data_6D3N
# 
_entry.id   6D3N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.296 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6D3N         
WWPDB D_1000233946 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6D3N 
_pdbx_database_status.recvd_initial_deposition_date   2018-04-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Aruna, B.'    1 ? 
'Zajonc, D.M.' 2 ? 
'Doukov, T.'   3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            293 
_citation.language                  ? 
_citation.page_first                9958 
_citation.page_last                 9969 
_citation.title                     
;Crystal structures of the human 4-1BB receptor bound to its ligand 4-1BBL reveal covalent receptor dimerization as a potential signaling amplifier.
;
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA118.003176 
_citation.pdbx_database_id_PubMed   29720398 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bitra, A.'    1 ? 
primary 'Doukov, T.'   2 ? 
primary 'Croft, M.'    3 ? 
primary 'Zajonc, D.M.' 4 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6D3N 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     73.167 
_cell.length_a_esd                 ? 
_cell.length_b                     73.167 
_cell.length_b_esd                 ? 
_cell.length_c                     162.814 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        18 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6D3N 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Tumor necrosis factor ligand superfamily member 9' 18317.826 1  ? ? 'residues 80-244' ? 
2 non-polymer syn GLYCEROL                                            92.094    1  ? ? ?                 ? 
3 water       nat water                                               18.015    10 ? ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        '4-1BB ligand,4-1BBL' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSG
SVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFR
VTPEIHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSG
SVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFR
VTPEIHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   PRO n 
1 3   ALA n 
1 4   GLY n 
1 5   LEU n 
1 6   LEU n 
1 7   ASP n 
1 8   LEU n 
1 9   ARG n 
1 10  GLN n 
1 11  GLY n 
1 12  MET n 
1 13  PHE n 
1 14  ALA n 
1 15  GLN n 
1 16  LEU n 
1 17  VAL n 
1 18  ALA n 
1 19  GLN n 
1 20  ASN n 
1 21  VAL n 
1 22  LEU n 
1 23  LEU n 
1 24  ILE n 
1 25  ASP n 
1 26  GLY n 
1 27  PRO n 
1 28  LEU n 
1 29  SER n 
1 30  TRP n 
1 31  TYR n 
1 32  SER n 
1 33  ASP n 
1 34  PRO n 
1 35  GLY n 
1 36  LEU n 
1 37  ALA n 
1 38  GLY n 
1 39  VAL n 
1 40  SER n 
1 41  LEU n 
1 42  THR n 
1 43  GLY n 
1 44  GLY n 
1 45  LEU n 
1 46  SER n 
1 47  TYR n 
1 48  LYS n 
1 49  GLU n 
1 50  ASP n 
1 51  THR n 
1 52  LYS n 
1 53  GLU n 
1 54  LEU n 
1 55  VAL n 
1 56  VAL n 
1 57  ALA n 
1 58  LYS n 
1 59  ALA n 
1 60  GLY n 
1 61  VAL n 
1 62  TYR n 
1 63  TYR n 
1 64  VAL n 
1 65  PHE n 
1 66  PHE n 
1 67  GLN n 
1 68  LEU n 
1 69  GLU n 
1 70  LEU n 
1 71  ARG n 
1 72  ARG n 
1 73  VAL n 
1 74  VAL n 
1 75  ALA n 
1 76  GLY n 
1 77  GLU n 
1 78  GLY n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  VAL n 
1 83  SER n 
1 84  LEU n 
1 85  ALA n 
1 86  LEU n 
1 87  HIS n 
1 88  LEU n 
1 89  GLN n 
1 90  PRO n 
1 91  LEU n 
1 92  ARG n 
1 93  SER n 
1 94  ALA n 
1 95  ALA n 
1 96  GLY n 
1 97  ALA n 
1 98  ALA n 
1 99  ALA n 
1 100 LEU n 
1 101 ALA n 
1 102 LEU n 
1 103 THR n 
1 104 VAL n 
1 105 ASP n 
1 106 LEU n 
1 107 PRO n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 SER n 
1 112 GLU n 
1 113 ALA n 
1 114 ARG n 
1 115 ASN n 
1 116 SER n 
1 117 ALA n 
1 118 PHE n 
1 119 GLY n 
1 120 PHE n 
1 121 GLN n 
1 122 GLY n 
1 123 ARG n 
1 124 LEU n 
1 125 LEU n 
1 126 HIS n 
1 127 LEU n 
1 128 SER n 
1 129 ALA n 
1 130 GLY n 
1 131 GLN n 
1 132 ARG n 
1 133 LEU n 
1 134 GLY n 
1 135 VAL n 
1 136 HIS n 
1 137 LEU n 
1 138 HIS n 
1 139 THR n 
1 140 GLU n 
1 141 ALA n 
1 142 ARG n 
1 143 ALA n 
1 144 ARG n 
1 145 HIS n 
1 146 ALA n 
1 147 TRP n 
1 148 GLN n 
1 149 LEU n 
1 150 THR n 
1 151 GLN n 
1 152 GLY n 
1 153 ALA n 
1 154 THR n 
1 155 VAL n 
1 156 LEU n 
1 157 GLY n 
1 158 LEU n 
1 159 PHE n 
1 160 ARG n 
1 161 VAL n 
1 162 THR n 
1 163 PRO n 
1 164 GLU n 
1 165 ILE n 
1 166 HIS n 
1 167 HIS n 
1 168 HIS n 
1 169 HIS n 
1 170 HIS n 
1 171 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   171 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TNFSF9 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Insect cell expression vector pTIE1' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     266783 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TNFL9_HUMAN 
_struct_ref.pdbx_db_accession          P41273 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSG
SVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFR
VTPEI
;
_struct_ref.pdbx_align_begin           80 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6D3N 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 165 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P41273 
_struct_ref_seq.db_align_beg                  80 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  244 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       80 
_struct_ref_seq.pdbx_auth_seq_align_end       244 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6D3N HIS A 166 ? UNP P41273 ? ? 'expression tag' 245 1 
1 6D3N HIS A 167 ? UNP P41273 ? ? 'expression tag' 246 2 
1 6D3N HIS A 168 ? UNP P41273 ? ? 'expression tag' 247 3 
1 6D3N HIS A 169 ? UNP P41273 ? ? 'expression tag' 248 4 
1 6D3N HIS A 170 ? UNP P41273 ? ? 'expression tag' 249 5 
1 6D3N HIS A 171 ? UNP P41273 ? ? 'expression tag' 250 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6D3N 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.29 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         46.27 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;0.085M tri- Na citrate, pH 5.6,
25.5% PEG 4000
0.17M Amm acetate
15% glycerol
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-04-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6D3N 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.700 
_reflns.d_resolution_low                 59.050 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       4818 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  9.200 
_reflns.pdbx_Rmerge_I_obs                0.095 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.600 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             117 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.101 
_reflns.pdbx_Rpim_I_all                  0.033 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         44504 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.996 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.700 2.830  ? ? ? ? ? ? 630 99.400 ? ? ? ? 0.859 ? ? ? ? ? ? ? ? 8.400 ? ? ? ? 0.913 0.303 ? 1 1 0.927 ? 
8.960 59.050 ? ? ? ? ? ? 157 98.500 ? ? ? ? 0.072 ? ? ? ? ? ? ? ? 7.900 ? ? ? ? 0.078 0.028 ? 2 1 0.993 ? 
# 
_refine.aniso_B[1][1]                            0.0800 
_refine.aniso_B[1][2]                            0.0400 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            0.0800 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -0.2600 
_refine.B_iso_max                                169.630 
_refine.B_iso_mean                               77.1540 
_refine.B_iso_min                                46.240 
_refine.correlation_coeff_Fo_to_Fc               0.9470 
_refine.correlation_coeff_Fo_to_Fc_free          0.9070 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6D3N 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.7000 
_refine.ls_d_res_low                             59.0500 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     4340 
_refine.ls_number_reflns_R_free                  475 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.3400 
_refine.ls_percent_reflns_R_free                 9.9000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2119 
_refine.ls_R_factor_R_free                       0.2523 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2076 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6CPR 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       1.1240 
_refine.pdbx_overall_ESU_R_Free                  0.3420 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             13.7550 
_refine.overall_SU_ML                            0.2710 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.7000 
_refine_hist.d_res_low                        59.0500 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             10 
_refine_hist.number_atoms_total               1017 
_refine_hist.pdbx_number_residues_total       137 
_refine_hist.pdbx_B_iso_mean_ligand           118.37 
_refine_hist.pdbx_B_iso_mean_solvent          86.74 
_refine_hist.pdbx_number_atoms_protein        1001 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  0.019  1024 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  963  ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.267  1.966  1393 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 0.853  3.000  2196 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 7.590  5.000  133  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 37.999 22.973 37   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 16.486 15.000 143  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 12.062 15.000 5    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.074  0.200  170  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.020  1139 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  214  ? r_gen_planes_other     ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.7000 
_refine_ls_shell.d_res_low                        2.7700 
_refine_ls_shell.number_reflns_all                349 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             31 
_refine_ls_shell.number_reflns_R_work             318 
_refine_ls_shell.percent_reflns_obs               99.1500 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3370 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.3210 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6D3N 
_struct.title                        'Crystal structure of h4-1BB ligand' 
_struct.pdbx_descriptor              
'Tumor necrosis factor ligand superfamily member 9, Tumor necrosis factor receptor superfamily member 9' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6D3N 
_struct_keywords.text            'TNF, bell shape fold, SIGNALING PROTEIN' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TRP A 30  ? SER A 32  ? TRP A 109 SER A 111 
AA1 2 PHE A 13  ? ALA A 18  ? PHE A 92  ALA A 97  
AA1 3 VAL A 155 ? ARG A 160 ? VAL A 234 ARG A 239 
AA1 4 GLY A 60  ? ARG A 72  ? GLY A 139 ARG A 151 
AA1 5 SER A 116 ? LEU A 127 ? SER A 195 LEU A 206 
AA2 1 TRP A 30  ? SER A 32  ? TRP A 109 SER A 111 
AA2 2 PHE A 13  ? ALA A 18  ? PHE A 92  ALA A 97  
AA2 3 VAL A 155 ? ARG A 160 ? VAL A 234 ARG A 239 
AA2 4 GLY A 60  ? ARG A 72  ? GLY A 139 ARG A 151 
AA2 5 TRP A 147 ? LEU A 149 ? TRP A 226 LEU A 228 
AA3 1 GLY A 26  ? PRO A 27  ? GLY A 105 PRO A 106 
AA3 2 ARG A 132 ? ALA A 141 ? ARG A 211 ALA A 220 
AA3 3 GLU A 53  ? VAL A 55  ? GLU A 132 VAL A 134 
AA3 4 SER A 46  ? LYS A 48  ? SER A 125 LYS A 127 
AA4 1 GLY A 26  ? PRO A 27  ? GLY A 105 PRO A 106 
AA4 2 ARG A 132 ? ALA A 141 ? ARG A 211 ALA A 220 
AA4 3 GLY A 80  ? LEU A 88  ? GLY A 159 LEU A 167 
AA4 4 LEU A 100 ? LEU A 106 ? LEU A 179 LEU A 185 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O TYR A 31  ? O TYR A 110 N VAL A 17  ? N VAL A 96  
AA1 2 3 N LEU A 16  ? N LEU A 95  O LEU A 156 ? O LEU A 235 
AA1 3 4 O GLY A 157 ? O GLY A 236 N PHE A 65  ? N PHE A 144 
AA1 4 5 N GLY A 60  ? N GLY A 139 O LEU A 127 ? O LEU A 206 
AA2 1 2 O TYR A 31  ? O TYR A 110 N VAL A 17  ? N VAL A 96  
AA2 2 3 N LEU A 16  ? N LEU A 95  O LEU A 156 ? O LEU A 235 
AA2 3 4 O GLY A 157 ? O GLY A 236 N PHE A 65  ? N PHE A 144 
AA2 4 5 N ARG A 71  ? N ARG A 150 O GLN A 148 ? O GLN A 227 
AA3 1 2 N GLY A 26  ? N GLY A 105 O LEU A 137 ? O LEU A 216 
AA3 2 3 O LEU A 133 ? O LEU A 212 N LEU A 54  ? N LEU A 133 
AA3 3 4 O VAL A 55  ? O VAL A 134 N SER A 46  ? N SER A 125 
AA4 1 2 N GLY A 26  ? N GLY A 105 O LEU A 137 ? O LEU A 216 
AA4 2 3 O HIS A 138 ? O HIS A 217 N SER A 83  ? N SER A 162 
AA4 3 4 N LEU A 86  ? N LEU A 165 O LEU A 100 ? O LEU A 179 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    GOL 
_struct_site.pdbx_auth_seq_id     601 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    1 
_struct_site.details              'binding site for residue GOL A 601' 
# 
_struct_site_gen.id                   1 
_struct_site_gen.site_id              AC1 
_struct_site_gen.pdbx_num_res         1 
_struct_site_gen.label_comp_id        LEU 
_struct_site_gen.label_asym_id        A 
_struct_site_gen.label_seq_id         36 
_struct_site_gen.pdbx_auth_ins_code   ? 
_struct_site_gen.auth_comp_id         LEU 
_struct_site_gen.auth_asym_id         A 
_struct_site_gen.auth_seq_id          115 
_struct_site_gen.label_atom_id        . 
_struct_site_gen.label_alt_id         ? 
_struct_site_gen.symmetry             1_555 
_struct_site_gen.details              ? 
# 
_atom_sites.entry_id                    6D3N 
_atom_sites.fract_transf_matrix[1][1]   0.013667 
_atom_sites.fract_transf_matrix[1][2]   0.007891 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015782 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006142 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 12  ? -2.885  -33.941 22.123  1.00 75.27  ? 91  MET A N   1 
ATOM   2    C CA  . MET A 1 12  ? -2.460  -32.771 21.277  1.00 79.65  ? 91  MET A CA  1 
ATOM   3    C C   . MET A 1 12  ? -2.426  -33.161 19.793  1.00 76.39  ? 91  MET A C   1 
ATOM   4    O O   . MET A 1 12  ? -1.594  -33.960 19.363  1.00 72.15  ? 91  MET A O   1 
ATOM   5    C CB  . MET A 1 12  ? -1.093  -32.214 21.716  1.00 78.93  ? 91  MET A CB  1 
ATOM   6    N N   . PHE A 1 13  ? -3.354  -32.591 19.032  1.00 71.39  ? 92  PHE A N   1 
ATOM   7    C CA  . PHE A 1 13  ? -3.545  -32.922 17.638  1.00 68.64  ? 92  PHE A CA  1 
ATOM   8    C C   . PHE A 1 13  ? -4.309  -31.808 16.954  1.00 65.73  ? 92  PHE A C   1 
ATOM   9    O O   . PHE A 1 13  ? -4.897  -30.962 17.612  1.00 69.47  ? 92  PHE A O   1 
ATOM   10   C CB  . PHE A 1 13  ? -4.337  -34.233 17.504  1.00 73.65  ? 92  PHE A CB  1 
ATOM   11   C CG  . PHE A 1 13  ? -5.755  -34.150 18.022  1.00 78.10  ? 92  PHE A CG  1 
