CE2  5  
ATOM   6178  C CE3  . TRP A 1 51 ? 0.090   -9.614  -1.938  1.00 0.09 ? 51  TRP A CE3  5  
ATOM   6179  C CZ2  . TRP A 1 51 ? 1.842   -8.293  -0.156  1.00 0.11 ? 51  TRP A CZ2  5  
ATOM   6180  C CZ3  . TRP A 1 51 ? 1.459   -9.775  -2.022  1.00 0.11 ? 51  TRP A CZ3  5  
ATOM   6181  C CH2  . TRP A 1 51 ? 2.321   -9.118  -1.136  1.00 0.11 ? 51  TRP A CH2  5  
ATOM   6182  H H    . TRP A 1 51 ? -3.599  -10.313 0.764   1.00 0.07 ? 51  TRP A H    5  
ATOM   6183  H HA   . TRP A 1 51 ? -4.238  -7.625  0.092   1.00 0.06 ? 51  TRP A HA   5  
ATOM   6184  H HB2  . TRP A 1 51 ? -2.946  -9.863  -1.467  1.00 0.07 ? 51  TRP A HB2  5  
ATOM   6185  H HB3  . TRP A 1 51 ? -3.165  -8.243  -2.123  1.00 0.07 ? 51  TRP A HB3  5  
ATOM   6186  H HD1  . TRP A 1 51 ? -2.441  -7.063  1.004   1.00 0.07 ? 51  TRP A HD1  5  
ATOM   6187  H HE1  . TRP A 1 51 ? 0.068   -6.819  1.520   1.00 0.09 ? 51  TRP A HE1  5  
ATOM   6188  H HE3  . TRP A 1 51 ? -0.560  -10.128 -2.630  1.00 0.09 ? 51  TRP A HE3  5  
ATOM   6189  H HZ2  . TRP A 1 51 ? 2.519   -7.795  0.519   1.00 0.11 ? 51  TRP A HZ2  5  
ATOM   6190  H HZ3  . TRP A 1 51 ? 1.877   -10.418 -2.782  1.00 0.11 ? 51  TRP A HZ3  5  
ATOM   6191  H HH2  . TRP A 1 51 ? 3.386   -9.274  -1.241  1.00 0.12 ? 51  TRP A HH2  5  
ATOM   6192  N N    . ASP A 1 52 ? -6.172  -9.942  -1.017  1.00 0.06 ? 52  ASP A N    5  
ATOM   6193  C CA   . ASP A 1 52 ? -7.402  -10.223 -1.747  1.00 0.07 ? 52  ASP A CA   5  
ATOM   6194  C C    . ASP A 1 52 ? -8.519  -9.280  -1.310  1.00 0.06 ? 52  ASP A C    5  
ATOM   6195  O O    . ASP A 1 52 ? -9.071  -8.519  -2.104  1.00 0.06 ? 52  ASP A O    5  
ATOM   6196  C CB   . ASP A 1 52 ? -7.830  -11.674 -1.531  1.00 0.07 ? 52  ASP A CB   5  
ATOM   6197  C CG   . ASP A 1 52 ? -7.425  -12.575 -2.682  1.00 0.08 ? 52  ASP A CG   5  
ATOM   6198  O OD1  . ASP A 1 52 ? -8.195  -13.502 -3.010  1.00 0.09 ? 52  ASP A OD1  5  
ATOM   6199  O OD2  . ASP A 1 52 ? -6.339  -12.350 -3.257  1.00 0.08 ? 52  ASP A OD2  5  
ATOM   6200  H H    . ASP A 1 52 ? -5.803  -10.627 -0.421  1.00 0.06 ? 52  ASP A H    5  
ATOM   6201  H HA   . ASP A 1 52 ? -7.207  -10.067 -2.797  1.00 0.07 ? 52  ASP A HA   5  
ATOM   6202  H HB2  . ASP A 1 52 ? -7.370  -12.048 -0.629  1.00 0.07 ? 52  ASP A HB2  5  
ATOM   6203  H HB3  . ASP A 1 52 ? -8.905  -11.714 -1.427  1.00 0.08 ? 52  ASP A HB3  5  
ATOM   6204  N N    . PRO A 1 53 ? -8.864  -9.331  -0.013  1.00 0.06 ? 53  PRO A N    5  
ATOM   6205  C CA   . PRO A 1 53 ? -9.919  -8.491  0.560   1.00 0.06 ? 53  PRO A CA   5  
ATOM   6206  C C    . PRO A 1 53 ? -9.517  -7.020  0.624   1.00 0.05 ? 53  PRO A C    5  
ATOM   6207  O O    . PRO A 1 53 ? -10.334 -6.159  0.948   1.00 0.06 ? 53  PRO A O    5  
ATOM   6208  C CB   . PRO A 1 53 ? -10.099 -9.059  1.968   1.00 0.06 ? 53  PRO A CB   5  
ATOM   6209  C CG   . PRO A 1 53 ? -8.790  -9.691  2.293   1.00 0.06 ? 53  PRO A CG   5  
ATOM   6210  C CD   . PRO A 1 53 ? -8.251  -10.216 0.991   1.00 0.06 ? 53  PRO A CD   5  
ATOM   6211  H HA   . PRO A 1 53 ? -10.843 -8.586  0.008   1.00 0.07 ? 53  PRO A HA   5  
ATOM   6212  H HB2  . PRO A 1 53 ? -10.330 -8.260  2.662   1.00 0.06 ? 53  PRO A HB2  5  
ATOM   6213  H HB3  . PRO A 1 53 ? -10.881 -9.801  1.975   1.00 0.07 ? 53  PRO A HB3  5  
ATOM   6214  H HG2  . PRO A 1 53 ? -8.119  -8.951  2.710   1.00 0.06 ? 53  PRO A HG2  5  
ATOM   6215  H HG3  . PRO A 1 53 ? -8.934  -10.504 2.986   1.00 0.07 ? 53  PRO A HG3  5  
ATOM   6216  H HD2  . PRO A 1 53 ? -7.173  -10.137 0.969   1.00 0.06 ? 53  PRO A HD2  5  
ATOM   6217  H HD3  . PRO A 1 53 ? -8.559  -11.240 0.843   1.00 0.07 ? 53  PRO A HD3  5  
ATOM   6218  N N    . ILE A 1 54 ? -8.255  -6.744  0.314   1.00 0.05 ? 54  ILE A N    5  
ATOM   6219  C CA   . ILE A 1 54 ? -7.746  -5.379  0.337   1.00 0.05 ? 54  ILE A CA   5  
ATOM   6220  C C    . ILE A 1 54 ? -7.620  -4.816  -1.075  1.00 0.05 ? 54  ILE A C    5  
ATOM   6221  O O    . ILE A 1 54 ? -7.582  -3.600  -1.271  1.00 0.05 ? 54  ILE A O    5  
ATOM   6222  C CB   . ILE A 1 54 ? -6.375  -5.299  1.034   1.00 0.05 ? 54  ILE A CB   5  
ATOM   6223  C CG1  . ILE A 1 54 ? -6.491  -5.754  2.489   1.00 0.05 ? 54  ILE A CG1  5  
ATOM   6224  C CG2  . ILE A 1 54 ? -5.823  -3.884  0.955   1.00 0.05 ? 54  ILE A CG2  5  
ATOM   6225  C CD1  . ILE A 1 54 ? -5.155  -6.005  3.152   1.00 0.06 ? 54  ILE A CD1  5  
ATOM   6226  H H    . ILE A 1 54 ? -7.652  -7.475  0.067   1.00 0.05 ? 54  ILE A H    5  
ATOM   6227  H HA   . ILE A 1 54 ? -8.446  -4.772  0.894   1.00 0.05 ? 54  ILE A HA   5  
ATOM   6228  H HB   . ILE A 1 54 ? -5.694  -5.954  0.512   1.00 0.05 ? 54  ILE A HB   5  
ATOM   6229  H HG12 . ILE A 1 54 ? -7.004  -4.994  3.057   1.00 0.06 ? 54  ILE A HG12 5  
ATOM   6230  H HG13 . ILE A 1 54 ? -7.059  -6.672  2.528   1.00 0.05 ? 54  ILE A HG13 5  
ATOM   6231  H HG21 . ILE A 1 54 ? -4.923  -3.815  1.549   1.00 0.06 ? 54  ILE A HG21 5  
ATOM   6232  H HG22 . ILE A 1 54 ? -6.558  -3.192  1.334   1.00 0.05 ? 54  ILE A HG22 5  
ATOM   6233  H HG23 . ILE A 1 54 ? -5.596  -3.642  -0.072  1.00 0.06 ? 54  ILE A HG23 5  
ATOM   6234  H HD11 . ILE A 1 54 ? -5.315  -6.398  4.145   1.00 0.07 ? 54  ILE A HD11 5  
ATOM   6235  H HD12 . ILE A 1 54 ? -4.606  -5.078  3.216   1.00 0.07 ? 54  ILE A HD12 5  
ATOM   6236  H HD13 . ILE A 1 54 ? -4.591  -6.718  2.569   1.00 0.06 ? 54  ILE A HD13 5  
ATOM   6237  N N    . THR A 1 55 ? -7.557  -5.708  -2.060  1.00 0.06 ? 55  THR A N    5  
ATOM   6238  C CA   . THR A 1 55 ? -7.437  -5.301  -3.452  1.00 0.06 ? 55  THR A CA   5  
ATOM   6239  C C    . THR A 1 55 ? -8.808  -5.159  -4.105  1.00 0.07 ? 55  THR A C    5  
ATOM   6240  O O    . THR A 1 55 ? -9.031  -4.256  -4.911  1.00 0.08 ? 55  THR A O    5  
ATOM   6241  C CB   . THR A 1 55 ? -6.599  -6.310  -4.261  1.00 0.07 ? 55  THR A CB   5  
ATOM   6242  O OG1  . THR A 1 55 ? -5.243  -6.295  -3.807  1.00 0.07 ? 55  THR A OG1  5  
ATOM   6243  C CG2  . THR A 1 55 ? -6.646  -5.984  -5.747  1.00 0.08 ? 55  THR A CG2  5  
ATOM   6244  H H    . THR A 1 55 ? -7.591  -6.663  -1.842  1.00 0.06 ? 55  THR A H    5  
ATOM   6245  H HA   . THR A 1 55 ? -6.935  -4.345  -3.478  1.00 0.07 ? 55  THR A HA   5  
ATOM   6246  H HB   . THR A 1 55 ? -7.010  -7.298  -4.111  1.00 0.07 ? 55  THR A HB   5  
ATOM   6247  H HG1  . THR A 1 55 ? -4.664  -6.051  -4.533  1.00 0.08 ? 55  THR A HG1  5  
ATOM   6248  H HG21 . THR A 1 55 ? -7.669  -6.017  -6.090  1.00 0.09 ? 55  THR A HG21 5  
ATOM   6249  H HG22 . THR A 1 55 ? -6.059  -6.709  -6.293  1.00 0.09 ? 55  THR A HG22 5  
ATOM   6250  H HG23 . THR A 1 55 ? -6.242  -4.996  -5.912  1.00 0.08 ? 55  THR A HG23 5  
ATOM   6251  N N    . ALA A 1 56 ? -9.724  -6.055  -3.750  1.00 0.07 ? 56  ALA A N    5  
ATOM   6252  C CA   . ALA A 1 56 ? -11.073 -6.026  -4.299  1.00 0.08 ? 56  ALA A CA   5  
ATOM   6253  C C    . ALA A 1 56 ? -11.850 -4.821  -3.782  1.00 0.08 ? 56  ALA A C    5  
ATOM   6254  O O    . ALA A 1 56 ? -12.594 -4.184  -4.528  1.00 0.09 ? 56  ALA A O    5  
ATOM   6255  C CB   . ALA A 1 56 ? -11.807 -7.315  -3.960  1.00 0.08 ? 56  ALA A CB   5  
ATOM   6256  H H    . ALA A 1 56 ? -9.484  -6.753  -3.105  1.00 0.07 ? 56  ALA A H    5  
ATOM   6257  H HA   . ALA A 1 56 ? -10.994 -5.957  -5.374  1.00 0.09 ? 56  ALA A HA   5  
ATOM   6258  H HB1  . ALA A 1 56 ? -12.785 -7.302  -4.417  1.00 0.09 ? 56  ALA A HB1  5  
ATOM   6259  H HB2  . ALA A 1 56 ? -11.913 -7.398  -2.888  1.00 0.08 ? 56  ALA A HB2  5  
ATOM   6260  H HB3  . ALA A 1 56 ? -11.246 -8.159  -4.333  1.00 0.09 ? 56  ALA A HB3  5  
ATOM   6261  N N    . ALA A 1 57 ? -11.673 -4.513  -2.501  1.00 0.07 ? 57  ALA A N    5  
ATOM   6262  C CA   . ALA A 1 57 ? -12.357 -3.383  -1.886  1.00 0.07 ? 57  ALA A CA   5  
ATOM   6263  C C    . ALA A 1 57 ? -11.961 -2.071  -2.554  1.00 0.07 ? 57  ALA A C    5  
ATOM   6264  O O    . ALA A 1 57 ? -12.814 -1.323  -3.030  1.00 0.08 ? 57  ALA A O    5  
ATOM   6265  C CB   . ALA A 1 57 ? -12.054 -3.331  -0.395  1.00 0.06 ? 57  ALA A CB   5  
ATOM   6266  H H    . ALA A 1 57 ? -11.069 -5.060  -1.958  1.00 0.07 ? 57  ALA A H    5  
ATOM   6267  H HA   . ALA A 1 57 ? -13.420 -3.530  -2.008  1.00 0.08 ? 57  ALA A HA   5  
ATOM   6268  H HB1  . ALA A 1 57 ? -12.339 -4.267  0.063   1.00 0.07 ? 57  ALA A HB1  5  
ATOM   6269  H HB2  . ALA A 1 57 ? -12.611 -2.525  0.058   1.00 0.07 ? 57  ALA A HB2  5  
ATOM   6270  H HB3  . ALA A 1 57 ? -10.997 -3.166  -0.248  1.00 0.06 ? 57  ALA A HB3  5  
ATOM   6271  N N    . LEU A 1 58 ? -10.661 -1.797  -2.582  1.00 0.07 ? 58  LEU A N    5  
ATOM   6272  C CA   . LEU A 1 58 ? -10.151 -0.573  -3.192  1.00 0.08 ? 58  LEU A CA   5  
ATOM   6273  C C    . LEU A 1 58 ? -10.614 -0.453  -4.640  1.00 0.09 ? 58  LEU A C    5  
ATOM   6274  O O    . LEU A 1 58 ? -11.014 0.622   -5.087  1.00 0.09 ? 58  LEU A O    5  
ATOM   6275  C CB   . LEU A 1 58 ? -8.623  -0.547  -3.129  1.00 0.07 ? 58  LEU A CB   5  
ATOM   6276  C CG   . LEU A 1 58 ? -8.011  -0.316  -1.747  1.00 0.07 ? 58  LEU A CG   5  
ATOM   6277  C CD1  . LEU A 1 58 ? -6.543  -0.709  -1.739  1.00 0.07 ? 58  LEU A CD1  5  
ATOM   6278  C CD2  . LEU A 1 58 ? -8.181  1.137   -1.324  1.00 0.07 ? 58  LEU A CD2  5  
ATOM   6279  H H    . LEU A 1 58 ? -10.029 -2.432  -2.185  1.00 0.06 ? 58  LEU A H    5  
ATOM   6280  H HA   . LEU A 1 58 ? -10.540 0.264   -2.632  1.00 0.08 ? 58  LEU A HA   5  
ATOM   6281  H HB2  . LEU A 1 58 ? -8.256  -1.491  -3.504  1.00 0.07 ? 58  LEU A HB2  5  
ATOM   6282  H HB3  . LEU A 1 58 ? -8.275  0.237   -3.784  1.00 0.08 ? 58  LEU A HB3  5  
ATOM   6283  H HG   . LEU A 1 58 ? -8.526  -0.936  -1.026  1.00 0.06 ? 58  LEU A HG   5  
ATOM   6284  H HD11 . LEU A 1 58 ? -6.099  -0.430  -0.795  1.00 0.07 ? 58  LEU A HD11 5  
ATOM   6285  H HD12 . LEU A 1 58 ? -6.031  -0.200  -2.543  1.00 0.08 ? 58  LEU A HD12 5  
ATOM   6286  H HD13 . LEU A 1 58 ? -6.455  -1.777  -1.876  1.00 0.06 ? 58  LEU A HD13 5  
ATOM   6287  H HD21 . LEU A 1 58 ? -9.228  1.343   -1.157  1.00 0.07 ? 58  LEU A HD21 5  
ATOM   6288  H HD22 . LEU A 1 58 ? -7.807  1.783   -2.104  1.00 0.08 ? 58  LEU A HD22 5  
ATOM   6289  H HD23 . LEU A 1 58 ? -7.628  1.313   -0.413  1.00 0.07 ? 58  LEU A HD23 5  
ATOM   6290  N N    . SER A 1 59 ? -10.558 -1.564  -5.369  1.00 0.09 ? 59  SER A N    5  
ATOM   6291  C CA   . SER A 1 59 ? -10.970 -1.582  -6.768  1.00 0.10 ? 59  SER A CA   5  
ATOM   6292  C C    . SER A 1 59 ? -12.487 -1.493  -6.888  1.00 0.11 ? 59  SER A C    5  
ATOM   6293  O O    . SER A 1 59 ? -13.016 -1.126  -7.937  1.00 0.12 ? 59  SER A O    5  
ATOM   6294  C CB   . SER A 1 59 ? -10.466 -2.854  -7.453  1.00 0.10 ? 59  SER A CB   5  
ATOM   6295  O OG   . SER A 1 59 ? -11.100 -3.044  -8.705  1.00 0.12 ? 59  SER A OG   5  
ATOM   6296  H H    . SER A 1 59 ? -10.231 -2.390  -4.956  1.00 0.08 ? 59  SER A H    5  
ATOM   6297  H HA   . SER A 1 59 ? -10.532 -0.724  -7.255  1.00 0.11 ? 59  SER A HA   5  
ATOM   6298  H HB2  . SER A 1 59 ? -9.400  -2.779  -7.611  1.00 0.10 ? 59  SER A HB2  5  
ATOM   6299  H HB3  . SER A 1 59 ? -10.677 -3.707  -6.823  1.00 0.10 ? 59  SER A HB3  5  
ATOM   6300  H HG   . SER A 1 59 ? -10.441 -3.032  -9.403  1.00 0.12 ? 59  SER A HG   5  
ATOM   6301  N N    . GLN A 1 60 ? -13.182 -1.832  -5.806  1.00 0.10 ? 60  GLN A N    5  
ATOM   6302  C CA   . GLN A 1 60 ? -14.639 -1.791  -5.790  1.00 0.11 ? 60  GLN A CA   5  
ATOM   6303  C C    . GLN A 1 60 ? -15.142 -0.373  -5.545  1.00 0.11 ? 60  GLN A C    5  
ATOM   6304  O O    . GLN A 1 60 ? -16.092 0.079   -6.185  1.00 0.13 ? 60  GLN A O    5  
ATOM   6305  C CB   . GLN A 1 60 ? -15.186 -2.732  -4.716  1.00 0.11 ? 60  GLN A CB   5  
ATOM   6306  C CG   . GLN A 1 60 ? -16.700 -2.697  -4.588  1.00 0.12 ? 60  GLN A CG   5  
ATOM   6307  C CD   . GLN A 1 60 ? -17.201 -3.427  -3.357  1.00 0.12 ? 60  GLN A CD   5  
ATOM   6308  O OE1  . GLN A 1 60 ? -18.080 -4.285  -3.446  1.00 0.12 ? 60  GLN A OE1  5  
ATOM   6309  N NE2  . GLN A 1 60 ? -16.640 -3.093  -2.202  1.00 0.11 ? 60  GLN A NE2  5  
ATOM   6310  H H    . GLN A 1 60 ? -12.703 -2.118  -5.000  1.00 0.09 ? 60  GLN A H    5  
ATOM   6311  H HA   . GLN A 1 60 ? -14.989 -2.122  -6.757  1.00 0.12 ? 60  GLN A HA   5  
ATOM   6312  H HB2  . GLN A 1 60 ? -14.889 -3.743  -4.953  1.00 0.11 ? 60  GLN A HB2  5  
ATOM   6313  H HB3  . GLN A 1 60 ? -14.759 -2.456  -3.763  1.00 0.10 ? 60  GLN A HB3  5  
ATOM   6314  H HG2  . GLN A 1 60 ? -17.019 -1.668  -4.530  1.00 0.12 ? 60  GLN A HG2  5  
ATOM   6315  H HG3  . GLN A 1 60 ? -17.133 -3.158  -5.464  1.00 0.13 ? 60  GLN A HG3  5  
ATOM   6316  H HE21 . GLN A 1 60 ? -15.944 -2.403  -2.207  1.00 0.10 ? 60  GLN A HE21 5  
ATOM   6317  H HE22 . GLN A 1 60 ? -16.945 -3.550  -1.390  1.00 0.11 ? 60  GLN A HE22 5  
ATOM   6318  N N    . ARG A 1 61 ? -14.499 0.325   -4.613  1.00 0.11 ? 61  ARG A N    5  
ATOM   6319  C CA   . ARG A 1 61 ? -14.882 1.692   -4.283  1.00 0.11 ? 61  ARG A CA   5  
ATOM   6320  C C    . ARG A 1 61 ? -14.523 2.647   -5.417  1.00 0.12 ? 61  ARG A C    5  
ATOM   6321  O O    . ARG A 1 61 ? -15.229 3.623   -5.668  1.00 0.13 ? 61  ARG A O    5  
ATOM   6322  C CB   . ARG A 1 61 ? -14.194 2.138   -2.992  1.00 0.10 ? 61  ARG A CB   5  
ATOM   6323  C CG   . ARG A 1 61 ? -12.812 2.729   -3.208  1.00 0.10 ? 61  ARG A CG   5  
ATOM   6324  C CD   . ARG A 1 61 ? -12.150 3.097   -1.891  1.00 0.09 ? 61  ARG A CD   5  
ATOM   6325  N NE   . ARG A 1 61 ? -11.763 4.505   -1.846  1.00 0.10 ? 61  ARG A NE   5  
ATOM   6326  C CZ   . ARG A 1 61 ? -11.340 5.115   -0.744  1.00 0.09 ? 61  ARG A CZ   5  
ATOM   6327  N NH1  . ARG A 1 61 ? -11.250 4.447   0.396   1.00 0.09 ? 61  ARG A NH1  5  
ATOM   6328  N NH2  . ARG A 1 61 ? -11.008 6.399   -0.784  1.00 0.10 ? 61  ARG A NH2  5  
ATOM   6329  H H    . ARG A 1 61 ? -13.750 -0.091  -4.137  1.00 0.10 ? 61  ARG A H    5  
ATOM   6330  H HA   . ARG A 1 61 ? -15.951 1.711   -4.137  1.00 0.12 ? 61  ARG A HA   5  
ATOM   6331  H HB2  . ARG A 1 61 ? -14.809 2.883   -2.510  1.00 0.10 ? 61  ARG A HB2  5  
ATOM   6332  H HB3  . ARG A 1 61 ? -14.100 1.284   -2.337  1.00 0.09 ? 61  ARG A HB3  5  
ATOM   6333  H HG2  . ARG A 1 61 ? -12.197 2.002   -3.718  1.00 0.09 ? 61  ARG A HG2  5  
ATOM   6334  H HG3  . ARG A 1 61 ? -12.903 3.617   -3.816  1.00 0.10 ? 61  ARG A HG3  5  
ATOM   6335  H HD2  . ARG A 1 61 ? -12.842 2.898   -1.086  1.00 0.09 ? 61  ARG A HD2  5  
ATOM   6336  H HD3  . ARG A 1 61 ? -11.267 2.487   -1.763  1.00 0.08 ? 61  ARG A HD3  5  
ATOM   6337  H HE   . ARG A 1 61 ? -11.822 5.019   -2.678  1.00 0.10 ? 61  ARG A HE   5  
ATOM   6338  H HH11 . ARG A 1 61 ? -10.931 4.908   1.224   1.00 0.09 ? 61  ARG A HH11 5  
ATOM   6339  H HH12 . ARG A 1 61 ? -11.501 3.479   0.430   1.00 0.08 ? 61  ARG A HH12 5  
ATOM   6340  H HH21 . ARG A 1 61 ? -11.076 6.907   -1.641  1.00 0.11 ? 61  ARG A HH21 5  
ATOM   6341  H HH22 . ARG A 1 61 ? -10.689 6.859   0.046   1.00 0.10 ? 61  ARG A HH22 5  
ATOM   6342  N N    . ALA A 1 62 ? -13.421 2.358   -6.102  1.00 0.12 ? 62  ALA A N    5  
ATOM   6343  C CA   . ALA A 1 62 ? -12.969 3.190   -7.211  1.00 0.13 ? 62  ALA A CA   5  
ATOM   6344  C C    . ALA A 1 62 ? -13.886 3.038   -8.419  1.00 0.14 ? 62  ALA A C    5  
ATOM   6345  O O    . ALA A 1 62 ? -14.267 4.025   -9.048  1.00 0.15 ? 62  ALA A O    5  
ATOM   6346  C CB   . ALA A 1 62 ? -11.537 2.838   -7.585  1.00 0.12 ? 62  ALA A CB   5  
ATOM   6347  H H    . ALA A 1 62 ? -12.899 1.566   -5.856  1.00 0.11 ? 62  ALA A H    5  
ATOM   6348  H HA   . ALA A 1 62 ? -12.988 4.220   -6.884  1.00 0.13 ? 62  ALA A HA   5  
ATOM   6349  H HB1  . ALA A 1 62 ? -11.494 1.810   -7.913  1.00 0.12 ? 62  ALA A HB1  5  
ATOM   6350  H HB2  . ALA A 1 62 ? -10.898 2.969   -6.725  1.00 0.11 ? 62  ALA A HB2  5  
ATOM   6351  H HB3  . ALA A 1 62 ? -11.205 3.485   -8.383  1.00 0.13 ? 62  ALA A HB3  5  
ATOM   6352  N N    . MET A 1 63 ? -14.237 1.797   -8.738  1.00 0.14 ? 63  MET A N    5  
ATOM   6353  C CA   . MET A 1 63 ? -15.111 1.518   -9.873  1.00 0.15 ? 63  MET A CA   5  
ATOM   6354  C C    . MET A 1 63 ? -16.527 2.015   -9.603  1.00 0.16 ? 63  MET A C    5  
ATOM   6355  O O    . MET A 1 63 ? -17.230 2.443   -10.519 1.00 0.17 ? 63  MET A O    5  
ATOM   6356  C CB   . MET A 1 63 ? -15.133 0.018   -10.168 1.00 0.15 ? 63  MET A CB   5  
ATOM   6357  C CG   . MET A 1 63 ? -15.899 -0.796  -9.139  1.00 0.15 ? 63  MET A CG   5  
ATOM   6358  S SD   . MET A 1 63 ? -16.069 -2.529  -9.607  1.00 0.15 ? 63  MET A SD   5  
ATOM   6359  C CE   . MET A 1 63 ? -14.352 -3.036  -9.651  1.00 0.14 ? 63  MET A CE   5  
ATOM   6360  H H    . MET A 1 63 ? -13.901 1.051   -8.199  1.00 0.13 ? 63  MET A H    5  
ATOM   6361  H HA   . MET A 1 63 ? -14.715 2.039   -10.731 1.00 0.16 ? 63  MET A HA   5  
ATOM   6362  H HB2  . MET A 1 63 ? -15.591 -0.141  -11.134 1.00 0.16 ? 63  MET A HB2  5  
ATOM   6363  H HB3  . MET A 1 63 ? -14.116 -0.346  -10.198 1.00 0.15 ? 63  MET A HB3  5  
ATOM   6364  H HG2  . MET A 1 63 ? -15.378 -0.741  -8.196  1.00 0.14 ? 63  MET A HG2  5  
ATOM   6365  H HG3  . MET A 1 63 ? -16.885 -0.369  -9.028  1.00 0.15 ? 63  MET A HG3  5  
ATOM   6366  H HE1  . MET A 1 63 ? -13.852 -2.547  -10.475 1.00 0.15 ? 63  MET A HE1  5  
ATOM   6367  H HE2  . MET A 1 63 ? -14.294 -4.106  -9.780  1.00 0.14 ? 63  MET A HE2  5  
ATOM   6368  H HE3  . MET A 1 63 ? -13.870 -2.759  -8.724  1.00 0.13 ? 63  MET A HE3  5  
ATOM   6369  N N    . ILE A 1 64 ? -16.939 1.957   -8.341  1.00 0.15 ? 64  ILE A N    5  
ATOM   6370  C CA   . ILE A 1 64 ? -18.273 2.401   -7.952  1.00 0.16 ? 64  ILE A CA   5  
ATOM   6371  C C    . ILE A 1 64 ? -18.292 3.900   -7.673  1.00 0.16 ? 64  ILE A C    5  
ATOM   6372  O O    . ILE A 1 64 ? -18.795 4.687   -8.476  1.00 0.17 ? 64  ILE A O    5  
ATOM   6373  C CB   . ILE A 1 64 ? -18.775 1.652   -6.704  1.00 0.15 ? 64  ILE A CB   5  
ATOM   6374  C CG1  . ILE A 1 64 ? -18.932 0.160   -7.007  1.00 0.15 ? 64  ILE A CG1  5  
ATOM   6375  C CG2  . ILE A 1 64 ? -20.092 2.241   -6.227  1.00 0.16 ? 64  ILE A CG2  5  
ATOM   6376  C CD1  . ILE A 1 64 ? -19.321 -0.664  -5.801  1.00 0.15 ? 64  ILE A CD1  5  
ATOM   6377  H H    . ILE A 1 64 ? -16.333 1.606   -7.656  1.00 0.14 ? 64  ILE A H    5  
ATOM   6378  H HA   . ILE A 1 64 ? -18.947 2.189   -8.769  1.00 0.17 ? 64  ILE A HA   5  
ATOM   6379  H HB   . ILE A 1 64 ? -18.046 1.778   -5.917  1.00 0.14 ? 64  ILE A HB   5  
ATOM   6380  H HG12 . ILE A 1 64 ? -19.698 0.031   -7.757  1.00 0.16 ? 64  ILE A HG12 5  
ATOM   6381  H HG13 . ILE A 1 64 ? -17.996 -0.224  -7.384  1.00 0.15 ? 64  ILE A HG13 5  
ATOM   6382  H HG21 . ILE A 1 64 ? -20.411 1.731   -5.330  1.00 0.15 ? 64  ILE A HG21 5  
ATOM   6383  H HG22 . ILE A 1 64 ? -20.841 2.118   -6.995  1.00 0.17 ? 64  ILE A HG22 5  
ATOM   6384  H HG23 . ILE A 1 64 ? -19.962 3.292   -6.016  1.00 0.16 ? 64  ILE A HG23 5  
ATOM   6385  H HD11 . ILE A 1 64 ? -20.339 -0.438  -5.523  1.00 0.15 ? 64  ILE A HD11 5  
ATOM   6386  H HD12 . ILE A 1 64 ? -18.662 -0.428  -4.978  1.00 0.14 ? 64  ILE A HD12 5  
ATOM   6387  H HD13 . ILE A 1 64 ? -19.237 -1.715  -6.040  1.00 0.15 ? 64  ILE A HD13 5  
ATOM   6388  N N    . LEU A 1 65 ? -17.739 4.289   -6.529  1.00 0.15 ? 65  LEU A N    5  
ATOM   6389  C CA   . LEU A 1 65 ? -17.689 5.696   -6.142  1.00 0.15 ? 65  LEU A CA   5  
ATOM   6390  C C    . LEU A 1 65 ? -17.103 6.548   -7.263  1.00 0.16 ? 65  LEU A C    5  
ATOM   6391  O O    . LEU A 1 65 ? -17.556 7.666   -7.509  1.00 0.16 ? 65  LEU A O    5  
ATOM   6392  C CB   . LEU A 1 65 ? -16.860 5.866   -4.868  1.00 0.14 ? 65  LEU A CB   5  
ATOM   6393  C CG   . LEU A 1 65 ? -17.468 6.761   -3.785  1.00 0.14 ? 65  LEU A CG   5  
ATOM   6394  C CD1  . LEU A 1 65 ? -18.360 5.947   -2.861  1.00 0.14 ? 65  LEU A CD1  5  
ATOM   6395  C CD2  . LEU A 1 65 ? -16.372 7.460   -2.996  1.00 0.13 ? 65  LEU A CD2  5  
ATOM   6396  H H    . LEU A 1 65 ? -17.353 3.616   -5.931  1.00 0.14 ? 65  LEU A H    5  
ATOM   6397  H HA   . LEU A 1 65 ? -18.700 6.022   -5.949  1.00 0.16 ? 65  LEU A HA   5  
ATOM   6398  H HB2  . LEU A 1 65 ? -16.698 4.887   -4.441  1.00 0.13 ? 65  LEU A HB2  5  
ATOM   6399  H HB3  . LEU A 1 65 ? -15.902 6.279   -5.144  1.00 0.14 ? 65  LEU A HB3  5  
ATOM   6400  H HG   . LEU A 1 65 ? -18.078 7.518   -4.256  1.00 0.15 ? 65  LEU A HG   5  
ATOM   6401  H HD11 . LEU A 1 65 ? -17.764 5.211   -2.342  1.00 0.13 ? 65  LEU A HD11 5  
ATOM   6402  H HD12 . LEU A 1 65 ? -19.122 5.449   -3.442  1.00 0.14 ? 65  LEU A HD12 5  
ATOM   6403  H HD13 . LEU A 1 65 ? -18.827 6.604   -2.142  1.00 0.14 ? 65  LEU A HD13 5  
ATOM   6404  H HD21 . LEU A 1 65 ? -15.868 8.172   -3.631  1.00 0.14 ? 65  LEU A HD21 5  
ATOM   6405  H HD22 . LEU A 1 65 ? -15.661 6.728   -2.641  1.00 0.13 ? 65  LEU A HD22 5  
ATOM   6406  H HD23 . LEU A 1 65 ? -16.809 7.975   -2.153  1.00 0.14 ? 65  LEU A HD23 5  
ATOM   6407  N N    . GLY A 1 66 ? -16.094 6.011   -7.942  1.00 0.15 ? 66  GLY A N    5  
ATOM   6408  C CA   . GLY A 1 66 ? -15.463 6.736   -9.030  1.00 0.16 ? 66  GLY A CA   5  
ATOM   6409  C C    . GLY A 1 66 ? -14.240 7.508   -8.580  1.00 0.16 ? 66  GLY A C    5  
ATOM   6410  O O    . GLY A 1 66 ? -14.047 8.661   -8.967  1.00 0.16 ? 66  GLY A O    5  
ATOM   6411  H H    . GLY A 1 66 ? -15.777 5.114   -7.703  1.00 0.15 ? 66  GLY A H    5  
ATOM   6412  H HA2  . GLY A 1 66 ? -15.170 6.032   -9.794  1.00 0.16 ? 66  GLY A HA2  5  
ATOM   6413  H HA3  . GLY A 1 66 ? -16.179 7.428   -9.448  1.00 0.17 ? 66  GLY A HA3  5  
ATOM   6414  N N    . LYS A 1 67 ? -13.411 6.873   -7.758  1.00 0.15 ? 67  LYS A N    5  
ATOM   6415  C CA   . LYS A 1 67 ? -12.199 7.508   -7.254  1.00 0.14 ? 67  LYS A CA   5  
ATOM   6416  C C    . LYS A 1 67 ? -11.221 6.467   -6.719  1.00 0.13 ? 67  LYS A C    5  
ATOM   6417  O O    . LYS A 1 67 ? -11.558 5.681   -5.833  1.00 0.12 ? 67  LYS A O    5  
ATOM   6418  C CB   . LYS A 1 67 ? -12.545 8.510   -6.150  1.00 0.14 ? 67  LYS A CB   5  
ATOM   6419  C CG   . LYS A 1 67 ? -13.222 7.878   -4.946  1.00 0.13 ? 67  LYS A CG   5  
ATOM   6420  C CD   . LYS A 1 67 ? -12.248 7.689   -3.794  1.00 0.12 ? 67  LYS A CD   5  
ATOM   6421  C CE   . LYS A 1 67 ? -12.298 8.859   -2.824  1.00 0.13 ? 67  LYS A CE   5  
ATOM   6422  N NZ   . LYS A 1 67 ? -12.153 10.166  -3.523  1.00 0.14 ? 67  LYS A NZ   5  
ATOM   6423  H H    . LYS A 1 67 ? -13.618 5.955   -7.486  1.00 0.14 ? 67  LYS A H    5  
ATOM   6424  H HA   . LYS A 1 67 ? -11.734 8.035   -8.073  1.00 0.15 ? 67  LYS A HA   5  
ATOM   6425  H HB2  . LYS A 1 67 ? -11.636 8.988   -5.815  1.00 0.14 ? 67  LYS A HB2  5  
ATOM   6426  H HB3  . LYS A 1 67 ? -13.207 9.259   -6.556  1.00 0.15 ? 67  LYS A HB3  5  
ATOM   6427  H HG2  . LYS A 1 67 ? -14.027 8.519   -4.621  1.00 0.14 ? 67  LYS A HG2  5  
ATOM   6428  H HG3  . LYS A 1 67 ? -13.618 6.915   -5.232  1.00 0.13 ? 67  LYS A HG3  5  
ATOM   6429  H HD2  . LYS A 1 67 ? -12.504 6.784   -3.265  1.00 0.12 ? 67  LYS A HD2  5  
ATOM   6430  H HD3  . LYS A 1 67 ? -11.247 7.606   -4.192  1.00 0.12 ? 67  LYS A HD3  5  
ATOM   6431  H HE2  . LYS A 1 67 ? -13.247 8.841   -2.306  1.00 0.13 ? 67  LYS A HE2  5  
ATOM   6432  H HE3  . LYS A 1 67 ? -11.496 8.752   -2.108  1.00 0.12 ? 67  LYS A HE3  5  
ATOM   6433  H HZ1  . LYS A 1 67 ? -12.917 10.286  -4.219  1.00 0.14 ? 67  LYS A HZ1  5  
ATOM   6434  H HZ2  . LYS A 1 67 ? -11.240 10.207  -4.018  1.00 0.14 ? 67  LYS A HZ2  5  
ATOM   6435  H HZ3  . LYS A 1 67 ? -12.198 10.947  -2.836  1.00 0.14 ? 67  LYS A HZ3  5  
ATOM   6436  N N    . SER A 1 68 ? -10.009 6.465   -7.267  1.00 0.13 ? 68  SER A N    5  
ATOM   6437  C CA   . SER A 1 68 ? -8.983  5.518   -6.847  1.00 0.13 ? 68  SER A CA   5  
ATOM   6438  C C    . SER A 1 68 ? -7.842  6.234   -6.134  1.00 0.13 ? 68  SER A C    5  
ATOM   6439  O O    . SER A 1 68 ? -6.668  5.926   -6.345  1.00 0.13 ? 68  SER A O    5  
ATOM   6440  C CB   . SER A 1 68 ? -8.443  4.750   -8.056  1.00 0.13 ? 68  SER A CB   5  
ATOM   6441  O OG   . SER A 1 68 ? -8.325  5.597   -9.186  1.00 0.14 ? 68  SER A OG   5  
ATOM   6442  H H    . SER A 1 68 ? -9.800  7.116   -7.970  1.00 0.14 ? 68  SER A H    5  
ATOM   6443  H HA   . SER A 1 68 ? -9.438  4.818   -6.162  1.00 0.12 ? 68  SER A HA   5  
ATOM   6444  H HB2  . SER A 1 68 ? -7.467  4.354   -7.820  1.00 0.13 ? 68  SER A HB2  5  
ATOM   6445  H HB3  . SER A 1 68 ? -9.113  3.939   -8.296  1.00 0.13 ? 68  SER A HB3  5  
ATOM   6446  H HG   . SER A 1 68 ? -8.586  5.115   -9.975  1.00 0.15 ? 68  SER A HG   5  
ATOM   6447  N N    . GLY A 1 69 ? -8.193  7.193   -5.283  1.00 0.13 ? 69  GLY A N    5  
ATOM   6448  C CA   . GLY A 1 69 ? -7.187  7.941   -4.549  1.00 0.13 ? 69  GLY A CA   5  
ATOM   6449  C C    . GLY A 1 69 ? -6.312  7.047   -3.694  1.00 0.12 ? 69  GLY A C    5  
ATOM   6450  O O    . GLY A 1 69 ? -5.187  7.412   -3.356  1.00 0.13 ? 69  GLY A O    5  
ATOM   6451  H H    . GLY A 1 69 ? -9.142  7.396   -5.152  1.00 0.13 ? 69  GLY A H    5  
ATOM   6452  H HA2  . GLY A 1 69 ? -6.562  8.470   -5.253  1.00 0.14 ? 69  GLY A HA2  5  
ATOM   6453  H HA3  . GLY A 1 69 ? -7.682  8.659   -3.912  1.00 0.13 ? 69  GLY A HA3  5  
ATOM   6454  N N    . GLU A 1 70 ? -6.830  5.876   -3.341  1.00 0.11 ? 70  GLU A N    5  
ATOM   6455  C CA   . GLU A 1 70 ? -6.088  4.928   -2.516  1.00 0.10 ? 70  GLU A CA   5  
ATOM   6456  C C    . GLU A 1 70 ? -5.609  3.743   -3.347  1.00 0.10 ? 70  GLU A C    5  
ATOM   6457  O O    . GLU A 1 70 ? -4.621  3.090   -3.008  1.00 0.10 ? 70  GLU A O    5  
ATOM   6458  C CB   . GLU A 1 70 ? -6.957  4.437   -1.357  1.00 0.09 ? 70  GLU A CB   5  
ATOM   6459  C CG   . GLU A 1 70 ? -6.700  5.167   -0.050  1.00 0.10 ? 70  GLU A CG   5  
ATOM   6460  C CD   . GLU A 1 70 ? -7.417  6.500   0.027   1.00 0.10 ? 70  GLU A CD   5  
ATOM   6461  O OE1  . GLU A 1 70 ? -7.442  7.098   1.122   1.00 0.11 ? 70  GLU A OE1  5  
ATOM   6462  O OE2  . GLU A 1 70 ? -7.951  6.946   -1.010  1.00 0.11 ? 70  GLU A OE2  5  
ATOM   6463  H H    . GLU A 1 70 ? -7.733  5.642   -3.640  1.00 0.11 ? 70  GLU A H    5  
ATOM   6464  H HA   . GLU A 1 70 ? -5.227  5.443   -2.116  1.00 0.11 ? 70  GLU A HA   5  
ATOM   6465  H HB2  . GLU A 1 70 ? -7.997  4.569   -1.619  1.00 0.09 ? 70  GLU A HB2  5  
ATOM   6466  H HB3  . GLU A 1 70 ? -6.766  3.386   -1.201  1.00 0.09 ? 70  GLU A HB3  5  
ATOM   6467  H HG2  . GLU A 1 70 ? -7.037  4.548   0.767   1.00 0.09 ? 70  GLU A HG2  5  
ATOM   6468  H HG3  . GLU A 1 70 ? -5.638  5.340   0.045   1.00 0.10 ? 70  GLU A HG3  5  
ATOM   6469  N N    . LEU A 1 71 ? -6.318  3.467   -4.437  1.00 0.10 ? 71  LEU A N    5  
ATOM   6470  C CA   . LEU A 1 71 ? -5.965  2.358   -5.317  1.00 0.10 ? 71  LEU A CA   5  
ATOM   6471  C C    . LEU A 1 71 ? -4.594  2.576   -5.947  1.00 0.11 ? 71  LEU A C    5  
ATOM   6472  O O    . LEU A 1 71 ? -3.744  1.686   -5.934  1.00 0.11 ? 71  LEU A O    5  
ATOM   6473  C CB   . LEU A 1 71 ? -7.023  2.195   -6.412  1.00 0.11 ? 71  LEU A CB   5  
ATOM   6474  C CG   . LEU A 1 71 ? -7.562  0.780   -6.620  1.00 0.10 ? 71  LEU A CG   5  
ATOM   6475  C CD1  . LEU A 1 71 ? -8.461  0.726   -7.846  1.00 0.11 ? 71  LEU A CD1  5  
ATOM   6476  C CD2  . LEU A 1 71 ? -6.415  -0.213  -6.751  1.00 0.10 ? 71  LEU A CD2  5  
ATOM   6477  H H    . LEU A 1 71 ? -7.095  4.023   -4.655  1.00 0.11 ? 71  LEU A H    5  
ATOM   6478  H HA   . LEU A 1 71 ? -5.936  1.460   -4.720  1.00 0.10 ? 71  LEU A HA   5  
ATOM   6479  H HB2  . LEU A 1 71 ? -7.855  2.840   -6.173  1.00 0.11 ? 71  LEU A HB2  5  
ATOM   6480  H HB3  . LEU A 1 71 ? -6.591  2.528   -7.344  1.00 0.12 ? 71  LEU A HB3  5  
ATOM   6481  H HG   . LEU A 1 71 ? -8.154  0.497   -5.762  1.00 0.10 ? 71  LEU A HG   5  
ATOM   6482  H HD11 . LEU A 1 71 ? -9.361  1.293   -7.658  1.00 0.11 ? 71  LEU A HD11 5  
ATOM   6483  H HD12 . LEU A 1 71 ? -8.718  -0.302  -8.058  1.00 0.11 ? 71  LEU A HD12 5  
ATOM   6484  H HD13 . LEU A 1 71 ? -7.939  1.148   -8.692  1.00 0.12 ? 71  LEU A HD13 5  
ATOM   6485  H HD21 . LEU A 1 71 ? -5.756  0.101   -7.546  1.00 0.11 ? 71  LEU A HD21 5  
ATOM   6486  H HD22 . LEU A 1 71 ? -6.811  -1.192  -6.977  1.00 0.10 ? 71  LEU A HD22 5  
ATOM   6487  H HD23 . LEU A 1 71 ? -5.866  -0.254  -5.822  1.00 0.10 ? 71  LEU A HD23 5  
ATOM   6488  N N    . LYS A 1 72 ? -4.384  3.767   -6.496  1.00 0.12 ? 72  LYS A N    5  
ATOM   6489  C CA   . LYS A 1 72 ? -3.115  4.106   -7.129  1.00 0.13 ? 72  LYS A CA   5  
ATOM   6490  C C    . LYS A 1 72 ? -1.946  3.811   -6.193  1.00 0.13 ? 72  LYS A C    5  
ATOM   6491  O O    . LYS A 1 72 ? -0.844  3.492   -6.641  1.00 0.14 ? 72  LYS A O    5  
ATOM   6492  C CB   . LYS A 1 72 ? -3.099  5.582   -7.531  1.00 0.14 ? 72  LYS A CB   5  
ATOM   6493  C CG   . LYS A 1 72 ? -3.938  5.887   -8.760  1.00 0.15 ? 72  LYS A CG   5  
ATOM   6494  C CD   . LYS A 1 72 ? -3.075  6.324   -9.931  1.00 0.16 ? 72  LYS A CD   5  
ATOM   6495  C CE   . LYS A 1 72 ? -2.459  7.693   -9.688  1.00 0.17 ? 72  LYS A CE   5  
ATOM   6496  N NZ   . LYS A 1 72 ? -2.740  8.635   -10.805 1.00 0.18 ? 72  LYS A NZ   5  
ATOM   6497  H H    . LYS A 1 72 ? -5.100  4.436   -6.474  1.00 0.12 ? 72  LYS A H    5  
ATOM   6498  H HA   . LYS A 1 72 ? -3.013  3.498   -8.015  1.00 0.14 ? 72  LYS A HA   5  
ATOM   6499  H HB2  . LYS A 1 72 ? -3.477  6.171   -6.708  1.00 0.14 ? 72  LYS A HB2  5  
ATOM   6500  H HB3  . LYS A 1 72 ? -2.080  5.876   -7.735  1.00 0.15 ? 72  LYS A HB3  5  
ATOM   6501  H HG2  . LYS A 1 72 ? -4.483  4.998   -9.041  1.00 0.15 ? 72  LYS A HG2  5  
ATOM   6502  H HG3  . LYS A 1 72 ? -4.635  6.678   -8.522  1.00 0.15 ? 72  LYS A HG3  5  
ATOM   6503  H HD2  . LYS A 1 72 ? -2.283  5.604   -10.071 1.00 0.17 ? 72  LYS A HD2  5  
ATOM   6504  H HD3  . LYS A 1 72 ? -3.686  6.367   -10.820 1.00 0.17 ? 72  LYS A HD3  5  
ATOM   6505  H HE2  . LYS A 1 72 ? -2.866  8.102   -8.775  1.00 0.17 ? 72  LYS A HE2  5  
ATOM   6506  H HE3  . LYS A 1 72 ? -1.390  7.581   -9.585  1.00 0.18 ? 72  LYS A HE3  5  
ATOM   6507  H HZ1  . LYS A 1 72 ? -3.767  8.762   -10.916 1.00 0.18 ? 72  LYS A HZ1  5  
ATOM   6508  H HZ2  . LYS A 1 72 ? -2.351  8.263   -11.694 1.00 0.19 ? 72  LYS A HZ2  5  
ATOM   6509  H HZ3  . LYS A 1 72 ? -2.306  9.560   -10.610 1.00 0.19 ? 72  LYS A HZ3  5  
ATOM   6510  N N    . THR A 1 73 ? -2.192  3.919   -4.892  1.00 0.13 ? 73  THR A N    5  
ATOM   6511  C CA   . THR A 1 73 ? -1.161  3.664   -3.894  1.00 0.13 ? 73  THR A CA   5  
ATOM   6512  C C    . THR A 1 73 ? -1.030  2.173   -3.609  1.00 0.12 ? 73  THR A C    5  
ATOM   6513  O O    . THR A 1 73 ? 0.076   1.642   -3.523  1.00 0.12 ? 73  THR A O    5  
ATOM   6514  C CB   . THR A 1 73 ? -1.458  4.404   -2.577  1.00 0.12 ? 73  THR A CB   5  
ATOM   6515  O OG1  . THR A 1 73 ? -2.026  5.690   -2.854  1.00 0.13 ? 73  THR A OG1  5  
ATOM   6516  C CG2  . THR A 1 73 ? -0.191  4.570   -1.753  1.00 0.13 ? 73  THR A CG2  5  
ATOM   6517  H H    . THR A 1 73 ? -3.090  4.178   -4.595  1.00 0.12 ? 73  THR A H    5  
ATOM   6518  H HA   . THR A 1 73 ? -0.222  4.029   -4.285  1.00 0.14 ? 73  THR A HA   5  
ATOM   6519  H HB   . THR A 1 73 ? -2.167  3.821   -2.005  1.00 0.12 ? 73  THR A HB   5  
ATOM   6520  H HG1  . THR A 1 73 ? -1.433  6.185   -3.425  1.00 0.15 ? 73  THR A HG1  5  
ATOM   6521  H HG21 . THR A 1 73 ? 0.566   5.055   -2.350  1.00 0.14 ? 73  THR A HG21 5  
ATOM   6522  H HG22 . THR A 1 73 ? 0.164   3.600   -1.437  1.00 0.13 ? 73  THR A HG22 5  
ATOM   6523  H HG23 . THR A 1 73 ? -0.405  5.175   -0.883  1.00 0.13 ? 73  THR A HG23 5  
ATOM   6524  N N    . TRP A 1 74 ? -2.167  1.502   -3.462  1.00 0.11 ? 74  TRP A N    5  
ATOM   6525  C CA   . TRP A 1 74 ? -2.179  0.069   -3.186  1.00 0.10 ? 74  TRP A CA   5  
ATOM   6526  C C    . TRP A 1 74 ? -1.493  -0.707  -4.305  1.00 0.11 ? 74  TRP A C    5  
ATOM   6527  O O    . TRP A 1 74 ? -0.592  -1.507  -4.056  1.00 0.11 ? 74  TRP A O    5  
ATOM   6528  C CB   . TRP A 1 74 ? -3.615  -0.425  -3.011  1.00 0.09 ? 74  TRP A CB   5  
ATOM   6529  C CG   . TRP A 1 74 ? -3.702  -1.872  -2.625  1.00 0.08 ? 74  TRP A CG   5  
ATOM   6530  C CD1  . TRP A 1 74 ? -4.452  -2.838  -3.234  1.00 0.08 ? 74  TRP A CD1  5  
ATOM   6531  C CD2  . TRP A 1 74 ? -3.021  -2.512  -1.544  1.00 0.08 ? 74  TRP A CD2  5  
ATOM   6532  N NE1  . TRP A 1 74 ? -4.274  -4.042  -2.596  1.00 0.07 ? 74  TRP A NE1  5  
ATOM   6533  C CE2  . TRP A 1 74 ? -3.401  -3.870  -1.555  1.00 0.07 ? 74  TRP A CE2  5  
ATOM   6534  C CE3  . TRP A 1 74 ? -2.122  -2.074  -0.565  1.00 0.08 ? 74  TRP A CE3  5  
ATOM   6535  C CZ2  . TRP A 1 74 ? -2.915  -4.787  -0.628  1.00 0.07 ? 74  TRP A CZ2  5  
ATOM   6536  C CZ3  . TRP A 1 74 ? -1.641  -2.986  0.355   1.00 0.08 ? 74  TRP A CZ3  5  
ATOM   6537  C CH2  . TRP A 1 74 ? -2.037  -4.329  0.318   1.00 0.08 ? 74  TRP A CH2  5  
ATOM   6538  H H    . TRP A 1 74 ? -3.019  1.980   -3.540  1.00 0.10 ? 74  TRP A H    5  
ATOM   6539  H HA   . TRP A 1 74 ? -1.638  -0.094  -2.267  1.00 0.10 ? 74  TRP A HA   5  
ATOM   6540  H HB2  . TRP A 1 74 ? -4.095  0.155   -2.238  1.00 0.08 ? 74  TRP A HB2  5  
ATOM   6541  H HB3  . TRP A 1 74 ? -4.151  -0.293  -3.940  1.00 0.09 ? 74  TRP A HB3  5  
ATOM   6542  H HD1  . TRP A 1 74 ? -5.086  -2.666  -4.091  1.00 0.08 ? 74  TRP A HD1  5  
ATOM   6543  H HE1  . TRP A 1 74 ? -4.704  -4.887  -2.845  1.00 0.07 ? 74  TRP A HE1  5  
ATOM   6544  H HE3  . TRP A 1 74 ? -1.805  -1.043  -0.520  1.00 0.09 ? 74  TRP A HE3  5  
ATOM   6545  H HZ2  . TRP A 1 74 ? -3.210  -5.825  -0.643  1.00 0.07 ? 74  TRP A HZ2  5  
ATOM   6546  H HZ3  . TRP A 1 74 ? -0.948  -2.664  1.116   1.00 0.09 ? 74  TRP A HZ3  5  
ATOM   6547  H HH2  . TRP A 1 74 ? -1.636  -5.005  1.057   1.00 0.08 ? 74  TRP A HH2  5  
ATOM   6548  N N    . GLY A 1 75 ? -1.925  -0.464  -5.538  1.00 0.11 ? 75  GLY A N    5  
ATOM   6549  C CA   . GLY A 1 75 ? -1.342  -1.149  -6.677  1.00 0.12 ? 75  GLY A CA   5  
ATOM   6550  C C    . GLY A 1 75 ? 0.171   -1.054  -6.698  1.00 0.13 ? 75  GLY A C    5  
ATOM   6551  O O    . GLY A 1 75 ? 0.858   -2.034  -6.986  1.00 0.13 ? 75  GLY A O    5  
ATOM   6552  H H    . GLY A 1 75 ? -2.646  0.186   -5.676  1.00 0.11 ? 75  GLY A H    5  
ATOM   6553  H HA2  . GLY A 1 75 ? -1.625  -2.190  -6.641  1.00 0.11 ? 75  GLY A HA2  5  
ATOM   6554  H HA3  . GLY A 1 75 ? -1.732  -0.712  -7.584  1.00 0.12 ? 75  GLY A HA3  5  
ATOM   6555  N N    . LEU A 1 76 ? 0.691   0.131   -6.392  1.00 0.13 ? 76  LEU A N    5  
ATOM   6556  C CA   . LEU A 1 76 ? 2.133   0.351   -6.379  1.00 0.14 ? 76  LEU A CA   5  
ATOM   6557  C C    . LEU A 1 76 ? 2.788   -0.402  -5.225  1.00 0.14 ? 76  LEU A C    5  
ATOM   6558  O O    . LEU A 1 76 ? 3.692   -1.210  -5.433  1.00 0.15 ? 76  LEU A O    5  
ATOM   6559  C CB   . LEU A 1 76 ? 2.438   1.846   -6.267  1.00 0.15 ? 76  LEU A CB   5  
ATOM   6560  C CG   . LEU A 1 76 ? 2.656   2.588   -7.586  1.00 0.16 ? 76  LEU A CG   5  
ATOM   6561  C CD1  . LEU A 1 76 ? 2.190   4.031   -7.470  1.00 0.17 ? 76  LEU A CD1  5  
ATOM   6562  C CD2  . LEU A 1 76 ? 4.121   2.529   -7.994  1.00 0.18 ? 76  LEU A CD2  5  
ATOM   6563  H H    . LEU A 1 76 ? 0.092   0.874   -6.169  1.00 0.13 ? 76  LEU A H    5  
ATOM   6564  H HA   . LEU A 1 76 ? 2.534   -0.021  -7.311  1.00 0.15 ? 76  LEU A HA   5  
ATOM   6565  H HB2  . LEU A 1 76 ? 1.616   2.317   -5.749  1.00 0.15 ? 76  LEU A HB2  5  
ATOM   6566  H HB3  . LEU A 1 76 ? 3.329   1.962   -5.667  1.00 0.16 ? 76  LEU A HB3  5  
ATOM   6567  H HG   . LEU A 1 76 ? 2.072   2.111   -8.360  1.00 0.16 ? 76  LEU A HG   5  
ATOM   6568  H HD11 . LEU A 1 76 ? 1.131   4.053   -7.257  1.00 0.16 ? 76  LEU A HD11 5  
ATOM   6569  H HD12 . LEU A 1 76 ? 2.380   4.547   -8.399  1.00 0.18 ? 76  LEU A HD12 5  
ATOM   6570  H HD13 . LEU A 1 76 ? 2.727   4.520   -6.670  1.00 0.17 ? 76  LEU A HD13 5  
ATOM   6571  H HD21 . LEU A 1 76 ? 4.674   3.286   -7.462  1.00 0.17 ? 76  LEU A HD21 5  
ATOM   6572  H HD22 . LEU A 1 76 ? 4.206   2.704   -9.057  1.00 0.22 ? 76  LEU A HD22 5  
ATOM   6573  H HD23 . LEU A 1 76 ? 4.522   1.555   -7.757  1.00 0.25 ? 76  LEU A HD23 5  
ATOM   6574  N N    . VAL A 1 77 ? 2.324   -0.131  -4.009  1.00 0.14 ? 77  VAL A N    5  
ATOM   6575  C CA   . VAL A 1 77 ? 2.864   -0.785  -2.823  1.00 0.13 ? 77  VAL A CA   5  
ATOM   6576  C C    . VAL A 1 77 ? 2.766   -2.302  -2.939  1.00 0.13 ? 77  VAL A C    5  
ATOM   6577  O O    . VAL A 1 77 ? 3.520   -3.035  -2.301  1.00 0.13 ? 77  VAL A O    5  
ATOM   6578  C CB   . VAL A 1 77 ? 2.127   -0.329  -1.550  1.00 0.13 ? 77  VAL A CB   5  
ATOM   6579  C CG1  . VAL A 1 77 ? 2.629   -1.102  -0.339  1.00 0.13 ? 77  VAL A CG1  5  
ATOM   6580  C CG2  . VAL A 1 77 ? 2.293   1.167   -1.344  1.00 0.13 ? 77  VAL A CG2  5  
ATOM   6581  H H    . VAL A 1 77 ? 1.601   0.522   -3.908  1.00 0.13 ? 77  VAL A H    5  
ATOM   6582  H HA   . VAL A 1 77 ? 3.903   -0.507  -2.732  1.00 0.14 ? 77  VAL A HA   5  
ATOM   6583  H HB   . VAL A 1 77 ? 1.074   -0.540  -1.671  1.00 0.12 ? 77  VAL A HB   5  
ATOM   6584  H HG11 . VAL A 1 77 ? 2.330   -2.136  -0.422  1.00 0.15 ? 77  VAL A HG11 5  
ATOM   6585  H HG12 . VAL A 1 77 ? 2.208   -0.675  0.561   1.00 0.16 ? 77  VAL A HG12 5  
ATOM   6586  H HG13 . VAL A 1 77 ? 3.708   -1.041  -0.296  1.00 0.17 ? 77  VAL A HG13 5  
ATOM   6587  H HG21 . VAL A 1 77 ? 3.342   1.401   -1.236  1.00 0.14 ? 77  VAL A HG21 5  
ATOM   6588  H HG22 . VAL A 1 77 ? 1.763   1.469   -0.454  1.00 0.13 ? 77  VAL A HG22 5  
ATOM   6589  H HG23 . VAL A 1 77 ? 1.893   1.694   -2.198  1.00 0.14 ? 77  VAL A HG23 5  
ATOM   6590  N N    . LEU A 1 78 ? 1.829   -2.767  -3.760  1.00 0.12 ? 78  LEU A N    5  
ATOM   6591  C CA   . LEU A 1 78 ? 1.631   -4.198  -3.962  1.00 0.12 ? 78  LEU A CA   5  
ATOM   6592  C C    . LEU A 1 78 ? 2.575   -4.733  -5.033  1.00 0.13 ? 78  LEU A C    5  
ATOM   6593  O O    . LEU A 1 78 ? 3.225   -5.762  -4.845  1.00 0.13 ? 78  LEU A O    5  
ATOM   6594  C CB   . LEU A 1 78 ? 0.181   -4.483  -4.356  1.00 0.11 ? 78  LEU A CB   5  
ATOM   6595  C CG   . LEU A 1 78 ? -0.335  -5.891  -4.055  1.00 0.10 ? 78  LEU A CG   5  
ATOM   6596  C CD1  . LEU A 1 78 ? -0.668  -6.031  -2.579  1.00 0.09 ? 78  LEU A CD1  5  
ATOM   6597  C CD2  . LEU A 1 78 ? -1.551  -6.208  -4.911  1.00 0.09 ? 78  LEU A CD2  5  
ATOM   6598  H H    . LEU A 1 78 ? 1.255   -2.134  -4.239  1.00 0.12 ? 78  LEU A H    5  
ATOM   6599  H HA   . LEU A 1 78 ? 1.844   -4.696  -3.029  1.00 0.11 ? 78  LEU A HA   5  
ATOM   6600  H HB2  . LEU A 1 78 ? -0.452  -3.776  -3.840  1.00 0.10 ? 78  LEU A HB2  5  
ATOM   6601  H HB3  . LEU A 1 78 ? 0.084   -4.311  -5.419  1.00 0.11 ? 78  LEU A HB3  5  
ATOM   6602  H HG   . LEU A 1 78 ? 0.438   -6.607  -4.290  1.00 0.10 ? 78  LEU A HG   5  
ATOM   6603  H HD11 . LEU A 1 78 ? -1.445  -5.329  -2.316  1.00 0.08 ? 78  LEU A HD11 5  
ATOM   6604  H HD12 . LEU A 1 78 ? 0.214   -5.829  -1.989  1.00 0.10 ? 78  LEU A HD12 5  
ATOM   6605  H HD13 . LEU A 1 78 ? -1.009  -7.036  -2.381  1.00 0.09 ? 78  LEU A HD13 5  
ATOM   6606  H HD21 . LEU A 1 78 ? -1.264  -6.231  -5.951  1.00 0.10 ? 78  LEU A HD21 5  
ATOM   6607  H HD22 . LEU A 1 78 ? -2.304  -5.446  -4.762  1.00 0.09 ? 78  LEU A HD22 5  
ATOM   6608  H HD23 . LEU A 1 78 ? -1.952  -7.169  -4.626  1.00 0.09 ? 78  LEU A HD23 5  
ATOM   6609  N N    . GLY A 1 79 ? 2.651   -4.027  -6.156  1.00 0.13 ? 79  GLY A N    5  
ATOM   6610  C CA   . GLY A 1 79 ? 3.521   -4.444  -7.239  1.00 0.15 ? 79  GLY A CA   5  
ATOM   6611  C C    . GLY A 1 79 ? 4.941   -4.701  -6.775  1.00 0.15 ? 79  GLY A C    5  
ATOM   6612  O O    . GLY A 1 79 ? 5.659   -5.503  -7.371  1.00 0.16 ? 79  GLY A O    5  
ATOM   6613  H H    . GLY A 1 79 ? 2.112   -3.213  -6.250  1.00 0.13 ? 79  GLY A H    5  
ATOM   6614  H HA2  . GLY A 1 79 ? 3.126   -5.350  -7.675  1.00 0.14 ? 79  GLY A HA2  5  
ATOM   6615  H HA3  . GLY A 1 79 ? 3.535   -3.671  -7.993  1.00 0.15 ? 79  GLY A HA3  5  
ATOM   6616  N N    . ALA A 1 80 ? 5.347   -4.019  -5.709  1.00 0.15 ? 80  ALA A N    5  
ATOM   6617  C CA   . ALA A 1 80 ? 6.690   -4.179  -5.167  1.00 0.16 ? 80  ALA A CA   5  
ATOM   6618  C C    . ALA A 1 80 ? 6.765   -5.386  -4.237  1.00 0.16 ? 80  ALA A C    5  
ATOM   6619  O O    . ALA A 1 80 ? 7.605   -6.269  -4.417  1.00 0.17 ? 80  ALA A O    5  
ATOM   6620  C CB   . ALA A 1 80 ? 7.117   -2.917  -4.433  1.00 0.17 ? 80  ALA A CB   5  
ATOM   6621  H H    . ALA A 1 80 ? 4.728   -3.393  -5.278  1.00 0.15 ? 80  ALA A H    5  
ATOM   6622  H HA   . ALA A 1 80 ? 7.367   -4.333  -5.994  1.00 0.17 ? 80  ALA A HA   5  
ATOM   6623  H HB1  . ALA A 1 80 ? 6.501   -2.786  -3.555  1.00 0.16 ? 80  ALA A HB1  5  
ATOM   6624  H HB2  . ALA A 1 80 ? 6.999   -2.064  -5.085  1.00 0.18 ? 80  ALA A HB2  5  
ATOM   6625  H HB3  . ALA A 1 80 ? 8.152   -3.005  -4.137  1.00 0.18 ? 80  ALA A HB3  5  
ATOM   6626  N N    . LEU A 1 81 ? 5.887   -5.414  -3.241  1.00 0.15 ? 81  LEU A N    5  
ATOM   6627  C CA   . LEU A 1 81 ? 5.856   -6.512  -2.280  1.00 0.15 ? 81  LEU A CA   5  
ATOM   6628  C C    . LEU A 1 81 ? 5.671   -7.851  -2.989  1.00 0.14 ? 81  LEU A C    5  
ATOM   6629  O O    . LEU A 1 81 ? 6.345   -8.830  -2.673  1.00 0.15 ? 81  LEU A O    5  
ATOM   6630  C CB   . LEU A 1 81 ? 4.729   -6.297  -1.269  1.00 0.14 ? 81  LEU A CB   5  
ATOM   6631  C CG   . LEU A 1 81 ? 5.157   -5.825  0.122   1.00 0.14 ? 81  LEU A CG   5  
ATOM   6632  C CD1  . LEU A 1 81 ? 3.949   -5.700  1.040   1.00 0.13 ? 81  LEU A CD1  5  
ATOM   6633  C CD2  . LEU A 1 81 ? 6.184   -6.776  0.716   1.00 0.15 ? 81  LEU A CD2  5  
ATOM   6634  H H    . LEU A 1 81 ? 5.244   -4.681  -3.148  1.00 0.14 ? 81  LEU A H    5  
ATOM   6635  H HA   . LEU A 1 81 ? 6.800   -6.523  -1.758  1.00 0.15 ? 81  LEU A HA   5  
ATOM   6636  H HB2  . LEU A 1 81 ? 4.047   -5.566  -1.676  1.00 0.13 ? 81  LEU A HB2  5  
ATOM   6637  H HB3  . LEU A 1 81 ? 4.198   -7.231  -1.156  1.00 0.13 ? 81  LEU A HB3  5  
ATOM   6638  H HG   . LEU A 1 81 ? 5.613   -4.849  0.038   1.00 0.15 ? 81  LEU A HG   5  
ATOM   6639  H HD11 . LEU A 1 81 ? 3.733   -6.660  1.482   1.00 0.13 ? 81  LEU A HD11 5  
ATOM   6640  H HD12 . LEU A 1 81 ? 3.096   -5.367  0.467   1.00 0.12 ? 81  LEU A HD12 5  
ATOM   6641  H HD13 . LEU A 1 81 ? 4.163   -4.985  1.819   1.00 0.13 ? 81  LEU A HD13 5  
ATOM   6642  H HD21 . LEU A 1 81 ? 5.864   -7.795  0.558   1.00 0.14 ? 81  LEU A HD21 5  
ATOM   6643  H HD22 . LEU A 1 81 ? 6.277   -6.588  1.775   1.00 0.15 ? 81  LEU A HD22 5  
ATOM   6644  H HD23 . LEU A 1 81 ? 7.140   -6.620  0.239   1.00 0.16 ? 81  LEU A HD23 5  
ATOM   6645  N N    . LYS A 1 82 ? 4.752   -7.883  -3.948  1.00 0.14 ? 82  LYS A N    5  
ATOM   6646  C CA   . LYS A 1 82 ? 4.480   -9.100  -4.705  1.00 0.14 ? 82  LYS A CA   5  
ATOM   6647  C C    . LYS A 1 82 ? 5.768   -9.691  -5.267  1.00 0.15 ? 82  LYS A C    5  
ATOM   6648  O O    . LYS A 1 82 ? 5.899   -10.908 -5.394  1.00 0.15 ? 82  LYS A O    5  
ATOM   6649  C CB   . LYS A 1 82 ? 3.502   -8.806  -5.845  1.00 0.13 ? 82  LYS A CB   5  
ATOM   6650  C CG   . LYS A 1 82 ? 2.093   -9.309  -5.583  1.00 0.12 ? 82  LYS A CG   5  
ATOM   6651  C CD   . LYS A 1 82 ? 1.065   -8.536  -6.393  1.00 0.12 ? 82  LYS A CD   5  
ATOM   6652  C CE   . LYS A 1 82 ? -0.294  -9.219  -6.364  1.00 0.11 ? 82  LYS A CE   5  
ATOM   6653  N NZ   . LYS A 1 82 ? -0.655  -9.789  -7.693  1.00 0.12 ? 82  LYS A NZ   5  
ATOM   6654  H H    . LYS A 1 82 ? 4.246   -7.069  -4.153  1.00 0.13 ? 82  LYS A H    5  
ATOM   6655  H HA   . LYS A 1 82 ? 4.031   -9.815  -4.033  1.00 0.13 ? 82  LYS A HA   5  
ATOM   6656  H HB2  . LYS A 1 82 ? 3.457   -7.737  -6.000  1.00 0.13 ? 82  LYS A HB2  5  
ATOM   6657  H HB3  . LYS A 1 82 ? 3.867   -9.274  -6.747  1.00 0.14 ? 82  LYS A HB3  5  
ATOM   6658  H HG2  . LYS A 1 82 ? 2.037   -10.353 -5.852  1.00 0.12 ? 82  LYS A HG2  5  
ATOM   6659  H HG3  . LYS A 1 82 ? 1.871   -9.193  -4.532  1.00 0.12 ? 82  LYS A HG3  5  
ATOM   6660  H HD2  . LYS A 1 82 ? 0.968   -7.543  -5.981  1.00 0.12 ? 82  LYS A HD2  5  
ATOM   6661  H HD3  . LYS A 1 82 ? 1.404   -8.471  -7.416  1.00 0.13 ? 82  LYS A HD3  5  
ATOM   6662  H HE2  . LYS A 1 82 ? -0.268  -10.015 -5.636  1.00 0.11 ? 82  LYS A HE2  5  
ATOM   6663  H HE3  . LYS A 1 82 ? -1.042  -8.494  -6.078  1.00 0.10 ? 82  LYS A HE3  5  
ATOM   6664  H HZ1  . LYS A 1 82 ? -1.587  -10.250 -7.642  1.00 0.11 ? 82  LYS A HZ1  5  
ATOM   6665  H HZ2  . LYS A 1 82 ? 0.052   -10.492 -7.984  1.00 0.12 ? 82  LYS A HZ2  5  
ATOM   6666  H HZ3  . LYS A 1 82 ? -0.693  -9.033  -8.407  1.00 0.12 ? 82  LYS A HZ3  5  
ATOM   6667  N N    . ALA A 1 83 ? 6.719   -8.823  -5.599  1.00 0.16 ? 83  ALA A N    5  
ATOM   6668  C CA   . ALA A 1 83 ? 7.998   -9.261  -6.141  1.00 0.17 ? 83  ALA A CA   5  
ATOM   6669  C C    . ALA A 1 83 ? 8.967   -9.641  -5.026  1.00 0.18 ? 83  ALA A C    5  
ATOM   6670  O O    . ALA A 1 83 ? 9.835   -10.493 -5.211  1.00 0.19 ? 83  ALA A O    5  
ATOM   6671  C CB   . ALA A 1 83 ? 8.599   -8.173  -7.018  1.00 0.18 ? 83  ALA A CB   5  
ATOM   6672  H H    . ALA A 1 83 ? 6.554   -7.865  -5.475  1.00 0.16 ? 83  ALA A H    5  
ATOM   6673  H HA   . ALA A 1 83 ? 7.819   -10.130 -6.758  1.00 0.17 ? 83  ALA A HA   5  
ATOM   6674  H HB1  . ALA A 1 83 ? 8.796   -7.297  -6.420  1.00 0.18 ? 83  ALA A HB1  5  
ATOM   6675  H HB2  . ALA A 1 83 ? 7.904   -7.922  -7.806  1.00 0.18 ? 83  ALA A HB2  5  
ATOM   6676  H HB3  . ALA A 1 83 ? 9.522   -8.529  -7.453  1.00 0.19 ? 83  ALA A HB3  5  
ATOM   6677  N N    . ALA A 1 84 ? 8.813   -9.001  -3.872  1.00 0.17 ? 84  ALA A N    5  
ATOM   6678  C CA   . ALA A 1 84 ? 9.674   -9.272  -2.728  1.00 0.18 ? 84  ALA A CA   5  
ATOM   6679  C C    . ALA A 1 84 ? 9.339   -10.619 -2.097  1.00 0.18 ? 84  ALA A C    5  
ATOM   6680  O O    . ALA A 1 84 ? 10.180  -11.234 -1.441  1.00 0.18 ? 84  ALA A O    5  
ATOM   6681  C CB   . ALA A 1 84 ? 9.550   -8.158  -1.698  1.00 0.18 ? 84  ALA A CB   5  
ATOM   6682  H H    . ALA A 1 84 ? 8.103   -8.330  -3.788  1.00 0.17 ? 84  ALA A H    5  
ATOM   6683  H HA   . ALA A 1 84 ? 10.696  -9.294  -3.079  1.00 0.19 ? 84  ALA A HA   5  
ATOM   6684  H HB1  . ALA A 1 84 ? 10.235  -8.344  -0.884  1.00 0.19 ? 84  ALA A HB1  5  
ATOM   6685  H HB2  . ALA A 1 84 ? 8.539   -8.129  -1.319  1.00 0.17 ? 84  ALA A HB2  5  
ATOM   6686  H HB3  . ALA A 1 84 ? 9.788   -7.212  -2.161  1.00 0.18 ? 84  ALA A HB3  5  
ATOM   6687  N N    . ARG A 1 85 ? 8.107   -11.071 -2.298  1.00 0.16 ? 85  ARG A N    5  
ATOM   6688  C CA   . ARG A 1 85 ? 7.660   -12.345 -1.747  1.00 0.16 ? 85  ARG A CA   5  
ATOM   6689  C C    . ARG A 1 85 ? 7.635   -13.425 -2.824  1.00 0.16 ? 85  ARG A C    5  
ATOM   6690  O O    . ARG A 1 85 ? 6.937   -14.431 -2.691  1.00 0.16 ? 85  ARG A O    5  
ATOM   6691  C CB   . ARG A 1 85 ? 6.270   -12.197 -1.124  1.00 0.15 ? 85  ARG A CB   5  
ATOM   6692  C CG   . ARG A 1 85 ? 6.230   -11.244 0.059   1.00 0.15 ? 85  ARG A CG   5  
ATOM   6693  C CD   . ARG A 1 85 ? 4.842   -11.183 0.679   1.00 0.14 ? 85  ARG A CD   5  
ATOM   6694  N NE   . ARG A 1 85 ? 4.895   -11.193 2.138   1.00 0.14 ? 85  ARG A NE   5  
ATOM   6695  C CZ   . ARG A 1 85 ? 5.279   -12.245 2.853   1.00 0.14 ? 85  ARG A CZ   5  
ATOM   6696  N NH1  . ARG A 1 85 ? 5.642   -13.365 2.247   1.00 0.15 ? 85  ARG A NH1  5  
ATOM   6697  N NH2  . ARG A 1 85 ? 5.299   -12.177 4.178   1.00 0.15 ? 85  ARG A NH2  5  
ATOM   6698  H H    . ARG A 1 85 ? 7.482   -10.535 -2.830  1.00 0.16 ? 85  ARG A H    5  
ATOM   6699  H HA   . ARG A 1 85 ? 8.359   -12.636 -0.977  1.00 0.17 ? 85  ARG A HA   5  
ATOM   6700  H HB2  . ARG A 1 85 ? 5.588   -11.830 -1.878  1.00 0.14 ? 85  ARG A HB2  5  
ATOM   6701  H HB3  . ARG A 1 85 ? 5.933   -13.167 -0.790  1.00 0.15 ? 85  ARG A HB3  5  
ATOM   6702  H HG2  . ARG A 1 85 ? 6.932   -11.583 0.805   1.00 0.15 ? 85  ARG A HG2  5  
ATOM   6703  H HG3  . ARG A 1 85 ? 6.508   -10.256 -0.278  1.00 0.15 ? 85  ARG A HG3  5  
ATOM   6704  H HD2  . ARG A 1 85 ? 4.355   -10.277 0.353   1.00 0.13 ? 85  ARG A HD2  5  
ATOM   6705  H HD3  . ARG A 1 85 ? 4.275   -12.038 0.342   1.00 0.13 ? 85  ARG A HD3  5  
ATOM   6706  H HE   . ARG A 1 85 ? 4.630   -10.375 2.608   1.00 0.14 ? 85  ARG A HE   5  
ATOM   6707  H HH11 . ARG A 1 85 ? 5.931   -14.157 2.786   1.00 0.15 ? 85  ARG A HH11 5  
ATOM   6708  H HH12 . ARG A 1 85 ? 5.626   -13.422 1.248   1.00 0.15 ? 85  ARG A HH12 5  
ATOM   6709  H HH21 . ARG A 1 85 ? 5.024   -11.333 4.640   1.00 0.15 ? 85  ARG A HH21 5  
ATOM   6710  H HH22 . ARG A 1 85 ? 5.589   -12.968 4.716   1.00 0.15 ? 85  ARG A HH22 5  
ATOM   6711  N N    . GLU A 1 86 ? 8.400   -13.210 -3.889  1.00 0.17 ? 86  GLU A N    5  
ATOM   6712  C CA   . GLU A 1 86 ? 8.464   -14.164 -4.990  1.00 0.17 ? 86  GLU A CA   5  
ATOM   6713  C C    . GLU A 1 86 ? 9.873   -14.734 -5.134  1.00 0.19 ? 86  GLU A C    5  
ATOM   6714  O O    . GLU A 1 86 ? 10.050  -15.875 -5.558  1.00 0.19 ? 86  GLU A O    5  
ATOM   6715  C CB   . GLU A 1 86 ? 8.034   -13.498 -6.298  1.00 0.17 ? 86  GLU A CB   5  
ATOM   6716  C CG   . GLU A 1 86 ? 6.623   -13.862 -6.730  1.00 0.16 ? 86  GLU A CG   5  
ATOM   6717  C CD   . GLU A 1 86 ? 6.274   -13.313 -8.100  1.00 0.17 ? 86  GLU A CD   5  
ATOM   6718  O OE1  . GLU A 1 86 ? 6.913   -13.733 -9.087  1.00 0.18 ? 86  GLU A OE1  5  
ATOM   6719  O OE2  . GLU A 1 86 ? 5.362   -12.464 -8.185  1.00 0.16 ? 86  GLU A OE2  5  
ATOM   6720  H H    . GLU A 1 86 ? 8.934   -12.389 -3.935  1.00 0.17 ? 86  GLU A H    5  
ATOM   6721  H HA   . GLU A 1 86 ? 7.783   -14.972 -4.766  1.00 0.17 ? 86  GLU A HA   5  
ATOM   6722  H HB2  . GLU A 1 86 ? 8.085   -12.426 -6.176  1.00 0.17 ? 86  GLU A HB2  5  
ATOM   6723  H HB3  . GLU A 1 86 ? 8.714   -13.795 -7.081  1.00 0.18 ? 86  GLU A HB3  5  
ATOM   6724  H HG2  . GLU A 1 86 ? 6.535   -14.937 -6.757  1.00 0.17 ? 86  GLU A HG2  5  
ATOM   6725  H HG3  . GLU A 1 86 ? 5.925   -13.461 -6.009  1.00 0.16 ? 86  GLU A HG3  5  
ATOM   6726  N N    . GLU A 1 87 ? 10.869  -13.929 -4.780  1.00 0.19 ? 87  GLU A N    5  
ATOM   6727  C CA   . GLU A 1 87 ? 12.261  -14.352 -4.872  1.00 0.21 ? 87  GLU A CA   5  
ATOM   6728  C C    . GLU A 1 87 ? 12.635  -15.253 -3.700  1.00 0.21 ? 87  GLU A C    5  
ATOM   6729  O O    . GLU A 1 87 ? 13.689  -15.889 -3.704  1.00 0.22 ? 87  GLU A O    5  
ATOM   6730  C CB   . GLU A 1 87 ? 13.186  -13.133 -4.908  1.00 0.21 ? 87  GLU A CB   5  
ATOM   6731  C CG   . GLU A 1 87 ? 13.624  -12.742 -6.309  1.00 0.22 ? 87  GLU A CG   5  
ATOM   6732  C CD   . GLU A 1 87 ? 15.131  -12.662 -6.449  1.00 0.24 ? 87  GLU A CD   5  
ATOM   6733  O OE1  . GLU A 1 87 ? 15.736  -13.651 -6.916  1.00 0.24 ? 87  GLU A OE1  5  
ATOM   6734  O OE2  . GLU A 1 87 ? 15.706  -11.615 -6.091  1.00 0.24 ? 87  GLU A OE2  5  
ATOM   6735  O OXT  . GLU A 1 87 ? 11.870  -15.311 -2.691  1.00 0.20 ? 87  GLU A OXT  5  
ATOM   6736  H H    . GLU A 1 87 ? 10.664  -13.030 -4.449  1.00 0.19 ? 87  GLU A H    5  
ATOM   6737  H HA   . GLU A 1 87 ? 12.378  -14.909 -5.790  1.00 0.21 ? 87  GLU A HA   5  
ATOM   6738  H HB2  . GLU A 1 87 ? 12.672  -12.293 -4.466  1.00 0.21 ? 87  GLU A HB2  5  
ATOM   6739  H HB3  . GLU A 1 87 ? 14.069  -13.351 -4.325  1.00 0.22 ? 87  GLU A HB3  5  
ATOM   6740  H HG2  . GLU A 1 87 ? 13.252  -13.476 -7.008  1.00 0.22 ? 87  GLU A HG2  5  
ATOM   6741  H HG3  . GLU A 1 87 ? 13.203  -11.776 -6.546  1.00 0.22 ? 87  GLU A HG3  5  
HETATM 6742  C C1   . I3P B 2 .  ? 11.886  9.415   1.147   1.00 0.80 ? 101 I3P A C1   5  
HETATM 6743  C C2   . I3P B 2 .  ? 11.873  9.852   2.631   1.00 0.90 ? 101 I3P A C2   5  
HETATM 6744  C C3   . I3P B 2 .  ? 11.613  11.368  2.734   1.00 0.87 ? 101 I3P A C3   5  
HETATM 6745  C C4   . I3P B 2 .  ? 10.280  11.748  2.051   1.00 0.99 ? 101 I3P A C4   5  
HETATM 6746  C C5   . I3P B 2 .  ? 10.289  11.301  0.572   1.00 0.89 ? 101 I3P A C5   5  
HETATM 6747  C C6   . I3P B 2 .  ? 10.555  9.784   0.464   1.00 0.77 ? 101 I3P A C6   5  
HETATM 6748  O O1   . I3P B 2 .  ? 12.071  8.015   1.063   1.00 1.09 ? 101 I3P A O1   5  
HETATM 6749  O O2   . I3P B 2 .  ? 10.879  9.153   3.342   1.00 1.13 ? 101 I3P A O2   5  
HETATM 6750  O O3   . I3P B 2 .  ? 11.588  11.738  4.089   1.00 1.18 ? 101 I3P A O3   5  
HETATM 6751  O O4   . I3P B 2 .  ? 10.125  13.154  2.101   1.00 1.27 ? 101 I3P A O4   5  
HETATM 6752  O O5   . I3P B 2 .  ? 9.027   11.584  -0.001  1.00 1.24 ? 101 I3P A O5   5  
HETATM 6753  O O6   . I3P B 2 .  ? 10.618  9.404   -0.888  1.00 0.95 ? 101 I3P A O6   5  
HETATM 6754  P P1   . I3P B 2 .  ? 13.727  7.641   0.631   1.00 1.49 ? 101 I3P A P1   5  
HETATM 6755  O O11  . I3P B 2 .  ? 14.174  8.342   -0.894  1.00 1.57 ? 101 I3P A O11  5  
HETATM 6756  O O12  . I3P B 2 .  ? 14.657  8.228   1.729   1.00 1.59 ? 101 I3P A O12  5  
HETATM 6757  O O13  . I3P B 2 .  ? 13.977  5.923   0.620   1.00 1.97 ? 101 I3P A O13  5  
HETATM 6758  P P4   . I3P B 2 .  ? 8.681   13.580  2.995   1.00 1.78 ? 101 I3P A P4   5  
HETATM 6759  O O41  . I3P B 2 .  ? 7.452   13.060  2.202   1.00 1.94 ? 101 I3P A O41  5  
HETATM 6760  O O42  . I3P B 2 .  ? 8.644   12.853  4.572   1.00 1.90 ? 101 I3P A O42  5  
HETATM 6761  O O43  . I3P B 2 .  ? 8.514   15.303  3.109   1.00 2.20 ? 101 I3P A O43  5  
HETATM 6762  P P5   . I3P B 2 .  ? 9.178   12.800  -1.255  1.00 1.58 ? 101 I3P A P5   5  
HETATM 6763  O O51  . I3P B 2 .  ? 9.989   12.180  -2.424  1.00 1.56 ? 101 I3P A O51  5  
HETATM 6764  O O52  . I3P B 2 .  ? 7.621   13.223  -1.891  1.00 2.10 ? 101 I3P A O52  5  
HETATM 6765  O O53  . I3P B 2 .  ? 10.027  14.212  -0.708  1.00 1.65 ? 101 I3P A O53  5  
HETATM 6766  H H1   . I3P B 2 .  ? 12.689  9.949   0.628   1.00 0.84 ? 101 I3P A H1   5  
HETATM 6767  H H2   . I3P B 2 .  ? 12.847  9.635   3.076   1.00 1.09 ? 101 I3P A H2   5  
HETATM 6768  H H3   . I3P B 2 .  ? 12.429  11.903  2.241   1.00 0.81 ? 101 I3P A H3   5  
HETATM 6769  H H4   . I3P B 2 .  ? 9.459   11.239  2.564   1.00 1.17 ? 101 I3P A H4   5  
HETATM 6770  H H5   . I3P B 2 .  ? 11.094  11.829  0.051   1.00 0.89 ? 101 I3P A H5   5  
HETATM 6771  H H6   . I3P B 2 .  ? 9.732   9.243   0.941   1.00 0.90 ? 101 I3P A H6   5  
HETATM 6772  H HO2  . I3P B 2 .  ? 10.423  8.573   2.703   1.00 1.23 ? 101 I3P A HO2  5  
HETATM 6773  H HO3  . I3P B 2 .  ? 10.973  12.493  4.172   1.00 1.33 ? 101 I3P A HO3  5  
HETATM 6774  H HO6  . I3P B 2 .  ? 10.187  10.110  -1.408  1.00 1.04 ? 101 I3P A HO6  5  
HETATM 6775  H HO13 . I3P B 2 .  ? 14.908  5.730   0.409   1.00 2.23 ? 101 I3P A HO13 5  
ATOM   6776  N N    . SER A 1 1  ? 2.666   3.704   10.410  1.00 0.76 ? 1   SER A N    6  
ATOM   6777  C CA   . SER A 1 1  ? 2.273   4.799   11.292  1.00 0.88 ? 1   SER A CA   6  
ATOM   6778  C C    . SER A 1 1  ? 3.396   5.822   11.419  1.00 0.88 ? 1   SER A C    6  
ATOM   6779  O O    . SER A 1 1  ? 3.155   6.987   11.735  1.00 0.98 ? 1   SER A O    6  
ATOM   6780  C CB   . SER A 1 1  ? 1.900   4.258   12.673  1.00 0.96 ? 1   SER A CB   6  
ATOM   6781  O OG   . SER A 1 1  ? 0.498   4.090   12.794  1.00 1.05 ? 1   SER A OG   6  
ATOM   6782  H H1   . SER A 1 1  ? 2.897   4.071   9.465   1.00 0.73 ? 1   SER A H1   6  
ATOM   6783  H H2   . SER A 1 1  ? 1.888   3.019   10.324  1.00 0.79 ? 1   SER A H2   6  
ATOM   6784  H H3   . SER A 1 1  ? 3.500   3.218   10.794  1.00 0.72 ? 1   SER A H3   6  
ATOM   6785  H HA   . SER A 1 1  ? 1.410   5.284   10.861  1.00 0.95 ? 1   SER A HA   6  
ATOM   6786  H HB2  . SER A 1 1  ? 2.378   3.302   12.826  1.00 0.91 ? 1   SER A HB2  6  
ATOM   6787  H HB3  . SER A 1 1  ? 2.233   4.952   13.432  1.00 1.02 ? 1   SER A HB3  6  
ATOM   6788  H HG   . SER A 1 1  ? 0.165   4.661   13.490  1.00 1.13 ? 1   SER A HG   6  
ATOM   6789  N N    . GLU A 1 2  ? 4.626   5.378   11.172  1.00 0.79 ? 2   GLU A N    6  
ATOM   6790  C CA   . GLU A 1 2  ? 5.785   6.257   11.262  1.00 0.83 ? 2   GLU A CA   6  
ATOM   6791  C C    . GLU A 1 2  ? 7.047   5.538   10.790  1.00 0.76 ? 2   GLU A C    6  
ATOM   6792  O O    . GLU A 1 2  ? 7.922   6.141   10.170  1.00 0.77 ? 2   GLU A O    6  
ATOM   6793  C CB   . GLU A 1 2  ? 5.971   6.749   12.697  1.00 0.96 ? 2   GLU A CB   6  
ATOM   6794  C CG   . GLU A 1 2  ? 6.460   5.673   13.652  1.00 0.99 ? 2   GLU A CG   6  
ATOM   6795  C CD   . GLU A 1 2  ? 6.661   6.191   15.063  1.00 1.14 ? 2   GLU A CD   6  
ATOM   6796  O OE1  . GLU A 1 2  ? 7.135   7.338   15.211  1.00 1.22 ? 2   GLU A OE1  6  
ATOM   6797  O OE2  . GLU A 1 2  ? 6.342   5.453   16.018  1.00 1.19 ? 2   GLU A OE2  6  
ATOM   6798  H H    . GLU A 1 2  ? 4.755   4.440   10.925  1.00 0.72 ? 2   GLU A H    6  
ATOM   6799  H HA   . GLU A 1 2  ? 5.608   7.105   10.619  1.00 0.86 ? 2   GLU A HA   6  
ATOM   6800  H HB2  . GLU A 1 2  ? 6.691   7.555   12.699  1.00 1.02 ? 2   GLU A HB2  6  
ATOM   6801  H HB3  . GLU A 1 2  ? 5.026   7.122   13.062  1.00 1.02 ? 2   GLU A HB3  6  
ATOM   6802  H HG2  . GLU A 1 2  ? 5.733   4.876   13.679  1.00 0.95 ? 2   GLU A HG2  6  
ATOM   6803  H HG3  . GLU A 1 2  ? 7.402   5.287   13.288  1.00 0.95 ? 2   GLU A HG3  6  
ATOM   6804  N N    . ALA A 1 3  ? 7.134   4.247   11.092  1.00 0.72 ? 3   ALA A N    6  
ATOM   6805  C CA   . ALA A 1 3  ? 8.287   3.447   10.698  1.00 0.70 ? 3   ALA A CA   6  
ATOM   6806  C C    . ALA A 1 3  ? 8.021   2.703   9.395   1.00 0.57 ? 3   ALA A C    6  
ATOM   6807  O O    . ALA A 1 3  ? 8.839   2.728   8.475   1.00 0.56 ? 3   ALA A O    6  
ATOM   6808  C CB   . ALA A 1 3  ? 8.650   2.465   11.804  1.00 0.79 ? 3   ALA A CB   6  
ATOM   6809  H H    . ALA A 1 3  ? 6.408   3.823   11.595  1.00 0.73 ? 3   ALA A H    6  
ATOM   6810  H HA   . ALA A 1 3  ? 9.124   4.116   10.556  1.00 0.75 ? 3   ALA A HA   6  
ATOM   6811  H HB1  . ALA A 1 3  ? 8.834   3.006   12.720  1.00 0.89 ? 3   ALA A HB1  6  
ATOM   6812  H HB2  . ALA A 1 3  ? 9.538   1.918   11.523  1.00 0.82 ? 3   ALA A HB2  6  
ATOM   6813  H HB3  . ALA A 1 3  ? 7.833   1.774   11.953  1.00 0.76 ? 3   ALA A HB3  6  
ATOM   6814  N N    . VAL A 1 4  ? 6.859   2.058   9.318   1.00 0.52 ? 4   VAL A N    6  
ATOM   6815  C CA   . VAL A 1 4  ? 6.472   1.279   8.139   1.00 0.45 ? 4   VAL A CA   6  
ATOM   6816  C C    . VAL A 1 4  ? 6.372   2.149   6.879   1.00 0.43 ? 4   VAL A C    6  
ATOM   6817  O O    . VAL A 1 4  ? 6.481   1.647   5.760   1.00 0.44 ? 4   VAL A O    6  
ATOM   6818  C CB   . VAL A 1 4  ? 5.129   0.551   8.371   1.00 0.49 ? 4   VAL A CB   6  
ATOM   6819  C CG1  . VAL A 1 4  ? 4.896   -0.512  7.308   1.00 0.55 ? 4   VAL A CG1  6  
ATOM   6820  C CG2  . VAL A 1 4  ? 5.092   -0.067  9.761   1.00 0.62 ? 4   VAL A CG2  6  
ATOM   6821  H H    . VAL A 1 4  ? 6.243   2.103   10.077  1.00 0.57 ? 4   VAL A H    6  
ATOM   6822  H HA   . VAL A 1 4  ? 7.233   0.530   7.978   1.00 0.46 ? 4   VAL A HA   6  
ATOM   6823  H HB   . VAL A 1 4  ? 4.332   1.278   8.302   1.00 0.59 ? 4   VAL A HB   6  
ATOM   6824  H HG11 . VAL A 1 4  ? 4.859   -0.047  6.334   1.00 0.62 ? 4   VAL A HG11 6  
ATOM   6825  H HG12 . VAL A 1 4  ? 3.959   -1.016  7.501   1.00 0.62 ? 4   VAL A HG12 6  
ATOM   6826  H HG13 . VAL A 1 4  ? 5.703   -1.230  7.333   1.00 0.62 ? 4   VAL A HG13 6  
ATOM   6827  H HG21 . VAL A 1 4  ? 4.210   -0.684  9.858   1.00 0.68 ? 4   VAL A HG21 6  
ATOM   6828  H HG22 . VAL A 1 4  ? 5.064   0.717   10.503  1.00 0.78 ? 4   VAL A HG22 6  
ATOM   6829  H HG23 . VAL A 1 4  ? 5.973   -0.672  9.909   1.00 0.70 ? 4   VAL A HG23 6  
ATOM   6830  N N    . ILE A 1 5  ? 6.183   3.454   7.062   1.00 0.45 ? 5   ILE A N    6  
ATOM   6831  C CA   . ILE A 1 5  ? 6.078   4.375   5.930   1.00 0.48 ? 5   ILE A CA   6  
ATOM   6832  C C    . ILE A 1 5  ? 7.461   4.688   5.343   1.00 0.46 ? 5   ILE A C    6  
ATOM   6833  O O    . ILE A 1 5  ? 7.574   5.362   4.320   1.00 0.57 ? 5   ILE A O    6  