ATOM   12   C CD1 . PHE A 1 13  ? -6.077  -34.633 19.287  1.00 77.32  ? 92  PHE A CD1 1 
ATOM   13   C CD2 . PHE A 1 13  ? -6.777  -33.584 17.243  1.00 80.63  ? 92  PHE A CD2 1 
ATOM   14   C CE1 . PHE A 1 13  ? -7.380  -34.548 19.771  1.00 78.09  ? 92  PHE A CE1 1 
ATOM   15   C CE2 . PHE A 1 13  ? -8.076  -33.495 17.726  1.00 79.59  ? 92  PHE A CE2 1 
ATOM   16   C CZ  . PHE A 1 13  ? -8.378  -33.977 18.994  1.00 78.43  ? 92  PHE A CZ  1 
ATOM   17   N N   . ALA A 1 14  ? -4.342  -31.851 15.630  1.00 62.77  ? 93  ALA A N   1 
ATOM   18   C CA  . ALA A 1 14  ? -5.139  -30.917 14.847  1.00 56.69  ? 93  ALA A CA  1 
ATOM   19   C C   . ALA A 1 14  ? -5.283  -31.395 13.427  1.00 54.46  ? 93  ALA A C   1 
ATOM   20   O O   . ALA A 1 14  ? -4.454  -32.130 12.916  1.00 53.55  ? 93  ALA A O   1 
ATOM   21   C CB  . ALA A 1 14  ? -4.515  -29.533 14.855  1.00 54.96  ? 93  ALA A CB  1 
ATOM   22   N N   . GLN A 1 15  ? -6.347  -30.941 12.795  1.00 55.21  ? 94  GLN A N   1 
ATOM   23   C CA  . GLN A 1 15  ? -6.590  -31.205 11.402  1.00 53.22  ? 94  GLN A CA  1 
ATOM   24   C C   . GLN A 1 15  ? -7.329  -30.021 10.778  1.00 52.48  ? 94  GLN A C   1 
ATOM   25   O O   . GLN A 1 15  ? -8.325  -29.570 11.319  1.00 51.66  ? 94  GLN A O   1 
ATOM   26   C CB  . GLN A 1 15  ? -7.386  -32.485 11.272  1.00 52.41  ? 94  GLN A CB  1 
ATOM   27   C CG  . GLN A 1 15  ? -7.640  -32.904 9.834   1.00 52.46  ? 94  GLN A CG  1 
ATOM   28   C CD  . GLN A 1 15  ? -7.853  -34.392 9.721   1.00 50.39  ? 94  GLN A CD  1 
ATOM   29   O OE1 . GLN A 1 15  ? -6.896  -35.153 9.685   1.00 51.12  ? 94  GLN A OE1 1 
ATOM   30   N NE2 . GLN A 1 15  ? -9.104  -34.813 9.689   1.00 48.11  ? 94  GLN A NE2 1 
ATOM   31   N N   . LEU A 1 16  ? -6.816  -29.523 9.655   1.00 53.84  ? 95  LEU A N   1 
ATOM   32   C CA  . LEU A 1 16  ? -7.380  -28.380 8.951   1.00 54.60  ? 95  LEU A CA  1 
ATOM   33   C C   . LEU A 1 16  ? -7.706  -28.764 7.522   1.00 54.62  ? 95  LEU A C   1 
ATOM   34   O O   . LEU A 1 16  ? -7.064  -29.623 6.938   1.00 57.07  ? 95  LEU A O   1 
ATOM   35   C CB  . LEU A 1 16  ? -6.384  -27.231 8.922   1.00 57.83  ? 95  LEU A CB  1 
ATOM   36   C CG  . LEU A 1 16  ? -5.724  -26.836 10.244  1.00 61.22  ? 95  LEU A CG  1 
ATOM   37   C CD1 . LEU A 1 16  ? -4.493  -25.992 9.959   1.00 63.73  ? 95  LEU A CD1 1 
ATOM   38   C CD2 . LEU A 1 16  ? -6.700  -26.106 11.152  1.00 59.95  ? 95  LEU A CD2 1 
ATOM   39   N N   . VAL A 1 17  ? -8.693  -28.091 6.960   1.00 56.21  ? 96  VAL A N   1 
ATOM   40   C CA  . VAL A 1 17  ? -9.120  -28.295 5.590   1.00 54.73  ? 96  VAL A CA  1 
ATOM   41   C C   . VAL A 1 17  ? -8.904  -26.976 4.819   1.00 58.34  ? 96  VAL A C   1 
ATOM   42   O O   . VAL A 1 17  ? -9.116  -25.879 5.358   1.00 56.13  ? 96  VAL A O   1 
ATOM   43   C CB  . VAL A 1 17  ? -10.590 -28.716 5.579   1.00 53.61  ? 96  VAL A CB  1 
ATOM   44   C CG1 . VAL A 1 17  ? -11.086 -28.927 4.155   1.00 54.63  ? 96  VAL A CG1 1 
ATOM   45   C CG2 . VAL A 1 17  ? -10.782 -29.967 6.443   1.00 55.09  ? 96  VAL A CG2 1 
ATOM   46   N N   . ALA A 1 18  ? -8.462  -27.082 3.569   1.00 59.26  ? 97  ALA A N   1 
ATOM   47   C CA  . ALA A 1 18  ? -8.149  -25.903 2.777   1.00 64.67  ? 97  ALA A CA  1 
ATOM   48   C C   . ALA A 1 18  ? -9.426  -25.353 2.154   1.00 67.66  ? 97  ALA A C   1 
ATOM   49   O O   . ALA A 1 18  ? -10.224 -26.114 1.611   1.00 66.71  ? 97  ALA A O   1 
ATOM   50   C CB  . ALA A 1 18  ? -7.122  -26.225 1.700   1.00 65.33  ? 97  ALA A CB  1 
ATOM   51   N N   . GLN A 1 19  ? -9.601  -24.030 2.239   1.00 73.77  ? 98  GLN A N   1 
ATOM   52   C CA  . GLN A 1 19  ? -10.718 -23.321 1.594   1.00 72.37  ? 98  GLN A CA  1 
ATOM   53   C C   . GLN A 1 19  ? -10.528 -23.232 0.089   1.00 66.80  ? 98  GLN A C   1 
ATOM   54   O O   . GLN A 1 19  ? -11.501 -23.208 -0.662  1.00 68.41  ? 98  GLN A O   1 
ATOM   55   C CB  . GLN A 1 19  ? -10.847 -21.895 2.131   1.00 79.07  ? 98  GLN A CB  1 
ATOM   56   C CG  . GLN A 1 19  ? -11.085 -21.782 3.627   1.00 85.64  ? 98  GLN A CG  1 
ATOM   57   C CD  . GLN A 1 19  ? -11.125 -20.337 4.086   1.00 89.96  ? 98  GLN A CD  1 
ATOM   58   O OE1 . GLN A 1 19  ? -12.044 -19.593 3.734   1.00 93.18  ? 98  GLN A OE1 1 
ATOM   59   N NE2 . GLN A 1 19  ? -10.130 -19.931 4.879   1.00 84.66  ? 98  GLN A NE2 1 
ATOM   60   N N   . ASN A 1 20  ? -9.271  -23.217 -0.344  1.00 64.97  ? 99  ASN A N   1 
ATOM   61   C CA  . ASN A 1 20  ? -8.920  -22.908 -1.729  1.00 65.63  ? 99  ASN A CA  1 
ATOM   62   C C   . ASN A 1 20  ? -9.370  -24.031 -2.626  1.00 64.40  ? 99  ASN A C   1 
ATOM   63   O O   . ASN A 1 20  ? -9.082  -25.186 -2.319  1.00 67.21  ? 99  ASN A O   1 
ATOM   64   C CB  . ASN A 1 20  ? -7.404  -22.769 -1.906  1.00 66.54  ? 99  ASN A CB  1 
ATOM   65   C CG  . ASN A 1 20  ? -6.785  -21.752 -0.970  1.00 67.40  ? 99  ASN A CG  1 
ATOM   66   O OD1 . ASN A 1 20  ? -6.423  -20.650 -1.377  1.00 64.49  ? 99  ASN A OD1 1 
ATOM   67   N ND2 . ASN A 1 20  ? -6.640  -22.131 0.286   1.00 65.99  ? 99  ASN A ND2 1 
ATOM   68   N N   . VAL A 1 21  ? -10.095 -23.712 -3.702  1.00 65.98  ? 100 VAL A N   1 
ATOM   69   C CA  . VAL A 1 21  ? -10.246 -24.671 -4.819  1.00 69.77  ? 100 VAL A CA  1 
ATOM   70   C C   . VAL A 1 21  ? -9.485  -24.250 -6.073  1.00 70.33  ? 100 VAL A C   1 
ATOM   71   O O   . VAL A 1 21  ? -8.984  -25.109 -6.793  1.00 76.38  ? 100 VAL A O   1 
ATOM   72   C CB  . VAL A 1 21  ? -11.710 -25.033 -5.183  1.00 68.55  ? 100 VAL A CB  1 
ATOM   73   C CG1 . VAL A 1 21  ? -12.582 -25.165 -3.941  1.00 68.63  ? 100 VAL A CG1 1 
ATOM   74   C CG2 . VAL A 1 21  ? -12.297 -24.044 -6.149  1.00 72.02  ? 100 VAL A CG2 1 
ATOM   75   N N   . LEU A 1 22  ? -9.406  -22.949 -6.343  1.00 71.04  ? 101 LEU A N   1 
ATOM   76   C CA  . LEU A 1 22  ? -8.678  -22.462 -7.512  1.00 72.61  ? 101 LEU A CA  1 
ATOM   77   C C   . LEU A 1 22  ? -7.175  -22.555 -7.312  1.00 73.58  ? 101 LEU A C   1 
ATOM   78   O O   . LEU A 1 22  ? -6.675  -22.339 -6.209  1.00 72.14  ? 101 LEU A O   1 
ATOM   79   C CB  . LEU A 1 22  ? -9.053  -21.015 -7.841  1.00 72.35  ? 101 LEU A CB  1 
ATOM   80   C CG  . LEU A 1 22  ? -10.496 -20.764 -8.273  1.00 71.76  ? 101 LEU A CG  1 
ATOM   81   C CD1 . LEU A 1 22  ? -10.694 -19.279 -8.537  1.00 70.80  ? 101 LEU A CD1 1 
ATOM   82   C CD2 . LEU A 1 22  ? -10.871 -21.597 -9.495  1.00 70.93  ? 101 LEU A CD2 1 
ATOM   83   N N   . LEU A 1 23  ? -6.474  -22.839 -8.408  1.00 77.03  ? 102 LEU A N   1 
ATOM   84   C CA  . LEU A 1 23  ? -5.033  -23.029 -8.408  1.00 78.30  ? 102 LEU A CA  1 
ATOM   85   C C   . LEU A 1 23  ? -4.292  -21.710 -8.488  1.00 79.91  ? 102 LEU A C   1 
ATOM   86   O O   . LEU A 1 23  ? -3.641  -21.412 -9.489  1.00 85.76  ? 102 LEU A O   1 
ATOM   87   C CB  . LEU A 1 23  ? -4.618  -23.930 -9.580  1.00 79.26  ? 102 LEU A CB  1 
ATOM   88   C CG  . LEU A 1 23  ? -5.112  -25.372 -9.533  1.00 81.68  ? 102 LEU A CG  1 
ATOM   89   C CD1 . LEU A 1 23  ? -4.650  -26.115 -10.775 1.00 84.44  ? 102 LEU A CD1 1 
ATOM   90   C CD2 . LEU A 1 23  ? -4.634  -26.089 -8.278  1.00 79.75  ? 102 LEU A CD2 1 
ATOM   91   N N   . ILE A 1 24  ? -4.377  -20.927 -7.424  1.00 84.77  ? 103 ILE A N   1 
ATOM   92   C CA  . ILE A 1 24  ? -3.615  -19.689 -7.332  1.00 95.16  ? 103 ILE A CA  1 
ATOM   93   C C   . ILE A 1 24  ? -2.394  -20.006 -6.476  1.00 92.14  ? 103 ILE A C   1 
ATOM   94   O O   . ILE A 1 24  ? -2.535  -20.535 -5.373  1.00 89.26  ? 103 ILE A O   1 
ATOM   95   C CB  . ILE A 1 24  ? -4.466  -18.512 -6.767  1.00 98.68  ? 103 ILE A CB  1 
ATOM   96   C CG1 . ILE A 1 24  ? -5.510  -18.074 -7.815  1.00 96.43  ? 103 ILE A CG1 1 
ATOM   97   C CG2 . ILE A 1 24  ? -3.582  -17.323 -6.366  1.00 95.61  ? 103 ILE A CG2 1 
ATOM   98   C CD1 . ILE A 1 24  ? -6.592  -17.143 -7.299  1.00 95.08  ? 103 ILE A CD1 1 
ATOM   99   N N   . ASP A 1 25  ? -1.209  -19.677 -6.999  1.00 94.98  ? 104 ASP A N   1 
ATOM   100  C CA  . ASP A 1 25  ? 0.064   -19.831 -6.275  1.00 98.59  ? 104 ASP A CA  1 
ATOM   101  C C   . ASP A 1 25  ? 0.048   -19.076 -4.947  1.00 95.09  ? 104 ASP A C   1 
ATOM   102  O O   . ASP A 1 25  ? -0.757  -18.156 -4.751  1.00 103.97 ? 104 ASP A O   1 
ATOM   103  C CB  . ASP A 1 25  ? 1.253   -19.312 -7.105  1.00 105.92 ? 104 ASP A CB  1 
ATOM   104  C CG  . ASP A 1 25  ? 1.494   -20.119 -8.378  1.00 112.15 ? 104 ASP A CG  1 
ATOM   105  O OD1 . ASP A 1 25  ? 0.529   -20.326 -9.143  1.00 121.78 ? 104 ASP A OD1 1 
ATOM   106  O OD2 . ASP A 1 25  ? 2.653   -20.523 -8.623  1.00 113.04 ? 104 ASP A OD2 1 
ATOM   107  N N   . GLY A 1 26  ? 0.945   -19.467 -4.047  1.00 88.51  ? 105 GLY A N   1 
ATOM   108  C CA  . GLY A 1 26  ? 1.070   -18.826 -2.735  1.00 85.59  ? 105 GLY A CA  1 
ATOM   109  C C   . GLY A 1 26  ? 0.435   -19.626 -1.612  1.00 80.86  ? 105 GLY A C   1 
ATOM   110  O O   . GLY A 1 26  ? 0.046   -20.776 -1.819  1.00 78.07  ? 105 GLY A O   1 
ATOM   111  N N   . PRO A 1 27  ? 0.313   -19.022 -0.412  1.00 80.09  ? 106 PRO A N   1 
ATOM   112  C CA  . PRO A 1 27  ? -0.078  -19.792 0.779   1.00 78.01  ? 106 PRO A CA  1 
ATOM   113  C C   . PRO A 1 27  ? -1.564  -20.148 0.834   1.00 72.97  ? 106 PRO A C   1 
ATOM   114  O O   . PRO A 1 27  ? -2.403  -19.330 0.462   1.00 77.43  ? 106 PRO A O   1 
ATOM   115  C CB  . PRO A 1 27  ? 0.294   -18.859 1.951   1.00 80.33  ? 106 PRO A CB  1 
ATOM   116  C CG  . PRO A 1 27  ? 0.958   -17.663 1.346   1.00 80.82  ? 106 PRO A CG  1 
ATOM   117  C CD  . PRO A 1 27  ? 0.509   -17.602 -0.081  1.00 79.17  ? 106 PRO A CD  1 
ATOM   118  N N   . LEU A 1 28  ? -1.871  -21.354 1.305   1.00 67.43  ? 107 LEU A N   1 
ATOM   119  C CA  . LEU A 1 28  ? -3.260  -21.813 1.449   1.00 65.70  ? 107 LEU A CA  1 
ATOM   120  C C   . LEU A 1 28  ? -3.936  -21.231 2.689   1.00 64.08  ? 107 LEU A C   1 
ATOM   121  O O   . LEU A 1 28  ? -3.285  -20.973 3.705   1.00 61.23  ? 107 LEU A O   1 
ATOM   122  C CB  . LEU A 1 28  ? -3.337  -23.343 1.525   1.00 62.59  ? 107 LEU A CB  1 
ATOM   123  C CG  . LEU A 1 28  ? -2.943  -24.166 0.295   1.00 62.76  ? 107 LEU A CG  1 
ATOM   124  C CD1 . LEU A 1 28  ? -3.250  -25.639 0.547   1.00 63.25  ? 107 LEU A CD1 1 
ATOM   125  C CD2 . LEU A 1 28  ? -3.644  -23.687 -0.971  1.00 63.82  ? 107 LEU A CD2 1 
ATOM   126  N N   . SER A 1 29  ? -5.238  -20.992 2.560   1.00 64.84  ? 108 SER A N   1 
ATOM   127  C CA  . SER A 1 29  ? -6.119  -20.624 3.664   1.00 70.18  ? 108 SER A CA  1 
ATOM   128  C C   . SER A 1 29  ? -6.817  -21.875 4.203   1.00 71.53  ? 108 SER A C   1 
ATOM   129  O O   . SER A 1 29  ? -7.313  -22.711 3.435   1.00 69.41  ? 108 SER A O   1 
ATOM   130  C CB  . SER A 1 29  ? -7.174  -19.619 3.187   1.00 72.41  ? 108 SER A CB  1 
ATOM   131  O OG  . SER A 1 29  ? -6.575  -18.547 2.481   1.00 75.18  ? 108 SER A OG  1 
ATOM   132  N N   . TRP A 1 30  ? -6.879  -21.972 5.526   1.00 67.28  ? 109 TRP A N   1 
ATOM   133  C CA  . TRP A 1 30  ? -7.327  -23.176 6.195   1.00 67.38  ? 109 TRP A CA  1 
ATOM   134  C C   . TRP A 1 30  ? -8.487  -22.881 7.111   1.00 72.37  ? 109 TRP A C   1 
ATOM   135  O O   . TRP A 1 30  ? -8.770  -21.725 7.419   1.00 83.32  ? 109 TRP A O   1 
ATOM   136  C CB  . TRP A 1 30  ? -6.181  -23.772 7.008   1.00 66.84  ? 109 TRP A CB  1 
ATOM   137  C CG  . TRP A 1 30  ? -5.013  -24.120 6.162   1.00 66.48  ? 109 TRP A CG  1 
ATOM   138  C CD1 . TRP A 1 30  ? -3.960  -23.315 5.847   1.00 64.75  ? 109 TRP A CD1 1 
ATOM   139  C CD2 . TRP A 1 30  ? -4.797  -25.353 5.483   1.00 66.51  ? 109 TRP A CD2 1 
ATOM   140  N NE1 . TRP A 1 30  ? -3.092  -23.978 5.018   1.00 66.15  ? 109 TRP A NE1 1 
ATOM   141  C CE2 . TRP A 1 30  ? -3.578  -25.236 4.782   1.00 67.78  ? 109 TRP A CE2 1 
ATOM   142  C CE3 . TRP A 1 30  ? -5.511  -26.556 5.405   1.00 69.25  ? 109 TRP A CE3 1 
ATOM   143  C CZ2 . TRP A 1 30  ? -3.048  -26.288 4.014   1.00 66.13  ? 109 TRP A CZ2 1 
ATOM   144  C CZ3 . TRP A 1 30  ? -4.982  -27.604 4.637   1.00 67.29  ? 109 TRP A CZ3 1 
ATOM   145  C CH2 . TRP A 1 30  ? -3.766  -27.454 3.952   1.00 65.55  ? 109 TRP A CH2 1 
ATOM   146  N N   . TYR A 1 31  ? -9.161  -23.943 7.538   1.00 68.48  ? 110 TYR A N   1 
ATOM   147  C CA  . TYR A 1 31  ? -10.178 -23.851 8.569   1.00 63.13  ? 110 TYR A CA  1 
ATOM   148  C C   . TYR A 1 31  ? -10.234 -25.173 9.310   1.00 62.50  ? 110 TYR A C   1 
ATOM   149  O O   . TYR A 1 31  ? -10.009 -26.209 8.695   1.00 62.96  ? 110 TYR A O   1 
ATOM   150  C CB  . TYR A 1 31  ? -11.531 -23.486 7.940   1.00 59.28  ? 110 TYR A CB  1 
ATOM   151  C CG  . TYR A 1 31  ? -12.232 -24.579 7.169   1.00 55.50  ? 110 TYR A CG  1 
ATOM   152  C CD1 . TYR A 1 31  ? -12.048 -24.741 5.793   1.00 54.77  ? 110 TYR A CD1 1 
ATOM   153  C CD2 . TYR A 1 31  ? -13.143 -25.409 7.801   1.00 57.91  ? 110 TYR A CD2 1 
ATOM   154  C CE1 . TYR A 1 31  ? -12.730 -25.732 5.086   1.00 51.71  ? 110 TYR A CE1 1 
ATOM   155  C CE2 . TYR A 1 31  ? -13.816 -26.410 7.111   1.00 56.66  ? 110 TYR A CE2 1 
ATOM   156  C CZ  . TYR A 1 31  ? -13.609 -26.566 5.759   1.00 54.19  ? 110 TYR A CZ  1 
ATOM   157  O OH  . TYR A 1 31  ? -14.293 -27.562 5.120   1.00 55.75  ? 110 TYR A OH  1 
ATOM   158  N N   . SER A 1 32  ? -10.526 -25.139 10.614  1.00 61.29  ? 111 SER A N   1 
ATOM   159  C CA  . SER A 1 32  ? -10.671 -26.372 11.401  1.00 64.38  ? 111 SER A CA  1 
ATOM   160  C C   . SER A 1 32  ? -11.647 -27.373 10.787  1.00 68.11  ? 111 SER A C   1 
ATOM   161  O O   . SER A 1 32  ? -12.665 -27.002 10.227  1.00 66.20  ? 111 SER A O   1 
ATOM   162  C CB  . SER A 1 32  ? -11.122 -26.083 12.831  1.00 65.64  ? 111 SER A CB  1 
ATOM   163  O OG  . SER A 1 32  ? -10.011 -26.005 13.687  1.00 70.70  ? 111 SER A OG  1 
ATOM   164  N N   . ASP A 1 33  ? -11.333 -28.653 10.926  1.00 76.21  ? 112 ASP A N   1 
ATOM   165  C CA  . ASP A 1 33  ? -12.179 -29.708 10.389  1.00 81.42  ? 112 ASP A CA  1 
ATOM   166  C C   . ASP A 1 33  ? -13.507 -29.715 11.163  1.00 82.69  ? 112 ASP A C   1 
ATOM   167  O O   . ASP A 1 33  ? -13.486 -29.738 12.394  1.00 77.96  ? 112 ASP A O   1 
ATOM   168  C CB  . ASP A 1 33  ? -11.481 -31.072 10.501  1.00 81.66  ? 112 ASP A CB  1 
ATOM   169  C CG  . ASP A 1 33  ? -12.114 -32.129 9.620   1.00 81.17  ? 112 ASP A CG  1 
ATOM   170  O OD1 . ASP A 1 33  ? -11.351 -32.878 8.981   1.00 90.46  ? 112 ASP A OD1 1 
ATOM   171  O OD2 . ASP A 1 33  ? -13.360 -32.219 9.558   1.00 77.56  ? 112 ASP A OD2 1 
ATOM   172  N N   . PRO A 1 34  ? -14.656 -29.666 10.447  1.00 87.69  ? 113 PRO A N   1 
ATOM   173  C CA  . PRO A 1 34  ? -15.964 -29.869 11.073  1.00 85.87  ? 113 PRO A CA  1 
ATOM   174  C C   . PRO A 1 34  ? -16.056 -31.202 11.813  1.00 84.26  ? 113 PRO A C   1 