ATOM   6834  C CB   . ILE A 1 5  ? 5.380   5.697   6.332   1.00 0.56 ? 5   ILE A CB   6  
ATOM   6835  C CG1  . ILE A 1 5  ? 4.266   5.430   7.349   1.00 0.73 ? 5   ILE A CG1  6  
ATOM   6836  C CG2  . ILE A 1 5  ? 4.812   6.395   5.102   1.00 0.81 ? 5   ILE A CG2  6  
ATOM   6837  C CD1  . ILE A 1 5  ? 3.577   6.685   7.843   1.00 0.82 ? 5   ILE A CD1  6  
ATOM   6838  H H    . ILE A 1 5  ? 6.114   3.805   7.973   1.00 0.48 ? 5   ILE A H    6  
ATOM   6839  H HA   . ILE A 1 5  ? 5.479   3.896   5.168   1.00 0.50 ? 5   ILE A HA   6  
ATOM   6840  H HB   . ILE A 1 5  ? 6.118   6.348   6.777   1.00 0.65 ? 5   ILE A HB   6  
ATOM   6841  H HG12 . ILE A 1 5  ? 3.516   4.799   6.894   1.00 0.89 ? 5   ILE A HG12 6  
ATOM   6842  H HG13 . ILE A 1 5  ? 4.683   4.921   8.205   1.00 0.89 ? 5   ILE A HG13 6  
ATOM   6843  H HG21 . ILE A 1 5  ? 4.095   5.747   4.619   1.00 0.99 ? 5   ILE A HG21 6  
ATOM   6844  H HG22 . ILE A 1 5  ? 5.613   6.622   4.414   1.00 0.98 ? 5   ILE A HG22 6  
ATOM   6845  H HG23 . ILE A 1 5  ? 4.324   7.311   5.401   1.00 0.91 ? 5   ILE A HG23 6  
ATOM   6846  H HD11 . ILE A 1 5  ? 3.200   7.244   7.001   1.00 0.92 ? 5   ILE A HD11 6  
ATOM   6847  H HD12 . ILE A 1 5  ? 4.284   7.290   8.391   1.00 0.99 ? 5   ILE A HD12 6  
ATOM   6848  H HD13 . ILE A 1 5  ? 2.757   6.414   8.492   1.00 1.11 ? 5   ILE A HD13 6  
ATOM   6849  N N    . LYS A 1 6  ? 8.510   4.188   5.993   1.00 0.44 ? 6   LYS A N    6  
ATOM   6850  C CA   . LYS A 1 6  ? 9.878   4.409   5.530   1.00 0.45 ? 6   LYS A CA   6  
ATOM   6851  C C    . LYS A 1 6  ? 10.537  3.101   5.099   1.00 0.41 ? 6   LYS A C    6  
ATOM   6852  O O    . LYS A 1 6  ? 11.339  3.085   4.164   1.00 0.42 ? 6   LYS A O    6  
ATOM   6853  C CB   . LYS A 1 6  ? 10.714  5.079   6.623   1.00 0.52 ? 6   LYS A CB   6  
ATOM   6854  C CG   . LYS A 1 6  ? 11.069  6.528   6.318   1.00 0.78 ? 6   LYS A CG   6  
ATOM   6855  C CD   . LYS A 1 6  ? 11.945  6.649   5.077   1.00 1.08 ? 6   LYS A CD   6  
ATOM   6856  C CE   . LYS A 1 6  ? 13.326  6.047   5.296   1.00 1.30 ? 6   LYS A CE   6  
ATOM   6857  N NZ   . LYS A 1 6  ? 14.169  6.133   4.073   1.00 1.91 ? 6   LYS A NZ   6  
ATOM   6858  H H    . LYS A 1 6  ? 8.361   3.659   6.805   1.00 0.51 ? 6   LYS A H    6  
ATOM   6859  H HA   . LYS A 1 6  ? 9.829   5.068   4.677   1.00 0.46 ? 6   LYS A HA   6  
ATOM   6860  H HB2  . LYS A 1 6  ? 10.160  5.053   7.549   1.00 0.72 ? 6   LYS A HB2  6  
ATOM   6861  H HB3  . LYS A 1 6  ? 11.632  4.525   6.747   1.00 0.62 ? 6   LYS A HB3  6  
ATOM   6862  H HG2  . LYS A 1 6  ? 10.158  7.083   6.155   1.00 1.09 ? 6   LYS A HG2  6  
ATOM   6863  H HG3  . LYS A 1 6  ? 11.598  6.942   7.164   1.00 0.83 ? 6   LYS A HG3  6  
ATOM   6864  H HD2  . LYS A 1 6  ? 11.468  6.132   4.259   1.00 1.25 ? 6   LYS A HD2  6  
ATOM   6865  H HD3  . LYS A 1 6  ? 12.054  7.694   4.829   1.00 1.41 ? 6   LYS A HD3  6  
ATOM   6866  H HE2  . LYS A 1 6  ? 13.815  6.582   6.097   1.00 1.39 ? 6   LYS A HE2  6  
ATOM   6867  H HE3  . LYS A 1 6  ? 13.214  5.010   5.574   1.00 1.37 ? 6   LYS A HE3  6  
ATOM   6868  H HZ1  . LYS A 1 6  ? 15.102  5.709   4.250   1.00 2.23 ? 6   LYS A HZ1  6  
ATOM   6869  H HZ2  . LYS A 1 6  ? 14.300  7.128   3.796   1.00 2.11 ? 6   LYS A HZ2  6  
ATOM   6870  H HZ3  . LYS A 1 6  ? 13.713  5.626   3.288   1.00 2.10 ? 6   LYS A HZ3  6  
ATOM   6871  N N    . VAL A 1 7  ? 10.202  2.007   5.787   1.00 0.40 ? 7   VAL A N    6  
ATOM   6872  C CA   . VAL A 1 7  ? 10.759  0.700   5.464   1.00 0.41 ? 7   VAL A CA   6  
ATOM   6873  C C    . VAL A 1 7  ? 10.222  0.185   4.133   1.00 0.37 ? 7   VAL A C    6  
ATOM   6874  O O    . VAL A 1 7  ? 10.864  -0.621  3.462   1.00 0.41 ? 7   VAL A O    6  
ATOM   6875  C CB   . VAL A 1 7  ? 10.443  -0.332  6.564   1.00 0.46 ? 7   VAL A CB   6  
ATOM   6876  C CG1  . VAL A 1 7  ? 11.204  -1.626  6.316   1.00 0.52 ? 7   VAL A CG1  6  
ATOM   6877  C CG2  . VAL A 1 7  ? 10.772  0.236   7.936   1.00 0.53 ? 7   VAL A CG2  6  
ATOM   6878  H H    . VAL A 1 7  ? 9.565   2.085   6.528   1.00 0.42 ? 7   VAL A H    6  
ATOM   6879  H HA   . VAL A 1 7  ? 11.832  0.802   5.393   1.00 0.46 ? 7   VAL A HA   6  
ATOM   6880  H HB   . VAL A 1 7  ? 9.385   -0.550  6.532   1.00 0.44 ? 7   VAL A HB   6  
ATOM   6881  H HG11 . VAL A 1 7  ? 12.265  -1.433  6.354   1.00 0.57 ? 7   VAL A HG11 6  
ATOM   6882  H HG12 . VAL A 1 7  ? 10.945  -2.015  5.342   1.00 0.49 ? 7   VAL A HG12 6  
ATOM   6883  H HG13 . VAL A 1 7  ? 10.941  -2.350  7.073   1.00 0.56 ? 7   VAL A HG13 6  
ATOM   6884  H HG21 . VAL A 1 7  ? 10.171  1.114   8.116   1.00 0.51 ? 7   VAL A HG21 6  
ATOM   6885  H HG22 . VAL A 1 7  ? 11.818  0.502   7.975   1.00 0.57 ? 7   VAL A HG22 6  
ATOM   6886  H HG23 . VAL A 1 7  ? 10.561  -0.506  8.693   1.00 0.58 ? 7   VAL A HG23 6  
ATOM   6887  N N    . ILE A 1 8  ? 9.027   0.652   3.769   1.00 0.34 ? 8   ILE A N    6  
ATOM   6888  C CA   . ILE A 1 8  ? 8.384   0.250   2.522   1.00 0.36 ? 8   ILE A CA   6  
ATOM   6889  C C    . ILE A 1 8  ? 8.635   1.284   1.424   1.00 0.34 ? 8   ILE A C    6  
ATOM   6890  O O    . ILE A 1 8  ? 8.646   0.953   0.237   1.00 0.34 ? 8   ILE A O    6  
ATOM   6891  C CB   . ILE A 1 8  ? 6.861   0.052   2.718   1.00 0.43 ? 8   ILE A CB   6  
ATOM   6892  C CG1  . ILE A 1 8  ? 6.589   -0.927  3.867   1.00 0.57 ? 8   ILE A CG1  6  
ATOM   6893  C CG2  . ILE A 1 8  ? 6.205   -0.445  1.435   1.00 0.61 ? 8   ILE A CG2  6  
ATOM   6894  C CD1  . ILE A 1 8  ? 7.130   -2.322  3.628   1.00 0.78 ? 8   ILE A CD1  6  
ATOM   6895  H H    . ILE A 1 8  ? 8.565   1.284   4.359   1.00 0.34 ? 8   ILE A H    6  
ATOM   6896  H HA   . ILE A 1 8  ? 8.813   -0.693  2.217   1.00 0.39 ? 8   ILE A HA   6  
ATOM   6897  H HB   . ILE A 1 8  ? 6.427   1.009   2.964   1.00 0.58 ? 8   ILE A HB   6  
ATOM   6898  H HG12 . ILE A 1 8  ? 7.048   -0.549  4.769   1.00 0.73 ? 8   ILE A HG12 6  
ATOM   6899  H HG13 . ILE A 1 8  ? 5.523   -1.007  4.019   1.00 0.61 ? 8   ILE A HG13 6  
ATOM   6900  H HG21 . ILE A 1 8  ? 5.149   -0.597  1.607   1.00 1.01 ? 8   ILE A HG21 6  
ATOM   6901  H HG22 . ILE A 1 8  ? 6.659   -1.377  1.137   1.00 1.07 ? 8   ILE A HG22 6  
ATOM   6902  H HG23 . ILE A 1 8  ? 6.339   0.289   0.654   1.00 1.06 ? 8   ILE A HG23 6  
ATOM   6903  H HD11 . ILE A 1 8  ? 8.208   -2.291  3.597   1.00 0.95 ? 8   ILE A HD11 6  
ATOM   6904  H HD12 . ILE A 1 8  ? 6.754   -2.697  2.686   1.00 0.89 ? 8   ILE A HD12 6  
ATOM   6905  H HD13 . ILE A 1 8  ? 6.810   -2.975  4.426   1.00 1.07 ? 8   ILE A HD13 6  
ATOM   6906  N N    . SER A 1 9  ? 8.854   2.535   1.828   1.00 0.36 ? 9   SER A N    6  
ATOM   6907  C CA   . SER A 1 9  ? 9.113   3.615   0.877   1.00 0.37 ? 9   SER A CA   6  
ATOM   6908  C C    . SER A 1 9  ? 10.476  3.437   0.211   1.00 0.35 ? 9   SER A C    6  
ATOM   6909  O O    . SER A 1 9  ? 10.672  3.837   -0.934  1.00 0.36 ? 9   SER A O    6  
ATOM   6910  C CB   . SER A 1 9  ? 9.045   4.973   1.578   1.00 0.43 ? 9   SER A CB   6  
ATOM   6911  O OG   . SER A 1 9  ? 9.159   6.037   0.648   1.00 0.49 ? 9   SER A OG   6  
ATOM   6912  H H    . SER A 1 9  ? 8.843   2.737   2.787   1.00 0.38 ? 9   SER A H    6  
ATOM   6913  H HA   . SER A 1 9  ? 8.347   3.574   0.116   1.00 0.39 ? 9   SER A HA   6  
ATOM   6914  H HB2  . SER A 1 9  ? 8.101   5.062   2.093   1.00 0.45 ? 9   SER A HB2  6  
ATOM   6915  H HB3  . SER A 1 9  ? 9.853   5.047   2.291   1.00 0.44 ? 9   SER A HB3  6  
ATOM   6916  H HG   . SER A 1 9  ? 9.952   6.544   0.837   1.00 0.81 ? 9   SER A HG   6  
ATOM   6917  N N    . SER A 1 10 ? 11.411  2.830   0.938   1.00 0.36 ? 10  SER A N    6  
ATOM   6918  C CA   . SER A 1 10 ? 12.752  2.586   0.419   1.00 0.37 ? 10  SER A CA   6  
ATOM   6919  C C    . SER A 1 10 ? 12.796  1.261   -0.339  1.00 0.35 ? 10  SER A C    6  
ATOM   6920  O O    . SER A 1 10 ? 13.714  1.008   -1.121  1.00 0.35 ? 10  SER A O    6  
ATOM   6921  C CB   . SER A 1 10 ? 13.770  2.568   1.564   1.00 0.43 ? 10  SER A CB   6  
ATOM   6922  O OG   . SER A 1 10 ? 15.098  2.552   1.070   1.00 0.46 ? 10  SER A OG   6  
ATOM   6923  H H    . SER A 1 10 ? 11.193  2.541   1.849   1.00 0.38 ? 10  SER A H    6  
ATOM   6924  H HA   . SER A 1 10 ? 12.999  3.387   -0.261  1.00 0.37 ? 10  SER A HA   6  
ATOM   6925  H HB2  . SER A 1 10 ? 13.637  3.449   2.175   1.00 0.45 ? 10  SER A HB2  6  
ATOM   6926  H HB3  . SER A 1 10 ? 13.612  1.686   2.167   1.00 0.44 ? 10  SER A HB3  6  
ATOM   6927  H HG   . SER A 1 10 ? 15.129  2.057   0.248   1.00 0.67 ? 10  SER A HG   6  
ATOM   6928  N N    . ALA A 1 11 ? 11.790  0.424   -0.099  1.00 0.35 ? 11  ALA A N    6  
ATOM   6929  C CA   . ALA A 1 11 ? 11.695  -0.879  -0.747  1.00 0.36 ? 11  ALA A CA   6  
ATOM   6930  C C    . ALA A 1 11 ? 11.220  -0.739  -2.192  1.00 0.31 ? 11  ALA A C    6  
ATOM   6931  O O    . ALA A 1 11 ? 11.822  -1.302  -3.105  1.00 0.33 ? 11  ALA A O    6  
ATOM   6932  C CB   . ALA A 1 11 ? 10.753  -1.791  0.029   1.00 0.40 ? 11  ALA A CB   6  
ATOM   6933  H H    . ALA A 1 11 ? 11.091  0.693   0.533   1.00 0.36 ? 11  ALA A H    6  
ATOM   6934  H HA   . ALA A 1 11 ? 12.678  -1.327  -0.743  1.00 0.39 ? 11  ALA A HA   6  
ATOM   6935  H HB1  . ALA A 1 11 ? 9.755   -1.379  0.008   1.00 0.38 ? 11  ALA A HB1  6  
ATOM   6936  H HB2  . ALA A 1 11 ? 11.090  -1.869  1.052   1.00 0.44 ? 11  ALA A HB2  6  
ATOM   6937  H HB3  . ALA A 1 11 ? 10.747  -2.772  -0.424  1.00 0.42 ? 11  ALA A HB3  6  
ATOM   6938  N N    . CYS A 1 12 ? 10.160  0.048   -2.384  1.00 0.28 ? 12  CYS A N    6  
ATOM   6939  C CA   . CYS A 1 12 ? 9.589   0.276   -3.709  1.00 0.26 ? 12  CYS A CA   6  
ATOM   6940  C C    . CYS A 1 12 ? 10.531  1.085   -4.604  1.00 0.25 ? 12  CYS A C    6  
ATOM   6941  O O    . CYS A 1 12 ? 10.296  1.211   -5.802  1.00 0.26 ? 12  CYS A O    6  
ATOM   6942  C CB   . CYS A 1 12 ? 8.238   0.986   -3.589  1.00 0.28 ? 12  CYS A CB   6  
ATOM   6943  S SG   . CYS A 1 12 ? 8.285   2.520   -2.634  1.00 0.26 ? 12  CYS A SG   6  
ATOM   6944  H H    . CYS A 1 12 ? 9.751   0.488   -1.610  1.00 0.29 ? 12  CYS A H    6  
ATOM   6945  H HA   . CYS A 1 12 ? 9.431   -0.690  -4.165  1.00 0.29 ? 12  CYS A HA   6  
ATOM   6946  H HB2  . CYS A 1 12 ? 7.878   1.227   -4.577  1.00 0.29 ? 12  CYS A HB2  6  
ATOM   6947  H HB3  . CYS A 1 12 ? 7.534   0.322   -3.108  1.00 0.34 ? 12  CYS A HB3  6  
ATOM   6948  H HG   . CYS A 1 12 ? 9.511   3.018   -2.719  1.00 1.12 ? 12  CYS A HG   6  
ATOM   6949  N N    . LYS A 1 13 ? 11.594  1.633   -4.022  1.00 0.25 ? 13  LYS A N    6  
ATOM   6950  C CA   . LYS A 1 13 ? 12.573  2.406   -4.784  1.00 0.26 ? 13  LYS A CA   6  
ATOM   6951  C C    . LYS A 1 13 ? 13.507  1.476   -5.558  1.00 0.31 ? 13  LYS A C    6  
ATOM   6952  O O    . LYS A 1 13 ? 14.294  1.922   -6.391  1.00 0.35 ? 13  LYS A O    6  
ATOM   6953  C CB   . LYS A 1 13 ? 13.401  3.292   -3.847  1.00 0.29 ? 13  LYS A CB   6  
ATOM   6954  C CG   . LYS A 1 13 ? 12.619  4.436   -3.225  1.00 0.79 ? 13  LYS A CG   6  
ATOM   6955  C CD   . LYS A 1 13 ? 12.382  5.564   -4.213  1.00 1.28 ? 13  LYS A CD   6  
ATOM   6956  C CE   . LYS A 1 13 ? 11.661  6.731   -3.558  1.00 1.89 ? 13  LYS A CE   6  
ATOM   6957  N NZ   . LYS A 1 13 ? 11.373  7.824   -4.527  1.00 2.67 ? 13  LYS A NZ   6  
ATOM   6958  H H    . LYS A 1 13 ? 11.724  1.516   -3.057  1.00 0.28 ? 13  LYS A H    6  
ATOM   6959  H HA   . LYS A 1 13 ? 12.037  3.031   -5.483  1.00 0.25 ? 13  LYS A HA   6  
ATOM   6960  H HB2  . LYS A 1 13 ? 13.794  2.680   -3.050  1.00 0.60 ? 13  LYS A HB2  6  
ATOM   6961  H HB3  . LYS A 1 13 ? 14.226  3.711   -4.406  1.00 0.66 ? 13  LYS A HB3  6  
ATOM   6962  H HG2  . LYS A 1 13 ? 11.664  4.062   -2.887  1.00 1.52 ? 13  LYS A HG2  6  
ATOM   6963  H HG3  . LYS A 1 13 ? 13.175  4.819   -2.381  1.00 0.94 ? 13  LYS A HG3  6  
ATOM   6964  H HD2  . LYS A 1 13 ? 13.334  5.907   -4.590  1.00 1.26 ? 13  LYS A HD2  6  
ATOM   6965  H HD3  . LYS A 1 13 ? 11.781  5.195   -5.032  1.00 1.89 ? 13  LYS A HD3  6  
ATOM   6966  H HE2  . LYS A 1 13 ? 10.730  6.376   -3.143  1.00 2.36 ? 13  LYS A HE2  6  
ATOM   6967  H HE3  . LYS A 1 13 ? 12.281  7.120   -2.765  1.00 1.74 ? 13  LYS A HE3  6  
ATOM   6968  H HZ1  . LYS A 1 13 ? 12.260  8.210   -4.905  1.00 2.68 ? 13  LYS A HZ1  6  
ATOM   6969  H HZ2  . LYS A 1 13 ? 10.846  8.588   -4.056  1.00 3.10 ? 13  LYS A HZ2  6  
ATOM   6970  H HZ3  . LYS A 1 13 ? 10.801  7.459   -5.316  1.00 3.07 ? 13  LYS A HZ3  6  
ATOM   6971  N N    . THR A 1 14 ? 13.404  0.179   -5.276  1.00 0.33 ? 14  THR A N    6  
ATOM   6972  C CA   . THR A 1 14 ? 14.241  -0.824  -5.923  1.00 0.39 ? 14  THR A CA   6  
ATOM   6973  C C    . THR A 1 14 ? 13.412  -1.738  -6.818  1.00 0.41 ? 14  THR A C    6  
ATOM   6974  O O    . THR A 1 14 ? 13.956  -2.510  -7.607  1.00 0.46 ? 14  THR A O    6  
ATOM   6975  C CB   . THR A 1 14 ? 14.994  -1.680  -4.887  1.00 0.43 ? 14  THR A CB   6  
ATOM   6976  O OG1  . THR A 1 14 ? 15.676  -0.836  -3.957  1.00 0.44 ? 14  THR A OG1  6  
ATOM   6977  C CG2  . THR A 1 14 ? 15.991  -2.601  -5.572  1.00 0.50 ? 14  THR A CG2  6  
ATOM   6978  H H    . THR A 1 14 ? 12.745  -0.111  -4.611  1.00 0.32 ? 14  THR A H    6  
ATOM   6979  H HA   . THR A 1 14 ? 14.970  -0.307  -6.530  1.00 0.41 ? 14  THR A HA   6  
ATOM   6980  H HB   . THR A 1 14 ? 14.275  -2.286  -4.353  1.00 0.42 ? 14  THR A HB   6  
ATOM   6981  H HG1  . THR A 1 14 ? 15.081  -0.599  -3.242  1.00 0.42 ? 14  THR A HG1  6  
ATOM   6982  H HG21 . THR A 1 14 ? 15.473  -3.232  -6.280  1.00 0.50 ? 14  THR A HG21 6  
ATOM   6983  H HG22 . THR A 1 14 ? 16.480  -3.218  -4.832  1.00 0.53 ? 14  THR A HG22 6  
ATOM   6984  H HG23 . THR A 1 14 ? 16.730  -2.010  -6.091  1.00 0.51 ? 14  THR A HG23 6  
ATOM   6985  N N    . TYR A 1 15 ? 12.092  -1.645  -6.690  1.00 0.37 ? 15  TYR A N    6  
ATOM   6986  C CA   . TYR A 1 15 ? 11.189  -2.466  -7.486  1.00 0.40 ? 15  TYR A CA   6  
ATOM   6987  C C    . TYR A 1 15 ? 10.344  -1.601  -8.417  1.00 0.39 ? 15  TYR A C    6  
ATOM   6988  O O    . TYR A 1 15 ? 9.585   -2.113  -9.239  1.00 0.43 ? 15  TYR A O    6  
ATOM   6989  C CB   . TYR A 1 15 ? 10.279  -3.292  -6.574  1.00 0.39 ? 15  TYR A CB   6  
ATOM   6990  C CG   . TYR A 1 15 ? 11.006  -4.375  -5.814  1.00 0.43 ? 15  TYR A CG   6  
ATOM   6991  C CD1  . TYR A 1 15 ? 10.982  -4.414  -4.425  1.00 0.41 ? 15  TYR A CD1  6  
ATOM   6992  C CD2  . TYR A 1 15 ? 11.721  -5.361  -6.483  1.00 0.49 ? 15  TYR A CD2  6  
ATOM   6993  C CE1  . TYR A 1 15 ? 11.646  -5.402  -3.725  1.00 0.46 ? 15  TYR A CE1  6  
ATOM   6994  C CE2  . TYR A 1 15 ? 12.388  -6.355  -5.792  1.00 0.52 ? 15  TYR A CE2  6  
ATOM   6995  C CZ   . TYR A 1 15 ? 12.347  -6.371  -4.412  1.00 0.51 ? 15  TYR A CZ   6  
ATOM   6996  O OH   . TYR A 1 15 ? 13.011  -7.358  -3.720  1.00 0.56 ? 15  TYR A OH   6  
ATOM   6997  H H    . TYR A 1 15 ? 11.717  -1.010  -6.045  1.00 0.33 ? 15  TYR A H    6  
ATOM   6998  H HA   . TYR A 1 15 ? 11.789  -3.136  -8.083  1.00 0.45 ? 15  TYR A HA   6  
ATOM   6999  H HB2  . TYR A 1 15 ? 9.814   -2.637  -5.852  1.00 0.35 ? 15  TYR A HB2  6  
ATOM   7000  H HB3  . TYR A 1 15 ? 9.512   -3.762  -7.172  1.00 0.42 ? 15  TYR A HB3  6  
ATOM   7001  H HD1  . TYR A 1 15 ? 10.431  -3.655  -3.889  1.00 0.38 ? 15  TYR A HD1  6  
ATOM   7002  H HD2  . TYR A 1 15 ? 11.751  -5.346  -7.562  1.00 0.51 ? 15  TYR A HD2  6  
ATOM   7003  H HE1  . TYR A 1 15 ? 11.614  -5.414  -2.646  1.00 0.47 ? 15  TYR A HE1  6  
ATOM   7004  H HE2  . TYR A 1 15 ? 12.936  -7.113  -6.331  1.00 0.57 ? 15  TYR A HE2  6  
ATOM   7005  H HH   . TYR A 1 15 ? 12.440  -7.708  -3.032  1.00 0.57 ? 15  TYR A HH   6  
ATOM   7006  N N    . CYS A 1 16 ? 10.483  -0.288  -8.281  1.00 0.35 ? 16  CYS A N    6  
ATOM   7007  C CA   . CYS A 1 16 ? 9.735   0.652   -9.109  1.00 0.36 ? 16  CYS A CA   6  
ATOM   7008  C C    . CYS A 1 16 ? 10.623  1.807   -9.561  1.00 0.37 ? 16  CYS A C    6  
ATOM   7009  O O    . CYS A 1 16 ? 10.662  2.147   -10.742 1.00 0.42 ? 16  CYS A O    6  
ATOM   7010  C CB   . CYS A 1 16 ? 8.527   1.191   -8.340  1.00 0.32 ? 16  CYS A CB   6  
ATOM   7011  S SG   . CYS A 1 16 ? 7.594   -0.076  -7.449  1.00 0.32 ? 16  CYS A SG   6  
ATOM   7012  H H    . CYS A 1 16 ? 11.105  0.060   -7.608  1.00 0.33 ? 16  CYS A H    6  
ATOM   7013  H HA   . CYS A 1 16 ? 9.386   0.119   -9.981  1.00 0.41 ? 16  CYS A HA   6  
ATOM   7014  H HB2  . CYS A 1 16 ? 8.866   1.917   -7.617  1.00 0.28 ? 16  CYS A HB2  6  
ATOM   7015  H HB3  . CYS A 1 16 ? 7.852   1.670   -9.034  1.00 0.35 ? 16  CYS A HB3  6  
ATOM   7016  H HG   . CYS A 1 16 ? 8.059   -0.129  -6.209  1.00 0.27 ? 16  CYS A HG   6  
ATOM   7017  N N    . GLY A 1 17 ? 11.334  2.406   -8.612  1.00 0.33 ? 17  GLY A N    6  
ATOM   7018  C CA   . GLY A 1 17 ? 12.209  3.520   -8.931  1.00 0.34 ? 17  GLY A CA   6  
ATOM   7019  C C    . GLY A 1 17 ? 11.570  4.863   -8.646  1.00 0.32 ? 17  GLY A C    6  
ATOM   7020  O O    . GLY A 1 17 ? 11.066  5.099   -7.547  1.00 0.27 ? 17  GLY A O    6  
ATOM   7021  H H    . GLY A 1 17 ? 11.261  2.093   -7.686  1.00 0.29 ? 17  GLY A H    6  
ATOM   7022  H HA2  . GLY A 1 17 ? 13.113  3.432   -8.345  1.00 0.34 ? 17  GLY A HA2  6  
ATOM   7023  H HA3  . GLY A 1 17 ? 12.467  3.470   -9.979  1.00 0.39 ? 17  GLY A HA3  6  
ATOM   7024  N N    . LYS A 1 18 ? 11.589  5.747   -9.637  1.00 0.36 ? 18  LYS A N    6  
ATOM   7025  C CA   . LYS A 1 18 ? 11.005  7.076   -9.488  1.00 0.36 ? 18  LYS A CA   6  
ATOM   7026  C C    . LYS A 1 18 ? 9.483   7.007   -9.507  1.00 0.36 ? 18  LYS A C    6  
ATOM   7027  O O    . LYS A 1 18 ? 8.803   7.911   -9.021  1.00 0.36 ? 18  LYS A O    6  
ATOM   7028  C CB   . LYS A 1 18 ? 11.499  8.000   -10.605 1.00 0.43 ? 18  LYS A CB   6  
ATOM   7029  C CG   . LYS A 1 18 ? 11.313  7.423   -11.998 1.00 0.48 ? 18  LYS A CG   6  
ATOM   7030  C CD   . LYS A 1 18 ? 12.629  6.932   -12.579 1.00 0.52 ? 18  LYS A CD   6  
ATOM   7031  C CE   . LYS A 1 18 ? 13.148  7.874   -13.655 1.00 0.58 ? 18  LYS A CE   6  
ATOM   7032  N NZ   . LYS A 1 18 ? 14.586  8.205   -13.453 1.00 0.59 ? 18  LYS A NZ   6  
ATOM   7033  H H    . LYS A 1 18 ? 12.005  5.501   -10.489 1.00 0.40 ? 18  LYS A H    6  
ATOM   7034  H HA   . LYS A 1 18 ? 11.324  7.474   -8.536  1.00 0.34 ? 18  LYS A HA   6  
ATOM   7035  H HB2  . LYS A 1 18 ? 10.957  8.933   -10.550 1.00 0.43 ? 18  LYS A HB2  6  
ATOM   7036  H HB3  . LYS A 1 18 ? 12.550  8.196   -10.456 1.00 0.43 ? 18  LYS A HB3  6  
ATOM   7037  H HG2  . LYS A 1 18 ? 10.624  6.593   -11.943 1.00 0.47 ? 18  LYS A HG2  6  
ATOM   7038  H HG3  . LYS A 1 18 ? 10.906  8.189   -12.643 1.00 0.52 ? 18  LYS A HG3  6  
ATOM   7039  H HD2  . LYS A 1 18 ? 13.360  6.867   -11.788 1.00 0.49 ? 18  LYS A HD2  6  
ATOM   7040  H HD3  . LYS A 1 18 ? 12.476  5.954   -13.012 1.00 0.53 ? 18  LYS A HD3  6  
ATOM   7041  H HE2  . LYS A 1 18 ? 13.028  7.401   -14.618 1.00 0.62 ? 18  LYS A HE2  6  
ATOM   7042  H HE3  . LYS A 1 18 ? 12.570  8.785   -13.628 1.00 0.58 ? 18  LYS A HE3  6  
ATOM   7043  H HZ1  . LYS A 1 18 ? 15.161  7.339   -13.482 1.00 0.60 ? 18  LYS A HZ1  6  
ATOM   7044  H HZ2  . LYS A 1 18 ? 14.722  8.667   -12.532 1.00 0.56 ? 18  LYS A HZ2  6  
ATOM   7045  H HZ3  . LYS A 1 18 ? 14.913  8.850   -14.203 1.00 0.64 ? 18  LYS A HZ3  6  
ATOM   7046  N N    . THR A 1 19 ? 8.950   5.927   -10.071 1.00 0.37 ? 19  THR A N    6  
ATOM   7047  C CA   . THR A 1 19 ? 7.507   5.739   -10.152 1.00 0.39 ? 19  THR A CA   6  
ATOM   7048  C C    . THR A 1 19 ? 6.917   5.410   -8.786  1.00 0.33 ? 19  THR A C    6  
ATOM   7049  O O    . THR A 1 19 ? 5.725   5.610   -8.550  1.00 0.43 ? 19  THR A O    6  
ATOM   7050  C CB   . THR A 1 19 ? 7.141   4.616   -11.141 1.00 0.46 ? 19  THR A CB   6  
ATOM   7051  O OG1  . THR A 1 19 ? 7.338   3.339   -10.524 1.00 0.53 ? 19  THR A OG1  6  
ATOM   7052  C CG2  . THR A 1 19 ? 7.985   4.710   -12.403 1.00 0.61 ? 19  THR A CG2  6  
ATOM   7053  H H    . THR A 1 19 ? 9.542   5.240   -10.441 1.00 0.39 ? 19  THR A H    6  
ATOM   7054  H HA   . THR A 1 19 ? 7.071   6.661   -10.509 1.00 0.42 ? 19  THR A HA   6  
ATOM   7055  H HB   . THR A 1 19 ? 6.100   4.720   -11.414 1.00 0.49 ? 19  THR A HB   6  
ATOM   7056  H HG1  . THR A 1 19 ? 7.713   2.728   -11.164 1.00 0.54 ? 19  THR A HG1  6  
ATOM   7057  H HG21 . THR A 1 19 ? 7.684   3.940   -13.097 1.00 0.66 ? 19  THR A HG21 6  
ATOM   7058  H HG22 . THR A 1 19 ? 9.027   4.578   -12.150 1.00 0.68 ? 19  THR A HG22 6  
ATOM   7059  H HG23 . THR A 1 19 ? 7.846   5.680   -12.859 1.00 0.69 ? 19  THR A HG23 6  
ATOM   7060  N N    . SER A 1 20 ? 7.775   4.924   -7.882  1.00 0.30 ? 20  SER A N    6  
ATOM   7061  C CA   . SER A 1 20 ? 7.370   4.540   -6.526  1.00 0.24 ? 20  SER A CA   6  
ATOM   7062  C C    . SER A 1 20 ? 6.619   5.664   -5.804  1.00 0.22 ? 20  SER A C    6  
ATOM   7063  O O    . SER A 1 20 ? 6.859   6.846   -6.057  1.00 0.26 ? 20  SER A O    6  
ATOM   7064  C CB   . SER A 1 20 ? 8.603   4.145   -5.709  1.00 0.22 ? 20  SER A CB   6  
ATOM   7065  O OG   . SER A 1 20 ? 9.335   5.288   -5.309  1.00 0.25 ? 20  SER A OG   6  
ATOM   7066  H H    . SER A 1 20 ? 8.716   4.823   -8.137  1.00 0.38 ? 20  SER A H    6  
ATOM   7067  H HA   . SER A 1 20 ? 6.721   3.684   -6.604  1.00 0.26 ? 20  SER A HA   6  
ATOM   7068  H HB2  . SER A 1 20 ? 8.292   3.606   -4.828  1.00 0.26 ? 20  SER A HB2  6  
ATOM   7069  H HB3  . SER A 1 20 ? 9.243   3.516   -6.310  1.00 0.24 ? 20  SER A HB3  6  
ATOM   7070  H HG   . SER A 1 20 ? 8.742   6.042   -5.243  1.00 0.41 ? 20  SER A HG   6  
ATOM   7071  N N    . PRO A 1 21 ? 5.707   5.298   -4.882  1.00 0.20 ? 21  PRO A N    6  
ATOM   7072  C CA   . PRO A 1 21 ? 4.918   6.271   -4.119  1.00 0.22 ? 21  PRO A CA   6  
ATOM   7073  C C    . PRO A 1 21 ? 5.761   7.028   -3.097  1.00 0.22 ? 21  PRO A C    6  
ATOM   7074  O O    . PRO A 1 21 ? 6.873   6.615   -2.761  1.00 0.24 ? 21  PRO A O    6  
ATOM   7075  C CB   . PRO A 1 21 ? 3.873   5.403   -3.411  1.00 0.23 ? 21  PRO A CB   6  
ATOM   7076  C CG   . PRO A 1 21 ? 4.495   4.057   -3.305  1.00 0.21 ? 21  PRO A CG   6  
ATOM   7077  C CD   . PRO A 1 21 ? 5.375   3.907   -4.513  1.00 0.20 ? 21  PRO A CD   6  
ATOM   7078  H HA   . PRO A 1 21 ? 4.423   6.976   -4.770  1.00 0.26 ? 21  PRO A HA   6  
ATOM   7079  H HB2  . PRO A 1 21 ? 3.659   5.812   -2.432  1.00 0.25 ? 21  PRO A HB2  6  
ATOM   7080  H HB3  . PRO A 1 21 ? 2.973   5.350   -4.001  1.00 0.26 ? 21  PRO A HB3  6  
ATOM   7081  H HG2  . PRO A 1 21 ? 5.083   3.998   -2.399  1.00 0.21 ? 21  PRO A HG2  6  
ATOM   7082  H HG3  . PRO A 1 21 ? 3.731   3.297   -3.308  1.00 0.24 ? 21  PRO A HG3  6  
ATOM   7083  H HD2  . PRO A 1 21 ? 6.267   3.352   -4.262  1.00 0.21 ? 21  PRO A HD2  6  
ATOM   7084  H HD3  . PRO A 1 21 ? 4.838   3.418   -5.310  1.00 0.24 ? 21  PRO A HD3  6  
ATOM   7085  N N    . SER A 1 22 ? 5.223   8.136   -2.605  1.00 0.24 ? 22  SER A N    6  
ATOM   7086  C CA   . SER A 1 22 ? 5.921   8.957   -1.626  1.00 0.26 ? 22  SER A CA   6  
ATOM   7087  C C    . SER A 1 22 ? 5.476   8.618   -0.208  1.00 0.23 ? 22  SER A C    6  
ATOM   7088  O O    . SER A 1 22 ? 4.557   7.820   -0.007  1.00 0.23 ? 22  SER A O    6  
ATOM   7089  C CB   . SER A 1 22 ? 5.668   10.439  -1.908  1.00 0.31 ? 22  SER A CB   6  
ATOM   7090  O OG   . SER A 1 22 ? 4.279   10.727  -1.923  1.00 0.32 ? 22  SER A OG   6  
ATOM   7091  H H    . SER A 1 22 ? 4.331   8.408   -2.907  1.00 0.26 ? 22  SER A H    6  
ATOM   7092  H HA   . SER A 1 22 ? 6.978   8.757   -1.718  1.00 0.29 ? 22  SER A HA   6  
ATOM   7093  H HB2  . SER A 1 22 ? 6.136   11.034  -1.139  1.00 0.34 ? 22  SER A HB2  6  
ATOM   7094  H HB3  . SER A 1 22 ? 6.087   10.697  -2.870  1.00 0.35 ? 22  SER A HB3  6  
ATOM   7095  H HG   . SER A 1 22 ? 4.007   10.948  -2.819  1.00 0.54 ? 22  SER A HG   6  
ATOM   7096  N N    . LYS A 1 23 ? 6.135   9.230   0.772   1.00 0.24 ? 23  LYS A N    6  
ATOM   7097  C CA   . LYS A 1 23 ? 5.805   9.015   2.176   1.00 0.25 ? 23  LYS A CA   6  
ATOM   7098  C C    . LYS A 1 23 ? 4.452   9.652   2.504   1.00 0.23 ? 23  LYS A C    6  
ATOM   7099  O O    . LYS A 1 23 ? 3.730   9.187   3.388   1.00 0.26 ? 23  LYS A O    6  
ATOM   7100  C CB   . LYS A 1 23 ? 6.922   9.588   3.063   1.00 0.29 ? 23  LYS A CB   6  
ATOM   7101  C CG   . LYS A 1 23 ? 6.555   9.752   4.530   1.00 0.41 ? 23  LYS A CG   6  
ATOM   7102  C CD   . LYS A 1 23 ? 6.284   11.210  4.865   1.00 0.87 ? 23  LYS A CD   6  
ATOM   7103  C CE   . LYS A 1 23 ? 6.159   11.434  6.361   1.00 1.02 ? 23  LYS A CE   6  
ATOM   7104  N NZ   . LYS A 1 23 ? 6.063   12.883  6.691   1.00 1.62 ? 23  LYS A NZ   6  
ATOM   7105  H H    . LYS A 1 23 ? 6.866   9.845   0.544   1.00 0.26 ? 23  LYS A H    6  
ATOM   7106  H HA   . LYS A 1 23 ? 5.736   7.951   2.339   1.00 0.27 ? 23  LYS A HA   6  
ATOM   7107  H HB2  . LYS A 1 23 ? 7.777   8.929   3.005   1.00 0.35 ? 23  LYS A HB2  6  
ATOM   7108  H HB3  . LYS A 1 23 ? 7.206   10.555  2.676   1.00 0.34 ? 23  LYS A HB3  6  
ATOM   7109  H HG2  . LYS A 1 23 ? 5.669   9.172   4.738   1.00 0.71 ? 23  LYS A HG2  6  
ATOM   7110  H HG3  . LYS A 1 23 ? 7.374   9.397   5.140   1.00 0.67 ? 23  LYS A HG3  6  
ATOM   7111  H HD2  . LYS A 1 23 ? 7.098   11.809  4.491   1.00 1.16 ? 23  LYS A HD2  6  
ATOM   7112  H HD3  . LYS A 1 23 ? 5.364   11.512  4.386   1.00 1.26 ? 23  LYS A HD3  6  
ATOM   7113  H HE2  . LYS A 1 23 ? 5.271   10.933  6.716   1.00 1.11 ? 23  LYS A HE2  6  
ATOM   7114  H HE3  . LYS A 1 23 ? 7.028   11.018  6.850   1.00 1.06 ? 23  LYS A HE3  6  
ATOM   7115  H HZ1  . LYS A 1 23 ? 5.233   13.300  6.225   1.00 1.74 ? 23  LYS A HZ1  6  
ATOM   7116  H HZ2  . LYS A 1 23 ? 6.915   13.380  6.363   1.00 1.95 ? 23  LYS A HZ2  6  
ATOM   7117  H HZ3  . LYS A 1 23 ? 5.973   13.011  7.719   1.00 1.88 ? 23  LYS A HZ3  6  
ATOM   7118  N N    . LYS A 1 24 ? 4.109   10.709  1.767   1.00 0.20 ? 24  LYS A N    6  
ATOM   7119  C CA   . LYS A 1 24 ? 2.842   11.407  1.958   1.00 0.21 ? 24  LYS A CA   6  
ATOM   7120  C C    . LYS A 1 24 ? 1.679   10.581  1.411   1.00 0.20 ? 24  LYS A C    6  
ATOM   7121  O O    . LYS A 1 24 ? 0.573   10.617  1.952   1.00 0.22 ? 24  LYS A O    6  
ATOM   7122  C CB   . LYS A 1 24 ? 2.881   12.774  1.270   1.00 0.24 ? 24  LYS A CB   6  
ATOM   7123  C CG   . LYS A 1 24 ? 3.725   13.801  2.009   1.00 0.43 ? 24  LYS A CG   6  
ATOM   7124  C CD   . LYS A 1 24 ? 4.019   15.016  1.141   1.00 0.79 ? 24  LYS A CD   6  
ATOM   7125  C CE   . LYS A 1 24 ? 4.945   14.664  -0.011  1.00 1.35 ? 24  LYS A CE   6  
ATOM   7126  N NZ   . LYS A 1 24 ? 5.565   15.872  -0.622  1.00 2.01 ? 24  LYS A NZ   6  
ATOM   7127  H H    . LYS A 1 24 ? 4.730   11.029  1.078   1.00 0.20 ? 24  LYS A H    6  
ATOM   7128  H HA   . LYS A 1 24 ? 2.699   11.551  3.018   1.00 0.24 ? 24  LYS A HA   6  
ATOM   7129  H HB2  . LYS A 1 24 ? 3.288   12.652  0.277   1.00 0.37 ? 24  LYS A HB2  6  
ATOM   7130  H HB3  . LYS A 1 24 ? 1.873   13.155  1.193   1.00 0.38 ? 24  LYS A HB3  6  
ATOM   7131  H HG2  . LYS A 1 24 ? 3.192   14.124  2.891   1.00 0.80 ? 24  LYS A HG2  6  
ATOM   7132  H HG3  . LYS A 1 24 ? 4.659   13.343  2.299   1.00 0.81 ? 24  LYS A HG3  6  
ATOM   7133  H HD2  . LYS A 1 24 ? 3.090   15.394  0.740   1.00 1.14 ? 24  LYS A HD2  6  
ATOM   7134  H HD3  . LYS A 1 24 ? 4.488   15.777  1.748   1.00 0.95 ? 24  LYS A HD3  6  
ATOM   7135  H HE2  . LYS A 1 24 ? 5.727   14.018  0.356   1.00 1.59 ? 24  LYS A HE2  6  
ATOM   7136  H HE3  . LYS A 1 24 ? 4.376   14.143  -0.768  1.00 1.51 ? 24  LYS A HE3  6  
ATOM   7137  H HZ1  . LYS A 1 24 ? 6.126   16.383  0.090   1.00 2.09 ? 24  LYS A HZ1  6  
ATOM   7138  H HZ2  . LYS A 1 24 ? 4.829   16.507  -0.988  1.00 2.20 ? 24  LYS A HZ2  6  
ATOM   7139  H HZ3  . LYS A 1 24 ? 6.191   15.594  -1.405  1.00 2.49 ? 24  LYS A HZ3  6  
ATOM   7140  N N    . GLU A 1 25 ? 1.939   9.837   0.335   1.00 0.18 ? 25  GLU A N    6  
ATOM   7141  C CA   . GLU A 1 25 ? 0.921   8.992   -0.279  1.00 0.17 ? 25  GLU A CA   6  
ATOM   7142  C C    . GLU A 1 25 ? 0.625   7.776   0.594   1.00 0.16 ? 25  GLU A C    6  
ATOM   7143  O O    . GLU A 1 25 ? -0.495  7.603   1.076   1.00 0.17 ? 25  GLU A O    6  
ATOM   7144  C CB   . GLU A 1 25 ? 1.375   8.538   -1.668  1.00 0.17 ? 25  GLU A CB   6  
ATOM   7145  C CG   . GLU A 1 25 ? 0.510   9.073   -2.796  1.00 0.19 ? 25  GLU A CG   6  
ATOM   7146  C CD   . GLU A 1 25 ? 0.746   8.349   -4.107  1.00 0.18 ? 25  GLU A CD   6  
ATOM   7147  O OE1  . GLU A 1 25 ? 0.549   8.971   -5.173  1.00 0.26 ? 25  GLU A OE1  6  
ATOM   7148  O OE2  . GLU A 1 25 ? 1.128   7.161   -4.069  1.00 0.21 ? 25  GLU A OE2  6  
ATOM   7149  H H    . GLU A 1 25 ? 2.838   9.859   -0.054  1.00 0.18 ? 25  GLU A H    6  
ATOM   7150  H HA   . GLU A 1 25 ? 0.019   9.577   -0.378  1.00 0.17 ? 25  GLU A HA   6  
ATOM   7151  H HB2  . GLU A 1 25 ? 2.389   8.872   -1.831  1.00 0.19 ? 25  GLU A HB2  6  
ATOM   7152  H HB3  . GLU A 1 25 ? 1.351   7.458   -1.707  1.00 0.18 ? 25  GLU A HB3  6  
ATOM   7153  H HG2  . GLU A 1 25 ? -0.528  8.959   -2.523  1.00 0.23 ? 25  GLU A HG2  6  
ATOM   7154  H HG3  . GLU A 1 25 ? 0.731   10.122  -2.936  1.00 0.23 ? 25  GLU A HG3  6  
ATOM   7155  N N    . ILE A 1 26 ? 1.636   6.938   0.794   1.00 0.16 ? 26  ILE A N    6  
ATOM   7156  C CA   . ILE A 1 26 ? 1.482   5.738   1.609   1.00 0.15 ? 26  ILE A CA   6  
ATOM   7157  C C    . ILE A 1 26 ? 0.881   6.072   2.970   1.00 0.15 ? 26  ILE A C    6  
ATOM   7158  O O    . ILE A 1 26 ? -0.048  5.409   3.428   1.00 0.14 ? 26  ILE A O    6  
ATOM   7159  C CB   . ILE A 1 26 ? 2.833   5.026   1.818   1.00 0.16 ? 26  ILE A CB   6  
ATOM   7160  C CG1  . ILE A 1 26 ? 3.426   4.607   0.472   1.00 0.16 ? 26  ILE A CG1  6  
ATOM   7161  C CG2  . ILE A 1 26 ? 2.657   3.817   2.724   1.00 0.15 ? 26  ILE A CG2  6  
ATOM   7162  C CD1  . ILE A 1 26 ? 4.760   3.901   0.594   1.00 0.17 ? 26  ILE A CD1  6  
ATOM   7163  H H    . ILE A 1 26 ? 2.505   7.131   0.385   1.00 0.17 ? 26  ILE A H    6  
ATOM   7164  H HA   . ILE A 1 26 ? 0.819   5.063   1.089   1.00 0.14 ? 26  ILE A HA   6  
ATOM   7165  H HB   . ILE A 1 26 ? 3.508   5.715   2.302   1.00 0.17 ? 26  ILE A HB   6  
ATOM   7166  H HG12 . ILE A 1 26 ? 2.741   3.937   -0.024  1.00 0.15 ? 26  ILE A HG12 6  
ATOM   7167  H HG13 . ILE A 1 26 ? 3.570   5.486   -0.140  1.00 0.16 ? 26  ILE A HG13 6  
ATOM   7168  H HG21 . ILE A 1 26 ? 2.317   4.143   3.696   1.00 0.15 ? 26  ILE A HG21 6  
ATOM   7169  H HG22 . ILE A 1 26 ? 3.602   3.304   2.827   1.00 0.16 ? 26  ILE A HG22 6  
ATOM   7170  H HG23 . ILE A 1 26 ? 1.929   3.147   2.294   1.00 0.14 ? 26  ILE A HG23 6  
ATOM   7171  H HD11 . ILE A 1 26 ? 4.646   3.023   1.212   1.00 0.16 ? 26  ILE A HD11 6  
ATOM   7172  H HD12 . ILE A 1 26 ? 5.480   4.568   1.044   1.00 0.19 ? 26  ILE A HD12 6  
ATOM   7173  H HD13 . ILE A 1 26 ? 5.104   3.609   -0.387  1.00 0.17 ? 26  ILE A HD13 6  
ATOM   7174  N N    . GLY A 1 27 ? 1.417   7.107   3.611   1.00 0.16 ? 27  GLY A N    6  
ATOM   7175  C CA   . GLY A 1 27 ? 0.919   7.512   4.912   1.00 0.16 ? 27  GLY A CA   6  
ATOM   7176  C C    . GLY A 1 27 ? -0.583  7.717   4.920   1.00 0.15 ? 27  GLY A C    6  
ATOM   7177  O O    . GLY A 1 27 ? -1.264  7.331   5.870   1.00 0.15 ? 27  GLY A O    6  
ATOM   7178  H H    . GLY A 1 27 ? 2.156   7.600   3.196   1.00 0.17 ? 27  GLY A H    6  
ATOM   7179  H HA2  . GLY A 1 27 ? 1.171   6.750   5.634   1.00 0.16 ? 27  GLY A HA2  6  
ATOM   7180  H HA3  . GLY A 1 27 ? 1.400   8.437   5.197   1.00 0.17 ? 27  GLY A HA3  6  
ATOM   7181  N N    . ALA A 1 28 ? -1.100  8.328   3.859   1.00 0.15 ? 28  ALA A N    6  
ATOM   7182  C CA   . ALA A 1 28 ? -2.531  8.584   3.748   1.00 0.14 ? 28  ALA A CA   6  
ATOM   7183  C C    . ALA A 1 28 ? -3.298  7.298   3.458   1.00 0.13 ? 28  ALA A C    6  
ATOM   7184  O O    . ALA A 1 28 ? -4.361  7.055   4.030   1.00 0.12 ? 28  ALA A O    6  
ATOM   7185  C CB   . ALA A 1 28 ? -2.801  9.616   2.661   1.00 0.15 ? 28  ALA A CB   6  
ATOM   7186  H H    . ALA A 1 28 ? -0.507  8.612   3.134   1.00 0.16 ? 28  ALA A H    6  
ATOM   7187  H HA   . ALA A 1 28 ? -2.871  8.990   4.690   1.00 0.15 ? 28  ALA A HA   6  
ATOM   7188  H HB1  . ALA A 1 28 ? -3.857  9.834   2.627   1.00 0.14 ? 28  ALA A HB1  6  
ATOM   7189  H HB2  . ALA A 1 28 ? -2.482  9.226   1.707   1.00 0.14 ? 28  ALA A HB2  6  
ATOM   7190  H HB3  . ALA A 1 28 ? -2.253  10.521  2.881   1.00 0.16 ? 28  ALA A HB3  6  
ATOM   7191  N N    . MET A 1 29 ? -2.752  6.478   2.567   1.00 0.13 ? 29  MET A N    6  
ATOM   7192  C CA   . MET A 1 29 ? -3.385  5.216   2.202   1.00 0.11 ? 29  MET A CA   6  
ATOM   7193  C C    . MET A 1 29 ? -3.508  4.299   3.414   1.00 0.11 ? 29  MET A C    6  
ATOM   7194  O O    . MET A 1 29 ? -4.508  3.599   3.580   1.00 0.10 ? 29  MET A O    6  
ATOM   7195  C CB   . MET A 1 29 ? -2.586  4.519   1.099   1.00 0.11 ? 29  MET A CB   6  
ATOM   7196  C CG   . MET A 1 29 ? -3.203  3.209   0.638   1.00 0.10 ? 29  MET A CG   6  
ATOM   7197  S SD   . MET A 1 29 ? -1.964  1.980   0.182   1.00 0.10 ? 29  MET A SD   6  
ATOM   7198  C CE   . MET A 1 29 ? -1.105  1.775   1.741   1.00 0.11 ? 29  MET A CE   6  
ATOM   7199  H H    . MET A 1 29 ? -1.904  6.727   2.143   1.00 0.13 ? 29  MET A H    6  
ATOM   7200  H HA   . MET A 1 29 ? -4.374  5.437   1.834   1.00 0.11 ? 29  MET A HA   6  
ATOM   7201  H HB2  . MET A 1 29 ? -2.517  5.180   0.247   1.00 0.12 ? 29  MET A HB2  6  
ATOM   7202  H HB3  . MET A 1 29 ? -1.592  4.315   1.465   1.00 0.12 ? 29  MET A HB3  6  
ATOM   7203  H HG2  . MET A 1 29 ? -3.808  2.810   1.438   1.00 0.10 ? 29  MET A HG2  6  
ATOM   7204  H HG3  . MET A 1 29 ? -3.829  3.404   -0.222  1.00 0.10 ? 29  MET A HG3  6  
ATOM   7205  H HE1  . MET A 1 29 ? -0.470  2.631   1.918   1.00 0.12 ? 29  MET A HE1  6  
ATOM   7206  H HE2  . MET A 1 29 ? -0.501  0.880   1.705   1.00 0.11 ? 29  MET A HE2  6  
ATOM   7207  H HE3  . MET A 1 29 ? -1.826  1.691   2.539   1.00 0.11 ? 29  MET A HE3  6  
ATOM   7208  N N    . LEU A 1 30 ? -2.484  4.304   4.261   1.00 0.12 ? 30  LEU A N    6  
ATOM   7209  C CA   . LEU A 1 30 ? -2.475  3.472   5.459   1.00 0.12 ? 30  LEU A CA   6  
ATOM   7210  C C    . LEU A 1 30 ? -3.642  3.827   6.375   1.00 0.12 ? 30  LEU A C    6  
ATOM   7211  O O    . LEU A 1 30 ? -4.417  2.957   6.773   1.00 0.11 ? 30  LEU A O    6  
ATOM   7212  C CB   . LEU A 1 30 ? -1.154  3.638   6.210   1.00 0.13 ? 30  LEU A CB   6  
ATOM   7213  C CG   . LEU A 1 30 ? -0.177  2.466   6.118   1.00 0.13 ? 30  LEU A CG   6  
ATOM   7214  C CD1  . LEU A 1 30 ? 0.215   2.209   4.673   1.00 0.13 ? 30  LEU A CD1  6  
ATOM   7215  C CD2  . LEU A 1 30 ? 1.057   2.731   6.969   1.00 0.15 ? 30  LEU A CD2  6  
ATOM   7216  H H    . LEU A 1 30 ? -1.714  4.881   4.075   1.00 0.13 ? 30  LEU A H    6  
ATOM   7217  H HA   . LEU A 1 30 ? -2.576  2.443   5.149   1.00 0.11 ? 30  LEU A HA   6  
ATOM   7218  H HB2  . LEU A 1 30 ? -0.658  4.519   5.826   1.00 0.14 ? 30  LEU A HB2  6  
ATOM   7219  H HB3  . LEU A 1 30 ? -1.380  3.804   7.254   1.00 0.14 ? 30  LEU A HB3  6  
ATOM   7220  H HG   . LEU A 1 30 ? -0.659  1.576   6.496   1.00 0.13 ? 30  LEU A HG   6  
ATOM   7221  H HD11 . LEU A 1 30 ? 0.515   3.137   4.210   1.00 0.13 ? 30  LEU A HD11 6  
ATOM   7222  H HD12 . LEU A 1 30 ? -0.629  1.798   4.139   1.00 0.12 ? 30  LEU A HD12 6  
ATOM   7223  H HD13 . LEU A 1 30 ? 1.036   1.509   4.641   1.00 0.13 ? 30  LEU A HD13 6  
ATOM   7224  H HD21 . LEU A 1 30 ? 1.725   1.885   6.909   1.00 0.15 ? 30  LEU A HD21 6  
ATOM   7225  H HD22 . LEU A 1 30 ? 0.761   2.883   7.996   1.00 0.16 ? 30  LEU A HD22 6  
ATOM   7226  H HD23 . LEU A 1 30 ? 1.562   3.614   6.606   1.00 0.15 ? 30  LEU A HD23 6  
ATOM   7227  N N    . SER A 1 31 ? -3.763  5.109   6.704   1.00 0.13 ? 31  SER A N    6  
ATOM   7228  C CA   . SER A 1 31 ? -4.835  5.578   7.575   1.00 0.13 ? 31  SER A CA   6  
ATOM   7229  C C    . SER A 1 31 ? -6.193  5.114   7.059   1.00 0.12 ? 31  SER A C    6  
ATOM   7230  O O    . SER A 1 31 ? -7.124  4.896   7.837   1.00 0.12 ? 31  SER A O    6  
ATOM   7231  C CB   . SER A 1 31 ? -4.807  7.104   7.675   1.00 0.14 ? 31  SER A CB   6  
ATOM   7232  O OG   . SER A 1 31 ? -6.066  7.610   8.085   1.00 0.14 ? 31  SER A OG   6  
ATOM   7233  H H    . SER A 1 31 ? -3.116  5.756   6.352   1.00 0.13 ? 31  SER A H    6  
ATOM   7234  H HA   . SER A 1 31 ? -4.672  5.158   8.556   1.00 0.13 ? 31  SER A HA   6  
ATOM   7235  H HB2  . SER A 1 31 ? -4.061  7.402   8.396   1.00 0.15 ? 31  SER A HB2  6  
ATOM   7236  H HB3  . SER A 1 31 ? -4.561  7.522   6.710   1.00 0.14 ? 31  SER A HB3  6  
ATOM   7237  H HG   . SER A 1 31 ? -6.609  6.890   8.414   1.00 0.13 ? 31  SER A HG   6  
ATOM   7238  N N    . LEU A 1 32 ? -6.301  4.968   5.744   1.00 0.11 ? 32  LEU A N    6  
ATOM   7239  C CA   . LEU A 1 32 ? -7.547  4.532   5.122   1.00 0.10 ? 32  LEU A CA   6  
ATOM   7240  C C    . LEU A 1 32 ? -7.717  3.019   5.243   1.00 0.09 ? 32  LEU A C    6  
ATOM   7241  O O    . LEU A 1 32 ? -8.829  2.518   5.395   1.00 0.09 ? 32  LEU A O    6  
ATOM   7242  C CB   . LEU A 1 32 ? -7.579  4.943   3.651   1.00 0.10 ? 32  LEU A CB   6  
ATOM   7243  C CG   . LEU A 1 32 ? -8.863  4.615   2.888   1.00 0.09 ? 32  LEU A CG   6  
ATOM   7244  C CD1  . LEU A 1 32 ? -8.866  3.160   2.450   1.00 0.08 ? 32  LEU A CD1  6  
ATOM   7245  C CD2  . LEU A 1 32 ? -10.083 4.920   3.743   1.00 0.09 ? 32  LEU A CD2  6  
ATOM   7246  H H    . LEU A 1 32 ? -5.525  5.159   5.176   1.00 0.11 ? 32  LEU A H    6  
ATOM   7247  H HA   . LEU A 1 32 ? -8.361  5.016   5.640   1.00 0.10 ? 32  LEU A HA   6  
ATOM   7248  H HB2  . LEU A 1 32 ? -7.421  6.011   3.598   1.00 0.10 ? 32  LEU A HB2  6  
ATOM   7249  H HB3  . LEU A 1 32 ? -6.757  4.454   3.149   1.00 0.09 ? 32  LEU A HB3  6  
ATOM   7250  H HG   . LEU A 1 32 ? -8.914  5.231   2.001   1.00 0.09 ? 32  LEU A HG   6  
ATOM   7251  H HD11 . LEU A 1 32 ? -8.005  2.969   1.827   1.00 0.08 ? 32  LEU A HD11 6  
ATOM   7252  H HD12 . LEU A 1 32 ? -9.767  2.955   1.890   1.00 0.08 ? 32  LEU A HD12 6  
ATOM   7253  H HD13 . LEU A 1 32 ? -8.830  2.522   3.320   1.00 0.08 ? 32  LEU A HD13 6  
ATOM   7254  H HD21 . LEU A 1 32 ? -10.979 4.658   3.200   1.00 0.09 ? 32  LEU A HD21 6  
ATOM   7255  H HD22 . LEU A 1 32 ? -10.102 5.974   3.979   1.00 0.10 ? 32  LEU A HD22 6  
ATOM   7256  H HD23 . LEU A 1 32 ? -10.035 4.348   4.656   1.00 0.09 ? 32  LEU A HD23 6  
ATOM   7257  N N    . LEU A 1 33 ? -6.602  2.300   5.176   1.00 0.09 ? 33  LEU A N    6  
ATOM   7258  C CA   . LEU A 1 33 ? -6.625  0.845   5.279   1.00 0.08 ? 33  LEU A CA   6  
ATOM   7259  C C    . LEU A 1 33 ? -6.870  0.405   6.719   1.00 0.09 ? 33  LEU A C    6  
ATOM   7260  O O    . LEU A 1 33 ? -7.061  -0.781  6.991   1.00 0.09 ? 33  LEU A O    6  
ATOM   7261  C CB   . LEU A 1 33 ? -5.305  0.256   4.774   1.00 0.08 ? 33  LEU A CB   6  
ATOM   7262  C CG   . LEU A 1 33 ? -5.285  -0.187  3.309   1.00 0.08 ? 33  LEU A CG   6  
ATOM   7263  C CD1  . LEU A 1 33 ? -3.890  -0.644  2.910   1.00 0.08 ? 33  LEU A CD1  6  
ATOM   7264  C CD2  . LEU A 1 33 ? -6.301  -1.295  3.074   1.00 0.07 ? 33  LEU A CD2  6  
ATOM   7265  H H    . LEU A 1 33 ? -5.743  2.757   5.053   1.00 0.10 ? 33  LEU A H    6  
ATOM   7266  H HA   . LEU A 1 33 ? -7.432  0.483   4.662   1.00 0.08 ? 33  LEU A HA   6  
ATOM   7267  H HB2  . LEU A 1 33 ? -4.532  0.999   4.910   1.00 0.09 ? 33  LEU A HB2  6  
ATOM   7268  H HB3  . LEU A 1 33 ? -5.066  -0.598  5.385   1.00 0.09 ? 33  LEU A HB3  6  
ATOM   7269  H HG   . LEU A 1 33 ? -5.553  0.652   2.683   1.00 0.08 ? 33  LEU A HG   6  
ATOM   7270  H HD11 . LEU A 1 33 ? -3.940  -1.174  1.969   1.00 0.09 ? 33  LEU A HD11 6  
ATOM   7271  H HD12 . LEU A 1 33 ? -3.493  -1.298  3.671   1.00 0.10 ? 33  LEU A HD12 6  
ATOM   7272  H HD13 . LEU A 1 33 ? -3.247  0.216   2.803   1.00 0.10 ? 33  LEU A HD13 6  
ATOM   7273  H HD21 . LEU A 1 33 ? -5.907  -2.230  3.445   1.00 0.07 ? 33  LEU A HD21 6  
ATOM   7274  H HD22 . LEU A 1 33 ? -6.498  -1.379  2.016   1.00 0.06 ? 33  LEU A HD22 6  
ATOM   7275  H HD23 . LEU A 1 33 ? -7.218  -1.062  3.591   1.00 0.07 ? 33  LEU A HD23 6  
ATOM   7276  N N    . GLN A 1 34 ? -6.869  1.367   7.636   1.00 0.10 ? 34  GLN A N    6  
ATOM   7277  C CA   . GLN A 1 34 ? -7.095  1.079   9.046   1.00 0.11 ? 34  GLN A CA   6  
ATOM   7278  C C    . GLN A 1 34 ? -8.500  1.496   9.470   1.00 0.11 ? 34  GLN A C    6  
ATOM   7279  O O    . GLN A 1 34 ? -9.091  0.899   10.371  1.00 0.12 ? 34  GLN A O    6  
ATOM   7280  C CB   . GLN A 1 34 ? -6.055  1.799   9.908   1.00 0.12 ? 34  GLN A CB   6  
ATOM   7281  C CG   . GLN A 1 34 ? -4.620  1.495   9.509   1.00 0.13 ? 34  GLN A CG   6  
ATOM   7282  C CD   . GLN A 1 34 ? -3.734  1.202   10.702  1.00 0.14 ? 34  GLN A CD   6  
ATOM   7283  O OE1  . GLN A 1 34 ? -3.885  1.802   11.767  1.00 0.15 ? 34  GLN A OE1  6  
ATOM   7284  N NE2  . GLN A 1 34 ? -2.799  0.274   10.532  1.00 0.14 ? 34  GLN A NE2  6  
ATOM   7285  H H    . GLN A 1 34 ? -6.711  2.293   7.356   1.00 0.10 ? 34  GLN A H    6  
ATOM   7286  H HA   . GLN A 1 34 ? -6.991  0.014   9.187   1.00 0.11 ? 34  GLN A HA   6  
ATOM   7287  H HB2  . GLN A 1 34 ? -6.212  2.864   9.827   1.00 0.13 ? 34  GLN A HB2  6  
ATOM   7288  H HB3  . GLN A 1 34 ? -6.191  1.501   10.937  1.00 0.13 ? 34  GLN A HB3  6  
ATOM   7289  H HG2  . GLN A 1 34 ? -4.615  0.635   8.857   1.00 0.12 ? 34  GLN A HG2  6  
ATOM   7290  H HG3  . GLN A 1 34 ? -4.219  2.348   8.981   1.00 0.13 ? 34  GLN A HG3  6  
ATOM   7291  H HE21 . GLN A 1 34 ? -2.735  -0.165  9.658   1.00 0.13 ? 34  GLN A HE21 6  
ATOM   7292  H HE22 . GLN A 1 34 ? -2.214  0.063   11.288  1.00 0.15 ? 34  GLN A HE22 6  
ATOM   7293  N N    . LYS A 1 35 ? -9.029  2.523   8.813   1.00 0.11 ? 35  LYS A N    6  
ATOM   7294  C CA   . LYS A 1 35 ? -10.366 3.019   9.119   1.00 0.11 ? 35  LYS A CA   6  
ATOM   7295  C C    . LYS A 1 35 ? -11.435 2.126   8.495   1.00 0.11 ? 35  LYS A C    6  
ATOM   7296  O O    . LYS A 1 35 ? -12.493 1.907   9.082   1.00 0.11 ? 35  LYS A O    6  
ATOM   7297  C CB   . LYS A 1 35 ? -10.526 4.454   8.615   1.00 0.12 ? 35  LYS A CB   6  
ATOM   7298  C CG   . LYS A 1 35 ? -10.725 4.553   7.113   1.00 0.11 ? 35  LYS A CG   6  
ATOM   7299  C CD   . LYS A 1 35 ? -10.913 5.995   6.669   1.00 0.11 ? 35  LYS A CD   6  
ATOM   7300  C CE   . LYS A 1 35 ? -12.236 6.186   5.944   1.00 0.11 ? 35  LYS A CE   6  
ATOM   7301  N NZ   . LYS A 1 35 ? -12.890 7.472   6.315   1.00 0.12 ? 35  LYS A NZ   6  
ATOM   7302  H H    . LYS A 1 35 ? -8.508  2.958   8.106   1.00 0.11 ? 35  LYS A H    6  
ATOM   7303  H HA   . LYS A 1 35 ? -10.487 3.007   10.192  1.00 0.12 ? 35  LYS A HA   6  
ATOM   7304  H HB2  . LYS A 1 35 ? -11.382 4.900   9.100   1.00 0.12 ? 35  LYS A HB2  6  
ATOM   7305  H HB3  . LYS A 1 35 ? -9.641  5.016   8.877   1.00 0.12 ? 35  LYS A HB3  6  
ATOM   7306  H HG2  . LYS A 1 35 ? -9.858  4.144   6.620   1.00 0.10 ? 35  LYS A HG2  6  
ATOM   7307  H HG3  . LYS A 1 35 ? -11.599 3.981   6.838   1.00 0.10 ? 35  LYS A HG3  6  
ATOM   7308  H HD2  . LYS A 1 35 ? -10.897 6.633   7.540   1.00 0.12 ? 35  LYS A HD2  6  
ATOM   7309  H HD3  . LYS A 1 35 ? -10.105 6.266   6.007   1.00 0.11 ? 35  LYS A HD3  6  
ATOM   7310  H HE2  . LYS A 1 35 ? -12.053 6.179   4.880   1.00 0.11 ? 35  LYS A HE2  6  
ATOM   7311  H HE3  . LYS A 1 35 ? -12.895 5.370   6.200   1.00 0.11 ? 35  LYS A HE3  6  
ATOM   7312  H HZ1  . LYS A 1 35 ? -13.080 7.493   7.336   1.00 0.13 ? 35  LYS A HZ1  6  
ATOM   7313  H HZ2  . LYS A 1 35 ? -13.789 7.575   5.803   1.00 0.12 ? 35  LYS A HZ2  6  
ATOM   7314  H HZ3  . LYS A 1 35 ? -12.271 8.271   6.070   1.00 0.12 ? 35  LYS A HZ3  6  
ATOM   7315  N N    . GLU A 1 36 ? -11.148 1.617   7.300   1.00 0.10 ? 36  GLU A N    6  
ATOM   7316  C CA   . GLU A 1 36 ? -12.086 0.749   6.598   1.00 0.09 ? 36  GLU A CA   6  
ATOM   7317  C C    . GLU A 1 36 ? -12.168 -0.620  7.268   1.00 0.09 ? 36  GLU A C    6  
ATOM   7318  O O    . GLU A 1 36 ? -13.028 -1.436  6.937   1.00 0.09 ? 36  GLU A O    6  
ATOM   7319  C CB   . GLU A 1 36 ? -11.667 0.588   5.135   1.00 0.08 ? 36  GLU A CB   6  
ATOM   7320  C CG   . GLU A 1 36 ? -11.658 1.893   4.358   1.00 0.08 ? 36  GLU A CG   6  
ATOM   7321  C CD   . GLU A 1 36 ? -13.049 2.451   4.137   1.00 0.09 ? 36  GLU A CD   6  
ATOM   7322  O OE1  . GLU A 1 36 ? -13.165 3.523   3.507   1.00 0.09 ? 36  GLU A OE1  6  
ATOM   7323  O OE2  . GLU A 1 36 ? -14.023 1.817   4.591   1.00 0.09 ? 36  GLU A OE2  6  
ATOM   7324  H H    . GLU A 1 36 ? -10.287 1.829   6.883   1.00 0.09 ? 36  GLU A H    6  
ATOM   7325  H HA   . GLU A 1 36 ? -13.060 1.214   6.635   1.00 0.10 ? 36  GLU A HA   6  
ATOM   7326  H HB2  . GLU A 1 36 ? -10.674 0.166   5.102   1.00 0.08 ? 36  GLU A HB2  6  
ATOM   7327  H HB3  . GLU A 1 36 ? -12.352 -0.092  4.649   1.00 0.08 ? 36  GLU A HB3  6  
ATOM   7328  H HG2  . GLU A 1 36 ? -11.080 2.619   4.909   1.00 0.09 ? 36  GLU A HG2  6  
ATOM   7329  H HG3  . GLU A 1 36 ? -11.197 1.722   3.397   1.00 0.08 ? 36  GLU A HG3  6  
ATOM   7330  N N    . GLY A 1 37 ? -11.266 -0.864  8.214   1.00 0.10 ? 37  GLY A N    6  
ATOM   7331  C CA   . GLY A 1 37 ? -11.253 -2.135  8.917   1.00 0.10 ? 37  GLY A CA   6  
ATOM   7332  C C    . GLY A 1 37 ? -10.539 -3.220  8.137   1.00 0.09 ? 37  GLY A C    6  
ATOM   7333  O O    . GLY A 1 37 ? -10.537 -4.384  8.539   1.00 0.10 ? 37  GLY A O    6  
ATOM   7334  H H    . GLY A 1 37 ? -10.607 -0.174  8.439   1.00 0.10 ? 37  GLY A H    6  
ATOM   7335  H HA2  . GLY A 1 37 ? -10.756 -2.003  9.867   1.00 0.11 ? 37  GLY A HA2  6  
ATOM   7336  H HA3  . GLY A 1 37 ? -12.272 -2.445  9.096   1.00 0.11 ? 37  GLY A HA3  6  
ATOM   7337  N N    . LEU A 1 38 ? -9.932  -2.840  7.018   1.00 0.08 ? 38  LEU A N    6  
ATOM   7338  C CA   . LEU A 1 38 ? -9.211  -3.793  6.178   1.00 0.08 ? 38  LEU A CA   6  
ATOM   7339  C C    . LEU A 1 38 ? -7.902  -4.217  6.836   1.00 0.08 ? 38  LEU A C    6  
ATOM   7340  O O    . LEU A 1 38 ? -7.358  -5.278  6.531   1.00 0.08 ? 38  LEU A O    6  
ATOM   7341  C CB   . LEU A 1 38 ? -8.930  -3.178  4.805   1.00 0.07 ? 38  LEU A CB   6  
ATOM   7342  C CG   . LEU A 1 38 ? -10.147 -2.952  3.910   1.00 0.06 ? 38  LEU A CG   6  
ATOM   7343  C CD1  . LEU A 1 38 ? -9.841  -1.912  2.843   1.00 0.06 ? 38  LEU A CD1  6  
ATOM   7344  C CD2  . LEU A 1 38 ? -10.590 -4.260  3.269   1.00 0.06 ? 38  LEU A CD2  6  
ATOM   7345  H H    . LEU A 1 38 ? -9.968  -1.898  6.749   1.00 0.08 ? 38  LEU A H    6  
ATOM   7346  H HA   . LEU A 1 38 ? -9.836  -4.663  6.052   1.00 0.08 ? 38  LEU A HA   6  
ATOM   7347  H HB2  . LEU A 1 38 ? -8.444  -2.226  4.958   1.00 0.07 ? 38  LEU A HB2  6  
ATOM   7348  H HB3  . LEU A 1 38 ? -8.246  -3.829  4.282   1.00 0.06 ? 38  LEU A HB3  6  
ATOM   7349  H HG   . LEU A 1 38 ? -10.965 -2.581  4.511   1.00 0.07 ? 38  LEU A HG   6  
ATOM   7350  H HD11 . LEU A 1 38 ? -9.595  -0.973  3.316   1.00 0.06 ? 38  LEU A HD11 6  
ATOM   7351  H HD12 . LEU A 1 38 ? -10.706 -1.780  2.210   1.00 0.06 ? 38  LEU A HD12 6  
ATOM   7352  H HD13 . LEU A 1 38 ? -9.005  -2.244  2.246   1.00 0.05 ? 38  LEU A HD13 6  
ATOM   7353  H HD21 . LEU A 1 38 ? -9.773  -4.675  2.696   1.00 0.06 ? 38  LEU A HD21 6  
ATOM   7354  H HD22 . LEU A 1 38 ? -11.430 -4.075  2.615   1.00 0.06 ? 38  LEU A HD22 6  
ATOM   7355  H HD23 . LEU A 1 38 ? -10.881 -4.959  4.040   1.00 0.07 ? 38  LEU A HD23 6  
ATOM   7356  N N    . LEU A 1 39 ? -7.403  -3.381  7.740   1.00 0.09 ? 39  LEU A N    6  
ATOM   7357  C CA   . LEU A 1 39 ? -6.158  -3.671  8.444   1.00 0.10 ? 39  LEU A CA   6  
ATOM   7358  C C    . LEU A 1 39 ? -6.228  -3.196  9.892   1.00 0.11 ? 39  LEU A C    6  
ATOM   7359  O O    . LEU A 1 39 ? -6.901  -2.214  10.202  1.00 0.11 ? 39  LEU A O    6  
ATOM   7360  C CB   . LEU A 1 39 ? -4.980  -3.003  7.733   1.00 0.10 ? 39  LEU A CB   6  
ATOM   7361  C CG   . LEU A 1 39 ? -4.657  -3.526  6.332   1.00 0.09 ? 39  LEU A CG   6  
ATOM   7362  C CD1  . LEU A 1 39 ? -3.446  -2.806  5.760   1.00 0.09 ? 39  LEU A CD1  6  
ATOM   7363  C CD2  . LEU A 1 39 ? -4.419  -5.029  6.367   1.00 0.09 ? 39  LEU A CD2  6  
ATOM   7364  H H    . LEU A 1 39 ? -7.882  -2.549  7.940   1.00 0.09 ? 39  LEU A H    6  
ATOM   7365  H HA   . LEU A 1 39 ? -6.013  -4.741  8.435   1.00 0.10 ? 39  LEU A HA   6  
ATOM   7366  H HB2  . LEU A 1 39 ? -5.191  -1.946  7.656   1.00 0.10 ? 39  LEU A HB2  6  
ATOM   7367  H HB3  . LEU A 1 39 ? -4.101  -3.130  8.348   1.00 0.11 ? 39  LEU A HB3  6  
ATOM   7368  H HG   . LEU A 1 39 ? -5.497  -3.334  5.682   1.00 0.08 ? 39  LEU A HG   6  
ATOM   7369  H HD11 . LEU A 1 39 ? -3.357  -3.033  4.708   1.00 0.08 ? 39  LEU A HD11 6  
ATOM   7370  H HD12 . LEU A 1 39 ? -2.555  -3.137  6.275   1.00 0.10 ? 39  LEU A HD12 6  
ATOM   7371  H HD13 . LEU A 1 39 ? -3.562  -1.742  5.891   1.00 0.09 ? 39  LEU A HD13 6  
ATOM   7372  H HD21 . LEU A 1 39 ? -3.752  -5.306  5.565   1.00 0.08 ? 39  LEU A HD21 6  
ATOM   7373  H HD22 . LEU A 1 39 ? -5.362  -5.544  6.246   1.00 0.08 ? 39  LEU A HD22 6  
ATOM   7374  H HD23 . LEU A 1 39 ? -3.981  -5.303  7.314   1.00 0.10 ? 39  LEU A HD23 6  
ATOM   7375  N N    . MET A 1 40 ? -5.526  -3.900  10.774  1.00 0.12 ? 40  MET A N    6  
ATOM   7376  C CA   . MET A 1 40 ? -5.506  -3.549  12.189  1.00 0.14 ? 40  MET A CA   6  
ATOM   7377  C C    . MET A 1 40 ? -4.209  -2.832  12.554  1.00 0.14 ? 40  MET A C    6  
ATOM   7378  O O    . MET A 1 40 ? -4.149  -2.102  13.543  1.00 0.15 ? 40  MET A O    6  
ATOM   7379  C CB   . MET A 1 40 ? -5.668  -4.802  13.051  1.00 0.14 ? 40  MET A CB   6  
ATOM   7380  C CG   . MET A 1 40 ? -6.017  -4.503  14.501  1.00 0.16 ? 40  MET A CG   6  
ATOM   7381  S SD   . MET A 1 40 ? -5.362  -5.737  15.641  1.00 0.17 ? 40  MET A SD   6  
ATOM   7382  C CE   . MET A 1 40 ? -3.616  -5.339  15.604  1.00 0.17 ? 40  MET A CE   6  
ATOM   7383  H H    . MET A 1 40 ? -5.009  -4.674  10.466  1.00 0.12 ? 40  MET A H    6  
ATOM   7384  H HA   . MET A 1 40 ? -6.336  -2.884  12.377  1.00 0.14 ? 40  MET A HA   6  
ATOM   7385  H HB2  . MET A 1 40 ? -6.454  -5.414  12.633  1.00 0.14 ? 40  MET A HB2  6  
ATOM   7386  H HB3  . MET A 1 40 ? -4.743  -5.359  13.033  1.00 0.14 ? 40  MET A HB3  6  
ATOM   7387  H HG2  . MET A 1 40 ? -5.608  -3.539  14.764  1.00 0.16 ? 40  MET A HG2  6  
ATOM   7388  H HG3  . MET A 1 40 ? -7.092  -4.476  14.600  1.00 0.15 ? 40  MET A HG3  6  
ATOM   7389  H HE1  . MET A 1 40 ? -3.476  -4.308  15.892  1.00 0.18 ? 40  MET A HE1  6  
ATOM   7390  H HE2  . MET A 1 40 ? -3.233  -5.489  14.606  1.00 0.17 ? 40  MET A HE2  6  
ATOM   7391  H HE3  . MET A 1 40 ? -3.086  -5.979  16.294  1.00 0.18 ? 40  MET A HE3  6  
ATOM   7392  N N    . SER A 1 41 ? -3.174  -3.045  11.747  1.00 0.14 ? 41  SER A N    6  
ATOM   7393  C CA   . SER A 1 41 ? -1.878  -2.421  11.986  1.00 0.15 ? 41  SER A CA   6  
ATOM   7394  C C    . SER A 1 41 ? -1.143  -2.175  10.673  1.00 0.14 ? 41  SER A C    6  
ATOM   7395  O O    . SER A 1 41 ? -1.442  -2.776  9.641   1.00 0.13 ? 41  SER A O    6  
ATOM   7396  C CB   . SER A 1 41 ? -1.027  -3.302  12.903  1.00 0.16 ? 41  SER A CB   6  
ATOM   7397  O OG   . SER A 1 41 ? -1.577  -4.603  13.015  1.00 0.16 ? 41  SER A OG   6  
ATOM   7398  H H    . SER A 1 41 ? -3.284  -3.636  10.973  1.00 0.13 ? 41  SER A H    6  
ATOM   7399  H HA   . SER A 1 41 ? -2.052  -1.473  12.472  1.00 0.15 ? 41  SER A HA   6  
ATOM   7400  H HB2  . SER A 1 41 ? -0.030  -3.382  12.497  1.00 0.16 ? 41  SER A HB2  6  
ATOM   7401  H HB3  . SER A 1 41 ? -0.981  -2.857  13.887  1.00 0.17 ? 41  SER A HB3  6  
ATOM   7402  H HG   . SER A 1 41 ? -1.370  -4.966  13.880  1.00 0.17 ? 41  SER A HG   6  
ATOM   7403  N N    . PRO A 1 42 ? -0.155  -1.269  10.710  1.00 0.15 ? 42  PRO A N    6  
ATOM   7404  C CA   . PRO A 1 42 ? 0.644   -0.920  9.532   1.00 0.15 ? 42  PRO A CA   6  
ATOM   7405  C C    . PRO A 1 42 ? 1.569   -2.055  9.103   1.00 0.15 ? 42  PRO A C    6  
ATOM   7406  O O    . PRO A 1 42 ? 2.090   -2.056  7.989   1.00 0.15 ? 42  PRO A O    6  
ATOM   7407  C CB   . PRO A 1 42 ? 1.462   0.287   10.002  1.00 0.16 ? 42  PRO A CB   6  
ATOM   7408  C CG   . PRO A 1 42 ? 1.547   0.134   11.481  1.00 0.17 ? 42  PRO A CG   6  
ATOM   7409  C CD   . PRO A 1 42 ? 0.258   -0.514  11.906  1.00 0.17 ? 42  PRO A CD   6  
ATOM   7410  H HA   . PRO A 1 42 ? 0.019   -0.634  8.700   1.00 0.14 ? 42  PRO A HA   6  
ATOM   7411  H HB2  . PRO A 1 42 ? 2.445   0.266   9.549   1.00 0.17 ? 42  PRO A HB2  6  
ATOM   7412  H HB3  . PRO A 1 42 ? 0.952   1.203   9.751   1.00 0.16 ? 42  PRO A HB3  6  
ATOM   7413  H HG2  . PRO A 1 42 ? 2.389   -0.495  11.736  1.00 0.18 ? 42  PRO A HG2  6  
ATOM   7414  H HG3  . PRO A 1 42 ? 1.644   1.102   11.948  1.00 0.18 ? 42  PRO A HG3  6  
ATOM   7415  H HD2  . PRO A 1 42 ? 0.425   -1.176  12.742  1.00 0.17 ? 42  PRO A HD2  6  
ATOM   7416  H HD3  . PRO A 1 42 ? -0.476  0.238   12.159  1.00 0.16 ? 42  PRO A HD3  6  
ATOM   7417  N N    . SER A 1 43 ? 1.770   -3.018  9.998   1.00 0.16 ? 43  SER A N    6  
ATOM   7418  C CA   . SER A 1 43 ? 2.636   -4.156  9.713   1.00 0.16 ? 43  SER A CA   6  
ATOM   7419  C C    . SER A 1 43 ? 1.861   -5.263  9.003   1.00 0.15 ? 43  SER A C    6  
ATOM   7420  O O    . SER A 1 43 ? 2.435   -6.270  8.588   1.00 0.15 ? 43  SER A O    6  
ATOM   7421  C CB   . SER A 1 43 ? 3.246   -4.697  11.007  1.00 0.17 ? 43  SER A CB   6  
ATOM   7422  O OG   . SER A 1 43 ? 2.241   -4.993  11.961  1.00 0.17 ? 43  SER A OG   6  
ATOM   7423  H H    . SER A 1 43 ? 1.326   -2.961  10.869  1.00 0.16 ? 43  SER A H    6  
ATOM   7424  H HA   . SER A 1 43 ? 3.429   -3.816  9.065   1.00 0.16 ? 43  SER A HA   6  
ATOM   7425  H HB2  . SER A 1 43 ? 3.799   -5.599  10.793  1.00 0.17 ? 43  SER A HB2  6  
ATOM   7426  H HB3  . SER A 1 43 ? 3.914   -3.957  11.424  1.00 0.18 ? 43  SER A HB3  6  
ATOM   7427  H HG   . SER A 1 43 ? 2.256   -5.933  12.161  1.00 0.17 ? 43  SER A HG   6  
ATOM   7428  N N    . ASP A 1 44 ? 0.554   -5.069  8.867   1.00 0.14 ? 44  ASP A N    6  
ATOM   7429  C CA   . ASP A 1 44 ? -0.301  -6.048  8.207   1.00 0.12 ? 44  ASP A CA   6  
ATOM   7430  C C    . ASP A 1 44 ? 0.096   -6.217  6.744   1.00 0.12 ? 44  ASP A C    6  
ATOM   7431  O O    . ASP A 1 44 ? -0.282  -7.194  6.094   1.00 0.11 ? 44  ASP A O    6  
ATOM   7432  C CB   . ASP A 1 44 ? -1.768  -5.626  8.305   1.00 0.12 ? 44  ASP A CB   6  
ATOM   7433  C CG   . ASP A 1 44 ? -2.702  -6.808  8.461   1.00 0.11 ? 44  ASP A CG   6  
ATOM   7434  O OD1  . ASP A 1 44 ? -2.448  -7.853  7.825   1.00 0.11 ? 44  ASP A OD1  6  
ATOM   7435  O OD2  . ASP A 1 44 ? -3.687  -6.691  9.218   1.00 0.11 ? 44  ASP A OD2  6  
ATOM   7436  H H    . ASP A 1 44 ? 0.154   -4.246  9.219   1.00 0.14 ? 44  ASP A H    6  
ATOM   7437  H HA   . ASP A 1 44 ? -0.173  -6.994  8.713   1.00 0.13 ? 44  ASP A HA   6  
ATOM   7438  H HB2  . ASP A 1 44 ? -1.894  -4.977  9.158   1.00 0.12 ? 44  ASP A HB2  6  
ATOM   7439  H HB3  . ASP A 1 44 ? -2.040  -5.091  7.408   1.00 0.11 ? 44  ASP A HB3  6  
ATOM   7440  N N    . LEU A 1 45 ? 0.860   -5.259  6.229   1.00 0.12 ? 45  LEU A N    6  
ATOM   7441  C CA   . LEU A 1 45 ? 1.308   -5.301  4.841   1.00 0.12 ? 45  LEU A CA   6  
ATOM   7442  C C    . LEU A 1 45 ? 2.199   -6.515  4.592   1.00 0.12 ? 45  LEU A C    6  
ATOM   7443  O O    . LEU A 1 45 ? 2.428   -6.905  3.448   1.00 0.12 ? 45  LEU A O    6  
ATOM   7444  C CB   . LEU A 1 45 ? 2.063   -4.018  4.489   1.00 0.12 ? 45  LEU A CB   6  
ATOM   7445  C CG   . LEU A 1 45 ? 1.444   -3.154  3.391   1.00 0.12 ? 45  LEU A CG   6  
ATOM   7446  C CD1  . LEU A 1 45 ? 1.709   -3.761  2.021   1.00 0.11 ? 45  LEU A CD1  6  
ATOM   7447  C CD2  . LEU A 1 45 ? -0.052  -2.989  3.622   1.00 0.10 ? 45  LEU A CD2  6  
ATOM   7448  H H    . LEU A 1 45 ? 1.129   -4.506  6.795   1.00 0.13 ? 45  LEU A H    6  
ATOM   7449  H HA   . LEU A 1 45 ? 0.434   -5.377  4.214   1.00 0.11 ? 45  LEU A HA   6  
ATOM   7450  H HB2  . LEU A 1 45 ? 2.140   -3.419  5.385   1.00 0.13 ? 45  LEU A HB2  6  
ATOM   7451  H HB3  . LEU A 1 45 ? 3.060   -4.292  4.178   1.00 0.13 ? 45  LEU A HB3  6  
ATOM   7452  H HG   . LEU A 1 45 ? 1.897   -2.174  3.414   1.00 0.12 ? 45  LEU A HG   6  
ATOM   7453  H HD11 . LEU A 1 45 ? 2.752   -3.646  1.774   1.00 0.12 ? 45  LEU A HD11 6  
ATOM   7454  H HD12 . LEU A 1 45 ? 1.107   -3.257  1.281   1.00 0.11 ? 45  LEU A HD12 6  
ATOM   7455  H HD13 . LEU A 1 45 ? 1.456   -4.811  2.037   1.00 0.11 ? 45  LEU A HD13 6  
ATOM   7456  H HD21 . LEU A 1 45 ? -0.398  -2.100  3.116   1.00 0.10 ? 45  LEU A HD21 6  
ATOM   7457  H HD22 . LEU A 1 45 ? -0.246  -2.900  4.680   1.00 0.11 ? 45  LEU A HD22 6  
ATOM   7458  H HD23 . LEU A 1 45 ? -0.574  -3.849  3.231   1.00 0.10 ? 45  LEU A HD23 6  
ATOM   7459  N N    . TYR A 1 46 ? 2.697   -7.107  5.673   1.00 0.13 ? 46  TYR A N    6  
ATOM   7460  C CA   . TYR A 1 46 ? 3.562   -8.275  5.572   1.00 0.14 ? 46  TYR A CA   6  
ATOM   7461  C C    . TYR A 1 46 ? 2.744   -9.544  5.357   1.00 0.13 ? 46  TYR A C    6  
ATOM   7462  O O    . TYR A 1 46 ? 3.288   -10.645 5.303   1.00 0.13 ? 46  TYR A O    6  
ATOM   7463  C CB   . TYR A 1 46 ? 4.416   -8.412  6.835   1.00 0.15 ? 46  TYR A CB   6  
ATOM   7464  C CG   . TYR A 1 46 ? 5.187   -7.161  7.184   1.00 0.16 ? 46  TYR A CG   6  
ATOM   7465  C CD1  . TYR A 1 46 ? 5.741   -6.362  6.191   1.00 0.16 ? 46  TYR A CD1  6  
ATOM   7466  C CD2  . TYR A 1 46 ? 5.361   -6.774  8.507   1.00 0.17 ? 46  TYR A CD2  6  
ATOM   7467  C CE1  . TYR A 1 46 ? 6.448   -5.217  6.505   1.00 0.17 ? 46  TYR A CE1  6  
ATOM   7468  C CE2  . TYR A 1 46 ? 6.063   -5.630  8.831   1.00 0.18 ? 46  TYR A CE2  6  
ATOM   7469  C CZ   . TYR A 1 46 ? 6.605   -4.854  7.826   1.00 0.18 ? 46  TYR A CZ   6  
ATOM   7470  O OH   . TYR A 1 46 ? 7.307   -3.715  8.147   1.00 0.19 ? 46  TYR A OH   6  
ATOM   7471  H H    . TYR A 1 46 ? 2.477   -6.750  6.559   1.00 0.13 ? 46  TYR A H    6  
ATOM   7472  H HA   . TYR A 1 46 ? 4.212   -8.133  4.723   1.00 0.14 ? 46  TYR A HA   6  
ATOM   7473  H HB2  . TYR A 1 46 ? 3.775   -8.651  7.670   1.00 0.15 ? 46  TYR A HB2  6  
ATOM   7474  H HB3  . TYR A 1 46 ? 5.127   -9.213  6.693   1.00 0.16 ? 46  TYR A HB3  6  
ATOM   7475  H HD1  . TYR A 1 46 ? 5.616   -6.647  5.157   1.00 0.15 ? 46  TYR A HD1  6  
ATOM   7476  H HD2  . TYR A 1 46 ? 4.936   -7.383  9.291   1.00 0.17 ? 46  TYR A HD2  6  
ATOM   7477  H HE1  . TYR A 1 46 ? 6.871   -4.612  5.719   1.00 0.17 ? 46  TYR A HE1  6  
ATOM   7478  H HE2  . TYR A 1 46 ? 6.186   -5.347  9.866   1.00 0.19 ? 46  TYR A HE2  6  
ATOM   7479  H HH   . TYR A 1 46 ? 7.921   -3.906  8.860   1.00 0.20 ? 46  TYR A HH   6  
ATOM   7480  N N    . SER A 1 47 ? 1.430   -9.380  5.235   1.00 0.12 ? 47  SER A N    6  
ATOM   7481  C CA   . SER A 1 47 ? 0.533   -10.510 5.030   1.00 0.11 ? 47  SER A CA   6  
ATOM   7482  C C    . SER A 1 47 ? 0.023   -10.545 3.592   1.00 0.10 ? 47  SER A C    6  
ATOM   7483  O O    . SER A 1 47 ? -0.974  -9.913  3.245   1.00 0.09 ? 47  SER A O    6  
ATOM   7484  C CB   . SER A 1 47 ? -0.647  -10.435 6.000   1.00 0.11 ? 47  SER A CB   6  
ATOM   7485  O OG   . SER A 1 47 ? -0.356  -11.109 7.212   1.00 0.12 ? 47  SER A OG   6  
ATOM   7486  H H    . SER A 1 47 ? 1.054   -8.476  5.287   1.00 0.12 ? 47  SER A H    6  
ATOM   7487  H HA   . SER A 1 47 ? 1.090   -11.412 5.226   1.00 0.12 ? 47  SER A HA   6  
ATOM   7488  H HB2  . SER A 1 47 ? -0.862  -9.400  6.222   1.00 0.11 ? 47  SER A HB2  6  
ATOM   7489  H HB3  . SER A 1 47 ? -1.513  -10.893 5.545   1.00 0.10 ? 47  SER A HB3  6  
ATOM   7490  H HG   . SER A 1 47 ? -0.755  -10.635 7.946   1.00 0.12 ? 47  SER A HG   6  
ATOM   7491  N N    . PRO A 1 48 ? 0.725   -11.302 2.734   1.00 0.11 ? 48  PRO A N    6  
ATOM   7492  C CA   . PRO A 1 48 ? 0.363   -11.439 1.321   1.00 0.10 ? 48  PRO A CA   6  
ATOM   7493  C C    . PRO A 1 48 ? -0.920  -12.236 1.126   1.00 0.09 ? 48  PRO A C    6  
ATOM   7494  O O    . PRO A 1 48 ? -1.412  -12.378 0.006   1.00 0.09 ? 48  PRO A O    6  
ATOM   7495  C CB   . PRO A 1 48 ? 1.555   -12.188 0.721   1.00 0.11 ? 48  PRO A CB   6  
ATOM   7496  C CG   . PRO A 1 48 ? 2.146   -12.938 1.864   1.00 0.12 ? 48  PRO A CG   6  
ATOM   7497  C CD   . PRO A 1 48 ? 1.926   -12.080 3.080   1.00 0.12 ? 48  PRO A CD   6  
ATOM   7498  H HA   . PRO A 1 48 ? 0.263   -10.475 0.843   1.00 0.10 ? 48  PRO A HA   6  
ATOM   7499  H HB2  . PRO A 1 48 ? 1.215   -12.862 -0.054  1.00 0.11 ? 48  PRO A HB2  6  
ATOM   7500  H HB3  . PRO A 1 48 ? 2.274   -11.490 0.325   1.00 0.11 ? 48  PRO A HB3  6  
ATOM   7501  H HG2  . PRO A 1 48 ? 1.643   -13.890 1.975   1.00 0.12 ? 48  PRO A HG2  6  
ATOM   7502  H HG3  . PRO A 1 48 ? 3.202   -13.086 1.705   1.00 0.13 ? 48  PRO A HG3  6  
ATOM   7503  H HD2  . PRO A 1 48 ? 1.749   -12.699 3.947   1.00 0.12 ? 48  PRO A HD2  6  
ATOM   7504  H HD3  . PRO A 1 48 ? 2.773   -11.431 3.244   1.00 0.12 ? 48  PRO A HD3  6  
ATOM   7505  N N    . GLY A 1 49 ? -1.462  -12.754 2.224   1.00 0.09 ? 49  GLY A N    6  
ATOM   7506  C CA   . GLY A 1 49 ? -2.685  -13.532 2.152   1.00 0.09 ? 49  GLY A CA   6  
ATOM   7507  C C    . GLY A 1 49 ? -3.920  -12.699 2.440   1.00 0.08 ? 49  GLY A C    6  
ATOM   7508  O O    . GLY A 1 49 ? -5.029  -13.227 2.520   1.00 0.08 ? 49  GLY A O    6  
ATOM   7509  H H    . GLY A 1 49 ? -1.027  -12.607 3.090   1.00 0.10 ? 49  GLY A H    6  
ATOM   7510  H HA2  . GLY A 1 49 ? -2.773  -13.955 1.162   1.00 0.09 ? 49  GLY A HA2  6  
ATOM   7511  H HA3  . GLY A 1 49 ? -2.632  -14.336 2.871   1.00 0.10 ? 49  GLY A HA3  6  
ATOM   7512  N N    . SER A 1 50 ? -3.727  -11.395 2.598   1.00 0.08 ? 50  SER A N    6  
ATOM   7513  C CA   . SER A 1 50 ? -4.832  -10.487 2.884   1.00 0.07 ? 50  SER A CA   6  
ATOM   7514  C C    . SER A 1 50 ? -4.953  -9.420  1.802   1.00 0.06 ? 50  SER A C    6  
ATOM   7515  O O    . SER A 1 50 ? -5.774  -8.506  1.904   1.00 0.06 ? 50  SER A O    6  
ATOM   7516  C CB   . SER A 1 50 ? -4.637  -9.827  4.250   1.00 0.08 ? 50  SER A CB   6  
ATOM   7517  O OG   . SER A 1 50 ? -4.770  -10.771 5.298   1.00 0.09 ? 50  SER A OG   6  
ATOM   7518  H H    . SER A 1 50 ? -2.820  -11.032 2.522   1.00 0.08 ? 50  SER A H    6  
ATOM   7519  H HA   . SER A 1 50 ? -5.742  -11.069 2.902   1.00 0.07 ? 50  SER A HA   6  
ATOM   7520  H HB2  . SER A 1 50 ? -3.651  -9.390  4.299   1.00 0.08 ? 50  SER A HB2  6  
ATOM   7521  H HB3  . SER A 1 50 ? -5.379  -9.053  4.382   1.00 0.07 ? 50  SER A HB3  6  
ATOM   7522  H HG   . SER A 1 50 ? -5.112  -11.596 4.945   1.00 0.09 ? 50  SER A HG   6  
ATOM   7523  N N    . TRP A 1 51 ? -4.130  -9.538  0.767   1.00 0.07 ? 51  TRP A N    6  
ATOM   7524  C CA   . TRP A 1 51 ? -4.143  -8.583  -0.335  1.00 0.06 ? 51  TRP A CA   6  
ATOM   7525  C C    . TRP A 1 51 ? -5.410  -8.734  -1.170  1.00 0.06 ? 51  TRP A C    6  
ATOM   7526  O O    . TRP A 1 51 ? -5.797  -7.820  -1.898  1.00 0.06 ? 51  TRP A O    6  
ATOM   7527  C CB   . TRP A 1 51 ? -2.910  -8.775  -1.217  1.00 0.07 ? 51  TRP A CB   6  
ATOM   7528  C CG   . TRP A 1 51 ? -1.634  -8.350  -0.555  1.00 0.08 ? 51  TRP A CG   6  
ATOM   7529  C CD1  . TRP A 1 51 ? -1.506  -7.511  0.515   1.00 0.08 ? 51  TRP A CD1  6  
ATOM   7530  C CD2  . TRP A 1 51 ? -0.307  -8.745  -0.920  1.00 0.09 ? 51  TRP A CD2  6  
ATOM   7531  N NE1  . TRP A 1 51 ? -0.178  -7.361  0.838   1.00 0.09 ? 51  TRP A NE1  6  
ATOM   7532  C CE2  . TRP A 1 51 ? 0.578   -8.108  -0.027  1.00 0.10 ? 51  TRP A CE2  6  
ATOM   7533  C CE3  . TRP A 1 51 ? 0.221   -9.575  -1.912  1.00 0.09 ? 51  TRP A CE3  6  
ATOM   7534  C CZ2  . TRP A 1 51 ? 1.958   -8.274  -0.101  1.00 0.11 ? 51  TRP A CZ2  6  
ATOM   7535  C CZ3  . TRP A 1 51 ? 1.591   -9.739  -1.983  1.00 0.11 ? 51  TRP A CZ3  6  
ATOM   7536  C CH2  . TRP A 1 51 ? 2.446   -9.092  -1.082  1.00 0.11 ? 51  TRP A CH2  6  
ATOM   7537  H H    . TRP A 1 51 ? -3.498  -10.286 0.743   1.00 0.07 ? 51  TRP A H    6  
ATOM   7538  H HA   . TRP A 1 51 ? -4.122  -7.590  0.086   1.00 0.06 ? 51  TRP A HA   6  
ATOM   7539  H HB2  . TRP A 1 51 ? -2.820  -9.818  -1.477  1.00 0.07 ? 51  TRP A HB2  6  
ATOM   7540  H HB3  . TRP A 1 51 ? -3.028  -8.193  -2.120  1.00 0.07 ? 51  TRP A HB3  6  
ATOM   7541  H HD1  . TRP A 1 51 ? -2.335  -7.042  1.023   1.00 0.07 ? 51  TRP A HD1  6  
ATOM   7542  H HE1  . TRP A 1 51 ? 0.170   -6.810  1.569   1.00 0.09 ? 51  TRP A HE1  6  
ATOM   7543  H HE3  . TRP A 1 51 ? -0.422  -10.081 -2.616  1.00 0.09 ? 51  TRP A HE3  6  
ATOM   7544  H HZ2  . TRP A 1 51 ? 2.629   -7.784  0.587   1.00 0.11 ? 51  TRP A HZ2  6  
ATOM   7545  H HZ3  . TRP A 1 51 ? 2.016   -10.378 -2.744  1.00 0.11 ? 51  TRP A HZ3  6  
ATOM   7546  H HH2  . TRP A 1 51 ? 3.510   -9.250  -1.176  1.00 0.12 ? 51  TRP A HH2  6  
ATOM   7547  N N    . ASP A 1 52 ? -6.050  -9.892  -1.063  1.00 0.06 ? 52  ASP A N    6  
ATOM   7548  C CA   . ASP A 1 52 ? -7.274  -10.163 -1.808  1.00 0.07 ? 52  ASP A CA   6  
ATOM   7549  C C    . ASP A 1 52 ? -8.393  -9.221  -1.375  1.00 0.06 ? 52  ASP A C    6  
ATOM   7550  O O    . ASP A 1 52 ? -8.934  -8.451  -2.168  1.00 0.06 ? 52  ASP A O    6  
ATOM   7551  C CB   . ASP A 1 52 ? -7.708  -11.615 -1.610  1.00 0.07 ? 52  ASP A CB   6  
ATOM   7552  C CG   . ASP A 1 52 ? -7.293  -12.507 -2.764  1.00 0.08 ? 52  ASP A CG   6  
ATOM   7553  O OD1  . ASP A 1 52 ? -8.063  -13.430 -3.109  1.00 0.09 ? 52  ASP A OD1  6  
ATOM   7554  O OD2  . ASP A 1 52 ? -6.201  -12.281 -3.325  1.00 0.08 ? 52  ASP A OD2  6  
ATOM   7555  H H    . ASP A 1 52 ? -5.691  -10.583 -0.468  1.00 0.06 ? 52  ASP A H    6  
ATOM   7556  H HA   . ASP A 1 52 ? -7.067  -9.999  -2.855  1.00 0.07 ? 52  ASP A HA   6  
ATOM   7557  H HB2  . ASP A 1 52 ? -7.259  -11.998 -0.706  1.00 0.07 ? 52  ASP A HB2  6  
ATOM   7558  H HB3  . ASP A 1 52 ? -8.784  -11.653 -1.517  1.00 0.08 ? 52  ASP A HB3  6  
ATOM   7559  N N    . PRO A 1 53 ? -8.752  -9.283  -0.082  1.00 0.06 ? 53  PRO A N    6  
ATOM   7560  C CA   . PRO A 1 53 ? -9.810  -8.443  0.486   1.00 0.06 ? 53  PRO A CA   6  
ATOM   7561  C C    . PRO A 1 53 ? -9.406  -6.975  0.567   1.00 0.05 ? 53  PRO A C    6  
ATOM   7562  O O    . PRO A 1 53 ? -10.224 -6.115  0.889   1.00 0.06 ? 53  PRO A O    6  
ATOM   7563  C CB   . PRO A 1 53 ? -10.008 -9.024  1.888   1.00 0.06 ? 53  PRO A CB   6  
ATOM   7564  C CG   . PRO A 1 53 ? -8.704  -9.662  2.220   1.00 0.06 ? 53  PRO A CG   6  
ATOM   7565  C CD   . PRO A 1 53 ? -8.151  -10.177 0.921   1.00 0.06 ? 53  PRO A CD   6  
ATOM   7566  H HA   . PRO A 1 53 ? -10.728 -8.531  -0.077  1.00 0.07 ? 53  PRO A HA   6  
ATOM   7567  H HB2  . PRO A 1 53 ? -10.244 -8.230  2.586   1.00 0.06 ? 53  PRO A HB2  6  
ATOM   7568  H HB3  . PRO A 1 53 ? -10.792 -9.763  1.879   1.00 0.07 ? 53  PRO A HB3  6  
ATOM   7569  H HG2  . PRO A 1 53 ? -8.036  -8.928  2.652   1.00 0.06 ? 53  PRO A HG2  6  
ATOM   7570  H HG3  . PRO A 1 53 ? -8.857  -10.481 2.905   1.00 0.07 ? 53  PRO A HG3  6  
ATOM   7571  H HD2  . PRO A 1 53 ? -7.074  -10.102 0.910   1.00 0.06 ? 53  PRO A HD2  6  
ATOM   7572  H HD3  . PRO A 1 53 ? -8.462  -11.199 0.760   1.00 0.07 ? 53  PRO A HD3  6  
ATOM   7573  N N    . ILE A 1 54 ? -8.139  -6.700  0.274   1.00 0.05 ? 54  ILE A N    6  
ATOM   7574  C CA   . ILE A 1 54 ? -7.627  -5.336  0.314   1.00 0.05 ? 54  ILE A CA   6  
ATOM   7575  C C    . ILE A 1 54 ? -7.484  -4.761  -1.092  1.00 0.05 ? 54  ILE A C    6  
ATOM   7576  O O    . ILE A 1 54 ? -7.441  -3.544  -1.277  1.00 0.05 ? 54  ILE A O    6  
ATOM   7577  C CB   . ILE A 1 54 ? -6.264  -5.267  1.025   1.00 0.05 ? 54  ILE A CB   6  
ATOM   7578  C CG1  . ILE A 1 54 ? -6.396  -5.734  2.475   1.00 0.05 ? 54  ILE A CG1  6  
ATOM   7579  C CG2  . ILE A 1 54 ? -5.706  -3.852  0.966   1.00 0.05 ? 54  ILE A CG2  6  
ATOM   7580  C CD1  . ILE A 1 54 ? -5.068  -5.994  3.151   1.00 0.06 ? 54  ILE A CD1  6  
ATOM   7581  H H    . ILE A 1 54 ? -7.535  -7.431  0.026   1.00 0.05 ? 54  ILE A H    6  
ATOM   7582  H HA   . ILE A 1 54 ? -8.331  -4.733  0.868   1.00 0.05 ? 54  ILE A HA   6  
ATOM   7583  H HB   . ILE A 1 54 ? -5.578  -5.919  0.506   1.00 0.05 ? 54  ILE A HB   6  
ATOM   7584  H HG12 . ILE A 1 54 ? -6.913  -4.977  3.045   1.00 0.06 ? 54  ILE A HG12 6  
ATOM   7585  H HG13 . ILE A 1 54 ? -6.968  -6.650  2.501   1.00 0.05 ? 54  ILE A HG13 6  
ATOM   7586  H HG21 . ILE A 1 54 ? -4.813  -3.791  1.570   1.00 0.06 ? 54  ILE A HG21 6  
ATOM   7587  H HG22 . ILE A 1 54 ? -6.444  -3.162  1.341   1.00 0.05 ? 54  ILE A HG22 6  
ATOM   7588  H HG23 . ILE A 1 54 ? -5.466  -3.603  -0.057  1.00 0.06 ? 54  ILE A HG23 6  
ATOM   7589  H HD11 . ILE A 1 54 ? -5.240  -6.392  4.141   1.00 0.07 ? 54  ILE A HD11 6  
ATOM   7590  H HD12 . ILE A 1 54 ? -4.515  -5.070  3.227   1.00 0.07 ? 54  ILE A HD12 6  
ATOM   7591  H HD13 . ILE A 1 54 ? -4.502  -6.708  2.570   1.00 0.06 ? 54  ILE A HD13 6  
ATOM   7592  N N    . THR A 1 55 ? -7.413  -5.645  -2.083  1.00 0.06 ? 55  THR A N    6  
ATOM   7593  C CA   . THR A 1 55 ? -7.276  -5.228  -3.471  1.00 0.06 ? 55  THR A CA   6  
ATOM   7594  C C    . THR A 1 55 ? -8.639  -5.076  -4.137  1.00 0.07 ? 55  THR A C    6  
ATOM   7595  O O    . THR A 1 55 ? -8.851  -4.164  -4.937  1.00 0.08 ? 55  THR A O    6  
ATOM   7596  C CB   . THR A 1 55 ? -6.432  -6.231  -4.279  1.00 0.07 ? 55  THR A CB   6  
ATOM   7597  O OG1  . THR A 1 55 ? -5.080  -6.224  -3.811  1.00 0.07 ? 55  THR A OG1  6  
ATOM   7598  C CG2  . THR A 1 55 ? -6.462  -5.892  -5.762  1.00 0.08 ? 55  THR A CG2  6  
ATOM   7599  H H    . THR A 1 55 ? -7.452  -6.602  -1.874  1.00 0.06 ? 55  THR A H    6  
ATOM   7600  H HA   . THR A 1 55 ? -6.772  -4.273  -3.483  1.00 0.07 ? 55  THR A HA   6  
ATOM   7601  H HB   . THR A 1 55 ? -6.848  -7.219  -4.142  1.00 0.07 ? 55  THR A HB   6  
ATOM   7602  H HG1  . THR A 1 55 ? -4.494  -5.975  -4.528  1.00 0.08 ? 55  THR A HG1  6  
ATOM   7603  H HG21 . THR A 1 55 ? -7.482  -5.919  -6.117  1.00 0.09 ? 55  THR A HG21 6  
ATOM   7604  H HG22 . THR A 1 55 ? -5.872  -6.614  -6.309  1.00 0.09 ? 55  THR A HG22 6  
ATOM   7605  H HG23 . THR A 1 55 ? -6.054  -4.904  -5.914  1.00 0.08 ? 55  THR A HG23 6  
ATOM   7606  N N    . ALA A 1 56 ? -9.561  -5.972  -3.801  1.00 0.07 ? 56  ALA A N    6  
ATOM   7607  C CA   . ALA A 1 56 ? -10.904 -5.934  -4.364  1.00 0.08 ? 56  ALA A CA   6  
ATOM   7608  C C    . ALA A 1 56 ? -11.685 -4.731  -3.845  1.00 0.08 ? 56  ALA A C    6  
ATOM   7609  O O    . ALA A 1 56 ? -12.418 -4.085  -4.592  1.00 0.09 ? 56  ALA A O    6  
ATOM   7610  C CB   . ALA A 1 56 ? -11.646 -7.224  -4.043  1.00 0.08 ? 56  ALA A CB   6  
ATOM   7611  H H    . ALA A 1 56 ? -9.331  -6.676  -3.158  1.00 0.07 ? 56  ALA A H    6  
ATOM   7612  H HA   . ALA A 1 56 ? -10.814 -5.856  -5.437  1.00 0.09 ? 56  ALA A HA   6  
ATOM   7613  H HB1  . ALA A 1 56 ? -12.620 -7.204  -4.511  1.00 0.09 ? 56  ALA A HB1  6  
ATOM   7614  H HB2  . ALA A 1 56 ? -11.764 -7.315  -2.974  1.00 0.08 ? 56  ALA A HB2  6  
ATOM   7615  H HB3  . ALA A 1 56 ? -11.083 -8.066  -4.417  1.00 0.09 ? 56  ALA A HB3  6  
ATOM   7616  N N    . ALA A 1 57 ? -11.520 -4.434  -2.559  1.00 0.07 ? 57  ALA A N    6  
ATOM   7617  C CA   . ALA A 1 57 ? -12.207 -3.308  -1.941  1.00 0.07 ? 57  ALA A CA   6  
ATOM   7618  C C    . ALA A 1 57 ? -11.800 -1.992  -2.593  1.00 0.07 ? 57  ALA A C    6  
ATOM   7619  O O    . ALA A 1 57 ? -12.647 -1.236  -3.073  1.00 0.08 ? 57  ALA A O    6  
ATOM   7620  C CB   . ALA A 1 57 ? -11.921 -3.270  -0.447  1.00 0.06 ? 57  ALA A CB   6  
ATOM   7621  H H    . ALA A 1 57 ? -10.923 -4.988  -2.013  1.00 0.07 ? 57  ALA A H    6  
ATOM   7622  H HA   . ALA A 1 57 ? -13.270 -3.451  -2.076  1.00 0.08 ? 57  ALA A HA   6  
ATOM   7623  H HB1  . ALA A 1 57 ? -12.213 -4.209  -0.001  1.00 0.07 ? 57  ALA A HB1  6  
ATOM   7624  H HB2  . ALA A 1 57 ? -12.480 -2.466  0.007   1.00 0.07 ? 57  ALA A HB2  6  
ATOM   7625  H HB3  . ALA A 1 57 ? -10.865 -3.108  -0.287  1.00 0.06 ? 57  ALA A HB3  6  
ATOM   7626  N N    . LEU A 1 58 ? -10.499 -1.721  -2.605  1.00 0.07 ? 58  LEU A N    6  
ATOM   7627  C CA   . LEU A 1 58 ? -9.980  -0.493  -3.199  1.00 0.08 ? 58  LEU A CA   6  
ATOM   7628  C C    . LEU A 1 58 ? -10.426 -0.360  -4.651  1.00 0.09 ? 58  LEU A C    6  
ATOM   7629  O O    . LEU A 1 58 ? -10.818 0.721   -5.093  1.00 0.09 ? 58  LEU A O    6  
ATOM   7630  C CB   . LEU A 1 58 ? -8.452  -0.473  -3.119  1.00 0.07 ? 58  LEU A CB   6  
ATOM   7631  C CG   . LEU A 1 58 ? -7.856  -0.255  -1.729  1.00 0.07 ? 58  LEU A CG   6  
ATOM   7632  C CD1  . LEU A 1 58 ? -6.388  -0.652  -1.709  1.00 0.07 ? 58  LEU A CD1  6  
ATOM   7633  C CD2  . LEU A 1 58 ? -8.025  1.194   -1.296  1.00 0.07 ? 58  LEU A CD2  6  
ATOM   7634  H H    . LEU A 1 58 ? -9.874  -2.361  -2.207  1.00 0.06 ? 58  LEU A H    6  
ATOM   7635  H HA   . LEU A 1 58 ? -10.372 0.339   -2.636  1.00 0.08 ? 58  LEU A HA   6  
ATOM   7636  H HB2  . LEU A 1 58 ? -8.084  -1.415  -3.499  1.00 0.07 ? 58  LEU A HB2  6  
ATOM   7637  H HB3  . LEU A 1 58 ? -8.094  0.316   -3.763  1.00 0.08 ? 58  LEU A HB3  6  
ATOM   7638  H HG   . LEU A 1 58 ? -8.378  -0.880  -1.019  1.00 0.06 ? 58  LEU A HG   6  
ATOM   7639  H HD11 . LEU A 1 58 ? -5.954  -0.383  -0.758  1.00 0.07 ? 58  LEU A HD11 6  
ATOM   7640  H HD12 . LEU A 1 58 ? -5.866  -0.139  -2.502  1.00 0.08 ? 58  LEU A HD12 6  
ATOM   7641  H HD13 . LEU A 1 58 ? -6.301  -1.720  -1.853  1.00 0.06 ? 58  LEU A HD13 6  
ATOM   7642  H HD21 . LEU A 1 58 ? -9.073  1.403   -1.140  1.00 0.07 ? 58  LEU A HD21 6  
ATOM   7643  H HD22 . LEU A 1 58 ? -7.637  1.847   -2.064  1.00 0.08 ? 58  LEU A HD22 6  
ATOM   7644  H HD23 . LEU A 1 58 ? -7.484  1.360   -0.375  1.00 0.07 ? 58  LEU A HD23 6  
ATOM   7645  N N    . SER A 1 59 ? -10.365 -1.464  -5.389  1.00 0.09 ? 59  SER A N    6  
ATOM   7646  C CA   . SER A 1 59 ? -10.762 -1.470  -6.793  1.00 0.10 ? 59  SER A CA   6  
ATOM   7647  C C    . SER A 1 59 ? -12.278 -1.374  -6.928  1.00 0.11 ? 59  SER A C    6  
ATOM   7648  O O    . SER A 1 59 ? -12.795 -0.996  -7.980  1.00 0.12 ? 59  SER A O    6  
ATOM   7649  C CB   . SER A 1 59 ? -10.254 -2.737  -7.482  1.00 0.10 ? 59  SER A CB   6  
ATOM   7650  O OG   . SER A 1 59 ? -10.875 -2.914  -8.744  1.00 0.12 ? 59  SER A OG   6  
ATOM   7651  H H    . SER A 1 59 ? -10.045 -2.295  -4.979  1.00 0.08 ? 59  SER A H    6  
ATOM   7652  H HA   . SER A 1 59 ? -10.317 -0.609  -7.267  1.00 0.11 ? 59  SER A HA   6  
ATOM   7653  H HB2  . SER A 1 59 ? -9.187  -2.663  -7.629  1.00 0.10 ? 59  SER A HB2  6  
ATOM   7654  H HB3  . SER A 1 59 ? -10.474 -3.595  -6.863  1.00 0.10 ? 59  SER A HB3  6  
ATOM   7655  H HG   . SER A 1 59 ? -10.209 -2.898  -9.434  1.00 0.12 ? 59  SER A HG   6  
ATOM   7656  N N    . GLN A 1 60 ? -12.986 -1.721  -5.856  1.00 0.10 ? 60  GLN A N    6  
ATOM   7657  C CA   . GLN A 1 60 ? -14.442 -1.676  -5.857  1.00 0.11 ? 60  GLN A CA   6  
ATOM   7658  C C    . GLN A 1 60 ? -14.944 -0.258  -5.604  1.00 0.11 ? 60  GLN A C    6  
ATOM   7659  O O    . GLN A 1 60 ? -15.886 0.202   -6.251  1.00 0.13 ? 60  GLN A O    6  
ATOM   7660  C CB   . GLN A 1 60 ? -15.003 -2.624  -4.796  1.00 0.11 ? 60  GLN A CB   6  
ATOM   7661  C CG   . GLN A 1 60 ? -16.519 -2.586  -4.684  1.00 0.12 ? 60  GLN A CG   6  
ATOM   7662  C CD   . GLN A 1 60 ? -17.035 -3.326  -3.466  1.00 0.12 ? 60  GLN A CD   6  
ATOM   7663  O OE1  . GLN A 1 60 ? -17.916 -4.179  -3.571  1.00 0.12 ? 60  GLN A OE1  6  
ATOM   7664  N NE2  . GLN A 1 60 ? -16.486 -3.003  -2.301  1.00 0.11 ? 60  GLN A NE2  6  
ATOM   7665  H H    . GLN A 1 60 ? -12.516 -2.015  -5.048  1.00 0.09 ? 60  GLN A H    6  
ATOM   7666  H HA   . GLN A 1 60 ? -14.784 -1.998  -6.829  1.00 0.12 ? 60  GLN A HA   6  
ATOM   7667  H HB2  . GLN A 1 60 ? -14.706 -3.634  -5.039  1.00 0.11 ? 60  GLN A HB2  6  
ATOM   7668  H HB3  . GLN A 1 60 ? -14.586 -2.357  -3.836  1.00 0.10 ? 60  GLN A HB3  6  
ATOM   7669  H HG2  . GLN A 1 60 ? -16.836 -1.556  -4.621  1.00 0.12 ? 60  GLN A HG2  6  
ATOM   7670  H HG3  . GLN A 1 60 ? -16.944 -3.038  -5.569  1.00 0.13 ? 60  GLN A HG3  6  
ATOM   7671  H HE21 . GLN A 1 60 ? -15.788 -2.315  -2.293  1.00 0.10 ? 60  GLN A HE21 6  
ATOM   7672  H HE22 . GLN A 1 60 ? -16.800 -3.466  -1.497  1.00 0.11 ? 60  GLN A HE22 6  
ATOM   7673  N N    . ARG A 1 61 ? -14.309 0.429   -4.661  1.00 0.11 ? 61  ARG A N    6  
ATOM   7674  C CA   . ARG A 1 61 ? -14.692 1.795   -4.322  1.00 0.11 ? 61  ARG A CA   6  
ATOM   7675  C C    . ARG A 1 61 ? -14.318 2.758   -5.443  1.00 0.12 ? 61  ARG A C    6  
ATOM   7676  O O    . ARG A 1 61 ? -15.018 3.739   -5.693  1.00 0.13 ? 61  ARG A O    6  
ATOM   7677  C CB   . ARG A 1 61 ? -14.017 2.227   -3.020  1.00 0.10 ? 61  ARG A CB   6  
ATOM   7678  C CG   . ARG A 1 61 ? -12.630 2.816   -3.215  1.00 0.10 ? 61  ARG A CG   6  
ATOM   7679  C CD   . ARG A 1 61 ? -11.982 3.171   -1.888  1.00 0.09 ? 61  ARG A CD   6  
ATOM   7680  N NE   . ARG A 1 61 ? -11.592 4.577   -1.827  1.00 0.10 ? 61  ARG A NE   6  
ATOM   7681  C CZ   . ARG A 1 61 ? -11.180 5.178   -0.716  1.00 0.09 ? 61  ARG A CZ   6  
ATOM   7682  N NH1  . ARG A 1 61 ? -11.104 4.498   0.420   1.00 0.09 ? 61  ARG A NH1  6  
ATOM   7683  N NH2  . ARG A 1 61 ? -10.844 6.460   -0.740  1.00 0.10 ? 61  ARG A NH2  6  
ATOM   7684  H H    . ARG A 1 61 ? -13.567 0.007   -4.179  1.00 0.10 ? 61  ARG A H    6  
ATOM   7685  H HA   . ARG A 1 61 ? -15.762 1.815   -4.188  1.00 0.12 ? 61  ARG A HA   6  
ATOM   7686  H HB2  . ARG A 1 61 ? -14.635 2.971   -2.538  1.00 0.10 ? 61  ARG A HB2  6  
ATOM   7687  H HB3  . ARG A 1 61 ? -13.931 1.367   -2.370  1.00 0.09 ? 61  ARG A HB3  6  
ATOM   7688  H HG2  . ARG A 1 61 ? -12.012 2.093   -3.726  1.00 0.09 ? 61  ARG A HG2  6  
ATOM   7689  H HG3  . ARG A 1 61 ? -12.712 3.709   -3.817  1.00 0.10 ? 61  ARG A HG3  6  
ATOM   7690  H HD2  . ARG A 1 61 ? -12.683 2.967   -1.092  1.00 0.09 ? 61  ARG A HD2  6  
ATOM   7691  H HD3  . ARG A 1 61 ? -11.102 2.557   -1.756  1.00 0.08 ? 61  ARG A HD3  6  
ATOM   7692  H HE   . ARG A 1 61 ? -11.640 5.099   -2.655  1.00 0.10 ? 61  ARG A HE   6  
ATOM   7693  H HH11 . ARG A 1 61 ? -10.793 4.952   1.255   1.00 0.09 ? 61  ARG A HH11 6  
ATOM   7694  H HH12 . ARG A 1 61 ? -11.357 3.531   0.443   1.00 0.08 ? 61  ARG A HH12 6  
ATOM   7695  H HH21 . ARG A 1 61 ? -10.899 6.976   -1.593  1.00 0.11 ? 61  ARG A HH21 6  
ATOM   7696  H HH22 . ARG A 1 61 ? -10.531 6.911   0.097   1.00 0.10 ? 61  ARG A HH22 6  
ATOM   7697  N N    . ALA A 1 62 ? -13.209 2.472   -6.119  1.00 0.12 ? 62  ALA A N    6  
ATOM   7698  C CA   . ALA A 1 62 ? -12.743 3.312   -7.215  1.00 0.13 ? 62  ALA A CA   6  
ATOM   7699  C C    . ALA A 1 62 ? -13.647 3.174   -8.434  1.00 0.14 ? 62  ALA A C    6  
ATOM   7700  O O    . ALA A 1 62 ? -14.019 4.167   -9.059  1.00 0.15 ? 62  ALA A O    6  
ATOM   7701  C CB   . ALA A 1 62 ? -11.308 2.959   -7.578  1.00 0.12 ? 62  ALA A CB   6  
ATOM   7702  H H    . ALA A 1 62 ? -12.693 1.676   -5.873  1.00 0.11 ? 62  ALA A H    6  
ATOM   7703  H HA   . ALA A 1 62 ? -12.762 4.339   -6.880  1.00 0.13 ? 62  ALA A HA   6  
ATOM   7704  H HB1  . ALA A 1 62 ? -11.264 1.934   -7.914  1.00 0.12 ? 62  ALA A HB1  6  
ATOM   7705  H HB2  . ALA A 1 62 ? -10.678 3.081   -6.709  1.00 0.11 ? 62  ALA A HB2  6  
ATOM   7706  H HB3  . ALA A 1 62 ? -10.965 3.612   -8.366  1.00 0.13 ? 62  ALA A HB3  6  
ATOM   7707  N N    . MET A 1 63 ? -13.998 1.936   -8.769  1.00 0.14 ? 63  MET A N    6  
ATOM   7708  C CA   . MET A 1 63 ? -14.860 1.669   -9.915  1.00 0.15 ? 63  MET A CA   6  
ATOM   7709  C C    . MET A 1 63 ? -16.279 2.168   -9.656  1.00 0.16 ? 63  MET A C    6  
ATOM   7710  O O    . MET A 1 63 ? -16.970 2.606   -10.575 1.00 0.17 ? 63  MET A O    6  
ATOM   7711  C CB   . MET A 1 63 ? -14.883 0.172   -10.224 1.00 0.15 ? 63  MET A CB   6  
ATOM   7712  C CG   . MET A 1 63 ? -15.663 -0.648  -9.210  1.00 0.15 ? 63  MET A CG   6  
ATOM   7713  S SD   . MET A 1 63 ? -15.832 -2.376  -9.696  1.00 0.15 ? 63  MET A SD   6  
ATOM   7714  C CE   . MET A 1 63 ? -14.116 -2.888  -9.724  1.00 0.14 ? 63  MET A CE   6  
ATOM   7715  H H    . MET A 1 63 ? -13.670 1.184   -8.232  1.00 0.13 ? 63  MET A H    6  
ATOM   7716  H HA   . MET A 1 63 ? -14.454 2.197   -10.764 1.00 0.16 ? 63  MET A HA   6  
ATOM   7717  H HB2  . MET A 1 63 ? -15.330 0.023   -11.195 1.00 0.16 ? 63  MET A HB2  6  
ATOM   7718  H HB3  . MET A 1 63 ? -13.867 -0.194  -10.245 1.00 0.15 ? 63  MET A HB3  6  
ATOM   7719  H HG2  . MET A 1 63 ? -15.151 -0.603  -8.261  1.00 0.14 ? 63  MET A HG2  6  
ATOM   7720  H HG3  . MET A 1 63 ? -16.648 -0.219  -9.106  1.00 0.15 ? 63  MET A HG3  6  
ATOM   7721  H HE1  . MET A 1 63 ? -13.606 -2.389  -10.534 1.00 0.15 ? 63  MET A HE1  6  
ATOM   7722  H HE2  . MET A 1 63 ? -14.061 -3.957  -9.868  1.00 0.14 ? 63  MET A HE2  6  
ATOM   7723  H HE3  . MET A 1 63 ? -13.646 -2.626  -8.788  1.00 0.13 ? 63  MET A HE3  6  
ATOM   7724  N N    . ILE A 1 64 ? -16.704 2.101   -8.399  1.00 0.15 ? 64  ILE A N    6  
ATOM   7725  C CA   . ILE A 1 64 ? -18.040 2.546   -8.021  1.00 0.16 ? 64  ILE A CA   6  
ATOM   7726  C C    . ILE A 1 64 ? -18.058 4.042   -7.729  1.00 0.16 ? 64  ILE A C    6  
ATOM   7727  O O    . ILE A 1 64 ? -18.551 4.837   -8.531  1.00 0.17 ? 64  ILE A O    6  
ATOM   7728  C CB   . ILE A 1 64 ? -18.558 1.787   -6.785  1.00 0.15 ? 64  ILE A CB   6  
ATOM   7729  C CG1  . ILE A 1 64 ? -18.716 0.299   -7.103  1.00 0.15 ? 64  ILE A CG1  6  
ATOM   7730  C CG2  . ILE A 1 64 ? -19.879 2.376   -6.317  1.00 0.16 ? 64  ILE A CG2  6  
ATOM   7731  C CD1  . ILE A 1 64 ? -19.120 -0.536  -5.908  1.00 0.15 ? 64  ILE A CD1  6  
ATOM   7732  H H    . ILE A 1 64 ? -16.106 1.742   -7.710  1.00 0.14 ? 64  ILE A H    6  
ATOM   7733  H HA   . ILE A 1 64 ? -18.706 2.342   -8.847  1.00 0.17 ? 64  ILE A HA   6  
ATOM   7734  H HB   . ILE A 1 64 ? -17.838 1.904   -5.990  1.00 0.14 ? 64  ILE A HB   6  
ATOM   7735  H HG12 . ILE A 1 64 ? -19.474 0.177   -7.862  1.00 0.16 ? 64  ILE A HG12 6  
ATOM   7736  H HG13 . ILE A 1 64 ? -17.778 -0.085  -7.473  1.00 0.15 ? 64  ILE A HG13 6  
ATOM   7737  H HG21 . ILE A 1 64 ? -20.211 1.857   -5.430  1.00 0.15 ? 64  ILE A HG21 6  
ATOM   7738  H HG22 . ILE A 1 64 ? -20.619 2.264   -7.096  1.00 0.17 ? 64  ILE A HG22 6  
ATOM   7739  H HG23 . ILE A 1 64 ? -19.747 3.424   -6.094  1.00 0.16 ? 64  ILE A HG23 6  
ATOM   7740  H HD11 . ILE A 1 64 ? -20.139 -0.306  -5.637  1.00 0.15 ? 64  ILE A HD11 6  
ATOM   7741  H HD12 . ILE A 1 64 ? -18.468 -0.312  -5.077  1.00 0.14 ? 64  ILE A HD12 6  
ATOM   7742  H HD13 . ILE A 1 64 ? -19.041 -1.583  -6.157  1.00 0.15 ? 64  ILE A HD13 6  
ATOM   7743  N N    . LEU A 1 65 ? -17.517 4.420   -6.575  1.00 0.15 ? 65  LEU A N    6  
ATOM   7744  C CA   . LEU A 1 65 ? -17.468 5.822   -6.176  1.00 0.15 ? 65  LEU A CA   6  
ATOM   7745  C C    . LEU A 1 65 ? -16.868 6.684   -7.283  1.00 0.16 ? 65  LEU A C    6  
ATOM   7746  O O    . LEU A 1 65 ? -17.314 7.803   -7.524  1.00 0.16 ? 65  LEU A O    6  
ATOM   7747  C CB   . LEU A 1 65 ? -16.652 5.979   -4.891  1.00 0.14 ? 65  LEU A CB   6  
ATOM   7748  C CG   . LEU A 1 65 ? -17.269 6.867   -3.809  1.00 0.14 ? 65  LEU A CG   6  
ATOM   7749  C CD1  . LEU A 1 65 ? -18.173 6.048   -2.901  1.00 0.14 ? 65  LEU A CD1  6  
ATOM   7750  C CD2  . LEU A 1 65 ? -16.180 7.555   -3.000  1.00 0.13 ? 65  LEU A CD2  6  
ATOM   7751  H H    . LEU A 1 65 ? -17.139 3.741   -5.979  1.00 0.14 ? 65  LEU A H    6  
ATOM   7752  H HA   . LEU A 1 65 ? -18.480 6.150   -5.991  1.00 0.16 ? 65  LEU A HA   6  
ATOM   7753  H HB2  . LEU A 1 65 ? -16.497 4.996   -4.472  1.00 0.13 ? 65  LEU A HB2  6  
ATOM   7754  H HB3  . LEU A 1 65 ? -15.689 6.391   -5.155  1.00 0.14 ? 65  LEU A HB3  6  
ATOM   7755  H HG   . LEU A 1 65 ? -17.871 7.630   -4.279  1.00 0.15 ? 65  LEU A HG   6  
ATOM   7756  H HD11 . LEU A 1 65 ? -17.585 5.303   -2.385  1.00 0.13 ? 65  LEU A HD11 6  
ATOM   7757  H HD12 . LEU A 1 65 ? -18.931 5.559   -3.494  1.00 0.14 ? 65  LEU A HD12 6  
ATOM   7758  H HD13 . LEU A 1 65 ? -18.644 6.699   -2.179  1.00 0.14 ? 65  LEU A HD13 6  
ATOM   7759  H HD21 . LEU A 1 65 ? -15.664 8.269   -3.626  1.00 0.14 ? 65  LEU A HD21 6  
ATOM   7760  H HD22 . LEU A 1 65 ? -15.477 6.818   -2.642  1.00 0.13 ? 65  LEU A HD22 6  
ATOM   7761  H HD23 . LEU A 1 65 ? -16.624 8.068   -2.161  1.00 0.14 ? 65  LEU A HD23 6  
ATOM   7762  N N    . GLY A 1 66 ? -15.852 6.148   -7.956  1.00 0.15 ? 66  GLY A N    6  
ATOM   7763  C CA   . GLY A 1 66 ? -15.208 6.881   -9.030  1.00 0.16 ? 66  GLY A CA   6  
ATOM   7764  C C    . GLY A 1 66 ? -13.987 7.646   -8.561  1.00 0.16 ? 66  GLY A C    6  
ATOM   7765  O O    . GLY A 1 66 ? -13.787 8.802   -8.936  1.00 0.16 ? 66  GLY A O    6  
ATOM   7766  H H    . GLY A 1 66 ? -15.540 5.249   -7.722  1.00 0.15 ? 66  GLY A H    6  
ATOM   7767  H HA2  . GLY A 1 66 ? -14.908 6.183   -9.798  1.00 0.16 ? 66  GLY A HA2  6  
ATOM   7768  H HA3  . GLY A 1 66 ? -15.916 7.579   -9.450  1.00 0.17 ? 66  GLY A HA3  6  
ATOM   7769  N N    . LYS A 1 67 ? -13.168 7.001   -7.736  1.00 0.15 ? 67  LYS A N    6  
ATOM   7770  C CA   . LYS A 1 67 ? -11.960 7.628   -7.213  1.00 0.14 ? 67  LYS A CA   6  
ATOM   7771  C C    . LYS A 1 67 ? -10.991 6.579   -6.677  1.00 0.13 ? 67  LYS A C    6  
ATOM   7772  O O    . LYS A 1 67 ? -11.339 5.788   -5.802  1.00 0.12 ? 67  LYS A O    6  
ATOM   7773  C CB   . LYS A 1 67 ? -12.316 8.621   -6.103  1.00 0.14 ? 67  LYS A CB   6  
ATOM   7774  C CG   . LYS A 1 67 ? -13.007 7.981   -4.913  1.00 0.13 ? 67  LYS A CG   6  
ATOM   7775  C CD   . LYS A 1 67 ? -12.046 7.780   -3.753  1.00 0.12 ? 67  LYS A CD   6  
ATOM   7776  C CE   . LYS A 1 67 ? -12.104 8.941   -2.772  1.00 0.13 ? 67  LYS A CE   6  
ATOM   7777  N NZ   . LYS A 1 67 ? -11.947 10.254  -3.459  1.00 0.14 ? 67  LYS A NZ   6  
ATOM   7778  H H    . LYS A 1 67 ? -13.381 6.081   -7.474  1.00 0.14 ? 67  LYS A H    6  
ATOM   7779  H HA   . LYS A 1 67 ? -11.485 8.161   -8.023  1.00 0.15 ? 67  LYS A HA   6  
ATOM   7780  H HB2  . LYS A 1 67 ? -11.410 9.094   -5.756  1.00 0.14 ? 67  LYS A HB2  6  
ATOM   7781  H HB3  . LYS A 1 67 ? -12.972 9.377   -6.511  1.00 0.15 ? 67  LYS A HB3  6  
ATOM   7782  H HG2  . LYS A 1 67 ? -13.815 8.622   -4.591  1.00 0.14 ? 67  LYS A HG2  6  
ATOM   7783  H HG3  . LYS A 1 67 ? -13.404 7.022   -5.212  1.00 0.13 ? 67  LYS A HG3  6  
ATOM   7784  H HD2  . LYS A 1 67 ? -12.310 6.871   -3.234  1.00 0.12 ? 67  LYS A HD2  6  
ATOM   7785  H HD3  . LYS A 1 67 ? -11.041 7.697   -4.141  1.00 0.12 ? 67  LYS A HD3  6  
ATOM   7786  H HE2  . LYS A 1 67 ? -13.058 8.922   -2.265  1.00 0.13 ? 67  LYS A HE2  6  
ATOM   7787  H HE3  . LYS A 1 67 ? -11.311 8.825   -2.049  1.00 0.12 ? 67  LYS A HE3  6  
ATOM   7788  H HZ1  . LYS A 1 67 ? -12.703 10.383  -4.162  1.00 0.14 ? 67  LYS A HZ1  6  
ATOM   7789  H HZ2  . LYS A 1 67 ? -11.028 10.297  -3.943  1.00 0.14 ? 67  LYS A HZ2  6  
ATOM   7790  H HZ3  . LYS A 1 67 ? -11.998 11.028  -2.765  1.00 0.14 ? 67  LYS A HZ3  6  
ATOM   7791  N N    . SER A 1 68 ? -9.773  6.580   -7.211  1.00 0.13 ? 68  SER A N    6  
ATOM   7792  C CA   . SER A 1 68 ? -8.754  5.625   -6.789  1.00 0.13 ? 68  SER A CA   6  
ATOM   7793  C C    . SER A 1 68 ? -7.619  6.332   -6.056  1.00 0.13 ? 68  SER A C    6  
ATOM   7794  O O    . SER A 1 68 ? -6.445  6.022   -6.258  1.00 0.13 ? 68  SER A O    6  
ATOM   7795  C CB   . SER A 1 68 ? -8.203  4.868   -7.998  1.00 0.13 ? 68  SER A CB   6  
ATOM   7796  O OG   . SER A 1 68 ? -8.072  5.723   -9.119  1.00 0.14 ? 68  SER A OG   6  
ATOM   7797  H H    . SER A 1 68 ? -9.555  7.236   -7.906  1.00 0.14 ? 68  SER A H    6  
ATOM   7798  H HA   . SER A 1 68 ? -9.219  4.921   -6.115  1.00 0.12 ? 68  SER A HA   6  
ATOM   7799  H HB2  . SER A 1 68 ? -7.232  4.465   -7.754  1.00 0.13 ? 68  SER A HB2  6  
ATOM   7800  H HB3  . SER A 1 68 ? -8.873  4.060   -8.252  1.00 0.13 ? 68  SER A HB3  6  
ATOM   7801  H HG   . SER A 1 68 ? -8.323  5.249   -9.916  1.00 0.15 ? 68  SER A HG   6  
ATOM   7802  N N    . GLY A 1 69 ? -7.977  7.285   -5.201  1.00 0.13 ? 69  GLY A N    6  
ATOM   7803  C CA   . GLY A 1 69 ? -6.977  8.023   -4.450  1.00 0.13 ? 69  GLY A CA   6  
ATOM   7804  C C    . GLY A 1 69 ? -6.114  7.120   -3.593  1.00 0.12 ? 69  GLY A C    6  
ATOM   7805  O O    . GLY A 1 69 ? -4.991  7.479   -3.239  1.00 0.13 ? 69  GLY A O    6  
ATOM   7806  H H    . GLY A 1 69 ? -8.927  7.490   -5.080  1.00 0.13 ? 69  GLY A H    6  
ATOM   7807  H HA2  . GLY A 1 69 ? -6.344  8.557   -5.143  1.00 0.14 ? 69  GLY A HA2  6  
ATOM   7808  H HA3  . GLY A 1 69 ? -7.476  8.737   -3.812  1.00 0.13 ? 69  GLY A HA3  6  
ATOM   7809  N N    . GLU A 1 70 ? -6.639  5.946   -3.256  1.00 0.11 ? 70  GLU A N    6  
ATOM   7810  C CA   . GLU A 1 70 ? -5.909  4.990   -2.432  1.00 0.10 ? 70  GLU A CA   6  
ATOM   7811  C C    . GLU A 1 70 ? -5.425  3.810   -3.267  1.00 0.10 ? 70  GLU A C    6  
ATOM   7812  O O    . GLU A 1 70 ? -4.442  3.151   -2.923  1.00 0.10 ? 70  GLU A O    6  
ATOM   7813  C CB   . GLU A 1 70 ? -6.792  4.491   -1.286  1.00 0.09 ? 70  GLU A CB   6  
ATOM   7814  C CG   . GLU A 1 70 ? -6.546  5.209   0.030   1.00 0.10 ? 70  GLU A CG   6  
ATOM   7815  C CD   . GLU A 1 70 ? -7.260  6.543   0.110   1.00 0.10 ? 70  GLU A CD   6  
ATOM   7816  O OE1  . GLU A 1 70 ? -7.296  7.133   1.211   1.00 0.11 ? 70  GLU A OE1  6  
ATOM   7817  O OE2  . GLU A 1 70 ? -7.783  6.999   -0.928  1.00 0.11 ? 70  GLU A OE2  6  
ATOM   7818  H H    . GLU A 1 70 ? -7.539  5.719   -3.567  1.00 0.11 ? 70  GLU A H    6  
ATOM   7819  H HA   . GLU A 1 70 ? -5.050  5.498   -2.017  1.00 0.11 ? 70  GLU A HA   6  
ATOM   7820  H HB2  . GLU A 1 70 ? -7.828  4.629   -1.559  1.00 0.09 ? 70  GLU A HB2  6  
ATOM   7821  H HB3  . GLU A 1 70 ? -6.605  3.438   -1.136  1.00 0.09 ? 70  GLU A HB3  6  
ATOM   7822  H HG2  . GLU A 1 70 ? -6.894  4.583   0.837   1.00 0.09 ? 70  GLU A HG2  6  
ATOM   7823  H HG3  . GLU A 1 70 ? -5.486  5.379   0.139   1.00 0.10 ? 70  GLU A HG3  6  
ATOM   7824  N N    . LEU A 1 71 ? -6.122  3.546   -4.367  1.00 0.10 ? 71  LEU A N    6  
ATOM   7825  C CA   . LEU A 1 71 ? -5.763  2.444   -5.253  1.00 0.10 ? 71  LEU A CA   6  
ATOM   7826  C C    . LEU A 1 71 ? -4.385  2.663   -5.867  1.00 0.11 ? 71  LEU A C    6  
ATOM   7827  O O    . LEU A 1 71 ? -3.537  1.770   -5.852  1.00 0.11 ? 71  LEU A O    6  
ATOM   7828  C CB   . LEU A 1 71 ? -6.808  2.293   -6.360  1.00 0.11 ? 71  LEU A CB   6  
ATOM   7829  C CG   . LEU A 1 71 ? -7.350  0.881   -6.587  1.00 0.10 ? 71  LEU A CG   6  
ATOM   7830  C CD1  . LEU A 1 71 ? -8.235  0.840   -7.823  1.00 0.11 ? 71  LEU A CD1  6  
ATOM   7831  C CD2  . LEU A 1 71 ? -6.204  -0.114  -6.714  1.00 0.10 ? 71  LEU A CD2  6  
ATOM   7832  H H    . LEU A 1 71 ? -6.894  4.106   -4.588  1.00 0.11 ? 71  LEU A H    6  
ATOM   7833  H HA   . LEU A 1 71 ? -5.743  1.540   -4.664  1.00 0.10 ? 71  LEU A HA   6  
ATOM   7834  H HB2  . LEU A 1 71 ? -7.642  2.939   -6.125  1.00 0.11 ? 71  LEU A HB2  6  
ATOM   7835  H HB3  . LEU A 1 71 ? -6.366  2.634   -7.286  1.00 0.12 ? 71  LEU A HB3  6  
ATOM   7836  H HG   . LEU A 1 71 ? -7.952  0.593   -5.739  1.00 0.10 ? 71  LEU A HG   6  
ATOM   7837  H HD11 . LEU A 1 71 ? -9.136  1.407   -7.639  1.00 0.11 ? 71  LEU A HD11 6  
ATOM   7838  H HD12 . LEU A 1 71 ? -8.492  -0.184  -8.047  1.00 0.11 ? 71  LEU A HD12 6  
ATOM   7839  H HD13 . LEU A 1 71 ? -7.704  1.270   -8.659  1.00 0.12 ? 71  LEU A HD13 6  
ATOM   7840  H HD21 . LEU A 1 71 ? -5.536  0.206   -7.499  1.00 0.11 ? 71  LEU A HD21 6  
ATOM   7841  H HD22 . LEU A 1 71 ? -6.600  -1.089  -6.952  1.00 0.10 ? 71  LEU A HD22 6  
ATOM   7842  H HD23 . LEU A 1 71 ? -5.665  -0.164  -5.780  1.00 0.10 ? 71  LEU A HD23 6  
ATOM   7843  N N    . LYS A 1 72 ? -4.165  3.858   -6.402  1.00 0.12 ? 72  LYS A N    6  
ATOM   7844  C CA   . LYS A 1 72 ? -2.888  4.198   -7.018  1.00 0.13 ? 72  LYS A CA   6  
ATOM   7845  C C    . LYS A 1 72 ? -1.730  3.892   -6.073  1.00 0.13 ? 72  LYS A C    6  
ATOM   7846  O O    . LYS A 1 72 ? -0.624  3.574   -6.512  1.00 0.14 ? 72  LYS A O    6  
ATOM   7847  C CB   . LYS A 1 72 ? -2.864  5.678   -7.408  1.00 0.14 ? 72  LYS A CB   6  
ATOM   7848  C CG   . LYS A 1 72 ? -3.688  5.996   -8.644  1.00 0.15 ? 72  LYS A CG   6  
ATOM   7849  C CD   . LYS A 1 72 ? -2.810  6.441   -9.800  1.00 0.16 ? 72  LYS A CD   6  
ATOM   7850  C CE   . LYS A 1 72 ? -2.194  7.807   -9.539  1.00 0.17 ? 72  LYS A CE   6  
ATOM   7851  N NZ   . LYS A 1 72 ? -2.460  8.759   -10.651 1.00 0.18 ? 72  LYS A NZ   6  
ATOM   7852  H H    . LYS A 1 72 ? -4.879  4.529   -6.382  1.00 0.12 ? 72  LYS A H    6  
ATOM   7853  H HA   . LYS A 1 72 ? -2.778  3.598   -7.909  1.00 0.14 ? 72  LYS A HA   6  
ATOM   7854  H HB2  . LYS A 1 72 ? -3.249  6.261   -6.584  1.00 0.14 ? 72  LYS A HB2  6  
ATOM   7855  H HB3  . LYS A 1 72 ? -1.842  5.971   -7.597  1.00 0.15 ? 72  LYS A HB3  6  
ATOM   7856  H HG2  . LYS A 1 72 ? -4.233  5.111   -8.938  1.00 0.15 ? 72  LYS A HG2  6  
ATOM   7857  H HG3  . LYS A 1 72 ? -4.385  6.787   -8.406  1.00 0.15 ? 72  LYS A HG3  6  
ATOM   7858  H HD2  . LYS A 1 72 ? -2.019  5.720   -9.939  1.00 0.17 ? 72  LYS A HD2  6  
ATOM   7859  H HD3  . LYS A 1 72 ? -3.412  6.494   -10.697 1.00 0.17 ? 72  LYS A HD3  6  
ATOM   7860  H HE2  . LYS A 1 72 ? -2.611  8.208   -8.627  1.00 0.17 ? 72  LYS A HE2  6  
ATOM   7861  H HE3  . LYS A 1 72 ? -1.126  7.690   -9.425  1.00 0.18 ? 72  LYS A HE3  6  
ATOM   7862  H HZ1  . LYS A 1 72 ? -3.485  8.889   -10.771 1.00 0.18 ? 72  LYS A HZ1  6  
ATOM   7863  H HZ2  . LYS A 1 72 ? -2.062  8.392   -11.539 1.00 0.19 ? 72  LYS A HZ2  6  
ATOM   7864  H HZ3  . LYS A 1 72 ? -2.026  9.681   -10.444 1.00 0.19 ? 72  LYS A HZ3  6  
ATOM   7865  N N    . THR A 1 73 ? -1.990  3.991   -4.774  1.00 0.13 ? 73  THR A N    6  
ATOM   7866  C CA   . THR A 1 73 ? -0.970  3.723   -3.767  1.00 0.13 ? 73  THR A CA   6  
ATOM   7867  C C    . THR A 1 73 ? -0.847  2.229   -3.493  1.00 0.12 ? 73  THR A C    6  
ATOM   7868  O O    . THR A 1 73 ? 0.257   1.694   -3.400  1.00 0.12 ? 73  THR A O    6  
ATOM   7869  C CB   . THR A 1 73 ? -1.280  4.453   -2.446  1.00 0.12 ? 73  THR A CB   6  
ATOM   7870  O OG1  . THR A 1 73 ? -1.841  5.742   -2.718  1.00 0.13 ? 73  THR A OG1  6  
ATOM   7871  C CG2  . THR A 1 73 ? -0.022  4.609   -1.607  1.00 0.13 ? 73  THR A CG2  6  
ATOM   7872  H H    . THR A 1 73 ? -2.890  4.250   -4.484  1.00 0.12 ? 73  THR A H    6  
ATOM   7873  H HA   . THR A 1 73 ? -0.027  4.089   -4.144  1.00 0.14 ? 73  THR A HA   6  
ATOM   7874  H HB   . THR A 1 73 ? -1.996  3.867   -1.888  1.00 0.12 ? 73  THR A HB   6  
ATOM   7875  H HG1  . THR A 1 73 ? -1.241  6.241   -3.279  1.00 0.15 ? 73  THR A HG1  6  
ATOM   7876  H HG21 . THR A 1 73 ? 0.743   5.099   -2.191  1.00 0.14 ? 73  THR A HG21 6  
ATOM   7877  H HG22 . THR A 1 73 ? 0.330   3.635   -1.300  1.00 0.13 ? 73  THR A HG22 6  
ATOM   7878  H HG23 . THR A 1 73 ? -0.244  5.203   -0.734  1.00 0.13 ? 73  THR A HG23 6  
ATOM   7879  N N    . TRP A 1 74 ? -1.987  1.560   -3.364  1.00 0.11 ? 74  TRP A N    6  
ATOM   7880  C CA   . TRP A 1 74 ? -2.007  0.125   -3.100  1.00 0.10 ? 74  TRP A CA   6  
ATOM   7881  C C    . TRP A 1 74 ? -1.310  -0.642  -4.219  1.00 0.11 ? 74  TRP A C    6  
ATOM   7882  O O    . TRP A 1 74 ? -0.415  -1.447  -3.967  1.00 0.11 ? 74  TRP A O    6  
ATOM   7883  C CB   . TRP A 1 74 ? -3.446  -0.367  -2.946  1.00 0.09 ? 74  TRP A CB   6  
ATOM   7884  C CG   . TRP A 1 74 ? -3.542  -1.815  -2.573  1.00 0.08 ? 74  TRP A CG   6  
ATOM   7885  C CD1  . TRP A 1 74 ? -4.286  -2.775  -3.199  1.00 0.08 ? 74  TRP A CD1  6  
ATOM   7886  C CD2  . TRP A 1 74 ? -2.873  -2.467  -1.490  1.00 0.08 ? 74  TRP A CD2  6  
ATOM   7887  N NE1  . TRP A 1 74 ? -4.120  -3.984  -2.570  1.00 0.07 ? 74  TRP A NE1  6  
ATOM   7888  C CE2  . TRP A 1 74 ? -3.257  -3.823  -1.517  1.00 0.07 ? 74  TRP A CE2  6  
ATOM   7889  C CE3  . TRP A 1 74 ? -1.984  -2.040  -0.499  1.00 0.08 ? 74  TRP A CE3  6  
ATOM   7890  C CZ2  . TRP A 1 74 ? -2.784  -4.751  -0.593  1.00 0.07 ? 74  TRP A CZ2  6  
ATOM   7891  C CZ3  . TRP A 1 74 ? -1.515  -2.962  0.419   1.00 0.08 ? 74  TRP A CZ3  6  
ATOM   7892  C CH2  . TRP A 1 74 ? -1.915  -4.303  0.365   1.00 0.08 ? 74  TRP A CH2  6  
ATOM   7893  H H    . TRP A 1 74 ? -2.837  2.042   -3.447  1.00 0.10 ? 74  TRP A H    6  
ATOM   7894  H HA   . TRP A 1 74 ? -1.475  -0.048  -2.178  1.00 0.10 ? 74  TRP A HA   6  
ATOM   7895  H HB2  . TRP A 1 74 ? -3.932  0.209   -2.173  1.00 0.08 ? 74  TRP A HB2  6  
ATOM   7896  H HB3  . TRP A 1 74 ? -3.970  -0.225  -3.879  1.00 0.09 ? 74  TRP A HB3  6  
ATOM   7897  H HD1  . TRP A 1 74 ? -4.911  -2.594  -4.061  1.00 0.08 ? 74  TRP A HD1  6  
ATOM   7898  H HE1  . TRP A 1 74 ? -4.549  -4.826  -2.831  1.00 0.07 ? 74  TRP A HE1  6  
ATOM   7899  H HE3  . TRP A 1 74 ? -1.665  -1.011  -0.441  1.00 0.09 ? 74  TRP A HE3  6  
ATOM   7900  H HZ2  . TRP A 1 74 ? -3.082  -5.787  -0.621  1.00 0.07 ? 74  TRP A HZ2  6  
ATOM   7901  H HZ3  . TRP A 1 74 ? -0.830  -2.649  1.190   1.00 0.09 ? 74  TRP A HZ3  6  
ATOM   7902  H HH2  . TRP A 1 74 ? -1.523  -4.987  1.103   1.00 0.08 ? 74  TRP A HH2  6  
ATOM   7903  N N    . GLY A 1 75 ? -1.729  -0.389  -5.455  1.00 0.11 ? 75  GLY A N    6  
ATOM   7904  C CA   . GLY A 1 75 ? -1.135  -1.066  -6.593  1.00 0.12 ? 75  GLY A CA   6  
ATOM   7905  C C    . GLY A 1 75 ? 0.378   -0.974  -6.597  1.00 0.13 ? 75  GLY A C    6  
ATOM   7906  O O    . GLY A 1 75 ? 1.066   -1.953  -6.886  1.00 0.13 ? 75  GLY A O    6  
ATOM   7907  H H    . GLY A 1 75 ? -2.446  0.265   -5.594  1.00 0.11 ? 75  GLY A H    6  
ATOM   7908  H HA2  . GLY A 1 75 ? -1.421  -2.106  -6.569  1.00 0.11 ? 75  GLY A HA2  6  
ATOM   7909  H HA3  . GLY A 1 75 ? -1.514  -0.620  -7.500  1.00 0.12 ? 75  GLY A HA3  6  
ATOM   7910  N N    . LEU A 1 76 ? 0.899   0.206   -6.276  1.00 0.13 ? 76  LEU A N    6  
ATOM   7911  C CA   . LEU A 1 76 ? 2.341   0.423   -6.245  1.00 0.14 ? 76  LEU A CA   6  
ATOM   7912  C C    . LEU A 1 76 ? 2.981   -0.343  -5.091  1.00 0.14 ? 76  LEU A C    6  
ATOM   7913  O O    . LEU A 1 76 ? 3.885   -1.152  -5.294  1.00 0.15 ? 76  LEU A O    6  
ATOM   7914  C CB   . LEU A 1 76 ? 2.650   1.915   -6.116  1.00 0.15 ? 76  LEU A CB   6  
ATOM   7915  C CG   . LEU A 1 76 ? 2.883   2.668   -7.426  1.00 0.16 ? 76  LEU A CG   6  
ATOM   7916  C CD1  . LEU A 1 76 ? 2.420   4.112   -7.303  1.00 0.17 ? 76  LEU A CD1  6  
ATOM   7917  C CD2  . LEU A 1 76 ? 4.353   2.609   -7.819  1.00 0.18 ? 76  LEU A CD2  6  
ATOM   7918  H H    . LEU A 1 76 ? 0.299   0.949   -6.053  1.00 0.13 ? 76  LEU A H    6  
ATOM   7919  H HA   . LEU A 1 76 ? 2.751   0.058   -7.175  1.00 0.15 ? 76  LEU A HA   6  
ATOM   7920  H HB2  . LEU A 1 76 ? 1.824   2.384   -5.602  1.00 0.15 ? 76  LEU A HB2  6  
ATOM   7921  H HB3  . LEU A 1 76 ? 3.532   2.021   -5.506  1.00 0.16 ? 76  LEU A HB3  6  
ATOM   7922  H HG   . LEU A 1 76 ? 2.307   2.200   -8.211  1.00 0.16 ? 76  LEU A HG   6  
ATOM   7923  H HD11 . LEU A 1 76 ? 1.359   4.134   -7.101  1.00 0.16 ? 76  LEU A HD11 6  
ATOM   7924  H HD12 . LEU A 1 76 ? 2.623   4.636   -8.226  1.00 0.18 ? 76  LEU A HD12 6  
ATOM   7925  H HD13 . LEU A 1 76 ? 2.950   4.592   -6.493  1.00 0.17 ? 76  LEU A HD13 6  
ATOM   7926  H HD21 . LEU A 1 76 ? 4.890   3.397   -7.319  1.00 0.17 ? 76  LEU A HD21 6  
ATOM   7927  H HD22 . LEU A 1 76 ? 4.444   2.732   -8.889  1.00 0.22 ? 76  LEU A HD22 6  
ATOM   7928  H HD23 . LEU A 1 76 ? 4.764   1.653   -7.531  1.00 0.25 ? 76  LEU A HD23 6  
ATOM   7929  N N    . VAL A 1 77 ? 2.505   -0.081  -3.877  1.00 0.14 ? 77  VAL A N    6  
ATOM   7930  C CA   . VAL A 1 77 ? 3.029   -0.747  -2.690  1.00 0.13 ? 77  VAL A CA   6  
ATOM   7931  C C    . VAL A 1 77 ? 2.928   -2.262  -2.821  1.00 0.13 ? 77  VAL A C    6  
ATOM   7932  O O    . VAL A 1 77 ? 3.674   -3.003  -2.181  1.00 0.13 ? 77  VAL A O    6  
ATOM   7933  C CB   . VAL A 1 77 ? 2.280   -0.301  -1.421  1.00 0.13 ? 77  VAL A CB   6  
ATOM   7934  C CG1  . VAL A 1 77 ? 2.768   -1.084  -0.212  1.00 0.13 ? 77  VAL A CG1  6  
ATOM   7935  C CG2  . VAL A 1 77 ? 2.449   1.195   -1.201  1.00 0.13 ? 77  VAL A CG2  6  
ATOM   7936  H H    . VAL A 1 77 ? 1.783   0.574   -3.778  1.00 0.13 ? 77  VAL A H    6  
ATOM   7937  H HA   . VAL A 1 77 ? 4.069   -0.472  -2.585  1.00 0.14 ? 77  VAL A HA   6  
ATOM   7938  H HB   . VAL A 1 77 ? 1.228   -0.506  -1.557  1.00 0.12 ? 77  VAL A HB   6  
ATOM   7939  H HG11 . VAL A 1 77 ? 2.449   -2.113  -0.298  1.00 0.15 ? 77  VAL A HG11 6  
ATOM   7940  H HG12 . VAL A 1 77 ? 2.355   -0.652  0.688   1.00 0.16 ? 77  VAL A HG12 6  
ATOM   7941  H HG13 . VAL A 1 77 ? 3.846   -1.045  -0.168  1.00 0.17 ? 77  VAL A HG13 6  
ATOM   7942  H HG21 . VAL A 1 77 ? 3.498   1.425   -1.085  1.00 0.14 ? 77  VAL A HG21 6  
ATOM   7943  H HG22 . VAL A 1 77 ? 1.915   1.490   -0.310  1.00 0.13 ? 77  VAL A HG22 6  
ATOM   7944  H HG23 . VAL A 1 77 ? 2.054   1.731   -2.052  1.00 0.14 ? 77  VAL A HG23 6  
ATOM   7945  N N    . LEU A 1 78 ? 1.999   -2.719  -3.655  1.00 0.12 ? 78  LEU A N    6  
ATOM   7946  C CA   . LEU A 1 78 ? 1.800   -4.146  -3.872  1.00 0.12 ? 78  LEU A CA   6  
ATOM   7947  C C    . LEU A 1 78 ? 2.754   -4.675  -4.937  1.00 0.13 ? 78  LEU A C    6  
ATOM   7948  O O    . LEU A 1 78 ? 3.398   -5.708  -4.752  1.00 0.13 ? 78  LEU A O    6  
ATOM   7949  C CB   . LEU A 1 78 ? 0.354   -4.422  -4.286  1.00 0.11 ? 78  LEU A CB   6  
ATOM   7950  C CG   . LEU A 1 78 ? -0.169  -5.832  -4.001  1.00 0.10 ? 78  LEU A CG   6  
ATOM   7951  C CD1  . LEU A 1 78 ? -0.519  -5.984  -2.530  1.00 0.09 ? 78  LEU A CD1  6  
ATOM   7952  C CD2  . LEU A 1 78 ? -1.378  -6.138  -4.873  1.00 0.09 ? 78  LEU A CD2  6  
ATOM   7953  H H    . LEU A 1 78 ? 1.433   -2.078  -4.136  1.00 0.12 ? 78  LEU A H    6  
ATOM   7954  H HA   . LEU A 1 78 ? 2.002   -4.653  -2.941  1.00 0.11 ? 78  LEU A HA   6  
ATOM   7955  H HB2  . LEU A 1 78 ? -0.283  -3.719  -3.769  1.00 0.10 ? 78  LEU A HB2  6  
ATOM   7956  H HB3  . LEU A 1 78 ? 0.268   -4.242  -5.347  1.00 0.11 ? 78  LEU A HB3  6  
ATOM   7957  H HG   . LEU A 1 78 ? 0.604   -6.549  -4.235  1.00 0.10 ? 78  LEU A HG   6  
ATOM   7958  H HD11 . LEU A 1 78 ? -1.296  -5.280  -2.270  1.00 0.08 ? 78  LEU A HD11 6  
ATOM   7959  H HD12 . LEU A 1 78 ? 0.358   -5.792  -1.930  1.00 0.10 ? 78  LEU A HD12 6  
ATOM   7960  H HD13 . LEU A 1 78 ? -0.867  -6.990  -2.346  1.00 0.09 ? 78  LEU A HD13 6  
ATOM   7961  H HD21 . LEU A 1 78 ? -1.080  -6.151  -5.911  1.00 0.10 ? 78  LEU A HD21 6  
ATOM   7962  H HD22 . LEU A 1 78 ? -2.130  -5.377  -4.725  1.00 0.09 ? 78  LEU A HD22 6  
ATOM   7963  H HD23 . LEU A 1 78 ? -1.783  -7.101  -4.602  1.00 0.09 ? 78  LEU A HD23 6  
ATOM   7964  N N    . GLY A 1 79 ? 2.844   -3.958  -6.054  1.00 0.13 ? 79  GLY A N    6  
ATOM   7965  C CA   . GLY A 1 79 ? 3.725   -4.369  -7.130  1.00 0.15 ? 79  GLY A CA   6  
ATOM   7966  C C    . GLY A 1 79 ? 5.139   -4.635  -6.654  1.00 0.15 ? 79  GLY A C    6  
ATOM   7967  O O    . GLY A 1 79 ? 5.862   -5.433  -7.249  1.00 0.16 ? 79  GLY A O    6  
ATOM   7968  H H    . GLY A 1 79 ? 2.309   -3.143  -6.146  1.00 0.13 ? 79  GLY A H    6  
ATOM   7969  H HA2  . GLY A 1 79 ? 3.332   -5.270  -7.578  1.00 0.14 ? 79  GLY A HA2  6  
ATOM   7970  H HA3  . GLY A 1 79 ? 3.749   -3.590  -7.878  1.00 0.15 ? 79  GLY A HA3  6  
ATOM   7971  N N    . ALA A 1 80 ? 5.534   -3.963  -5.578  1.00 0.15 ? 80  ALA A N    6  
ATOM   7972  C CA   . ALA A 1 80 ? 6.872   -4.132  -5.021  1.00 0.16 ? 80  ALA A CA   6  
ATOM   7973  C C    . ALA A 1 80 ? 6.934   -5.347  -4.101  1.00 0.16 ? 80  ALA A C    6  
ATOM   7974  O O    . ALA A 1 80 ? 7.772   -6.230  -4.280  1.00 0.17 ? 80  ALA A O    6  
ATOM   7975  C CB   . ALA A 1 80 ? 7.294   -2.877  -4.273  1.00 0.17 ? 80  ALA A CB   6  
ATOM   7976  H H    . ALA A 1 80 ? 4.913   -3.339  -5.148  1.00 0.15 ? 80  ALA A H    6  
ATOM   7977  H HA   . ALA A 1 80 ? 7.557   -4.280  -5.844  1.00 0.17 ? 80  ALA A HA   6  
ATOM   7978  H HB1  . ALA A 1 80 ? 6.651   -2.736  -3.416  1.00 0.16 ? 80  ALA A HB1  6  
ATOM   7979  H HB2  . ALA A 1 80 ? 7.214   -2.023  -4.928  1.00 0.18 ? 80  ALA A HB2  6  
ATOM   7980  H HB3  . ALA A 1 80 ? 8.317   -2.982  -3.942  1.00 0.18 ? 80  ALA A HB3  6  
ATOM   7981  N N    . LEU A 1 81 ? 6.045   -5.381  -3.116  1.00 0.15 ? 81  LEU A N    6  
ATOM   7982  C CA   . LEU A 1 81 ? 5.999   -6.487  -2.165  1.00 0.15 ? 81  LEU A CA   6  
ATOM   7983  C C    . LEU A 1 81 ? 5.819   -7.818  -2.887  1.00 0.14 ? 81  LEU A C    6  
ATOM   7984  O O    . LEU A 1 81 ? 6.488   -8.803  -2.573  1.00 0.15 ? 81  LEU A O    6  
ATOM   7985  C CB   . LEU A 1 81 ? 4.862   -6.278  -1.164  1.00 0.14 ? 81  LEU A CB   6  
ATOM   7986  C CG   . LEU A 1 81 ? 5.277   -5.819  0.236   1.00 0.14 ? 81  LEU A CG   6  
ATOM   7987  C CD1  . LEU A 1 81 ? 4.059   -5.698  1.140   1.00 0.13 ? 81  LEU A CD1  6  
ATOM   7988  C CD2  . LEU A 1 81 ? 6.295   -6.777  0.832   1.00 0.15 ? 81  LEU A CD2  6  
ATOM   7989  H H    . LEU A 1 81 ? 5.403   -4.646  -3.024  1.00 0.14 ? 81  LEU A H    6  
ATOM   7990  H HA   . LEU A 1 81 ? 6.938   -6.505  -1.633  1.00 0.15 ? 81  LEU A HA   6  
ATOM   7991  H HB2  . LEU A 1 81 ? 4.187   -5.540  -1.572  1.00 0.13 ? 81  LEU A HB2  6  
ATOM   7992  H HB3  . LEU A 1 81 ? 4.327   -7.210  -1.065  1.00 0.13 ? 81  LEU A HB3  6  
ATOM   7993  H HG   . LEU A 1 81 ? 5.737   -4.844  0.165   1.00 0.15 ? 81  LEU A HG   6  
ATOM   7994  H HD11 . LEU A 1 81 ? 3.836   -6.662  1.572   1.00 0.13 ? 81  LEU A HD11 6  
ATOM   7995  H HD12 . LEU A 1 81 ? 3.214   -5.358  0.563   1.00 0.12 ? 81  LEU A HD12 6  
ATOM   7996  H HD13 . LEU A 1 81 ? 4.266   -4.990  1.929   1.00 0.13 ? 81  LEU A HD13 6  
ATOM   7997  H HD21 . LEU A 1 81 ? 5.971   -7.795  0.667   1.00 0.14 ? 81  LEU A HD21 6  
ATOM   7998  H HD22 . LEU A 1 81 ? 6.381   -6.596  1.893   1.00 0.15 ? 81  LEU A HD22 6  
ATOM   7999  H HD23 . LEU A 1 81 ? 7.255   -6.624  0.363   1.00 0.16 ? 81  LEU A HD23 6  
ATOM   8000  N N    . LYS A 1 82 ? 4.910   -7.841  -3.857  1.00 0.14 ? 82  LYS A N    6  
ATOM   8001  C CA   . LYS A 1 82 ? 4.643   -9.049  -4.627  1.00 0.14 ? 82  LYS A CA   6  
ATOM   8002  C C    . LYS A 1 82 ? 5.936   -9.640  -5.180  1.00 0.15 ? 82  LYS A C    6  
ATOM   8003  O O    . LYS A 1 82 ? 6.064   -10.856 -5.316  1.00 0.15 ? 82  LYS A O    6  
ATOM   8004  C CB   . LYS A 1 82 ? 3.678   -8.742  -5.776  1.00 0.13 ? 82  LYS A CB   6  
ATOM   8005  C CG   . LYS A 1 82 ? 2.265   -9.244  -5.532  1.00 0.12 ? 82  LYS A CG   6  
ATOM   8006  C CD   . LYS A 1 82 ? 1.248   -8.461  -6.347  1.00 0.12 ? 82  LYS A CD   6  
ATOM   8007  C CE   . LYS A 1 82 ? -0.113  -9.140  -6.339  1.00 0.11 ? 82  LYS A CE   6  
ATOM   8008  N NZ   . LYS A 1 82 ? -0.461  -9.698  -7.676  1.00 0.12 ? 82  LYS A NZ   6  
ATOM   8009  H H    . LYS A 1 82 ? 4.409   -7.023  -4.059  1.00 0.13 ? 82  LYS A H    6  
ATOM   8010  H HA   . LYS A 1 82 ? 4.185   -9.770  -3.966  1.00 0.13 ? 82  LYS A HA   6  
ATOM   8011  H HB2  . LYS A 1 82 ? 3.638   -7.673  -5.920  1.00 0.13 ? 82  LYS A HB2  6  
ATOM   8012  H HB3  . LYS A 1 82 ? 4.052   -9.205  -6.677  1.00 0.14 ? 82  LYS A HB3  6  
ATOM   8013  H HG2  . LYS A 1 82 ? 2.209   -10.285 -5.811  1.00 0.12 ? 82  LYS A HG2  6  
ATOM   8014  H HG3  . LYS A 1 82 ? 2.031   -9.137  -4.483  1.00 0.12 ? 82  LYS A HG3  6  
ATOM   8015  H HD2  . LYS A 1 82 ? 1.149   -7.471  -5.928  1.00 0.12 ? 82  LYS A HD2  6  
ATOM   8016  H HD3  . LYS A 1 82 ? 1.599   -8.388  -7.366  1.00 0.13 ? 82  LYS A HD3  6  
ATOM   8017  H HE2  . LYS A 1 82 ? -0.097  -9.943  -5.618  1.00 0.11 ? 82  LYS A HE2  6  
ATOM   8018  H HE3  . LYS A 1 82 ? -0.862  -8.416  -6.054  1.00 0.10 ? 82  LYS A HE3  6  
ATOM   8019  H HZ1  . LYS A 1 82 ? -1.395  -10.157 -7.639  1.00 0.11 ? 82  LYS A HZ1  6  
ATOM   8020  H HZ2  . LYS A 1 82 ? 0.247   -10.400 -7.966  1.00 0.12 ? 82  LYS A HZ2  6  
ATOM   8021  H HZ3  . LYS A 1 82 ? -0.489  -8.936  -8.384  1.00 0.12 ? 82  LYS A HZ3  6  
ATOM   8022  N N    . ALA A 1 83 ? 6.892   -8.772  -5.494  1.00 0.16 ? 83  ALA A N    6  
ATOM   8023  C CA   . ALA A 1 83 ? 8.176   -9.209  -6.027  1.00 0.17 ? 83  ALA A CA   6  
ATOM   8024  C C    . ALA A 1 83 ? 9.131   -9.600  -4.905  1.00 0.18 ? 83  ALA A C    6  
ATOM   8025  O O    . ALA A 1 83 ? 10.000  -10.453 -5.087  1.00 0.19 ? 83  ALA A O    6  
ATOM   8026  C CB   . ALA A 1 83 ? 8.789   -8.115  -6.888  1.00 0.18 ? 83  ALA A CB   6  
ATOM   8027  H H    . ALA A 1 83 ? 6.729   -7.814  -5.364  1.00 0.16 ? 83  ALA A H    6  
ATOM   8028  H HA   . ALA A 1 83 ? 8.000   -10.072 -6.652  1.00 0.17 ? 83  ALA A HA   6  
ATOM   8029  H HB1  . ALA A 1 83 ? 8.986   -7.245  -6.279  1.00 0.18 ? 83  ALA A HB1  6  
ATOM   8030  H HB2  . ALA A 1 83 ? 8.103   -7.852  -7.679  1.00 0.18 ? 83  ALA A HB2  6  
ATOM   8031  H HB3  . ALA A 1 83 ? 9.714   -8.470  -7.317  1.00 0.19 ? 83  ALA A HB3  6  
ATOM   8032  N N    . ALA A 1 84 ? 8.967   -8.971  -3.747  1.00 0.17 ? 84  ALA A N    6  
ATOM   8033  C CA   . ALA A 1 84 ? 9.814   -9.254  -2.595  1.00 0.18 ? 84  ALA A CA   6  
ATOM   8034  C C    . ALA A 1 84 ? 9.470   -10.606 -1.980  1.00 0.18 ? 84  ALA A C    6  
ATOM   8035  O O    . ALA A 1 84 ? 10.301  -11.228 -1.321  1.00 0.18 ? 84  ALA A O    6  
ATOM   8036  C CB   . ALA A 1 84 ? 9.682   -8.149  -1.557  1.00 0.18 ? 84  ALA A CB   6  
ATOM   8037  H H    . ALA A 1 84 ? 8.257   -8.299  -3.664  1.00 0.17 ? 84  ALA A H    6  
ATOM   8038  H HA   . ALA A 1 84 ? 10.840  -9.276  -2.935  1.00 0.19 ? 84  ALA A HA   6  
ATOM   8039  H HB1  . ALA A 1 84 ? 10.361  -8.342  -0.739  1.00 0.19 ? 84  ALA A HB1  6  
ATOM   8040  H HB2  . ALA A 1 84 ? 8.669   -8.123  -1.186  1.00 0.17 ? 84  ALA A HB2  6  
ATOM   8041  H HB3  . ALA A 1 84 ? 9.925   -7.199  -2.009  1.00 0.18 ? 84  ALA A HB3  6  
ATOM   8042  N N    . ARG A 1 85 ? 8.238   -11.052 -2.198  1.00 0.16 ? 85  ARG A N    6  
ATOM   8043  C CA   . ARG A 1 85 ? 7.781   -12.329 -1.663  1.00 0.16 ? 85  ARG A CA   6  
ATOM   8044  C C    . ARG A 1 85 ? 7.765   -13.400 -2.749  1.00 0.16 ? 85  ARG A C    6  
ATOM   8045  O O    . ARG A 1 85 ? 7.062   -14.405 -2.633  1.00 0.16 ? 85  ARG A O    6  
ATOM   8046  C CB   . ARG A 1 85 ? 6.385   -12.183 -1.054  1.00 0.15 ? 85  ARG A CB   6  
ATOM   8047  C CG   . ARG A 1 85 ? 6.335   -11.240 0.137   1.00 0.15 ? 85  ARG A CG   6  
ATOM   8048  C CD   . ARG A 1 85 ? 4.941   -11.181 0.743   1.00 0.14 ? 85  ARG A CD   6  
ATOM   8049  N NE   . ARG A 1 85 ? 4.977   -11.203 2.201   1.00 0.14 ? 85  ARG A NE   6  
ATOM   8050  C CZ   . ARG A 1 85 ? 5.351   -12.262 2.912   1.00 0.14 ? 85  ARG A CZ   6  
ATOM   8051  N NH1  . ARG A 1 85 ? 5.717   -13.379 2.299   1.00 0.15 ? 85  ARG A NH1  6  
ATOM   8052  N NH2  . ARG A 1 85 ? 5.357   -12.205 4.238   1.00 0.15 ? 85  ARG A NH2  6  
ATOM   8053  H H    . ARG A 1 85 ? 7.620   -10.510 -2.732  1.00 0.16 ? 85  ARG A H    6  
ATOM   8054  H HA   . ARG A 1 85 ? 8.471   -12.629 -0.888  1.00 0.17 ? 85  ARG A HA   6  
ATOM   8055  H HB2  . ARG A 1 85 ? 5.713   -11.807 -1.812  1.00 0.14 ? 85  ARG A HB2  6  
ATOM   8056  H HB3  . ARG A 1 85 ? 6.042   -13.154 -0.731  1.00 0.15 ? 85  ARG A HB3  6  
ATOM   8057  H HG2  . ARG A 1 85 ? 7.027   -11.587 0.888   1.00 0.15 ? 85  ARG A HG2  6  
ATOM   8058  H HG3  . ARG A 1 85 ? 6.619   -10.250 -0.189  1.00 0.15 ? 85  ARG A HG3  6  
ATOM   8059  H HD2  . ARG A 1 85 ? 4.459   -10.270 0.419   1.00 0.13 ? 85  ARG A HD2  6  
ATOM   8060  H HD3  . ARG A 1 85 ? 4.374   -12.030 0.392   1.00 0.13 ? 85  ARG A HD3  6  
ATOM   8061  H HE   . ARG A 1 85 ? 4.708   -10.388 2.675   1.00 0.14 ? 85  ARG A HE   6  
ATOM   8062  H HH11 . ARG A 1 85 ? 5.997   -14.175 2.836   1.00 0.15 ? 85  ARG A HH11 6  
ATOM   8063  H HH12 . ARG A 1 85 ? 5.712   -13.426 1.300   1.00 0.15 ? 85  ARG A HH12 6  
ATOM   8064  H HH21 . ARG A 1 85 ? 5.079   -11.365 4.704   1.00 0.15 ? 85  ARG A HH21 6  
ATOM   8065  H HH22 . ARG A 1 85 ? 5.638   -13.003 4.772   1.00 0.15 ? 85  ARG A HH22 6  
ATOM   8066  N N    . GLU A 1 86 ? 8.542   -13.177 -3.804  1.00 0.17 ? 86  GLU A N    6  
ATOM   8067  C CA   . GLU A 1 86 ? 8.616   -14.123 -4.912  1.00 0.17 ? 86  GLU A CA   6  
ATOM   8068  C C    . GLU A 1 86 ? 10.024  -14.696 -5.046  1.00 0.19 ? 86  GLU A C    6  
ATOM   8069  O O    . GLU A 1 86 ? 10.203  -15.833 -5.479  1.00 0.19 ? 86  GLU A O    6  
ATOM   8070  C CB   . GLU A 1 86 ? 8.201   -13.443 -6.218  1.00 0.17 ? 86  GLU A CB   6  
ATOM   8071  C CG   . GLU A 1 86 ? 6.795   -13.799 -6.669  1.00 0.16 ? 86  GLU A CG   6  
ATOM   8072  C CD   . GLU A 1 86 ? 6.461   -13.239 -8.039  1.00 0.17 ? 86  GLU A CD   6  
ATOM   8073  O OE1  . GLU A 1 86 ? 7.110   -13.651 -9.022  1.00 0.18 ? 86  GLU A OE1  6  
ATOM   8074  O OE2  . GLU A 1 86 ? 5.554   -12.386 -8.126  1.00 0.16 ? 86  GLU A OE2  6  
ATOM   8075  H H    . GLU A 1 86 ? 9.079   -12.359 -3.838  1.00 0.17 ? 86  GLU A H    6  
ATOM   8076  H HA   . GLU A 1 86 ? 7.930   -14.931 -4.703  1.00 0.17 ? 86  GLU A HA   6  
ATOM   8077  H HB2  . GLU A 1 86 ? 8.254   -12.373 -6.088  1.00 0.17 ? 86  GLU A HB2  6  
ATOM   8078  H HB3  . GLU A 1 86 ? 8.890   -13.736 -6.998  1.00 0.18 ? 86  GLU A HB3  6  
ATOM   8079  H HG2  . GLU A 1 86 ? 6.703   -14.875 -6.706  1.00 0.17 ? 86  GLU A HG2  6  
ATOM   8080  H HG3  . GLU A 1 86 ? 6.089   -13.403 -5.953  1.00 0.16 ? 86  GLU A HG3  6  
ATOM   8081  N N    . GLU A 1 87 ? 11.019  -13.897 -4.675  1.00 0.19 ? 87  GLU A N    6  
ATOM   8082  C CA   . GLU A 1 87 ? 12.411  -14.322 -4.755  1.00 0.21 ? 87  GLU A CA   6  
ATOM   8083  C C    . GLU A 1 87 ? 12.769  -15.235 -3.588  1.00 0.21 ? 87  GLU A C    6  
ATOM   8084  O O    . GLU A 1 87 ? 13.821  -15.874 -3.585  1.00 0.22 ? 87  GLU A O    6  
ATOM   8085  C CB   . GLU A 1 87 ? 13.339  -13.107 -4.770  1.00 0.21 ? 87  GLU A CB   6  
ATOM   8086  C CG   . GLU A 1 87 ? 13.793  -12.705 -6.162  1.00 0.22 ? 87  GLU A CG   6  
ATOM   8087  C CD   . GLU A 1 87 ? 15.302  -12.628 -6.285  1.00 0.24 ? 87  GLU A CD   6  
ATOM   8088  O OE1  . GLU A 1 87 ? 15.910  -13.614 -6.755  1.00 0.24 ? 87  GLU A OE1  6  
ATOM   8089  O OE2  . GLU A 1 87 ? 15.877  -11.585 -5.913  1.00 0.24 ? 87  GLU A OE2  6  
ATOM   8090  O OXT  . GLU A 1 87 ? 11.994  -15.299 -2.587  1.00 0.20 ? 87  GLU A OXT  6  
ATOM   8091  H H    . GLU A 1 87 ? 10.813  -13.000 -4.337  1.00 0.19 ? 87  GLU A H    6  
ATOM   8092  H HA   . GLU A 1 87 ? 12.536  -14.872 -5.675  1.00 0.21 ? 87  GLU A HA   6  
ATOM   8093  H HB2  . GLU A 1 87 ? 12.823  -12.268 -4.327  1.00 0.21 ? 87  GLU A HB2  6  
ATOM   8094  H HB3  . GLU A 1 87 ? 14.216  -13.330 -4.180  1.00 0.22 ? 87  GLU A HB3  6  
ATOM   8095  H HG2  . GLU A 1 87 ? 13.427  -13.431 -6.872  1.00 0.22 ? 87  GLU A HG2  6  
ATOM   8096  H HG3  . GLU A 1 87 ? 13.378  -11.735 -6.396  1.00 0.22 ? 87  GLU A HG3  6  
HETATM 8097  C C1   . I3P B 2 .  ? 11.334  9.496   1.334   1.00 0.80 ? 101 I3P A C1   6  
HETATM 8098  C C2   . I3P B 2 .  ? 11.496  10.092  2.751   1.00 0.90 ? 101 I3P A C2   6  
HETATM 8099  C C3   . I3P B 2 .  ? 11.372  11.627  2.700   1.00 0.87 ? 101 I3P A C3   6  
HETATM 8100  C C4   . I3P B 2 .  ? 10.018  12.053  2.088   1.00 0.99 ? 101 I3P A C4   6  
HETATM 8101  C C5   . I3P B 2 .  ? 9.855   11.449  0.677   1.00 0.89 ? 101 I3P A C5   6  
HETATM 8102  C C6   . I3P B 2 .  ? 9.981   9.910   0.724   1.00 0.77 ? 101 I3P A C6   6  
HETATM 8103  O O1   . I3P B 2 .  ? 11.395  8.084   1.400   1.00 1.09 ? 101 I3P A O1   6  
HETATM 8104  O O2   . I3P B 2 .  ? 10.516  9.570   3.619   1.00 1.13 ? 101 I3P A O2   6  
HETATM 8105  O O3   . I3P B 2 .  ? 11.504  12.143  3.998   1.00 1.18 ? 101 I3P A O3   6  
HETATM 8106  O O4   . I3P B 2 .  ? 9.986   13.464  1.986   1.00 1.27 ? 101 I3P A O4   6  
HETATM 8107  O O5   . I3P B 2 .  ? 8.572   11.783  0.180   1.00 1.24 ? 101 I3P A O5   6  
HETATM 8108  O O6   . I3P B 2 .  ? 9.888   9.382   -0.575  1.00 0.95 ? 101 I3P A O6   6  
HETATM 8109  P P1   . I3P B 2 .  ? 12.967  7.513   0.880   1.00 1.49 ? 101 I3P A P1   6  
HETATM 8110  O O11  . I3P B 2 .  ? 13.326  7.999   -0.749  1.00 1.57 ? 101 I3P A O11  6  
HETATM 8111  O O12  . I3P B 2 .  ? 14.040  8.128   1.820   1.00 1.59 ? 101 I3P A O12  6  
HETATM 8112  O O13  . I3P B 2 .  ? 13.070  5.789   1.048   1.00 1.97 ? 101 I3P A O13  6  
HETATM 8113  P P4   . I3P B 2 .  ? 8.670   14.118  2.941   1.00 1.78 ? 101 I3P A P4   6  
HETATM 8114  O O41  . I3P B 2 .  ? 7.334   13.632  2.316   1.00 1.94 ? 101 I3P A O41  6  
HETATM 8115  O O42  . I3P B 2 .  ? 8.719   13.575  4.589   1.00 1.90 ? 101 I3P A O42  6  
HETATM 8116  O O43  . I3P B 2 .  ? 8.659   15.852  2.865   1.00 2.20 ? 101 I3P A O43  6  
HETATM 8117  P P5   . I3P B 2 .  ? 8.708   12.836  -1.216  1.00 1.58 ? 101 I3P A P5   6  
HETATM 8118  O O51  . I3P B 2 .  ? 9.352   12.019  -2.368  1.00 1.56 ? 101 I3P A O51  6  
HETATM 8119  O O52  . I3P B 2 .  ? 7.139   13.331  -1.767  1.00 2.10 ? 101 I3P A O52  6  
HETATM 8120  O O53  . I3P B 2 .  ? 9.717   14.215  -0.910  1.00 1.65 ? 101 I3P A O53  6  
HETATM 8121  H H1   . I3P B 2 .  ? 12.128  9.890   0.690   1.00 0.84 ? 101 I3P A H1   6  
HETATM 8122  H H2   . I3P B 2 .  ? 12.484  9.830   3.139   1.00 1.09 ? 101 I3P A H2   6  
HETATM 8123  H H3   . I3P B 2 .  ? 12.182  12.025  2.080   1.00 0.81 ? 101 I3P A H3   6  
HETATM 8124  H H4   . I3P B 2 .  ? 9.209   11.684  2.725   1.00 1.17 ? 101 I3P A H4   6  
HETATM 8125  H H5   . I3P B 2 .  ? 10.647  11.841  0.031   1.00 0.89 ? 101 I3P A H5   6  
HETATM 8126  H H6   . I3P B 2 .  ? 9.170   9.497   1.325   1.00 0.90 ? 101 I3P A H6   6  
HETATM 8127  H HO2  . I3P B 2 .  ? 10.235  8.712   3.255   1.00 1.23 ? 101 I3P A HO2  6  
HETATM 8128  H HO3  . I3P B 2 .  ? 10.929  12.931  4.058   1.00 1.33 ? 101 I3P A HO3  6  
HETATM 8129  H HO6  . I3P B 2 .  ? 9.486   10.069  -1.140  1.00 1.04 ? 101 I3P A HO6  6  
HETATM 8130  H HO13 . I3P B 2 .  ? 13.950  5.492   0.752   1.00 2.23 ? 101 I3P A HO13 6  
ATOM   8131  N N    . SER A 1 1  ? 2.781   3.669   10.303  1.00 0.76 ? 1   SER A N    7  
ATOM   8132  C CA   . SER A 1 1  ? 2.342   4.824   11.078  1.00 0.88 ? 1   SER A CA   7  
ATOM   8133  C C    . SER A 1 1  ? 3.444   5.875   11.160  1.00 0.88 ? 1   SER A C    7  
ATOM   8134  O O    . SER A 1 1  ? 3.175   7.057   11.370  1.00 0.98 ? 1   SER A O    7  
ATOM   8135  C CB   . SER A 1 1  ? 1.926   4.391   12.485  1.00 0.96 ? 1   SER A CB   7  
ATOM   8136  O OG   . SER A 1 1  ? 0.524   4.210   12.569  1.00 1.05 ? 1   SER A OG   7  
ATOM   8137  H H1   . SER A 1 1  ? 3.047   3.963   9.341   1.00 0.73 ? 1   SER A H1   7  
ATOM   8138  H H2   . SER A 1 1  ? 2.015   2.969   10.239  1.00 0.79 ? 1   SER A H2   7  
ATOM   8139  H H3   . SER A 1 1  ? 3.604   3.225   10.757  1.00 0.72 ? 1   SER A H3   7  
ATOM   8140  H HA   . SER A 1 1  ? 1.488   5.258   10.578  1.00 0.95 ? 1   SER A HA   7  
ATOM   8141  H HB2  . SER A 1 1  ? 2.413   3.460   12.731  1.00 0.91 ? 1   SER A HB2  7  
ATOM   8142  H HB3  . SER A 1 1  ? 2.223   5.150   13.193  1.00 1.02 ? 1   SER A HB3  7  
ATOM   8143  H HG   . SER A 1 1  ? 0.158   4.834   13.201  1.00 1.13 ? 1   SER A HG   7  
ATOM   8144  N N    . GLU A 1 2  ? 4.688   5.434   10.993  1.00 0.79 ? 2   GLU A N    7  
ATOM   8145  C CA   . GLU A 1 2  ? 5.831   6.336   11.049  1.00 0.83 ? 2   GLU A CA   7  
ATOM   8146  C C    . GLU A 1 2  ? 7.119   5.604   10.682  1.00 0.76 ? 2   GLU A C    7  