ATOM   175  O O   . PRO A 1 34  ? -16.583 -31.246 12.922  1.00 84.68  ? 113 PRO A O   1 
ATOM   176  C CB  . PRO A 1 34  ? -16.931 -29.873 9.883   1.00 88.42  ? 113 PRO A CB  1 
ATOM   177  C CG  . PRO A 1 34  ? -16.237 -29.131 8.804   1.00 88.11  ? 113 PRO A CG  1 
ATOM   178  C CD  . PRO A 1 34  ? -14.782 -29.409 8.999   1.00 90.37  ? 113 PRO A CD  1 
ATOM   179  N N   . GLY A 1 35  ? -15.520 -32.263 11.204  1.00 80.45  ? 114 GLY A N   1 
ATOM   180  C CA  . GLY A 1 35  ? -15.490 -33.599 11.798  1.00 80.65  ? 114 GLY A CA  1 
ATOM   181  C C   . GLY A 1 35  ? -15.025 -33.730 13.247  1.00 81.08  ? 114 GLY A C   1 
ATOM   182  O O   . GLY A 1 35  ? -15.436 -34.670 13.928  1.00 89.09  ? 114 GLY A O   1 
ATOM   183  N N   . LEU A 1 36  ? -14.182 -32.805 13.718  1.00 75.08  ? 115 LEU A N   1 
ATOM   184  C CA  . LEU A 1 36  ? -13.584 -32.872 15.059  1.00 78.30  ? 115 LEU A CA  1 
ATOM   185  C C   . LEU A 1 36  ? -14.105 -31.809 16.026  1.00 78.41  ? 115 LEU A C   1 
ATOM   186  O O   . LEU A 1 36  ? -14.984 -31.013 15.693  1.00 87.40  ? 115 LEU A O   1 
ATOM   187  C CB  . LEU A 1 36  ? -12.069 -32.711 14.946  1.00 80.04  ? 115 LEU A CB  1 
ATOM   188  C CG  . LEU A 1 36  ? -11.295 -33.670 14.035  1.00 77.29  ? 115 LEU A CG  1 
ATOM   189  C CD1 . LEU A 1 36  ? -9.856  -33.203 13.951  1.00 79.74  ? 115 LEU A CD1 1 
ATOM   190  C CD2 . LEU A 1 36  ? -11.351 -35.105 14.536  1.00 76.28  ? 115 LEU A CD2 1 
ATOM   191  N N   . LEU A 1 45  ? -2.965  -25.734 20.756  1.00 107.94 ? 124 LEU A N   1 
ATOM   192  C CA  . LEU A 1 45  ? -2.455  -25.238 19.472  1.00 107.72 ? 124 LEU A CA  1 
ATOM   193  C C   . LEU A 1 45  ? -3.599  -24.687 18.602  1.00 107.52 ? 124 LEU A C   1 
ATOM   194  O O   . LEU A 1 45  ? -4.751  -25.099 18.767  1.00 106.74 ? 124 LEU A O   1 
ATOM   195  C CB  . LEU A 1 45  ? -1.652  -26.342 18.755  1.00 103.74 ? 124 LEU A CB  1 
ATOM   196  C CG  . LEU A 1 45  ? -2.303  -27.388 17.834  1.00 95.93  ? 124 LEU A CG  1 
ATOM   197  C CD1 . LEU A 1 45  ? -2.359  -26.913 16.386  1.00 95.62  ? 124 LEU A CD1 1 
ATOM   198  C CD2 . LEU A 1 45  ? -1.551  -28.708 17.917  1.00 90.91  ? 124 LEU A CD2 1 
ATOM   199  N N   . SER A 1 46  ? -3.280  -23.758 17.691  1.00 104.21 ? 125 SER A N   1 
ATOM   200  C CA  . SER A 1 46  ? -4.311  -23.013 16.944  1.00 98.82  ? 125 SER A CA  1 
ATOM   201  C C   . SER A 1 46  ? -3.867  -22.406 15.610  1.00 94.72  ? 125 SER A C   1 
ATOM   202  O O   . SER A 1 46  ? -2.680  -22.300 15.303  1.00 93.32  ? 125 SER A O   1 
ATOM   203  C CB  . SER A 1 46  ? -4.872  -21.880 17.811  1.00 98.53  ? 125 SER A CB  1 
ATOM   204  O OG  . SER A 1 46  ? -4.058  -20.722 17.712  1.00 95.57  ? 125 SER A OG  1 
ATOM   205  N N   . TYR A 1 47  ? -4.871  -21.962 14.860  1.00 88.74  ? 126 TYR A N   1 
ATOM   206  C CA  . TYR A 1 47  ? -4.712  -21.370 13.543  1.00 85.84  ? 126 TYR A CA  1 
ATOM   207  C C   . TYR A 1 47  ? -4.784  -19.838 13.634  1.00 88.20  ? 126 TYR A C   1 
ATOM   208  O O   . TYR A 1 47  ? -5.474  -19.301 14.497  1.00 93.12  ? 126 TYR A O   1 
ATOM   209  C CB  . TYR A 1 47  ? -5.822  -21.921 12.636  1.00 81.49  ? 126 TYR A CB  1 
ATOM   210  C CG  . TYR A 1 47  ? -5.792  -21.419 11.219  1.00 78.27  ? 126 TYR A CG  1 
ATOM   211  C CD1 . TYR A 1 47  ? -6.904  -20.789 10.657  1.00 76.89  ? 126 TYR A CD1 1 
ATOM   212  C CD2 . TYR A 1 47  ? -4.650  -21.565 10.435  1.00 76.72  ? 126 TYR A CD2 1 
ATOM   213  C CE1 . TYR A 1 47  ? -6.879  -20.321 9.349   1.00 76.59  ? 126 TYR A CE1 1 
ATOM   214  C CE2 . TYR A 1 47  ? -4.613  -21.096 9.127   1.00 79.03  ? 126 TYR A CE2 1 
ATOM   215  C CZ  . TYR A 1 47  ? -5.727  -20.474 8.585   1.00 77.07  ? 126 TYR A CZ  1 
ATOM   216  O OH  . TYR A 1 47  ? -5.684  -20.019 7.279   1.00 78.03  ? 126 TYR A OH  1 
ATOM   217  N N   . LYS A 1 48  ? -4.054  -19.156 12.748  1.00 93.64  ? 127 LYS A N   1 
ATOM   218  C CA  . LYS A 1 48  ? -4.069  -17.691 12.613  1.00 91.81  ? 127 LYS A CA  1 
ATOM   219  C C   . LYS A 1 48  ? -4.508  -17.316 11.201  1.00 95.53  ? 127 LYS A C   1 
ATOM   220  O O   . LYS A 1 48  ? -3.731  -17.455 10.255  1.00 99.18  ? 127 LYS A O   1 
ATOM   221  C CB  . LYS A 1 48  ? -2.675  -17.111 12.846  1.00 91.75  ? 127 LYS A CB  1 
ATOM   222  C CG  . LYS A 1 48  ? -2.135  -17.244 14.259  1.00 98.23  ? 127 LYS A CG  1 
ATOM   223  C CD  . LYS A 1 48  ? -0.755  -16.598 14.360  1.00 105.34 ? 127 LYS A CD  1 
ATOM   224  C CE  . LYS A 1 48  ? -0.829  -15.069 14.368  1.00 110.01 ? 127 LYS A CE  1 
ATOM   225  N NZ  . LYS A 1 48  ? 0.050   -14.444 13.340  1.00 108.66 ? 127 LYS A NZ  1 
ATOM   226  N N   . GLU A 1 49  ? -5.738  -16.830 11.058  1.00 101.11 ? 128 GLU A N   1 
ATOM   227  C CA  . GLU A 1 49  ? -6.294  -16.502 9.737   1.00 106.63 ? 128 GLU A CA  1 
ATOM   228  C C   . GLU A 1 49  ? -5.560  -15.359 9.032   1.00 111.14 ? 128 GLU A C   1 
ATOM   229  O O   . GLU A 1 49  ? -5.468  -15.357 7.804   1.00 112.49 ? 128 GLU A O   1 
ATOM   230  C CB  . GLU A 1 49  ? -7.786  -16.167 9.847   1.00 106.59 ? 128 GLU A CB  1 
ATOM   231  N N   . ASP A 1 50  ? -5.036  -14.406 9.805   1.00 121.70 ? 129 ASP A N   1 
ATOM   232  C CA  . ASP A 1 50  ? -4.361  -13.219 9.242   1.00 131.82 ? 129 ASP A CA  1 
ATOM   233  C C   . ASP A 1 50  ? -3.068  -13.527 8.456   1.00 130.68 ? 129 ASP A C   1 
ATOM   234  O O   . ASP A 1 50  ? -2.877  -12.989 7.359   1.00 136.60 ? 129 ASP A O   1 
ATOM   235  C CB  . ASP A 1 50  ? -4.117  -12.131 10.318  1.00 135.78 ? 129 ASP A CB  1 
ATOM   236  C CG  . ASP A 1 50  ? -3.219  -12.599 11.461  1.00 137.07 ? 129 ASP A CG  1 
ATOM   237  O OD1 . ASP A 1 50  ? -3.461  -13.699 12.001  1.00 143.17 ? 129 ASP A OD1 1 
ATOM   238  O OD2 . ASP A 1 50  ? -2.279  -11.860 11.827  1.00 133.39 ? 129 ASP A OD2 1 
ATOM   239  N N   . THR A 1 51  ? -2.204  -14.386 9.007   1.00 122.32 ? 130 THR A N   1 
ATOM   240  C CA  . THR A 1 51  ? -0.960  -14.816 8.340   1.00 116.66 ? 130 THR A CA  1 
ATOM   241  C C   . THR A 1 51  ? -1.083  -16.185 7.644   1.00 113.98 ? 130 THR A C   1 
ATOM   242  O O   . THR A 1 51  ? -0.129  -16.632 6.997   1.00 114.82 ? 130 THR A O   1 
ATOM   243  C CB  . THR A 1 51  ? 0.223   -14.869 9.335   1.00 116.28 ? 130 THR A CB  1 
ATOM   244  O OG1 . THR A 1 51  ? -0.162  -15.588 10.513  1.00 109.01 ? 130 THR A OG1 1 
ATOM   245  C CG2 . THR A 1 51  ? 0.664   -13.462 9.720   1.00 119.19 ? 130 THR A CG2 1 
ATOM   246  N N   . LYS A 1 52  ? -2.253  -16.826 7.770   1.00 107.50 ? 131 LYS A N   1 
ATOM   247  C CA  . LYS A 1 52  ? -2.531  -18.164 7.221   1.00 95.98  ? 131 LYS A CA  1 
ATOM   248  C C   . LYS A 1 52  ? -1.566  -19.212 7.798   1.00 93.27  ? 131 LYS A C   1 
ATOM   249  O O   . LYS A 1 52  ? -1.084  -20.092 7.078   1.00 85.02  ? 131 LYS A O   1 
ATOM   250  C CB  . LYS A 1 52  ? -2.483  -18.164 5.686   1.00 90.96  ? 131 LYS A CB  1 
ATOM   251  C CG  . LYS A 1 52  ? -3.226  -17.028 5.004   1.00 93.10  ? 131 LYS A CG  1 
ATOM   252  C CD  . LYS A 1 52  ? -3.005  -17.080 3.500   1.00 95.48  ? 131 LYS A CD  1 
ATOM   253  C CE  . LYS A 1 52  ? -3.324  -15.767 2.811   1.00 96.13  ? 131 LYS A CE  1 
ATOM   254  N NZ  . LYS A 1 52  ? -4.788  -15.550 2.696   1.00 100.33 ? 131 LYS A NZ  1 
ATOM   255  N N   . GLU A 1 53  ? -1.305  -19.109 9.103   1.00 90.54  ? 132 GLU A N   1 
ATOM   256  C CA  . GLU A 1 53  ? -0.306  -19.929 9.771   1.00 91.09  ? 132 GLU A CA  1 
ATOM   257  C C   . GLU A 1 53  ? -0.901  -20.684 10.948  1.00 90.14  ? 132 GLU A C   1 
ATOM   258  O O   . GLU A 1 53  ? -1.450  -20.072 11.852  1.00 97.56  ? 132 GLU A O   1 
ATOM   259  C CB  . GLU A 1 53  ? 0.856   -19.058 10.253  1.00 96.55  ? 132 GLU A CB  1 
ATOM   260  C CG  . GLU A 1 53  ? 1.876   -18.735 9.171   1.00 102.93 ? 132 GLU A CG  1 
ATOM   261  C CD  . GLU A 1 53  ? 3.060   -17.931 9.693   1.00 109.45 ? 132 GLU A CD  1 
ATOM   262  O OE1 . GLU A 1 53  ? 2.834   -16.854 10.297  1.00 111.91 ? 132 GLU A OE1 1 
ATOM   263  O OE2 . GLU A 1 53  ? 4.219   -18.371 9.487   1.00 110.54 ? 132 GLU A OE2 1 
ATOM   264  N N   . LEU A 1 54  ? -0.795  -22.013 10.922  1.00 89.94  ? 133 LEU A N   1 
ATOM   265  C CA  . LEU A 1 54  ? -1.027  -22.844 12.100  1.00 88.56  ? 133 LEU A CA  1 
ATOM   266  C C   . LEU A 1 54  ? 0.110   -22.584 13.084  1.00 83.57  ? 133 LEU A C   1 
ATOM   267  O O   . LEU A 1 54  ? 1.241   -22.399 12.661  1.00 81.11  ? 133 LEU A O   1 
ATOM   268  C CB  . LEU A 1 54  ? -1.066  -24.327 11.712  1.00 94.72  ? 133 LEU A CB  1 
ATOM   269  C CG  . LEU A 1 54  ? -1.256  -25.367 12.832  1.00 102.09 ? 133 LEU A CG  1 
ATOM   270  C CD1 . LEU A 1 54  ? -2.581  -25.188 13.576  1.00 102.23 ? 133 LEU A CD1 1 
ATOM   271  C CD2 . LEU A 1 54  ? -1.147  -26.768 12.248  1.00 104.36 ? 133 LEU A CD2 1 
ATOM   272  N N   . VAL A 1 55  ? -0.185  -22.566 14.383  1.00 81.78  ? 134 VAL A N   1 
ATOM   273  C CA  . VAL A 1 55  ? 0.840   -22.349 15.411  1.00 81.69  ? 134 VAL A CA  1 
ATOM   274  C C   . VAL A 1 55  ? 0.800   -23.462 16.451  1.00 79.31  ? 134 VAL A C   1 
ATOM   275  O O   . VAL A 1 55  ? -0.260  -23.775 16.981  1.00 81.99  ? 134 VAL A O   1 
ATOM   276  C CB  . VAL A 1 55  ? 0.669   -20.990 16.124  1.00 82.79  ? 134 VAL A CB  1 
ATOM   277  C CG1 . VAL A 1 55  ? 1.897   -20.676 16.976  1.00 82.44  ? 134 VAL A CG1 1 
ATOM   278  C CG2 . VAL A 1 55  ? 0.419   -19.882 15.106  1.00 85.68  ? 134 VAL A CG2 1 
ATOM   279  N N   . VAL A 1 56  ? 1.969   -24.021 16.754  1.00 78.01  ? 135 VAL A N   1 
ATOM   280  C CA  . VAL A 1 56  ? 2.109   -25.135 17.690  1.00 80.93  ? 135 VAL A CA  1 
ATOM   281  C C   . VAL A 1 56  ? 2.349   -24.592 19.097  1.00 85.11  ? 135 VAL A C   1 
ATOM   282  O O   . VAL A 1 56  ? 3.197   -23.720 19.287  1.00 95.08  ? 135 VAL A O   1 
ATOM   283  C CB  . VAL A 1 56  ? 3.286   -26.055 17.283  1.00 79.89  ? 135 VAL A CB  1 
ATOM   284  C CG1 . VAL A 1 56  ? 3.446   -27.220 18.259  1.00 78.17  ? 135 VAL A CG1 1 
ATOM   285  C CG2 . VAL A 1 56  ? 3.088   -26.564 15.860  1.00 79.06  ? 135 VAL A CG2 1 
ATOM   286  N N   . ALA A 1 57  ? 1.604   -25.120 20.069  1.00 89.36  ? 136 ALA A N   1 
ATOM   287  C CA  . ALA A 1 57  ? 1.732   -24.734 21.476  1.00 85.22  ? 136 ALA A CA  1 
ATOM   288  C C   . ALA A 1 57  ? 2.795   -25.593 22.152  1.00 85.50  ? 136 ALA A C   1 
ATOM   289  O O   . ALA A 1 57  ? 3.843   -25.079 22.540  1.00 87.22  ? 136 ALA A O   1 
ATOM   290  C CB  . ALA A 1 57  ? 0.396   -24.869 22.193  1.00 85.31  ? 136 ALA A CB  1 
ATOM   291  N N   . LYS A 1 58  ? 2.540   -26.896 22.269  1.00 84.93  ? 137 LYS A N   1 
ATOM   292  C CA  . LYS A 1 58  ? 3.460   -27.806 22.970  1.00 88.04  ? 137 LYS A CA  1 
ATOM   293  C C   . LYS A 1 58  ? 4.612   -28.276 22.071  1.00 90.76  ? 137 LYS A C   1 
ATOM   294  O O   . LYS A 1 58  ? 4.397   -28.682 20.927  1.00 84.89  ? 137 LYS A O   1 
ATOM   295  C CB  . LYS A 1 58  ? 2.710   -29.022 23.522  1.00 85.31  ? 137 LYS A CB  1 
ATOM   296  N N   . ALA A 1 59  ? 5.834   -28.223 22.604  1.00 96.79  ? 138 ALA A N   1 
ATOM   297  C CA  . ALA A 1 59  ? 7.005   -28.765 21.912  1.00 93.63  ? 138 ALA A CA  1 
ATOM   298  C C   . ALA A 1 59  ? 6.890   -30.279 21.849  1.00 84.74  ? 138 ALA A C   1 
ATOM   299  O O   . ALA A 1 59  ? 6.304   -30.889 22.741  1.00 83.20  ? 138 ALA A O   1 
ATOM   300  C CB  . ALA A 1 59  ? 8.288   -28.371 22.633  1.00 96.47  ? 138 ALA A CB  1 
ATOM   301  N N   . GLY A 1 60  ? 7.430   -30.877 20.791  1.00 77.23  ? 139 GLY A N   1 
ATOM   302  C CA  . GLY A 1 60  ? 7.479   -32.336 20.684  1.00 74.15  ? 139 GLY A CA  1 
ATOM   303  C C   . GLY A 1 60  ? 7.658   -32.870 19.281  1.00 69.57  ? 139 GLY A C   1 
ATOM   304  O O   . GLY A 1 60  ? 7.792   -32.104 18.316  1.00 63.43  ? 139 GLY A O   1 
ATOM   305  N N   . VAL A 1 61  ? 7.668   -34.199 19.189  1.00 67.24  ? 140 VAL A N   1 
ATOM   306  C CA  . VAL A 1 61  ? 7.684   -34.896 17.908  1.00 65.44  ? 140 VAL A CA  1 
ATOM   307  C C   . VAL A 1 61  ? 6.246   -35.211 17.492  1.00 63.72  ? 140 VAL A C   1 
ATOM   308  O O   . VAL A 1 61  ? 5.489   -35.865 18.234  1.00 60.06  ? 140 VAL A O   1 
ATOM   309  C CB  . VAL A 1 61  ? 8.518   -36.187 17.957  1.00 65.27  ? 140 VAL A CB  1 
ATOM   310  C CG1 . VAL A 1 61  ? 8.602   -36.829 16.571  1.00 67.69  ? 140 VAL A CG1 1 
ATOM   311  C CG2 . VAL A 1 61  ? 9.909   -35.871 18.482  1.00 67.67  ? 140 VAL A CG2 1 
ATOM   312  N N   . TYR A 1 62  ? 5.890   -34.735 16.301  1.00 56.98  ? 141 TYR A N   1 
ATOM   313  C CA  . TYR A 1 62  ? 4.552   -34.875 15.764  1.00 57.13  ? 141 TYR A CA  1 
ATOM   314  C C   . TYR A 1 62  ? 4.600   -35.728 14.526  1.00 54.35  ? 141 TYR A C   1 
ATOM   315  O O   . TYR A 1 62  ? 5.540   -35.617 13.746  1.00 59.48  ? 141 TYR A O   1 
ATOM   316  C CB  . TYR A 1 62  ? 4.007   -33.502 15.374  1.00 60.30  ? 141 TYR A CB  1 
ATOM   317  C CG  . TYR A 1 62  ? 3.573   -32.670 16.541  1.00 61.76  ? 141 TYR A CG  1 
ATOM   318  C CD1 . TYR A 1 62  ? 4.492   -31.931 17.263  1.00 65.89  ? 141 TYR A CD1 1 
ATOM   319  C CD2 . TYR A 1 62  ? 2.234   -32.630 16.936  1.00 64.53  ? 141 TYR A CD2 1 
ATOM   320  C CE1 . TYR A 1 62  ? 4.095   -31.167 18.350  1.00 71.76  ? 141 TYR A CE1 1 
ATOM   321  C CE2 . TYR A 1 62  ? 1.822   -31.867 18.013  1.00 66.00  ? 141 TYR A CE2 1 
ATOM   322  C CZ  . TYR A 1 62  ? 2.758   -31.133 18.716  1.00 70.17  ? 141 TYR A CZ  1 
ATOM   323  O OH  . TYR A 1 62  ? 2.373   -30.366 19.783  1.00 73.55  ? 141 TYR A OH  1 
ATOM   324  N N   . TYR A 1 63  ? 3.596   -36.575 14.338  1.00 50.19  ? 142 TYR A N   1 
ATOM   325  C CA  . TYR A 1 63  ? 3.349   -37.155 13.032  1.00 48.73  ? 142 TYR A CA  1 
ATOM   326  C C   . TYR A 1 63  ? 2.552   -36.134 12.240  1.00 48.12  ? 142 TYR A C   1 
ATOM   327  O O   . TYR A 1 63  ? 1.495   -35.719 12.688  1.00 47.35  ? 142 TYR A O   1 
ATOM   328  C CB  . TYR A 1 63  ? 2.562   -38.454 13.133  1.00 51.26  ? 142 TYR A CB  1 
ATOM   329  C CG  . TYR A 1 63  ? 2.415   -39.101 11.786  1.00 52.76  ? 142 TYR A CG  1 
ATOM   330  C CD1 . TYR A 1 63  ? 3.530   -39.624 11.134  1.00 54.65  ? 142 TYR A CD1 1 
ATOM   331  C CD2 . TYR A 1 63  ? 1.189   -39.146 11.139  1.00 52.47  ? 142 TYR A CD2 1 
ATOM   332  C CE1 . TYR A 1 63  ? 3.429   -40.192 9.884   1.00 55.94  ? 142 TYR A CE1 1 
ATOM   333  C CE2 . TYR A 1 63  ? 1.071   -39.721 9.887   1.00 55.24  ? 142 TYR A CE2 1 
ATOM   334  C CZ  . TYR A 1 63  ? 2.196   -40.243 9.263   1.00 57.88  ? 142 TYR A CZ  1 
ATOM   335  O OH  . TYR A 1 63  ? 2.110   -40.810 8.013   1.00 59.05  ? 142 TYR A OH  1 
ATOM   336  N N   . VAL A 1 64  ? 3.059   -35.716 11.084  1.00 48.16  ? 143 VAL A N   1 
ATOM   337  C CA  . VAL A 1 64  ? 2.395   -34.681 10.285  1.00 50.14  ? 143 VAL A CA  1 