ATOM   8147  O O    . GLU A 1 2  ? 8.007   6.170   10.045  1.00 0.77 ? 2   GLU A O    7  
ATOM   8148  C CB   . GLU A 1 2  ? 5.958   6.947   12.445  1.00 0.96 ? 2   GLU A CB   7  
ATOM   8149  C CG   . GLU A 1 2  ? 6.427   5.961   13.502  1.00 0.99 ? 2   GLU A CG   7  
ATOM   8150  C CD   . GLU A 1 2  ? 6.570   6.596   14.872  1.00 1.14 ? 2   GLU A CD   7  
ATOM   8151  O OE1  . GLU A 1 2  ? 7.022   7.759   14.941  1.00 1.22 ? 2   GLU A OE1  7  
ATOM   8152  O OE2  . GLU A 1 2  ? 6.228   5.931   15.873  1.00 1.19 ? 2   GLU A OE2  7  
ATOM   8153  H H    . GLU A 1 2  ? 4.840   4.481   10.828  1.00 0.72 ? 2   GLU A H    7  
ATOM   8154  H HA   . GLU A 1 2  ? 5.665   7.128   10.333  1.00 0.86 ? 2   GLU A HA   7  
ATOM   8155  H HB2  . GLU A 1 2  ? 6.664   7.764   12.406  1.00 1.02 ? 2   GLU A HB2  7  
ATOM   8156  H HB3  . GLU A 1 2  ? 4.994   7.332   12.746  1.00 1.02 ? 2   GLU A HB3  7  
ATOM   8157  H HG2  . GLU A 1 2  ? 5.711   5.156   13.568  1.00 0.95 ? 2   GLU A HG2  7  
ATOM   8158  H HG3  . GLU A 1 2  ? 7.387   5.564   13.203  1.00 0.95 ? 2   GLU A HG3  7  
ATOM   8159  N N    . ALA A 1 3  ? 7.214   4.343   11.092  1.00 0.72 ? 3   ALA A N    7  
ATOM   8160  C CA   . ALA A 1 3  ? 8.392   3.534   10.805  1.00 0.70 ? 3   ALA A CA   7  
ATOM   8161  C C    . ALA A 1 3  ? 8.184   2.683   9.559   1.00 0.57 ? 3   ALA A C    7  
ATOM   8162  O O    . ALA A 1 3  ? 9.034   2.647   8.670   1.00 0.56 ? 3   ALA A O    7  
ATOM   8163  C CB   . ALA A 1 3  ? 8.729   2.653   11.999  1.00 0.79 ? 3   ALA A CB   7  
ATOM   8164  H H    . ALA A 1 3  ? 6.476   3.950   11.602  1.00 0.73 ? 3   ALA A H    7  
ATOM   8165  H HA   . ALA A 1 3  ? 9.223   4.204   10.637  1.00 0.75 ? 3   ALA A HA   7  
ATOM   8166  H HB1  . ALA A 1 3  ? 8.872   3.270   12.874  1.00 0.89 ? 3   ALA A HB1  7  
ATOM   8167  H HB2  . ALA A 1 3  ? 9.635   2.101   11.796  1.00 0.82 ? 3   ALA A HB2  7  
ATOM   8168  H HB3  . ALA A 1 3  ? 7.918   1.961   12.176  1.00 0.76 ? 3   ALA A HB3  7  
ATOM   8169  N N    . VAL A 1 4  ? 7.038   2.001   9.511   1.00 0.52 ? 4   VAL A N    7  
ATOM   8170  C CA   . VAL A 1 4  ? 6.695   1.125   8.392   1.00 0.45 ? 4   VAL A CA   7  
ATOM   8171  C C    . VAL A 1 4  ? 6.646   1.888   7.067   1.00 0.43 ? 4   VAL A C    7  
ATOM   8172  O O    . VAL A 1 4  ? 6.921   1.324   6.011   1.00 0.44 ? 4   VAL A O    7  
ATOM   8173  C CB   . VAL A 1 4  ? 5.339   0.423   8.626   1.00 0.49 ? 4   VAL A CB   7  
ATOM   8174  C CG1  . VAL A 1 4  ? 5.124   -0.690  7.611   1.00 0.55 ? 4   VAL A CG1  7  
ATOM   8175  C CG2  . VAL A 1 4  ? 5.252   -0.124  10.045  1.00 0.62 ? 4   VAL A CG2  7  
ATOM   8176  H H    . VAL A 1 4  ? 6.406   2.090   10.252  1.00 0.57 ? 4   VAL A H    7  
ATOM   8177  H HA   . VAL A 1 4  ? 7.459   0.364   8.325   1.00 0.46 ? 4   VAL A HA   7  
ATOM   8178  H HB   . VAL A 1 4  ? 4.553   1.153   8.497   1.00 0.59 ? 4   VAL A HB   7  
ATOM   8179  H HG11 . VAL A 1 4  ? 5.138   -0.275  6.614   1.00 0.62 ? 4   VAL A HG11 7  
ATOM   8180  H HG12 . VAL A 1 4  ? 4.170   -1.162  7.791   1.00 0.62 ? 4   VAL A HG12 7  
ATOM   8181  H HG13 . VAL A 1 4  ? 5.912   -1.422  7.707   1.00 0.62 ? 4   VAL A HG13 7  
ATOM   8182  H HG21 . VAL A 1 4  ? 4.334   -0.680  10.161  1.00 0.68 ? 4   VAL A HG21 7  
ATOM   8183  H HG22 . VAL A 1 4  ? 5.268   0.695   10.748  1.00 0.78 ? 4   VAL A HG22 7  
ATOM   8184  H HG23 . VAL A 1 4  ? 6.094   -0.775  10.232  1.00 0.70 ? 4   VAL A HG23 7  
ATOM   8185  N N    . ILE A 1 5  ? 6.309   3.177   7.132   1.00 0.45 ? 5   ILE A N    7  
ATOM   8186  C CA   . ILE A 1 5  ? 6.232   4.010   5.933   1.00 0.48 ? 5   ILE A CA   7  
ATOM   8187  C C    . ILE A 1 5  ? 7.609   4.158   5.277   1.00 0.46 ? 5   ILE A C    7  
ATOM   8188  O O    . ILE A 1 5  ? 7.712   4.262   4.057   1.00 0.57 ? 5   ILE A O    7  
ATOM   8189  C CB   . ILE A 1 5  ? 5.662   5.413   6.247   1.00 0.56 ? 5   ILE A CB   7  
ATOM   8190  C CG1  . ILE A 1 5  ? 4.394   5.300   7.099   1.00 0.73 ? 5   ILE A CG1  7  
ATOM   8191  C CG2  . ILE A 1 5  ? 5.361   6.164   4.956   1.00 0.81 ? 5   ILE A CG2  7  
ATOM   8192  C CD1  . ILE A 1 5  ? 3.835   6.639   7.537   1.00 0.82 ? 5   ILE A CD1  7  
ATOM   8193  H H    . ILE A 1 5  ? 6.110   3.576   8.004   1.00 0.48 ? 5   ILE A H    7  
ATOM   8194  H HA   . ILE A 1 5  ? 5.566   3.524   5.235   1.00 0.50 ? 5   ILE A HA   7  
ATOM   8195  H HB   . ILE A 1 5  ? 6.408   5.968   6.794   1.00 0.65 ? 5   ILE A HB   7  
ATOM   8196  H HG12 . ILE A 1 5  ? 3.630   4.794   6.530   1.00 0.89 ? 5   ILE A HG12 7  
ATOM   8197  H HG13 . ILE A 1 5  ? 4.614   4.727   7.987   1.00 0.89 ? 5   ILE A HG13 7  
ATOM   8198  H HG21 . ILE A 1 5  ? 4.640   5.606   4.376   1.00 0.99 ? 5   ILE A HG21 7  
ATOM   8199  H HG22 . ILE A 1 5  ? 6.270   6.279   4.385   1.00 0.98 ? 5   ILE A HG22 7  
ATOM   8200  H HG23 . ILE A 1 5  ? 4.958   7.138   5.192   1.00 0.91 ? 5   ILE A HG23 7  
ATOM   8201  H HD11 . ILE A 1 5  ? 3.606   7.235   6.665   1.00 0.92 ? 5   ILE A HD11 7  
ATOM   8202  H HD12 . ILE A 1 5  ? 4.566   7.153   8.142   1.00 0.99 ? 5   ILE A HD12 7  
ATOM   8203  H HD13 . ILE A 1 5  ? 2.935   6.483   8.112   1.00 1.11 ? 5   ILE A HD13 7  
ATOM   8204  N N    . LYS A 1 6  ? 8.662   4.151   6.095   1.00 0.44 ? 6   LYS A N    7  
ATOM   8205  C CA   . LYS A 1 6  ? 10.028  4.278   5.590   1.00 0.45 ? 6   LYS A CA   7  
ATOM   8206  C C    . LYS A 1 6  ? 10.571  2.930   5.121   1.00 0.41 ? 6   LYS A C    7  
ATOM   8207  O O    . LYS A 1 6  ? 11.345  2.866   4.167   1.00 0.42 ? 6   LYS A O    7  
ATOM   8208  C CB   . LYS A 1 6  ? 10.950  4.860   6.666   1.00 0.52 ? 6   LYS A CB   7  
ATOM   8209  C CG   . LYS A 1 6  ? 10.811  6.366   6.853   1.00 0.78 ? 6   LYS A CG   7  
ATOM   8210  C CD   . LYS A 1 6  ? 11.195  7.136   5.594   1.00 1.08 ? 6   LYS A CD   7  
ATOM   8211  C CE   . LYS A 1 6  ? 12.644  6.891   5.197   1.00 1.30 ? 6   LYS A CE   7  
ATOM   8212  N NZ   . LYS A 1 6  ? 13.025  7.664   3.982   1.00 1.91 ? 6   LYS A NZ   7  
ATOM   8213  H H    . LYS A 1 6  ? 8.518   4.058   7.060   1.00 0.51 ? 6   LYS A H    7  
ATOM   8214  H HA   . LYS A 1 6  ? 10.005  4.951   4.748   1.00 0.46 ? 6   LYS A HA   7  
ATOM   8215  H HB2  . LYS A 1 6  ? 10.727  4.383   7.609   1.00 0.72 ? 6   LYS A HB2  7  
ATOM   8216  H HB3  . LYS A 1 6  ? 11.975  4.645   6.400   1.00 0.62 ? 6   LYS A HB3  7  
ATOM   8217  H HG2  . LYS A 1 6  ? 9.786   6.594   7.101   1.00 1.09 ? 6   LYS A HG2  7  
ATOM   8218  H HG3  . LYS A 1 6  ? 11.454  6.677   7.663   1.00 0.83 ? 6   LYS A HG3  7  
ATOM   8219  H HD2  . LYS A 1 6  ? 10.555  6.827   4.784   1.00 1.25 ? 6   LYS A HD2  7  
ATOM   8220  H HD3  . LYS A 1 6  ? 11.057  8.193   5.777   1.00 1.41 ? 6   LYS A HD3  7  
ATOM   8221  H HE2  . LYS A 1 6  ? 13.284  7.187   6.015   1.00 1.39 ? 6   LYS A HE2  7  
ATOM   8222  H HE3  . LYS A 1 6  ? 12.777  5.838   4.998   1.00 1.37 ? 6   LYS A HE3  7  
ATOM   8223  H HZ1  . LYS A 1 6  ? 14.016  7.471   3.732   1.00 2.23 ? 6   LYS A HZ1  7  
ATOM   8224  H HZ2  . LYS A 1 6  ? 12.915  8.683   4.156   1.00 2.11 ? 6   LYS A HZ2  7  
ATOM   8225  H HZ3  . LYS A 1 6  ? 12.418  7.395   3.181   1.00 2.10 ? 6   LYS A HZ3  7  
ATOM   8226  N N    . VAL A 1 7  ? 10.159  1.860   5.799   1.00 0.40 ? 7   VAL A N    7  
ATOM   8227  C CA   . VAL A 1 7  ? 10.595  0.513   5.451   1.00 0.41 ? 7   VAL A CA   7  
ATOM   8228  C C    . VAL A 1 7  ? 10.000  0.069   4.119   1.00 0.37 ? 7   VAL A C    7  
ATOM   8229  O O    . VAL A 1 7  ? 10.562  -0.781  3.429   1.00 0.41 ? 7   VAL A O    7  
ATOM   8230  C CB   . VAL A 1 7  ? 10.199  -0.504  6.540   1.00 0.46 ? 7   VAL A CB   7  
ATOM   8231  C CG1  . VAL A 1 7  ? 10.839  -1.856  6.264   1.00 0.52 ? 7   VAL A CG1  7  
ATOM   8232  C CG2  . VAL A 1 7  ? 10.592  0.012   7.916   1.00 0.53 ? 7   VAL A CG2  7  
ATOM   8233  H H    . VAL A 1 7  ? 9.545   1.980   6.553   1.00 0.42 ? 7   VAL A H    7  
ATOM   8234  H HA   . VAL A 1 7  ? 11.672  0.521   5.370   1.00 0.46 ? 7   VAL A HA   7  
ATOM   8235  H HB   . VAL A 1 7  ? 9.126   -0.627  6.516   1.00 0.44 ? 7   VAL A HB   7  
ATOM   8236  H HG11 . VAL A 1 7  ? 11.914  -1.756  6.282   1.00 0.57 ? 7   VAL A HG11 7  
ATOM   8237  H HG12 . VAL A 1 7  ? 10.527  -2.211  5.294   1.00 0.49 ? 7   VAL A HG12 7  
ATOM   8238  H HG13 . VAL A 1 7  ? 10.531  -2.561  7.022   1.00 0.56 ? 7   VAL A HG13 7  
ATOM   8239  H HG21 . VAL A 1 7  ? 10.078  0.942   8.113   1.00 0.51 ? 7   VAL A HG21 7  
ATOM   8240  H HG22 . VAL A 1 7  ? 11.658  0.177   7.949   1.00 0.57 ? 7   VAL A HG22 7  
ATOM   8241  H HG23 . VAL A 1 7  ? 10.318  -0.716  8.666   1.00 0.58 ? 7   VAL A HG23 7  
ATOM   8242  N N    . ILE A 1 8  ? 8.861   0.659   3.759   1.00 0.34 ? 8   ILE A N    7  
ATOM   8243  C CA   . ILE A 1 8  ? 8.183   0.333   2.508   1.00 0.36 ? 8   ILE A CA   7  
ATOM   8244  C C    . ILE A 1 8  ? 8.603   1.294   1.392   1.00 0.34 ? 8   ILE A C    7  
ATOM   8245  O O    . ILE A 1 8  ? 8.696   0.902   0.229   1.00 0.34 ? 8   ILE A O    7  
ATOM   8246  C CB   . ILE A 1 8  ? 6.644   0.366   2.676   1.00 0.43 ? 8   ILE A CB   7  
ATOM   8247  C CG1  . ILE A 1 8  ? 6.194   -0.676  3.707   1.00 0.57 ? 8   ILE A CG1  7  
ATOM   8248  C CG2  . ILE A 1 8  ? 5.941   0.132   1.345   1.00 0.61 ? 8   ILE A CG2  7  
ATOM   8249  C CD1  . ILE A 1 8  ? 6.543   -2.104  3.333   1.00 0.78 ? 8   ILE A CD1  7  
ATOM   8250  H H    . ILE A 1 8  ? 8.464   1.329   4.355   1.00 0.34 ? 8   ILE A H    7  
ATOM   8251  H HA   . ILE A 1 8  ? 8.471   -0.670  2.227   1.00 0.39 ? 8   ILE A HA   7  
ATOM   8252  H HB   . ILE A 1 8  ? 6.368   1.349   3.029   1.00 0.58 ? 8   ILE A HB   7  
ATOM   8253  H HG12 . ILE A 1 8  ? 6.665   -0.461  4.655   1.00 0.73 ? 8   ILE A HG12 7  
ATOM   8254  H HG13 . ILE A 1 8  ? 5.121   -0.617  3.823   1.00 0.61 ? 8   ILE A HG13 7  
ATOM   8255  H HG21 . ILE A 1 8  ? 4.871   0.188   1.487   1.00 1.01 ? 8   ILE A HG21 7  
ATOM   8256  H HG22 . ILE A 1 8  ? 6.204   -0.844  0.965   1.00 1.07 ? 8   ILE A HG22 7  
ATOM   8257  H HG23 . ILE A 1 8  ? 6.249   0.889   0.637   1.00 1.06 ? 8   ILE A HG23 7  
ATOM   8258  H HD11 . ILE A 1 8  ? 7.615   -2.231  3.359   1.00 0.95 ? 8   ILE A HD11 7  
ATOM   8259  H HD12 . ILE A 1 8  ? 6.180   -2.313  2.338   1.00 0.89 ? 8   ILE A HD12 7  
ATOM   8260  H HD13 . ILE A 1 8  ? 6.083   -2.784  4.036   1.00 1.07 ? 8   ILE A HD13 7  
ATOM   8261  N N    . SER A 1 9  ? 8.873   2.550   1.757   1.00 0.36 ? 9   SER A N    7  
ATOM   8262  C CA   . SER A 1 9  ? 9.285   3.562   0.783   1.00 0.37 ? 9   SER A CA   7  
ATOM   8263  C C    . SER A 1 9  ? 10.672  3.249   0.225   1.00 0.35 ? 9   SER A C    7  
ATOM   8264  O O    . SER A 1 9  ? 10.957  3.521   -0.941  1.00 0.36 ? 9   SER A O    7  
ATOM   8265  C CB   . SER A 1 9  ? 9.279   4.953   1.420   1.00 0.43 ? 9   SER A CB   7  
ATOM   8266  O OG   . SER A 1 9  ? 9.345   5.966   0.433   1.00 0.49 ? 9   SER A OG   7  
ATOM   8267  H H    . SER A 1 9  ? 8.792   2.801   2.701   1.00 0.38 ? 9   SER A H    7  
ATOM   8268  H HA   . SER A 1 9  ? 8.574   3.545   -0.028  1.00 0.39 ? 9   SER A HA   7  
ATOM   8269  H HB2  . SER A 1 9  ? 8.371   5.083   1.990   1.00 0.45 ? 9   SER A HB2  7  
ATOM   8270  H HB3  . SER A 1 9  ? 10.132  5.049   2.075   1.00 0.44 ? 9   SER A HB3  7  
ATOM   8271  H HG   . SER A 1 9  ? 10.180  5.902   -0.037  1.00 0.81 ? 9   SER A HG   7  
ATOM   8272  N N    . SER A 1 10 ? 11.530  2.676   1.066   1.00 0.36 ? 10  SER A N    7  
ATOM   8273  C CA   . SER A 1 10 ? 12.880  2.312   0.651   1.00 0.37 ? 10  SER A CA   7  
ATOM   8274  C C    . SER A 1 10 ? 12.851  1.024   -0.166  1.00 0.35 ? 10  SER A C    7  
ATOM   8275  O O    . SER A 1 10 ? 13.736  0.773   -0.986  1.00 0.35 ? 10  SER A O    7  
ATOM   8276  C CB   . SER A 1 10 ? 13.786  2.139   1.873   1.00 0.43 ? 10  SER A CB   7  
ATOM   8277  O OG   . SER A 1 10 ? 15.133  1.931   1.485   1.00 0.46 ? 10  SER A OG   7  
ATOM   8278  H H    . SER A 1 10 ? 11.247  2.495   1.987   1.00 0.38 ? 10  SER A H    7  
ATOM   8279  H HA   . SER A 1 10 ? 13.266  3.109   0.034   1.00 0.37 ? 10  SER A HA   7  
ATOM   8280  H HB2  . SER A 1 10 ? 13.733  3.025   2.487   1.00 0.45 ? 10  SER A HB2  7  
ATOM   8281  H HB3  . SER A 1 10 ? 13.455  1.284   2.444   1.00 0.44 ? 10  SER A HB3  7  
ATOM   8282  H HG   . SER A 1 10 ? 15.190  1.152   0.927   1.00 0.67 ? 10  SER A HG   7  
ATOM   8283  N N    . ALA A 1 11 ? 11.821  0.213   0.068   1.00 0.35 ? 11  ALA A N    7  
ATOM   8284  C CA   . ALA A 1 11 ? 11.653  -1.049  -0.643  1.00 0.36 ? 11  ALA A CA   7  
ATOM   8285  C C    . ALA A 1 11 ? 11.210  -0.813  -2.084  1.00 0.31 ? 11  ALA A C    7  
ATOM   8286  O O    . ALA A 1 11 ? 11.787  -1.369  -3.015  1.00 0.33 ? 11  ALA A O    7  
ATOM   8287  C CB   . ALA A 1 11 ? 10.645  -1.935  0.079   1.00 0.40 ? 11  ALA A CB   7  
ATOM   8288  H H    . ALA A 1 11 ? 11.155  0.474   0.738   1.00 0.36 ? 11  ALA A H    7  
ATOM   8289  H HA   . ALA A 1 11 ? 12.606  -1.559  -0.648  1.00 0.39 ? 11  ALA A HA   7  
ATOM   8290  H HB1  . ALA A 1 11 ? 9.678   -1.455  0.077   1.00 0.38 ? 11  ALA A HB1  7  
ATOM   8291  H HB2  . ALA A 1 11 ? 10.967  -2.091  1.097   1.00 0.44 ? 11  ALA A HB2  7  
ATOM   8292  H HB3  . ALA A 1 11 ? 10.576  -2.887  -0.427  1.00 0.42 ? 11  ALA A HB3  7  
ATOM   8293  N N    . CYS A 1 12 ? 10.187  0.028   -2.259  1.00 0.28 ? 12  CYS A N    7  
ATOM   8294  C CA   . CYS A 1 12 ? 9.653   0.332   -3.586  1.00 0.26 ? 12  CYS A CA   7  
ATOM   8295  C C    . CYS A 1 12 ? 10.621  1.185   -4.406  1.00 0.25 ? 12  CYS A C    7  
ATOM   8296  O O    . CYS A 1 12 ? 10.437  1.360   -5.606  1.00 0.26 ? 12  CYS A O    7  
ATOM   8297  C CB   . CYS A 1 12 ? 8.295   1.032   -3.473  1.00 0.28 ? 12  CYS A CB   7  
ATOM   8298  S SG   . CYS A 1 12 ? 8.321   2.566   -2.520  1.00 0.26 ? 12  CYS A SG   7  
ATOM   8299  H H    . CYS A 1 12 ? 9.781   0.455   -1.473  1.00 0.29 ? 12  CYS A H    7  
ATOM   8300  H HA   . CYS A 1 12 ? 9.511   -0.607  -4.099  1.00 0.29 ? 12  CYS A HA   7  
ATOM   8301  H HB2  . CYS A 1 12 ? 7.940   1.271   -4.464  1.00 0.29 ? 12  CYS A HB2  7  
ATOM   8302  H HB3  . CYS A 1 12 ? 7.593   0.362   -2.998  1.00 0.34 ? 12  CYS A HB3  7  
ATOM   8303  H HG   . CYS A 1 12 ? 9.496   3.150   -2.711  1.00 1.12 ? 12  CYS A HG   7  
ATOM   8304  N N    . LYS A 1 13 ? 11.650  1.714   -3.756  1.00 0.25 ? 13  LYS A N    7  
ATOM   8305  C CA   . LYS A 1 13 ? 12.651  2.527   -4.439  1.00 0.26 ? 13  LYS A CA   7  
ATOM   8306  C C    . LYS A 1 13 ? 13.661  1.621   -5.157  1.00 0.31 ? 13  LYS A C    7  
ATOM   8307  O O    . LYS A 1 13 ? 14.474  2.081   -5.961  1.00 0.35 ? 13  LYS A O    7  
ATOM   8308  C CB   . LYS A 1 13 ? 13.364  3.429   -3.425  1.00 0.29 ? 13  LYS A CB   7  
ATOM   8309  C CG   . LYS A 1 13 ? 14.269  4.478   -4.051  1.00 0.79 ? 13  LYS A CG   7  
ATOM   8310  C CD   . LYS A 1 13 ? 14.995  5.287   -2.987  1.00 1.28 ? 13  LYS A CD   7  
ATOM   8311  C CE   . LYS A 1 13 ? 16.060  6.186   -3.596  1.00 1.89 ? 13  LYS A CE   7  
ATOM   8312  N NZ   . LYS A 1 13 ? 17.138  5.399   -4.256  1.00 2.67 ? 13  LYS A NZ   7  
ATOM   8313  H H    . LYS A 1 13 ? 11.739  1.557   -2.792  1.00 0.28 ? 13  LYS A H    7  
ATOM   8314  H HA   . LYS A 1 13 ? 12.145  3.139   -5.170  1.00 0.25 ? 13  LYS A HA   7  
ATOM   8315  H HB2  . LYS A 1 13 ? 12.618  3.940   -2.835  1.00 0.60 ? 13  LYS A HB2  7  
ATOM   8316  H HB3  . LYS A 1 13 ? 13.963  2.812   -2.773  1.00 0.66 ? 13  LYS A HB3  7  
ATOM   8317  H HG2  . LYS A 1 13 ? 14.999  3.984   -4.675  1.00 1.52 ? 13  LYS A HG2  7  
ATOM   8318  H HG3  . LYS A 1 13 ? 13.670  5.146   -4.654  1.00 0.94 ? 13  LYS A HG3  7  
ATOM   8319  H HD2  . LYS A 1 13 ? 14.279  5.901   -2.464  1.00 1.26 ? 13  LYS A HD2  7  
ATOM   8320  H HD3  . LYS A 1 13 ? 15.466  4.608   -2.291  1.00 1.89 ? 13  LYS A HD3  7  
ATOM   8321  H HE2  . LYS A 1 13 ? 15.594  6.828   -4.329  1.00 2.36 ? 13  LYS A HE2  7  
ATOM   8322  H HE3  . LYS A 1 13 ? 16.494  6.790   -2.813  1.00 1.74 ? 13  LYS A HE3  7  
ATOM   8323  H HZ1  . LYS A 1 13 ? 17.594  4.770   -3.566  1.00 2.68 ? 13  LYS A HZ1  7  
ATOM   8324  H HZ2  . LYS A 1 13 ? 17.856  6.039   -4.652  1.00 3.10 ? 13  LYS A HZ2  7  
ATOM   8325  H HZ3  . LYS A 1 13 ? 16.740  4.825   -5.026  1.00 3.07 ? 13  LYS A HZ3  7  
ATOM   8326  N N    . THR A 1 14 ? 13.578  0.324   -4.868  1.00 0.33 ? 14  THR A N    7  
ATOM   8327  C CA   . THR A 1 14 ? 14.470  -0.670  -5.452  1.00 0.39 ? 14  THR A CA   7  
ATOM   8328  C C    . THR A 1 14 ? 13.713  -1.601  -6.393  1.00 0.41 ? 14  THR A C    7  
ATOM   8329  O O    . THR A 1 14 ? 14.319  -2.370  -7.140  1.00 0.46 ? 14  THR A O    7  
ATOM   8330  C CB   . THR A 1 14 ? 15.163  -1.511  -4.363  1.00 0.43 ? 14  THR A CB   7  
ATOM   8331  O OG1  . THR A 1 14 ? 15.771  -0.652  -3.395  1.00 0.44 ? 14  THR A OG1  7  
ATOM   8332  C CG2  . THR A 1 14 ? 16.216  -2.422  -4.974  1.00 0.50 ? 14  THR A CG2  7  
ATOM   8333  H H    . THR A 1 14 ? 12.891  0.027   -4.236  1.00 0.32 ? 14  THR A H    7  
ATOM   8334  H HA   . THR A 1 14 ? 15.230  -0.148  -6.013  1.00 0.41 ? 14  THR A HA   7  
ATOM   8335  H HB   . THR A 1 14 ? 14.419  -2.123  -3.873  1.00 0.42 ? 14  THR A HB   7  
ATOM   8336  H HG1  . THR A 1 14 ? 15.174  -0.532  -2.653  1.00 0.42 ? 14  THR A HG1  7  
ATOM   8337  H HG21 . THR A 1 14 ? 15.751  -3.073  -5.701  1.00 0.50 ? 14  THR A HG21 7  
ATOM   8338  H HG22 . THR A 1 14 ? 16.671  -3.019  -4.197  1.00 0.53 ? 14  THR A HG22 7  
ATOM   8339  H HG23 . THR A 1 14 ? 16.973  -1.823  -5.458  1.00 0.51 ? 14  THR A HG23 7  
ATOM   8340  N N    . TYR A 1 15 ? 12.386  -1.527  -6.354  1.00 0.37 ? 15  TYR A N    7  
ATOM   8341  C CA   . TYR A 1 15 ? 11.549  -2.364  -7.202  1.00 0.40 ? 15  TYR A CA   7  
ATOM   8342  C C    . TYR A 1 15 ? 10.757  -1.517  -8.192  1.00 0.39 ? 15  TYR A C    7  
ATOM   8343  O O    . TYR A 1 15 ? 10.060  -2.042  -9.059  1.00 0.43 ? 15  TYR A O    7  
ATOM   8344  C CB   . TYR A 1 15 ? 10.591  -3.197  -6.346  1.00 0.39 ? 15  TYR A CB   7  
ATOM   8345  C CG   . TYR A 1 15 ? 11.282  -4.266  -5.532  1.00 0.43 ? 15  TYR A CG   7  
ATOM   8346  C CD1  . TYR A 1 15 ? 11.166  -4.296  -4.147  1.00 0.41 ? 15  TYR A CD1  7  
ATOM   8347  C CD2  . TYR A 1 15 ? 12.053  -5.246  -6.146  1.00 0.49 ? 15  TYR A CD2  7  
ATOM   8348  C CE1  . TYR A 1 15 ? 11.796  -5.272  -3.399  1.00 0.46 ? 15  TYR A CE1  7  
ATOM   8349  C CE2  . TYR A 1 15 ? 12.685  -6.226  -5.407  1.00 0.52 ? 15  TYR A CE2  7  
ATOM   8350  C CZ   . TYR A 1 15 ? 12.553  -6.235  -4.032  1.00 0.51 ? 15  TYR A CZ   7  
ATOM   8351  O OH   . TYR A 1 15 ? 13.184  -7.208  -3.291  1.00 0.56 ? 15  TYR A OH   7  
ATOM   8352  H H    . TYR A 1 15 ? 11.962  -0.893  -5.739  1.00 0.33 ? 15  TYR A H    7  
ATOM   8353  H HA   . TYR A 1 15 ? 12.196  -3.029  -7.753  1.00 0.45 ? 15  TYR A HA   7  
ATOM   8354  H HB2  . TYR A 1 15 ? 10.071  -2.544  -5.662  1.00 0.35 ? 15  TYR A HB2  7  
ATOM   8355  H HB3  . TYR A 1 15 ? 9.872   -3.681  -6.991  1.00 0.42 ? 15  TYR A HB3  7  
ATOM   8356  H HD1  . TYR A 1 15 ? 10.571  -3.542  -3.654  1.00 0.38 ? 15  TYR A HD1  7  
ATOM   8357  H HD2  . TYR A 1 15 ? 12.154  -5.236  -7.221  1.00 0.51 ? 15  TYR A HD2  7  
ATOM   8358  H HE1  . TYR A 1 15 ? 11.693  -5.278  -2.324  1.00 0.47 ? 15  TYR A HE1  7  
ATOM   8359  H HE2  . TYR A 1 15 ? 13.277  -6.979  -5.903  1.00 0.57 ? 15  TYR A HE2  7  
ATOM   8360  H HH   . TYR A 1 15 ? 12.589  -7.528  -2.608  1.00 0.57 ? 15  TYR A HH   7  
ATOM   8361  N N    . CYS A 1 16 ? 10.869  -0.199  -8.056  1.00 0.35 ? 16  CYS A N    7  
ATOM   8362  C CA   . CYS A 1 16 ? 10.165  0.725   -8.939  1.00 0.36 ? 16  CYS A CA   7  
ATOM   8363  C C    . CYS A 1 16 ? 11.065  1.889   -9.338  1.00 0.37 ? 16  CYS A C    7  
ATOM   8364  O O    . CYS A 1 16 ? 11.178  2.223   -10.516 1.00 0.42 ? 16  CYS A O    7  
ATOM   8365  C CB   . CYS A 1 16 ? 8.901   1.252   -8.254  1.00 0.32 ? 16  CYS A CB   7  
ATOM   8366  S SG   . CYS A 1 16 ? 7.929   -0.023  -7.417  1.00 0.32 ? 16  CYS A SG   7  
ATOM   8367  H H    . CYS A 1 16 ? 11.439  0.160   -7.346  1.00 0.33 ? 16  CYS A H    7  
ATOM   8368  H HA   . CYS A 1 16 ? 9.881   0.181   -9.828  1.00 0.41 ? 16  CYS A HA   7  
ATOM   8369  H HB2  . CYS A 1 16 ? 9.182   1.986   -7.516  1.00 0.28 ? 16  CYS A HB2  7  
ATOM   8370  H HB3  . CYS A 1 16 ? 8.268   1.717   -8.994  1.00 0.35 ? 16  CYS A HB3  7  
ATOM   8371  H HG   . CYS A 1 16 ? 8.270   -0.023  -6.137  1.00 0.27 ? 16  CYS A HG   7  
ATOM   8372  N N    . GLY A 1 17 ? 11.703  2.504   -8.348  1.00 0.33 ? 17  GLY A N    7  
ATOM   8373  C CA   . GLY A 1 17 ? 12.584  3.626   -8.616  1.00 0.34 ? 17  GLY A CA   7  
ATOM   8374  C C    . GLY A 1 17 ? 11.908  4.962   -8.384  1.00 0.32 ? 17  GLY A C    7  
ATOM   8375  O O    . GLY A 1 17 ? 11.329  5.198   -7.321  1.00 0.27 ? 17  GLY A O    7  
ATOM   8376  H H    . GLY A 1 17 ? 11.572  2.195   -7.427  1.00 0.29 ? 17  GLY A H    7  
ATOM   8377  H HA2  . GLY A 1 17 ? 13.447  3.554   -7.971  1.00 0.34 ? 17  GLY A HA2  7  
ATOM   8378  H HA3  . GLY A 1 17 ? 12.910  3.575   -9.645  1.00 0.39 ? 17  GLY A HA3  7  
ATOM   8379  N N    . LYS A 1 18 ? 11.981  5.841   -9.376  1.00 0.36 ? 18  LYS A N    7  
ATOM   8380  C CA   . LYS A 1 18 ? 11.371  7.164   -9.275  1.00 0.36 ? 18  LYS A CA   7  
ATOM   8381  C C    . LYS A 1 18 ? 9.855   7.073   -9.394  1.00 0.36 ? 18  LYS A C    7  
ATOM   8382  O O    . LYS A 1 18 ? 9.132   7.970   -8.960  1.00 0.36 ? 18  LYS A O    7  
ATOM   8383  C CB   . LYS A 1 18 ? 11.925  8.087   -10.363 1.00 0.43 ? 18  LYS A CB   7  
ATOM   8384  C CG   . LYS A 1 18 ? 11.840  7.500   -11.761 1.00 0.48 ? 18  LYS A CG   7  
ATOM   8385  C CD   . LYS A 1 18 ? 13.197  7.024   -12.251 1.00 0.52 ? 18  LYS A CD   7  
ATOM   8386  C CE   . LYS A 1 18 ? 13.774  7.965   -13.297 1.00 0.58 ? 18  LYS A CE   7  
ATOM   8387  N NZ   . LYS A 1 18 ? 15.191  8.319   -13.004 1.00 0.59 ? 18  LYS A NZ   7  
ATOM   8388  H H    . LYS A 1 18 ? 12.456  5.595   -10.197 1.00 0.40 ? 18  LYS A H    7  
ATOM   8389  H HA   . LYS A 1 18 ? 11.621  7.571   -8.307  1.00 0.34 ? 18  LYS A HA   7  
ATOM   8390  H HB2  . LYS A 1 18 ? 11.369  9.012   -10.351 1.00 0.43 ? 18  LYS A HB2  7  
ATOM   8391  H HB3  . LYS A 1 18 ? 12.962  8.299   -10.147 1.00 0.43 ? 18  LYS A HB3  7  
ATOM   8392  H HG2  . LYS A 1 18 ? 11.160  6.661   -11.747 1.00 0.47 ? 18  LYS A HG2  7  
ATOM   8393  H HG3  . LYS A 1 18 ? 11.467  8.256   -12.436 1.00 0.52 ? 18  LYS A HG3  7  
ATOM   8394  H HD2  . LYS A 1 18 ? 13.876  6.973   -11.413 1.00 0.49 ? 18  LYS A HD2  7  
ATOM   8395  H HD3  . LYS A 1 18 ? 13.087  6.041   -12.686 1.00 0.53 ? 18  LYS A HD3  7  
ATOM   8396  H HE2  . LYS A 1 18 ? 13.724  7.486   -14.263 1.00 0.62 ? 18  LYS A HE2  7  
ATOM   8397  H HE3  . LYS A 1 18 ? 13.184  8.870   -13.314 1.00 0.58 ? 18  LYS A HE3  7  
ATOM   8398  H HZ1  . LYS A 1 18 ? 15.777  7.459   -12.987 1.00 0.60 ? 18  LYS A HZ1  7  
ATOM   8399  H HZ2  . LYS A 1 18 ? 15.260  8.787   -12.078 1.00 0.56 ? 18  LYS A HZ2  7  
ATOM   8400  H HZ3  . LYS A 1 18 ? 15.557  8.963   -13.733 1.00 0.64 ? 18  LYS A HZ3  7  
ATOM   8401  N N    . THR A 1 19 ? 9.375   5.983   -9.986  1.00 0.37 ? 19  THR A N    7  
ATOM   8402  C CA   . THR A 1 19 ? 7.943   5.775   -10.160 1.00 0.39 ? 19  THR A CA   7  
ATOM   8403  C C    . THR A 1 19 ? 7.268   5.446   -8.834  1.00 0.33 ? 19  THR A C    7  
ATOM   8404  O O    . THR A 1 19 ? 6.060   5.630   -8.679  1.00 0.43 ? 19  THR A O    7  
ATOM   8405  C CB   . THR A 1 19 ? 7.658   4.640   -11.164 1.00 0.46 ? 19  THR A CB   7  
ATOM   8406  O OG1  . THR A 1 19 ? 7.830   3.369   -10.526 1.00 0.53 ? 19  THR A OG1  7  
ATOM   8407  C CG2  . THR A 1 19 ? 8.583   4.739   -12.368 1.00 0.61 ? 19  THR A CG2  7  
ATOM   8408  H H    . THR A 1 19 ? 9.999   5.301   -10.310 1.00 0.39 ? 19  THR A H    7  
ATOM   8409  H HA   . THR A 1 19 ? 7.519   6.689   -10.551 1.00 0.42 ? 19  THR A HA   7  
ATOM   8410  H HB   . THR A 1 19 ? 6.636   4.729   -11.505 1.00 0.49 ? 19  THR A HB   7  
ATOM   8411  H HG1  . THR A 1 19 ? 8.303   2.777   -11.116 1.00 0.54 ? 19  THR A HG1  7  
ATOM   8412  H HG21 . THR A 1 19 ? 8.342   3.956   -13.071 1.00 0.66 ? 19  THR A HG21 7  
ATOM   8413  H HG22 . THR A 1 19 ? 9.607   4.631   -12.044 1.00 0.68 ? 19  THR A HG22 7  
ATOM   8414  H HG23 . THR A 1 19 ? 8.455   5.701   -12.843 1.00 0.69 ? 19  THR A HG23 7  
ATOM   8415  N N    . SER A 1 20 ? 8.067   4.976   -7.866  1.00 0.30 ? 20  SER A N    7  
ATOM   8416  C CA   . SER A 1 20 ? 7.569   4.592   -6.536  1.00 0.24 ? 20  SER A CA   7  
ATOM   8417  C C    . SER A 1 20 ? 6.762   5.711   -5.869  1.00 0.22 ? 20  SER A C    7  
ATOM   8418  O O    . SER A 1 20 ? 6.991   6.894   -6.128  1.00 0.26 ? 20  SER A O    7  
ATOM   8419  C CB   . SER A 1 20 ? 8.741   4.202   -5.632  1.00 0.22 ? 20  SER A CB   7  
ATOM   8420  O OG   . SER A 1 20 ? 9.480   5.340   -5.227  1.00 0.25 ? 20  SER A OG   7  
ATOM   8421  H H    . SER A 1 20 ? 9.025   4.887   -8.051  1.00 0.38 ? 20  SER A H    7  
ATOM   8422  H HA   . SER A 1 20 ? 6.927   3.734   -6.662  1.00 0.26 ? 20  SER A HA   7  
ATOM   8423  H HB2  . SER A 1 20 ? 8.363   3.704   -4.751  1.00 0.26 ? 20  SER A HB2  7  
ATOM   8424  H HB3  . SER A 1 20 ? 9.398   3.534   -6.167  1.00 0.24 ? 20  SER A HB3  7  
ATOM   8425  H HG   . SER A 1 20 ? 8.906   6.110   -5.221  1.00 0.41 ? 20  SER A HG   7  
ATOM   8426  N N    . PRO A 1 21 ? 5.808   5.341   -4.987  1.00 0.20 ? 21  PRO A N    7  
ATOM   8427  C CA   . PRO A 1 21 ? 4.965   6.310   -4.278  1.00 0.22 ? 21  PRO A CA   7  
ATOM   8428  C C    . PRO A 1 21 ? 5.748   7.103   -3.234  1.00 0.22 ? 21  PRO A C    7  
ATOM   8429  O O    . PRO A 1 21 ? 6.826   6.692   -2.803  1.00 0.24 ? 21  PRO A O    7  
ATOM   8430  C CB   . PRO A 1 21 ? 3.908   5.433   -3.601  1.00 0.23 ? 21  PRO A CB   7  
ATOM   8431  C CG   . PRO A 1 21 ? 4.549   4.100   -3.446  1.00 0.21 ? 21  PRO A CG   7  
ATOM   8432  C CD   . PRO A 1 21 ? 5.483   3.948   -4.613  1.00 0.20 ? 21  PRO A CD   7  
ATOM   8433  H HA   . PRO A 1 21 ? 4.486   6.992   -4.963  1.00 0.26 ? 21  PRO A HA   7  
ATOM   8434  H HB2  . PRO A 1 21 ? 3.645   5.853   -2.638  1.00 0.25 ? 21  PRO A HB2  7  
ATOM   8435  H HB3  . PRO A 1 21 ? 3.035   5.354   -4.227  1.00 0.26 ? 21  PRO A HB3  7  
ATOM   8436  H HG2  . PRO A 1 21 ? 5.099   4.066   -2.515  1.00 0.21 ? 21  PRO A HG2  7  
ATOM   8437  H HG3  . PRO A 1 21 ? 3.800   3.325   -3.471  1.00 0.24 ? 21  PRO A HG3  7  
ATOM   8438  H HD2  . PRO A 1 21 ? 6.372   3.411   -4.316  1.00 0.21 ? 21  PRO A HD2  7  
ATOM   8439  H HD3  . PRO A 1 21 ? 4.989   3.438   -5.425  1.00 0.24 ? 21  PRO A HD3  7  
ATOM   8440  N N    . SER A 1 22 ? 5.193   8.239   -2.831  1.00 0.24 ? 22  SER A N    7  
ATOM   8441  C CA   . SER A 1 22 ? 5.836   9.099   -1.846  1.00 0.26 ? 22  SER A CA   7  
ATOM   8442  C C    . SER A 1 22 ? 5.421   8.721   -0.426  1.00 0.23 ? 22  SER A C    7  
ATOM   8443  O O    . SER A 1 22 ? 4.527   7.897   -0.225  1.00 0.23 ? 22  SER A O    7  
ATOM   8444  C CB   . SER A 1 22 ? 5.482   10.561  -2.114  1.00 0.31 ? 22  SER A CB   7  
ATOM   8445  O OG   . SER A 1 22 ? 4.077   10.757  -2.110  1.00 0.32 ? 22  SER A OG   7  
ATOM   8446  H H    . SER A 1 22 ? 4.327   8.507   -3.205  1.00 0.26 ? 22  SER A H    7  
ATOM   8447  H HA   . SER A 1 22 ? 6.904   8.974   -1.942  1.00 0.29 ? 22  SER A HA   7  
ATOM   8448  H HB2  . SER A 1 22 ? 5.919   11.181  -1.346  1.00 0.34 ? 22  SER A HB2  7  
ATOM   8449  H HB3  . SER A 1 22 ? 5.871   10.855  -3.078  1.00 0.35 ? 22  SER A HB3  7  
ATOM   8450  H HG   . SER A 1 22 ? 3.764   10.851  -3.012  1.00 0.54 ? 22  SER A HG   7  
ATOM   8451  N N    . LYS A 1 23 ? 6.084   9.334   0.551   1.00 0.24 ? 23  LYS A N    7  
ATOM   8452  C CA   . LYS A 1 23 ? 5.793   9.090   1.960   1.00 0.25 ? 23  LYS A CA   7  
ATOM   8453  C C    . LYS A 1 23 ? 4.423   9.659   2.331   1.00 0.23 ? 23  LYS A C    7  
ATOM   8454  O O    . LYS A 1 23 ? 3.721   9.111   3.182   1.00 0.26 ? 23  LYS A O    7  
ATOM   8455  C CB   . LYS A 1 23 ? 6.886   9.721   2.830   1.00 0.29 ? 23  LYS A CB   7  
ATOM   8456  C CG   . LYS A 1 23 ? 6.592   9.691   4.322   1.00 0.41 ? 23  LYS A CG   7  
ATOM   8457  C CD   . LYS A 1 23 ? 7.558   10.578  5.089   1.00 0.87 ? 23  LYS A CD   7  
ATOM   8458  C CE   . LYS A 1 23 ? 7.082   10.831  6.509   1.00 1.02 ? 23  LYS A CE   7  
ATOM   8459  N NZ   . LYS A 1 23 ? 7.899   11.874  7.186   1.00 1.62 ? 23  LYS A NZ   7  
ATOM   8460  H H    . LYS A 1 23 ? 6.791   9.973   0.317   1.00 0.26 ? 23  LYS A H    7  
ATOM   8461  H HA   . LYS A 1 23 ? 5.785   8.021   2.120   1.00 0.27 ? 23  LYS A HA   7  
ATOM   8462  H HB2  . LYS A 1 23 ? 7.812   9.192   2.660   1.00 0.35 ? 23  LYS A HB2  7  
ATOM   8463  H HB3  . LYS A 1 23 ? 7.013   10.751  2.532   1.00 0.34 ? 23  LYS A HB3  7  
ATOM   8464  H HG2  . LYS A 1 23 ? 5.584   10.041  4.489   1.00 0.71 ? 23  LYS A HG2  7  
ATOM   8465  H HG3  . LYS A 1 23 ? 6.689   8.676   4.679   1.00 0.67 ? 23  LYS A HG3  7  
ATOM   8466  H HD2  . LYS A 1 23 ? 8.523   10.096  5.126   1.00 1.16 ? 23  LYS A HD2  7  
ATOM   8467  H HD3  . LYS A 1 23 ? 7.645   11.523  4.575   1.00 1.26 ? 23  LYS A HD3  7  
ATOM   8468  H HE2  . LYS A 1 23 ? 6.052   11.156  6.479   1.00 1.11 ? 23  LYS A HE2  7  
ATOM   8469  H HE3  . LYS A 1 23 ? 7.151   9.910   7.068   1.00 1.06 ? 23  LYS A HE3  7  
ATOM   8470  H HZ1  . LYS A 1 23 ? 7.532   12.052  8.143   1.00 1.74 ? 23  LYS A HZ1  7  
ATOM   8471  H HZ2  . LYS A 1 23 ? 7.869   12.760  6.643   1.00 1.95 ? 23  LYS A HZ2  7  
ATOM   8472  H HZ3  . LYS A 1 23 ? 8.889   11.560  7.259   1.00 1.88 ? 23  LYS A HZ3  7  
ATOM   8473  N N    . LYS A 1 24 ? 4.051   10.757  1.674   1.00 0.20 ? 24  LYS A N    7  
ATOM   8474  C CA   . LYS A 1 24 ? 2.769   11.407  1.922   1.00 0.21 ? 24  LYS A CA   7  
ATOM   8475  C C    . LYS A 1 24 ? 1.614   10.577  1.365   1.00 0.20 ? 24  LYS A C    7  
ATOM   8476  O O    . LYS A 1 24 ? 0.509   10.598  1.909   1.00 0.22 ? 24  LYS A O    7  
ATOM   8477  C CB   . LYS A 1 24 ? 2.762   12.808  1.310   1.00 0.24 ? 24  LYS A CB   7  
ATOM   8478  C CG   . LYS A 1 24 ? 3.617   13.805  2.077   1.00 0.43 ? 24  LYS A CG   7  
ATOM   8479  C CD   . LYS A 1 24 ? 3.944   15.033  1.239   1.00 0.79 ? 24  LYS A CD   7  
ATOM   8480  C CE   . LYS A 1 24 ? 4.831   14.680  0.057   1.00 1.35 ? 24  LYS A CE   7  
ATOM   8481  N NZ   . LYS A 1 24 ? 5.635   15.843  -0.406  1.00 2.01 ? 24  LYS A NZ   7  
ATOM   8482  H H    . LYS A 1 24 ? 4.658   11.140  1.006   1.00 0.20 ? 24  LYS A H    7  
ATOM   8483  H HA   . LYS A 1 24 ? 2.646   11.493  2.992   1.00 0.24 ? 24  LYS A HA   7  
ATOM   8484  H HB2  . LYS A 1 24 ? 3.133   12.749  0.297   1.00 0.37 ? 24  LYS A HB2  7  
ATOM   8485  H HB3  . LYS A 1 24 ? 1.747   13.176  1.291   1.00 0.38 ? 24  LYS A HB3  7  
ATOM   8486  H HG2  . LYS A 1 24 ? 3.083   14.119  2.960   1.00 0.80 ? 24  LYS A HG2  7  
ATOM   8487  H HG3  . LYS A 1 24 ? 4.540   13.323  2.366   1.00 0.81 ? 24  LYS A HG3  7  
ATOM   8488  H HD2  . LYS A 1 24 ? 3.022   15.460  0.869   1.00 1.14 ? 24  LYS A HD2  7  
ATOM   8489  H HD3  . LYS A 1 24 ? 4.454   15.755  1.859   1.00 0.95 ? 24  LYS A HD3  7  
ATOM   8490  H HE2  . LYS A 1 24 ? 5.502   13.887  0.353   1.00 1.59 ? 24  LYS A HE2  7  
ATOM   8491  H HE3  . LYS A 1 24 ? 4.208   14.338  -0.755  1.00 1.51 ? 24  LYS A HE3  7  
ATOM   8492  H HZ1  . LYS A 1 24 ? 6.252   16.179  0.361   1.00 2.09 ? 24  LYS A HZ1  7  
ATOM   8493  H HZ2  . LYS A 1 24 ? 5.007   16.619  -0.695  1.00 2.20 ? 24  LYS A HZ2  7  
ATOM   8494  H HZ3  . LYS A 1 24 ? 6.226   15.569  -1.218  1.00 2.49 ? 24  LYS A HZ3  7  
ATOM   8495  N N    . GLU A 1 25 ? 1.871   9.849   0.277   1.00 0.18 ? 25  GLU A N    7  
ATOM   8496  C CA   . GLU A 1 25 ? 0.851   9.001   -0.329  1.00 0.17 ? 25  GLU A CA   7  
ATOM   8497  C C    . GLU A 1 25 ? 0.563   7.785   0.546   1.00 0.16 ? 25  GLU A C    7  
ATOM   8498  O O    . GLU A 1 25 ? -0.554  7.610   1.035   1.00 0.17 ? 25  GLU A O    7  
ATOM   8499  C CB   . GLU A 1 25 ? 1.297   8.545   -1.721  1.00 0.17 ? 25  GLU A CB   7  
ATOM   8500  C CG   . GLU A 1 25 ? 0.425   9.078   -2.845  1.00 0.19 ? 25  GLU A CG   7  
ATOM   8501  C CD   . GLU A 1 25 ? 0.655   8.353   -4.155  1.00 0.18 ? 25  GLU A CD   7  
ATOM   8502  O OE1  . GLU A 1 25 ? 0.449   8.974   -5.220  1.00 0.26 ? 25  GLU A OE1  7  
ATOM   8503  O OE2  . GLU A 1 25 ? 1.039   7.166   -4.119  1.00 0.21 ? 25  GLU A OE2  7  
ATOM   8504  H H    . GLU A 1 25 ? 2.766   9.884   -0.123  1.00 0.18 ? 25  GLU A H    7  
ATOM   8505  H HA   . GLU A 1 25 ? -0.052  9.585   -0.423  1.00 0.17 ? 25  GLU A HA   7  
ATOM   8506  H HB2  . GLU A 1 25 ? 2.310   8.882   -1.890  1.00 0.19 ? 25  GLU A HB2  7  
ATOM   8507  H HB3  . GLU A 1 25 ? 1.276   7.467   -1.758  1.00 0.18 ? 25  GLU A HB3  7  
ATOM   8508  H HG2  . GLU A 1 25 ? -0.612  8.962   -2.564  1.00 0.23 ? 25  GLU A HG2  7  
ATOM   8509  H HG3  . GLU A 1 25 ? 0.643   10.127  -2.986  1.00 0.23 ? 25  GLU A HG3  7  
ATOM   8510  N N    . ILE A 1 26 ? 1.577   6.950   0.742   1.00 0.16 ? 26  ILE A N    7  
ATOM   8511  C CA   . ILE A 1 26 ? 1.432   5.751   1.558   1.00 0.15 ? 26  ILE A CA   7  
ATOM   8512  C C    . ILE A 1 26 ? 0.838   6.084   2.923   1.00 0.15 ? 26  ILE A C    7  
ATOM   8513  O O    . ILE A 1 26 ? -0.088  5.419   3.387   1.00 0.14 ? 26  ILE A O    7  
ATOM   8514  C CB   . ILE A 1 26 ? 2.784   5.041   1.759   1.00 0.16 ? 26  ILE A CB   7  
ATOM   8515  C CG1  . ILE A 1 26 ? 3.370   4.623   0.411   1.00 0.16 ? 26  ILE A CG1  7  
ATOM   8516  C CG2  . ILE A 1 26 ? 2.617   3.833   2.669   1.00 0.15 ? 26  ILE A CG2  7  
ATOM   8517  C CD1  . ILE A 1 26 ? 4.705   3.919   0.525   1.00 0.17 ? 26  ILE A CD1  7  
ATOM   8518  H H    . ILE A 1 26 ? 2.443   7.144   0.326   1.00 0.17 ? 26  ILE A H    7  
ATOM   8519  H HA   . ILE A 1 26 ? 0.766   5.073   1.043   1.00 0.14 ? 26  ILE A HA   7  
ATOM   8520  H HB   . ILE A 1 26 ? 3.461   5.732   2.240   1.00 0.17 ? 26  ILE A HB   7  
ATOM   8521  H HG12 . ILE A 1 26 ? 2.683   3.950   -0.080  1.00 0.15 ? 26  ILE A HG12 7  
ATOM   8522  H HG13 . ILE A 1 26 ? 3.508   5.501   -0.203  1.00 0.16 ? 26  ILE A HG13 7  
ATOM   8523  H HG21 . ILE A 1 26 ? 2.290   4.160   3.644   1.00 0.15 ? 26  ILE A HG21 7  
ATOM   8524  H HG22 . ILE A 1 26 ? 3.561   3.316   2.759   1.00 0.16 ? 26  ILE A HG22 7  
ATOM   8525  H HG23 . ILE A 1 26 ? 1.880   3.165   2.248   1.00 0.14 ? 26  ILE A HG23 7  
ATOM   8526  H HD11 . ILE A 1 26 ? 4.598   3.043   1.147   1.00 0.16 ? 26  ILE A HD11 7  
ATOM   8527  H HD12 . ILE A 1 26 ? 5.429   4.588   0.966   1.00 0.19 ? 26  ILE A HD12 7  
ATOM   8528  H HD13 . ILE A 1 26 ? 5.043   3.623   -0.457  1.00 0.17 ? 26  ILE A HD13 7  
ATOM   8529  N N    . GLY A 1 27 ? 1.375   7.121   3.559   1.00 0.16 ? 27  GLY A N    7  
ATOM   8530  C CA   . GLY A 1 27 ? 0.884   7.526   4.863   1.00 0.16 ? 27  GLY A CA   7  
ATOM   8531  C C    . GLY A 1 27 ? -0.619  7.729   4.880   1.00 0.15 ? 27  GLY A C    7  
ATOM   8532  O O    . GLY A 1 27 ? -1.293  7.342   5.834   1.00 0.15 ? 27  GLY A O    7  
ATOM   8533  H H    . GLY A 1 27 ? 2.111   7.615   3.139   1.00 0.17 ? 27  GLY A H    7  
ATOM   8534  H HA2  . GLY A 1 27 ? 1.142   6.765   5.585   1.00 0.16 ? 27  GLY A HA2  7  
ATOM   8535  H HA3  . GLY A 1 27 ? 1.364   8.452   5.145   1.00 0.17 ? 27  GLY A HA3  7  
ATOM   8536  N N    . ALA A 1 28 ? -1.143  8.337   3.823   1.00 0.15 ? 28  ALA A N    7  
ATOM   8537  C CA   . ALA A 1 28 ? -2.575  8.590   3.718   1.00 0.14 ? 28  ALA A CA   7  
ATOM   8538  C C    . ALA A 1 28 ? -3.341  7.303   3.435   1.00 0.13 ? 28  ALA A C    7  
ATOM   8539  O O    . ALA A 1 28 ? -4.399  7.059   4.014   1.00 0.12 ? 28  ALA A O    7  
ATOM   8540  C CB   . ALA A 1 28 ? -2.853  9.620   2.634   1.00 0.15 ? 28  ALA A CB   7  
ATOM   8541  H H    . ALA A 1 28 ? -0.554  8.622   3.092   1.00 0.16 ? 28  ALA A H    7  
ATOM   8542  H HA   . ALA A 1 28 ? -2.910  8.996   4.662   1.00 0.15 ? 28  ALA A HA   7  
ATOM   8543  H HB1  . ALA A 1 28 ? -3.911  9.837   2.606   1.00 0.14 ? 28  ALA A HB1  7  
ATOM   8544  H HB2  . ALA A 1 28 ? -2.541  9.229   1.677   1.00 0.14 ? 28  ALA A HB2  7  
ATOM   8545  H HB3  . ALA A 1 28 ? -2.306  10.526  2.849   1.00 0.16 ? 28  ALA A HB3  7  
ATOM   8546  N N    . MET A 1 29 ? -2.799  6.483   2.541   1.00 0.13 ? 29  MET A N    7  
ATOM   8547  C CA   . MET A 1 29 ? -3.431  5.219   2.182   1.00 0.11 ? 29  MET A CA   7  
ATOM   8548  C C    . MET A 1 29 ? -3.545  4.303   3.396   1.00 0.11 ? 29  MET A C    7  
ATOM   8549  O O    . MET A 1 29 ? -4.543  3.602   3.568   1.00 0.10 ? 29  MET A O    7  
ATOM   8550  C CB   . MET A 1 29 ? -2.638  4.523   1.075   1.00 0.11 ? 29  MET A CB   7  
ATOM   8551  C CG   . MET A 1 29 ? -3.255  3.211   0.618   1.00 0.10 ? 29  MET A CG   7  
ATOM   8552  S SD   . MET A 1 29 ? -2.017  1.984   0.157   1.00 0.10 ? 29  MET A SD   7  
ATOM   8553  C CE   . MET A 1 29 ? -1.147  1.782   1.710   1.00 0.11 ? 29  MET A CE   7  
ATOM   8554  H H    . MET A 1 29 ? -1.954  6.733   2.112   1.00 0.13 ? 29  MET A H    7  
ATOM   8555  H HA   . MET A 1 29 ? -4.424  5.437   1.819   1.00 0.11 ? 29  MET A HA   7  
ATOM   8556  H HB2  . MET A 1 29 ? -2.576  5.183   0.222   1.00 0.12 ? 29  MET A HB2  7  
ATOM   8557  H HB3  . MET A 1 29 ? -1.640  4.320   1.435   1.00 0.12 ? 29  MET A HB3  7  
ATOM   8558  H HG2  . MET A 1 29 ? -3.854  2.811   1.422   1.00 0.10 ? 29  MET A HG2  7  
ATOM   8559  H HG3  . MET A 1 29 ? -3.887  3.404   -0.237  1.00 0.10 ? 29  MET A HG3  7  
ATOM   8560  H HE1  . MET A 1 29 ? -0.538  2.653   1.899   1.00 0.12 ? 29  MET A HE1  7  
ATOM   8561  H HE2  . MET A 1 29 ? -0.517  0.907   1.659   1.00 0.11 ? 29  MET A HE2  7  
ATOM   8562  H HE3  . MET A 1 29 ? -1.863  1.664   2.509   1.00 0.11 ? 29  MET A HE3  7  
ATOM   8563  N N    . LEU A 1 30 ? -2.515  4.311   4.236   1.00 0.12 ? 30  LEU A N    7  
ATOM   8564  C CA   . LEU A 1 30 ? -2.498  3.480   5.435   1.00 0.12 ? 30  LEU A CA   7  
ATOM   8565  C C    . LEU A 1 30 ? -3.660  3.833   6.357   1.00 0.12 ? 30  LEU A C    7  
ATOM   8566  O O    . LEU A 1 30 ? -4.431  2.962   6.761   1.00 0.11 ? 30  LEU A O    7  
ATOM   8567  C CB   . LEU A 1 30 ? -1.172  3.650   6.178   1.00 0.13 ? 30  LEU A CB   7  
ATOM   8568  C CG   . LEU A 1 30 ? -0.194  2.479   6.080   1.00 0.13 ? 30  LEU A CG   7  
ATOM   8569  C CD1  . LEU A 1 30 ? 0.189   2.222   4.633   1.00 0.13 ? 30  LEU A CD1  7  
ATOM   8570  C CD2  . LEU A 1 30 ? 1.044   2.747   6.924   1.00 0.15 ? 30  LEU A CD2  7  
ATOM   8571  H H    . LEU A 1 30 ? -1.748  4.889   4.045   1.00 0.13 ? 30  LEU A H    7  
ATOM   8572  H HA   . LEU A 1 30 ? -2.598  2.450   5.127   1.00 0.11 ? 30  LEU A HA   7  
ATOM   8573  H HB2  . LEU A 1 30 ? -0.682  4.530   5.790   1.00 0.14 ? 30  LEU A HB2  7  
ATOM   8574  H HB3  . LEU A 1 30 ? -1.392  3.816   7.223   1.00 0.14 ? 30  LEU A HB3  7  
ATOM   8575  H HG   . LEU A 1 30 ? -0.671  1.587   6.462   1.00 0.13 ? 30  LEU A HG   7  
ATOM   8576  H HD11 . LEU A 1 30 ? 0.486   3.150   4.168   1.00 0.13 ? 30  LEU A HD11 7  
ATOM   8577  H HD12 . LEU A 1 30 ? -0.656  1.809   4.105   1.00 0.12 ? 30  LEU A HD12 7  
ATOM   8578  H HD13 . LEU A 1 30 ? 1.011   1.523   4.597   1.00 0.13 ? 30  LEU A HD13 7  
ATOM   8579  H HD21 . LEU A 1 30 ? 1.718   1.906   6.853   1.00 0.15 ? 30  LEU A HD21 7  
ATOM   8580  H HD22 . LEU A 1 30 ? 0.754   2.892   7.954   1.00 0.16 ? 30  LEU A HD22 7  
ATOM   8581  H HD23 . LEU A 1 30 ? 1.541   3.636   6.562   1.00 0.15 ? 30  LEU A HD23 7  
ATOM   8582  N N    . SER A 1 31 ? -3.781  5.115   6.686   1.00 0.13 ? 31  SER A N    7  
ATOM   8583  C CA   . SER A 1 31 ? -4.849  5.583   7.564   1.00 0.13 ? 31  SER A CA   7  
ATOM   8584  C C    . SER A 1 31 ? -6.210  5.117   7.057   1.00 0.12 ? 31  SER A C    7  
ATOM   8585  O O    . SER A 1 31 ? -7.135  4.897   7.840   1.00 0.12 ? 31  SER A O    7  
ATOM   8586  C CB   . SER A 1 31 ? -4.824  7.110   7.661   1.00 0.14 ? 31  SER A CB   7  
ATOM   8587  O OG   . SER A 1 31 ? -6.081  7.614   8.079   1.00 0.14 ? 31  SER A OG   7  
ATOM   8588  H H    . SER A 1 31 ? -3.138  5.763   6.329   1.00 0.13 ? 31  SER A H    7  
ATOM   8589  H HA   . SER A 1 31 ? -4.680  5.164   8.544   1.00 0.13 ? 31  SER A HA   7  
ATOM   8590  H HB2  . SER A 1 31 ? -4.073  7.410   8.378   1.00 0.15 ? 31  SER A HB2  7  
ATOM   8591  H HB3  . SER A 1 31 ? -4.585  7.527   6.694   1.00 0.14 ? 31  SER A HB3  7  
ATOM   8592  H HG   . SER A 1 31 ? -6.620  6.893   8.413   1.00 0.13 ? 31  SER A HG   7  
ATOM   8593  N N    . LEU A 1 32 ? -6.326  4.969   5.742   1.00 0.11 ? 32  LEU A N    7  
ATOM   8594  C CA   . LEU A 1 32 ? -7.575  4.528   5.129   1.00 0.10 ? 32  LEU A CA   7  
ATOM   8595  C C    . LEU A 1 32 ? -7.740  3.016   5.252   1.00 0.09 ? 32  LEU A C    7  
ATOM   8596  O O    . LEU A 1 32 ? -8.851  2.514   5.411   1.00 0.09 ? 32  LEU A O    7  
ATOM   8597  C CB   . LEU A 1 32 ? -7.616  4.939   3.656   1.00 0.10 ? 32  LEU A CB   7  
ATOM   8598  C CG   . LEU A 1 32 ? -8.904  4.608   2.902   1.00 0.09 ? 32  LEU A CG   7  
ATOM   8599  C CD1  . LEU A 1 32 ? -8.907  3.152   2.465   1.00 0.08 ? 32  LEU A CD1  7  
ATOM   8600  C CD2  . LEU A 1 32 ? -10.119 4.911   3.765   1.00 0.09 ? 32  LEU A CD2  7  
ATOM   8601  H H    . LEU A 1 32 ? -5.554  5.160   5.169   1.00 0.11 ? 32  LEU A H    7  
ATOM   8602  H HA   . LEU A 1 32 ? -8.385  5.012   5.650   1.00 0.10 ? 32  LEU A HA   7  
ATOM   8603  H HB2  . LEU A 1 32 ? -7.460  6.007   3.603   1.00 0.10 ? 32  LEU A HB2  7  
ATOM   8604  H HB3  . LEU A 1 32 ? -6.796  4.451   3.150   1.00 0.09 ? 32  LEU A HB3  7  
ATOM   8605  H HG   . LEU A 1 32 ? -8.961  5.222   2.014   1.00 0.09 ? 32  LEU A HG   7  
ATOM   8606  H HD11 . LEU A 1 32 ? -8.051  2.963   1.834   1.00 0.08 ? 32  LEU A HD11 7  
ATOM   8607  H HD12 . LEU A 1 32 ? -9.812  2.943   1.915   1.00 0.08 ? 32  LEU A HD12 7  
ATOM   8608  H HD13 . LEU A 1 32 ? -8.861  2.515   3.336   1.00 0.08 ? 32  LEU A HD13 7  
ATOM   8609  H HD21 . LEU A 1 32 ? -11.018 4.646   3.227   1.00 0.09 ? 32  LEU A HD21 7  
ATOM   8610  H HD22 . LEU A 1 32 ? -10.139 5.964   4.000   1.00 0.10 ? 32  LEU A HD22 7  
ATOM   8611  H HD23 . LEU A 1 32 ? -10.066 4.339   4.677   1.00 0.09 ? 32  LEU A HD23 7  
ATOM   8612  N N    . LEU A 1 33 ? -6.625  2.298   5.178   1.00 0.09 ? 33  LEU A N    7  
ATOM   8613  C CA   . LEU A 1 33 ? -6.644  0.845   5.283   1.00 0.08 ? 33  LEU A CA   7  
ATOM   8614  C C    . LEU A 1 33 ? -6.880  0.406   6.725   1.00 0.09 ? 33  LEU A C    7  
ATOM   8615  O O    . LEU A 1 33 ? -7.066  -0.781  6.999   1.00 0.09 ? 33  LEU A O    7  
ATOM   8616  C CB   . LEU A 1 33 ? -5.325  0.258   4.770   1.00 0.08 ? 33  LEU A CB   7  
ATOM   8617  C CG   . LEU A 1 33 ? -5.314  -0.186  3.306   1.00 0.08 ? 33  LEU A CG   7  
ATOM   8618  C CD1  . LEU A 1 33 ? -3.920  -0.642  2.899   1.00 0.08 ? 33  LEU A CD1  7  
ATOM   8619  C CD2  . LEU A 1 33 ? -6.329  -1.297  3.077   1.00 0.07 ? 33  LEU A CD2  7  
ATOM   8620  H H    . LEU A 1 33 ? -5.768  2.758   5.049   1.00 0.10 ? 33  LEU A H    7  
ATOM   8621  H HA   . LEU A 1 33 ? -7.454  0.481   4.672   1.00 0.08 ? 33  LEU A HA   7  
ATOM   8622  H HB2  . LEU A 1 33 ? -4.554  1.002   4.901   1.00 0.09 ? 33  LEU A HB2  7  
ATOM   8623  H HB3  . LEU A 1 33 ? -5.081  -0.596  5.382   1.00 0.09 ? 33  LEU A HB3  7  
ATOM   8624  H HG   . LEU A 1 33 ? -5.587  0.652   2.680   1.00 0.08 ? 33  LEU A HG   7  
ATOM   8625  H HD11 . LEU A 1 33 ? -3.984  -1.229  1.994   1.00 0.09 ? 33  LEU A HD11 7  
ATOM   8626  H HD12 . LEU A 1 33 ? -3.491  -1.240  3.688   1.00 0.10 ? 33  LEU A HD12 7  
ATOM   8627  H HD13 . LEU A 1 33 ? -3.298  0.222   2.723   1.00 0.10 ? 33  LEU A HD13 7  
ATOM   8628  H HD21 . LEU A 1 33 ? -5.930  -2.231  3.444   1.00 0.07 ? 33  LEU A HD21 7  
ATOM   8629  H HD22 . LEU A 1 33 ? -6.535  -1.380  2.022   1.00 0.06 ? 33  LEU A HD22 7  
ATOM   8630  H HD23 . LEU A 1 33 ? -7.243  -1.066  3.603   1.00 0.07 ? 33  LEU A HD23 7  
ATOM   8631  N N    . GLN A 1 34 ? -6.875  1.368   7.640   1.00 0.10 ? 34  GLN A N    7  
ATOM   8632  C CA   . GLN A 1 34 ? -7.091  1.081   9.053   1.00 0.11 ? 34  GLN A CA   7  
ATOM   8633  C C    . GLN A 1 34 ? -8.494  1.495   9.485   1.00 0.11 ? 34  GLN A C    7  
ATOM   8634  O O    . GLN A 1 34 ? -9.079  0.900   10.389  1.00 0.12 ? 34  GLN A O    7  
ATOM   8635  C CB   . GLN A 1 34 ? -6.047  1.803   9.908   1.00 0.12 ? 34  GLN A CB   7  
ATOM   8636  C CG   . GLN A 1 34 ? -4.613  1.503   9.500   1.00 0.13 ? 34  GLN A CG   7  
ATOM   8637  C CD   . GLN A 1 34 ? -3.719  1.213   10.688  1.00 0.14 ? 34  GLN A CD   7  
ATOM   8638  O OE1  . GLN A 1 34 ? -3.866  1.813   11.752  1.00 0.15 ? 34  GLN A OE1  7  
ATOM   8639  N NE2  . GLN A 1 34 ? -2.785  0.286   10.513  1.00 0.14 ? 34  GLN A NE2  7  
ATOM   8640  H H    . GLN A 1 34 ? -6.720  2.294   7.358   1.00 0.10 ? 34  GLN A H    7  
ATOM   8641  H HA   . GLN A 1 34 ? -6.984  0.016   9.195   1.00 0.11 ? 34  GLN A HA   7  
ATOM   8642  H HB2  . GLN A 1 34 ? -6.207  2.868   9.826   1.00 0.13 ? 34  GLN A HB2  7  
ATOM   8643  H HB3  . GLN A 1 34 ? -6.176  1.507   10.938  1.00 0.13 ? 34  GLN A HB3  7  
ATOM   8644  H HG2  . GLN A 1 34 ? -4.611  0.642   8.848   1.00 0.12 ? 34  GLN A HG2  7  
ATOM   8645  H HG3  . GLN A 1 34 ? -4.217  2.357   8.969   1.00 0.13 ? 34  GLN A HG3  7  
ATOM   8646  H HE21 . GLN A 1 34 ? -2.725  -0.153  9.638   1.00 0.13 ? 34  GLN A HE21 7  
ATOM   8647  H HE22 . GLN A 1 34 ? -2.193  0.078   11.266  1.00 0.15 ? 34  GLN A HE22 7  
ATOM   8648  N N    . LYS A 1 35 ? -9.030  2.520   8.830   1.00 0.11 ? 35  LYS A N    7  
ATOM   8649  C CA   . LYS A 1 35 ? -10.365 3.014   9.143   1.00 0.11 ? 35  LYS A CA   7  
ATOM   8650  C C    . LYS A 1 35 ? -11.436 2.119   8.527   1.00 0.11 ? 35  LYS A C    7  
ATOM   8651  O O    . LYS A 1 35 ? -12.491 1.899   9.122   1.00 0.11 ? 35  LYS A O    7  
ATOM   8652  C CB   . LYS A 1 35 ? -10.531 4.448   8.640   1.00 0.12 ? 35  LYS A CB   7  
ATOM   8653  C CG   . LYS A 1 35 ? -10.740 4.546   7.139   1.00 0.11 ? 35  LYS A CG   7  
ATOM   8654  C CD   . LYS A 1 35 ? -10.933 5.986   6.695   1.00 0.11 ? 35  LYS A CD   7  
ATOM   8655  C CE   . LYS A 1 35 ? -12.261 6.175   5.976   1.00 0.11 ? 35  LYS A CE   7  
ATOM   8656  N NZ   . LYS A 1 35 ? -12.916 7.459   6.351   1.00 0.12 ? 35  LYS A NZ   7  
ATOM   8657  H H    . LYS A 1 35 ? -8.513  2.956   8.119   1.00 0.11 ? 35  LYS A H    7  
ATOM   8658  H HA   . LYS A 1 35 ? -10.479 3.003   10.218  1.00 0.12 ? 35  LYS A HA   7  
ATOM   8659  H HB2  . LYS A 1 35 ? -11.385 4.894   9.130   1.00 0.12 ? 35  LYS A HB2  7  
ATOM   8660  H HB3  . LYS A 1 35 ? -9.646  5.012   8.895   1.00 0.12 ? 35  LYS A HB3  7  
ATOM   8661  H HG2  . LYS A 1 35 ? -9.875  4.137   6.641   1.00 0.10 ? 35  LYS A HG2  7  
ATOM   8662  H HG3  . LYS A 1 35 ? -11.615 3.973   6.869   1.00 0.10 ? 35  LYS A HG3  7  
ATOM   8663  H HD2  . LYS A 1 35 ? -10.914 6.626   7.565   1.00 0.12 ? 35  LYS A HD2  7  
ATOM   8664  H HD3  . LYS A 1 35 ? -10.130 6.260   6.027   1.00 0.11 ? 35  LYS A HD3  7  
ATOM   8665  H HE2  . LYS A 1 35 ? -12.085 6.168   4.912   1.00 0.11 ? 35  LYS A HE2  7  
ATOM   8666  H HE3  . LYS A 1 35 ? -12.917 5.357   6.238   1.00 0.11 ? 35  LYS A HE3  7  
ATOM   8667  H HZ1  . LYS A 1 35 ? -13.100 7.482   7.374   1.00 0.13 ? 35  LYS A HZ1  7  
ATOM   8668  H HZ2  . LYS A 1 35 ? -13.819 7.560   5.845   1.00 0.12 ? 35  LYS A HZ2  7  
ATOM   8669  H HZ3  . LYS A 1 35 ? -12.300 8.260   6.101   1.00 0.12 ? 35  LYS A HZ3  7  
ATOM   8670  N N    . GLU A 1 36 ? -11.156 1.609   7.332   1.00 0.10 ? 36  GLU A N    7  
ATOM   8671  C CA   . GLU A 1 36 ? -12.097 0.738   6.636   1.00 0.09 ? 36  GLU A CA   7  
ATOM   8672  C C    . GLU A 1 36 ? -12.171 -0.630  7.308   1.00 0.09 ? 36  GLU A C    7  
ATOM   8673  O O    . GLU A 1 36 ? -13.031 -1.448  6.982   1.00 0.09 ? 36  GLU A O    7  
ATOM   8674  C CB   . GLU A 1 36 ? -11.686 0.577   5.170   1.00 0.08 ? 36  GLU A CB   7  
ATOM   8675  C CG   . GLU A 1 36 ? -11.684 1.881   4.392   1.00 0.08 ? 36  GLU A CG   7  
ATOM   8676  C CD   . GLU A 1 36 ? -13.078 2.436   4.178   1.00 0.09 ? 36  GLU A CD   7  
ATOM   8677  O OE1  . GLU A 1 36 ? -13.199 3.508   3.548   1.00 0.09 ? 36  GLU A OE1  7  
ATOM   8678  O OE2  . GLU A 1 36 ? -14.048 1.800   4.639   1.00 0.09 ? 36  GLU A OE2  7  
ATOM   8679  H H    . GLU A 1 36 ? -10.299 1.823   6.909   1.00 0.09 ? 36  GLU A H    7  
ATOM   8680  H HA   . GLU A 1 36 ? -13.071 1.201   6.678   1.00 0.10 ? 36  GLU A HA   7  
ATOM   8681  H HB2  . GLU A 1 36 ? -10.692 0.157   5.132   1.00 0.08 ? 36  GLU A HB2  7  
ATOM   8682  H HB3  . GLU A 1 36 ? -12.373 -0.104  4.689   1.00 0.08 ? 36  GLU A HB3  7  
ATOM   8683  H HG2  . GLU A 1 36 ? -11.105 2.609   4.939   1.00 0.09 ? 36  GLU A HG2  7  
ATOM   8684  H HG3  . GLU A 1 36 ? -11.228 1.710   3.428   1.00 0.08 ? 36  GLU A HG3  7  
ATOM   8685  N N    . GLY A 1 37 ? -11.263 -0.871  8.249   1.00 0.10 ? 37  GLY A N    7  
ATOM   8686  C CA   . GLY A 1 37 ? -11.243 -2.141  8.952   1.00 0.10 ? 37  GLY A CA   7  
ATOM   8687  C C    . GLY A 1 37 ? -10.533 -3.225  8.169   1.00 0.09 ? 37  GLY A C    7  
ATOM   8688  O O    . GLY A 1 37 ? -10.525 -4.389  8.572   1.00 0.10 ? 37  GLY A O    7  
ATOM   8689  H H    . GLY A 1 37 ? -10.604 -0.180  8.469   1.00 0.10 ? 37  GLY A H    7  
ATOM   8690  H HA2  . GLY A 1 37 ? -10.741 -2.007  9.899   1.00 0.11 ? 37  GLY A HA2  7  
ATOM   8691  H HA3  . GLY A 1 37 ? -12.260 -2.453  9.138   1.00 0.11 ? 37  GLY A HA3  7  
ATOM   8692  N N    . LEU A 1 38 ? -9.932  -2.846  7.046   1.00 0.08 ? 38  LEU A N    7  
ATOM   8693  C CA   . LEU A 1 38 ? -9.214  -3.798  6.202   1.00 0.08 ? 38  LEU A CA   7  
ATOM   8694  C C    . LEU A 1 38 ? -7.901  -4.219  6.853   1.00 0.08 ? 38  LEU A C    7  
ATOM   8695  O O    . LEU A 1 38 ? -7.357  -5.279  6.546   1.00 0.08 ? 38  LEU A O    7  
ATOM   8696  C CB   . LEU A 1 38 ? -8.944  -3.184  4.827   1.00 0.07 ? 38  LEU A CB   7  
ATOM   8697  C CG   . LEU A 1 38 ? -10.167 -2.961  3.939   1.00 0.06 ? 38  LEU A CG   7  
ATOM   8698  C CD1  . LEU A 1 38 ? -9.869  -1.921  2.870   1.00 0.06 ? 38  LEU A CD1  7  
ATOM   8699  C CD2  . LEU A 1 38 ? -10.611 -4.270  3.302   1.00 0.06 ? 38  LEU A CD2  7  
ATOM   8700  H H    . LEU A 1 38 ? -9.973  -1.904  6.776   1.00 0.08 ? 38  LEU A H    7  
ATOM   8701  H HA   . LEU A 1 38 ? -9.840  -4.670  6.082   1.00 0.08 ? 38  LEU A HA   7  
ATOM   8702  H HB2  . LEU A 1 38 ? -8.459  -2.231  4.976   1.00 0.07 ? 38  LEU A HB2  7  
ATOM   8703  H HB3  . LEU A 1 38 ? -8.261  -3.834  4.300   1.00 0.06 ? 38  LEU A HB3  7  
ATOM   8704  H HG   . LEU A 1 38 ? -10.981 -2.591  4.545   1.00 0.07 ? 38  LEU A HG   7  
ATOM   8705  H HD11 . LEU A 1 38 ? -9.621  -0.981  3.340   1.00 0.06 ? 38  LEU A HD11 7  
ATOM   8706  H HD12 . LEU A 1 38 ? -10.739 -1.791  2.242   1.00 0.06 ? 38  LEU A HD12 7  
ATOM   8707  H HD13 . LEU A 1 38 ? -9.037  -2.253  2.267   1.00 0.05 ? 38  LEU A HD13 7  
ATOM   8708  H HD21 . LEU A 1 38 ? -9.801  -4.679  2.717   1.00 0.06 ? 38  LEU A HD21 7  
ATOM   8709  H HD22 . LEU A 1 38 ? -11.462 -4.090  2.663   1.00 0.06 ? 38  LEU A HD22 7  
ATOM   8710  H HD23 . LEU A 1 38 ? -10.885 -4.972  4.076   1.00 0.07 ? 38  LEU A HD23 7  
ATOM   8711  N N    . LEU A 1 39 ? -7.397  -3.380  7.754   1.00 0.09 ? 39  LEU A N    7  
ATOM   8712  C CA   . LEU A 1 39 ? -6.148  -3.668  8.450   1.00 0.10 ? 39  LEU A CA   7  
ATOM   8713  C C    . LEU A 1 39 ? -6.210  -3.192  9.897   1.00 0.11 ? 39  LEU A C    7  
ATOM   8714  O O    . LEU A 1 39 ? -6.883  -2.211  10.211  1.00 0.11 ? 39  LEU A O    7  
ATOM   8715  C CB   . LEU A 1 39 ? -4.975  -2.998  7.730   1.00 0.10 ? 39  LEU A CB   7  
ATOM   8716  C CG   . LEU A 1 39 ? -4.661  -3.522  6.328   1.00 0.09 ? 39  LEU A CG   7  
ATOM   8717  C CD1  . LEU A 1 39 ? -3.454  -2.800  5.748   1.00 0.09 ? 39  LEU A CD1  7  
ATOM   8718  C CD2  . LEU A 1 39 ? -4.420  -5.024  6.363   1.00 0.09 ? 39  LEU A CD2  7  
ATOM   8719  H H    . LEU A 1 39 ? -7.878  -2.550  7.955   1.00 0.09 ? 39  LEU A H    7  
ATOM   8720  H HA   . LEU A 1 39 ? -6.001  -4.737  8.441   1.00 0.10 ? 39  LEU A HA   7  
ATOM   8721  H HB2  . LEU A 1 39 ? -5.188  -1.941  7.654   1.00 0.10 ? 39  LEU A HB2  7  
ATOM   8722  H HB3  . LEU A 1 39 ? -4.093  -3.122  8.341   1.00 0.11 ? 39  LEU A HB3  7  
ATOM   8723  H HG   . LEU A 1 39 ? -5.506  -3.333  5.682   1.00 0.08 ? 39  LEU A HG   7  
ATOM   8724  H HD11 . LEU A 1 39 ? -3.366  -3.034  4.697   1.00 0.08 ? 39  LEU A HD11 7  
ATOM   8725  H HD12 . LEU A 1 39 ? -2.562  -3.122  6.264   1.00 0.10 ? 39  LEU A HD12 7  
ATOM   8726  H HD13 . LEU A 1 39 ? -3.576  -1.735  5.873   1.00 0.09 ? 39  LEU A HD13 7  
ATOM   8727  H HD21 . LEU A 1 39 ? -3.759  -5.302  5.555   1.00 0.08 ? 39  LEU A HD21 7  
ATOM   8728  H HD22 . LEU A 1 39 ? -5.362  -5.540  6.251   1.00 0.08 ? 39  LEU A HD22 7  
ATOM   8729  H HD23 . LEU A 1 39 ? -3.972  -5.295  7.307   1.00 0.10 ? 39  LEU A HD23 7  
ATOM   8730  N N    . MET A 1 40 ? -5.501  -3.893  10.776  1.00 0.12 ? 40  MET A N    7  
ATOM   8731  C CA   . MET A 1 40 ? -5.474  -3.541  12.191  1.00 0.14 ? 40  MET A CA   7  
ATOM   8732  C C    . MET A 1 40 ? -4.176  -2.820  12.546  1.00 0.14 ? 40  MET A C    7  
ATOM   8733  O O    . MET A 1 40 ? -4.112  -2.090  13.535  1.00 0.15 ? 40  MET A O    7  
ATOM   8734  C CB   . MET A 1 40 ? -5.628  -4.794  13.054  1.00 0.14 ? 40  MET A CB   7  
ATOM   8735  C CG   . MET A 1 40 ? -5.969  -4.494  14.506  1.00 0.16 ? 40  MET A CG   7  
ATOM   8736  S SD   . MET A 1 40 ? -5.304  -5.725  15.643  1.00 0.17 ? 40  MET A SD   7  
ATOM   8737  C CE   . MET A 1 40 ? -3.560  -5.323  15.596  1.00 0.17 ? 40  MET A CE   7  
ATOM   8738  H H    . MET A 1 40 ? -4.986  -4.666  10.465  1.00 0.12 ? 40  MET A H    7  
ATOM   8739  H HA   . MET A 1 40 ? -6.304  -2.877  12.383  1.00 0.14 ? 40  MET A HA   7  
ATOM   8740  H HB2  . MET A 1 40 ? -6.415  -5.407  12.641  1.00 0.14 ? 40  MET A HB2  7  
ATOM   8741  H HB3  . MET A 1 40 ? -4.702  -5.349  13.032  1.00 0.14 ? 40  MET A HB3  7  
ATOM   8742  H HG2  . MET A 1 40 ? -5.560  -3.529  14.765  1.00 0.16 ? 40  MET A HG2  7  
ATOM   8743  H HG3  . MET A 1 40 ? -7.043  -4.468  14.612  1.00 0.15 ? 40  MET A HG3  7  
ATOM   8744  H HE1  . MET A 1 40 ? -3.418  -4.295  15.895  1.00 0.18 ? 40  MET A HE1  7  
ATOM   8745  H HE2  . MET A 1 40 ? -3.185  -5.461  14.593  1.00 0.17 ? 40  MET A HE2  7  
ATOM   8746  H HE3  . MET A 1 40 ? -3.023  -5.972  16.272  1.00 0.18 ? 40  MET A HE3  7  
ATOM   8747  N N    . SER A 1 41 ? -3.145  -3.032  11.733  1.00 0.14 ? 41  SER A N    7  
ATOM   8748  C CA   . SER A 1 41 ? -1.849  -2.406  11.965  1.00 0.15 ? 41  SER A CA   7  
ATOM   8749  C C    . SER A 1 41 ? -1.122  -2.159  10.646  1.00 0.14 ? 41  SER A C    7  
ATOM   8750  O O    . SER A 1 41 ? -1.427  -2.762  9.616   1.00 0.13 ? 41  SER A O    7  
ATOM   8751  C CB   . SER A 1 41 ? -0.991  -3.284  12.876  1.00 0.16 ? 41  SER A CB   7  
ATOM   8752  O OG   . SER A 1 41 ? -1.538  -4.586  12.994  1.00 0.16 ? 41  SER A OG   7  
ATOM   8753  H H    . SER A 1 41 ? -3.259  -3.625  10.961  1.00 0.13 ? 41  SER A H    7  
ATOM   8754  H HA   . SER A 1 41 ? -2.022  -1.457  12.450  1.00 0.15 ? 41  SER A HA   7  
ATOM   8755  H HB2  . SER A 1 41 ? 0.005   -3.362  12.465  1.00 0.16 ? 41  SER A HB2  7  
ATOM   8756  H HB3  . SER A 1 41 ? -0.940  -2.839  13.859  1.00 0.17 ? 41  SER A HB3  7  
ATOM   8757  H HG   . SER A 1 41 ? -1.376  -4.924  13.877  1.00 0.17 ? 41  SER A HG   7  
ATOM   8758  N N    . PRO A 1 42 ? -0.136  -1.251  10.676  1.00 0.15 ? 42  PRO A N    7  
ATOM   8759  C CA   . PRO A 1 42 ? 0.655   -0.903  9.494   1.00 0.15 ? 42  PRO A CA   7  
ATOM   8760  C C    . PRO A 1 42 ? 1.579   -2.035  9.060   1.00 0.15 ? 42  PRO A C    7  
ATOM   8761  O O    . PRO A 1 42 ? 2.092   -2.036  7.942   1.00 0.15 ? 42  PRO A O    7  
ATOM   8762  C CB   . PRO A 1 42 ? 1.473   0.307   9.957   1.00 0.16 ? 42  PRO A CB   7  
ATOM   8763  C CG   . PRO A 1 42 ? 1.567   0.156   11.435  1.00 0.17 ? 42  PRO A CG   7  
ATOM   8764  C CD   . PRO A 1 42 ? 0.282   -0.494  11.868  1.00 0.17 ? 42  PRO A CD   7  
ATOM   8765  H HA   . PRO A 1 42 ? 0.024   -0.618  8.665   1.00 0.14 ? 42  PRO A HA   7  
ATOM   8766  H HB2  . PRO A 1 42 ? 2.454   0.286   9.498   1.00 0.17 ? 42  PRO A HB2  7  
ATOM   8767  H HB3  . PRO A 1 42 ? 0.960   1.221   9.709   1.00 0.16 ? 42  PRO A HB3  7  
ATOM   8768  H HG2  . PRO A 1 42 ? 2.413   -0.471  11.686  1.00 0.18 ? 42  PRO A HG2  7  
ATOM   8769  H HG3  . PRO A 1 42 ? 1.666   1.125   11.900  1.00 0.18 ? 42  PRO A HG3  7  
ATOM   8770  H HD2  . PRO A 1 42 ? 0.455   -1.155  12.705  1.00 0.17 ? 42  PRO A HD2  7  
ATOM   8771  H HD3  . PRO A 1 42 ? -0.451  0.257   12.125  1.00 0.16 ? 42  PRO A HD3  7  
ATOM   8772  N N    . SER A 1 43 ? 1.788   -2.997  9.953   1.00 0.16 ? 43  SER A N    7  
ATOM   8773  C CA   . SER A 1 43 ? 2.654   -4.135  9.665   1.00 0.16 ? 43  SER A CA   7  
ATOM   8774  C C    . SER A 1 43 ? 1.876   -5.243  8.961   1.00 0.15 ? 43  SER A C    7  
ATOM   8775  O O    . SER A 1 43 ? 2.450   -6.249  8.544   1.00 0.15 ? 43  SER A O    7  
ATOM   8776  C CB   . SER A 1 43 ? 3.274   -4.672  10.956  1.00 0.17 ? 43  SER A CB   7  
ATOM   8777  O OG   . SER A 1 43 ? 2.275   -4.969  11.916  1.00 0.17 ? 43  SER A OG   7  
ATOM   8778  H H    . SER A 1 43 ? 1.349   -2.941  10.828  1.00 0.16 ? 43  SER A H    7  
ATOM   8779  H HA   . SER A 1 43 ? 3.443   -3.792  9.012   1.00 0.16 ? 43  SER A HA   7  
ATOM   8780  H HB2  . SER A 1 43 ? 3.826   -5.574  10.739  1.00 0.17 ? 43  SER A HB2  7  
ATOM   8781  H HB3  . SER A 1 43 ? 3.943   -3.931  11.367  1.00 0.18 ? 43  SER A HB3  7  
ATOM   8782  H HG   . SER A 1 43 ? 2.316   -5.902  12.142  1.00 0.17 ? 43  SER A HG   7  
ATOM   8783  N N    . ASP A 1 44 ? 0.569   -5.052  8.833   1.00 0.14 ? 44  ASP A N    7  
ATOM   8784  C CA   . ASP A 1 44 ? -0.288  -6.033  8.178   1.00 0.12 ? 44  ASP A CA   7  
ATOM   8785  C C    . ASP A 1 44 ? 0.100   -6.204  6.714   1.00 0.12 ? 44  ASP A C    7  
ATOM   8786  O O    . ASP A 1 44 ? -0.280  -7.181  6.067   1.00 0.11 ? 44  ASP A O    7  
ATOM   8787  C CB   . ASP A 1 44 ? -1.756  -5.614  8.285   1.00 0.12 ? 44  ASP A CB   7  
ATOM   8788  C CG   . ASP A 1 44 ? -2.686  -6.798  8.448   1.00 0.11 ? 44  ASP A CG   7  
ATOM   8789  O OD1  . ASP A 1 44 ? -2.434  -7.843  7.813   1.00 0.11 ? 44  ASP A OD1  7  
ATOM   8790  O OD2  . ASP A 1 44 ? -3.667  -6.681  9.211   1.00 0.11 ? 44  ASP A OD2  7  
ATOM   8791  H H    . ASP A 1 44 ? 0.169   -4.229  9.186   1.00 0.14 ? 44  ASP A H    7  
ATOM   8792  H HA   . ASP A 1 44 ? -0.156  -6.978  8.685   1.00 0.13 ? 44  ASP A HA   7  
ATOM   8793  H HB2  . ASP A 1 44 ? -1.878  -4.964  9.138   1.00 0.12 ? 44  ASP A HB2  7  
ATOM   8794  H HB3  . ASP A 1 44 ? -2.033  -5.079  7.388   1.00 0.11 ? 44  ASP A HB3  7  
ATOM   8795  N N    . LEU A 1 45 ? 0.859   -5.244  6.192   1.00 0.12 ? 45  LEU A N    7  
ATOM   8796  C CA   . LEU A 1 45 ? 1.298   -5.286  4.803   1.00 0.12 ? 45  LEU A CA   7  
ATOM   8797  C C    . LEU A 1 45 ? 2.190   -6.498  4.549   1.00 0.12 ? 45  LEU A C    7  
ATOM   8798  O O    . LEU A 1 45 ? 2.412   -6.888  3.404   1.00 0.12 ? 45  LEU A O    7  
ATOM   8799  C CB   . LEU A 1 45 ? 2.049   -4.002  4.445   1.00 0.12 ? 45  LEU A CB   7  
ATOM   8800  C CG   . LEU A 1 45 ? 1.420   -3.141  3.349   1.00 0.12 ? 45  LEU A CG   7  
ATOM   8801  C CD1  . LEU A 1 45 ? 1.679   -3.748  1.979   1.00 0.11 ? 45  LEU A CD1  7  
ATOM   8802  C CD2  . LEU A 1 45 ? -0.074  -2.978  3.589   1.00 0.10 ? 45  LEU A CD2  7  
ATOM   8803  H H    . LEU A 1 45 ? 1.130   -4.490  6.757   1.00 0.13 ? 45  LEU A H    7  
ATOM   8804  H HA   . LEU A 1 45 ? 0.420   -5.364  4.180   1.00 0.11 ? 45  LEU A HA   7  
ATOM   8805  H HB2  . LEU A 1 45 ? 2.130   -3.402  5.338   1.00 0.13 ? 45  LEU A HB2  7  
ATOM   8806  H HB3  . LEU A 1 45 ? 3.045   -4.274  4.128   1.00 0.13 ? 45  LEU A HB3  7  
ATOM   8807  H HG   . LEU A 1 45 ? 1.872   -2.160  3.369   1.00 0.12 ? 45  LEU A HG   7  
ATOM   8808  H HD11 . LEU A 1 45 ? 2.726   -3.653  1.736   1.00 0.12 ? 45  LEU A HD11 7  
ATOM   8809  H HD12 . LEU A 1 45 ? 1.089   -3.230  1.237   1.00 0.11 ? 45  LEU A HD12 7  
ATOM   8810  H HD13 . LEU A 1 45 ? 1.406   -4.793  1.990   1.00 0.11 ? 45  LEU A HD13 7  
ATOM   8811  H HD21 . LEU A 1 45 ? -0.426  -2.095  3.077   1.00 0.10 ? 45  LEU A HD21 7  
ATOM   8812  H HD22 . LEU A 1 45 ? -0.260  -2.879  4.648   1.00 0.11 ? 45  LEU A HD22 7  
ATOM   8813  H HD23 . LEU A 1 45 ? -0.596  -3.844  3.212   1.00 0.10 ? 45  LEU A HD23 7  
ATOM   8814  N N    . TYR A 1 46 ? 2.696   -7.089  5.627   1.00 0.13 ? 46  TYR A N    7  
ATOM   8815  C CA   . TYR A 1 46 ? 3.563   -8.255  5.523   1.00 0.14 ? 46  TYR A CA   7  
ATOM   8816  C C    . TYR A 1 46 ? 2.746   -9.526  5.314   1.00 0.13 ? 46  TYR A C    7  
ATOM   8817  O O    . TYR A 1 46 ? 3.293   -10.627 5.257   1.00 0.13 ? 46  TYR A O    7  
ATOM   8818  C CB   . TYR A 1 46 ? 4.425   -8.389  6.780   1.00 0.15 ? 46  TYR A CB   7  
ATOM   8819  C CG   . TYR A 1 46 ? 5.195   -7.135  7.123   1.00 0.16 ? 46  TYR A CG   7  
ATOM   8820  C CD1  . TYR A 1 46 ? 5.743   -6.338  6.125   1.00 0.16 ? 46  TYR A CD1  7  
ATOM   8821  C CD2  . TYR A 1 46 ? 5.377   -6.748  8.445   1.00 0.17 ? 46  TYR A CD2  7  
ATOM   8822  C CE1  . TYR A 1 46 ? 6.448   -5.191  6.434   1.00 0.17 ? 46  TYR A CE1  7  
ATOM   8823  C CE2  . TYR A 1 46 ? 6.079   -5.602  8.763   1.00 0.18 ? 46  TYR A CE2  7  
ATOM   8824  C CZ   . TYR A 1 46 ? 6.613   -4.827  7.754   1.00 0.18 ? 46  TYR A CZ   7  
ATOM   8825  O OH   . TYR A 1 46 ? 7.314   -3.685  8.069   1.00 0.19 ? 46  TYR A OH   7  
ATOM   8826  H H    . TYR A 1 46 ? 2.480   -6.731  6.515   1.00 0.13 ? 46  TYR A H    7  
ATOM   8827  H HA   . TYR A 1 46 ? 4.208   -8.112  4.669   1.00 0.14 ? 46  TYR A HA   7  
ATOM   8828  H HB2  . TYR A 1 46 ? 3.789   -8.628  7.619   1.00 0.15 ? 46  TYR A HB2  7  
ATOM   8829  H HB3  . TYR A 1 46 ? 5.137   -9.188  6.635   1.00 0.16 ? 46  TYR A HB3  7  
ATOM   8830  H HD1  . TYR A 1 46 ? 5.611   -6.624  5.092   1.00 0.15 ? 46  TYR A HD1  7  
ATOM   8831  H HD2  . TYR A 1 46 ? 4.959   -7.357  9.232   1.00 0.17 ? 46  TYR A HD2  7  
ATOM   8832  H HE1  . TYR A 1 46 ? 6.866   -4.583  5.644   1.00 0.17 ? 46  TYR A HE1  7  
ATOM   8833  H HE2  . TYR A 1 46 ? 6.209   -5.318  9.797   1.00 0.19 ? 46  TYR A HE2  7  
ATOM   8834  H HH   . TYR A 1 46 ? 7.935   -3.875  8.776   1.00 0.20 ? 46  TYR A HH   7  
ATOM   8835  N N    . SER A 1 47 ? 1.431   -9.365  5.200   1.00 0.12 ? 47  SER A N    7  
ATOM   8836  C CA   . SER A 1 47 ? 0.536   -10.496 5.001   1.00 0.11 ? 47  SER A CA   7  
ATOM   8837  C C    . SER A 1 47 ? 0.016   -10.534 3.566   1.00 0.10 ? 47  SER A C    7  
ATOM   8838  O O    . SER A 1 47 ? -0.984  -9.904  3.224   1.00 0.09 ? 47  SER A O    7  
ATOM   8839  C CB   . SER A 1 47 ? -0.639  -10.423 5.978   1.00 0.11 ? 47  SER A CB   7  
ATOM   8840  O OG   . SER A 1 47 ? -0.339  -11.095 7.189   1.00 0.12 ? 47  SER A OG   7  
ATOM   8841  H H    . SER A 1 47 ? 1.053   -8.461  5.253   1.00 0.12 ? 47  SER A H    7  
ATOM   8842  H HA   . SER A 1 47 ? 1.095   -11.397 5.194   1.00 0.12 ? 47  SER A HA   7  
ATOM   8843  H HB2  . SER A 1 47 ? -0.855  -9.389  6.201   1.00 0.11 ? 47  SER A HB2  7  
ATOM   8844  H HB3  . SER A 1 47 ? -1.507  -10.884 5.529   1.00 0.10 ? 47  SER A HB3  7  
ATOM   8845  H HG   . SER A 1 47 ? -0.755  -10.634 7.922   1.00 0.12 ? 47  SER A HG   7  
ATOM   8846  N N    . PRO A 1 48 ? 0.715   -11.290 2.705   1.00 0.11 ? 48  PRO A N    7  
ATOM   8847  C CA   . PRO A 1 48 ? 0.345   -11.429 1.293   1.00 0.10 ? 48  PRO A CA   7  
ATOM   8848  C C    . PRO A 1 48 ? -0.939  -12.229 1.108   1.00 0.09 ? 48  PRO A C    7  
ATOM   8849  O O    . PRO A 1 48 ? -1.437  -12.374 -0.010  1.00 0.09 ? 48  PRO A O    7  
ATOM   8850  C CB   . PRO A 1 48 ? 1.535   -12.177 0.688   1.00 0.11 ? 48  PRO A CB   7  
ATOM   8851  C CG   . PRO A 1 48 ? 2.133   -12.925 1.828   1.00 0.12 ? 48  PRO A CG   7  
ATOM   8852  C CD   . PRO A 1 48 ? 1.919   -12.066 3.044   1.00 0.12 ? 48  PRO A CD   7  
ATOM   8853  H HA   . PRO A 1 48 ? 0.239   -10.466 0.816   1.00 0.10 ? 48  PRO A HA   7  
ATOM   8854  H HB2  . PRO A 1 48 ? 1.191   -12.852 -0.086  1.00 0.11 ? 48  PRO A HB2  7  
ATOM   8855  H HB3  . PRO A 1 48 ? 2.249   -11.478 0.286   1.00 0.11 ? 48  PRO A HB3  7  
ATOM   8856  H HG2  . PRO A 1 48 ? 1.633   -13.877 1.943   1.00 0.12 ? 48  PRO A HG2  7  
ATOM   8857  H HG3  . PRO A 1 48 ? 3.189   -13.070 1.663   1.00 0.13 ? 48  PRO A HG3  7  
ATOM   8858  H HD2  . PRO A 1 48 ? 1.748   -12.684 3.914   1.00 0.12 ? 48  PRO A HD2  7  
ATOM   8859  H HD3  . PRO A 1 48 ? 2.766   -11.415 3.201   1.00 0.12 ? 48  PRO A HD3  7  
ATOM   8860  N N    . GLY A 1 49 ? -1.473  -12.747 2.210   1.00 0.09 ? 49  GLY A N    7  
ATOM   8861  C CA   . GLY A 1 49 ? -2.695  -13.528 2.145   1.00 0.09 ? 49  GLY A CA   7  
ATOM   8862  C C    . GLY A 1 49 ? -3.929  -12.697 2.441   1.00 0.08 ? 49  GLY A C    7  
ATOM   8863  O O    . GLY A 1 49 ? -5.036  -13.227 2.528   1.00 0.08 ? 49  GLY A O    7  
ATOM   8864  H H    . GLY A 1 49 ? -1.033  -12.599 3.072   1.00 0.10 ? 49  GLY A H    7  
ATOM   8865  H HA2  . GLY A 1 49 ? -2.788  -13.951 1.157   1.00 0.09 ? 49  GLY A HA2  7  
ATOM   8866  H HA3  . GLY A 1 49 ? -2.635  -14.331 2.866   1.00 0.10 ? 49  GLY A HA3  7  
ATOM   8867  N N    . SER A 1 50 ? -3.738  -11.392 2.596   1.00 0.08 ? 50  SER A N    7  
ATOM   8868  C CA   . SER A 1 50 ? -4.843  -10.487 2.889   1.00 0.07 ? 50  SER A CA   7  
ATOM   8869  C C    . SER A 1 50 ? -4.973  -9.420  1.807   1.00 0.06 ? 50  SER A C    7  
ATOM   8870  O O    . SER A 1 50 ? -5.794  -8.508  1.912   1.00 0.06 ? 50  SER A O    7  
ATOM   8871  C CB   . SER A 1 50 ? -4.641  -9.824  4.252   1.00 0.08 ? 50  SER A CB   7  
ATOM   8872  O OG   . SER A 1 50 ? -4.766  -10.768 5.303   1.00 0.09 ? 50  SER A OG   7  
ATOM   8873  H H    . SER A 1 50 ? -2.832  -11.028 2.514   1.00 0.08 ? 50  SER A H    7  
ATOM   8874  H HA   . SER A 1 50 ? -5.752  -11.070 2.912   1.00 0.07 ? 50  SER A HA   7  
ATOM   8875  H HB2  . SER A 1 50 ? -3.655  -9.386  4.294   1.00 0.08 ? 50  SER A HB2  7  
ATOM   8876  H HB3  . SER A 1 50 ? -5.384  -9.052  4.388   1.00 0.07 ? 50  SER A HB3  7  
ATOM   8877  H HG   . SER A 1 50 ? -5.116  -11.591 4.953   1.00 0.09 ? 50  SER A HG   7  
ATOM   8878  N N    . TRP A 1 51 ? -4.156  -9.537  0.766   1.00 0.07 ? 51  TRP A N    7  
ATOM   8879  C CA   . TRP A 1 51 ? -4.178  -8.585  -0.337  1.00 0.06 ? 51  TRP A CA   7  
ATOM   8880  C C    . TRP A 1 51 ? -5.449  -8.739  -1.165  1.00 0.06 ? 51  TRP A C    7  
ATOM   8881  O O    . TRP A 1 51 ? -5.843  -7.826  -1.891  1.00 0.06 ? 51  TRP A O    7  
ATOM   8882  C CB   . TRP A 1 51 ? -2.950  -8.774  -1.227  1.00 0.07 ? 51  TRP A CB   7  
ATOM   8883  C CG   . TRP A 1 51 ? -1.670  -8.347  -0.573  1.00 0.08 ? 51  TRP A CG   7  
ATOM   8884  C CD1  . TRP A 1 51 ? -1.538  -7.506  0.495   1.00 0.08 ? 51  TRP A CD1  7  
ATOM   8885  C CD2  . TRP A 1 51 ? -0.344  -8.739  -0.946  1.00 0.09 ? 51  TRP A CD2  7  
ATOM   8886  N NE1  . TRP A 1 51 ? -0.208  -7.353  0.810   1.00 0.09 ? 51  TRP A NE1  7  
ATOM   8887  C CE2  . TRP A 1 51 ? 0.544   -8.099  -0.059  1.00 0.10 ? 51  TRP A CE2  7  
ATOM   8888  C CE3  . TRP A 1 51 ? 0.179   -9.568  -1.940  1.00 0.09 ? 51  TRP A CE3  7  
ATOM   8889  C CZ2  . TRP A 1 51 ? 1.923   -8.263  -0.140  1.00 0.11 ? 51  TRP A CZ2  7  
ATOM   8890  C CZ3  . TRP A 1 51 ? 1.548   -9.730  -2.020  1.00 0.11 ? 51  TRP A CZ3  7  
ATOM   8891  C CH2  . TRP A 1 51 ? 2.408   -9.081  -1.124  1.00 0.11 ? 51  TRP A CH2  7  
ATOM   8892  H H    . TRP A 1 51 ? -3.522  -10.285 0.739   1.00 0.07 ? 51  TRP A H    7  
ATOM   8893  H HA   . TRP A 1 51 ? -4.156  -7.591  0.084   1.00 0.06 ? 51  TRP A HA   7  
ATOM   8894  H HB2  . TRP A 1 51 ? -2.859  -9.818  -1.486  1.00 0.07 ? 51  TRP A HB2  7  
ATOM   8895  H HB3  . TRP A 1 51 ? -3.074  -8.194  -2.129  1.00 0.07 ? 51  TRP A HB3  7  
ATOM   8896  H HD1  . TRP A 1 51 ? -2.364  -7.038  1.009   1.00 0.07 ? 51  TRP A HD1  7  
ATOM   8897  H HE1  . TRP A 1 51 ? 0.143   -6.800  1.538   1.00 0.09 ? 51  TRP A HE1  7  
ATOM   8898  H HE3  . TRP A 1 51 ? -0.468  -10.078 -2.640  1.00 0.09 ? 51  TRP A HE3  7  
ATOM   8899  H HZ2  . TRP A 1 51 ? 2.598   -7.771  0.542   1.00 0.11 ? 51  TRP A HZ2  7  
ATOM   8900  H HZ3  . TRP A 1 51 ? 1.970   -10.368 -2.781  1.00 0.11 ? 51  TRP A HZ3  7  
ATOM   8901  H HH2  . TRP A 1 51 ? 3.472   -9.237  -1.225  1.00 0.12 ? 51  TRP A HH2  7  
ATOM   8902  N N    . ASP A 1 52 ? -6.087  -9.898  -1.051  1.00 0.06 ? 52  ASP A N    7  
ATOM   8903  C CA   . ASP A 1 52 ? -7.315  -10.172 -1.789  1.00 0.07 ? 52  ASP A CA   7  
ATOM   8904  C C    . ASP A 1 52 ? -8.433  -9.231  -1.349  1.00 0.06 ? 52  ASP A C    7  
ATOM   8905  O O    . ASP A 1 52 ? -8.979  -8.463  -2.141  1.00 0.06 ? 52  ASP A O    7  
ATOM   8906  C CB   . ASP A 1 52 ? -7.744  -11.625 -1.587  1.00 0.07 ? 52  ASP A CB   7  
ATOM   8907  C CG   . ASP A 1 52 ? -7.335  -12.516 -2.743  1.00 0.08 ? 52  ASP A CG   7  
ATOM   8908  O OD1  . ASP A 1 52 ? -8.104  -13.441 -3.082  1.00 0.09 ? 52  ASP A OD1  7  
ATOM   8909  O OD2  . ASP A 1 52 ? -6.246  -12.288 -3.311  1.00 0.08 ? 52  ASP A OD2  7  
ATOM   8910  H H    . ASP A 1 52 ? -5.722  -10.587 -0.458  1.00 0.06 ? 52  ASP A H    7  
ATOM   8911  H HA   . ASP A 1 52 ? -7.114  -10.008 -2.838  1.00 0.07 ? 52  ASP A HA   7  
ATOM   8912  H HB2  . ASP A 1 52 ? -7.289  -12.006 -0.685  1.00 0.07 ? 52  ASP A HB2  7  
ATOM   8913  H HB3  . ASP A 1 52 ? -8.820  -11.665 -1.487  1.00 0.08 ? 52  ASP A HB3  7  
ATOM   8914  N N    . PRO A 1 53 ? -8.784  -9.293  -0.056  1.00 0.06 ? 53  PRO A N    7  
ATOM   8915  C CA   . PRO A 1 53 ? -9.840  -8.456  0.518   1.00 0.06 ? 53  PRO A CA   7  
ATOM   8916  C C    . PRO A 1 53 ? -9.437  -6.987  0.596   1.00 0.05 ? 53  PRO A C    7  
ATOM   8917  O O    . PRO A 1 53 ? -10.256 -6.127  0.922   1.00 0.06 ? 53  PRO A O    7  
ATOM   8918  C CB   . PRO A 1 53 ? -10.028 -9.035  1.922   1.00 0.06 ? 53  PRO A CB   7  
ATOM   8919  C CG   . PRO A 1 53 ? -8.721  -9.669  2.247   1.00 0.06 ? 53  PRO A CG   7  
ATOM   8920  C CD   . PRO A 1 53 ? -8.175  -10.186 0.945   1.00 0.06 ? 53  PRO A CD   7  
ATOM   8921  H HA   . PRO A 1 53 ? -10.761 -8.546  -0.038  1.00 0.07 ? 53  PRO A HA   7  
ATOM   8922  H HB2  . PRO A 1 53 ? -10.261 -8.240  2.622   1.00 0.06 ? 53  PRO A HB2  7  
ATOM   8923  H HB3  . PRO A 1 53 ? -10.811 -9.775  1.920   1.00 0.07 ? 53  PRO A HB3  7  
ATOM   8924  H HG2  . PRO A 1 53 ? -8.052  -8.934  2.674   1.00 0.06 ? 53  PRO A HG2  7  
ATOM   8925  H HG3  . PRO A 1 53 ? -8.868  -10.488 2.934   1.00 0.07 ? 53  PRO A HG3  7  
ATOM   8926  H HD2  . PRO A 1 53 ? -7.097  -10.108 0.928   1.00 0.06 ? 53  PRO A HD2  7  
ATOM   8927  H HD3  . PRO A 1 53 ? -8.485  -11.208 0.787   1.00 0.07 ? 53  PRO A HD3  7  
ATOM   8928  N N    . ILE A 1 54 ? -8.174  -6.709  0.294   1.00 0.05 ? 54  ILE A N    7  
ATOM   8929  C CA   . ILE A 1 54 ? -7.665  -5.344  0.330   1.00 0.05 ? 54  ILE A CA   7  
ATOM   8930  C C    . ILE A 1 54 ? -7.530  -4.770  -1.076  1.00 0.05 ? 54  ILE A C    7  
ATOM   8931  O O    . ILE A 1 54 ? -7.491  -3.553  -1.263  1.00 0.05 ? 54  ILE A O    7  
ATOM   8932  C CB   . ILE A 1 54 ? -6.296  -5.271  1.034   1.00 0.05 ? 54  ILE A CB   7  
ATOM   8933  C CG1  . ILE A 1 54 ? -6.418  -5.737  2.485   1.00 0.05 ? 54  ILE A CG1  7  
ATOM   8934  C CG2  . ILE A 1 54 ? -5.742  -3.856  0.969   1.00 0.05 ? 54  ILE A CG2  7  
ATOM   8935  C CD1  . ILE A 1 54 ? -5.087  -5.994  3.153   1.00 0.06 ? 54  ILE A CD1  7  
ATOM   8936  H H    . ILE A 1 54 ? -7.570  -7.438  0.044   1.00 0.05 ? 54  ILE A H    7  
ATOM   8937  H HA   . ILE A 1 54 ? -8.365  -4.741  0.889   1.00 0.05 ? 54  ILE A HA   7  
ATOM   8938  H HB   . ILE A 1 54 ? -5.612  -5.923  0.510   1.00 0.05 ? 54  ILE A HB   7  
ATOM   8939  H HG12 . ILE A 1 54 ? -6.934  -4.980  3.057   1.00 0.06 ? 54  ILE A HG12 7  
ATOM   8940  H HG13 . ILE A 1 54 ? -6.989  -6.654  2.515   1.00 0.05 ? 54  ILE A HG13 7  
ATOM   8941  H HG21 . ILE A 1 54 ? -4.851  -3.789  1.576   1.00 0.06 ? 54  ILE A HG21 7  
ATOM   8942  H HG22 . ILE A 1 54 ? -6.483  -3.165  1.339   1.00 0.05 ? 54  ILE A HG22 7  
ATOM   8943  H HG23 . ILE A 1 54 ? -5.500  -3.610  -0.054  1.00 0.06 ? 54  ILE A HG23 7  
ATOM   8944  H HD11 . ILE A 1 54 ? -5.251  -6.363  4.154   1.00 0.07 ? 54  ILE A HD11 7  
ATOM   8945  H HD12 . ILE A 1 54 ? -4.522  -5.075  3.196   1.00 0.07 ? 54  ILE A HD12 7  
ATOM   8946  H HD13 . ILE A 1 54 ? -4.535  -6.729  2.584   1.00 0.06 ? 54  ILE A HD13 7  
ATOM   8947  N N    . THR A 1 55 ? -7.464  -5.655  -2.067  1.00 0.06 ? 55  THR A N    7  
ATOM   8948  C CA   . THR A 1 55 ? -7.337  -5.238  -3.456  1.00 0.06 ? 55  THR A CA   7  
ATOM   8949  C C    . THR A 1 55 ? -8.704  -5.089  -4.114  1.00 0.07 ? 55  THR A C    7  
ATOM   8950  O O    . THR A 1 55 ? -8.923  -4.180  -4.915  1.00 0.08 ? 55  THR A O    7  
ATOM   8951  C CB   . THR A 1 55 ? -6.496  -6.241  -4.270  1.00 0.07 ? 55  THR A CB   7  
ATOM   8952  O OG1  . THR A 1 55 ? -5.141  -6.230  -3.808  1.00 0.07 ? 55  THR A OG1  7  
ATOM   8953  C CG2  . THR A 1 55 ? -6.535  -5.904  -5.753  1.00 0.08 ? 55  THR A CG2  7  
ATOM   8954  H H    . THR A 1 55 ? -7.499  -6.612  -1.858  1.00 0.06 ? 55  THR A H    7  
ATOM   8955  H HA   . THR A 1 55 ? -6.834  -4.281  -3.473  1.00 0.07 ? 55  THR A HA   7  
ATOM   8956  H HB   . THR A 1 55 ? -6.908  -7.230  -4.129  1.00 0.07 ? 55  THR A HB   7  
ATOM   8957  H HG1  . THR A 1 55 ? -4.560  -5.975  -4.528  1.00 0.08 ? 55  THR A HG1  7  
ATOM   8958  H HG21 . THR A 1 55 ? -7.557  -5.934  -6.102  1.00 0.09 ? 55  THR A HG21 7  
ATOM   8959  H HG22 . THR A 1 55 ? -5.946  -6.624  -6.302  1.00 0.09 ? 55  THR A HG22 7  
ATOM   8960  H HG23 . THR A 1 55 ? -6.131  -4.915  -5.908  1.00 0.08 ? 55  THR A HG23 7  
ATOM   8961  N N    . ALA A 1 56 ? -9.622  -5.987  -3.772  1.00 0.07 ? 56  ALA A N    7  
ATOM   8962  C CA   . ALA A 1 56 ? -10.969 -5.953  -4.327  1.00 0.08 ? 56  ALA A CA   7  
ATOM   8963  C C    . ALA A 1 56 ? -11.748 -4.750  -3.803  1.00 0.08 ? 56  ALA A C    7  
ATOM   8964  O O    . ALA A 1 56 ? -12.487 -4.107  -4.547  1.00 0.09 ? 56  ALA A O    7  
ATOM   8965  C CB   . ALA A 1 56 ? -11.706 -7.243  -4.001  1.00 0.08 ? 56  ALA A CB   7  
ATOM   8966  H H    . ALA A 1 56 ? -9.387  -6.690  -3.131  1.00 0.07 ? 56  ALA A H    7  
ATOM   8967  H HA   . ALA A 1 56 ? -10.885 -5.876  -5.401  1.00 0.09 ? 56  ALA A HA   7  
ATOM   8968  H HB1  . ALA A 1 56 ? -12.682 -7.228  -4.464  1.00 0.09 ? 56  ALA A HB1  7  
ATOM   8969  H HB2  . ALA A 1 56 ? -11.817 -7.334  -2.930  1.00 0.08 ? 56  ALA A HB2  7  
ATOM   8970  H HB3  . ALA A 1 56 ? -11.143 -8.084  -4.377  1.00 0.09 ? 56  ALA A HB3  7  
ATOM   8971  N N    . ALA A 1 57 ? -11.578 -4.453  -2.520  1.00 0.07 ? 57  ALA A N    7  
ATOM   8972  C CA   . ALA A 1 57 ? -12.262 -3.326  -1.899  1.00 0.07 ? 57  ALA A CA   7  
ATOM   8973  C C    . ALA A 1 57 ? -11.862 -2.010  -2.554  1.00 0.07 ? 57  ALA A C    7  
ATOM   8974  O O    . ALA A 1 57 ? -12.713 -1.257  -3.030  1.00 0.08 ? 57  ALA A O    7  
ATOM   8975  C CB   . ALA A 1 57 ? -11.967 -3.287  -0.406  1.00 0.06 ? 57  ALA A CB   7  
ATOM   8976  H H    . ALA A 1 57 ? -10.976 -5.005  -1.978  1.00 0.07 ? 57  ALA A H    7  
ATOM   8977  H HA   . ALA A 1 57 ? -13.325 -3.472  -2.027  1.00 0.08 ? 57  ALA A HA   7  
ATOM   8978  H HB1  . ALA A 1 57 ? -12.252 -4.226  0.043   1.00 0.07 ? 57  ALA A HB1  7  
ATOM   8979  H HB2  . ALA A 1 57 ? -12.526 -2.484  0.051   1.00 0.07 ? 57  ALA A HB2  7  
ATOM   8980  H HB3  . ALA A 1 57 ? -10.910 -3.122  -0.253  1.00 0.06 ? 57  ALA A HB3  7  
ATOM   8981  N N    . LEU A 1 58 ? -10.561 -1.737  -2.575  1.00 0.07 ? 58  LEU A N    7  
ATOM   8982  C CA   . LEU A 1 58 ? -10.048 -0.509  -3.173  1.00 0.08 ? 58  LEU A CA   7  
ATOM   8983  C C    . LEU A 1 58 ? -10.503 -0.377  -4.623  1.00 0.09 ? 58  LEU A C    7  
ATOM   8984  O O    . LEU A 1 58 ? -10.900 0.701   -5.063  1.00 0.09 ? 58  LEU A O    7  
ATOM   8985  C CB   . LEU A 1 58 ? -8.521  -0.485  -3.103  1.00 0.07 ? 58  LEU A CB   7  
ATOM   8986  C CG   . LEU A 1 58 ? -7.915  -0.265  -1.716  1.00 0.07 ? 58  LEU A CG   7  
ATOM   8987  C CD1  . LEU A 1 58 ? -6.446  -0.659  -1.705  1.00 0.07 ? 58  LEU A CD1  7  
ATOM   8988  C CD2  . LEU A 1 58 ? -8.085  1.184   -1.283  1.00 0.07 ? 58  LEU A CD2  7  
ATOM   8989  H H    . LEU A 1 58 ? -9.931  -2.375  -2.180  1.00 0.06 ? 58  LEU A H    7  
ATOM   8990  H HA   . LEU A 1 58 ? -10.439 0.323   -2.608  1.00 0.08 ? 58  LEU A HA   7  
ATOM   8991  H HB2  . LEU A 1 58 ? -8.153  -1.426  -3.483  1.00 0.07 ? 58  LEU A HB2  7  
ATOM   8992  H HB3  . LEU A 1 58 ? -8.168  0.304   -3.749  1.00 0.08 ? 58  LEU A HB3  7  
ATOM   8993  H HG   . LEU A 1 58 ? -8.432  -0.890  -1.003  1.00 0.06 ? 58  LEU A HG   7  
ATOM   8994  H HD11 . LEU A 1 58 ? -6.006  -0.384  -0.757  1.00 0.07 ? 58  LEU A HD11 7  
ATOM   8995  H HD12 . LEU A 1 58 ? -5.932  -0.148  -2.503  1.00 0.08 ? 58  LEU A HD12 7  
ATOM   8996  H HD13 . LEU A 1 58 ? -6.359  -1.726  -1.845  1.00 0.06 ? 58  LEU A HD13 7  
ATOM   8997  H HD21 . LEU A 1 58 ? -9.134  1.397   -1.143  1.00 0.07 ? 58  LEU A HD21 7  
ATOM   8998  H HD22 . LEU A 1 58 ? -7.684  1.836   -2.045  1.00 0.08 ? 58  LEU A HD22 7  
ATOM   8999  H HD23 . LEU A 1 58 ? -7.557  1.347   -0.356  1.00 0.07 ? 58  LEU A HD23 7  
ATOM   9000  N N    . SER A 1 59 ? -10.445 -1.482  -5.359  1.00 0.09 ? 59  SER A N    7  
ATOM   9001  C CA   . SER A 1 59 ? -10.850 -1.490  -6.761  1.00 0.10 ? 59  SER A CA   7  
ATOM   9002  C C    . SER A 1 59 ? -12.368 -1.398  -6.887  1.00 0.11 ? 59  SER A C    7  
ATOM   9003  O O    . SER A 1 59 ? -12.892 -1.023  -7.936  1.00 0.12 ? 59  SER A O    7  
ATOM   9004  C CB   . SER A 1 59 ? -10.344 -2.758  -7.452  1.00 0.10 ? 59  SER A CB   7  
ATOM   9005  O OG   . SER A 1 59 ? -10.973 -2.936  -8.710  1.00 0.12 ? 59  SER A OG   7  
ATOM   9006  H H    . SER A 1 59 ? -10.121 -2.312  -4.951  1.00 0.08 ? 59  SER A H    7  
ATOM   9007  H HA   . SER A 1 59 ? -10.410 -0.629  -7.238  1.00 0.11 ? 59  SER A HA   7  
ATOM   9008  H HB2  . SER A 1 59 ? -9.278  -2.681  -7.604  1.00 0.10 ? 59  SER A HB2  7  
ATOM   9009  H HB3  . SER A 1 59 ? -10.559 -3.614  -6.831  1.00 0.10 ? 59  SER A HB3  7  
ATOM   9010  H HG   . SER A 1 59 ? -10.310 -2.924  -9.404  1.00 0.12 ? 59  SER A HG   7  
ATOM   9011  N N    . GLN A 1 60 ? -13.068 -1.746  -5.811  1.00 0.10 ? 60  GLN A N    7  
ATOM   9012  C CA   . GLN A 1 60 ? -14.525 -1.703  -5.802  1.00 0.11 ? 60  GLN A CA   7  
ATOM   9013  C C    . GLN A 1 60 ? -15.027 -0.286  -5.548  1.00 0.11 ? 60  GLN A C    7  
ATOM   9014  O O    . GLN A 1 60 ? -15.974 0.172   -6.189  1.00 0.13 ? 60  GLN A O    7  
ATOM   9015  C CB   . GLN A 1 60 ? -15.078 -2.651  -4.737  1.00 0.11 ? 60  GLN A CB   7  
ATOM   9016  C CG   . GLN A 1 60 ? -16.592 -2.616  -4.616  1.00 0.12 ? 60  GLN A CG   7  
ATOM   9017  C CD   . GLN A 1 60 ? -17.099 -3.356  -3.393  1.00 0.12 ? 60  GLN A CD   7  
ATOM   9018  O OE1  . GLN A 1 60 ? -17.978 -4.211  -3.492  1.00 0.12 ? 60  GLN A OE1  7  
ATOM   9019  N NE2  . GLN A 1 60 ? -16.543 -3.030  -2.232  1.00 0.11 ? 60  GLN A NE2  7  
ATOM   9020  H H    . GLN A 1 60 ? -12.592 -2.038  -5.004  1.00 0.09 ? 60  GLN A H    7  
ATOM   9021  H HA   . GLN A 1 60 ? -14.871 -2.027  -6.771  1.00 0.12 ? 60  GLN A HA   7  
ATOM   9022  H HB2  . GLN A 1 60 ? -14.780 -3.660  -4.981  1.00 0.11 ? 60  GLN A HB2  7  
ATOM   9023  H HB3  . GLN A 1 60 ? -14.655 -2.383  -3.779  1.00 0.10 ? 60  GLN A HB3  7  
ATOM   9024  H HG2  . GLN A 1 60 ? -16.911 -1.587  -4.552  1.00 0.12 ? 60  GLN A HG2  7  
ATOM   9025  H HG3  . GLN A 1 60 ? -17.021 -3.070  -5.497  1.00 0.13 ? 60  GLN A HG3  7  
ATOM   9026  H HE21 . GLN A 1 60 ? -15.847 -2.341  -2.229  1.00 0.10 ? 60  GLN A HE21 7  
ATOM   9027  H HE22 . GLN A 1 60 ? -16.853 -3.494  -1.426  1.00 0.11 ? 60  GLN A HE22 7  
ATOM   9028  N N    . ARG A 1 61 ? -14.389 0.404   -4.609  1.00 0.11 ? 61  ARG A N    7  
ATOM   9029  C CA   . ARG A 1 61 ? -14.772 1.769   -4.269  1.00 0.11 ? 61  ARG A CA   7  
ATOM   9030  C C    . ARG A 1 61 ? -14.407 2.732   -5.394  1.00 0.12 ? 61  ARG A C    7  
ATOM   9031  O O    . ARG A 1 61 ? -15.110 3.710   -5.639  1.00 0.13 ? 61  ARG A O    7  
ATOM   9032  C CB   . ARG A 1 61 ? -14.090 2.203   -2.971  1.00 0.10 ? 61  ARG A CB   7  
ATOM   9033  C CG   . ARG A 1 61 ? -12.706 2.795   -3.176  1.00 0.10 ? 61  ARG A CG   7  
ATOM   9034  C CD   . ARG A 1 61 ? -12.049 3.152   -1.852  1.00 0.09 ? 61  ARG A CD   7  
ATOM   9035  N NE   . ARG A 1 61 ? -11.662 4.560   -1.795  1.00 0.10 ? 61  ARG A NE   7  
ATOM   9036  C CZ   . ARG A 1 61 ? -11.244 5.162   -0.687  1.00 0.09 ? 61  ARG A CZ   7  
ATOM   9037  N NH1  . ARG A 1 61 ? -11.159 4.484   0.448   1.00 0.09 ? 61  ARG A NH1  7  
ATOM   9038  N NH2  . ARG A 1 61 ? -10.911 6.445   -0.715  1.00 0.10 ? 61  ARG A NH2  7  
ATOM   9039  H H    . ARG A 1 61 ? -13.642 -0.016  -4.131  1.00 0.10 ? 61  ARG A H    7  
ATOM   9040  H HA   . ARG A 1 61 ? -15.841 1.787   -4.128  1.00 0.12 ? 61  ARG A HA   7  
ATOM   9041  H HB2  . ARG A 1 61 ? -14.706 2.946   -2.486  1.00 0.10 ? 61  ARG A HB2  7  
ATOM   9042  H HB3  . ARG A 1 61 ? -13.998 1.345   -2.322  1.00 0.09 ? 61  ARG A HB3  7  
ATOM   9043  H HG2  . ARG A 1 61 ? -12.088 2.072   -3.689  1.00 0.09 ? 61  ARG A HG2  7  
ATOM   9044  H HG3  . ARG A 1 61 ? -12.792 3.688   -3.778  1.00 0.10 ? 61  ARG A HG3  7  
ATOM   9045  H HD2  . ARG A 1 61 ? -12.746 2.948   -1.054  1.00 0.09 ? 61  ARG A HD2  7  
ATOM   9046  H HD3  . ARG A 1 61 ? -11.168 2.541   -1.725  1.00 0.08 ? 61  ARG A HD3  7  
ATOM   9047  H HE   . ARG A 1 61 ? -11.717 5.080   -2.624  1.00 0.10 ? 61  ARG A HE   7  
ATOM   9048  H HH11 . ARG A 1 61 ? -10.844 4.939   1.281   1.00 0.09 ? 61  ARG A HH11 7  
ATOM   9049  H HH12 . ARG A 1 61 ? -11.411 3.516   0.473   1.00 0.08 ? 61  ARG A HH12 7  
ATOM   9050  H HH21 . ARG A 1 61 ? -10.973 6.960   -1.570  1.00 0.11 ? 61  ARG A HH21 7  
ATOM   9051  H HH22 . ARG A 1 61 ? -10.594 6.898   0.119   1.00 0.10 ? 61  ARG A HH22 7  
ATOM   9052  N N    . ALA A 1 62 ? -13.301 2.447   -6.076  1.00 0.12 ? 62  ALA A N    7  
ATOM   9053  C CA   . ALA A 1 62 ? -12.843 3.287   -7.176  1.00 0.13 ? 62  ALA A CA   7  
ATOM   9054  C C    . ALA A 1 62 ? -13.756 3.146   -8.389  1.00 0.14 ? 62  ALA A C    7  
ATOM   9055  O O    . ALA A 1 62 ? -14.132 4.138   -9.013  1.00 0.15 ? 62  ALA A O    7  
ATOM   9056  C CB   . ALA A 1 62 ? -11.410 2.937   -7.546  1.00 0.12 ? 62  ALA A CB   7  
ATOM   9057  H H    . ALA A 1 62 ? -12.781 1.653   -5.833  1.00 0.11 ? 62  ALA A H    7  
ATOM   9058  H HA   . ALA A 1 62 ? -12.863 4.314   -6.841  1.00 0.13 ? 62  ALA A HA   7  
ATOM   9059  H HB1  . ALA A 1 62 ? -11.367 1.912   -7.884  1.00 0.12 ? 62  ALA A HB1  7  
ATOM   9060  H HB2  . ALA A 1 62 ? -10.775 3.059   -6.681  1.00 0.11 ? 62  ALA A HB2  7  
ATOM   9061  H HB3  . ALA A 1 62 ? -11.073 3.591   -8.336  1.00 0.13 ? 62  ALA A HB3  7  
ATOM   9062  N N    . MET A 1 63 ? -14.106 1.907   -8.720  1.00 0.14 ? 63  MET A N    7  
ATOM   9063  C CA   . MET A 1 63 ? -14.974 1.637   -9.860  1.00 0.15 ? 63  MET A CA   7  
ATOM   9064  C C    . MET A 1 63 ? -16.392 2.133   -9.593  1.00 0.16 ? 63  MET A C    7  
ATOM   9065  O O    . MET A 1 63 ? -17.090 2.570   -10.509 1.00 0.17 ? 63  MET A O    7  
ATOM   9066  C CB   . MET A 1 63 ? -14.996 0.140   -10.168 1.00 0.15 ? 63  MET A CB   7  
ATOM   9067  C CG   . MET A 1 63 ? -15.767 -0.681  -9.148  1.00 0.15 ? 63  MET A CG   7  
ATOM   9068  S SD   . MET A 1 63 ? -15.937 -2.410  -9.631  1.00 0.15 ? 63  MET A SD   7  
ATOM   9069  C CE   . MET A 1 63 ? -14.219 -2.918  -9.670  1.00 0.14 ? 63  MET A CE   7  
ATOM   9070  H H    . MET A 1 63 ? -13.773 1.157   -8.184  1.00 0.13 ? 63  MET A H    7  
ATOM   9071  H HA   . MET A 1 63 ? -14.575 2.166   -10.713 1.00 0.16 ? 63  MET A HA   7  
ATOM   9072  H HB2  . MET A 1 63 ? -15.449 -0.011  -11.137 1.00 0.16 ? 63  MET A HB2  7  
ATOM   9073  H HB3  . MET A 1 63 ? -13.980 -0.225  -10.195 1.00 0.15 ? 63  MET A HB3  7  
ATOM   9074  H HG2  . MET A 1 63 ? -15.251 -0.634  -8.203  1.00 0.14 ? 63  MET A HG2  7  
ATOM   9075  H HG3  . MET A 1 63 ? -16.754 -0.254  -9.040  1.00 0.15 ? 63  MET A HG3  7  
ATOM   9076  H HE1  . MET A 1 63 ? -13.705 -2.388  -10.458 1.00 0.15 ? 63  MET A HE1  7  
ATOM   9077  H HE2  . MET A 1 63 ? -14.162 -3.981  -9.854  1.00 0.14 ? 63  MET A HE2  7  
ATOM   9078  H HE3  . MET A 1 63 ? -13.755 -2.691  -8.722  1.00 0.13 ? 63  MET A HE3  7  
ATOM   9079  N N    . ILE A 1 64 ? -16.810 2.066   -8.334  1.00 0.15 ? 64  ILE A N    7  
ATOM   9080  C CA   . ILE A 1 64 ? -18.145 2.510   -7.948  1.00 0.16 ? 64  ILE A CA   7  
ATOM   9081  C C    . ILE A 1 64 ? -18.163 4.006   -7.657  1.00 0.16 ? 64  ILE A C    7  
ATOM   9082  O O    . ILE A 1 64 ? -18.662 4.799   -8.457  1.00 0.17 ? 64  ILE A O    7  
ATOM   9083  C CB   . ILE A 1 64 ? -18.652 1.751   -6.708  1.00 0.15 ? 64  ILE A CB   7  
ATOM   9084  C CG1  . ILE A 1 64 ? -18.810 0.261   -7.024  1.00 0.15 ? 64  ILE A CG1  7  
ATOM   9085  C CG2  . ILE A 1 64 ? -19.973 2.337   -6.232  1.00 0.16 ? 64  ILE A CG2  7  
ATOM   9086  C CD1  . ILE A 1 64 ? -19.205 -0.572  -5.826  1.00 0.15 ? 64  ILE A CD1  7  
ATOM   9087  H H    . ILE A 1 64 ? -16.207 1.710   -7.649  1.00 0.14 ? 64  ILE A H    7  
ATOM   9088  H HA   . ILE A 1 64 ? -18.815 2.304   -8.771  1.00 0.17 ? 64  ILE A HA   7  
ATOM   9089  H HB   . ILE A 1 64 ? -17.928 1.869   -5.917  1.00 0.14 ? 64  ILE A HB   7  
ATOM   9090  H HG12 . ILE A 1 64 ? -19.572 0.138   -7.778  1.00 0.16 ? 64  ILE A HG12 7  
ATOM   9091  H HG13 . ILE A 1 64 ? -17.873 -0.121  -7.399  1.00 0.15 ? 64  ILE A HG13 7  
ATOM   9092  H HG21 . ILE A 1 64 ? -20.308 1.805   -5.354  1.00 0.15 ? 64  ILE A HG21 7  
ATOM   9093  H HG22 . ILE A 1 64 ? -20.711 2.242   -7.015  1.00 0.17 ? 64  ILE A HG22 7  
ATOM   9094  H HG23 . ILE A 1 64 ? -19.836 3.382   -5.991  1.00 0.16 ? 64  ILE A HG23 7  
ATOM   9095  H HD11 . ILE A 1 64 ? -20.213 -0.322  -5.530  1.00 0.15 ? 64  ILE A HD11 7  
ATOM   9096  H HD12 . ILE A 1 64 ? -18.530 -0.368  -5.008  1.00 0.14 ? 64  ILE A HD12 7  
ATOM   9097  H HD13 . ILE A 1 64 ? -19.154 -1.619  -6.083  1.00 0.15 ? 64  ILE A HD13 7  
ATOM   9098  N N    . LEU A 1 65 ? -17.616 4.385   -6.508  1.00 0.15 ? 65  LEU A N    7  
ATOM   9099  C CA   . LEU A 1 65 ? -17.567 5.789   -6.111  1.00 0.15 ? 65  LEU A CA   7  
ATOM   9100  C C    . LEU A 1 65 ? -16.975 6.649   -7.222  1.00 0.16 ? 65  LEU A C    7  
ATOM   9101  O O    . LEU A 1 65 ? -17.425 7.769   -7.461  1.00 0.16 ? 65  LEU A O    7  
ATOM   9102  C CB   . LEU A 1 65 ? -16.744 5.949   -4.831  1.00 0.14 ? 65  LEU A CB   7  
ATOM   9103  C CG   . LEU A 1 65 ? -17.355 6.836   -3.745  1.00 0.14 ? 65  LEU A CG   7  
ATOM   9104  C CD1  . LEU A 1 65 ? -18.252 6.016   -2.831  1.00 0.14 ? 65  LEU A CD1  7  
ATOM   9105  C CD2  . LEU A 1 65 ? -16.263 7.527   -2.945  1.00 0.13 ? 65  LEU A CD2  7  
ATOM   9106  H H    . LEU A 1 65 ? -17.232 3.708   -5.913  1.00 0.14 ? 65  LEU A H    7  
ATOM   9107  H HA   . LEU A 1 65 ? -18.579 6.115   -5.919  1.00 0.16 ? 65  LEU A HA   7  
ATOM   9108  H HB2  . LEU A 1 65 ? -16.585 4.966   -4.411  1.00 0.13 ? 65  LEU A HB2  7  
ATOM   9109  H HB3  . LEU A 1 65 ? -15.784 6.362   -5.100  1.00 0.14 ? 65  LEU A HB3  7  
ATOM   9110  H HG   . LEU A 1 65 ? -17.963 7.598   -4.211  1.00 0.15 ? 65  LEU A HG   7  
ATOM   9111  H HD11 . LEU A 1 65 ? -17.664 5.257   -2.335  1.00 0.13 ? 65  LEU A HD11 7  
ATOM   9112  H HD12 . LEU A 1 65 ? -19.028 5.545   -3.416  1.00 0.14 ? 65  LEU A HD12 7  
ATOM   9113  H HD13 . LEU A 1 65 ? -18.701 6.663   -2.092  1.00 0.14 ? 65  LEU A HD13 7  
ATOM   9114  H HD21 . LEU A 1 65 ? -15.734 8.220   -3.581  1.00 0.14 ? 65  LEU A HD21 7  
ATOM   9115  H HD22 . LEU A 1 65 ? -15.571 6.789   -2.565  1.00 0.13 ? 65  LEU A HD22 7  
ATOM   9116  H HD23 . LEU A 1 65 ? -16.706 8.064   -2.118  1.00 0.14 ? 65  LEU A HD23 7  
ATOM   9117  N N    . GLY A 1 66 ? -15.962 6.116   -7.899  1.00 0.15 ? 66  GLY A N    7  
ATOM   9118  C CA   . GLY A 1 66 ? -15.327 6.849   -8.979  1.00 0.16 ? 66  GLY A CA   7  
ATOM   9119  C C    . GLY A 1 66 ? -14.105 7.617   -8.518  1.00 0.16 ? 66  GLY A C    7  
ATOM   9120  O O    . GLY A 1 66 ? -13.909 8.773   -8.895  1.00 0.16 ? 66  GLY A O    7  
ATOM   9121  H H    . GLY A 1 66 ? -15.647 5.218   -7.667  1.00 0.15 ? 66  GLY A H    7  
ATOM   9122  H HA2  . GLY A 1 66 ? -15.030 6.151   -9.748  1.00 0.16 ? 66  GLY A HA2  7  
ATOM   9123  H HA3  . GLY A 1 66 ? -16.039 7.545   -9.396  1.00 0.17 ? 66  GLY A HA3  7  
ATOM   9124  N N    . LYS A 1 67 ? -13.279 6.975   -7.698  1.00 0.15 ? 67  LYS A N    7  
ATOM   9125  C CA   . LYS A 1 67 ? -12.069 7.604   -7.182  1.00 0.14 ? 67  LYS A CA   7  
ATOM   9126  C C    . LYS A 1 67 ? -11.094 6.558   -6.651  1.00 0.13 ? 67  LYS A C    7  
ATOM   9127  O O    . LYS A 1 67 ? -11.436 5.767   -5.773  1.00 0.12 ? 67  LYS A O    7  
ATOM   9128  C CB   . LYS A 1 67 ? -12.420 8.599   -6.072  1.00 0.14 ? 67  LYS A CB   7  
ATOM   9129  C CG   . LYS A 1 67 ? -13.103 7.958   -4.876  1.00 0.13 ? 67  LYS A CG   7  
ATOM   9130  C CD   . LYS A 1 67 ? -12.135 7.760   -3.722  1.00 0.12 ? 67  LYS A CD   7  
ATOM   9131  C CE   . LYS A 1 67 ? -12.189 8.921   -2.742  1.00 0.13 ? 67  LYS A CE   7  
ATOM   9132  N NZ   . LYS A 1 67 ? -12.039 10.235  -3.431  1.00 0.14 ? 67  LYS A NZ   7  
ATOM   9133  H H    . LYS A 1 67 ? -13.489 6.055   -7.433  1.00 0.14 ? 67  LYS A H    7  
ATOM   9134  H HA   . LYS A 1 67 ? -11.600 8.138   -7.996  1.00 0.15 ? 67  LYS A HA   7  
ATOM   9135  H HB2  . LYS A 1 67 ? -11.512 9.074   -5.730  1.00 0.14 ? 67  LYS A HB2  7  
ATOM   9136  H HB3  . LYS A 1 67 ? -13.080 9.352   -6.475  1.00 0.15 ? 67  LYS A HB3  7  
ATOM   9137  H HG2  . LYS A 1 67 ? -13.910 8.598   -4.550  1.00 0.14 ? 67  LYS A HG2  7  
ATOM   9138  H HG3  . LYS A 1 67 ? -13.499 6.998   -5.172  1.00 0.13 ? 67  LYS A HG3  7  
ATOM   9139  H HD2  . LYS A 1 67 ? -12.393 6.851   -3.200  1.00 0.12 ? 67  LYS A HD2  7  
ATOM   9140  H HD3  . LYS A 1 67 ? -11.132 7.678   -4.116  1.00 0.12 ? 67  LYS A HD3  7  
ATOM   9141  H HE2  . LYS A 1 67 ? -13.139 8.901   -2.229  1.00 0.13 ? 67  LYS A HE2  7  
ATOM   9142  H HE3  . LYS A 1 67 ? -11.390 8.808   -2.023  1.00 0.12 ? 67  LYS A HE3  7  
ATOM   9143  H HZ1  . LYS A 1 67 ? -12.799 10.360  -4.130  1.00 0.14 ? 67  LYS A HZ1  7  
ATOM   9144  H HZ2  . LYS A 1 67 ? -11.122 10.279  -3.920  1.00 0.14 ? 67  LYS A HZ2  7  
ATOM   9145  H HZ3  . LYS A 1 67 ? -12.087 11.009  -2.739  1.00 0.14 ? 67  LYS A HZ3  7  
ATOM   9146  N N    . SER A 1 68 ? -9.880  6.561   -7.192  1.00 0.13 ? 68  SER A N    7  
ATOM   9147  C CA   . SER A 1 68 ? -8.857  5.608   -6.776  1.00 0.13 ? 68  SER A CA   7  
ATOM   9148  C C    . SER A 1 68 ? -7.718  6.318   -6.051  1.00 0.13 ? 68  SER A C    7  
ATOM   9149  O O    . SER A 1 68 ? -6.545  6.011   -6.260  1.00 0.13 ? 68  SER A O    7  
ATOM   9150  C CB   . SER A 1 68 ? -8.312  4.851   -7.988  1.00 0.13 ? 68  SER A CB   7  
ATOM   9151  O OG   . SER A 1 68 ? -8.189  5.705   -9.111  1.00 0.14 ? 68  SER A OG   7  
ATOM   9152  H H    . SER A 1 68 ? -9.668  7.216   -7.890  1.00 0.14 ? 68  SER A H    7  
ATOM   9153  H HA   . SER A 1 68 ? -9.316  4.904   -6.098  1.00 0.12 ? 68  SER A HA   7  
ATOM   9154  H HB2  . SER A 1 68 ? -7.338  4.451   -7.750  1.00 0.13 ? 68  SER A HB2  7  
ATOM   9155  H HB3  . SER A 1 68 ? -8.982  4.042   -8.236  1.00 0.13 ? 68  SER A HB3  7  
ATOM   9156  H HG   . SER A 1 68 ? -8.420  5.223   -9.908  1.00 0.15 ? 68  SER A HG   7  
ATOM   9157  N N    . GLY A 1 69 ? -8.072  7.272   -5.194  1.00 0.13 ? 69  GLY A N    7  
ATOM   9158  C CA   . GLY A 1 69 ? -7.070  8.012   -4.451  1.00 0.13 ? 69  GLY A CA   7  
ATOM   9159  C C    . GLY A 1 69 ? -6.200  7.112   -3.598  1.00 0.12 ? 69  GLY A C    7  
ATOM   9160  O O    . GLY A 1 69 ? -5.076  7.473   -3.252  1.00 0.13 ? 69  GLY A O    7  
ATOM   9161  H H    . GLY A 1 69 ? -9.023  7.474   -5.067  1.00 0.13 ? 69  GLY A H    7  
ATOM   9162  H HA2  . GLY A 1 69 ? -6.442  8.546   -5.148  1.00 0.14 ? 69  GLY A HA2  7  
ATOM   9163  H HA3  . GLY A 1 69 ? -7.567  8.726   -3.810  1.00 0.13 ? 69  GLY A HA3  7  
ATOM   9164  N N    . GLU A 1 70 ? -6.720  5.937   -3.256  1.00 0.11 ? 70  GLU A N    7  
ATOM   9165  C CA   . GLU A 1 70 ? -5.983  4.984   -2.436  1.00 0.10 ? 70  GLU A CA   7  
ATOM   9166  C C    . GLU A 1 70 ? -5.501  3.804   -3.273  1.00 0.10 ? 70  GLU A C    7  
ATOM   9167  O O    . GLU A 1 70 ? -4.516  3.148   -2.935  1.00 0.10 ? 70  GLU A O    7  
ATOM   9168  C CB   . GLU A 1 70 ? -6.859  4.484   -1.284  1.00 0.09 ? 70  GLU A CB   7  
ATOM   9169  C CG   . GLU A 1 70 ? -6.606  5.203   0.029   1.00 0.10 ? 70  GLU A CG   7  
ATOM   9170  C CD   . GLU A 1 70 ? -7.323  6.536   0.113   1.00 0.10 ? 70  GLU A CD   7  
ATOM   9171  O OE1  . GLU A 1 70 ? -7.353  7.127   1.212   1.00 0.11 ? 70  GLU A OE1  7  
ATOM   9172  O OE2  . GLU A 1 70 ? -7.852  6.990   -0.922  1.00 0.11 ? 70  GLU A OE2  7  
ATOM   9173  H H    . GLU A 1 70 ? -7.622  5.708   -3.561  1.00 0.11 ? 70  GLU A H    7  
ATOM   9174  H HA   . GLU A 1 70 ? -5.124  5.494   -2.028  1.00 0.11 ? 70  GLU A HA   7  
ATOM   9175  H HB2  . GLU A 1 70 ? -7.896  4.619   -1.550  1.00 0.09 ? 70  GLU A HB2  7  
ATOM   9176  H HB3  . GLU A 1 70 ? -6.668  3.431   -1.135  1.00 0.09 ? 70  GLU A HB3  7  
ATOM   9177  H HG2  . GLU A 1 70 ? -6.948  4.577   0.840   1.00 0.09 ? 70  GLU A HG2  7  
ATOM   9178  H HG3  . GLU A 1 70 ? -5.545  5.375   0.131   1.00 0.10 ? 70  GLU A HG3  7  
ATOM   9179  N N    . LEU A 1 71 ? -6.205  3.537   -4.368  1.00 0.10 ? 71  LEU A N    7  
ATOM   9180  C CA   . LEU A 1 71 ? -5.850  2.435   -5.256  1.00 0.10 ? 71  LEU A CA   7  
ATOM   9181  C C    . LEU A 1 71 ? -4.475  2.656   -5.878  1.00 0.11 ? 71  LEU A C    7  
ATOM   9182  O O    . LEU A 1 71 ? -3.626  1.765   -5.868  1.00 0.11 ? 71  LEU A O    7  
ATOM   9183  C CB   . LEU A 1 71 ? -6.902  2.281   -6.357  1.00 0.11 ? 71  LEU A CB   7  
ATOM   9184  C CG   . LEU A 1 71 ? -7.442  0.867   -6.578  1.00 0.10 ? 71  LEU A CG   7  
ATOM   9185  C CD1  . LEU A 1 71 ? -8.334  0.824   -7.808  1.00 0.11 ? 71  LEU A CD1  7  
ATOM   9186  C CD2  . LEU A 1 71 ? -6.296  -0.125  -6.711  1.00 0.10 ? 71  LEU A CD2  7  
ATOM   9187  H H    . LEU A 1 71 ? -6.980  4.095   -4.585  1.00 0.11 ? 71  LEU A H    7  
ATOM   9188  H HA   . LEU A 1 71 ? -5.824  1.531   -4.667  1.00 0.10 ? 71  LEU A HA   7  
ATOM   9189  H HB2  . LEU A 1 71 ? -7.735  2.925   -6.116  1.00 0.11 ? 71  LEU A HB2  7  
ATOM   9190  H HB3  . LEU A 1 71 ? -6.466  2.622   -7.284  1.00 0.12 ? 71  LEU A HB3  7  
ATOM   9191  H HG   . LEU A 1 71 ? -8.037  0.580   -5.725  1.00 0.10 ? 71  LEU A HG   7  
ATOM   9192  H HD11 . LEU A 1 71 ? -9.241  1.378   -7.615  1.00 0.11 ? 71  LEU A HD11 7  
ATOM   9193  H HD12 . LEU A 1 71 ? -8.581  -0.202  -8.038  1.00 0.11 ? 71  LEU A HD12 7  
ATOM   9194  H HD13 . LEU A 1 71 ? -7.814  1.265   -8.645  1.00 0.12 ? 71  LEU A HD13 7  
ATOM   9195  H HD21 . LEU A 1 71 ? -5.629  0.197   -7.498  1.00 0.11 ? 71  LEU A HD21 7  
ATOM   9196  H HD22 . LEU A 1 71 ? -6.690  -1.101  -6.951  1.00 0.10 ? 71  LEU A HD22 7  
ATOM   9197  H HD23 . LEU A 1 71 ? -5.753  -0.177  -5.779  1.00 0.10 ? 71  LEU A HD23 7  
ATOM   9198  N N    . LYS A 1 72 ? -4.262  3.851   -6.416  1.00 0.12 ? 72  LYS A N    7  
ATOM   9199  C CA   . LYS A 1 72 ? -2.989  4.193   -7.040  1.00 0.13 ? 72  LYS A CA   7  
ATOM   9200  C C    . LYS A 1 72 ? -1.825  3.890   -6.102  1.00 0.13 ? 72  LYS A C    7  
ATOM   9201  O O    . LYS A 1 72 ? -0.721  3.574   -6.548  1.00 0.14 ? 72  LYS A O    7  
ATOM   9202  C CB   . LYS A 1 72 ? -2.970  5.672   -7.431  1.00 0.14 ? 72  LYS A CB   7  
ATOM   9203  C CG   . LYS A 1 72 ? -3.803  5.987   -8.662  1.00 0.15 ? 72  LYS A CG   7  
ATOM   9204  C CD   . LYS A 1 72 ? -2.933  6.433   -9.826  1.00 0.16 ? 72  LYS A CD   7  
ATOM   9205  C CE   . LYS A 1 72 ? -2.318  7.800   -9.569  1.00 0.17 ? 72  LYS A CE   7  
ATOM   9206  N NZ   . LYS A 1 72 ? -2.593  8.751   -10.680 1.00 0.18 ? 72  LYS A NZ   7  
ATOM   9207  H H    . LYS A 1 72 ? -4.977  4.521   -6.392  1.00 0.12 ? 72  LYS A H    7  
ATOM   9208  H HA   . LYS A 1 72 ? -2.884  3.593   -7.931  1.00 0.14 ? 72  LYS A HA   7  
ATOM   9209  H HB2  . LYS A 1 72 ? -3.351  6.255   -6.606  1.00 0.14 ? 72  LYS A HB2  7  
ATOM   9210  H HB3  . LYS A 1 72 ? -1.951  5.967   -7.627  1.00 0.15 ? 72  LYS A HB3  7  
ATOM   9211  H HG2  . LYS A 1 72 ? -4.348  5.102   -8.952  1.00 0.15 ? 72  LYS A HG2  7  
ATOM   9212  H HG3  . LYS A 1 72 ? -4.500  6.778   -8.421  1.00 0.15 ? 72  LYS A HG3  7  
ATOM   9213  H HD2  . LYS A 1 72 ? -2.142  5.713   -9.967  1.00 0.17 ? 72  LYS A HD2  7  
ATOM   9214  H HD3  . LYS A 1 72 ? -3.540  6.483   -10.718 1.00 0.17 ? 72  LYS A HD3  7  
ATOM   9215  H HE2  . LYS A 1 72 ? -2.729  8.202   -8.654  1.00 0.17 ? 72  LYS A HE2  7  
ATOM   9216  H HE3  . LYS A 1 72 ? -1.249  7.686   -9.461  1.00 0.18 ? 72  LYS A HE3  7  
ATOM   9217  H HZ1  . LYS A 1 72 ? -3.619  8.879   -10.795 1.00 0.18 ? 72  LYS A HZ1  7  
ATOM   9218  H HZ2  . LYS A 1 72 ? -2.200  8.384   -11.570 1.00 0.19 ? 72  LYS A HZ2  7  
ATOM   9219  H HZ3  . LYS A 1 72 ? -2.160  9.674   -10.477 1.00 0.19 ? 72  LYS A HZ3  7  
ATOM   9220  N N    . THR A 1 73 ? -2.077  3.989   -4.801  1.00 0.13 ? 73  THR A N    7  
ATOM   9221  C CA   . THR A 1 73 ? -1.051  3.725   -3.800  1.00 0.13 ? 73  THR A CA   7  
ATOM   9222  C C    . THR A 1 73 ? -0.923  2.232   -3.526  1.00 0.12 ? 73  THR A C    7  
ATOM   9223  O O    . THR A 1 73 ? 0.183   1.699   -3.439  1.00 0.12 ? 73  THR A O    7  
ATOM   9224  C CB   . THR A 1 73 ? -1.353  4.455   -2.479  1.00 0.12 ? 73  THR A CB   7  
ATOM   9225  O OG1  . THR A 1 73 ? -1.919  5.744   -2.749  1.00 0.13 ? 73  THR A OG1  7  
ATOM   9226  C CG2  . THR A 1 73 ? -0.090  4.615   -1.647  1.00 0.13 ? 73  THR A CG2  7  
ATOM   9227  H H    . THR A 1 73 ? -2.976  4.247   -4.506  1.00 0.12 ? 73  THR A H    7  
ATOM   9228  H HA   . THR A 1 73 ? -0.110  4.093   -4.183  1.00 0.14 ? 73  THR A HA   7  
ATOM   9229  H HB   . THR A 1 73 ? -2.066  3.869   -1.916  1.00 0.12 ? 73  THR A HB   7  
ATOM   9230  H HG1  . THR A 1 73 ? -1.296  6.266   -3.260  1.00 0.15 ? 73  THR A HG1  7  
ATOM   9231  H HG21 . THR A 1 73 ? 0.661   5.130   -2.227  1.00 0.14 ? 73  THR A HG21 7  
ATOM   9232  H HG22 . THR A 1 73 ? 0.280   3.640   -1.364  1.00 0.13 ? 73  THR A HG22 7  
ATOM   9233  H HG23 . THR A 1 73 ? -0.314  5.187   -0.759  1.00 0.13 ? 73  THR A HG23 7  
ATOM   9234  N N    . TRP A 1 74 ? -2.062  1.561   -3.389  1.00 0.11 ? 74  TRP A N    7  
ATOM   9235  C CA   . TRP A 1 74 ? -2.075  0.126   -3.124  1.00 0.10 ? 74  TRP A CA   7  
ATOM   9236  C C    . TRP A 1 74 ? -1.385  -0.642  -4.245  1.00 0.11 ? 74  TRP A C    7  
ATOM   9237  O O    . TRP A 1 74 ? -0.486  -1.445  -3.998  1.00 0.11 ? 74  TRP A O    7  
ATOM   9238  C CB   . TRP A 1 74 ? -3.513  -0.368  -2.960  1.00 0.09 ? 74  TRP A CB   7  
ATOM   9239  C CG   . TRP A 1 74 ? -3.604  -1.818  -2.585  1.00 0.08 ? 74  TRP A CG   7  
ATOM   9240  C CD1  . TRP A 1 74 ? -4.351  -2.779  -3.206  1.00 0.08 ? 74  TRP A CD1  7  
ATOM   9241  C CD2  . TRP A 1 74 ? -2.926  -2.467  -1.506  1.00 0.08 ? 74  TRP A CD2  7  
ATOM   9242  N NE1  . TRP A 1 74 ? -4.177  -3.988  -2.576  1.00 0.07 ? 74  TRP A NE1  7  
ATOM   9243  C CE2  . TRP A 1 74 ? -3.308  -3.824  -1.530  1.00 0.07 ? 74  TRP A CE2  7  
ATOM   9244  C CE3  . TRP A 1 74 ? -2.033  -2.038  -0.520  1.00 0.08 ? 74  TRP A CE3  7  
ATOM   9245  C CZ2  . TRP A 1 74 ? -2.827  -4.750  -0.607  1.00 0.07 ? 74  TRP A CZ2  7  
ATOM   9246  C CZ3  . TRP A 1 74 ? -1.556  -2.957  0.394   1.00 0.08 ? 74  TRP A CZ3  7  
ATOM   9247  C CH2  . TRP A 1 74 ? -1.954  -4.299  0.346   1.00 0.08 ? 74  TRP A CH2  7  
ATOM   9248  H H    . TRP A 1 74 ? -2.912  2.040   -3.468  1.00 0.10 ? 74  TRP A H    7  
ATOM   9249  H HA   . TRP A 1 74 ? -1.538  -0.046  -2.205  1.00 0.10 ? 74  TRP A HA   7  
ATOM   9250  H HB2  . TRP A 1 74 ? -3.997  0.206   -2.185  1.00 0.08 ? 74  TRP A HB2  7  
ATOM   9251  H HB3  . TRP A 1 74 ? -4.044  -0.230  -3.891  1.00 0.09 ? 74  TRP A HB3  7  
ATOM   9252  H HD1  . TRP A 1 74 ? -4.981  -2.600  -4.064  1.00 0.08 ? 74  TRP A HD1  7  
ATOM   9253  H HE1  . TRP A 1 74 ? -4.606  -4.830  -2.835  1.00 0.07 ? 74  TRP A HE1  7  
ATOM   9254  H HE3  . TRP A 1 74 ? -1.716  -1.007  -0.465  1.00 0.09 ? 74  TRP A HE3  7  
ATOM   9255  H HZ2  . TRP A 1 74 ? -3.123  -5.787  -0.633  1.00 0.07 ? 74  TRP A HZ2  7  
ATOM   9256  H HZ3  . TRP A 1 74 ? -0.867  -2.641  1.163   1.00 0.09 ? 74  TRP A HZ3  7  
ATOM   9257  H HH2  . TRP A 1 74 ? -1.556  -4.981  1.081   1.00 0.08 ? 74  TRP A HH2  7  
ATOM   9258  N N    . GLY A 1 75 ? -1.811  -0.389  -5.479  1.00 0.11 ? 75  GLY A N    7  
ATOM   9259  C CA   . GLY A 1 75 ? -1.223  -1.067  -6.620  1.00 0.12 ? 75  GLY A CA   7  
ATOM   9260  C C    . GLY A 1 75 ? 0.290   -0.972  -6.634  1.00 0.13 ? 75  GLY A C    7  
ATOM   9261  O O    . GLY A 1 75 ? 0.978   -1.951  -6.926  1.00 0.13 ? 75  GLY A O    7  
ATOM   9262  H H    . GLY A 1 75 ? -2.531  0.263   -5.616  1.00 0.11 ? 75  GLY A H    7  
ATOM   9263  H HA2  . GLY A 1 75 ? -1.508  -2.108  -6.593  1.00 0.11 ? 75  GLY A HA2  7  
ATOM   9264  H HA3  . GLY A 1 75 ? -1.608  -0.622  -7.527  1.00 0.12 ? 75  GLY A HA3  7  
ATOM   9265  N N    . LEU A 1 76 ? 0.809   0.210   -6.316  1.00 0.13 ? 76  LEU A N    7  
ATOM   9266  C CA   . LEU A 1 76 ? 2.252   0.429   -6.295  1.00 0.14 ? 76  LEU A CA   7  
ATOM   9267  C C    . LEU A 1 76 ? 2.901   -0.334  -5.144  1.00 0.14 ? 76  LEU A C    7  
ATOM   9268  O O    . LEU A 1 76 ? 3.804   -1.142  -5.353  1.00 0.15 ? 76  LEU A O    7  
ATOM   9269  C CB   . LEU A 1 76 ? 2.558   1.922   -6.170  1.00 0.15 ? 76  LEU A CB   7  
ATOM   9270  C CG   . LEU A 1 76 ? 2.782   2.674   -7.482  1.00 0.16 ? 76  LEU A CG   7  
ATOM   9271  C CD1  . LEU A 1 76 ? 2.318   4.117   -7.357  1.00 0.17 ? 76  LEU A CD1  7  
ATOM   9272  C CD2  . LEU A 1 76 ? 4.249   2.617   -7.884  1.00 0.18 ? 76  LEU A CD2  7  
ATOM   9273  H H    . LEU A 1 76 ? 0.210   0.951   -6.091  1.00 0.13 ? 76  LEU A H    7  
ATOM   9274  H HA   . LEU A 1 76 ? 2.657   0.064   -7.227  1.00 0.15 ? 76  LEU A HA   7  
ATOM   9275  H HB2  . LEU A 1 76 ? 1.734   2.390   -5.651  1.00 0.15 ? 76  LEU A HB2  7  
ATOM   9276  H HB3  . LEU A 1 76 ? 3.446   2.032   -5.565  1.00 0.16 ? 76  LEU A HB3  7  
ATOM   9277  H HG   . LEU A 1 76 ? 2.202   2.203   -8.263  1.00 0.16 ? 76  LEU A HG   7  
ATOM   9278  H HD11 . LEU A 1 76 ? 1.260   4.137   -7.134  1.00 0.16 ? 76  LEU A HD11 7  
ATOM   9279  H HD12 . LEU A 1 76 ? 2.499   4.635   -8.287  1.00 0.18 ? 76  LEU A HD12 7  
ATOM   9280  H HD13 . LEU A 1 76 ? 2.863   4.604   -6.562  1.00 0.17 ? 76  LEU A HD13 7  
ATOM   9281  H HD21 . LEU A 1 76 ? 4.794   3.396   -7.374  1.00 0.17 ? 76  LEU A HD21 7  
ATOM   9282  H HD22 . LEU A 1 76 ? 4.335   2.758   -8.952  1.00 0.22 ? 76  LEU A HD22 7  
ATOM   9283  H HD23 . LEU A 1 76 ? 4.659   1.655   -7.614  1.00 0.25 ? 76  LEU A HD23 7  
ATOM   9284  N N    . VAL A 1 77 ? 2.431   -0.073  -3.928  1.00 0.14 ? 77  VAL A N    7  
ATOM   9285  C CA   . VAL A 1 77 ? 2.964   -0.736  -2.744  1.00 0.13 ? 77  VAL A CA   7  
ATOM   9286  C C    . VAL A 1 77 ? 2.866   -2.252  -2.873  1.00 0.13 ? 77  VAL A C    7  
ATOM   9287  O O    . VAL A 1 77 ? 3.617   -2.990  -2.236  1.00 0.13 ? 77  VAL A O    7  
ATOM   9288  C CB   . VAL A 1 77 ? 2.222   -0.290  -1.471  1.00 0.13 ? 77  VAL A CB   7  
ATOM   9289  C CG1  . VAL A 1 77 ? 2.719   -1.071  -0.263  1.00 0.13 ? 77  VAL A CG1  7  
ATOM   9290  C CG2  . VAL A 1 77 ? 2.390   1.206   -1.254  1.00 0.13 ? 77  VAL A CG2  7  
ATOM   9291  H H    . VAL A 1 77 ? 1.709   0.581   -3.825  1.00 0.13 ? 77  VAL A H    7  
ATOM   9292  H HA   . VAL A 1 77 ? 4.005   -0.459  -2.646  1.00 0.14 ? 77  VAL A HA   7  
ATOM   9293  H HB   . VAL A 1 77 ? 1.170   -0.498  -1.600  1.00 0.12 ? 77  VAL A HB   7  
ATOM   9294  H HG11 . VAL A 1 77 ? 2.472   -2.115  -0.385  1.00 0.15 ? 77  VAL A HG11 7  
ATOM   9295  H HG12 . VAL A 1 77 ? 2.246   -0.692  0.631   1.00 0.16 ? 77  VAL A HG12 7  
ATOM   9296  H HG13 . VAL A 1 77 ? 3.790   -0.962  -0.180  1.00 0.17 ? 77  VAL A HG13 7  
ATOM   9297  H HG21 . VAL A 1 77 ? 3.438   1.438   -1.143  1.00 0.14 ? 77  VAL A HG21 7  
ATOM   9298  H HG22 . VAL A 1 77 ? 1.859   1.501   -0.361  1.00 0.13 ? 77  VAL A HG22 7  
ATOM   9299  H HG23 . VAL A 1 77 ? 1.990   1.740   -2.102  1.00 0.14 ? 77  VAL A HG23 7  
ATOM   9300  N N    . LEU A 1 78 ? 1.933   -2.711  -3.701  1.00 0.12 ? 78  LEU A N    7  
ATOM   9301  C CA   . LEU A 1 78 ? 1.734   -4.138  -3.915  1.00 0.12 ? 78  LEU A CA   7  
ATOM   9302  C C    . LEU A 1 78 ? 2.683   -4.666  -4.986  1.00 0.13 ? 78  LEU A C    7  
ATOM   9303  O O    . LEU A 1 78 ? 3.331   -5.698  -4.804  1.00 0.13 ? 78  LEU A O    7  
ATOM   9304  C CB   . LEU A 1 78 ? 0.286   -4.419  -4.319  1.00 0.11 ? 78  LEU A CB   7  
ATOM   9305  C CG   . LEU A 1 78 ? -0.232  -5.829  -4.030  1.00 0.10 ? 78  LEU A CG   7  
ATOM   9306  C CD1  . LEU A 1 78 ? -0.572  -5.981  -2.556  1.00 0.09 ? 78  LEU A CD1  7  
ATOM   9307  C CD2  . LEU A 1 78 ? -1.445  -6.138  -4.894  1.00 0.09 ? 78  LEU A CD2  7  
ATOM   9308  H H    . LEU A 1 78 ? 1.362   -2.071  -4.178  1.00 0.12 ? 78  LEU A H    7  
ATOM   9309  H HA   . LEU A 1 78 ? 1.943   -4.644  -2.984  1.00 0.11 ? 78  LEU A HA   7  
ATOM   9310  H HB2  . LEU A 1 78 ? -0.349  -3.715  -3.799  1.00 0.10 ? 78  LEU A HB2  7  
ATOM   9311  H HB3  . LEU A 1 78 ? 0.194   -4.239  -5.380  1.00 0.11 ? 78  LEU A HB3  7  
ATOM   9312  H HG   . LEU A 1 78 ? 0.541   -6.545  -4.268  1.00 0.10 ? 78  LEU A HG   7  
ATOM   9313  H HD11 . LEU A 1 78 ? -1.336  -5.266  -2.289  1.00 0.08 ? 78  LEU A HD11 7  
ATOM   9314  H HD12 . LEU A 1 78 ? 0.312   -5.802  -1.962  1.00 0.10 ? 78  LEU A HD12 7  
ATOM   9315  H HD13 . LEU A 1 78 ? -0.934  -6.981  -2.372  1.00 0.09 ? 78  LEU A HD13 7  
ATOM   9316  H HD21 . LEU A 1 78 ? -1.155  -6.140  -5.935  1.00 0.10 ? 78  LEU A HD21 7  
ATOM   9317  H HD22 . LEU A 1 78 ? -2.203  -5.385  -4.733  1.00 0.09 ? 78  LEU A HD22 7  
ATOM   9318  H HD23 . LEU A 1 78 ? -1.839  -7.108  -4.629  1.00 0.09 ? 78  LEU A HD23 7  
ATOM   9319  N N    . GLY A 1 79 ? 2.765   -3.951  -6.103  1.00 0.13 ? 79  GLY A N    7  
ATOM   9320  C CA   . GLY A 1 79 ? 3.639   -4.361  -7.185  1.00 0.15 ? 79  GLY A CA   7  
ATOM   9321  C C    . GLY A 1 79 ? 5.057   -4.624  -6.717  1.00 0.15 ? 79  GLY A C    7  
ATOM   9322  O O    . GLY A 1 79 ? 5.778   -5.421  -7.316  1.00 0.16 ? 79  GLY A O    7  
ATOM   9323  H H    . GLY A 1 79 ? 2.227   -3.136  -6.192  1.00 0.13 ? 79  GLY A H    7  
ATOM   9324  H HA2  . GLY A 1 79 ? 3.246   -5.264  -7.629  1.00 0.14 ? 79  GLY A HA2  7  
ATOM   9325  H HA3  . GLY A 1 79 ? 3.658   -3.583  -7.933  1.00 0.15 ? 79  GLY A HA3  7  
ATOM   9326  N N    . ALA A 1 80 ? 5.458   -3.950  -5.644  1.00 0.15 ? 80  ALA A N    7  
ATOM   9327  C CA   . ALA A 1 80 ? 6.800   -4.116  -5.096  1.00 0.16 ? 80  ALA A CA   7  
ATOM   9328  C C    . ALA A 1 80 ? 6.870   -5.329  -4.175  1.00 0.16 ? 80  ALA A C    7  
ATOM   9329  O O    . ALA A 1 80 ? 7.709   -6.212  -4.358  1.00 0.17 ? 80  ALA A O    7  
ATOM   9330  C CB   . ALA A 1 80 ? 7.224   -2.859  -4.351  1.00 0.17 ? 80  ALA A CB   7  
ATOM   9331  H H    . ALA A 1 80 ? 4.838   -3.327  -5.210  1.00 0.15 ? 80  ALA A H    7  
ATOM   9332  H HA   . ALA A 1 80 ? 7.481   -4.264  -5.922  1.00 0.17 ? 80  ALA A HA   7  
ATOM   9333  H HB1  . ALA A 1 80 ? 6.572   -2.706  -3.502  1.00 0.16 ? 80  ALA A HB1  7  
ATOM   9334  H HB2  . ALA A 1 80 ? 7.158   -2.008  -5.012  1.00 0.18 ? 80  ALA A HB2  7  
ATOM   9335  H HB3  . ALA A 1 80 ? 8.241   -2.970  -4.007  1.00 0.18 ? 80  ALA A HB3  7  
ATOM   9336  N N    . LEU A 1 81 ? 5.987   -5.364  -3.183  1.00 0.15 ? 81  LEU A N    7  
ATOM   9337  C CA   . LEU A 1 81 ? 5.949   -6.470  -2.231  1.00 0.15 ? 81  LEU A CA   7  
ATOM   9338  C C    . LEU A 1 81 ? 5.766   -7.803  -2.952  1.00 0.14 ? 81  LEU A C    7  
ATOM   9339  O O    . LEU A 1 81 ? 6.439   -8.785  -2.641  1.00 0.15 ? 81  LEU A O    7  
ATOM   9340  C CB   . LEU A 1 81 ? 4.818   -6.262  -1.223  1.00 0.14 ? 81  LEU A CB   7  
ATOM   9341  C CG   . LEU A 1 81 ? 5.240   -5.800  0.173   1.00 0.14 ? 81  LEU A CG   7  
ATOM   9342  C CD1  . LEU A 1 81 ? 4.028   -5.681  1.085   1.00 0.13 ? 81  LEU A CD1  7  
ATOM   9343  C CD2  . LEU A 1 81 ? 6.264   -6.757  0.764   1.00 0.15 ? 81  LEU A CD2  7  
ATOM   9344  H H    . LEU A 1 81 ? 5.344   -4.630  -3.089  1.00 0.14 ? 81  LEU A H    7  
ATOM   9345  H HA   . LEU A 1 81 ? 6.891   -6.485  -1.705  1.00 0.15 ? 81  LEU A HA   7  
ATOM   9346  H HB2  . LEU A 1 81 ? 4.139   -5.526  -1.628  1.00 0.13 ? 81  LEU A HB2  7  
ATOM   9347  H HB3  . LEU A 1 81 ? 4.286   -7.195  -1.120  1.00 0.13 ? 81  LEU A HB3  7  
ATOM   9348  H HG   . LEU A 1 81 ? 5.698   -4.824  0.099   1.00 0.15 ? 81  LEU A HG   7  
ATOM   9349  H HD11 . LEU A 1 81 ? 3.804   -6.646  1.514   1.00 0.13 ? 81  LEU A HD11 7  
ATOM   9350  H HD12 . LEU A 1 81 ? 3.180   -5.336  0.514   1.00 0.12 ? 81  LEU A HD12 7  
ATOM   9351  H HD13 . LEU A 1 81 ? 4.241   -4.978  1.876   1.00 0.13 ? 81  LEU A HD13 7  
ATOM   9352  H HD21 . LEU A 1 81 ? 5.924   -7.773  0.633   1.00 0.14 ? 81  LEU A HD21 7  
ATOM   9353  H HD22 . LEU A 1 81 ? 6.381   -6.550  1.818   1.00 0.15 ? 81  LEU A HD22 7  
ATOM   9354  H HD23 . LEU A 1 81 ? 7.211   -6.626  0.265   1.00 0.16 ? 81  LEU A HD23 7  
ATOM   9355  N N    . LYS A 1 82 ? 4.853   -7.826  -3.915  1.00 0.14 ? 82  LYS A N    7  
ATOM   9356  C CA   . LYS A 1 82 ? 4.583   -9.036  -4.682  1.00 0.14 ? 82  LYS A CA   7  
ATOM   9357  C C    . LYS A 1 82 ? 5.873   -9.625  -5.243  1.00 0.15 ? 82  LYS A C    7  
ATOM   9358  O O    . LYS A 1 82 ? 6.003   -10.841 -5.378  1.00 0.15 ? 82  LYS A O    7  
ATOM   9359  C CB   . LYS A 1 82 ? 3.611   -8.733  -5.826  1.00 0.13 ? 82  LYS A CB   7  
ATOM   9360  C CG   . LYS A 1 82 ? 2.200   -9.237  -5.573  1.00 0.12 ? 82  LYS A CG   7  
ATOM   9361  C CD   . LYS A 1 82 ? 1.176   -8.457  -6.382  1.00 0.12 ? 82  LYS A CD   7  
ATOM   9362  C CE   . LYS A 1 82 ? -0.184  -9.139  -6.365  1.00 0.11 ? 82  LYS A CE   7  
ATOM   9363  N NZ   . LYS A 1 82 ? -0.539  -9.698  -7.699  1.00 0.12 ? 82  LYS A NZ   7  
ATOM   9364  H H    . LYS A 1 82 ? 4.348   -7.011  -4.116  1.00 0.13 ? 82  LYS A H    7  
ATOM   9365  H HA   . LYS A 1 82 ? 4.130   -9.757  -4.018  1.00 0.13 ? 82  LYS A HA   7  
ATOM   9366  H HB2  . LYS A 1 82 ? 3.567   -7.664  -5.971  1.00 0.13 ? 82  LYS A HB2  7  
ATOM   9367  H HB3  . LYS A 1 82 ? 3.979   -9.196  -6.729  1.00 0.14 ? 82  LYS A HB3  7  
ATOM   9368  H HG2  . LYS A 1 82 ? 2.144   -10.279 -5.850  1.00 0.12 ? 82  LYS A HG2  7  
ATOM   9369  H HG3  . LYS A 1 82 ? 1.972   -9.129  -4.522  1.00 0.12 ? 82  LYS A HG3  7  
ATOM   9370  H HD2  . LYS A 1 82 ? 1.078   -7.468  -5.963  1.00 0.12 ? 82  LYS A HD2  7  
ATOM   9371  H HD3  . LYS A 1 82 ? 1.520   -8.385  -7.403  1.00 0.13 ? 82  LYS A HD3  7  
ATOM   9372  H HE2  . LYS A 1 82 ? -0.162  -9.941  -5.643  1.00 0.11 ? 82  LYS A HE2  7  
ATOM   9373  H HE3  . LYS A 1 82 ? -0.932  -8.416  -6.076  1.00 0.10 ? 82  LYS A HE3  7  
ATOM   9374  H HZ1  . LYS A 1 82 ? -1.470  -10.160 -7.656  1.00 0.11 ? 82  LYS A HZ1  7  
ATOM   9375  H HZ2  . LYS A 1 82 ? 0.169   -10.400 -7.994  1.00 0.12 ? 82  LYS A HZ2  7  
ATOM   9376  H HZ3  . LYS A 1 82 ? -0.573  -8.938  -8.408  1.00 0.12 ? 82  LYS A HZ3  7  
ATOM   9377  N N    . ALA A 1 83 ? 6.826   -8.756  -5.563  1.00 0.16 ? 83  ALA A N    7  
ATOM   9378  C CA   . ALA A 1 83 ? 8.107   -9.191  -6.103  1.00 0.17 ? 83  ALA A CA   7  
ATOM   9379  C C    . ALA A 1 83 ? 9.070   -9.580  -4.987  1.00 0.18 ? 83  ALA A C    7  
ATOM   9380  O O    . ALA A 1 83 ? 9.939   -10.431 -5.173  1.00 0.19 ? 83  ALA A O    7  
ATOM   9381  C CB   . ALA A 1 83 ? 8.713   -8.097  -6.969  1.00 0.18 ? 83  ALA A CB   7  
ATOM   9382  H H    . ALA A 1 83 ? 6.662   -7.798  -5.434  1.00 0.16 ? 83  ALA A H    7  
ATOM   9383  H HA   . ALA A 1 83 ? 7.929   -10.055 -6.728  1.00 0.17 ? 83  ALA A HA   7  
ATOM   9384  H HB1  . ALA A 1 83 ? 8.912   -7.226  -6.363  1.00 0.18 ? 83  ALA A HB1  7  
ATOM   9385  H HB2  . ALA A 1 83 ? 8.021   -7.836  -7.757  1.00 0.18 ? 83  ALA A HB2  7  
ATOM   9386  H HB3  . ALA A 1 83 ? 9.636   -8.450  -7.405  1.00 0.19 ? 83  ALA A HB3  7  
ATOM   9387  N N    . ALA A 1 84 ? 8.912   -8.948  -3.829  1.00 0.17 ? 84  ALA A N    7  
ATOM   9388  C CA   . ALA A 1 84 ? 9.767   -9.230  -2.683  1.00 0.18 ? 84  ALA A CA   7  
ATOM   9389  C C    . ALA A 1 84 ? 9.429   -10.581 -2.064  1.00 0.18 ? 84  ALA A C    7  
ATOM   9390  O O    . ALA A 1 84 ? 10.266  -11.201 -1.408  1.00 0.18 ? 84  ALA A O    7  
ATOM   9391  C CB   . ALA A 1 84 ? 9.639   -8.124  -1.644  1.00 0.18 ? 84  ALA A CB   7  
ATOM   9392  H H    . ALA A 1 84 ? 8.201   -8.278  -3.743  1.00 0.17 ? 84  ALA A H    7  
ATOM   9393  H HA   . ALA A 1 84 ? 10.791  -9.250  -3.029  1.00 0.19 ? 84  ALA A HA   7  
ATOM   9394  H HB1  . ALA A 1 84 ? 10.324  -8.313  -0.831  1.00 0.19 ? 84  ALA A HB1  7  
ATOM   9395  H HB2  . ALA A 1 84 ? 8.629   -8.100  -1.267  1.00 0.17 ? 84  ALA A HB2  7  
ATOM   9396  H HB3  . ALA A 1 84 ? 9.876   -7.174  -2.100  1.00 0.18 ? 84  ALA A HB3  7  
ATOM   9397  N N    . ARG A 1 85 ? 8.196   -11.030 -2.274  1.00 0.16 ? 85  ARG A N    7  
ATOM   9398  C CA   . ARG A 1 85 ? 7.746   -12.307 -1.735  1.00 0.16 ? 85  ARG A CA   7  
ATOM   9399  C C    . ARG A 1 85 ? 7.725   -13.379 -2.819  1.00 0.16 ? 85  ARG A C    7  
ATOM   9400  O O    . ARG A 1 85 ? 7.025   -14.385 -2.699  1.00 0.16 ? 85  ARG A O    7  
ATOM   9401  C CB   . ARG A 1 85 ? 6.353   -12.164 -1.118  1.00 0.15 ? 85  ARG A CB   7  
ATOM   9402  C CG   . ARG A 1 85 ? 6.308   -11.219 0.073   1.00 0.15 ? 85  ARG A CG   7  
ATOM   9403  C CD   . ARG A 1 85 ? 4.918   -11.163 0.687   1.00 0.14 ? 85  ARG A CD   7  
ATOM   9404  N NE   . ARG A 1 85 ? 4.963   -11.184 2.146   1.00 0.14 ? 85  ARG A NE   7  
ATOM   9405  C CZ   . ARG A 1 85 ? 5.343   -12.241 2.855   1.00 0.14 ? 85  ARG A CZ   7  
ATOM   9406  N NH1  . ARG A 1 85 ? 5.708   -13.358 2.241   1.00 0.15 ? 85  ARG A NH1  7  
ATOM   9407  N NH2  . ARG A 1 85 ? 5.357   -12.183 4.181   1.00 0.15 ? 85  ARG A NH2  7  
ATOM   9408  H H    . ARG A 1 85 ? 7.574   -10.490 -2.805  1.00 0.16 ? 85  ARG A H    7  
ATOM   9409  H HA   . ARG A 1 85 ? 8.441   -12.606 -0.964  1.00 0.17 ? 85  ARG A HA   7  
ATOM   9410  H HB2  . ARG A 1 85 ? 5.675   -11.791 -1.871  1.00 0.14 ? 85  ARG A HB2  7  
ATOM   9411  H HB3  . ARG A 1 85 ? 6.014   -13.136 -0.791  1.00 0.15 ? 85  ARG A HB3  7  
ATOM   9412  H HG2  . ARG A 1 85 ? 7.007   -11.565 0.820   1.00 0.15 ? 85  ARG A HG2  7  
ATOM   9413  H HG3  . ARG A 1 85 ? 6.588   -10.229 -0.255  1.00 0.15 ? 85  ARG A HG3  7  
ATOM   9414  H HD2  . ARG A 1 85 ? 4.433   -10.254 0.366   1.00 0.13 ? 85  ARG A HD2  7  
ATOM   9415  H HD3  . ARG A 1 85 ? 4.351   -12.014 0.341   1.00 0.13 ? 85  ARG A HD3  7  
ATOM   9416  H HE   . ARG A 1 85 ? 4.696   -10.369 2.621   1.00 0.14 ? 85  ARG A HE   7  
ATOM   9417  H HH11 . ARG A 1 85 ? 5.994   -14.153 2.777   1.00 0.15 ? 85  ARG A HH11 7  
ATOM   9418  H HH12 . ARG A 1 85 ? 5.698   -13.406 1.242   1.00 0.15 ? 85  ARG A HH12 7  
ATOM   9419  H HH21 . ARG A 1 85 ? 5.081   -11.342 4.648   1.00 0.15 ? 85  ARG A HH21 7  
ATOM   9420  H HH22 . ARG A 1 85 ? 5.644   -12.979 4.714   1.00 0.15 ? 85  ARG A HH22 7  
ATOM   9421  N N    . GLU A 1 86 ? 8.496   -13.156 -3.879  1.00 0.17 ? 86  GLU A N    7  
ATOM   9422  C CA   . GLU A 1 86 ? 8.563   -14.103 -4.987  1.00 0.17 ? 86  GLU A CA   7  
ATOM   9423  C C    . GLU A 1 86 ? 9.972   -14.672 -5.129  1.00 0.19 ? 86  GLU A C    7  
ATOM   9424  O O    . GLU A 1 86 ? 10.150  -15.810 -5.562  1.00 0.19 ? 86  GLU A O    7  
ATOM   9425  C CB   . GLU A 1 86 ? 8.140   -13.426 -6.292  1.00 0.17 ? 86  GLU A CB   7  
ATOM   9426  C CG   . GLU A 1 86 ? 6.731   -13.785 -6.733  1.00 0.16 ? 86  GLU A CG   7  
ATOM   9427  C CD   . GLU A 1 86 ? 6.388   -13.226 -8.102  1.00 0.17 ? 86  GLU A CD   7  
ATOM   9428  O OE1  . GLU A 1 86 ? 7.032   -13.638 -9.088  1.00 0.18 ? 86  GLU A OE1  7  
ATOM   9429  O OE2  . GLU A 1 86 ? 5.479   -12.375 -8.184  1.00 0.16 ? 86  GLU A OE2  7  
ATOM   9430  H H    . GLU A 1 86 ? 9.031   -12.337 -3.918  1.00 0.17 ? 86  GLU A H    7  
ATOM   9431  H HA   . GLU A 1 86 ? 7.881   -14.912 -4.774  1.00 0.17 ? 86  GLU A HA   7  
ATOM   9432  H HB2  . GLU A 1 86 ? 8.191   -12.355 -6.162  1.00 0.17 ? 86  GLU A HB2  7  
ATOM   9433  H HB3  . GLU A 1 86 ? 8.825   -13.718 -7.074  1.00 0.18 ? 86  GLU A HB3  7  
ATOM   9434  H HG2  . GLU A 1 86 ? 6.641   -14.860 -6.769  1.00 0.17 ? 86  GLU A HG2  7  
ATOM   9435  H HG3  . GLU A 1 86 ? 6.030   -13.389 -6.013  1.00 0.16 ? 86  GLU A HG3  7  
ATOM   9436  N N    . GLU A 1 87 ? 10.968  -13.872 -4.765  1.00 0.19 ? 87  GLU A N    7  
ATOM   9437  C CA   . GLU A 1 87 ? 12.360  -14.295 -4.854  1.00 0.21 ? 87  GLU A CA   7  
ATOM   9438  C C    . GLU A 1 87 ? 12.727  -15.206 -3.687  1.00 0.21 ? 87  GLU A C    7  
ATOM   9439  O O    . GLU A 1 87 ? 13.780  -15.842 -3.691  1.00 0.22 ? 87  GLU A O    7  
ATOM   9440  C CB   . GLU A 1 87 ? 13.286  -13.078 -4.875  1.00 0.21 ? 87  GLU A CB   7  
ATOM   9441  C CG   . GLU A 1 87 ? 13.731  -12.676 -6.271  1.00 0.22 ? 87  GLU A CG   7  
ATOM   9442  C CD   . GLU A 1 87 ? 15.238  -12.596 -6.403  1.00 0.24 ? 87  GLU A CD   7  
ATOM   9443  O OE1  . GLU A 1 87 ? 15.845  -13.581 -6.876  1.00 0.24 ? 87  GLU A OE1  7  
ATOM   9444  O OE2  . GLU A 1 87 ? 15.814  -11.552 -6.035  1.00 0.24 ? 87  GLU A OE2  7  
ATOM   9445  O OXT  . GLU A 1 87 ? 11.959  -15.270 -2.681  1.00 0.20 ? 87  GLU A OXT  7  
ATOM   9446  H H    . GLU A 1 87 ? 10.762  -12.975 -4.428  1.00 0.19 ? 87  GLU A H    7  
ATOM   9447  H HA   . GLU A 1 87 ? 12.481  -14.845 -5.774  1.00 0.21 ? 87  GLU A HA   7  
ATOM   9448  H HB2  . GLU A 1 87 ? 12.771  -12.240 -4.430  1.00 0.21 ? 87  GLU A HB2  7  
ATOM   9449  H HB3  . GLU A 1 87 ? 14.167  -13.299 -4.291  1.00 0.22 ? 87  GLU A HB3  7  
ATOM   9450  H HG2  . GLU A 1 87 ? 13.361  -13.404 -6.977  1.00 0.22 ? 87  GLU A HG2  7  
ATOM   9451  H HG3  . GLU A 1 87 ? 13.312  -11.706 -6.503  1.00 0.22 ? 87  GLU A HG3  7  
HETATM 9452  C C1   . I3P B 2 .  ? 11.248  9.554   0.843   1.00 0.80 ? 101 I3P A C1   7  
HETATM 9453  C C2   . I3P B 2 .  ? 11.493  10.116  2.262   1.00 0.90 ? 101 I3P A C2   7  
HETATM 9454  C C3   . I3P B 2 .  ? 11.382  11.653  2.251   1.00 0.87 ? 101 I3P A C3   7  
HETATM 9455  C C4   . I3P B 2 .  ? 9.999   12.103  1.725   1.00 0.99 ? 101 I3P A C4   7  
HETATM 9456  C C5   . I3P B 2 .  ? 9.752   11.533  0.311   1.00 0.89 ? 101 I3P A C5   7  
HETATM 9457  C C6   . I3P B 2 .  ? 9.866   9.993   0.318   1.00 0.77 ? 101 I3P A C6   7  
HETATM 9458  O O1   . I3P B 2 .  ? 11.299  8.139   0.873   1.00 1.09 ? 101 I3P A O1   7  
HETATM 9459  O O2   . I3P B 2 .  ? 10.558  9.582   3.170   1.00 1.13 ? 101 I3P A O2   7  