ATOM   338  C C   . VAL A 1 64  ? 2.108   -35.204 8.896   1.00 49.92  ? 143 VAL A C   1 
ATOM   339  O O   . VAL A 1 64  ? 2.983   -35.741 8.252   1.00 47.02  ? 143 VAL A O   1 
ATOM   340  C CB  . VAL A 1 64  ? 3.263   -33.418 10.134  1.00 51.40  ? 143 VAL A CB  1 
ATOM   341  C CG1 . VAL A 1 64  ? 2.546   -32.366 9.283   1.00 50.36  ? 143 VAL A CG1 1 
ATOM   342  C CG2 . VAL A 1 64  ? 3.625   -32.859 11.503  1.00 53.16  ? 143 VAL A CG2 1 
ATOM   343  N N   . PHE A 1 65  ? 0.890   -34.997 8.422   1.00 51.17  ? 144 PHE A N   1 
ATOM   344  C CA  . PHE A 1 65  ? 0.499   -35.483 7.108   1.00 51.74  ? 144 PHE A CA  1 
ATOM   345  C C   . PHE A 1 65  ? -0.288  -34.437 6.372   1.00 50.94  ? 144 PHE A C   1 
ATOM   346  O O   . PHE A 1 65  ? -0.960  -33.627 6.980   1.00 51.94  ? 144 PHE A O   1 
ATOM   347  C CB  . PHE A 1 65  ? -0.333  -36.759 7.219   1.00 51.31  ? 144 PHE A CB  1 
ATOM   348  C CG  . PHE A 1 65  ? -1.537  -36.626 8.106   1.00 50.29  ? 144 PHE A CG  1 
ATOM   349  C CD1 . PHE A 1 65  ? -2.777  -36.291 7.574   1.00 50.31  ? 144 PHE A CD1 1 
ATOM   350  C CD2 . PHE A 1 65  ? -1.431  -36.843 9.480   1.00 50.00  ? 144 PHE A CD2 1 
ATOM   351  C CE1 . PHE A 1 65  ? -3.888  -36.173 8.396   1.00 49.54  ? 144 PHE A CE1 1 
ATOM   352  C CE2 . PHE A 1 65  ? -2.539  -36.728 10.305  1.00 49.36  ? 144 PHE A CE2 1 
ATOM   353  C CZ  . PHE A 1 65  ? -3.767  -36.399 9.762   1.00 49.53  ? 144 PHE A CZ  1 
ATOM   354  N N   . PHE A 1 66  ? -0.176  -34.460 5.054   1.00 55.14  ? 145 PHE A N   1 
ATOM   355  C CA  . PHE A 1 66  ? -1.078  -33.714 4.208   1.00 56.55  ? 145 PHE A CA  1 
ATOM   356  C C   . PHE A 1 66  ? -1.415  -34.477 2.940   1.00 56.40  ? 145 PHE A C   1 
ATOM   357  O O   . PHE A 1 66  ? -0.792  -35.485 2.611   1.00 54.77  ? 145 PHE A O   1 
ATOM   358  C CB  . PHE A 1 66  ? -0.647  -32.248 3.973   1.00 59.64  ? 145 PHE A CB  1 
ATOM   359  C CG  . PHE A 1 66  ? 0.662   -32.044 3.247   1.00 64.84  ? 145 PHE A CG  1 
ATOM   360  C CD1 . PHE A 1 66  ? 1.422   -33.079 2.694   1.00 69.17  ? 145 PHE A CD1 1 
ATOM   361  C CD2 . PHE A 1 66  ? 1.128   -30.738 3.100   1.00 69.32  ? 145 PHE A CD2 1 
ATOM   362  C CE1 . PHE A 1 66  ? 2.619   -32.806 2.039   1.00 72.32  ? 145 PHE A CE1 1 
ATOM   363  C CE2 . PHE A 1 66  ? 2.319   -30.465 2.451   1.00 68.33  ? 145 PHE A CE2 1 
ATOM   364  C CZ  . PHE A 1 66  ? 3.065   -31.502 1.918   1.00 71.23  ? 145 PHE A CZ  1 
ATOM   365  N N   . GLN A 1 67  ? -2.427  -33.960 2.263   1.00 58.99  ? 146 GLN A N   1 
ATOM   366  C CA  . GLN A 1 67  ? -3.236  -34.686 1.324   1.00 61.27  ? 146 GLN A CA  1 
ATOM   367  C C   . GLN A 1 67  ? -3.767  -33.643 0.354   1.00 60.73  ? 146 GLN A C   1 
ATOM   368  O O   . GLN A 1 67  ? -4.113  -32.541 0.757   1.00 59.06  ? 146 GLN A O   1 
ATOM   369  C CB  . GLN A 1 67  ? -4.368  -35.321 2.119   1.00 68.72  ? 146 GLN A CB  1 
ATOM   370  C CG  . GLN A 1 67  ? -5.418  -36.085 1.345   1.00 75.26  ? 146 GLN A CG  1 
ATOM   371  C CD  . GLN A 1 67  ? -6.557  -36.550 2.237   1.00 81.15  ? 146 GLN A CD  1 
ATOM   372  O OE1 . GLN A 1 67  ? -6.335  -37.028 3.356   1.00 81.27  ? 146 GLN A OE1 1 
ATOM   373  N NE2 . GLN A 1 67  ? -7.789  -36.400 1.750   1.00 86.94  ? 146 GLN A NE2 1 
ATOM   374  N N   . LEU A 1 68  ? -3.823  -33.990 -0.920  1.00 65.21  ? 147 LEU A N   1 
ATOM   375  C CA  . LEU A 1 68  ? -4.188  -33.053 -1.986  1.00 66.55  ? 147 LEU A CA  1 
ATOM   376  C C   . LEU A 1 68  ? -4.931  -33.842 -3.047  1.00 63.87  ? 147 LEU A C   1 
ATOM   377  O O   . LEU A 1 68  ? -4.416  -34.841 -3.531  1.00 62.46  ? 147 LEU A O   1 
ATOM   378  C CB  . LEU A 1 68  ? -2.908  -32.471 -2.588  1.00 70.87  ? 147 LEU A CB  1 
ATOM   379  C CG  . LEU A 1 68  ? -3.016  -31.418 -3.690  1.00 74.54  ? 147 LEU A CG  1 
ATOM   380  C CD1 . LEU A 1 68  ? -3.322  -30.058 -3.083  1.00 78.99  ? 147 LEU A CD1 1 
ATOM   381  C CD2 . LEU A 1 68  ? -1.733  -31.351 -4.500  1.00 76.60  ? 147 LEU A CD2 1 
ATOM   382  N N   . GLU A 1 69  ? -6.144  -33.427 -3.382  1.00 66.63  ? 148 GLU A N   1 
ATOM   383  C CA  . GLU A 1 69  ? -6.860  -34.003 -4.521  1.00 68.25  ? 148 GLU A CA  1 
ATOM   384  C C   . GLU A 1 69  ? -7.061  -32.932 -5.598  1.00 65.24  ? 148 GLU A C   1 
ATOM   385  O O   . GLU A 1 69  ? -7.205  -31.749 -5.296  1.00 65.39  ? 148 GLU A O   1 
ATOM   386  C CB  . GLU A 1 69  ? -8.185  -34.596 -4.069  1.00 72.95  ? 148 GLU A CB  1 
ATOM   387  C CG  . GLU A 1 69  ? -8.797  -35.564 -5.070  1.00 82.33  ? 148 GLU A CG  1 
ATOM   388  C CD  . GLU A 1 69  ? -10.202 -36.004 -4.679  1.00 91.55  ? 148 GLU A CD  1 
ATOM   389  O OE1 . GLU A 1 69  ? -11.117 -35.889 -5.530  1.00 97.65  ? 148 GLU A OE1 1 
ATOM   390  O OE2 . GLU A 1 69  ? -10.394 -36.450 -3.520  1.00 90.51  ? 148 GLU A OE2 1 
ATOM   391  N N   . LEU A 1 70  ? -7.037  -33.350 -6.855  1.00 66.85  ? 149 LEU A N   1 
ATOM   392  C CA  . LEU A 1 70  ? -7.240  -32.443 -7.988  1.00 69.66  ? 149 LEU A CA  1 
ATOM   393  C C   . LEU A 1 70  ? -8.241  -33.039 -8.978  1.00 67.07  ? 149 LEU A C   1 
ATOM   394  O O   . LEU A 1 70  ? -8.298  -34.249 -9.171  1.00 63.80  ? 149 LEU A O   1 
ATOM   395  C CB  . LEU A 1 70  ? -5.897  -32.145 -8.659  1.00 73.33  ? 149 LEU A CB  1 
ATOM   396  C CG  . LEU A 1 70  ? -5.045  -31.071 -7.949  1.00 77.24  ? 149 LEU A CG  1 
ATOM   397  C CD1 . LEU A 1 70  ? -3.635  -31.553 -7.621  1.00 82.46  ? 149 LEU A CD1 1 
ATOM   398  C CD2 . LEU A 1 70  ? -4.978  -29.790 -8.764  1.00 74.75  ? 149 LEU A CD2 1 
ATOM   399  N N   . ARG A 1 71  ? -9.051  -32.178 -9.578  1.00 72.45  ? 150 ARG A N   1 
ATOM   400  C CA  . ARG A 1 71  ? -10.072 -32.600 -10.539 1.00 74.54  ? 150 ARG A CA  1 
ATOM   401  C C   . ARG A 1 71  ? -9.925  -31.767 -11.806 1.00 74.78  ? 150 ARG A C   1 
ATOM   402  O O   . ARG A 1 71  ? -9.732  -30.540 -11.738 1.00 71.49  ? 150 ARG A O   1 
ATOM   403  C CB  . ARG A 1 71  ? -11.472 -32.461 -9.944  1.00 78.65  ? 150 ARG A CB  1 
ATOM   404  C CG  . ARG A 1 71  ? -11.872 -31.047 -9.528  1.00 88.47  ? 150 ARG A CG  1 
ATOM   405  C CD  . ARG A 1 71  ? -13.121 -31.040 -8.668  1.00 94.25  ? 150 ARG A CD  1 
ATOM   406  N NE  . ARG A 1 71  ? -14.222 -31.741 -9.322  1.00 103.21 ? 150 ARG A NE  1 
ATOM   407  C CZ  . ARG A 1 71  ? -15.343 -32.149 -8.725  1.00 111.21 ? 150 ARG A CZ  1 
ATOM   408  N NH1 . ARG A 1 71  ? -15.562 -31.923 -7.425  1.00 115.10 ? 150 ARG A NH1 1 
ATOM   409  N NH2 . ARG A 1 71  ? -16.269 -32.784 -9.446  1.00 110.10 ? 150 ARG A NH2 1 
ATOM   410  N N   . ARG A 1 72  ? -9.955  -32.446 -12.952 1.00 76.09  ? 151 ARG A N   1 
ATOM   411  C CA  . ARG A 1 72  ? -9.916  -31.779 -14.250 1.00 80.96  ? 151 ARG A CA  1 
ATOM   412  C C   . ARG A 1 72  ? -11.324 -31.291 -14.544 1.00 79.65  ? 151 ARG A C   1 
ATOM   413  O O   . ARG A 1 72  ? -12.282 -32.056 -14.429 1.00 76.46  ? 151 ARG A O   1 
ATOM   414  C CB  . ARG A 1 72  ? -9.454  -32.738 -15.349 1.00 84.80  ? 151 ARG A CB  1 
ATOM   415  C CG  . ARG A 1 72  ? -9.018  -32.043 -16.635 1.00 88.18  ? 151 ARG A CG  1 
ATOM   416  C CD  . ARG A 1 72  ? -9.154  -32.942 -17.857 1.00 87.44  ? 151 ARG A CD  1 
ATOM   417  N NE  . ARG A 1 72  ? -8.320  -34.140 -17.759 1.00 83.55  ? 151 ARG A NE  1 
ATOM   418  C CZ  . ARG A 1 72  ? -6.999  -34.172 -17.944 1.00 83.35  ? 151 ARG A CZ  1 
ATOM   419  N NH1 . ARG A 1 72  ? -6.297  -33.069 -18.234 1.00 82.61  ? 151 ARG A NH1 1 
ATOM   420  N NH2 . ARG A 1 72  ? -6.362  -35.330 -17.818 1.00 83.15  ? 151 ARG A NH2 1 
ATOM   421  N N   . VAL A 1 73  ? -11.444 -30.023 -14.921 1.00 81.33  ? 152 VAL A N   1 
ATOM   422  C CA  . VAL A 1 73  ? -12.752 -29.408 -15.140 1.00 92.30  ? 152 VAL A CA  1 
ATOM   423  C C   . VAL A 1 73  ? -12.822 -28.740 -16.522 1.00 99.51  ? 152 VAL A C   1 
ATOM   424  O O   . VAL A 1 73  ? -13.123 -27.551 -16.646 1.00 97.97  ? 152 VAL A O   1 
ATOM   425  C CB  . VAL A 1 73  ? -13.116 -28.449 -13.975 1.00 93.34  ? 152 VAL A CB  1 
ATOM   426  C CG1 . VAL A 1 73  ? -13.432 -29.257 -12.715 1.00 90.70  ? 152 VAL A CG1 1 
ATOM   427  C CG2 . VAL A 1 73  ? -12.011 -27.421 -13.703 1.00 86.17  ? 152 VAL A CG2 1 
ATOM   428  N N   . VAL A 1 74  ? -12.527 -29.536 -17.554 1.00 107.70 ? 153 VAL A N   1 
ATOM   429  C CA  . VAL A 1 74  ? -12.582 -29.103 -18.959 1.00 109.50 ? 153 VAL A CA  1 
ATOM   430  C C   . VAL A 1 74  ? -13.074 -30.267 -19.826 1.00 109.62 ? 153 VAL A C   1 
ATOM   431  O O   . VAL A 1 74  ? -12.337 -31.215 -20.095 1.00 112.46 ? 153 VAL A O   1 
ATOM   432  C CB  . VAL A 1 74  ? -11.205 -28.575 -19.453 1.00 107.90 ? 153 VAL A CB  1 
ATOM   433  C CG1 . VAL A 1 74  ? -11.195 -28.359 -20.965 1.00 110.07 ? 153 VAL A CG1 1 
ATOM   434  C CG2 . VAL A 1 74  ? -10.847 -27.275 -18.743 1.00 105.24 ? 153 VAL A CG2 1 
ATOM   435  N N   . GLU A 1 77  ? -8.477  -30.048 -20.835 1.00 137.04 ? 156 GLU A N   1 
ATOM   436  C CA  . GLU A 1 77  ? -7.355  -30.459 -21.675 1.00 134.58 ? 156 GLU A CA  1 
ATOM   437  C C   . GLU A 1 77  ? -6.039  -29.787 -21.247 1.00 134.74 ? 156 GLU A C   1 
ATOM   438  O O   . GLU A 1 77  ? -5.257  -29.344 -22.097 1.00 134.51 ? 156 GLU A O   1 
ATOM   439  C CB  . GLU A 1 77  ? -7.664  -30.150 -23.143 1.00 125.35 ? 156 GLU A CB  1 
ATOM   440  N N   . GLY A 1 78  ? -5.805  -29.730 -19.931 1.00 128.11 ? 157 GLY A N   1 
ATOM   441  C CA  . GLY A 1 78  ? -4.594  -29.128 -19.343 1.00 121.22 ? 157 GLY A CA  1 
ATOM   442  C C   . GLY A 1 78  ? -3.622  -30.175 -18.822 1.00 116.96 ? 157 GLY A C   1 
ATOM   443  O O   . GLY A 1 78  ? -3.968  -31.354 -18.713 1.00 116.29 ? 157 GLY A O   1 
ATOM   444  N N   . SER A 1 79  ? -2.404  -29.743 -18.501 1.00 110.43 ? 158 SER A N   1 
ATOM   445  C CA  . SER A 1 79  ? -1.362  -30.649 -17.993 1.00 114.97 ? 158 SER A CA  1 
ATOM   446  C C   . SER A 1 79  ? -0.269  -29.901 -17.216 1.00 112.56 ? 158 SER A C   1 
ATOM   447  O O   . SER A 1 79  ? -0.305  -28.676 -17.133 1.00 121.30 ? 158 SER A O   1 
ATOM   448  C CB  . SER A 1 79  ? -0.742  -31.439 -19.152 1.00 116.12 ? 158 SER A CB  1 
ATOM   449  O OG  . SER A 1 79  ? -0.047  -30.586 -20.048 1.00 112.50 ? 158 SER A OG  1 
ATOM   450  N N   . GLY A 1 80  ? 0.683   -30.642 -16.642 1.00 104.04 ? 159 GLY A N   1 
ATOM   451  C CA  . GLY A 1 80  ? 1.830   -30.056 -15.922 1.00 105.42 ? 159 GLY A CA  1 
ATOM   452  C C   . GLY A 1 80  ? 2.075   -30.702 -14.567 1.00 101.72 ? 159 GLY A C   1 
ATOM   453  O O   . GLY A 1 80  ? 2.136   -31.930 -14.470 1.00 104.08 ? 159 GLY A O   1 
ATOM   454  N N   . SER A 1 81  ? 2.237   -29.884 -13.525 1.00 96.61  ? 160 SER A N   1 
ATOM   455  C CA  . SER A 1 81  ? 2.310   -30.391 -12.146 1.00 93.29  ? 160 SER A CA  1 
ATOM   456  C C   . SER A 1 81  ? 1.980   -29.329 -11.091 1.00 88.51  ? 160 SER A C   1 
ATOM   457  O O   . SER A 1 81  ? 2.064   -28.122 -11.352 1.00 87.43  ? 160 SER A O   1 
ATOM   458  C CB  . SER A 1 81  ? 3.691   -30.998 -11.852 1.00 94.16  ? 160 SER A CB  1 
ATOM   459  O OG  . SER A 1 81  ? 4.625   -30.010 -11.439 1.00 96.61  ? 160 SER A OG  1 
ATOM   460  N N   . VAL A 1 82  ? 1.622   -29.809 -9.900  1.00 80.96  ? 161 VAL A N   1 
ATOM   461  C CA  . VAL A 1 82  ? 1.281   -28.967 -8.754  1.00 78.18  ? 161 VAL A CA  1 
ATOM   462  C C   . VAL A 1 82  ? 2.102   -29.431 -7.562  1.00 77.99  ? 161 VAL A C   1 
ATOM   463  O O   . VAL A 1 82  ? 2.413   -30.614 -7.452  1.00 83.50  ? 161 VAL A O   1 
ATOM   464  C CB  . VAL A 1 82  ? -0.218  -29.068 -8.397  1.00 78.13  ? 161 VAL A CB  1 
ATOM   465  C CG1 . VAL A 1 82  ? -0.608  -27.995 -7.391  1.00 79.87  ? 161 VAL A CG1 1 
ATOM   466  C CG2 . VAL A 1 82  ? -1.076  -28.934 -9.645  1.00 81.64  ? 161 VAL A CG2 1 
ATOM   467  N N   . SER A 1 83  ? 2.431   -28.498 -6.672  1.00 74.60  ? 162 SER A N   1 
ATOM   468  C CA  . SER A 1 83  ? 3.289   -28.763 -5.524  1.00 75.20  ? 162 SER A CA  1 
ATOM   469  C C   . SER A 1 83  ? 2.730   -28.158 -4.243  1.00 71.10  ? 162 SER A C   1 
ATOM   470  O O   . SER A 1 83  ? 2.333   -27.003 -4.230  1.00 71.99  ? 162 SER A O   1 
ATOM   471  C CB  . SER A 1 83  ? 4.685   -28.178 -5.773  1.00 80.34  ? 162 SER A CB  1 
ATOM   472  O OG  . SER A 1 83  ? 5.490   -29.070 -6.520  1.00 87.01  ? 162 SER A OG  1 
ATOM   473  N N   . LEU A 1 84  ? 2.723   -28.940 -3.171  1.00 66.31  ? 163 LEU A N   1 
ATOM   474  C CA  . LEU A 1 84  ? 2.486   -28.425 -1.829  1.00 66.13  ? 163 LEU A CA  1 
ATOM   475  C C   . LEU A 1 84  ? 3.776   -28.483 -1.042  1.00 67.04  ? 163 LEU A C   1 
ATOM   476  O O   . LEU A 1 84  ? 4.504   -29.474 -1.126  1.00 70.84  ? 163 LEU A O   1 
ATOM   477  C CB  . LEU A 1 84  ? 1.462   -29.274 -1.083  1.00 68.60  ? 163 LEU A CB  1 
ATOM   478  C CG  . LEU A 1 84  ? -0.014  -28.917 -1.124  1.00 68.36  ? 163 LEU A CG  1 
ATOM   479  C CD1 . LEU A 1 84  ? -0.730  -29.777 -0.078  1.00 69.45  ? 163 LEU A CD1 1 
ATOM   480  C CD2 . LEU A 1 84  ? -0.238  -27.428 -0.882  1.00 65.89  ? 163 LEU A CD2 1 
ATOM   481  N N   . ALA A 1 85  ? 4.035   -27.452 -0.241  1.00 64.18  ? 164 ALA A N   1 
ATOM   482  C CA  . ALA A 1 85  ? 5.206   -27.439 0.622   1.00 62.69  ? 164 ALA A CA  1 
ATOM   483  C C   . ALA A 1 85  ? 4.868   -26.875 1.990   1.00 64.19  ? 164 ALA A C   1 
ATOM   484  O O   . ALA A 1 85  ? 4.323   -25.787 2.090   1.00 65.91  ? 164 ALA A O   1 
ATOM   485  C CB  . ALA A 1 85  ? 6.306   -26.628 -0.016  1.00 61.39  ? 164 ALA A CB  1 
ATOM   486  N N   . LEU A 1 86  ? 5.194   -27.621 3.039   1.00 64.11  ? 165 LEU A N   1 
ATOM   487  C CA  . LEU A 1 86  ? 5.041   -27.137 4.401   1.00 67.05  ? 165 LEU A CA  1 
ATOM   488  C C   . LEU A 1 86  ? 6.341   -26.456 4.808   1.00 68.30  ? 165 LEU A C   1 
ATOM   489  O O   . LEU A 1 86  ? 7.392   -27.106 4.809   1.00 67.81  ? 165 LEU A O   1 
ATOM   490  C CB  . LEU A 1 86  ? 4.751   -28.302 5.347   1.00 70.14  ? 165 LEU A CB  1 
ATOM   491  C CG  . LEU A 1 86  ? 4.630   -27.954 6.835   1.00 71.56  ? 165 LEU A CG  1 
ATOM   492  C CD1 . LEU A 1 86  ? 3.308   -27.264 7.111   1.00 72.36  ? 165 LEU A CD1 1 
ATOM   493  C CD2 . LEU A 1 86  ? 4.774   -29.205 7.682   1.00 74.16  ? 165 LEU A CD2 1 
ATOM   494  N N   . HIS A 1 87  ? 6.267   -25.166 5.154   1.00 69.51  ? 166 HIS A N   1 
ATOM   495  C CA  . HIS A 1 87  ? 7.417   -24.404 5.670   1.00 69.32  ? 166 HIS A CA  1 
ATOM   496  C C   . HIS A 1 87  ? 7.238   -24.077 7.150   1.00 71.33  ? 166 HIS A C   1 
ATOM   497  O O   . HIS A 1 87  ? 6.156   -23.673 7.579   1.00 75.33  ? 166 HIS A O   1 
ATOM   498  C CB  . HIS A 1 87  ? 7.605   -23.120 4.879   1.00 68.95  ? 166 HIS A CB  1 
ATOM   499  C CG  . HIS A 1 87  ? 7.988   -23.348 3.453   1.00 77.27  ? 166 HIS A CG  1 
ATOM   500  N ND1 . HIS A 1 87  ? 9.298   -23.499 3.051   1.00 83.12  ? 166 HIS A ND1 1 
ATOM   501  C CD2 . HIS A 1 87  ? 7.235   -23.460 2.331   1.00 81.18  ? 166 HIS A CD2 1 
ATOM   502  C CE1 . HIS A 1 87  ? 9.335   -23.693 1.743   1.00 86.35  ? 166 HIS A CE1 1 
ATOM   503  N NE2 . HIS A 1 87  ? 8.097   -23.674 1.281   1.00 81.64  ? 166 HIS A NE2 1 
ATOM   504  N N   . LEU A 1 88  ? 8.307   -24.203 7.900   1.00 75.41  ? 167 LEU A N   1 
ATOM   505  C CA  . LEU A 1 88  ? 8.228   -23.993 9.307   1.00 80.57  ? 167 LEU A CA  1 
ATOM   506  C C   . LEU A 1 88  ? 8.509   -22.612 9.779   1.00 86.46  ? 167 LEU A C   1 
ATOM   507  O O   . LEU A 1 88  ? 9.591   -22.125 9.575   1.00 86.06  ? 167 LEU A O   1 
ATOM   508  C CB  . LEU A 1 88  ? 9.276   -24.852 9.978   1.00 81.79  ? 167 LEU A CB  1 
ATOM   509  C CG  . LEU A 1 88  ? 9.035   -26.330 10.141  1.00 87.61  ? 167 LEU A CG  1 
ATOM   510  C CD1 . LEU A 1 88  ? 10.111  -26.850 11.057  1.00 92.24  ? 167 LEU A CD1 1 
ATOM   511  C CD2 . LEU A 1 88  ? 7.689   -26.542 10.782  1.00 91.12  ? 167 LEU A CD2 1 
ATOM   512  N N   . GLN A 1 89  ? 7.483   -21.961 10.312  1.00 100.37 ? 168 GLN A N   1 
ATOM   513  C CA  . GLN A 1 89  ? 7.583   -20.683 11.009  1.00 106.18 ? 168 GLN A CA  1 
ATOM   514  C C   . GLN A 1 89  ? 8.433   -19.654 10.319  1.00 117.44 ? 168 GLN A C   1 
ATOM   515  O O   . GLN A 1 89  ? 8.300   -19.415 9.127   1.00 116.11 ? 168 GLN A O   1 
ATOM   516  C CB  . GLN A 1 89  ? 8.082   -20.926 12.438  1.00 98.96  ? 168 GLN A CB  1 
ATOM   517  N N   . PRO A 1 90  ? 9.318   -19.034 11.104  1.00 128.17 ? 169 PRO A N   1 
ATOM   518  C CA  . PRO A 1 90  ? 10.377  -18.120 10.712  1.00 130.65 ? 169 PRO A CA  1 
ATOM   519  C C   . PRO A 1 90  ? 11.339  -19.089 10.048  1.00 134.34 ? 169 PRO A C   1 
ATOM   520  O O   . PRO A 1 90  ? 11.659  -20.117 10.652  1.00 130.68 ? 169 PRO A O   1 
ATOM   521  C CB  . PRO A 1 90  ? 10.931  -17.671 12.050  1.00 127.30 ? 169 PRO A CB  1 
ATOM   522  N N   . LEU A 1 91  ? 11.907  -18.744 8.907   1.00 135.12 ? 170 LEU A N   1 
ATOM   523  C CA  . LEU A 1 91  ? 12.706  -19.725 8.192   1.00 135.53 ? 170 LEU A CA  1 
ATOM   524  C C   . LEU A 1 91  ? 13.897  -20.318 8.923   1.00 136.16 ? 170 LEU A C   1 
ATOM   525  O O   . LEU A 1 91  ? 14.170  -21.503 8.760   1.00 137.75 ? 170 LEU A O   1 
ATOM   526  C CB  . LEU A 1 91  ? 13.188  -19.143 6.872   1.00 135.02 ? 170 LEU A CB  1 
ATOM   527  C CG  . LEU A 1 91  ? 12.122  -18.717 5.876   1.00 137.00 ? 170 LEU A CG  1 
ATOM   528  C CD1 . LEU A 1 91  ? 11.321  -19.904 5.373   1.00 135.45 ? 170 LEU A CD1 1 
ATOM   529  C CD2 . LEU A 1 91  ? 11.220  -17.671 6.499   1.00 139.37 ? 170 LEU A CD2 1 
ATOM   530  N N   . ARG A 1 92  ? 14.650  -19.475 9.629   1.00 135.78 ? 171 ARG A N   1 
ATOM   531  C CA  . ARG A 1 92  ? 15.862  -19.812 10.419  1.00 133.70 ? 171 ARG A CA  1 
ATOM   532  C C   . ARG A 1 92  ? 17.127  -20.123 9.601   1.00 134.02 ? 171 ARG A C   1 
ATOM   533  O O   . ARG A 1 92  ? 18.125  -20.594 10.127  1.00 130.32 ? 171 ARG A O   1 
ATOM   534  C CB  . ARG A 1 92  ? 15.617  -20.840 11.533  1.00 128.87 ? 171 ARG A CB  1 
ATOM   535  N N   . SER A 1 93  ? 17.026  -19.886 8.302   1.00 131.07 ? 172 SER A N   1 
ATOM   536  C CA  . SER A 1 93  ? 18.060  -20.040 7.308   1.00 124.72 ? 172 SER A CA  1 
ATOM   537  C C   . SER A 1 93  ? 17.564  -19.331 6.058   1.00 125.64 ? 172 SER A C   1 
ATOM   538  O O   . SER A 1 93  ? 16.366  -19.135 5.878   1.00 129.77 ? 172 SER A O   1 
ATOM   539  C CB  . SER A 1 93  ? 18.275  -21.508 6.990   1.00 121.39 ? 172 SER A CB  1 
ATOM   540  O OG  . SER A 1 93  ? 18.925  -21.649 5.747   1.00 116.96 ? 172 SER A OG  1 
ATOM   541  N N   . ALA A 1 94  ? 18.460  -18.967 5.159   1.00 122.64 ? 173 ALA A N   1 
ATOM   542  C CA  . ALA A 1 94  ? 18.016  -18.342 3.920   1.00 114.81 ? 173 ALA A CA  1 
ATOM   543  C C   . ALA A 1 94  ? 17.724  -19.394 2.863   1.00 110.01 ? 173 ALA A C   1 
ATOM   544  O O   . ALA A 1 94  ? 17.095  -19.115 1.858   1.00 104.23 ? 173 ALA A O   1 
ATOM   545  C CB  . ALA A 1 94  ? 19.045  -17.360 3.419   1.00 114.09 ? 173 ALA A CB  1 
ATOM   546  N N   . ALA A 1 95  ? 18.129  -20.623 3.140   1.00 108.55 ? 174 ALA A N   1 
ATOM   547  C CA  . ALA A 1 95  ? 17.958  -21.744 2.243   1.00 114.24 ? 174 ALA A CA  1 
ATOM   548  C C   . ALA A 1 95  ? 16.500  -22.036 1.952   1.00 118.67 ? 174 ALA A C   1 
ATOM   549  O O   . ALA A 1 95  ? 16.158  -22.378 0.835   1.00 119.45 ? 174 ALA A O   1 
ATOM   550  C CB  . ALA A 1 95  ? 18.638  -22.968 2.815   1.00 113.73 ? 174 ALA A CB  1 
ATOM   551  N N   . GLY A 1 96  ? 15.641  -21.876 2.949   1.00 119.92 ? 175 GLY A N   1 
ATOM   552  C CA  . GLY A 1 96  ? 14.223  -22.129 2.793   1.00 117.43 ? 175 GLY A CA  1 
ATOM   553  C C   . GLY A 1 96  ? 13.758  -23.529 2.460   1.00 117.44 ? 175 GLY A C   1 
ATOM   554  O O   . GLY A 1 96  ? 12.933  -23.719 1.588   1.00 120.66 ? 175 GLY A O   1 
ATOM   555  N N   . ALA A 1 97  ? 14.329  -24.521 3.121   1.00 113.16 ? 176 ALA A N   1 
ATOM   556  C CA  . ALA A 1 97  ? 13.924  -25.895 2.902   1.00 107.42 ? 176 ALA A CA  1 
ATOM   557  C C   . ALA A 1 97  ? 12.529  -26.185 3.429   1.00 102.01 ? 176 ALA A C   1 
ATOM   558  O O   . ALA A 1 97  ? 12.082  -25.622 4.412   1.00 106.48 ? 176 ALA A O   1 
ATOM   559  C CB  . ALA A 1 97  ? 14.914  -26.843 3.539   1.00 105.86 ? 176 ALA A CB  1 
ATOM   560  N N   . ALA A 1 98  ? 11.852  -27.079 2.742   1.00 88.75  ? 177 ALA A N   1 
ATOM   561  C CA  . ALA A 1 98  ? 10.515  -27.536 3.089   1.00 80.41  ? 177 ALA A CA  1 
ATOM   562  C C   . ALA A 1 98  ? 10.644  -28.726 4.027   1.00 74.90  ? 177 ALA A C   1 
ATOM   563  O O   . ALA A 1 98  ? 11.377  -29.663 3.734   1.00 76.94  ? 177 ALA A O   1 
ATOM   564  C CB  . ALA A 1 98  ? 9.751   -27.940 1.837   1.00 78.60  ? 177 ALA A CB  1 
ATOM   565  N N   . ALA A 1 99  ? 9.932   -28.685 5.150   1.00 71.22  ? 178 ALA A N   1 
ATOM   566  C CA  . ALA A 1 99  ? 9.820   -29.838 6.054   1.00 68.88  ? 178 ALA A CA  1 
ATOM   567  C C   . ALA A 1 99  ? 9.067   -31.010 5.400   1.00 68.40  ? 178 ALA A C   1 
ATOM   568  O O   . ALA A 1 99  ? 9.346   -32.180 5.677   1.00 72.36  ? 178 ALA A O   1 
ATOM   569  C CB  . ALA A 1 99  ? 9.127   -29.424 7.349   1.00 65.15  ? 178 ALA A CB  1 
ATOM   570  N N   . LEU A 1 100 ? 8.108   -30.676 4.543   1.00 66.97  ? 179 LEU A N   1 
ATOM   571  C CA  . LEU A 1 100 ? 7.255   -31.650 3.889   1.00 66.96  ? 179 LEU A CA  1 
ATOM   572  C C   . LEU A 1 100 ? 6.946   -31.114 2.510   1.00 61.85  ? 179 LEU A C   1 
ATOM   573  O O   . LEU A 1 100 ? 6.698   -29.923 2.363   1.00 63.66  ? 179 LEU A O   1 
ATOM   574  C CB  . LEU A 1 100 ? 5.968   -31.789 4.698   1.00 71.73  ? 179 LEU A CB  1 
ATOM   575  C CG  . LEU A 1 100 ? 5.224   -33.115 4.673   1.00 75.85  ? 179 LEU A CG  1 
ATOM   576  C CD1 . LEU A 1 100 ? 6.079   -34.207 5.278   1.00 75.21  ? 179 LEU A CD1 1 
ATOM   577  C CD2 . LEU A 1 100 ? 3.905   -32.991 5.427   1.00 79.65  ? 179 LEU A CD2 1 
ATOM   578  N N   . ALA A 1 101 ? 6.959   -31.972 1.501   1.00 61.25  ? 180 ALA A N   1 
ATOM   579  C CA  . ALA A 1 101 ? 6.698   -31.528 0.132   1.00 63.93  ? 180 ALA A CA  1 
ATOM   580  C C   . ALA A 1 101 ? 6.097   -32.630 -0.720  1.00 64.37  ? 180 ALA A C   1 
ATOM   581  O O   . ALA A 1 101 ? 6.535   -33.773 -0.666  1.00 69.57  ? 180 ALA A O   1 
ATOM   582  C CB  . ALA A 1 101 ? 7.973   -31.010 -0.503  1.00 64.97  ? 180 ALA A CB  1 
ATOM   583  N N   . LEU A 1 102 ? 5.102   -32.266 -1.515  1.00 65.25  ? 181 LEU A N   1 
ATOM   584  C CA  . LEU A 1 102 ? 4.328   -33.219 -2.294  1.00 68.20  ? 181 LEU A CA  1 
ATOM   585  C C   . LEU A 1 102 ? 4.242   -32.682 -3.703  1.00 68.01  ? 181 LEU A C   1 
ATOM   586  O O   . LEU A 1 102 ? 3.988   -31.503 -3.894  1.00 69.81  ? 181 LEU A O   1 
ATOM   587  C CB  . LEU A 1 102 ? 2.921   -33.317 -1.711  1.00 73.23  ? 181 LEU A CB  1 
ATOM   588  C CG  . LEU A 1 102 ? 2.413   -34.681 -1.268  1.00 77.07  ? 181 LEU A CG  1 
ATOM   589  C CD1 . LEU A 1 102 ? 0.960   -34.528 -0.836  1.00 75.81  ? 181 LEU A CD1 1 
ATOM   590  C CD2 . LEU A 1 102 ? 2.566   -35.734 -2.363  1.00 81.54  ? 181 LEU A CD2 1 
ATOM   591  N N   . THR A 1 103 ? 4.467   -33.545 -4.682  1.00 73.85  ? 182 THR A N   1 
ATOM   592  C CA  . THR A 1 103 ? 4.360   -33.187 -6.094  1.00 75.81  ? 182 THR A CA  1 
ATOM   593  C C   . THR A 1 103 ? 3.373   -34.150 -6.734  1.00 77.64  ? 182 THR A C   1 
ATOM   594  O O   . THR A 1 103 ? 3.337   -35.334 -6.387  1.00 80.93  ? 182 THR A O   1 
ATOM   595  C CB  . THR A 1 103 ? 5.729   -33.234 -6.796  1.00 78.51  ? 182 THR A CB  1 
ATOM   596  O OG1 . THR A 1 103 ? 6.551   -32.181 -6.280  1.00 82.83  ? 182 THR A OG1 1 
ATOM   597  C CG2 . THR A 1 103 ? 5.598   -33.064 -8.313  1.00 82.20  ? 182 THR A CG2 1 
ATOM   598  N N   . VAL A 1 104 ? 2.550   -33.614 -7.633  1.00 78.04  ? 183 VAL A N   1 
ATOM   599  C CA  . VAL A 1 104 ? 1.499   -34.367 -8.301  1.00 80.25  ? 183 VAL A CA  1 
ATOM   600  C C   . VAL A 1 104 ? 1.484   -33.882 -9.735  1.00 84.33  ? 183 VAL A C   1 
ATOM   601  O O   . VAL A 1 104 ? 1.388   -32.681 -9.969  1.00 85.85  ? 183 VAL A O   1 
ATOM   602  C CB  . VAL A 1 104 ? 0.118   -34.126 -7.648  1.00 78.71  ? 183 VAL A CB  1 
ATOM   603  C CG1 . VAL A 1 104 ? -0.970  -34.929 -8.356  1.00 79.34  ? 183 VAL A CG1 1 
ATOM   604  C CG2 . VAL A 1 104 ? 0.155   -34.462 -6.157  1.00 75.04  ? 183 VAL A CG2 1 
ATOM   605  N N   . ASP A 1 105 ? 1.614   -34.813 -10.680 1.00 93.53  ? 184 ASP A N   1 
ATOM   606  C CA  . ASP A 1 105 ? 1.598   -34.490 -12.107 1.00 98.37  ? 184 ASP A CA  1 
ATOM   607  C C   . ASP A 1 105 ? 0.163   -34.567 -12.617 1.00 93.06  ? 184 ASP A C   1 
ATOM   608  O O   . ASP A 1 105 ? -0.620  -35.423 -12.192 1.00 85.17  ? 184 ASP A O   1 
ATOM   609  C CB  . ASP A 1 105 ? 2.506   -35.440 -12.921 1.00 107.74 ? 184 ASP A CB  1 
ATOM   610  C CG  . ASP A 1 105 ? 4.016   -35.173 -12.718 1.00 111.83 ? 184 ASP A CG  1 
ATOM   611  O OD1 . ASP A 1 105 ? 4.804   -36.136 -12.845 1.00 110.39 ? 184 ASP A OD1 1 
ATOM   612  O OD2 . ASP A 1 105 ? 4.428   -34.020 -12.452 1.00 113.29 ? 184 ASP A OD2 1 
ATOM   613  N N   . LEU A 1 106 ? -0.159  -33.658 -13.532 1.00 91.98  ? 185 LEU A N   1 
ATOM   614  C CA  . LEU A 1 106 ? -1.484  -33.540 -14.118 1.00 96.44  ? 185 LEU A CA  1 
ATOM   615  C C   . LEU A 1 106 ? -1.421  -34.048 -15.560 1.00 102.09 ? 185 LEU A C   1 
ATOM   616  O O   . LEU A 1 106 ? -0.788  -33.406 -16.414 1.00 100.63 ? 185 LEU A O   1 
ATOM   617  C CB  . LEU A 1 106 ? -1.926  -32.076 -14.107 1.00 94.29  ? 185 LEU A CB  1 
ATOM   618  C CG  . LEU A 1 106 ? -1.724  -31.300 -12.806 1.00 91.59  ? 185 LEU A CG  1 
ATOM   619  C CD1 . LEU A 1 106 ? -2.176  -29.857 -12.992 1.00 91.76  ? 185 LEU A CD1 1 
ATOM   620  C CD2 . LEU A 1 106 ? -2.458  -31.977 -11.659 1.00 91.28  ? 185 LEU A CD2 1 
ATOM   621  N N   . PRO A 1 107 ? -2.053  -35.206 -15.845 1.00 103.20 ? 186 PRO A N   1 
ATOM   622  C CA  . PRO A 1 107 ? -1.979  -35.716 -17.228 1.00 108.54 ? 186 PRO A CA  1 
ATOM   623  C C   . PRO A 1 107 ? -2.753  -34.847 -18.250 1.00 113.33 ? 186 PRO A C   1 
ATOM   624  O O   . PRO A 1 107 ? -3.753  -34.223 -17.875 1.00 116.68 ? 186 PRO A O   1 
ATOM   625  C CB  . PRO A 1 107 ? -2.585  -37.124 -17.126 1.00 104.46 ? 186 PRO A CB  1 
ATOM   626  C CG  . PRO A 1 107 ? -3.386  -37.123 -15.865 1.00 102.21 ? 186 PRO A CG  1 
ATOM   627  C CD  . PRO A 1 107 ? -2.744  -36.142 -14.936 1.00 98.80  ? 186 PRO A CD  1 
ATOM   628  N N   . PRO A 1 108 ? -2.283  -34.781 -19.518 1.00 111.73 ? 187 PRO A N   1 
ATOM   629  C CA  . PRO A 1 108 ? -3.137  -34.230 -20.585 1.00 107.43 ? 187 PRO A CA  1 
ATOM   630  C C   . PRO A 1 108 ? -4.166  -35.265 -21.059 1.00 102.50 ? 187 PRO A C   1 
ATOM   631  O O   . PRO A 1 108 ? -3.995  -36.459 -20.805 1.00 99.37  ? 187 PRO A O   1 
ATOM   632  C CB  . PRO A 1 108 ? -2.146  -33.868 -21.704 1.00 110.27 ? 187 PRO A CB  1 
ATOM   633  C CG  . PRO A 1 108 ? -0.786  -34.275 -21.229 1.00 112.20 ? 187 PRO A CG  1 
ATOM   634  C CD  . PRO A 1 108 ? -0.944  -35.138 -20.019 1.00 111.49 ? 187 PRO A CD  1 
ATOM   635  N N   . ALA A 1 109 ? -5.220  -34.808 -21.733 1.00 98.12  ? 188 ALA A N   1 
ATOM   636  C CA  . ALA A 1 109 ? -6.320  -35.688 -22.150 1.00 98.30  ? 188 ALA A CA  1 
ATOM   637  C C   . ALA A 1 109 ? -5.931  -36.604 -23.317 1.00 95.77  ? 188 ALA A C   1 
ATOM   638  O O   . ALA A 1 109 ? -6.499  -37.687 -23.490 1.00 91.60  ? 188 ALA A O   1 
ATOM   639  C CB  . ALA A 1 109 ? -7.547  -34.864 -22.508 1.00 99.03  ? 188 ALA A CB  1 
ATOM   640  N N   . ARG A 1 114 ? -7.988  -40.234 -17.330 1.00 87.84  ? 193 ARG A N   1 
ATOM   641  C CA  . ARG A 1 114 ? -7.672  -39.929 -15.942 1.00 85.30  ? 193 ARG A CA  1 
ATOM   642  C C   . ARG A 1 114 ? -7.899  -38.439 -15.675 1.00 84.76  ? 193 ARG A C   1 
ATOM   643  O O   . ARG A 1 114 ? -7.032  -37.609 -15.957 1.00 79.33  ? 193 ARG A O   1 
ATOM   644  C CB  . ARG A 1 114 ? -6.227  -40.327 -15.610 1.00 80.32  ? 193 ARG A CB  1 
ATOM   645  N N   . ASN A 1 115 ? -9.071  -38.123 -15.125 1.00 87.62  ? 194 ASN A N   1 
ATOM   646  C CA  . ASN A 1 115 ? -9.467  -36.744 -14.794 1.00 92.03  ? 194 ASN A CA  1 
ATOM   647  C C   . ASN A 1 115 ? -9.200  -36.321 -13.329 1.00 88.19  ? 194 ASN A C   1 
ATOM   648  O O   . ASN A 1 115 ? -9.572  -35.212 -12.930 1.00 84.89  ? 194 ASN A O   1 
ATOM   649  C CB  . ASN A 1 115 ? -10.960 -36.541 -15.134 1.00 100.45 ? 194 ASN A CB  1 
ATOM   650  C CG  . ASN A 1 115 ? -11.197 -36.260 -16.610 1.00 101.08 ? 194 ASN A CG  1 
ATOM   651  O OD1 . ASN A 1 115 ? -10.476 -36.756 -17.480 1.00 97.80  ? 194 ASN A OD1 1 
ATOM   652  N ND2 . ASN A 1 115 ? -12.215 -35.450 -16.895 1.00 105.30 ? 194 ASN A ND2 1 
ATOM   653  N N   . SER A 1 116 ? -8.563  -37.185 -12.535 1.00 87.68  ? 195 SER A N   1 
ATOM   654  C CA  . SER A 1 116 ? -8.237  -36.873 -11.140 1.00 83.61  ? 195 SER A CA  1 
ATOM   655  C C   . SER A 1 116 ? -6.777  -37.181 -10.816 1.00 79.71  ? 195 SER A C   1 
ATOM   656  O O   . SER A 1 116 ? -6.123  -37.954 -11.507 1.00 82.71  ? 195 SER A O   1 
ATOM   657  C CB  . SER A 1 116 ? -9.169  -37.620 -10.183 1.00 83.89  ? 195 SER A CB  1 
ATOM   658  O OG  . SER A 1 116 ? -9.062  -39.023 -10.341 1.00 89.02  ? 195 SER A OG  1 
ATOM   659  N N   . ALA A 1 117 ? -6.277  -36.535 -9.767  1.00 76.05  ? 196 ALA A N   1 
ATOM   660  C CA  . ALA A 1 117 ? -4.918  -36.736 -9.257  1.00 71.84  ? 196 ALA A CA  1 
ATOM   661  C C   . ALA A 1 117 ? -4.931  -36.566 -7.734  1.00 66.78  ? 196 ALA A C   1 
ATOM   662  O O   . ALA A 1 117 ? -5.712  -35.783 -7.199  1.00 63.71  ? 196 ALA A O   1 
ATOM   663  C CB  . ALA A 1 117 ? -3.952  -35.749 -9.907  1.00 71.08  ? 196 ALA A CB  1 
ATOM   664  N N   . PHE A 1 118 ? -4.064  -37.296 -7.048  1.00 65.03  ? 197 PHE A N   1 