HETATM 9460  O O3   . I3P B 2 .  ? 11.588  12.138  3.551   1.00 1.18 ? 101 I3P A O3   7  
HETATM 9461  O O4   . I3P B 2 .  ? 9.973   13.516  1.656   1.00 1.27 ? 101 I3P A O4   7  
HETATM 9462  O O5   . I3P B 2 .  ? 8.446   11.889  -0.106  1.00 1.24 ? 101 I3P A O5   7  
HETATM 9463  O O6   . I3P B 2 .  ? 9.696   9.493   -0.985  1.00 0.95 ? 101 I3P A O6   7  
HETATM 9464  P P1   . I3P B 2 .  ? 12.835  7.569   0.253   1.00 1.49 ? 101 I3P A P1   7  
HETATM 9465  O O11  . I3P B 2 .  ? 13.108  8.088   -1.381  1.00 1.57 ? 101 I3P A O11  7  
HETATM 9466  O O12  . I3P B 2 .  ? 13.963  8.153   1.146   1.00 1.59 ? 101 I3P A O12  7  
HETATM 9467  O O13  . I3P B 2 .  ? 12.931  5.840   0.376   1.00 1.97 ? 101 I3P A O13  7  
HETATM 9468  P P4   . I3P B 2 .  ? 8.720   14.159  2.697   1.00 1.78 ? 101 I3P A P4   7  
HETATM 9469  O O41  . I3P B 2 .  ? 7.346   13.697  2.138   1.00 1.94 ? 101 I3P A O41  7  
HETATM 9470  O O42  . I3P B 2 .  ? 8.853   13.577  4.327   1.00 1.90 ? 101 I3P A O42  7  
HETATM 9471  O O43  . I3P B 2 .  ? 8.718   15.894  2.660   1.00 2.20 ? 101 I3P A O43  7  
HETATM 9472  P P5   . I3P B 2 .  ? 8.514   12.970  -1.483  1.00 1.58 ? 101 I3P A P5   7  
HETATM 9473  O O51  . I3P B 2 .  ? 9.086   12.175  -2.687  1.00 1.56 ? 101 I3P A O51  7  
HETATM 9474  O O52  . I3P B 2 .  ? 6.922   13.491  -1.936  1.00 2.10 ? 101 I3P A O52  7  
HETATM 9475  O O53  . I3P B 2 .  ? 9.551   14.334  -1.203  1.00 1.65 ? 101 I3P A O53  7  
HETATM 9476  H H1   . I3P B 2 .  ? 12.009  9.958   0.165   1.00 0.84 ? 101 I3P A H1   7  
HETATM 9477  H H2   . I3P B 2 .  ? 12.501  9.850   2.583   1.00 1.09 ? 101 I3P A H2   7  
HETATM 9478  H H3   . I3P B 2 .  ? 12.159  12.059  1.597   1.00 0.81 ? 101 I3P A H3   7  
HETATM 9479  H H4   . I3P B 2 .  ? 9.223   11.725  2.396   1.00 1.17 ? 101 I3P A H4   7  
HETATM 9480  H H5   . I3P B 2 .  ? 10.512  11.932  -0.368  1.00 0.89 ? 101 I3P A H5   7  
HETATM 9481  H H6   . I3P B 2 .  ? 9.087   9.571   0.952   1.00 0.90 ? 101 I3P A H6   7  
HETATM 9482  H HO2  . I3P B 2 .  ? 9.871   9.130   2.645   1.00 1.23 ? 101 I3P A HO2  7  
HETATM 9483  H HO3  . I3P B 2 .  ? 11.150  13.009  3.610   1.00 1.33 ? 101 I3P A HO3  7  
HETATM 9484  H HO6  . I3P B 2 .  ? 9.591   10.256  -1.587  1.00 1.04 ? 101 I3P A HO6  7  
HETATM 9485  H HO13 . I3P B 2 .  ? 13.798  5.541   0.049   1.00 2.23 ? 101 I3P A HO13 7  
ATOM   9486  N N    . SER A 1 1  ? 2.997   4.062   10.300  1.00 0.76 ? 1   SER A N    8  
ATOM   9487  C CA   . SER A 1 1  ? 2.637   5.276   11.026  1.00 0.88 ? 1   SER A CA   8  
ATOM   9488  C C    . SER A 1 1  ? 3.820   6.236   11.098  1.00 0.88 ? 1   SER A C    8  
ATOM   9489  O O    . SER A 1 1  ? 3.643   7.443   11.263  1.00 0.98 ? 1   SER A O    8  
ATOM   9490  C CB   . SER A 1 1  ? 2.163   4.926   12.438  1.00 0.96 ? 1   SER A CB   8  
ATOM   9491  O OG   . SER A 1 1  ? 0.749   4.861   12.500  1.00 1.05 ? 1   SER A OG   8  
ATOM   9492  H H1   . SER A 1 1  ? 3.295   4.301   9.333   1.00 0.73 ? 1   SER A H1   8  
ATOM   9493  H H2   . SER A 1 1  ? 2.180   3.421   10.251  1.00 0.79 ? 1   SER A H2   8  
ATOM   9494  H H3   . SER A 1 1  ? 3.778   3.575   10.781  1.00 0.72 ? 1   SER A H3   8  
ATOM   9495  H HA   . SER A 1 1  ? 1.831   5.759   10.496  1.00 0.95 ? 1   SER A HA   8  
ATOM   9496  H HB2  . SER A 1 1  ? 2.568   3.968   12.726  1.00 0.91 ? 1   SER A HB2  8  
ATOM   9497  H HB3  . SER A 1 1  ? 2.506   5.684   13.128  1.00 1.02 ? 1   SER A HB3  8  
ATOM   9498  H HG   . SER A 1 1  ? 0.427   5.490   13.150  1.00 1.13 ? 1   SER A HG   8  
ATOM   9499  N N    . GLU A 1 2  ? 5.026   5.692   10.971  1.00 0.79 ? 2   GLU A N    8  
ATOM   9500  C CA   . GLU A 1 2  ? 6.238   6.502   11.022  1.00 0.83 ? 2   GLU A CA   8  
ATOM   9501  C C    . GLU A 1 2  ? 7.469   5.656   10.707  1.00 0.76 ? 2   GLU A C    8  
ATOM   9502  O O    . GLU A 1 2  ? 8.411   6.127   10.071  1.00 0.77 ? 2   GLU A O    8  
ATOM   9503  C CB   . GLU A 1 2  ? 6.388   7.148   12.400  1.00 0.96 ? 2   GLU A CB   8  
ATOM   9504  C CG   . GLU A 1 2  ? 6.757   6.165   13.497  1.00 0.99 ? 2   GLU A CG   8  
ATOM   9505  C CD   . GLU A 1 2  ? 6.924   6.833   14.849  1.00 1.14 ? 2   GLU A CD   8  
ATOM   9506  O OE1  . GLU A 1 2  ? 7.468   7.957   14.889  1.00 1.22 ? 2   GLU A OE1  8  
ATOM   9507  O OE2  . GLU A 1 2  ? 6.512   6.233   15.863  1.00 1.19 ? 2   GLU A OE2  8  
ATOM   9508  H H    . GLU A 1 2  ? 5.104   4.725   10.841  1.00 0.72 ? 2   GLU A H    8  
ATOM   9509  H HA   . GLU A 1 2  ? 6.148   7.278   10.278  1.00 0.86 ? 2   GLU A HA   8  
ATOM   9510  H HB2  . GLU A 1 2  ? 7.158   7.903   12.348  1.00 1.02 ? 2   GLU A HB2  8  
ATOM   9511  H HB3  . GLU A 1 2  ? 5.453   7.619   12.667  1.00 1.02 ? 2   GLU A HB3  8  
ATOM   9512  H HG2  . GLU A 1 2  ? 5.976   5.422   13.575  1.00 0.95 ? 2   GLU A HG2  8  
ATOM   9513  H HG3  . GLU A 1 2  ? 7.686   5.682   13.233  1.00 0.95 ? 2   GLU A HG3  8  
ATOM   9514  N N    . ALA A 1 3  ? 7.454   4.406   11.160  1.00 0.72 ? 3   ALA A N    8  
ATOM   9515  C CA   . ALA A 1 3  ? 8.568   3.497   10.925  1.00 0.70 ? 3   ALA A CA   8  
ATOM   9516  C C    . ALA A 1 3  ? 8.314   2.622   9.703   1.00 0.57 ? 3   ALA A C    8  
ATOM   9517  O O    . ALA A 1 3  ? 9.176   2.488   8.833   1.00 0.56 ? 3   ALA A O    8  
ATOM   9518  C CB   . ALA A 1 3  ? 8.810   2.633   12.154  1.00 0.79 ? 3   ALA A CB   8  
ATOM   9519  H H    . ALA A 1 3  ? 6.678   4.092   11.668  1.00 0.73 ? 3   ALA A H    8  
ATOM   9520  H HA   . ALA A 1 3  ? 9.454   4.092   10.753  1.00 0.75 ? 3   ALA A HA   8  
ATOM   9521  H HB1  . ALA A 1 3  ? 8.987   3.267   13.011  1.00 0.89 ? 3   ALA A HB1  8  
ATOM   9522  H HB2  . ALA A 1 3  ? 9.672   2.003   11.988  1.00 0.82 ? 3   ALA A HB2  8  
ATOM   9523  H HB3  . ALA A 1 3  ? 7.943   2.015   12.336  1.00 0.76 ? 3   ALA A HB3  8  
ATOM   9524  N N    . VAL A 1 4  ? 7.127   2.018   9.663   1.00 0.52 ? 4   VAL A N    8  
ATOM   9525  C CA   . VAL A 1 4  ? 6.738   1.132   8.570   1.00 0.45 ? 4   VAL A CA   8  
ATOM   9526  C C    . VAL A 1 4  ? 6.723   1.865   7.231   1.00 0.43 ? 4   VAL A C    8  
ATOM   9527  O O    . VAL A 1 4  ? 7.028   1.278   6.194   1.00 0.44 ? 4   VAL A O    8  
ATOM   9528  C CB   . VAL A 1 4  ? 5.351   0.504   8.824   1.00 0.49 ? 4   VAL A CB   8  
ATOM   9529  C CG1  . VAL A 1 4  ? 5.048   -0.567  7.787   1.00 0.55 ? 4   VAL A CG1  8  
ATOM   9530  C CG2  . VAL A 1 4  ? 5.269   -0.075  10.230  1.00 0.62 ? 4   VAL A CG2  8  
ATOM   9531  H H    . VAL A 1 4  ? 6.495   2.171   10.394  1.00 0.57 ? 4   VAL A H    8  
ATOM   9532  H HA   . VAL A 1 4  ? 7.464   0.333   8.520   1.00 0.46 ? 4   VAL A HA   8  
ATOM   9533  H HB   . VAL A 1 4  ? 4.606   1.281   8.733   1.00 0.59 ? 4   VAL A HB   8  
ATOM   9534  H HG11 . VAL A 1 4  ? 5.069   -0.128  6.801   1.00 0.62 ? 4   VAL A HG11 8  
ATOM   9535  H HG12 . VAL A 1 4  ? 4.071   -0.985  7.975   1.00 0.62 ? 4   VAL A HG12 8  
ATOM   9536  H HG13 . VAL A 1 4  ? 5.793   -1.348  7.849   1.00 0.62 ? 4   VAL A HG13 8  
ATOM   9537  H HG21 . VAL A 1 4  ? 4.306   -0.543  10.371  1.00 0.68 ? 4   VAL A HG21 8  
ATOM   9538  H HG22 . VAL A 1 4  ? 5.393   0.717   10.953  1.00 0.78 ? 4   VAL A HG22 8  
ATOM   9539  H HG23 . VAL A 1 4  ? 6.049   -0.810  10.364  1.00 0.70 ? 4   VAL A HG23 8  
ATOM   9540  N N    . ILE A 1 5  ? 6.383   3.153   7.261   1.00 0.45 ? 5   ILE A N    8  
ATOM   9541  C CA   . ILE A 1 5  ? 6.339   3.958   6.046   1.00 0.48 ? 5   ILE A CA   8  
ATOM   9542  C C    . ILE A 1 5  ? 7.733   4.083   5.427   1.00 0.46 ? 5   ILE A C    8  
ATOM   9543  O O    . ILE A 1 5  ? 7.871   4.198   4.212   1.00 0.57 ? 5   ILE A O    8  
ATOM   9544  C CB   . ILE A 1 5  ? 5.765   5.368   6.316   1.00 0.56 ? 5   ILE A CB   8  
ATOM   9545  C CG1  . ILE A 1 5  ? 4.468   5.272   7.126   1.00 0.73 ? 5   ILE A CG1  8  
ATOM   9546  C CG2  . ILE A 1 5  ? 5.513   6.098   5.003   1.00 0.81 ? 5   ILE A CG2  8  
ATOM   9547  C CD1  . ILE A 1 5  ? 3.867   6.619   7.476   1.00 0.82 ? 5   ILE A CD1  8  
ATOM   9548  H H    . ILE A 1 5  ? 6.159   3.568   8.120   1.00 0.48 ? 5   ILE A H    8  
ATOM   9549  H HA   . ILE A 1 5  ? 5.690   3.458   5.341   1.00 0.50 ? 5   ILE A HA   8  
ATOM   9550  H HB   . ILE A 1 5  ? 6.495   5.929   6.881   1.00 0.65 ? 5   ILE A HB   8  
ATOM   9551  H HG12 . ILE A 1 5  ? 3.734   4.721   6.555   1.00 0.89 ? 5   ILE A HG12 8  
ATOM   9552  H HG13 . ILE A 1 5  ? 4.665   4.747   8.049   1.00 0.89 ? 5   ILE A HG13 8  
ATOM   9553  H HG21 . ILE A 1 5  ? 4.837   5.517   4.393   1.00 0.99 ? 5   ILE A HG21 8  
ATOM   9554  H HG22 . ILE A 1 5  ? 6.449   6.229   4.479   1.00 0.98 ? 5   ILE A HG22 8  
ATOM   9555  H HG23 . ILE A 1 5  ? 5.076   7.064   5.206   1.00 0.91 ? 5   ILE A HG23 8  
ATOM   9556  H HD11 . ILE A 1 5  ? 3.743   7.203   6.575   1.00 0.92 ? 5   ILE A HD11 8  
ATOM   9557  H HD12 . ILE A 1 5  ? 4.524   7.140   8.156   1.00 0.99 ? 5   ILE A HD12 8  
ATOM   9558  H HD13 . ILE A 1 5  ? 2.905   6.473   7.945   1.00 1.11 ? 5   ILE A HD13 8  
ATOM   9559  N N    . LYS A 1 6  ? 8.764   4.041   6.272   1.00 0.44 ? 6   LYS A N    8  
ATOM   9560  C CA   . LYS A 1 6  ? 10.144  4.142   5.806   1.00 0.45 ? 6   LYS A CA   8  
ATOM   9561  C C    . LYS A 1 6  ? 10.661  2.788   5.315   1.00 0.41 ? 6   LYS A C    8  
ATOM   9562  O O    . LYS A 1 6  ? 11.447  2.730   4.369   1.00 0.42 ? 6   LYS A O    8  
ATOM   9563  C CB   . LYS A 1 6  ? 11.052  4.681   6.915   1.00 0.52 ? 6   LYS A CB   8  
ATOM   9564  C CG   . LYS A 1 6  ? 10.681  6.082   7.391   1.00 0.78 ? 6   LYS A CG   8  
ATOM   9565  C CD   . LYS A 1 6  ? 10.643  7.087   6.243   1.00 1.08 ? 6   LYS A CD   8  
ATOM   9566  C CE   . LYS A 1 6  ? 12.008  7.259   5.588   1.00 1.30 ? 6   LYS A CE   8  
ATOM   9567  N NZ   . LYS A 1 6  ? 13.009  7.829   6.531   1.00 1.91 ? 6   LYS A NZ   8  
ATOM   9568  H H    . LYS A 1 6  ? 8.591   3.938   7.231   1.00 0.51 ? 6   LYS A H    8  
ATOM   9569  H HA   . LYS A 1 6  ? 10.157  4.833   4.978   1.00 0.46 ? 6   LYS A HA   8  
ATOM   9570  H HB2  . LYS A 1 6  ? 11.001  4.013   7.763   1.00 0.72 ? 6   LYS A HB2  8  
ATOM   9571  H HB3  . LYS A 1 6  ? 12.068  4.707   6.551   1.00 0.62 ? 6   LYS A HB3  8  
ATOM   9572  H HG2  . LYS A 1 6  ? 9.707   6.046   7.855   1.00 1.09 ? 6   LYS A HG2  8  
ATOM   9573  H HG3  . LYS A 1 6  ? 11.413  6.407   8.117   1.00 0.83 ? 6   LYS A HG3  8  
ATOM   9574  H HD2  . LYS A 1 6  ? 9.940   6.743   5.501   1.00 1.25 ? 6   LYS A HD2  8  
ATOM   9575  H HD3  . LYS A 1 6  ? 10.318  8.042   6.629   1.00 1.41 ? 6   LYS A HD3  8  
ATOM   9576  H HE2  . LYS A 1 6  ? 12.355  6.295   5.249   1.00 1.39 ? 6   LYS A HE2  8  
ATOM   9577  H HE3  . LYS A 1 6  ? 11.905  7.921   4.741   1.00 1.37 ? 6   LYS A HE3  8  
ATOM   9578  H HZ1  . LYS A 1 6  ? 13.930  7.932   6.055   1.00 2.23 ? 6   LYS A HZ1  8  
ATOM   9579  H HZ2  . LYS A 1 6  ? 13.125  7.203   7.352   1.00 2.11 ? 6   LYS A HZ2  8  
ATOM   9580  H HZ3  . LYS A 1 6  ? 12.696  8.763   6.864   1.00 2.10 ? 6   LYS A HZ3  8  
ATOM   9581  N N    . VAL A 1 7  ? 10.219  1.703   5.960   1.00 0.40 ? 7   VAL A N    8  
ATOM   9582  C CA   . VAL A 1 7  ? 10.631  0.361   5.569   1.00 0.41 ? 7   VAL A CA   8  
ATOM   9583  C C    . VAL A 1 7  ? 10.004  -0.040  4.237   1.00 0.37 ? 7   VAL A C    8  
ATOM   9584  O O    . VAL A 1 7  ? 10.542  -0.879  3.514   1.00 0.41 ? 7   VAL A O    8  
ATOM   9585  C CB   . VAL A 1 7  ? 10.246  -0.679  6.638   1.00 0.46 ? 7   VAL A CB   8  
ATOM   9586  C CG1  . VAL A 1 7  ? 10.862  -2.031  6.314   1.00 0.52 ? 7   VAL A CG1  8  
ATOM   9587  C CG2  . VAL A 1 7  ? 10.672  -0.205  8.019   1.00 0.53 ? 7   VAL A CG2  8  
ATOM   9588  H H    . VAL A 1 7  ? 9.602   1.813   6.714   1.00 0.42 ? 7   VAL A H    8  
ATOM   9589  H HA   . VAL A 1 7  ? 11.707  0.358   5.465   1.00 0.46 ? 7   VAL A HA   8  
ATOM   9590  H HB   . VAL A 1 7  ? 9.170   -0.788  6.633   1.00 0.44 ? 7   VAL A HB   8  
ATOM   9591  H HG11 . VAL A 1 7  ? 11.940  -1.948  6.326   1.00 0.57 ? 7   VAL A HG11 8  
ATOM   9592  H HG12 . VAL A 1 7  ? 10.538  -2.350  5.335   1.00 0.49 ? 7   VAL A HG12 8  
ATOM   9593  H HG13 . VAL A 1 7  ? 10.549  -2.756  7.051   1.00 0.56 ? 7   VAL A HG13 8  
ATOM   9594  H HG21 . VAL A 1 7  ? 10.175  0.725   8.250   1.00 0.51 ? 7   VAL A HG21 8  
ATOM   9595  H HG22 . VAL A 1 7  ? 11.742  -0.054  8.034   1.00 0.57 ? 7   VAL A HG22 8  
ATOM   9596  H HG23 . VAL A 1 7  ? 10.404  -0.949  8.754   1.00 0.58 ? 7   VAL A HG23 8  
ATOM   9597  N N    . ILE A 1 8  ? 8.864   0.572   3.919   1.00 0.34 ? 8   ILE A N    8  
ATOM   9598  C CA   . ILE A 1 8  ? 8.154   0.290   2.676   1.00 0.36 ? 8   ILE A CA   8  
ATOM   9599  C C    . ILE A 1 8  ? 8.599   1.244   1.566   1.00 0.34 ? 8   ILE A C    8  
ATOM   9600  O O    . ILE A 1 8  ? 8.674   0.857   0.399   1.00 0.34 ? 8   ILE A O    8  
ATOM   9601  C CB   . ILE A 1 8  ? 6.620   0.393   2.868   1.00 0.43 ? 8   ILE A CB   8  
ATOM   9602  C CG1  . ILE A 1 8  ? 6.137   -0.641  3.892   1.00 0.57 ? 8   ILE A CG1  8  
ATOM   9603  C CG2  . ILE A 1 8  ? 5.888   0.206   1.545   1.00 0.61 ? 8   ILE A CG2  8  
ATOM   9604  C CD1  . ILE A 1 8  ? 6.412   -2.077  3.492   1.00 0.78 ? 8   ILE A CD1  8  
ATOM   9605  H H    . ILE A 1 8  ? 8.489   1.230   4.542   1.00 0.34 ? 8   ILE A H    8  
ATOM   9606  H HA   . ILE A 1 8  ? 8.391   -0.721  2.379   1.00 0.39 ? 8   ILE A HA   8  
ATOM   9607  H HB   . ILE A 1 8  ? 6.393   1.382   3.236   1.00 0.58 ? 8   ILE A HB   8  
ATOM   9608  H HG12 . ILE A 1 8  ? 6.633   -0.461  4.835   1.00 0.73 ? 8   ILE A HG12 8  
ATOM   9609  H HG13 . ILE A 1 8  ? 5.070   -0.532  4.027   1.00 0.61 ? 8   ILE A HG13 8  
ATOM   9610  H HG21 . ILE A 1 8  ? 4.827   0.335   1.700   1.00 1.01 ? 8   ILE A HG21 8  
ATOM   9611  H HG22 . ILE A 1 8  ? 6.078   -0.788  1.167   1.00 1.07 ? 8   ILE A HG22 8  
ATOM   9612  H HG23 . ILE A 1 8  ? 6.239   0.936   0.832   1.00 1.06 ? 8   ILE A HG23 8  
ATOM   9613  H HD11 . ILE A 1 8  ? 7.477   -2.259  3.510   1.00 0.95 ? 8   ILE A HD11 8  
ATOM   9614  H HD12 . ILE A 1 8  ? 6.035   -2.250  2.494   1.00 0.89 ? 8   ILE A HD12 8  
ATOM   9615  H HD13 . ILE A 1 8  ? 5.920   -2.745  4.184   1.00 1.07 ? 8   ILE A HD13 8  
ATOM   9616  N N    . SER A 1 9  ? 8.909   2.487   1.937   1.00 0.36 ? 9   SER A N    8  
ATOM   9617  C CA   . SER A 1 9  ? 9.352   3.489   0.969   1.00 0.37 ? 9   SER A CA   8  
ATOM   9618  C C    . SER A 1 9  ? 10.721  3.125   0.405   1.00 0.35 ? 9   SER A C    8  
ATOM   9619  O O    . SER A 1 9  ? 10.965  3.270   -0.790  1.00 0.36 ? 9   SER A O    8  
ATOM   9620  C CB   . SER A 1 9  ? 9.401   4.876   1.611   1.00 0.43 ? 9   SER A CB   8  
ATOM   9621  O OG   . SER A 1 9  ? 9.635   5.882   0.640   1.00 0.49 ? 9   SER A OG   8  
ATOM   9622  H H    . SER A 1 9  ? 8.836   2.736   2.883   1.00 0.38 ? 9   SER A H    8  
ATOM   9623  H HA   . SER A 1 9  ? 8.637   3.502   0.159   1.00 0.39 ? 9   SER A HA   8  
ATOM   9624  H HB2  . SER A 1 9  ? 8.460   5.077   2.099   1.00 0.45 ? 9   SER A HB2  8  
ATOM   9625  H HB3  . SER A 1 9  ? 10.198  4.904   2.339   1.00 0.44 ? 9   SER A HB3  8  
ATOM   9626  H HG   . SER A 1 9  ? 10.526  6.223   0.741   1.00 0.81 ? 9   SER A HG   8  
ATOM   9627  N N    . SER A 1 10 ? 11.610  2.648   1.273   1.00 0.36 ? 10  SER A N    8  
ATOM   9628  C CA   . SER A 1 10 ? 12.951  2.250   0.856   1.00 0.37 ? 10  SER A CA   8  
ATOM   9629  C C    . SER A 1 10 ? 12.898  0.955   0.048   1.00 0.35 ? 10  SER A C    8  
ATOM   9630  O O    . SER A 1 10 ? 13.780  0.680   -0.768  1.00 0.35 ? 10  SER A O    8  
ATOM   9631  C CB   . SER A 1 10 ? 13.856  2.070   2.077   1.00 0.43 ? 10  SER A CB   8  
ATOM   9632  O OG   . SER A 1 10 ? 15.185  1.763   1.691   1.00 0.46 ? 10  SER A OG   8  
ATOM   9633  H H    . SER A 1 10 ? 11.358  2.560   2.216   1.00 0.38 ? 10  SER A H    8  
ATOM   9634  H HA   . SER A 1 10 ? 13.351  3.035   0.233   1.00 0.37 ? 10  SER A HA   8  
ATOM   9635  H HB2  . SER A 1 10 ? 13.865  2.980   2.655   1.00 0.45 ? 10  SER A HB2  8  
ATOM   9636  H HB3  . SER A 1 10 ? 13.477  1.263   2.686   1.00 0.44 ? 10  SER A HB3  8  
ATOM   9637  H HG   . SER A 1 10 ? 15.176  1.314   0.841   1.00 0.67 ? 10  SER A HG   8  
ATOM   9638  N N    . ALA A 1 11 ? 11.851  0.167   0.285   1.00 0.35 ? 11  ALA A N    8  
ATOM   9639  C CA   . ALA A 1 11 ? 11.661  -1.099  -0.416  1.00 0.36 ? 11  ALA A CA   8  
ATOM   9640  C C    . ALA A 1 11 ? 11.211  -0.867  -1.856  1.00 0.31 ? 11  ALA A C    8  
ATOM   9641  O O    . ALA A 1 11 ? 11.775  -1.438  -2.786  1.00 0.33 ? 11  ALA A O    8  
ATOM   9642  C CB   . ALA A 1 11 ? 10.646  -1.965  0.320   1.00 0.40 ? 11  ALA A CB   8  
ATOM   9643  H H    . ALA A 1 11 ? 11.187  0.446   0.949   1.00 0.36 ? 11  ALA A H    8  
ATOM   9644  H HA   . ALA A 1 11 ? 12.607  -1.621  -0.423  1.00 0.39 ? 11  ALA A HA   8  
ATOM   9645  H HB1  . ALA A 1 11 ? 9.684   -1.475  0.315   1.00 0.38 ? 11  ALA A HB1  8  
ATOM   9646  H HB2  . ALA A 1 11 ? 10.969  -2.112  1.339   1.00 0.44 ? 11  ALA A HB2  8  
ATOM   9647  H HB3  . ALA A 1 11 ? 10.566  -2.922  -0.174  1.00 0.42 ? 11  ALA A HB3  8  
ATOM   9648  N N    . CYS A 1 12 ? 10.205  -0.008  -2.029  1.00 0.28 ? 12  CYS A N    8  
ATOM   9649  C CA   . CYS A 1 12 ? 9.668   0.294   -3.354  1.00 0.26 ? 12  CYS A CA   8  
ATOM   9650  C C    . CYS A 1 12 ? 10.645  1.121   -4.191  1.00 0.25 ? 12  CYS A C    8  
ATOM   9651  O O    . CYS A 1 12 ? 10.488  1.227   -5.404  1.00 0.26 ? 12  CYS A O    8  
ATOM   9652  C CB   . CYS A 1 12 ? 8.322   1.017   -3.236  1.00 0.28 ? 12  CYS A CB   8  
ATOM   9653  S SG   . CYS A 1 12 ? 8.402   2.618   -2.400  1.00 0.26 ? 12  CYS A SG   8  
ATOM   9654  H H    . CYS A 1 12 ? 9.815   0.434   -1.245  1.00 0.29 ? 12  CYS A H    8  
ATOM   9655  H HA   . CYS A 1 12 ? 9.506   -0.648  -3.856  1.00 0.29 ? 12  CYS A HA   8  
ATOM   9656  H HB2  . CYS A 1 12 ? 7.926   1.187   -4.226  1.00 0.29 ? 12  CYS A HB2  8  
ATOM   9657  H HB3  . CYS A 1 12 ? 7.635   0.393   -2.684  1.00 0.34 ? 12  CYS A HB3  8  
ATOM   9658  H HG   . CYS A 1 12 ? 9.477   3.255   -2.839  1.00 1.12 ? 12  CYS A HG   8  
ATOM   9659  N N    . LYS A 1 13 ? 11.654  1.703   -3.547  1.00 0.25 ? 13  LYS A N    8  
ATOM   9660  C CA   . LYS A 1 13 ? 12.656  2.494   -4.259  1.00 0.26 ? 13  LYS A CA   8  
ATOM   9661  C C    . LYS A 1 13 ? 13.689  1.575   -4.909  1.00 0.31 ? 13  LYS A C    8  
ATOM   9662  O O    . LYS A 1 13 ? 14.527  2.017   -5.695  1.00 0.35 ? 13  LYS A O    8  
ATOM   9663  C CB   . LYS A 1 13 ? 13.355  3.467   -3.304  1.00 0.29 ? 13  LYS A CB   8  
ATOM   9664  C CG   . LYS A 1 13 ? 12.523  4.690   -2.945  1.00 0.79 ? 13  LYS A CG   8  
ATOM   9665  C CD   . LYS A 1 13 ? 12.665  5.797   -3.979  1.00 1.28 ? 13  LYS A CD   8  
ATOM   9666  C CE   . LYS A 1 13 ? 11.878  7.035   -3.578  1.00 1.89 ? 13  LYS A CE   8  
ATOM   9667  N NZ   . LYS A 1 13 ? 12.038  8.143   -4.559  1.00 2.67 ? 13  LYS A NZ   8  
ATOM   9668  H H    . LYS A 1 13 ? 11.727  1.598   -2.575  1.00 0.28 ? 13  LYS A H    8  
ATOM   9669  H HA   . LYS A 1 13 ? 12.151  3.055   -5.031  1.00 0.25 ? 13  LYS A HA   8  
ATOM   9670  H HB2  . LYS A 1 13 ? 13.594  2.943   -2.390  1.00 0.60 ? 13  LYS A HB2  8  
ATOM   9671  H HB3  . LYS A 1 13 ? 14.272  3.804   -3.762  1.00 0.66 ? 13  LYS A HB3  8  
ATOM   9672  H HG2  . LYS A 1 13 ? 11.485  4.401   -2.886  1.00 1.52 ? 13  LYS A HG2  8  
ATOM   9673  H HG3  . LYS A 1 13 ? 12.849  5.064   -1.985  1.00 0.94 ? 13  LYS A HG3  8  
ATOM   9674  H HD2  . LYS A 1 13 ? 13.709  6.061   -4.069  1.00 1.26 ? 13  LYS A HD2  8  
ATOM   9675  H HD3  . LYS A 1 13 ? 12.299  5.439   -4.930  1.00 1.89 ? 13  LYS A HD3  8  
ATOM   9676  H HE2  . LYS A 1 13 ? 10.831  6.775   -3.512  1.00 2.36 ? 13  LYS A HE2  8  
ATOM   9677  H HE3  . LYS A 1 13 ? 12.226  7.370   -2.611  1.00 1.74 ? 13  LYS A HE3  8  
ATOM   9678  H HZ1  . LYS A 1 13 ? 13.039  8.411   -4.636  1.00 2.68 ? 13  LYS A HZ1  8  
ATOM   9679  H HZ2  . LYS A 1 13 ? 11.490  8.973   -4.254  1.00 3.10 ? 13  LYS A HZ2  8  
ATOM   9680  H HZ3  . LYS A 1 13 ? 11.697  7.843   -5.496  1.00 3.07 ? 13  LYS A HZ3  8  
ATOM   9681  N N    . THR A 1 14 ? 13.610  0.288   -4.578  1.00 0.33 ? 14  THR A N    8  
ATOM   9682  C CA   . THR A 1 14 ? 14.530  -0.709  -5.109  1.00 0.39 ? 14  THR A CA   8  
ATOM   9683  C C    . THR A 1 14 ? 13.816  -1.667  -6.056  1.00 0.41 ? 14  THR A C    8  
ATOM   9684  O O    . THR A 1 14 ? 14.454  -2.444  -6.766  1.00 0.46 ? 14  THR A O    8  
ATOM   9685  C CB   . THR A 1 14 ? 15.193  -1.520  -3.980  1.00 0.43 ? 14  THR A CB   8  
ATOM   9686  O OG1  . THR A 1 14 ? 15.759  -0.635  -3.009  1.00 0.44 ? 14  THR A OG1  8  
ATOM   9687  C CG2  . THR A 1 14 ? 16.276  -2.433  -4.535  1.00 0.50 ? 14  THR A CG2  8  
ATOM   9688  H H    . THR A 1 14 ? 12.910  0.002   -3.952  1.00 0.32 ? 14  THR A H    8  
ATOM   9689  H HA   . THR A 1 14 ? 15.305  -0.190  -5.654  1.00 0.41 ? 14  THR A HA   8  
ATOM   9690  H HB   . THR A 1 14 ? 14.439  -2.130  -3.504  1.00 0.42 ? 14  THR A HB   8  
ATOM   9691  H HG1  . THR A 1 14 ? 15.066  -0.309  -2.430  1.00 0.42 ? 14  THR A HG1  8  
ATOM   9692  H HG21 . THR A 1 14 ? 15.846  -3.094  -5.273  1.00 0.50 ? 14  THR A HG21 8  
ATOM   9693  H HG22 . THR A 1 14 ? 16.700  -3.018  -3.732  1.00 0.53 ? 14  THR A HG22 8  
ATOM   9694  H HG23 . THR A 1 14 ? 17.050  -1.836  -4.993  1.00 0.51 ? 14  THR A HG23 8  
ATOM   9695  N N    . TYR A 1 15 ? 12.488  -1.605  -6.065  1.00 0.37 ? 15  TYR A N    8  
ATOM   9696  C CA   . TYR A 1 15 ? 11.688  -2.468  -6.924  1.00 0.40 ? 15  TYR A CA   8  
ATOM   9697  C C    . TYR A 1 15 ? 10.924  -1.649  -7.959  1.00 0.39 ? 15  TYR A C    8  
ATOM   9698  O O    . TYR A 1 15 ? 10.262  -2.200  -8.839  1.00 0.43 ? 15  TYR A O    8  
ATOM   9699  C CB   . TYR A 1 15 ? 10.710  -3.293  -6.085  1.00 0.39 ? 15  TYR A CB   8  
ATOM   9700  C CG   . TYR A 1 15 ? 11.382  -4.339  -5.226  1.00 0.43 ? 15  TYR A CG   8  
ATOM   9701  C CD1  . TYR A 1 15 ? 11.218  -4.342  -3.845  1.00 0.41 ? 15  TYR A CD1  8  
ATOM   9702  C CD2  . TYR A 1 15 ? 12.183  -5.322  -5.792  1.00 0.49 ? 15  TYR A CD2  8  
ATOM   9703  C CE1  . TYR A 1 15 ? 11.831  -5.295  -3.056  1.00 0.46 ? 15  TYR A CE1  8  
ATOM   9704  C CE2  . TYR A 1 15 ? 12.798  -6.281  -5.011  1.00 0.52 ? 15  TYR A CE2  8  
ATOM   9705  C CZ   . TYR A 1 15 ? 12.619  -6.264  -3.642  1.00 0.51 ? 15  TYR A CZ   8  
ATOM   9706  O OH   . TYR A 1 15 ? 13.232  -7.215  -2.860  1.00 0.56 ? 15  TYR A OH   8  
ATOM   9707  H H    . TYR A 1 15 ? 12.036  -0.963  -5.479  1.00 0.33 ? 15  TYR A H    8  
ATOM   9708  H HA   . TYR A 1 15 ? 12.362  -3.137  -7.438  1.00 0.45 ? 15  TYR A HA   8  
ATOM   9709  H HB2  . TYR A 1 15 ? 10.161  -2.632  -5.433  1.00 0.35 ? 15  TYR A HB2  8  
ATOM   9710  H HB3  . TYR A 1 15 ? 10.019  -3.798  -6.744  1.00 0.42 ? 15  TYR A HB3  8  
ATOM   9711  H HD1  . TYR A 1 15 ? 10.600  -3.585  -3.388  1.00 0.38 ? 15  TYR A HD1  8  
ATOM   9712  H HD2  . TYR A 1 15 ? 12.322  -5.333  -6.863  1.00 0.51 ? 15  TYR A HD2  8  
ATOM   9713  H HE1  . TYR A 1 15 ? 11.690  -5.280  -1.985  1.00 0.47 ? 15  TYR A HE1  8  
ATOM   9714  H HE2  . TYR A 1 15 ? 13.415  -7.038  -5.471  1.00 0.57 ? 15  TYR A HE2  8  
ATOM   9715  H HH   . TYR A 1 15 ? 12.625  -7.510  -2.178  1.00 0.57 ? 15  TYR A HH   8  
ATOM   9716  N N    . CYS A 1 16 ? 11.018  -0.328  -7.846  1.00 0.35 ? 16  CYS A N    8  
ATOM   9717  C CA   . CYS A 1 16 ? 10.336  0.570   -8.771  1.00 0.36 ? 16  CYS A CA   8  
ATOM   9718  C C    . CYS A 1 16 ? 11.239  1.735   -9.163  1.00 0.37 ? 16  CYS A C    8  
ATOM   9719  O O    . CYS A 1 16 ? 11.390  2.047   -10.344 1.00 0.42 ? 16  CYS A O    8  
ATOM   9720  C CB   . CYS A 1 16 ? 9.046   1.097   -8.142  1.00 0.32 ? 16  CYS A CB   8  
ATOM   9721  S SG   . CYS A 1 16 ? 8.056   -0.169  -7.314  1.00 0.32 ? 16  CYS A SG   8  
ATOM   9722  H H    . CYS A 1 16 ? 11.561  0.052   -7.124  1.00 0.33 ? 16  CYS A H    8  
ATOM   9723  H HA   . CYS A 1 16 ? 10.090  0.007   -9.659  1.00 0.41 ? 16  CYS A HA   8  
ATOM   9724  H HB2  . CYS A 1 16 ? 9.294   1.851   -7.410  1.00 0.28 ? 16  CYS A HB2  8  
ATOM   9725  H HB3  . CYS A 1 16 ? 8.433   1.542   -8.914  1.00 0.35 ? 16  CYS A HB3  8  
ATOM   9726  H HG   . CYS A 1 16 ? 8.361   -0.147  -6.025  1.00 0.27 ? 16  CYS A HG   8  
ATOM   9727  N N    . GLY A 1 17 ? 11.836  2.377   -8.165  1.00 0.33 ? 17  GLY A N    8  
ATOM   9728  C CA   . GLY A 1 17 ? 12.715  3.502   -8.426  1.00 0.34 ? 17  GLY A CA   8  
ATOM   9729  C C    . GLY A 1 17 ? 12.018  4.836   -8.244  1.00 0.32 ? 17  GLY A C    8  
ATOM   9730  O O    . GLY A 1 17 ? 11.401  5.087   -7.208  1.00 0.27 ? 17  GLY A O    8  
ATOM   9731  H H    . GLY A 1 17 ? 11.677  2.085   -7.242  1.00 0.29 ? 17  GLY A H    8  
ATOM   9732  H HA2  . GLY A 1 17 ? 13.556  3.454   -7.750  1.00 0.34 ? 17  GLY A HA2  8  
ATOM   9733  H HA3  . GLY A 1 17 ? 13.078  3.434   -9.441  1.00 0.39 ? 17  GLY A HA3  8  
ATOM   9734  N N    . LYS A 1 18 ? 12.119  5.695   -9.252  1.00 0.36 ? 18  LYS A N    8  
ATOM   9735  C CA   . LYS A 1 18 ? 11.492  7.013   -9.199  1.00 0.36 ? 18  LYS A CA   8  
ATOM   9736  C C    . LYS A 1 18 ? 9.982   6.905   -9.369  1.00 0.36 ? 18  LYS A C    8  
ATOM   9737  O O    . LYS A 1 18 ? 9.236   7.803   -8.979  1.00 0.36 ? 18  LYS A O    8  
ATOM   9738  C CB   . LYS A 1 18 ? 12.076  7.920   -10.287 1.00 0.43 ? 18  LYS A CB   8  
ATOM   9739  C CG   . LYS A 1 18 ? 12.044  7.303   -11.673 1.00 0.48 ? 18  LYS A CG   8  
ATOM   9740  C CD   . LYS A 1 18 ? 13.423  6.831   -12.106 1.00 0.52 ? 18  LYS A CD   8  
ATOM   9741  C CE   . LYS A 1 18 ? 14.026  7.758   -13.150 1.00 0.58 ? 18  LYS A CE   8  
ATOM   9742  N NZ   . LYS A 1 18 ? 15.430  8.132   -12.815 1.00 0.59 ? 18  LYS A NZ   8  
ATOM   9743  H H    . LYS A 1 18 ? 12.623  5.438   -10.050 1.00 0.40 ? 18  LYS A H    8  
ATOM   9744  H HA   . LYS A 1 18 ? 11.705  7.443   -8.231  1.00 0.34 ? 18  LYS A HA   8  
ATOM   9745  H HB2  . LYS A 1 18 ? 11.510  8.840   -10.312 1.00 0.43 ? 18  LYS A HB2  8  
ATOM   9746  H HB3  . LYS A 1 18 ? 13.102  8.146   -10.038 1.00 0.43 ? 18  LYS A HB3  8  
ATOM   9747  H HG2  . LYS A 1 18 ? 11.373  6.459   -11.665 1.00 0.47 ? 18  LYS A HG2  8  
ATOM   9748  H HG3  . LYS A 1 18 ? 11.688  8.042   -12.377 1.00 0.52 ? 18  LYS A HG3  8  
ATOM   9749  H HD2  . LYS A 1 18 ? 14.072  6.805   -11.244 1.00 0.49 ? 18  LYS A HD2  8  
ATOM   9750  H HD3  . LYS A 1 18 ? 13.337  5.839   -12.524 1.00 0.53 ? 18  LYS A HD3  8  
ATOM   9751  H HE2  . LYS A 1 18 ? 14.016  7.258   -14.107 1.00 0.62 ? 18  LYS A HE2  8  
ATOM   9752  H HE3  . LYS A 1 18 ? 13.428  8.656   -13.207 1.00 0.58 ? 18  LYS A HE3  8  
ATOM   9753  H HZ1  . LYS A 1 18 ? 16.023  7.278   -12.760 1.00 0.60 ? 18  LYS A HZ1  8  
ATOM   9754  H HZ2  . LYS A 1 18 ? 15.460  8.621   -11.898 1.00 0.56 ? 18  LYS A HZ2  8  
ATOM   9755  H HZ3  . LYS A 1 18 ? 15.815  8.763   -13.545 1.00 0.64 ? 18  LYS A HZ3  8  
ATOM   9756  N N    . THR A 1 19 ? 9.533   5.797   -9.954  1.00 0.37 ? 19  THR A N    8  
ATOM   9757  C CA   . THR A 1 19 ? 8.110   5.571   -10.173 1.00 0.39 ? 19  THR A CA   8  
ATOM   9758  C C    . THR A 1 19 ? 7.394   5.262   -8.866  1.00 0.33 ? 19  THR A C    8  
ATOM   9759  O O    . THR A 1 19 ? 6.179   5.438   -8.756  1.00 0.43 ? 19  THR A O    8  
ATOM   9760  C CB   . THR A 1 19 ? 7.871   4.415   -11.163 1.00 0.46 ? 19  THR A CB   8  
ATOM   9761  O OG1  . THR A 1 19 ? 8.035   3.159   -10.494 1.00 0.53 ? 19  THR A OG1  8  
ATOM   9762  C CG2  . THR A 1 19 ? 8.837   4.498   -12.336 1.00 0.61 ? 19  THR A CG2  8  
ATOM   9763  H H    . THR A 1 19 ? 10.175  5.116   -10.242 1.00 0.39 ? 19  THR A H    8  
ATOM   9764  H HA   . THR A 1 19 ? 7.692   6.472   -10.598 1.00 0.42 ? 19  THR A HA   8  
ATOM   9765  H HB   . THR A 1 19 ? 6.862   4.484   -11.541 1.00 0.49 ? 19  THR A HB   8  
ATOM   9766  H HG1  . THR A 1 19 ? 8.475   2.538   -11.079 1.00 0.54 ? 19  THR A HG1  8  
ATOM   9767  H HG21 . THR A 1 19 ? 8.624   3.703   -13.035 1.00 0.66 ? 19  THR A HG21 8  
ATOM   9768  H HG22 . THR A 1 19 ? 9.851   4.398   -11.976 1.00 0.68 ? 19  THR A HG22 8  
ATOM   9769  H HG23 . THR A 1 19 ? 8.722   5.452   -12.829 1.00 0.69 ? 19  THR A HG23 8  
ATOM   9770  N N    . SER A 1 20 ? 8.160   4.829   -7.856  1.00 0.30 ? 20  SER A N    8  
ATOM   9771  C CA   . SER A 1 20 ? 7.610   4.481   -6.537  1.00 0.24 ? 20  SER A CA   8  
ATOM   9772  C C    . SER A 1 20 ? 6.795   5.629   -5.932  1.00 0.22 ? 20  SER A C    8  
ATOM   9773  O O    . SER A 1 20 ? 7.038   6.799   -6.231  1.00 0.26 ? 20  SER A O    8  
ATOM   9774  C CB   . SER A 1 20 ? 8.745   4.103   -5.582  1.00 0.22 ? 20  SER A CB   8  
ATOM   9775  O OG   . SER A 1 20 ? 9.483   5.245   -5.189  1.00 0.25 ? 20  SER A OG   8  
ATOM   9776  H H    . SER A 1 20 ? 9.125   4.744   -8.001  1.00 0.38 ? 20  SER A H    8  
ATOM   9777  H HA   . SER A 1 20 ? 6.965   3.628   -6.664  1.00 0.26 ? 20  SER A HA   8  
ATOM   9778  H HB2  . SER A 1 20 ? 8.331   3.641   -4.700  1.00 0.26 ? 20  SER A HB2  8  
ATOM   9779  H HB3  . SER A 1 20 ? 9.410   3.410   -6.074  1.00 0.24 ? 20  SER A HB3  8  
ATOM   9780  H HG   . SER A 1 20 ? 8.881   5.967   -4.998  1.00 0.41 ? 20  SER A HG   8  
ATOM   9781  N N    . PRO A 1 21 ? 5.822   5.301   -5.054  1.00 0.20 ? 21  PRO A N    8  
ATOM   9782  C CA   . PRO A 1 21 ? 4.971   6.306   -4.403  1.00 0.22 ? 21  PRO A CA   8  
ATOM   9783  C C    . PRO A 1 21 ? 5.741   7.148   -3.386  1.00 0.22 ? 21  PRO A C    8  
ATOM   9784  O O    . PRO A 1 21 ? 6.886   6.842   -3.046  1.00 0.24 ? 21  PRO A O    8  
ATOM   9785  C CB   . PRO A 1 21 ? 3.904   5.464   -3.699  1.00 0.23 ? 21  PRO A CB   8  
ATOM   9786  C CG   . PRO A 1 21 ? 4.548   4.145   -3.467  1.00 0.21 ? 21  PRO A CG   8  
ATOM   9787  C CD   . PRO A 1 21 ? 5.477   3.929   -4.627  1.00 0.20 ? 21  PRO A CD   8  
ATOM   9788  H HA   . PRO A 1 21 ? 4.503   6.956   -5.127  1.00 0.26 ? 21  PRO A HA   8  
ATOM   9789  H HB2  . PRO A 1 21 ? 3.623   5.932   -2.763  1.00 0.25 ? 21  PRO A HB2  8  
ATOM   9790  H HB3  . PRO A 1 21 ? 3.041   5.350   -4.335  1.00 0.26 ? 21  PRO A HB3  8  
ATOM   9791  H HG2  . PRO A 1 21 ? 5.102   4.168   -2.539  1.00 0.21 ? 21  PRO A HG2  8  
ATOM   9792  H HG3  . PRO A 1 21 ? 3.802   3.367   -3.442  1.00 0.24 ? 21  PRO A HG3  8  
ATOM   9793  H HD2  . PRO A 1 21 ? 6.357   3.390   -4.309  1.00 0.21 ? 21  PRO A HD2  8  
ATOM   9794  H HD3  . PRO A 1 21 ? 4.973   3.396   -5.418  1.00 0.24 ? 21  PRO A HD3  8  
ATOM   9795  N N    . SER A 1 22 ? 5.103   8.206   -2.904  1.00 0.24 ? 22  SER A N    8  
ATOM   9796  C CA   . SER A 1 22 ? 5.722   9.099   -1.931  1.00 0.26 ? 22  SER A CA   8  
ATOM   9797  C C    . SER A 1 22 ? 5.313   8.735   -0.510  1.00 0.23 ? 22  SER A C    8  
ATOM   9798  O O    . SER A 1 22 ? 4.416   7.917   -0.298  1.00 0.23 ? 22  SER A O    8  
ATOM   9799  C CB   . SER A 1 22 ? 5.331   10.549  -2.224  1.00 0.31 ? 22  SER A CB   8  
ATOM   9800  O OG   . SER A 1 22 ? 3.924   10.716  -2.181  1.00 0.32 ? 22  SER A OG   8  
ATOM   9801  H H    . SER A 1 22 ? 4.189   8.392   -3.207  1.00 0.26 ? 22  SER A H    8  
ATOM   9802  H HA   . SER A 1 22 ? 6.795   8.999   -2.023  1.00 0.29 ? 22  SER A HA   8  
ATOM   9803  H HB2  . SER A 1 22 ? 5.779   11.195  -1.483  1.00 0.34 ? 22  SER A HB2  8  
ATOM   9804  H HB3  . SER A 1 22 ? 5.686   10.826  -3.205  1.00 0.35 ? 22  SER A HB3  8  
ATOM   9805  H HG   . SER A 1 22 ? 3.578   10.750  -3.076  1.00 0.54 ? 22  SER A HG   8  
ATOM   9806  N N    . LYS A 1 23 ? 5.978   9.354   0.462   1.00 0.24 ? 23  LYS A N    8  
ATOM   9807  C CA   . LYS A 1 23 ? 5.686   9.120   1.871   1.00 0.25 ? 23  LYS A CA   8  
ATOM   9808  C C    . LYS A 1 23 ? 4.324   9.709   2.235   1.00 0.23 ? 23  LYS A C    8  
ATOM   9809  O O    . LYS A 1 23 ? 3.609   9.171   3.081   1.00 0.26 ? 23  LYS A O    8  
ATOM   9810  C CB   . LYS A 1 23 ? 6.782   9.740   2.742   1.00 0.29 ? 23  LYS A CB   8  
ATOM   9811  C CG   . LYS A 1 23 ? 6.505   9.666   4.236   1.00 0.41 ? 23  LYS A CG   8  
ATOM   9812  C CD   . LYS A 1 23 ? 7.224   10.775  4.985   1.00 0.87 ? 23  LYS A CD   8  
ATOM   9813  C CE   . LYS A 1 23 ? 6.754   10.875  6.425   1.00 1.02 ? 23  LYS A CE   8  
ATOM   9814  N NZ   . LYS A 1 23 ? 7.297   12.087  7.096   1.00 1.62 ? 23  LYS A NZ   8  
ATOM   9815  H H    . LYS A 1 23 ? 6.689   9.987   0.222   1.00 0.26 ? 23  LYS A H    8  
ATOM   9816  H HA   . LYS A 1 23 ? 5.662   8.052   2.034   1.00 0.27 ? 23  LYS A HA   8  
ATOM   9817  H HB2  . LYS A 1 23 ? 7.711   9.224   2.547   1.00 0.35 ? 23  LYS A HB2  8  
ATOM   9818  H HB3  . LYS A 1 23 ? 6.894   10.777  2.470   1.00 0.34 ? 23  LYS A HB3  8  
ATOM   9819  H HG2  . LYS A 1 23 ? 5.443   9.763   4.401   1.00 0.71 ? 23  LYS A HG2  8  
ATOM   9820  H HG3  . LYS A 1 23 ? 6.844   8.711   4.610   1.00 0.67 ? 23  LYS A HG3  8  
ATOM   9821  H HD2  . LYS A 1 23 ? 8.284   10.571  4.978   1.00 1.16 ? 23  LYS A HD2  8  
ATOM   9822  H HD3  . LYS A 1 23 ? 7.034   11.713  4.487   1.00 1.26 ? 23  LYS A HD3  8  
ATOM   9823  H HE2  . LYS A 1 23 ? 5.675   10.920  6.437   1.00 1.11 ? 23  LYS A HE2  8  
ATOM   9824  H HE3  . LYS A 1 23 ? 7.084   9.998   6.960   1.00 1.06 ? 23  LYS A HE3  8  
ATOM   9825  H HZ1  . LYS A 1 23 ? 6.948   12.142  8.073   1.00 1.74 ? 23  LYS A HZ1  8  
ATOM   9826  H HZ2  . LYS A 1 23 ? 6.999   12.942  6.584   1.00 1.95 ? 23  LYS A HZ2  8  
ATOM   9827  H HZ3  . LYS A 1 23 ? 8.336   12.051  7.110   1.00 1.88 ? 23  LYS A HZ3  8  
ATOM   9828  N N    . LYS A 1 24 ? 3.971   10.816  1.580   1.00 0.20 ? 24  LYS A N    8  
ATOM   9829  C CA   . LYS A 1 24 ? 2.695   11.482  1.820   1.00 0.21 ? 24  LYS A CA   8  
ATOM   9830  C C    . LYS A 1 24 ? 1.533   10.646  1.283   1.00 0.20 ? 24  LYS A C    8  
ATOM   9831  O O    . LYS A 1 24 ? 0.428   10.685  1.826   1.00 0.22 ? 24  LYS A O    8  
ATOM   9832  C CB   . LYS A 1 24 ? 2.688   12.870  1.174   1.00 0.24 ? 24  LYS A CB   8  
ATOM   9833  C CG   . LYS A 1 24 ? 3.686   13.839  1.791   1.00 0.43 ? 24  LYS A CG   8  
ATOM   9834  C CD   . LYS A 1 24 ? 3.823   15.111  0.966   1.00 0.79 ? 24  LYS A CD   8  
ATOM   9835  C CE   . LYS A 1 24 ? 4.437   14.832  -0.398  1.00 1.35 ? 24  LYS A CE   8  
ATOM   9836  N NZ   . LYS A 1 24 ? 5.250   15.980  -0.885  1.00 2.01 ? 24  LYS A NZ   8  
ATOM   9837  H H    . LYS A 1 24 ? 4.591   11.195  0.921   1.00 0.20 ? 24  LYS A H    8  
ATOM   9838  H HA   . LYS A 1 24 ? 2.577   11.592  2.888   1.00 0.24 ? 24  LYS A HA   8  
ATOM   9839  H HB2  . LYS A 1 24 ? 2.921   12.767  0.124   1.00 0.37 ? 24  LYS A HB2  8  
ATOM   9840  H HB3  . LYS A 1 24 ? 1.699   13.295  1.273   1.00 0.38 ? 24  LYS A HB3  8  
ATOM   9841  H HG2  . LYS A 1 24 ? 3.350   14.101  2.784   1.00 0.80 ? 24  LYS A HG2  8  
ATOM   9842  H HG3  . LYS A 1 24 ? 4.650   13.355  1.854   1.00 0.81 ? 24  LYS A HG3  8  
ATOM   9843  H HD2  . LYS A 1 24 ? 2.843   15.543  0.825   1.00 1.14 ? 24  LYS A HD2  8  
ATOM   9844  H HD3  . LYS A 1 24 ? 4.453   15.810  1.498   1.00 0.95 ? 24  LYS A HD3  8  
ATOM   9845  H HE2  . LYS A 1 24 ? 5.070   13.961  -0.322  1.00 1.59 ? 24  LYS A HE2  8  
ATOM   9846  H HE3  . LYS A 1 24 ? 3.643   14.639  -1.104  1.00 1.51 ? 24  LYS A HE3  8  
ATOM   9847  H HZ1  . LYS A 1 24 ? 6.045   16.155  -0.237  1.00 2.09 ? 24  LYS A HZ1  8  
ATOM   9848  H HZ2  . LYS A 1 24 ? 4.663   16.837  -0.935  1.00 2.20 ? 24  LYS A HZ2  8  
ATOM   9849  H HZ3  . LYS A 1 24 ? 5.626   15.775  -1.833  1.00 2.49 ? 24  LYS A HZ3  8  
ATOM   9850  N N    . GLU A 1 25 ? 1.791   9.893   0.212   1.00 0.18 ? 25  GLU A N    8  
ATOM   9851  C CA   . GLU A 1 25 ? 0.771   9.040   -0.388  1.00 0.17 ? 25  GLU A CA   8  
ATOM   9852  C C    . GLU A 1 25 ? 0.494   7.823   0.488   1.00 0.16 ? 25  GLU A C    8  
ATOM   9853  O O    . GLU A 1 25 ? -0.620  7.642   0.983   1.00 0.17 ? 25  GLU A O    8  
ATOM   9854  C CB   . GLU A 1 25 ? 1.211   8.589   -1.783  1.00 0.17 ? 25  GLU A CB   8  
ATOM   9855  C CG   . GLU A 1 25 ? 0.329   9.117   -2.901  1.00 0.19 ? 25  GLU A CG   8  
ATOM   9856  C CD   . GLU A 1 25 ? 0.555   8.395   -4.214  1.00 0.18 ? 25  GLU A CD   8  
ATOM   9857  O OE1  . GLU A 1 25 ? 0.339   9.016   -5.278  1.00 0.26 ? 25  GLU A OE1  8  
ATOM   9858  O OE2  . GLU A 1 25 ? 0.944   7.210   -4.181  1.00 0.21 ? 25  GLU A OE2  8  
ATOM   9859  H H    . GLU A 1 25 ? 2.688   9.913   -0.181  1.00 0.18 ? 25  GLU A H    8  
ATOM   9860  H HA   . GLU A 1 25 ? -0.136  9.619   -0.477  1.00 0.17 ? 25  GLU A HA   8  
ATOM   9861  H HB2  . GLU A 1 25 ? 2.221   8.930   -1.958  1.00 0.19 ? 25  GLU A HB2  8  
ATOM   9862  H HB3  . GLU A 1 25 ? 1.193   7.509   -1.821  1.00 0.18 ? 25  GLU A HB3  8  
ATOM   9863  H HG2  . GLU A 1 25 ? -0.705  8.997   -2.615  1.00 0.23 ? 25  GLU A HG2  8  
ATOM   9864  H HG3  . GLU A 1 25 ? 0.541   10.167  -3.044  1.00 0.23 ? 25  GLU A HG3  8  
ATOM   9865  N N    . ILE A 1 26 ? 1.512   6.992   0.676   1.00 0.16 ? 26  ILE A N    8  
ATOM   9866  C CA   . ILE A 1 26 ? 1.377   5.791   1.493   1.00 0.15 ? 26  ILE A CA   8  
ATOM   9867  C C    . ILE A 1 26 ? 0.791   6.122   2.862   1.00 0.15 ? 26  ILE A C    8  
ATOM   9868  O O    . ILE A 1 26 ? -0.129  5.453   3.331   1.00 0.14 ? 26  ILE A O    8  
ATOM   9869  C CB   . ILE A 1 26 ? 2.735   5.088   1.686   1.00 0.16 ? 26  ILE A CB   8  
ATOM   9870  C CG1  . ILE A 1 26 ? 3.315   4.673   0.332   1.00 0.16 ? 26  ILE A CG1  8  
ATOM   9871  C CG2  . ILE A 1 26 ? 2.579   3.879   2.595   1.00 0.15 ? 26  ILE A CG2  8  
ATOM   9872  C CD1  . ILE A 1 26 ? 4.654   3.977   0.438   1.00 0.17 ? 26  ILE A CD1  8  
ATOM   9873  H H    . ILE A 1 26 ? 2.376   7.190   0.256   1.00 0.17 ? 26  ILE A H    8  
ATOM   9874  H HA   . ILE A 1 26 ? 0.712   5.112   0.981   1.00 0.14 ? 26  ILE A HA   8  
ATOM   9875  H HB   . ILE A 1 26 ? 3.411   5.781   2.162   1.00 0.17 ? 26  ILE A HB   8  
ATOM   9876  H HG12 . ILE A 1 26 ? 2.627   3.998   -0.154  1.00 0.15 ? 26  ILE A HG12 8  
ATOM   9877  H HG13 . ILE A 1 26 ? 3.445   5.552   -0.281  1.00 0.16 ? 26  ILE A HG13 8  
ATOM   9878  H HG21 . ILE A 1 26 ? 2.253   4.203   3.572   1.00 0.15 ? 26  ILE A HG21 8  
ATOM   9879  H HG22 . ILE A 1 26 ? 3.527   3.369   2.682   1.00 0.16 ? 26  ILE A HG22 8  
ATOM   9880  H HG23 . ILE A 1 26 ? 1.845   3.206   2.176   1.00 0.14 ? 26  ILE A HG23 8  
ATOM   9881  H HD11 . ILE A 1 26 ? 4.555   3.100   1.062   1.00 0.16 ? 26  ILE A HD11 8  
ATOM   9882  H HD12 . ILE A 1 26 ? 5.376   4.649   0.874   1.00 0.19 ? 26  ILE A HD12 8  
ATOM   9883  H HD13 . ILE A 1 26 ? 4.984   3.681   -0.546  1.00 0.17 ? 26  ILE A HD13 8  
ATOM   9884  N N    . GLY A 1 27 ? 1.327   7.160   3.495   1.00 0.16 ? 27  GLY A N    8  
ATOM   9885  C CA   . GLY A 1 27 ? 0.842   7.563   4.803   1.00 0.16 ? 27  GLY A CA   8  
ATOM   9886  C C    . GLY A 1 27 ? -0.662  7.758   4.828   1.00 0.15 ? 27  GLY A C    8  
ATOM   9887  O O    . GLY A 1 27 ? -1.328  7.367   5.786   1.00 0.15 ? 27  GLY A O    8  
ATOM   9888  H H    . GLY A 1 27 ? 2.058   7.658   3.071   1.00 0.17 ? 27  GLY A H    8  
ATOM   9889  H HA2  . GLY A 1 27 ? 1.108   6.802   5.522   1.00 0.16 ? 27  GLY A HA2  8  
ATOM   9890  H HA3  . GLY A 1 27 ? 1.320   8.490   5.082   1.00 0.17 ? 27  GLY A HA3  8  
ATOM   9891  N N    . ALA A 1 28 ? -1.196  8.365   3.774   1.00 0.15 ? 28  ALA A N    8  
ATOM   9892  C CA   . ALA A 1 28 ? -2.628  8.611   3.680   1.00 0.14 ? 28  ALA A CA   8  
ATOM   9893  C C    . ALA A 1 28 ? -3.390  7.320   3.401   1.00 0.13 ? 28  ALA A C    8  
ATOM   9894  O O    . ALA A 1 28 ? -4.444  7.070   3.985   1.00 0.12 ? 28  ALA A O    8  
ATOM   9895  C CB   . ALA A 1 28 ? -2.918  9.640   2.597   1.00 0.15 ? 28  ALA A CB   8  
ATOM   9896  H H    . ALA A 1 28 ? -0.612  8.652   3.042   1.00 0.16 ? 28  ALA A H    8  
ATOM   9897  H HA   . ALA A 1 28 ? -2.961  9.014   4.626   1.00 0.15 ? 28  ALA A HA   8  
ATOM   9898  H HB1  . ALA A 1 28 ? -3.978  9.852   2.575   1.00 0.14 ? 28  ALA A HB1  8  
ATOM   9899  H HB2  . ALA A 1 28 ? -2.609  9.252   1.638   1.00 0.14 ? 28  ALA A HB2  8  
ATOM   9900  H HB3  . ALA A 1 28 ? -2.375  10.549  2.810   1.00 0.16 ? 28  ALA A HB3  8  
ATOM   9901  N N    . MET A 1 29 ? -2.851  6.503   2.502   1.00 0.13 ? 29  MET A N    8  
ATOM   9902  C CA   . MET A 1 29 ? -3.479  5.237   2.146   1.00 0.11 ? 29  MET A CA   8  
ATOM   9903  C C    . MET A 1 29 ? -3.581  4.320   3.359   1.00 0.11 ? 29  MET A C    8  
ATOM   9904  O O    . MET A 1 29 ? -4.574  3.614   3.538   1.00 0.10 ? 29  MET A O    8  
ATOM   9905  C CB   . MET A 1 29 ? -2.689  4.544   1.034   1.00 0.11 ? 29  MET A CB   8  
ATOM   9906  C CG   . MET A 1 29 ? -3.303  3.231   0.580   1.00 0.10 ? 29  MET A CG   8  
ATOM   9907  S SD   . MET A 1 29 ? -2.061  2.009   0.110   1.00 0.10 ? 29  MET A SD   8  
ATOM   9908  C CE   . MET A 1 29 ? -1.182  1.811   1.658   1.00 0.11 ? 29  MET A CE   8  
ATOM   9909  H H    . MET A 1 29 ? -2.010  6.758   2.068   1.00 0.13 ? 29  MET A H    8  
ATOM   9910  H HA   . MET A 1 29 ? -4.475  5.451   1.790   1.00 0.11 ? 29  MET A HA   8  
ATOM   9911  H HB2  . MET A 1 29 ? -2.635  5.206   0.182   1.00 0.12 ? 29  MET A HB2  8  
ATOM   9912  H HB3  . MET A 1 29 ? -1.688  4.347   1.388   1.00 0.12 ? 29  MET A HB3  8  
ATOM   9913  H HG2  . MET A 1 29 ? -3.895  2.827   1.387   1.00 0.10 ? 29  MET A HG2  8  
ATOM   9914  H HG3  . MET A 1 29 ? -3.941  3.421   -0.272  1.00 0.10 ? 29  MET A HG3  8  
ATOM   9915  H HE1  . MET A 1 29 ? -0.547  2.669   1.825   1.00 0.12 ? 29  MET A HE1  8  
ATOM   9916  H HE2  . MET A 1 29 ? -0.575  0.918   1.616   1.00 0.11 ? 29  MET A HE2  8  
ATOM   9917  H HE3  . MET A 1 29 ? -1.892  1.727   2.466   1.00 0.11 ? 29  MET A HE3  8  
ATOM   9918  N N    . LEU A 1 30 ? -2.546  4.331   4.194   1.00 0.12 ? 30  LEU A N    8  
ATOM   9919  C CA   . LEU A 1 30 ? -2.517  3.500   5.392   1.00 0.12 ? 30  LEU A CA   8  
ATOM   9920  C C    . LEU A 1 30 ? -3.677  3.847   6.322   1.00 0.12 ? 30  LEU A C    8  
ATOM   9921  O O    . LEU A 1 30 ? -4.440  2.972   6.730   1.00 0.11 ? 30  LEU A O    8  
ATOM   9922  C CB   . LEU A 1 30 ? -1.189  3.676   6.127   1.00 0.13 ? 30  LEU A CB   8  
ATOM   9923  C CG   . LEU A 1 30 ? -0.205  2.510   6.023   1.00 0.13 ? 30  LEU A CG   8  
ATOM   9924  C CD1  . LEU A 1 30 ? 0.170   2.255   4.573   1.00 0.13 ? 30  LEU A CD1  8  
ATOM   9925  C CD2  . LEU A 1 30 ? 1.037   2.783   6.859   1.00 0.15 ? 30  LEU A CD2  8  
ATOM   9926  H H    . LEU A 1 30 ? -1.782  4.914   3.999   1.00 0.13 ? 30  LEU A H    8  
ATOM   9927  H HA   . LEU A 1 30 ? -2.615  2.470   5.084   1.00 0.11 ? 30  LEU A HA   8  
ATOM   9928  H HB2  . LEU A 1 30 ? -0.704  4.559   5.736   1.00 0.14 ? 30  LEU A HB2  8  
ATOM   9929  H HB3  . LEU A 1 30 ? -1.403  3.841   7.172   1.00 0.14 ? 30  LEU A HB3  8  
ATOM   9930  H HG   . LEU A 1 30 ? -0.676  1.616   6.406   1.00 0.13 ? 30  LEU A HG   8  
ATOM   9931  H HD11 . LEU A 1 30 ? 0.454   3.186   4.106   1.00 0.13 ? 30  LEU A HD11 8  
ATOM   9932  H HD12 . LEU A 1 30 ? -0.675  1.832   4.052   1.00 0.12 ? 30  LEU A HD12 8  
ATOM   9933  H HD13 . LEU A 1 30 ? 1.000   1.564   4.532   1.00 0.13 ? 30  LEU A HD13 8  
ATOM   9934  H HD21 . LEU A 1 30 ? 1.709   1.939   6.794   1.00 0.15 ? 30  LEU A HD21 8  
ATOM   9935  H HD22 . LEU A 1 30 ? 0.752   2.937   7.889   1.00 0.16 ? 30  LEU A HD22 8  
ATOM   9936  H HD23 . LEU A 1 30 ? 1.534   3.667   6.487   1.00 0.15 ? 30  LEU A HD23 8  
ATOM   9937  N N    . SER A 1 31 ? -3.801  5.129   6.652   1.00 0.13 ? 31  SER A N    8  
ATOM   9938  C CA   . SER A 1 31 ? -4.866  5.590   7.536   1.00 0.13 ? 31  SER A CA   8  
ATOM   9939  C C    . SER A 1 31 ? -6.227  5.117   7.038   1.00 0.12 ? 31  SER A C    8  
ATOM   9940  O O    . SER A 1 31 ? -7.147  4.893   7.826   1.00 0.12 ? 31  SER A O    8  
ATOM   9941  C CB   . SER A 1 31 ? -4.847  7.117   7.635   1.00 0.14 ? 31  SER A CB   8  
ATOM   9942  O OG   . SER A 1 31 ? -6.104  7.615   8.061   1.00 0.14 ? 31  SER A OG   8  
ATOM   9943  H H    . SER A 1 31 ? -3.163  5.780   6.292   1.00 0.13 ? 31  SER A H    8  
ATOM   9944  H HA   . SER A 1 31 ? -4.688  5.172   8.515   1.00 0.13 ? 31  SER A HA   8  
ATOM   9945  H HB2  . SER A 1 31 ? -4.094  7.421   8.347   1.00 0.15 ? 31  SER A HB2  8  
ATOM   9946  H HB3  . SER A 1 31 ? -4.616  7.535   6.667   1.00 0.14 ? 31  SER A HB3  8  
ATOM   9947  H HG   . SER A 1 31 ? -6.638  6.891   8.396   1.00 0.13 ? 31  SER A HG   8  
ATOM   9948  N N    . LEU A 1 32 ? -6.351  4.971   5.723   1.00 0.11 ? 32  LEU A N    8  
ATOM   9949  C CA   . LEU A 1 32 ? -7.602  4.525   5.117   1.00 0.10 ? 32  LEU A CA   8  
ATOM   9950  C C    . LEU A 1 32 ? -7.758  3.012   5.240   1.00 0.09 ? 32  LEU A C    8  
ATOM   9951  O O    . LEU A 1 32 ? -8.866  2.503   5.407   1.00 0.09 ? 32  LEU A O    8  
ATOM   9952  C CB   . LEU A 1 32 ? -7.652  4.937   3.646   1.00 0.10 ? 32  LEU A CB   8  
ATOM   9953  C CG   . LEU A 1 32 ? -8.944  4.600   2.898   1.00 0.09 ? 32  LEU A CG   8  
ATOM   9954  C CD1  . LEU A 1 32 ? -8.943  3.144   2.461   1.00 0.08 ? 32  LEU A CD1  8  
ATOM   9955  C CD2  . LEU A 1 32 ? -10.156 4.897   3.769   1.00 0.09 ? 32  LEU A CD2  8  
ATOM   9956  H H    . LEU A 1 32 ? -5.583  5.166   5.146   1.00 0.11 ? 32  LEU A H    8  
ATOM   9957  H HA   . LEU A 1 32 ? -8.411  5.005   5.644   1.00 0.10 ? 32  LEU A HA   8  
ATOM   9958  H HB2  . LEU A 1 32 ? -7.503  6.005   3.591   1.00 0.10 ? 32  LEU A HB2  8  
ATOM   9959  H HB3  . LEU A 1 32 ? -6.834  4.452   3.134   1.00 0.09 ? 32  LEU A HB3  8  
ATOM   9960  H HG   . LEU A 1 32 ? -9.010  5.214   2.012   1.00 0.09 ? 32  LEU A HG   8  
ATOM   9961  H HD11 . LEU A 1 32 ? -8.088  2.959   1.828   1.00 0.08 ? 32  LEU A HD11 8  
ATOM   9962  H HD12 . LEU A 1 32 ? -9.849  2.933   1.912   1.00 0.08 ? 32  LEU A HD12 8  
ATOM   9963  H HD13 . LEU A 1 32 ? -8.892  2.506   3.331   1.00 0.08 ? 32  LEU A HD13 8  
ATOM   9964  H HD21 . LEU A 1 32 ? -11.057 4.629   3.236   1.00 0.09 ? 32  LEU A HD21 8  
ATOM   9965  H HD22 . LEU A 1 32 ? -10.178 5.949   4.006   1.00 0.10 ? 32  LEU A HD22 8  
ATOM   9966  H HD23 . LEU A 1 32 ? -10.094 4.323   4.680   1.00 0.09 ? 32  LEU A HD23 8  
ATOM   9967  N N    . LEU A 1 33 ? -6.640  2.299   5.160   1.00 0.09 ? 33  LEU A N    8  
ATOM   9968  C CA   . LEU A 1 33 ? -6.651  0.846   5.263   1.00 0.08 ? 33  LEU A CA   8  
ATOM   9969  C C    . LEU A 1 33 ? -6.878  0.404   6.706   1.00 0.09 ? 33  LEU A C    8  
ATOM   9970  O O    . LEU A 1 33 ? -7.057  -0.783  6.980   1.00 0.09 ? 33  LEU A O    8  
ATOM   9971  C CB   . LEU A 1 33 ? -5.334  0.265   4.742   1.00 0.08 ? 33  LEU A CB   8  
ATOM   9972  C CG   . LEU A 1 33 ? -5.330  -0.178  3.278   1.00 0.08 ? 33  LEU A CG   8  
ATOM   9973  C CD1  . LEU A 1 33 ? -3.936  -0.626  2.862   1.00 0.08 ? 33  LEU A CD1  8  
ATOM   9974  C CD2  . LEU A 1 33 ? -6.340  -1.293  3.054   1.00 0.07 ? 33  LEU A CD2  8  
ATOM   9975  H H    . LEU A 1 33 ? -5.786  2.763   5.027   1.00 0.10 ? 33  LEU A H    8  
ATOM   9976  H HA   . LEU A 1 33 ? -7.464  0.478   4.657   1.00 0.08 ? 33  LEU A HA   8  
ATOM   9977  H HB2  . LEU A 1 33 ? -4.565  1.014   4.869   1.00 0.09 ? 33  LEU A HB2  8  
ATOM   9978  H HB3  . LEU A 1 33 ? -5.081  -0.588  5.351   1.00 0.09 ? 33  LEU A HB3  8  
ATOM   9979  H HG   . LEU A 1 33 ? -5.610  0.659   2.654   1.00 0.08 ? 33  LEU A HG   8  
ATOM   9980  H HD11 . LEU A 1 33 ? -3.985  -1.098  1.891   1.00 0.09 ? 33  LEU A HD11 8  
ATOM   9981  H HD12 . LEU A 1 33 ? -3.553  -1.329  3.584   1.00 0.10 ? 33  LEU A HD12 8  
ATOM   9982  H HD13 . LEU A 1 33 ? -3.283  0.231   2.811   1.00 0.10 ? 33  LEU A HD13 8  
ATOM   9983  H HD21 . LEU A 1 33 ? -5.934  -2.226  3.417   1.00 0.07 ? 33  LEU A HD21 8  
ATOM   9984  H HD22 . LEU A 1 33 ? -6.554  -1.375  2.000   1.00 0.06 ? 33  LEU A HD22 8  
ATOM   9985  H HD23 . LEU A 1 33 ? -7.251  -1.068  3.587   1.00 0.07 ? 33  LEU A HD23 8  
ATOM   9986  N N    . GLN A 1 34 ? -6.871  1.366   7.622   1.00 0.10 ? 34  GLN A N    8  
ATOM   9987  C CA   . GLN A 1 34 ? -7.078  1.077   9.036   1.00 0.11 ? 34  GLN A CA   8  
ATOM   9988  C C    . GLN A 1 34 ? -8.480  1.485   9.476   1.00 0.11 ? 34  GLN A C    8  
ATOM   9989  O O    . GLN A 1 34 ? -9.056  0.886   10.385  1.00 0.12 ? 34  GLN A O    8  
ATOM   9990  C CB   . GLN A 1 34 ? -6.032  1.804   9.884   1.00 0.12 ? 34  GLN A CB   8  
ATOM   9991  C CG   . GLN A 1 34 ? -4.599  1.511   9.468   1.00 0.13 ? 34  GLN A CG   8  
ATOM   9992  C CD   . GLN A 1 34 ? -3.696  1.224   10.651  1.00 0.14 ? 34  GLN A CD   8  
ATOM   9993  O OE1  . GLN A 1 34 ? -3.839  1.823   11.717  1.00 0.15 ? 34  GLN A OE1  8  
ATOM   9994  N NE2  . GLN A 1 34 ? -2.758  0.302   10.469  1.00 0.14 ? 34  GLN A NE2  8  
ATOM   9995  H H    . GLN A 1 34 ? -6.722  2.293   7.340   1.00 0.10 ? 34  GLN A H    8  
ATOM   9996  H HA   . GLN A 1 34 ? -6.965  0.013   9.176   1.00 0.11 ? 34  GLN A HA   8  
ATOM   9997  H HB2  . GLN A 1 34 ? -6.197  2.869   9.805   1.00 0.13 ? 34  GLN A HB2  8  
ATOM   9998  H HB3  . GLN A 1 34 ? -6.152  1.506   10.916  1.00 0.13 ? 34  GLN A HB3  8  
ATOM   9999  H HG2  . GLN A 1 34 ? -4.597  0.649   8.816   1.00 0.12 ? 34  GLN A HG2  8  
ATOM   10000 H HG3  . GLN A 1 34 ? -4.210  2.366   8.935   1.00 0.13 ? 34  GLN A HG3  8  
ATOM   10001 H HE21 . GLN A 1 34 ? -2.702  -0.136  9.594   1.00 0.13 ? 34  GLN A HE21 8  
ATOM   10002 H HE22 . GLN A 1 34 ? -2.162  0.096   11.219  1.00 0.15 ? 34  GLN A HE22 8  
ATOM   10003 N N    . LYS A 1 35 ? -9.024  2.508   8.827   1.00 0.11 ? 35  LYS A N    8  
ATOM   10004 C CA   . LYS A 1 35 ? -10.360 2.995   9.148   1.00 0.11 ? 35  LYS A CA   8  
ATOM   10005 C C    . LYS A 1 35 ? -11.430 2.096   8.537   1.00 0.11 ? 35  LYS A C    8  
ATOM   10006 O O    . LYS A 1 35 ? -12.480 1.870   9.138   1.00 0.11 ? 35  LYS A O    8  
ATOM   10007 C CB   . LYS A 1 35 ? -10.536 4.429   8.646   1.00 0.12 ? 35  LYS A CB   8  
ATOM   10008 C CG   . LYS A 1 35 ? -10.754 4.526   7.146   1.00 0.11 ? 35  LYS A CG   8  
ATOM   10009 C CD   . LYS A 1 35 ? -10.958 5.967   6.705   1.00 0.11 ? 35  LYS A CD   8  
ATOM   10010 C CE   . LYS A 1 35 ? -12.290 6.149   5.995   1.00 0.11 ? 35  LYS A CE   8  
ATOM   10011 N NZ   . LYS A 1 35 ? -12.949 7.430   6.373   1.00 0.12 ? 35  LYS A NZ   8  
ATOM   10012 H H    . LYS A 1 35 ? -8.514  2.946   8.113   1.00 0.11 ? 35  LYS A H    8  
ATOM   10013 H HA   . LYS A 1 35 ? -10.467 2.983   10.222  1.00 0.12 ? 35  LYS A HA   8  
ATOM   10014 H HB2  . LYS A 1 35 ? -11.389 4.870   9.141   1.00 0.12 ? 35  LYS A HB2  8  
ATOM   10015 H HB3  . LYS A 1 35 ? -9.652  4.997   8.897   1.00 0.12 ? 35  LYS A HB3  8  
ATOM   10016 H HG2  . LYS A 1 35 ? -9.890  4.122   6.643   1.00 0.10 ? 35  LYS A HG2  8  
ATOM   10017 H HG3  . LYS A 1 35 ? -11.628 3.949   6.883   1.00 0.10 ? 35  LYS A HG3  8  
ATOM   10018 H HD2  . LYS A 1 35 ? -10.935 6.606   7.574   1.00 0.12 ? 35  LYS A HD2  8  
ATOM   10019 H HD3  . LYS A 1 35 ? -10.159 6.244   6.032   1.00 0.11 ? 35  LYS A HD3  8  
ATOM   10020 H HE2  . LYS A 1 35 ? -12.121 6.144   4.928   1.00 0.11 ? 35  LYS A HE2  8  
ATOM   10021 H HE3  . LYS A 1 35 ? -12.941 5.329   6.260   1.00 0.11 ? 35  LYS A HE3  8  
ATOM   10022 H HZ1  . LYS A 1 35 ? -13.126 7.451   7.398   1.00 0.13 ? 35  LYS A HZ1  8  
ATOM   10023 H HZ2  . LYS A 1 35 ? -13.854 7.527   5.874   1.00 0.12 ? 35  LYS A HZ2  8  
ATOM   10024 H HZ3  . LYS A 1 35 ? -12.338 8.234   6.121   1.00 0.12 ? 35  LYS A HZ3  8  
ATOM   10025 N N    . GLU A 1 36 ? -11.155 1.587   7.340   1.00 0.10 ? 36  GLU A N    8  
ATOM   10026 C CA   . GLU A 1 36 ? -12.096 0.712   6.649   1.00 0.09 ? 36  GLU A CA   8  
ATOM   10027 C C    . GLU A 1 36 ? -12.160 -0.657  7.320   1.00 0.09 ? 36  GLU A C    8  
ATOM   10028 O O    . GLU A 1 36 ? -13.018 -1.478  7.000   1.00 0.09 ? 36  GLU A O    8  
ATOM   10029 C CB   . GLU A 1 36 ? -11.693 0.554   5.181   1.00 0.08 ? 36  GLU A CB   8  
ATOM   10030 C CG   . GLU A 1 36 ? -11.703 1.859   4.404   1.00 0.08 ? 36  GLU A CG   8  
ATOM   10031 C CD   . GLU A 1 36 ? -13.100 2.407   4.199   1.00 0.09 ? 36  GLU A CD   8  
ATOM   10032 O OE1  . GLU A 1 36 ? -13.230 3.479   3.571   1.00 0.09 ? 36  GLU A OE1  8  
ATOM   10033 O OE2  . GLU A 1 36 ? -14.064 1.767   4.665   1.00 0.09 ? 36  GLU A OE2  8  
ATOM   10034 H H    . GLU A 1 36 ? -10.301 1.806   6.912   1.00 0.09 ? 36  GLU A H    8  
ATOM   10035 H HA   . GLU A 1 36 ? -13.073 1.170   6.698   1.00 0.10 ? 36  GLU A HA   8  
ATOM   10036 H HB2  . GLU A 1 36 ? -10.697 0.139   5.136   1.00 0.08 ? 36  GLU A HB2  8  
ATOM   10037 H HB3  . GLU A 1 36 ? -12.380 -0.129  4.703   1.00 0.08 ? 36  GLU A HB3  8  
ATOM   10038 H HG2  . GLU A 1 36 ? -11.123 2.589   4.947   1.00 0.09 ? 36  GLU A HG2  8  
ATOM   10039 H HG3  . GLU A 1 36 ? -11.252 1.691   3.437   1.00 0.08 ? 36  GLU A HG3  8  
ATOM   10040 N N    . GLY A 1 37 ? -11.245 -0.893  8.256   1.00 0.10 ? 37  GLY A N    8  
ATOM   10041 C CA   . GLY A 1 37 ? -11.215 -2.164  8.958   1.00 0.10 ? 37  GLY A CA   8  
ATOM   10042 C C    . GLY A 1 37 ? -10.504 -3.245  8.170   1.00 0.09 ? 37  GLY A C    8  
ATOM   10043 O O    . GLY A 1 37 ? -10.489 -4.410  8.573   1.00 0.10 ? 37  GLY A O    8  
ATOM   10044 H H    . GLY A 1 37 ? -10.588 -0.200  8.473   1.00 0.10 ? 37  GLY A H    8  
ATOM   10045 H HA2  . GLY A 1 37 ? -10.708 -2.029  9.902   1.00 0.11 ? 37  GLY A HA2  8  
ATOM   10046 H HA3  . GLY A 1 37 ? -12.229 -2.482  9.150   1.00 0.11 ? 37  GLY A HA3  8  
ATOM   10047 N N    . LEU A 1 38 ? -9.912  -2.862  7.043   1.00 0.08 ? 38  LEU A N    8  
ATOM   10048 C CA   . LEU A 1 38 ? -9.195  -3.809  6.196   1.00 0.08 ? 38  LEU A CA   8  
ATOM   10049 C C    . LEU A 1 38 ? -7.876  -4.225  6.837   1.00 0.08 ? 38  LEU A C    8  
ATOM   10050 O O    . LEU A 1 38 ? -7.328  -5.283  6.527   1.00 0.08 ? 38  LEU A O    8  
ATOM   10051 C CB   . LEU A 1 38 ? -8.936  -3.194  4.819   1.00 0.07 ? 38  LEU A CB   8  
ATOM   10052 C CG   . LEU A 1 38 ? -10.165 -2.976  3.938   1.00 0.06 ? 38  LEU A CG   8  
ATOM   10053 C CD1  . LEU A 1 38 ? -9.879  -1.934  2.867   1.00 0.06 ? 38  LEU A CD1  8  
ATOM   10054 C CD2  . LEU A 1 38 ? -10.606 -4.288  3.303   1.00 0.06 ? 38  LEU A CD2  8  
ATOM   10055 H H    . LEU A 1 38 ? -9.959  -1.920  6.775   1.00 0.08 ? 38  LEU A H    8  
ATOM   10056 H HA   . LEU A 1 38 ? -9.816  -4.684  6.078   1.00 0.08 ? 38  LEU A HA   8  
ATOM   10057 H HB2  . LEU A 1 38 ? -8.454  -2.238  4.965   1.00 0.07 ? 38  LEU A HB2  8  
ATOM   10058 H HB3  . LEU A 1 38 ? -8.253  -3.840  4.288   1.00 0.06 ? 38  LEU A HB3  8  
ATOM   10059 H HG   . LEU A 1 38 ? -10.977 -2.610  4.550   1.00 0.07 ? 38  LEU A HG   8  
ATOM   10060 H HD11 . LEU A 1 38 ? -9.633  -0.993  3.337   1.00 0.06 ? 38  LEU A HD11 8  
ATOM   10061 H HD12 . LEU A 1 38 ? -10.753 -1.809  2.245   1.00 0.06 ? 38  LEU A HD12 8  
ATOM   10062 H HD13 . LEU A 1 38 ? -9.048  -2.262  2.261   1.00 0.05 ? 38  LEU A HD13 8  
ATOM   10063 H HD21 . LEU A 1 38 ? -9.795  -4.697  2.721   1.00 0.06 ? 38  LEU A HD21 8  
ATOM   10064 H HD22 . LEU A 1 38 ? -11.455 -4.108  2.660   1.00 0.06 ? 38  LEU A HD22 8  
ATOM   10065 H HD23 . LEU A 1 38 ? -10.883 -4.988  4.078   1.00 0.07 ? 38  LEU A HD23 8  
ATOM   10066 N N    . LEU A 1 39 ? -7.371  -3.385  7.735   1.00 0.09 ? 39  LEU A N    8  
ATOM   10067 C CA   . LEU A 1 39 ? -6.115  -3.667  8.424   1.00 0.10 ? 39  LEU A CA   8  
ATOM   10068 C C    . LEU A 1 39 ? -6.171  -3.192  9.872   1.00 0.11 ? 39  LEU A C    8  
ATOM   10069 O O    . LEU A 1 39 ? -6.848  -2.214  10.190  1.00 0.11 ? 39  LEU A O    8  
ATOM   10070 C CB   . LEU A 1 39 ? -4.950  -2.990  7.698   1.00 0.10 ? 39  LEU A CB   8  
ATOM   10071 C CG   . LEU A 1 39 ? -4.641  -3.513  6.295   1.00 0.09 ? 39  LEU A CG   8  
ATOM   10072 C CD1  . LEU A 1 39 ? -3.442  -2.784  5.707   1.00 0.09 ? 39  LEU A CD1  8  
ATOM   10073 C CD2  . LEU A 1 39 ? -4.394  -5.013  6.326   1.00 0.09 ? 39  LEU A CD2  8  
ATOM   10074 H H    . LEU A 1 39 ? -7.854  -2.557  7.940   1.00 0.09 ? 39  LEU A H    8  
ATOM   10075 H HA   . LEU A 1 39 ? -5.964  -4.736  8.413   1.00 0.10 ? 39  LEU A HA   8  
ATOM   10076 H HB2  . LEU A 1 39 ? -5.169  -1.936  7.623   1.00 0.10 ? 39  LEU A HB2  8  
ATOM   10077 H HB3  . LEU A 1 39 ? -4.063  -3.112  8.303   1.00 0.11 ? 39  LEU A HB3  8  
ATOM   10078 H HG   . LEU A 1 39 ? -5.491  -3.327  5.653   1.00 0.08 ? 39  LEU A HG   8  
ATOM   10079 H HD11 . LEU A 1 39 ? -3.353  -3.027  4.659   1.00 0.08 ? 39  LEU A HD11 8  
ATOM   10080 H HD12 . LEU A 1 39 ? -2.546  -3.093  6.225   1.00 0.10 ? 39  LEU A HD12 8  
ATOM   10081 H HD13 . LEU A 1 39 ? -3.573  -1.720  5.821   1.00 0.09 ? 39  LEU A HD13 8  
ATOM   10082 H HD21 . LEU A 1 39 ? -3.735  -5.287  5.515   1.00 0.08 ? 39  LEU A HD21 8  
ATOM   10083 H HD22 . LEU A 1 39 ? -5.334  -5.534  6.218   1.00 0.08 ? 39  LEU A HD22 8  
ATOM   10084 H HD23 . LEU A 1 39 ? -3.940  -5.284  7.267   1.00 0.10 ? 39  LEU A HD23 8  
ATOM   10085 N N    . MET A 1 40 ? -5.454  -3.890  10.746  1.00 0.12 ? 40  MET A N    8  
ATOM   10086 C CA   . MET A 1 40 ? -5.419  -3.539  12.161  1.00 0.14 ? 40  MET A CA   8  
ATOM   10087 C C    . MET A 1 40 ? -4.123  -2.813  12.509  1.00 0.14 ? 40  MET A C    8  
ATOM   10088 O O    . MET A 1 40 ? -4.056  -2.083  13.498  1.00 0.15 ? 40  MET A O    8  
ATOM   10089 C CB   . MET A 1 40 ? -5.562  -4.793  13.025  1.00 0.14 ? 40  MET A CB   8  
ATOM   10090 C CG   . MET A 1 40 ? -5.895  -4.496  14.478  1.00 0.16 ? 40  MET A CG   8  
ATOM   10091 S SD   . MET A 1 40 ? -5.219  -5.725  15.611  1.00 0.17 ? 40  MET A SD   8  
ATOM   10092 C CE   . MET A 1 40 ? -3.476  -5.315  15.553  1.00 0.17 ? 40  MET A CE   8  
ATOM   10093 H H    . MET A 1 40 ? -4.937  -4.661  10.432  1.00 0.12 ? 40  MET A H    8  
ATOM   10094 H HA   . MET A 1 40 ? -6.251  -2.880  12.359  1.00 0.14 ? 40  MET A HA   8  
ATOM   10095 H HB2  . MET A 1 40 ? -6.349  -5.409  12.616  1.00 0.14 ? 40  MET A HB2  8  
ATOM   10096 H HB3  . MET A 1 40 ? -4.634  -5.343  12.996  1.00 0.14 ? 40  MET A HB3  8  
ATOM   10097 H HG2  . MET A 1 40 ? -5.490  -3.529  14.736  1.00 0.16 ? 40  MET A HG2  8  
ATOM   10098 H HG3  . MET A 1 40 ? -6.970  -4.476  14.591  1.00 0.15 ? 40  MET A HG3  8  
ATOM   10099 H HE1  . MET A 1 40 ? -3.339  -4.283  15.840  1.00 0.18 ? 40  MET A HE1  8  
ATOM   10100 H HE2  . MET A 1 40 ? -3.104  -5.462  14.550  1.00 0.17 ? 40  MET A HE2  8  
ATOM   10101 H HE3  . MET A 1 40 ? -2.933  -5.952  16.235  1.00 0.18 ? 40  MET A HE3  8  
ATOM   10102 N N    . SER A 1 41 ? -3.096  -3.019  11.689  1.00 0.14 ? 41  SER A N    8  
ATOM   10103 C CA   . SER A 1 41 ? -1.802  -2.387  11.913  1.00 0.15 ? 41  SER A CA   8  
ATOM   10104 C C    . SER A 1 41 ? -1.084  -2.137  10.591  1.00 0.14 ? 41  SER A C    8  
ATOM   10105 O O    . SER A 1 41 ? -1.392  -2.740  9.563   1.00 0.13 ? 41  SER A O    8  
ATOM   10106 C CB   . SER A 1 41 ? -0.934  -3.262  12.819  1.00 0.16 ? 41  SER A CB   8  
ATOM   10107 O OG   . SER A 1 41 ? -1.474  -4.567  12.939  1.00 0.16 ? 41  SER A OG   8  
ATOM   10108 H H    . SER A 1 41 ? -3.211  -3.612  10.917  1.00 0.13 ? 41  SER A H    8  
ATOM   10109 H HA   . SER A 1 41 ? -1.975  -1.439  12.401  1.00 0.15 ? 41  SER A HA   8  
ATOM   10110 H HB2  . SER A 1 41 ? 0.060   -3.335  12.402  1.00 0.16 ? 41  SER A HB2  8  
ATOM   10111 H HB3  . SER A 1 41 ? -0.879  -2.816  13.802  1.00 0.17 ? 41  SER A HB3  8  
ATOM   10112 H HG   . SER A 1 41 ? -1.232  -4.936  13.792  1.00 0.17 ? 41  SER A HG   8  
ATOM   10113 N N    . PRO A 1 42 ? -0.102  -1.223  10.616  1.00 0.15 ? 42  PRO A N    8  
ATOM   10114 C CA   . PRO A 1 42 ? 0.681   -0.870  9.429   1.00 0.15 ? 42  PRO A CA   8  
ATOM   10115 C C    . PRO A 1 42 ? 1.608   -1.999  8.988   1.00 0.15 ? 42  PRO A C    8  
ATOM   10116 O O    . PRO A 1 42 ? 2.114   -1.997  7.867   1.00 0.15 ? 42  PRO A O    8  