ATOM   665  C CA  . PHE A 1 118 ? -4.102  -37.364 -5.592  1.00 63.77  ? 197 PHE A CA  1 
ATOM   666  C C   . PHE A 1 118 ? -2.719  -37.630 -4.992  1.00 61.10  ? 197 PHE A C   1 
ATOM   667  O O   . PHE A 1 118 ? -1.992  -38.487 -5.462  1.00 63.84  ? 197 PHE A O   1 
ATOM   668  C CB  . PHE A 1 118 ? -5.084  -38.447 -5.151  1.00 61.21  ? 197 PHE A CB  1 
ATOM   669  C CG  . PHE A 1 118 ? -5.132  -38.639 -3.670  1.00 66.74  ? 197 PHE A CG  1 
ATOM   670  C CD1 . PHE A 1 118 ? -5.817  -37.734 -2.865  1.00 69.57  ? 197 PHE A CD1 1 
ATOM   671  C CD2 . PHE A 1 118 ? -4.479  -39.707 -3.067  1.00 70.42  ? 197 PHE A CD2 1 
ATOM   672  C CE1 . PHE A 1 118 ? -5.866  -37.900 -1.490  1.00 67.89  ? 197 PHE A CE1 1 
ATOM   673  C CE2 . PHE A 1 118 ? -4.520  -39.877 -1.688  1.00 71.42  ? 197 PHE A CE2 1 
ATOM   674  C CZ  . PHE A 1 118 ? -5.209  -38.970 -0.897  1.00 69.27  ? 197 PHE A CZ  1 
ATOM   675  N N   . GLY A 1 119 ? -2.380  -36.891 -3.945  1.00 58.63  ? 198 GLY A N   1 
ATOM   676  C CA  . GLY A 1 119 ? -1.122  -37.064 -3.238  1.00 56.27  ? 198 GLY A CA  1 
ATOM   677  C C   . GLY A 1 119 ? -1.358  -37.150 -1.747  1.00 53.40  ? 198 GLY A C   1 
ATOM   678  O O   . GLY A 1 119 ? -2.160  -36.412 -1.195  1.00 53.80  ? 198 GLY A O   1 
ATOM   679  N N   . PHE A 1 120 ? -0.665  -38.075 -1.104  1.00 53.43  ? 199 PHE A N   1 
ATOM   680  C CA  . PHE A 1 120 ? -0.607  -38.167 0.349   1.00 52.80  ? 199 PHE A CA  1 
ATOM   681  C C   . PHE A 1 120 ? 0.848   -38.323 0.770   1.00 55.45  ? 199 PHE A C   1 
ATOM   682  O O   . PHE A 1 120 ? 1.616   -39.027 0.119   1.00 59.45  ? 199 PHE A O   1 
ATOM   683  C CB  . PHE A 1 120 ? -1.411  -39.355 0.867   1.00 49.33  ? 199 PHE A CB  1 
ATOM   684  C CG  . PHE A 1 120 ? -1.423  -39.451 2.357   1.00 51.30  ? 199 PHE A CG  1 
ATOM   685  C CD1 . PHE A 1 120 ? -2.429  -38.847 3.092   1.00 49.75  ? 199 PHE A CD1 1 
ATOM   686  C CD2 . PHE A 1 120 ? -0.401  -40.118 3.040   1.00 56.15  ? 199 PHE A CD2 1 
ATOM   687  C CE1 . PHE A 1 120 ? -2.440  -38.918 4.475   1.00 50.06  ? 199 PHE A CE1 1 
ATOM   688  C CE2 . PHE A 1 120 ? -0.403  -40.183 4.429   1.00 55.39  ? 199 PHE A CE2 1 
ATOM   689  C CZ  . PHE A 1 120 ? -1.428  -39.582 5.146   1.00 51.99  ? 199 PHE A CZ  1 
ATOM   690  N N   . GLN A 1 121 ? 1.207   -37.668 1.867   1.00 59.16  ? 200 GLN A N   1 
ATOM   691  C CA  . GLN A 1 121 ? 2.530   -37.782 2.449   1.00 58.62  ? 200 GLN A CA  1 
ATOM   692  C C   . GLN A 1 121 ? 2.440   -37.502 3.914   1.00 55.78  ? 200 GLN A C   1 
ATOM   693  O O   . GLN A 1 121 ? 1.734   -36.591 4.317   1.00 58.42  ? 200 GLN A O   1 
ATOM   694  C CB  . GLN A 1 121 ? 3.485   -36.757 1.834   1.00 65.09  ? 200 GLN A CB  1 
ATOM   695  C CG  . GLN A 1 121 ? 4.862   -36.733 2.496   1.00 68.42  ? 200 GLN A CG  1 
ATOM   696  C CD  . GLN A 1 121 ? 5.886   -35.984 1.692   1.00 70.31  ? 200 GLN A CD  1 
ATOM   697  O OE1 . GLN A 1 121 ? 6.360   -34.930 2.107   1.00 79.95  ? 200 GLN A OE1 1 
ATOM   698  N NE2 . GLN A 1 121 ? 6.229   -36.516 0.527   1.00 73.70  ? 200 GLN A NE2 1 
ATOM   699  N N   . GLY A 1 122 ? 3.197   -38.258 4.698   1.00 57.52  ? 201 GLY A N   1 
ATOM   700  C CA  . GLY A 1 122 ? 3.339   -38.014 6.126   1.00 56.96  ? 201 GLY A CA  1 
ATOM   701  C C   . GLY A 1 122 ? 4.740   -38.320 6.602   1.00 56.65  ? 201 GLY A C   1 
ATOM   702  O O   . GLY A 1 122 ? 5.405   -39.174 6.031   1.00 60.26  ? 201 GLY A O   1 
ATOM   703  N N   . ARG A 1 123 ? 5.192   -37.604 7.631   1.00 58.64  ? 202 ARG A N   1 
ATOM   704  C CA  . ARG A 1 123 ? 6.380   -37.989 8.394   1.00 58.38  ? 202 ARG A CA  1 
ATOM   705  C C   . ARG A 1 123 ? 6.472   -37.352 9.771   1.00 52.39  ? 202 ARG A C   1 
ATOM   706  O O   . ARG A 1 123 ? 5.732   -36.422 10.103  1.00 47.97  ? 202 ARG A O   1 
ATOM   707  C CB  . ARG A 1 123 ? 7.655   -37.677 7.621   1.00 66.58  ? 202 ARG A CB  1 
ATOM   708  C CG  . ARG A 1 123 ? 7.942   -36.204 7.438   1.00 71.09  ? 202 ARG A CG  1 
ATOM   709  C CD  . ARG A 1 123 ? 8.733   -35.977 6.162   1.00 77.81  ? 202 ARG A CD  1 
ATOM   710  N NE  . ARG A 1 123 ? 10.165  -36.209 6.316   1.00 82.23  ? 202 ARG A NE  1 
ATOM   711  C CZ  . ARG A 1 123 ? 11.028  -36.336 5.305   1.00 87.24  ? 202 ARG A CZ  1 
ATOM   712  N NH1 . ARG A 1 123 ? 10.612  -36.310 4.028   1.00 82.24  ? 202 ARG A NH1 1 
ATOM   713  N NH2 . ARG A 1 123 ? 12.327  -36.511 5.579   1.00 88.13  ? 202 ARG A NH2 1 
ATOM   714  N N   . LEU A 1 124 ? 7.407   -37.881 10.555  1.00 51.17  ? 203 LEU A N   1 
ATOM   715  C CA  . LEU A 1 124 ? 7.674   -37.416 11.902  1.00 52.85  ? 203 LEU A CA  1 
ATOM   716  C C   . LEU A 1 124 ? 8.467   -36.121 11.848  1.00 52.88  ? 203 LEU A C   1 
ATOM   717  O O   . LEU A 1 124 ? 9.429   -36.026 11.100  1.00 50.71  ? 203 LEU A O   1 
ATOM   718  C CB  . LEU A 1 124 ? 8.431   -38.489 12.685  1.00 54.68  ? 203 LEU A CB  1 
ATOM   719  C CG  . LEU A 1 124 ? 7.582   -39.723 13.010  1.00 58.88  ? 203 LEU A CG  1 
ATOM   720  C CD1 . LEU A 1 124 ? 8.433   -40.921 13.390  1.00 60.74  ? 203 LEU A CD1 1 
ATOM   721  C CD2 . LEU A 1 124 ? 6.583   -39.420 14.120  1.00 61.81  ? 203 LEU A CD2 1 
ATOM   722  N N   . LEU A 1 125 ? 8.033   -35.126 12.622  1.00 56.77  ? 204 LEU A N   1 
ATOM   723  C CA  . LEU A 1 125 ? 8.689   -33.810 12.708  1.00 59.28  ? 204 LEU A CA  1 
ATOM   724  C C   . LEU A 1 125 ? 8.895   -33.401 14.162  1.00 59.60  ? 204 LEU A C   1 
ATOM   725  O O   . LEU A 1 125 ? 7.983   -33.552 14.980  1.00 58.88  ? 204 LEU A O   1 
ATOM   726  C CB  . LEU A 1 125 ? 7.828   -32.728 12.054  1.00 60.99  ? 204 LEU A CB  1 
ATOM   727  C CG  . LEU A 1 125 ? 7.617   -32.655 10.542  1.00 63.38  ? 204 LEU A CG  1 
ATOM   728  C CD1 . LEU A 1 125 ? 6.990   -31.305 10.199  1.00 61.61  ? 204 LEU A CD1 1 
ATOM   729  C CD2 . LEU A 1 125 ? 8.906   -32.843 9.759   1.00 64.52  ? 204 LEU A CD2 1 
ATOM   730  N N   . HIS A 1 126 ? 10.082  -32.880 14.476  1.00 64.99  ? 205 HIS A N   1 
ATOM   731  C CA  . HIS A 1 126 ? 10.305  -32.179 15.739  1.00 70.70  ? 205 HIS A CA  1 
ATOM   732  C C   . HIS A 1 126 ? 9.768   -30.759 15.590  1.00 68.01  ? 205 HIS A C   1 
ATOM   733  O O   . HIS A 1 126 ? 10.231  -30.014 14.719  1.00 65.99  ? 205 HIS A O   1 
ATOM   734  C CB  . HIS A 1 126 ? 11.787  -32.123 16.097  1.00 77.88  ? 205 HIS A CB  1 
ATOM   735  C CG  . HIS A 1 126 ? 12.069  -31.362 17.357  1.00 86.86  ? 205 HIS A CG  1 
ATOM   736  N ND1 . HIS A 1 126 ? 11.953  -31.927 18.611  1.00 92.37  ? 205 HIS A ND1 1 
ATOM   737  C CD2 . HIS A 1 126 ? 12.439  -30.075 17.557  1.00 89.40  ? 205 HIS A CD2 1 
ATOM   738  C CE1 . HIS A 1 126 ? 12.245  -31.023 19.527  1.00 94.04  ? 205 HIS A CE1 1 
ATOM   739  N NE2 . HIS A 1 126 ? 12.546  -29.891 18.914  1.00 95.87  ? 205 HIS A NE2 1 
ATOM   740  N N   . LEU A 1 127 ? 8.798   -30.397 16.426  1.00 63.84  ? 206 LEU A N   1 
ATOM   741  C CA  . LEU A 1 127 ? 8.220   -29.057 16.404  1.00 68.52  ? 206 LEU A CA  1 
ATOM   742  C C   . LEU A 1 127 ? 8.415   -28.331 17.737  1.00 72.22  ? 206 LEU A C   1 
ATOM   743  O O   . LEU A 1 127 ? 8.267   -28.915 18.817  1.00 67.31  ? 206 LEU A O   1 
ATOM   744  C CB  . LEU A 1 127 ? 6.736   -29.109 16.031  1.00 64.52  ? 206 LEU A CB  1 
ATOM   745  C CG  . LEU A 1 127 ? 6.426   -29.613 14.615  1.00 64.59  ? 206 LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 127 ? 4.923   -29.627 14.364  1.00 64.04  ? 206 LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 127 ? 7.125   -28.791 13.539  1.00 62.18  ? 206 LEU A CD2 1 
ATOM   748  N N   . SER A 1 128 ? 8.734   -27.043 17.628  1.00 80.00  ? 207 SER A N   1 
ATOM   749  C CA  . SER A 1 128 ? 9.058   -26.196 18.772  1.00 85.62  ? 207 SER A CA  1 
ATOM   750  C C   . SER A 1 128 ? 7.815   -25.489 19.279  1.00 85.74  ? 207 SER A C   1 
ATOM   751  O O   . SER A 1 128 ? 6.947   -25.101 18.489  1.00 87.59  ? 207 SER A O   1 
ATOM   752  C CB  . SER A 1 128 ? 10.092  -25.147 18.361  1.00 88.64  ? 207 SER A CB  1 
ATOM   753  O OG  . SER A 1 128 ? 11.194  -25.752 17.703  1.00 98.28  ? 207 SER A OG  1 
ATOM   754  N N   . ALA A 1 129 ? 7.738   -25.305 20.594  1.00 86.99  ? 208 ALA A N   1 
ATOM   755  C CA  . ALA A 1 129 ? 6.663   -24.513 21.196  1.00 87.61  ? 208 ALA A CA  1 
ATOM   756  C C   . ALA A 1 129 ? 6.685   -23.094 20.614  1.00 83.97  ? 208 ALA A C   1 
ATOM   757  O O   . ALA A 1 129 ? 7.733   -22.447 20.596  1.00 83.22  ? 208 ALA A O   1 
ATOM   758  C CB  . ALA A 1 129 ? 6.802   -24.480 22.713  1.00 88.96  ? 208 ALA A CB  1 
ATOM   759  N N   . GLY A 1 130 ? 5.539   -22.651 20.093  1.00 82.18  ? 209 GLY A N   1 
ATOM   760  C CA  . GLY A 1 130 ? 5.410   -21.362 19.412  1.00 78.73  ? 209 GLY A CA  1 
ATOM   761  C C   . GLY A 1 130 ? 5.622   -21.368 17.904  1.00 82.06  ? 209 GLY A C   1 
ATOM   762  O O   . GLY A 1 130 ? 5.306   -20.374 17.238  1.00 83.27  ? 209 GLY A O   1 
ATOM   763  N N   . GLN A 1 131 ? 6.137   -22.473 17.356  1.00 84.61  ? 210 GLN A N   1 
ATOM   764  C CA  . GLN A 1 131 ? 6.452   -22.576 15.923  1.00 83.02  ? 210 GLN A CA  1 
ATOM   765  C C   . GLN A 1 131 ? 5.212   -22.465 15.031  1.00 81.43  ? 210 GLN A C   1 
ATOM   766  O O   . GLN A 1 131 ? 4.277   -23.249 15.153  1.00 73.82  ? 210 GLN A O   1 
ATOM   767  C CB  . GLN A 1 131 ? 7.129   -23.907 15.625  1.00 84.52  ? 210 GLN A CB  1 
ATOM   768  C CG  . GLN A 1 131 ? 7.664   -24.040 14.210  1.00 88.27  ? 210 GLN A CG  1 
ATOM   769  C CD  . GLN A 1 131 ? 9.174   -24.066 14.167  1.00 94.73  ? 210 GLN A CD  1 
ATOM   770  O OE1 . GLN A 1 131 ? 9.806   -23.136 13.674  1.00 99.29  ? 210 GLN A OE1 1 
ATOM   771  N NE2 . GLN A 1 131 ? 9.765   -25.139 14.694  1.00 95.12  ? 210 GLN A NE2 1 
ATOM   772  N N   . ARG A 1 132 ? 5.223   -21.484 14.136  1.00 83.64  ? 211 ARG A N   1 
ATOM   773  C CA  . ARG A 1 132 ? 4.195   -21.363 13.113  1.00 84.61  ? 211 ARG A CA  1 
ATOM   774  C C   . ARG A 1 132 ? 4.477   -22.334 11.952  1.00 81.42  ? 211 ARG A C   1 
ATOM   775  O O   . ARG A 1 132 ? 5.631   -22.636 11.657  1.00 79.71  ? 211 ARG A O   1 
ATOM   776  C CB  . ARG A 1 132 ? 4.097   -19.919 12.605  1.00 88.74  ? 211 ARG A CB  1 
ATOM   777  C CG  . ARG A 1 132 ? 3.599   -18.914 13.640  1.00 93.97  ? 211 ARG A CG  1 
ATOM   778  C CD  . ARG A 1 132 ? 4.705   -18.043 14.222  1.00 101.76 ? 211 ARG A CD  1 
ATOM   779  N NE  . ARG A 1 132 ? 5.356   -17.209 13.209  1.00 108.60 ? 211 ARG A NE  1 
ATOM   780  C CZ  . ARG A 1 132 ? 6.384   -16.384 13.433  1.00 118.26 ? 211 ARG A CZ  1 
ATOM   781  N NH1 . ARG A 1 132 ? 6.911   -16.249 14.652  1.00 122.36 ? 211 ARG A NH1 1 
ATOM   782  N NH2 . ARG A 1 132 ? 6.893   -15.681 12.422  1.00 120.29 ? 211 ARG A NH2 1 
ATOM   783  N N   . LEU A 1 133 ? 3.412   -22.830 11.324  1.00 77.08  ? 212 LEU A N   1 
ATOM   784  C CA  . LEU A 1 133 ? 3.476   -23.709 10.149  1.00 72.27  ? 212 LEU A CA  1 
ATOM   785  C C   . LEU A 1 133 ? 2.711   -23.044 9.028   1.00 69.35  ? 212 LEU A C   1 
ATOM   786  O O   . LEU A 1 133 ? 1.646   -22.500 9.256   1.00 76.35  ? 212 LEU A O   1 
ATOM   787  C CB  . LEU A 1 133 ? 2.812   -25.058 10.444  1.00 69.01  ? 212 LEU A CB  1 
ATOM   788  C CG  . LEU A 1 133 ? 3.705   -26.179 10.960  1.00 73.22  ? 212 LEU A CG  1 
ATOM   789  C CD1 . LEU A 1 133 ? 4.388   -25.764 12.253  1.00 75.15  ? 212 LEU A CD1 1 
ATOM   790  C CD2 . LEU A 1 133 ? 2.896   -27.458 11.151  1.00 72.39  ? 212 LEU A CD2 1 
ATOM   791  N N   . GLY A 1 134 ? 3.227   -23.097 7.815   1.00 64.47  ? 213 GLY A N   1 
ATOM   792  C CA  . GLY A 1 134 ? 2.499   -22.565 6.675   1.00 63.25  ? 213 GLY A CA  1 
ATOM   793  C C   . GLY A 1 134 ? 2.636   -23.496 5.502   1.00 64.67  ? 213 GLY A C   1 
ATOM   794  O O   . GLY A 1 134 ? 3.660   -24.163 5.353   1.00 70.33  ? 213 GLY A O   1 
ATOM   795  N N   . VAL A 1 135 ? 1.613   -23.524 4.657   1.00 62.32  ? 214 VAL A N   1 
ATOM   796  C CA  . VAL A 1 135 ? 1.583   -24.420 3.521   1.00 60.73  ? 214 VAL A CA  1 
ATOM   797  C C   . VAL A 1 135 ? 1.416   -23.603 2.258   1.00 60.66  ? 214 VAL A C   1 
ATOM   798  O O   . VAL A 1 135 ? 0.532   -22.767 2.183   1.00 61.33  ? 214 VAL A O   1 
ATOM   799  C CB  . VAL A 1 135 ? 0.437   -25.426 3.647   1.00 57.02  ? 214 VAL A CB  1 
ATOM   800  C CG1 . VAL A 1 135 ? 0.440   -26.392 2.476   1.00 54.78  ? 214 VAL A CG1 1 
ATOM   801  C CG2 . VAL A 1 135 ? 0.550   -26.173 4.964   1.00 58.90  ? 214 VAL A CG2 1 
ATOM   802  N N   . HIS A 1 136 ? 2.266   -23.877 1.272   1.00 66.28  ? 215 HIS A N   1 
ATOM   803  C CA  . HIS A 1 136 ? 2.319   -23.139 0.015   1.00 66.71  ? 215 HIS A CA  1 
ATOM   804  C C   . HIS A 1 136 ? 2.030   -24.068 -1.130  1.00 64.44  ? 215 HIS A C   1 
ATOM   805  O O   . HIS A 1 136 ? 2.453   -25.214 -1.118  1.00 65.22  ? 215 HIS A O   1 
ATOM   806  C CB  . HIS A 1 136 ? 3.695   -22.505 -0.173  1.00 69.88  ? 215 HIS A CB  1 
ATOM   807  C CG  . HIS A 1 136 ? 3.932   -21.338 0.729   1.00 76.39  ? 215 HIS A CG  1 
ATOM   808  N ND1 . HIS A 1 136 ? 4.104   -21.476 2.090   1.00 81.12  ? 215 HIS A ND1 1 
ATOM   809  C CD2 . HIS A 1 136 ? 3.988   -20.011 0.473   1.00 79.59  ? 215 HIS A CD2 1 
ATOM   810  C CE1 . HIS A 1 136 ? 4.270   -20.284 2.631   1.00 84.71  ? 215 HIS A CE1 1 
ATOM   811  N NE2 . HIS A 1 136 ? 4.198   -19.378 1.672   1.00 85.32  ? 215 HIS A NE2 1 
ATOM   812  N N   . LEU A 1 137 ? 1.311   -23.541 -2.115  1.00 66.86  ? 216 LEU A N   1 
ATOM   813  C CA  . LEU A 1 137 ? 0.908   -24.254 -3.312  1.00 67.30  ? 216 LEU A CA  1 
ATOM   814  C C   . LEU A 1 137 ? 1.606   -23.612 -4.513  1.00 67.65  ? 216 LEU A C   1 
ATOM   815  O O   . LEU A 1 137 ? 1.543   -22.404 -4.689  1.00 66.50  ? 216 LEU A O   1 
ATOM   816  C CB  . LEU A 1 137 ? -0.606  -24.126 -3.464  1.00 69.35  ? 216 LEU A CB  1 
ATOM   817  C CG  . LEU A 1 137 ? -1.287  -24.889 -4.603  1.00 72.77  ? 216 LEU A CG  1 
ATOM   818  C CD1 . LEU A 1 137 ? -1.329  -26.374 -4.281  1.00 73.99  ? 216 LEU A CD1 1 
ATOM   819  C CD2 . LEU A 1 137 ? -2.693  -24.355 -4.850  1.00 70.84  ? 216 LEU A CD2 1 
ATOM   820  N N   . HIS A 1 138 ? 2.280   -24.412 -5.330  1.00 74.39  ? 217 HIS A N   1 
ATOM   821  C CA  . HIS A 1 138 ? 2.830   -23.934 -6.599  1.00 79.02  ? 217 HIS A CA  1 
ATOM   822  C C   . HIS A 1 138 ? 2.316   -24.807 -7.710  1.00 78.47  ? 217 HIS A C   1 
ATOM   823  O O   . HIS A 1 138 ? 2.209   -26.017 -7.552  1.00 74.34  ? 217 HIS A O   1 
ATOM   824  C CB  . HIS A 1 138 ? 4.360   -23.964 -6.600  1.00 87.54  ? 217 HIS A CB  1 
ATOM   825  C CG  . HIS A 1 138 ? 4.973   -23.497 -7.889  1.00 92.54  ? 217 HIS A CG  1 
ATOM   826  N ND1 . HIS A 1 138 ? 5.115   -22.162 -8.208  1.00 91.12  ? 217 HIS A ND1 1 
ATOM   827  C CD2 . HIS A 1 138 ? 5.467   -24.192 -8.943  1.00 93.89  ? 217 HIS A CD2 1 
ATOM   828  C CE1 . HIS A 1 138 ? 5.677   -22.056 -9.400  1.00 93.92  ? 217 HIS A CE1 1 
ATOM   829  N NE2 . HIS A 1 138 ? 5.900   -23.272 -9.867  1.00 95.38  ? 217 HIS A NE2 1 
ATOM   830  N N   . THR A 1 139 ? 2.028   -24.183 -8.845  1.00 89.56  ? 218 THR A N   1 
ATOM   831  C CA  . THR A 1 139 ? 1.544   -24.891 -10.025 1.00 98.72  ? 218 THR A CA  1 
ATOM   832  C C   . THR A 1 139 ? 2.315   -24.433 -11.270 1.00 100.08 ? 218 THR A C   1 
ATOM   833  O O   . THR A 1 139 ? 2.316   -23.248 -11.618 1.00 95.28  ? 218 THR A O   1 
ATOM   834  C CB  . THR A 1 139 ? 0.016   -24.725 -10.207 1.00 101.74 ? 218 THR A CB  1 
ATOM   835  O OG1 . THR A 1 139 ? -0.346  -24.991 -11.571 1.00 109.98 ? 218 THR A OG1 1 
ATOM   836  C CG2 . THR A 1 139 ? -0.446  -23.322 -9.823  1.00 101.74 ? 218 THR A CG2 1 
ATOM   837  N N   . GLU A 1 140 ? 2.996   -25.388 -11.900 1.00 101.88 ? 219 GLU A N   1 
ATOM   838  C CA  . GLU A 1 140 ? 3.654   -25.184 -13.177 1.00 108.56 ? 219 GLU A CA  1 
ATOM   839  C C   . GLU A 1 140 ? 2.877   -26.031 -14.186 1.00 107.99 ? 219 GLU A C   1 
ATOM   840  O O   . GLU A 1 140 ? 3.106   -27.242 -14.313 1.00 100.84 ? 219 GLU A O   1 
ATOM   841  C CB  . GLU A 1 140 ? 5.133   -25.593 -13.081 1.00 116.94 ? 219 GLU A CB  1 
ATOM   842  C CG  . GLU A 1 140 ? 6.055   -24.860 -14.051 1.00 123.10 ? 219 GLU A CG  1 
ATOM   843  C CD  . GLU A 1 140 ? 6.322   -23.402 -13.678 1.00 125.52 ? 219 GLU A CD  1 
ATOM   844  O OE1 . GLU A 1 140 ? 5.798   -22.908 -12.653 1.00 122.68 ? 219 GLU A OE1 1 
ATOM   845  O OE2 . GLU A 1 140 ? 7.071   -22.740 -14.426 1.00 128.85 ? 219 GLU A OE2 1 
ATOM   846  N N   . ALA A 1 141 ? 1.938   -25.380 -14.876 1.00 110.80 ? 220 ALA A N   1 
ATOM   847  C CA  . ALA A 1 141 ? 0.986   -26.061 -15.755 1.00 116.76 ? 220 ALA A CA  1 
ATOM   848  C C   . ALA A 1 141 ? 0.717   -25.311 -17.072 1.00 123.53 ? 220 ALA A C   1 
ATOM   849  O O   . ALA A 1 141 ? 0.686   -24.078 -17.106 1.00 122.31 ? 220 ALA A O   1 
ATOM   850  C CB  . ALA A 1 141 ? -0.321  -26.294 -15.006 1.00 114.08 ? 220 ALA A CB  1 
ATOM   851  N N   . ARG A 1 142 ? 0.516   -26.081 -18.146 1.00 129.13 ? 221 ARG A N   1 
ATOM   852  C CA  . ARG A 1 142 ? 0.093   -25.557 -19.449 1.00 128.87 ? 221 ARG A CA  1 
ATOM   853  C C   . ARG A 1 142 ? -1.330  -24.985 -19.413 1.00 135.42 ? 221 ARG A C   1 
ATOM   854  O O   . ARG A 1 142 ? -1.706  -24.214 -20.295 1.00 145.82 ? 221 ARG A O   1 
ATOM   855  C CB  . ARG A 1 142 ? 0.180   -26.647 -20.522 1.00 124.55 ? 221 ARG A CB  1 
ATOM   856  N N   . ALA A 1 143 ? -2.122  -25.389 -18.419 1.00 139.00 ? 222 ALA A N   1 
ATOM   857  C CA  . ALA A 1 143 ? -3.376  -24.709 -18.092 1.00 141.41 ? 222 ALA A CA  1 
ATOM   858  C C   . ALA A 1 143 ? -3.670  -24.794 -16.586 1.00 143.79 ? 222 ALA A C   1 
ATOM   859  O O   . ALA A 1 143 ? -4.170  -25.813 -16.097 1.00 153.72 ? 222 ALA A O   1 
ATOM   860  C CB  . ALA A 1 143 ? -4.525  -25.291 -18.902 1.00 138.58 ? 222 ALA A CB  1 
ATOM   861  N N   . ARG A 1 144 ? -3.345  -23.723 -15.859 1.00 132.63 ? 223 ARG A N   1 
ATOM   862  C CA  . ARG A 1 144 ? -3.750  -23.573 -14.457 1.00 122.29 ? 223 ARG A CA  1 
ATOM   863  C C   . ARG A 1 144 ? -5.275  -23.439 -14.333 1.00 116.75 ? 223 ARG A C   1 
ATOM   864  O O   . ARG A 1 144 ? -5.845  -23.765 -13.293 1.00 121.63 ? 223 ARG A O   1 
ATOM   865  C CB  . ARG A 1 144 ? -3.054  -22.366 -13.815 1.00 116.26 ? 223 ARG A CB  1 
ATOM   866  N N   . HIS A 1 145 ? -5.921  -22.952 -15.393 1.00 111.60 ? 224 HIS A N   1 
ATOM   867  C CA  . HIS A 1 145 ? -7.381  -22.881 -15.471 1.00 110.76 ? 224 HIS A CA  1 
ATOM   868  C C   . HIS A 1 145 ? -8.074  -24.254 -15.537 1.00 107.03 ? 224 HIS A C   1 
ATOM   869  O O   . HIS A 1 145 ? -9.208  -24.394 -15.074 1.00 101.61 ? 224 HIS A O   1 
ATOM   870  C CB  . HIS A 1 145 ? -7.802  -22.042 -16.691 1.00 110.03 ? 224 HIS A CB  1 
ATOM   871  N N   . ALA A 1 146 ? -7.400  -25.256 -16.102 1.00 106.99 ? 225 ALA A N   1 
ATOM   872  C CA  . ALA A 1 146 ? -8.044  -26.537 -16.455 1.00 107.96 ? 225 ALA A CA  1 
ATOM   873  C C   . ALA A 1 146 ? -8.366  -27.453 -15.270 1.00 102.36 ? 225 ALA A C   1 
ATOM   874  O O   . ALA A 1 146 ? -9.420  -28.103 -15.255 1.00 100.24 ? 225 ALA A O   1 
ATOM   875  C CB  . ALA A 1 146 ? -7.193  -27.289 -17.470 1.00 110.83 ? 225 ALA A CB  1 
ATOM   876  N N   . TRP A 1 147 ? -7.442  -27.523 -14.311 1.00 94.22  ? 226 TRP A N   1 
ATOM   877  C CA  . TRP A 1 147 ? -7.615  -28.314 -13.086 1.00 86.94  ? 226 TRP A CA  1 
ATOM   878  C C   . TRP A 1 147 ? -7.985  -27.406 -11.936 1.00 79.04  ? 226 TRP A C   1 
ATOM   879  O O   . TRP A 1 147 ? -7.697  -26.207 -11.965 1.00 76.56  ? 226 TRP A O   1 
ATOM   880  C CB  . TRP A 1 147 ? -6.309  -29.027 -12.713 1.00 85.23  ? 226 TRP A CB  1 
ATOM   881  C CG  . TRP A 1 147 ? -5.900  -30.058 -13.682 1.00 81.76  ? 226 TRP A CG  1 
ATOM   882  C CD1 . TRP A 1 147 ? -5.244  -29.862 -14.861 1.00 80.61  ? 226 TRP A CD1 1 
ATOM   883  C CD2 . TRP A 1 147 ? -6.120  -31.464 -13.569 1.00 78.77  ? 226 TRP A CD2 1 
ATOM   884  N NE1 . TRP A 1 147 ? -5.044  -31.064 -15.491 1.00 82.16  ? 226 TRP A NE1 1 
ATOM   885  C CE2 . TRP A 1 147 ? -5.577  -32.064 -14.719 1.00 79.81  ? 226 TRP A CE2 1 
ATOM   886  C CE3 . TRP A 1 147 ? -6.726  -32.276 -12.609 1.00 76.00  ? 226 TRP A CE3 1 
ATOM   887  C CZ2 . TRP A 1 147 ? -5.617  -33.441 -14.929 1.00 75.94  ? 226 TRP A CZ2 1 
ATOM   888  C CZ3 . TRP A 1 147 ? -6.771  -33.641 -12.823 1.00 73.46  ? 226 TRP A CZ3 1 
ATOM   889  C CH2 . TRP A 1 147 ? -6.223  -34.209 -13.973 1.00 74.53  ? 226 TRP A CH2 1 
ATOM   890  N N   . GLN A 1 148 ? -8.595  -27.986 -10.910 1.00 74.46  ? 227 GLN A N   1 
ATOM   891  C CA  . GLN A 1 148 ? -8.674  -27.312 -9.614  1.00 76.02  ? 227 GLN A CA  1 
ATOM   892  C C   . GLN A 1 148 ? -8.724  -28.289 -8.445  1.00 73.54  ? 227 GLN A C   1 
ATOM   893  O O   . GLN A 1 148 ? -8.918  -29.499 -8.642  1.00 68.90  ? 227 GLN A O   1 
ATOM   894  C CB  . GLN A 1 148 ? -9.839  -26.323 -9.592  1.00 77.69  ? 227 GLN A CB  1 
ATOM   895  C CG  . GLN A 1 148 ? -11.232 -26.914 -9.746  1.00 78.14  ? 227 GLN A CG  1 
ATOM   896  C CD  . GLN A 1 148 ? -12.299 -25.837 -9.940  1.00 79.07  ? 227 GLN A CD  1 
ATOM   897  O OE1 . GLN A 1 148 ? -13.484 -26.078 -9.695  1.00 76.40  ? 227 GLN A OE1 1 
ATOM   898  N NE2 . GLN A 1 148 ? -11.882 -24.641 -10.389 1.00 73.03  ? 227 GLN A NE2 1 
ATOM   899  N N   . LEU A 1 149 ? -8.510  -27.768 -7.237  1.00 68.99  ? 228 LEU A N   1 
ATOM   900  C CA  . LEU A 1 149 ? -8.518  -28.607 -6.033  1.00 67.09  ? 228 LEU A CA  1 
ATOM   901  C C   . LEU A 1 149 ? -9.943  -29.030 -5.731  1.00 64.93  ? 228 LEU A C   1 
ATOM   902  O O   . LEU A 1 149 ? -10.847 -28.211 -5.751  1.00 73.19  ? 228 LEU A O   1 
ATOM   903  C CB  . LEU A 1 149 ? -7.944  -27.874 -4.816  1.00 66.75  ? 228 LEU A CB  1 
ATOM   904  C CG  . LEU A 1 149 ? -6.539  -27.290 -4.895  1.00 68.95  ? 228 LEU A CG  1 
ATOM   905  C CD1 . LEU A 1 149 ? -6.200  -26.562 -3.606  1.00 70.47  ? 228 LEU A CD1 1 
ATOM   906  C CD2 . LEU A 1 149 ? -5.529  -28.389 -5.165  1.00 72.79  ? 228 LEU A CD2 1 
ATOM   907  N N   . THR A 1 150 ? -10.148 -30.308 -5.469  1.00 63.02  ? 229 THR A N   1 
ATOM   908  C CA  . THR A 1 150 ? -11.435 -30.784 -5.009  1.00 65.43  ? 229 THR A CA  1 
ATOM   909  C C   . THR A 1 150 ? -11.717 -30.167 -3.632  1.00 70.49  ? 229 THR A C   1 
ATOM   910  O O   . THR A 1 150 ? -10.879 -30.238 -2.732  1.00 75.37  ? 229 THR A O   1 
ATOM   911  C CB  . THR A 1 150 ? -11.441 -32.314 -4.948  1.00 66.75  ? 229 THR A CB  1 
ATOM   912  O OG1 . THR A 1 150 ? -11.067 -32.827 -6.234  1.00 69.35  ? 229 THR A OG1 1 
ATOM   913  C CG2 . THR A 1 150 ? -12.801 -32.851 -4.556  1.00 64.35  ? 229 THR A CG2 1 
ATOM   914  N N   . GLN A 1 151 ? -12.886 -29.539 -3.495  1.00 76.66  ? 230 GLN A N   1 
ATOM   915  C CA  . GLN A 1 151 ? -13.233 -28.758 -2.304  1.00 76.82  ? 230 GLN A CA  1 
ATOM   916  C C   . GLN A 1 151 ? -13.419 -29.691 -1.113  1.00 71.67  ? 230 GLN A C   1 
ATOM   917  O O   . GLN A 1 151 ? -14.127 -30.692 -1.218  1.00 68.98  ? 230 GLN A O   1 
ATOM   918  C CB  . GLN A 1 151 ? -14.498 -27.908 -2.548  1.00 81.20  ? 230 GLN A CB  1 
ATOM   919  C CG  . GLN A 1 151 ? -14.732 -26.846 -1.477  1.00 84.31  ? 230 GLN A CG  1 
ATOM   920  C CD  . GLN A 1 151 ? -15.685 -25.701 -1.876  1.00 91.53  ? 230 GLN A CD  1 
ATOM   921  O OE1 . GLN A 1 151 ? -16.658 -25.894 -2.610  1.00 87.98  ? 230 GLN A OE1 1 
ATOM   922  N NE2 . GLN A 1 151 ? -15.414 -24.504 -1.353  1.00 85.19  ? 230 GLN A NE2 1 
ATOM   923  N N   . GLY A 1 152 ? -12.740 -29.380 -0.006  1.00 68.45  ? 231 GLY A N   1 
ATOM   924  C CA  . GLY A 1 152 ? -12.738 -30.227 1.196   1.00 66.58  ? 231 GLY A CA  1 
ATOM   925  C C   . GLY A 1 152 ? -11.728 -31.371 1.237   1.00 66.13  ? 231 GLY A C   1 
ATOM   926  O O   . GLY A 1 152 ? -11.595 -32.037 2.270   1.00 65.02  ? 231 GLY A O   1 
ATOM   927  N N   . ALA A 1 153 ? -10.999 -31.585 0.134   1.00 63.24  ? 232 ALA A N   1 
ATOM   928  C CA  . ALA A 1 153 ? -10.146 -32.762 -0.051  1.00 60.62  ? 232 ALA A CA  1 
ATOM   929  C C   . ALA A 1 153 ? -8.643  -32.504 0.161   1.00 60.03  ? 232 ALA A C   1 
ATOM   930  O O   . ALA A 1 153 ? -7.831  -33.433 0.041   1.00 62.34  ? 232 ALA A O   1 
ATOM   931  C CB  . ALA A 1 153 ? -10.388 -33.335 -1.436  1.00 62.49  ? 232 ALA A CB  1 
ATOM   932  N N   . THR A 1 154 ? -8.287  -31.255 0.457   1.00 56.18  ? 233 THR A N   1 
ATOM   933  C CA  . THR A 1 154 ? -6.934  -30.870 0.817   1.00 55.51  ? 233 THR A CA  1 
ATOM   934  C C   . THR A 1 154 ? -6.849  -30.644 2.324   1.00 54.61  ? 233 THR A C   1 
ATOM   935  O O   . THR A 1 154 ? -7.390  -29.681 2.843   1.00 53.98  ? 233 THR A O   1 
ATOM   936  C CB  . THR A 1 154 ? -6.510  -29.613 0.053   1.00 56.99  ? 233 THR A CB  1 
ATOM   937  O OG1 . THR A 1 154 ? -6.427  -29.939 -1.343  1.00 62.06  ? 233 THR A OG1 1 
ATOM   938  C CG2 . THR A 1 154 ? -5.147  -29.095 0.540   1.00 55.86  ? 233 THR A CG2 1 
ATOM   939  N N   . VAL A 1 155 ? -6.135  -31.532 3.006   1.00 55.03  ? 234 VAL A N   1 
ATOM   940  C CA  . VAL A 1 155 ? -6.125  -31.607 4.458   1.00 51.92  ? 234 VAL A CA  1 
ATOM   941  C C   . VAL A 1 155 ? -4.696  -31.593 4.980   1.00 54.12  ? 234 VAL A C   1 
ATOM   942  O O   . VAL A 1 155 ? -3.812  -32.193 4.380   1.00 53.67  ? 234 VAL A O   1 
ATOM   943  C CB  . VAL A 1 155 ? -6.809  -32.907 4.890   1.00 51.64  ? 234 VAL A CB  1 
ATOM   944  C CG1 . VAL A 1 155 ? -6.778  -33.086 6.402   1.00 51.62  ? 234 VAL A CG1 1 
ATOM   945  C CG2 . VAL A 1 155 ? -8.232  -32.919 4.355   1.00 52.82  ? 234 VAL A CG2 1 
ATOM   946  N N   . LEU A 1 156 ? -4.477  -30.884 6.084   1.00 55.16  ? 235 LEU A N   1 
ATOM   947  C CA  . LEU A 1 156 ? -3.221  -30.935 6.840   1.00 51.61  ? 235 LEU A CA  1 
ATOM   948  C C   . LEU A 1 156 ? -3.581  -31.418 8.231   1.00 49.30  ? 235 LEU A C   1 
ATOM   949  O O   . LEU A 1 156 ? -4.391  -30.797 8.897   1.00 49.13  ? 235 LEU A O   1 
ATOM   950  C CB  . LEU A 1 156 ? -2.581  -29.558 6.932   1.00 51.62  ? 235 LEU A CB  1 
ATOM   951  C CG  . LEU A 1 156 ? -1.395  -29.390 7.898   1.00 56.94  ? 235 LEU A CG  1 
ATOM   952  C CD1 . LEU A 1 156 ? -0.218  -30.274 7.501   1.00 56.89  ? 235 LEU A CD1 1 
ATOM   953  C CD2 . LEU A 1 156 ? -0.955  -27.924 7.972   1.00 61.35  ? 235 LEU A CD2 1 
ATOM   954  N N   . GLY A 1 157 ? -2.984  -32.515 8.671   1.00 46.24  ? 236 GLY A N   1 
ATOM   955  C CA  . GLY A 1 157 ? -3.264  -33.028 9.992   1.00 47.96  ? 236 GLY A CA  1 
ATOM   956  C C   . GLY A 1 157 ? -2.008  -33.396 10.726  1.00 47.14  ? 236 GLY A C   1 
ATOM   957  O O   . GLY A 1 157 ? -0.974  -33.620 10.112  1.00 49.71  ? 236 GLY A O   1 
ATOM   958  N N   . LEU A 1 158 ? -2.102  -33.426 12.050  1.00 48.15  ? 237 LEU A N   1 
ATOM   959  C CA  . LEU A 1 158 ? -0.985  -33.823 12.889  1.00 51.77  ? 237 LEU A CA  1 
ATOM   960  C C   . LEU A 1 158 ? -1.426  -34.227 14.273  1.00 51.54  ? 237 LEU A C   1 
ATOM   961  O O   . LEU A 1 158 ? -2.477  -33.814 14.737  1.00 50.85  ? 237 LEU A O   1 
ATOM   962  C CB  . LEU A 1 158 ? 0.077   -32.712 13.004  1.00 54.24  ? 237 LEU A CB  1 
ATOM   963  C CG  . LEU A 1 158 ? -0.144  -31.520 13.943  1.00 55.47  ? 237 LEU A CG  1 
ATOM   964  C CD1 . LEU A 1 158 ? 1.045   -30.590 13.887  1.00 53.80  ? 237 LEU A CD1 1 
ATOM   965  C CD2 . LEU A 1 158 ? -1.405  -30.766 13.581  1.00 60.11  ? 237 LEU A CD2 1 
ATOM   966  N N   . PHE A 1 159 ? -0.591  -35.036 14.915  1.00 52.74  ? 238 PHE A N   1 
ATOM   967  C CA  . PHE A 1 159 ? -0.766  -35.413 16.311  1.00 54.88  ? 238 PHE A CA  1 
ATOM   968  C C   . PHE A 1 159 ? 0.589   -35.690 16.928  1.00 57.10  ? 238 PHE A C   1 
ATOM   969  O O   . PHE A 1 159 ? 1.513   -36.111 16.228  1.00 53.31  ? 238 PHE A O   1 
ATOM   970  C CB  . PHE A 1 159 ? -1.692  -36.636 16.463  1.00 54.01  ? 238 PHE A CB  1 
ATOM   971  C CG  . PHE A 1 159 ? -1.343  -37.802 15.570  1.00 52.05  ? 238 PHE A CG  1 
ATOM   972  C CD1 . PHE A 1 159 ? -0.443  -38.776 15.988  1.00 53.50  ? 238 PHE A CD1 1 
ATOM   973  C CD2 . PHE A 1 159 ? -1.931  -37.940 14.322  1.00 50.85  ? 238 PHE A CD2 1 
ATOM   974  C CE1 . PHE A 1 159 ? -0.124  -39.852 15.165  1.00 54.34  ? 238 PHE A CE1 1 
ATOM   975  C CE2 . PHE A 1 159 ? -1.626  -39.016 13.499  1.00 51.29  ? 238 PHE A CE2 1 
ATOM   976  C CZ  . PHE A 1 159 ? -0.718  -39.971 13.915  1.00 53.81  ? 238 PHE A CZ  1 
ATOM   977  N N   . ARG A 1 160 ? 0.688   -35.466 18.238  1.00 65.17  ? 239 ARG A N   1 
ATOM   978  C CA  . ARG A 1 160 ? 1.950   -35.616 18.978  1.00 70.22  ? 239 ARG A CA  1 
ATOM   979  C C   . ARG A 1 160 ? 2.203   -37.084 19.242  1.00 68.04  ? 239 ARG A C   1 
ATOM   980  O O   . ARG A 1 160 ? 1.292   -37.806 19.642  1.00 62.37  ? 239 ARG A O   1 
ATOM   981  C CB  . ARG A 1 160 ? 1.905   -34.849 20.308  1.00 77.60  ? 239 ARG A CB  1 
ATOM   982  C CG  . ARG A 1 160 ? 3.245   -34.302 20.787  1.00 85.22  ? 239 ARG A CG  1 
ATOM   983  C CD  . ARG A 1 160 ? 3.072   -33.191 21.823  1.00 94.14  ? 239 ARG A CD  1 
ATOM   984  N NE  . ARG A 1 160 ? 3.111   -33.707 23.194  1.00 103.51 ? 239 ARG A NE  1 
ATOM   985  C CZ  . ARG A 1 160 ? 4.160   -33.658 24.025  1.00 112.23 ? 239 ARG A CZ  1 
ATOM   986  N NH1 . ARG A 1 160 ? 5.323   -33.105 23.674  1.00 113.51 ? 239 ARG A NH1 1 
ATOM   987  N NH2 . ARG A 1 160 ? 4.050   -34.190 25.240  1.00 119.51 ? 239 ARG A NH2 1 
ATOM   988  N N   . VAL A 1 161 ? 3.431   -37.525 18.990  1.00 74.55  ? 240 VAL A N   1 
ATOM   989  C CA  . VAL A 1 161 ? 3.847   -38.893 19.306  1.00 80.43  ? 240 VAL A CA  1 
ATOM   990  C C   . VAL A 1 161 ? 4.464   -38.952 20.709  1.00 88.08  ? 240 VAL A C   1 