ATOM   10117 C CB   . PRO A 1 42 ? 1.496   0.342   9.887   1.00 0.16 ? 42  PRO A CB   8  
ATOM   10118 C CG   . PRO A 1 42 ? 1.599   0.191   11.366  1.00 0.17 ? 42  PRO A CG   8  
ATOM   10119 C CD   . PRO A 1 42 ? 0.320   -0.465  11.806  1.00 0.17 ? 42  PRO A CD   8  
ATOM   10120 H HA   . PRO A 1 42 ? 0.043   -0.588  8.604   1.00 0.14 ? 42  PRO A HA   8  
ATOM   10121 H HB2  . PRO A 1 42 ? 2.474   0.328   9.423   1.00 0.17 ? 42  PRO A HB2  8  
ATOM   10122 H HB3  . PRO A 1 42 ? 0.976   1.255   9.643   1.00 0.16 ? 42  PRO A HB3  8  
ATOM   10123 H HG2  . PRO A 1 42 ? 2.449   -0.432  11.611  1.00 0.18 ? 42  PRO A HG2  8  
ATOM   10124 H HG3  . PRO A 1 42 ? 1.696   1.160   11.830  1.00 0.18 ? 42  PRO A HG3  8  
ATOM   10125 H HD2  . PRO A 1 42 ? 0.502   -1.126  12.640  1.00 0.17 ? 42  PRO A HD2  8  
ATOM   10126 H HD3  . PRO A 1 42 ? -0.416  0.282   12.068  1.00 0.16 ? 42  PRO A HD3  8  
ATOM   10127 N N    . SER A 1 43 ? 1.826   -2.960  9.880   1.00 0.16 ? 43  SER A N    8  
ATOM   10128 C CA   . SER A 1 43 ? 2.695   -4.093  9.586   1.00 0.16 ? 43  SER A CA   8  
ATOM   10129 C C    . SER A 1 43 ? 1.919   -5.204  8.885   1.00 0.15 ? 43  SER A C    8  
ATOM   10130 O O    . SER A 1 43 ? 2.496   -6.208  8.463   1.00 0.15 ? 43  SER A O    8  
ATOM   10131 C CB   . SER A 1 43 ? 3.325   -4.628  10.872  1.00 0.17 ? 43  SER A CB   8  
ATOM   10132 O OG   . SER A 1 43 ? 2.334   -4.931  11.838  1.00 0.17 ? 43  SER A OG   8  
ATOM   10133 H H    . SER A 1 43 ? 1.392   -2.906  10.758  1.00 0.16 ? 43  SER A H    8  
ATOM   10134 H HA   . SER A 1 43 ? 3.479   -3.747  8.927   1.00 0.16 ? 43  SER A HA   8  
ATOM   10135 H HB2  . SER A 1 43 ? 3.882   -5.528  10.651  1.00 0.17 ? 43  SER A HB2  8  
ATOM   10136 H HB3  . SER A 1 43 ? 3.994   -3.884  11.280  1.00 0.18 ? 43  SER A HB3  8  
ATOM   10137 H HG   . SER A 1 43 ? 2.337   -5.874  12.015  1.00 0.17 ? 43  SER A HG   8  
ATOM   10138 N N    . ASP A 1 44 ? 0.610   -5.019  8.765   1.00 0.14 ? 44  ASP A N    8  
ATOM   10139 C CA   . ASP A 1 44 ? -0.247  -6.005  8.115   1.00 0.12 ? 44  ASP A CA   8  
ATOM   10140 C C    . ASP A 1 44 ? 0.134   -6.171  6.649   1.00 0.12 ? 44  ASP A C    8  
ATOM   10141 O O    . ASP A 1 44 ? -0.246  -7.151  6.003   1.00 0.11 ? 44  ASP A O    8  
ATOM   10142 C CB   . ASP A 1 44 ? -1.715  -5.592  8.231   1.00 0.12 ? 44  ASP A CB   8  
ATOM   10143 C CG   . ASP A 1 44 ? -2.639  -6.780  8.400   1.00 0.11 ? 44  ASP A CG   8  
ATOM   10144 O OD1  . ASP A 1 44 ? -2.386  -7.824  7.761   1.00 0.11 ? 44  ASP A OD1  8  
ATOM   10145 O OD2  . ASP A 1 44 ? -3.616  -6.669  9.168   1.00 0.11 ? 44  ASP A OD2  8  
ATOM   10146 H H    . ASP A 1 44 ? 0.209   -4.199  9.122   1.00 0.14 ? 44  ASP A H    8  
ATOM   10147 H HA   . ASP A 1 44 ? -0.106  -6.948  8.621   1.00 0.13 ? 44  ASP A HA   8  
ATOM   10148 H HB2  . ASP A 1 44 ? -1.834  -4.943  9.086   1.00 0.12 ? 44  ASP A HB2  8  
ATOM   10149 H HB3  . ASP A 1 44 ? -2.001  -5.058  7.337   1.00 0.11 ? 44  ASP A HB3  8  
ATOM   10150 N N    . LEU A 1 45 ? 0.885   -5.209  6.123   1.00 0.12 ? 45  LEU A N    8  
ATOM   10151 C CA   . LEU A 1 45 ? 1.316   -5.247  4.731   1.00 0.12 ? 45  LEU A CA   8  
ATOM   10152 C C    . LEU A 1 45 ? 2.213   -6.455  4.471   1.00 0.12 ? 45  LEU A C    8  
ATOM   10153 O O    . LEU A 1 45 ? 2.429   -6.844  3.324   1.00 0.12 ? 45  LEU A O    8  
ATOM   10154 C CB   . LEU A 1 45 ? 2.058   -3.960  4.369   1.00 0.12 ? 45  LEU A CB   8  
ATOM   10155 C CG   . LEU A 1 45 ? 1.419   -3.101  3.278   1.00 0.12 ? 45  LEU A CG   8  
ATOM   10156 C CD1  . LEU A 1 45 ? 1.672   -3.706  1.906   1.00 0.11 ? 45  LEU A CD1  8  
ATOM   10157 C CD2  . LEU A 1 45 ? -0.074  -2.945  3.527   1.00 0.10 ? 45  LEU A CD2  8  
ATOM   10158 H H    . LEU A 1 45 ? 1.156   -4.454  6.686   1.00 0.13 ? 45  LEU A H    8  
ATOM   10159 H HA   . LEU A 1 45 ? 0.434   -5.330  4.113   1.00 0.11 ? 45  LEU A HA   8  
ATOM   10160 H HB2  . LEU A 1 45 ? 2.142   -3.359  5.263   1.00 0.13 ? 45  LEU A HB2  8  
ATOM   10161 H HB3  . LEU A 1 45 ? 3.053   -4.227  4.046   1.00 0.13 ? 45  LEU A HB3  8  
ATOM   10162 H HG   . LEU A 1 45 ? 1.866   -2.118  3.296   1.00 0.12 ? 45  LEU A HG   8  
ATOM   10163 H HD11 . LEU A 1 45 ? 2.715   -3.596  1.651   1.00 0.12 ? 45  LEU A HD11 8  
ATOM   10164 H HD12 . LEU A 1 45 ? 1.068   -3.198  1.170   1.00 0.11 ? 45  LEU A HD12 8  
ATOM   10165 H HD13 . LEU A 1 45 ? 1.414   -4.755  1.921   1.00 0.11 ? 45  LEU A HD13 8  
ATOM   10166 H HD21 . LEU A 1 45 ? -0.434  -2.063  3.020   1.00 0.10 ? 45  LEU A HD21 8  
ATOM   10167 H HD22 . LEU A 1 45 ? -0.255  -2.849  4.587   1.00 0.11 ? 45  LEU A HD22 8  
ATOM   10168 H HD23 . LEU A 1 45 ? -0.595  -3.813  3.150   1.00 0.10 ? 45  LEU A HD23 8  
ATOM   10169 N N    . TYR A 1 46 ? 2.728   -7.044  5.546   1.00 0.13 ? 46  TYR A N    8  
ATOM   10170 C CA   . TYR A 1 46 ? 3.599   -8.206  5.436   1.00 0.14 ? 46  TYR A CA   8  
ATOM   10171 C C    . TYR A 1 46 ? 2.787   -9.481  5.230   1.00 0.13 ? 46  TYR A C    8  
ATOM   10172 O O    . TYR A 1 46 ? 3.338   -10.579 5.169   1.00 0.13 ? 46  TYR A O    8  
ATOM   10173 C CB   . TYR A 1 46 ? 4.468   -8.338  6.687   1.00 0.15 ? 46  TYR A CB   8  
ATOM   10174 C CG   . TYR A 1 46 ? 5.235   -7.080  7.026   1.00 0.16 ? 46  TYR A CG   8  
ATOM   10175 C CD1  . TYR A 1 46 ? 5.773   -6.279  6.026   1.00 0.16 ? 46  TYR A CD1  8  
ATOM   10176 C CD2  . TYR A 1 46 ? 5.423   -6.693  8.346   1.00 0.17 ? 46  TYR A CD2  8  
ATOM   10177 C CE1  . TYR A 1 46 ? 6.475   -5.128  6.331   1.00 0.17 ? 46  TYR A CE1  8  
ATOM   10178 C CE2  . TYR A 1 46 ? 6.122   -5.544  8.662   1.00 0.18 ? 46  TYR A CE2  8  
ATOM   10179 C CZ   . TYR A 1 46 ? 6.646   -4.765  7.651   1.00 0.18 ? 46  TYR A CZ   8  
ATOM   10180 O OH   . TYR A 1 46 ? 7.344   -3.621  7.962   1.00 0.19 ? 46  TYR A OH   8  
ATOM   10181 H H    . TYR A 1 46 ? 2.515   -6.689  6.435   1.00 0.13 ? 46  TYR A H    8  
ATOM   10182 H HA   . TYR A 1 46 ? 4.237   -8.060  4.577   1.00 0.14 ? 46  TYR A HA   8  
ATOM   10183 H HB2  . TYR A 1 46 ? 3.840   -8.580  7.529   1.00 0.15 ? 46  TYR A HB2  8  
ATOM   10184 H HB3  . TYR A 1 46 ? 5.184   -9.133  6.537   1.00 0.16 ? 46  TYR A HB3  8  
ATOM   10185 H HD1  . TYR A 1 46 ? 5.636   -6.565  4.994   1.00 0.15 ? 46  TYR A HD1  8  
ATOM   10186 H HD2  . TYR A 1 46 ? 5.012   -7.304  9.136   1.00 0.17 ? 46  TYR A HD2  8  
ATOM   10187 H HE1  . TYR A 1 46 ? 6.884   -4.519  5.540   1.00 0.17 ? 46  TYR A HE1  8  
ATOM   10188 H HE2  . TYR A 1 46 ? 6.256   -5.259  9.696   1.00 0.19 ? 46  TYR A HE2  8  
ATOM   10189 H HH   . TYR A 1 46 ? 7.971   -3.809  8.664   1.00 0.20 ? 46  TYR A HH   8  
ATOM   10190 N N    . SER A 1 47 ? 1.470   -9.325  5.124   1.00 0.12 ? 47  SER A N    8  
ATOM   10191 C CA   . SER A 1 47 ? 0.579   -10.461 4.930   1.00 0.11 ? 47  SER A CA   8  
ATOM   10192 C C    . SER A 1 47 ? 0.051   -10.501 3.499   1.00 0.10 ? 47  SER A C    8  
ATOM   10193 O O    . SER A 1 47 ? -0.954  -9.875  3.163   1.00 0.09 ? 47  SER A O    8  
ATOM   10194 C CB   . SER A 1 47 ? -0.590  -10.394 5.914   1.00 0.11 ? 47  SER A CB   8  
ATOM   10195 O OG   . SER A 1 47 ? -0.280  -11.066 7.123   1.00 0.12 ? 47  SER A OG   8  
ATOM   10196 H H    . SER A 1 47 ? 1.089   -8.424  5.181   1.00 0.12 ? 47  SER A H    8  
ATOM   10197 H HA   . SER A 1 47 ? 1.144   -11.360 5.120   1.00 0.12 ? 47  SER A HA   8  
ATOM   10198 H HB2  . SER A 1 47 ? -0.809  -9.361  6.139   1.00 0.11 ? 47  SER A HB2  8  
ATOM   10199 H HB3  . SER A 1 47 ? -1.458  -10.859 5.471   1.00 0.10 ? 47  SER A HB3  8  
ATOM   10200 H HG   . SER A 1 47 ? -0.666  -10.590 7.862   1.00 0.12 ? 47  SER A HG   8  
ATOM   10201 N N    . PRO A 1 48 ? 0.748   -11.253 2.633   1.00 0.11 ? 48  PRO A N    8  
ATOM   10202 C CA   . PRO A 1 48 ? 0.370   -11.392 1.224   1.00 0.10 ? 48  PRO A CA   8  
ATOM   10203 C C    . PRO A 1 48 ? -0.911  -12.199 1.045   1.00 0.09 ? 48  PRO A C    8  
ATOM   10204 O O    . PRO A 1 48 ? -1.415  -12.345 -0.069  1.00 0.09 ? 48  PRO A O    8  
ATOM   10205 C CB   . PRO A 1 48 ? 1.560   -12.134 0.610   1.00 0.11 ? 48  PRO A CB   8  
ATOM   10206 C CG   . PRO A 1 48 ? 2.168   -12.881 1.746   1.00 0.12 ? 48  PRO A CG   8  
ATOM   10207 C CD   . PRO A 1 48 ? 1.958   -12.023 2.965   1.00 0.12 ? 48  PRO A CD   8  
ATOM   10208 H HA   . PRO A 1 48 ? 0.257   -10.430 0.746   1.00 0.10 ? 48  PRO A HA   8  
ATOM   10209 H HB2  . PRO A 1 48 ? 1.214   -12.812 -0.161  1.00 0.11 ? 48  PRO A HB2  8  
ATOM   10210 H HB3  . PRO A 1 48 ? 2.269   -11.432 0.204   1.00 0.11 ? 48  PRO A HB3  8  
ATOM   10211 H HG2  . PRO A 1 48 ? 1.673   -13.835 1.863   1.00 0.12 ? 48  PRO A HG2  8  
ATOM   10212 H HG3  . PRO A 1 48 ? 3.223   -13.021 1.574   1.00 0.13 ? 48  PRO A HG3  8  
ATOM   10213 H HD2  . PRO A 1 48 ? 1.796   -12.642 3.834   1.00 0.12 ? 48  PRO A HD2  8  
ATOM   10214 H HD3  . PRO A 1 48 ? 2.803   -11.368 3.117   1.00 0.12 ? 48  PRO A HD3  8  
ATOM   10215 N N    . GLY A 1 49 ? -1.435  -12.721 2.149   1.00 0.09 ? 49  GLY A N    8  
ATOM   10216 C CA   . GLY A 1 49 ? -2.655  -13.507 2.092   1.00 0.09 ? 49  GLY A CA   8  
ATOM   10217 C C    . GLY A 1 49 ? -3.891  -12.682 2.395   1.00 0.08 ? 49  GLY A C    8  
ATOM   10218 O O    . GLY A 1 49 ? -4.995  -13.217 2.489   1.00 0.08 ? 49  GLY A O    8  
ATOM   10219 H H    . GLY A 1 49 ? -0.991  -12.569 3.010   1.00 0.10 ? 49  GLY A H    8  
ATOM   10220 H HA2  . GLY A 1 49 ? -2.751  -13.930 1.103   1.00 0.09 ? 49  GLY A HA2  8  
ATOM   10221 H HA3  . GLY A 1 49 ? -2.586  -14.310 2.812   1.00 0.10 ? 49  GLY A HA3  8  
ATOM   10222 N N    . SER A 1 50 ? -3.705  -11.376 2.551   1.00 0.08 ? 50  SER A N    8  
ATOM   10223 C CA   . SER A 1 50 ? -4.813  -10.476 2.850   1.00 0.07 ? 50  SER A CA   8  
ATOM   10224 C C    . SER A 1 50 ? -4.954  -9.408  1.770   1.00 0.06 ? 50  SER A C    8  
ATOM   10225 O O    . SER A 1 50 ? -5.779  -8.501  1.881   1.00 0.06 ? 50  SER A O    8  
ATOM   10226 C CB   . SER A 1 50 ? -4.605  -9.813  4.213   1.00 0.08 ? 50  SER A CB   8  
ATOM   10227 O OG   . SER A 1 50 ? -4.719  -10.758 5.264   1.00 0.09 ? 50  SER A OG   8  
ATOM   10228 H H    . SER A 1 50 ? -2.801  -11.008 2.464   1.00 0.08 ? 50  SER A H    8  
ATOM   10229 H HA   . SER A 1 50 ? -5.718  -11.063 2.880   1.00 0.07 ? 50  SER A HA   8  
ATOM   10230 H HB2  . SER A 1 50 ? -3.621  -9.370  4.250   1.00 0.08 ? 50  SER A HB2  8  
ATOM   10231 H HB3  . SER A 1 50 ? -5.351  -9.045  4.354   1.00 0.07 ? 50  SER A HB3  8  
ATOM   10232 H HG   . SER A 1 50 ? -5.052  -11.587 4.914   1.00 0.09 ? 50  SER A HG   8  
ATOM   10233 N N    . TRP A 1 51 ? -4.142  -9.522  0.724   1.00 0.07 ? 51  TRP A N    8  
ATOM   10234 C CA   . TRP A 1 51 ? -4.175  -8.568  -0.378  1.00 0.06 ? 51  TRP A CA   8  
ATOM   10235 C C    . TRP A 1 51 ? -5.451  -8.729  -1.199  1.00 0.06 ? 51  TRP A C    8  
ATOM   10236 O O    . TRP A 1 51 ? -5.853  -7.816  -1.921  1.00 0.06 ? 51  TRP A O    8  
ATOM   10237 C CB   . TRP A 1 51 ? -2.952  -8.752  -1.275  1.00 0.07 ? 51  TRP A CB   8  
ATOM   10238 C CG   . TRP A 1 51 ? -1.671  -8.319  -0.628  1.00 0.08 ? 51  TRP A CG   8  
ATOM   10239 C CD1  . TRP A 1 51 ? -1.536  -7.478  0.439   1.00 0.08 ? 51  TRP A CD1  8  
ATOM   10240 C CD2  . TRP A 1 51 ? -0.345  -8.705  -1.010  1.00 0.09 ? 51  TRP A CD2  8  
ATOM   10241 N NE1  . TRP A 1 51 ? -0.206  -7.319  0.746   1.00 0.09 ? 51  TRP A NE1  8  
ATOM   10242 C CE2  . TRP A 1 51 ? 0.546   -8.061  -0.128  1.00 0.10 ? 51  TRP A CE2  8  
ATOM   10243 C CE3  . TRP A 1 51 ? 0.176   -9.531  -2.008  1.00 0.09 ? 51  TRP A CE3  8  
ATOM   10244 C CZ2  . TRP A 1 51 ? 1.925   -8.219  -0.218  1.00 0.11 ? 51  TRP A CZ2  8  
ATOM   10245 C CZ3  . TRP A 1 51 ? 1.546   -9.687  -2.096  1.00 0.11 ? 51  TRP A CZ3  8  
ATOM   10246 C CH2  . TRP A 1 51 ? 2.408   -9.033  -1.206  1.00 0.11 ? 51  TRP A CH2  8  
ATOM   10247 H H    . TRP A 1 51 ? -3.506  -10.267 0.692   1.00 0.07 ? 51  TRP A H    8  
ATOM   10248 H HA   . TRP A 1 51 ? -4.156  -7.575  0.044   1.00 0.06 ? 51  TRP A HA   8  
ATOM   10249 H HB2  . TRP A 1 51 ? -2.857  -9.795  -1.536  1.00 0.07 ? 51  TRP A HB2  8  
ATOM   10250 H HB3  . TRP A 1 51 ? -3.085  -8.171  -2.176  1.00 0.07 ? 51  TRP A HB3  8  
ATOM   10251 H HD1  . TRP A 1 51 ? -2.361  -7.014  0.958   1.00 0.07 ? 51  TRP A HD1  8  
ATOM   10252 H HE1  . TRP A 1 51 ? 0.148   -6.765  1.473   1.00 0.09 ? 51  TRP A HE1  8  
ATOM   10253 H HE3  . TRP A 1 51 ? -0.473  -10.042 -2.704  1.00 0.09 ? 51  TRP A HE3  8  
ATOM   10254 H HZ2  . TRP A 1 51 ? 2.601   -7.723  0.460   1.00 0.11 ? 51  TRP A HZ2  8  
ATOM   10255 H HZ3  . TRP A 1 51 ? 1.966   -10.322 -2.861  1.00 0.11 ? 51  TRP A HZ3  8  
ATOM   10256 H HH2  . TRP A 1 51 ? 3.471   -9.184  -1.312  1.00 0.12 ? 51  TRP A HH2  8  
ATOM   10257 N N    . ASP A 1 52 ? -6.083  -9.890  -1.081  1.00 0.06 ? 52  ASP A N    8  
ATOM   10258 C CA   . ASP A 1 52 ? -7.313  -10.170 -1.812  1.00 0.07 ? 52  ASP A CA   8  
ATOM   10259 C C    . ASP A 1 52 ? -8.434  -9.235  -1.365  1.00 0.06 ? 52  ASP A C    8  
ATOM   10260 O O    . ASP A 1 52 ? -8.989  -8.469  -2.153  1.00 0.06 ? 52  ASP A O    8  
ATOM   10261 C CB   . ASP A 1 52 ? -7.736  -11.625 -1.608  1.00 0.07 ? 52  ASP A CB   8  
ATOM   10262 C CG   . ASP A 1 52 ? -7.328  -12.514 -2.767  1.00 0.08 ? 52  ASP A CG   8  
ATOM   10263 O OD1  . ASP A 1 52 ? -8.096  -13.441 -3.102  1.00 0.09 ? 52  ASP A OD1  8  
ATOM   10264 O OD2  . ASP A 1 52 ? -6.245  -12.280 -3.341  1.00 0.08 ? 52  ASP A OD2  8  
ATOM   10265 H H    . ASP A 1 52 ? -5.711  -10.578 -0.491  1.00 0.06 ? 52  ASP A H    8  
ATOM   10266 H HA   . ASP A 1 52 ? -7.120  -10.005 -2.861  1.00 0.07 ? 52  ASP A HA   8  
ATOM   10267 H HB2  . ASP A 1 52 ? -7.273  -12.005 -0.709  1.00 0.07 ? 52  ASP A HB2  8  
ATOM   10268 H HB3  . ASP A 1 52 ? -8.810  -11.670 -1.502  1.00 0.08 ? 52  ASP A HB3  8  
ATOM   10269 N N    . PRO A 1 53 ? -8.776  -9.299  -0.069  1.00 0.06 ? 53  PRO A N    8  
ATOM   10270 C CA   . PRO A 1 53 ? -9.833  -8.467  0.512   1.00 0.06 ? 53  PRO A CA   8  
ATOM   10271 C C    . PRO A 1 53 ? -9.437  -6.995  0.588   1.00 0.05 ? 53  PRO A C    8  
ATOM   10272 O O    . PRO A 1 53 ? -10.257 -6.140  0.920   1.00 0.06 ? 53  PRO A O    8  
ATOM   10273 C CB   . PRO A 1 53 ? -10.010 -9.047  1.917   1.00 0.06 ? 53  PRO A CB   8  
ATOM   10274 C CG   . PRO A 1 53 ? -8.698  -9.677  2.233   1.00 0.06 ? 53  PRO A CG   8  
ATOM   10275 C CD   . PRO A 1 53 ? -8.157  -10.189 0.927   1.00 0.06 ? 53  PRO A CD   8  
ATOM   10276 H HA   . PRO A 1 53 ? -10.757 -8.560  -0.039  1.00 0.07 ? 53  PRO A HA   8  
ATOM   10277 H HB2  . PRO A 1 53 ? -10.242 -8.254  2.618   1.00 0.06 ? 53  PRO A HB2  8  
ATOM   10278 H HB3  . PRO A 1 53 ? -10.789 -9.792  1.918   1.00 0.07 ? 53  PRO A HB3  8  
ATOM   10279 H HG2  . PRO A 1 53 ? -8.030  -8.937  2.656   1.00 0.06 ? 53  PRO A HG2  8  
ATOM   10280 H HG3  . PRO A 1 53 ? -8.837  -10.497 2.920   1.00 0.07 ? 53  PRO A HG3  8  
ATOM   10281 H HD2  . PRO A 1 53 ? -7.080  -10.105 0.904   1.00 0.06 ? 53  PRO A HD2  8  
ATOM   10282 H HD3  . PRO A 1 53 ? -8.462  -11.213 0.770   1.00 0.07 ? 53  PRO A HD3  8  
ATOM   10283 N N    . ILE A 1 54 ? -8.176  -6.712  0.279   1.00 0.05 ? 54  ILE A N    8  
ATOM   10284 C CA   . ILE A 1 54 ? -7.673  -5.345  0.313   1.00 0.05 ? 54  ILE A CA   8  
ATOM   10285 C C    . ILE A 1 54 ? -7.551  -4.769  -1.095  1.00 0.05 ? 54  ILE A C    8  
ATOM   10286 O O    . ILE A 1 54 ? -7.518  -3.552  -1.281  1.00 0.05 ? 54  ILE A O    8  
ATOM   10287 C CB   . ILE A 1 54 ? -6.301  -5.265  1.008   1.00 0.05 ? 54  ILE A CB   8  
ATOM   10288 C CG1  . ILE A 1 54 ? -6.413  -5.733  2.459   1.00 0.05 ? 54  ILE A CG1  8  
ATOM   10289 C CG2  . ILE A 1 54 ? -5.754  -3.848  0.941   1.00 0.05 ? 54  ILE A CG2  8  
ATOM   10290 C CD1  . ILE A 1 54 ? -5.076  -5.984  3.119   1.00 0.06 ? 54  ILE A CD1  8  
ATOM   10291 H H    . ILE A 1 54 ? -7.571  -7.439  0.024   1.00 0.05 ? 54  ILE A H    8  
ATOM   10292 H HA   . ILE A 1 54 ? -8.374  -4.745  0.877   1.00 0.05 ? 54  ILE A HA   8  
ATOM   10293 H HB   . ILE A 1 54 ? -5.617  -5.914  0.480   1.00 0.05 ? 54  ILE A HB   8  
ATOM   10294 H HG12 . ILE A 1 54 ? -6.929  -4.979  3.035   1.00 0.06 ? 54  ILE A HG12 8  
ATOM   10295 H HG13 . ILE A 1 54 ? -6.978  -6.654  2.492   1.00 0.05 ? 54  ILE A HG13 8  
ATOM   10296 H HG21 . ILE A 1 54 ? -4.854  -3.780  1.534   1.00 0.06 ? 54  ILE A HG21 8  
ATOM   10297 H HG22 . ILE A 1 54 ? -6.492  -3.162  1.325   1.00 0.05 ? 54  ILE A HG22 8  
ATOM   10298 H HG23 . ILE A 1 54 ? -5.529  -3.596  -0.085  1.00 0.06 ? 54  ILE A HG23 8  
ATOM   10299 H HD11 . ILE A 1 54 ? -5.232  -6.380  4.111   1.00 0.07 ? 54  ILE A HD11 8  
ATOM   10300 H HD12 . ILE A 1 54 ? -4.526  -5.056  3.184   1.00 0.07 ? 54  ILE A HD12 8  
ATOM   10301 H HD13 . ILE A 1 54 ? -4.513  -6.696  2.533   1.00 0.06 ? 54  ILE A HD13 8  
ATOM   10302 N N    . THR A 1 55 ? -7.487  -5.653  -2.086  1.00 0.06 ? 55  THR A N    8  
ATOM   10303 C CA   . THR A 1 55 ? -7.369  -5.235  -3.476  1.00 0.06 ? 55  THR A CA   8  
ATOM   10304 C C    . THR A 1 55 ? -8.740  -5.093  -4.126  1.00 0.07 ? 55  THR A C    8  
ATOM   10305 O O    . THR A 1 55 ? -8.969  -4.183  -4.923  1.00 0.08 ? 55  THR A O    8  
ATOM   10306 C CB   . THR A 1 55 ? -6.529  -6.233  -4.295  1.00 0.07 ? 55  THR A CB   8  
ATOM   10307 O OG1  . THR A 1 55 ? -5.171  -6.216  -3.842  1.00 0.07 ? 55  THR A OG1  8  
ATOM   10308 C CG2  . THR A 1 55 ? -6.579  -5.895  -5.777  1.00 0.08 ? 55  THR A CG2  8  
ATOM   10309 H H    . THR A 1 55 ? -7.515  -6.610  -1.877  1.00 0.06 ? 55  THR A H    8  
ATOM   10310 H HA   . THR A 1 55 ? -6.871  -4.276  -3.495  1.00 0.07 ? 55  THR A HA   8  
ATOM   10311 H HB   . THR A 1 55 ? -6.935  -7.224  -4.153  1.00 0.07 ? 55  THR A HB   8  
ATOM   10312 H HG1  . THR A 1 55 ? -4.594  -5.970  -4.568  1.00 0.08 ? 55  THR A HG1  8  
ATOM   10313 H HG21 . THR A 1 55 ? -7.603  -5.929  -6.120  1.00 0.09 ? 55  THR A HG21 8  
ATOM   10314 H HG22 . THR A 1 55 ? -5.990  -6.613  -6.330  1.00 0.09 ? 55  THR A HG22 8  
ATOM   10315 H HG23 . THR A 1 55 ? -6.178  -4.905  -5.935  1.00 0.08 ? 55  THR A HG23 8  
ATOM   10316 N N    . ALA A 1 56 ? -9.653  -5.994  -3.778  1.00 0.07 ? 56  ALA A N    8  
ATOM   10317 C CA   . ALA A 1 56 ? -11.003 -5.966  -4.324  1.00 0.08 ? 56  ALA A CA   8  
ATOM   10318 C C    . ALA A 1 56 ? -11.785 -4.768  -3.796  1.00 0.08 ? 56  ALA A C    8  
ATOM   10319 O O    . ALA A 1 56 ? -12.532 -4.128  -4.534  1.00 0.09 ? 56  ALA A O    8  
ATOM   10320 C CB   . ALA A 1 56 ? -11.732 -7.260  -3.994  1.00 0.08 ? 56  ALA A CB   8  
ATOM   10321 H H    . ALA A 1 56 ? -9.411  -6.697  -3.139  1.00 0.07 ? 56  ALA A H    8  
ATOM   10322 H HA   . ALA A 1 56 ? -10.926 -5.888  -5.399  1.00 0.09 ? 56  ALA A HA   8  
ATOM   10323 H HB1  . ALA A 1 56 ? -12.711 -7.248  -4.451  1.00 0.09 ? 56  ALA A HB1  8  
ATOM   10324 H HB2  . ALA A 1 56 ? -11.836 -7.352  -2.924  1.00 0.08 ? 56  ALA A HB2  8  
ATOM   10325 H HB3  . ALA A 1 56 ? -11.168 -8.099  -4.376  1.00 0.09 ? 56  ALA A HB3  8  
ATOM   10326 N N    . ALA A 1 57 ? -11.608 -4.470  -2.513  1.00 0.07 ? 57  ALA A N    8  
ATOM   10327 C CA   . ALA A 1 57 ? -12.294 -3.347  -1.887  1.00 0.07 ? 57  ALA A CA   8  
ATOM   10328 C C    . ALA A 1 57 ? -11.904 -2.029  -2.543  1.00 0.07 ? 57  ALA A C    8  
ATOM   10329 O O    . ALA A 1 57 ? -12.762 -1.279  -3.015  1.00 0.08 ? 57  ALA A O    8  
ATOM   10330 C CB   . ALA A 1 57 ? -11.990 -3.308  -0.396  1.00 0.06 ? 57  ALA A CB   8  
ATOM   10331 H H    . ALA A 1 57 ? -11.000 -5.019  -1.974  1.00 0.07 ? 57  ALA A H    8  
ATOM   10332 H HA   . ALA A 1 57 ? -13.357 -3.498  -2.009  1.00 0.08 ? 57  ALA A HA   8  
ATOM   10333 H HB1  . ALA A 1 57 ? -12.270 -4.248  0.054   1.00 0.07 ? 57  ALA A HB1  8  
ATOM   10334 H HB2  . ALA A 1 57 ? -12.549 -2.507  0.064   1.00 0.07 ? 57  ALA A HB2  8  
ATOM   10335 H HB3  . ALA A 1 57 ? -10.933 -3.139  -0.249  1.00 0.06 ? 57  ALA A HB3  8  
ATOM   10336 N N    . LEU A 1 58 ? -10.605 -1.750  -2.573  1.00 0.07 ? 58  LEU A N    8  
ATOM   10337 C CA   . LEU A 1 58 ? -10.101 -0.519  -3.173  1.00 0.08 ? 58  LEU A CA   8  
ATOM   10338 C C    . LEU A 1 58 ? -10.566 -0.388  -4.620  1.00 0.09 ? 58  LEU A C    8  
ATOM   10339 O O    . LEU A 1 58 ? -10.970 0.688   -5.057  1.00 0.09 ? 58  LEU A O    8  
ATOM   10340 C CB   . LEU A 1 58 ? -8.573  -0.488  -3.112  1.00 0.07 ? 58  LEU A CB   8  
ATOM   10341 C CG   . LEU A 1 58 ? -7.961  -0.266  -1.729  1.00 0.07 ? 58  LEU A CG   8  
ATOM   10342 C CD1  . LEU A 1 58 ? -6.490  -0.653  -1.726  1.00 0.07 ? 58  LEU A CD1  8  
ATOM   10343 C CD2  . LEU A 1 58 ? -8.135  1.182   -1.294  1.00 0.07 ? 58  LEU A CD2  8  
ATOM   10344 H H    . LEU A 1 58 ? -9.970  -2.386  -2.181  1.00 0.06 ? 58  LEU A H    8  
ATOM   10345 H HA   . LEU A 1 58 ? -10.492 0.312   -2.605  1.00 0.08 ? 58  LEU A HA   8  
ATOM   10346 H HB2  . LEU A 1 58 ? -8.203  -1.427  -3.496  1.00 0.07 ? 58  LEU A HB2  8  
ATOM   10347 H HB3  . LEU A 1 58 ? -8.228  0.303   -3.760  1.00 0.08 ? 58  LEU A HB3  8  
ATOM   10348 H HG   . LEU A 1 58 ? -8.471  -0.894  -1.012  1.00 0.06 ? 58  LEU A HG   8  
ATOM   10349 H HD11 . LEU A 1 58 ? -6.046  -0.379  -0.780  1.00 0.07 ? 58  LEU A HD11 8  
ATOM   10350 H HD12 . LEU A 1 58 ? -5.982  -0.136  -2.526  1.00 0.08 ? 58  LEU A HD12 8  
ATOM   10351 H HD13 . LEU A 1 58 ? -6.398  -1.720  -1.871  1.00 0.06 ? 58  LEU A HD13 8  
ATOM   10352 H HD21 . LEU A 1 58 ? -9.182  1.386   -1.131  1.00 0.07 ? 58  LEU A HD21 8  
ATOM   10353 H HD22 . LEU A 1 58 ? -7.756  1.837   -2.065  1.00 0.08 ? 58  LEU A HD22 8  
ATOM   10354 H HD23 . LEU A 1 58 ? -7.588  1.352   -0.378  1.00 0.07 ? 58  LEU A HD23 8  
ATOM   10355 N N    . SER A 1 59 ? -10.507 -1.493  -5.357  1.00 0.09 ? 59  SER A N    8  
ATOM   10356 C CA   . SER A 1 59 ? -10.921 -1.502  -6.756  1.00 0.10 ? 59  SER A CA   8  
ATOM   10357 C C    . SER A 1 59 ? -12.439 -1.416  -6.873  1.00 0.11 ? 59  SER A C    8  
ATOM   10358 O O    . SER A 1 59 ? -12.971 -1.042  -7.918  1.00 0.12 ? 59  SER A O    8  
ATOM   10359 C CB   . SER A 1 59 ? -10.413 -2.766  -7.452  1.00 0.10 ? 59  SER A CB   8  
ATOM   10360 O OG   . SER A 1 59 ? -11.048 -2.947  -8.705  1.00 0.12 ? 59  SER A OG   8  
ATOM   10361 H H    . SER A 1 59 ? -10.176 -2.321  -4.951  1.00 0.08 ? 59  SER A H    8  
ATOM   10362 H HA   . SER A 1 59 ? -10.487 -0.638  -7.235  1.00 0.11 ? 59  SER A HA   8  
ATOM   10363 H HB2  . SER A 1 59 ? -9.347  -2.684  -7.611  1.00 0.10 ? 59  SER A HB2  8  
ATOM   10364 H HB3  . SER A 1 59 ? -10.620 -3.625  -6.830  1.00 0.10 ? 59  SER A HB3  8  
ATOM   10365 H HG   . SER A 1 59 ? -10.390 -2.924  -9.404  1.00 0.12 ? 59  SER A HG   8  
ATOM   10366 N N    . GLN A 1 60 ? -13.131 -1.767  -5.793  1.00 0.10 ? 60  GLN A N    8  
ATOM   10367 C CA   . GLN A 1 60 ? -14.588 -1.732  -5.776  1.00 0.11 ? 60  GLN A CA   8  
ATOM   10368 C C    . GLN A 1 60 ? -15.095 -0.318  -5.517  1.00 0.11 ? 60  GLN A C    8  
ATOM   10369 O O    . GLN A 1 60 ? -16.048 0.136   -6.153  1.00 0.13 ? 60  GLN A O    8  
ATOM   10370 C CB   . GLN A 1 60 ? -15.130 -2.684  -4.707  1.00 0.11 ? 60  GLN A CB   8  
ATOM   10371 C CG   . GLN A 1 60 ? -16.644 -2.655  -4.577  1.00 0.12 ? 60  GLN A CG   8  
ATOM   10372 C CD   . GLN A 1 60 ? -17.140 -3.399  -3.352  1.00 0.12 ? 60  GLN A CD   8  
ATOM   10373 O OE1  . GLN A 1 60 ? -18.016 -4.258  -3.446  1.00 0.12 ? 60  GLN A OE1  8  
ATOM   10374 N NE2  . GLN A 1 60 ? -16.579 -3.071  -2.194  1.00 0.11 ? 60  GLN A NE2  8  
ATOM   10375 H H    . GLN A 1 60 ? -12.650 -2.058  -4.990  1.00 0.09 ? 60  GLN A H    8  
ATOM   10376 H HA   . GLN A 1 60 ? -14.938 -2.057  -6.743  1.00 0.12 ? 60  GLN A HA   8  
ATOM   10377 H HB2  . GLN A 1 60 ? -14.829 -3.692  -4.955  1.00 0.11 ? 60  GLN A HB2  8  
ATOM   10378 H HB3  . GLN A 1 60 ? -14.702 -2.414  -3.753  1.00 0.10 ? 60  GLN A HB3  8  
ATOM   10379 H HG2  . GLN A 1 60 ? -16.966 -1.628  -4.510  1.00 0.12 ? 60  GLN A HG2  8  
ATOM   10380 H HG3  . GLN A 1 60 ? -17.076 -3.111  -5.457  1.00 0.13 ? 60  GLN A HG3  8  
ATOM   10381 H HE21 . GLN A 1 60 ? -15.885 -2.379  -2.195  1.00 0.10 ? 60  GLN A HE21 8  
ATOM   10382 H HE22 . GLN A 1 60 ? -16.881 -3.536  -1.387  1.00 0.11 ? 60  GLN A HE22 8  
ATOM   10383 N N    . ARG A 1 61 ? -14.454 0.375   -4.580  1.00 0.11 ? 61  ARG A N    8  
ATOM   10384 C CA   . ARG A 1 61 ? -14.841 1.737   -4.238  1.00 0.11 ? 61  ARG A CA   8  
ATOM   10385 C C    . ARG A 1 61 ? -14.488 2.703   -5.365  1.00 0.12 ? 61  ARG A C    8  
ATOM   10386 O O    . ARG A 1 61 ? -15.198 3.678   -5.606  1.00 0.13 ? 61  ARG A O    8  
ATOM   10387 C CB   . ARG A 1 61 ? -14.154 2.175   -2.944  1.00 0.10 ? 61  ARG A CB   8  
ATOM   10388 C CG   . ARG A 1 61 ? -12.774 2.772   -3.158  1.00 0.10 ? 61  ARG A CG   8  
ATOM   10389 C CD   . ARG A 1 61 ? -12.111 3.132   -1.838  1.00 0.09 ? 61  ARG A CD   8  
ATOM   10390 N NE   . ARG A 1 61 ? -11.730 4.542   -1.782  1.00 0.10 ? 61  ARG A NE   8  
ATOM   10391 C CZ   . ARG A 1 61 ? -11.309 5.145   -0.676  1.00 0.09 ? 61  ARG A CZ   8  
ATOM   10392 N NH1  . ARG A 1 61 ? -11.214 4.466   0.459   1.00 0.09 ? 61  ARG A NH1  8  
ATOM   10393 N NH2  . ARG A 1 61 ? -10.981 6.430   -0.705  1.00 0.10 ? 61  ARG A NH2  8  
ATOM   10394 H H    . ARG A 1 61 ? -13.703 -0.043  -4.109  1.00 0.10 ? 61  ARG A H    8  
ATOM   10395 H HA   . ARG A 1 61 ? -15.910 1.751   -4.091  1.00 0.12 ? 61  ARG A HA   8  
ATOM   10396 H HB2  . ARG A 1 61 ? -14.772 2.914   -2.455  1.00 0.10 ? 61  ARG A HB2  8  
ATOM   10397 H HB3  . ARG A 1 61 ? -14.055 1.316   -2.296  1.00 0.09 ? 61  ARG A HB3  8  
ATOM   10398 H HG2  . ARG A 1 61 ? -12.157 2.053   -3.675  1.00 0.09 ? 61  ARG A HG2  8  
ATOM   10399 H HG3  . ARG A 1 61 ? -12.869 3.666   -3.758  1.00 0.10 ? 61  ARG A HG3  8  
ATOM   10400 H HD2  . ARG A 1 61 ? -12.802 2.925   -1.034  1.00 0.09 ? 61  ARG A HD2  8  
ATOM   10401 H HD3  . ARG A 1 61 ? -11.226 2.525   -1.716  1.00 0.08 ? 61  ARG A HD3  8  
ATOM   10402 H HE   . ARG A 1 61 ? -11.792 5.062   -2.610  1.00 0.10 ? 61  ARG A HE   8  
ATOM   10403 H HH11 . ARG A 1 61 ? -10.895 4.923   1.290   1.00 0.09 ? 61  ARG A HH11 8  
ATOM   10404 H HH12 . ARG A 1 61 ? -11.460 3.497   0.484   1.00 0.08 ? 61  ARG A HH12 8  
ATOM   10405 H HH21 . ARG A 1 61 ? -11.051 6.945   -1.558  1.00 0.11 ? 61  ARG A HH21 8  
ATOM   10406 H HH22 . ARG A 1 61 ? -10.662 6.884   0.128   1.00 0.10 ? 61  ARG A HH22 8  
ATOM   10407 N N    . ALA A 1 62 ? -13.385 2.424   -6.053  1.00 0.12 ? 62  ALA A N    8  
ATOM   10408 C CA   . ALA A 1 62 ? -12.939 3.267   -7.156  1.00 0.13 ? 62  ALA A CA   8  
ATOM   10409 C C    . ALA A 1 62 ? -13.857 3.123   -8.364  1.00 0.14 ? 62  ALA A C    8  
ATOM   10410 O O    . ALA A 1 62 ? -14.243 4.113   -8.984  1.00 0.15 ? 62  ALA A O    8  
ATOM   10411 C CB   . ALA A 1 62 ? -11.506 2.923   -7.536  1.00 0.12 ? 62  ALA A CB   8  
ATOM   10412 H H    . ALA A 1 62 ? -12.860 1.632   -5.815  1.00 0.11 ? 62  ALA A H    8  
ATOM   10413 H HA   . ALA A 1 62 ? -12.961 4.294   -6.820  1.00 0.13 ? 62  ALA A HA   8  
ATOM   10414 H HB1  . ALA A 1 62 ? -11.459 1.898   -7.872  1.00 0.12 ? 62  ALA A HB1  8  
ATOM   10415 H HB2  . ALA A 1 62 ? -10.865 3.050   -6.674  1.00 0.11 ? 62  ALA A HB2  8  
ATOM   10416 H HB3  . ALA A 1 62 ? -11.177 3.579   -8.328  1.00 0.13 ? 62  ALA A HB3  8  
ATOM   10417 N N    . MET A 1 63 ? -14.204 1.882   -8.694  1.00 0.14 ? 63  MET A N    8  
ATOM   10418 C CA   . MET A 1 63 ? -15.077 1.609   -9.828  1.00 0.15 ? 63  MET A CA   8  
ATOM   10419 C C    . MET A 1 63 ? -16.496 2.098   -9.552  1.00 0.16 ? 63  MET A C    8  
ATOM   10420 O O    . MET A 1 63 ? -17.201 2.532   -10.464 1.00 0.17 ? 63  MET A O    8  
ATOM   10421 C CB   . MET A 1 63 ? -15.094 0.111   -10.137 1.00 0.15 ? 63  MET A CB   8  
ATOM   10422 C CG   . MET A 1 63 ? -15.856 -0.713  -9.114  1.00 0.15 ? 63  MET A CG   8  
ATOM   10423 S SD   . MET A 1 63 ? -16.020 -2.443  -9.596  1.00 0.15 ? 63  MET A SD   8  
ATOM   10424 C CE   . MET A 1 63 ? -14.300 -2.943  -9.646  1.00 0.14 ? 63  MET A CE   8  
ATOM   10425 H H    . MET A 1 63 ? -13.864 1.132   -8.161  1.00 0.13 ? 63  MET A H    8  
ATOM   10426 H HA   . MET A 1 63 ? -14.686 2.139   -10.684 1.00 0.16 ? 63  MET A HA   8  
ATOM   10427 H HB2  . MET A 1 63 ? -15.552 -0.041  -11.103 1.00 0.16 ? 63  MET A HB2  8  
ATOM   10428 H HB3  . MET A 1 63 ? -14.076 -0.248  -10.171 1.00 0.15 ? 63  MET A HB3  8  
ATOM   10429 H HG2  . MET A 1 63 ? -15.333 -0.665  -8.171  1.00 0.14 ? 63  MET A HG2  8  
ATOM   10430 H HG3  . MET A 1 63 ? -16.843 -0.291  -8.998  1.00 0.15 ? 63  MET A HG3  8  
ATOM   10431 H HE1  . MET A 1 63 ? -13.802 -2.438  -10.460 1.00 0.15 ? 63  MET A HE1  8  
ATOM   10432 H HE2  . MET A 1 63 ? -14.240 -4.011  -9.795  1.00 0.14 ? 63  MET A HE2  8  
ATOM   10433 H HE3  . MET A 1 63 ? -13.823 -2.682  -8.714  1.00 0.13 ? 63  MET A HE3  8  
ATOM   10434 N N    . ILE A 1 64 ? -16.905 2.028   -8.291  1.00 0.15 ? 64  ILE A N    8  
ATOM   10435 C CA   . ILE A 1 64 ? -18.241 2.465   -7.897  1.00 0.16 ? 64  ILE A CA   8  
ATOM   10436 C C    . ILE A 1 64 ? -18.264 3.961   -7.604  1.00 0.16 ? 64  ILE A C    8  
ATOM   10437 O O    . ILE A 1 64 ? -18.772 4.752   -8.400  1.00 0.17 ? 64  ILE A O    8  
ATOM   10438 C CB   . ILE A 1 64 ? -18.737 1.703   -6.654  1.00 0.15 ? 64  ILE A CB   8  
ATOM   10439 C CG1  . ILE A 1 64 ? -18.890 0.214   -6.970  1.00 0.15 ? 64  ILE A CG1  8  
ATOM   10440 C CG2  . ILE A 1 64 ? -20.057 2.283   -6.170  1.00 0.16 ? 64  ILE A CG2  8  
ATOM   10441 C CD1  . ILE A 1 64 ? -19.273 -0.623  -5.770  1.00 0.15 ? 64  ILE A CD1  8  
ATOM   10442 H H    . ILE A 1 64 ? -16.297 1.674   -7.609  1.00 0.14 ? 64  ILE A H    8  
ATOM   10443 H HA   . ILE A 1 64 ? -18.915 2.256   -8.715  1.00 0.17 ? 64  ILE A HA   8  
ATOM   10444 H HB   . ILE A 1 64 ? -18.008 1.824   -5.868  1.00 0.14 ? 64  ILE A HB   8  
ATOM   10445 H HG12 . ILE A 1 64 ? -19.656 0.086   -7.719  1.00 0.16 ? 64  ILE A HG12 8  
ATOM   10446 H HG13 . ILE A 1 64 ? -17.953 -0.164  -7.351  1.00 0.15 ? 64  ILE A HG13 8  
ATOM   10447 H HG21 . ILE A 1 64 ? -20.373 1.763   -5.278  1.00 0.15 ? 64  ILE A HG21 8  
ATOM   10448 H HG22 . ILE A 1 64 ? -20.806 2.165   -6.940  1.00 0.17 ? 64  ILE A HG22 8  
ATOM   10449 H HG23 . ILE A 1 64 ? -19.930 3.332   -5.950  1.00 0.16 ? 64  ILE A HG23 8  
ATOM   10450 H HD11 . ILE A 1 64 ? -20.287 -0.391  -5.479  1.00 0.15 ? 64  ILE A HD11 8  
ATOM   10451 H HD12 . ILE A 1 64 ? -18.605 -0.403  -4.950  1.00 0.14 ? 64  ILE A HD12 8  
ATOM   10452 H HD13 . ILE A 1 64 ? -19.200 -1.670  -6.023  1.00 0.15 ? 64  ILE A HD13 8  
ATOM   10453 N N    . LEU A 1 65 ? -17.711 4.343   -6.458  1.00 0.15 ? 65  LEU A N    8  
ATOM   10454 C CA   . LEU A 1 65 ? -17.667 5.746   -6.060  1.00 0.15 ? 65  LEU A CA   8  
ATOM   10455 C C    . LEU A 1 65 ? -17.085 6.610   -7.174  1.00 0.16 ? 65  LEU A C    8  
ATOM   10456 O O    . LEU A 1 65 ? -17.542 7.727   -7.410  1.00 0.16 ? 65  LEU A O    8  
ATOM   10457 C CB   . LEU A 1 65 ? -16.836 5.909   -4.785  1.00 0.14 ? 65  LEU A CB   8  
ATOM   10458 C CG   . LEU A 1 65 ? -17.446 6.792   -3.695  1.00 0.14 ? 65  LEU A CG   8  
ATOM   10459 C CD1  . LEU A 1 65 ? -18.333 5.967   -2.776  1.00 0.14 ? 65  LEU A CD1  8  
ATOM   10460 C CD2  . LEU A 1 65 ? -16.352 7.488   -2.901  1.00 0.13 ? 65  LEU A CD2  8  
ATOM   10461 H H    . LEU A 1 65 ? -17.322 3.666   -5.867  1.00 0.14 ? 65  LEU A H    8  
ATOM   10462 H HA   . LEU A 1 65 ? -18.679 6.067   -5.863  1.00 0.16 ? 65  LEU A HA   8  
ATOM   10463 H HB2  . LEU A 1 65 ? -16.671 4.927   -4.367  1.00 0.13 ? 65  LEU A HB2  8  
ATOM   10464 H HB3  . LEU A 1 65 ? -15.880 6.327   -5.060  1.00 0.14 ? 65  LEU A HB3  8  
ATOM   10465 H HG   . LEU A 1 65 ? -18.060 7.551   -4.158  1.00 0.15 ? 65  LEU A HG   8  
ATOM   10466 H HD11 . LEU A 1 65 ? -17.734 5.227   -2.267  1.00 0.13 ? 65  LEU A HD11 8  
ATOM   10467 H HD12 . LEU A 1 65 ? -19.096 5.473   -3.360  1.00 0.14 ? 65  LEU A HD12 8  
ATOM   10468 H HD13 . LEU A 1 65 ? -18.800 6.616   -2.050  1.00 0.14 ? 65  LEU A HD13 8  
ATOM   10469 H HD21 . LEU A 1 65 ? -15.848 8.205   -3.533  1.00 0.14 ? 65  LEU A HD21 8  
ATOM   10470 H HD22 . LEU A 1 65 ? -15.640 6.755   -2.549  1.00 0.13 ? 65  LEU A HD22 8  
ATOM   10471 H HD23 . LEU A 1 65 ? -16.789 7.999   -2.055  1.00 0.14 ? 65  LEU A HD23 8  
ATOM   10472 N N    . GLY A 1 66 ? -16.076 6.081   -7.859  1.00 0.15 ? 66  GLY A N    8  
ATOM   10473 C CA   . GLY A 1 66 ? -15.449 6.819   -8.942  1.00 0.16 ? 66  GLY A CA   8  
ATOM   10474 C C    . GLY A 1 66 ? -14.228 7.591   -8.488  1.00 0.16 ? 66  GLY A C    8  
ATOM   10475 O O    . GLY A 1 66 ? -14.041 8.748   -8.865  1.00 0.16 ? 66  GLY A O    8  
ATOM   10476 H H    . GLY A 1 66 ? -15.754 5.185   -7.629  1.00 0.15 ? 66  GLY A H    8  
ATOM   10477 H HA2  . GLY A 1 66 ? -15.154 6.122   -9.713  1.00 0.16 ? 66  GLY A HA2  8  
ATOM   10478 H HA3  . GLY A 1 66 ? -16.168 7.511   -9.353  1.00 0.17 ? 66  GLY A HA3  8  
ATOM   10479 N N    . LYS A 1 67 ? -13.394 6.952   -7.672  1.00 0.15 ? 67  LYS A N    8  
ATOM   10480 C CA   . LYS A 1 67 ? -12.185 7.588   -7.164  1.00 0.14 ? 67  LYS A CA   8  
ATOM   10481 C C    . LYS A 1 67 ? -11.202 6.546   -6.640  1.00 0.13 ? 67  LYS A C    8  
ATOM   10482 O O    . LYS A 1 67 ? -11.534 5.752   -5.760  1.00 0.12 ? 67  LYS A O    8  
ATOM   10483 C CB   . LYS A 1 67 ? -12.533 8.579   -6.051  1.00 0.14 ? 67  LYS A CB   8  
ATOM   10484 C CG   . LYS A 1 67 ? -13.206 7.935   -4.851  1.00 0.13 ? 67  LYS A CG   8  
ATOM   10485 C CD   . LYS A 1 67 ? -12.229 7.740   -3.703  1.00 0.12 ? 67  LYS A CD   8  
ATOM   10486 C CE   . LYS A 1 67 ? -12.283 8.902   -2.722  1.00 0.13 ? 67  LYS A CE   8  
ATOM   10487 N NZ   . LYS A 1 67 ? -12.143 10.216  -3.411  1.00 0.14 ? 67  LYS A NZ   8  
ATOM   10488 H H    . LYS A 1 67 ? -13.599 6.031   -7.407  1.00 0.14 ? 67  LYS A H    8  
ATOM   10489 H HA   . LYS A 1 67 ? -11.723 8.123   -7.980  1.00 0.15 ? 67  LYS A HA   8  
ATOM   10490 H HB2  . LYS A 1 67 ? -11.626 9.058   -5.714  1.00 0.14 ? 67  LYS A HB2  8  
ATOM   10491 H HB3  . LYS A 1 67 ? -13.199 9.331   -6.450  1.00 0.15 ? 67  LYS A HB3  8  
ATOM   10492 H HG2  . LYS A 1 67 ? -14.014 8.570   -4.519  1.00 0.14 ? 67  LYS A HG2  8  
ATOM   10493 H HG3  . LYS A 1 67 ? -13.599 6.973   -5.146  1.00 0.13 ? 67  LYS A HG3  8  
ATOM   10494 H HD2  . LYS A 1 67 ? -12.481 6.830   -3.181  1.00 0.12 ? 67  LYS A HD2  8  
ATOM   10495 H HD3  . LYS A 1 67 ? -11.229 7.664   -4.103  1.00 0.12 ? 67  LYS A HD3  8  
ATOM   10496 H HE2  . LYS A 1 67 ? -13.231 8.876   -2.205  1.00 0.13 ? 67  LYS A HE2  8  
ATOM   10497 H HE3  . LYS A 1 67 ? -11.480 8.791   -2.009  1.00 0.12 ? 67  LYS A HE3  8  
ATOM   10498 H HZ1  . LYS A 1 67 ? -12.909 10.338  -4.105  1.00 0.14 ? 67  LYS A HZ1  8  
ATOM   10499 H HZ2  . LYS A 1 67 ? -11.231 10.264  -3.906  1.00 0.14 ? 67  LYS A HZ2  8  
ATOM   10500 H HZ3  . LYS A 1 67 ? -12.191 10.990  -2.718  1.00 0.14 ? 67  LYS A HZ3  8  
ATOM   10501 N N    . SER A 1 68 ? -9.990  6.554   -7.188  1.00 0.13 ? 68  SER A N    8  
ATOM   10502 C CA   . SER A 1 68 ? -8.960  5.607   -6.779  1.00 0.13 ? 68  SER A CA   8  
ATOM   10503 C C    . SER A 1 68 ? -7.821  6.321   -6.060  1.00 0.13 ? 68  SER A C    8  
ATOM   10504 O O    . SER A 1 68 ? -6.648  6.019   -6.277  1.00 0.13 ? 68  SER A O    8  
ATOM   10505 C CB   . SER A 1 68 ? -8.419  4.852   -7.995  1.00 0.13 ? 68  SER A CB   8  
ATOM   10506 O OG   . SER A 1 68 ? -8.307  5.709   -9.117  1.00 0.14 ? 68  SER A OG   8  
ATOM   10507 H H    . SER A 1 68 ? -9.786  7.211   -7.886  1.00 0.14 ? 68  SER A H    8  
ATOM   10508 H HA   . SER A 1 68 ? -9.412  4.899   -6.099  1.00 0.12 ? 68  SER A HA   8  
ATOM   10509 H HB2  . SER A 1 68 ? -7.442  4.456   -7.762  1.00 0.13 ? 68  SER A HB2  8  
ATOM   10510 H HB3  . SER A 1 68 ? -9.087  4.041   -8.240  1.00 0.13 ? 68  SER A HB3  8  
ATOM   10511 H HG   . SER A 1 68 ? -8.583  5.237   -9.908  1.00 0.15 ? 68  SER A HG   8  
ATOM   10512 N N    . GLY A 1 69 ? -8.174  7.273   -5.201  1.00 0.13 ? 69  GLY A N    8  
ATOM   10513 C CA   . GLY A 1 69 ? -7.171  8.018   -4.463  1.00 0.13 ? 69  GLY A CA   8  
ATOM   10514 C C    . GLY A 1 69 ? -6.291  7.120   -3.616  1.00 0.12 ? 69  GLY A C    8  
ATOM   10515 O O    . GLY A 1 69 ? -5.167  7.486   -3.276  1.00 0.13 ? 69  GLY A O    8  
ATOM   10516 H H    . GLY A 1 69 ? -9.124  7.470   -5.068  1.00 0.13 ? 69  GLY A H    8  
ATOM   10517 H HA2  . GLY A 1 69 ? -6.549  8.555   -5.163  1.00 0.14 ? 69  GLY A HA2  8  
ATOM   10518 H HA3  . GLY A 1 69 ? -7.667  8.728   -3.819  1.00 0.13 ? 69  GLY A HA3  8  
ATOM   10519 N N    . GLU A 1 70 ? -6.804  5.943   -3.272  1.00 0.11 ? 70  GLU A N    8  
ATOM   10520 C CA   . GLU A 1 70 ? -6.057  4.992   -2.456  1.00 0.10 ? 70  GLU A CA   8  
ATOM   10521 C C    . GLU A 1 70 ? -5.576  3.816   -3.297  1.00 0.10 ? 70  GLU A C    8  
ATOM   10522 O O    . GLU A 1 70 ? -4.584  3.163   -2.965  1.00 0.10 ? 70  GLU A O    8  
ATOM   10523 C CB   . GLU A 1 70 ? -6.923  4.487   -1.300  1.00 0.09 ? 70  GLU A CB   8  
ATOM   10524 C CG   . GLU A 1 70 ? -6.666  5.208   0.012   1.00 0.10 ? 70  GLU A CG   8  
ATOM   10525 C CD   . GLU A 1 70 ? -7.389  6.537   0.101   1.00 0.10 ? 70  GLU A CD   8  
ATOM   10526 O OE1  . GLU A 1 70 ? -7.415  7.127   1.202   1.00 0.11 ? 70  GLU A OE1  8  
ATOM   10527 O OE2  . GLU A 1 70 ? -7.927  6.989   -0.931  1.00 0.11 ? 70  GLU A OE2  8  
ATOM   10528 H H    . GLU A 1 70 ? -7.706  5.709   -3.572  1.00 0.11 ? 70  GLU A H    8  
ATOM   10529 H HA   . GLU A 1 70 ? -5.198  5.506   -2.053  1.00 0.11 ? 70  GLU A HA   8  
ATOM   10530 H HB2  . GLU A 1 70 ? -7.963  4.618   -1.560  1.00 0.09 ? 70  GLU A HB2  8  
ATOM   10531 H HB3  . GLU A 1 70 ? -6.728  3.436   -1.153  1.00 0.09 ? 70  GLU A HB3  8  
ATOM   10532 H HG2  . GLU A 1 70 ? -7.000  4.580   0.825   1.00 0.09 ? 70  GLU A HG2  8  
ATOM   10533 H HG3  . GLU A 1 70 ? -5.605  5.384   0.108   1.00 0.10 ? 70  GLU A HG3  8  
ATOM   10534 N N    . LEU A 1 71 ? -6.285  3.546   -4.388  1.00 0.10 ? 71  LEU A N    8  
ATOM   10535 C CA   . LEU A 1 71 ? -5.930  2.446   -5.279  1.00 0.10 ? 71  LEU A CA   8  
ATOM   10536 C C    . LEU A 1 71 ? -4.560  2.675   -5.909  1.00 0.11 ? 71  LEU A C    8  
ATOM   10537 O O    . LEU A 1 71 ? -3.707  1.787   -5.905  1.00 0.11 ? 71  LEU A O    8  
ATOM   10538 C CB   . LEU A 1 71 ? -6.987  2.289   -6.373  1.00 0.11 ? 71  LEU A CB   8  
ATOM   10539 C CG   . LEU A 1 71 ? -7.523  0.873   -6.593  1.00 0.10 ? 71  LEU A CG   8  
ATOM   10540 C CD1  . LEU A 1 71 ? -8.421  0.825   -7.818  1.00 0.11 ? 71  LEU A CD1  8  
ATOM   10541 C CD2  . LEU A 1 71 ? -6.372  -0.115  -6.733  1.00 0.10 ? 71  LEU A CD2  8  
ATOM   10542 H H    . LEU A 1 71 ? -7.064  4.100   -4.601  1.00 0.11 ? 71  LEU A H    8  
ATOM   10543 H HA   . LEU A 1 71 ? -5.895  1.542   -4.690  1.00 0.10 ? 71  LEU A HA   8  
ATOM   10544 H HB2  . LEU A 1 71 ? -7.822  2.928   -6.127  1.00 0.11 ? 71  LEU A HB2  8  
ATOM   10545 H HB3  . LEU A 1 71 ? -6.559  2.631   -7.304  1.00 0.12 ? 71  LEU A HB3  8  
ATOM   10546 H HG   . LEU A 1 71 ? -8.112  0.580   -5.737  1.00 0.10 ? 71  LEU A HG   8  
ATOM   10547 H HD11 . LEU A 1 71 ? -9.328  1.377   -7.620  1.00 0.11 ? 71  LEU A HD11 8  
ATOM   10548 H HD12 . LEU A 1 71 ? -8.667  -0.202  -8.045  1.00 0.11 ? 71  LEU A HD12 8  
ATOM   10549 H HD13 . LEU A 1 71 ? -7.908  1.267   -8.659  1.00 0.12 ? 71  LEU A HD13 8  
ATOM   10550 H HD21 . LEU A 1 71 ? -5.715  0.209   -7.527  1.00 0.11 ? 71  LEU A HD21 8  
ATOM   10551 H HD22 . LEU A 1 71 ? -6.764  -1.094  -6.967  1.00 0.10 ? 71  LEU A HD22 8  
ATOM   10552 H HD23 . LEU A 1 71 ? -5.821  -0.161  -5.806  1.00 0.10 ? 71  LEU A HD23 8  
ATOM   10553 N N    . LYS A 1 72 ? -4.355  3.870   -6.448  1.00 0.12 ? 72  LYS A N    8  
ATOM   10554 C CA   . LYS A 1 72 ? -3.087  4.220   -7.079  1.00 0.13 ? 72  LYS A CA   8  
ATOM   10555 C C    . LYS A 1 72 ? -1.916  3.922   -6.148  1.00 0.13 ? 72  LYS A C    8  
ATOM   10556 O O    . LYS A 1 72 ? -0.813  3.610   -6.601  1.00 0.14 ? 72  LYS A O    8  
ATOM   10557 C CB   . LYS A 1 72 ? -3.078  5.698   -7.470  1.00 0.14 ? 72  LYS A CB   8  
ATOM   10558 C CG   . LYS A 1 72 ? -3.920  6.010   -8.696  1.00 0.15 ? 72  LYS A CG   8  
ATOM   10559 C CD   . LYS A 1 72 ? -3.060  6.461   -9.864  1.00 0.16 ? 72  LYS A CD   8  
ATOM   10560 C CE   . LYS A 1 72 ? -2.448  7.831   -9.610  1.00 0.17 ? 72  LYS A CE   8  
ATOM   10561 N NZ   . LYS A 1 72 ? -2.735  8.781   -10.719 1.00 0.18 ? 72  LYS A NZ   8  
ATOM   10562 H H    . LYS A 1 72 ? -5.073  4.537   -6.419  1.00 0.12 ? 72  LYS A H    8  
ATOM   10563 H HA   . LYS A 1 72 ? -2.985  3.620   -7.971  1.00 0.14 ? 72  LYS A HA   8  
ATOM   10564 H HB2  . LYS A 1 72 ? -3.457  6.279   -6.642  1.00 0.14 ? 72  LYS A HB2  8  
ATOM   10565 H HB3  . LYS A 1 72 ? -2.061  5.999   -7.672  1.00 0.15 ? 72  LYS A HB3  8  
ATOM   10566 H HG2  . LYS A 1 72 ? -4.463  5.122   -8.983  1.00 0.15 ? 72  LYS A HG2  8  
ATOM   10567 H HG3  . LYS A 1 72 ? -4.619  6.797   -8.450  1.00 0.15 ? 72  LYS A HG3  8  
ATOM   10568 H HD2  . LYS A 1 72 ? -2.265  5.745   -10.010 1.00 0.17 ? 72  LYS A HD2  8  
ATOM   10569 H HD3  . LYS A 1 72 ? -3.673  6.509   -10.752 1.00 0.17 ? 72  LYS A HD3  8  
ATOM   10570 H HE2  . LYS A 1 72 ? -2.857  8.230   -8.693  1.00 0.17 ? 72  LYS A HE2  8  
ATOM   10571 H HE3  . LYS A 1 72 ? -1.378  7.721   -9.508  1.00 0.18 ? 72  LYS A HE3  8  
ATOM   10572 H HZ1  . LYS A 1 72 ? -3.762  8.904   -10.826 1.00 0.18 ? 72  LYS A HZ1  8  
ATOM   10573 H HZ2  . LYS A 1 72 ? -2.346  8.417   -11.611 1.00 0.19 ? 72  LYS A HZ2  8  
ATOM   10574 H HZ3  . LYS A 1 72 ? -2.305  9.706   -10.517 1.00 0.19 ? 72  LYS A HZ3  8  
ATOM   10575 N N    . THR A 1 73 ? -2.162  4.017   -4.846  1.00 0.13 ? 73  THR A N    8  
ATOM   10576 C CA   . THR A 1 73 ? -1.128  3.757   -3.852  1.00 0.13 ? 73  THR A CA   8  
ATOM   10577 C C    . THR A 1 73 ? -0.991  2.265   -3.578  1.00 0.12 ? 73  THR A C    8  
ATOM   10578 O O    . THR A 1 73 ? 0.117   1.738   -3.499  1.00 0.12 ? 73  THR A O    8  
ATOM   10579 C CB   . THR A 1 73 ? -1.426  4.486   -2.528  1.00 0.12 ? 73  THR A CB   8  
ATOM   10580 O OG1  . THR A 1 73 ? -1.999  5.771   -2.794  1.00 0.13 ? 73  THR A OG1  8  
ATOM   10581 C CG2  . THR A 1 73 ? -0.158  4.650   -1.704  1.00 0.13 ? 73  THR A CG2  8  
ATOM   10582 H H    . THR A 1 73 ? -3.059  4.272   -4.546  1.00 0.12 ? 73  THR A H    8  
ATOM   10583 H HA   . THR A 1 73 ? -0.191  4.130   -4.239  1.00 0.14 ? 73  THR A HA   8  
ATOM   10584 H HB   . THR A 1 73 ? -2.132  3.896   -1.960  1.00 0.12 ? 73  THR A HB   8  
ATOM   10585 H HG1  . THR A 1 73 ? -1.415  6.269   -3.372  1.00 0.15 ? 73  THR A HG1  8  
ATOM   10586 H HG21 . THR A 1 73 ? 0.595   5.147   -2.297  1.00 0.14 ? 73  THR A HG21 8  
ATOM   10587 H HG22 . THR A 1 73 ? 0.203   3.678   -1.401  1.00 0.13 ? 73  THR A HG22 8  
ATOM   10588 H HG23 . THR A 1 73 ? -0.374  5.243   -0.828  1.00 0.13 ? 73  THR A HG23 8  
ATOM   10589 N N    . TRP A 1 74 ? -2.126  1.588   -3.436  1.00 0.11 ? 74  TRP A N    8  
ATOM   10590 C CA   . TRP A 1 74 ? -2.132  0.153   -3.172  1.00 0.10 ? 74  TRP A CA   8  
ATOM   10591 C C    . TRP A 1 74 ? -1.444  -0.611  -4.297  1.00 0.11 ? 74  TRP A C    8  
ATOM   10592 O O    . TRP A 1 74 ? -0.540  -1.409  -4.057  1.00 0.11 ? 74  TRP A O    8  
ATOM   10593 C CB   . TRP A 1 74 ? -3.566  -0.348  -2.999  1.00 0.09 ? 74  TRP A CB   8  
ATOM   10594 C CG   . TRP A 1 74 ? -3.647  -1.797  -2.625  1.00 0.08 ? 74  TRP A CG   8  
ATOM   10595 C CD1  . TRP A 1 74 ? -4.393  -2.761  -3.242  1.00 0.08 ? 74  TRP A CD1  8  
ATOM   10596 C CD2  . TRP A 1 74 ? -2.960  -2.445  -1.551  1.00 0.08 ? 74  TRP A CD2  8  
ATOM   10597 N NE1  . TRP A 1 74 ? -4.211  -3.971  -2.614  1.00 0.07 ? 74  TRP A NE1  8  
ATOM   10598 C CE2  . TRP A 1 74 ? -3.335  -3.802  -1.572  1.00 0.07 ? 74  TRP A CE2  8  
ATOM   10599 C CE3  . TRP A 1 74 ? -2.063  -2.011  -0.570  1.00 0.08 ? 74  TRP A CE3  8  
ATOM   10600 C CZ2  . TRP A 1 74 ? -2.845  -4.727  -0.654  1.00 0.07 ? 74  TRP A CZ2  8  
ATOM   10601 C CZ3  . TRP A 1 74 ? -1.576  -2.929  0.342   1.00 0.08 ? 74  TRP A CZ3  8  
ATOM   10602 C CH2  . TRP A 1 74 ? -1.967  -4.272  0.294   1.00 0.08 ? 74  TRP A CH2  8  
ATOM   10603 H H    . TRP A 1 74 ? -2.978  2.064   -3.509  1.00 0.10 ? 74  TRP A H    8  
ATOM   10604 H HA   . TRP A 1 74 ? -1.588  -0.016  -2.255  1.00 0.10 ? 74  TRP A HA   8  
ATOM   10605 H HB2  . TRP A 1 74 ? -4.047  0.224   -2.221  1.00 0.08 ? 74  TRP A HB2  8  
ATOM   10606 H HB3  . TRP A 1 74 ? -4.103  -0.211  -3.926  1.00 0.09 ? 74  TRP A HB3  8  
ATOM   10607 H HD1  . TRP A 1 74 ? -5.029  -2.585  -4.095  1.00 0.08 ? 74  TRP A HD1  8  
ATOM   10608 H HE1  . TRP A 1 74 ? -4.637  -4.815  -2.870  1.00 0.07 ? 74  TRP A HE1  8  
ATOM   10609 H HE3  . TRP A 1 74 ? -1.749  -0.980  -0.516  1.00 0.09 ? 74  TRP A HE3  8  
ATOM   10610 H HZ2  . TRP A 1 74 ? -3.136  -5.766  -0.677  1.00 0.07 ? 74  TRP A HZ2  8  
ATOM   10611 H HZ3  . TRP A 1 74 ? -0.884  -2.611  1.106   1.00 0.09 ? 74  TRP A HZ3  8  
ATOM   10612 H HH2  . TRP A 1 74 ? -1.563  -4.954  1.028   1.00 0.08 ? 74  TRP A HH2  8  
ATOM   10613 N N    . GLY A 1 75 ? -1.879  -0.359  -5.529  1.00 0.11 ? 75  GLY A N    8  
ATOM   10614 C CA   . GLY A 1 75 ? -1.294  -1.032  -6.674  1.00 0.12 ? 75  GLY A CA   8  
ATOM   10615 C C    . GLY A 1 75 ? 0.219   -0.931  -6.696  1.00 0.13 ? 75  GLY A C    8  
ATOM   10616 O O    . GLY A 1 75 ? 0.908   -1.906  -6.994  1.00 0.13 ? 75  GLY A O    8  
ATOM   10617 H H    . GLY A 1 75 ? -2.602  0.290   -5.660  1.00 0.11 ? 75  GLY A H    8  
ATOM   10618 H HA2  . GLY A 1 75 ? -1.574  -2.075  -6.646  1.00 0.11 ? 75  GLY A HA2  8  
ATOM   10619 H HA3  . GLY A 1 75 ? -1.687  -0.589  -7.578  1.00 0.12 ? 75  GLY A HA3  8  
ATOM   10620 N N    . LEU A 1 76 ? 0.734   0.253   -6.381  1.00 0.13 ? 76  LEU A N    8  
ATOM   10621 C CA   . LEU A 1 76 ? 2.175   0.478   -6.369  1.00 0.14 ? 76  LEU A CA   8  
ATOM   10622 C C    . LEU A 1 76 ? 2.835   -0.281  -5.223  1.00 0.14 ? 76  LEU A C    8  
ATOM   10623 O O    . LEU A 1 76 ? 3.741   -1.085  -5.437  1.00 0.15 ? 76  LEU A O    8  
ATOM   10624 C CB   . LEU A 1 76 ? 2.476   1.974   -6.244  1.00 0.15 ? 76  LEU A CB   8  
ATOM   10625 C CG   . LEU A 1 76 ? 2.687   2.728   -7.558  1.00 0.16 ? 76  LEU A CG   8  
ATOM   10626 C CD1  . LEU A 1 76 ? 2.217   4.168   -7.428  1.00 0.17 ? 76  LEU A CD1  8  
ATOM   10627 C CD2  . LEU A 1 76 ? 4.153   2.678   -7.969  1.00 0.18 ? 76  LEU A CD2  8  
ATOM   10628 H H    . LEU A 1 76 ? 0.132   0.992   -6.152  1.00 0.13 ? 76  LEU A H    8  
ATOM   10629 H HA   . LEU A 1 76 ? 2.577   0.116   -7.303  1.00 0.15 ? 76  LEU A HA   8  
ATOM   10630 H HB2  . LEU A 1 76 ? 1.652   2.438   -5.721  1.00 0.15 ? 76  LEU A HB2  8  
ATOM   10631 H HB3  . LEU A 1 76 ? 3.366   2.087   -5.645  1.00 0.16 ? 76  LEU A HB3  8  
ATOM   10632 H HG   . LEU A 1 76 ? 2.105   2.254   -8.335  1.00 0.16 ? 76  LEU A HG   8  
ATOM   10633 H HD11 . LEU A 1 76 ? 1.160   4.183   -7.205  1.00 0.16 ? 76  LEU A HD11 8  
ATOM   10634 H HD12 . LEU A 1 76 ? 2.396   4.690   -8.357  1.00 0.18 ? 76  LEU A HD12 8  
ATOM   10635 H HD13 . LEU A 1 76 ? 2.760   4.654   -6.631  1.00 0.17 ? 76  LEU A HD13 8  
ATOM   10636 H HD21 . LEU A 1 76 ? 4.714   3.393   -7.388  1.00 0.17 ? 76  LEU A HD21 8  
ATOM   10637 H HD22 . LEU A 1 76 ? 4.240   2.917   -9.018  1.00 0.22 ? 76  LEU A HD22 8  
ATOM   10638 H HD23 . LEU A 1 76 ? 4.542   1.686   -7.793  1.00 0.25 ? 76  LEU A HD23 8  
ATOM   10639 N N    . VAL A 1 77 ? 2.371   -0.023  -4.003  1.00 0.14 ? 77  VAL A N    8  
ATOM   10640 C CA   . VAL A 1 77 ? 2.914   -0.685  -2.823  1.00 0.13 ? 77  VAL A CA   8  
ATOM   10641 C C    . VAL A 1 77 ? 2.822   -2.201  -2.953  1.00 0.13 ? 77  VAL A C    8  
ATOM   10642 O O    . VAL A 1 77 ? 3.581   -2.936  -2.320  1.00 0.13 ? 77  VAL A O    8  
ATOM   10643 C CB   . VAL A 1 77 ? 2.178   -0.243  -1.545  1.00 0.13 ? 77  VAL A CB   8  
ATOM   10644 C CG1  . VAL A 1 77 ? 2.686   -1.022  -0.341  1.00 0.13 ? 77  VAL A CG1  8  
ATOM   10645 C CG2  . VAL A 1 77 ? 2.340   1.253   -1.328  1.00 0.13 ? 77  VAL A CG2  8  
ATOM   10646 H H    . VAL A 1 77 ? 1.646   0.627   -3.896  1.00 0.13 ? 77  VAL A H    8  
ATOM   10647 H HA   . VAL A 1 77 ? 3.953   -0.403  -2.731  1.00 0.14 ? 77  VAL A HA   8  
ATOM   10648 H HB   . VAL A 1 77 ? 1.126   -0.456  -1.667  1.00 0.12 ? 77  VAL A HB   8  
ATOM   10649 H HG11 . VAL A 1 77 ? 2.391   -2.057  -0.433  1.00 0.15 ? 77  VAL A HG11 8  
ATOM   10650 H HG12 . VAL A 1 77 ? 2.265   -0.606  0.561   1.00 0.16 ? 77  VAL A HG12 8  
ATOM   10651 H HG13 . VAL A 1 77 ? 3.762   -0.958  -0.300  1.00 0.17 ? 77  VAL A HG13 8  
ATOM   10652 H HG21 . VAL A 1 77 ? 3.388   1.491   -1.221  1.00 0.14 ? 77  VAL A HG21 8  
ATOM   10653 H HG22 . VAL A 1 77 ? 1.812   1.545   -0.431  1.00 0.13 ? 77  VAL A HG22 8  
ATOM   10654 H HG23 . VAL A 1 77 ? 1.934   1.786   -2.175  1.00 0.14 ? 77  VAL A HG23 8  
ATOM   10655 N N    . LEU A 1 78 ? 1.886   -2.663  -3.775  1.00 0.12 ? 78  LEU A N    8  
ATOM   10656 C CA   . LEU A 1 78 ? 1.694   -4.092  -3.989  1.00 0.12 ? 78  LEU A CA   8  
ATOM   10657 C C    . LEU A 1 78 ? 2.638   -4.615  -5.066  1.00 0.13 ? 78  LEU A C    8  
ATOM   10658 O O    . LEU A 1 78 ? 3.292   -5.644  -4.888  1.00 0.13 ? 78  LEU A O    8  
ATOM   10659 C CB   . LEU A 1 78 ? 0.244   -4.379  -4.384  1.00 0.11 ? 78  LEU A CB   8  
ATOM   10660 C CG   . LEU A 1 78 ? -0.265  -5.791  -4.093  1.00 0.10 ? 78  LEU A CG   8  
ATOM   10661 C CD1  . LEU A 1 78 ? -0.595  -5.946  -2.618  1.00 0.09 ? 78  LEU A CD1  8  
ATOM   10662 C CD2  . LEU A 1 78 ? -1.482  -6.106  -4.950  1.00 0.09 ? 78  LEU A CD2  8  
ATOM   10663 H H    . LEU A 1 78 ? 1.309   -2.027  -4.248  1.00 0.12 ? 78  LEU A H    8  
ATOM   10664 H HA   . LEU A 1 78 ? 1.910   -4.599  -3.060  1.00 0.11 ? 78  LEU A HA   8  
ATOM   10665 H HB2  . LEU A 1 78 ? -0.391  -3.680  -3.860  1.00 0.10 ? 78  LEU A HB2  8  
ATOM   10666 H HB3  . LEU A 1 78 ? 0.145   -4.199  -5.444  1.00 0.11 ? 78  LEU A HB3  8  
ATOM   10667 H HG   . LEU A 1 78 ? 0.509   -6.503  -4.336  1.00 0.10 ? 78  LEU A HG   8  
ATOM   10668 H HD11 . LEU A 1 78 ? -1.374  -5.247  -2.348  1.00 0.08 ? 78  LEU A HD11 8  
ATOM   10669 H HD12 . LEU A 1 78 ? 0.286   -5.747  -2.028  1.00 0.10 ? 78  LEU A HD12 8  
ATOM   10670 H HD13 . LEU A 1 78 ? -0.935  -6.953  -2.428  1.00 0.09 ? 78  LEU A HD13 8  
ATOM   10671 H HD21 . LEU A 1 78 ? -1.198  -6.111  -5.992  1.00 0.10 ? 78  LEU A HD21 8  
ATOM   10672 H HD22 . LEU A 1 78 ? -2.240  -5.354  -4.788  1.00 0.09 ? 78  LEU A HD22 8  
ATOM   10673 H HD23 . LEU A 1 78 ? -1.873  -7.076  -4.678  1.00 0.09 ? 78  LEU A HD23 8  
ATOM   10674 N N    . GLY A 1 79 ? 2.711   -3.899  -6.183  1.00 0.13 ? 79  GLY A N    8  
ATOM   10675 C CA   . GLY A 1 79 ? 3.580   -4.304  -7.271  1.00 0.15 ? 79  GLY A CA   8  
ATOM   10676 C C    . GLY A 1 79 ? 5.002   -4.560  -6.811  1.00 0.15 ? 79  GLY A C    8  
ATOM   10677 O O    . GLY A 1 79 ? 5.723   -5.353  -7.415  1.00 0.16 ? 79  GLY A O    8  
ATOM   10678 H H    . GLY A 1 79 ? 2.168   -3.086  -6.269  1.00 0.13 ? 79  GLY A H    8  
ATOM   10679 H HA2  . GLY A 1 79 ? 3.188   -5.208  -7.713  1.00 0.14 ? 79  GLY A HA2  8  
ATOM   10680 H HA3  . GLY A 1 79 ? 3.590   -3.524  -8.018  1.00 0.15 ? 79  GLY A HA3  8  
ATOM   10681 N N    . ALA A 1 80 ? 5.406   -3.885  -5.739  1.00 0.15 ? 80  ALA A N    8  
ATOM   10682 C CA   . ALA A 1 80 ? 6.752   -4.046  -5.201  1.00 0.16 ? 80  ALA A CA   8  
ATOM   10683 C C    . ALA A 1 80 ? 6.832   -5.258  -4.280  1.00 0.16 ? 80  ALA A C    8  
ATOM   10684 O O    . ALA A 1 80 ? 7.675   -6.137  -4.469  1.00 0.17 ? 80  ALA A O    8  
ATOM   10685 C CB   . ALA A 1 80 ? 7.174   -2.787  -4.456  1.00 0.17 ? 80  ALA A CB   8  
ATOM   10686 H H    . ALA A 1 80 ? 4.786   -3.265  -5.303  1.00 0.15 ? 80  ALA A H    8  
ATOM   10687 H HA   . ALA A 1 80 ? 7.428   -4.189  -6.030  1.00 0.17 ? 80  ALA A HA   8  
ATOM   10688 H HB1  . ALA A 1 80 ? 6.542   -2.651  -3.591  1.00 0.16 ? 80  ALA A HB1  8  
ATOM   10689 H HB2  . ALA A 1 80 ? 7.077   -1.933  -5.110  1.00 0.18 ? 80  ALA A HB2  8  
ATOM   10690 H HB3  . ALA A 1 80 ? 8.202   -2.884  -4.141  1.00 0.18 ? 80  ALA A HB3  8  
ATOM   10691 N N    . LEU A 1 81 ? 5.956   -5.299  -3.283  1.00 0.15 ? 81  LEU A N    8  
ATOM   10692 C CA   . LEU A 1 81 ? 5.930   -6.404  -2.332  1.00 0.15 ? 81  LEU A CA   8  
ATOM   10693 C C    . LEU A 1 81 ? 5.749   -7.737  -3.053  1.00 0.14 ? 81  LEU A C    8  
ATOM   10694 O O    . LEU A 1 81 ? 6.427   -8.718  -2.746  1.00 0.15 ? 81  LEU A O    8  
ATOM   10695 C CB   . LEU A 1 81 ? 4.803   -6.203  -1.317  1.00 0.14 ? 81  LEU A CB   8  
ATOM   10696 C CG   . LEU A 1 81 ? 5.232   -5.740  0.077   1.00 0.14 ? 81  LEU A CG   8  
ATOM   10697 C CD1  . LEU A 1 81 ? 4.025   -5.628  0.997   1.00 0.13 ? 81  LEU A CD1  8  
ATOM   10698 C CD2  . LEU A 1 81 ? 6.264   -6.693  0.661   1.00 0.15 ? 81  LEU A CD2  8  
ATOM   10699 H H    . LEU A 1 81 ? 5.311   -4.568  -3.185  1.00 0.14 ? 81  LEU A H    8  
ATOM   10700 H HA   . LEU A 1 81 ? 6.874   -6.416  -1.812  1.00 0.15 ? 81  LEU A HA   8  
ATOM   10701 H HB2  . LEU A 1 81 ? 4.118   -5.471  -1.718  1.00 0.13 ? 81  LEU A HB2  8  
ATOM   10702 H HB3  . LEU A 1 81 ? 4.276   -7.139  -1.211  1.00 0.13 ? 81  LEU A HB3  8  
ATOM   10703 H HG   . LEU A 1 81 ? 5.684   -4.762  0.001   1.00 0.15 ? 81  LEU A HG   8  
ATOM   10704 H HD11 . LEU A 1 81 ? 3.809   -6.594  1.426   1.00 0.13 ? 81  LEU A HD11 8  
ATOM   10705 H HD12 . LEU A 1 81 ? 3.171   -5.287  0.430   1.00 0.12 ? 81  LEU A HD12 8  
ATOM   10706 H HD13 . LEU A 1 81 ? 4.239   -4.923  1.785   1.00 0.13 ? 81  LEU A HD13 8  
ATOM   10707 H HD21 . LEU A 1 81 ? 5.940   -7.712  0.507   1.00 0.14 ? 81  LEU A HD21 8  
ATOM   10708 H HD22 . LEU A 1 81 ? 6.367   -6.504  1.720   1.00 0.15 ? 81  LEU A HD22 8  
ATOM   10709 H HD23 . LEU A 1 81 ? 7.214   -6.538  0.174   1.00 0.16 ? 81  LEU A HD23 8  
ATOM   10710 N N    . LYS A 1 82 ? 4.830   -7.766  -4.010  1.00 0.14 ? 82  LYS A N    8  
ATOM   10711 C CA   . LYS A 1 82 ? 4.560   -8.977  -4.777  1.00 0.14 ? 82  LYS A CA   8  
ATOM   10712 C C    . LYS A 1 82 ? 5.851   -9.559  -5.345  1.00 0.15 ? 82  LYS A C    8  
ATOM   10713 O O    . LYS A 1 82 ? 5.985   -10.775 -5.483  1.00 0.15 ? 82  LYS A O    8  
ATOM   10714 C CB   . LYS A 1 82 ? 3.580   -8.677  -5.914  1.00 0.13 ? 82  LYS A CB   8  
ATOM   10715 C CG   . LYS A 1 82 ? 2.173   -9.187  -5.653  1.00 0.12 ? 82  LYS A CG   8  
ATOM   10716 C CD   . LYS A 1 82 ? 1.141   -8.412  -6.455  1.00 0.12 ? 82  LYS A CD   8  
ATOM   10717 C CE   . LYS A 1 82 ? -0.216  -9.100  -6.431  1.00 0.11 ? 82  LYS A CE   8  
ATOM   10718 N NZ   . LYS A 1 82 ? -0.577  -9.660  -7.763  1.00 0.12 ? 82  LYS A NZ   8  
ATOM   10719 H H    . LYS A 1 82 ? 4.320   -6.952  -4.207  1.00 0.13 ? 82  LYS A H    8  
ATOM   10720 H HA   . LYS A 1 82 ? 4.115   -9.700  -4.110  1.00 0.13 ? 82  LYS A HA   8  
ATOM   10721 H HB2  . LYS A 1 82 ? 3.531   -7.608  -6.058  1.00 0.13 ? 82  LYS A HB2  8  
ATOM   10722 H HB3  . LYS A 1 82 ? 3.945   -9.138  -6.820  1.00 0.14 ? 82  LYS A HB3  8  
ATOM   10723 H HG2  . LYS A 1 82 ? 2.120   -10.229 -5.931  1.00 0.12 ? 82  LYS A HG2  8  
ATOM   10724 H HG3  . LYS A 1 82 ? 1.951   -9.081  -4.601  1.00 0.12 ? 82  LYS A HG3  8  
ATOM   10725 H HD2  . LYS A 1 82 ? 1.040   -7.423  -6.035  1.00 0.12 ? 82  LYS A HD2  8  
ATOM   10726 H HD3  . LYS A 1 82 ? 1.478   -8.336  -7.479  1.00 0.13 ? 82  LYS A HD3  8  
ATOM   10727 H HE2  . LYS A 1 82 ? -0.186  -9.903  -5.709  1.00 0.11 ? 82  LYS A HE2  8  
ATOM   10728 H HE3  . LYS A 1 82 ? -0.965  -8.380  -6.137  1.00 0.10 ? 82  LYS A HE3  8  
ATOM   10729 H HZ1  . LYS A 1 82 ? -1.506  -10.126 -7.715  1.00 0.11 ? 82  LYS A HZ1  8  
ATOM   10730 H HZ2  . LYS A 1 82 ? 0.133   -10.358 -8.061  1.00 0.12 ? 82  LYS A HZ2  8  
ATOM   10731 H HZ3  . LYS A 1 82 ? -0.618  -8.900  -8.471  1.00 0.12 ? 82  LYS A HZ3  8  
ATOM   10732 N N    . ALA A 1 83 ? 6.796   -8.684  -5.671  1.00 0.16 ? 83  ALA A N    8  
ATOM   10733 C CA   . ALA A 1 83 ? 8.077   -9.113  -6.220  1.00 0.17 ? 83  ALA A CA   8  
ATOM   10734 C C    . ALA A 1 83 ? 9.048   -9.498  -5.109  1.00 0.18 ? 83  ALA A C    8  
ATOM   10735 O O    . ALA A 1 83 ? 9.920   -10.345 -5.301  1.00 0.19 ? 83  ALA A O    8  
ATOM   10736 C CB   . ALA A 1 83 ? 8.672   -8.016  -7.088  1.00 0.18 ? 83  ALA A CB   8  
ATOM   10737 H H    . ALA A 1 83 ? 6.629   -7.728  -5.540  1.00 0.16 ? 83  ALA A H    8  
ATOM   10738 H HA   . ALA A 1 83 ? 7.900   -9.977  -6.843  1.00 0.17 ? 83  ALA A HA   8  
ATOM   10739 H HB1  . ALA A 1 83 ? 8.869   -7.143  -6.483  1.00 0.18 ? 83  ALA A HB1  8  
ATOM   10740 H HB2  . ALA A 1 83 ? 7.976   -7.759  -7.872  1.00 0.18 ? 83  ALA A HB2  8  
ATOM   10741 H HB3  . ALA A 1 83 ? 9.596   -8.365  -7.527  1.00 0.19 ? 83  ALA A HB3  8  
ATOM   10742 N N    . ALA A 1 84 ? 8.894   -8.869  -3.949  1.00 0.17 ? 84  ALA A N    8  
ATOM   10743 C CA   . ALA A 1 84 ? 9.758   -9.146  -2.808  1.00 0.18 ? 84  ALA A CA   8  
ATOM   10744 C C    . ALA A 1 84 ? 9.429   -10.500 -2.189  1.00 0.18 ? 84  ALA A C    8  
ATOM   10745 O O    . ALA A 1 84 ? 10.273  -11.117 -1.539  1.00 0.18 ? 84  ALA A O    8  
ATOM   10746 C CB   . ALA A 1 84 ? 9.631   -8.041  -1.769  1.00 0.18 ? 84  ALA A CB   8  
ATOM   10747 H H    . ALA A 1 84 ? 8.181   -8.201  -3.858  1.00 0.17 ? 84  ALA A H    8  
ATOM   10748 H HA   . ALA A 1 84 ? 10.779  -9.162  -3.160  1.00 0.19 ? 84  ALA A HA   8  
ATOM   10749 H HB1  . ALA A 1 84 ? 10.318  -8.231  -0.957  1.00 0.19 ? 84  ALA A HB1  8  
ATOM   10750 H HB2  . ALA A 1 84 ? 8.621   -8.020  -1.388  1.00 0.17 ? 84  ALA A HB2  8  
ATOM   10751 H HB3  . ALA A 1 84 ? 9.864   -7.091  -2.223  1.00 0.18 ? 84  ALA A HB3  8  
ATOM   10752 N N    . ARG A 1 85 ? 8.197   -10.955 -2.391  1.00 0.16 ? 85  ARG A N    8  
ATOM   10753 C CA   . ARG A 1 85 ? 7.756   -12.235 -1.850  1.00 0.16 ? 85  ARG A CA   8  
ATOM   10754 C C    . ARG A 1 85 ? 7.735   -13.306 -2.936  1.00 0.16 ? 85  ARG A C    8  
ATOM   10755 O O    . ARG A 1 85 ? 7.040   -14.316 -2.811  1.00 0.16 ? 85  ARG A O    8  
ATOM   10756 C CB   . ARG A 1 85 ? 6.367   -12.097 -1.225  1.00 0.15 ? 85  ARG A CB   8  
ATOM   10757 C CG   . ARG A 1 85 ? 6.324   -11.154 -0.034  1.00 0.15 ? 85  ARG A CG   8  
ATOM   10758 C CD   . ARG A 1 85 ? 4.938   -11.104 0.590   1.00 0.14 ? 85  ARG A CD   8  
ATOM   10759 N NE   . ARG A 1 85 ? 4.992   -11.126 2.048   1.00 0.14 ? 85  ARG A NE   8  
ATOM   10760 C CZ   . ARG A 1 85 ? 5.382   -12.183 2.754   1.00 0.14 ? 85  ARG A CZ   8  
ATOM   10761 N NH1  . ARG A 1 85 ? 5.748   -13.296 2.137   1.00 0.15 ? 85  ARG A NH1  8  
ATOM   10762 N NH2  . ARG A 1 85 ? 5.403   -12.125 4.080   1.00 0.15 ? 85  ARG A NH2  8  
ATOM   10763 H H    . ARG A 1 85 ? 7.570   -10.417 -2.918  1.00 0.16 ? 85  ARG A H    8  
ATOM   10764 H HA   . ARG A 1 85 ? 8.458   -12.530 -1.085  1.00 0.17 ? 85  ARG A HA   8  
ATOM   10765 H HB2  . ARG A 1 85 ? 5.683   -11.727 -1.974  1.00 0.14 ? 85  ARG A HB2  8  
ATOM   10766 H HB3  . ARG A 1 85 ? 6.035   -13.071 -0.897  1.00 0.15 ? 85  ARG A HB3  8  
ATOM   10767 H HG2  . ARG A 1 85 ? 7.029   -11.496 0.710   1.00 0.15 ? 85  ARG A HG2  8  
ATOM   10768 H HG3  . ARG A 1 85 ? 6.598   -10.162 -0.362  1.00 0.15 ? 85  ARG A HG3  8  
ATOM   10769 H HD2  . ARG A 1 85 ? 4.447   -10.197 0.271   1.00 0.13 ? 85  ARG A HD2  8  
ATOM   10770 H HD3  . ARG A 1 85 ? 4.373   -11.957 0.245   1.00 0.13 ? 85  ARG A HD3  8  
ATOM   10771 H HE   . ARG A 1 85 ? 4.724   -10.313 2.524   1.00 0.14 ? 85  ARG A HE   8  
ATOM   10772 H HH11 . ARG A 1 85 ? 6.040   -14.090 2.670   1.00 0.15 ? 85  ARG A HH11 8  