ATOM   991  O O   . VAL A 1 161 ? 4.403   -39.995 21.362  1.00 91.13  ? 240 VAL A O   1 
ATOM   992  C CB  . VAL A 1 161 ? 4.790   -39.456 18.224  1.00 78.28  ? 240 VAL A CB  1 
ATOM   993  C CG1 . VAL A 1 161 ? 5.323   -40.824 18.616  1.00 81.99  ? 240 VAL A CG1 1 
ATOM   994  C CG2 . VAL A 1 161 ? 4.044   -39.565 16.905  1.00 77.82  ? 240 VAL A CG2 1 
ATOM   995  N N   . THR A 1 162 ? 5.052   -37.841 21.164  1.00 100.06 ? 241 THR A N   1 
ATOM   996  C CA  . THR A 1 162 ? 5.464   -37.671 22.562  1.00 104.53 ? 241 THR A CA  1 
ATOM   997  C C   . THR A 1 162 ? 4.246   -37.802 23.489  1.00 109.82 ? 241 THR A C   1 
ATOM   998  O O   . THR A 1 162 ? 4.179   -38.701 24.328  1.00 114.67 ? 241 THR A O   1 
ATOM   999  C CB  . THR A 1 162 ? 6.112   -36.285 22.787  1.00 105.51 ? 241 THR A CB  1 
ATOM   1000 O OG1 . THR A 1 162 ? 7.083   -36.020 21.763  1.00 96.96  ? 241 THR A OG1 1 
ATOM   1001 C CG2 . THR A 1 162 ? 6.771   -36.184 24.180  1.00 106.03 ? 241 THR A CG2 1 
HETATM 1002 C C1  . GOL B 2 .   ? -11.980 -32.330 22.918  1.00 121.03 ? 601 GOL A C1  1 
HETATM 1003 O O1  . GOL B 2 .   ? -10.550 -32.409 22.874  1.00 116.31 ? 601 GOL A O1  1 
HETATM 1004 C C2  . GOL B 2 .   ? -12.528 -31.944 21.544  1.00 121.42 ? 601 GOL A C2  1 
HETATM 1005 O O2  . GOL B 2 .   ? -13.789 -31.279 21.702  1.00 112.71 ? 601 GOL A O2  1 
HETATM 1006 C C3  . GOL B 2 .   ? -12.689 -33.183 20.661  1.00 120.00 ? 601 GOL A C3  1 
HETATM 1007 O O3  . GOL B 2 .   ? -13.200 -32.820 19.371  1.00 118.76 ? 601 GOL A O3  1 
HETATM 1008 O O   . HOH C 3 .   ? -8.055  -31.076 -2.615  1.00 53.51  ? 701 HOH A O   1 
HETATM 1009 O O   . HOH C 3 .   ? 0.061   -42.269 7.925   0.33 169.63 ? 702 HOH A O   1 
HETATM 1010 O O   . HOH C 3 .   ? -15.202 -36.855 12.319  1.00 72.59  ? 703 HOH A O   1 
HETATM 1011 O O   . HOH C 3 .   ? -13.668 -32.125 4.292   1.00 61.98  ? 704 HOH A O   1 
HETATM 1012 O O   . HOH C 3 .   ? -4.011  -34.700 -24.589 1.00 103.39 ? 705 HOH A O   1 
HETATM 1013 O O   . HOH C 3 .   ? -11.321 -22.565 12.171  1.00 64.34  ? 706 HOH A O   1 
HETATM 1014 O O   . HOH C 3 .   ? 4.762   -27.486 -9.431  1.00 80.23  ? 707 HOH A O   1 
HETATM 1015 O O   . HOH C 3 .   ? 8.405   -16.604 7.449   1.00 101.14 ? 708 HOH A O   1 
HETATM 1016 O O   . HOH C 3 .   ? -10.281 -18.025 1.127   1.00 75.06  ? 709 HOH A O   1 
HETATM 1017 O O   . HOH C 3 .   ? 9.022   -33.996 24.284  1.00 85.48  ? 710 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   80  ?   ?   ?   A . n 
A 1 2   PRO 2   81  ?   ?   ?   A . n 
A 1 3   ALA 3   82  ?   ?   ?   A . n 
A 1 4   GLY 4   83  ?   ?   ?   A . n 
A 1 5   LEU 5   84  ?   ?   ?   A . n 
A 1 6   LEU 6   85  ?   ?   ?   A . n 
A 1 7   ASP 7   86  ?   ?   ?   A . n 
A 1 8   LEU 8   87  ?   ?   ?   A . n 
A 1 9   ARG 9   88  ?   ?   ?   A . n 
A 1 10  GLN 10  89  ?   ?   ?   A . n 
A 1 11  GLY 11  90  ?   ?   ?   A . n 
A 1 12  MET 12  91  91  MET MET A . n 
A 1 13  PHE 13  92  92  PHE PHE A . n 
A 1 14  ALA 14  93  93  ALA ALA A . n 
A 1 15  GLN 15  94  94  GLN GLN A . n 
A 1 16  LEU 16  95  95  LEU LEU A . n 
A 1 17  VAL 17  96  96  VAL VAL A . n 
A 1 18  ALA 18  97  97  ALA ALA A . n 
A 1 19  GLN 19  98  98  GLN GLN A . n 
A 1 20  ASN 20  99  99  ASN ASN A . n 
A 1 21  VAL 21  100 100 VAL VAL A . n 
A 1 22  LEU 22  101 101 LEU LEU A . n 
A 1 23  LEU 23  102 102 LEU LEU A . n 
A 1 24  ILE 24  103 103 ILE ILE A . n 
A 1 25  ASP 25  104 104 ASP ASP A . n 
A 1 26  GLY 26  105 105 GLY GLY A . n 
A 1 27  PRO 27  106 106 PRO PRO A . n 
A 1 28  LEU 28  107 107 LEU LEU A . n 
A 1 29  SER 29  108 108 SER SER A . n 
A 1 30  TRP 30  109 109 TRP TRP A . n 
A 1 31  TYR 31  110 110 TYR TYR A . n 
A 1 32  SER 32  111 111 SER SER A . n 
A 1 33  ASP 33  112 112 ASP ASP A . n 
A 1 34  PRO 34  113 113 PRO PRO A . n 
A 1 35  GLY 35  114 114 GLY GLY A . n 
A 1 36  LEU 36  115 115 LEU LEU A . n 
A 1 37  ALA 37  116 ?   ?   ?   A . n 
A 1 38  GLY 38  117 ?   ?   ?   A . n 
A 1 39  VAL 39  118 ?   ?   ?   A . n 
A 1 40  SER 40  119 ?   ?   ?   A . n 
A 1 41  LEU 41  120 ?   ?   ?   A . n 
A 1 42  THR 42  121 ?   ?   ?   A . n 
A 1 43  GLY 43  122 ?   ?   ?   A . n 
A 1 44  GLY 44  123 ?   ?   ?   A . n 
A 1 45  LEU 45  124 124 LEU LEU A . n 
A 1 46  SER 46  125 125 SER SER A . n 
A 1 47  TYR 47  126 126 TYR TYR A . n 
A 1 48  LYS 48  127 127 LYS LYS A . n 
A 1 49  GLU 49  128 128 GLU GLU A . n 
A 1 50  ASP 50  129 129 ASP ASP A . n 
A 1 51  THR 51  130 130 THR THR A . n 
A 1 52  LYS 52  131 131 LYS LYS A . n 
A 1 53  GLU 53  132 132 GLU GLU A . n 
A 1 54  LEU 54  133 133 LEU LEU A . n 
A 1 55  VAL 55  134 134 VAL VAL A . n 
A 1 56  VAL 56  135 135 VAL VAL A . n 
A 1 57  ALA 57  136 136 ALA ALA A . n 
A 1 58  LYS 58  137 137 LYS LYS A . n 
A 1 59  ALA 59  138 138 ALA ALA A . n 
A 1 60  GLY 60  139 139 GLY GLY A . n 
A 1 61  VAL 61  140 140 VAL VAL A . n 
A 1 62  TYR 62  141 141 TYR TYR A . n 
A 1 63  TYR 63  142 142 TYR TYR A . n 
A 1 64  VAL 64  143 143 VAL VAL A . n 
A 1 65  PHE 65  144 144 PHE PHE A . n 
A 1 66  PHE 66  145 145 PHE PHE A . n 
A 1 67  GLN 67  146 146 GLN GLN A . n 
A 1 68  LEU 68  147 147 LEU LEU A . n 
A 1 69  GLU 69  148 148 GLU GLU A . n 
A 1 70  LEU 70  149 149 LEU LEU A . n 
A 1 71  ARG 71  150 150 ARG ARG A . n 
A 1 72  ARG 72  151 151 ARG ARG A . n 
A 1 73  VAL 73  152 152 VAL VAL A . n 
A 1 74  VAL 74  153 153 VAL VAL A . n 
A 1 75  ALA 75  154 ?   ?   ?   A . n 
A 1 76  GLY 76  155 ?   ?   ?   A . n 
A 1 77  GLU 77  156 156 GLU GLU A . n 
A 1 78  GLY 78  157 157 GLY GLY A . n 
A 1 79  SER 79  158 158 SER SER A . n 
A 1 80  GLY 80  159 159 GLY GLY A . n 
A 1 81  SER 81  160 160 SER SER A . n 
A 1 82  VAL 82  161 161 VAL VAL A . n 
A 1 83  SER 83  162 162 SER SER A . n 
A 1 84  LEU 84  163 163 LEU LEU A . n 
A 1 85  ALA 85  164 164 ALA ALA A . n 
A 1 86  LEU 86  165 165 LEU LEU A . n 
A 1 87  HIS 87  166 166 HIS HIS A . n 
A 1 88  LEU 88  167 167 LEU LEU A . n 
A 1 89  GLN 89  168 168 GLN GLN A . n 
A 1 90  PRO 90  169 169 PRO PRO A . n 
A 1 91  LEU 91  170 170 LEU LEU A . n 
A 1 92  ARG 92  171 171 ARG ARG A . n 
A 1 93  SER 93  172 172 SER SER A . n 
A 1 94  ALA 94  173 173 ALA ALA A . n 
A 1 95  ALA 95  174 174 ALA ALA A . n 
A 1 96  GLY 96  175 175 GLY GLY A . n 
A 1 97  ALA 97  176 176 ALA ALA A . n 
A 1 98  ALA 98  177 177 ALA ALA A . n 
A 1 99  ALA 99  178 178 ALA ALA A . n 
A 1 100 LEU 100 179 179 LEU LEU A . n 
A 1 101 ALA 101 180 180 ALA ALA A . n 
A 1 102 LEU 102 181 181 LEU LEU A . n 
A 1 103 THR 103 182 182 THR THR A . n 
A 1 104 VAL 104 183 183 VAL VAL A . n 
A 1 105 ASP 105 184 184 ASP ASP A . n 
A 1 106 LEU 106 185 185 LEU LEU A . n 
A 1 107 PRO 107 186 186 PRO PRO A . n 
A 1 108 PRO 108 187 187 PRO PRO A . n 
A 1 109 ALA 109 188 188 ALA ALA A . n 
A 1 110 SER 110 189 ?   ?   ?   A . n 
A 1 111 SER 111 190 ?   ?   ?   A . n 
A 1 112 GLU 112 191 ?   ?   ?   A . n 
A 1 113 ALA 113 192 ?   ?   ?   A . n 
A 1 114 ARG 114 193 193 ARG ARG A . n 
A 1 115 ASN 115 194 194 ASN ASN A . n 
A 1 116 SER 116 195 195 SER SER A . n 
A 1 117 ALA 117 196 196 ALA ALA A . n 
A 1 118 PHE 118 197 197 PHE PHE A . n 
A 1 119 GLY 119 198 198 GLY GLY A . n 
A 1 120 PHE 120 199 199 PHE PHE A . n 
A 1 121 GLN 121 200 200 GLN GLN A . n 
A 1 122 GLY 122 201 201 GLY GLY A . n 
A 1 123 ARG 123 202 202 ARG ARG A . n 
A 1 124 LEU 124 203 203 LEU LEU A . n 
A 1 125 LEU 125 204 204 LEU LEU A . n 
A 1 126 HIS 126 205 205 HIS HIS A . n 
A 1 127 LEU 127 206 206 LEU LEU A . n 
A 1 128 SER 128 207 207 SER SER A . n 
A 1 129 ALA 129 208 208 ALA ALA A . n 
A 1 130 GLY 130 209 209 GLY GLY A . n 
A 1 131 GLN 131 210 210 GLN GLN A . n 
A 1 132 ARG 132 211 211 ARG ARG A . n 
A 1 133 LEU 133 212 212 LEU LEU A . n 
A 1 134 GLY 134 213 213 GLY GLY A . n 
A 1 135 VAL 135 214 214 VAL VAL A . n 
A 1 136 HIS 136 215 215 HIS HIS A . n 
A 1 137 LEU 137 216 216 LEU LEU A . n 
A 1 138 HIS 138 217 217 HIS HIS A . n 
A 1 139 THR 139 218 218 THR THR A . n 
A 1 140 GLU 140 219 219 GLU GLU A . n 
A 1 141 ALA 141 220 220 ALA ALA A . n 
A 1 142 ARG 142 221 221 ARG ARG A . n 
A 1 143 ALA 143 222 222 ALA ALA A . n 
A 1 144 ARG 144 223 223 ARG ARG A . n 
A 1 145 HIS 145 224 224 HIS HIS A . n 
A 1 146 ALA 146 225 225 ALA ALA A . n 
A 1 147 TRP 147 226 226 TRP TRP A . n 
A 1 148 GLN 148 227 227 GLN GLN A . n 
A 1 149 LEU 149 228 228 LEU LEU A . n 
A 1 150 THR 150 229 229 THR THR A . n 
A 1 151 GLN 151 230 230 GLN GLN A . n 
A 1 152 GLY 152 231 231 GLY GLY A . n 
A 1 153 ALA 153 232 232 ALA ALA A . n 
A 1 154 THR 154 233 233 THR THR A . n 
A 1 155 VAL 155 234 234 VAL VAL A . n 
A 1 156 LEU 156 235 235 LEU LEU A . n 
A 1 157 GLY 157 236 236 GLY GLY A . n 
A 1 158 LEU 158 237 237 LEU LEU A . n 
A 1 159 PHE 159 238 238 PHE PHE A . n 
A 1 160 ARG 160 239 239 ARG ARG A . n 
A 1 161 VAL 161 240 240 VAL VAL A . n 
A 1 162 THR 162 241 241 THR THR A . n 
A 1 163 PRO 163 242 ?   ?   ?   A . n 
A 1 164 GLU 164 243 ?   ?   ?   A . n 
A 1 165 ILE 165 244 ?   ?   ?   A . n 
A 1 166 HIS 166 245 ?   ?   ?   A . n 
A 1 167 HIS 167 246 ?   ?   ?   A . n 
A 1 168 HIS 168 247 ?   ?   ?   A . n 
A 1 169 HIS 169 248 ?   ?   ?   A . n 
A 1 170 HIS 170 249 ?   ?   ?   A . n 
A 1 171 HIS 171 250 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GOL 1  601 601 GOL GOL A . 
C 3 HOH 1  701 17  HOH HOH A . 
C 3 HOH 2  702 5   HOH HOH A . 
C 3 HOH 3  703 3   HOH HOH A . 
C 3 HOH 4  704 9   HOH HOH A . 
C 3 HOH 5  705 6   HOH HOH A . 
C 3 HOH 6  706 10  HOH HOH A . 
C 3 HOH 7  707 18  HOH HOH A . 
C 3 HOH 8  708 16  HOH HOH A . 
C 3 HOH 9  709 13  HOH HOH A . 
C 3 HOH 10 710 4   HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4140  ? 
1 MORE         -22   ? 
1 'SSA (A^2)'  17600 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_445 -y-1,x-y-1,z -0.5000000000 -0.8660254038 0.0000000000 -36.5835000000 0.8660254038  
-0.5000000000 0.0000000000 -63.3644807187 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_545 -x+y,-x-1,z  -0.5000000000 0.8660254038  0.0000000000 36.5835000000  -0.8660254038 
-0.5000000000 0.0000000000 -63.3644807187 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     702 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-05-09 
2 'Structure model' 1 1 2018-07-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_CSD'          
5  2 'Structure model' '_citation.journal_id_ISSN'         
6  2 'Structure model' '_citation.journal_volume'          
7  2 'Structure model' '_citation.page_first'              
8  2 'Structure model' '_citation.page_last'               
9  2 'Structure model' '_citation.pdbx_database_id_DOI'    
10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
11 2 'Structure model' '_citation.title'                   
12 2 'Structure model' '_citation.year'                    
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALA       ? ? ? 0.6.3    1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0189 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? iMOSFLM     ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .        5 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    GLN 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     168 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             45.41 
_pdbx_validate_torsion.psi             -132.47 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A MET 91  ? CG  ? A MET 12  CG  
2  1 Y 1 A MET 91  ? SD  ? A MET 12  SD  
3  1 Y 1 A MET 91  ? CE  ? A MET 12  CE  
4  1 Y 1 A GLU 128 ? CG  ? A GLU 49  CG  
5  1 Y 1 A GLU 128 ? CD  ? A GLU 49  CD  
6  1 Y 1 A GLU 128 ? OE1 ? A GLU 49  OE1 
7  1 Y 1 A GLU 128 ? OE2 ? A GLU 49  OE2 
8  1 Y 1 A LYS 137 ? CG  ? A LYS 58  CG  
9  1 Y 1 A LYS 137 ? CD  ? A LYS 58  CD  
10 1 Y 1 A LYS 137 ? CE  ? A LYS 58  CE  
11 1 Y 1 A LYS 137 ? NZ  ? A LYS 58  NZ  
12 1 Y 1 A GLU 156 ? CG  ? A GLU 77  CG  
13 1 Y 1 A GLU 156 ? CD  ? A GLU 77  CD  
14 1 Y 1 A GLU 156 ? OE1 ? A GLU 77  OE1 
15 1 Y 1 A GLU 156 ? OE2 ? A GLU 77  OE2 
16 1 Y 1 A GLN 168 ? CG  ? A GLN 89  CG  
17 1 Y 1 A GLN 168 ? CD  ? A GLN 89  CD  
18 1 Y 1 A GLN 168 ? OE1 ? A GLN 89  OE1 
19 1 Y 1 A GLN 168 ? NE2 ? A GLN 89  NE2 
20 1 Y 1 A PRO 169 ? CG  ? A PRO 90  CG  
21 1 Y 1 A PRO 169 ? CD  ? A PRO 90  CD  
22 1 Y 1 A ARG 171 ? CG  ? A ARG 92  CG  
23 1 Y 1 A ARG 171 ? CD  ? A ARG 92  CD  
24 1 Y 1 A ARG 171 ? NE  ? A ARG 92  NE  
25 1 Y 1 A ARG 171 ? CZ  ? A ARG 92  CZ  
26 1 Y 1 A ARG 171 ? NH1 ? A ARG 92  NH1 
27 1 Y 1 A ARG 171 ? NH2 ? A ARG 92  NH2 
28 1 Y 1 A ARG 193 ? CG  ? A ARG 114 CG  
29 1 Y 1 A ARG 193 ? CD  ? A ARG 114 CD  
30 1 Y 1 A ARG 193 ? NE  ? A ARG 114 NE  
31 1 Y 1 A ARG 193 ? CZ  ? A ARG 114 CZ  
32 1 Y 1 A ARG 193 ? NH1 ? A ARG 114 NH1 
33 1 Y 1 A ARG 193 ? NH2 ? A ARG 114 NH2 
34 1 Y 1 A ARG 221 ? CG  ? A ARG 142 CG  
35 1 Y 1 A ARG 221 ? CD  ? A ARG 142 CD  
36 1 Y 1 A ARG 221 ? NE  ? A ARG 142 NE  
37 1 Y 1 A ARG 221 ? CZ  ? A ARG 142 CZ  
38 1 Y 1 A ARG 221 ? NH1 ? A ARG 142 NH1 
39 1 Y 1 A ARG 221 ? NH2 ? A ARG 142 NH2 
40 1 Y 1 A ARG 223 ? CG  ? A ARG 144 CG  
41 1 Y 1 A ARG 223 ? CD  ? A ARG 144 CD  
42 1 Y 1 A ARG 223 ? NE  ? A ARG 144 NE  
43 1 Y 1 A ARG 223 ? CZ  ? A ARG 144 CZ  
44 1 Y 1 A ARG 223 ? NH1 ? A ARG 144 NH1 
45 1 Y 1 A ARG 223 ? NH2 ? A ARG 144 NH2 
46 1 Y 1 A HIS 224 ? CG  ? A HIS 145 CG  
47 1 Y 1 A HIS 224 ? ND1 ? A HIS 145 ND1 
48 1 Y 1 A HIS 224 ? CD2 ? A HIS 145 CD2 
49 1 Y 1 A HIS 224 ? CE1 ? A HIS 145 CE1 
50 1 Y 1 A HIS 224 ? NE2 ? A HIS 145 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 80  ? A ASP 1   
2  1 Y 1 A PRO 81  ? A PRO 2   
3  1 Y 1 A ALA 82  ? A ALA 3   
4  1 Y 1 A GLY 83  ? A GLY 4   
5  1 Y 1 A LEU 84  ? A LEU 5   
6  1 Y 1 A LEU 85  ? A LEU 6   
7  1 Y 1 A ASP 86  ? A ASP 7   
8  1 Y 1 A LEU 87  ? A LEU 8   
9  1 Y 1 A ARG 88  ? A ARG 9   
10 1 Y 1 A GLN 89  ? A GLN 10  
11 1 Y 1 A GLY 90  ? A GLY 11  
12 1 Y 1 A ALA 116 ? A ALA 37  
13 1 Y 1 A GLY 117 ? A GLY 38  
14 1 Y 1 A VAL 118 ? A VAL 39  
15 1 Y 1 A SER 119 ? A SER 40  
16 1 Y 1 A LEU 120 ? A LEU 41  
17 1 Y 1 A THR 121 ? A THR 42  
18 1 Y 1 A GLY 122 ? A GLY 43  
19 1 Y 1 A GLY 123 ? A GLY 44  
20 1 Y 1 A ALA 154 ? A ALA 75  
21 1 Y 1 A GLY 155 ? A GLY 76  
22 1 Y 1 A SER 189 ? A SER 110 
23 1 Y 1 A SER 190 ? A SER 111 
24 1 Y 1 A GLU 191 ? A GLU 112 
25 1 Y 1 A ALA 192 ? A ALA 113 
26 1 Y 1 A PRO 242 ? A PRO 163 
27 1 Y 1 A GLU 243 ? A GLU 164 
28 1 Y 1 A ILE 244 ? A ILE 165 
29 1 Y 1 A HIS 245 ? A HIS 166 
30 1 Y 1 A HIS 246 ? A HIS 167 
31 1 Y 1 A HIS 247 ? A HIS 168 
32 1 Y 1 A HIS 248 ? A HIS 169 
33 1 Y 1 A HIS 249 ? A HIS 170 
34 1 Y 1 A HIS 250 ? A HIS 171 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL GOL 
3 water    HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#