ATOM   10773 H HH12 . ARG A 1 85 ? 5.732   -13.344 1.138   1.00 0.15 ? 85  ARG A HH12 8  
ATOM   10774 H HH21 . ARG A 1 85 ? 5.126   -11.286 4.549   1.00 0.15 ? 85  ARG A HH21 8  
ATOM   10775 H HH22 . ARG A 1 85 ? 5.697   -12.920 4.610   1.00 0.15 ? 85  ARG A HH22 8  
ATOM   10776 N N    . GLU A 1 86 ? 8.497   -13.079 -4.000  1.00 0.17 ? 86  GLU A N    8  
ATOM   10777 C CA   . GLU A 1 86 ? 8.563   -14.024 -5.109  1.00 0.17 ? 86  GLU A CA   8  
ATOM   10778 C C    . GLU A 1 86 ? 9.973   -14.587 -5.260  1.00 0.19 ? 86  GLU A C    8  
ATOM   10779 O O    . GLU A 1 86 ? 10.154  -15.724 -5.695  1.00 0.19 ? 86  GLU A O    8  
ATOM   10780 C CB   . GLU A 1 86 ? 8.128   -13.348 -6.411  1.00 0.17 ? 86  GLU A CB   8  
ATOM   10781 C CG   . GLU A 1 86 ? 6.719   -13.713 -6.844  1.00 0.16 ? 86  GLU A CG   8  
ATOM   10782 C CD   . GLU A 1 86 ? 6.365   -13.155 -8.210  1.00 0.17 ? 86  GLU A CD   8  
ATOM   10783 O OE1  . GLU A 1 86 ? 7.004   -13.565 -9.201  1.00 0.18 ? 86  GLU A OE1  8  
ATOM   10784 O OE2  . GLU A 1 86 ? 5.450   -12.308 -8.286  1.00 0.16 ? 86  GLU A OE2  8  
ATOM   10785 H H    . GLU A 1 86 ? 9.028   -12.257 -4.041  1.00 0.17 ? 86  GLU A H    8  
ATOM   10786 H HA   . GLU A 1 86 ? 7.885   -14.836 -4.892  1.00 0.17 ? 86  GLU A HA   8  
ATOM   10787 H HB2  . GLU A 1 86 ? 8.175   -12.277 -6.280  1.00 0.17 ? 86  GLU A HB2  8  
ATOM   10788 H HB3  . GLU A 1 86 ? 8.809   -13.636 -7.197  1.00 0.18 ? 86  GLU A HB3  8  
ATOM   10789 H HG2  . GLU A 1 86 ? 6.634   -14.789 -6.879  1.00 0.17 ? 86  GLU A HG2  8  
ATOM   10790 H HG3  . GLU A 1 86 ? 6.020   -13.322 -6.119  1.00 0.16 ? 86  GLU A HG3  8  
ATOM   10791 N N    . GLU A 1 87 ? 10.968  -13.781 -4.901  1.00 0.19 ? 87  GLU A N    8  
ATOM   10792 C CA   . GLU A 1 87 ? 12.361  -14.198 -4.998  1.00 0.21 ? 87  GLU A CA   8  
ATOM   10793 C C    . GLU A 1 87 ? 12.740  -15.108 -3.835  1.00 0.21 ? 87  GLU A C    8  
ATOM   10794 O O    . GLU A 1 87 ? 13.796  -15.739 -3.845  1.00 0.22 ? 87  GLU A O    8  
ATOM   10795 C CB   . GLU A 1 87 ? 13.281  -12.977 -5.026  1.00 0.21 ? 87  GLU A CB   8  
ATOM   10796 C CG   . GLU A 1 87 ? 13.715  -12.572 -6.423  1.00 0.22 ? 87  GLU A CG   8  
ATOM   10797 C CD   . GLU A 1 87 ? 15.222  -12.485 -6.564  1.00 0.24 ? 87  GLU A CD   8  
ATOM   10798 O OE1  . GLU A 1 87 ? 15.830  -13.467 -7.041  1.00 0.24 ? 87  GLU A OE1  8  
ATOM   10799 O OE2  . GLU A 1 87 ? 15.795  -11.437 -6.199  1.00 0.24 ? 87  GLU A OE2  8  
ATOM   10800 O OXT  . GLU A 1 87 ? 11.977  -15.177 -2.824  1.00 0.20 ? 87  GLU A OXT  8  
ATOM   10801 H H    . GLU A 1 87 ? 10.760  -12.887 -4.562  1.00 0.19 ? 87  GLU A H    8  
ATOM   10802 H HA   . GLU A 1 87 ? 12.479  -14.746 -5.920  1.00 0.21 ? 87  GLU A HA   8  
ATOM   10803 H HB2  . GLU A 1 87 ? 12.765  -12.141 -4.576  1.00 0.21 ? 87  GLU A HB2  8  
ATOM   10804 H HB3  . GLU A 1 87 ? 14.167  -13.194 -4.446  1.00 0.22 ? 87  GLU A HB3  8  
ATOM   10805 H HG2  . GLU A 1 87 ? 13.345  -13.301 -7.128  1.00 0.22 ? 87  GLU A HG2  8  
ATOM   10806 H HG3  . GLU A 1 87 ? 13.291  -11.604 -6.652  1.00 0.22 ? 87  GLU A HG3  8  
HETATM 10807 C C1   . I3P B 2 .  ? 11.395  9.470   1.094   1.00 0.80 ? 101 I3P A C1   8  
HETATM 10808 C C2   . I3P B 2 .  ? 11.274  10.214  2.442   1.00 0.90 ? 101 I3P A C2   8  
HETATM 10809 C C3   . I3P B 2 .  ? 11.085  11.725  2.201   1.00 0.87 ? 101 I3P A C3   8  
HETATM 10810 C C4   . I3P B 2 .  ? 9.840   11.993  1.326   1.00 0.99 ? 101 I3P A C4   8  
HETATM 10811 C C5   . I3P B 2 .  ? 9.957   11.241  -0.019  1.00 0.89 ? 101 I3P A C5   8  
HETATM 10812 C C6   . I3P B 2 .  ? 10.151  9.727   0.220   1.00 0.77 ? 101 I3P A C6   8  
HETATM 10813 O O1   . I3P B 2 .  ? 11.513  8.079   1.324   1.00 1.09 ? 101 I3P A O1   8  
HETATM 10814 O O2   . I3P B 2 .  ? 10.184  9.715   3.183   1.00 1.13 ? 101 I3P A O2   8  
HETATM 10815 O O3   . I3P B 2 .  ? 10.959  12.377  3.438   1.00 1.18 ? 101 I3P A O3   8  
HETATM 10816 O O4   . I3P B 2 .  ? 9.754   13.381  1.063   1.00 1.27 ? 101 I3P A O4   8  
HETATM 10817 O O5   . I3P B 2 .  ? 8.767   11.435  -0.760  1.00 1.24 ? 101 I3P A O5   8  
HETATM 10818 O O6   . I3P B 2 .  ? 10.314  9.066   -1.009  1.00 0.95 ? 101 I3P A O6   8  
HETATM 10819 P P1   . I3P B 2 .  ? 13.180  7.569   1.144   1.00 1.49 ? 101 I3P A P1   8  
HETATM 10820 O O11  . I3P B 2 .  ? 13.796  7.913   -0.443  1.00 1.57 ? 101 I3P A O11  8  
HETATM 10821 O O12  . I3P B 2 .  ? 14.038  8.347   2.178   1.00 1.59 ? 101 I3P A O12  8  
HETATM 10822 O O13  . I3P B 2 .  ? 13.339  5.881   1.516   1.00 1.97 ? 101 I3P A O13  8  
HETATM 10823 P P4   . I3P B 2 .  ? 8.260   14.036  1.703   1.00 1.78 ? 101 I3P A P4   8  
HETATM 10824 O O41  . I3P B 2 .  ? 7.082   13.398  0.920   1.00 1.94 ? 101 I3P A O41  8  
HETATM 10825 O O42  . I3P B 2 .  ? 8.046   13.664  3.386   1.00 1.90 ? 101 I3P A O42  8  
HETATM 10826 O O43  . I3P B 2 .  ? 8.174   15.748  1.436   1.00 2.20 ? 101 I3P A O43  8  
HETATM 10827 P P5   . I3P B 2 .  ? 9.092   12.350  -2.219  1.00 1.58 ? 101 I3P A P5   8  
HETATM 10828 O O51  . I3P B 2 .  ? 9.970   11.467  -3.148  1.00 1.56 ? 101 I3P A O51  8  
HETATM 10829 O O52  . I3P B 2 .  ? 7.622   12.677  -3.080  1.00 2.10 ? 101 I3P A O52  8  
HETATM 10830 O O53  . I3P B 2 .  ? 9.961   13.817  -1.900  1.00 1.65 ? 101 I3P A O53  8  
HETATM 10831 H H1   . I3P B 2 .  ? 12.268  9.852   0.554   1.00 0.84 ? 101 I3P A H1   8  
HETATM 10832 H H2   . I3P B 2 .  ? 12.190  10.062  3.018   1.00 1.09 ? 101 I3P A H2   8  
HETATM 10833 H H3   . I3P B 2 .  ? 11.970  12.114  1.688   1.00 0.81 ? 101 I3P A H3   8  
HETATM 10834 H H4   . I3P B 2 .  ? 8.951   11.637  1.852   1.00 1.17 ? 101 I3P A H4   8  
HETATM 10835 H H5   . I3P B 2 .  ? 10.829  11.620  -0.561  1.00 0.89 ? 101 I3P A H5   8  
HETATM 10836 H H6   . I3P B 2 .  ? 9.265   9.325   0.717   1.00 0.90 ? 101 I3P A H6   8  
HETATM 10837 H HO2  . I3P B 2 .  ? 9.848   8.935   2.706   1.00 1.23 ? 101 I3P A HO2  8  
HETATM 10838 H HO3  . I3P B 2 .  ? 10.562  13.252  3.265   1.00 1.33 ? 101 I3P A HO3  8  
HETATM 10839 H HO6  . I3P B 2 .  ? 9.717   9.492   -1.653  1.00 1.04 ? 101 I3P A HO6  8  
HETATM 10840 H HO13 . I3P B 2 .  ? 14.275  5.624   1.443   1.00 2.23 ? 101 I3P A HO13 8  
ATOM   10841 N N    . SER A 1 1  ? 3.744   3.303   11.561  1.00 0.76 ? 1   SER A N    9  
ATOM   10842 C CA   . SER A 1 1  ? 3.475   4.439   12.435  1.00 0.88 ? 1   SER A CA   9  
ATOM   10843 C C    . SER A 1 1  ? 4.566   5.497   12.303  1.00 0.88 ? 1   SER A C    9  
ATOM   10844 O O    . SER A 1 1  ? 4.344   6.672   12.591  1.00 0.98 ? 1   SER A O    9  
ATOM   10845 C CB   . SER A 1 1  ? 3.370   3.976   13.889  1.00 0.96 ? 1   SER A CB   9  
ATOM   10846 O OG   . SER A 1 1  ? 2.018   3.782   14.267  1.00 1.05 ? 1   SER A OG   9  
ATOM   10847 H H1   . SER A 1 1  ? 3.790   3.618   10.571  1.00 0.73 ? 1   SER A H1   9  
ATOM   10848 H H2   . SER A 1 1  ? 2.987   2.596   11.653  1.00 0.79 ? 1   SER A H2   9  
ATOM   10849 H H3   . SER A 1 1  ? 4.649   2.861   11.816  1.00 0.72 ? 1   SER A H3   9  
ATOM   10850 H HA   . SER A 1 1  ? 2.533   4.877   12.138  1.00 0.95 ? 1   SER A HA   9  
ATOM   10851 H HB2  . SER A 1 1  ? 3.900   3.043   14.008  1.00 0.91 ? 1   SER A HB2  9  
ATOM   10852 H HB3  . SER A 1 1  ? 3.807   4.723   14.535  1.00 1.02 ? 1   SER A HB3  9  
ATOM   10853 H HG   . SER A 1 1  ? 1.804   4.361   15.002  1.00 1.13 ? 1   SER A HG   9  
ATOM   10854 N N    . GLU A 1 2  ? 5.747   5.068   11.866  1.00 0.79 ? 2   GLU A N    9  
ATOM   10855 C CA   . GLU A 1 2  ? 6.874   5.979   11.698  1.00 0.83 ? 2   GLU A CA   9  
ATOM   10856 C C    . GLU A 1 2  ? 8.056   5.264   11.050  1.00 0.76 ? 2   GLU A C    9  
ATOM   10857 O O    . GLU A 1 2  ? 8.787   5.849   10.251  1.00 0.77 ? 2   GLU A O    9  
ATOM   10858 C CB   . GLU A 1 2  ? 7.291   6.564   13.047  1.00 0.96 ? 2   GLU A CB   9  
ATOM   10859 C CG   . GLU A 1 2  ? 7.978   5.561   13.959  1.00 0.99 ? 2   GLU A CG   9  
ATOM   10860 C CD   . GLU A 1 2  ? 8.407   6.169   15.281  1.00 1.14 ? 2   GLU A CD   9  
ATOM   10861 O OE1  . GLU A 1 2  ? 8.860   7.334   15.275  1.00 1.22 ? 2   GLU A OE1  9  
ATOM   10862 O OE2  . GLU A 1 2  ? 8.288   5.483   16.316  1.00 1.19 ? 2   GLU A OE2  9  
ATOM   10863 H H    . GLU A 1 2  ? 5.864   4.120   11.653  1.00 0.72 ? 2   GLU A H    9  
ATOM   10864 H HA   . GLU A 1 2  ? 6.556   6.782   11.050  1.00 0.86 ? 2   GLU A HA   9  
ATOM   10865 H HB2  . GLU A 1 2  ? 7.971   7.386   12.875  1.00 1.02 ? 2   GLU A HB2  9  
ATOM   10866 H HB3  . GLU A 1 2  ? 6.412   6.935   13.553  1.00 1.02 ? 2   GLU A HB3  9  
ATOM   10867 H HG2  . GLU A 1 2  ? 7.295   4.748   14.159  1.00 0.95 ? 2   GLU A HG2  9  
ATOM   10868 H HG3  . GLU A 1 2  ? 8.854   5.177   13.455  1.00 0.95 ? 2   GLU A HG3  9  
ATOM   10869 N N    . ALA A 1 3  ? 8.239   3.996   11.404  1.00 0.72 ? 3   ALA A N    9  
ATOM   10870 C CA   . ALA A 1 3  ? 9.333   3.202   10.857  1.00 0.70 ? 3   ALA A CA   9  
ATOM   10871 C C    . ALA A 1 3  ? 8.867   2.374   9.665   1.00 0.57 ? 3   ALA A C    9  
ATOM   10872 O O    . ALA A 1 3  ? 9.509   2.361   8.615   1.00 0.56 ? 3   ALA A O    9  
ATOM   10873 C CB   . ALA A 1 3  ? 9.919   2.300   11.933  1.00 0.79 ? 3   ALA A CB   9  
ATOM   10874 H H    . ALA A 1 3  ? 7.629   3.586   12.050  1.00 0.73 ? 3   ALA A H    9  
ATOM   10875 H HA   . ALA A 1 3  ? 10.108  3.882   10.530  1.00 0.75 ? 3   ALA A HA   9  
ATOM   10876 H HB1  . ALA A 1 3  ? 10.243  2.901   12.770  1.00 0.89 ? 3   ALA A HB1  9  
ATOM   10877 H HB2  . ALA A 1 3  ? 10.762  1.759   11.530  1.00 0.82 ? 3   ALA A HB2  9  
ATOM   10878 H HB3  . ALA A 1 3  ? 9.166   1.599   12.264  1.00 0.76 ? 3   ALA A HB3  9  
ATOM   10879 N N    . VAL A 1 4  ? 7.750   1.665   9.835   1.00 0.52 ? 4   VAL A N    9  
ATOM   10880 C CA   . VAL A 1 4  ? 7.208   0.805   8.777   1.00 0.45 ? 4   VAL A CA   9  
ATOM   10881 C C    . VAL A 1 4  ? 7.048   1.549   7.453   1.00 0.43 ? 4   VAL A C    9  
ATOM   10882 O O    . VAL A 1 4  ? 7.242   0.967   6.386   1.00 0.44 ? 4   VAL A O    9  
ATOM   10883 C CB   . VAL A 1 4  ? 5.857   0.192   9.184   1.00 0.49 ? 4   VAL A CB   9  
ATOM   10884 C CG1  . VAL A 1 4  ? 5.259   -0.597  8.027   1.00 0.55 ? 4   VAL A CG1  9  
ATOM   10885 C CG2  . VAL A 1 4  ? 6.025   -0.694  10.409  1.00 0.62 ? 4   VAL A CG2  9  
ATOM   10886 H H    . VAL A 1 4  ? 7.280   1.717   10.692  1.00 0.57 ? 4   VAL A H    9  
ATOM   10887 H HA   . VAL A 1 4  ? 7.907   -0.004  8.630   1.00 0.46 ? 4   VAL A HA   9  
ATOM   10888 H HB   . VAL A 1 4  ? 5.179   0.994   9.435   1.00 0.59 ? 4   VAL A HB   9  
ATOM   10889 H HG11 . VAL A 1 4  ? 5.164   0.045   7.164   1.00 0.62 ? 4   VAL A HG11 9  
ATOM   10890 H HG12 . VAL A 1 4  ? 4.284   -0.967  8.309   1.00 0.62 ? 4   VAL A HG12 9  
ATOM   10891 H HG13 . VAL A 1 4  ? 5.904   -1.429  7.787   1.00 0.62 ? 4   VAL A HG13 9  
ATOM   10892 H HG21 . VAL A 1 4  ? 5.088   -1.184  10.630  1.00 0.68 ? 4   VAL A HG21 9  
ATOM   10893 H HG22 . VAL A 1 4  ? 6.322   -0.089  11.253  1.00 0.78 ? 4   VAL A HG22 9  
ATOM   10894 H HG23 . VAL A 1 4  ? 6.783   -1.438  10.214  1.00 0.70 ? 4   VAL A HG23 9  
ATOM   10895 N N    . ILE A 1 5  ? 6.703   2.833   7.539   1.00 0.45 ? 5   ILE A N    9  
ATOM   10896 C CA   . ILE A 1 5  ? 6.521   3.670   6.357   1.00 0.48 ? 5   ILE A CA   9  
ATOM   10897 C C    . ILE A 1 5  ? 7.833   3.822   5.587   1.00 0.46 ? 5   ILE A C    9  
ATOM   10898 O O    . ILE A 1 5  ? 7.836   3.875   4.357   1.00 0.57 ? 5   ILE A O    9  
ATOM   10899 C CB   . ILE A 1 5  ? 5.988   5.066   6.744   1.00 0.56 ? 5   ILE A CB   9  
ATOM   10900 C CG1  . ILE A 1 5  ? 4.765   4.935   7.658   1.00 0.73 ? 5   ILE A CG1  9  
ATOM   10901 C CG2  . ILE A 1 5  ? 5.638   5.869   5.498   1.00 0.81 ? 5   ILE A CG2  9  
ATOM   10902 C CD1  . ILE A 1 5  ? 4.283   6.256   8.221   1.00 0.82 ? 5   ILE A CD1  9  
ATOM   10903 H H    . ILE A 1 5  ? 6.569   3.228   8.424   1.00 0.48 ? 5   ILE A H    9  
ATOM   10904 H HA   . ILE A 1 5  ? 5.792   3.192   5.719   1.00 0.50 ? 5   ILE A HA   9  
ATOM   10905 H HB   . ILE A 1 5  ? 6.769   5.592   7.273   1.00 0.65 ? 5   ILE A HB   9  
ATOM   10906 H HG12 . ILE A 1 5  ? 3.952   4.498   7.099   1.00 0.89 ? 5   ILE A HG12 9  
ATOM   10907 H HG13 . ILE A 1 5  ? 5.013   4.290   8.488   1.00 0.89 ? 5   ILE A HG13 9  
ATOM   10908 H HG21 . ILE A 1 5  ? 4.870   5.353   4.941   1.00 0.99 ? 5   ILE A HG21 9  
ATOM   10909 H HG22 . ILE A 1 5  ? 6.517   5.979   4.881   1.00 0.98 ? 5   ILE A HG22 9  
ATOM   10910 H HG23 . ILE A 1 5  ? 5.278   6.846   5.788   1.00 0.91 ? 5   ILE A HG23 9  
ATOM   10911 H HD11 . ILE A 1 5  ? 4.071   6.936   7.411   1.00 0.92 ? 5   ILE A HD11 9  
ATOM   10912 H HD12 . ILE A 1 5  ? 5.050   6.677   8.854   1.00 0.99 ? 5   ILE A HD12 9  
ATOM   10913 H HD13 . ILE A 1 5  ? 3.386   6.094   8.800   1.00 1.11 ? 5   ILE A HD13 9  
ATOM   10914 N N    . LYS A 1 6  ? 8.947   3.881   6.318   1.00 0.44 ? 6   LYS A N    9  
ATOM   10915 C CA   . LYS A 1 6  ? 10.265  4.015   5.704   1.00 0.45 ? 6   LYS A CA   9  
ATOM   10916 C C    . LYS A 1 6  ? 10.730  2.679   5.128   1.00 0.41 ? 6   LYS A C    9  
ATOM   10917 O O    . LYS A 1 6  ? 11.452  2.650   4.131   1.00 0.42 ? 6   LYS A O    9  
ATOM   10918 C CB   . LYS A 1 6  ? 11.288  4.545   6.713   1.00 0.52 ? 6   LYS A CB   9  
ATOM   10919 C CG   . LYS A 1 6  ? 11.029  5.979   7.166   1.00 0.78 ? 6   LYS A CG   9  
ATOM   10920 C CD   . LYS A 1 6  ? 11.055  6.967   6.003   1.00 1.08 ? 6   LYS A CD   9  
ATOM   10921 C CE   . LYS A 1 6  ? 12.436  7.060   5.366   1.00 1.30 ? 6   LYS A CE   9  
ATOM   10922 N NZ   . LYS A 1 6  ? 12.470  8.057   4.258   1.00 1.91 ? 6   LYS A NZ   9  
ATOM   10923 H H    . LYS A 1 6  ? 8.880   3.827   7.295   1.00 0.51 ? 6   LYS A H    9  
ATOM   10924 H HA   . LYS A 1 6  ? 10.174  4.723   4.894   1.00 0.46 ? 6   LYS A HA   9  
ATOM   10925 H HB2  . LYS A 1 6  ? 11.277  3.909   7.584   1.00 0.72 ? 6   LYS A HB2  9  
ATOM   10926 H HB3  . LYS A 1 6  ? 12.269  4.506   6.264   1.00 0.62 ? 6   LYS A HB3  9  
ATOM   10927 H HG2  . LYS A 1 6  ? 10.058  6.024   7.636   1.00 1.09 ? 6   LYS A HG2  9  
ATOM   10928 H HG3  . LYS A 1 6  ? 11.788  6.260   7.880   1.00 0.83 ? 6   LYS A HG3  9  
ATOM   10929 H HD2  . LYS A 1 6  ? 10.348  6.648   5.254   1.00 1.25 ? 6   LYS A HD2  9  
ATOM   10930 H HD3  . LYS A 1 6  ? 10.774  7.944   6.370   1.00 1.41 ? 6   LYS A HD3  9  
ATOM   10931 H HE2  . LYS A 1 6  ? 13.149  7.353   6.122   1.00 1.39 ? 6   LYS A HE2  9  
ATOM   10932 H HE3  . LYS A 1 6  ? 12.705  6.091   4.975   1.00 1.37 ? 6   LYS A HE3  9  
ATOM   10933 H HZ1  . LYS A 1 6  ? 11.789  7.792   3.517   1.00 2.23 ? 6   LYS A HZ1  9  
ATOM   10934 H HZ2  . LYS A 1 6  ? 13.421  8.094   3.840   1.00 2.11 ? 6   LYS A HZ2  9  
ATOM   10935 H HZ3  . LYS A 1 6  ? 12.224  9.002   4.618   1.00 2.10 ? 6   LYS A HZ3  9  
ATOM   10936 N N    . VAL A 1 7  ? 10.323  1.574   5.764   1.00 0.40 ? 7   VAL A N    9  
ATOM   10937 C CA   . VAL A 1 7  ? 10.670  0.244   5.281   1.00 0.41 ? 7   VAL A CA   9  
ATOM   10938 C C    . VAL A 1 7  ? 10.009  -0.042  3.936   1.00 0.37 ? 7   VAL A C    9  
ATOM   10939 O O    . VAL A 1 7  ? 10.499  -0.854  3.152   1.00 0.41 ? 7   VAL A O    9  
ATOM   10940 C CB   . VAL A 1 7  ? 10.255  -0.846  6.287   1.00 0.46 ? 7   VAL A CB   9  
ATOM   10941 C CG1  . VAL A 1 7  ? 10.810  -2.199  5.866   1.00 0.52 ? 7   VAL A CG1  9  
ATOM   10942 C CG2  . VAL A 1 7  ? 10.721  -0.480  7.688   1.00 0.53 ? 7   VAL A CG2  9  
ATOM   10943 H H    . VAL A 1 7  ? 9.777   1.662   6.574   1.00 0.42 ? 7   VAL A H    9  
ATOM   10944 H HA   . VAL A 1 7  ? 11.744  0.204   5.159   1.00 0.46 ? 7   VAL A HA   9  
ATOM   10945 H HB   . VAL A 1 7  ? 9.177   -0.908  6.294   1.00 0.44 ? 7   VAL A HB   9  
ATOM   10946 H HG11 . VAL A 1 7  ? 11.889  -2.161  5.867   1.00 0.57 ? 7   VAL A HG11 9  
ATOM   10947 H HG12 . VAL A 1 7  ? 10.458  -2.439  4.874   1.00 0.49 ? 7   VAL A HG12 9  
ATOM   10948 H HG13 . VAL A 1 7  ? 10.474  -2.956  6.560   1.00 0.56 ? 7   VAL A HG13 9  
ATOM   10949 H HG21 . VAL A 1 7  ? 10.270  0.455   7.986   1.00 0.51 ? 7   VAL A HG21 9  
ATOM   10950 H HG22 . VAL A 1 7  ? 11.796  -0.381  7.696   1.00 0.57 ? 7   VAL A HG22 9  
ATOM   10951 H HG23 . VAL A 1 7  ? 10.427  -1.256  8.380   1.00 0.58 ? 7   VAL A HG23 9  
ATOM   10952 N N    . ILE A 1 8  ? 8.885   0.630   3.689   1.00 0.34 ? 8   ILE A N    9  
ATOM   10953 C CA   . ILE A 1 8  ? 8.145   0.471   2.444   1.00 0.36 ? 8   ILE A CA   9  
ATOM   10954 C C    . ILE A 1 8  ? 8.610   1.498   1.412   1.00 0.34 ? 8   ILE A C    9  
ATOM   10955 O O    . ILE A 1 8  ? 8.601   1.232   0.211   1.00 0.34 ? 8   ILE A O    9  
ATOM   10956 C CB   . ILE A 1 8  ? 6.620   0.621   2.673   1.00 0.43 ? 8   ILE A CB   9  
ATOM   10957 C CG1  . ILE A 1 8  ? 6.140   -0.357  3.753   1.00 0.57 ? 8   ILE A CG1  9  
ATOM   10958 C CG2  . ILE A 1 8  ? 5.852   0.399   1.375   1.00 0.61 ? 8   ILE A CG2  9  
ATOM   10959 C CD1  . ILE A 1 8  ? 6.373   -1.816  3.412   1.00 0.78 ? 8   ILE A CD1  9  
ATOM   10960 H H    . ILE A 1 8  ? 8.544   1.250   4.368   1.00 0.34 ? 8   ILE A H    9  
ATOM   10961 H HA   . ILE A 1 8  ? 8.338   -0.521  2.064   1.00 0.39 ? 8   ILE A HA   9  
ATOM   10962 H HB   . ILE A 1 8  ? 6.427   1.630   3.005   1.00 0.58 ? 8   ILE A HB   9  
ATOM   10963 H HG12 . ILE A 1 8  ? 6.664   -0.149  4.674   1.00 0.73 ? 8   ILE A HG12 9  
ATOM   10964 H HG13 . ILE A 1 8  ? 5.080   -0.218  3.910   1.00 0.61 ? 8   ILE A HG13 9  
ATOM   10965 H HG21 . ILE A 1 8  ? 4.799   0.565   1.548   1.00 1.01 ? 8   ILE A HG21 9  
ATOM   10966 H HG22 . ILE A 1 8  ? 6.006   -0.614  1.034   1.00 1.07 ? 8   ILE A HG22 9  
ATOM   10967 H HG23 . ILE A 1 8  ? 6.208   1.089   0.625   1.00 1.06 ? 8   ILE A HG23 9  
ATOM   10968 H HD11 . ILE A 1 8  ? 7.433   -2.019  3.409   1.00 0.95 ? 8   ILE A HD11 9  
ATOM   10969 H HD12 . ILE A 1 8  ? 5.963   -2.026  2.434   1.00 0.89 ? 8   ILE A HD12 9  
ATOM   10970 H HD13 . ILE A 1 8  ? 5.888   -2.441  4.147   1.00 1.07 ? 8   ILE A HD13 9  
ATOM   10971 N N    . SER A 1 9  ? 9.034   2.666   1.895   1.00 0.36 ? 9   SER A N    9  
ATOM   10972 C CA   . SER A 1 9  ? 9.507   3.740   1.024   1.00 0.37 ? 9   SER A CA   9  
ATOM   10973 C C    . SER A 1 9  ? 10.845  3.375   0.386   1.00 0.35 ? 9   SER A C    9  
ATOM   10974 O O    . SER A 1 9  ? 11.089  3.682   -0.778  1.00 0.36 ? 9   SER A O    9  
ATOM   10975 C CB   . SER A 1 9  ? 9.645   5.046   1.814   1.00 0.43 ? 9   SER A CB   9  
ATOM   10976 O OG   . SER A 1 9  ? 9.978   6.129   0.964   1.00 0.49 ? 9   SER A OG   9  
ATOM   10977 H H    . SER A 1 9  ? 9.030   2.809   2.865   1.00 0.38 ? 9   SER A H    9  
ATOM   10978 H HA   . SER A 1 9  ? 8.775   3.879   0.242   1.00 0.39 ? 9   SER A HA   9  
ATOM   10979 H HB2  . SER A 1 9  ? 8.709   5.266   2.305   1.00 0.45 ? 9   SER A HB2  9  
ATOM   10980 H HB3  . SER A 1 9  ? 10.422  4.933   2.555   1.00 0.44 ? 9   SER A HB3  9  
ATOM   10981 H HG   . SER A 1 9  ? 9.506   6.040   0.131   1.00 0.81 ? 9   SER A HG   9  
ATOM   10982 N N    . SER A 1 10 ? 11.708  2.718   1.157   1.00 0.36 ? 10  SER A N    9  
ATOM   10983 C CA   . SER A 1 10 ? 13.018  2.305   0.663   1.00 0.37 ? 10  SER A CA   9  
ATOM   10984 C C    . SER A 1 10 ? 12.903  1.028   -0.167  1.00 0.35 ? 10  SER A C    9  
ATOM   10985 O O    . SER A 1 10 ? 13.717  0.779   -1.058  1.00 0.35 ? 10  SER A O    9  
ATOM   10986 C CB   . SER A 1 10 ? 13.984  2.088   1.830   1.00 0.43 ? 10  SER A CB   9  
ATOM   10987 O OG   . SER A 1 10 ? 15.293  1.808   1.366   1.00 0.46 ? 10  SER A OG   9  
ATOM   10988 H H    . SER A 1 10 ? 11.458  2.506   2.080   1.00 0.38 ? 10  SER A H    9  
ATOM   10989 H HA   . SER A 1 10 ? 13.398  3.097   0.033   1.00 0.37 ? 10  SER A HA   9  
ATOM   10990 H HB2  . SER A 1 10 ? 14.016  2.978   2.441   1.00 0.45 ? 10  SER A HB2  9  
ATOM   10991 H HB3  . SER A 1 10 ? 13.642  1.256   2.427   1.00 0.44 ? 10  SER A HB3  9  
ATOM   10992 H HG   . SER A 1 10 ? 15.246  1.222   0.609   1.00 0.67 ? 10  SER A HG   9  
ATOM   10993 N N    . ALA A 1 11 ? 11.883  0.225   0.133   1.00 0.35 ? 11  ALA A N    9  
ATOM   10994 C CA   . ALA A 1 11 ? 11.647  -1.026  -0.580  1.00 0.36 ? 11  ALA A CA   9  
ATOM   10995 C C    . ALA A 1 11 ? 11.132  -0.763  -1.992  1.00 0.31 ? 11  ALA A C    9  
ATOM   10996 O O    . ALA A 1 11 ? 11.645  -1.323  -2.960  1.00 0.33 ? 11  ALA A O    9  
ATOM   10997 C CB   . ALA A 1 11 ? 10.659  -1.896  0.186   1.00 0.40 ? 11  ALA A CB   9  
ATOM   10998 H H    . ALA A 1 11 ? 11.272  0.483   0.854   1.00 0.36 ? 11  ALA A H    9  
ATOM   10999 H HA   . ALA A 1 11 ? 12.586  -1.557  -0.641  1.00 0.39 ? 11  ALA A HA   9  
ATOM   11000 H HB1  . ALA A 1 11 ? 9.699   -1.402  0.224   1.00 0.38 ? 11  ALA A HB1  9  
ATOM   11001 H HB2  . ALA A 1 11 ? 11.021  -2.053  1.192   1.00 0.44 ? 11  ALA A HB2  9  
ATOM   11002 H HB3  . ALA A 1 11 ? 10.554  -2.849  -0.313  1.00 0.42 ? 11  ALA A HB3  9  
ATOM   11003 N N    . CYS A 1 12 ? 10.128  0.110   -2.103  1.00 0.28 ? 12  CYS A N    9  
ATOM   11004 C CA   . CYS A 1 12 ? 9.528   0.444   -3.395  1.00 0.26 ? 12  CYS A CA   9  
ATOM   11005 C C    . CYS A 1 12 ? 10.490  1.236   -4.281  1.00 0.25 ? 12  CYS A C    9  
ATOM   11006 O O    . CYS A 1 12 ? 10.312  1.298   -5.494  1.00 0.26 ? 12  CYS A O    9  
ATOM   11007 C CB   . CYS A 1 12 ? 8.229   1.231   -3.194  1.00 0.28 ? 12  CYS A CB   9  
ATOM   11008 S SG   . CYS A 1 12 ? 8.455   2.875   -2.481  1.00 0.26 ? 12  CYS A SG   9  
ATOM   11009 H H    . CYS A 1 12 ? 9.783   0.542   -1.293  1.00 0.29 ? 12  CYS A H    9  
ATOM   11010 H HA   . CYS A 1 12 ? 9.294   -0.485  -3.892  1.00 0.29 ? 12  CYS A HA   9  
ATOM   11011 H HB2  . CYS A 1 12 ? 7.742   1.354   -4.150  1.00 0.29 ? 12  CYS A HB2  9  
ATOM   11012 H HB3  . CYS A 1 12 ? 7.579   0.673   -2.536  1.00 0.34 ? 12  CYS A HB3  9  
ATOM   11013 H HG   . CYS A 1 12 ? 7.569   3.023   -1.506  1.00 1.12 ? 12  CYS A HG   9  
ATOM   11014 N N    . LYS A 1 13 ? 11.510  1.840   -3.674  1.00 0.25 ? 13  LYS A N    9  
ATOM   11015 C CA   . LYS A 1 13 ? 12.501  2.608   -4.426  1.00 0.26 ? 13  LYS A CA   9  
ATOM   11016 C C    . LYS A 1 13 ? 13.521  1.677   -5.080  1.00 0.31 ? 13  LYS A C    9  
ATOM   11017 O O    . LYS A 1 13 ? 14.366  2.114   -5.863  1.00 0.35 ? 13  LYS A O    9  
ATOM   11018 C CB   . LYS A 1 13 ? 13.217  3.603   -3.507  1.00 0.29 ? 13  LYS A CB   9  
ATOM   11019 C CG   . LYS A 1 13 ? 12.443  4.893   -3.275  1.00 0.79 ? 13  LYS A CG   9  
ATOM   11020 C CD   . LYS A 1 13 ? 12.725  5.924   -4.357  1.00 1.28 ? 13  LYS A CD   9  
ATOM   11021 C CE   . LYS A 1 13 ? 11.930  7.202   -4.132  1.00 1.89 ? 13  LYS A CE   9  
ATOM   11022 N NZ   . LYS A 1 13 ? 12.276  7.857   -2.839  1.00 2.67 ? 13  LYS A NZ   9  
ATOM   11023 H H    . LYS A 1 13 ? 11.599  1.767   -2.701  1.00 0.28 ? 13  LYS A H    9  
ATOM   11024 H HA   . LYS A 1 13 ? 11.981  3.154   -5.200  1.00 0.25 ? 13  LYS A HA   9  
ATOM   11025 H HB2  . LYS A 1 13 ? 13.383  3.133   -2.549  1.00 0.60 ? 13  LYS A HB2  9  
ATOM   11026 H HB3  . LYS A 1 13 ? 14.171  3.856   -3.943  1.00 0.66 ? 13  LYS A HB3  9  
ATOM   11027 H HG2  . LYS A 1 13 ? 11.386  4.670   -3.274  1.00 1.52 ? 13  LYS A HG2  9  
ATOM   11028 H HG3  . LYS A 1 13 ? 12.725  5.303   -2.317  1.00 0.94 ? 13  LYS A HG3  9  
ATOM   11029 H HD2  . LYS A 1 13 ? 13.778  6.161   -4.349  1.00 1.26 ? 13  LYS A HD2  9  
ATOM   11030 H HD3  . LYS A 1 13 ? 12.455  5.507   -5.317  1.00 1.89 ? 13  LYS A HD3  9  
ATOM   11031 H HE2  . LYS A 1 13 ? 12.139  7.888   -4.939  1.00 2.36 ? 13  LYS A HE2  9  
ATOM   11032 H HE3  . LYS A 1 13 ? 10.877  6.960   -4.132  1.00 1.74 ? 13  LYS A HE3  9  
ATOM   11033 H HZ1  . LYS A 1 13 ? 12.052  7.222   -2.046  1.00 2.68 ? 13  LYS A HZ1  9  
ATOM   11034 H HZ2  . LYS A 1 13 ? 11.733  8.737   -2.726  1.00 3.10 ? 13  LYS A HZ2  9  
ATOM   11035 H HZ3  . LYS A 1 13 ? 13.291  8.083   -2.812  1.00 3.07 ? 13  LYS A HZ3  9  
ATOM   11036 N N    . THR A 1 14 ? 13.427  0.392   -4.753  1.00 0.33 ? 14  THR A N    9  
ATOM   11037 C CA   . THR A 1 14 ? 14.332  -0.616  -5.293  1.00 0.39 ? 14  THR A CA   9  
ATOM   11038 C C    . THR A 1 14 ? 13.603  -1.556  -6.245  1.00 0.41 ? 14  THR A C    9  
ATOM   11039 O O    . THR A 1 14 ? 14.230  -2.338  -6.960  1.00 0.46 ? 14  THR A O    9  
ATOM   11040 C CB   . THR A 1 14 ? 14.984  -1.444  -4.169  1.00 0.43 ? 14  THR A CB   9  
ATOM   11041 O OG1  . THR A 1 14 ? 15.565  -0.574  -3.193  1.00 0.44 ? 14  THR A OG1  9  
ATOM   11042 C CG2  . THR A 1 14 ? 16.053  -2.369  -4.731  1.00 0.50 ? 14  THR A CG2  9  
ATOM   11043 H H    . THR A 1 14 ? 12.725  0.111   -4.128  1.00 0.32 ? 14  THR A H    9  
ATOM   11044 H HA   . THR A 1 14 ? 15.114  -0.104  -5.836  1.00 0.41 ? 14  THR A HA   9  
ATOM   11045 H HB   . THR A 1 14 ? 14.221  -2.045  -3.696  1.00 0.42 ? 14  THR A HB   9  
ATOM   11046 H HG1  . THR A 1 14 ? 14.872  -0.210  -2.636  1.00 0.42 ? 14  THR A HG1  9  
ATOM   11047 H HG21 . THR A 1 14 ? 15.613  -3.017  -5.475  1.00 0.50 ? 14  THR A HG21 9  
ATOM   11048 H HG22 . THR A 1 14 ? 16.469  -2.966  -3.933  1.00 0.53 ? 14  THR A HG22 9  
ATOM   11049 H HG23 . THR A 1 14 ? 16.836  -1.780  -5.186  1.00 0.51 ? 14  THR A HG23 9  
ATOM   11050 N N    . TYR A 1 15 ? 12.276  -1.475  -6.252  1.00 0.37 ? 15  TYR A N    9  
ATOM   11051 C CA   . TYR A 1 15 ? 11.464  -2.320  -7.116  1.00 0.40 ? 15  TYR A CA   9  
ATOM   11052 C C    . TYR A 1 15 ? 10.710  -1.484  -8.144  1.00 0.39 ? 15  TYR A C    9  
ATOM   11053 O O    . TYR A 1 15 ? 10.039  -2.020  -9.027  1.00 0.43 ? 15  TYR A O    9  
ATOM   11054 C CB   . TYR A 1 15 ? 10.474  -3.136  -6.282  1.00 0.39 ? 15  TYR A CB   9  
ATOM   11055 C CG   . TYR A 1 15 ? 11.131  -4.197  -5.430  1.00 0.43 ? 15  TYR A CG   9  
ATOM   11056 C CD1  . TYR A 1 15 ? 10.969  -4.207  -4.050  1.00 0.41 ? 15  TYR A CD1  9  
ATOM   11057 C CD2  . TYR A 1 15 ? 11.917  -5.189  -6.003  1.00 0.49 ? 15  TYR A CD2  9  
ATOM   11058 C CE1  . TYR A 1 15 ? 11.568  -5.175  -3.267  1.00 0.46 ? 15  TYR A CE1  9  
ATOM   11059 C CE2  . TYR A 1 15 ? 12.518  -6.161  -5.229  1.00 0.52 ? 15  TYR A CE2  9  
ATOM   11060 C CZ   . TYR A 1 15 ? 12.342  -6.151  -3.860  1.00 0.51 ? 15  TYR A CZ   9  
ATOM   11061 O OH   . TYR A 1 15 ? 12.942  -7.116  -3.084  1.00 0.56 ? 15  TYR A OH   9  
ATOM   11062 H H    . TYR A 1 15 ? 11.834  -0.830  -5.661  1.00 0.33 ? 15  TYR A H    9  
ATOM   11063 H HA   . TYR A 1 15 ? 12.126  -2.997  -7.635  1.00 0.45 ? 15  TYR A HA   9  
ATOM   11064 H HB2  . TYR A 1 15 ? 9.935   -2.472  -5.625  1.00 0.35 ? 15  TYR A HB2  9  
ATOM   11065 H HB3  . TYR A 1 15 ? 9.775   -3.627  -6.943  1.00 0.42 ? 15  TYR A HB3  9  
ATOM   11066 H HD1  . TYR A 1 15 ? 10.362  -3.443  -3.587  1.00 0.38 ? 15  TYR A HD1  9  
ATOM   11067 H HD2  . TYR A 1 15 ? 12.055  -5.196  -7.074  1.00 0.51 ? 15  TYR A HD2  9  
ATOM   11068 H HE1  . TYR A 1 15 ? 11.428  -5.165  -2.195  1.00 0.47 ? 15  TYR A HE1  9  
ATOM   11069 H HE2  . TYR A 1 15 ? 13.124  -6.925  -5.695  1.00 0.57 ? 15  TYR A HE2  9  
ATOM   11070 H HH   . TYR A 1 15 ? 12.310  -7.450  -2.443  1.00 0.57 ? 15  TYR A HH   9  
ATOM   11071 N N    . CYS A 1 16 ? 10.824  -0.166  -8.024  1.00 0.35 ? 16  CYS A N    9  
ATOM   11072 C CA   . CYS A 1 16 ? 10.154  0.748   -8.942  1.00 0.36 ? 16  CYS A CA   9  
ATOM   11073 C C    . CYS A 1 16 ? 11.073  1.903   -9.327  1.00 0.37 ? 16  CYS A C    9  
ATOM   11074 O O    . CYS A 1 16 ? 11.227  2.219   -10.506 1.00 0.42 ? 16  CYS A O    9  
ATOM   11075 C CB   . CYS A 1 16 ? 8.871   1.292   -8.308  1.00 0.32 ? 16  CYS A CB   9  
ATOM   11076 S SG   . CYS A 1 16 ? 7.865   0.034   -7.487  1.00 0.32 ? 16  CYS A SG   9  
ATOM   11077 H H    . CYS A 1 16 ? 11.372  0.202   -7.300  1.00 0.33 ? 16  CYS A H    9  
ATOM   11078 H HA   . CYS A 1 16 ? 9.898   0.195   -9.833  1.00 0.41 ? 16  CYS A HA   9  
ATOM   11079 H HB2  . CYS A 1 16 ? 9.131   2.036   -7.571  1.00 0.28 ? 16  CYS A HB2  9  
ATOM   11080 H HB3  . CYS A 1 16 ? 8.265   1.749   -9.076  1.00 0.35 ? 16  CYS A HB3  9  
ATOM   11081 H HG   . CYS A 1 16 ? 8.184   0.031   -6.201  1.00 0.27 ? 16  CYS A HG   9  
ATOM   11082 N N    . GLY A 1 17 ? 11.681  2.529   -8.325  1.00 0.33 ? 17  GLY A N    9  
ATOM   11083 C CA   . GLY A 1 17 ? 12.576  3.644   -8.580  1.00 0.34 ? 17  GLY A CA   9  
ATOM   11084 C C    . GLY A 1 17 ? 11.900  4.986   -8.389  1.00 0.32 ? 17  GLY A C    9  
ATOM   11085 O O    . GLY A 1 17 ? 11.287  5.240   -7.350  1.00 0.27 ? 17  GLY A O    9  
ATOM   11086 H H    . GLY A 1 17 ? 11.519  2.234   -7.405  1.00 0.29 ? 17  GLY A H    9  
ATOM   11087 H HA2  . GLY A 1 17 ? 13.417  3.577   -7.906  1.00 0.34 ? 17  GLY A HA2  9  
ATOM   11088 H HA3  . GLY A 1 17 ? 12.936  3.577   -9.596  1.00 0.39 ? 17  GLY A HA3  9  
ATOM   11089 N N    . LYS A 1 18 ? 12.010  5.851   -9.391  1.00 0.36 ? 18  LYS A N    9  
ATOM   11090 C CA   . LYS A 1 18 ? 11.405  7.177   -9.329  1.00 0.36 ? 18  LYS A CA   9  
ATOM   11091 C C    . LYS A 1 18 ? 9.891   7.091   -9.498  1.00 0.36 ? 18  LYS A C    9  
ATOM   11092 O O    . LYS A 1 18 ? 9.160   7.998   -9.101  1.00 0.36 ? 18  LYS A O    9  
ATOM   11093 C CB   . LYS A 1 18 ? 12.000  8.083   -10.412 1.00 0.43 ? 18  LYS A CB   9  
ATOM   11094 C CG   . LYS A 1 18 ? 11.958  7.475   -11.802 1.00 0.48 ? 18  LYS A CG   9  
ATOM   11095 C CD   . LYS A 1 18 ? 13.328  6.986   -12.239 1.00 0.52 ? 18  LYS A CD   9  
ATOM   11096 C CE   . LYS A 1 18 ? 13.945  7.910   -13.278 1.00 0.58 ? 18  LYS A CE   9  
ATOM   11097 N NZ   . LYS A 1 18 ? 15.354  8.261   -12.943 1.00 0.59 ? 18  LYS A NZ   9  
ATOM   11098 H H    . LYS A 1 18 ? 12.512  5.590   -10.192 1.00 0.40 ? 18  LYS A H    9  
ATOM   11099 H HA   . LYS A 1 18 ? 11.624  7.597   -8.359  1.00 0.34 ? 18  LYS A HA   9  
ATOM   11100 H HB2  . LYS A 1 18 ? 11.447  9.011   -10.430 1.00 0.43 ? 18  LYS A HB2  9  
ATOM   11101 H HB3  . LYS A 1 18 ? 13.029  8.293   -10.162 1.00 0.43 ? 18  LYS A HB3  9  
ATOM   11102 H HG2  . LYS A 1 18 ? 11.273  6.640   -11.799 1.00 0.47 ? 18  LYS A HG2  9  
ATOM   11103 H HG3  . LYS A 1 18 ? 11.611  8.223   -12.501 1.00 0.52 ? 18  LYS A HG3  9  
ATOM   11104 H HD2  . LYS A 1 18 ? 13.978  6.945   -11.378 1.00 0.49 ? 18  LYS A HD2  9  
ATOM   11105 H HD3  . LYS A 1 18 ? 13.228  5.997   -12.665 1.00 0.53 ? 18  LYS A HD3  9  
ATOM   11106 H HE2  . LYS A 1 18 ? 13.926  7.416   -14.239 1.00 0.62 ? 18  LYS A HE2  9  
ATOM   11107 H HE3  . LYS A 1 18 ? 13.361  8.817   -13.329 1.00 0.58 ? 18  LYS A HE3  9  
ATOM   11108 H HZ1  . LYS A 1 18 ? 15.936  7.400   -12.898 1.00 0.60 ? 18  LYS A HZ1  9  
ATOM   11109 H HZ2  . LYS A 1 18 ? 15.394  8.740   -12.021 1.00 0.56 ? 18  LYS A HZ2  9  
ATOM   11110 H HZ3  . LYS A 1 18 ? 15.747  8.895   -13.667 1.00 0.64 ? 18  LYS A HZ3  9  
ATOM   11111 N N    . THR A 1 19 ? 9.427   5.995   -10.090 1.00 0.37 ? 19  THR A N    9  
ATOM   11112 C CA   . THR A 1 19 ? 8.000   5.791   -10.310 1.00 0.39 ? 19  THR A CA   9  
ATOM   11113 C C    . THR A 1 19 ? 7.280   5.485   -9.003  1.00 0.33 ? 19  THR A C    9  
ATOM   11114 O O    . THR A 1 19 ? 6.068   5.676   -8.890  1.00 0.43 ? 19  THR A O    9  
ATOM   11115 C CB   . THR A 1 19 ? 7.743   4.644   -11.306 1.00 0.46 ? 19  THR A CB   9  
ATOM   11116 O OG1  . THR A 1 19 ? 7.889   3.382   -10.646 1.00 0.53 ? 19  THR A OG1  9  
ATOM   11117 C CG2  . THR A 1 19 ? 8.709   4.721   -12.480 1.00 0.61 ? 19  THR A CG2  9  
ATOM   11118 H H    . THR A 1 19 ? 10.058  5.306   -10.383 1.00 0.39 ? 19  THR A H    9  
ATOM   11119 H HA   . THR A 1 19 ? 7.595   6.701   -10.728 1.00 0.42 ? 19  THR A HA   9  
ATOM   11120 H HB   . THR A 1 19 ? 6.735   4.732   -11.682 1.00 0.49 ? 19  THR A HB   9  
ATOM   11121 H HG1  . THR A 1 19 ? 8.377   2.778   -11.210 1.00 0.54 ? 19  THR A HG1  9  
ATOM   11122 H HG21 . THR A 1 19 ? 8.483   3.934   -13.184 1.00 0.66 ? 19  THR A HG21 9  
ATOM   11123 H HG22 . THR A 1 19 ? 9.722   4.604   -12.121 1.00 0.68 ? 19  THR A HG22 9  
ATOM   11124 H HG23 . THR A 1 19 ? 8.608   5.680   -12.966 1.00 0.69 ? 19  THR A HG23 9  
ATOM   11125 N N    . SER A 1 20 ? 8.044   5.024   -7.996  1.00 0.30 ? 20  SER A N    9  
ATOM   11126 C CA   . SER A 1 20 ? 7.494   4.667   -6.676  1.00 0.24 ? 20  SER A CA   9  
ATOM   11127 C C    . SER A 1 20 ? 6.695   5.806   -6.041  1.00 0.22 ? 20  SER A C    9  
ATOM   11128 O O    . SER A 1 20 ? 6.926   6.982   -6.332  1.00 0.26 ? 20  SER A O    9  
ATOM   11129 C CB   . SER A 1 20 ? 8.621   4.257   -5.720  1.00 0.22 ? 20  SER A CB   9  
ATOM   11130 O OG   . SER A 1 20 ? 9.326   5.384   -5.240  1.00 0.25 ? 20  SER A OG   9  
ATOM   11131 H H    . SER A 1 20 ? 9.007   4.925   -8.146  1.00 0.38 ? 20  SER A H    9  
ATOM   11132 H HA   . SER A 1 20 ? 6.836   3.822   -6.815  1.00 0.26 ? 20  SER A HA   9  
ATOM   11133 H HB2  . SER A 1 20 ? 8.201   3.729   -4.879  1.00 0.26 ? 20  SER A HB2  9  
ATOM   11134 H HB3  . SER A 1 20 ? 9.313   3.611   -6.240  1.00 0.24 ? 20  SER A HB3  9  
ATOM   11135 H HG   . SER A 1 20 ? 8.833   5.786   -4.520  1.00 0.41 ? 20  SER A HG   9  
ATOM   11136 N N    . PRO A 1 21 ? 5.735   5.461   -5.155  1.00 0.20 ? 21  PRO A N    9  
ATOM   11137 C CA   . PRO A 1 21 ? 4.898   6.452   -4.469  1.00 0.22 ? 21  PRO A CA   9  
ATOM   11138 C C    . PRO A 1 21 ? 5.678   7.248   -3.428  1.00 0.22 ? 21  PRO A C    9  
ATOM   11139 O O    . PRO A 1 21 ? 6.754   6.835   -2.990  1.00 0.24 ? 21  PRO A O    9  
ATOM   11140 C CB   . PRO A 1 21 ? 3.821   5.601   -3.792  1.00 0.23 ? 21  PRO A CB   9  
ATOM   11141 C CG   . PRO A 1 21 ? 4.449   4.268   -3.599  1.00 0.21 ? 21  PRO A CG   9  
ATOM   11142 C CD   . PRO A 1 21 ? 5.390   4.080   -4.755  1.00 0.20 ? 21  PRO A CD   9  
ATOM   11143 H HA   . PRO A 1 21 ? 4.436   7.133   -5.171  1.00 0.26 ? 21  PRO A HA   9  
ATOM   11144 H HB2  . PRO A 1 21 ? 3.547   6.043   -2.842  1.00 0.25 ? 21  PRO A HB2  9  
ATOM   11145 H HB3  . PRO A 1 21 ? 2.957   5.515   -4.430  1.00 0.26 ? 21  PRO A HB3  9  
ATOM   11146 H HG2  . PRO A 1 21 ? 4.991   4.251   -2.663  1.00 0.21 ? 21  PRO A HG2  9  
ATOM   11147 H HG3  . PRO A 1 21 ? 3.693   3.498   -3.610  1.00 0.24 ? 21  PRO A HG3  9  
ATOM   11148 H HD2  . PRO A 1 21 ? 6.268   3.539   -4.440  1.00 0.21 ? 21  PRO A HD2  9  
ATOM   11149 H HD3  . PRO A 1 21 ? 4.894   3.559   -5.559  1.00 0.24 ? 21  PRO A HD3  9  
ATOM   11150 N N    . SER A 1 22 ? 5.127   8.389   -3.034  1.00 0.24 ? 22  SER A N    9  
ATOM   11151 C CA   . SER A 1 22 ? 5.768   9.246   -2.045  1.00 0.26 ? 22  SER A CA   9  
ATOM   11152 C C    . SER A 1 22 ? 5.381   8.830   -0.629  1.00 0.23 ? 22  SER A C    9  
ATOM   11153 O O    . SER A 1 22 ? 4.507   7.982   -0.436  1.00 0.23 ? 22  SER A O    9  
ATOM   11154 C CB   . SER A 1 22 ? 5.381   10.708  -2.287  1.00 0.31 ? 22  SER A CB   9  
ATOM   11155 O OG   . SER A 1 22 ? 3.976   10.881  -2.219  1.00 0.32 ? 22  SER A OG   9  
ATOM   11156 H H    . SER A 1 22 ? 4.268   8.662   -3.417  1.00 0.26 ? 22  SER A H    9  
ATOM   11157 H HA   . SER A 1 22 ? 6.836   9.142   -2.159  1.00 0.29 ? 22  SER A HA   9  
ATOM   11158 H HB2  . SER A 1 22 ? 5.844   11.328  -1.537  1.00 0.34 ? 22  SER A HB2  9  
ATOM   11159 H HB3  . SER A 1 22 ? 5.723   11.010  -3.266  1.00 0.35 ? 22  SER A HB3  9  
ATOM   11160 H HG   . SER A 1 22 ? 3.626   11.017  -3.103  1.00 0.54 ? 22  SER A HG   9  
ATOM   11161 N N    . LYS A 1 23 ? 6.038   9.434   0.357   1.00 0.24 ? 23  LYS A N    9  
ATOM   11162 C CA   . LYS A 1 23 ? 5.761   9.141   1.760   1.00 0.25 ? 23  LYS A CA   9  
ATOM   11163 C C    . LYS A 1 23 ? 4.395   9.702   2.157   1.00 0.23 ? 23  LYS A C    9  
ATOM   11164 O O    . LYS A 1 23 ? 3.717   9.160   3.031   1.00 0.26 ? 23  LYS A O    9  
ATOM   11165 C CB   . LYS A 1 23 ? 6.873   9.726   2.640   1.00 0.29 ? 23  LYS A CB   9  
ATOM   11166 C CG   . LYS A 1 23 ? 6.635   9.580   4.137   1.00 0.41 ? 23  LYS A CG   9  
ATOM   11167 C CD   . LYS A 1 23 ? 6.370   10.932  4.780   1.00 0.87 ? 23  LYS A CD   9  
ATOM   11168 C CE   . LYS A 1 23 ? 6.193   10.819  6.283   1.00 1.02 ? 23  LYS A CE   9  
ATOM   11169 N NZ   . LYS A 1 23 ? 5.972   12.150  6.908   1.00 1.62 ? 23  LYS A NZ   9  
ATOM   11170 H H    . LYS A 1 23 ? 6.729   10.096  0.135   1.00 0.26 ? 23  LYS A H    9  
ATOM   11171 H HA   . LYS A 1 23 ? 5.745   8.068   1.877   1.00 0.27 ? 23  LYS A HA   9  
ATOM   11172 H HB2  . LYS A 1 23 ? 7.801   9.230   2.400   1.00 0.35 ? 23  LYS A HB2  9  
ATOM   11173 H HB3  . LYS A 1 23 ? 6.973   10.778  2.416   1.00 0.34 ? 23  LYS A HB3  9  
ATOM   11174 H HG2  . LYS A 1 23 ? 5.781   8.941   4.298   1.00 0.71 ? 23  LYS A HG2  9  
ATOM   11175 H HG3  . LYS A 1 23 ? 7.511   9.140   4.591   1.00 0.67 ? 23  LYS A HG3  9  
ATOM   11176 H HD2  . LYS A 1 23 ? 7.207   11.582  4.577   1.00 1.16 ? 23  LYS A HD2  9  
ATOM   11177 H HD3  . LYS A 1 23 ? 5.473   11.353  4.349   1.00 1.26 ? 23  LYS A HD3  9  
ATOM   11178 H HE2  . LYS A 1 23 ? 5.340   10.187  6.487   1.00 1.11 ? 23  LYS A HE2  9  
ATOM   11179 H HE3  . LYS A 1 23 ? 7.081   10.374  6.706   1.00 1.06 ? 23  LYS A HE3  9  
ATOM   11180 H HZ1  . LYS A 1 23 ? 5.897   12.053  7.940   1.00 1.74 ? 23  LYS A HZ1  9  
ATOM   11181 H HZ2  . LYS A 1 23 ? 5.093   12.573  6.545   1.00 1.95 ? 23  LYS A HZ2  9  
ATOM   11182 H HZ3  . LYS A 1 23 ? 6.765   12.786  6.684   1.00 1.88 ? 23  LYS A HZ3  9  
ATOM   11183 N N    . LYS A 1 24 ? 3.996   10.786  1.492   1.00 0.20 ? 24  LYS A N    9  
ATOM   11184 C CA   . LYS A 1 24 ? 2.709   11.425  1.750   1.00 0.21 ? 24  LYS A CA   9  
ATOM   11185 C C    . LYS A 1 24 ? 1.556   10.574  1.222   1.00 0.20 ? 24  LYS A C    9  
ATOM   11186 O O    . LYS A 1 24 ? 0.466   10.575  1.792   1.00 0.22 ? 24  LYS A O    9  
ATOM   11187 C CB   . LYS A 1 24 ? 2.664   12.812  1.104   1.00 0.24 ? 24  LYS A CB   9  
ATOM   11188 C CG   . LYS A 1 24 ? 3.378   13.884  1.910   1.00 0.43 ? 24  LYS A CG   9  
ATOM   11189 C CD   . LYS A 1 24 ? 3.601   15.151  1.095   1.00 0.79 ? 24  LYS A CD   9  
ATOM   11190 C CE   . LYS A 1 24 ? 4.505   14.895  -0.101  1.00 1.35 ? 24  LYS A CE   9  
ATOM   11191 N NZ   . LYS A 1 24 ? 5.285   16.105  -0.479  1.00 2.01 ? 24  LYS A NZ   9  
ATOM   11192 H H    . LYS A 1 24 ? 4.586   11.167  0.808   1.00 0.20 ? 24  LYS A H    9  
ATOM   11193 H HA   . LYS A 1 24 ? 2.601   11.534  2.819   1.00 0.24 ? 24  LYS A HA   9  
ATOM   11194 H HB2  . LYS A 1 24 ? 3.129   12.756  0.130   1.00 0.37 ? 24  LYS A HB2  9  
ATOM   11195 H HB3  . LYS A 1 24 ? 1.633   13.109  0.984   1.00 0.38 ? 24  LYS A HB3  9  
ATOM   11196 H HG2  . LYS A 1 24 ? 2.778   14.128  2.774   1.00 0.80 ? 24  LYS A HG2  9  
ATOM   11197 H HG3  . LYS A 1 24 ? 4.334   13.501  2.233   1.00 0.81 ? 24  LYS A HG3  9  
ATOM   11198 H HD2  . LYS A 1 24 ? 2.647   15.512  0.741   1.00 1.14 ? 24  LYS A HD2  9  
ATOM   11199 H HD3  . LYS A 1 24 ? 4.059   15.899  1.726   1.00 0.95 ? 24  LYS A HD3  9  
ATOM   11200 H HE2  . LYS A 1 24 ? 5.189   14.098  0.144   1.00 1.59 ? 24  LYS A HE2  9  
ATOM   11201 H HE3  . LYS A 1 24 ? 3.893   14.596  -0.940  1.00 1.51 ? 24  LYS A HE3  9  
ATOM   11202 H HZ1  . LYS A 1 24 ? 5.878   16.410  0.320   1.00 2.09 ? 24  LYS A HZ1  9  
ATOM   11203 H HZ2  . LYS A 1 24 ? 4.643   16.881  -0.735  1.00 2.20 ? 24  LYS A HZ2  9  
ATOM   11204 H HZ3  . LYS A 1 24 ? 5.900   15.895  -1.292  1.00 2.49 ? 24  LYS A HZ3  9  
ATOM   11205 N N    . GLU A 1 25 ? 1.807   9.851   0.131   1.00 0.18 ? 25  GLU A N    9  
ATOM   11206 C CA   . GLU A 1 25 ? 0.787   8.997   -0.469  1.00 0.17 ? 25  GLU A CA   9  
ATOM   11207 C C    . GLU A 1 25 ? 0.501   7.788   0.417   1.00 0.16 ? 25  GLU A C    9  
ATOM   11208 O O    . GLU A 1 25 ? -0.617  7.616   0.907   1.00 0.17 ? 25  GLU A O    9  
ATOM   11209 C CB   . GLU A 1 25 ? 1.233   8.531   -1.856  1.00 0.17 ? 25  GLU A CB   9  
ATOM   11210 C CG   . GLU A 1 25 ? 0.358   9.054   -2.984  1.00 0.19 ? 25  GLU A CG   9  
ATOM   11211 C CD   . GLU A 1 25 ? 0.588   8.319   -4.289  1.00 0.18 ? 25  GLU A CD   9  
ATOM   11212 O OE1  . GLU A 1 25 ? 0.381   8.930   -5.360  1.00 0.26 ? 25  GLU A OE1  9  
ATOM   11213 O OE2  . GLU A 1 25 ? 0.973   7.132   -4.243  1.00 0.21 ? 25  GLU A OE2  9  
ATOM   11214 H H    . GLU A 1 25 ? 2.696   9.894   -0.279  1.00 0.18 ? 25  GLU A H    9  
ATOM   11215 H HA   . GLU A 1 25 ? -0.117  9.578   -0.567  1.00 0.17 ? 25  GLU A HA   9  
ATOM   11216 H HB2  . GLU A 1 25 ? 2.245   8.867   -2.029  1.00 0.19 ? 25  GLU A HB2  9  
ATOM   11217 H HB3  . GLU A 1 25 ? 1.211   7.451   -1.885  1.00 0.18 ? 25  GLU A HB3  9  
ATOM   11218 H HG2  . GLU A 1 25 ? -0.678  8.939   -2.702  1.00 0.23 ? 25  GLU A HG2  9  
ATOM   11219 H HG3  . GLU A 1 25 ? 0.576   10.101  -3.135  1.00 0.23 ? 25  GLU A HG3  9  
ATOM   11220 N N    . ILE A 1 26 ? 1.515   6.955   0.618   1.00 0.16 ? 26  ILE A N    9  
ATOM   11221 C CA   . ILE A 1 26 ? 1.371   5.763   1.445   1.00 0.15 ? 26  ILE A CA   9  
ATOM   11222 C C    . ILE A 1 26 ? 0.778   6.107   2.807   1.00 0.15 ? 26  ILE A C    9  
ATOM   11223 O O    . ILE A 1 26 ? -0.147  5.445   3.277   1.00 0.14 ? 26  ILE A O    9  
ATOM   11224 C CB   . ILE A 1 26 ? 2.725   5.056   1.651   1.00 0.16 ? 26  ILE A CB   9  
ATOM   11225 C CG1  . ILE A 1 26 ? 3.309   4.626   0.305   1.00 0.16 ? 26  ILE A CG1  9  
ATOM   11226 C CG2  . ILE A 1 26 ? 2.558   3.854   2.570   1.00 0.15 ? 26  ILE A CG2  9  
ATOM   11227 C CD1  . ILE A 1 26 ? 4.646   3.925   0.423   1.00 0.17 ? 26  ILE A CD1  9  
ATOM   11228 H H    . ILE A 1 26 ? 2.381   7.146   0.201   1.00 0.17 ? 26  ILE A H    9  
ATOM   11229 H HA   . ILE A 1 26 ? 0.706   5.081   0.935   1.00 0.14 ? 26  ILE A HA   9  
ATOM   11230 H HB   . ILE A 1 26 ? 3.401   5.750   2.125   1.00 0.17 ? 26  ILE A HB   9  
ATOM   11231 H HG12 . ILE A 1 26 ? 2.622   3.950   -0.180  1.00 0.15 ? 26  ILE A HG12 9  
ATOM   11232 H HG13 . ILE A 1 26 ? 3.447   5.499   -0.316  1.00 0.16 ? 26  ILE A HG13 9  
ATOM   11233 H HG21 . ILE A 1 26 ? 2.227   4.188   3.542   1.00 0.15 ? 26  ILE A HG21 9  
ATOM   11234 H HG22 . ILE A 1 26 ? 3.505   3.343   2.668   1.00 0.16 ? 26  ILE A HG22 9  
ATOM   11235 H HG23 . ILE A 1 26 ? 1.827   3.180   2.151   1.00 0.14 ? 26  ILE A HG23 9  
ATOM   11236 H HD11 . ILE A 1 26 ? 4.533   3.035   1.024   1.00 0.16 ? 26  ILE A HD11 9  
ATOM   11237 H HD12 . ILE A 1 26 ? 5.359   4.586   0.892   1.00 0.19 ? 26  ILE A HD12 9  
ATOM   11238 H HD13 . ILE A 1 26 ? 4.999   3.654   -0.560  1.00 0.17 ? 26  ILE A HD13 9  
ATOM   11239 N N    . GLY A 1 27 ? 1.315   7.149   3.434   1.00 0.16 ? 27  GLY A N    9  
ATOM   11240 C CA   . GLY A 1 27 ? 0.825   7.565   4.735   1.00 0.16 ? 27  GLY A CA   9  
ATOM   11241 C C    . GLY A 1 27 ? -0.678  7.766   4.752   1.00 0.15 ? 27  GLY A C    9  
ATOM   11242 O O    . GLY A 1 27 ? -1.352  7.386   5.709   1.00 0.15 ? 27  GLY A O    9  
ATOM   11243 H H    . GLY A 1 27 ? 2.049   7.640   3.010   1.00 0.17 ? 27  GLY A H    9  
ATOM   11244 H HA2  . GLY A 1 27 ? 1.083   6.809   5.463   1.00 0.16 ? 27  GLY A HA2  9  
ATOM   11245 H HA3  . GLY A 1 27 ? 1.304   8.493   5.009   1.00 0.17 ? 27  GLY A HA3  9  
ATOM   11246 N N    . ALA A 1 28 ? -1.205  8.365   3.690   1.00 0.15 ? 28  ALA A N    9  
ATOM   11247 C CA   . ALA A 1 28 ? -2.636  8.616   3.584   1.00 0.14 ? 28  ALA A CA   9  
ATOM   11248 C C    . ALA A 1 28 ? -3.402  7.326   3.312   1.00 0.13 ? 28  ALA A C    9  
ATOM   11249 O O    . ALA A 1 28 ? -4.459  7.085   3.893   1.00 0.12 ? 28  ALA A O    9  
ATOM   11250 C CB   . ALA A 1 28 ? -2.917  9.637   2.492   1.00 0.15 ? 28  ALA A CB   9  
ATOM   11251 H H    . ALA A 1 28 ? -0.616  8.644   2.957   1.00 0.16 ? 28  ALA A H    9  
ATOM   11252 H HA   . ALA A 1 28 ? -2.971  9.029   4.525   1.00 0.15 ? 28  ALA A HA   9  
ATOM   11253 H HB1  . ALA A 1 28 ? -3.974  9.852   2.462   1.00 0.14 ? 28  ALA A HB1  9  
ATOM   11254 H HB2  . ALA A 1 28 ? -2.603  9.239   1.538   1.00 0.14 ? 28  ALA A HB2  9  
ATOM   11255 H HB3  . ALA A 1 28 ? -2.370  10.546  2.699   1.00 0.16 ? 28  ALA A HB3  9  
ATOM   11256 N N    . MET A 1 29 ? -2.860  6.498   2.425   1.00 0.13 ? 29  MET A N    9  
ATOM   11257 C CA   . MET A 1 29 ? -3.492  5.232   2.076   1.00 0.11 ? 29  MET A CA   9  
ATOM   11258 C C    . MET A 1 29 ? -3.603  4.326   3.298   1.00 0.11 ? 29  MET A C    9  
ATOM   11259 O O    . MET A 1 29 ? -4.600  3.625   3.476   1.00 0.10 ? 29  MET A O    9  
ATOM   11260 C CB   . MET A 1 29 ? -2.698  4.526   0.973   1.00 0.11 ? 29  MET A CB   9  
ATOM   11261 C CG   . MET A 1 29 ? -3.315  3.211   0.528   1.00 0.10 ? 29  MET A CG   9  
ATOM   11262 S SD   . MET A 1 29 ? -2.075  1.981   0.076   1.00 0.10 ? 29  MET A SD   9  
ATOM   11263 C CE   . MET A 1 29 ? -1.204  1.793   1.630   1.00 0.11 ? 29  MET A CE   9  
ATOM   11264 H H    . MET A 1 29 ? -2.015  6.747   1.993   1.00 0.13 ? 29  MET A H    9  
ATOM   11265 H HA   . MET A 1 29 ? -4.484  5.447   1.712   1.00 0.11 ? 29  MET A HA   9  
ATOM   11266 H HB2  . MET A 1 29 ? -2.637  5.180   0.116   1.00 0.12 ? 29  MET A HB2  9  
ATOM   11267 H HB3  . MET A 1 29 ? -1.700  4.329   1.335   1.00 0.12 ? 29  MET A HB3  9  
ATOM   11268 H HG2  . MET A 1 29 ? -3.912  2.818   1.336   1.00 0.10 ? 29  MET A HG2  9  
ATOM   11269 H HG3  . MET A 1 29 ? -3.947  3.396   -0.328  1.00 0.10 ? 29  MET A HG3  9  
ATOM   11270 H HE1  . MET A 1 29 ? -0.567  2.649   1.793   1.00 0.12 ? 29  MET A HE1  9  
ATOM   11271 H HE2  . MET A 1 29 ? -0.602  0.897   1.600   1.00 0.11 ? 29  MET A HE2  9  
ATOM   11272 H HE3  . MET A 1 29 ? -1.920  1.720   2.435   1.00 0.11 ? 29  MET A HE3  9  
ATOM   11273 N N    . LEU A 1 30 ? -2.573  4.341   4.137   1.00 0.12 ? 30  LEU A N    9  
ATOM   11274 C CA   . LEU A 1 30 ? -2.554  3.520   5.343   1.00 0.12 ? 30  LEU A CA   9  
ATOM   11275 C C    . LEU A 1 30 ? -3.717  3.879   6.262   1.00 0.12 ? 30  LEU A C    9  
ATOM   11276 O O    . LEU A 1 30 ? -4.486  3.011   6.674   1.00 0.11 ? 30  LEU A O    9  
ATOM   11277 C CB   . LEU A 1 30 ? -1.228  3.697   6.083   1.00 0.13 ? 30  LEU A CB   9  
ATOM   11278 C CG   . LEU A 1 30 ? -0.249  2.526   5.994   1.00 0.13 ? 30  LEU A CG   9  
ATOM   11279 C CD1  . LEU A 1 30 ? 0.133   2.257   4.549   1.00 0.13 ? 30  LEU A CD1  9  
ATOM   11280 C CD2  . LEU A 1 30 ? 0.990   2.803   6.834   1.00 0.15 ? 30  LEU A CD2  9  
ATOM   11281 H H    . LEU A 1 30 ? -1.806  4.919   3.941   1.00 0.13 ? 30  LEU A H    9  
ATOM   11282 H HA   . LEU A 1 30 ? -2.655  2.488   5.043   1.00 0.11 ? 30  LEU A HA   9  
ATOM   11283 H HB2  . LEU A 1 30 ? -0.739  4.575   5.687   1.00 0.14 ? 30  LEU A HB2  9  
ATOM   11284 H HB3  . LEU A 1 30 ? -1.448  3.872   7.126   1.00 0.14 ? 30  LEU A HB3  9  
ATOM   11285 H HG   . LEU A 1 30 ? -0.725  1.638   6.383   1.00 0.13 ? 30  LEU A HG   9  
ATOM   11286 H HD11 . LEU A 1 30 ? 0.428   3.182   4.076   1.00 0.13 ? 30  LEU A HD11 9  
ATOM   11287 H HD12 . LEU A 1 30 ? -0.712  1.838   4.025   1.00 0.12 ? 30  LEU A HD12 9  
ATOM   11288 H HD13 . LEU A 1 30 ? 0.958   1.560   4.519   1.00 0.13 ? 30  LEU A HD13 9  
ATOM   11289 H HD21 . LEU A 1 30 ? 1.655   1.954   6.786   1.00 0.15 ? 30  LEU A HD21 9  
ATOM   11290 H HD22 . LEU A 1 30 ? 0.699   2.974   7.861   1.00 0.16 ? 30  LEU A HD22 9  
ATOM   11291 H HD23 . LEU A 1 30 ? 1.496   3.678   6.453   1.00 0.15 ? 30  LEU A HD23 9  
ATOM   11292 N N    . SER A 1 31 ? -3.838  5.165   6.581   1.00 0.13 ? 31  SER A N    9  
ATOM   11293 C CA   . SER A 1 31 ? -4.906  5.638   7.454   1.00 0.13 ? 31  SER A CA   9  
ATOM   11294 C C    . SER A 1 31 ? -6.267  5.167   6.953   1.00 0.12 ? 31  SER A C    9  
ATOM   11295 O O    . SER A 1 31 ? -7.191  4.952   7.739   1.00 0.12 ? 31  SER A O    9  
ATOM   11296 C CB   . SER A 1 31 ? -4.881  7.165   7.541   1.00 0.14 ? 31  SER A CB   9  
ATOM   11297 O OG   . SER A 1 31 ? -6.139  7.672   7.955   1.00 0.14 ? 31  SER A OG   9  
ATOM   11298 H H    . SER A 1 31 ? -3.195  5.809   6.218   1.00 0.13 ? 31  SER A H    9  
ATOM   11299 H HA   . SER A 1 31 ? -4.735  5.228   8.438   1.00 0.13 ? 31  SER A HA   9  
ATOM   11300 H HB2  . SER A 1 31 ? -4.132  7.472   8.254   1.00 0.15 ? 31  SER A HB2  9  
ATOM   11301 H HB3  . SER A 1 31 ? -4.644  7.575   6.570   1.00 0.14 ? 31  SER A HB3  9  
ATOM   11302 H HG   . SER A 1 31 ? -6.678  6.953   8.295   1.00 0.13 ? 31  SER A HG   9  
ATOM   11303 N N    . LEU A 1 32 ? -6.384  5.008   5.640   1.00 0.11 ? 32  LEU A N    9  
ATOM   11304 C CA   . LEU A 1 32 ? -7.633  4.562   5.031   1.00 0.10 ? 32  LEU A CA   9  
ATOM   11305 C C    . LEU A 1 32 ? -7.796  3.051   5.166   1.00 0.09 ? 32  LEU A C    9  
ATOM   11306 O O    . LEU A 1 32 ? -8.907  2.548   5.330   1.00 0.09 ? 32  LEU A O    9  
ATOM   11307 C CB   . LEU A 1 32 ? -7.674  4.961   3.555   1.00 0.10 ? 32  LEU A CB   9  
ATOM   11308 C CG   . LEU A 1 32 ? -8.963  4.622   2.804   1.00 0.09 ? 32  LEU A CG   9  
ATOM   11309 C CD1  . LEU A 1 32 ? -8.965  3.163   2.379   1.00 0.08 ? 32  LEU A CD1  9  
ATOM   11310 C CD2  . LEU A 1 32 ? -10.179 4.931   3.665   1.00 0.09 ? 32  LEU A CD2  9  
ATOM   11311 H H    . LEU A 1 32 ? -5.612  5.196   5.065   1.00 0.11 ? 32  LEU A H    9  
ATOM   11312 H HA   . LEU A 1 32 ? -8.442  5.049   5.549   1.00 0.10 ? 32  LEU A HA   9  
ATOM   11313 H HB2  . LEU A 1 32 ? -7.520  6.028   3.492   1.00 0.10 ? 32  LEU A HB2  9  
ATOM   11314 H HB3  . LEU A 1 32 ? -6.854  4.469   3.052   1.00 0.09 ? 32  LEU A HB3  9  
ATOM   11315 H HG   . LEU A 1 32 ? -9.022  5.229   1.912   1.00 0.09 ? 32  LEU A HG   9  
ATOM   11316 H HD11 . LEU A 1 32 ? -8.106  2.968   1.753   1.00 0.08 ? 32  LEU A HD11 9  
ATOM   11317 H HD12 . LEU A 1 32 ? -9.869  2.949   1.826   1.00 0.08 ? 32  LEU A HD12 9  
ATOM   11318 H HD13 . LEU A 1 32 ? -8.922  2.532   3.255   1.00 0.08 ? 32  LEU A HD13 9  
ATOM   11319 H HD21 . LEU A 1 32 ? -11.077 4.660   3.130   1.00 0.09 ? 32  LEU A HD21 9  
ATOM   11320 H HD22 . LEU A 1 32 ? -10.199 5.986   3.891   1.00 0.10 ? 32  LEU A HD22 9  
ATOM   11321 H HD23 . LEU A 1 32 ? -10.122 4.367   4.582   1.00 0.09 ? 32  LEU A HD23 9  
ATOM   11322 N N    . LEU A 1 33 ? -6.680  2.333   5.097   1.00 0.09 ? 33  LEU A N    9  
ATOM   11323 C CA   . LEU A 1 33 ? -6.698  0.880   5.214   1.00 0.08 ? 33  LEU A CA   9  
ATOM   11324 C C    . LEU A 1 33 ? -6.932  0.452   6.660   1.00 0.09 ? 33  LEU A C    9  
ATOM   11325 O O    . LEU A 1 33 ? -7.118  -0.731  6.944   1.00 0.09 ? 33  LEU A O    9  
ATOM   11326 C CB   . LEU A 1 33 ? -5.379  0.291   4.705   1.00 0.08 ? 33  LEU A CB   9  
ATOM   11327 C CG   . LEU A 1 33 ? -5.369  -0.165  3.245   1.00 0.08 ? 33  LEU A CG   9  
ATOM   11328 C CD1  . LEU A 1 33 ? -3.975  -0.623  2.840   1.00 0.08 ? 33  LEU A CD1  9  
ATOM   11329 C CD2  . LEU A 1 33 ? -6.382  -1.279  3.026   1.00 0.07 ? 33  LEU A CD2  9  
ATOM   11330 H H    . LEU A 1 33 ? -5.824  2.792   4.965   1.00 0.10 ? 33  LEU A H    9  
ATOM   11331 H HA   . LEU A 1 33 ? -7.508  0.511   4.606   1.00 0.08 ? 33  LEU A HA   9  
ATOM   11332 H HB2  . LEU A 1 33 ? -4.609  1.036   4.830   1.00 0.09 ? 33  LEU A HB2  9  
ATOM   11333 H HB3  . LEU A 1 33 ? -5.134  -0.559  5.323   1.00 0.09 ? 33  LEU A HB3  9  
ATOM   11334 H HG   . LEU A 1 33 ? -5.643  0.667   2.613   1.00 0.08 ? 33  LEU A HG   9  
ATOM   11335 H HD11 . LEU A 1 33 ? -4.027  -1.145  1.896   1.00 0.09 ? 33  LEU A HD11 9  
ATOM   11336 H HD12 . LEU A 1 33 ? -3.579  -1.284  3.595   1.00 0.10 ? 33  LEU A HD12 9  
ATOM   11337 H HD13 . LEU A 1 33 ? -3.330  0.236   2.741   1.00 0.10 ? 33  LEU A HD13 9  
ATOM   11338 H HD21 . LEU A 1 33 ? -5.983  -2.209  3.403   1.00 0.07 ? 33  LEU A HD21 9  
ATOM   11339 H HD22 . LEU A 1 33 ? -6.587  -1.374  1.971   1.00 0.06 ? 33  LEU A HD22 9  
ATOM   11340 H HD23 . LEU A 1 33 ? -7.297  -1.044  3.548   1.00 0.07 ? 33  LEU A HD23 9  
ATOM   11341 N N    . GLN A 1 34 ? -6.927  1.422   7.568   1.00 0.10 ? 34  GLN A N    9  
ATOM   11342 C CA   . GLN A 1 34 ? -7.143  1.147   8.983   1.00 0.11 ? 34  GLN A CA   9  
ATOM   11343 C C    . GLN A 1 34 ? -8.546  1.563   9.411   1.00 0.11 ? 34  GLN A C    9  
ATOM   11344 O O    . GLN A 1 34 ? -9.130  0.974   10.322  1.00 0.12 ? 34  GLN A O    9  
ATOM   11345 C CB   . GLN A 1 34 ? -6.099  1.877   9.830   1.00 0.12 ? 34  GLN A CB   9  
ATOM   11346 C CG   . GLN A 1 34 ? -4.665  1.575   9.425   1.00 0.13 ? 34  GLN A CG   9  
ATOM   11347 C CD   . GLN A 1 34 ? -3.770  1.294   10.614  1.00 0.14 ? 34  GLN A CD   9  
ATOM   11348 O OE1  . GLN A 1 34 ? -3.917  1.903   11.675  1.00 0.15 ? 34  GLN A OE1  9  
ATOM   11349 N NE2  . GLN A 1 34 ? -2.835  0.367   10.446  1.00 0.14 ? 34  GLN A NE2  9  
ATOM   11350 H H    . GLN A 1 34 ? -6.773  2.346   7.278   1.00 0.10 ? 34  GLN A H    9  
ATOM   11351 H HA   . GLN A 1 34 ? -7.036  0.083   9.133   1.00 0.11 ? 34  GLN A HA   9  
ATOM   11352 H HB2  . GLN A 1 34 ? -6.260  2.941   9.740   1.00 0.13 ? 34  GLN A HB2  9  
ATOM   11353 H HB3  . GLN A 1 34 ? -6.227  1.589   10.864  1.00 0.13 ? 34  GLN A HB3  9  
ATOM   11354 H HG2  . GLN A 1 34 ? -4.663  0.708   8.780   1.00 0.12 ? 34  GLN A HG2  9  
ATOM   11355 H HG3  . GLN A 1 34 ? -4.270  2.424   8.886   1.00 0.13 ? 34  GLN A HG3  9  
ATOM   11356 H HE21 . GLN A 1 34 ? -2.776  -0.079  9.575   1.00 0.13 ? 34  GLN A HE21 9  
ATOM   11357 H HE22 . GLN A 1 34 ? -2.243  0.166   11.200  1.00 0.15 ? 34  GLN A HE22 9  
ATOM   11358 N N    . LYS A 1 35 ? -9.083  2.583   8.749   1.00 0.11 ? 35  LYS A N    9  
ATOM   11359 C CA   . LYS A 1 35 ? -10.419 3.078   9.060   1.00 0.11 ? 35  LYS A CA   9  
ATOM   11360 C C    . LYS A 1 35 ? -11.490 2.177   8.450   1.00 0.11 ? 35  LYS A C    9  
ATOM   11361 O O    . LYS A 1 35 ? -12.544 1.960   9.048   1.00 0.11 ? 35  LYS A O    9  
ATOM   11362 C CB   . LYS A 1 35 ? -10.587 4.509   8.544   1.00 0.12 ? 35  LYS A CB   9  
ATOM   11363 C CG   . LYS A 1 35 ? -10.796 4.593   7.042   1.00 0.11 ? 35  LYS A CG   9  
ATOM   11364 C CD   . LYS A 1 35 ? -10.991 6.030   6.587   1.00 0.11 ? 35  LYS A CD   9  
ATOM   11365 C CE   . LYS A 1 35 ? -12.319 6.211   5.868   1.00 0.11 ? 35  LYS A CE   9  
ATOM   11366 N NZ   . LYS A 1 35 ? -12.975 7.497   6.232   1.00 0.12 ? 35  LYS A NZ   9  
ATOM   11367 H H    . LYS A 1 35 ? -8.567  3.013   8.035   1.00 0.11 ? 35  LYS A H    9  
ATOM   11368 H HA   . LYS A 1 35 ? -10.532 3.076   10.134  1.00 0.12 ? 35  LYS A HA   9  
ATOM   11369 H HB2  . LYS A 1 35 ? -11.440 4.956   9.031   1.00 0.12 ? 35  LYS A HB2  9  
ATOM   11370 H HB3  . LYS A 1 35 ? -9.702  5.075   8.795   1.00 0.12 ? 35  LYS A HB3  9  
ATOM   11371 H HG2  . LYS A 1 35 ? -9.931  4.181   6.547   1.00 0.10 ? 35  LYS A HG2  9  
ATOM   11372 H HG3  . LYS A 1 35 ? -11.671 4.016   6.778   1.00 0.10 ? 35  LYS A HG3  9  
ATOM   11373 H HD2  . LYS A 1 35 ? -10.971 6.677   7.451   1.00 0.12 ? 35  LYS A HD2  9  
ATOM   11374 H HD3  . LYS A 1 35 ? -10.188 6.298   5.917   1.00 0.11 ? 35  LYS A HD3  9  
ATOM   11375 H HE2  . LYS A 1 35 ? -12.144 6.195   4.803   1.00 0.11 ? 35  LYS A HE2  9  
ATOM   11376 H HE3  . LYS A 1 35 ? -12.974 5.395   6.136   1.00 0.11 ? 35  LYS A HE3  9  
ATOM   11377 H HZ1  . LYS A 1 35 ? -13.158 7.528   7.255   1.00 0.13 ? 35  LYS A HZ1  9  
ATOM   11378 H HZ2  . LYS A 1 35 ? -13.878 7.594   5.726   1.00 0.12 ? 35  LYS A HZ2  9  
ATOM   11379 H HZ3  . LYS A 1 35 ? -12.360 8.297   5.976   1.00 0.12 ? 35  LYS A HZ3  9  
ATOM   11380 N N    . GLU A 1 36 ? -11.210 1.657   7.260   1.00 0.10 ? 36  GLU A N    9  
ATOM   11381 C CA   . GLU A 1 36 ? -12.150 0.779   6.571   1.00 0.09 ? 36  GLU A CA   9  
ATOM   11382 C C    . GLU A 1 36 ? -12.223 -0.583  7.253   1.00 0.09 ? 36  GLU A C    9  
ATOM   11383 O O    . GLU A 1 36 ? -13.083 -1.403  6.936   1.00 0.09 ? 36  GLU A O    9  
ATOM   11384 C CB   . GLU A 1 36 ? -11.740 0.607   5.107   1.00 0.08 ? 36  GLU A CB   9  
ATOM   11385 C CG   . GLU A 1 36 ? -11.739 1.905   4.318   1.00 0.08 ? 36  GLU A CG   9  
ATOM   11386 C CD   . GLU A 1 36 ? -13.135 2.456   4.101   1.00 0.09 ? 36  GLU A CD   9  
ATOM   11387 O OE1  . GLU A 1 36 ? -13.256 3.523   3.462   1.00 0.09 ? 36  GLU A OE1  9  
ATOM   11388 O OE2  . GLU A 1 36 ? -14.103 1.824   4.567   1.00 0.09 ? 36  GLU A OE2  9  
ATOM   11389 H H    . GLU A 1 36 ? -10.352 1.869   6.833   1.00 0.09 ? 36  GLU A H    9  
ATOM   11390 H HA   . GLU A 1 36 ? -13.125 1.243   6.611   1.00 0.10 ? 36  GLU A HA   9  
ATOM   11391 H HB2  . GLU A 1 36 ? -10.745 0.188   5.070   1.00 0.08 ? 36  GLU A HB2  9  
ATOM   11392 H HB3  . GLU A 1 36 ? -12.427 -0.078  4.632   1.00 0.08 ? 36  GLU A HB3  9  
ATOM   11393 H HG2  . GLU A 1 36 ? -11.161 2.638   4.859   1.00 0.09 ? 36  GLU A HG2  9  
ATOM   11394 H HG3  . GLU A 1 36 ? -11.284 1.726   3.355   1.00 0.08 ? 36  GLU A HG3  9  
ATOM   11395 N N    . GLY A 1 37 ? -11.314 -0.815  8.197   1.00 0.10 ? 37  GLY A N    9  
ATOM   11396 C CA   . GLY A 1 37 ? -11.293 -2.079  8.911   1.00 0.10 ? 37  GLY A CA   9  
ATOM   11397 C C    . GLY A 1 37 ? -10.581 -3.170  8.136   1.00 0.09 ? 37  GLY A C    9  
ATOM   11398 O O    . GLY A 1 37 ? -10.573 -4.330  8.549   1.00 0.10 ? 37  GLY A O    9  
ATOM   11399 H H    . GLY A 1 37 ? -10.655 -0.122  8.411   1.00 0.10 ? 37  GLY A H    9  
ATOM   11400 H HA2  . GLY A 1 37 ? -10.789 -1.938  9.856   1.00 0.11 ? 37  GLY A HA2  9  
ATOM   11401 H HA3  . GLY A 1 37 ? -12.309 -2.391  9.099   1.00 0.11 ? 37  GLY A HA3  9  
ATOM   11402 N N    . LEU A 1 38 ? -9.982  -2.798  7.009   1.00 0.08 ? 38  LEU A N    9  
ATOM   11403 C CA   . LEU A 1 38 ? -9.264  -3.757  6.173   1.00 0.08 ? 38  LEU A CA   9  
ATOM   11404 C C    . LEU A 1 38 ? -7.950  -4.171  6.826   1.00 0.08 ? 38  LEU A C    9  
ATOM   11405 O O    . LEU A 1 38 ? -7.405  -5.234  6.527   1.00 0.08 ? 38  LEU A O    9  
ATOM   11406 C CB   . LEU A 1 38 ? -8.994  -3.154  4.793   1.00 0.07 ? 38  LEU A CB   9  
ATOM   11407 C CG   . LEU A 1 38 ? -10.219 -2.939  3.904   1.00 0.06 ? 38  LEU A CG   9  
ATOM   11408 C CD1  . LEU A 1 38 ? -9.923  -1.908  2.825   1.00 0.06 ? 38  LEU A CD1  9  
ATOM   11409 C CD2  . LEU A 1 38 ? -10.662 -4.254  3.278   1.00 0.06 ? 38  LEU A CD2  9  
ATOM   11410 H H    . LEU A 1 38 ? -10.023 -1.859  6.732   1.00 0.08 ? 38  LEU A H    9  
ATOM   11411 H HA   . LEU A 1 38 ? -9.888  -4.631  6.060   1.00 0.08 ? 38  LEU A HA   9  
ATOM   11412 H HB2  . LEU A 1 38 ? -8.510  -2.200  4.934   1.00 0.07 ? 38  LEU A HB2  9  
ATOM   11413 H HB3  . LEU A 1 38 ? -8.311  -3.807  4.271   1.00 0.06 ? 38  LEU A HB3  9  
ATOM   11414 H HG   . LEU A 1 38 ? -11.032 -2.565  4.507   1.00 0.07 ? 38  LEU A HG   9  
ATOM   11415 H HD11 . LEU A 1 38 ? -9.676  -0.964  3.288   1.00 0.06 ? 38  LEU A HD11 9  
ATOM   11416 H HD12 . LEU A 1 38 ? -10.792 -1.784  2.197   1.00 0.06 ? 38  LEU A HD12 9  
ATOM   11417 H HD13 . LEU A 1 38 ? -9.090  -2.244  2.225   1.00 0.05 ? 38  LEU A HD13 9  
ATOM   11418 H HD21 . LEU A 1 38 ? -9.848  -4.673  2.705   1.00 0.06 ? 38  LEU A HD21 9  
ATOM   11419 H HD22 . LEU A 1 38 ? -11.506 -4.078  2.628   1.00 0.06 ? 38  LEU A HD22 9  
ATOM   11420 H HD23 . LEU A 1 38 ? -10.946 -4.946  4.057   1.00 0.07 ? 38  LEU A HD23 9  
ATOM   11421 N N    . LEU A 1 39 ? -7.447  -3.326  7.720   1.00 0.09 ? 39  LEU A N    9  
ATOM   11422 C CA   . LEU A 1 39 ? -6.197  -3.606  8.417   1.00 0.10 ? 39  LEU A CA   9  
ATOM   11423 C C    . LEU A 1 39 ? -6.258  -3.118  9.860   1.00 0.11 ? 39  LEU A C    9  
ATOM   11424 O O    . LEU A 1 39 ? -6.932  -2.135  10.166  1.00 0.11 ? 39  LEU A O    9  
ATOM   11425 C CB   . LEU A 1 39 ? -5.025  -2.941  7.692   1.00 0.10 ? 39  LEU A CB   9  
ATOM   11426 C CG   . LEU A 1 39 ? -4.710  -3.477  6.294   1.00 0.09 ? 39  LEU A CG   9  
ATOM   11427 C CD1  . LEU A 1 39 ? -3.504  -2.758  5.707   1.00 0.09 ? 39  LEU A CD1  9  
ATOM   11428 C CD2  . LEU A 1 39 ? -4.468  -4.977  6.340   1.00 0.09 ? 39  LEU A CD2  9  
ATOM   11429 H H    . LEU A 1 39 ? -7.927  -2.494  7.9